data_3R2W
# 
_entry.id   3R2W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3R2W         
RCSB  RCSB064420   
WWPDB D_1000064420 
# 
_pdbx_database_status.entry_id                        3R2W 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-03-14 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zheng, X.' 1 
'Yu, Q.'    2 
# 
_citation.id                        primary 
_citation.title                     
'The crystal structure of human UDP-glucose pyrophosphorylase reveals a latch effect that influences enzymatic activity.' 
_citation.journal_abbrev            Biochem.J. 
_citation.journal_volume            442 
_citation.page_first                283 
_citation.page_last                 291 
_citation.year                      2012 
_citation.journal_id_ASTM           BIJOAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0264-6021 
_citation.journal_id_CSD            0043 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22132858 
_citation.pdbx_database_id_DOI      10.1042/BJ20111598 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Yu, Q.'    1 
primary 'Zheng, X.' 2 
# 
_cell.length_a           140.445 
_cell.length_b           140.445 
_cell.length_c           311.724 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           3R2W 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              24 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.entry_id                         3R2W 
_symmetry.Int_Tables_number                152 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'UTP--glucose-1-phosphate uridylyltransferase' 
_entity.formula_weight             59184.402 
_entity.pdbx_number_of_molecules   4 
_entity.pdbx_ec                    2.7.7.9 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'UDP-glucose pyrophosphorylase, UDPGP, UGPase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHMSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRK
LFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLD
LTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYP
PGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEG
KLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFE
NSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTV
SGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHMSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRK
LFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLD
LTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYP
PGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEG
KLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFE
NSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTV
SGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  SER n 
1 23  ARG n 
1 24  PHE n 
1 25  VAL n 
1 26  GLN n 
1 27  ASP n 
1 28  LEU n 
1 29  SER n 
1 30  LYS n 
1 31  ALA n 
1 32  MET n 
1 33  SER n 
1 34  GLN n 
1 35  ASP n 
1 36  GLY n 
1 37  ALA n 
1 38  SER n 
1 39  GLN n 
1 40  PHE n 
1 41  GLN n 
1 42  GLU n 
1 43  VAL n 
1 44  ILE n 
1 45  ARG n 
1 46  GLN n 
1 47  GLU n 
1 48  LEU n 
1 49  GLU n 
1 50  LEU n 
1 51  SER n 
1 52  VAL n 
1 53  LYS n 
1 54  LYS n 
1 55  GLU n 
1 56  LEU n 
1 57  GLU n 
1 58  LYS n 
1 59  ILE n 
1 60  LEU n 
1 61  THR n 
1 62  THR n 
1 63  ALA n 
1 64  SER n 
1 65  SER n 
1 66  HIS n 
1 67  GLU n 
1 68  PHE n 
1 69  GLU n 
1 70  HIS n 
1 71  THR n 
1 72  LYS n 
1 73  LYS n 
1 74  ASP n 
1 75  LEU n 
1 76  ASP n 
1 77  GLY n 
1 78  PHE n 
1 79  ARG n 
1 80  LYS n 
1 81  LEU n 
1 82  PHE n 
1 83  HIS n 
1 84  ARG n 
1 85  PHE n 
1 86  LEU n 
1 87  GLN n 
1 88  GLU n 
1 89  LYS n 
1 90  GLY n 
1 91  PRO n 
1 92  SER n 
1 93  VAL n 
1 94  ASP n 
1 95  TRP n 
1 96  GLY n 
1 97  LYS n 
1 98  ILE n 
1 99  GLN n 
1 100 ARG n 
1 101 PRO n 
1 102 PRO n 
1 103 GLU n 
1 104 ASP n 
1 105 SER n 
1 106 ILE n 
1 107 GLN n 
1 108 PRO n 
1 109 TYR n 
1 110 GLU n 
1 111 LYS n 
1 112 ILE n 
1 113 LYS n 
1 114 ALA n 
1 115 ARG n 
1 116 GLY n 
1 117 LEU n 
1 118 PRO n 
1 119 ASP n 
1 120 ASN n 
1 121 ILE n 
1 122 SER n 
1 123 SER n 
1 124 VAL n 
1 125 LEU n 
1 126 ASN n 
1 127 LYS n 
1 128 LEU n 
1 129 VAL n 
1 130 VAL n 
1 131 VAL n 
1 132 LYS n 
1 133 LEU n 
1 134 ASN n 
1 135 GLY n 
1 136 GLY n 
1 137 LEU n 
1 138 GLY n 
1 139 THR n 
1 140 SER n 
1 141 MET n 
1 142 GLY n 
1 143 CYS n 
1 144 LYS n 
1 145 GLY n 
1 146 PRO n 
1 147 LYS n 
1 148 SER n 
1 149 LEU n 
1 150 ILE n 
1 151 GLY n 
1 152 VAL n 
1 153 ARG n 
1 154 ASN n 
1 155 GLU n 
1 156 ASN n 
1 157 THR n 
1 158 PHE n 
1 159 LEU n 
1 160 ASP n 
1 161 LEU n 
1 162 THR n 
1 163 VAL n 
1 164 GLN n 
1 165 GLN n 
1 166 ILE n 
1 167 GLU n 
1 168 HIS n 
1 169 LEU n 
1 170 ASN n 
1 171 LYS n 
1 172 THR n 
1 173 TYR n 
1 174 ASN n 
1 175 THR n 
1 176 ASP n 
1 177 VAL n 
1 178 PRO n 
1 179 LEU n 
1 180 VAL n 
1 181 LEU n 
1 182 MET n 
1 183 ASN n 
1 184 SER n 
1 185 PHE n 
1 186 ASN n 
1 187 THR n 
1 188 ASP n 
1 189 GLU n 
1 190 ASP n 
1 191 THR n 
1 192 LYS n 
1 193 LYS n 
1 194 ILE n 
1 195 LEU n 
1 196 GLN n 
1 197 LYS n 
1 198 TYR n 
1 199 ASN n 
1 200 HIS n 
1 201 CYS n 
1 202 ARG n 
1 203 VAL n 
1 204 LYS n 
1 205 ILE n 
1 206 TYR n 
1 207 THR n 
1 208 PHE n 
1 209 ASN n 
1 210 GLN n 
1 211 SER n 
1 212 ARG n 
1 213 TYR n 
1 214 PRO n 
1 215 ARG n 
1 216 ILE n 
1 217 ASN n 
1 218 LYS n 
1 219 GLU n 
1 220 SER n 
1 221 LEU n 
1 222 LEU n 
1 223 PRO n 
1 224 VAL n 
1 225 ALA n 
1 226 LYS n 
1 227 ASP n 
1 228 VAL n 
1 229 SER n 
1 230 TYR n 
1 231 SER n 
1 232 GLY n 
1 233 GLU n 
1 234 ASN n 
1 235 THR n 
1 236 GLU n 
1 237 ALA n 
1 238 TRP n 
1 239 TYR n 
1 240 PRO n 
1 241 PRO n 
1 242 GLY n 
1 243 HIS n 
1 244 GLY n 
1 245 ASP n 
1 246 ILE n 
1 247 TYR n 
1 248 ALA n 
1 249 SER n 
1 250 PHE n 
1 251 TYR n 
1 252 ASN n 
1 253 SER n 
1 254 GLY n 
1 255 LEU n 
1 256 LEU n 
1 257 ASP n 
1 258 THR n 
1 259 PHE n 
1 260 ILE n 
1 261 GLY n 
1 262 GLU n 
1 263 GLY n 
1 264 LYS n 
1 265 GLU n 
1 266 TYR n 
1 267 ILE n 
1 268 PHE n 
1 269 VAL n 
1 270 SER n 
1 271 ASN n 
1 272 ILE n 
1 273 ASP n 
1 274 ASN n 
1 275 LEU n 
1 276 GLY n 
1 277 ALA n 
1 278 THR n 
1 279 VAL n 
1 280 ASP n 
1 281 LEU n 
1 282 TYR n 
1 283 ILE n 
1 284 LEU n 
1 285 ASN n 
1 286 HIS n 
1 287 LEU n 
1 288 MET n 
1 289 ASN n 
1 290 PRO n 
1 291 PRO n 
1 292 ASN n 
1 293 GLY n 
1 294 LYS n 
1 295 ARG n 
1 296 CYS n 
1 297 GLU n 
1 298 PHE n 
1 299 VAL n 
1 300 MET n 
1 301 GLU n 
1 302 VAL n 
1 303 THR n 
1 304 ASN n 
1 305 LYS n 
1 306 THR n 
1 307 ARG n 
1 308 ALA n 
1 309 ASP n 
1 310 VAL n 
1 311 LYS n 
1 312 GLY n 
1 313 GLY n 
1 314 THR n 
1 315 LEU n 
1 316 THR n 
1 317 GLN n 
1 318 TYR n 
1 319 GLU n 
1 320 GLY n 
1 321 LYS n 
1 322 LEU n 
1 323 ARG n 
1 324 LEU n 
1 325 VAL n 
1 326 GLU n 
1 327 ILE n 
1 328 ALA n 
1 329 GLN n 
1 330 VAL n 
1 331 PRO n 
1 332 LYS n 
1 333 ALA n 
1 334 HIS n 
1 335 VAL n 
1 336 ASP n 
1 337 GLU n 
1 338 PHE n 
1 339 LYS n 
1 340 SER n 
1 341 VAL n 
1 342 SER n 
1 343 LYS n 
1 344 PHE n 
1 345 LYS n 
1 346 ILE n 
1 347 PHE n 
1 348 ASN n 
1 349 THR n 
1 350 ASN n 
1 351 ASN n 
1 352 LEU n 
1 353 TRP n 
1 354 ILE n 
1 355 SER n 
1 356 LEU n 
1 357 ALA n 
1 358 ALA n 
1 359 VAL n 
1 360 LYS n 
1 361 ARG n 
1 362 LEU n 
1 363 GLN n 
1 364 GLU n 
1 365 GLN n 
1 366 ASN n 
1 367 ALA n 
1 368 ILE n 
1 369 ASP n 
1 370 MET n 
1 371 GLU n 
1 372 ILE n 
1 373 ILE n 
1 374 VAL n 
1 375 ASN n 
1 376 ALA n 
1 377 LYS n 
1 378 THR n 
1 379 LEU n 
1 380 ASP n 
1 381 GLY n 
1 382 GLY n 
1 383 LEU n 
1 384 ASN n 
1 385 VAL n 
1 386 ILE n 
1 387 GLN n 
1 388 LEU n 
1 389 GLU n 
1 390 THR n 
1 391 ALA n 
1 392 VAL n 
1 393 GLY n 
1 394 ALA n 
1 395 ALA n 
1 396 ILE n 
1 397 LYS n 
1 398 SER n 
1 399 PHE n 
1 400 GLU n 
1 401 ASN n 
1 402 SER n 
1 403 LEU n 
1 404 GLY n 
1 405 ILE n 
1 406 ASN n 
1 407 VAL n 
1 408 PRO n 
1 409 ARG n 
1 410 SER n 
1 411 ARG n 
1 412 PHE n 
1 413 LEU n 
1 414 PRO n 
1 415 VAL n 
1 416 LYS n 
1 417 THR n 
1 418 THR n 
1 419 SER n 
1 420 ASP n 
1 421 LEU n 
1 422 LEU n 
1 423 LEU n 
1 424 VAL n 
1 425 MET n 
1 426 SER n 
1 427 ASN n 
1 428 LEU n 
1 429 TYR n 
1 430 SER n 
1 431 LEU n 
1 432 ASN n 
1 433 ALA n 
1 434 GLY n 
1 435 SER n 
1 436 LEU n 
1 437 THR n 
1 438 MET n 
1 439 SER n 
1 440 GLU n 
1 441 LYS n 
1 442 ARG n 
1 443 GLU n 
1 444 PHE n 
1 445 PRO n 
1 446 THR n 
1 447 VAL n 
1 448 PRO n 
1 449 LEU n 
1 450 VAL n 
1 451 LYS n 
1 452 LEU n 
1 453 GLY n 
1 454 SER n 
1 455 SER n 
1 456 PHE n 
1 457 THR n 
1 458 LYS n 
1 459 VAL n 
1 460 GLN n 
1 461 ASP n 
1 462 TYR n 
1 463 LEU n 
1 464 ARG n 
1 465 ARG n 
1 466 PHE n 
1 467 GLU n 
1 468 SER n 
1 469 ILE n 
1 470 PRO n 
1 471 ASP n 
1 472 MET n 
1 473 LEU n 
1 474 GLU n 
1 475 LEU n 
1 476 ASP n 
1 477 HIS n 
1 478 LEU n 
1 479 THR n 
1 480 VAL n 
1 481 SER n 
1 482 GLY n 
1 483 ASP n 
1 484 VAL n 
1 485 THR n 
1 486 PHE n 
1 487 GLY n 
1 488 LYS n 
1 489 ASN n 
1 490 VAL n 
1 491 SER n 
1 492 LEU n 
1 493 LYS n 
1 494 GLY n 
1 495 THR n 
1 496 VAL n 
1 497 ILE n 
1 498 ILE n 
1 499 ILE n 
1 500 ALA n 
1 501 ASN n 
1 502 HIS n 
1 503 GLY n 
1 504 ASP n 
1 505 ARG n 
1 506 ILE n 
1 507 ASP n 
1 508 ILE n 
1 509 PRO n 
1 510 PRO n 
1 511 GLY n 
1 512 ALA n 
1 513 VAL n 
1 514 LEU n 
1 515 GLU n 
1 516 ASN n 
1 517 LYS n 
1 518 ILE n 
1 519 VAL n 
1 520 SER n 
1 521 GLY n 
1 522 ASN n 
1 523 LEU n 
1 524 ARG n 
1 525 ILE n 
1 526 LEU n 
1 527 ASP n 
1 528 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'UGP2, UGP1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Bl21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    UGPA_HUMAN 
_struct_ref.pdbx_db_accession          Q16851 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQR
PPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLV
LMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFI
GEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKS
VSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSD
LLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIA
NHGDRIDIPPGAVLENKIVSGNLRILDH
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3R2W A 21 ? 528 ? Q16851 1 ? 508 ? -10 497 
2 1 3R2W B 21 ? 528 ? Q16851 1 ? 508 ? -10 497 
3 1 3R2W C 21 ? 528 ? Q16851 1 ? 508 ? -10 497 
4 1 3R2W D 21 ? 528 ? Q16851 1 ? 508 ? -10 497 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3R2W MET A 1  ? UNP Q16851 ? ? 'EXPRESSION TAG' -30 1  
1 3R2W GLY A 2  ? UNP Q16851 ? ? 'EXPRESSION TAG' -29 2  
1 3R2W SER A 3  ? UNP Q16851 ? ? 'EXPRESSION TAG' -28 3  
1 3R2W SER A 4  ? UNP Q16851 ? ? 'EXPRESSION TAG' -27 4  
1 3R2W HIS A 5  ? UNP Q16851 ? ? 'EXPRESSION TAG' -26 5  
1 3R2W HIS A 6  ? UNP Q16851 ? ? 'EXPRESSION TAG' -25 6  
1 3R2W HIS A 7  ? UNP Q16851 ? ? 'EXPRESSION TAG' -24 7  
1 3R2W HIS A 8  ? UNP Q16851 ? ? 'EXPRESSION TAG' -23 8  
1 3R2W HIS A 9  ? UNP Q16851 ? ? 'EXPRESSION TAG' -22 9  
1 3R2W HIS A 10 ? UNP Q16851 ? ? 'EXPRESSION TAG' -21 10 
1 3R2W SER A 11 ? UNP Q16851 ? ? 'EXPRESSION TAG' -20 11 
1 3R2W SER A 12 ? UNP Q16851 ? ? 'EXPRESSION TAG' -19 12 
1 3R2W GLY A 13 ? UNP Q16851 ? ? 'EXPRESSION TAG' -18 13 
1 3R2W LEU A 14 ? UNP Q16851 ? ? 'EXPRESSION TAG' -17 14 
1 3R2W VAL A 15 ? UNP Q16851 ? ? 'EXPRESSION TAG' -16 15 
1 3R2W PRO A 16 ? UNP Q16851 ? ? 'EXPRESSION TAG' -15 16 
1 3R2W ARG A 17 ? UNP Q16851 ? ? 'EXPRESSION TAG' -14 17 
1 3R2W GLY A 18 ? UNP Q16851 ? ? 'EXPRESSION TAG' -13 18 
1 3R2W SER A 19 ? UNP Q16851 ? ? 'EXPRESSION TAG' -12 19 
1 3R2W HIS A 20 ? UNP Q16851 ? ? 'EXPRESSION TAG' -11 20 
2 3R2W MET B 1  ? UNP Q16851 ? ? 'EXPRESSION TAG' -30 21 
2 3R2W GLY B 2  ? UNP Q16851 ? ? 'EXPRESSION TAG' -29 22 
2 3R2W SER B 3  ? UNP Q16851 ? ? 'EXPRESSION TAG' -28 23 
2 3R2W SER B 4  ? UNP Q16851 ? ? 'EXPRESSION TAG' -27 24 
2 3R2W HIS B 5  ? UNP Q16851 ? ? 'EXPRESSION TAG' -26 25 
2 3R2W HIS B 6  ? UNP Q16851 ? ? 'EXPRESSION TAG' -25 26 
2 3R2W HIS B 7  ? UNP Q16851 ? ? 'EXPRESSION TAG' -24 27 
2 3R2W HIS B 8  ? UNP Q16851 ? ? 'EXPRESSION TAG' -23 28 
2 3R2W HIS B 9  ? UNP Q16851 ? ? 'EXPRESSION TAG' -22 29 
2 3R2W HIS B 10 ? UNP Q16851 ? ? 'EXPRESSION TAG' -21 30 
2 3R2W SER B 11 ? UNP Q16851 ? ? 'EXPRESSION TAG' -20 31 
2 3R2W SER B 12 ? UNP Q16851 ? ? 'EXPRESSION TAG' -19 32 
2 3R2W GLY B 13 ? UNP Q16851 ? ? 'EXPRESSION TAG' -18 33 
2 3R2W LEU B 14 ? UNP Q16851 ? ? 'EXPRESSION TAG' -17 34 
2 3R2W VAL B 15 ? UNP Q16851 ? ? 'EXPRESSION TAG' -16 35 
2 3R2W PRO B 16 ? UNP Q16851 ? ? 'EXPRESSION TAG' -15 36 
2 3R2W ARG B 17 ? UNP Q16851 ? ? 'EXPRESSION TAG' -14 37 
2 3R2W GLY B 18 ? UNP Q16851 ? ? 'EXPRESSION TAG' -13 38 
2 3R2W SER B 19 ? UNP Q16851 ? ? 'EXPRESSION TAG' -12 39 
2 3R2W HIS B 20 ? UNP Q16851 ? ? 'EXPRESSION TAG' -11 40 
3 3R2W MET C 1  ? UNP Q16851 ? ? 'EXPRESSION TAG' -30 41 
3 3R2W GLY C 2  ? UNP Q16851 ? ? 'EXPRESSION TAG' -29 42 
3 3R2W SER C 3  ? UNP Q16851 ? ? 'EXPRESSION TAG' -28 43 
3 3R2W SER C 4  ? UNP Q16851 ? ? 'EXPRESSION TAG' -27 44 
3 3R2W HIS C 5  ? UNP Q16851 ? ? 'EXPRESSION TAG' -26 45 
3 3R2W HIS C 6  ? UNP Q16851 ? ? 'EXPRESSION TAG' -25 46 
3 3R2W HIS C 7  ? UNP Q16851 ? ? 'EXPRESSION TAG' -24 47 
3 3R2W HIS C 8  ? UNP Q16851 ? ? 'EXPRESSION TAG' -23 48 
3 3R2W HIS C 9  ? UNP Q16851 ? ? 'EXPRESSION TAG' -22 49 
3 3R2W HIS C 10 ? UNP Q16851 ? ? 'EXPRESSION TAG' -21 50 
3 3R2W SER C 11 ? UNP Q16851 ? ? 'EXPRESSION TAG' -20 51 
3 3R2W SER C 12 ? UNP Q16851 ? ? 'EXPRESSION TAG' -19 52 
3 3R2W GLY C 13 ? UNP Q16851 ? ? 'EXPRESSION TAG' -18 53 
3 3R2W LEU C 14 ? UNP Q16851 ? ? 'EXPRESSION TAG' -17 54 
3 3R2W VAL C 15 ? UNP Q16851 ? ? 'EXPRESSION TAG' -16 55 
3 3R2W PRO C 16 ? UNP Q16851 ? ? 'EXPRESSION TAG' -15 56 
3 3R2W ARG C 17 ? UNP Q16851 ? ? 'EXPRESSION TAG' -14 57 
3 3R2W GLY C 18 ? UNP Q16851 ? ? 'EXPRESSION TAG' -13 58 
3 3R2W SER C 19 ? UNP Q16851 ? ? 'EXPRESSION TAG' -12 59 
3 3R2W HIS C 20 ? UNP Q16851 ? ? 'EXPRESSION TAG' -11 60 
4 3R2W MET D 1  ? UNP Q16851 ? ? 'EXPRESSION TAG' -30 61 
4 3R2W GLY D 2  ? UNP Q16851 ? ? 'EXPRESSION TAG' -29 62 
4 3R2W SER D 3  ? UNP Q16851 ? ? 'EXPRESSION TAG' -28 63 
4 3R2W SER D 4  ? UNP Q16851 ? ? 'EXPRESSION TAG' -27 64 
4 3R2W HIS D 5  ? UNP Q16851 ? ? 'EXPRESSION TAG' -26 65 
4 3R2W HIS D 6  ? UNP Q16851 ? ? 'EXPRESSION TAG' -25 66 
4 3R2W HIS D 7  ? UNP Q16851 ? ? 'EXPRESSION TAG' -24 67 
4 3R2W HIS D 8  ? UNP Q16851 ? ? 'EXPRESSION TAG' -23 68 
4 3R2W HIS D 9  ? UNP Q16851 ? ? 'EXPRESSION TAG' -22 69 
4 3R2W HIS D 10 ? UNP Q16851 ? ? 'EXPRESSION TAG' -21 70 
4 3R2W SER D 11 ? UNP Q16851 ? ? 'EXPRESSION TAG' -20 71 
4 3R2W SER D 12 ? UNP Q16851 ? ? 'EXPRESSION TAG' -19 72 
4 3R2W GLY D 13 ? UNP Q16851 ? ? 'EXPRESSION TAG' -18 73 
4 3R2W LEU D 14 ? UNP Q16851 ? ? 'EXPRESSION TAG' -17 74 
4 3R2W VAL D 15 ? UNP Q16851 ? ? 'EXPRESSION TAG' -16 75 
4 3R2W PRO D 16 ? UNP Q16851 ? ? 'EXPRESSION TAG' -15 76 
4 3R2W ARG D 17 ? UNP Q16851 ? ? 'EXPRESSION TAG' -14 77 
4 3R2W GLY D 18 ? UNP Q16851 ? ? 'EXPRESSION TAG' -13 78 
4 3R2W SER D 19 ? UNP Q16851 ? ? 'EXPRESSION TAG' -12 79 
4 3R2W HIS D 20 ? UNP Q16851 ? ? 'EXPRESSION TAG' -11 80 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3R2W 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.75 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   67.19 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.pdbx_details    
'MgSO4, 35.8% PEG3350, glycerol, HEPES, pH 6.5, vapor diffusion, hanging drop, temperature 290K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 325 mm CCD' 
_diffrn_detector.pdbx_collection_date   2009-12-15 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SSRF 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
# 
_reflns.entry_id                     3R2W 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.d_resolution_high            3.6 
_reflns.d_resolution_low             120 
_reflns.number_all                   39283 
_reflns.number_obs                   39283 
_reflns.percent_possible_obs         96.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.60 
_reflns_shell.d_res_low              3.69 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   64.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3R2W 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            3.6000 
_refine.ls_d_res_low                             20.0000 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    93.9700 
_refine.ls_number_reflns_obs                     39283 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : RESIDUAL ONLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2502 
_refine.ls_R_factor_R_work                       0.2475 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.3038 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.1000 
_refine.ls_number_reflns_R_free                  1985 
_refine.ls_number_reflns_R_work                  37298 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               144.356 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            4.7200 
_refine.aniso_B[2][2]                            4.7200 
_refine.aniso_B[3][3]                            -7.0800 
_refine.aniso_B[1][2]                            2.3600 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9340 
_refine.correlation_coeff_Fo_to_Fc_free          0.8910 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R_Free                  0.6950 
_refine.overall_SU_ML                            0.5420 
_refine.overall_SU_B                             79.8860 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                119.770 
_refine.B_iso_min                                20.000 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        13938 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               13938 
_refine_hist.d_res_high                       3.6000 
_refine_hist.d_res_low                        20.0000 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' r_bond_refined_d       14181 0.013  0.022  ? ? 
'X-RAY DIFFRACTION' r_angle_refined_deg    19301 1.558  1.968  ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 1837  7.032  5.000  ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 582   40.341 24.828 ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 2291  22.049 15.000 ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 64    19.929 15.000 ? ? 
'X-RAY DIFFRACTION' r_chiral_restr         2318  0.100  0.200  ? ? 
'X-RAY DIFFRACTION' r_gen_planes_refined   10601 0.006  0.021  ? ? 
'X-RAY DIFFRACTION' r_mcbond_it            9193  0.468  1.500  ? ? 
'X-RAY DIFFRACTION' r_mcangle_it           14783 0.900  2.000  ? ? 
'X-RAY DIFFRACTION' r_scbond_it            4988  1.071  3.000  ? ? 
'X-RAY DIFFRACTION' r_scangle_it           4518  1.946  4.500  ? ? 
# 
_refine_ls_shell.d_res_high                       3.6000 
_refine_ls_shell.d_res_low                        3.6900 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               55.1900 
_refine_ls_shell.number_reflns_R_work             1558 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.3680 
_refine_ls_shell.R_factor_R_free                  0.3860 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             80 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1638 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
# 
_struct.entry_id                  3R2W 
_struct.title                     'Crystal Strucutre of UDP-glucose Pyrophosphorylase of Homo Sapiens' 
_struct.pdbx_descriptor           'UTP--glucose-1-phosphate uridylyltransferase (E.C.2.7.7.9)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3R2W 
_struct_keywords.text            'Homo sapiens, Rossmann Fold Beta Barrel, Nucleotidyltransferase, Transferase' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 56  ? THR A 61  ? LEU A 25  THR A 30  1 ? 6  
HELX_P HELX_P2  2  HIS A 70  ? GLU A 88  ? HIS A 39  GLU A 57  1 ? 19 
HELX_P HELX_P3  3  TYR A 109 ? ALA A 114 ? TYR A 78  ALA A 83  1 ? 6  
HELX_P HELX_P4  4  VAL A 124 ? ASN A 126 ? VAL A 93  ASN A 95  5 ? 3  
HELX_P HELX_P5  5  PRO A 146 ? LEU A 149 ? PRO A 115 LEU A 118 5 ? 4  
HELX_P HELX_P6  6  LEU A 159 ? ASN A 174 ? LEU A 128 ASN A 143 1 ? 16 
HELX_P HELX_P7  7  THR A 187 ? ILE A 194 ? THR A 156 ILE A 163 1 ? 8  
HELX_P HELX_P8  8  LEU A 195 ? ASN A 199 ? LEU A 164 ASN A 168 5 ? 5  
HELX_P HELX_P9  9  ASP A 245 ? GLY A 254 ? ASP A 214 GLY A 223 1 ? 10 
HELX_P HELX_P10 10 GLY A 254 ? GLY A 261 ? GLY A 223 GLY A 230 1 ? 8  
HELX_P HELX_P11 11 ASP A 280 ? ASN A 285 ? ASP A 249 ASN A 254 1 ? 6  
HELX_P HELX_P12 12 PRO A 331 ? VAL A 335 ? PRO A 300 VAL A 304 5 ? 5  
HELX_P HELX_P13 13 LEU A 356 ? ASN A 366 ? LEU A 325 ASN A 335 1 ? 11 
HELX_P HELX_P14 14 VAL A 392 ? ILE A 396 ? VAL A 361 ILE A 365 5 ? 5  
HELX_P HELX_P15 15 PRO A 408 ? PHE A 412 ? PRO A 377 PHE A 381 5 ? 5  
HELX_P HELX_P16 16 THR A 417 ? MET A 425 ? THR A 386 MET A 394 1 ? 9  
HELX_P HELX_P17 17 LYS A 458 ? PHE A 466 ? LYS A 427 PHE A 435 1 ? 9  
HELX_P HELX_P18 18 GLN B 41  ? GLU B 57  ? GLN B 10  GLU B 26  1 ? 17 
HELX_P HELX_P19 19 LYS B 58  ? ALA B 63  ? LYS B 27  ALA B 32  5 ? 6  
HELX_P HELX_P20 20 PHE B 68  ? LEU B 86  ? PHE B 37  LEU B 55  1 ? 19 
HELX_P HELX_P21 21 TYR B 109 ? ALA B 114 ? TYR B 78  ALA B 83  1 ? 6  
HELX_P HELX_P22 22 PRO B 146 ? LEU B 149 ? PRO B 115 LEU B 118 5 ? 4  
HELX_P HELX_P23 23 PHE B 158 ? TYR B 173 ? PHE B 127 TYR B 142 1 ? 16 
HELX_P HELX_P24 24 SER B 184 ? GLN B 196 ? SER B 153 GLN B 165 1 ? 13 
HELX_P HELX_P25 25 LYS B 197 ? ASN B 199 ? LYS B 166 ASN B 168 5 ? 3  
HELX_P HELX_P26 26 ASP B 245 ? SER B 253 ? ASP B 214 SER B 222 1 ? 9  
HELX_P HELX_P27 27 LEU B 255 ? GLY B 261 ? LEU B 224 GLY B 230 1 ? 7  
HELX_P HELX_P28 28 LEU B 281 ? HIS B 286 ? LEU B 250 HIS B 255 1 ? 6  
HELX_P HELX_P29 29 PRO B 331 ? HIS B 334 ? PRO B 300 HIS B 303 5 ? 4  
HELX_P HELX_P30 30 VAL B 335 ? SER B 340 ? VAL B 304 SER B 309 1 ? 6  
HELX_P HELX_P31 31 LEU B 356 ? GLU B 364 ? LEU B 325 GLU B 333 1 ? 9  
HELX_P HELX_P32 32 VAL B 392 ? PHE B 399 ? VAL B 361 PHE B 368 5 ? 8  
HELX_P HELX_P33 33 PRO B 408 ? PHE B 412 ? PRO B 377 PHE B 381 5 ? 5  
HELX_P HELX_P34 34 THR B 417 ? VAL B 424 ? THR B 386 VAL B 393 1 ? 8  
HELX_P HELX_P35 35 SER B 454 ? THR B 457 ? SER B 423 THR B 426 5 ? 4  
HELX_P HELX_P36 36 LYS B 458 ? PHE B 466 ? LYS B 427 PHE B 435 1 ? 9  
HELX_P HELX_P37 37 LEU C 48  ? GLU C 57  ? LEU C 17  GLU C 26  1 ? 10 
HELX_P HELX_P38 38 HIS C 70  ? HIS C 83  ? HIS C 39  HIS C 52  1 ? 14 
HELX_P HELX_P39 39 THR C 162 ? LYS C 171 ? THR C 131 LYS C 140 1 ? 10 
HELX_P HELX_P40 40 SER C 184 ? LYS C 192 ? SER C 153 LYS C 161 1 ? 9  
HELX_P HELX_P41 41 ILE C 194 ? TYR C 198 ? ILE C 163 TYR C 167 5 ? 5  
HELX_P HELX_P42 42 ILE C 246 ? GLY C 254 ? ILE C 215 GLY C 223 1 ? 9  
HELX_P HELX_P43 43 GLY C 254 ? ILE C 260 ? GLY C 223 ILE C 229 1 ? 7  
HELX_P HELX_P44 44 GLY C 261 ? GLY C 263 ? GLY C 230 GLY C 232 5 ? 3  
HELX_P HELX_P45 45 PRO C 331 ? VAL C 335 ? PRO C 300 VAL C 304 5 ? 5  
HELX_P HELX_P46 46 LEU C 356 ? GLN C 363 ? LEU C 325 GLN C 332 1 ? 8  
HELX_P HELX_P47 47 PRO C 408 ? PHE C 412 ? PRO C 377 PHE C 381 5 ? 5  
HELX_P HELX_P48 48 THR C 417 ? MET C 425 ? THR C 386 MET C 394 1 ? 9  
HELX_P HELX_P49 49 SER C 454 ? THR C 457 ? SER C 423 THR C 426 5 ? 4  
HELX_P HELX_P50 50 LYS C 458 ? PHE C 466 ? LYS C 427 PHE C 435 1 ? 9  
HELX_P HELX_P51 51 GLU D 42  ? THR D 61  ? GLU D 11  THR D 30  1 ? 20 
HELX_P HELX_P52 52 GLU D 67  ? GLU D 88  ? GLU D 36  GLU D 57  1 ? 22 
HELX_P HELX_P53 53 TYR D 109 ? ALA D 114 ? TYR D 78  ALA D 83  1 ? 6  
HELX_P HELX_P54 54 PRO D 146 ? LEU D 149 ? PRO D 115 LEU D 118 5 ? 4  
HELX_P HELX_P55 55 PHE D 158 ? THR D 172 ? PHE D 127 THR D 141 1 ? 15 
HELX_P HELX_P56 56 ASP D 188 ? LYS D 193 ? ASP D 157 LYS D 162 1 ? 6  
HELX_P HELX_P57 57 ILE D 194 ? ASN D 199 ? ILE D 163 ASN D 168 5 ? 6  
HELX_P HELX_P58 58 ILE D 246 ? ASN D 252 ? ILE D 215 ASN D 221 1 ? 7  
HELX_P HELX_P59 59 GLY D 254 ? GLY D 261 ? GLY D 223 GLY D 230 1 ? 8  
HELX_P HELX_P60 60 ASP D 280 ? ASN D 285 ? ASP D 249 ASN D 254 1 ? 6  
HELX_P HELX_P61 61 GLU D 326 ? VAL D 330 ? GLU D 295 VAL D 299 5 ? 5  
HELX_P HELX_P62 62 ALA D 333 ? GLU D 337 ? ALA D 302 GLU D 306 5 ? 5  
HELX_P HELX_P63 63 LEU D 356 ? GLU D 364 ? LEU D 325 GLU D 333 1 ? 9  
HELX_P HELX_P64 64 VAL D 392 ? PHE D 399 ? VAL D 361 PHE D 368 5 ? 8  
HELX_P HELX_P65 65 PRO D 408 ? PHE D 412 ? PRO D 377 PHE D 381 5 ? 5  
HELX_P HELX_P66 66 THR D 417 ? MET D 425 ? THR D 386 MET D 394 1 ? 9  
HELX_P HELX_P67 67 LYS D 458 ? PHE D 466 ? LYS D 427 PHE D 435 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLY 96  A . ? GLY 65  A LYS 97  A ? LYS 66  A 1 7.19   
2  ARG 115 A . ? ARG 84  A GLY 116 A ? GLY 85  A 1 -1.80  
3  ASN 120 A . ? ASN 89  A ILE 121 A ? ILE 90  A 1 -12.18 
4  ILE 121 A . ? ILE 90  A SER 122 A ? SER 91  A 1 -0.95  
5  SER 122 A . ? SER 91  A SER 123 A ? SER 92  A 1 -6.59  
6  ASN 154 A . ? ASN 123 A GLU 155 A ? GLU 124 A 1 -19.38 
7  ARG 295 A . ? ARG 264 A CYS 296 A ? CYS 265 A 1 3.30   
8  SER 340 A . ? SER 309 A VAL 341 A ? VAL 310 A 1 0.03   
9  LEU 379 A . ? LEU 348 A ASP 380 A ? ASP 349 A 1 2.12   
10 GLU 440 A . ? GLU 409 A LYS 441 A ? LYS 410 A 1 4.42   
11 GLY 96  B . ? GLY 65  B LYS 97  B ? LYS 66  B 1 -4.86  
12 ARG 115 B . ? ARG 84  B GLY 116 B ? GLY 85  B 1 -6.65  
13 ASN 120 B . ? ASN 89  B ILE 121 B ? ILE 90  B 1 -20.24 
14 ILE 121 B . ? ILE 90  B SER 122 B ? SER 91  B 1 4.59   
15 ASN 154 B . ? ASN 123 B GLU 155 B ? GLU 124 B 1 -14.96 
16 LYS 294 B . ? LYS 263 B ARG 295 B ? ARG 264 B 1 18.90  
17 CYS 296 B . ? CYS 265 B GLU 297 B ? GLU 266 B 1 11.53  
18 SER 340 B . ? SER 309 B VAL 341 B ? VAL 310 B 1 -12.57 
19 SER 342 B . ? SER 311 B LYS 343 B ? LYS 312 B 1 -1.14  
20 LEU 379 B . ? LEU 348 B ASP 380 B ? ASP 349 B 1 -3.12  
21 GLU 440 B . ? GLU 409 B LYS 441 B ? LYS 410 B 1 0.38   
22 GLY 96  C . ? GLY 65  C LYS 97  C ? LYS 66  C 1 2.48   
23 ARG 115 C . ? ARG 84  C GLY 116 C ? GLY 85  C 1 0.62   
24 ASP 119 C . ? ASP 88  C ASN 120 C ? ASN 89  C 1 -5.64  
25 ILE 121 C . ? ILE 90  C SER 122 C ? SER 91  C 1 -2.24  
26 SER 122 C . ? SER 91  C SER 123 C ? SER 92  C 1 -0.10  
27 SER 123 C . ? SER 92  C VAL 124 C ? VAL 93  C 1 18.78  
28 ASN 154 C . ? ASN 123 C GLU 155 C ? GLU 124 C 1 -8.27  
29 SER 340 C . ? SER 309 C VAL 341 C ? VAL 310 C 1 -6.74  
30 SER 342 C . ? SER 311 C LYS 343 C ? LYS 312 C 1 6.07   
31 LEU 379 C . ? LEU 348 C ASP 380 C ? ASP 349 C 1 3.11   
32 GLU 440 C . ? GLU 409 C LYS 441 C ? LYS 410 C 1 -9.68  
33 GLY 96  D . ? GLY 65  D LYS 97  D ? LYS 66  D 1 -7.14  
34 ARG 115 D . ? ARG 84  D GLY 116 D ? GLY 85  D 1 -4.90  
35 ASN 120 D . ? ASN 89  D ILE 121 D ? ILE 90  D 1 -15.08 
36 ILE 121 D . ? ILE 90  D SER 122 D ? SER 91  D 1 4.72   
37 SER 122 D . ? SER 91  D SER 123 D ? SER 92  D 1 17.20  
38 ASN 154 D . ? ASN 123 D GLU 155 D ? GLU 124 D 1 13.62  
39 LYS 294 D . ? LYS 263 D ARG 295 D ? ARG 264 D 1 5.79   
40 CYS 296 D . ? CYS 265 D GLU 297 D ? GLU 266 D 1 -1.05  
41 SER 340 D . ? SER 309 D VAL 341 D ? VAL 310 D 1 -4.45  
42 SER 342 D . ? SER 311 D LYS 343 D ? LYS 312 D 1 -11.29 
43 LEU 379 D . ? LEU 348 D ASP 380 D ? ASP 349 D 1 4.20   
44 GLU 440 D . ? GLU 409 D LYS 441 D ? LYS 410 D 1 20.09  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 8 ? 
B  ? 2 ? 
C  ? 3 ? 
D  ? 2 ? 
E  ? 2 ? 
F  ? 8 ? 
G  ? 2 ? 
H  ? 2 ? 
I  ? 6 ? 
J  ? 2 ? 
K  ? 3 ? 
L  ? 2 ? 
M  ? 2 ? 
N  ? 2 ? 
O  ? 2 ? 
P  ? 7 ? 
Q  ? 2 ? 
R  ? 2 ? 
S  ? 2 ? 
T  ? 2 ? 
U  ? 8 ? 
V  ? 7 ? 
W  ? 2 ? 
X  ? 2 ? 
Y  ? 6 ? 
Z  ? 2 ? 
AA ? 2 ? 
AB ? 3 ? 
AC ? 2 ? 
AD ? 2 ? 
AE ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? parallel      
A  2 3 ? parallel      
A  3 4 ? anti-parallel 
A  4 5 ? anti-parallel 
A  5 6 ? parallel      
A  6 7 ? parallel      
A  7 8 ? parallel      
B  1 2 ? anti-parallel 
C  1 2 ? anti-parallel 
C  2 3 ? anti-parallel 
D  1 2 ? anti-parallel 
E  1 2 ? anti-parallel 
F  1 2 ? parallel      
F  2 3 ? parallel      
F  3 4 ? parallel      
F  4 5 ? anti-parallel 
F  5 6 ? parallel      
F  6 7 ? parallel      
F  7 8 ? parallel      
G  1 2 ? parallel      
H  1 2 ? parallel      
I  1 2 ? parallel      
I  2 3 ? parallel      
I  3 4 ? parallel      
I  4 5 ? anti-parallel 
I  5 6 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
L  1 2 ? anti-parallel 
M  1 2 ? anti-parallel 
N  1 2 ? anti-parallel 
O  1 2 ? parallel      
P  1 2 ? parallel      
P  2 3 ? parallel      
P  3 4 ? parallel      
P  4 5 ? anti-parallel 
P  5 6 ? anti-parallel 
P  6 7 ? parallel      
Q  1 2 ? anti-parallel 
R  1 2 ? anti-parallel 
S  1 2 ? anti-parallel 
T  1 2 ? anti-parallel 
U  1 2 ? parallel      
U  2 3 ? parallel      
U  3 4 ? parallel      
U  4 5 ? anti-parallel 
U  5 6 ? parallel      
U  6 7 ? parallel      
U  7 8 ? parallel      
V  1 2 ? parallel      
V  2 3 ? parallel      
V  3 4 ? parallel      
V  4 5 ? anti-parallel 
V  5 6 ? parallel      
V  6 7 ? parallel      
W  1 2 ? parallel      
X  1 2 ? parallel      
Y  1 2 ? parallel      
Y  2 3 ? parallel      
Y  3 4 ? parallel      
Y  4 5 ? anti-parallel 
Y  5 6 ? anti-parallel 
Z  1 2 ? anti-parallel 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 GLN A 107 ? PRO A 108 ? GLN A 76  PRO A 77  
A  2 ILE A 405 ? ASN A 406 ? ILE A 374 ASN A 375 
A  3 PHE A 298 ? THR A 303 ? PHE A 267 THR A 272 
A  4 PHE A 347 ? SER A 355 ? PHE A 316 SER A 324 
A  5 TYR A 266 ? ASN A 271 ? TYR A 235 ASN A 240 
A  6 LEU A 128 ? LEU A 133 ? LEU A 97  LEU A 102 
A  7 LEU A 179 ? ASN A 183 ? LEU A 148 ASN A 152 
A  8 ILE A 205 ? ASN A 209 ? ILE A 174 ASN A 178 
B  1 GLY A 151 ? ARG A 153 ? GLY A 120 ARG A 122 
B  2 ASN A 156 ? THR A 157 ? ASN A 125 THR A 126 
C  1 ILE A 216 ? ASN A 217 ? ILE A 185 ASN A 186 
C  2 VAL A 385 ? GLU A 389 ? VAL A 354 GLU A 358 
C  3 ILE A 373 ? LYS A 377 ? ILE A 342 LYS A 346 
D  1 GLY A 313 ? TYR A 318 ? GLY A 282 TYR A 287 
D  2 LYS A 321 ? GLU A 326 ? LYS A 290 GLU A 295 
E  1 TYR A 429 ? LEU A 431 ? TYR A 398 LEU A 400 
E  2 LEU A 436 ? MET A 438 ? LEU A 405 MET A 407 
F  1 LEU A 449 ? LEU A 452 ? LEU A 418 LEU A 421 
F  2 LEU A 475 ? SER A 481 ? LEU A 444 SER A 450 
F  3 SER A 491 ? ILE A 499 ? SER A 460 ILE A 468 
F  4 VAL A 513 ? LEU A 526 ? VAL A 482 LEU A 495 
F  5 VAL B 513 ? ASP B 527 ? VAL B 482 ASP B 496 
F  6 SER B 491 ? ILE B 499 ? SER B 460 ILE B 468 
F  7 ASP B 471 ? SER B 481 ? ASP B 440 SER B 450 
F  8 LEU B 449 ? LEU B 452 ? LEU B 418 LEU B 421 
G  1 ASP A 483 ? THR A 485 ? ASP A 452 THR A 454 
G  2 ARG A 505 ? ASP A 507 ? ARG A 474 ASP A 476 
H  1 ILE B 106 ? PRO B 108 ? ILE B 75  PRO B 77  
H  2 GLY B 404 ? ASN B 406 ? GLY B 373 ASN B 375 
I  1 ILE B 205 ? ASN B 209 ? ILE B 174 ASN B 178 
I  2 LEU B 179 ? ASN B 183 ? LEU B 148 ASN B 152 
I  3 LEU B 128 ? LEU B 133 ? LEU B 97  LEU B 102 
I  4 TYR B 266 ? ASN B 271 ? TYR B 235 ASN B 240 
I  5 ILE B 346 ? SER B 355 ? ILE B 315 SER B 324 
I  6 PHE B 298 ? ASN B 304 ? PHE B 267 ASN B 273 
J  1 GLY B 151 ? ARG B 153 ? GLY B 120 ARG B 122 
J  2 ASN B 156 ? THR B 157 ? ASN B 125 THR B 126 
K  1 ILE B 216 ? ASN B 217 ? ILE B 185 ASN B 186 
K  2 VAL B 385 ? ILE B 386 ? VAL B 354 ILE B 355 
K  3 ALA B 376 ? LYS B 377 ? ALA B 345 LYS B 346 
L  1 THR B 314 ? TYR B 318 ? THR B 283 TYR B 287 
L  2 LYS B 321 ? VAL B 325 ? LYS B 290 VAL B 294 
M  1 ILE B 372 ? ILE B 373 ? ILE B 341 ILE B 342 
M  2 GLU B 389 ? THR B 390 ? GLU B 358 THR B 359 
N  1 SER B 430 ? ASN B 432 ? SER B 399 ASN B 401 
N  2 SER B 435 ? THR B 437 ? SER B 404 THR B 406 
O  1 ASP B 483 ? PHE B 486 ? ASP B 452 PHE B 455 
O  2 ARG B 505 ? ILE B 508 ? ARG B 474 ILE B 477 
P  1 ILE C 205 ? THR C 207 ? ILE C 174 THR C 176 
P  2 LEU C 179 ? MET C 182 ? LEU C 148 MET C 151 
P  3 LEU C 128 ? LEU C 133 ? LEU C 97  LEU C 102 
P  4 TYR C 266 ? SER C 270 ? TYR C 235 SER C 239 
P  5 ASN C 348 ? SER C 355 ? ASN C 317 SER C 324 
P  6 PHE C 298 ? VAL C 302 ? PHE C 267 VAL C 271 
P  7 ILE C 405 ? ASN C 406 ? ILE C 374 ASN C 375 
Q  1 THR C 314 ? THR C 316 ? THR C 283 THR C 285 
Q  2 ARG C 323 ? VAL C 325 ? ARG C 292 VAL C 294 
R  1 ILE C 372 ? ILE C 373 ? ILE C 341 ILE C 342 
R  2 GLU C 389 ? THR C 390 ? GLU C 358 THR C 359 
S  1 ALA C 376 ? LYS C 377 ? ALA C 345 LYS C 346 
S  2 VAL C 385 ? ILE C 386 ? VAL C 354 ILE C 355 
T  1 TYR C 429 ? LEU C 431 ? TYR C 398 LEU C 400 
T  2 LEU C 436 ? MET C 438 ? LEU C 405 MET C 407 
U  1 VAL C 450 ? LEU C 452 ? VAL C 419 LEU C 421 
U  2 LEU C 475 ? SER C 481 ? LEU C 444 SER C 450 
U  3 SER C 491 ? ILE C 499 ? SER C 460 ILE C 468 
U  4 VAL C 513 ? LEU C 526 ? VAL C 482 LEU C 495 
U  5 ILE D 518 ? ARG D 524 ? ILE D 487 ARG D 493 
U  6 SER D 491 ? ILE D 499 ? SER D 460 ILE D 468 
U  7 LEU D 475 ? SER D 481 ? LEU D 444 SER D 450 
U  8 LEU D 449 ? LEU D 452 ? LEU D 418 LEU D 421 
V  1 VAL C 450 ? LEU C 452 ? VAL C 419 LEU C 421 
V  2 LEU C 475 ? SER C 481 ? LEU C 444 SER C 450 
V  3 SER C 491 ? ILE C 499 ? SER C 460 ILE C 468 
V  4 VAL C 513 ? LEU C 526 ? VAL C 482 LEU C 495 
V  5 ILE D 518 ? ARG D 524 ? ILE D 487 ARG D 493 
V  6 SER D 491 ? ILE D 499 ? SER D 460 ILE D 468 
V  7 VAL D 513 ? GLU D 515 ? VAL D 482 GLU D 484 
W  1 ASP C 483 ? THR C 485 ? ASP C 452 THR C 454 
W  2 ARG C 505 ? ASP C 507 ? ARG C 474 ASP C 476 
X  1 ILE D 106 ? PRO D 108 ? ILE D 75  PRO D 77  
X  2 GLY D 404 ? ASN D 406 ? GLY D 373 ASN D 375 
Y  1 LYS D 204 ? ASN D 209 ? LYS D 173 ASN D 178 
Y  2 PRO D 178 ? ASN D 183 ? PRO D 147 ASN D 152 
Y  3 LEU D 128 ? LEU D 133 ? LEU D 97  LEU D 102 
Y  4 TYR D 266 ? ASN D 271 ? TYR D 235 ASN D 240 
Y  5 ILE D 346 ? SER D 355 ? ILE D 315 SER D 324 
Y  6 PHE D 298 ? ASN D 304 ? PHE D 267 ASN D 273 
Z  1 GLY D 151 ? ARG D 153 ? GLY D 120 ARG D 122 
Z  2 ASN D 156 ? THR D 157 ? ASN D 125 THR D 126 
AA 1 TYR D 213 ? PRO D 214 ? TYR D 182 PRO D 183 
AA 2 TRP D 238 ? TYR D 239 ? TRP D 207 TYR D 208 
AB 1 ILE D 216 ? ASN D 217 ? ILE D 185 ASN D 186 
AB 2 VAL D 385 ? THR D 390 ? VAL D 354 THR D 359 
AB 3 ILE D 372 ? ASN D 375 ? ILE D 341 ASN D 344 
AC 1 THR D 314 ? TYR D 318 ? THR D 283 TYR D 287 
AC 2 LYS D 321 ? VAL D 325 ? LYS D 290 VAL D 294 
AD 1 TYR D 429 ? ASN D 432 ? TYR D 398 ASN D 401 
AD 2 SER D 435 ? MET D 438 ? SER D 404 MET D 407 
AE 1 VAL D 484 ? PHE D 486 ? VAL D 453 PHE D 455 
AE 2 ILE D 506 ? ILE D 508 ? ILE D 475 ILE D 477 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N GLN A 107 ? N GLN A 76  O ASN A 406 ? O ASN A 375 
A  2 3 O ILE A 405 ? O ILE A 374 N VAL A 302 ? N VAL A 271 
A  3 4 N GLU A 301 ? N GLU A 270 O ASN A 351 ? O ASN A 320 
A  4 5 O LEU A 352 ? O LEU A 321 N VAL A 269 ? N VAL A 238 
A  5 6 O TYR A 266 ? O TYR A 235 N VAL A 129 ? N VAL A 98  
A  6 7 N VAL A 130 ? N VAL A 99  O VAL A 180 ? O VAL A 149 
A  7 8 N LEU A 181 ? N LEU A 150 O TYR A 206 ? O TYR A 175 
B  1 2 N ARG A 153 ? N ARG A 122 O ASN A 156 ? O ASN A 125 
C  1 2 N ILE A 216 ? N ILE A 185 O ILE A 386 ? O ILE A 355 
C  2 3 O GLU A 389 ? O GLU A 358 N ILE A 373 ? N ILE A 342 
D  1 2 N THR A 316 ? N THR A 285 O ARG A 323 ? O ARG A 292 
E  1 2 N SER A 430 ? N SER A 399 O THR A 437 ? O THR A 406 
F  1 2 N LYS A 451 ? N LYS A 420 O LEU A 478 ? O LEU A 447 
F  2 3 N ASP A 476 ? N ASP A 445 O GLY A 494 ? O GLY A 463 
F  3 4 N ILE A 499 ? N ILE A 468 O VAL A 519 ? O VAL A 488 
F  4 5 N ILE A 518 ? N ILE A 487 O LEU B 526 ? O LEU B 495 
F  5 6 O VAL B 519 ? O VAL B 488 N ILE B 497 ? N ILE B 466 
F  6 7 O ILE B 498 ? O ILE B 467 N THR B 479 ? N THR B 448 
F  7 8 O LEU B 478 ? O LEU B 447 N LEU B 449 ? N LEU B 418 
G  1 2 N ASP A 483 ? N ASP A 452 O ILE A 506 ? O ILE A 475 
H  1 2 N GLN B 107 ? N GLN B 76  O GLY B 404 ? O GLY B 373 
I  1 2 O TYR B 206 ? O TYR B 175 N LEU B 179 ? N LEU B 148 
I  2 3 O VAL B 180 ? O VAL B 149 N VAL B 130 ? N VAL B 99  
I  3 4 N VAL B 129 ? N VAL B 98  O PHE B 268 ? O PHE B 237 
I  4 5 N ILE B 267 ? N ILE B 236 O ILE B 354 ? O ILE B 323 
I  5 6 O TRP B 353 ? O TRP B 322 N VAL B 299 ? N VAL B 268 
J  1 2 N ARG B 153 ? N ARG B 122 O ASN B 156 ? O ASN B 125 
K  1 2 N ILE B 216 ? N ILE B 185 O ILE B 386 ? O ILE B 355 
K  2 3 O VAL B 385 ? O VAL B 354 N LYS B 377 ? N LYS B 346 
L  1 2 N THR B 314 ? N THR B 283 O VAL B 325 ? O VAL B 294 
M  1 2 N ILE B 373 ? N ILE B 342 O GLU B 389 ? O GLU B 358 
N  1 2 N ASN B 432 ? N ASN B 401 O SER B 435 ? O SER B 404 
O  1 2 N THR B 485 ? N THR B 454 O ILE B 508 ? O ILE B 477 
P  1 2 O TYR C 206 ? O TYR C 175 N LEU C 179 ? N LEU C 148 
P  2 3 O VAL C 180 ? O VAL C 149 N LYS C 132 ? N LYS C 101 
P  3 4 N VAL C 131 ? N VAL C 100 O PHE C 268 ? O PHE C 237 
P  4 5 N VAL C 269 ? N VAL C 238 O LEU C 352 ? O LEU C 321 
P  5 6 O ASN C 351 ? O ASN C 320 N GLU C 301 ? N GLU C 270 
P  6 7 N VAL C 302 ? N VAL C 271 O ILE C 405 ? O ILE C 374 
Q  1 2 N THR C 314 ? N THR C 283 O VAL C 325 ? O VAL C 294 
R  1 2 N ILE C 373 ? N ILE C 342 O GLU C 389 ? O GLU C 358 
S  1 2 N LYS C 377 ? N LYS C 346 O VAL C 385 ? O VAL C 354 
T  1 2 N SER C 430 ? N SER C 399 O THR C 437 ? O THR C 406 
U  1 2 N LYS C 451 ? N LYS C 420 O VAL C 480 ? O VAL C 449 
U  2 3 N THR C 479 ? N THR C 448 O ILE C 498 ? O ILE C 467 
U  3 4 N LYS C 493 ? N LYS C 462 O LEU C 514 ? O LEU C 483 
U  4 5 N ARG C 524 ? N ARG C 493 O SER D 520 ? O SER D 489 
U  5 6 O VAL D 519 ? O VAL D 488 N ILE D 497 ? N ILE D 466 
U  6 7 O GLY D 494 ? O GLY D 463 N ASP D 476 ? N ASP D 445 
U  7 8 O LEU D 478 ? O LEU D 447 N LYS D 451 ? N LYS D 420 
V  1 2 N LYS C 451 ? N LYS C 420 O VAL C 480 ? O VAL C 449 
V  2 3 N THR C 479 ? N THR C 448 O ILE C 498 ? O ILE C 467 
V  3 4 N LYS C 493 ? N LYS C 462 O LEU C 514 ? O LEU C 483 
V  4 5 N ARG C 524 ? N ARG C 493 O SER D 520 ? O SER D 489 
V  5 6 O VAL D 519 ? O VAL D 488 N ILE D 497 ? N ILE D 466 
V  6 7 N SER D 491 ? N SER D 460 O LEU D 514 ? O LEU D 483 
W  1 2 N ASP C 483 ? N ASP C 452 O ILE C 506 ? O ILE C 475 
X  1 2 N GLN D 107 ? N GLN D 76  O ASN D 406 ? O ASN D 375 
Y  1 2 O TYR D 206 ? O TYR D 175 N LEU D 181 ? N LEU D 150 
Y  2 3 O VAL D 180 ? O VAL D 149 N VAL D 130 ? N VAL D 99  
Y  3 4 N VAL D 129 ? N VAL D 98  O TYR D 266 ? O TYR D 235 
Y  4 5 N ILE D 267 ? N ILE D 236 O ILE D 354 ? O ILE D 323 
Y  5 6 O TRP D 353 ? O TRP D 322 N VAL D 299 ? N VAL D 268 
Z  1 2 N VAL D 152 ? N VAL D 121 O ASN D 156 ? O ASN D 125 
AA 1 2 N TYR D 213 ? N TYR D 182 O TYR D 239 ? O TYR D 208 
AB 1 2 N ILE D 216 ? N ILE D 185 O ILE D 386 ? O ILE D 355 
AB 2 3 O GLU D 389 ? O GLU D 358 N ILE D 373 ? N ILE D 342 
AC 1 2 N THR D 316 ? N THR D 285 O ARG D 323 ? O ARG D 292 
AD 1 2 N SER D 430 ? N SER D 399 O THR D 437 ? O THR D 406 
AE 1 2 N THR D 485 ? N THR D 454 O ILE D 508 ? O ILE D 477 
# 
_atom_sites.entry_id                    3R2W 
_atom_sites.fract_transf_matrix[1][1]   0.007120 
_atom_sites.fract_transf_matrix[1][2]   0.004111 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008222 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003208 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . ILE A 1 44  ? -101.119 13.548  5.797    1.00 107.67 ? 13  ILE A N   1 
ATOM 2     C CA  . ILE A 1 44  ? -100.476 12.961  4.581    1.00 107.64 ? 13  ILE A CA  1 
ATOM 3     C C   . ILE A 1 44  ? -99.256  13.783  4.121    1.00 107.69 ? 13  ILE A C   1 
ATOM 4     O O   . ILE A 1 44  ? -98.483  13.333  3.265    1.00 107.68 ? 13  ILE A O   1 
ATOM 5     C CB  . ILE A 1 44  ? -101.513 12.764  3.424    1.00 107.66 ? 13  ILE A CB  1 
ATOM 6     C CG1 . ILE A 1 44  ? -101.113 11.578  2.529    1.00 107.45 ? 13  ILE A CG1 1 
ATOM 7     C CG2 . ILE A 1 44  ? -101.727 14.072  2.637    1.00 107.48 ? 13  ILE A CG2 1 
ATOM 8     C CD1 . ILE A 1 44  ? -102.276 10.870  1.841    1.00 106.92 ? 13  ILE A CD1 1 
ATOM 9     N N   . ARG A 1 45  ? -99.089  14.972  4.714    1.00 107.68 ? 14  ARG A N   1 
ATOM 10    C CA  . ARG A 1 45  ? -97.991  15.915  4.390    1.00 107.51 ? 14  ARG A CA  1 
ATOM 11    C C   . ARG A 1 45  ? -96.686  15.673  5.179    1.00 107.36 ? 14  ARG A C   1 
ATOM 12    O O   . ARG A 1 45  ? -95.603  15.613  4.596    1.00 107.07 ? 14  ARG A O   1 
ATOM 13    C CB  . ARG A 1 45  ? -98.455  17.384  4.522    1.00 107.51 ? 14  ARG A CB  1 
ATOM 14    C CG  . ARG A 1 45  ? -99.604  17.653  5.516    1.00 107.16 ? 14  ARG A CG  1 
ATOM 15    C CD  . ARG A 1 45  ? -100.982 17.545  4.853    1.00 106.75 ? 14  ARG A CD  1 
ATOM 16    N NE  . ARG A 1 45  ? -102.047 18.082  5.703    1.00 106.76 ? 14  ARG A NE  1 
ATOM 17    C CZ  . ARG A 1 45  ? -103.343 18.101  5.387    1.00 106.49 ? 14  ARG A CZ  1 
ATOM 18    N NH1 . ARG A 1 45  ? -103.764 17.606  4.230    1.00 106.77 ? 14  ARG A NH1 1 
ATOM 19    N NH2 . ARG A 1 45  ? -104.226 18.618  6.235    1.00 105.70 ? 14  ARG A NH2 1 
ATOM 20    N N   . GLN A 1 46  ? -96.809  15.554  6.501    1.00 107.36 ? 15  GLN A N   1 
ATOM 21    C CA  . GLN A 1 46  ? -95.705  15.158  7.380    1.00 107.30 ? 15  GLN A CA  1 
ATOM 22    C C   . GLN A 1 46  ? -95.962  13.764  7.972    1.00 107.35 ? 15  GLN A C   1 
ATOM 23    O O   . GLN A 1 46  ? -95.152  13.249  8.752    1.00 107.30 ? 15  GLN A O   1 
ATOM 24    C CB  . GLN A 1 46  ? -95.513  16.190  8.498    1.00 107.22 ? 15  GLN A CB  1 
ATOM 25    N N   . GLU A 1 47  ? -97.096  13.169  7.586    1.00 107.46 ? 16  GLU A N   1 
ATOM 26    C CA  . GLU A 1 47  ? -97.527  11.841  8.050    1.00 107.51 ? 16  GLU A CA  1 
ATOM 27    C C   . GLU A 1 47  ? -96.831  10.704  7.297    1.00 107.52 ? 16  GLU A C   1 
ATOM 28    O O   . GLU A 1 47  ? -96.658  9.606   7.834    1.00 107.57 ? 16  GLU A O   1 
ATOM 29    C CB  . GLU A 1 47  ? -99.050  11.695  7.934    1.00 107.43 ? 16  GLU A CB  1 
ATOM 30    N N   . LEU A 1 48  ? -96.449  10.973  6.050    1.00 107.52 ? 17  LEU A N   1 
ATOM 31    C CA  . LEU A 1 48  ? -95.644  10.039  5.261    1.00 107.52 ? 17  LEU A CA  1 
ATOM 32    C C   . LEU A 1 48  ? -94.186  10.554  5.170    1.00 107.52 ? 17  LEU A C   1 
ATOM 33    O O   . LEU A 1 48  ? -93.464  10.315  4.193    1.00 107.33 ? 17  LEU A O   1 
ATOM 34    C CB  . LEU A 1 48  ? -96.293  9.790   3.888    1.00 107.52 ? 17  LEU A CB  1 
ATOM 35    C CG  . LEU A 1 48  ? -97.806  9.476   3.853    1.00 107.60 ? 17  LEU A CG  1 
ATOM 36    C CD1 . LEU A 1 48  ? -98.330  9.430   2.421    1.00 107.57 ? 17  LEU A CD1 1 
ATOM 37    C CD2 . LEU A 1 48  ? -98.175  8.186   4.599    1.00 107.38 ? 17  LEU A CD2 1 
ATOM 38    N N   . GLU A 1 49  ? -93.791  11.268  6.227    1.00 107.56 ? 18  GLU A N   1 
ATOM 39    C CA  . GLU A 1 49  ? -92.439  11.779  6.453    1.00 107.44 ? 18  GLU A CA  1 
ATOM 40    C C   . GLU A 1 49  ? -91.951  11.202  7.778    1.00 107.40 ? 18  GLU A C   1 
ATOM 41    O O   . GLU A 1 49  ? -90.777  10.864  7.927    1.00 107.26 ? 18  GLU A O   1 
ATOM 42    C CB  . GLU A 1 49  ? -92.464  13.313  6.539    1.00 107.45 ? 18  GLU A CB  1 
ATOM 43    C CG  . GLU A 1 49  ? -91.118  13.971  6.857    1.00 107.38 ? 18  GLU A CG  1 
ATOM 44    C CD  . GLU A 1 49  ? -91.254  15.277  7.633    1.00 107.05 ? 18  GLU A CD  1 
ATOM 45    O OE1 . GLU A 1 49  ? -91.398  15.223  8.873    1.00 106.76 ? 18  GLU A OE1 1 
ATOM 46    O OE2 . GLU A 1 49  ? -91.192  16.358  7.009    1.00 107.02 ? 18  GLU A OE2 1 
ATOM 47    N N   . LEU A 1 50  ? -92.875  11.106  8.737    1.00 107.49 ? 19  LEU A N   1 
ATOM 48    C CA  . LEU A 1 50  ? -92.615  10.527  10.051   1.00 107.68 ? 19  LEU A CA  1 
ATOM 49    C C   . LEU A 1 50  ? -92.293  9.030   9.967    1.00 107.92 ? 19  LEU A C   1 
ATOM 50    O O   . LEU A 1 50  ? -91.618  8.486   10.848   1.00 108.04 ? 19  LEU A O   1 
ATOM 51    C CB  . LEU A 1 50  ? -93.809  10.763  10.980   1.00 107.50 ? 19  LEU A CB  1 
ATOM 52    N N   . SER A 1 51  ? -92.778  8.373   8.910    1.00 108.12 ? 20  SER A N   1 
ATOM 53    C CA  . SER A 1 51  ? -92.481  6.954   8.663    1.00 108.18 ? 20  SER A CA  1 
ATOM 54    C C   . SER A 1 51  ? -91.136  6.769   7.959    1.00 108.16 ? 20  SER A C   1 
ATOM 55    O O   . SER A 1 51  ? -90.545  5.688   8.009    1.00 108.08 ? 20  SER A O   1 
ATOM 56    C CB  . SER A 1 51  ? -93.608  6.277   7.864    1.00 108.21 ? 20  SER A CB  1 
ATOM 57    O OG  . SER A 1 51  ? -93.670  6.751   6.531    1.00 108.06 ? 20  SER A OG  1 
ATOM 58    N N   . VAL A 1 52  ? -90.665  7.834   7.312    1.00 108.24 ? 21  VAL A N   1 
ATOM 59    C CA  . VAL A 1 52  ? -89.374  7.828   6.614    1.00 108.27 ? 21  VAL A CA  1 
ATOM 60    C C   . VAL A 1 52  ? -88.238  8.381   7.501    1.00 108.12 ? 21  VAL A C   1 
ATOM 61    O O   . VAL A 1 52  ? -87.057  8.222   7.181    1.00 108.05 ? 21  VAL A O   1 
ATOM 62    C CB  . VAL A 1 52  ? -89.449  8.574   5.246    1.00 108.37 ? 21  VAL A CB  1 
ATOM 63    C CG1 . VAL A 1 52  ? -88.306  8.140   4.321    1.00 108.29 ? 21  VAL A CG1 1 
ATOM 64    C CG2 . VAL A 1 52  ? -90.797  8.316   4.566    1.00 108.37 ? 21  VAL A CG2 1 
ATOM 65    N N   . LYS A 1 53  ? -88.599  9.021   8.614    1.00 107.94 ? 22  LYS A N   1 
ATOM 66    C CA  . LYS A 1 53  ? -87.613  9.401   9.622    1.00 107.69 ? 22  LYS A CA  1 
ATOM 67    C C   . LYS A 1 53  ? -87.299  8.217   10.535   1.00 107.79 ? 22  LYS A C   1 
ATOM 68    O O   . LYS A 1 53  ? -86.254  8.192   11.187   1.00 107.81 ? 22  LYS A O   1 
ATOM 69    C CB  . LYS A 1 53  ? -88.074  10.607  10.441   1.00 107.50 ? 22  LYS A CB  1 
ATOM 70    C CG  . LYS A 1 53  ? -86.911  11.338  11.080   1.00 107.09 ? 22  LYS A CG  1 
ATOM 71    C CD  . LYS A 1 53  ? -87.348  12.497  11.941   1.00 106.40 ? 22  LYS A CD  1 
ATOM 72    C CE  . LYS A 1 53  ? -86.137  13.316  12.347   1.00 105.92 ? 22  LYS A CE  1 
ATOM 73    N NZ  . LYS A 1 53  ? -86.516  14.603  12.980   1.00 105.39 ? 22  LYS A NZ  1 
ATOM 74    N N   . LYS A 1 54  ? -88.208  7.240   10.570   1.00 107.88 ? 23  LYS A N   1 
ATOM 75    C CA  . LYS A 1 54  ? -88.022  6.007   11.346   1.00 107.96 ? 23  LYS A CA  1 
ATOM 76    C C   . LYS A 1 54  ? -87.140  4.990   10.609   1.00 107.96 ? 23  LYS A C   1 
ATOM 77    O O   . LYS A 1 54  ? -86.674  4.011   11.204   1.00 108.04 ? 23  LYS A O   1 
ATOM 78    C CB  . LYS A 1 54  ? -89.378  5.381   11.705   1.00 107.88 ? 23  LYS A CB  1 
ATOM 79    N N   . GLU A 1 55  ? -86.920  5.235   9.317    1.00 203.66 ? 24  GLU A N   1 
ATOM 80    C CA  . GLU A 1 55  ? -86.130  4.351   8.463    1.00 202.42 ? 24  GLU A CA  1 
ATOM 81    C C   . GLU A 1 55  ? -84.634  4.618   8.636    1.00 201.07 ? 24  GLU A C   1 
ATOM 82    O O   . GLU A 1 55  ? -83.823  3.692   8.547    1.00 200.60 ? 24  GLU A O   1 
ATOM 83    C CB  . GLU A 1 55  ? -86.545  4.530   6.996    1.00 201.61 ? 24  GLU A CB  1 
ATOM 84    C CG  . GLU A 1 55  ? -85.956  3.514   6.011    1.00 200.79 ? 24  GLU A CG  1 
ATOM 85    C CD  . GLU A 1 55  ? -86.898  2.363   5.690    1.00 202.04 ? 24  GLU A CD  1 
ATOM 86    O OE1 . GLU A 1 55  ? -88.019  2.617   5.197    1.00 202.75 ? 24  GLU A OE1 1 
ATOM 87    O OE2 . GLU A 1 55  ? -86.506  1.198   5.912    1.00 202.70 ? 24  GLU A OE2 1 
ATOM 88    N N   . LEU A 1 56  ? -84.277  5.880   8.882    1.00 200.53 ? 25  LEU A N   1 
ATOM 89    C CA  . LEU A 1 56  ? -82.878  6.268   9.098    1.00 199.39 ? 25  LEU A CA  1 
ATOM 90    C C   . LEU A 1 56  ? -82.361  5.789   10.459   1.00 200.25 ? 25  LEU A C   1 
ATOM 91    O O   . LEU A 1 56  ? -81.150  5.654   10.658   1.00 199.42 ? 25  LEU A O   1 
ATOM 92    C CB  . LEU A 1 56  ? -82.679  7.783   8.910    1.00 198.73 ? 25  LEU A CB  1 
ATOM 93    C CG  . LEU A 1 56  ? -83.350  8.822   9.819    1.00 199.79 ? 25  LEU A CG  1 
ATOM 94    C CD1 . LEU A 1 56  ? -82.427  9.288   10.942   1.00 199.22 ? 25  LEU A CD1 1 
ATOM 95    C CD2 . LEU A 1 56  ? -83.782  10.013  8.979    1.00 199.27 ? 25  LEU A CD2 1 
ATOM 96    N N   . GLU A 1 57  ? -83.294  5.531   11.378   1.00 201.98 ? 26  GLU A N   1 
ATOM 97    C CA  . GLU A 1 57  ? -83.004  4.890   12.672   1.00 203.12 ? 26  GLU A CA  1 
ATOM 98    C C   . GLU A 1 57  ? -82.665  3.400   12.496   1.00 202.93 ? 26  GLU A C   1 
ATOM 99    O O   . GLU A 1 57  ? -81.940  2.817   13.310   1.00 203.26 ? 26  GLU A O   1 
ATOM 100   C CB  . GLU A 1 57  ? -84.189  5.049   13.645   1.00 205.18 ? 26  GLU A CB  1 
ATOM 101   C CG  . GLU A 1 57  ? -84.685  6.490   13.853   1.00 205.64 ? 26  GLU A CG  1 
ATOM 102   C CD  . GLU A 1 57  ? -83.599  7.431   14.361   1.00 205.21 ? 26  GLU A CD  1 
ATOM 103   O OE1 . GLU A 1 57  ? -83.069  7.192   15.468   1.00 206.01 ? 26  GLU A OE1 1 
ATOM 104   O OE2 . GLU A 1 57  ? -83.280  8.412   13.653   1.00 203.84 ? 26  GLU A OE2 1 
ATOM 105   N N   . LYS A 1 58  ? -83.208  2.797   11.436   1.00 202.34 ? 27  LYS A N   1 
ATOM 106   C CA  . LYS A 1 58  ? -82.876  1.432   11.034   1.00 201.78 ? 27  LYS A CA  1 
ATOM 107   C C   . LYS A 1 58  ? -81.508  1.370   10.341   1.00 199.76 ? 27  LYS A C   1 
ATOM 108   O O   . LYS A 1 58  ? -80.961  0.282   10.136   1.00 199.63 ? 27  LYS A O   1 
ATOM 109   C CB  . LYS A 1 58  ? -83.963  0.861   10.116   1.00 202.08 ? 27  LYS A CB  1 
ATOM 110   N N   . ILE A 1 59  ? -80.961  2.535   9.988    1.00 198.18 ? 28  ILE A N   1 
ATOM 111   C CA  . ILE A 1 59  ? -79.638  2.610   9.360    1.00 196.04 ? 28  ILE A CA  1 
ATOM 112   C C   . ILE A 1 59  ? -78.567  3.088   10.353   1.00 195.52 ? 28  ILE A C   1 
ATOM 113   O O   . ILE A 1 59  ? -77.520  2.449   10.475   1.00 194.82 ? 28  ILE A O   1 
ATOM 114   C CB  . ILE A 1 59  ? -79.642  3.457   8.049    1.00 194.77 ? 28  ILE A CB  1 
ATOM 115   C CG1 . ILE A 1 59  ? -80.875  3.122   7.195    1.00 195.06 ? 28  ILE A CG1 1 
ATOM 116   C CG2 . ILE A 1 59  ? -78.368  3.190   7.245    1.00 193.23 ? 28  ILE A CG2 1 
ATOM 117   C CD1 . ILE A 1 59  ? -81.272  4.185   6.183    1.00 193.77 ? 28  ILE A CD1 1 
ATOM 118   N N   . LEU A 1 60  ? -78.841  4.191   11.061   1.00 195.65 ? 29  LEU A N   1 
ATOM 119   C CA  . LEU A 1 60  ? -77.942  4.708   12.108   1.00 195.38 ? 29  LEU A CA  1 
ATOM 120   C C   . LEU A 1 60  ? -77.490  3.613   13.059   1.00 196.11 ? 29  LEU A C   1 
ATOM 121   O O   . LEU A 1 60  ? -76.328  3.574   13.455   1.00 195.51 ? 29  LEU A O   1 
ATOM 122   C CB  . LEU A 1 60  ? -78.592  5.839   12.919   1.00 196.26 ? 29  LEU A CB  1 
ATOM 123   C CG  . LEU A 1 60  ? -78.149  7.301   12.759   1.00 195.16 ? 29  LEU A CG  1 
ATOM 124   C CD1 . LEU A 1 60  ? -78.834  8.167   13.807   1.00 196.51 ? 29  LEU A CD1 1 
ATOM 125   C CD2 . LEU A 1 60  ? -76.642  7.484   12.855   1.00 193.62 ? 29  LEU A CD2 1 
ATOM 126   N N   . THR A 1 61  ? -78.417  2.728   13.419   1.00 197.46 ? 30  THR A N   1 
ATOM 127   C CA  . THR A 1 61  ? -78.100  1.559   14.235   1.00 198.41 ? 30  THR A CA  1 
ATOM 128   C C   . THR A 1 61  ? -76.880  0.806   13.683   1.00 197.30 ? 30  THR A C   1 
ATOM 129   O O   . THR A 1 61  ? -76.060  0.301   14.459   1.00 197.75 ? 30  THR A O   1 
ATOM 130   C CB  . THR A 1 61  ? -79.326  0.610   14.422   1.00 199.90 ? 30  THR A CB  1 
ATOM 131   O OG1 . THR A 1 61  ? -78.934  -0.539  15.181   1.00 200.98 ? 30  THR A OG1 1 
ATOM 132   C CG2 . THR A 1 61  ? -79.898  0.144   13.094   1.00 198.94 ? 30  THR A CG2 1 
ATOM 133   N N   . THR A 1 62  ? -76.759  0.752   12.352   1.00 195.89 ? 31  THR A N   1 
ATOM 134   C CA  . THR A 1 62  ? -75.568  0.213   11.697   1.00 194.40 ? 31  THR A CA  1 
ATOM 135   C C   . THR A 1 62  ? -74.558  1.334   11.553   1.00 193.23 ? 31  THR A C   1 
ATOM 136   O O   . THR A 1 62  ? -74.327  1.839   10.457   1.00 191.84 ? 31  THR A O   1 
ATOM 137   C CB  . THR A 1 62  ? -75.864  -0.369  10.305   1.00 193.47 ? 31  THR A CB  1 
ATOM 138   O OG1 . THR A 1 62  ? -77.185  -0.913  10.285   1.00 194.82 ? 31  THR A OG1 1 
ATOM 139   C CG2 . THR A 1 62  ? -74.853  -1.456  9.952    1.00 192.45 ? 31  THR A CG2 1 
ATOM 140   N N   . ALA A 1 63  ? -73.981  1.730   12.683   1.00 193.99 ? 32  ALA A N   1 
ATOM 141   C CA  . ALA A 1 63  ? -72.896  2.702   12.724   1.00 193.22 ? 32  ALA A CA  1 
ATOM 142   C C   . ALA A 1 63  ? -71.530  2.017   12.850   1.00 192.84 ? 32  ALA A C   1 
ATOM 143   O O   . ALA A 1 63  ? -71.432  0.816   13.129   1.00 193.35 ? 32  ALA A O   1 
ATOM 144   C CB  . ALA A 1 63  ? -73.105  3.690   13.866   1.00 194.08 ? 32  ALA A CB  1 
ATOM 145   N N   . SER A 1 64  ? -70.480  2.804   12.645   1.00 192.06 ? 33  SER A N   1 
ATOM 146   C CA  . SER A 1 64  ? -69.108  2.318   12.635   1.00 191.64 ? 33  SER A CA  1 
ATOM 147   C C   . SER A 1 64  ? -68.498  2.425   14.037   1.00 192.75 ? 33  SER A C   1 
ATOM 148   O O   . SER A 1 64  ? -67.316  2.749   14.186   1.00 192.12 ? 33  SER A O   1 
ATOM 149   C CB  . SER A 1 64  ? -68.302  3.124   11.605   1.00 190.00 ? 33  SER A CB  1 
ATOM 150   O OG  . SER A 1 64  ? -66.980  2.642   11.462   1.00 189.45 ? 33  SER A OG  1 
ATOM 151   N N   . SER A 1 65  ? -69.312  2.125   15.054   1.00 194.54 ? 34  SER A N   1 
ATOM 152   C CA  . SER A 1 65  ? -68.967  2.330   16.467   1.00 195.93 ? 34  SER A CA  1 
ATOM 153   C C   . SER A 1 65  ? -68.422  3.738   16.721   1.00 195.70 ? 34  SER A C   1 
ATOM 154   O O   . SER A 1 65  ? -69.141  4.577   17.262   1.00 196.46 ? 34  SER A O   1 
ATOM 155   C CB  . SER A 1 65  ? -68.031  1.234   17.001   1.00 196.24 ? 34  SER A CB  1 
ATOM 156   O OG  . SER A 1 65  ? -66.797  1.218   16.304   1.00 194.83 ? 34  SER A OG  1 
ATOM 157   N N   . HIS A 1 66  ? -67.176  4.008   16.318   1.00 194.83 ? 35  HIS A N   1 
ATOM 158   C CA  . HIS A 1 66  ? -66.631  5.371   16.428   1.00 194.71 ? 35  HIS A CA  1 
ATOM 159   C C   . HIS A 1 66  ? -67.252  6.350   15.418   1.00 193.69 ? 35  HIS A C   1 
ATOM 160   O O   . HIS A 1 66  ? -67.784  7.388   15.824   1.00 194.27 ? 35  HIS A O   1 
ATOM 161   C CB  . HIS A 1 66  ? -65.077  5.429   16.474   1.00 194.26 ? 35  HIS A CB  1 
ATOM 162   C CG  . HIS A 1 66  ? -64.376  4.870   15.264   1.00 194.31 ? 35  HIS A CG  1 
ATOM 163   N ND1 . HIS A 1 66  ? -64.195  3.516   15.059   1.00 195.49 ? 35  HIS A ND1 1 
ATOM 164   C CD2 . HIS A 1 66  ? -63.751  5.489   14.230   1.00 193.77 ? 35  HIS A CD2 1 
ATOM 165   C CE1 . HIS A 1 66  ? -63.520  3.324   13.938   1.00 194.28 ? 35  HIS A CE1 1 
ATOM 166   N NE2 . HIS A 1 66  ? -63.239  4.505   13.415   1.00 193.40 ? 35  HIS A NE2 1 
ATOM 167   N N   . GLU A 1 67  ? -67.213  6.009   14.126   1.00 192.25 ? 36  GLU A N   1 
ATOM 168   C CA  . GLU A 1 67  ? -67.827  6.835   13.077   1.00 191.17 ? 36  GLU A CA  1 
ATOM 169   C C   . GLU A 1 67  ? -69.355  6.774   13.199   1.00 192.02 ? 36  GLU A C   1 
ATOM 170   O O   . GLU A 1 67  ? -70.005  5.976   12.527   1.00 192.01 ? 36  GLU A O   1 
ATOM 171   C CB  . GLU A 1 67  ? -67.350  6.391   11.688   1.00 189.53 ? 36  GLU A CB  1 
ATOM 172   N N   . PHE A 1 68  ? -69.906  7.629   14.067   1.00 192.82 ? 37  PHE A N   1 
ATOM 173   C CA  . PHE A 1 68  ? -71.301  7.554   14.528   1.00 193.84 ? 37  PHE A CA  1 
ATOM 174   C C   . PHE A 1 68  ? -71.798  8.964   14.811   1.00 193.90 ? 37  PHE A C   1 
ATOM 175   O O   . PHE A 1 68  ? -72.957  9.287   14.547   1.00 194.22 ? 37  PHE A O   1 
ATOM 176   C CB  . PHE A 1 68  ? -71.368  6.686   15.799   1.00 195.36 ? 37  PHE A CB  1 
ATOM 177   C CG  . PHE A 1 68  ? -72.723  6.652   16.496   1.00 197.28 ? 37  PHE A CG  1 
ATOM 178   C CD1 . PHE A 1 68  ? -73.501  5.493   16.467   1.00 198.06 ? 37  PHE A CD1 1 
ATOM 179   C CD2 . PHE A 1 68  ? -73.182  7.744   17.248   1.00 198.45 ? 37  PHE A CD2 1 
ATOM 180   C CE1 . PHE A 1 68  ? -74.734  5.430   17.135   1.00 199.69 ? 37  PHE A CE1 1 
ATOM 181   C CE2 . PHE A 1 68  ? -74.416  7.693   17.915   1.00 199.85 ? 37  PHE A CE2 1 
ATOM 182   C CZ  . PHE A 1 68  ? -75.191  6.531   17.859   1.00 200.38 ? 37  PHE A CZ  1 
ATOM 183   N N   . GLU A 1 69  ? -70.911  9.796   15.354   1.00 193.50 ? 38  GLU A N   1 
ATOM 184   C CA  . GLU A 1 69  ? -71.256  11.174  15.666   1.00 193.65 ? 38  GLU A CA  1 
ATOM 185   C C   . GLU A 1 69  ? -71.212  12.067  14.429   1.00 191.98 ? 38  GLU A C   1 
ATOM 186   O O   . GLU A 1 69  ? -71.800  13.148  14.434   1.00 192.30 ? 38  GLU A O   1 
ATOM 187   C CB  . GLU A 1 69  ? -70.359  11.745  16.767   1.00 194.28 ? 38  GLU A CB  1 
ATOM 188   C CG  . GLU A 1 69  ? -70.947  13.001  17.430   1.00 196.09 ? 38  GLU A CG  1 
ATOM 189   C CD  . GLU A 1 69  ? -69.958  13.757  18.315   1.00 197.81 ? 38  GLU A CD  1 
ATOM 190   O OE1 . GLU A 1 69  ? -69.262  13.116  19.136   1.00 198.77 ? 38  GLU A OE1 1 
ATOM 191   O OE2 . GLU A 1 69  ? -69.891  15.003  18.204   1.00 198.24 ? 38  GLU A OE2 1 
ATOM 192   N N   . HIS A 1 70  ? -70.525  11.624  13.376   1.00 190.14 ? 39  HIS A N   1 
ATOM 193   C CA  . HIS A 1 70  ? -70.471  12.400  12.126   1.00 188.47 ? 39  HIS A CA  1 
ATOM 194   C C   . HIS A 1 70  ? -71.525  11.959  11.100   1.00 187.50 ? 39  HIS A C   1 
ATOM 195   O O   . HIS A 1 70  ? -71.709  12.617  10.071   1.00 186.62 ? 39  HIS A O   1 
ATOM 196   C CB  . HIS A 1 70  ? -69.070  12.357  11.502   1.00 187.43 ? 39  HIS A CB  1 
ATOM 197   C CG  . HIS A 1 70  ? -68.832  11.151  10.649   1.00 187.54 ? 39  HIS A CG  1 
ATOM 198   N ND1 . HIS A 1 70  ? -68.854  9.869   11.156   1.00 189.10 ? 39  HIS A ND1 1 
ATOM 199   C CD2 . HIS A 1 70  ? -68.581  11.029  9.323    1.00 186.86 ? 39  HIS A CD2 1 
ATOM 200   C CE1 . HIS A 1 70  ? -68.622  9.009   10.180   1.00 188.33 ? 39  HIS A CE1 1 
ATOM 201   N NE2 . HIS A 1 70  ? -68.452  9.687   9.058    1.00 187.11 ? 39  HIS A NE2 1 
ATOM 202   N N   . THR A 1 71  ? -72.201  10.846  11.382   1.00 187.33 ? 40  THR A N   1 
ATOM 203   C CA  . THR A 1 71  ? -73.220  10.302  10.485   1.00 186.37 ? 40  THR A CA  1 
ATOM 204   C C   . THR A 1 71  ? -74.586  10.922  10.781   1.00 187.11 ? 40  THR A C   1 
ATOM 205   O O   . THR A 1 71  ? -75.288  11.357  9.865    1.00 186.63 ? 40  THR A O   1 
ATOM 206   C CB  . THR A 1 71  ? -73.301  8.768   10.589   1.00 186.54 ? 40  THR A CB  1 
ATOM 207   O OG1 . THR A 1 71  ? -71.997  8.240   10.839   1.00 185.57 ? 40  THR A OG1 1 
ATOM 208   C CG2 . THR A 1 71  ? -73.832  8.176   9.304    1.00 185.44 ? 40  THR A CG2 1 
ATOM 209   N N   . LYS A 1 72  ? -74.946  10.964  12.065   1.00 188.06 ? 41  LYS A N   1 
ATOM 210   C CA  . LYS A 1 72  ? -76.200  11.576  12.523   1.00 188.78 ? 41  LYS A CA  1 
ATOM 211   C C   . LYS A 1 72  ? -76.177  13.100  12.391   1.00 188.13 ? 41  LYS A C   1 
ATOM 212   O O   . LYS A 1 72  ? -77.231  13.734  12.317   1.00 188.70 ? 41  LYS A O   1 
ATOM 213   C CB  . LYS A 1 72  ? -76.513  11.167  13.968   1.00 190.31 ? 41  LYS A CB  1 
ATOM 214   N N   . LYS A 1 73  ? -74.972  13.673  12.377   1.00 186.80 ? 42  LYS A N   1 
ATOM 215   C CA  . LYS A 1 73  ? -74.761  15.081  12.045   1.00 185.91 ? 42  LYS A CA  1 
ATOM 216   C C   . LYS A 1 73  ? -75.289  15.339  10.639   1.00 184.98 ? 42  LYS A C   1 
ATOM 217   O O   . LYS A 1 73  ? -75.967  16.335  10.390   1.00 185.21 ? 42  LYS A O   1 
ATOM 218   C CB  . LYS A 1 73  ? -73.267  15.431  12.130   1.00 185.02 ? 42  LYS A CB  1 
ATOM 219   C CG  . LYS A 1 73  ? -72.801  16.619  11.270   1.00 183.67 ? 42  LYS A CG  1 
ATOM 220   C CD  . LYS A 1 73  ? -71.438  16.337  10.610   1.00 181.73 ? 42  LYS A CD  1 
ATOM 221   C CE  . LYS A 1 73  ? -71.190  17.241  9.402    1.00 180.24 ? 42  LYS A CE  1 
ATOM 222   N NZ  . LYS A 1 73  ? -70.298  16.625  8.376    1.00 178.53 ? 42  LYS A NZ  1 
ATOM 223   N N   . ASP A 1 74  ? -74.978  14.426  9.726    1.00 183.94 ? 43  ASP A N   1 
ATOM 224   C CA  . ASP A 1 74  ? -75.427  14.544  8.348    1.00 183.10 ? 43  ASP A CA  1 
ATOM 225   C C   . ASP A 1 74  ? -76.909  14.190  8.242    1.00 183.65 ? 43  ASP A C   1 
ATOM 226   O O   . ASP A 1 74  ? -77.713  15.008  7.787    1.00 183.91 ? 43  ASP A O   1 
ATOM 227   C CB  . ASP A 1 74  ? -74.586  13.654  7.417    1.00 182.17 ? 43  ASP A CB  1 
ATOM 228   C CG  . ASP A 1 74  ? -73.132  14.117  7.299    1.00 181.91 ? 43  ASP A CG  1 
ATOM 229   O OD1 . ASP A 1 74  ? -72.874  15.340  7.369    1.00 182.66 ? 43  ASP A OD1 1 
ATOM 230   O OD2 . ASP A 1 74  ? -72.240  13.254  7.122    1.00 181.94 ? 43  ASP A OD2 1 
ATOM 231   N N   . LEU A 1 75  ? -77.265  12.984  8.688    1.00 183.66 ? 44  LEU A N   1 
ATOM 232   C CA  . LEU A 1 75  ? -78.615  12.457  8.500    1.00 183.86 ? 44  LEU A CA  1 
ATOM 233   C C   . LEU A 1 75  ? -79.705  13.434  8.926    1.00 184.64 ? 44  LEU A C   1 
ATOM 234   O O   . LEU A 1 75  ? -80.720  13.554  8.246    1.00 184.84 ? 44  LEU A O   1 
ATOM 235   C CB  . LEU A 1 75  ? -78.785  11.100  9.191    1.00 184.57 ? 44  LEU A CB  1 
ATOM 236   C CG  . LEU A 1 75  ? -78.081  9.897   8.552    1.00 183.27 ? 44  LEU A CG  1 
ATOM 237   C CD1 . LEU A 1 75  ? -78.345  8.636   9.352    1.00 184.26 ? 44  LEU A CD1 1 
ATOM 238   C CD2 . LEU A 1 75  ? -78.510  9.692   7.112    1.00 182.18 ? 44  LEU A CD2 1 
ATOM 239   N N   . ASP A 1 76  ? -79.484  14.142  10.032   1.00 185.01 ? 45  ASP A N   1 
ATOM 240   C CA  . ASP A 1 76  ? -80.450  15.141  10.499   1.00 185.86 ? 45  ASP A CA  1 
ATOM 241   C C   . ASP A 1 76  ? -80.226  16.549  9.942    1.00 184.93 ? 45  ASP A C   1 
ATOM 242   O O   . ASP A 1 76  ? -80.986  17.473  10.251   1.00 185.93 ? 45  ASP A O   1 
ATOM 243   C CB  . ASP A 1 76  ? -80.564  15.151  12.025   1.00 187.28 ? 45  ASP A CB  1 
ATOM 244   C CG  . ASP A 1 76  ? -81.774  14.373  12.520   1.00 188.99 ? 45  ASP A CG  1 
ATOM 245   O OD1 . ASP A 1 76  ? -82.852  14.449  11.880   1.00 189.06 ? 45  ASP A OD1 1 
ATOM 246   O OD2 . ASP A 1 76  ? -81.648  13.688  13.556   1.00 190.81 ? 45  ASP A OD2 1 
ATOM 247   N N   . GLY A 1 77  ? -79.185  16.707  9.130    1.00 183.05 ? 46  GLY A N   1 
ATOM 248   C CA  . GLY A 1 77  ? -79.065  17.873  8.262    1.00 181.83 ? 46  GLY A CA  1 
ATOM 249   C C   . GLY A 1 77  ? -79.840  17.584  6.989    1.00 181.14 ? 46  GLY A C   1 
ATOM 250   O O   . GLY A 1 77  ? -80.381  18.487  6.355    1.00 180.95 ? 46  GLY A O   1 
ATOM 251   N N   . PHE A 1 78  ? -79.892  16.303  6.634    1.00 180.73 ? 47  PHE A N   1 
ATOM 252   C CA  . PHE A 1 78  ? -80.654  15.805  5.493    1.00 180.45 ? 47  PHE A CA  1 
ATOM 253   C C   . PHE A 1 78  ? -82.161  15.777  5.769    1.00 181.61 ? 47  PHE A C   1 
ATOM 254   O O   . PHE A 1 78  ? -82.968  16.071  4.881    1.00 181.53 ? 47  PHE A O   1 
ATOM 255   C CB  . PHE A 1 78  ? -80.158  14.404  5.135    1.00 179.97 ? 47  PHE A CB  1 
ATOM 256   C CG  . PHE A 1 78  ? -80.970  13.718  4.082    1.00 180.45 ? 47  PHE A CG  1 
ATOM 257   C CD1 . PHE A 1 78  ? -80.852  14.087  2.747    1.00 180.20 ? 47  PHE A CD1 1 
ATOM 258   C CD2 . PHE A 1 78  ? -81.844  12.691  4.422    1.00 181.84 ? 47  PHE A CD2 1 
ATOM 259   C CE1 . PHE A 1 78  ? -81.598  13.447  1.763    1.00 180.66 ? 47  PHE A CE1 1 
ATOM 260   C CE2 . PHE A 1 78  ? -82.595  12.047  3.449    1.00 182.15 ? 47  PHE A CE2 1 
ATOM 261   C CZ  . PHE A 1 78  ? -82.471  12.423  2.115    1.00 181.61 ? 47  PHE A CZ  1 
ATOM 262   N N   . ARG A 1 79  ? -82.522  15.391  6.993    1.00 182.58 ? 48  ARG A N   1 
ATOM 263   C CA  . ARG A 1 79  ? -83.901  15.435  7.468    1.00 183.78 ? 48  ARG A CA  1 
ATOM 264   C C   . ARG A 1 79  ? -84.383  16.883  7.525    1.00 184.13 ? 48  ARG A C   1 
ATOM 265   O O   . ARG A 1 79  ? -85.436  17.201  6.977    1.00 184.72 ? 48  ARG A O   1 
ATOM 266   C CB  . ARG A 1 79  ? -84.031  14.764  8.838    1.00 184.79 ? 48  ARG A CB  1 
ATOM 267   N N   . LYS A 1 80  ? -83.603  17.758  8.162    1.00 183.89 ? 49  LYS A N   1 
ATOM 268   C CA  . LYS A 1 80  ? -83.907  19.192  8.201    1.00 184.19 ? 49  LYS A CA  1 
ATOM 269   C C   . LYS A 1 80  ? -83.938  19.806  6.797    1.00 183.37 ? 49  LYS A C   1 
ATOM 270   O O   . LYS A 1 80  ? -84.349  20.956  6.624    1.00 183.66 ? 49  LYS A O   1 
ATOM 271   C CB  . LYS A 1 80  ? -82.918  19.942  9.099    1.00 183.98 ? 49  LYS A CB  1 
ATOM 272   N N   . LEU A 1 81  ? -83.501  19.033  5.802    1.00 182.48 ? 50  LEU A N   1 
ATOM 273   C CA  . LEU A 1 81  ? -83.664  19.413  4.399    1.00 181.98 ? 50  LEU A CA  1 
ATOM 274   C C   . LEU A 1 81  ? -84.878  18.752  3.746    1.00 182.58 ? 50  LEU A C   1 
ATOM 275   O O   . LEU A 1 81  ? -85.555  19.381  2.940    1.00 182.82 ? 50  LEU A O   1 
ATOM 276   C CB  . LEU A 1 81  ? -82.399  19.135  3.579    1.00 180.58 ? 50  LEU A CB  1 
ATOM 277   C CG  . LEU A 1 81  ? -81.197  20.086  3.694    1.00 180.15 ? 50  LEU A CG  1 
ATOM 278   C CD1 . LEU A 1 81  ? -80.153  19.716  2.639    1.00 179.33 ? 50  LEU A CD1 1 
ATOM 279   C CD2 . LEU A 1 81  ? -81.583  21.562  3.559    1.00 180.43 ? 50  LEU A CD2 1 
ATOM 280   N N   . PHE A 1 82  ? -85.145  17.491  4.094    1.00 183.03 ? 51  PHE A N   1 
ATOM 281   C CA  . PHE A 1 82  ? -86.327  16.750  3.605    1.00 183.68 ? 51  PHE A CA  1 
ATOM 282   C C   . PHE A 1 82  ? -87.644  17.445  3.993    1.00 185.12 ? 51  PHE A C   1 
ATOM 283   O O   . PHE A 1 82  ? -88.581  17.515  3.189    1.00 185.45 ? 51  PHE A O   1 
ATOM 284   C CB  . PHE A 1 82  ? -86.299  15.305  4.130    1.00 183.97 ? 51  PHE A CB  1 
ATOM 285   C CG  . PHE A 1 82  ? -87.062  14.315  3.280    1.00 183.61 ? 51  PHE A CG  1 
ATOM 286   C CD1 . PHE A 1 82  ? -86.698  14.077  1.956    1.00 182.19 ? 51  PHE A CD1 1 
ATOM 287   C CD2 . PHE A 1 82  ? -88.117  13.592  3.817    1.00 184.36 ? 51  PHE A CD2 1 
ATOM 288   C CE1 . PHE A 1 82  ? -87.393  13.152  1.172    1.00 182.05 ? 51  PHE A CE1 1 
ATOM 289   C CE2 . PHE A 1 82  ? -88.815  12.666  3.041    1.00 184.53 ? 51  PHE A CE2 1 
ATOM 290   C CZ  . PHE A 1 82  ? -88.451  12.446  1.716    1.00 183.17 ? 51  PHE A CZ  1 
ATOM 291   N N   . HIS A 1 83  ? -87.694  17.947  5.231    1.00 185.99 ? 52  HIS A N   1 
ATOM 292   C CA  . HIS A 1 83  ? -88.769  18.817  5.730    1.00 187.30 ? 52  HIS A CA  1 
ATOM 293   C C   . HIS A 1 83  ? -88.967  19.988  4.764    1.00 186.74 ? 52  HIS A C   1 
ATOM 294   O O   . HIS A 1 83  ? -90.074  20.219  4.268    1.00 187.44 ? 52  HIS A O   1 
ATOM 295   C CB  . HIS A 1 83  ? -88.403  19.328  7.140    1.00 188.02 ? 52  HIS A CB  1 
ATOM 296   C CG  . HIS A 1 83  ? -89.547  19.933  7.902    1.00 189.78 ? 52  HIS A CG  1 
ATOM 297   N ND1 . HIS A 1 83  ? -90.537  19.174  8.490    1.00 191.13 ? 52  HIS A ND1 1 
ATOM 298   C CD2 . HIS A 1 83  ? -89.835  21.223  8.203    1.00 190.30 ? 52  HIS A CD2 1 
ATOM 299   C CE1 . HIS A 1 83  ? -91.397  19.970  9.101    1.00 192.27 ? 52  HIS A CE1 1 
ATOM 300   N NE2 . HIS A 1 83  ? -90.993  21.218  8.943    1.00 191.91 ? 52  HIS A NE2 1 
ATOM 301   N N   . ARG A 1 84  ? -87.868  20.688  4.482    1.00 185.46 ? 53  ARG A N   1 
ATOM 302   C CA  . ARG A 1 84  ? -87.833  21.851  3.592    1.00 184.83 ? 53  ARG A CA  1 
ATOM 303   C C   . ARG A 1 84  ? -88.185  21.511  2.119    1.00 184.17 ? 53  ARG A C   1 
ATOM 304   O O   . ARG A 1 84  ? -88.539  22.404  1.339    1.00 184.10 ? 53  ARG A O   1 
ATOM 305   C CB  . ARG A 1 84  ? -86.445  22.511  3.705    1.00 183.73 ? 53  ARG A CB  1 
ATOM 306   C CG  . ARG A 1 84  ? -86.363  23.982  3.313    1.00 183.55 ? 53  ARG A CG  1 
ATOM 307   C CD  . ARG A 1 84  ? -84.924  24.495  3.415    1.00 182.39 ? 53  ARG A CD  1 
ATOM 308   N NE  . ARG A 1 84  ? -84.780  25.864  2.918    1.00 182.19 ? 53  ARG A NE  1 
ATOM 309   N N   . PHE A 1 85  ? -88.107  20.224  1.764    1.00 183.66 ? 54  PHE A N   1 
ATOM 310   C CA  . PHE A 1 85  ? -88.304  19.732  0.387    1.00 182.91 ? 54  PHE A CA  1 
ATOM 311   C C   . PHE A 1 85  ? -89.771  19.678  -0.025   1.00 184.39 ? 54  PHE A C   1 
ATOM 312   O O   . PHE A 1 85  ? -90.118  20.039  -1.151   1.00 184.27 ? 54  PHE A O   1 
ATOM 313   C CB  . PHE A 1 85  ? -87.650  18.347  0.237    1.00 181.87 ? 54  PHE A CB  1 
ATOM 314   C CG  . PHE A 1 85  ? -87.941  17.637  -1.072   1.00 180.49 ? 54  PHE A CG  1 
ATOM 315   C CD1 . PHE A 1 85  ? -87.831  18.288  -2.300   1.00 178.84 ? 54  PHE A CD1 1 
ATOM 316   C CD2 . PHE A 1 85  ? -88.268  16.280  -1.071   1.00 180.09 ? 54  PHE A CD2 1 
ATOM 317   C CE1 . PHE A 1 85  ? -88.087  17.605  -3.499   1.00 177.84 ? 54  PHE A CE1 1 
ATOM 318   C CE2 . PHE A 1 85  ? -88.514  15.588  -2.267   1.00 178.82 ? 54  PHE A CE2 1 
ATOM 319   C CZ  . PHE A 1 85  ? -88.421  16.251  -3.479   1.00 177.70 ? 54  PHE A CZ  1 
ATOM 320   N N   . LEU A 1 86  ? -90.623  19.237  0.898    1.00 186.04 ? 55  LEU A N   1 
ATOM 321   C CA  . LEU A 1 86  ? -92.036  18.965  0.615    1.00 187.38 ? 55  LEU A CA  1 
ATOM 322   C C   . LEU A 1 86  ? -92.902  20.231  0.583    1.00 188.64 ? 55  LEU A C   1 
ATOM 323   O O   . LEU A 1 86  ? -93.976  20.246  -0.026   1.00 189.31 ? 55  LEU A O   1 
ATOM 324   C CB  . LEU A 1 86  ? -92.574  17.951  1.634    1.00 188.24 ? 55  LEU A CB  1 
ATOM 325   C CG  . LEU A 1 86  ? -91.659  16.754  1.950    1.00 186.65 ? 55  LEU A CG  1 
ATOM 326   C CD1 . LEU A 1 86  ? -91.960  16.173  3.322    1.00 186.90 ? 55  LEU A CD1 1 
ATOM 327   C CD2 . LEU A 1 86  ? -91.714  15.672  0.870    1.00 184.85 ? 55  LEU A CD2 1 
ATOM 328   N N   . GLN A 1 87  ? -92.410  21.289  1.224    1.00 189.12 ? 56  GLN A N   1 
ATOM 329   C CA  . GLN A 1 87  ? -93.131  22.555  1.341    1.00 190.58 ? 56  GLN A CA  1 
ATOM 330   C C   . GLN A 1 87  ? -93.007  23.462  0.109    1.00 190.28 ? 56  GLN A C   1 
ATOM 331   O O   . GLN A 1 87  ? -93.982  23.645  -0.637   1.00 190.92 ? 56  GLN A O   1 
ATOM 332   C CB  . GLN A 1 87  ? -92.675  23.315  2.594    1.00 190.83 ? 56  GLN A CB  1 
ATOM 333   C CG  . GLN A 1 87  ? -93.045  22.648  3.903    1.00 192.24 ? 56  GLN A CG  1 
ATOM 334   C CD  . GLN A 1 87  ? -93.472  23.647  4.968    1.00 194.11 ? 56  GLN A CD  1 
ATOM 335   O OE1 . GLN A 1 87  ? -94.585  24.185  4.931    1.00 195.58 ? 56  GLN A OE1 1 
ATOM 336   N NE2 . GLN A 1 87  ? -92.590  23.890  5.933    1.00 194.21 ? 56  GLN A NE2 1 
ATOM 337   N N   . GLU A 1 88  ? -91.798  24.007  -0.085   1.00 189.55 ? 57  GLU A N   1 
ATOM 338   C CA  . GLU A 1 88  ? -91.500  25.111  -1.025   1.00 189.24 ? 57  GLU A CA  1 
ATOM 339   C C   . GLU A 1 88  ? -92.532  26.258  -0.953   1.00 190.51 ? 57  GLU A C   1 
ATOM 340   O O   . GLU A 1 88  ? -92.150  27.440  -0.551   1.00 190.63 ? 57  GLU A O   1 
ATOM 341   C CB  . GLU A 1 88  ? -91.294  24.605  -2.470   1.00 188.30 ? 57  GLU A CB  1 
ATOM 342   C CG  . GLU A 1 88  ? -92.560  24.511  -3.321   1.00 189.11 ? 57  GLU A CG  1 
ATOM 343   C CD  . GLU A 1 88  ? -92.259  24.330  -4.790   1.00 188.00 ? 57  GLU A CD  1 
ATOM 344   O OE1 . GLU A 1 88  ? -92.219  25.346  -5.519   1.00 187.71 ? 57  GLU A OE1 1 
ATOM 345   O OE2 . GLU A 1 88  ? -92.051  23.175  -5.213   1.00 187.43 ? 57  GLU A OE2 1 
ATOM 346   N N   . GLY A 1 96  ? -91.611  37.968  -6.470   1.00 186.71 ? 65  GLY A N   1 
ATOM 347   C CA  . GLY A 1 96  ? -91.765  38.814  -7.644   1.00 186.95 ? 65  GLY A CA  1 
ATOM 348   C C   . GLY A 1 96  ? -92.734  38.216  -8.647   1.00 187.40 ? 65  GLY A C   1 
ATOM 349   O O   . GLY A 1 96  ? -93.585  37.408  -8.283   1.00 187.74 ? 65  GLY A O   1 
ATOM 350   N N   . LYS A 1 97  ? -92.589  38.575  -9.919   1.00 187.46 ? 66  LYS A N   1 
ATOM 351   C CA  . LYS A 1 97  ? -91.459  39.383  -10.394  1.00 187.16 ? 66  LYS A CA  1 
ATOM 352   C C   . LYS A 1 97  ? -91.638  40.899  -10.240  1.00 188.47 ? 66  LYS A C   1 
ATOM 353   O O   . LYS A 1 97  ? -92.692  41.449  -10.575  1.00 189.76 ? 66  LYS A O   1 
ATOM 354   C CB  . LYS A 1 97  ? -91.103  39.025  -11.844  1.00 186.36 ? 66  LYS A CB  1 
ATOM 355   C CG  . LYS A 1 97  ? -92.254  38.473  -12.680  1.00 186.51 ? 66  LYS A CG  1 
ATOM 356   C CD  . LYS A 1 97  ? -91.822  38.236  -14.117  1.00 185.36 ? 66  LYS A CD  1 
ATOM 357   C CE  . LYS A 1 97  ? -90.686  37.232  -14.204  1.00 183.42 ? 66  LYS A CE  1 
ATOM 358   N NZ  . LYS A 1 97  ? -90.055  37.268  -15.543  1.00 182.49 ? 66  LYS A NZ  1 
ATOM 359   N N   . ILE A 1 98  ? -90.600  41.549  -9.702   1.00 188.38 ? 67  ILE A N   1 
ATOM 360   C CA  . ILE A 1 98  ? -90.525  43.016  -9.568   1.00 189.33 ? 67  ILE A CA  1 
ATOM 361   C C   . ILE A 1 98  ? -89.088  43.504  -9.877   1.00 188.60 ? 67  ILE A C   1 
ATOM 362   O O   . ILE A 1 98  ? -88.877  44.649  -10.302  1.00 189.14 ? 67  ILE A O   1 
ATOM 363   C CB  . ILE A 1 98  ? -90.940  43.525  -8.127   1.00 190.24 ? 67  ILE A CB  1 
ATOM 364   C CG1 . ILE A 1 98  ? -91.864  42.538  -7.388   1.00 190.39 ? 67  ILE A CG1 1 
ATOM 365   C CG2 . ILE A 1 98  ? -91.552  44.936  -8.197   1.00 191.33 ? 67  ILE A CG2 1 
ATOM 366   C CD1 . ILE A 1 98  ? -91.842  42.669  -5.861   1.00 190.30 ? 67  ILE A CD1 1 
ATOM 367   N N   . GLN A 1 99  ? -88.127  42.596  -9.688   1.00 187.35 ? 68  GLN A N   1 
ATOM 368   C CA  . GLN A 1 99  ? -86.681  42.877  -9.592   1.00 186.43 ? 68  GLN A CA  1 
ATOM 369   C C   . GLN A 1 99  ? -85.950  43.457  -10.810  1.00 186.33 ? 68  GLN A C   1 
ATOM 370   O O   . GLN A 1 99  ? -86.021  42.896  -11.905  1.00 186.14 ? 68  GLN A O   1 
ATOM 371   C CB  . GLN A 1 99  ? -85.950  41.594  -9.169   1.00 185.20 ? 68  GLN A CB  1 
ATOM 372   C CG  . GLN A 1 99  ? -86.040  40.429  -10.162  1.00 183.50 ? 68  GLN A CG  1 
ATOM 373   C CD  . GLN A 1 99  ? -87.384  39.729  -10.139  1.00 183.36 ? 68  GLN A CD  1 
ATOM 374   O OE1 . GLN A 1 99  ? -88.122  39.790  -9.151   1.00 184.14 ? 68  GLN A OE1 1 
ATOM 375   N NE2 . GLN A 1 99  ? -87.709  39.056  -11.232  1.00 182.71 ? 68  GLN A NE2 1 
ATOM 376   N N   . ARG A 1 100 ? -85.212  44.550  -10.593  1.00 186.56 ? 69  ARG A N   1 
ATOM 377   C CA  . ARG A 1 100 ? -84.294  45.107  -11.603  1.00 186.15 ? 69  ARG A CA  1 
ATOM 378   C C   . ARG A 1 100 ? -82.865  45.272  -11.041  1.00 185.19 ? 69  ARG A C   1 
ATOM 379   O O   . ARG A 1 100 ? -82.621  46.211  -10.271  1.00 185.85 ? 69  ARG A O   1 
ATOM 380   C CB  . ARG A 1 100 ? -84.829  46.444  -12.148  1.00 187.36 ? 69  ARG A CB  1 
ATOM 381   C CG  . ARG A 1 100 ? -84.033  46.998  -13.316  1.00 187.60 ? 69  ARG A CG  1 
ATOM 382   C CD  . ARG A 1 100 ? -84.941  47.657  -14.333  1.00 189.79 ? 69  ARG A CD  1 
ATOM 383   N NE  . ARG A 1 100 ? -84.447  47.459  -15.697  1.00 190.78 ? 69  ARG A NE  1 
ATOM 384   C CZ  . ARG A 1 100 ? -85.067  47.876  -16.801  1.00 192.30 ? 69  ARG A CZ  1 
ATOM 385   N NH1 . ARG A 1 100 ? -86.223  48.531  -16.722  1.00 193.54 ? 69  ARG A NH1 1 
ATOM 386   N NH2 . ARG A 1 100 ? -84.526  47.637  -17.993  1.00 192.24 ? 69  ARG A NH2 1 
ATOM 387   N N   . PRO A 1 101 ? -81.919  44.368  -11.426  1.00 183.63 ? 70  PRO A N   1 
ATOM 388   C CA  . PRO A 1 101 ? -80.536  44.433  -10.890  1.00 182.53 ? 70  PRO A CA  1 
ATOM 389   C C   . PRO A 1 101 ? -79.902  45.825  -11.109  1.00 182.68 ? 70  PRO A C   1 
ATOM 390   O O   . PRO A 1 101 ? -80.146  46.446  -12.149  1.00 183.41 ? 70  PRO A O   1 
ATOM 391   C CB  . PRO A 1 101 ? -79.790  43.346  -11.680  1.00 181.30 ? 70  PRO A CB  1 
ATOM 392   C CG  . PRO A 1 101 ? -80.639  43.087  -12.897  1.00 181.81 ? 70  PRO A CG  1 
ATOM 393   C CD  . PRO A 1 101 ? -82.056  43.330  -12.469  1.00 182.83 ? 70  PRO A CD  1 
ATOM 394   N N   . PRO A 1 102 ? -79.118  46.329  -10.132  1.00 182.07 ? 71  PRO A N   1 
ATOM 395   C CA  . PRO A 1 102 ? -78.681  47.726  -10.199  1.00 182.36 ? 71  PRO A CA  1 
ATOM 396   C C   . PRO A 1 102 ? -77.410  47.953  -11.003  1.00 181.45 ? 71  PRO A C   1 
ATOM 397   O O   . PRO A 1 102 ? -76.507  47.119  -10.995  1.00 180.26 ? 71  PRO A O   1 
ATOM 398   C CB  . PRO A 1 102 ? -78.440  48.088  -8.732   1.00 182.55 ? 71  PRO A CB  1 
ATOM 399   C CG  . PRO A 1 102 ? -78.081  46.809  -8.078   1.00 181.82 ? 71  PRO A CG  1 
ATOM 400   C CD  . PRO A 1 102 ? -78.629  45.665  -8.913   1.00 181.46 ? 71  PRO A CD  1 
ATOM 401   N N   . GLU A 1 103 ? -77.354  49.093  -11.689  1.00 181.94 ? 72  GLU A N   1 
ATOM 402   C CA  . GLU A 1 103 ? -76.142  49.542  -12.365  1.00 181.38 ? 72  GLU A CA  1 
ATOM 403   C C   . GLU A 1 103 ? -75.176  50.074  -11.313  1.00 181.22 ? 72  GLU A C   1 
ATOM 404   O O   . GLU A 1 103 ? -74.185  50.733  -11.638  1.00 181.30 ? 72  GLU A O   1 
ATOM 405   C CB  . GLU A 1 103 ? -76.470  50.624  -13.401  1.00 182.39 ? 72  GLU A CB  1 
ATOM 406   N N   . ASP A 1 104 ? -75.484  49.764  -10.051  1.00 180.86 ? 73  ASP A N   1 
ATOM 407   C CA  . ASP A 1 104 ? -74.716  50.216  -8.891   1.00 180.83 ? 73  ASP A CA  1 
ATOM 408   C C   . ASP A 1 104 ? -73.753  49.153  -8.371   1.00 179.10 ? 73  ASP A C   1 
ATOM 409   O O   . ASP A 1 104 ? -72.543  49.386  -8.284   1.00 178.78 ? 73  ASP A O   1 
ATOM 410   C CB  . ASP A 1 104 ? -75.657  50.644  -7.749   1.00 181.89 ? 73  ASP A CB  1 
ATOM 411   C CG  . ASP A 1 104 ? -76.257  52.022  -7.965   1.00 184.09 ? 73  ASP A CG  1 
ATOM 412   O OD1 . ASP A 1 104 ? -75.807  52.989  -7.292   1.00 185.65 ? 73  ASP A OD1 1 
ATOM 413   O OD2 . ASP A 1 104 ? -77.176  52.137  -8.814   1.00 185.39 ? 73  ASP A OD2 1 
ATOM 414   N N   . SER A 1 105 ? -74.302  47.992  -8.020   1.00 177.77 ? 74  SER A N   1 
ATOM 415   C CA  . SER A 1 105 ? -73.538  46.970  -7.323   1.00 176.16 ? 74  SER A CA  1 
ATOM 416   C C   . SER A 1 105 ? -72.552  46.254  -8.250   1.00 174.74 ? 74  SER A C   1 
ATOM 417   O O   . SER A 1 105 ? -71.360  46.183  -7.940   1.00 174.68 ? 74  SER A O   1 
ATOM 418   C CB  . SER A 1 105 ? -74.464  45.981  -6.598   1.00 175.85 ? 74  SER A CB  1 
ATOM 419   O OG  . SER A 1 105 ? -74.871  44.924  -7.448   1.00 175.17 ? 74  SER A OG  1 
ATOM 420   N N   . ILE A 1 106 ? -73.031  45.760  -9.390   1.00 173.54 ? 75  ILE A N   1 
ATOM 421   C CA  . ILE A 1 106 ? -72.205  44.925  -10.271  1.00 171.77 ? 75  ILE A CA  1 
ATOM 422   C C   . ILE A 1 106 ? -71.192  45.721  -11.125  1.00 171.63 ? 75  ILE A C   1 
ATOM 423   O O   . ILE A 1 106 ? -71.421  46.014  -12.302  1.00 171.65 ? 75  ILE A O   1 
ATOM 424   C CB  . ILE A 1 106 ? -73.082  43.957  -11.091  1.00 171.27 ? 75  ILE A CB  1 
ATOM 425   C CG1 . ILE A 1 106 ? -73.796  42.992  -10.135  1.00 170.72 ? 75  ILE A CG1 1 
ATOM 426   C CG2 . ILE A 1 106 ? -72.250  43.194  -12.124  1.00 170.51 ? 75  ILE A CG2 1 
ATOM 427   C CD1 . ILE A 1 106 ? -74.904  42.153  -10.766  1.00 170.70 ? 75  ILE A CD1 1 
ATOM 428   N N   . GLN A 1 107 ? -70.060  46.039  -10.499  1.00 171.19 ? 76  GLN A N   1 
ATOM 429   C CA  . GLN A 1 107 ? -69.034  46.910  -11.070  1.00 171.32 ? 76  GLN A CA  1 
ATOM 430   C C   . GLN A 1 107 ? -68.221  46.221  -12.177  1.00 170.45 ? 76  GLN A C   1 
ATOM 431   O O   . GLN A 1 107 ? -68.140  44.995  -12.207  1.00 169.39 ? 76  GLN A O   1 
ATOM 432   C CB  . GLN A 1 107 ? -68.114  47.422  -9.953   1.00 171.36 ? 76  GLN A CB  1 
ATOM 433   N N   . PRO A 1 108 ? -67.633  47.007  -13.108  1.00 170.97 ? 77  PRO A N   1 
ATOM 434   C CA  . PRO A 1 108 ? -66.727  46.393  -14.083  1.00 170.07 ? 77  PRO A CA  1 
ATOM 435   C C   . PRO A 1 108 ? -65.339  46.139  -13.512  1.00 169.10 ? 77  PRO A C   1 
ATOM 436   O O   . PRO A 1 108 ? -64.836  46.921  -12.704  1.00 169.43 ? 77  PRO A O   1 
ATOM 437   C CB  . PRO A 1 108 ? -66.648  47.437  -15.208  1.00 171.16 ? 77  PRO A CB  1 
ATOM 438   C CG  . PRO A 1 108 ? -66.911  48.731  -14.543  1.00 172.63 ? 77  PRO A CG  1 
ATOM 439   C CD  . PRO A 1 108 ? -67.903  48.423  -13.434  1.00 172.48 ? 77  PRO A CD  1 
ATOM 440   N N   . TYR A 1 109 ? -64.737  45.043  -13.952  1.00 167.71 ? 78  TYR A N   1 
ATOM 441   C CA  . TYR A 1 109 ? -63.378  44.701  -13.592  1.00 166.91 ? 78  TYR A CA  1 
ATOM 442   C C   . TYR A 1 109 ? -62.403  45.822  -13.919  1.00 168.01 ? 78  TYR A C   1 
ATOM 443   O O   . TYR A 1 109 ? -61.458  46.051  -13.177  1.00 168.16 ? 78  TYR A O   1 
ATOM 444   C CB  . TYR A 1 109 ? -62.960  43.446  -14.339  1.00 165.60 ? 78  TYR A CB  1 
ATOM 445   C CG  . TYR A 1 109 ? -61.641  42.869  -13.893  1.00 163.75 ? 78  TYR A CG  1 
ATOM 446   C CD1 . TYR A 1 109 ? -61.592  41.893  -12.908  1.00 161.79 ? 78  TYR A CD1 1 
ATOM 447   C CD2 . TYR A 1 109 ? -60.443  43.287  -14.466  1.00 163.17 ? 78  TYR A CD2 1 
ATOM 448   C CE1 . TYR A 1 109 ? -60.384  41.353  -12.496  1.00 160.70 ? 78  TYR A CE1 1 
ATOM 449   C CE2 . TYR A 1 109 ? -59.229  42.753  -14.059  1.00 161.99 ? 78  TYR A CE2 1 
ATOM 450   C CZ  . TYR A 1 109 ? -59.208  41.787  -13.076  1.00 160.78 ? 78  TYR A CZ  1 
ATOM 451   O OH  . TYR A 1 109 ? -58.009  41.255  -12.673  1.00 159.87 ? 78  TYR A OH  1 
ATOM 452   N N   . GLU A 1 110 ? -62.627  46.508  -15.033  1.00 169.06 ? 79  GLU A N   1 
ATOM 453   C CA  . GLU A 1 110 ? -61.732  47.571  -15.471  1.00 170.46 ? 79  GLU A CA  1 
ATOM 454   C C   . GLU A 1 110 ? -61.648  48.734  -14.473  1.00 171.79 ? 79  GLU A C   1 
ATOM 455   O O   . GLU A 1 110 ? -60.557  49.267  -14.237  1.00 172.24 ? 79  GLU A O   1 
ATOM 456   C CB  . GLU A 1 110 ? -62.137  48.074  -16.858  1.00 171.12 ? 79  GLU A CB  1 
ATOM 457   N N   . LYS A 1 111 ? -62.782  49.116  -13.880  1.00 172.61 ? 80  LYS A N   1 
ATOM 458   C CA  . LYS A 1 111 ? -62.794  50.244  -12.933  1.00 173.99 ? 80  LYS A CA  1 
ATOM 459   C C   . LYS A 1 111 ? -62.106  49.959  -11.565  1.00 173.95 ? 80  LYS A C   1 
ATOM 460   O O   . LYS A 1 111 ? -61.651  50.897  -10.894  1.00 174.88 ? 80  LYS A O   1 
ATOM 461   C CB  . LYS A 1 111 ? -64.205  50.858  -12.775  1.00 174.56 ? 80  LYS A CB  1 
ATOM 462   C CG  . LYS A 1 111 ? -65.106  50.143  -11.791  1.00 173.66 ? 80  LYS A CG  1 
ATOM 463   C CD  . LYS A 1 111 ? -65.875  51.111  -10.918  1.00 174.08 ? 80  LYS A CD  1 
ATOM 464   C CE  . LYS A 1 111 ? -66.003  50.522  -9.523   1.00 173.77 ? 80  LYS A CE  1 
ATOM 465   N NZ  . LYS A 1 111 ? -67.145  51.070  -8.751   1.00 174.85 ? 80  LYS A NZ  1 
ATOM 466   N N   . ILE A 1 112 ? -62.027  48.678  -11.172  1.00 173.04 ? 81  ILE A N   1 
ATOM 467   C CA  . ILE A 1 112 ? -61.296  48.258  -9.954   1.00 172.74 ? 81  ILE A CA  1 
ATOM 468   C C   . ILE A 1 112 ? -59.810  48.020  -10.242  1.00 172.70 ? 81  ILE A C   1 
ATOM 469   O O   . ILE A 1 112 ? -58.959  48.211  -9.368   1.00 172.96 ? 81  ILE A O   1 
ATOM 470   C CB  . ILE A 1 112 ? -61.863  46.964  -9.270   1.00 171.55 ? 81  ILE A CB  1 
ATOM 471   C CG1 . ILE A 1 112 ? -63.318  46.673  -9.658   1.00 170.98 ? 81  ILE A CG1 1 
ATOM 472   C CG2 . ILE A 1 112 ? -61.690  47.048  -7.745   1.00 171.74 ? 81  ILE A CG2 1 
ATOM 473   C CD1 . ILE A 1 112 ? -63.783  45.269  -9.275   1.00 168.61 ? 81  ILE A CD1 1 
ATOM 474   N N   . LYS A 1 113 ? -59.510  47.590  -11.465  1.00 172.60 ? 82  LYS A N   1 
ATOM 475   C CA  . LYS A 1 113 ? -58.135  47.362  -11.891  1.00 172.75 ? 82  LYS A CA  1 
ATOM 476   C C   . LYS A 1 113 ? -57.369  48.682  -12.002  1.00 174.43 ? 82  LYS A C   1 
ATOM 477   O O   . LYS A 1 113 ? -56.160  48.717  -11.770  1.00 174.59 ? 82  LYS A O   1 
ATOM 478   C CB  . LYS A 1 113 ? -58.094  46.597  -13.219  1.00 172.01 ? 82  LYS A CB  1 
ATOM 479   C CG  . LYS A 1 113 ? -56.778  45.879  -13.487  1.00 170.86 ? 82  LYS A CG  1 
ATOM 480   C CD  . LYS A 1 113 ? -56.744  45.264  -14.874  1.00 169.47 ? 82  LYS A CD  1 
ATOM 481   C CE  . LYS A 1 113 ? -55.407  44.602  -15.139  1.00 168.44 ? 82  LYS A CE  1 
ATOM 482   N NZ  . LYS A 1 113 ? -55.449  43.752  -16.351  1.00 167.23 ? 82  LYS A NZ  1 
ATOM 483   N N   . ALA A 1 114 ? -58.073  49.759  -12.351  1.00 175.96 ? 83  ALA A N   1 
ATOM 484   C CA  . ALA A 1 114 ? -57.481  51.097  -12.375  1.00 177.90 ? 83  ALA A CA  1 
ATOM 485   C C   . ALA A 1 114 ? -57.103  51.556  -10.954  1.00 178.83 ? 83  ALA A C   1 
ATOM 486   O O   . ALA A 1 114 ? -57.982  51.722  -10.089  1.00 179.09 ? 83  ALA A O   1 
ATOM 487   C CB  . ALA A 1 114 ? -58.426  52.085  -13.035  1.00 178.81 ? 83  ALA A CB  1 
ATOM 488   N N   . ARG A 1 115 ? -55.791  51.762  -10.750  1.00 179.57 ? 84  ARG A N   1 
ATOM 489   C CA  . ARG A 1 115 ? -55.132  52.007  -9.432   1.00 180.06 ? 84  ARG A CA  1 
ATOM 490   C C   . ARG A 1 115 ? -56.010  51.883  -8.164   1.00 179.99 ? 84  ARG A C   1 
ATOM 491   O O   . ARG A 1 115 ? -56.660  52.842  -7.733   1.00 180.88 ? 84  ARG A O   1 
ATOM 492   C CB  . ARG A 1 115 ? -54.326  53.319  -9.435   1.00 181.33 ? 84  ARG A CB  1 
ATOM 493   N N   . GLY A 1 116 ? -56.025  50.685  -7.585   1.00 179.00 ? 85  GLY A N   1 
ATOM 494   C CA  . GLY A 1 116 ? -55.287  49.556  -8.145   1.00 178.04 ? 85  GLY A CA  1 
ATOM 495   C C   . GLY A 1 116 ? -54.524  48.734  -7.130   1.00 177.48 ? 85  GLY A C   1 
ATOM 496   O O   . GLY A 1 116 ? -55.088  48.292  -6.127   1.00 177.16 ? 85  GLY A O   1 
ATOM 497   N N   . LEU A 1 117 ? -53.239  48.533  -7.407   1.00 177.42 ? 86  LEU A N   1 
ATOM 498   C CA  . LEU A 1 117 ? -52.364  47.679  -6.606   1.00 176.99 ? 86  LEU A CA  1 
ATOM 499   C C   . LEU A 1 117 ? -52.240  48.181  -5.155   1.00 177.68 ? 86  LEU A C   1 
ATOM 500   O O   . LEU A 1 117 ? -52.093  49.380  -4.943   1.00 179.09 ? 86  LEU A O   1 
ATOM 501   C CB  . LEU A 1 117 ? -50.988  47.646  -7.278   1.00 177.09 ? 86  LEU A CB  1 
ATOM 502   C CG  . LEU A 1 117 ? -49.997  46.512  -7.022   1.00 176.31 ? 86  LEU A CG  1 
ATOM 503   C CD1 . LEU A 1 117 ? -50.425  45.254  -7.772   1.00 174.81 ? 86  LEU A CD1 1 
ATOM 504   C CD2 . LEU A 1 117 ? -48.610  46.962  -7.461   1.00 176.76 ? 86  LEU A CD2 1 
ATOM 505   N N   . PRO A 1 118 ? -52.336  47.277  -4.152   1.00 177.01 ? 87  PRO A N   1 
ATOM 506   C CA  . PRO A 1 118 ? -52.024  47.686  -2.767   1.00 177.68 ? 87  PRO A CA  1 
ATOM 507   C C   . PRO A 1 118 ? -50.536  48.005  -2.559   1.00 178.21 ? 87  PRO A C   1 
ATOM 508   O O   . PRO A 1 118 ? -49.683  47.494  -3.296   1.00 177.66 ? 87  PRO A O   1 
ATOM 509   C CB  . PRO A 1 118 ? -52.435  46.472  -1.924   1.00 176.91 ? 87  PRO A CB  1 
ATOM 510   C CG  . PRO A 1 118 ? -52.678  45.353  -2.897   1.00 175.50 ? 87  PRO A CG  1 
ATOM 511   C CD  . PRO A 1 118 ? -53.013  45.969  -4.206   1.00 175.70 ? 87  PRO A CD  1 
ATOM 512   N N   . ASP A 1 119 ? -50.236  48.848  -1.572   1.00 179.17 ? 88  ASP A N   1 
ATOM 513   C CA  . ASP A 1 119 ? -48.854  49.280  -1.311   1.00 179.84 ? 88  ASP A CA  1 
ATOM 514   C C   . ASP A 1 119 ? -48.200  48.498  -0.168   1.00 179.26 ? 88  ASP A C   1 
ATOM 515   O O   . ASP A 1 119 ? -47.121  47.910  -0.335   1.00 178.81 ? 88  ASP A O   1 
ATOM 516   C CB  . ASP A 1 119 ? -48.761  50.810  -1.079   1.00 181.54 ? 88  ASP A CB  1 
ATOM 517   C CG  . ASP A 1 119 ? -49.873  51.360  -0.163   1.00 182.45 ? 88  ASP A CG  1 
ATOM 518   O OD1 . ASP A 1 119 ? -51.046  51.418  -0.607   1.00 182.26 ? 88  ASP A OD1 1 
ATOM 519   O OD2 . ASP A 1 119 ? -49.563  51.765  0.988    1.00 183.48 ? 88  ASP A OD2 1 
ATOM 520   N N   . ASN A 1 120 ? -48.877  48.501  0.981    1.00 179.13 ? 89  ASN A N   1 
ATOM 521   C CA  . ASN A 1 120 ? -48.431  47.811  2.189    1.00 178.50 ? 89  ASN A CA  1 
ATOM 522   C C   . ASN A 1 120 ? -49.260  46.536  2.498    1.00 176.82 ? 89  ASN A C   1 
ATOM 523   O O   . ASN A 1 120 ? -50.492  46.504  2.328    1.00 176.45 ? 89  ASN A O   1 
ATOM 524   C CB  . ASN A 1 120 ? -48.395  48.778  3.392    1.00 179.70 ? 89  ASN A CB  1 
ATOM 525   N N   . ILE A 1 121 ? -48.561  45.466  2.874    1.00 175.34 ? 90  ILE A N   1 
ATOM 526   C CA  . ILE A 1 121 ? -47.096  45.414  2.735    1.00 174.49 ? 90  ILE A CA  1 
ATOM 527   C C   . ILE A 1 121 ? -46.629  44.473  1.582    1.00 172.39 ? 90  ILE A C   1 
ATOM 528   O O   . ILE A 1 121 ? -45.602  44.757  0.958    1.00 172.51 ? 90  ILE A O   1 
ATOM 529   C CB  . ILE A 1 121 ? -46.335  45.232  4.120    1.00 175.18 ? 90  ILE A CB  1 
ATOM 530   C CG1 . ILE A 1 121 ? -46.816  46.286  5.146    1.00 176.10 ? 90  ILE A CG1 1 
ATOM 531   C CG2 . ILE A 1 121 ? -44.810  45.312  3.932    1.00 175.99 ? 90  ILE A CG2 1 
ATOM 532   C CD1 . ILE A 1 121 ? -46.057  46.343  6.479    1.00 176.60 ? 90  ILE A CD1 1 
ATOM 533   N N   . SER A 1 122 ? -47.367  43.403  1.243    1.00 169.91 ? 91  SER A N   1 
ATOM 534   C CA  . SER A 1 122 ? -48.624  42.959  1.860    1.00 168.05 ? 91  SER A CA  1 
ATOM 535   C C   . SER A 1 122 ? -48.542  41.444  2.096    1.00 166.35 ? 91  SER A C   1 
ATOM 536   O O   . SER A 1 122 ? -47.936  40.747  1.293    1.00 165.54 ? 91  SER A O   1 
ATOM 537   C CB  . SER A 1 122 ? -49.821  43.313  0.962    1.00 167.64 ? 91  SER A CB  1 
ATOM 538   O OG  . SER A 1 122 ? -49.781  42.642  -0.283   1.00 165.32 ? 91  SER A OG  1 
ATOM 539   N N   . SER A 1 123 ? -49.082  40.904  3.192    1.00 165.42 ? 92  SER A N   1 
ATOM 540   C CA  . SER A 1 123 ? -49.677  41.607  4.348    1.00 165.55 ? 92  SER A CA  1 
ATOM 541   C C   . SER A 1 123 ? -51.167  41.959  4.235    1.00 164.80 ? 92  SER A C   1 
ATOM 542   O O   . SER A 1 123 ? -51.818  42.280  5.235    1.00 165.24 ? 92  SER A O   1 
ATOM 543   C CB  . SER A 1 123 ? -48.835  42.795  4.818    1.00 166.89 ? 92  SER A CB  1 
ATOM 544   O OG  . SER A 1 123 ? -49.168  43.152  6.148    1.00 168.16 ? 92  SER A OG  1 
ATOM 545   N N   . VAL A 1 124 ? -51.703  41.894  3.023    1.00 163.31 ? 93  VAL A N   1 
ATOM 546   C CA  . VAL A 1 124 ? -53.150  41.782  2.857    1.00 162.23 ? 93  VAL A CA  1 
ATOM 547   C C   . VAL A 1 124 ? -53.469  40.338  2.500    1.00 160.07 ? 93  VAL A C   1 
ATOM 548   O O   . VAL A 1 124 ? -54.610  39.892  2.635    1.00 159.61 ? 93  VAL A O   1 
ATOM 549   C CB  . VAL A 1 124 ? -53.749  42.763  1.795    1.00 162.78 ? 93  VAL A CB  1 
ATOM 550   C CG1 . VAL A 1 124 ? -53.538  44.237  2.218    1.00 164.60 ? 93  VAL A CG1 1 
ATOM 551   C CG2 . VAL A 1 124 ? -53.205  42.482  0.395    1.00 161.86 ? 93  VAL A CG2 1 
ATOM 552   N N   . LEU A 1 125 ? -52.435  39.619  2.056    1.00 158.28 ? 94  LEU A N   1 
ATOM 553   C CA  . LEU A 1 125 ? -52.536  38.210  1.669    1.00 155.90 ? 94  LEU A CA  1 
ATOM 554   C C   . LEU A 1 125 ? -52.659  37.300  2.882    1.00 155.07 ? 94  LEU A C   1 
ATOM 555   O O   . LEU A 1 125 ? -53.334  36.274  2.835    1.00 154.12 ? 94  LEU A O   1 
ATOM 556   C CB  . LEU A 1 125 ? -51.330  37.802  0.817    1.00 155.27 ? 94  LEU A CB  1 
ATOM 557   C CG  . LEU A 1 125 ? -51.402  37.902  -0.711   1.00 154.14 ? 94  LEU A CG  1 
ATOM 558   C CD1 . LEU A 1 125 ? -51.930  39.223  -1.169   1.00 155.07 ? 94  LEU A CD1 1 
ATOM 559   C CD2 . LEU A 1 125 ? -50.068  37.658  -1.361   1.00 153.87 ? 94  LEU A CD2 1 
ATOM 560   N N   . ASN A 1 126 ? -52.007  37.694  3.969    1.00 155.03 ? 95  ASN A N   1 
ATOM 561   C CA  . ASN A 1 126 ? -52.092  36.983  5.237    1.00 154.51 ? 95  ASN A CA  1 
ATOM 562   C C   . ASN A 1 126 ? -53.482  37.075  5.892    1.00 154.39 ? 95  ASN A C   1 
ATOM 563   O O   . ASN A 1 126 ? -53.667  36.668  7.051    1.00 154.67 ? 95  ASN A O   1 
ATOM 564   C CB  . ASN A 1 126 ? -51.012  37.511  6.178    1.00 155.41 ? 95  ASN A CB  1 
ATOM 565   C CG  . ASN A 1 126 ? -49.643  37.513  5.534    1.00 155.34 ? 95  ASN A CG  1 
ATOM 566   O OD1 . ASN A 1 126 ? -49.140  38.558  5.125    1.00 155.98 ? 95  ASN A OD1 1 
ATOM 567   N ND2 . ASN A 1 126 ? -49.041  36.334  5.419    1.00 154.89 ? 95  ASN A ND2 1 
ATOM 568   N N   . LYS A 1 127 ? -54.448  37.607  5.136    1.00 153.54 ? 96  LYS A N   1 
ATOM 569   C CA  . LYS A 1 127 ? -55.831  37.769  5.594    1.00 152.83 ? 96  LYS A CA  1 
ATOM 570   C C   . LYS A 1 127 ? -56.823  37.045  4.683    1.00 151.12 ? 96  LYS A C   1 
ATOM 571   O O   . LYS A 1 127 ? -58.041  37.197  4.861    1.00 151.20 ? 96  LYS A O   1 
ATOM 572   C CB  . LYS A 1 127 ? -56.200  39.261  5.725    1.00 154.06 ? 96  LYS A CB  1 
ATOM 573   C CG  . LYS A 1 127 ? -55.569  39.958  6.933    1.00 155.41 ? 96  LYS A CG  1 
ATOM 574   C CD  . LYS A 1 127 ? -56.423  41.093  7.501    1.00 156.77 ? 96  LYS A CD  1 
ATOM 575   C CE  . LYS A 1 127 ? -56.211  41.190  9.027    1.00 158.31 ? 96  LYS A CE  1 
ATOM 576   N NZ  . LYS A 1 127 ? -56.366  42.563  9.628    1.00 159.33 ? 96  LYS A NZ  1 
ATOM 577   N N   . LEU A 1 128 ? -56.289  36.263  3.726    1.00 149.17 ? 97  LEU A N   1 
ATOM 578   C CA  . LEU A 1 128 ? -57.074  35.433  2.770    1.00 147.09 ? 97  LEU A CA  1 
ATOM 579   C C   . LEU A 1 128 ? -56.764  33.927  2.807    1.00 145.68 ? 97  LEU A C   1 
ATOM 580   O O   . LEU A 1 128 ? -55.600  33.537  2.897    1.00 145.43 ? 97  LEU A O   1 
ATOM 581   C CB  . LEU A 1 128 ? -56.851  35.908  1.339    1.00 146.47 ? 97  LEU A CB  1 
ATOM 582   C CG  . LEU A 1 128 ? -57.327  34.887  0.316    1.00 144.58 ? 97  LEU A CG  1 
ATOM 583   C CD1 . LEU A 1 128 ? -58.766  35.138  -0.035   1.00 144.73 ? 97  LEU A CD1 1 
ATOM 584   C CD2 . LEU A 1 128 ? -56.466  34.949  -0.893   1.00 143.96 ? 97  LEU A CD2 1 
ATOM 585   N N   . VAL A 1 129 ? -57.801  33.091  2.716    1.00 144.54 ? 98  VAL A N   1 
ATOM 586   C CA  . VAL A 1 129 ? -57.614  31.640  2.587    1.00 143.24 ? 98  VAL A CA  1 
ATOM 587   C C   . VAL A 1 129 ? -58.127  31.172  1.233    1.00 142.18 ? 98  VAL A C   1 
ATOM 588   O O   . VAL A 1 129 ? -59.245  31.513  0.839    1.00 142.74 ? 98  VAL A O   1 
ATOM 589   C CB  . VAL A 1 129 ? -58.349  30.832  3.681    1.00 143.34 ? 98  VAL A CB  1 
ATOM 590   C CG1 . VAL A 1 129 ? -58.067  29.351  3.515    1.00 142.21 ? 98  VAL A CG1 1 
ATOM 591   C CG2 . VAL A 1 129 ? -57.922  31.269  5.059    1.00 144.41 ? 98  VAL A CG2 1 
ATOM 592   N N   . VAL A 1 130 ? -57.326  30.381  0.526    1.00 140.59 ? 99  VAL A N   1 
ATOM 593   C CA  . VAL A 1 130 ? -57.739  29.882  -0.780   1.00 138.89 ? 99  VAL A CA  1 
ATOM 594   C C   . VAL A 1 130 ? -58.390  28.510  -0.640   1.00 137.94 ? 99  VAL A C   1 
ATOM 595   O O   . VAL A 1 130 ? -57.715  27.521  -0.315   1.00 137.33 ? 99  VAL A O   1 
ATOM 596   C CB  . VAL A 1 130 ? -56.562  29.849  -1.783   1.00 138.40 ? 99  VAL A CB  1 
ATOM 597   C CG1 . VAL A 1 130 ? -56.934  29.059  -3.006   1.00 137.61 ? 99  VAL A CG1 1 
ATOM 598   C CG2 . VAL A 1 130 ? -56.136  31.266  -2.178   1.00 138.10 ? 99  VAL A CG2 1 
ATOM 599   N N   . VAL A 1 131 ? -59.706  28.473  -0.859   1.00 137.38 ? 100 VAL A N   1 
ATOM 600   C CA  . VAL A 1 131 ? -60.452  27.216  -0.887   1.00 136.53 ? 100 VAL A CA  1 
ATOM 601   C C   . VAL A 1 131 ? -60.743  26.855  -2.320   1.00 135.92 ? 100 VAL A C   1 
ATOM 602   O O   . VAL A 1 131 ? -61.106  27.709  -3.122   1.00 135.97 ? 100 VAL A O   1 
ATOM 603   C CB  . VAL A 1 131 ? -61.784  27.274  -0.123   1.00 136.85 ? 100 VAL A CB  1 
ATOM 604   C CG1 . VAL A 1 131 ? -62.312  25.871  0.154    1.00 136.21 ? 100 VAL A CG1 1 
ATOM 605   C CG2 . VAL A 1 131 ? -61.595  27.965  1.164    1.00 137.76 ? 100 VAL A CG2 1 
ATOM 606   N N   . LYS A 1 132 ? -60.554  25.583  -2.638   1.00 135.40 ? 101 LYS A N   1 
ATOM 607   C CA  . LYS A 1 132 ? -60.880  25.072  -3.945   1.00 135.01 ? 101 LYS A CA  1 
ATOM 608   C C   . LYS A 1 132 ? -61.713  23.819  -3.768   1.00 135.32 ? 101 LYS A C   1 
ATOM 609   O O   . LYS A 1 132 ? -61.454  23.027  -2.860   1.00 135.24 ? 101 LYS A O   1 
ATOM 610   C CB  . LYS A 1 132 ? -59.618  24.823  -4.759   1.00 134.03 ? 101 LYS A CB  1 
ATOM 611   C CG  . LYS A 1 132 ? -58.970  26.113  -5.205   1.00 133.97 ? 101 LYS A CG  1 
ATOM 612   C CD  . LYS A 1 132 ? -58.814  26.181  -6.708   1.00 134.04 ? 101 LYS A CD  1 
ATOM 613   C CE  . LYS A 1 132 ? -58.082  27.444  -7.141   1.00 134.73 ? 101 LYS A CE  1 
ATOM 614   N NZ  . LYS A 1 132 ? -57.657  27.395  -8.572   1.00 135.09 ? 101 LYS A NZ  1 
ATOM 615   N N   . LEU A 1 133 ? -62.737  23.675  -4.614   1.00 135.94 ? 102 LEU A N   1 
ATOM 616   C CA  . LEU A 1 133 ? -63.689  22.562  -4.541   1.00 136.50 ? 102 LEU A CA  1 
ATOM 617   C C   . LEU A 1 133 ? -63.141  21.361  -5.296   1.00 135.93 ? 102 LEU A C   1 
ATOM 618   O O   . LEU A 1 133 ? -62.913  21.445  -6.501   1.00 135.84 ? 102 LEU A O   1 
ATOM 619   C CB  . LEU A 1 133 ? -65.039  22.958  -5.160   1.00 137.12 ? 102 LEU A CB  1 
ATOM 620   C CG  . LEU A 1 133 ? -65.855  24.207  -4.781   1.00 138.63 ? 102 LEU A CG  1 
ATOM 621   C CD1 . LEU A 1 133 ? -67.124  24.292  -5.661   1.00 139.05 ? 102 LEU A CD1 1 
ATOM 622   C CD2 . LEU A 1 133 ? -66.215  24.266  -3.280   1.00 139.10 ? 102 LEU A CD2 1 
ATOM 623   N N   . ASN A 1 134 ? -62.949  20.243  -4.607   1.00 135.83 ? 103 ASN A N   1 
ATOM 624   C CA  . ASN A 1 134 ? -62.329  19.079  -5.225   1.00 135.33 ? 103 ASN A CA  1 
ATOM 625   C C   . ASN A 1 134 ? -63.165  17.827  -5.032   1.00 135.19 ? 103 ASN A C   1 
ATOM 626   O O   . ASN A 1 134 ? -62.662  16.755  -4.704   1.00 134.64 ? 103 ASN A O   1 
ATOM 627   C CB  . ASN A 1 134 ? -60.917  18.894  -4.677   1.00 135.43 ? 103 ASN A CB  1 
ATOM 628   C CG  . ASN A 1 134 ? -60.230  17.666  -5.232   1.00 136.21 ? 103 ASN A CG  1 
ATOM 629   O OD1 . ASN A 1 134 ? -60.017  17.550  -6.440   1.00 137.67 ? 103 ASN A OD1 1 
ATOM 630   N ND2 . ASN A 1 134 ? -59.884  16.731  -4.348   1.00 137.19 ? 103 ASN A ND2 1 
ATOM 631   N N   . GLY A 1 135 ? -64.460  17.975  -5.249   1.00 135.76 ? 104 GLY A N   1 
ATOM 632   C CA  . GLY A 1 135 ? -65.389  16.884  -5.035   1.00 136.43 ? 104 GLY A CA  1 
ATOM 633   C C   . GLY A 1 135 ? -65.722  16.103  -6.287   1.00 136.30 ? 104 GLY A C   1 
ATOM 634   O O   . GLY A 1 135 ? -66.322  15.024  -6.207   1.00 136.52 ? 104 GLY A O   1 
ATOM 635   N N   . GLY A 1 136 ? -65.338  16.639  -7.443   1.00 136.10 ? 105 GLY A N   1 
ATOM 636   C CA  . GLY A 1 136 ? -65.708  16.034  -8.720   1.00 135.86 ? 105 GLY A CA  1 
ATOM 637   C C   . GLY A 1 136 ? -64.796  14.889  -9.098   1.00 135.17 ? 105 GLY A C   1 
ATOM 638   O O   . GLY A 1 136 ? -63.578  15.076  -9.133   1.00 135.21 ? 105 GLY A O   1 
ATOM 639   N N   . LEU A 1 137 ? -65.378  13.709  -9.347   1.00 134.74 ? 106 LEU A N   1 
ATOM 640   C CA  . LEU A 1 137 ? -64.687  12.608  -10.022  1.00 134.03 ? 106 LEU A CA  1 
ATOM 641   C C   . LEU A 1 137 ? -64.460  13.007  -11.469  1.00 133.84 ? 106 LEU A C   1 
ATOM 642   O O   . LEU A 1 137 ? -65.133  13.908  -11.971  1.00 134.60 ? 106 LEU A O   1 
ATOM 643   C CB  . LEU A 1 137 ? -65.551  11.369  -10.035  1.00 134.05 ? 106 LEU A CB  1 
ATOM 644   C CG  . LEU A 1 137 ? -65.682  10.531  -8.786   1.00 134.64 ? 106 LEU A CG  1 
ATOM 645   C CD1 . LEU A 1 137 ? -67.112  10.049  -8.741   1.00 135.92 ? 106 LEU A CD1 1 
ATOM 646   C CD2 . LEU A 1 137 ? -64.707  9.358   -8.812   1.00 134.44 ? 106 LEU A CD2 1 
ATOM 647   N N   . GLY A 1 138 ? -63.542  12.341  -12.160  1.00 120.58 ? 107 GLY A N   1 
ATOM 648   C CA  . GLY A 1 138 ? -63.290  12.691  -13.550  1.00 119.94 ? 107 GLY A CA  1 
ATOM 649   C C   . GLY A 1 138 ? -63.583  11.528  -14.454  1.00 121.75 ? 107 GLY A C   1 
ATOM 650   O O   . GLY A 1 138 ? -62.738  11.146  -15.241  1.00 121.93 ? 107 GLY A O   1 
ATOM 651   N N   . THR A 1 139 ? -64.775  10.953  -14.334  1.00 123.54 ? 108 THR A N   1 
ATOM 652   C CA  . THR A 1 139 ? -65.144  9.776   -15.135  1.00 126.01 ? 108 THR A CA  1 
ATOM 653   C C   . THR A 1 139 ? -65.776  10.134  -16.471  1.00 126.51 ? 108 THR A C   1 
ATOM 654   O O   . THR A 1 139 ? -65.921  9.269   -17.337  1.00 128.40 ? 108 THR A O   1 
ATOM 655   C CB  . THR A 1 139 ? -66.085  8.816   -14.388  1.00 128.26 ? 108 THR A CB  1 
ATOM 656   O OG1 . THR A 1 139 ? -67.026  9.580   -13.625  1.00 128.34 ? 108 THR A OG1 1 
ATOM 657   C CG2 . THR A 1 139 ? -65.290  7.878   -13.462  1.00 129.05 ? 108 THR A CG2 1 
ATOM 658   N N   . SER A 1 140 ? -66.151  11.405  -16.623  1.00 125.09 ? 109 SER A N   1 
ATOM 659   C CA  . SER A 1 140 ? -66.634  11.935  -17.902  1.00 125.52 ? 109 SER A CA  1 
ATOM 660   C C   . SER A 1 140 ? -65.470  12.199  -18.865  1.00 124.79 ? 109 SER A C   1 
ATOM 661   O O   . SER A 1 140 ? -65.654  12.261  -20.078  1.00 126.30 ? 109 SER A O   1 
ATOM 662   C CB  . SER A 1 140 ? -67.464  13.202  -17.695  1.00 124.61 ? 109 SER A CB  1 
ATOM 663   O OG  . SER A 1 140 ? -66.745  14.156  -16.942  1.00 122.16 ? 109 SER A OG  1 
ATOM 664   N N   . MET A 1 141 ? -64.272  12.355  -18.318  1.00 122.89 ? 110 MET A N   1 
ATOM 665   C CA  . MET A 1 141 ? -63.074  12.427  -19.126  1.00 122.28 ? 110 MET A CA  1 
ATOM 666   C C   . MET A 1 141 ? -62.574  11.007  -19.304  1.00 123.76 ? 110 MET A C   1 
ATOM 667   O O   . MET A 1 141 ? -61.705  10.749  -20.123  1.00 124.03 ? 110 MET A O   1 
ATOM 668   C CB  . MET A 1 141 ? -62.023  13.255  -18.407  1.00 120.22 ? 110 MET A CB  1 
ATOM 669   C CG  . MET A 1 141 ? -62.524  14.576  -17.862  1.00 119.25 ? 110 MET A CG  1 
ATOM 670   S SD  . MET A 1 141 ? -62.044  15.932  -18.938  1.00 120.12 ? 110 MET A SD  1 
ATOM 671   C CE  . MET A 1 141 ? -60.410  16.276  -18.301  1.00 118.22 ? 110 MET A CE  1 
ATOM 672   N N   . GLY A 1 142 ? -63.135  10.093  -18.516  1.00 125.09 ? 111 GLY A N   1 
ATOM 673   C CA  . GLY A 1 142 ? -62.764  8.679   -18.533  1.00 127.91 ? 111 GLY A CA  1 
ATOM 674   C C   . GLY A 1 142 ? -61.575  8.326   -17.649  1.00 127.76 ? 111 GLY A C   1 
ATOM 675   O O   . GLY A 1 142 ? -60.687  7.569   -18.061  1.00 129.12 ? 111 GLY A O   1 
ATOM 676   N N   . CYS A 1 143 ? -61.556  8.867   -16.431  1.00 126.59 ? 112 CYS A N   1 
ATOM 677   C CA  . CYS A 1 143 ? -60.450  8.646   -15.491  1.00 126.26 ? 112 CYS A CA  1 
ATOM 678   C C   . CYS A 1 143 ? -60.956  8.171   -14.123  1.00 127.00 ? 112 CYS A C   1 
ATOM 679   O O   . CYS A 1 143 ? -61.916  8.742   -13.569  1.00 126.55 ? 112 CYS A O   1 
ATOM 680   C CB  . CYS A 1 143 ? -59.586  9.917   -15.337  1.00 123.81 ? 112 CYS A CB  1 
ATOM 681   S SG  . CYS A 1 143 ? -58.664  10.442  -16.831  1.00 123.70 ? 112 CYS A SG  1 
ATOM 682   N N   . LYS A 1 144 ? -60.309  7.123   -13.598  1.00 128.50 ? 113 LYS A N   1 
ATOM 683   C CA  . LYS A 1 144 ? -60.586  6.600   -12.254  1.00 129.24 ? 113 LYS A CA  1 
ATOM 684   C C   . LYS A 1 144 ? -60.231  7.664   -11.216  1.00 126.90 ? 113 LYS A C   1 
ATOM 685   O O   . LYS A 1 144 ? -59.221  8.362   -11.339  1.00 125.23 ? 113 LYS A O   1 
ATOM 686   C CB  . LYS A 1 144 ? -59.788  5.316   -11.997  1.00 131.20 ? 113 LYS A CB  1 
ATOM 687   N N   . GLY A 1 145 ? -61.074  7.812   -10.206  1.00 127.12 ? 114 GLY A N   1 
ATOM 688   C CA  . GLY A 1 145 ? -60.778  8.752   -9.127   1.00 125.31 ? 114 GLY A CA  1 
ATOM 689   C C   . GLY A 1 145 ? -60.835  10.220  -9.525   1.00 122.68 ? 114 GLY A C   1 
ATOM 690   O O   . GLY A 1 145 ? -61.254  10.543  -10.637  1.00 122.56 ? 114 GLY A O   1 
ATOM 691   N N   . PRO A 1 146 ? -60.402  11.109  -8.612   1.00 120.93 ? 115 PRO A N   1 
ATOM 692   C CA  . PRO A 1 146 ? -60.490  12.573  -8.592   1.00 118.93 ? 115 PRO A CA  1 
ATOM 693   C C   . PRO A 1 146 ? -60.176  13.221  -9.917   1.00 117.94 ? 115 PRO A C   1 
ATOM 694   O O   . PRO A 1 146 ? -59.347  12.702  -10.653  1.00 118.48 ? 115 PRO A O   1 
ATOM 695   C CB  . PRO A 1 146 ? -59.401  12.960  -7.611   1.00 118.04 ? 115 PRO A CB  1 
ATOM 696   C CG  . PRO A 1 146 ? -59.329  11.816  -6.690   1.00 119.90 ? 115 PRO A CG  1 
ATOM 697   C CD  . PRO A 1 146 ? -59.629  10.599  -7.469   1.00 121.46 ? 115 PRO A CD  1 
ATOM 698   N N   . LYS A 1 147 ? -60.806  14.353  -10.213  1.00 117.22 ? 116 LYS A N   1 
ATOM 699   C CA  . LYS A 1 147 ? -60.565  15.024  -11.483  1.00 116.91 ? 116 LYS A CA  1 
ATOM 700   C C   . LYS A 1 147 ? -59.276  15.818  -11.448  1.00 116.38 ? 116 LYS A C   1 
ATOM 701   O O   . LYS A 1 147 ? -58.579  15.934  -12.457  1.00 116.26 ? 116 LYS A O   1 
ATOM 702   C CB  . LYS A 1 147 ? -61.700  15.952  -11.847  1.00 116.60 ? 116 LYS A CB  1 
ATOM 703   C CG  . LYS A 1 147 ? -61.742  16.212  -13.315  1.00 116.61 ? 116 LYS A CG  1 
ATOM 704   C CD  . LYS A 1 147 ? -62.374  17.535  -13.628  1.00 116.50 ? 116 LYS A CD  1 
ATOM 705   C CE  . LYS A 1 147 ? -63.032  17.489  -15.005  1.00 117.62 ? 116 LYS A CE  1 
ATOM 706   N NZ  . LYS A 1 147 ? -63.701  18.773  -15.332  1.00 117.30 ? 116 LYS A NZ  1 
ATOM 707   N N   . SER A 1 148 ? -58.967  16.352  -10.269  1.00 116.60 ? 117 SER A N   1 
ATOM 708   C CA  . SER A 1 148 ? -57.756  17.141  -10.027  1.00 116.29 ? 117 SER A CA  1 
ATOM 709   C C   . SER A 1 148 ? -56.490  16.296  -10.095  1.00 117.04 ? 117 SER A C   1 
ATOM 710   O O   . SER A 1 148 ? -55.423  16.723  -9.645   1.00 116.82 ? 117 SER A O   1 
ATOM 711   C CB  . SER A 1 148 ? -57.842  17.766  -8.646   1.00 115.96 ? 117 SER A CB  1 
ATOM 712   O OG  . SER A 1 148 ? -57.857  16.754  -7.665   1.00 116.56 ? 117 SER A OG  1 
ATOM 713   N N   . LEU A 1 149 ? -56.622  15.097  -10.654  1.00 118.44 ? 118 LEU A N   1 
ATOM 714   C CA  . LEU A 1 149 ? -55.541  14.136  -10.718  1.00 119.54 ? 118 LEU A CA  1 
ATOM 715   C C   . LEU A 1 149 ? -55.235  13.832  -12.179  1.00 120.10 ? 118 LEU A C   1 
ATOM 716   O O   . LEU A 1 149 ? -54.510  12.888  -12.511  1.00 121.42 ? 118 LEU A O   1 
ATOM 717   C CB  . LEU A 1 149 ? -55.946  12.876  -9.968   1.00 121.05 ? 118 LEU A CB  1 
ATOM 718   C CG  . LEU A 1 149 ? -54.991  12.454  -8.855   1.00 122.45 ? 118 LEU A CG  1 
ATOM 719   C CD1 . LEU A 1 149 ? -55.131  13.343  -7.583   1.00 120.91 ? 118 LEU A CD1 1 
ATOM 720   C CD2 . LEU A 1 149 ? -55.197  10.962  -8.554   1.00 125.83 ? 118 LEU A CD2 1 
ATOM 721   N N   . ILE A 1 150 ? -55.776  14.685  -13.038  1.00 119.38 ? 119 ILE A N   1 
ATOM 722   C CA  . ILE A 1 150 ? -55.681  14.532  -14.472  1.00 119.98 ? 119 ILE A CA  1 
ATOM 723   C C   . ILE A 1 150 ? -54.555  15.374  -15.083  1.00 119.65 ? 119 ILE A C   1 
ATOM 724   O O   . ILE A 1 150 ? -54.341  16.523  -14.700  1.00 118.49 ? 119 ILE A O   1 
ATOM 725   C CB  . ILE A 1 150 ? -57.052  14.820  -15.092  1.00 120.12 ? 119 ILE A CB  1 
ATOM 726   C CG1 . ILE A 1 150 ? -57.958  13.602  -14.858  1.00 121.24 ? 119 ILE A CG1 1 
ATOM 727   C CG2 . ILE A 1 150 ? -56.930  15.203  -16.564  1.00 121.05 ? 119 ILE A CG2 1 
ATOM 728   C CD1 . ILE A 1 150 ? -59.327  13.693  -15.482  1.00 122.17 ? 119 ILE A CD1 1 
ATOM 729   N N   . GLY A 1 151 ? -53.828  14.789  -16.027  1.00 120.99 ? 120 GLY A N   1 
ATOM 730   C CA  . GLY A 1 151 ? -52.669  15.457  -16.609  1.00 121.48 ? 120 GLY A CA  1 
ATOM 731   C C   . GLY A 1 151 ? -53.037  16.643  -17.479  1.00 121.44 ? 120 GLY A C   1 
ATOM 732   O O   . GLY A 1 151 ? -53.483  16.442  -18.616  1.00 122.66 ? 120 GLY A O   1 
ATOM 733   N N   . VAL A 1 152 ? -52.822  17.862  -16.958  1.00 120.28 ? 121 VAL A N   1 
ATOM 734   C CA  . VAL A 1 152 ? -53.159  19.126  -17.658  1.00 120.32 ? 121 VAL A CA  1 
ATOM 735   C C   . VAL A 1 152 ? -52.046  19.801  -18.486  1.00 121.98 ? 121 VAL A C   1 
ATOM 736   O O   . VAL A 1 152 ? -52.340  20.527  -19.434  1.00 122.89 ? 121 VAL A O   1 
ATOM 737   C CB  . VAL A 1 152 ? -53.743  20.163  -16.695  1.00 118.85 ? 121 VAL A CB  1 
ATOM 738   C CG1 . VAL A 1 152 ? -54.139  21.426  -17.438  1.00 118.96 ? 121 VAL A CG1 1 
ATOM 739   C CG2 . VAL A 1 152 ? -54.938  19.598  -16.020  1.00 117.67 ? 121 VAL A CG2 1 
ATOM 740   N N   . ARG A 1 153 ? -50.784  19.601  -18.126  1.00 122.93 ? 122 ARG A N   1 
ATOM 741   C CA  . ARG A 1 153 ? -49.692  20.120  -18.946  1.00 125.24 ? 122 ARG A CA  1 
ATOM 742   C C   . ARG A 1 153 ? -48.308  19.819  -18.386  1.00 126.38 ? 122 ARG A C   1 
ATOM 743   O O   . ARG A 1 153 ? -47.906  20.404  -17.384  1.00 125.74 ? 122 ARG A O   1 
ATOM 744   C CB  . ARG A 1 153 ? -49.843  21.635  -19.140  1.00 125.24 ? 122 ARG A CB  1 
ATOM 745   C CG  . ARG A 1 153 ? -48.795  22.230  -20.051  1.00 127.39 ? 122 ARG A CG  1 
ATOM 746   C CD  . ARG A 1 153 ? -48.654  23.719  -19.847  1.00 127.57 ? 122 ARG A CD  1 
ATOM 747   N NE  . ARG A 1 153 ? -49.574  24.478  -20.687  1.00 128.58 ? 122 ARG A NE  1 
ATOM 748   C CZ  . ARG A 1 153 ? -49.294  24.895  -21.920  1.00 131.06 ? 122 ARG A CZ  1 
ATOM 749   N NH1 . ARG A 1 153 ? -48.120  24.626  -22.473  1.00 132.96 ? 122 ARG A NH1 1 
ATOM 750   N NH2 . ARG A 1 153 ? -50.192  25.584  -22.606  1.00 132.14 ? 122 ARG A NH2 1 
ATOM 751   N N   . ASN A 1 154 ? -47.583  18.904  -19.021  1.00 128.76 ? 123 ASN A N   1 
ATOM 752   C CA  . ASN A 1 154 ? -46.121  18.879  -18.875  1.00 131.32 ? 123 ASN A CA  1 
ATOM 753   C C   . ASN A 1 154 ? -45.428  18.206  -17.658  1.00 131.37 ? 123 ASN A C   1 
ATOM 754   O O   . ASN A 1 154 ? -44.280  18.567  -17.354  1.00 132.56 ? 123 ASN A O   1 
ATOM 755   C CB  . ASN A 1 154 ? -45.555  20.316  -19.022  1.00 132.22 ? 123 ASN A CB  1 
ATOM 756   C CG  . ASN A 1 154 ? -44.997  20.612  -20.425  1.00 136.13 ? 123 ASN A CG  1 
ATOM 757   O OD1 . ASN A 1 154 ? -45.216  19.860  -21.383  1.00 138.80 ? 123 ASN A OD1 1 
ATOM 758   N ND2 . ASN A 1 154 ? -44.270  21.723  -20.542  1.00 138.30 ? 123 ASN A ND2 1 
ATOM 759   N N   . GLU A 1 155 ? -46.064  17.290  -16.927  1.00 130.68 ? 124 GLU A N   1 
ATOM 760   C CA  . GLU A 1 155 ? -47.484  17.098  -16.881  1.00 129.87 ? 124 GLU A CA  1 
ATOM 761   C C   . GLU A 1 155 ? -47.935  17.382  -15.464  1.00 127.54 ? 124 GLU A C   1 
ATOM 762   O O   . GLU A 1 155 ? -48.168  16.465  -14.666  1.00 127.14 ? 124 GLU A O   1 
ATOM 763   C CB  . GLU A 1 155 ? -47.849  15.704  -17.298  1.00 131.13 ? 124 GLU A CB  1 
ATOM 764   C CG  . GLU A 1 155 ? -48.149  15.637  -18.755  1.00 136.81 ? 124 GLU A CG  1 
ATOM 765   C CD  . GLU A 1 155 ? -48.979  14.414  -19.093  1.00 143.88 ? 124 GLU A CD  1 
ATOM 766   O OE1 . GLU A 1 155 ? -48.641  13.323  -18.558  1.00 147.12 ? 124 GLU A OE1 1 
ATOM 767   O OE2 . GLU A 1 155 ? -49.964  14.541  -19.880  1.00 146.29 ? 124 GLU A OE2 1 
ATOM 768   N N   . ASN A 1 156 ? -47.998  18.682  -15.171  1.00 126.19 ? 125 ASN A N   1 
ATOM 769   C CA  . ASN A 1 156 ? -48.625  19.246  -13.980  1.00 123.97 ? 125 ASN A CA  1 
ATOM 770   C C   . ASN A 1 156 ? -50.126  18.950  -13.937  1.00 122.03 ? 125 ASN A C   1 
ATOM 771   O O   . ASN A 1 156 ? -50.877  19.358  -14.827  1.00 121.85 ? 125 ASN A O   1 
ATOM 772   C CB  . ASN A 1 156 ? -48.459  20.774  -13.970  1.00 124.43 ? 125 ASN A CB  1 
ATOM 773   C CG  . ASN A 1 156 ? -47.004  21.229  -14.003  1.00 126.51 ? 125 ASN A CG  1 
ATOM 774   O OD1 . ASN A 1 156 ? -46.374  21.261  -15.062  1.00 128.46 ? 125 ASN A OD1 1 
ATOM 775   N ND2 . ASN A 1 156 ? -46.483  21.638  -12.840  1.00 127.75 ? 125 ASN A ND2 1 
ATOM 776   N N   . THR A 1 157 ? -50.576  18.270  -12.896  1.00 120.23 ? 126 THR A N   1 
ATOM 777   C CA  . THR A 1 157 ? -51.991  18.035  -12.774  1.00 118.69 ? 126 THR A CA  1 
ATOM 778   C C   . THR A 1 157 ? -52.717  19.298  -12.347  1.00 117.36 ? 126 THR A C   1 
ATOM 779   O O   . THR A 1 157 ? -52.095  20.343  -12.136  1.00 117.12 ? 126 THR A O   1 
ATOM 780   C CB  . THR A 1 157 ? -52.311  16.924  -11.801  1.00 118.74 ? 126 THR A CB  1 
ATOM 781   O OG1 . THR A 1 157 ? -53.660  16.515  -12.028  1.00 119.06 ? 126 THR A OG1 1 
ATOM 782   C CG2 . THR A 1 157 ? -52.164  17.399  -10.356  1.00 117.87 ? 126 THR A CG2 1 
ATOM 783   N N   . PHE A 1 158 ? -54.039  19.174  -12.226  1.00 116.40 ? 127 PHE A N   1 
ATOM 784   C CA  . PHE A 1 158 ? -54.937  20.277  -11.909  1.00 115.16 ? 127 PHE A CA  1 
ATOM 785   C C   . PHE A 1 158 ? -54.660  20.865  -10.551  1.00 114.57 ? 127 PHE A C   1 
ATOM 786   O O   . PHE A 1 158 ? -54.762  22.075  -10.342  1.00 114.56 ? 127 PHE A O   1 
ATOM 787   C CB  . PHE A 1 158 ? -56.369  19.783  -11.926  1.00 114.95 ? 127 PHE A CB  1 
ATOM 788   C CG  . PHE A 1 158 ? -57.062  20.008  -13.218  1.00 114.40 ? 127 PHE A CG  1 
ATOM 789   C CD1 . PHE A 1 158 ? -57.118  21.272  -13.777  1.00 113.42 ? 127 PHE A CD1 1 
ATOM 790   C CD2 . PHE A 1 158 ? -57.691  18.963  -13.863  1.00 114.62 ? 127 PHE A CD2 1 
ATOM 791   C CE1 . PHE A 1 158 ? -57.775  21.482  -14.964  1.00 114.22 ? 127 PHE A CE1 1 
ATOM 792   C CE2 . PHE A 1 158 ? -58.348  19.167  -15.055  1.00 114.97 ? 127 PHE A CE2 1 
ATOM 793   C CZ  . PHE A 1 158 ? -58.391  20.429  -15.605  1.00 114.83 ? 127 PHE A CZ  1 
ATOM 794   N N   . LEU A 1 159 ? -54.333  19.980  -9.625   1.00 114.23 ? 128 LEU A N   1 
ATOM 795   C CA  . LEU A 1 159 ? -53.940  20.361  -8.296   1.00 113.75 ? 128 LEU A CA  1 
ATOM 796   C C   . LEU A 1 159 ? -52.623  21.139  -8.356   1.00 113.89 ? 128 LEU A C   1 
ATOM 797   O O   . LEU A 1 159 ? -52.562  22.315  -8.001   1.00 113.97 ? 128 LEU A O   1 
ATOM 798   C CB  . LEU A 1 159 ? -53.800  19.092  -7.476   1.00 113.89 ? 128 LEU A CB  1 
ATOM 799   C CG  . LEU A 1 159 ? -53.476  19.189  -6.006   1.00 113.57 ? 128 LEU A CG  1 
ATOM 800   C CD1 . LEU A 1 159 ? -54.440  20.112  -5.278   1.00 111.85 ? 128 LEU A CD1 1 
ATOM 801   C CD2 . LEU A 1 159 ? -53.533  17.767  -5.496   1.00 114.67 ? 128 LEU A CD2 1 
ATOM 802   N N   . ASP A 1 160 ? -51.582  20.481  -8.849   1.00 114.17 ? 129 ASP A N   1 
ATOM 803   C CA  . ASP A 1 160 ? -50.258  21.071  -8.965   1.00 114.61 ? 129 ASP A CA  1 
ATOM 804   C C   . ASP A 1 160 ? -50.244  22.505  -9.435   1.00 113.95 ? 129 ASP A C   1 
ATOM 805   O O   . ASP A 1 160 ? -49.421  23.290  -8.974   1.00 114.93 ? 129 ASP A O   1 
ATOM 806   C CB  . ASP A 1 160 ? -49.432  20.268  -9.952   1.00 116.13 ? 129 ASP A CB  1 
ATOM 807   C CG  . ASP A 1 160 ? -48.985  18.959  -9.390   1.00 118.73 ? 129 ASP A CG  1 
ATOM 808   O OD1 . ASP A 1 160 ? -47.979  18.964  -8.643   1.00 122.26 ? 129 ASP A OD1 1 
ATOM 809   O OD2 . ASP A 1 160 ? -49.637  17.930  -9.693   1.00 121.10 ? 129 ASP A OD2 1 
ATOM 810   N N   . LEU A 1 161 ? -51.127  22.833  -10.374  1.00 112.45 ? 130 LEU A N   1 
ATOM 811   C CA  . LEU A 1 161 ? -51.089  24.132  -11.018  1.00 111.84 ? 130 LEU A CA  1 
ATOM 812   C C   . LEU A 1 161 ? -51.596  25.225  -10.109  1.00 111.24 ? 130 LEU A C   1 
ATOM 813   O O   . LEU A 1 161 ? -51.411  26.405  -10.390  1.00 111.66 ? 130 LEU A O   1 
ATOM 814   C CB  . LEU A 1 161 ? -51.886  24.118  -12.313  1.00 112.01 ? 130 LEU A CB  1 
ATOM 815   C CG  . LEU A 1 161 ? -51.302  23.347  -13.483  1.00 112.00 ? 130 LEU A CG  1 
ATOM 816   C CD1 . LEU A 1 161 ? -52.349  23.293  -14.552  1.00 111.92 ? 130 LEU A CD1 1 
ATOM 817   C CD2 . LEU A 1 161 ? -50.048  24.021  -14.000  1.00 112.78 ? 130 LEU A CD2 1 
ATOM 818   N N   . THR A 1 162 ? -52.250  24.836  -9.023   1.00 110.15 ? 131 THR A N   1 
ATOM 819   C CA  . THR A 1 162 ? -52.650  25.818  -8.028   1.00 110.39 ? 131 THR A CA  1 
ATOM 820   C C   . THR A 1 162 ? -51.569  25.944  -6.964   1.00 110.76 ? 131 THR A C   1 
ATOM 821   O O   . THR A 1 162 ? -51.085  27.050  -6.717   1.00 112.11 ? 131 THR A O   1 
ATOM 822   C CB  . THR A 1 162 ? -54.049  25.560  -7.400   1.00 109.77 ? 131 THR A CB  1 
ATOM 823   O OG1 . THR A 1 162 ? -54.224  24.163  -7.185   1.00 109.57 ? 131 THR A OG1 1 
ATOM 824   C CG2 . THR A 1 162 ? -55.149  26.047  -8.315   1.00 109.83 ? 131 THR A CG2 1 
ATOM 825   N N   . VAL A 1 163 ? -51.159  24.832  -6.351   1.00 109.92 ? 132 VAL A N   1 
ATOM 826   C CA  . VAL A 1 163 ? -50.103  24.922  -5.356   1.00 110.11 ? 132 VAL A CA  1 
ATOM 827   C C   . VAL A 1 163 ? -48.899  25.595  -5.984   1.00 111.10 ? 132 VAL A C   1 
ATOM 828   O O   . VAL A 1 163 ? -48.230  26.357  -5.313   1.00 112.30 ? 132 VAL A O   1 
ATOM 829   C CB  . VAL A 1 163 ? -49.715  23.584  -4.720   1.00 109.66 ? 132 VAL A CB  1 
ATOM 830   C CG1 . VAL A 1 163 ? -50.934  22.777  -4.436   1.00 109.11 ? 132 VAL A CG1 1 
ATOM 831   C CG2 . VAL A 1 163 ? -48.807  22.813  -5.616   1.00 110.48 ? 132 VAL A CG2 1 
ATOM 832   N N   . GLN A 1 164 ? -48.645  25.351  -7.272   1.00 111.26 ? 133 GLN A N   1 
ATOM 833   C CA  . GLN A 1 164 ? -47.601  26.083  -7.990   1.00 112.79 ? 133 GLN A CA  1 
ATOM 834   C C   . GLN A 1 164 ? -47.907  27.598  -7.991   1.00 114.26 ? 133 GLN A C   1 
ATOM 835   O O   . GLN A 1 164 ? -47.016  28.389  -7.700   1.00 116.03 ? 133 GLN A O   1 
ATOM 836   C CB  . GLN A 1 164 ? -47.329  25.509  -9.395   1.00 112.42 ? 133 GLN A CB  1 
ATOM 837   N N   . GLN A 1 165 ? -49.155  27.997  -8.260   1.00 114.39 ? 134 GLN A N   1 
ATOM 838   C CA  . GLN A 1 165 ? -49.564  29.407  -8.149   1.00 116.02 ? 134 GLN A CA  1 
ATOM 839   C C   . GLN A 1 165 ? -49.268  29.961  -6.755   1.00 117.13 ? 134 GLN A C   1 
ATOM 840   O O   . GLN A 1 165 ? -48.668  31.031  -6.647   1.00 118.89 ? 134 GLN A O   1 
ATOM 841   C CB  . GLN A 1 165 ? -51.054  29.583  -8.443   1.00 115.46 ? 134 GLN A CB  1 
ATOM 842   C CG  . GLN A 1 165 ? -51.461  29.544  -9.904   1.00 116.16 ? 134 GLN A CG  1 
ATOM 843   C CD  . GLN A 1 165 ? -52.979  29.653  -10.082  1.00 117.01 ? 134 GLN A CD  1 
ATOM 844   O OE1 . GLN A 1 165 ? -53.733  29.540  -9.110   1.00 117.13 ? 134 GLN A OE1 1 
ATOM 845   N NE2 . GLN A 1 165 ? -53.431  29.878  -11.323  1.00 116.93 ? 134 GLN A NE2 1 
ATOM 846   N N   . ILE A 1 166 ? -49.687  29.228  -5.710   1.00 116.75 ? 135 ILE A N   1 
ATOM 847   C CA  . ILE A 1 166 ? -49.500  29.607  -4.286   1.00 118.16 ? 135 ILE A CA  1 
ATOM 848   C C   . ILE A 1 166 ? -48.014  29.649  -3.829   1.00 120.35 ? 135 ILE A C   1 
ATOM 849   O O   . ILE A 1 166 ? -47.560  30.635  -3.221   1.00 122.02 ? 135 ILE A O   1 
ATOM 850   C CB  . ILE A 1 166 ? -50.303  28.680  -3.317   1.00 116.69 ? 135 ILE A CB  1 
ATOM 851   C CG1 . ILE A 1 166 ? -51.717  28.449  -3.802   1.00 114.58 ? 135 ILE A CG1 1 
ATOM 852   C CG2 . ILE A 1 166 ? -50.384  29.280  -1.929   1.00 117.74 ? 135 ILE A CG2 1 
ATOM 853   C CD1 . ILE A 1 166 ? -52.592  29.632  -3.614   1.00 115.42 ? 135 ILE A CD1 1 
ATOM 854   N N   . GLU A 1 167 ? -47.278  28.571  -4.102   1.00 120.79 ? 136 GLU A N   1 
ATOM 855   C CA  . GLU A 1 167 ? -45.832  28.552  -3.924   1.00 123.16 ? 136 GLU A CA  1 
ATOM 856   C C   . GLU A 1 167 ? -45.193  29.805  -4.520   1.00 125.37 ? 136 GLU A C   1 
ATOM 857   O O   . GLU A 1 167 ? -44.352  30.416  -3.873   1.00 127.45 ? 136 GLU A O   1 
ATOM 858   C CB  . GLU A 1 167 ? -45.197  27.304  -4.554   1.00 122.83 ? 136 GLU A CB  1 
ATOM 859   C CG  . GLU A 1 167 ? -44.912  26.135  -3.585   1.00 124.11 ? 136 GLU A CG  1 
ATOM 860   C CD  . GLU A 1 167 ? -43.784  25.182  -4.069   1.00 126.65 ? 136 GLU A CD  1 
ATOM 861   O OE1 . GLU A 1 167 ? -42.714  25.159  -3.413   1.00 128.73 ? 136 GLU A OE1 1 
ATOM 862   O OE2 . GLU A 1 167 ? -43.959  24.454  -5.086   1.00 126.28 ? 136 GLU A OE2 1 
ATOM 863   N N   . HIS A 1 168 ? -45.583  30.191  -5.737   1.00 125.82 ? 137 HIS A N   1 
ATOM 864   C CA  . HIS A 1 168 ? -45.039  31.410  -6.351   1.00 128.49 ? 137 HIS A CA  1 
ATOM 865   C C   . HIS A 1 168 ? -45.384  32.622  -5.519   1.00 129.99 ? 137 HIS A C   1 
ATOM 866   O O   . HIS A 1 168 ? -44.596  33.566  -5.457   1.00 132.57 ? 137 HIS A O   1 
ATOM 867   C CB  . HIS A 1 168 ? -45.520  31.620  -7.797   1.00 128.77 ? 137 HIS A CB  1 
ATOM 868   C CG  . HIS A 1 168 ? -44.970  32.857  -8.456   1.00 132.06 ? 137 HIS A CG  1 
ATOM 869   N ND1 . HIS A 1 168 ? -43.616  33.101  -8.579   1.00 134.73 ? 137 HIS A ND1 1 
ATOM 870   C CD2 . HIS A 1 168 ? -45.596  33.906  -9.046   1.00 133.77 ? 137 HIS A CD2 1 
ATOM 871   C CE1 . HIS A 1 168 ? -43.431  34.252  -9.201   1.00 137.61 ? 137 HIS A CE1 1 
ATOM 872   N NE2 . HIS A 1 168 ? -44.617  34.760  -9.495   1.00 137.78 ? 137 HIS A NE2 1 
ATOM 873   N N   . LEU A 1 169 ? -46.548  32.593  -4.873   1.00 129.01 ? 138 LEU A N   1 
ATOM 874   C CA  . LEU A 1 169 ? -47.008  33.752  -4.116   1.00 130.71 ? 138 LEU A CA  1 
ATOM 875   C C   . LEU A 1 169 ? -46.231  33.955  -2.831   1.00 132.44 ? 138 LEU A C   1 
ATOM 876   O O   . LEU A 1 169 ? -45.631  35.015  -2.616   1.00 135.07 ? 138 LEU A O   1 
ATOM 877   C CB  . LEU A 1 169 ? -48.507  33.696  -3.844   1.00 129.12 ? 138 LEU A CB  1 
ATOM 878   C CG  . LEU A 1 169 ? -49.372  34.330  -4.922   1.00 128.35 ? 138 LEU A CG  1 
ATOM 879   C CD1 . LEU A 1 169 ? -50.689  34.547  -4.275   1.00 127.61 ? 138 LEU A CD1 1 
ATOM 880   C CD2 . LEU A 1 169 ? -48.818  35.655  -5.469   1.00 129.34 ? 138 LEU A CD2 1 
ATOM 881   N N   . ASN A 1 170 ? -46.230  32.933  -1.987   1.00 131.52 ? 139 ASN A N   1 
ATOM 882   C CA  . ASN A 1 170 ? -45.460  32.978  -0.754   1.00 133.23 ? 139 ASN A CA  1 
ATOM 883   C C   . ASN A 1 170 ? -43.958  33.262  -1.005   1.00 135.57 ? 139 ASN A C   1 
ATOM 884   O O   . ASN A 1 170 ? -43.356  34.113  -0.345   1.00 137.84 ? 139 ASN A O   1 
ATOM 885   C CB  . ASN A 1 170 ? -45.716  31.700  0.056    1.00 131.42 ? 139 ASN A CB  1 
ATOM 886   C CG  . ASN A 1 170 ? -47.198  31.518  0.416    1.00 129.13 ? 139 ASN A CG  1 
ATOM 887   O OD1 . ASN A 1 170 ? -48.027  32.384  0.136    1.00 128.33 ? 139 ASN A OD1 1 
ATOM 888   N ND2 . ASN A 1 170 ? -47.527  30.391  1.040    1.00 126.48 ? 139 ASN A ND2 1 
ATOM 889   N N   . LYS A 1 171 ? -43.392  32.594  -2.007   1.00 135.53 ? 140 LYS A N   1 
ATOM 890   C CA  . LYS A 1 171 ? -41.979  32.717  -2.349   1.00 137.97 ? 140 LYS A CA  1 
ATOM 891   C C   . LYS A 1 171 ? -41.648  33.934  -3.220   1.00 140.64 ? 140 LYS A C   1 
ATOM 892   O O   . LYS A 1 171 ? -40.605  33.943  -3.882   1.00 142.34 ? 140 LYS A O   1 
ATOM 893   C CB  . LYS A 1 171 ? -41.481  31.429  -3.024   1.00 136.49 ? 140 LYS A CB  1 
ATOM 894   N N   . THR A 1 172 ? -42.527  34.939  -3.240   1.00 141.75 ? 141 THR A N   1 
ATOM 895   C CA  . THR A 1 172 ? -42.198  36.247  -3.843   1.00 145.28 ? 141 THR A CA  1 
ATOM 896   C C   . THR A 1 172 ? -42.717  37.419  -3.012   1.00 147.61 ? 141 THR A C   1 
ATOM 897   O O   . THR A 1 172 ? -42.516  38.578  -3.379   1.00 150.51 ? 141 THR A O   1 
ATOM 898   C CB  . THR A 1 172 ? -42.685  36.436  -5.338   1.00 145.02 ? 141 THR A CB  1 
ATOM 899   O OG1 . THR A 1 172 ? -44.097  36.221  -5.449   1.00 142.62 ? 141 THR A OG1 1 
ATOM 900   C CG2 . THR A 1 172 ? -41.936  35.535  -6.320   1.00 144.30 ? 141 THR A CG2 1 
ATOM 901   N N   . TYR A 1 173 ? -43.389  37.114  -1.903   1.00 146.97 ? 142 TYR A N   1 
ATOM 902   C CA  . TYR A 1 173 ? -44.021  38.139  -1.060   1.00 149.12 ? 142 TYR A CA  1 
ATOM 903   C C   . TYR A 1 173 ? -43.811  37.836  0.425    1.00 149.42 ? 142 TYR A C   1 
ATOM 904   O O   . TYR A 1 173 ? -44.445  38.459  1.289    1.00 150.65 ? 142 TYR A O   1 
ATOM 905   C CB  . TYR A 1 173 ? -45.529  38.222  -1.347   1.00 147.80 ? 142 TYR A CB  1 
ATOM 906   C CG  . TYR A 1 173 ? -45.943  38.833  -2.679   1.00 148.85 ? 142 TYR A CG  1 
ATOM 907   C CD1 . TYR A 1 173 ? -46.484  40.120  -2.740   1.00 151.73 ? 142 TYR A CD1 1 
ATOM 908   C CD2 . TYR A 1 173 ? -45.841  38.110  -3.869   1.00 147.71 ? 142 TYR A CD2 1 
ATOM 909   C CE1 . TYR A 1 173 ? -46.889  40.681  -3.951   1.00 152.53 ? 142 TYR A CE1 1 
ATOM 910   C CE2 . TYR A 1 173 ? -46.237  38.663  -5.088   1.00 148.85 ? 142 TYR A CE2 1 
ATOM 911   C CZ  . TYR A 1 173 ? -46.761  39.949  -5.120   1.00 151.24 ? 142 TYR A CZ  1 
ATOM 912   O OH  . TYR A 1 173 ? -47.160  40.495  -6.320   1.00 152.16 ? 142 TYR A OH  1 
ATOM 913   N N   . ASN A 1 174 ? -42.934  36.869  0.702    1.00 148.54 ? 143 ASN A N   1 
ATOM 914   C CA  . ASN A 1 174 ? -42.632  36.411  2.058    1.00 149.00 ? 143 ASN A CA  1 
ATOM 915   C C   . ASN A 1 174 ? -43.842  35.917  2.839    1.00 147.22 ? 143 ASN A C   1 
ATOM 916   O O   . ASN A 1 174 ? -43.778  35.779  4.056    1.00 148.26 ? 143 ASN A O   1 
ATOM 917   C CB  . ASN A 1 174 ? -41.924  37.510  2.862    1.00 152.83 ? 143 ASN A CB  1 
ATOM 918   C CG  . ASN A 1 174 ? -40.426  37.544  2.624    1.00 155.39 ? 143 ASN A CG  1 
ATOM 919   O OD1 . ASN A 1 174 ? -39.633  37.182  3.507    1.00 157.33 ? 143 ASN A OD1 1 
ATOM 920   N ND2 . ASN A 1 174 ? -40.025  37.984  1.430    1.00 156.31 ? 143 ASN A ND2 1 
ATOM 921   N N   . THR A 1 175 ? -44.939  35.641  2.145    1.00 145.00 ? 144 THR A N   1 
ATOM 922   C CA  . THR A 1 175 ? -46.203  35.364  2.826    1.00 143.97 ? 144 THR A CA  1 
ATOM 923   C C   . THR A 1 175 ? -46.430  33.885  3.095    1.00 141.56 ? 144 THR A C   1 
ATOM 924   O O   . THR A 1 175 ? -45.629  33.057  2.669    1.00 140.75 ? 144 THR A O   1 
ATOM 925   C CB  . THR A 1 175 ? -47.405  35.938  2.054    1.00 143.43 ? 144 THR A CB  1 
ATOM 926   O OG1 . THR A 1 175 ? -48.608  35.650  2.777    1.00 143.07 ? 144 THR A OG1 1 
ATOM 927   C CG2 . THR A 1 175 ? -47.497  35.340  0.657    1.00 140.83 ? 144 THR A CG2 1 
ATOM 928   N N   . ASP A 1 176 ? -47.501  33.569  3.829    1.00 140.83 ? 145 ASP A N   1 
ATOM 929   C CA  . ASP A 1 176 ? -47.989  32.189  3.954    1.00 138.57 ? 145 ASP A CA  1 
ATOM 930   C C   . ASP A 1 176 ? -49.514  32.090  3.862    1.00 136.63 ? 145 ASP A C   1 
ATOM 931   O O   . ASP A 1 176 ? -50.229  32.147  4.860    1.00 137.30 ? 145 ASP A O   1 
ATOM 932   C CB  . ASP A 1 176 ? -47.421  31.463  5.194    1.00 140.02 ? 145 ASP A CB  1 
ATOM 933   C CG  . ASP A 1 176 ? -46.219  30.534  4.852    1.00 141.23 ? 145 ASP A CG  1 
ATOM 934   O OD1 . ASP A 1 176 ? -45.054  31.013  4.834    1.00 144.18 ? 145 ASP A OD1 1 
ATOM 935   O OD2 . ASP A 1 176 ? -46.436  29.315  4.611    1.00 141.37 ? 145 ASP A OD2 1 
ATOM 936   N N   . VAL A 1 177 ? -49.979  31.953  2.625    1.00 134.05 ? 146 VAL A N   1 
ATOM 937   C CA  . VAL A 1 177 ? -51.379  31.749  2.287    1.00 131.93 ? 146 VAL A CA  1 
ATOM 938   C C   . VAL A 1 177 ? -51.672  30.260  2.307    1.00 129.61 ? 146 VAL A C   1 
ATOM 939   O O   . VAL A 1 177 ? -51.032  29.510  1.579    1.00 128.92 ? 146 VAL A O   1 
ATOM 940   C CB  . VAL A 1 177 ? -51.638  32.180  0.849    1.00 130.94 ? 146 VAL A CB  1 
ATOM 941   C CG1 . VAL A 1 177 ? -53.108  32.109  0.548    1.00 130.24 ? 146 VAL A CG1 1 
ATOM 942   C CG2 . VAL A 1 177 ? -51.086  33.557  0.592    1.00 132.79 ? 146 VAL A CG2 1 
ATOM 943   N N   . PRO A 1 178 ? -52.647  29.818  3.110    1.00 128.86 ? 147 PRO A N   1 
ATOM 944   C CA  . PRO A 1 178 ? -52.966  28.388  3.174    1.00 126.93 ? 147 PRO A CA  1 
ATOM 945   C C   . PRO A 1 178 ? -53.823  27.929  1.995    1.00 124.58 ? 147 PRO A C   1 
ATOM 946   O O   . PRO A 1 178 ? -54.323  28.768  1.252    1.00 124.62 ? 147 PRO A O   1 
ATOM 947   C CB  . PRO A 1 178 ? -53.738  28.271  4.480    1.00 128.27 ? 147 PRO A CB  1 
ATOM 948   C CG  . PRO A 1 178 ? -54.371  29.591  4.646    1.00 130.12 ? 147 PRO A CG  1 
ATOM 949   C CD  . PRO A 1 178 ? -53.502  30.617  3.995    1.00 130.50 ? 147 PRO A CD  1 
ATOM 950   N N   . LEU A 1 179 ? -53.983  26.615  1.827    1.00 122.71 ? 148 LEU A N   1 
ATOM 951   C CA  . LEU A 1 179 ? -54.773  26.067  0.718    1.00 120.78 ? 148 LEU A CA  1 
ATOM 952   C C   . LEU A 1 179 ? -55.703  24.949  1.174    1.00 120.18 ? 148 LEU A C   1 
ATOM 953   O O   . LEU A 1 179 ? -55.237  23.914  1.641    1.00 120.33 ? 148 LEU A O   1 
ATOM 954   C CB  . LEU A 1 179 ? -53.858  25.538  -0.382   1.00 119.68 ? 148 LEU A CB  1 
ATOM 955   C CG  . LEU A 1 179 ? -54.407  25.471  -1.809   1.00 119.19 ? 148 LEU A CG  1 
ATOM 956   C CD1 . LEU A 1 179 ? -53.587  24.516  -2.628   1.00 118.87 ? 148 LEU A CD1 1 
ATOM 957   C CD2 . LEU A 1 179 ? -55.853  25.050  -1.884   1.00 119.79 ? 148 LEU A CD2 1 
ATOM 958   N N   . VAL A 1 180 ? -57.008  25.149  1.008    1.00 119.40 ? 149 VAL A N   1 
ATOM 959   C CA  . VAL A 1 180 ? -57.981  24.223  1.541    1.00 119.30 ? 149 VAL A CA  1 
ATOM 960   C C   . VAL A 1 180 ? -58.736  23.542  0.445    1.00 118.55 ? 149 VAL A C   1 
ATOM 961   O O   . VAL A 1 180 ? -59.353  24.196  -0.367   1.00 118.35 ? 149 VAL A O   1 
ATOM 962   C CB  . VAL A 1 180 ? -59.017  24.942  2.364    1.00 120.63 ? 149 VAL A CB  1 
ATOM 963   C CG1 . VAL A 1 180 ? -59.771  23.946  3.196    1.00 122.04 ? 149 VAL A CG1 1 
ATOM 964   C CG2 . VAL A 1 180 ? -58.375  25.973  3.246    1.00 121.16 ? 149 VAL A CG2 1 
ATOM 965   N N   . LEU A 1 181 ? -58.725  22.223  0.433    1.00 118.92 ? 150 LEU A N   1 
ATOM 966   C CA  . LEU A 1 181 ? -59.478  21.496  -0.578   1.00 119.19 ? 150 LEU A CA  1 
ATOM 967   C C   . LEU A 1 181 ? -60.722  20.894  0.041    1.00 121.61 ? 150 LEU A C   1 
ATOM 968   O O   . LEU A 1 181 ? -60.651  20.305  1.121    1.00 123.41 ? 150 LEU A O   1 
ATOM 969   C CB  . LEU A 1 181 ? -58.637  20.387  -1.185   1.00 118.00 ? 150 LEU A CB  1 
ATOM 970   C CG  . LEU A 1 181 ? -57.158  20.688  -1.347   1.00 116.76 ? 150 LEU A CG  1 
ATOM 971   C CD1 . LEU A 1 181 ? -56.390  19.386  -1.501   1.00 116.55 ? 150 LEU A CD1 1 
ATOM 972   C CD2 . LEU A 1 181 ? -56.907  21.634  -2.511   1.00 114.86 ? 150 LEU A CD2 1 
ATOM 973   N N   . MET A 1 182 ? -61.857  21.042  -0.637   1.00 122.63 ? 151 MET A N   1 
ATOM 974   C CA  . MET A 1 182 ? -63.124  20.494  -0.158   1.00 125.06 ? 151 MET A CA  1 
ATOM 975   C C   . MET A 1 182 ? -63.438  19.261  -0.960   1.00 124.86 ? 151 MET A C   1 
ATOM 976   O O   . MET A 1 182 ? -63.927  19.366  -2.088   1.00 124.56 ? 151 MET A O   1 
ATOM 977   C CB  . MET A 1 182 ? -64.258  21.513  -0.337   1.00 126.47 ? 151 MET A CB  1 
ATOM 978   C CG  . MET A 1 182 ? -65.544  21.212  0.482    1.00 130.70 ? 151 MET A CG  1 
ATOM 979   S SD  . MET A 1 182 ? -66.936  22.349  0.193    1.00 134.69 ? 151 MET A SD  1 
ATOM 980   C CE  . MET A 1 182 ? -67.726  21.503  -1.193   1.00 133.50 ? 151 MET A CE  1 
ATOM 981   N N   . ASN A 1 183 ? -63.153  18.093  -0.405   1.00 125.56 ? 152 ASN A N   1 
ATOM 982   C CA  . ASN A 1 183 ? -63.407  16.887  -1.170   1.00 125.94 ? 152 ASN A CA  1 
ATOM 983   C C   . ASN A 1 183 ? -64.515  16.023  -0.637   1.00 128.44 ? 152 ASN A C   1 
ATOM 984   O O   . ASN A 1 183 ? -64.722  15.922  0.559    1.00 130.10 ? 152 ASN A O   1 
ATOM 985   C CB  . ASN A 1 183 ? -62.133  16.086  -1.480   1.00 125.07 ? 152 ASN A CB  1 
ATOM 986   C CG  . ASN A 1 183 ? -61.083  16.215  -0.424   1.00 124.33 ? 152 ASN A CG  1 
ATOM 987   O OD1 . ASN A 1 183 ? -61.215  15.661  0.658    1.00 125.96 ? 152 ASN A OD1 1 
ATOM 988   N ND2 . ASN A 1 183 ? -60.012  16.930  -0.740   1.00 121.44 ? 152 ASN A ND2 1 
ATOM 989   N N   . SER A 1 184 ? -65.224  15.409  -1.570   1.00 129.29 ? 153 SER A N   1 
ATOM 990   C CA  . SER A 1 184 ? -66.313  14.506  -1.287   1.00 132.52 ? 153 SER A CA  1 
ATOM 991   C C   . SER A 1 184 ? -65.793  13.180  -0.777   1.00 134.30 ? 153 SER A C   1 
ATOM 992   O O   . SER A 1 184 ? -64.609  13.023  -0.555   1.00 133.46 ? 153 SER A O   1 
ATOM 993   C CB  . SER A 1 184 ? -67.102  14.272  -2.572   1.00 132.76 ? 153 SER A CB  1 
ATOM 994   O OG  . SER A 1 184 ? -66.388  13.440  -3.475   1.00 132.47 ? 153 SER A OG  1 
ATOM 995   N N   . PHE A 1 185 ? -66.689  12.220  -0.621   1.00 137.60 ? 154 PHE A N   1 
ATOM 996   C CA  . PHE A 1 185 ? -66.307  10.892  -0.193   1.00 140.55 ? 154 PHE A CA  1 
ATOM 997   C C   . PHE A 1 185 ? -65.764  10.034  -1.323   1.00 140.34 ? 154 PHE A C   1 
ATOM 998   O O   . PHE A 1 185 ? -65.309  8.925   -1.082   1.00 142.06 ? 154 PHE A O   1 
ATOM 999   C CB  . PHE A 1 185 ? -67.467  10.187  0.527    1.00 144.63 ? 154 PHE A CB  1 
ATOM 1000  C CG  . PHE A 1 185 ? -68.634  9.818   -0.366   1.00 146.85 ? 154 PHE A CG  1 
ATOM 1001  C CD1 . PHE A 1 185 ? -68.793  8.507   -0.821   1.00 149.43 ? 154 PHE A CD1 1 
ATOM 1002  C CD2 . PHE A 1 185 ? -69.594  10.769  -0.713   1.00 147.41 ? 154 PHE A CD2 1 
ATOM 1003  C CE1 . PHE A 1 185 ? -69.869  8.155   -1.627   1.00 151.50 ? 154 PHE A CE1 1 
ATOM 1004  C CE2 . PHE A 1 185 ? -70.672  10.431  -1.525   1.00 149.38 ? 154 PHE A CE2 1 
ATOM 1005  C CZ  . PHE A 1 185 ? -70.808  9.120   -1.984   1.00 151.73 ? 154 PHE A CZ  1 
ATOM 1006  N N   . ASN A 1 186 ? -65.808  10.540  -2.549   1.00 139.08 ? 155 ASN A N   1 
ATOM 1007  C CA  . ASN A 1 186 ? -65.199  9.839   -3.687   1.00 139.51 ? 155 ASN A CA  1 
ATOM 1008  C C   . ASN A 1 186 ? -63.721  10.201  -3.872   1.00 137.73 ? 155 ASN A C   1 
ATOM 1009  O O   . ASN A 1 186 ? -62.904  9.381   -4.317   1.00 138.15 ? 155 ASN A O   1 
ATOM 1010  C CB  . ASN A 1 186 ? -65.938  10.163  -4.989   1.00 138.92 ? 155 ASN A CB  1 
ATOM 1011  C CG  . ASN A 1 186 ? -67.431  9.961   -4.888   1.00 141.44 ? 155 ASN A CG  1 
ATOM 1012  O OD1 . ASN A 1 186 ? -67.900  8.900   -4.471   1.00 144.93 ? 155 ASN A OD1 1 
ATOM 1013  N ND2 . ASN A 1 186 ? -68.193  10.982  -5.286   1.00 140.15 ? 155 ASN A ND2 1 
ATOM 1014  N N   . THR A 1 187 ? -63.389  11.440  -3.537   1.00 136.25 ? 156 THR A N   1 
ATOM 1015  C CA  . THR A 1 187 ? -62.110  11.991  -3.909   1.00 134.59 ? 156 THR A CA  1 
ATOM 1016  C C   . THR A 1 187 ? -61.179  12.216  -2.721   1.00 135.61 ? 156 THR A C   1 
ATOM 1017  O O   . THR A 1 187 ? -60.032  12.629  -2.918   1.00 134.70 ? 156 THR A O   1 
ATOM 1018  C CB  . THR A 1 187 ? -62.279  13.303  -4.691   1.00 132.11 ? 156 THR A CB  1 
ATOM 1019  O OG1 . THR A 1 187 ? -62.754  14.321  -3.817   1.00 130.97 ? 156 THR A OG1 1 
ATOM 1020  C CG2 . THR A 1 187 ? -63.267  13.135  -5.823   1.00 132.28 ? 156 THR A CG2 1 
ATOM 1021  N N   . ASP A 1 188 ? -61.645  11.940  -1.501   1.00 138.40 ? 157 ASP A N   1 
ATOM 1022  C CA  . ASP A 1 188 ? -60.826  12.168  -0.292   1.00 139.62 ? 157 ASP A CA  1 
ATOM 1023  C C   . ASP A 1 188 ? -59.805  11.051  -0.004   1.00 141.44 ? 157 ASP A C   1 
ATOM 1024  O O   . ASP A 1 188 ? -58.639  11.321  0.311    1.00 140.90 ? 157 ASP A O   1 
ATOM 1025  C CB  . ASP A 1 188 ? -61.706  12.420  0.930    1.00 141.35 ? 157 ASP A CB  1 
ATOM 1026  C CG  . ASP A 1 188 ? -60.918  12.937  2.115    1.00 142.30 ? 157 ASP A CG  1 
ATOM 1027  O OD1 . ASP A 1 188 ? -61.120  12.410  3.230    1.00 146.04 ? 157 ASP A OD1 1 
ATOM 1028  O OD2 . ASP A 1 188 ? -60.091  13.860  1.936    1.00 140.99 ? 157 ASP A OD2 1 
ATOM 1029  N N   . GLU A 1 189 ? -60.264  9.806   -0.093   1.00 144.21 ? 158 GLU A N   1 
ATOM 1030  C CA  . GLU A 1 189 ? -59.406  8.630   -0.129   1.00 146.17 ? 158 GLU A CA  1 
ATOM 1031  C C   . GLU A 1 189 ? -58.141  8.915   -0.966   1.00 144.04 ? 158 GLU A C   1 
ATOM 1032  O O   . GLU A 1 189 ? -57.006  8.817   -0.483   1.00 144.01 ? 158 GLU A O   1 
ATOM 1033  C CB  . GLU A 1 189 ? -60.236  7.479   -0.736   1.00 148.53 ? 158 GLU A CB  1 
ATOM 1034  C CG  . GLU A 1 189 ? -59.501  6.163   -1.020   1.00 151.89 ? 158 GLU A CG  1 
ATOM 1035  C CD  . GLU A 1 189 ? -59.398  5.232   0.185    1.00 156.37 ? 158 GLU A CD  1 
ATOM 1036  O OE1 . GLU A 1 189 ? -59.976  5.540   1.250    1.00 157.97 ? 158 GLU A OE1 1 
ATOM 1037  O OE2 . GLU A 1 189 ? -58.733  4.178   0.055    1.00 158.51 ? 158 GLU A OE2 1 
ATOM 1038  N N   . ASP A 1 190 ? -58.368  9.327   -2.208   1.00 142.36 ? 159 ASP A N   1 
ATOM 1039  C CA  . ASP A 1 190 ? -57.333  9.369   -3.217   1.00 141.27 ? 159 ASP A CA  1 
ATOM 1040  C C   . ASP A 1 190 ? -56.545  10.661  -3.293   1.00 138.56 ? 159 ASP A C   1 
ATOM 1041  O O   . ASP A 1 190 ? -55.491  10.683  -3.918   1.00 138.13 ? 159 ASP A O   1 
ATOM 1042  C CB  . ASP A 1 190 ? -57.926  9.038   -4.591   1.00 141.51 ? 159 ASP A CB  1 
ATOM 1043  C CG  . ASP A 1 190 ? -58.194  7.539   -4.779   1.00 145.82 ? 159 ASP A CG  1 
ATOM 1044  O OD1 . ASP A 1 190 ? -58.211  6.785   -3.775   1.00 149.06 ? 159 ASP A OD1 1 
ATOM 1045  O OD2 . ASP A 1 190 ? -58.390  7.109   -5.946   1.00 148.03 ? 159 ASP A OD2 1 
ATOM 1046  N N   . THR A 1 191 ? -57.034  11.745  -2.701   1.00 137.20 ? 160 THR A N   1 
ATOM 1047  C CA  . THR A 1 191 ? -56.214  12.963  -2.688   1.00 135.22 ? 160 THR A CA  1 
ATOM 1048  C C   . THR A 1 191 ? -55.191  12.914  -1.552   1.00 136.22 ? 160 THR A C   1 
ATOM 1049  O O   . THR A 1 191 ? -54.036  13.305  -1.731   1.00 135.76 ? 160 THR A O   1 
ATOM 1050  C CB  . THR A 1 191 ? -57.016  14.302  -2.668   1.00 133.49 ? 160 THR A CB  1 
ATOM 1051  O OG1 . THR A 1 191 ? -58.106  14.205  -1.761   1.00 134.91 ? 160 THR A OG1 1 
ATOM 1052  C CG2 . THR A 1 191 ? -57.558  14.628  -4.023   1.00 131.69 ? 160 THR A CG2 1 
ATOM 1053  N N   . LYS A 1 192 ? -55.604  12.412  -0.393   1.00 137.97 ? 161 LYS A N   1 
ATOM 1054  C CA  . LYS A 1 192 ? -54.699  12.334  0.746    1.00 139.01 ? 161 LYS A CA  1 
ATOM 1055  C C   . LYS A 1 192 ? -53.408  11.612  0.355    1.00 139.31 ? 161 LYS A C   1 
ATOM 1056  O O   . LYS A 1 192 ? -52.330  12.177  0.479    1.00 138.74 ? 161 LYS A O   1 
ATOM 1057  C CB  . LYS A 1 192 ? -55.379  11.701  1.968    1.00 141.67 ? 161 LYS A CB  1 
ATOM 1058  C CG  . LYS A 1 192 ? -56.461  12.583  2.608    1.00 141.35 ? 161 LYS A CG  1 
ATOM 1059  C CD  . LYS A 1 192 ? -57.159  11.855  3.757    1.00 144.85 ? 161 LYS A CD  1 
ATOM 1060  C CE  . LYS A 1 192 ? -58.180  12.757  4.457    1.00 145.79 ? 161 LYS A CE  1 
ATOM 1061  N NZ  . LYS A 1 192 ? -59.043  12.044  5.458    1.00 148.61 ? 161 LYS A NZ  1 
ATOM 1062  N N   . LYS A 1 193 ? -53.514  10.397  -0.166   1.00 140.33 ? 162 LYS A N   1 
ATOM 1063  C CA  . LYS A 1 193 ? -52.331  9.713   -0.690   1.00 140.95 ? 162 LYS A CA  1 
ATOM 1064  C C   . LYS A 1 193 ? -51.414  10.637  -1.522   1.00 138.32 ? 162 LYS A C   1 
ATOM 1065  O O   . LYS A 1 193 ? -50.213  10.710  -1.286   1.00 138.76 ? 162 LYS A O   1 
ATOM 1066  C CB  . LYS A 1 193 ? -52.734  8.489   -1.520   1.00 142.62 ? 162 LYS A CB  1 
ATOM 1067  C CG  . LYS A 1 193 ? -53.307  7.343   -0.714   1.00 146.44 ? 162 LYS A CG  1 
ATOM 1068  C CD  . LYS A 1 193 ? -53.340  6.088   -1.553   1.00 149.85 ? 162 LYS A CD  1 
ATOM 1069  C CE  . LYS A 1 193 ? -53.524  4.850   -0.689   1.00 154.90 ? 162 LYS A CE  1 
ATOM 1070  N NZ  . LYS A 1 193 ? -53.451  3.584   -1.498   1.00 158.36 ? 162 LYS A NZ  1 
ATOM 1071  N N   . ILE A 1 194 ? -51.999  11.358  -2.471   1.00 135.75 ? 163 ILE A N   1 
ATOM 1072  C CA  . ILE A 1 194 ? -51.244  12.141  -3.450   1.00 133.60 ? 163 ILE A CA  1 
ATOM 1073  C C   . ILE A 1 194 ? -50.935  13.537  -2.906   1.00 131.59 ? 163 ILE A C   1 
ATOM 1074  O O   . ILE A 1 194 ? -51.116  14.523  -3.598   1.00 130.35 ? 163 ILE A O   1 
ATOM 1075  C CB  . ILE A 1 194 ? -52.022  12.196  -4.839   1.00 132.70 ? 163 ILE A CB  1 
ATOM 1076  C CG1 . ILE A 1 194 ? -52.267  10.765  -5.369   1.00 135.14 ? 163 ILE A CG1 1 
ATOM 1077  C CG2 . ILE A 1 194 ? -51.319  13.095  -5.876   1.00 131.49 ? 163 ILE A CG2 1 
ATOM 1078  C CD1 . ILE A 1 194 ? -52.165  10.549  -6.902   1.00 135.26 ? 163 ILE A CD1 1 
ATOM 1079  N N   . LEU A 1 195 ? -50.485  13.636  -1.665   1.00 131.53 ? 164 LEU A N   1 
ATOM 1080  C CA  . LEU A 1 195 ? -50.240  14.950  -1.078   1.00 129.91 ? 164 LEU A CA  1 
ATOM 1081  C C   . LEU A 1 195 ? -48.867  15.011  -0.467   1.00 131.08 ? 164 LEU A C   1 
ATOM 1082  O O   . LEU A 1 195 ? -48.287  16.093  -0.321   1.00 130.57 ? 164 LEU A O   1 
ATOM 1083  C CB  . LEU A 1 195 ? -51.260  15.264  0.004    1.00 129.82 ? 164 LEU A CB  1 
ATOM 1084  C CG  . LEU A 1 195 ? -52.616  15.840  -0.348   1.00 127.66 ? 164 LEU A CG  1 
ATOM 1085  C CD1 . LEU A 1 195 ? -53.456  15.887  0.899    1.00 128.07 ? 164 LEU A CD1 1 
ATOM 1086  C CD2 . LEU A 1 195 ? -52.464  17.220  -0.915   1.00 125.47 ? 164 LEU A CD2 1 
ATOM 1087  N N   . GLN A 1 196 ? -48.374  13.833  -0.084   1.00 132.86 ? 165 GLN A N   1 
ATOM 1088  C CA  . GLN A 1 196 ? -47.022  13.643  0.425    1.00 134.26 ? 165 GLN A CA  1 
ATOM 1089  C C   . GLN A 1 196 ? -45.998  14.347  -0.485   1.00 132.78 ? 165 GLN A C   1 
ATOM 1090  O O   . GLN A 1 196 ? -44.898  14.702  -0.051   1.00 134.04 ? 165 GLN A O   1 
ATOM 1091  C CB  . GLN A 1 196 ? -46.714  12.146  0.498    1.00 136.61 ? 165 GLN A CB  1 
ATOM 1092  C CG  . GLN A 1 196 ? -46.657  11.501  -0.897   1.00 138.59 ? 165 GLN A CG  1 
ATOM 1093  C CD  . GLN A 1 196 ? -46.471  9.988   -0.896   1.00 143.56 ? 165 GLN A CD  1 
ATOM 1094  O OE1 . GLN A 1 196 ? -46.665  9.319   0.130    1.00 146.39 ? 165 GLN A OE1 1 
ATOM 1095  N NE2 . GLN A 1 196 ? -46.109  9.437   -2.067   1.00 143.92 ? 165 GLN A NE2 1 
ATOM 1096  N N   . LYS A 1 197 ? -46.367  14.562  -1.744   1.00 130.20 ? 166 LYS A N   1 
ATOM 1097  C CA  . LYS A 1 197 ? -45.443  15.147  -2.687   1.00 128.66 ? 166 LYS A CA  1 
ATOM 1098  C C   . LYS A 1 197 ? -45.477  16.666  -2.657   1.00 126.54 ? 166 LYS A C   1 
ATOM 1099  O O   . LYS A 1 197 ? -44.922  17.316  -3.520   1.00 126.08 ? 166 LYS A O   1 
ATOM 1100  C CB  . LYS A 1 197 ? -45.693  14.596  -4.093   1.00 128.44 ? 166 LYS A CB  1 
ATOM 1101  C CG  . LYS A 1 197 ? -46.928  15.140  -4.806   1.00 126.74 ? 166 LYS A CG  1 
ATOM 1102  C CD  . LYS A 1 197 ? -46.890  14.717  -6.270   1.00 127.07 ? 166 LYS A CD  1 
ATOM 1103  C CE  . LYS A 1 197 ? -47.747  15.583  -7.178   1.00 124.67 ? 166 LYS A CE  1 
ATOM 1104  N NZ  . LYS A 1 197 ? -47.615  15.158  -8.607   1.00 124.77 ? 166 LYS A NZ  1 
ATOM 1105  N N   . TYR A 1 198 ? -46.114  17.245  -1.660   1.00 125.34 ? 167 TYR A N   1 
ATOM 1106  C CA  . TYR A 1 198 ? -46.109  18.677  -1.601   1.00 124.45 ? 167 TYR A CA  1 
ATOM 1107  C C   . TYR A 1 198 ? -45.520  19.221  -0.325   1.00 125.43 ? 167 TYR A C   1 
ATOM 1108  O O   . TYR A 1 198 ? -45.446  20.433  -0.167   1.00 125.26 ? 167 TYR A O   1 
ATOM 1109  C CB  . TYR A 1 198 ? -47.497  19.242  -1.803   1.00 123.48 ? 167 TYR A CB  1 
ATOM 1110  C CG  . TYR A 1 198 ? -48.158  18.859  -3.104   1.00 123.88 ? 167 TYR A CG  1 
ATOM 1111  C CD1 . TYR A 1 198 ? -47.814  19.474  -4.300   1.00 124.32 ? 167 TYR A CD1 1 
ATOM 1112  C CD2 . TYR A 1 198 ? -49.160  17.895  -3.127   1.00 125.52 ? 167 TYR A CD2 1 
ATOM 1113  C CE1 . TYR A 1 198 ? -48.437  19.115  -5.488   1.00 124.45 ? 167 TYR A CE1 1 
ATOM 1114  C CE2 . TYR A 1 198 ? -49.787  17.537  -4.300   1.00 125.15 ? 167 TYR A CE2 1 
ATOM 1115  C CZ  . TYR A 1 198 ? -49.426  18.142  -5.477   1.00 124.81 ? 167 TYR A CZ  1 
ATOM 1116  O OH  . TYR A 1 198 ? -50.077  17.751  -6.633   1.00 125.98 ? 167 TYR A OH  1 
ATOM 1117  N N   . ASN A 1 199 ? -45.092  18.348  0.587    1.00 126.81 ? 168 ASN A N   1 
ATOM 1118  C CA  . ASN A 1 199 ? -44.290  18.787  1.737    1.00 128.08 ? 168 ASN A CA  1 
ATOM 1119  C C   . ASN A 1 199 ? -43.140  19.543  1.169    1.00 128.51 ? 168 ASN A C   1 
ATOM 1120  O O   . ASN A 1 199 ? -42.793  19.347  0.014    1.00 128.47 ? 168 ASN A O   1 
ATOM 1121  C CB  . ASN A 1 199 ? -43.714  17.609  2.491    1.00 129.82 ? 168 ASN A CB  1 
ATOM 1122  C CG  . ASN A 1 199 ? -44.748  16.590  2.844    1.00 130.06 ? 168 ASN A CG  1 
ATOM 1123  O OD1 . ASN A 1 199 ? -45.938  16.786  2.611    1.00 129.42 ? 168 ASN A OD1 1 
ATOM 1124  N ND2 . ASN A 1 199 ? -44.308  15.482  3.412    1.00 132.27 ? 168 ASN A ND2 1 
ATOM 1125  N N   . HIS A 1 200 ? -42.512  20.392  1.955    1.00 129.71 ? 169 HIS A N   1 
ATOM 1126  C CA  . HIS A 1 200 ? -41.340  21.087  1.433    1.00 130.76 ? 169 HIS A CA  1 
ATOM 1127  C C   . HIS A 1 200 ? -41.738  21.904  0.190    1.00 129.14 ? 169 HIS A C   1 
ATOM 1128  O O   . HIS A 1 200 ? -40.885  22.354  -0.570   1.00 130.13 ? 169 HIS A O   1 
ATOM 1129  C CB  . HIS A 1 200 ? -40.178  20.098  1.135    1.00 132.12 ? 169 HIS A CB  1 
ATOM 1130  N N   . CYS A 1 201 ? -43.040  22.059  -0.028   1.00 127.13 ? 170 CYS A N   1 
ATOM 1131  C CA  . CYS A 1 201 ? -43.538  23.089  -0.915   1.00 126.09 ? 170 CYS A CA  1 
ATOM 1132  C C   . CYS A 1 201 ? -44.065  24.138  0.040    1.00 126.48 ? 170 CYS A C   1 
ATOM 1133  O O   . CYS A 1 201 ? -44.691  23.782  1.032    1.00 126.69 ? 170 CYS A O   1 
ATOM 1134  C CB  . CYS A 1 201 ? -44.677  22.563  -1.786   1.00 124.42 ? 170 CYS A CB  1 
ATOM 1135  S SG  . CYS A 1 201 ? -44.244  21.850  -3.402   1.00 124.15 ? 170 CYS A SG  1 
ATOM 1136  N N   . ARG A 1 202 ? -43.821  25.417  -0.234   1.00 127.08 ? 171 ARG A N   1 
ATOM 1137  C CA  . ARG A 1 202 ? -44.200  26.480  0.709    1.00 128.08 ? 171 ARG A CA  1 
ATOM 1138  C C   . ARG A 1 202 ? -45.712  26.788  0.722    1.00 126.57 ? 171 ARG A C   1 
ATOM 1139  O O   . ARG A 1 202 ? -46.135  27.922  0.463    1.00 127.28 ? 171 ARG A O   1 
ATOM 1140  C CB  . ARG A 1 202 ? -43.373  27.751  0.460    1.00 129.91 ? 171 ARG A CB  1 
ATOM 1141  C CG  . ARG A 1 202 ? -43.429  28.755  1.608    1.00 132.67 ? 171 ARG A CG  1 
ATOM 1142  C CD  . ARG A 1 202 ? -42.508  29.923  1.369    1.00 136.44 ? 171 ARG A CD  1 
ATOM 1143  N NE  . ARG A 1 202 ? -42.738  30.977  2.352    1.00 139.57 ? 171 ARG A NE  1 
ATOM 1144  C CZ  . ARG A 1 202 ? -41.911  31.998  2.571    1.00 143.16 ? 171 ARG A CZ  1 
ATOM 1145  N NH1 . ARG A 1 202 ? -40.774  32.112  1.884    1.00 144.30 ? 171 ARG A NH1 1 
ATOM 1146  N NH2 . ARG A 1 202 ? -42.224  32.907  3.488    1.00 145.31 ? 171 ARG A NH2 1 
ATOM 1147  N N   . VAL A 1 203 ? -46.522  25.775  1.034    1.00 124.91 ? 172 VAL A N   1 
ATOM 1148  C CA  . VAL A 1 203 ? -47.981  25.911  1.022    1.00 123.00 ? 172 VAL A CA  1 
ATOM 1149  C C   . VAL A 1 203 ? -48.643  24.983  2.039    1.00 122.57 ? 172 VAL A C   1 
ATOM 1150  O O   . VAL A 1 203 ? -48.419  23.767  2.021    1.00 122.11 ? 172 VAL A O   1 
ATOM 1151  C CB  . VAL A 1 203 ? -48.550  25.618  -0.376   1.00 121.40 ? 172 VAL A CB  1 
ATOM 1152  C CG1 . VAL A 1 203 ? -50.045  25.839  -0.392   1.00 120.91 ? 172 VAL A CG1 1 
ATOM 1153  C CG2 . VAL A 1 203 ? -47.876  26.499  -1.432   1.00 121.62 ? 172 VAL A CG2 1 
ATOM 1154  N N   . LYS A 1 204 ? -49.462  25.560  2.915    1.00 122.58 ? 173 LYS A N   1 
ATOM 1155  C CA  . LYS A 1 204 ? -50.145  24.778  3.943    1.00 122.95 ? 173 LYS A CA  1 
ATOM 1156  C C   . LYS A 1 204 ? -51.480  24.203  3.450    1.00 121.71 ? 173 LYS A C   1 
ATOM 1157  O O   . LYS A 1 204 ? -52.442  24.948  3.208    1.00 121.79 ? 173 LYS A O   1 
ATOM 1158  C CB  . LYS A 1 204 ? -50.357  25.621  5.192    1.00 124.65 ? 173 LYS A CB  1 
ATOM 1159  C CG  . LYS A 1 204 ? -49.139  26.387  5.617    1.00 126.52 ? 173 LYS A CG  1 
ATOM 1160  C CD  . LYS A 1 204 ? -49.090  26.463  7.124    1.00 130.33 ? 173 LYS A CD  1 
ATOM 1161  C CE  . LYS A 1 204 ? -47.771  27.046  7.626    1.00 132.65 ? 173 LYS A CE  1 
ATOM 1162  N NZ  . LYS A 1 204 ? -47.745  27.140  9.123    1.00 135.29 ? 173 LYS A NZ  1 
ATOM 1163  N N   . ILE A 1 205 ? -51.547  22.880  3.311    1.00 120.79 ? 174 ILE A N   1 
ATOM 1164  C CA  . ILE A 1 205 ? -52.696  22.252  2.662    1.00 119.38 ? 174 ILE A CA  1 
ATOM 1165  C C   . ILE A 1 205 ? -53.613  21.561  3.651    1.00 120.65 ? 174 ILE A C   1 
ATOM 1166  O O   . ILE A 1 205 ? -53.145  20.811  4.477    1.00 121.96 ? 174 ILE A O   1 
ATOM 1167  C CB  . ILE A 1 205 ? -52.221  21.270  1.585    1.00 118.17 ? 174 ILE A CB  1 
ATOM 1168  C CG1 . ILE A 1 205 ? -51.841  22.035  0.326    1.00 115.73 ? 174 ILE A CG1 1 
ATOM 1169  C CG2 . ILE A 1 205 ? -53.298  20.248  1.246    1.00 118.44 ? 174 ILE A CG2 1 
ATOM 1170  C CD1 . ILE A 1 205 ? -51.067  21.222  -0.651   1.00 113.53 ? 174 ILE A CD1 1 
ATOM 1171  N N   . TYR A 1 206 ? -54.916  21.808  3.566    1.00 120.89 ? 175 TYR A N   1 
ATOM 1172  C CA  . TYR A 1 206 ? -55.871  21.150  4.454    1.00 123.11 ? 175 TYR A CA  1 
ATOM 1173  C C   . TYR A 1 206 ? -57.037  20.573  3.664    1.00 123.03 ? 175 TYR A C   1 
ATOM 1174  O O   . TYR A 1 206 ? -57.525  21.199  2.725    1.00 122.09 ? 175 TYR A O   1 
ATOM 1175  C CB  . TYR A 1 206 ? -56.421  22.128  5.495    1.00 124.81 ? 175 TYR A CB  1 
ATOM 1176  C CG  . TYR A 1 206 ? -55.414  23.076  6.149    1.00 126.46 ? 175 TYR A CG  1 
ATOM 1177  C CD1 . TYR A 1 206 ? -54.970  22.864  7.468    1.00 128.97 ? 175 TYR A CD1 1 
ATOM 1178  C CD2 . TYR A 1 206 ? -54.937  24.206  5.467    1.00 125.63 ? 175 TYR A CD2 1 
ATOM 1179  C CE1 . TYR A 1 206 ? -54.061  23.737  8.075    1.00 129.76 ? 175 TYR A CE1 1 
ATOM 1180  C CE2 . TYR A 1 206 ? -54.031  25.079  6.067    1.00 126.90 ? 175 TYR A CE2 1 
ATOM 1181  C CZ  . TYR A 1 206 ? -53.596  24.839  7.364    1.00 129.04 ? 175 TYR A CZ  1 
ATOM 1182  O OH  . TYR A 1 206 ? -52.702  25.715  7.936    1.00 130.80 ? 175 TYR A OH  1 
ATOM 1183  N N   . THR A 1 207 ? -57.492  19.385  4.046    1.00 124.84 ? 176 THR A N   1 
ATOM 1184  C CA  . THR A 1 207 ? -58.644  18.760  3.386    1.00 125.46 ? 176 THR A CA  1 
ATOM 1185  C C   . THR A 1 207 ? -59.832  18.701  4.323    1.00 128.17 ? 176 THR A C   1 
ATOM 1186  O O   . THR A 1 207 ? -59.663  18.739  5.540    1.00 130.33 ? 176 THR A O   1 
ATOM 1187  C CB  . THR A 1 207 ? -58.356  17.309  2.927    1.00 125.49 ? 176 THR A CB  1 
ATOM 1188  O OG1 . THR A 1 207 ? -57.849  16.531  4.021    1.00 127.26 ? 176 THR A OG1 1 
ATOM 1189  C CG2 . THR A 1 207 ? -57.368  17.294  1.799    1.00 123.83 ? 176 THR A CG2 1 
ATOM 1190  N N   . PHE A 1 208 ? -61.034  18.600  3.766    1.00 128.88 ? 177 PHE A N   1 
ATOM 1191  C CA  . PHE A 1 208 ? -62.206  18.295  4.578    1.00 131.82 ? 177 PHE A CA  1 
ATOM 1192  C C   . PHE A 1 208 ? -63.342  17.698  3.768    1.00 133.05 ? 177 PHE A C   1 
ATOM 1193  O O   . PHE A 1 208 ? -63.457  17.934  2.563    1.00 131.15 ? 177 PHE A O   1 
ATOM 1194  C CB  . PHE A 1 208 ? -62.661  19.511  5.404    1.00 132.52 ? 177 PHE A CB  1 
ATOM 1195  C CG  . PHE A 1 208 ? -63.288  20.611  4.598    1.00 129.87 ? 177 PHE A CG  1 
ATOM 1196  C CD1 . PHE A 1 208 ? -64.634  20.901  4.745    1.00 129.52 ? 177 PHE A CD1 1 
ATOM 1197  C CD2 . PHE A 1 208 ? -62.530  21.370  3.711    1.00 126.12 ? 177 PHE A CD2 1 
ATOM 1198  C CE1 . PHE A 1 208 ? -65.214  21.911  4.013    1.00 127.93 ? 177 PHE A CE1 1 
ATOM 1199  C CE2 . PHE A 1 208 ? -63.110  22.387  2.973    1.00 123.95 ? 177 PHE A CE2 1 
ATOM 1200  C CZ  . PHE A 1 208 ? -64.448  22.656  3.124    1.00 125.10 ? 177 PHE A CZ  1 
ATOM 1201  N N   . ASN A 1 209 ? -64.175  16.921  4.453    1.00 136.99 ? 178 ASN A N   1 
ATOM 1202  C CA  . ASN A 1 209 ? -65.226  16.147  3.808    1.00 139.49 ? 178 ASN A CA  1 
ATOM 1203  C C   . ASN A 1 209 ? -66.621  16.740  3.807    1.00 141.69 ? 178 ASN A C   1 
ATOM 1204  O O   . ASN A 1 209 ? -67.149  17.149  4.853    1.00 144.05 ? 178 ASN A O   1 
ATOM 1205  C CB  . ASN A 1 209 ? -65.278  14.739  4.376    1.00 141.88 ? 178 ASN A CB  1 
ATOM 1206  C CG  . ASN A 1 209 ? -64.152  13.902  3.879    1.00 141.75 ? 178 ASN A CG  1 
ATOM 1207  O OD1 . ASN A 1 209 ? -62.977  14.256  4.060    1.00 141.57 ? 178 ASN A OD1 1 
ATOM 1208  N ND2 . ASN A 1 209 ? -64.483  12.793  3.218    1.00 142.93 ? 178 ASN A ND2 1 
ATOM 1209  N N   . GLN A 1 210 ? -67.202  16.760  2.606    1.00 141.66 ? 179 GLN A N   1 
ATOM 1210  C CA  . GLN A 1 210 ? -68.616  17.004  2.400    1.00 144.03 ? 179 GLN A CA  1 
ATOM 1211  C C   . GLN A 1 210 ? -69.412  15.907  3.072    1.00 147.39 ? 179 GLN A C   1 
ATOM 1212  O O   . GLN A 1 210 ? -68.882  14.843  3.402    1.00 148.51 ? 179 GLN A O   1 
ATOM 1213  C CB  . GLN A 1 210 ? -68.937  16.971  0.918    1.00 142.79 ? 179 GLN A CB  1 
ATOM 1214  C CG  . GLN A 1 210 ? -68.724  18.281  0.201    1.00 143.01 ? 179 GLN A CG  1 
ATOM 1215  C CD  . GLN A 1 210 ? -69.509  18.349  -1.112   1.00 146.00 ? 179 GLN A CD  1 
ATOM 1216  O OE1 . GLN A 1 210 ? -69.224  17.616  -2.068   1.00 145.70 ? 179 GLN A OE1 1 
ATOM 1217  N NE2 . GLN A 1 210 ? -70.511  19.231  -1.158   1.00 148.50 ? 179 GLN A NE2 1 
ATOM 1218  N N   . SER A 1 211 ? -70.697  16.163  3.257    1.00 149.63 ? 180 SER A N   1 
ATOM 1219  C CA  . SER A 1 211 ? -71.594  15.169  3.802    1.00 153.05 ? 180 SER A CA  1 
ATOM 1220  C C   . SER A 1 211 ? -71.759  13.980  2.864    1.00 153.01 ? 180 SER A C   1 
ATOM 1221  O O   . SER A 1 211 ? -71.245  13.962  1.742    1.00 150.58 ? 180 SER A O   1 
ATOM 1222  C CB  . SER A 1 211 ? -72.947  15.803  4.073    1.00 155.51 ? 180 SER A CB  1 
ATOM 1223  O OG  . SER A 1 211 ? -72.776  16.936  4.897    1.00 156.40 ? 180 SER A OG  1 
ATOM 1224  N N   . ARG A 1 212 ? -72.476  12.982  3.353    1.00 156.04 ? 181 ARG A N   1 
ATOM 1225  C CA  . ARG A 1 212 ? -72.794  11.809  2.576    1.00 156.72 ? 181 ARG A CA  1 
ATOM 1226  C C   . ARG A 1 212 ? -74.281  11.498  2.848    1.00 160.21 ? 181 ARG A C   1 
ATOM 1227  O O   . ARG A 1 212 ? -74.639  10.887  3.868    1.00 163.55 ? 181 ARG A O   1 
ATOM 1228  C CB  . ARG A 1 212 ? -71.843  10.667  2.961    1.00 157.52 ? 181 ARG A CB  1 
ATOM 1229  C CG  . ARG A 1 212 ? -71.649  9.572   1.917    1.00 157.71 ? 181 ARG A CG  1 
ATOM 1230  C CD  . ARG A 1 212 ? -70.750  8.479   2.479    1.00 159.74 ? 181 ARG A CD  1 
ATOM 1231  N NE  . ARG A 1 212 ? -71.171  7.137   2.074    1.00 163.11 ? 181 ARG A NE  1 
ATOM 1232  C CZ  . ARG A 1 212 ? -71.015  6.047   2.825    1.00 166.81 ? 181 ARG A CZ  1 
ATOM 1233  N NH1 . ARG A 1 212 ? -70.458  6.133   4.030    1.00 167.27 ? 181 ARG A NH1 1 
ATOM 1234  N NH2 . ARG A 1 212 ? -71.427  4.865   2.378    1.00 170.15 ? 181 ARG A NH2 1 
ATOM 1235  N N   . TYR A 1 213 ? -75.134  11.978  1.938    1.00 159.14 ? 182 TYR A N   1 
ATOM 1236  C CA  . TYR A 1 213 ? -76.594  11.855  2.035    1.00 161.80 ? 182 TYR A CA  1 
ATOM 1237  C C   . TYR A 1 213 ? -77.130  10.644  1.249    1.00 163.29 ? 182 TYR A C   1 
ATOM 1238  O O   . TYR A 1 213 ? -76.501  10.203  0.280    1.00 161.16 ? 182 TYR A O   1 
ATOM 1239  C CB  . TYR A 1 213 ? -77.277  13.146  1.549    1.00 160.64 ? 182 TYR A CB  1 
ATOM 1240  C CG  . TYR A 1 213 ? -77.111  14.372  2.438    1.00 159.61 ? 182 TYR A CG  1 
ATOM 1241  C CD1 . TYR A 1 213 ? -76.754  14.255  3.789    1.00 160.77 ? 182 TYR A CD1 1 
ATOM 1242  C CD2 . TYR A 1 213 ? -77.350  15.654  1.937    1.00 157.74 ? 182 TYR A CD2 1 
ATOM 1243  C CE1 . TYR A 1 213 ? -76.611  15.391  4.614    1.00 160.00 ? 182 TYR A CE1 1 
ATOM 1244  C CE2 . TYR A 1 213 ? -77.218  16.797  2.757    1.00 157.33 ? 182 TYR A CE2 1 
ATOM 1245  C CZ  . TYR A 1 213 ? -76.847  16.655  4.092    1.00 158.19 ? 182 TYR A CZ  1 
ATOM 1246  O OH  . TYR A 1 213 ? -76.709  17.766  4.898    1.00 157.06 ? 182 TYR A OH  1 
ATOM 1247  N N   . PRO A 1 214 ? -78.291  10.099  1.669    1.00 167.11 ? 183 PRO A N   1 
ATOM 1248  C CA  . PRO A 1 214 ? -78.886  8.946   0.991    1.00 169.18 ? 183 PRO A CA  1 
ATOM 1249  C C   . PRO A 1 214 ? -79.719  9.292   -0.244   1.00 168.43 ? 183 PRO A C   1 
ATOM 1250  O O   . PRO A 1 214 ? -80.368  10.340  -0.298   1.00 167.97 ? 183 PRO A O   1 
ATOM 1251  C CB  . PRO A 1 214 ? -79.784  8.343   2.067    1.00 174.36 ? 183 PRO A CB  1 
ATOM 1252  C CG  . PRO A 1 214 ? -80.187  9.498   2.901    1.00 174.68 ? 183 PRO A CG  1 
ATOM 1253  C CD  . PRO A 1 214 ? -79.029  10.448  2.900    1.00 170.28 ? 183 PRO A CD  1 
ATOM 1254  N N   . ARG A 1 215 ? -79.699  8.384   -1.214   1.00 168.36 ? 184 ARG A N   1 
ATOM 1255  C CA  . ARG A 1 215 ? -80.442  8.519   -2.458   1.00 168.14 ? 184 ARG A CA  1 
ATOM 1256  C C   . ARG A 1 215 ? -81.927  8.217   -2.238   1.00 173.43 ? 184 ARG A C   1 
ATOM 1257  O O   . ARG A 1 215 ? -82.274  7.136   -1.748   1.00 177.38 ? 184 ARG A O   1 
ATOM 1258  C CB  . ARG A 1 215 ? -79.892  7.527   -3.474   1.00 167.23 ? 184 ARG A CB  1 
ATOM 1259  C CG  . ARG A 1 215 ? -78.391  7.425   -3.533   1.00 161.66 ? 184 ARG A CG  1 
ATOM 1260  C CD  . ARG A 1 215 ? -77.847  8.194   -4.708   1.00 154.54 ? 184 ARG A CD  1 
ATOM 1261  N NE  . ARG A 1 215 ? -76.811  7.422   -5.379   1.00 150.70 ? 184 ARG A NE  1 
ATOM 1262  C CZ  . ARG A 1 215 ? -76.329  7.695   -6.583   1.00 146.78 ? 184 ARG A CZ  1 
ATOM 1263  N NH1 . ARG A 1 215 ? -76.785  8.730   -7.272   1.00 143.79 ? 184 ARG A NH1 1 
ATOM 1264  N NH2 . ARG A 1 215 ? -75.386  6.921   -7.096   1.00 146.14 ? 184 ARG A NH2 1 
ATOM 1265  N N   . ILE A 1 216 ? -82.797  9.156   -2.622   1.00 173.87 ? 185 ILE A N   1 
ATOM 1266  C CA  . ILE A 1 216 ? -84.252  9.050   -2.375   1.00 178.82 ? 185 ILE A CA  1 
ATOM 1267  C C   . ILE A 1 216 ? -85.099  8.820   -3.651   1.00 180.48 ? 185 ILE A C   1 
ATOM 1268  O O   . ILE A 1 216 ? -85.054  9.626   -4.578   1.00 177.88 ? 185 ILE A O   1 
ATOM 1269  C CB  . ILE A 1 216 ? -84.781  10.268  -1.524   1.00 179.30 ? 185 ILE A CB  1 
ATOM 1270  C CG1 . ILE A 1 216 ? -86.252  10.093  -1.138   1.00 185.03 ? 185 ILE A CG1 1 
ATOM 1271  C CG2 . ILE A 1 216 ? -84.558  11.610  -2.223   1.00 175.41 ? 185 ILE A CG2 1 
ATOM 1272  C CD1 . ILE A 1 216 ? -86.463  9.346   0.162    1.00 189.38 ? 185 ILE A CD1 1 
ATOM 1273  N N   . ASN A 1 217 ? -85.872  7.726   -3.670   1.00 185.16 ? 186 ASN A N   1 
ATOM 1274  C CA  . ASN A 1 217 ? -86.654  7.274   -4.850   1.00 187.42 ? 186 ASN A CA  1 
ATOM 1275  C C   . ASN A 1 217 ? -87.803  8.174   -5.323   1.00 188.97 ? 186 ASN A C   1 
ATOM 1276  O O   . ASN A 1 217 ? -88.628  8.621   -4.526   1.00 191.69 ? 186 ASN A O   1 
ATOM 1277  C CB  . ASN A 1 217 ? -87.207  5.865   -4.620   1.00 192.47 ? 186 ASN A CB  1 
ATOM 1278  C CG  . ASN A 1 217 ? -86.230  4.777   -5.008   1.00 191.47 ? 186 ASN A CG  1 
ATOM 1279  O OD1 . ASN A 1 217 ? -85.026  4.889   -4.775   1.00 187.67 ? 186 ASN A OD1 1 
ATOM 1280  N ND2 . ASN A 1 217 ? -86.750  3.707   -5.597   1.00 195.17 ? 186 ASN A ND2 1 
ATOM 1281  N N   . LYS A 1 218 ? -87.863  8.403   -6.635   1.00 187.62 ? 187 LYS A N   1 
ATOM 1282  C CA  . LYS A 1 218 ? -88.880  9.266   -7.235   1.00 189.06 ? 187 LYS A CA  1 
ATOM 1283  C C   . LYS A 1 218 ? -90.233  8.593   -7.195   1.00 195.18 ? 187 LYS A C   1 
ATOM 1284  O O   . LYS A 1 218 ? -91.259  9.257   -7.066   1.00 197.77 ? 187 LYS A O   1 
ATOM 1285  C CB  . LYS A 1 218 ? -88.523  9.611   -8.681   1.00 186.19 ? 187 LYS A CB  1 
ATOM 1286  N N   . GLU A 1 219 ? -90.222  7.269   -7.308   1.00 197.86 ? 188 GLU A N   1 
ATOM 1287  C CA  . GLU A 1 219 ? -91.448  6.478   -7.277   1.00 204.24 ? 188 GLU A CA  1 
ATOM 1288  C C   . GLU A 1 219 ? -91.725  5.884   -5.890   1.00 207.87 ? 188 GLU A C   1 
ATOM 1289  O O   . GLU A 1 219 ? -92.888  5.760   -5.480   1.00 213.02 ? 188 GLU A O   1 
ATOM 1290  C CB  . GLU A 1 219 ? -91.392  5.367   -8.332   1.00 205.77 ? 188 GLU A CB  1 
ATOM 1291  N N   . SER A 1 220 ? -90.654  5.532   -5.174   1.00 205.34 ? 189 SER A N   1 
ATOM 1292  C CA  . SER A 1 220 ? -90.763  4.858   -3.873   1.00 208.54 ? 189 SER A CA  1 
ATOM 1293  C C   . SER A 1 220 ? -90.706  5.836   -2.686   1.00 207.25 ? 189 SER A C   1 
ATOM 1294  O O   . SER A 1 220 ? -91.469  5.695   -1.721   1.00 211.71 ? 189 SER A O   1 
ATOM 1295  C CB  . SER A 1 220 ? -89.673  3.781   -3.733   1.00 207.46 ? 189 SER A CB  1 
ATOM 1296  O OG  . SER A 1 220 ? -89.314  3.224   -4.991   1.00 206.00 ? 189 SER A OG  1 
ATOM 1297  N N   . LEU A 1 221 ? -89.815  6.830   -2.786   1.00 201.17 ? 190 LEU A N   1 
ATOM 1298  C CA  . LEU A 1 221 ? -89.497  7.790   -1.706   1.00 198.83 ? 190 LEU A CA  1 
ATOM 1299  C C   . LEU A 1 221 ? -88.997  7.101   -0.430   1.00 200.11 ? 190 LEU A C   1 
ATOM 1300  O O   . LEU A 1 221 ? -89.370  7.466   0.693    1.00 202.27 ? 190 LEU A O   1 
ATOM 1301  C CB  . LEU A 1 221 ? -90.660  8.757   -1.430   1.00 201.37 ? 190 LEU A CB  1 
ATOM 1302  C CG  . LEU A 1 221 ? -90.272  10.160  -0.951   1.00 197.50 ? 190 LEU A CG  1 
ATOM 1303  C CD1 . LEU A 1 221 ? -89.773  11.019  -2.101   1.00 192.23 ? 190 LEU A CD1 1 
ATOM 1304  C CD2 . LEU A 1 221 ? -91.456  10.822  -0.294   1.00 201.71 ? 190 LEU A CD2 1 
ATOM 1305  N N   . LEU A 1 222 ? -88.125  6.113   -0.641   1.00 198.65 ? 191 LEU A N   1 
ATOM 1306  C CA  . LEU A 1 222 ? -87.588  5.251   0.409    1.00 200.12 ? 191 LEU A CA  1 
ATOM 1307  C C   . LEU A 1 222 ? -86.093  5.007   0.141    1.00 194.99 ? 191 LEU A C   1 
ATOM 1308  O O   . LEU A 1 222 ? -85.735  4.401   -0.874   1.00 193.85 ? 191 LEU A O   1 
ATOM 1309  C CB  . LEU A 1 222 ? -88.360  3.919   0.433    1.00 206.21 ? 191 LEU A CB  1 
ATOM 1310  C CG  . LEU A 1 222 ? -88.622  3.159   1.739    1.00 211.27 ? 191 LEU A CG  1 
ATOM 1311  C CD1 . LEU A 1 222 ? -89.641  3.889   2.608    1.00 214.67 ? 191 LEU A CD1 1 
ATOM 1312  C CD2 . LEU A 1 222 ? -89.113  1.747   1.437    1.00 216.16 ? 191 LEU A CD2 1 
ATOM 1313  N N   . PRO A 1 223 ? -85.216  5.494   1.042    1.00 192.01 ? 192 PRO A N   1 
ATOM 1314  C CA  . PRO A 1 223 ? -83.765  5.347   0.908    1.00 187.32 ? 192 PRO A CA  1 
ATOM 1315  C C   . PRO A 1 223 ? -83.296  3.914   1.124    1.00 189.61 ? 192 PRO A C   1 
ATOM 1316  O O   . PRO A 1 223 ? -83.910  3.178   1.896    1.00 194.72 ? 192 PRO A O   1 
ATOM 1317  C CB  . PRO A 1 223 ? -83.219  6.236   2.030    1.00 185.39 ? 192 PRO A CB  1 
ATOM 1318  C CG  . PRO A 1 223 ? -84.346  7.129   2.410    1.00 187.51 ? 192 PRO A CG  1 
ATOM 1319  C CD  . PRO A 1 223 ? -85.565  6.309   2.217    1.00 193.16 ? 192 PRO A CD  1 
ATOM 1320  N N   . VAL A 1 224 ? -82.207  3.537   0.458    1.00 186.03 ? 193 VAL A N   1 
ATOM 1321  C CA  . VAL A 1 224 ? -81.671  2.178   0.552    1.00 188.13 ? 193 VAL A CA  1 
ATOM 1322  C C   . VAL A 1 224 ? -81.003  1.936   1.916    1.00 189.15 ? 193 VAL A C   1 
ATOM 1323  O O   . VAL A 1 224 ? -79.785  1.776   2.030    1.00 186.26 ? 193 VAL A O   1 
ATOM 1324  C CB  . VAL A 1 224 ? -80.707  1.860   -0.616   1.00 184.50 ? 193 VAL A CB  1 
ATOM 1325  C CG1 . VAL A 1 224 ? -80.483  0.355   -0.733   1.00 188.00 ? 193 VAL A CG1 1 
ATOM 1326  C CG2 . VAL A 1 224 ? -81.256  2.411   -1.923   1.00 182.35 ? 193 VAL A CG2 1 
ATOM 1327  N N   . TRP A 1 238 ? -75.848  6.528   -2.246   1.00 262.90 ? 207 TRP A N   1 
ATOM 1328  C CA  . TRP A 1 238 ? -75.142  7.571   -1.484   1.00 272.61 ? 207 TRP A CA  1 
ATOM 1329  C C   . TRP A 1 238 ? -74.501  8.689   -2.312   1.00 276.25 ? 207 TRP A C   1 
ATOM 1330  O O   . TRP A 1 238 ? -73.753  8.428   -3.267   1.00 276.91 ? 207 TRP A O   1 
ATOM 1331  C CB  . TRP A 1 238 ? -74.094  6.927   -0.591   1.00 281.79 ? 207 TRP A CB  1 
ATOM 1332  C CG  . TRP A 1 238 ? -74.727  6.108   0.447    1.00 280.16 ? 207 TRP A CG  1 
ATOM 1333  C CD1 . TRP A 1 238 ? -74.901  4.754   0.432    1.00 275.02 ? 207 TRP A CD1 1 
ATOM 1334  C CD2 . TRP A 1 238 ? -75.329  6.585   1.655    1.00 284.79 ? 207 TRP A CD2 1 
ATOM 1335  N NE1 . TRP A 1 238 ? -75.553  4.355   1.575    1.00 275.07 ? 207 TRP A NE1 1 
ATOM 1336  C CE2 . TRP A 1 238 ? -75.828  5.459   2.342    1.00 281.25 ? 207 TRP A CE2 1 
ATOM 1337  C CE3 . TRP A 1 238 ? -75.481  7.857   2.232    1.00 292.81 ? 207 TRP A CE3 1 
ATOM 1338  C CZ2 . TRP A 1 238 ? -76.471  5.565   3.581    1.00 285.51 ? 207 TRP A CZ2 1 
ATOM 1339  C CZ3 . TRP A 1 238 ? -76.118  7.962   3.457    1.00 298.24 ? 207 TRP A CZ3 1 
ATOM 1340  C CH2 . TRP A 1 238 ? -76.604  6.823   4.119    1.00 294.87 ? 207 TRP A CH2 1 
ATOM 1341  N N   . TYR A 1 239 ? -74.773  9.933   -1.919   1.00 280.33 ? 208 TYR A N   1 
ATOM 1342  C CA  . TYR A 1 239 ? -74.374  11.080  -2.718   1.00 283.04 ? 208 TYR A CA  1 
ATOM 1343  C C   . TYR A 1 239 ? -73.909  12.266  -1.900   1.00 296.26 ? 208 TYR A C   1 
ATOM 1344  O O   . TYR A 1 239 ? -74.291  12.400  -0.745   1.00 302.36 ? 208 TYR A O   1 
ATOM 1345  C CB  . TYR A 1 239 ? -75.537  11.519  -3.592   1.00 273.10 ? 208 TYR A CB  1 
ATOM 1346  C CG  . TYR A 1 239 ? -76.593  12.328  -2.885   1.00 275.65 ? 208 TYR A CG  1 
ATOM 1347  C CD1 . TYR A 1 239 ? -76.503  13.718  -2.820   1.00 283.99 ? 208 TYR A CD1 1 
ATOM 1348  C CD2 . TYR A 1 239 ? -77.692  11.709  -2.305   1.00 273.29 ? 208 TYR A CD2 1 
ATOM 1349  C CE1 . TYR A 1 239 ? -77.475  14.470  -2.182   1.00 289.80 ? 208 TYR A CE1 1 
ATOM 1350  C CE2 . TYR A 1 239 ? -78.675  12.450  -1.668   1.00 279.30 ? 208 TYR A CE2 1 
ATOM 1351  C CZ  . TYR A 1 239 ? -78.562  13.830  -1.609   1.00 287.86 ? 208 TYR A CZ  1 
ATOM 1352  O OH  . TYR A 1 239 ? -79.539  14.565  -0.975   1.00 296.51 ? 208 TYR A OH  1 
ATOM 1353  N N   . PRO A 1 240 ? -73.100  13.148  -2.513   1.00 302.67 ? 209 PRO A N   1 
ATOM 1354  C CA  . PRO A 1 240 ? -72.595  14.374  -1.886   1.00 317.80 ? 209 PRO A CA  1 
ATOM 1355  C C   . PRO A 1 240 ? -73.301  15.671  -2.324   1.00 315.88 ? 209 PRO A C   1 
ATOM 1356  O O   . PRO A 1 240 ? -73.136  16.097  -3.474   1.00 310.57 ? 209 PRO A O   1 
ATOM 1357  C CB  . PRO A 1 240 ? -71.127  14.400  -2.316   1.00 328.61 ? 209 PRO A CB  1 
ATOM 1358  C CG  . PRO A 1 240 ? -71.044  13.456  -3.528   1.00 316.82 ? 209 PRO A CG  1 
ATOM 1359  C CD  . PRO A 1 240 ? -72.393  12.864  -3.772   1.00 299.69 ? 209 PRO A CD  1 
ATOM 1360  N N   . PRO A 1 241 ? -74.044  16.307  -1.388   1.00 322.12 ? 210 PRO A N   1 
ATOM 1361  C CA  . PRO A 1 241 ? -74.898  17.497  -1.505   1.00 323.60 ? 210 PRO A CA  1 
ATOM 1362  C C   . PRO A 1 241 ? -74.213  18.695  -2.140   1.00 330.80 ? 210 PRO A C   1 
ATOM 1363  O O   . PRO A 1 241 ? -73.897  19.694  -1.479   1.00 347.19 ? 210 PRO A O   1 
ATOM 1364  C CB  . PRO A 1 241 ? -75.269  17.807  -0.057   1.00 338.26 ? 210 PRO A CB  1 
ATOM 1365  C CG  . PRO A 1 241 ? -74.233  17.107  0.749    1.00 347.91 ? 210 PRO A CG  1 
ATOM 1366  C CD  . PRO A 1 241 ? -73.993  15.853  0.009    1.00 332.16 ? 210 PRO A CD  1 
ATOM 1367  N N   . GLY A 1 242 ? -74.005  18.563  -3.441   1.00 84.92  ? 211 GLY A N   1 
ATOM 1368  C CA  . GLY A 1 242 ? -73.494  19.626  -4.282   1.00 85.07  ? 211 GLY A CA  1 
ATOM 1369  C C   . GLY A 1 242 ? -72.265  20.253  -3.694   1.00 84.96  ? 211 GLY A C   1 
ATOM 1370  O O   . GLY A 1 242 ? -71.364  19.560  -3.237   1.00 85.05  ? 211 GLY A O   1 
ATOM 1371  N N   . HIS A 1 243 ? -72.248  21.574  -3.712   1.00 84.79  ? 212 HIS A N   1 
ATOM 1372  C CA  . HIS A 1 243 ? -71.138  22.326  -3.186   1.00 84.74  ? 212 HIS A CA  1 
ATOM 1373  C C   . HIS A 1 243 ? -71.671  23.356  -2.207   1.00 84.40  ? 212 HIS A C   1 
ATOM 1374  O O   . HIS A 1 243 ? -70.912  24.006  -1.497   1.00 84.33  ? 212 HIS A O   1 
ATOM 1375  C CB  . HIS A 1 243 ? -70.308  22.955  -4.318   1.00 84.96  ? 212 HIS A CB  1 
ATOM 1376  C CG  . HIS A 1 243 ? -71.126  23.612  -5.384   1.00 85.65  ? 212 HIS A CG  1 
ATOM 1377  N ND1 . HIS A 1 243 ? -71.390  24.964  -5.392   1.00 86.67  ? 212 HIS A ND1 1 
ATOM 1378  C CD2 . HIS A 1 243 ? -71.739  23.103  -6.478   1.00 86.78  ? 212 HIS A CD2 1 
ATOM 1379  C CE1 . HIS A 1 243 ? -72.134  25.260  -6.443   1.00 87.35  ? 212 HIS A CE1 1 
ATOM 1380  N NE2 . HIS A 1 243 ? -72.359  24.148  -7.121   1.00 87.40  ? 212 HIS A NE2 1 
ATOM 1381  N N   . GLY A 1 244 ? -72.992  23.481  -2.148   1.00 84.14  ? 213 GLY A N   1 
ATOM 1382  C CA  . GLY A 1 244 ? -73.626  24.332  -1.144   1.00 83.79  ? 213 GLY A CA  1 
ATOM 1383  C C   . GLY A 1 244 ? -73.363  23.822  0.262    1.00 83.39  ? 213 GLY A C   1 
ATOM 1384  O O   . GLY A 1 244 ? -73.599  24.523  1.252    1.00 83.39  ? 213 GLY A O   1 
ATOM 1385  N N   . ASP A 1 245 ? -72.853  22.596  0.342    1.00 82.91  ? 214 ASP A N   1 
ATOM 1386  C CA  . ASP A 1 245 ? -72.526  21.982  1.613    1.00 82.28  ? 214 ASP A CA  1 
ATOM 1387  C C   . ASP A 1 245 ? -71.319  22.634  2.269    1.00 81.88  ? 214 ASP A C   1 
ATOM 1388  O O   . ASP A 1 245 ? -71.041  22.390  3.442    1.00 81.89  ? 214 ASP A O   1 
ATOM 1389  C CB  . ASP A 1 245 ? -72.273  20.492  1.426    1.00 82.24  ? 214 ASP A CB  1 
ATOM 1390  C CG  . ASP A 1 245 ? -72.448  19.715  2.707    1.00 82.06  ? 214 ASP A CG  1 
ATOM 1391  O OD1 . ASP A 1 245 ? -73.231  20.166  3.575    1.00 82.10  ? 214 ASP A OD1 1 
ATOM 1392  O OD2 . ASP A 1 245 ? -71.807  18.652  2.843    1.00 82.10  ? 214 ASP A OD2 1 
ATOM 1393  N N   . ILE A 1 246 ? -70.617  23.470  1.508    1.00 81.33  ? 215 ILE A N   1 
ATOM 1394  C CA  . ILE A 1 246 ? -69.425  24.151  1.993    1.00 80.76  ? 215 ILE A CA  1 
ATOM 1395  C C   . ILE A 1 246 ? -69.592  24.602  3.427    1.00 80.91  ? 215 ILE A C   1 
ATOM 1396  O O   . ILE A 1 246 ? -68.844  24.173  4.300    1.00 80.88  ? 215 ILE A O   1 
ATOM 1397  C CB  . ILE A 1 246 ? -69.027  25.356  1.100    1.00 80.56  ? 215 ILE A CB  1 
ATOM 1398  C CG1 . ILE A 1 246 ? -67.796  26.064  1.674    1.00 79.59  ? 215 ILE A CG1 1 
ATOM 1399  C CG2 . ILE A 1 246 ? -70.199  26.324  0.913    1.00 80.29  ? 215 ILE A CG2 1 
ATOM 1400  C CD1 . ILE A 1 246 ? -66.771  26.476  0.635    1.00 78.03  ? 215 ILE A CD1 1 
ATOM 1401  N N   . TYR A 1 247 ? -70.616  25.418  3.659    1.00 81.05  ? 216 TYR A N   1 
ATOM 1402  C CA  . TYR A 1 247 ? -70.778  26.163  4.909    1.00 81.16  ? 216 TYR A CA  1 
ATOM 1403  C C   . TYR A 1 247 ? -70.943  25.312  6.186    1.00 81.02  ? 216 TYR A C   1 
ATOM 1404  O O   . TYR A 1 247 ? -70.274  25.561  7.204    1.00 80.85  ? 216 TYR A O   1 
ATOM 1405  C CB  . TYR A 1 247 ? -71.930  27.170  4.761    1.00 81.21  ? 216 TYR A CB  1 
ATOM 1406  C CG  . TYR A 1 247 ? -71.789  28.109  3.575    1.00 81.15  ? 216 TYR A CG  1 
ATOM 1407  C CD1 . TYR A 1 247 ? -70.671  28.942  3.440    1.00 81.04  ? 216 TYR A CD1 1 
ATOM 1408  C CD2 . TYR A 1 247 ? -72.782  28.178  2.599    1.00 81.30  ? 216 TYR A CD2 1 
ATOM 1409  C CE1 . TYR A 1 247 ? -70.542  29.813  2.352    1.00 81.25  ? 216 TYR A CE1 1 
ATOM 1410  C CE2 . TYR A 1 247 ? -72.666  29.047  1.508    1.00 81.64  ? 216 TYR A CE2 1 
ATOM 1411  C CZ  . TYR A 1 247 ? -71.543  29.858  1.390    1.00 81.68  ? 216 TYR A CZ  1 
ATOM 1412  O OH  . TYR A 1 247 ? -71.429  30.712  0.313    1.00 81.71  ? 216 TYR A OH  1 
ATOM 1413  N N   . ALA A 1 248 ? -71.825  24.312  6.111    1.00 80.74  ? 217 ALA A N   1 
ATOM 1414  C CA  . ALA A 1 248 ? -72.132  23.433  7.241    1.00 80.29  ? 217 ALA A CA  1 
ATOM 1415  C C   . ALA A 1 248 ? -70.962  22.506  7.597    1.00 79.88  ? 217 ALA A C   1 
ATOM 1416  O O   . ALA A 1 248 ? -70.662  22.290  8.773    1.00 79.70  ? 217 ALA A O   1 
ATOM 1417  C CB  . ALA A 1 248 ? -73.408  22.628  6.950    1.00 80.33  ? 217 ALA A CB  1 
ATOM 1418  N N   . SER A 1 249 ? -70.302  21.979  6.572    1.00 141.97 ? 218 SER A N   1 
ATOM 1419  C CA  . SER A 1 249 ? -69.207  21.038  6.753    1.00 139.75 ? 218 SER A CA  1 
ATOM 1420  C C   . SER A 1 249 ? -67.848  21.743  6.915    1.00 138.16 ? 218 SER A C   1 
ATOM 1421  O O   . SER A 1 249 ? -66.838  21.109  7.249    1.00 137.25 ? 218 SER A O   1 
ATOM 1422  C CB  . SER A 1 249 ? -69.187  20.037  5.595    1.00 137.94 ? 218 SER A CB  1 
ATOM 1423  O OG  . SER A 1 249 ? -69.316  20.705  4.351    1.00 137.07 ? 218 SER A OG  1 
ATOM 1424  N N   . PHE A 1 250 ? -67.830  23.054  6.683    1.00 137.99 ? 219 PHE A N   1 
ATOM 1425  C CA  . PHE A 1 250 ? -66.633  23.863  6.876    1.00 136.84 ? 219 PHE A CA  1 
ATOM 1426  C C   . PHE A 1 250 ? -66.575  24.310  8.318    1.00 139.73 ? 219 PHE A C   1 
ATOM 1427  O O   . PHE A 1 250 ? -65.516  24.324  8.937    1.00 140.05 ? 219 PHE A O   1 
ATOM 1428  C CB  . PHE A 1 250 ? -66.702  25.089  5.992    1.00 136.06 ? 219 PHE A CB  1 
ATOM 1429  C CG  . PHE A 1 250 ? -65.425  25.827  5.883    1.00 133.78 ? 219 PHE A CG  1 
ATOM 1430  C CD1 . PHE A 1 250 ? -64.356  25.284  5.205    1.00 131.39 ? 219 PHE A CD1 1 
ATOM 1431  C CD2 . PHE A 1 250 ? -65.295  27.086  6.420    1.00 135.13 ? 219 PHE A CD2 1 
ATOM 1432  C CE1 . PHE A 1 250 ? -63.162  25.976  5.071    1.00 130.40 ? 219 PHE A CE1 1 
ATOM 1433  C CE2 . PHE A 1 250 ? -64.105  27.785  6.291    1.00 134.64 ? 219 PHE A CE2 1 
ATOM 1434  C CZ  . PHE A 1 250 ? -63.035  27.224  5.615    1.00 131.63 ? 219 PHE A CZ  1 
ATOM 1435  N N   . TYR A 1 251 ? -67.738  24.691  8.834    1.00 142.46 ? 220 TYR A N   1 
ATOM 1436  C CA  . TYR A 1 251 ? -67.920  25.083  10.216   1.00 145.73 ? 220 TYR A CA  1 
ATOM 1437  C C   . TYR A 1 251 ? -67.714  23.847  11.081   1.00 145.86 ? 220 TYR A C   1 
ATOM 1438  O O   . TYR A 1 251 ? -66.981  23.893  12.062   1.00 147.00 ? 220 TYR A O   1 
ATOM 1439  C CB  . TYR A 1 251 ? -69.333  25.649  10.340   1.00 148.99 ? 220 TYR A CB  1 
ATOM 1440  C CG  . TYR A 1 251 ? -69.852  26.004  11.716   1.00 154.49 ? 220 TYR A CG  1 
ATOM 1441  C CD1 . TYR A 1 251 ? -69.540  27.231  12.317   1.00 157.63 ? 220 TYR A CD1 1 
ATOM 1442  C CD2 . TYR A 1 251 ? -70.729  25.142  12.384   1.00 157.78 ? 220 TYR A CD2 1 
ATOM 1443  C CE1 . TYR A 1 251 ? -70.049  27.567  13.568   1.00 163.30 ? 220 TYR A CE1 1 
ATOM 1444  C CE2 . TYR A 1 251 ? -71.247  25.464  13.628   1.00 163.06 ? 220 TYR A CE2 1 
ATOM 1445  C CZ  . TYR A 1 251 ? -70.907  26.674  14.217   1.00 166.21 ? 220 TYR A CZ  1 
ATOM 1446  O OH  . TYR A 1 251 ? -71.436  26.975  15.455   1.00 172.46 ? 220 TYR A OH  1 
ATOM 1447  N N   . ASN A 1 252 ? -68.327  22.739  10.672   1.00 144.85 ? 221 ASN A N   1 
ATOM 1448  C CA  . ASN A 1 252 ? -68.249  21.469  11.399   1.00 145.49 ? 221 ASN A CA  1 
ATOM 1449  C C   . ASN A 1 252 ? -66.877  20.790  11.423   1.00 143.40 ? 221 ASN A C   1 
ATOM 1450  O O   . ASN A 1 252 ? -66.594  20.009  12.334   1.00 144.97 ? 221 ASN A O   1 
ATOM 1451  C CB  . ASN A 1 252 ? -69.300  20.481  10.875   1.00 145.57 ? 221 ASN A CB  1 
ATOM 1452  C CG  . ASN A 1 252 ? -70.644  20.618  11.578   1.00 149.57 ? 221 ASN A CG  1 
ATOM 1453  O OD1 . ASN A 1 252 ? -70.832  21.486  12.437   1.00 152.99 ? 221 ASN A OD1 1 
ATOM 1454  N ND2 . ASN A 1 252 ? -71.583  19.750  11.220   1.00 150.36 ? 221 ASN A ND2 1 
ATOM 1455  N N   . SER A 1 253 ? -66.040  21.070  10.425   1.00 140.25 ? 222 SER A N   1 
ATOM 1456  C CA  . SER A 1 253 ? -64.687  20.512  10.372   1.00 138.50 ? 222 SER A CA  1 
ATOM 1457  C C   . SER A 1 253 ? -63.851  21.039  11.524   1.00 140.22 ? 222 SER A C   1 
ATOM 1458  O O   . SER A 1 253 ? -63.155  20.282  12.204   1.00 141.33 ? 222 SER A O   1 
ATOM 1459  C CB  . SER A 1 253 ? -63.995  20.896  9.071    1.00 135.80 ? 222 SER A CB  1 
ATOM 1460  O OG  . SER A 1 253 ? -63.305  22.123  9.229    1.00 135.75 ? 222 SER A OG  1 
ATOM 1461  N N   . GLY A 1 254 ? -63.927  22.349  11.729   1.00 140.81 ? 223 GLY A N   1 
ATOM 1462  C CA  . GLY A 1 254 ? -63.152  23.021  12.762   1.00 142.68 ? 223 GLY A CA  1 
ATOM 1463  C C   . GLY A 1 254 ? -62.206  24.016  12.137   1.00 140.90 ? 223 GLY A C   1 
ATOM 1464  O O   . GLY A 1 254 ? -61.589  24.814  12.841   1.00 142.96 ? 223 GLY A O   1 
ATOM 1465  N N   . LEU A 1 255 ? -62.104  23.958  10.809   1.00 137.32 ? 224 LEU A N   1 
ATOM 1466  C CA  . LEU A 1 255 ? -61.193  24.802  10.045   1.00 135.55 ? 224 LEU A CA  1 
ATOM 1467  C C   . LEU A 1 255 ? -61.656  26.250  10.015   1.00 136.75 ? 224 LEU A C   1 
ATOM 1468  O O   . LEU A 1 255 ? -60.844  27.162  9.887    1.00 136.94 ? 224 LEU A O   1 
ATOM 1469  C CB  . LEU A 1 255 ? -61.042  24.276  8.617    1.00 132.18 ? 224 LEU A CB  1 
ATOM 1470  C CG  . LEU A 1 255 ? -60.363  22.921  8.414    1.00 130.74 ? 224 LEU A CG  1 
ATOM 1471  C CD1 . LEU A 1 255 ? -60.789  22.308  7.098    1.00 128.44 ? 224 LEU A CD1 1 
ATOM 1472  C CD2 . LEU A 1 255 ? -58.853  23.044  8.473    1.00 130.61 ? 224 LEU A CD2 1 
ATOM 1473  N N   . LEU A 1 256 ? -62.965  26.457  10.134   1.00 137.93 ? 225 LEU A N   1 
ATOM 1474  C CA  . LEU A 1 256 ? -63.526  27.795  10.109   1.00 139.63 ? 225 LEU A CA  1 
ATOM 1475  C C   . LEU A 1 256 ? -62.914  28.605  11.233   1.00 142.91 ? 225 LEU A C   1 
ATOM 1476  O O   . LEU A 1 256 ? -62.242  29.608  10.978   1.00 143.34 ? 225 LEU A O   1 
ATOM 1477  C CB  . LEU A 1 256 ? -65.045  27.748  10.237   1.00 141.01 ? 225 LEU A CB  1 
ATOM 1478  C CG  . LEU A 1 256 ? -65.757  29.099  10.275   1.00 143.52 ? 225 LEU A CG  1 
ATOM 1479  C CD1 . LEU A 1 256 ? -65.573  29.904  8.995    1.00 140.85 ? 225 LEU A CD1 1 
ATOM 1480  C CD2 . LEU A 1 256 ? -67.222  28.864  10.545   1.00 146.36 ? 225 LEU A CD2 1 
ATOM 1481  N N   . ASP A 1 257 ? -63.124  28.129  12.465   1.00 145.67 ? 226 ASP A N   1 
ATOM 1482  C CA  . ASP A 1 257 ? -62.613  28.753  13.699   1.00 149.50 ? 226 ASP A CA  1 
ATOM 1483  C C   . ASP A 1 257 ? -61.073  28.840  13.754   1.00 148.80 ? 226 ASP A C   1 
ATOM 1484  O O   . ASP A 1 257 ? -60.530  29.645  14.507   1.00 151.84 ? 226 ASP A O   1 
ATOM 1485  C CB  . ASP A 1 257 ? -63.153  28.025  14.959   1.00 152.73 ? 226 ASP A CB  1 
ATOM 1486  C CG  . ASP A 1 257 ? -64.662  28.283  15.225   1.00 155.41 ? 226 ASP A CG  1 
ATOM 1487  O OD1 . ASP A 1 257 ? -65.521  27.559  14.669   1.00 153.98 ? 226 ASP A OD1 1 
ATOM 1488  O OD2 . ASP A 1 257 ? -64.992  29.184  16.032   1.00 159.91 ? 226 ASP A OD2 1 
ATOM 1489  N N   . THR A 1 258 ? -60.384  28.017  12.962   1.00 145.26 ? 227 THR A N   1 
ATOM 1490  C CA  . THR A 1 258 ? -58.919  28.024  12.893   1.00 144.78 ? 227 THR A CA  1 
ATOM 1491  C C   . THR A 1 258 ? -58.387  29.247  12.172   1.00 144.29 ? 227 THR A C   1 
ATOM 1492  O O   . THR A 1 258 ? -57.416  29.857  12.610   1.00 146.16 ? 227 THR A O   1 
ATOM 1493  C CB  . THR A 1 258 ? -58.367  26.803  12.134   1.00 141.61 ? 227 THR A CB  1 
ATOM 1494  O OG1 . THR A 1 258 ? -58.923  25.600  12.670   1.00 142.23 ? 227 THR A OG1 1 
ATOM 1495  C CG2 . THR A 1 258 ? -56.854  26.740  12.243   1.00 142.04 ? 227 THR A CG2 1 
ATOM 1496  N N   . PHE A 1 259 ? -59.012  29.586  11.050   1.00 142.18 ? 228 PHE A N   1 
ATOM 1497  C CA  . PHE A 1 259 ? -58.465  30.611  10.163   1.00 141.60 ? 228 PHE A CA  1 
ATOM 1498  C C   . PHE A 1 259 ? -58.778  32.006  10.634   1.00 144.53 ? 228 PHE A C   1 
ATOM 1499  O O   . PHE A 1 259 ? -57.885  32.852  10.685   1.00 145.92 ? 228 PHE A O   1 
ATOM 1500  C CB  . PHE A 1 259 ? -58.879  30.405  8.696    1.00 138.43 ? 228 PHE A CB  1 
ATOM 1501  C CG  . PHE A 1 259 ? -58.245  29.198  8.060    1.00 136.18 ? 228 PHE A CG  1 
ATOM 1502  C CD1 . PHE A 1 259 ? -56.864  29.124  7.908    1.00 136.16 ? 228 PHE A CD1 1 
ATOM 1503  C CD2 . PHE A 1 259 ? -59.029  28.129  7.635    1.00 134.80 ? 228 PHE A CD2 1 
ATOM 1504  C CE1 . PHE A 1 259 ? -56.275  28.005  7.350    1.00 135.00 ? 228 PHE A CE1 1 
ATOM 1505  C CE2 . PHE A 1 259 ? -58.454  27.009  7.070    1.00 133.35 ? 228 PHE A CE2 1 
ATOM 1506  C CZ  . PHE A 1 259 ? -57.072  26.944  6.927    1.00 133.77 ? 228 PHE A CZ  1 
ATOM 1507  N N   . ILE A 1 260 ? -60.031  32.260  10.991   1.00 145.99 ? 229 ILE A N   1 
ATOM 1508  C CA  . ILE A 1 260 ? -60.329  33.538  11.615   1.00 149.76 ? 229 ILE A CA  1 
ATOM 1509  C C   . ILE A 1 260 ? -59.404  33.625  12.818   1.00 152.67 ? 229 ILE A C   1 
ATOM 1510  O O   . ILE A 1 260 ? -58.803  34.670  13.074   1.00 155.26 ? 229 ILE A O   1 
ATOM 1511  C CB  . ILE A 1 260 ? -61.833  33.724  11.974   1.00 151.86 ? 229 ILE A CB  1 
ATOM 1512  C CG1 . ILE A 1 260 ? -62.044  34.973  12.851   1.00 157.03 ? 229 ILE A CG1 1 
ATOM 1513  C CG2 . ILE A 1 260 ? -62.408  32.473  12.634   1.00 151.81 ? 229 ILE A CG2 1 
ATOM 1514  C CD1 . ILE A 1 260 ? -61.599  36.300  12.227   1.00 157.41 ? 229 ILE A CD1 1 
ATOM 1515  N N   . GLY A 1 261 ? -59.239  32.484  13.484   1.00 152.32 ? 230 GLY A N   1 
ATOM 1516  C CA  . GLY A 1 261 ? -58.365  32.346  14.637   1.00 155.24 ? 230 GLY A CA  1 
ATOM 1517  C C   . GLY A 1 261 ? -56.880  32.604  14.434   1.00 155.00 ? 230 GLY A C   1 
ATOM 1518  O O   . GLY A 1 261 ? -56.170  32.824  15.413   1.00 158.67 ? 230 GLY A O   1 
ATOM 1519  N N   . GLU A 1 262 ? -56.389  32.570  13.195   1.00 151.21 ? 231 GLU A N   1 
ATOM 1520  C CA  . GLU A 1 262 ? -54.979  32.923  12.950   1.00 151.44 ? 231 GLU A CA  1 
ATOM 1521  C C   . GLU A 1 262 ? -54.779  34.221  12.160   1.00 151.00 ? 231 GLU A C   1 
ATOM 1522  O O   . GLU A 1 262 ? -53.685  34.501  11.669   1.00 150.41 ? 231 GLU A O   1 
ATOM 1523  C CB  . GLU A 1 262 ? -54.137  31.744  12.398   1.00 148.88 ? 231 GLU A CB  1 
ATOM 1524  C CG  . GLU A 1 262 ? -54.601  31.091  11.090   1.00 145.56 ? 231 GLU A CG  1 
ATOM 1525  C CD  . GLU A 1 262 ? -53.489  30.298  10.367   1.00 145.18 ? 231 GLU A CD  1 
ATOM 1526  O OE1 . GLU A 1 262 ? -52.646  29.655  11.039   1.00 147.14 ? 231 GLU A OE1 1 
ATOM 1527  O OE2 . GLU A 1 262 ? -53.466  30.310  9.110    1.00 143.48 ? 231 GLU A OE2 1 
ATOM 1528  N N   . GLY A 1 263 ? -55.841  35.014  12.061   1.00 151.60 ? 232 GLY A N   1 
ATOM 1529  C CA  . GLY A 1 263 ? -55.719  36.373  11.557   1.00 153.08 ? 232 GLY A CA  1 
ATOM 1530  C C   . GLY A 1 263 ? -56.459  36.656  10.275   1.00 150.36 ? 232 GLY A C   1 
ATOM 1531  O O   . GLY A 1 263 ? -56.657  37.819  9.909    1.00 151.91 ? 232 GLY A O   1 
ATOM 1532  N N   . LYS A 1 264 ? -56.864  35.587  9.593    1.00 146.81 ? 233 LYS A N   1 
ATOM 1533  C CA  . LYS A 1 264 ? -57.616  35.674  8.336    1.00 144.20 ? 233 LYS A CA  1 
ATOM 1534  C C   . LYS A 1 264 ? -59.012  36.294  8.549    1.00 146.55 ? 233 LYS A C   1 
ATOM 1535  O O   . LYS A 1 264 ? -59.443  36.513  9.700    1.00 149.94 ? 233 LYS A O   1 
ATOM 1536  C CB  . LYS A 1 264 ? -57.746  34.280  7.697    1.00 140.10 ? 233 LYS A CB  1 
ATOM 1537  C CG  . LYS A 1 264 ? -56.464  33.451  7.659    1.00 137.99 ? 233 LYS A CG  1 
ATOM 1538  C CD  . LYS A 1 264 ? -55.439  34.072  6.733    1.00 136.73 ? 233 LYS A CD  1 
ATOM 1539  C CE  . LYS A 1 264 ? -54.115  33.342  6.779    1.00 136.00 ? 233 LYS A CE  1 
ATOM 1540  N NZ  . LYS A 1 264 ? -53.192  33.851  5.721    1.00 135.48 ? 233 LYS A NZ  1 
ATOM 1541  N N   . GLU A 1 265 ? -59.695  36.596  7.442    1.00 145.10 ? 234 GLU A N   1 
ATOM 1542  C CA  . GLU A 1 265 ? -61.098  37.033  7.470    1.00 146.97 ? 234 GLU A CA  1 
ATOM 1543  C C   . GLU A 1 265 ? -61.833  36.735  6.156    1.00 143.94 ? 234 GLU A C   1 
ATOM 1544  O O   . GLU A 1 265 ? -63.063  36.758  6.117    1.00 145.16 ? 234 GLU A O   1 
ATOM 1545  C CB  . GLU A 1 265 ? -61.245  38.513  7.899    1.00 151.66 ? 234 GLU A CB  1 
ATOM 1546  C CG  . GLU A 1 265 ? -60.266  39.527  7.250    1.00 153.39 ? 234 GLU A CG  1 
ATOM 1547  C CD  . GLU A 1 265 ? -60.336  40.939  7.878    1.00 160.06 ? 234 GLU A CD  1 
ATOM 1548  O OE1 . GLU A 1 265 ? -59.841  41.111  9.017    1.00 163.21 ? 234 GLU A OE1 1 
ATOM 1549  O OE2 . GLU A 1 265 ? -60.871  41.881  7.233    1.00 162.37 ? 234 GLU A OE2 1 
ATOM 1550  N N   . TYR A 1 266 ? -61.075  36.426  5.101    1.00 140.32 ? 235 TYR A N   1 
ATOM 1551  C CA  . TYR A 1 266 ? -61.641  36.160  3.768    1.00 137.68 ? 235 TYR A CA  1 
ATOM 1552  C C   . TYR A 1 266 ? -61.291  34.826  3.120    1.00 133.20 ? 235 TYR A C   1 
ATOM 1553  O O   . TYR A 1 266 ? -60.126  34.437  3.047    1.00 131.58 ? 235 TYR A O   1 
ATOM 1554  C CB  . TYR A 1 266 ? -61.268  37.265  2.795    1.00 138.58 ? 235 TYR A CB  1 
ATOM 1555  C CG  . TYR A 1 266 ? -62.170  38.457  2.896    1.00 143.64 ? 235 TYR A CG  1 
ATOM 1556  C CD1 . TYR A 1 266 ? -63.398  38.489  2.227    1.00 145.04 ? 235 TYR A CD1 1 
ATOM 1557  C CD2 . TYR A 1 266 ? -61.803  39.557  3.664    1.00 148.22 ? 235 TYR A CD2 1 
ATOM 1558  C CE1 . TYR A 1 266 ? -64.232  39.581  2.324    1.00 149.20 ? 235 TYR A CE1 1 
ATOM 1559  C CE2 . TYR A 1 266 ? -62.631  40.661  3.762    1.00 152.81 ? 235 TYR A CE2 1 
ATOM 1560  C CZ  . TYR A 1 266 ? -63.838  40.666  3.087    1.00 153.13 ? 235 TYR A CZ  1 
ATOM 1561  O OH  . TYR A 1 266 ? -64.640  41.768  3.183    1.00 158.07 ? 235 TYR A OH  1 
ATOM 1562  N N   . ILE A 1 267 ? -62.320  34.155  2.615    1.00 131.31 ? 236 ILE A N   1 
ATOM 1563  C CA  . ILE A 1 267 ? -62.164  32.888  1.912    1.00 127.40 ? 236 ILE A CA  1 
ATOM 1564  C C   . ILE A 1 267 ? -62.209  33.215  0.426    1.00 126.29 ? 236 ILE A C   1 
ATOM 1565  O O   . ILE A 1 267 ? -62.758  34.243  0.070    1.00 128.36 ? 236 ILE A O   1 
ATOM 1566  C CB  . ILE A 1 267 ? -63.286  31.909  2.336    1.00 127.12 ? 236 ILE A CB  1 
ATOM 1567  C CG1 . ILE A 1 267 ? -62.701  30.578  2.761    1.00 125.11 ? 236 ILE A CG1 1 
ATOM 1568  C CG2 . ILE A 1 267 ? -64.314  31.719  1.273    1.00 126.27 ? 236 ILE A CG2 1 
ATOM 1569  C CD1 . ILE A 1 267 ? -62.227  30.555  4.182    1.00 126.11 ? 236 ILE A CD1 1 
ATOM 1570  N N   . PHE A 1 268 ? -61.601  32.402  -0.435   1.00 123.55 ? 237 PHE A N   1 
ATOM 1571  C CA  . PHE A 1 268 ? -61.737  32.611  -1.880   1.00 122.81 ? 237 PHE A CA  1 
ATOM 1572  C C   . PHE A 1 268 ? -62.056  31.318  -2.576   1.00 121.43 ? 237 PHE A C   1 
ATOM 1573  O O   . PHE A 1 268 ? -61.165  30.616  -3.054   1.00 119.77 ? 237 PHE A O   1 
ATOM 1574  C CB  . PHE A 1 268 ? -60.503  33.269  -2.501   1.00 122.37 ? 237 PHE A CB  1 
ATOM 1575  C CG  . PHE A 1 268 ? -60.430  33.147  -4.016   1.00 121.09 ? 237 PHE A CG  1 
ATOM 1576  C CD1 . PHE A 1 268 ? -61.541  33.368  -4.808   1.00 121.46 ? 237 PHE A CD1 1 
ATOM 1577  C CD2 . PHE A 1 268 ? -59.235  32.824  -4.643   1.00 119.20 ? 237 PHE A CD2 1 
ATOM 1578  C CE1 . PHE A 1 268 ? -61.456  33.258  -6.179   1.00 120.63 ? 237 PHE A CE1 1 
ATOM 1579  C CE2 . PHE A 1 268 ? -59.148  32.725  -6.013   1.00 117.78 ? 237 PHE A CE2 1 
ATOM 1580  C CZ  . PHE A 1 268 ? -60.257  32.938  -6.779   1.00 118.94 ? 237 PHE A CZ  1 
ATOM 1581  N N   . VAL A 1 269 ? -63.344  31.017  -2.637   1.00 122.70 ? 238 VAL A N   1 
ATOM 1582  C CA  . VAL A 1 269 ? -63.786  29.753  -3.194   1.00 122.48 ? 238 VAL A CA  1 
ATOM 1583  C C   . VAL A 1 269 ? -63.780  29.803  -4.717   1.00 123.32 ? 238 VAL A C   1 
ATOM 1584  O O   . VAL A 1 269 ? -64.230  30.772  -5.320   1.00 125.22 ? 238 VAL A O   1 
ATOM 1585  C CB  . VAL A 1 269 ? -65.168  29.297  -2.648   1.00 123.48 ? 238 VAL A CB  1 
ATOM 1586  C CG1 . VAL A 1 269 ? -65.593  27.972  -3.279   1.00 122.37 ? 238 VAL A CG1 1 
ATOM 1587  C CG2 . VAL A 1 269 ? -65.122  29.136  -1.143   1.00 123.29 ? 238 VAL A CG2 1 
ATOM 1588  N N   . SER A 1 270 ? -63.228  28.750  -5.314   1.00 122.80 ? 239 SER A N   1 
ATOM 1589  C CA  . SER A 1 270 ? -63.230  28.530  -6.756   1.00 123.64 ? 239 SER A CA  1 
ATOM 1590  C C   . SER A 1 270 ? -63.239  27.014  -7.049   1.00 123.32 ? 239 SER A C   1 
ATOM 1591  O O   . SER A 1 270 ? -63.107  26.171  -6.145   1.00 122.19 ? 239 SER A O   1 
ATOM 1592  C CB  . SER A 1 270 ? -62.019  29.216  -7.412   1.00 123.37 ? 239 SER A CB  1 
ATOM 1593  O OG  . SER A 1 270 ? -60.795  28.693  -6.921   1.00 121.32 ? 239 SER A OG  1 
ATOM 1594  N N   . ASN A 1 271 ? -63.405  26.666  -8.316   1.00 124.49 ? 240 ASN A N   1 
ATOM 1595  C CA  . ASN A 1 271 ? -63.309  25.278  -8.709   1.00 124.56 ? 240 ASN A CA  1 
ATOM 1596  C C   . ASN A 1 271 ? -61.923  24.950  -9.317   1.00 124.04 ? 240 ASN A C   1 
ATOM 1597  O O   . ASN A 1 271 ? -61.320  25.798  -9.994   1.00 125.02 ? 240 ASN A O   1 
ATOM 1598  C CB  . ASN A 1 271 ? -64.426  24.982  -9.691   1.00 126.69 ? 240 ASN A CB  1 
ATOM 1599  C CG  . ASN A 1 271 ? -65.243  23.790  -9.282   1.00 127.91 ? 240 ASN A CG  1 
ATOM 1600  O OD1 . ASN A 1 271 ? -66.454  23.906  -9.084   1.00 130.32 ? 240 ASN A OD1 1 
ATOM 1601  N ND2 . ASN A 1 271 ? -64.591  22.631  -9.137   1.00 127.49 ? 240 ASN A ND2 1 
ATOM 1602  N N   . ILE A 1 272 ? -61.405  23.742  -9.076   1.00 122.84 ? 241 ILE A N   1 
ATOM 1603  C CA  . ILE A 1 272 ? -60.141  23.333  -9.705   1.00 122.31 ? 241 ILE A CA  1 
ATOM 1604  C C   . ILE A 1 272 ? -60.336  23.108  -11.197  1.00 124.19 ? 241 ILE A C   1 
ATOM 1605  O O   . ILE A 1 272 ? -59.376  23.031  -11.942  1.00 125.03 ? 241 ILE A O   1 
ATOM 1606  C CB  . ILE A 1 272 ? -59.480  22.089  -9.053   1.00 121.60 ? 241 ILE A CB  1 
ATOM 1607  C CG1 . ILE A 1 272 ? -60.502  21.204  -8.362   1.00 121.69 ? 241 ILE A CG1 1 
ATOM 1608  C CG2 . ILE A 1 272 ? -58.466  22.491  -8.034   1.00 119.76 ? 241 ILE A CG2 1 
ATOM 1609  C CD1 . ILE A 1 272 ? -61.393  20.444  -9.310   1.00 125.15 ? 241 ILE A CD1 1 
ATOM 1610  N N   . ASP A 1 273 ? -61.589  23.010  -11.624  1.00 125.47 ? 242 ASP A N   1 
ATOM 1611  C CA  . ASP A 1 273 ? -61.942  22.937  -13.041  1.00 128.18 ? 242 ASP A CA  1 
ATOM 1612  C C   . ASP A 1 273 ? -61.565  24.208  -13.780  1.00 128.45 ? 242 ASP A C   1 
ATOM 1613  O O   . ASP A 1 273 ? -61.125  24.160  -14.928  1.00 130.27 ? 242 ASP A O   1 
ATOM 1614  C CB  . ASP A 1 273 ? -63.454  22.742  -13.205  1.00 130.23 ? 242 ASP A CB  1 
ATOM 1615  C CG  . ASP A 1 273 ? -63.943  21.410  -12.668  1.00 131.67 ? 242 ASP A CG  1 
ATOM 1616  O OD1 . ASP A 1 273 ? -63.095  20.497  -12.496  1.00 133.05 ? 242 ASP A OD1 1 
ATOM 1617  O OD2 . ASP A 1 273 ? -65.177  21.286  -12.434  1.00 133.49 ? 242 ASP A OD2 1 
ATOM 1618  N N   . ASN A 1 274 ? -61.778  25.338  -13.116  1.00 126.89 ? 243 ASN A N   1 
ATOM 1619  C CA  . ASN A 1 274 ? -61.522  26.633  -13.695  1.00 127.47 ? 243 ASN A CA  1 
ATOM 1620  C C   . ASN A 1 274 ? -60.050  27.004  -13.565  1.00 125.97 ? 243 ASN A C   1 
ATOM 1621  O O   . ASN A 1 274 ? -59.538  27.246  -12.474  1.00 124.02 ? 243 ASN A O   1 
ATOM 1622  C CB  . ASN A 1 274 ? -62.422  27.690  -13.055  1.00 127.75 ? 243 ASN A CB  1 
ATOM 1623  C CG  . ASN A 1 274 ? -62.401  29.006  -13.811  1.00 130.26 ? 243 ASN A CG  1 
ATOM 1624  O OD1 . ASN A 1 274 ? -62.279  29.033  -15.043  1.00 132.73 ? 243 ASN A OD1 1 
ATOM 1625  N ND2 . ASN A 1 274 ? -62.524  30.108  -13.079  1.00 130.21 ? 243 ASN A ND2 1 
ATOM 1626  N N   . LEU A 1 275 ? -59.381  27.035  -14.706  1.00 127.10 ? 244 LEU A N   1 
ATOM 1627  C CA  . LEU A 1 275 ? -57.957  27.252  -14.762  1.00 126.39 ? 244 LEU A CA  1 
ATOM 1628  C C   . LEU A 1 275 ? -57.604  28.714  -14.780  1.00 126.96 ? 244 LEU A C   1 
ATOM 1629  O O   . LEU A 1 275 ? -56.491  29.084  -14.441  1.00 126.63 ? 244 LEU A O   1 
ATOM 1630  C CB  . LEU A 1 275 ? -57.392  26.573  -15.993  1.00 128.16 ? 244 LEU A CB  1 
ATOM 1631  C CG  . LEU A 1 275 ? -57.188  25.089  -15.765  1.00 126.86 ? 244 LEU A CG  1 
ATOM 1632  C CD1 . LEU A 1 275 ? -56.547  24.476  -16.981  1.00 128.71 ? 244 LEU A CD1 1 
ATOM 1633  C CD2 . LEU A 1 275 ? -56.329  24.882  -14.522  1.00 124.28 ? 244 LEU A CD2 1 
ATOM 1634  N N   . GLY A 1 276 ? -58.550  29.545  -15.192  1.00 128.56 ? 245 GLY A N   1 
ATOM 1635  C CA  . GLY A 1 276 ? -58.380  30.986  -15.132  1.00 129.60 ? 245 GLY A CA  1 
ATOM 1636  C C   . GLY A 1 276 ? -58.537  31.498  -13.713  1.00 128.13 ? 245 GLY A C   1 
ATOM 1637  O O   . GLY A 1 276 ? -58.067  32.599  -13.403  1.00 128.23 ? 245 GLY A O   1 
ATOM 1638  N N   . ALA A 1 277 ? -59.170  30.677  -12.859  1.00 127.09 ? 246 ALA A N   1 
ATOM 1639  C CA  . ALA A 1 277 ? -59.547  31.028  -11.470  1.00 126.31 ? 246 ALA A CA  1 
ATOM 1640  C C   . ALA A 1 277 ? -58.364  31.315  -10.565  1.00 125.51 ? 246 ALA A C   1 
ATOM 1641  O O   . ALA A 1 277 ? -58.101  30.563  -9.629   1.00 124.13 ? 246 ALA A O   1 
ATOM 1642  C CB  . ALA A 1 277 ? -60.420  29.931  -10.849  1.00 125.09 ? 246 ALA A CB  1 
ATOM 1643  N N   . THR A 1 278 ? -57.674  32.417  -10.840  1.00 127.22 ? 247 THR A N   1 
ATOM 1644  C CA  . THR A 1 278 ? -56.451  32.785  -10.132  1.00 127.42 ? 247 THR A CA  1 
ATOM 1645  C C   . THR A 1 278 ? -56.728  33.686  -8.914   1.00 127.92 ? 247 THR A C   1 
ATOM 1646  O O   . THR A 1 278 ? -57.821  34.234  -8.769   1.00 129.06 ? 247 THR A O   1 
ATOM 1647  C CB  . THR A 1 278 ? -55.427  33.432  -11.107  1.00 128.75 ? 247 THR A CB  1 
ATOM 1648  O OG1 . THR A 1 278 ? -54.110  33.345  -10.549  1.00 128.84 ? 247 THR A OG1 1 
ATOM 1649  C CG2 . THR A 1 278 ? -55.784  34.899  -11.418  1.00 130.56 ? 247 THR A CG2 1 
ATOM 1650  N N   . VAL A 1 279 ? -55.747  33.815  -8.030   1.00 128.00 ? 248 VAL A N   1 
ATOM 1651  C CA  . VAL A 1 279 ? -55.849  34.756  -6.929   1.00 129.22 ? 248 VAL A CA  1 
ATOM 1652  C C   . VAL A 1 279 ? -55.568  36.176  -7.450   1.00 132.00 ? 248 VAL A C   1 
ATOM 1653  O O   . VAL A 1 279 ? -54.412  36.585  -7.611   1.00 132.60 ? 248 VAL A O   1 
ATOM 1654  C CB  . VAL A 1 279 ? -54.885  34.382  -5.790   1.00 128.52 ? 248 VAL A CB  1 
ATOM 1655  C CG1 . VAL A 1 279 ? -54.949  35.409  -4.674   1.00 129.29 ? 248 VAL A CG1 1 
ATOM 1656  C CG2 . VAL A 1 279 ? -55.190  32.974  -5.266   1.00 126.50 ? 248 VAL A CG2 1 
ATOM 1657  N N   . ASP A 1 280 ? -56.634  36.920  -7.735   1.00 134.29 ? 249 ASP A N   1 
ATOM 1658  C CA  . ASP A 1 280 ? -56.479  38.286  -8.218   1.00 137.53 ? 249 ASP A CA  1 
ATOM 1659  C C   . ASP A 1 280 ? -56.389  39.291  -7.093   1.00 139.19 ? 249 ASP A C   1 
ATOM 1660  O O   . ASP A 1 280 ? -57.232  39.318  -6.192   1.00 139.31 ? 249 ASP A O   1 
ATOM 1661  C CB  . ASP A 1 280 ? -57.605  38.706  -9.162   1.00 139.55 ? 249 ASP A CB  1 
ATOM 1662  C CG  . ASP A 1 280 ? -57.459  40.164  -9.629   1.00 143.54 ? 249 ASP A CG  1 
ATOM 1663  O OD1 . ASP A 1 280 ? -56.366  40.521  -10.129  1.00 145.76 ? 249 ASP A OD1 1 
ATOM 1664  O OD2 . ASP A 1 280 ? -58.417  40.956  -9.484   1.00 145.82 ? 249 ASP A OD2 1 
ATOM 1665  N N   . LEU A 1 281 ? -55.374  40.140  -7.207   1.00 140.99 ? 250 LEU A N   1 
ATOM 1666  C CA  . LEU A 1 281 ? -55.067  41.169  -6.233   1.00 143.43 ? 250 LEU A CA  1 
ATOM 1667  C C   . LEU A 1 281 ? -56.043  42.355  -6.230   1.00 146.94 ? 250 LEU A C   1 
ATOM 1668  O O   . LEU A 1 281 ? -56.536  42.740  -5.165   1.00 148.48 ? 250 LEU A O   1 
ATOM 1669  C CB  . LEU A 1 281 ? -53.640  41.658  -6.457   1.00 144.14 ? 250 LEU A CB  1 
ATOM 1670  C CG  . LEU A 1 281 ? -52.594  40.560  -6.334   1.00 141.54 ? 250 LEU A CG  1 
ATOM 1671  C CD1 . LEU A 1 281 ? -51.310  40.983  -6.991   1.00 143.08 ? 250 LEU A CD1 1 
ATOM 1672  C CD2 . LEU A 1 281 ? -52.363  40.231  -4.881   1.00 140.42 ? 250 LEU A CD2 1 
ATOM 1673  N N   . TYR A 1 282 ? -56.320  42.933  -7.403   1.00 148.89 ? 251 TYR A N   1 
ATOM 1674  C CA  . TYR A 1 282 ? -57.131  44.157  -7.501   1.00 152.71 ? 251 TYR A CA  1 
ATOM 1675  C C   . TYR A 1 282 ? -58.520  44.001  -6.882   1.00 153.39 ? 251 TYR A C   1 
ATOM 1676  O O   . TYR A 1 282 ? -59.071  44.965  -6.362   1.00 156.50 ? 251 TYR A O   1 
ATOM 1677  C CB  . TYR A 1 282 ? -57.237  44.639  -8.948   1.00 154.46 ? 251 TYR A CB  1 
ATOM 1678  C CG  . TYR A 1 282 ? -55.916  44.683  -9.695   1.00 155.11 ? 251 TYR A CG  1 
ATOM 1679  C CD1 . TYR A 1 282 ? -55.084  45.802  -9.630   1.00 158.59 ? 251 TYR A CD1 1 
ATOM 1680  C CD2 . TYR A 1 282 ? -55.505  43.607  -10.480  1.00 153.81 ? 251 TYR A CD2 1 
ATOM 1681  C CE1 . TYR A 1 282 ? -53.869  45.843  -10.326  1.00 159.16 ? 251 TYR A CE1 1 
ATOM 1682  C CE2 . TYR A 1 282 ? -54.296  43.636  -11.174  1.00 154.71 ? 251 TYR A CE2 1 
ATOM 1683  C CZ  . TYR A 1 282 ? -53.488  44.754  -11.095  1.00 157.17 ? 251 TYR A CZ  1 
ATOM 1684  O OH  . TYR A 1 282 ? -52.304  44.766  -11.790  1.00 158.15 ? 251 TYR A OH  1 
ATOM 1685  N N   . ILE A 1 283 ? -59.064  42.786  -6.941   1.00 151.12 ? 252 ILE A N   1 
ATOM 1686  C CA  . ILE A 1 283 ? -60.291  42.413  -6.229   1.00 151.81 ? 252 ILE A CA  1 
ATOM 1687  C C   . ILE A 1 283 ? -60.076  42.372  -4.724   1.00 152.39 ? 252 ILE A C   1 
ATOM 1688  O O   . ILE A 1 283 ? -60.908  42.861  -3.957   1.00 154.76 ? 252 ILE A O   1 
ATOM 1689  C CB  . ILE A 1 283 ? -60.770  41.017  -6.646   1.00 148.84 ? 252 ILE A CB  1 
ATOM 1690  C CG1 . ILE A 1 283 ? -61.089  41.011  -8.131   1.00 149.69 ? 252 ILE A CG1 1 
ATOM 1691  C CG2 . ILE A 1 283 ? -61.988  40.574  -5.823   1.00 148.57 ? 252 ILE A CG2 1 
ATOM 1692  C CD1 . ILE A 1 283 ? -61.174  39.638  -8.727   1.00 147.77 ? 252 ILE A CD1 1 
ATOM 1693  N N   . LEU A 1 284 ? -58.967  41.757  -4.314   1.00 150.97 ? 253 LEU A N   1 
ATOM 1694  C CA  . LEU A 1 284 ? -58.632  41.583  -2.902   1.00 151.65 ? 253 LEU A CA  1 
ATOM 1695  C C   . LEU A 1 284 ? -58.478  42.941  -2.239   1.00 156.05 ? 253 LEU A C   1 
ATOM 1696  O O   . LEU A 1 284 ? -58.948  43.137  -1.123   1.00 158.17 ? 253 LEU A O   1 
ATOM 1697  C CB  . LEU A 1 284 ? -57.345  40.765  -2.738   1.00 148.98 ? 253 LEU A CB  1 
ATOM 1698  C CG  . LEU A 1 284 ? -57.250  39.856  -1.512   1.00 147.34 ? 253 LEU A CG  1 
ATOM 1699  C CD1 . LEU A 1 284 ? -57.724  38.454  -1.868   1.00 144.29 ? 253 LEU A CD1 1 
ATOM 1700  C CD2 . LEU A 1 284 ? -55.828  39.811  -1.008   1.00 146.49 ? 253 LEU A CD2 1 
ATOM 1701  N N   . ASN A 1 285 ? -57.839  43.875  -2.944   1.00 158.35 ? 254 ASN A N   1 
ATOM 1702  C CA  . ASN A 1 285 ? -57.661  45.248  -2.477   1.00 163.11 ? 254 ASN A CA  1 
ATOM 1703  C C   . ASN A 1 285 ? -58.999  45.932  -2.215   1.00 166.82 ? 254 ASN A C   1 
ATOM 1704  O O   . ASN A 1 285 ? -59.111  46.850  -1.406   1.00 170.30 ? 254 ASN A O   1 
ATOM 1705  C CB  . ASN A 1 285 ? -56.863  46.036  -3.511   1.00 164.21 ? 254 ASN A CB  1 
ATOM 1706  C CG  . ASN A 1 285 ? -56.078  47.175  -2.901   1.00 167.95 ? 254 ASN A CG  1 
ATOM 1707  O OD1 . ASN A 1 285 ? -55.948  48.238  -3.506   1.00 171.28 ? 254 ASN A OD1 1 
ATOM 1708  N ND2 . ASN A 1 285 ? -55.542  46.959  -1.700   1.00 168.34 ? 254 ASN A ND2 1 
ATOM 1709  N N   . HIS A 1 286 ? -60.016  45.449  -2.908   1.00 166.79 ? 255 HIS A N   1 
ATOM 1710  C CA  . HIS A 1 286 ? -61.358  45.960  -2.769   1.00 170.99 ? 255 HIS A CA  1 
ATOM 1711  C C   . HIS A 1 286 ? -62.045  45.366  -1.536   1.00 171.57 ? 255 HIS A C   1 
ATOM 1712  O O   . HIS A 1 286 ? -63.075  45.869  -1.099   1.00 175.36 ? 255 HIS A O   1 
ATOM 1713  C CB  . HIS A 1 286 ? -62.143  45.644  -4.040   1.00 170.42 ? 255 HIS A CB  1 
ATOM 1714  C CG  . HIS A 1 286 ? -63.349  46.503  -4.246   1.00 174.91 ? 255 HIS A CG  1 
ATOM 1715  N ND1 . HIS A 1 286 ? -64.623  46.083  -3.928   1.00 175.93 ? 255 HIS A ND1 1 
ATOM 1716  C CD2 . HIS A 1 286 ? -63.479  47.750  -4.755   1.00 178.85 ? 255 HIS A CD2 1 
ATOM 1717  C CE1 . HIS A 1 286 ? -65.487  47.036  -4.226   1.00 180.58 ? 255 HIS A CE1 1 
ATOM 1718  N NE2 . HIS A 1 286 ? -64.818  48.059  -4.728   1.00 182.83 ? 255 HIS A NE2 1 
ATOM 1719  N N   . LEU A 1 287 ? -61.478  44.305  -0.975   1.00 168.78 ? 256 LEU A N   1 
ATOM 1720  C CA  . LEU A 1 287 ? -62.029  43.709  0.238    1.00 169.53 ? 256 LEU A CA  1 
ATOM 1721  C C   . LEU A 1 287 ? -61.188  44.071  1.455    1.00 171.73 ? 256 LEU A C   1 
ATOM 1722  O O   . LEU A 1 287 ? -61.464  45.075  2.108    1.00 176.04 ? 256 LEU A O   1 
ATOM 1723  C CB  . LEU A 1 287 ? -62.144  42.199  0.091    1.00 165.10 ? 256 LEU A CB  1 
ATOM 1724  C CG  . LEU A 1 287 ? -63.121  41.752  -0.976   1.00 163.70 ? 256 LEU A CG  1 
ATOM 1725  C CD1 . LEU A 1 287 ? -62.640  40.475  -1.589   1.00 159.59 ? 256 LEU A CD1 1 
ATOM 1726  C CD2 . LEU A 1 287 ? -64.439  41.556  -0.337   1.00 165.31 ? 256 LEU A CD2 1 
ATOM 1727  N N   . MET A 1 288 ? -60.166  43.260  1.749    1.00 169.58 ? 257 MET A N   1 
ATOM 1728  C CA  . MET A 1 288 ? -59.255  43.492  2.875    1.00 171.88 ? 257 MET A CA  1 
ATOM 1729  C C   . MET A 1 288 ? -58.615  44.894  2.795    1.00 176.12 ? 257 MET A C   1 
ATOM 1730  O O   . MET A 1 288 ? -57.470  45.045  2.341    1.00 175.52 ? 257 MET A O   1 
ATOM 1731  C CB  . MET A 1 288 ? -58.193  42.385  2.948    1.00 167.88 ? 257 MET A CB  1 
ATOM 1732  N N   . ASN A 1 289 ? -59.373  45.898  3.261    1.00 181.24 ? 258 ASN A N   1 
ATOM 1733  C CA  . ASN A 1 289 ? -59.087  47.341  3.111    1.00 186.06 ? 258 ASN A CA  1 
ATOM 1734  C C   . ASN A 1 289 ? -59.814  47.931  1.894    1.00 187.42 ? 258 ASN A C   1 
ATOM 1735  O O   . ASN A 1 289 ? -59.177  48.265  0.892    1.00 186.52 ? 258 ASN A O   1 
ATOM 1736  C CB  . ASN A 1 289 ? -57.579  47.663  3.080    1.00 185.81 ? 258 ASN A CB  1 
ATOM 1737  N N   . PRO A 1 290 ? -61.153  48.080  1.991    1.00 190.26 ? 259 PRO A N   1 
ATOM 1738  C CA  . PRO A 1 290 ? -61.969  48.483  0.831    1.00 191.53 ? 259 PRO A CA  1 
ATOM 1739  C C   . PRO A 1 290 ? -61.957  49.994  0.517    1.00 196.86 ? 259 PRO A C   1 
ATOM 1740  O O   . PRO A 1 290 ? -61.486  50.791  1.335    1.00 200.30 ? 259 PRO A O   1 
ATOM 1741  C CB  . PRO A 1 290 ? -63.388  48.035  1.230    1.00 192.69 ? 259 PRO A CB  1 
ATOM 1742  C CG  . PRO A 1 290 ? -63.398  48.039  2.746    1.00 194.96 ? 259 PRO A CG  1 
ATOM 1743  C CD  . PRO A 1 290 ? -61.955  48.009  3.234    1.00 193.14 ? 259 PRO A CD  1 
ATOM 1744  N N   . PRO A 1 291 ? -62.433  50.381  -0.686   1.00 197.89 ? 260 PRO A N   1 
ATOM 1745  C CA  . PRO A 1 291 ? -62.859  51.768  -0.940   1.00 203.83 ? 260 PRO A CA  1 
ATOM 1746  C C   . PRO A 1 291 ? -64.150  52.139  -0.187   1.00 208.63 ? 260 PRO A C   1 
ATOM 1747  O O   . PRO A 1 291 ? -65.074  51.317  -0.089   1.00 207.44 ? 260 PRO A O   1 
ATOM 1748  C CB  . PRO A 1 291 ? -63.091  51.793  -2.458   1.00 202.88 ? 260 PRO A CB  1 
ATOM 1749  C CG  . PRO A 1 291 ? -62.182  50.734  -2.988   1.00 196.87 ? 260 PRO A CG  1 
ATOM 1750  C CD  . PRO A 1 291 ? -62.218  49.642  -1.946   1.00 193.63 ? 260 PRO A CD  1 
ATOM 1751  N N   . ASN A 1 292 ? -64.194  53.379  0.307    1.00 214.38 ? 261 ASN A N   1 
ATOM 1752  C CA  . ASN A 1 292 ? -65.237  53.909  1.219    1.00 219.83 ? 261 ASN A CA  1 
ATOM 1753  C C   . ASN A 1 292 ? -66.665  53.317  1.195    1.00 220.05 ? 261 ASN A C   1 
ATOM 1754  O O   . ASN A 1 292 ? -67.267  53.090  0.136    1.00 218.95 ? 261 ASN A O   1 
ATOM 1755  C CB  . ASN A 1 292 ? -65.293  55.444  1.122    1.00 226.87 ? 261 ASN A CB  1 
ATOM 1756  C CG  . ASN A 1 292 ? -64.044  56.117  1.676    1.00 228.22 ? 261 ASN A CG  1 
ATOM 1757  O OD1 . ASN A 1 292 ? -62.915  55.765  1.315    1.00 223.78 ? 261 ASN A OD1 1 
ATOM 1758  N ND2 . ASN A 1 292 ? -64.244  57.102  2.551    1.00 234.85 ? 261 ASN A ND2 1 
ATOM 1759  N N   . GLY A 1 293 ? -67.197  53.109  2.395    1.00 221.77 ? 262 GLY A N   1 
ATOM 1760  C CA  . GLY A 1 293 ? -68.418  52.351  2.592    1.00 221.36 ? 262 GLY A CA  1 
ATOM 1761  C C   . GLY A 1 293 ? -68.077  51.162  3.472    1.00 216.53 ? 262 GLY A C   1 
ATOM 1762  O O   . GLY A 1 293 ? -66.895  50.841  3.657    1.00 212.61 ? 262 GLY A O   1 
ATOM 1763  N N   . LYS A 1 294 ? -69.111  50.514  4.011    1.00 216.97 ? 263 LYS A N   1 
ATOM 1764  C CA  . LYS A 1 294 ? -68.960  49.358  4.901    1.00 212.88 ? 263 LYS A CA  1 
ATOM 1765  C C   . LYS A 1 294 ? -68.395  48.146  4.146    1.00 204.96 ? 263 LYS A C   1 
ATOM 1766  O O   . LYS A 1 294 ? -67.383  48.261  3.437    1.00 201.73 ? 263 LYS A O   1 
ATOM 1767  C CB  . LYS A 1 294 ? -70.310  49.024  5.556    1.00 216.24 ? 263 LYS A CB  1 
ATOM 1768  N N   . ARG A 1 295 ? -69.032  46.987  4.325    1.00 201.94 ? 264 ARG A N   1 
ATOM 1769  C CA  . ARG A 1 295 ? -68.797  45.813  3.483    1.00 195.21 ? 264 ARG A CA  1 
ATOM 1770  C C   . ARG A 1 295 ? -67.357  45.299  3.611    1.00 189.33 ? 264 ARG A C   1 
ATOM 1771  O O   . ARG A 1 295 ? -66.546  45.945  4.281    1.00 190.61 ? 264 ARG A O   1 
ATOM 1772  C CB  . ARG A 1 295 ? -69.144  46.147  2.024    1.00 195.66 ? 264 ARG A CB  1 
ATOM 1773  C CG  . ARG A 1 295 ? -70.607  46.539  1.777    1.00 202.63 ? 264 ARG A CG  1 
ATOM 1774  C CD  . ARG A 1 295 ? -71.095  46.043  0.421    1.00 204.41 ? 264 ARG A CD  1 
ATOM 1775  N NE  . ARG A 1 295 ? -71.014  44.578  0.312    1.00 202.68 ? 264 ARG A NE  1 
ATOM 1776  C CZ  . ARG A 1 295 ? -70.063  43.894  -0.338   1.00 199.04 ? 264 ARG A CZ  1 
ATOM 1777  N NH1 . ARG A 1 295 ? -69.082  44.531  -0.972   1.00 198.51 ? 264 ARG A NH1 1 
ATOM 1778  N NH2 . ARG A 1 295 ? -70.085  42.559  -0.360   1.00 195.55 ? 264 ARG A NH2 1 
ATOM 1779  N N   . CYS A 1 296 ? -67.007  44.159  2.991    1.00 182.90 ? 265 CYS A N   1 
ATOM 1780  C CA  . CYS A 1 296 ? -67.851  43.317  2.099    1.00 179.59 ? 265 CYS A CA  1 
ATOM 1781  C C   . CYS A 1 296 ? -68.100  41.920  2.653    1.00 175.29 ? 265 CYS A C   1 
ATOM 1782  O O   . CYS A 1 296 ? -67.194  41.276  3.171    1.00 172.34 ? 265 CYS A O   1 
ATOM 1783  C CB  . CYS A 1 296 ? -67.169  43.127  0.746    1.00 176.08 ? 265 CYS A CB  1 
ATOM 1784  S SG  . CYS A 1 296 ? -66.306  44.571  0.092    1.00 179.79 ? 265 CYS A SG  1 
ATOM 1785  N N   . GLU A 1 297 ? -69.311  41.417  2.502    1.00 174.70 ? 266 GLU A N   1 
ATOM 1786  C CA  . GLU A 1 297 ? -69.637  40.161  3.155    1.00 171.24 ? 266 GLU A CA  1 
ATOM 1787  C C   . GLU A 1 297 ? -69.622  38.976  2.199    1.00 165.17 ? 266 GLU A C   1 
ATOM 1788  O O   . GLU A 1 297 ? -69.619  37.833  2.644    1.00 162.57 ? 266 GLU A O   1 
ATOM 1789  C CB  . GLU A 1 297 ? -70.983  40.265  3.891    1.00 176.36 ? 266 GLU A CB  1 
ATOM 1790  C CG  . GLU A 1 297 ? -71.014  41.286  5.051    1.00 182.98 ? 266 GLU A CG  1 
ATOM 1791  C CD  . GLU A 1 297 ? -71.076  40.640  6.439    1.00 185.64 ? 266 GLU A CD  1 
ATOM 1792  O OE1 . GLU A 1 297 ? -72.168  40.151  6.821    1.00 188.29 ? 266 GLU A OE1 1 
ATOM 1793  O OE2 . GLU A 1 297 ? -70.042  40.642  7.155    1.00 185.23 ? 266 GLU A OE2 1 
ATOM 1794  N N   . PHE A 1 298 ? -69.597  39.242  0.895    1.00 150.19 ? 267 PHE A N   1 
ATOM 1795  C CA  . PHE A 1 298 ? -69.741  38.182  -0.092   1.00 146.78 ? 267 PHE A CA  1 
ATOM 1796  C C   . PHE A 1 298 ? -69.712  38.722  -1.504   1.00 146.11 ? 267 PHE A C   1 
ATOM 1797  O O   . PHE A 1 298 ? -70.709  39.258  -1.973   1.00 146.52 ? 267 PHE A O   1 
ATOM 1798  C CB  . PHE A 1 298 ? -71.069  37.463  0.122    1.00 145.66 ? 267 PHE A CB  1 
ATOM 1799  C CG  . PHE A 1 298 ? -71.209  36.209  -0.663   1.00 143.32 ? 267 PHE A CG  1 
ATOM 1800  C CD1 . PHE A 1 298 ? -71.548  35.023  -0.031   1.00 142.60 ? 267 PHE A CD1 1 
ATOM 1801  C CD2 . PHE A 1 298 ? -71.007  36.197  -2.031   1.00 141.88 ? 267 PHE A CD2 1 
ATOM 1802  C CE1 . PHE A 1 298 ? -71.690  33.835  -0.752   1.00 141.38 ? 267 PHE A CE1 1 
ATOM 1803  C CE2 . PHE A 1 298 ? -71.141  35.023  -2.754   1.00 141.31 ? 267 PHE A CE2 1 
ATOM 1804  C CZ  . PHE A 1 298 ? -71.490  33.837  -2.111   1.00 140.76 ? 267 PHE A CZ  1 
ATOM 1805  N N   . VAL A 1 299 ? -68.585  38.553  -2.190   1.00 145.13 ? 268 VAL A N   1 
ATOM 1806  C CA  . VAL A 1 299 ? -68.451  38.967  -3.592   1.00 144.33 ? 268 VAL A CA  1 
ATOM 1807  C C   . VAL A 1 299 ? -68.708  37.792  -4.541   1.00 143.15 ? 268 VAL A C   1 
ATOM 1808  O O   . VAL A 1 299 ? -68.450  36.643  -4.207   1.00 142.28 ? 268 VAL A O   1 
ATOM 1809  C CB  . VAL A 1 299 ? -67.076  39.636  -3.869   1.00 145.15 ? 268 VAL A CB  1 
ATOM 1810  C CG1 . VAL A 1 299 ? -66.928  40.052  -5.323   1.00 144.48 ? 268 VAL A CG1 1 
ATOM 1811  C CG2 . VAL A 1 299 ? -66.916  40.844  -2.996   1.00 146.31 ? 268 VAL A CG2 1 
ATOM 1812  N N   . MET A 1 300 ? -69.257  38.093  -5.712   1.00 143.40 ? 269 MET A N   1 
ATOM 1813  C CA  . MET A 1 300 ? -69.452  37.096  -6.765   1.00 143.01 ? 269 MET A CA  1 
ATOM 1814  C C   . MET A 1 300 ? -68.884  37.579  -8.101   1.00 143.80 ? 269 MET A C   1 
ATOM 1815  O O   . MET A 1 300 ? -69.373  38.546  -8.696   1.00 144.41 ? 269 MET A O   1 
ATOM 1816  C CB  . MET A 1 300 ? -70.934  36.730  -6.926   1.00 142.86 ? 269 MET A CB  1 
ATOM 1817  C CG  . MET A 1 300 ? -71.178  35.389  -7.624   1.00 141.82 ? 269 MET A CG  1 
ATOM 1818  S SD  . MET A 1 300 ? -72.917  35.082  -7.980   1.00 141.24 ? 269 MET A SD  1 
ATOM 1819  C CE  . MET A 1 300 ? -73.146  33.432  -7.333   1.00 140.37 ? 269 MET A CE  1 
ATOM 1820  N N   . GLU A 1 301 ? -67.837  36.901  -8.560   1.00 144.02 ? 270 GLU A N   1 
ATOM 1821  C CA  . GLU A 1 301 ? -67.337  37.103  -9.900   1.00 144.86 ? 270 GLU A CA  1 
ATOM 1822  C C   . GLU A 1 301 ? -68.467  36.700  -10.835  1.00 145.35 ? 270 GLU A C   1 
ATOM 1823  O O   . GLU A 1 301 ? -69.215  35.744  -10.569  1.00 145.15 ? 270 GLU A O   1 
ATOM 1824  C CB  . GLU A 1 301 ? -66.064  36.284  -10.161  1.00 144.92 ? 270 GLU A CB  1 
ATOM 1825  C CG  . GLU A 1 301 ? -64.783  36.873  -9.527   1.00 145.68 ? 270 GLU A CG  1 
ATOM 1826  C CD  . GLU A 1 301 ? -63.489  36.144  -9.923   1.00 146.57 ? 270 GLU A CD  1 
ATOM 1827  O OE1 . GLU A 1 301 ? -62.962  35.360  -9.106   1.00 146.13 ? 270 GLU A OE1 1 
ATOM 1828  O OE2 . GLU A 1 301 ? -62.988  36.353  -11.050  1.00 147.60 ? 270 GLU A OE2 1 
ATOM 1829  N N   . VAL A 1 302 ? -68.602  37.461  -11.916  1.00 146.54 ? 271 VAL A N   1 
ATOM 1830  C CA  . VAL A 1 302 ? -69.696  37.312  -12.858  1.00 147.10 ? 271 VAL A CA  1 
ATOM 1831  C C   . VAL A 1 302 ? -69.244  37.699  -14.251  1.00 148.14 ? 271 VAL A C   1 
ATOM 1832  O O   . VAL A 1 302 ? -68.624  38.746  -14.437  1.00 148.75 ? 271 VAL A O   1 
ATOM 1833  C CB  . VAL A 1 302 ? -70.867  38.167  -12.416  1.00 147.42 ? 271 VAL A CB  1 
ATOM 1834  C CG1 . VAL A 1 302 ? -71.484  38.915  -13.588  1.00 149.09 ? 271 VAL A CG1 1 
ATOM 1835  C CG2 . VAL A 1 302 ? -71.869  37.298  -11.691  1.00 147.16 ? 271 VAL A CG2 1 
ATOM 1836  N N   . THR A 1 303 ? -69.546  36.842  -15.222  1.00 148.76 ? 272 THR A N   1 
ATOM 1837  C CA  . THR A 1 303 ? -69.204  37.110  -16.619  1.00 150.05 ? 272 THR A CA  1 
ATOM 1838  C C   . THR A 1 303 ? -70.442  37.438  -17.465  1.00 151.64 ? 272 THR A C   1 
ATOM 1839  O O   . THR A 1 303 ? -71.565  37.167  -17.043  1.00 152.09 ? 272 THR A O   1 
ATOM 1840  C CB  . THR A 1 303 ? -68.436  35.934  -17.250  1.00 150.00 ? 272 THR A CB  1 
ATOM 1841  O OG1 . THR A 1 303 ? -68.119  36.251  -18.611  1.00 151.07 ? 272 THR A OG1 1 
ATOM 1842  C CG2 . THR A 1 303 ? -69.262  34.658  -17.214  1.00 149.86 ? 272 THR A CG2 1 
ATOM 1843  N N   . ASN A 1 304 ? -70.234  38.021  -18.649  1.00 152.97 ? 273 ASN A N   1 
ATOM 1844  C CA  . ASN A 1 304 ? -71.312  38.199  -19.629  1.00 154.84 ? 273 ASN A CA  1 
ATOM 1845  C C   . ASN A 1 304 ? -71.750  36.828  -20.174  1.00 155.70 ? 273 ASN A C   1 
ATOM 1846  O O   . ASN A 1 304 ? -71.310  35.790  -19.664  1.00 154.91 ? 273 ASN A O   1 
ATOM 1847  C CB  . ASN A 1 304 ? -70.871  39.144  -20.755  1.00 156.00 ? 273 ASN A CB  1 
ATOM 1848  C CG  . ASN A 1 304 ? -70.334  40.478  -20.233  1.00 156.38 ? 273 ASN A CG  1 
ATOM 1849  O OD1 . ASN A 1 304 ? -71.087  41.314  -19.729  1.00 157.40 ? 273 ASN A OD1 1 
ATOM 1850  N ND2 . ASN A 1 304 ? -69.024  40.685  -20.367  1.00 156.58 ? 273 ASN A ND2 1 
ATOM 1851  N N   . LYS A 1 305 ? -72.626  36.801  -21.178  1.00 157.90 ? 274 LYS A N   1 
ATOM 1852  C CA  . LYS A 1 305 ? -73.028  35.519  -21.788  1.00 159.29 ? 274 LYS A CA  1 
ATOM 1853  C C   . LYS A 1 305 ? -72.448  35.307  -23.187  1.00 160.95 ? 274 LYS A C   1 
ATOM 1854  O O   . LYS A 1 305 ? -72.441  36.217  -24.019  1.00 161.85 ? 274 LYS A O   1 
ATOM 1855  C CB  . LYS A 1 305 ? -74.551  35.362  -21.837  1.00 160.86 ? 274 LYS A CB  1 
ATOM 1856  C CG  . LYS A 1 305 ? -75.231  35.407  -20.489  1.00 159.36 ? 274 LYS A CG  1 
ATOM 1857  C CD  . LYS A 1 305 ? -76.572  34.714  -20.553  1.00 160.64 ? 274 LYS A CD  1 
ATOM 1858  C CE  . LYS A 1 305 ? -77.404  35.037  -19.330  1.00 159.70 ? 274 LYS A CE  1 
ATOM 1859  N NZ  . LYS A 1 305 ? -78.670  34.261  -19.305  1.00 161.80 ? 274 LYS A NZ  1 
ATOM 1860  N N   . THR A 1 306 ? -71.932  34.109  -23.432  1.00 161.72 ? 275 THR A N   1 
ATOM 1861  C CA  . THR A 1 306 ? -71.631  33.696  -24.791  1.00 164.21 ? 275 THR A CA  1 
ATOM 1862  C C   . THR A 1 306 ? -72.779  32.800  -25.176  1.00 166.81 ? 275 THR A C   1 
ATOM 1863  O O   . THR A 1 306 ? -73.478  32.253  -24.314  1.00 166.61 ? 275 THR A O   1 
ATOM 1864  C CB  . THR A 1 306 ? -70.332  32.831  -24.942  1.00 164.03 ? 275 THR A CB  1 
ATOM 1865  O OG1 . THR A 1 306 ? -69.391  33.105  -23.896  1.00 162.03 ? 275 THR A OG1 1 
ATOM 1866  C CG2 . THR A 1 306 ? -69.671  33.047  -26.330  1.00 165.62 ? 275 THR A CG2 1 
ATOM 1867  N N   . ARG A 1 307 ? -72.965  32.656  -26.480  1.00 169.62 ? 276 ARG A N   1 
ATOM 1868  C CA  . ARG A 1 307 ? -73.839  31.642  -27.008  1.00 172.91 ? 276 ARG A CA  1 
ATOM 1869  C C   . ARG A 1 307 ? -73.433  30.309  -26.394  1.00 173.21 ? 276 ARG A C   1 
ATOM 1870  O O   . ARG A 1 307 ? -74.281  29.461  -26.145  1.00 175.10 ? 276 ARG A O   1 
ATOM 1871  C CB  . ARG A 1 307 ? -73.701  31.599  -28.521  1.00 175.37 ? 276 ARG A CB  1 
ATOM 1872  C CG  . ARG A 1 307 ? -75.002  31.369  -29.230  1.00 178.46 ? 276 ARG A CG  1 
ATOM 1873  C CD  . ARG A 1 307 ? -75.032  32.122  -30.542  1.00 179.56 ? 276 ARG A CD  1 
ATOM 1874  N NE  . ARG A 1 307 ? -76.397  32.228  -31.037  1.00 182.31 ? 276 ARG A NE  1 
ATOM 1875  C CZ  . ARG A 1 307 ? -76.983  31.335  -31.825  1.00 185.95 ? 276 ARG A CZ  1 
ATOM 1876  N NH1 . ARG A 1 307 ? -76.326  30.258  -32.234  1.00 186.62 ? 276 ARG A NH1 1 
ATOM 1877  N NH2 . ARG A 1 307 ? -78.235  31.525  -32.208  1.00 189.58 ? 276 ARG A NH2 1 
ATOM 1878  N N   . ALA A 1 308 ? -72.133  30.159  -26.128  1.00 171.88 ? 277 ALA A N   1 
ATOM 1879  C CA  . ALA A 1 308 ? -71.555  28.947  -25.555  1.00 172.33 ? 277 ALA A CA  1 
ATOM 1880  C C   . ALA A 1 308 ? -72.411  28.343  -24.443  1.00 172.82 ? 277 ALA A C   1 
ATOM 1881  O O   . ALA A 1 308 ? -72.978  27.269  -24.614  1.00 175.34 ? 277 ALA A O   1 
ATOM 1882  C CB  . ALA A 1 308 ? -70.136  29.217  -25.066  1.00 169.78 ? 277 ALA A CB  1 
ATOM 1883  N N   . ASP A 1 309 ? -72.509  29.032  -23.312  1.00 171.11 ? 278 ASP A N   1 
ATOM 1884  C CA  . ASP A 1 309 ? -73.349  28.574  -22.208  1.00 171.93 ? 278 ASP A CA  1 
ATOM 1885  C C   . ASP A 1 309 ? -74.619  29.393  -22.209  1.00 173.24 ? 278 ASP A C   1 
ATOM 1886  O O   . ASP A 1 309 ? -74.606  30.569  -21.842  1.00 171.60 ? 278 ASP A O   1 
ATOM 1887  C CB  . ASP A 1 309 ? -72.628  28.712  -20.863  1.00 168.92 ? 278 ASP A CB  1 
ATOM 1888  C CG  . ASP A 1 309 ? -71.808  29.992  -20.758  1.00 166.55 ? 278 ASP A CG  1 
ATOM 1889  O OD1 . ASP A 1 309 ? -71.994  30.919  -21.579  1.00 167.09 ? 278 ASP A OD1 1 
ATOM 1890  O OD2 . ASP A 1 309 ? -70.963  30.063  -19.848  1.00 164.61 ? 278 ASP A OD2 1 
ATOM 1891  N N   . VAL A 1 310 ? -75.715  28.781  -22.647  1.00 177.20 ? 279 VAL A N   1 
ATOM 1892  C CA  . VAL A 1 310 ? -76.983  29.512  -22.789  1.00 179.35 ? 279 VAL A CA  1 
ATOM 1893  C C   . VAL A 1 310 ? -77.704  29.610  -21.441  1.00 178.84 ? 279 VAL A C   1 
ATOM 1894  O O   . VAL A 1 310 ? -78.322  30.645  -21.130  1.00 178.38 ? 279 VAL A O   1 
ATOM 1895  C CB  . VAL A 1 310 ? -77.928  28.921  -23.910  1.00 183.78 ? 279 VAL A CB  1 
ATOM 1896  C CG1 . VAL A 1 310 ? -79.253  29.693  -23.995  1.00 185.46 ? 279 VAL A CG1 1 
ATOM 1897  C CG2 . VAL A 1 310 ? -77.248  28.918  -25.276  1.00 184.65 ? 279 VAL A CG2 1 
ATOM 1898  N N   . LYS A 1 311 ? -77.609  28.549  -20.638  1.00 179.23 ? 280 LYS A N   1 
ATOM 1899  C CA  . LYS A 1 311 ? -78.377  28.507  -19.402  1.00 179.32 ? 280 LYS A CA  1 
ATOM 1900  C C   . LYS A 1 311 ? -77.568  28.262  -18.131  1.00 176.60 ? 280 LYS A C   1 
ATOM 1901  O O   . LYS A 1 311 ? -76.473  27.694  -18.165  1.00 175.59 ? 280 LYS A O   1 
ATOM 1902  C CB  . LYS A 1 311 ? -79.546  27.529  -19.519  1.00 183.18 ? 280 LYS A CB  1 
ATOM 1903  C CG  . LYS A 1 311 ? -80.866  28.141  -19.076  1.00 185.07 ? 280 LYS A CG  1 
ATOM 1904  C CD  . LYS A 1 311 ? -81.384  29.189  -20.078  1.00 188.10 ? 280 LYS A CD  1 
ATOM 1905  C CE  . LYS A 1 311 ? -82.690  29.855  -19.600  1.00 190.55 ? 280 LYS A CE  1 
ATOM 1906  N NZ  . LYS A 1 311 ? -83.599  30.325  -20.709  1.00 193.58 ? 280 LYS A NZ  1 
ATOM 1907  N N   . GLY A 1 312 ? -78.143  28.722  -17.019  1.00 175.83 ? 281 GLY A N   1 
ATOM 1908  C CA  . GLY A 1 312 ? -77.534  28.671  -15.685  1.00 173.47 ? 281 GLY A CA  1 
ATOM 1909  C C   . GLY A 1 312 ? -78.349  29.434  -14.633  1.00 172.86 ? 281 GLY A C   1 
ATOM 1910  O O   . GLY A 1 312 ? -78.664  28.883  -13.567  1.00 173.00 ? 281 GLY A O   1 
ATOM 1911  N N   . GLY A 1 313 ? -78.704  30.690  -14.942  1.00 172.40 ? 282 GLY A N   1 
ATOM 1912  C CA  . GLY A 1 313 ? -79.348  31.616  -13.990  1.00 171.16 ? 282 GLY A CA  1 
ATOM 1913  C C   . GLY A 1 313 ? -78.459  32.809  -13.658  1.00 168.22 ? 282 GLY A C   1 
ATOM 1914  O O   . GLY A 1 313 ? -77.229  32.724  -13.760  1.00 166.58 ? 282 GLY A O   1 
ATOM 1915  N N   . THR A 1 314 ? -79.070  33.920  -13.246  1.00 167.91 ? 283 THR A N   1 
ATOM 1916  C CA  . THR A 1 314 ? -78.331  35.179  -13.081  1.00 165.97 ? 283 THR A CA  1 
ATOM 1917  C C   . THR A 1 314 ? -78.545  35.864  -11.721  1.00 165.13 ? 283 THR A C   1 
ATOM 1918  O O   . THR A 1 314 ? -79.459  35.504  -10.976  1.00 165.88 ? 283 THR A O   1 
ATOM 1919  C CB  . THR A 1 314 ? -78.651  36.182  -14.221  1.00 167.31 ? 283 THR A CB  1 
ATOM 1920  O OG1 . THR A 1 314 ? -79.657  37.106  -13.792  1.00 168.67 ? 283 THR A OG1 1 
ATOM 1921  C CG2 . THR A 1 314 ? -79.121  35.463  -15.492  1.00 169.23 ? 283 THR A CG2 1 
ATOM 1922  N N   . LEU A 1 315 ? -77.690  36.847  -11.415  1.00 163.85 ? 284 LEU A N   1 
ATOM 1923  C CA  . LEU A 1 315 ? -77.776  37.643  -10.179  1.00 163.57 ? 284 LEU A CA  1 
ATOM 1924  C C   . LEU A 1 315 ? -78.594  38.937  -10.381  1.00 165.62 ? 284 LEU A C   1 
ATOM 1925  O O   . LEU A 1 315 ? -78.110  39.908  -10.978  1.00 166.13 ? 284 LEU A O   1 
ATOM 1926  C CB  . LEU A 1 315 ? -76.376  37.954  -9.621   1.00 161.29 ? 284 LEU A CB  1 
ATOM 1927  N N   . THR A 1 316 ? -79.834  38.932  -9.880   1.00 167.29 ? 285 THR A N   1 
ATOM 1928  C CA  . THR A 1 316 ? -80.784  40.065  -9.986   1.00 169.53 ? 285 THR A CA  1 
ATOM 1929  C C   . THR A 1 316 ? -81.141  40.616  -8.599   1.00 169.75 ? 285 THR A C   1 
ATOM 1930  O O   . THR A 1 316 ? -81.068  39.866  -7.619   1.00 168.89 ? 285 THR A O   1 
ATOM 1931  C CB  . THR A 1 316 ? -82.079  39.603  -10.649  1.00 172.02 ? 285 THR A CB  1 
ATOM 1932  O OG1 . THR A 1 316 ? -82.371  38.266  -10.218  1.00 171.20 ? 285 THR A OG1 1 
ATOM 1933  C CG2 . THR A 1 316 ? -81.943  39.630  -12.169  1.00 173.21 ? 285 THR A CG2 1 
ATOM 1934  N N   . GLN A 1 317 ? -81.536  41.893  -8.496   1.00 171.11 ? 286 GLN A N   1 
ATOM 1935  C CA  . GLN A 1 317 ? -81.778  42.485  -7.164   1.00 171.33 ? 286 GLN A CA  1 
ATOM 1936  C C   . GLN A 1 317 ? -83.206  42.351  -6.622   1.00 173.27 ? 286 GLN A C   1 
ATOM 1937  O O   . GLN A 1 317 ? -84.065  43.169  -6.927   1.00 176.34 ? 286 GLN A O   1 
ATOM 1938  C CB  . GLN A 1 317 ? -81.312  43.943  -7.082   1.00 172.34 ? 286 GLN A CB  1 
ATOM 1939  C CG  . GLN A 1 317 ? -81.346  44.477  -5.641   1.00 173.43 ? 286 GLN A CG  1 
ATOM 1940  C CD  . GLN A 1 317 ? -80.388  45.626  -5.388   1.00 174.86 ? 286 GLN A CD  1 
ATOM 1941  O OE1 . GLN A 1 317 ? -80.746  46.798  -5.549   1.00 177.48 ? 286 GLN A OE1 1 
ATOM 1942  N NE2 . GLN A 1 317 ? -79.164  45.296  -4.959   1.00 173.06 ? 286 GLN A NE2 1 
ATOM 1943  N N   . TYR A 1 318 ? -83.425  41.344  -5.775   1.00 171.98 ? 287 TYR A N   1 
ATOM 1944  C CA  . TYR A 1 318 ? -84.763  40.954  -5.306   1.00 173.82 ? 287 TYR A CA  1 
ATOM 1945  C C   . TYR A 1 318 ? -85.096  41.501  -3.913   1.00 174.20 ? 287 TYR A C   1 
ATOM 1946  O O   . TYR A 1 318 ? -84.785  40.888  -2.886   1.00 172.60 ? 287 TYR A O   1 
ATOM 1947  C CB  . TYR A 1 318 ? -84.890  39.424  -5.355   1.00 173.04 ? 287 TYR A CB  1 
ATOM 1948  C CG  . TYR A 1 318 ? -86.260  38.830  -5.078   1.00 176.09 ? 287 TYR A CG  1 
ATOM 1949  C CD1 . TYR A 1 318 ? -87.113  38.475  -6.126   1.00 178.92 ? 287 TYR A CD1 1 
ATOM 1950  C CD2 . TYR A 1 318 ? -86.679  38.570  -3.770   1.00 176.87 ? 287 TYR A CD2 1 
ATOM 1951  C CE1 . TYR A 1 318 ? -88.362  37.902  -5.878   1.00 182.39 ? 287 TYR A CE1 1 
ATOM 1952  C CE2 . TYR A 1 318 ? -87.925  38.000  -3.508   1.00 179.92 ? 287 TYR A CE2 1 
ATOM 1953  C CZ  . TYR A 1 318 ? -88.760  37.667  -4.564   1.00 182.83 ? 287 TYR A CZ  1 
ATOM 1954  O OH  . TYR A 1 318 ? -89.986  37.100  -4.297   1.00 186.24 ? 287 TYR A OH  1 
ATOM 1955  N N   . GLU A 1 319 ? -85.735  42.665  -3.901   1.00 176.45 ? 288 GLU A N   1 
ATOM 1956  C CA  . GLU A 1 319 ? -86.208  43.290  -2.675   1.00 177.82 ? 288 GLU A CA  1 
ATOM 1957  C C   . GLU A 1 319 ? -85.076  43.570  -1.690   1.00 175.27 ? 288 GLU A C   1 
ATOM 1958  O O   . GLU A 1 319 ? -85.023  42.984  -0.612   1.00 174.23 ? 288 GLU A O   1 
ATOM 1959  C CB  . GLU A 1 319 ? -87.326  42.451  -2.022   1.00 179.45 ? 288 GLU A CB  1 
ATOM 1960  C CG  . GLU A 1 319 ? -88.676  42.500  -2.776   1.00 183.98 ? 288 GLU A CG  1 
ATOM 1961  C CD  . GLU A 1 319 ? -89.866  41.902  -2.000   1.00 186.81 ? 288 GLU A CD  1 
ATOM 1962  O OE1 . GLU A 1 319 ? -89.651  41.083  -1.067   1.00 184.93 ? 288 GLU A OE1 1 
ATOM 1963  O OE2 . GLU A 1 319 ? -91.024  42.254  -2.348   1.00 190.36 ? 288 GLU A OE2 1 
ATOM 1964  N N   . GLY A 1 320 ? -84.173  44.466  -2.079   1.00 174.56 ? 289 GLY A N   1 
ATOM 1965  C CA  . GLY A 1 320 ? -83.106  44.933  -1.194   1.00 173.17 ? 289 GLY A CA  1 
ATOM 1966  C C   . GLY A 1 320 ? -81.752  44.315  -1.488   1.00 169.87 ? 289 GLY A C   1 
ATOM 1967  O O   . GLY A 1 320 ? -80.863  44.978  -2.027   1.00 169.62 ? 289 GLY A O   1 
ATOM 1968  N N   . LYS A 1 321 ? -81.596  43.046  -1.115   1.00 167.60 ? 290 LYS A N   1 
ATOM 1969  C CA  . LYS A 1 321 ? -80.381  42.279  -1.401   1.00 164.64 ? 290 LYS A CA  1 
ATOM 1970  C C   . LYS A 1 321 ? -80.409  41.619  -2.797   1.00 163.68 ? 290 LYS A C   1 
ATOM 1971  O O   . LYS A 1 321 ? -81.483  41.451  -3.391   1.00 165.20 ? 290 LYS A O   1 
ATOM 1972  C CB  . LYS A 1 321 ? -80.137  41.221  -0.311   1.00 163.16 ? 290 LYS A CB  1 
ATOM 1973  C CG  . LYS A 1 321 ? -79.126  41.622  0.748    1.00 162.42 ? 290 LYS A CG  1 
ATOM 1974  C CD  . LYS A 1 321 ? -79.813  42.065  2.011    1.00 164.29 ? 290 LYS A CD  1 
ATOM 1975  C CE  . LYS A 1 321 ? -78.831  42.759  2.931    1.00 164.91 ? 290 LYS A CE  1 
ATOM 1976  N NZ  . LYS A 1 321 ? -79.362  42.897  4.320    1.00 166.61 ? 290 LYS A NZ  1 
ATOM 1977  N N   . LEU A 1 322 ? -79.223  41.252  -3.298   1.00 161.28 ? 291 LEU A N   1 
ATOM 1978  C CA  . LEU A 1 322 ? -79.047  40.560  -4.586   1.00 159.85 ? 291 LEU A CA  1 
ATOM 1979  C C   . LEU A 1 322 ? -79.192  39.035  -4.427   1.00 158.61 ? 291 LEU A C   1 
ATOM 1980  O O   . LEU A 1 322 ? -78.680  38.464  -3.461   1.00 157.48 ? 291 LEU A O   1 
ATOM 1981  C CB  . LEU A 1 322 ? -77.673  40.908  -5.177   1.00 158.46 ? 291 LEU A CB  1 
ATOM 1982  C CG  . LEU A 1 322 ? -77.365  42.374  -5.509   1.00 159.04 ? 291 LEU A CG  1 
ATOM 1983  C CD1 . LEU A 1 322 ? -75.907  42.661  -5.350   1.00 157.38 ? 291 LEU A CD1 1 
ATOM 1984  C CD2 . LEU A 1 322 ? -77.789  42.707  -6.913   1.00 159.64 ? 291 LEU A CD2 1 
ATOM 1985  N N   . ARG A 1 323 ? -79.882  38.383  -5.366   1.00 159.09 ? 292 ARG A N   1 
ATOM 1986  C CA  . ARG A 1 323 ? -80.126  36.934  -5.276   1.00 158.71 ? 292 ARG A CA  1 
ATOM 1987  C C   . ARG A 1 323 ? -79.478  36.133  -6.401   1.00 158.10 ? 292 ARG A C   1 
ATOM 1988  O O   . ARG A 1 323 ? -79.201  36.675  -7.470   1.00 158.19 ? 292 ARG A O   1 
ATOM 1989  C CB  . ARG A 1 323 ? -81.627  36.632  -5.238   1.00 160.79 ? 292 ARG A CB  1 
ATOM 1990  C CG  . ARG A 1 323 ? -82.328  37.250  -4.065   1.00 161.41 ? 292 ARG A CG  1 
ATOM 1991  C CD  . ARG A 1 323 ? -83.476  36.400  -3.578   1.00 163.56 ? 292 ARG A CD  1 
ATOM 1992  N NE  . ARG A 1 323 ? -83.970  36.902  -2.292   1.00 165.15 ? 292 ARG A NE  1 
ATOM 1993  C CZ  . ARG A 1 323 ? -84.753  36.228  -1.446   1.00 166.29 ? 292 ARG A CZ  1 
ATOM 1994  N NH1 . ARG A 1 323 ? -85.161  34.994  -1.734   1.00 166.79 ? 292 ARG A NH1 1 
ATOM 1995  N NH2 . ARG A 1 323 ? -85.125  36.793  -0.301   1.00 166.68 ? 292 ARG A NH2 1 
ATOM 1996  N N   . LEU A 1 324 ? -79.214  34.850  -6.144   1.00 157.74 ? 293 LEU A N   1 
ATOM 1997  C CA  . LEU A 1 324 ? -79.023  33.899  -7.235   1.00 158.37 ? 293 LEU A CA  1 
ATOM 1998  C C   . LEU A 1 324 ? -80.400  33.378  -7.595   1.00 161.42 ? 293 LEU A C   1 
ATOM 1999  O O   . LEU A 1 324 ? -81.173  32.951  -6.729   1.00 162.39 ? 293 LEU A O   1 
ATOM 2000  C CB  . LEU A 1 324 ? -78.087  32.726  -6.900   1.00 156.97 ? 293 LEU A CB  1 
ATOM 2001  C CG  . LEU A 1 324 ? -77.645  31.899  -8.131   1.00 156.48 ? 293 LEU A CG  1 
ATOM 2002  C CD1 . LEU A 1 324 ? -76.340  32.423  -8.712   1.00 153.73 ? 293 LEU A CD1 1 
ATOM 2003  C CD2 . LEU A 1 324 ? -77.538  30.396  -7.866   1.00 155.94 ? 293 LEU A CD2 1 
ATOM 2004  N N   . VAL A 1 325 ? -80.692  33.437  -8.887   1.00 163.37 ? 294 VAL A N   1 
ATOM 2005  C CA  . VAL A 1 325 ? -81.984  33.083  -9.420   1.00 166.73 ? 294 VAL A CA  1 
ATOM 2006  C C   . VAL A 1 325 ? -81.752  31.986  -10.453  1.00 168.17 ? 294 VAL A C   1 
ATOM 2007  O O   . VAL A 1 325 ? -81.001  32.170  -11.414  1.00 167.21 ? 294 VAL A O   1 
ATOM 2008  C CB  . VAL A 1 325 ? -82.663  34.330  -10.035  1.00 168.09 ? 294 VAL A CB  1 
ATOM 2009  C CG1 . VAL A 1 325 ? -83.982  33.964  -10.661  1.00 172.06 ? 294 VAL A CG1 1 
ATOM 2010  C CG2 . VAL A 1 325 ? -82.869  35.412  -8.974   1.00 167.02 ? 294 VAL A CG2 1 
ATOM 2011  N N   . GLU A 1 326 ? -82.376  30.836  -10.229  1.00 170.86 ? 295 GLU A N   1 
ATOM 2012  C CA  . GLU A 1 326 ? -82.190  29.687  -11.103  1.00 173.44 ? 295 GLU A CA  1 
ATOM 2013  C C   . GLU A 1 326 ? -83.278  29.566  -12.177  1.00 177.97 ? 295 GLU A C   1 
ATOM 2014  O O   . GLU A 1 326 ? -84.370  30.135  -12.051  1.00 179.88 ? 295 GLU A O   1 
ATOM 2015  C CB  . GLU A 1 326 ? -82.116  28.402  -10.274  1.00 173.76 ? 295 GLU A CB  1 
ATOM 2016  N N   . ILE A 1 327 ? -82.960  28.824  -13.237  1.00 180.38 ? 296 ILE A N   1 
ATOM 2017  C CA  . ILE A 1 327 ? -83.932  28.451  -14.271  1.00 185.37 ? 296 ILE A CA  1 
ATOM 2018  C C   . ILE A 1 327 ? -84.919  27.430  -13.688  1.00 189.10 ? 296 ILE A C   1 
ATOM 2019  O O   . ILE A 1 327 ? -86.123  27.508  -13.934  1.00 192.59 ? 296 ILE A O   1 
ATOM 2020  C CB  . ILE A 1 327 ? -83.250  27.793  -15.503  1.00 186.33 ? 296 ILE A CB  1 
ATOM 2021  C CG1 . ILE A 1 327 ? -81.781  28.218  -15.628  1.00 182.78 ? 296 ILE A CG1 1 
ATOM 2022  C CG2 . ILE A 1 327 ? -84.051  28.069  -16.776  1.00 189.54 ? 296 ILE A CG2 1 
ATOM 2023  C CD1 . ILE A 1 327 ? -80.832  27.028  -15.739  1.00 183.29 ? 296 ILE A CD1 1 
ATOM 2024  N N   . ALA A 1 328 ? -84.390  26.483  -12.913  1.00 188.85 ? 297 ALA A N   1 
ATOM 2025  C CA  . ALA A 1 328 ? -85.184  25.452  -12.249  1.00 192.43 ? 297 ALA A CA  1 
ATOM 2026  C C   . ALA A 1 328 ? -86.254  26.022  -11.302  1.00 193.71 ? 297 ALA A C   1 
ATOM 2027  O O   . ALA A 1 328 ? -87.266  25.375  -11.041  1.00 197.28 ? 297 ALA A O   1 
ATOM 2028  C CB  . ALA A 1 328 ? -84.258  24.494  -11.504  1.00 190.71 ? 297 ALA A CB  1 
ATOM 2029  N N   . GLN A 1 329 ? -86.027  27.237  -10.806  1.00 191.46 ? 298 GLN A N   1 
ATOM 2030  C CA  . GLN A 1 329 ? -86.889  27.863  -9.801   1.00 192.80 ? 298 GLN A CA  1 
ATOM 2031  C C   . GLN A 1 329 ? -88.082  28.591  -10.376  1.00 196.53 ? 298 GLN A C   1 
ATOM 2032  O O   . GLN A 1 329 ? -89.076  28.792  -9.672   1.00 198.73 ? 298 GLN A O   1 
ATOM 2033  C CB  . GLN A 1 329 ? -86.100  28.890  -8.998   1.00 188.63 ? 298 GLN A CB  1 
ATOM 2034  C CG  . GLN A 1 329 ? -85.498  28.387  -7.710   1.00 187.27 ? 298 GLN A CG  1 
ATOM 2035  C CD  . GLN A 1 329 ? -84.226  29.132  -7.360   1.00 183.95 ? 298 GLN A CD  1 
ATOM 2036  O OE1 . GLN A 1 329 ? -84.167  30.366  -7.426   1.00 182.54 ? 298 GLN A OE1 1 
ATOM 2037  N NE2 . GLN A 1 329 ? -83.189  28.382  -6.999   1.00 182.80 ? 298 GLN A NE2 1 
ATOM 2038  N N   . VAL A 1 330 ? -87.976  29.009  -11.637  1.00 197.88 ? 299 VAL A N   1 
ATOM 2039  C CA  . VAL A 1 330 ? -88.942  29.955  -12.229  1.00 200.88 ? 299 VAL A CA  1 
ATOM 2040  C C   . VAL A 1 330 ? -90.178  29.305  -12.893  1.00 206.80 ? 299 VAL A C   1 
ATOM 2041  O O   . VAL A 1 330 ? -90.042  28.387  -13.713  1.00 208.49 ? 299 VAL A O   1 
ATOM 2042  C CB  . VAL A 1 330 ? -88.235  30.986  -13.176  1.00 198.89 ? 299 VAL A CB  1 
ATOM 2043  C CG1 . VAL A 1 330 ? -89.249  31.830  -13.952  1.00 202.16 ? 299 VAL A CG1 1 
ATOM 2044  C CG2 . VAL A 1 330 ? -87.288  31.892  -12.374  1.00 194.03 ? 299 VAL A CG2 1 
ATOM 2045  N N   . PRO A 1 331 ? -91.387  29.786  -12.513  1.00 210.24 ? 300 PRO A N   1 
ATOM 2046  C CA  . PRO A 1 331 ? -92.700  29.431  -13.076  1.00 216.67 ? 300 PRO A CA  1 
ATOM 2047  C C   . PRO A 1 331 ? -92.728  29.260  -14.607  1.00 219.67 ? 300 PRO A C   1 
ATOM 2048  O O   . PRO A 1 331 ? -92.008  29.964  -15.322  1.00 217.35 ? 300 PRO A O   1 
ATOM 2049  C CB  . PRO A 1 331 ? -93.578  30.620  -12.667  1.00 217.87 ? 300 PRO A CB  1 
ATOM 2050  C CG  . PRO A 1 331 ? -92.990  31.090  -11.373  1.00 213.14 ? 300 PRO A CG  1 
ATOM 2051  C CD  . PRO A 1 331 ? -91.536  30.671  -11.337  1.00 208.16 ? 300 PRO A CD  1 
ATOM 2052  N N   . LYS A 1 332 ? -93.578  28.345  -15.085  1.00 225.27 ? 301 LYS A N   1 
ATOM 2053  C CA  . LYS A 1 332 ? -93.673  27.984  -16.512  1.00 228.80 ? 301 LYS A CA  1 
ATOM 2054  C C   . LYS A 1 332 ? -93.834  29.188  -17.452  1.00 229.36 ? 301 LYS A C   1 
ATOM 2055  O O   . LYS A 1 332 ? -93.540  29.094  -18.650  1.00 230.46 ? 301 LYS A O   1 
ATOM 2056  C CB  . LYS A 1 332 ? -94.812  26.974  -16.737  1.00 235.54 ? 301 LYS A CB  1 
ATOM 2057  N N   . ALA A 1 333 ? -94.274  30.314  -16.889  1.00 228.74 ? 302 ALA A N   1 
ATOM 2058  C CA  . ALA A 1 333 ? -94.635  31.504  -17.662  1.00 230.37 ? 302 ALA A CA  1 
ATOM 2059  C C   . ALA A 1 333 ? -93.450  32.388  -18.050  1.00 225.41 ? 302 ALA A C   1 
ATOM 2060  O O   . ALA A 1 333 ? -93.558  33.214  -18.956  1.00 226.60 ? 302 ALA A O   1 
ATOM 2061  C CB  . ALA A 1 333 ? -95.696  32.322  -16.915  1.00 232.58 ? 302 ALA A CB  1 
ATOM 2062  N N   . HIS A 1 334 ? -92.324  32.219  -17.369  1.00 220.31 ? 303 HIS A N   1 
ATOM 2063  C CA  . HIS A 1 334 ? -91.171  33.093  -17.593  1.00 216.02 ? 303 HIS A CA  1 
ATOM 2064  C C   . HIS A 1 334 ? -89.831  32.336  -17.761  1.00 212.31 ? 303 HIS A C   1 
ATOM 2065  O O   . HIS A 1 334 ? -88.778  32.816  -17.323  1.00 207.78 ? 303 HIS A O   1 
ATOM 2066  C CB  . HIS A 1 334 ? -91.065  34.146  -16.470  1.00 213.18 ? 303 HIS A CB  1 
ATOM 2067  C CG  . HIS A 1 334 ? -92.309  34.963  -16.266  1.00 217.19 ? 303 HIS A CG  1 
ATOM 2068  N ND1 . HIS A 1 334 ? -92.616  36.063  -17.037  1.00 219.09 ? 303 HIS A ND1 1 
ATOM 2069  C CD2 . HIS A 1 334 ? -93.307  34.856  -15.357  1.00 219.97 ? 303 HIS A CD2 1 
ATOM 2070  C CE1 . HIS A 1 334 ? -93.755  36.589  -16.624  1.00 222.58 ? 303 HIS A CE1 1 
ATOM 2071  N NE2 . HIS A 1 334 ? -94.195  35.875  -15.605  1.00 223.21 ? 303 HIS A NE2 1 
ATOM 2072  N N   . VAL A 1 335 ? -89.871  31.161  -18.395  1.00 214.62 ? 304 VAL A N   1 
ATOM 2073  C CA  . VAL A 1 335 ? -88.644  30.408  -18.720  1.00 211.63 ? 304 VAL A CA  1 
ATOM 2074  C C   . VAL A 1 335 ? -87.956  31.046  -19.947  1.00 210.54 ? 304 VAL A C   1 
ATOM 2075  O O   . VAL A 1 335 ? -86.723  30.999  -20.082  1.00 207.04 ? 304 VAL A O   1 
ATOM 2076  C CB  . VAL A 1 335 ? -88.921  28.869  -18.916  1.00 215.03 ? 304 VAL A CB  1 
ATOM 2077  C CG1 . VAL A 1 335 ? -87.665  28.111  -19.367  1.00 212.85 ? 304 VAL A CG1 1 
ATOM 2078  C CG2 . VAL A 1 335 ? -89.473  28.244  -17.632  1.00 215.24 ? 304 VAL A CG2 1 
ATOM 2079  N N   . ASP A 1 336 ? -88.760  31.661  -20.815  1.00 213.54 ? 305 ASP A N   1 
ATOM 2080  C CA  . ASP A 1 336 ? -88.243  32.360  -21.987  1.00 212.83 ? 305 ASP A CA  1 
ATOM 2081  C C   . ASP A 1 336 ? -87.792  33.790  -21.695  1.00 209.15 ? 305 ASP A C   1 
ATOM 2082  O O   . ASP A 1 336 ? -86.906  34.304  -22.373  1.00 207.29 ? 305 ASP A O   1 
ATOM 2083  C CB  . ASP A 1 336 ? -89.266  32.340  -23.126  1.00 218.71 ? 305 ASP A CB  1 
ATOM 2084  C CG  . ASP A 1 336 ? -89.386  30.972  -23.781  1.00 222.36 ? 305 ASP A CG  1 
ATOM 2085  O OD1 . ASP A 1 336 ? -89.246  29.951  -23.064  1.00 221.89 ? 305 ASP A OD1 1 
ATOM 2086  O OD2 . ASP A 1 336 ? -89.626  30.919  -25.011  1.00 226.23 ? 305 ASP A OD2 1 
ATOM 2087  N N   . GLU A 1 337 ? -88.393  34.429  -20.692  1.00 208.32 ? 306 GLU A N   1 
ATOM 2088  C CA  . GLU A 1 337 ? -88.013  35.796  -20.319  1.00 205.29 ? 306 GLU A CA  1 
ATOM 2089  C C   . GLU A 1 337 ? -86.594  35.890  -19.760  1.00 199.66 ? 306 GLU A C   1 
ATOM 2090  O O   . GLU A 1 337 ? -85.913  36.900  -19.960  1.00 197.79 ? 306 GLU A O   1 
ATOM 2091  C CB  . GLU A 1 337 ? -89.025  36.402  -19.348  1.00 206.81 ? 306 GLU A CB  1 
ATOM 2092  C CG  . GLU A 1 337 ? -90.198  37.075  -20.050  1.00 212.09 ? 306 GLU A CG  1 
ATOM 2093  C CD  . GLU A 1 337 ? -91.327  37.471  -19.107  1.00 214.79 ? 306 GLU A CD  1 
ATOM 2094  O OE1 . GLU A 1 337 ? -91.078  38.142  -18.082  1.00 212.54 ? 306 GLU A OE1 1 
ATOM 2095  O OE2 . GLU A 1 337 ? -92.483  37.113  -19.400  1.00 219.79 ? 306 GLU A OE2 1 
ATOM 2096  N N   . PHE A 1 338 ? -86.159  34.839  -19.061  1.00 197.26 ? 307 PHE A N   1 
ATOM 2097  C CA  . PHE A 1 338 ? -84.766  34.702  -18.631  1.00 192.18 ? 307 PHE A CA  1 
ATOM 2098  C C   . PHE A 1 338 ? -83.907  34.286  -19.823  1.00 191.48 ? 307 PHE A C   1 
ATOM 2099  O O   . PHE A 1 338 ? -84.365  33.570  -20.719  1.00 194.37 ? 307 PHE A O   1 
ATOM 2100  C CB  . PHE A 1 338 ? -84.629  33.697  -17.481  1.00 190.58 ? 307 PHE A CB  1 
ATOM 2101  N N   . LYS A 1 339 ? -82.663  34.752  -19.817  1.00 187.66 ? 308 LYS A N   1 
ATOM 2102  C CA  . LYS A 1 339 ? -81.703  34.529  -20.898  1.00 186.50 ? 308 LYS A CA  1 
ATOM 2103  C C   . LYS A 1 339 ? -82.019  35.410  -22.093  1.00 188.08 ? 308 LYS A C   1 
ATOM 2104  O O   . LYS A 1 339 ? -82.374  34.916  -23.163  1.00 190.71 ? 308 LYS A O   1 
ATOM 2105  C CB  . LYS A 1 339 ? -81.610  33.046  -21.298  1.00 187.93 ? 308 LYS A CB  1 
ATOM 2106  N N   . SER A 1 340 ? -81.894  36.717  -21.896  1.00 185.54 ? 309 SER A N   1 
ATOM 2107  C CA  . SER A 1 340 ? -82.081  37.659  -22.975  1.00 187.29 ? 309 SER A CA  1 
ATOM 2108  C C   . SER A 1 340 ? -83.542  37.656  -23.449  1.00 190.20 ? 309 SER A C   1 
ATOM 2109  O O   . SER A 1 340 ? -84.206  36.626  -23.326  1.00 190.77 ? 309 SER A O   1 
ATOM 2110  C CB  . SER A 1 340 ? -81.120  37.328  -24.114  1.00 187.34 ? 309 SER A CB  1 
ATOM 2111  O OG  . SER A 1 340 ? -79.803  37.268  -23.611  1.00 183.86 ? 309 SER A OG  1 
ATOM 2112  N N   . VAL A 1 341 ? -84.074  38.774  -23.970  1.00 192.11 ? 310 VAL A N   1 
ATOM 2113  C CA  . VAL A 1 341 ? -83.382  40.063  -24.147  1.00 191.64 ? 310 VAL A CA  1 
ATOM 2114  C C   . VAL A 1 341 ? -82.449  40.333  -22.968  1.00 188.71 ? 310 VAL A C   1 
ATOM 2115  O O   . VAL A 1 341 ? -82.872  40.324  -21.802  1.00 187.70 ? 310 VAL A O   1 
ATOM 2116  C CB  . VAL A 1 341 ? -84.384  41.235  -24.374  1.00 194.06 ? 310 VAL A CB  1 
ATOM 2117  C CG1 . VAL A 1 341 ? -83.652  42.494  -24.815  1.00 194.19 ? 310 VAL A CG1 1 
ATOM 2118  C CG2 . VAL A 1 341 ? -85.427  40.855  -25.419  1.00 196.72 ? 310 VAL A CG2 1 
ATOM 2119  N N   . SER A 1 342 ? -81.174  40.543  -23.296  1.00 187.35 ? 311 SER A N   1 
ATOM 2120  C CA  . SER A 1 342 ? -80.090  40.491  -22.318  1.00 184.57 ? 311 SER A CA  1 
ATOM 2121  C C   . SER A 1 342 ? -80.066  41.665  -21.322  1.00 183.95 ? 311 SER A C   1 
ATOM 2122  O O   . SER A 1 342 ? -79.047  42.376  -21.189  1.00 183.00 ? 311 SER A O   1 
ATOM 2123  C CB  . SER A 1 342 ? -78.723  40.306  -23.016  1.00 183.63 ? 311 SER A CB  1 
ATOM 2124  O OG  . SER A 1 342 ? -78.982  39.389  -24.251  1.00 185.08 ? 311 SER A OG  1 
ATOM 2125  N N   . LYS A 1 343 ? -81.207  41.847  -20.636  1.00 184.51 ? 312 LYS A N   1 
ATOM 2126  C CA  . LYS A 1 343 ? -81.315  42.650  -19.403  1.00 183.28 ? 312 LYS A CA  1 
ATOM 2127  C C   . LYS A 1 343 ? -80.670  41.845  -18.244  1.00 180.20 ? 312 LYS A C   1 
ATOM 2128  O O   . LYS A 1 343 ? -80.691  42.259  -17.071  1.00 179.75 ? 312 LYS A O   1 
ATOM 2129  C CB  . LYS A 1 343 ? -82.791  42.988  -19.098  1.00 185.38 ? 312 LYS A CB  1 
ATOM 2130  C CG  . LYS A 1 343 ? -83.086  44.486  -18.912  1.00 186.61 ? 312 LYS A CG  1 
ATOM 2131  C CD  . LYS A 1 343 ? -82.247  45.094  -17.792  1.00 184.59 ? 312 LYS A CD  1 
ATOM 2132  C CE  . LYS A 1 343 ? -81.511  46.337  -18.264  1.00 184.54 ? 312 LYS A CE  1 
ATOM 2133  N NZ  . LYS A 1 343 ? -80.235  46.510  -17.528  1.00 181.80 ? 312 LYS A NZ  1 
ATOM 2134  N N   . PHE A 1 344 ? -80.099  40.696  -18.618  1.00 177.95 ? 313 PHE A N   1 
ATOM 2135  C CA  . PHE A 1 344 ? -79.421  39.765  -17.742  1.00 174.35 ? 313 PHE A CA  1 
ATOM 2136  C C   . PHE A 1 344 ? -78.206  39.323  -18.516  1.00 172.58 ? 313 PHE A C   1 
ATOM 2137  O O   . PHE A 1 344 ? -78.135  38.186  -18.981  1.00 172.28 ? 313 PHE A O   1 
ATOM 2138  C CB  . PHE A 1 344 ? -80.335  38.575  -17.441  1.00 174.68 ? 313 PHE A CB  1 
ATOM 2139  C CG  . PHE A 1 344 ? -81.752  38.976  -17.181  1.00 176.77 ? 313 PHE A CG  1 
ATOM 2140  C CD1 . PHE A 1 344 ? -82.166  39.297  -15.888  1.00 176.67 ? 313 PHE A CD1 1 
ATOM 2141  C CD2 . PHE A 1 344 ? -82.662  39.089  -18.234  1.00 179.00 ? 313 PHE A CD2 1 
ATOM 2142  C CE1 . PHE A 1 344 ? -83.465  39.701  -15.639  1.00 178.47 ? 313 PHE A CE1 1 
ATOM 2143  C CE2 . PHE A 1 344 ? -83.960  39.496  -17.999  1.00 181.24 ? 313 PHE A CE2 1 
ATOM 2144  C CZ  . PHE A 1 344 ? -84.366  39.801  -16.696  1.00 181.20 ? 313 PHE A CZ  1 
ATOM 2145  N N   . LYS A 1 345 ? -77.270  40.252  -18.693  1.00 171.22 ? 314 LYS A N   1 
ATOM 2146  C CA  . LYS A 1 345 ? -75.955  39.945  -19.256  1.00 169.68 ? 314 LYS A CA  1 
ATOM 2147  C C   . LYS A 1 345 ? -75.019  39.401  -18.142  1.00 166.91 ? 314 LYS A C   1 
ATOM 2148  O O   . LYS A 1 345 ? -73.799  39.611  -18.147  1.00 165.98 ? 314 LYS A O   1 
ATOM 2149  C CB  . LYS A 1 345 ? -75.383  41.191  -19.943  1.00 170.33 ? 314 LYS A CB  1 
ATOM 2150  N N   . ILE A 1 346 ? -75.628  38.666  -17.210  1.00 165.42 ? 315 ILE A N   1 
ATOM 2151  C CA  . ILE A 1 346 ? -75.057  38.316  -15.914  1.00 162.36 ? 315 ILE A CA  1 
ATOM 2152  C C   . ILE A 1 346 ? -74.967  36.799  -15.811  1.00 160.91 ? 315 ILE A C   1 
ATOM 2153  O O   . ILE A 1 346 ? -75.942  36.094  -16.043  1.00 161.64 ? 315 ILE A O   1 
ATOM 2154  C CB  . ILE A 1 346 ? -75.976  38.841  -14.778  1.00 162.77 ? 315 ILE A CB  1 
ATOM 2155  C CG1 . ILE A 1 346 ? -76.279  40.349  -14.965  1.00 164.51 ? 315 ILE A CG1 1 
ATOM 2156  C CG2 . ILE A 1 346 ? -75.388  38.522  -13.404  1.00 160.82 ? 315 ILE A CG2 1 
ATOM 2157  C CD1 . ILE A 1 346 ? -77.745  40.809  -14.653  1.00 165.49 ? 315 ILE A CD1 1 
ATOM 2158  N N   . PHE A 1 347 ? -73.790  36.300  -15.458  1.00 158.67 ? 316 PHE A N   1 
ATOM 2159  C CA  . PHE A 1 347 ? -73.563  34.863  -15.368  1.00 157.11 ? 316 PHE A CA  1 
ATOM 2160  C C   . PHE A 1 347 ? -72.696  34.477  -14.156  1.00 154.41 ? 316 PHE A C   1 
ATOM 2161  O O   . PHE A 1 347 ? -71.766  35.196  -13.770  1.00 153.08 ? 316 PHE A O   1 
ATOM 2162  C CB  . PHE A 1 347 ? -72.983  34.351  -16.693  1.00 158.00 ? 316 PHE A CB  1 
ATOM 2163  C CG  . PHE A 1 347 ? -72.769  32.879  -16.730  1.00 158.92 ? 316 PHE A CG  1 
ATOM 2164  C CD1 . PHE A 1 347 ? -73.740  32.005  -16.232  1.00 160.36 ? 316 PHE A CD1 1 
ATOM 2165  C CD2 . PHE A 1 347 ? -71.599  32.354  -17.271  1.00 159.66 ? 316 PHE A CD2 1 
ATOM 2166  C CE1 . PHE A 1 347 ? -73.540  30.621  -16.258  1.00 161.51 ? 316 PHE A CE1 1 
ATOM 2167  C CE2 . PHE A 1 347 ? -71.381  30.976  -17.302  1.00 160.78 ? 316 PHE A CE2 1 
ATOM 2168  C CZ  . PHE A 1 347 ? -72.355  30.102  -16.802  1.00 161.46 ? 316 PHE A CZ  1 
ATOM 2169  N N   . ASN A 1 348 ? -73.025  33.338  -13.555  1.00 152.99 ? 317 ASN A N   1 
ATOM 2170  C CA  . ASN A 1 348 ? -72.315  32.860  -12.373  1.00 150.69 ? 317 ASN A CA  1 
ATOM 2171  C C   . ASN A 1 348 ? -70.974  32.180  -12.661  1.00 149.05 ? 317 ASN A C   1 
ATOM 2172  O O   . ASN A 1 348 ? -70.928  31.056  -13.171  1.00 149.02 ? 317 ASN A O   1 
ATOM 2173  C CB  . ASN A 1 348 ? -73.205  31.909  -11.571  1.00 151.07 ? 317 ASN A CB  1 
ATOM 2174  C CG  . ASN A 1 348 ? -72.557  31.467  -10.265  1.00 149.91 ? 317 ASN A CG  1 
ATOM 2175  O OD1 . ASN A 1 348 ? -71.903  32.260  -9.584   1.00 148.59 ? 317 ASN A OD1 1 
ATOM 2176  N ND2 . ASN A 1 348 ? -72.740  30.197  -9.911   1.00 150.16 ? 317 ASN A ND2 1 
ATOM 2177  N N   . THR A 1 349 ? -69.888  32.859  -12.304  1.00 147.22 ? 318 THR A N   1 
ATOM 2178  C CA  . THR A 1 349 ? -68.540  32.324  -12.497  1.00 145.90 ? 318 THR A CA  1 
ATOM 2179  C C   . THR A 1 349 ? -68.314  31.121  -11.604  1.00 144.82 ? 318 THR A C   1 
ATOM 2180  O O   . THR A 1 349 ? -67.641  30.169  -11.978  1.00 144.91 ? 318 THR A O   1 
ATOM 2181  C CB  . THR A 1 349 ? -67.461  33.361  -12.143  1.00 145.12 ? 318 THR A CB  1 
ATOM 2182  O OG1 . THR A 1 349 ? -67.840  34.642  -12.642  1.00 145.95 ? 318 THR A OG1 1 
ATOM 2183  C CG2 . THR A 1 349 ? -66.155  32.989  -12.771  1.00 145.00 ? 318 THR A CG2 1 
ATOM 2184  N N   . ASN A 1 350 ? -68.924  31.183  -10.426  1.00 143.91 ? 319 ASN A N   1 
ATOM 2185  C CA  . ASN A 1 350 ? -68.638  30.328  -9.269   1.00 142.47 ? 319 ASN A CA  1 
ATOM 2186  C C   . ASN A 1 350 ? -67.285  30.618  -8.668   1.00 140.86 ? 319 ASN A C   1 
ATOM 2187  O O   . ASN A 1 350 ? -66.663  29.785  -8.018   1.00 140.22 ? 319 ASN A O   1 
ATOM 2188  C CB  . ASN A 1 350 ? -68.842  28.843  -9.541   1.00 143.02 ? 319 ASN A CB  1 
ATOM 2189  C CG  . ASN A 1 350 ? -69.693  28.189  -8.474   1.00 143.74 ? 319 ASN A CG  1 
ATOM 2190  O OD1 . ASN A 1 350 ? -69.845  28.720  -7.362   1.00 143.02 ? 319 ASN A OD1 1 
ATOM 2191  N ND2 . ASN A 1 350 ? -70.285  27.047  -8.812   1.00 146.12 ? 319 ASN A ND2 1 
ATOM 2192  N N   . ASN A 1 351 ? -66.853  31.842  -8.911   1.00 140.00 ? 320 ASN A N   1 
ATOM 2193  C CA  . ASN A 1 351 ? -65.738  32.413  -8.224   1.00 138.96 ? 320 ASN A CA  1 
ATOM 2194  C C   . ASN A 1 351 ? -66.273  33.399  -7.202   1.00 138.57 ? 320 ASN A C   1 
ATOM 2195  O O   . ASN A 1 351 ? -67.127  34.222  -7.515   1.00 139.38 ? 320 ASN A O   1 
ATOM 2196  C CB  . ASN A 1 351 ? -64.846  33.100  -9.223   1.00 138.97 ? 320 ASN A CB  1 
ATOM 2197  C CG  . ASN A 1 351 ? -64.239  32.142  -10.202  1.00 139.68 ? 320 ASN A CG  1 
ATOM 2198  O OD1 . ASN A 1 351 ? -63.627  32.563  -11.178  1.00 141.05 ? 320 ASN A OD1 1 
ATOM 2199  N ND2 . ASN A 1 351 ? -64.392  30.840  -9.952   1.00 140.22 ? 320 ASN A ND2 1 
ATOM 2200  N N   . LEU A 1 352 ? -65.790  33.301  -5.970   1.00 137.50 ? 321 LEU A N   1 
ATOM 2201  C CA  . LEU A 1 352 ? -66.416  33.991  -4.872   1.00 136.89 ? 321 LEU A CA  1 
ATOM 2202  C C   . LEU A 1 352 ? -65.407  34.220  -3.788   1.00 136.44 ? 321 LEU A C   1 
ATOM 2203  O O   . LEU A 1 352 ? -64.600  33.345  -3.491   1.00 136.05 ? 321 LEU A O   1 
ATOM 2204  C CB  . LEU A 1 352 ? -67.561  33.149  -4.304   1.00 137.06 ? 321 LEU A CB  1 
ATOM 2205  C CG  . LEU A 1 352 ? -68.317  32.202  -5.234   1.00 136.67 ? 321 LEU A CG  1 
ATOM 2206  C CD1 . LEU A 1 352 ? -67.752  30.821  -5.111   1.00 136.65 ? 321 LEU A CD1 1 
ATOM 2207  C CD2 . LEU A 1 352 ? -69.767  32.163  -4.892   1.00 137.40 ? 321 LEU A CD2 1 
ATOM 2208  N N   . TRP A 1 353 ? -65.460  35.413  -3.211   1.00 136.66 ? 322 TRP A N   1 
ATOM 2209  C CA  . TRP A 1 353 ? -64.816  35.708  -1.939   1.00 136.72 ? 322 TRP A CA  1 
ATOM 2210  C C   . TRP A 1 353 ? -65.866  35.735  -0.845   1.00 137.24 ? 322 TRP A C   1 
ATOM 2211  O O   . TRP A 1 353 ? -67.033  35.834  -1.136   1.00 137.83 ? 322 TRP A O   1 
ATOM 2212  C CB  . TRP A 1 353 ? -64.076  37.032  -2.016   1.00 136.84 ? 322 TRP A CB  1 
ATOM 2213  C CG  . TRP A 1 353 ? -62.788  36.939  -2.810   1.00 137.09 ? 322 TRP A CG  1 
ATOM 2214  C CD1 . TRP A 1 353 ? -61.503  36.844  -2.314   1.00 137.90 ? 322 TRP A CD1 1 
ATOM 2215  C CD2 . TRP A 1 353 ? -62.663  36.922  -4.223   1.00 136.98 ? 322 TRP A CD2 1 
ATOM 2216  N NE1 . TRP A 1 353 ? -60.591  36.779  -3.339   1.00 136.62 ? 322 TRP A NE1 1 
ATOM 2217  C CE2 . TRP A 1 353 ? -61.275  36.830  -4.522   1.00 137.13 ? 322 TRP A CE2 1 
ATOM 2218  C CE3 . TRP A 1 353 ? -63.582  36.979  -5.272   1.00 137.16 ? 322 TRP A CE3 1 
ATOM 2219  C CZ2 . TRP A 1 353 ? -60.799  36.793  -5.817   1.00 138.12 ? 322 TRP A CZ2 1 
ATOM 2220  C CZ3 . TRP A 1 353 ? -63.113  36.945  -6.551   1.00 138.15 ? 322 TRP A CZ3 1 
ATOM 2221  C CH2 . TRP A 1 353 ? -61.729  36.849  -6.821   1.00 139.01 ? 322 TRP A CH2 1 
ATOM 2222  N N   . ILE A 1 354 ? -65.467  35.624  0.411    1.00 137.77 ? 323 ILE A N   1 
ATOM 2223  C CA  . ILE A 1 354 ? -66.439  35.496  1.498    1.00 139.23 ? 323 ILE A CA  1 
ATOM 2224  C C   . ILE A 1 354 ? -65.851  36.031  2.820    1.00 141.08 ? 323 ILE A C   1 
ATOM 2225  O O   . ILE A 1 354 ? -64.654  35.883  3.068    1.00 140.98 ? 323 ILE A O   1 
ATOM 2226  C CB  . ILE A 1 354 ? -66.943  34.003  1.645    1.00 138.61 ? 323 ILE A CB  1 
ATOM 2227  C CG1 . ILE A 1 354 ? -67.495  33.465  0.321    1.00 136.39 ? 323 ILE A CG1 1 
ATOM 2228  C CG2 . ILE A 1 354 ? -67.982  33.853  2.754    1.00 139.36 ? 323 ILE A CG2 1 
ATOM 2229  C CD1 . ILE A 1 354 ? -68.472  32.341  0.469    1.00 134.80 ? 323 ILE A CD1 1 
ATOM 2230  N N   . SER A 1 355 ? -66.674  36.664  3.658    1.00 143.43 ? 324 SER A N   1 
ATOM 2231  C CA  . SER A 1 355 ? -66.238  36.991  5.014    1.00 145.66 ? 324 SER A CA  1 
ATOM 2232  C C   . SER A 1 355 ? -66.395  35.800  5.951    1.00 146.87 ? 324 SER A C   1 
ATOM 2233  O O   . SER A 1 355 ? -67.512  35.357  6.236    1.00 147.44 ? 324 SER A O   1 
ATOM 2234  C CB  . SER A 1 355 ? -66.981  38.201  5.585    1.00 147.31 ? 324 SER A CB  1 
ATOM 2235  O OG  . SER A 1 355 ? -66.696  38.366  6.974    1.00 148.77 ? 324 SER A OG  1 
ATOM 2236  N N   . LEU A 1 356 ? -65.255  35.292  6.414    1.00 147.75 ? 325 LEU A N   1 
ATOM 2237  C CA  . LEU A 1 356 ? -65.195  34.248  7.432    1.00 149.48 ? 325 LEU A CA  1 
ATOM 2238  C C   . LEU A 1 356 ? -65.991  34.648  8.662    1.00 152.04 ? 325 LEU A C   1 
ATOM 2239  O O   . LEU A 1 356 ? -66.897  33.930  9.090    1.00 152.84 ? 325 LEU A O   1 
ATOM 2240  C CB  . LEU A 1 356 ? -63.743  34.010  7.849    1.00 149.23 ? 325 LEU A CB  1 
ATOM 2241  C CG  . LEU A 1 356 ? -62.892  33.039  7.044    1.00 147.66 ? 325 LEU A CG  1 
ATOM 2242  C CD1 . LEU A 1 356 ? -61.431  33.386  7.206    1.00 147.15 ? 325 LEU A CD1 1 
ATOM 2243  C CD2 . LEU A 1 356 ? -63.155  31.625  7.511    1.00 147.82 ? 325 LEU A CD2 1 
ATOM 2244  N N   . ALA A 1 357 ? -65.641  35.806  9.214    1.00 153.87 ? 326 ALA A N   1 
ATOM 2245  C CA  . ALA A 1 357 ? -66.279  36.323  10.413   1.00 156.86 ? 326 ALA A CA  1 
ATOM 2246  C C   . ALA A 1 357 ? -67.803  36.328  10.266   1.00 158.13 ? 326 ALA A C   1 
ATOM 2247  O O   . ALA A 1 357 ? -68.540  36.049  11.220   1.00 159.59 ? 326 ALA A O   1 
ATOM 2248  C CB  . ALA A 1 357 ? -65.749  37.723  10.714   1.00 157.93 ? 326 ALA A CB  1 
ATOM 2249  N N   . ALA A 1 358 ? -68.257  36.627  9.052    1.00 157.84 ? 327 ALA A N   1 
ATOM 2250  C CA  . ALA A 1 358 ? -69.673  36.635  8.736    1.00 159.28 ? 327 ALA A CA  1 
ATOM 2251  C C   . ALA A 1 358 ? -70.259  35.224  8.679    1.00 159.31 ? 327 ALA A C   1 
ATOM 2252  O O   . ALA A 1 358 ? -71.374  34.999  9.163    1.00 160.95 ? 327 ALA A O   1 
ATOM 2253  C CB  . ALA A 1 358 ? -69.914  37.362  7.433    1.00 158.49 ? 327 ALA A CB  1 
ATOM 2254  N N   . VAL A 1 359 ? -69.515  34.280  8.101    1.00 157.97 ? 328 VAL A N   1 
ATOM 2255  C CA  . VAL A 1 359 ? -69.995  32.903  7.975    1.00 157.90 ? 328 VAL A CA  1 
ATOM 2256  C C   . VAL A 1 359 ? -70.230  32.257  9.340    1.00 159.86 ? 328 VAL A C   1 
ATOM 2257  O O   . VAL A 1 359 ? -71.165  31.465  9.498    1.00 160.26 ? 328 VAL A O   1 
ATOM 2258  C CB  . VAL A 1 359 ? -69.037  32.030  7.159    1.00 156.02 ? 328 VAL A CB  1 
ATOM 2259  C CG1 . VAL A 1 359 ? -69.724  30.729  6.753    1.00 155.63 ? 328 VAL A CG1 1 
ATOM 2260  C CG2 . VAL A 1 359 ? -68.568  32.771  5.935    1.00 154.56 ? 328 VAL A CG2 1 
ATOM 2261  N N   . LYS A 1 360 ? -69.383  32.608  10.314   1.00 161.39 ? 329 LYS A N   1 
ATOM 2262  C CA  . LYS A 1 360 ? -69.472  32.079  11.683   1.00 163.76 ? 329 LYS A CA  1 
ATOM 2263  C C   . LYS A 1 360 ? -70.697  32.621  12.406   1.00 166.41 ? 329 LYS A C   1 
ATOM 2264  O O   . LYS A 1 360 ? -71.316  31.908  13.199   1.00 167.99 ? 329 LYS A O   1 
ATOM 2265  C CB  . LYS A 1 360 ? -68.200  32.374  12.493   1.00 164.03 ? 329 LYS A CB  1 
ATOM 2266  N N   . ARG A 1 361 ? -71.045  33.878  12.124   1.00 167.38 ? 330 ARG A N   1 
ATOM 2267  C CA  . ARG A 1 361 ? -72.226  34.511  12.715   1.00 170.03 ? 330 ARG A CA  1 
ATOM 2268  C C   . ARG A 1 361 ? -73.514  33.922  12.156   1.00 170.03 ? 330 ARG A C   1 
ATOM 2269  O O   . ARG A 1 361 ? -74.484  33.720  12.889   1.00 172.10 ? 330 ARG A O   1 
ATOM 2270  C CB  . ARG A 1 361 ? -72.221  36.022  12.472   1.00 170.84 ? 330 ARG A CB  1 
ATOM 2271  C CG  . ARG A 1 361 ? -71.153  36.818  13.233   1.00 172.48 ? 330 ARG A CG  1 
ATOM 2272  C CD  . ARG A 1 361 ? -71.363  38.334  13.073   1.00 174.78 ? 330 ARG A CD  1 
ATOM 2273  N NE  . ARG A 1 361 ? -71.359  38.764  11.668   1.00 173.73 ? 330 ARG A NE  1 
ATOM 2274  C CZ  . ARG A 1 361 ? -72.451  39.011  10.938   1.00 173.91 ? 330 ARG A CZ  1 
ATOM 2275  N NH1 . ARG A 1 361 ? -73.667  38.877  11.460   1.00 175.40 ? 330 ARG A NH1 1 
ATOM 2276  N NH2 . ARG A 1 361 ? -72.323  39.393  9.673    1.00 172.14 ? 330 ARG A NH2 1 
ATOM 2277  N N   . LEU A 1 362 ? -73.514  33.646  10.857   1.00 168.00 ? 331 LEU A N   1 
ATOM 2278  C CA  . LEU A 1 362 ? -74.726  33.229  10.167   1.00 168.08 ? 331 LEU A CA  1 
ATOM 2279  C C   . LEU A 1 362 ? -74.945  31.709  10.169   1.00 167.57 ? 331 LEU A C   1 
ATOM 2280  O O   . LEU A 1 362 ? -76.072  31.252  9.992    1.00 168.25 ? 331 LEU A O   1 
ATOM 2281  C CB  . LEU A 1 362 ? -74.780  33.835  8.755    1.00 166.70 ? 331 LEU A CB  1 
ATOM 2282  C CG  . LEU A 1 362 ? -74.856  35.376  8.709    1.00 167.56 ? 331 LEU A CG  1 
ATOM 2283  C CD1 . LEU A 1 362 ? -74.040  35.955  7.562    1.00 165.54 ? 331 LEU A CD1 1 
ATOM 2284  C CD2 . LEU A 1 362 ? -76.298  35.898  8.660    1.00 169.29 ? 331 LEU A CD2 1 
ATOM 2285  N N   . GLN A 1 363 ? -73.884  30.934  10.391   1.00 166.64 ? 332 GLN A N   1 
ATOM 2286  C CA  . GLN A 1 363 ? -74.016  29.474  10.516   1.00 166.62 ? 332 GLN A CA  1 
ATOM 2287  C C   . GLN A 1 363 ? -74.140  29.041  11.984   1.00 168.96 ? 332 GLN A C   1 
ATOM 2288  O O   . GLN A 1 363 ? -74.243  27.848  12.296   1.00 169.09 ? 332 GLN A O   1 
ATOM 2289  C CB  . GLN A 1 363 ? -72.871  28.743  9.797    1.00 164.41 ? 332 GLN A CB  1 
ATOM 2290  C CG  . GLN A 1 363 ? -73.037  27.217  9.671    1.00 163.00 ? 332 GLN A CG  1 
ATOM 2291  C CD  . GLN A 1 363 ? -74.201  26.794  8.790    1.00 161.68 ? 332 GLN A CD  1 
ATOM 2292  O OE1 . GLN A 1 363 ? -74.612  27.516  7.882    1.00 160.98 ? 332 GLN A OE1 1 
ATOM 2293  N NE2 . GLN A 1 363 ? -74.731  25.606  9.049    1.00 161.62 ? 332 GLN A NE2 1 
ATOM 2294  N N   . GLU A 1 364 ? -74.124  30.022  12.881   1.00 171.08 ? 333 GLU A N   1 
ATOM 2295  C CA  . GLU A 1 364 ? -74.501  29.797  14.271   1.00 174.03 ? 333 GLU A CA  1 
ATOM 2296  C C   . GLU A 1 364 ? -75.987  30.092  14.454   1.00 176.11 ? 333 GLU A C   1 
ATOM 2297  O O   . GLU A 1 364 ? -76.628  29.575  15.373   1.00 178.21 ? 333 GLU A O   1 
ATOM 2298  C CB  . GLU A 1 364 ? -73.666  30.666  15.206   1.00 175.23 ? 333 GLU A CB  1 
ATOM 2299  C CG  . GLU A 1 364 ? -72.329  30.051  15.563   1.00 175.45 ? 333 GLU A CG  1 
ATOM 2300  C CD  . GLU A 1 364 ? -71.540  30.884  16.556   1.00 178.34 ? 333 GLU A CD  1 
ATOM 2301  O OE1 . GLU A 1 364 ? -70.918  31.886  16.136   1.00 178.22 ? 333 GLU A OE1 1 
ATOM 2302  O OE2 . GLU A 1 364 ? -71.533  30.527  17.758   1.00 180.88 ? 333 GLU A OE2 1 
ATOM 2303  N N   . GLN A 1 365 ? -76.525  30.930  13.571   1.00 175.76 ? 334 GLN A N   1 
ATOM 2304  C CA  . GLN A 1 365 ? -77.940  31.240  13.577   1.00 177.55 ? 334 GLN A CA  1 
ATOM 2305  C C   . GLN A 1 365 ? -78.685  30.231  12.709   1.00 176.71 ? 334 GLN A C   1 
ATOM 2306  O O   . GLN A 1 365 ? -79.894  30.075  12.838   1.00 178.43 ? 334 GLN A O   1 
ATOM 2307  C CB  . GLN A 1 365 ? -78.165  32.662  13.047   1.00 177.84 ? 334 GLN A CB  1 
ATOM 2308  C CG  . GLN A 1 365 ? -78.986  33.569  13.969   1.00 180.73 ? 334 GLN A CG  1 
ATOM 2309  C CD  . GLN A 1 365 ? -78.145  34.187  15.073   1.00 181.37 ? 334 GLN A CD  1 
ATOM 2310  O OE1 . GLN A 1 365 ? -77.000  34.575  14.844   1.00 179.69 ? 334 GLN A OE1 1 
ATOM 2311  N NE2 . GLN A 1 365 ? -78.712  34.287  16.275   1.00 183.65 ? 334 GLN A NE2 1 
ATOM 2312  N N   . ASN A 1 366 ? -77.950  29.531  11.845   1.00 174.46 ? 335 ASN A N   1 
ATOM 2313  C CA  . ASN A 1 366 ? -78.533  28.781  10.722   1.00 173.71 ? 335 ASN A CA  1 
ATOM 2314  C C   . ASN A 1 366 ? -79.211  29.718  9.708    1.00 173.98 ? 335 ASN A C   1 
ATOM 2315  O O   . ASN A 1 366 ? -80.051  29.287  8.905    1.00 173.96 ? 335 ASN A O   1 
ATOM 2316  C CB  . ASN A 1 366 ? -79.504  27.680  11.194   1.00 174.97 ? 335 ASN A CB  1 
ATOM 2317  C CG  . ASN A 1 366 ? -78.793  26.511  11.853   1.00 174.29 ? 335 ASN A CG  1 
ATOM 2318  O OD1 . ASN A 1 366 ? -77.823  26.694  12.584   1.00 173.87 ? 335 ASN A OD1 1 
ATOM 2319  N ND2 . ASN A 1 366 ? -79.284  25.300  11.604   1.00 173.73 ? 335 ASN A ND2 1 
ATOM 2320  N N   . ALA A 1 367 ? -78.811  30.994  9.741    1.00 174.48 ? 336 ALA A N   1 
ATOM 2321  C CA  . ALA A 1 367 ? -79.407  32.064  8.923    1.00 175.12 ? 336 ALA A CA  1 
ATOM 2322  C C   . ALA A 1 367 ? -79.056  31.980  7.434    1.00 173.17 ? 336 ALA A C   1 
ATOM 2323  O O   . ALA A 1 367 ? -79.316  32.918  6.670    1.00 173.27 ? 336 ALA A O   1 
ATOM 2324  C CB  . ALA A 1 367 ? -79.028  33.442  9.487    1.00 176.13 ? 336 ALA A CB  1 
ATOM 2325  N N   . ILE A 1 368 ? -78.475  30.848  7.037    1.00 171.74 ? 337 ILE A N   1 
ATOM 2326  C CA  . ILE A 1 368 ? -78.060  30.597  5.656    1.00 169.89 ? 337 ILE A CA  1 
ATOM 2327  C C   . ILE A 1 368 ? -78.992  29.579  4.972    1.00 170.12 ? 337 ILE A C   1 
ATOM 2328  O O   . ILE A 1 368 ? -78.674  28.386  4.852    1.00 169.25 ? 337 ILE A O   1 
ATOM 2329  C CB  . ILE A 1 368 ? -76.542  30.239  5.590    1.00 167.97 ? 337 ILE A CB  1 
ATOM 2330  C CG1 . ILE A 1 368 ? -75.719  31.536  5.604    1.00 167.47 ? 337 ILE A CG1 1 
ATOM 2331  C CG2 . ILE A 1 368 ? -76.205  29.397  4.364    1.00 166.48 ? 337 ILE A CG2 1 
ATOM 2332  C CD1 . ILE A 1 368 ? -74.245  31.352  5.867    1.00 166.27 ? 337 ILE A CD1 1 
ATOM 2333  N N   . ASP A 1 369 ? -80.160  30.077  4.554    1.00 171.50 ? 338 ASP A N   1 
ATOM 2334  C CA  . ASP A 1 369 ? -81.172  29.280  3.843    1.00 171.91 ? 338 ASP A CA  1 
ATOM 2335  C C   . ASP A 1 369 ? -80.869  29.269  2.327    1.00 170.33 ? 338 ASP A C   1 
ATOM 2336  O O   . ASP A 1 369 ? -80.604  30.317  1.722    1.00 169.94 ? 338 ASP A O   1 
ATOM 2337  C CB  . ASP A 1 369 ? -82.610  29.795  4.134    1.00 174.32 ? 338 ASP A CB  1 
ATOM 2338  C CG  . ASP A 1 369 ? -83.039  29.641  5.625    1.00 175.82 ? 338 ASP A CG  1 
ATOM 2339  O OD1 . ASP A 1 369 ? -82.442  28.840  6.384    1.00 174.39 ? 338 ASP A OD1 1 
ATOM 2340  O OD2 . ASP A 1 369 ? -84.003  30.329  6.038    1.00 177.52 ? 338 ASP A OD2 1 
ATOM 2341  N N   . MET A 1 370 ? -80.882  28.075  1.735    1.00 169.39 ? 339 MET A N   1 
ATOM 2342  C CA  . MET A 1 370 ? -80.557  27.893  0.313    1.00 167.97 ? 339 MET A CA  1 
ATOM 2343  C C   . MET A 1 370 ? -81.608  27.032  -0.394   1.00 168.71 ? 339 MET A C   1 
ATOM 2344  O O   . MET A 1 370 ? -82.293  26.221  0.241    1.00 169.65 ? 339 MET A O   1 
ATOM 2345  C CB  . MET A 1 370 ? -79.177  27.240  0.136    1.00 166.25 ? 339 MET A CB  1 
ATOM 2346  C CG  . MET A 1 370 ? -77.999  27.933  0.812    1.00 164.67 ? 339 MET A CG  1 
ATOM 2347  S SD  . MET A 1 370 ? -76.617  26.794  1.006    1.00 161.75 ? 339 MET A SD  1 
ATOM 2348  C CE  . MET A 1 370 ? -77.275  25.628  2.212    1.00 162.48 ? 339 MET A CE  1 
ATOM 2349  N N   . GLU A 1 371 ? -81.701  27.193  -1.714   1.00 168.23 ? 340 GLU A N   1 
ATOM 2350  C CA  . GLU A 1 371 ? -82.747  26.563  -2.522   1.00 169.05 ? 340 GLU A CA  1 
ATOM 2351  C C   . GLU A 1 371 ? -82.451  25.106  -2.810   1.00 168.29 ? 340 GLU A C   1 
ATOM 2352  O O   . GLU A 1 371 ? -81.385  24.778  -3.319   1.00 167.05 ? 340 GLU A O   1 
ATOM 2353  C CB  . GLU A 1 371 ? -82.946  27.334  -3.829   1.00 169.23 ? 340 GLU A CB  1 
ATOM 2354  C CG  . GLU A 1 371 ? -83.678  28.664  -3.655   1.00 170.59 ? 340 GLU A CG  1 
ATOM 2355  C CD  . GLU A 1 371 ? -82.901  29.674  -2.817   1.00 169.84 ? 340 GLU A CD  1 
ATOM 2356  O OE1 . GLU A 1 371 ? -81.732  29.955  -3.154   1.00 168.41 ? 340 GLU A OE1 1 
ATOM 2357  O OE2 . GLU A 1 371 ? -83.460  30.187  -1.824   1.00 170.85 ? 340 GLU A OE2 1 
ATOM 2358  N N   . ILE A 1 372 ? -83.409  24.241  -2.498   1.00 169.20 ? 341 ILE A N   1 
ATOM 2359  C CA  . ILE A 1 372 ? -83.228  22.804  -2.649   1.00 168.95 ? 341 ILE A CA  1 
ATOM 2360  C C   . ILE A 1 372 ? -83.201  22.363  -4.109   1.00 169.39 ? 341 ILE A C   1 
ATOM 2361  O O   . ILE A 1 372 ? -84.216  21.959  -4.669   1.00 170.84 ? 341 ILE A O   1 
ATOM 2362  C CB  . ILE A 1 372 ? -84.273  22.026  -1.843   1.00 170.17 ? 341 ILE A CB  1 
ATOM 2363  C CG1 . ILE A 1 372 ? -84.209  22.498  -0.391   1.00 170.00 ? 341 ILE A CG1 1 
ATOM 2364  C CG2 . ILE A 1 372 ? -84.052  20.509  -1.980   1.00 169.62 ? 341 ILE A CG2 1 
ATOM 2365  C CD1 . ILE A 1 372 ? -85.000  21.685  0.570    1.00 171.42 ? 341 ILE A CD1 1 
ATOM 2366  N N   . ILE A 1 373 ? -82.020  22.459  -4.713   1.00 168.60 ? 342 ILE A N   1 
ATOM 2367  C CA  . ILE A 1 373 ? -81.776  21.972  -6.068   1.00 169.27 ? 342 ILE A CA  1 
ATOM 2368  C C   . ILE A 1 373 ? -82.029  20.459  -6.112   1.00 170.37 ? 342 ILE A C   1 
ATOM 2369  O O   . ILE A 1 373 ? -81.319  19.682  -5.464   1.00 169.87 ? 342 ILE A O   1 
ATOM 2370  C CB  . ILE A 1 373 ? -80.331  22.350  -6.555   1.00 167.78 ? 342 ILE A CB  1 
ATOM 2371  C CG1 . ILE A 1 373 ? -80.275  23.812  -7.042   1.00 167.77 ? 342 ILE A CG1 1 
ATOM 2372  C CG2 . ILE A 1 373 ? -79.839  21.414  -7.668   1.00 167.87 ? 342 ILE A CG2 1 
ATOM 2373  C CD1 . ILE A 1 373 ? -79.841  24.854  -5.997   1.00 166.24 ? 342 ILE A CD1 1 
ATOM 2374  N N   . VAL A 1 374 ? -83.064  20.062  -6.855   1.00 172.31 ? 343 VAL A N   1 
ATOM 2375  C CA  . VAL A 1 374 ? -83.475  18.656  -6.962   1.00 173.67 ? 343 VAL A CA  1 
ATOM 2376  C C   . VAL A 1 374 ? -83.014  18.004  -8.250   1.00 174.27 ? 343 VAL A C   1 
ATOM 2377  O O   . VAL A 1 374 ? -83.406  18.411  -9.343   1.00 175.14 ? 343 VAL A O   1 
ATOM 2378  C CB  . VAL A 1 374 ? -85.004  18.478  -6.854   1.00 175.48 ? 343 VAL A CB  1 
ATOM 2379  C CG1 . VAL A 1 374 ? -85.394  18.183  -5.426   1.00 175.78 ? 343 VAL A CG1 1 
ATOM 2380  C CG2 . VAL A 1 374 ? -85.759  19.703  -7.417   1.00 176.34 ? 343 VAL A CG2 1 
ATOM 2381  N N   . ASN A 1 375 ? -82.176  16.989  -8.118   1.00 174.30 ? 344 ASN A N   1 
ATOM 2382  C CA  . ASN A 1 375 ? -81.732  16.243  -9.276   1.00 175.49 ? 344 ASN A CA  1 
ATOM 2383  C C   . ASN A 1 375 ? -82.454  14.911  -9.345   1.00 177.56 ? 344 ASN A C   1 
ATOM 2384  O O   . ASN A 1 375 ? -82.654  14.248  -8.329   1.00 177.59 ? 344 ASN A O   1 
ATOM 2385  C CB  . ASN A 1 375 ? -80.212  16.044  -9.251   1.00 174.17 ? 344 ASN A CB  1 
ATOM 2386  C CG  . ASN A 1 375 ? -79.443  17.340  -9.480   1.00 172.61 ? 344 ASN A CG  1 
ATOM 2387  O OD1 . ASN A 1 375 ? -79.944  18.433  -9.215   1.00 172.24 ? 344 ASN A OD1 1 
ATOM 2388  N ND2 . ASN A 1 375 ? -78.214  17.217  -9.972   1.00 171.46 ? 344 ASN A ND2 1 
ATOM 2389  N N   . ALA A 1 376 ? -82.875  14.541  -10.545  1.00 179.65 ? 345 ALA A N   1 
ATOM 2390  C CA  . ALA A 1 376 ? -83.444  13.229  -10.769  1.00 182.01 ? 345 ALA A CA  1 
ATOM 2391  C C   . ALA A 1 376 ? -82.464  12.441  -11.619  1.00 182.91 ? 345 ALA A C   1 
ATOM 2392  O O   . ALA A 1 376 ? -81.538  13.017  -12.199  1.00 182.08 ? 345 ALA A O   1 
ATOM 2393  C CB  . ALA A 1 376 ? -84.797  13.341  -11.450  1.00 183.92 ? 345 ALA A CB  1 
ATOM 2394  N N   . LYS A 1 377 ? -82.662  11.126  -11.675  1.00 185.00 ? 346 LYS A N   1 
ATOM 2395  C CA  . LYS A 1 377 ? -81.796  10.235  -12.430  1.00 186.53 ? 346 LYS A CA  1 
ATOM 2396  C C   . LYS A 1 377 ? -82.037  8.809   -11.987  1.00 188.12 ? 346 LYS A C   1 
ATOM 2397  O O   . LYS A 1 377 ? -82.031  8.515   -10.791  1.00 187.32 ? 346 LYS A O   1 
ATOM 2398  C CB  . LYS A 1 377 ? -80.328  10.594  -12.206  1.00 184.89 ? 346 LYS A CB  1 
ATOM 2399  C CG  . LYS A 1 377 ? -79.377  9.966   -13.198  1.00 186.77 ? 346 LYS A CG  1 
ATOM 2400  C CD  . LYS A 1 377 ? -78.265  10.934  -13.596  1.00 186.65 ? 346 LYS A CD  1 
ATOM 2401  C CE  . LYS A 1 377 ? -78.708  11.863  -14.730  1.00 187.58 ? 346 LYS A CE  1 
ATOM 2402  N NZ  . LYS A 1 377 ? -77.556  12.570  -15.356  1.00 186.76 ? 346 LYS A NZ  1 
ATOM 2403  N N   . THR A 1 378 ? -82.249  7.929   -12.957  1.00 190.82 ? 347 THR A N   1 
ATOM 2404  C CA  . THR A 1 378 ? -82.400  6.497   -12.688  1.00 192.92 ? 347 THR A CA  1 
ATOM 2405  C C   . THR A 1 378 ? -81.084  5.726   -12.850  1.00 193.36 ? 347 THR A C   1 
ATOM 2406  O O   . THR A 1 378 ? -80.905  4.667   -12.234  1.00 193.98 ? 347 THR A O   1 
ATOM 2407  C CB  . THR A 1 378 ? -83.517  5.837   -13.569  1.00 195.67 ? 347 THR A CB  1 
ATOM 2408  O OG1 . THR A 1 378 ? -83.468  4.408   -13.425  1.00 197.41 ? 347 THR A OG1 1 
ATOM 2409  C CG2 . THR A 1 378 ? -83.372  6.202   -15.060  1.00 196.88 ? 347 THR A CG2 1 
ATOM 2410  N N   . LEU A 1 379 ? -80.181  6.280   -13.666  1.00 193.26 ? 348 LEU A N   1 
ATOM 2411  C CA  . LEU A 1 379 ? -78.957  5.610   -14.146  1.00 194.29 ? 348 LEU A CA  1 
ATOM 2412  C C   . LEU A 1 379 ? -78.200  4.831   -13.049  1.00 193.83 ? 348 LEU A C   1 
ATOM 2413  O O   . LEU A 1 379 ? -77.996  5.371   -11.959  1.00 191.79 ? 348 LEU A O   1 
ATOM 2414  C CB  . LEU A 1 379 ? -78.026  6.637   -14.828  1.00 193.32 ? 348 LEU A CB  1 
ATOM 2415  C CG  . LEU A 1 379 ? -78.552  7.595   -15.920  1.00 193.86 ? 348 LEU A CG  1 
ATOM 2416  C CD1 . LEU A 1 379 ? -77.503  8.655   -16.281  1.00 192.27 ? 348 LEU A CD1 1 
ATOM 2417  C CD2 . LEU A 1 379 ? -79.036  6.868   -17.183  1.00 196.66 ? 348 LEU A CD2 1 
ATOM 2418  N N   . ASP A 1 380 ? -77.787  3.578   -13.307  1.00 195.93 ? 349 ASP A N   1 
ATOM 2419  C CA  . ASP A 1 380 ? -77.950  2.856   -14.592  1.00 198.83 ? 349 ASP A CA  1 
ATOM 2420  C C   . ASP A 1 380 ? -79.115  1.854   -14.583  1.00 200.89 ? 349 ASP A C   1 
ATOM 2421  O O   . ASP A 1 380 ? -80.151  2.073   -15.220  1.00 201.88 ? 349 ASP A O   1 
ATOM 2422  C CB  . ASP A 1 380 ? -76.676  2.066   -14.953  1.00 200.08 ? 349 ASP A CB  1 
ATOM 2423  C CG  . ASP A 1 380 ? -75.420  2.919   -14.986  1.00 198.22 ? 349 ASP A CG  1 
ATOM 2424  O OD1 . ASP A 1 380 ? -75.379  3.998   -14.353  1.00 195.22 ? 349 ASP A OD1 1 
ATOM 2425  O OD2 . ASP A 1 380 ? -74.455  2.479   -15.645  1.00 199.56 ? 349 ASP A OD2 1 
ATOM 2426  N N   . GLY A 1 381 ? -78.917  0.741   -13.879  1.00 201.65 ? 350 GLY A N   1 
ATOM 2427  C CA  . GLY A 1 381 ? -79.914  -0.313  -13.807  1.00 203.80 ? 350 GLY A CA  1 
ATOM 2428  C C   . GLY A 1 381 ? -80.711  -0.292  -12.517  1.00 202.68 ? 350 GLY A C   1 
ATOM 2429  O O   . GLY A 1 381 ? -81.221  -1.331  -12.088  1.00 204.26 ? 350 GLY A O   1 
ATOM 2430  N N   . GLY A 1 382 ? -80.822  0.888   -11.901  1.00 200.15 ? 351 GLY A N   1 
ATOM 2431  C CA  . GLY A 1 382 ? -81.592  1.060   -10.662  1.00 198.88 ? 351 GLY A CA  1 
ATOM 2432  C C   . GLY A 1 382 ? -83.043  1.437   -10.918  1.00 199.41 ? 351 GLY A C   1 
ATOM 2433  O O   . GLY A 1 382 ? -83.758  0.741   -11.651  1.00 201.81 ? 351 GLY A O   1 
ATOM 2434  N N   . LEU A 1 383 ? -83.481  2.530   -10.291  1.00 197.28 ? 352 LEU A N   1 
ATOM 2435  C CA  . LEU A 1 383 ? -84.797  3.126   -10.557  1.00 197.41 ? 352 LEU A CA  1 
ATOM 2436  C C   . LEU A 1 383 ? -84.681  4.637   -10.345  1.00 194.79 ? 352 LEU A C   1 
ATOM 2437  O O   . LEU A 1 383 ? -83.670  5.104   -9.806   1.00 192.74 ? 352 LEU A O   1 
ATOM 2438  C CB  . LEU A 1 383 ? -85.894  2.484   -9.682   1.00 198.55 ? 352 LEU A CB  1 
ATOM 2439  C CG  . LEU A 1 383 ? -87.371  2.544   -10.120  1.00 200.15 ? 352 LEU A CG  1 
ATOM 2440  C CD1 . LEU A 1 383 ? -88.002  1.152   -10.130  1.00 202.22 ? 352 LEU A CD1 1 
ATOM 2441  C CD2 . LEU A 1 383 ? -88.169  3.515   -9.243   1.00 199.12 ? 352 LEU A CD2 1 
ATOM 2442  N N   . ASN A 1 384 ? -85.687  5.390   -10.801  1.00 194.69 ? 353 ASN A N   1 
ATOM 2443  C CA  . ASN A 1 384 ? -85.704  6.855   -10.690  1.00 192.45 ? 353 ASN A CA  1 
ATOM 2444  C C   . ASN A 1 384 ? -85.533  7.362   -9.254   1.00 190.15 ? 353 ASN A C   1 
ATOM 2445  O O   . ASN A 1 384 ? -86.349  7.054   -8.369   1.00 190.73 ? 353 ASN A O   1 
ATOM 2446  C CB  . ASN A 1 384 ? -86.970  7.439   -11.330  1.00 193.79 ? 353 ASN A CB  1 
ATOM 2447  C CG  . ASN A 1 384 ? -86.761  7.839   -12.781  1.00 194.68 ? 353 ASN A CG  1 
ATOM 2448  O OD1 . ASN A 1 384 ? -85.881  8.646   -13.095  1.00 193.59 ? 353 ASN A OD1 1 
ATOM 2449  N ND2 . ASN A 1 384 ? -87.581  7.287   -13.674  1.00 197.15 ? 353 ASN A ND2 1 
ATOM 2450  N N   . VAL A 1 385 ? -84.457  8.126   -9.042   1.00 187.33 ? 354 VAL A N   1 
ATOM 2451  C CA  . VAL A 1 385 ? -84.042  8.586   -7.710   1.00 184.56 ? 354 VAL A CA  1 
ATOM 2452  C C   . VAL A 1 385 ? -83.758  10.099  -7.685   1.00 182.40 ? 354 VAL A C   1 
ATOM 2453  O O   . VAL A 1 385 ? -83.288  10.670  -8.677   1.00 182.10 ? 354 VAL A O   1 
ATOM 2454  C CB  . VAL A 1 385 ? -82.808  7.798   -7.200   1.00 183.73 ? 354 VAL A CB  1 
ATOM 2455  C CG1 . VAL A 1 385 ? -82.339  8.345   -5.881   1.00 181.95 ? 354 VAL A CG1 1 
ATOM 2456  C CG2 . VAL A 1 385 ? -83.131  6.323   -7.049   1.00 185.02 ? 354 VAL A CG2 1 
ATOM 2457  N N   . ILE A 1 386 ? -84.058  10.730  -6.546   1.00 180.70 ? 355 ILE A N   1 
ATOM 2458  C CA  . ILE A 1 386 ? -83.854  12.166  -6.339   1.00 178.40 ? 355 ILE A CA  1 
ATOM 2459  C C   . ILE A 1 386 ? -82.689  12.414  -5.379   1.00 175.80 ? 355 ILE A C   1 
ATOM 2460  O O   . ILE A 1 386 ? -82.485  11.660  -4.428   1.00 175.89 ? 355 ILE A O   1 
ATOM 2461  C CB  . ILE A 1 386 ? -85.144  12.866  -5.804   1.00 179.27 ? 355 ILE A CB  1 
ATOM 2462  C CG1 . ILE A 1 386 ? -86.307  12.700  -6.798   1.00 181.61 ? 355 ILE A CG1 1 
ATOM 2463  C CG2 . ILE A 1 386 ? -84.890  14.355  -5.514   1.00 178.04 ? 355 ILE A CG2 1 
ATOM 2464  C CD1 . ILE A 1 386 ? -87.697  13.103  -6.258   1.00 183.42 ? 355 ILE A CD1 1 
ATOM 2465  N N   . GLN A 1 387 ? -81.920  13.465  -5.657   1.00 173.25 ? 356 GLN A N   1 
ATOM 2466  C CA  . GLN A 1 387 ? -80.888  13.952  -4.749   1.00 170.39 ? 356 GLN A CA  1 
ATOM 2467  C C   . GLN A 1 387 ? -81.188  15.391  -4.364   1.00 169.30 ? 356 GLN A C   1 
ATOM 2468  O O   . GLN A 1 387 ? -81.424  16.234  -5.233   1.00 169.27 ? 356 GLN A O   1 
ATOM 2469  C CB  . GLN A 1 387 ? -79.519  13.890  -5.411   1.00 169.14 ? 356 GLN A CB  1 
ATOM 2470  C CG  . GLN A 1 387 ? -78.984  12.499  -5.590   1.00 168.19 ? 356 GLN A CG  1 
ATOM 2471  C CD  . GLN A 1 387 ? -77.743  12.469  -6.447   1.00 165.84 ? 356 GLN A CD  1 
ATOM 2472  O OE1 . GLN A 1 387 ? -77.332  13.489  -7.014   1.00 163.48 ? 356 GLN A OE1 1 
ATOM 2473  N NE2 . GLN A 1 387 ? -77.138  11.287  -6.559   1.00 165.63 ? 356 GLN A NE2 1 
ATOM 2474  N N   . LEU A 1 388 ? -81.186  15.671  -3.066   1.00 168.26 ? 357 LEU A N   1 
ATOM 2475  C CA  . LEU A 1 388 ? -81.365  17.038  -2.595   1.00 167.16 ? 357 LEU A CA  1 
ATOM 2476  C C   . LEU A 1 388 ? -80.010  17.717  -2.510   1.00 165.02 ? 357 LEU A C   1 
ATOM 2477  O O   . LEU A 1 388 ? -79.121  17.248  -1.804   1.00 164.44 ? 357 LEU A O   1 
ATOM 2478  C CB  . LEU A 1 388 ? -82.057  17.070  -1.231   1.00 168.05 ? 357 LEU A CB  1 
ATOM 2479  C CG  . LEU A 1 388 ? -83.336  16.259  -1.007   1.00 169.71 ? 357 LEU A CG  1 
ATOM 2480  C CD1 . LEU A 1 388 ? -83.915  16.613  0.356    1.00 170.63 ? 357 LEU A CD1 1 
ATOM 2481  C CD2 . LEU A 1 388 ? -84.355  16.504  -2.103   1.00 170.57 ? 357 LEU A CD2 1 
ATOM 2482  N N   . GLU A 1 389 ? -79.851  18.815  -3.239   1.00 163.80 ? 358 GLU A N   1 
ATOM 2483  C CA  . GLU A 1 389 ? -78.580  19.528  -3.280   1.00 161.84 ? 358 GLU A CA  1 
ATOM 2484  C C   . GLU A 1 389 ? -78.787  21.026  -3.095   1.00 161.04 ? 358 GLU A C   1 
ATOM 2485  O O   . GLU A 1 389 ? -79.884  21.525  -3.287   1.00 161.95 ? 358 GLU A O   1 
ATOM 2486  C CB  . GLU A 1 389 ? -77.833  19.225  -4.589   1.00 161.58 ? 358 GLU A CB  1 
ATOM 2487  C CG  . GLU A 1 389 ? -77.243  17.795  -4.670   1.00 162.08 ? 358 GLU A CG  1 
ATOM 2488  C CD  . GLU A 1 389 ? -76.621  17.454  -6.035   1.00 162.83 ? 358 GLU A CD  1 
ATOM 2489  O OE1 . GLU A 1 389 ? -75.915  18.318  -6.611   1.00 162.48 ? 358 GLU A OE1 1 
ATOM 2490  O OE2 . GLU A 1 389 ? -76.827  16.313  -6.525   1.00 163.53 ? 358 GLU A OE2 1 
ATOM 2491  N N   . THR A 1 390 ? -77.732  21.727  -2.692   1.00 159.41 ? 359 THR A N   1 
ATOM 2492  C CA  . THR A 1 390 ? -77.745  23.185  -2.550   1.00 158.66 ? 359 THR A CA  1 
ATOM 2493  C C   . THR A 1 390 ? -76.516  23.769  -3.256   1.00 157.16 ? 359 THR A C   1 
ATOM 2494  O O   . THR A 1 390 ? -75.514  23.073  -3.425   1.00 156.69 ? 359 THR A O   1 
ATOM 2495  C CB  . THR A 1 390 ? -77.748  23.607  -1.065   1.00 158.77 ? 359 THR A CB  1 
ATOM 2496  O OG1 . THR A 1 390 ? -76.608  23.046  -0.402   1.00 158.33 ? 359 THR A OG1 1 
ATOM 2497  C CG2 . THR A 1 390 ? -79.003  23.111  -0.364   1.00 160.01 ? 359 THR A CG2 1 
ATOM 2498  N N   . ALA A 1 391 ? -76.584  25.031  -3.675   1.00 156.48 ? 360 ALA A N   1 
ATOM 2499  C CA  . ALA A 1 391 ? -75.468  25.647  -4.401   1.00 155.03 ? 360 ALA A CA  1 
ATOM 2500  C C   . ALA A 1 391 ? -74.763  26.671  -3.534   1.00 154.03 ? 360 ALA A C   1 
ATOM 2501  O O   . ALA A 1 391 ? -75.318  27.089  -2.522   1.00 154.64 ? 360 ALA A O   1 
ATOM 2502  C CB  . ALA A 1 391 ? -75.958  26.284  -5.682   1.00 155.68 ? 360 ALA A CB  1 
ATOM 2503  N N   . VAL A 1 392 ? -73.553  27.074  -3.926   1.00 152.74 ? 361 VAL A N   1 
ATOM 2504  C CA  . VAL A 1 392 ? -72.749  28.025  -3.131   1.00 151.91 ? 361 VAL A CA  1 
ATOM 2505  C C   . VAL A 1 392 ? -73.194  29.486  -3.275   1.00 152.23 ? 361 VAL A C   1 
ATOM 2506  O O   . VAL A 1 392 ? -73.248  30.240  -2.287   1.00 152.36 ? 361 VAL A O   1 
ATOM 2507  C CB  . VAL A 1 392 ? -71.235  27.885  -3.406   1.00 150.81 ? 361 VAL A CB  1 
ATOM 2508  C CG1 . VAL A 1 392 ? -70.469  29.097  -2.897   1.00 150.12 ? 361 VAL A CG1 1 
ATOM 2509  C CG2 . VAL A 1 392 ? -70.712  26.656  -2.730   1.00 150.25 ? 361 VAL A CG2 1 
ATOM 2510  N N   . GLY A 1 393 ? -73.504  29.879  -4.505   1.00 152.36 ? 362 GLY A N   1 
ATOM 2511  C CA  . GLY A 1 393 ? -74.067  31.198  -4.765   1.00 152.78 ? 362 GLY A CA  1 
ATOM 2512  C C   . GLY A 1 393 ? -75.481  31.342  -4.236   1.00 153.93 ? 362 GLY A C   1 
ATOM 2513  O O   . GLY A 1 393 ? -75.970  32.456  -4.063   1.00 154.76 ? 362 GLY A O   1 
ATOM 2514  N N   . ALA A 1 394 ? -76.132  30.212  -3.965   1.00 154.24 ? 363 ALA A N   1 
ATOM 2515  C CA  . ALA A 1 394 ? -77.506  30.193  -3.467   1.00 155.71 ? 363 ALA A CA  1 
ATOM 2516  C C   . ALA A 1 394 ? -77.648  30.905  -2.111   1.00 156.34 ? 363 ALA A C   1 
ATOM 2517  O O   . ALA A 1 394 ? -78.665  30.780  -1.416   1.00 157.70 ? 363 ALA A O   1 
ATOM 2518  C CB  . ALA A 1 394 ? -78.014  28.750  -3.389   1.00 156.01 ? 363 ALA A CB  1 
ATOM 2519  N N   . ALA A 1 395 ? -76.627  31.677  -1.754   1.00 155.60 ? 364 ALA A N   1 
ATOM 2520  C CA  . ALA A 1 395 ? -76.566  32.283  -0.445   1.00 156.13 ? 364 ALA A CA  1 
ATOM 2521  C C   . ALA A 1 395 ? -75.930  33.671  -0.478   1.00 155.98 ? 364 ALA A C   1 
ATOM 2522  O O   . ALA A 1 395 ? -75.010  33.951  0.275    1.00 155.51 ? 364 ALA A O   1 
ATOM 2523  C CB  . ALA A 1 395 ? -75.809  31.357  0.502    1.00 155.56 ? 364 ALA A CB  1 
ATOM 2524  N N   . ILE A 1 396 ? -76.408  34.541  -1.359   1.00 156.70 ? 365 ILE A N   1 
ATOM 2525  C CA  . ILE A 1 396 ? -76.000  35.952  -1.317   1.00 157.18 ? 365 ILE A CA  1 
ATOM 2526  C C   . ILE A 1 396 ? -77.176  36.767  -0.776   1.00 159.60 ? 365 ILE A C   1 
ATOM 2527  O O   . ILE A 1 396 ? -77.023  37.904  -0.315   1.00 160.33 ? 365 ILE A O   1 
ATOM 2528  C CB  . ILE A 1 396 ? -75.542  36.478  -2.699   1.00 156.37 ? 365 ILE A CB  1 
ATOM 2529  C CG1 . ILE A 1 396 ? -74.700  35.429  -3.418   1.00 154.51 ? 365 ILE A CG1 1 
ATOM 2530  C CG2 . ILE A 1 396 ? -74.747  37.780  -2.557   1.00 155.95 ? 365 ILE A CG2 1 
ATOM 2531  C CD1 . ILE A 1 396 ? -74.220  35.856  -4.773   1.00 153.36 ? 365 ILE A CD1 1 
ATOM 2532  N N   . LYS A 1 397 ? -78.353  36.153  -0.841   1.00 161.04 ? 366 LYS A N   1 
ATOM 2533  C CA  . LYS A 1 397 ? -79.554  36.672  -0.213   1.00 163.49 ? 366 LYS A CA  1 
ATOM 2534  C C   . LYS A 1 397 ? -79.467  36.661  1.326    1.00 164.61 ? 366 LYS A C   1 
ATOM 2535  O O   . LYS A 1 397 ? -80.203  37.401  1.993    1.00 166.98 ? 366 LYS A O   1 
ATOM 2536  C CB  . LYS A 1 397 ? -80.790  35.898  -0.703   1.00 164.36 ? 366 LYS A CB  1 
ATOM 2537  C CG  . LYS A 1 397 ? -80.664  34.380  -0.688   1.00 163.08 ? 366 LYS A CG  1 
ATOM 2538  C CD  . LYS A 1 397 ? -82.023  33.718  -0.609   1.00 164.68 ? 366 LYS A CD  1 
ATOM 2539  C CE  . LYS A 1 397 ? -81.889  32.302  -0.086   1.00 164.52 ? 366 LYS A CE  1 
ATOM 2540  N NZ  . LYS A 1 397 ? -83.135  31.795  0.568    1.00 166.94 ? 366 LYS A NZ  1 
ATOM 2541  N N   . SER A 1 398 ? -78.566  35.844  1.882    1.00 163.38 ? 367 SER A N   1 
ATOM 2542  C CA  . SER A 1 398 ? -78.448  35.701  3.340    1.00 164.28 ? 367 SER A CA  1 
ATOM 2543  C C   . SER A 1 398 ? -77.269  36.444  3.975    1.00 164.10 ? 367 SER A C   1 
ATOM 2544  O O   . SER A 1 398 ? -77.224  36.618  5.195    1.00 165.37 ? 367 SER A O   1 
ATOM 2545  C CB  . SER A 1 398 ? -78.479  34.224  3.765    1.00 163.58 ? 367 SER A CB  1 
ATOM 2546  O OG  . SER A 1 398 ? -78.370  33.352  2.657    1.00 161.65 ? 367 SER A OG  1 
ATOM 2547  N N   . PHE A 1 399 ? -76.331  36.896  3.149    1.00 162.98 ? 368 PHE A N   1 
ATOM 2548  C CA  . PHE A 1 399 ? -75.251  37.761  3.616    1.00 163.12 ? 368 PHE A CA  1 
ATOM 2549  C C   . PHE A 1 399 ? -75.688  39.186  3.398    1.00 164.96 ? 368 PHE A C   1 
ATOM 2550  O O   . PHE A 1 399 ? -76.320  39.495  2.387    1.00 165.25 ? 368 PHE A O   1 
ATOM 2551  C CB  . PHE A 1 399 ? -73.964  37.499  2.838    1.00 160.89 ? 368 PHE A CB  1 
ATOM 2552  C CG  . PHE A 1 399 ? -73.277  36.224  3.218    1.00 159.34 ? 368 PHE A CG  1 
ATOM 2553  C CD1 . PHE A 1 399 ? -72.045  36.251  3.837    1.00 158.46 ? 368 PHE A CD1 1 
ATOM 2554  C CD2 . PHE A 1 399 ? -73.868  34.990  2.963    1.00 158.99 ? 368 PHE A CD2 1 
ATOM 2555  C CE1 . PHE A 1 399 ? -71.408  35.066  4.192    1.00 157.95 ? 368 PHE A CE1 1 
ATOM 2556  C CE2 . PHE A 1 399 ? -73.240  33.799  3.318    1.00 157.42 ? 368 PHE A CE2 1 
ATOM 2557  C CZ  . PHE A 1 399 ? -72.011  33.836  3.929    1.00 157.22 ? 368 PHE A CZ  1 
ATOM 2558  N N   . GLU A 1 400 ? -75.363  40.063  4.336    1.00 166.75 ? 369 GLU A N   1 
ATOM 2559  C CA  . GLU A 1 400 ? -75.834  41.438  4.210    1.00 169.15 ? 369 GLU A CA  1 
ATOM 2560  C C   . GLU A 1 400 ? -74.853  42.302  3.441    1.00 168.10 ? 369 GLU A C   1 
ATOM 2561  O O   . GLU A 1 400 ? -73.661  41.977  3.379    1.00 166.07 ? 369 GLU A O   1 
ATOM 2562  C CB  . GLU A 1 400 ? -76.227  42.057  5.561    1.00 171.83 ? 369 GLU A CB  1 
ATOM 2563  C CG  . GLU A 1 400 ? -75.098  42.614  6.411    1.00 172.77 ? 369 GLU A CG  1 
ATOM 2564  C CD  . GLU A 1 400 ? -75.633  43.418  7.584    1.00 177.07 ? 369 GLU A CD  1 
ATOM 2565  O OE1 . GLU A 1 400 ? -76.596  44.194  7.384    1.00 179.60 ? 369 GLU A OE1 1 
ATOM 2566  O OE2 . GLU A 1 400 ? -75.094  43.272  8.703    1.00 178.59 ? 369 GLU A OE2 1 
ATOM 2567  N N   . ASN A 1 401 ? -75.377  43.397  2.869    1.00 169.43 ? 370 ASN A N   1 
ATOM 2568  C CA  . ASN A 1 401 ? -74.648  44.237  1.909    1.00 168.42 ? 370 ASN A CA  1 
ATOM 2569  C C   . ASN A 1 401 ? -73.681  43.370  1.113    1.00 165.39 ? 370 ASN A C   1 
ATOM 2570  O O   . ASN A 1 401 ? -72.528  43.189  1.492    1.00 164.15 ? 370 ASN A O   1 
ATOM 2571  C CB  . ASN A 1 401 ? -73.945  45.420  2.599    1.00 169.60 ? 370 ASN A CB  1 
ATOM 2572  C CG  . ASN A 1 401 ? -73.249  45.025  3.901    1.00 169.90 ? 370 ASN A CG  1 
ATOM 2573  O OD1 . ASN A 1 401 ? -72.264  44.275  3.902    1.00 167.69 ? 370 ASN A OD1 1 
ATOM 2574  N ND2 . ASN A 1 401 ? -73.763  45.538  5.018    1.00 172.84 ? 370 ASN A ND2 1 
ATOM 2575  N N   . SER A 1 402 ? -74.190  42.802  0.027    1.00 164.08 ? 371 SER A N   1 
ATOM 2576  C CA  . SER A 1 402 ? -73.505  41.737  -0.689   1.00 161.32 ? 371 SER A CA  1 
ATOM 2577  C C   . SER A 1 402 ? -73.505  42.068  -2.164   1.00 160.32 ? 371 SER A C   1 
ATOM 2578  O O   . SER A 1 402 ? -74.576  42.175  -2.768   1.00 161.50 ? 371 SER A O   1 
ATOM 2579  C CB  . SER A 1 402 ? -74.243  40.420  -0.445   1.00 161.35 ? 371 SER A CB  1 
ATOM 2580  O OG  . SER A 1 402 ? -75.674  40.642  -0.442   1.00 163.25 ? 371 SER A OG  1 
ATOM 2581  N N   . LEU A 1 403 ? -72.319  42.231  -2.749   1.00 158.22 ? 372 LEU A N   1 
ATOM 2582  C CA  . LEU A 1 403 ? -72.239  42.778  -4.107   1.00 157.58 ? 372 LEU A CA  1 
ATOM 2583  C C   . LEU A 1 403 ? -71.043  42.332  -4.956   1.00 155.20 ? 372 LEU A C   1 
ATOM 2584  O O   . LEU A 1 403 ? -69.904  42.709  -4.685   1.00 154.42 ? 372 LEU A O   1 
ATOM 2585  C CB  . LEU A 1 403 ? -72.369  44.313  -4.081   1.00 159.36 ? 372 LEU A CB  1 
ATOM 2586  C CG  . LEU A 1 403 ? -71.761  45.175  -2.967   1.00 160.24 ? 372 LEU A CG  1 
ATOM 2587  C CD1 . LEU A 1 403 ? -70.396  45.751  -3.397   1.00 159.60 ? 372 LEU A CD1 1 
ATOM 2588  C CD2 . LEU A 1 403 ? -72.739  46.291  -2.525   1.00 162.17 ? 372 LEU A CD2 1 
ATOM 2589  N N   . GLY A 1 404 ? -71.338  41.567  -6.007   1.00 154.00 ? 373 GLY A N   1 
ATOM 2590  C CA  . GLY A 1 404 ? -70.323  40.987  -6.890   1.00 151.83 ? 373 GLY A CA  1 
ATOM 2591  C C   . GLY A 1 404 ? -69.901  41.848  -8.070   1.00 151.45 ? 373 GLY A C   1 
ATOM 2592  O O   . GLY A 1 404 ? -70.377  42.977  -8.215   1.00 152.37 ? 373 GLY A O   1 
ATOM 2593  N N   . ILE A 1 405 ? -69.003  41.310  -8.908   1.00 150.00 ? 374 ILE A N   1 
ATOM 2594  C CA  . ILE A 1 405 ? -68.441  42.054  -10.060  1.00 149.65 ? 374 ILE A CA  1 
ATOM 2595  C C   . ILE A 1 405 ? -68.371  41.290  -11.403  1.00 149.11 ? 374 ILE A C   1 
ATOM 2596  O O   . ILE A 1 405 ? -68.332  40.060  -11.422  1.00 148.42 ? 374 ILE A O   1 
ATOM 2597  C CB  . ILE A 1 405 ? -67.057  42.715  -9.729   1.00 149.06 ? 374 ILE A CB  1 
ATOM 2598  C CG1 . ILE A 1 405 ? -65.958  41.685  -9.492   1.00 147.27 ? 374 ILE A CG1 1 
ATOM 2599  C CG2 . ILE A 1 405 ? -67.157  43.642  -8.527   1.00 150.26 ? 374 ILE A CG2 1 
ATOM 2600  C CD1 . ILE A 1 405 ? -64.906  41.754  -10.550  1.00 146.74 ? 374 ILE A CD1 1 
ATOM 2601  N N   . ASN A 1 406 ? -68.387  42.046  -12.509  1.00 149.30 ? 375 ASN A N   1 
ATOM 2602  C CA  . ASN A 1 406 ? -68.219  41.529  -13.874  1.00 148.83 ? 375 ASN A CA  1 
ATOM 2603  C C   . ASN A 1 406 ? -66.744  41.295  -14.161  1.00 147.74 ? 375 ASN A C   1 
ATOM 2604  O O   . ASN A 1 406 ? -65.895  42.136  -13.817  1.00 147.57 ? 375 ASN A O   1 
ATOM 2605  C CB  . ASN A 1 406 ? -68.787  42.512  -14.906  1.00 150.26 ? 375 ASN A CB  1 
ATOM 2606  C CG  . ASN A 1 406 ? -68.149  42.356  -16.288  1.00 150.33 ? 375 ASN A CG  1 
ATOM 2607  O OD1 . ASN A 1 406 ? -67.348  43.191  -16.721  1.00 149.81 ? 375 ASN A OD1 1 
ATOM 2608  N ND2 . ASN A 1 406 ? -68.496  41.280  -16.976  1.00 150.36 ? 375 ASN A ND2 1 
ATOM 2609  N N   . VAL A 1 407 ? -66.449  40.160  -14.802  1.00 146.78 ? 376 VAL A N   1 
ATOM 2610  C CA  . VAL A 1 407 ? -65.077  39.679  -14.959  1.00 145.36 ? 376 VAL A CA  1 
ATOM 2611  C C   . VAL A 1 407 ? -64.799  39.170  -16.351  1.00 145.44 ? 376 VAL A C   1 
ATOM 2612  O O   . VAL A 1 407 ? -65.567  38.371  -16.866  1.00 145.90 ? 376 VAL A O   1 
ATOM 2613  C CB  . VAL A 1 407 ? -64.794  38.494  -14.036  1.00 144.46 ? 376 VAL A CB  1 
ATOM 2614  C CG1 . VAL A 1 407 ? -63.295  38.380  -13.760  1.00 144.45 ? 376 VAL A CG1 1 
ATOM 2615  C CG2 . VAL A 1 407 ? -65.549  38.628  -12.739  1.00 144.44 ? 376 VAL A CG2 1 
ATOM 2616  N N   . PRO A 1 408 ? -63.679  39.604  -16.951  1.00 145.14 ? 377 PRO A N   1 
ATOM 2617  C CA  . PRO A 1 408 ? -63.280  39.079  -18.232  1.00 145.98 ? 377 PRO A CA  1 
ATOM 2618  C C   . PRO A 1 408 ? -63.301  37.575  -18.208  1.00 145.59 ? 377 PRO A C   1 
ATOM 2619  O O   . PRO A 1 408 ? -62.789  36.969  -17.280  1.00 144.38 ? 377 PRO A O   1 
ATOM 2620  C CB  . PRO A 1 408 ? -61.842  39.571  -18.372  1.00 145.85 ? 377 PRO A CB  1 
ATOM 2621  C CG  . PRO A 1 408 ? -61.842  40.851  -17.693  1.00 145.52 ? 377 PRO A CG  1 
ATOM 2622  C CD  . PRO A 1 408 ? -62.770  40.676  -16.515  1.00 144.82 ? 377 PRO A CD  1 
ATOM 2623  N N   . ARG A 1 409 ? -63.922  36.992  -19.224  1.00 146.99 ? 378 ARG A N   1 
ATOM 2624  C CA  . ARG A 1 409 ? -63.889  35.555  -19.474  1.00 147.45 ? 378 ARG A CA  1 
ATOM 2625  C C   . ARG A 1 409 ? -62.462  35.038  -19.316  1.00 146.85 ? 378 ARG A C   1 
ATOM 2626  O O   . ARG A 1 409 ? -62.251  33.880  -18.950  1.00 146.84 ? 378 ARG A O   1 
ATOM 2627  C CB  . ARG A 1 409 ? -64.426  35.275  -20.880  1.00 149.65 ? 378 ARG A CB  1 
ATOM 2628  C CG  . ARG A 1 409 ? -64.464  33.813  -21.298  1.00 151.60 ? 378 ARG A CG  1 
ATOM 2629  C CD  . ARG A 1 409 ? -65.601  33.570  -22.288  1.00 155.21 ? 378 ARG A CD  1 
ATOM 2630  N NE  . ARG A 1 409 ? -66.882  33.374  -21.603  1.00 154.71 ? 378 ARG A NE  1 
ATOM 2631  C CZ  . ARG A 1 409 ? -67.486  32.196  -21.450  1.00 155.12 ? 378 ARG A CZ  1 
ATOM 2632  N NH1 . ARG A 1 409 ? -66.948  31.080  -21.940  1.00 156.41 ? 378 ARG A NH1 1 
ATOM 2633  N NH2 . ARG A 1 409 ? -68.641  32.131  -20.805  1.00 154.35 ? 378 ARG A NH2 1 
ATOM 2634  N N   . SER A 1 410 ? -61.496  35.920  -19.592  1.00 146.48 ? 379 SER A N   1 
ATOM 2635  C CA  . SER A 1 410 ? -60.078  35.727  -19.254  1.00 145.19 ? 379 SER A CA  1 
ATOM 2636  C C   . SER A 1 410 ? -59.879  34.877  -17.992  1.00 143.06 ? 379 SER A C   1 
ATOM 2637  O O   . SER A 1 410 ? -58.935  34.108  -17.892  1.00 143.04 ? 379 SER A O   1 
ATOM 2638  C CB  . SER A 1 410 ? -59.408  37.098  -19.057  1.00 144.91 ? 379 SER A CB  1 
ATOM 2639  O OG  . SER A 1 410 ? -58.732  37.530  -20.340  1.00 146.28 ? 379 SER A OG  1 
ATOM 2640  N N   . ARG A 1 411 ? -60.803  35.018  -17.051  1.00 141.16 ? 380 ARG A N   1 
ATOM 2641  C CA  . ARG A 1 411 ? -60.696  34.433  -15.726  1.00 139.27 ? 380 ARG A CA  1 
ATOM 2642  C C   . ARG A 1 411 ? -61.692  33.288  -15.508  1.00 138.55 ? 380 ARG A C   1 
ATOM 2643  O O   . ARG A 1 411 ? -62.015  32.958  -14.369  1.00 137.33 ? 380 ARG A O   1 
ATOM 2644  C CB  . ARG A 1 411 ? -60.936  35.531  -14.677  1.00 138.39 ? 380 ARG A CB  1 
ATOM 2645  C CG  . ARG A 1 411 ? -59.941  36.725  -14.714  1.00 139.14 ? 380 ARG A CG  1 
ATOM 2646  C CD  . ARG A 1 411 ? -58.824  36.576  -13.677  1.00 139.35 ? 380 ARG A CD  1 
ATOM 2647  N NE  . ARG A 1 411 ? -59.324  35.874  -12.494  1.00 138.69 ? 380 ARG A NE  1 
ATOM 2648  C CZ  . ARG A 1 411 ? -59.845  36.462  -11.427  1.00 137.10 ? 380 ARG A CZ  1 
ATOM 2649  N NH1 . ARG A 1 411 ? -59.909  37.781  -11.377  1.00 137.61 ? 380 ARG A NH1 1 
ATOM 2650  N NH2 . ARG A 1 411 ? -60.291  35.727  -10.412  1.00 135.51 ? 380 ARG A NH2 1 
ATOM 2651  N N   . PHE A 1 412 ? -62.186  32.704  -16.600  1.00 139.10 ? 381 PHE A N   1 
ATOM 2652  C CA  . PHE A 1 412 ? -63.148  31.585  -16.560  1.00 138.61 ? 381 PHE A CA  1 
ATOM 2653  C C   . PHE A 1 412 ? -62.910  30.630  -17.736  1.00 140.33 ? 381 PHE A C   1 
ATOM 2654  O O   . PHE A 1 412 ? -63.566  30.737  -18.778  1.00 141.83 ? 381 PHE A O   1 
ATOM 2655  C CB  . PHE A 1 412 ? -64.608  32.096  -16.549  1.00 138.08 ? 381 PHE A CB  1 
ATOM 2656  C CG  . PHE A 1 412 ? -65.664  30.994  -16.559  1.00 137.10 ? 381 PHE A CG  1 
ATOM 2657  C CD1 . PHE A 1 412 ? -66.086  30.398  -15.387  1.00 135.06 ? 381 PHE A CD1 1 
ATOM 2658  C CD2 . PHE A 1 412 ? -66.257  30.574  -17.751  1.00 138.06 ? 381 PHE A CD2 1 
ATOM 2659  C CE1 . PHE A 1 412 ? -67.065  29.384  -15.408  1.00 135.28 ? 381 PHE A CE1 1 
ATOM 2660  C CE2 . PHE A 1 412 ? -67.237  29.560  -17.776  1.00 136.96 ? 381 PHE A CE2 1 
ATOM 2661  C CZ  . PHE A 1 412 ? -67.638  28.972  -16.609  1.00 135.48 ? 381 PHE A CZ  1 
ATOM 2662  N N   . LEU A 1 413 ? -61.955  29.716  -17.591  1.00 140.35 ? 382 LEU A N   1 
ATOM 2663  C CA  . LEU A 1 413 ? -61.773  28.662  -18.587  1.00 142.13 ? 382 LEU A CA  1 
ATOM 2664  C C   . LEU A 1 413 ? -61.910  27.350  -17.861  1.00 141.90 ? 382 LEU A C   1 
ATOM 2665  O O   . LEU A 1 413 ? -60.906  26.783  -17.455  1.00 142.31 ? 382 LEU A O   1 
ATOM 2666  C CB  . LEU A 1 413 ? -60.392  28.691  -19.253  1.00 143.00 ? 382 LEU A CB  1 
ATOM 2667  C CG  . LEU A 1 413 ? -59.444  29.884  -19.154  1.00 142.77 ? 382 LEU A CG  1 
ATOM 2668  C CD1 . LEU A 1 413 ? -57.999  29.383  -19.274  1.00 142.88 ? 382 LEU A CD1 1 
ATOM 2669  C CD2 . LEU A 1 413 ? -59.774  31.008  -20.176  1.00 143.92 ? 382 LEU A CD2 1 
ATOM 2670  N N   . PRO A 1 414 ? -63.146  26.865  -17.671  1.00 141.72 ? 383 PRO A N   1 
ATOM 2671  C CA  . PRO A 1 414 ? -63.309  25.567  -17.029  1.00 141.35 ? 383 PRO A CA  1 
ATOM 2672  C C   . PRO A 1 414 ? -62.913  24.463  -17.992  1.00 142.94 ? 383 PRO A C   1 
ATOM 2673  O O   . PRO A 1 414 ? -63.139  24.581  -19.195  1.00 144.24 ? 383 PRO A O   1 
ATOM 2674  C CB  . PRO A 1 414 ? -64.802  25.506  -16.732  1.00 141.10 ? 383 PRO A CB  1 
ATOM 2675  C CG  . PRO A 1 414 ? -65.428  26.341  -17.784  1.00 142.38 ? 383 PRO A CG  1 
ATOM 2676  C CD  . PRO A 1 414 ? -64.428  27.410  -18.152  1.00 142.29 ? 383 PRO A CD  1 
ATOM 2677  N N   . VAL A 1 415 ? -62.282  23.421  -17.467  1.00 142.85 ? 384 VAL A N   1 
ATOM 2678  C CA  . VAL A 1 415 ? -61.845  22.322  -18.303  1.00 144.82 ? 384 VAL A CA  1 
ATOM 2679  C C   . VAL A 1 415 ? -62.808  21.210  -18.033  1.00 144.96 ? 384 VAL A C   1 
ATOM 2680  O O   . VAL A 1 415 ? -62.686  20.521  -17.020  1.00 144.28 ? 384 VAL A O   1 
ATOM 2681  C CB  . VAL A 1 415 ? -60.413  21.860  -17.974  1.00 145.16 ? 384 VAL A CB  1 
ATOM 2682  C CG1 . VAL A 1 415 ? -60.069  20.615  -18.756  1.00 147.73 ? 384 VAL A CG1 1 
ATOM 2683  C CG2 . VAL A 1 415 ? -59.418  22.934  -18.318  1.00 145.27 ? 384 VAL A CG2 1 
ATOM 2684  N N   . LYS A 1 416 ? -63.779  21.058  -18.928  1.00 145.80 ? 385 LYS A N   1 
ATOM 2685  C CA  . LYS A 1 416 ? -64.874  20.122  -18.702  1.00 145.99 ? 385 LYS A CA  1 
ATOM 2686  C C   . LYS A 1 416 ? -64.746  18.843  -19.534  1.00 148.31 ? 385 LYS A C   1 
ATOM 2687  O O   . LYS A 1 416 ? -65.049  17.756  -19.045  1.00 148.45 ? 385 LYS A O   1 
ATOM 2688  C CB  . LYS A 1 416 ? -66.236  20.807  -18.888  1.00 145.34 ? 385 LYS A CB  1 
ATOM 2689  N N   . THR A 1 417 ? -64.294  18.975  -20.782  1.00 150.33 ? 386 THR A N   1 
ATOM 2690  C CA  . THR A 1 417 ? -64.025  17.809  -21.648  1.00 152.99 ? 386 THR A CA  1 
ATOM 2691  C C   . THR A 1 417 ? -62.618  17.786  -22.219  1.00 154.38 ? 386 THR A C   1 
ATOM 2692  O O   . THR A 1 417 ? -61.887  18.786  -22.219  1.00 153.77 ? 386 THR A O   1 
ATOM 2693  C CB  . THR A 1 417 ? -64.936  17.743  -22.863  1.00 154.80 ? 386 THR A CB  1 
ATOM 2694  O OG1 . THR A 1 417 ? -64.745  18.922  -23.657  1.00 154.30 ? 386 THR A OG1 1 
ATOM 2695  C CG2 . THR A 1 417 ? -66.369  17.627  -22.429  1.00 154.84 ? 386 THR A CG2 1 
ATOM 2696  N N   . THR A 1 418 ? -62.269  16.624  -22.748  1.00 156.30 ? 387 THR A N   1 
ATOM 2697  C CA  . THR A 1 418 ? -61.003  16.416  -23.404  1.00 157.37 ? 387 THR A CA  1 
ATOM 2698  C C   . THR A 1 418 ? -60.684  17.514  -24.458  1.00 157.86 ? 387 THR A C   1 
ATOM 2699  O O   . THR A 1 418 ? -59.528  17.753  -24.768  1.00 158.63 ? 387 THR A O   1 
ATOM 2700  C CB  . THR A 1 418 ? -60.998  14.998  -23.988  1.00 160.24 ? 387 THR A CB  1 
ATOM 2701  O OG1 . THR A 1 418 ? -59.674  14.624  -24.346  1.00 161.50 ? 387 THR A OG1 1 
ATOM 2702  C CG2 . THR A 1 418 ? -61.924  14.896  -25.184  1.00 162.26 ? 387 THR A CG2 1 
ATOM 2703  N N   . SER A 1 419 ? -61.705  18.203  -24.967  1.00 157.22 ? 388 SER A N   1 
ATOM 2704  C CA  . SER A 1 419 ? -61.514  19.261  -25.967  1.00 157.77 ? 388 SER A CA  1 
ATOM 2705  C C   . SER A 1 419 ? -60.898  20.513  -25.383  1.00 155.10 ? 388 SER A C   1 
ATOM 2706  O O   . SER A 1 419 ? -60.264  21.295  -26.079  1.00 155.60 ? 388 SER A O   1 
ATOM 2707  C CB  . SER A 1 419 ? -62.843  19.634  -26.624  1.00 158.46 ? 388 SER A CB  1 
ATOM 2708  O OG  . SER A 1 419 ? -63.471  18.501  -27.191  1.00 160.99 ? 388 SER A OG  1 
ATOM 2709  N N   . ASP A 1 420 ? -61.129  20.713  -24.099  1.00 152.25 ? 389 ASP A N   1 
ATOM 2710  C CA  . ASP A 1 420 ? -60.615  21.873  -23.408  1.00 150.17 ? 389 ASP A CA  1 
ATOM 2711  C C   . ASP A 1 420 ? -59.176  21.639  -23.037  1.00 149.45 ? 389 ASP A C   1 
ATOM 2712  O O   . ASP A 1 420 ? -58.402  22.578  -22.887  1.00 148.56 ? 389 ASP A O   1 
ATOM 2713  C CB  . ASP A 1 420 ? -61.408  22.110  -22.129  1.00 148.26 ? 389 ASP A CB  1 
ATOM 2714  C CG  . ASP A 1 420 ? -62.772  22.720  -22.383  1.00 150.45 ? 389 ASP A CG  1 
ATOM 2715  O OD1 . ASP A 1 420 ? -63.081  23.105  -23.545  1.00 154.87 ? 389 ASP A OD1 1 
ATOM 2716  O OD2 . ASP A 1 420 ? -63.534  22.823  -21.393  1.00 151.86 ? 389 ASP A OD2 1 
ATOM 2717  N N   . LEU A 1 421 ? -58.827  20.376  -22.849  1.00 149.56 ? 390 LEU A N   1 
ATOM 2718  C CA  . LEU A 1 421 ? -57.461  20.045  -22.580  1.00 149.02 ? 390 LEU A CA  1 
ATOM 2719  C C   . LEU A 1 421 ? -56.652  20.464  -23.771  1.00 150.75 ? 390 LEU A C   1 
ATOM 2720  O O   . LEU A 1 421 ? -55.695  21.207  -23.608  1.00 150.58 ? 390 LEU A O   1 
ATOM 2721  C CB  . LEU A 1 421 ? -57.295  18.564  -22.343  1.00 150.32 ? 390 LEU A CB  1 
ATOM 2722  C CG  . LEU A 1 421 ? -57.776  18.134  -20.982  1.00 147.89 ? 390 LEU A CG  1 
ATOM 2723  C CD1 . LEU A 1 421 ? -57.654  16.643  -20.894  1.00 150.50 ? 390 LEU A CD1 1 
ATOM 2724  C CD2 . LEU A 1 421 ? -56.925  18.797  -19.941  1.00 145.63 ? 390 LEU A CD2 1 
ATOM 2725  N N   . LEU A 1 422 ? -57.040  20.027  -24.970  1.00 152.30 ? 391 LEU A N   1 
ATOM 2726  C CA  . LEU A 1 422 ? -56.239  20.339  -26.127  1.00 153.95 ? 391 LEU A CA  1 
ATOM 2727  C C   . LEU A 1 422 ? -56.054  21.830  -26.181  1.00 152.74 ? 391 LEU A C   1 
ATOM 2728  O O   . LEU A 1 422 ? -54.952  22.309  -26.329  1.00 153.52 ? 391 LEU A O   1 
ATOM 2729  C CB  . LEU A 1 422 ? -56.856  19.833  -27.411  1.00 156.51 ? 391 LEU A CB  1 
ATOM 2730  C CG  . LEU A 1 422 ? -55.974  20.121  -28.625  1.00 158.43 ? 391 LEU A CG  1 
ATOM 2731  C CD1 . LEU A 1 422 ? -55.075  18.971  -28.872  1.00 161.65 ? 391 LEU A CD1 1 
ATOM 2732  C CD2 . LEU A 1 422 ? -56.768  20.377  -29.852  1.00 159.52 ? 391 LEU A CD2 1 
ATOM 2733  N N   . LEU A 1 423 ? -57.131  22.569  -25.997  1.00 100.67 ? 392 LEU A N   1 
ATOM 2734  C CA  . LEU A 1 423 ? -57.077  24.022  -26.036  1.00 102.37 ? 392 LEU A CA  1 
ATOM 2735  C C   . LEU A 1 423 ? -56.010  24.596  -25.114  1.00 103.39 ? 392 LEU A C   1 
ATOM 2736  O O   . LEU A 1 423 ? -55.137  25.343  -25.546  1.00 104.31 ? 392 LEU A O   1 
ATOM 2737  C CB  . LEU A 1 423 ? -58.440  24.570  -25.639  1.00 102.79 ? 392 LEU A CB  1 
ATOM 2738  C CG  . LEU A 1 423 ? -58.771  25.954  -26.169  1.00 105.23 ? 392 LEU A CG  1 
ATOM 2739  C CD1 . LEU A 1 423 ? -58.657  26.004  -27.715  1.00 104.51 ? 392 LEU A CD1 1 
ATOM 2740  C CD2 . LEU A 1 423 ? -60.165  26.366  -25.644  1.00 106.54 ? 392 LEU A CD2 1 
ATOM 2741  N N   . VAL A 1 424 ? -56.098  24.211  -23.844  1.00 103.64 ? 393 VAL A N   1 
ATOM 2742  C CA  . VAL A 1 424 ? -55.251  24.726  -22.776  1.00 105.30 ? 393 VAL A CA  1 
ATOM 2743  C C   . VAL A 1 424 ? -53.812  24.260  -22.885  1.00 106.20 ? 393 VAL A C   1 
ATOM 2744  O O   . VAL A 1 424 ? -52.905  25.041  -22.652  1.00 108.27 ? 393 VAL A O   1 
ATOM 2745  C CB  . VAL A 1 424 ? -55.806  24.351  -21.376  1.00 105.02 ? 393 VAL A CB  1 
ATOM 2746  C CG1 . VAL A 1 424 ? -55.366  22.975  -20.962  1.00 104.38 ? 393 VAL A CG1 1 
ATOM 2747  C CG2 . VAL A 1 424 ? -55.350  25.335  -20.350  1.00 106.72 ? 393 VAL A CG2 1 
ATOM 2748  N N   . MET A 1 425 ? -53.604  22.998  -23.242  1.00 105.58 ? 394 MET A N   1 
ATOM 2749  C CA  . MET A 1 425 ? -52.266  22.435  -23.284  1.00 106.64 ? 394 MET A CA  1 
ATOM 2750  C C   . MET A 1 425 ? -51.595  22.568  -24.653  1.00 107.28 ? 394 MET A C   1 
ATOM 2751  O O   . MET A 1 425 ? -50.897  21.681  -25.112  1.00 107.07 ? 394 MET A O   1 
ATOM 2752  C CB  . MET A 1 425 ? -52.296  20.988  -22.810  1.00 106.23 ? 394 MET A CB  1 
ATOM 2753  C CG  . MET A 1 425 ? -52.992  20.009  -23.735  1.00 105.48 ? 394 MET A CG  1 
ATOM 2754  S SD  . MET A 1 425 ? -52.660  18.301  -23.252  1.00 107.63 ? 394 MET A SD  1 
ATOM 2755  C CE  . MET A 1 425 ? -53.724  18.063  -21.835  1.00 106.65 ? 394 MET A CE  1 
ATOM 2756  N N   . SER A 1 426 ? -51.813  23.702  -25.292  1.00 108.79 ? 395 SER A N   1 
ATOM 2757  C CA  . SER A 1 426 ? -51.219  23.989  -26.584  1.00 110.56 ? 395 SER A CA  1 
ATOM 2758  C C   . SER A 1 426 ? -50.577  25.345  -26.523  1.00 113.00 ? 395 SER A C   1 
ATOM 2759  O O   . SER A 1 426 ? -50.748  26.082  -25.552  1.00 113.93 ? 395 SER A O   1 
ATOM 2760  C CB  . SER A 1 426 ? -52.297  24.000  -27.665  1.00 110.05 ? 395 SER A CB  1 
ATOM 2761  O OG  . SER A 1 426 ? -53.602  24.237  -27.019  1.00 110.24 ? 395 SER A OG  1 
ATOM 2762  N N   . ASN A 1 427 ? -49.861  25.695  -27.576  1.00 114.74 ? 396 ASN A N   1 
ATOM 2763  C CA  . ASN A 1 427 ? -49.136  26.947  -27.573  1.00 117.86 ? 396 ASN A CA  1 
ATOM 2764  C C   . ASN A 1 427 ? -50.055  28.160  -27.564  1.00 118.99 ? 396 ASN A C   1 
ATOM 2765  O O   . ASN A 1 427 ? -49.611  29.284  -27.778  1.00 122.01 ? 396 ASN A O   1 
ATOM 2766  C CB  . ASN A 1 427 ? -48.179  27.008  -28.755  1.00 119.65 ? 396 ASN A CB  1 
ATOM 2767  C CG  . ASN A 1 427 ? -48.867  26.738  -30.053  1.00 119.26 ? 396 ASN A CG  1 
ATOM 2768  O OD1 . ASN A 1 427 ? -49.614  25.757  -30.186  1.00 117.45 ? 396 ASN A OD1 1 
ATOM 2769  N ND2 . ASN A 1 427 ? -48.634  27.610  -31.027  1.00 121.43 ? 396 ASN A ND2 1 
ATOM 2770  N N   . LEU A 1 428 ? -51.337  27.937  -27.313  1.00 117.32 ? 397 LEU A N   1 
ATOM 2771  C CA  . LEU A 1 428 ? -52.253  29.049  -27.137  1.00 118.83 ? 397 LEU A CA  1 
ATOM 2772  C C   . LEU A 1 428 ? -52.020  29.713  -25.800  1.00 120.26 ? 397 LEU A C   1 
ATOM 2773  O O   . LEU A 1 428 ? -52.026  30.931  -25.687  1.00 122.87 ? 397 LEU A O   1 
ATOM 2774  C CB  . LEU A 1 428 ? -53.701  28.588  -27.250  1.00 117.08 ? 397 LEU A CB  1 
ATOM 2775  C CG  . LEU A 1 428 ? -54.347  28.726  -28.630  1.00 117.18 ? 397 LEU A CG  1 
ATOM 2776  C CD1 . LEU A 1 428 ? -55.541  27.792  -28.715  1.00 114.26 ? 397 LEU A CD1 1 
ATOM 2777  C CD2 . LEU A 1 428 ? -54.737  30.191  -28.896  1.00 120.05 ? 397 LEU A CD2 1 
ATOM 2778  N N   . TYR A 1 429 ? -51.800  28.902  -24.783  1.00 119.18 ? 398 TYR A N   1 
ATOM 2779  C CA  . TYR A 1 429 ? -51.501  29.436  -23.480  1.00 121.14 ? 398 TYR A CA  1 
ATOM 2780  C C   . TYR A 1 429 ? -50.039  29.288  -23.102  1.00 122.86 ? 398 TYR A C   1 
ATOM 2781  O O   . TYR A 1 429 ? -49.393  28.280  -23.405  1.00 121.67 ? 398 TYR A O   1 
ATOM 2782  C CB  . TYR A 1 429 ? -52.368  28.757  -22.448  1.00 119.27 ? 398 TYR A CB  1 
ATOM 2783  C CG  . TYR A 1 429 ? -53.796  29.092  -22.632  1.00 118.67 ? 398 TYR A CG  1 
ATOM 2784  C CD1 . TYR A 1 429 ? -54.298  30.297  -22.176  1.00 121.37 ? 398 TYR A CD1 1 
ATOM 2785  C CD2 . TYR A 1 429 ? -54.652  28.220  -23.277  1.00 117.01 ? 398 TYR A CD2 1 
ATOM 2786  C CE1 . TYR A 1 429 ? -55.634  30.632  -22.345  1.00 121.78 ? 398 TYR A CE1 1 
ATOM 2787  C CE2 . TYR A 1 429 ? -55.998  28.540  -23.453  1.00 117.52 ? 398 TYR A CE2 1 
ATOM 2788  C CZ  . TYR A 1 429 ? -56.478  29.752  -22.983  1.00 119.35 ? 398 TYR A CZ  1 
ATOM 2789  O OH  . TYR A 1 429 ? -57.795  30.088  -23.153  1.00 119.66 ? 398 TYR A OH  1 
ATOM 2790  N N   . SER A 1 430 ? -49.520  30.311  -22.439  1.00 126.20 ? 399 SER A N   1 
ATOM 2791  C CA  . SER A 1 430 ? -48.212  30.219  -21.840  1.00 128.43 ? 399 SER A CA  1 
ATOM 2792  C C   . SER A 1 430 ? -48.411  29.963  -20.355  1.00 128.75 ? 399 SER A C   1 
ATOM 2793  O O   . SER A 1 430 ? -49.271  30.572  -19.725  1.00 129.38 ? 399 SER A O   1 
ATOM 2794  C CB  . SER A 1 430 ? -47.413  31.505  -22.071  1.00 132.21 ? 399 SER A CB  1 
ATOM 2795  O OG  . SER A 1 430 ? -46.031  31.243  -22.281  1.00 133.82 ? 399 SER A OG  1 
ATOM 2796  N N   . LEU A 1 431 ? -47.614  29.047  -19.817  1.00 128.94 ? 400 LEU A N   1 
ATOM 2797  C CA  . LEU A 1 431 ? -47.612  28.714  -18.403  1.00 130.12 ? 400 LEU A CA  1 
ATOM 2798  C C   . LEU A 1 431 ? -46.538  29.533  -17.651  1.00 134.51 ? 400 LEU A C   1 
ATOM 2799  O O   . LEU A 1 431 ? -45.378  29.590  -18.077  1.00 136.19 ? 400 LEU A O   1 
ATOM 2800  C CB  . LEU A 1 431 ? -47.378  27.209  -18.265  1.00 127.81 ? 400 LEU A CB  1 
ATOM 2801  C CG  . LEU A 1 431 ? -47.010  26.593  -16.921  1.00 128.91 ? 400 LEU A CG  1 
ATOM 2802  C CD1 . LEU A 1 431 ? -48.174  26.681  -15.964  1.00 128.30 ? 400 LEU A CD1 1 
ATOM 2803  C CD2 . LEU A 1 431 ? -46.556  25.149  -17.096  1.00 128.09 ? 400 LEU A CD2 1 
ATOM 2804  N N   . ASN A 1 432 ? -46.927  30.165  -16.541  1.00 137.09 ? 401 ASN A N   1 
ATOM 2805  C CA  . ASN A 1 432 ? -45.999  30.976  -15.736  1.00 141.55 ? 401 ASN A CA  1 
ATOM 2806  C C   . ASN A 1 432 ? -45.991  30.708  -14.230  1.00 143.02 ? 401 ASN A C   1 
ATOM 2807  O O   . ASN A 1 432 ? -46.342  31.589  -13.427  1.00 145.54 ? 401 ASN A O   1 
ATOM 2808  C CB  . ASN A 1 432 ? -46.235  32.456  -15.990  1.00 144.50 ? 401 ASN A CB  1 
ATOM 2809  C CG  . ASN A 1 432 ? -45.103  33.088  -16.741  1.00 148.16 ? 401 ASN A CG  1 
ATOM 2810  O OD1 . ASN A 1 432 ? -44.039  33.370  -16.167  1.00 152.29 ? 401 ASN A OD1 1 
ATOM 2811  N ND2 . ASN A 1 432 ? -45.310  33.315  -18.040  1.00 148.01 ? 401 ASN A ND2 1 
ATOM 2812  N N   . ALA A 1 433 ? -45.563  29.497  -13.865  1.00 141.91 ? 402 ALA A N   1 
ATOM 2813  C CA  . ALA A 1 433 ? -45.537  29.033  -12.476  1.00 143.16 ? 402 ALA A CA  1 
ATOM 2814  C C   . ALA A 1 433 ? -46.936  28.849  -11.956  1.00 141.70 ? 402 ALA A C   1 
ATOM 2815  O O   . ALA A 1 433 ? -47.411  29.616  -11.124  1.00 143.43 ? 402 ALA A O   1 
ATOM 2816  C CB  . ALA A 1 433 ? -44.759  29.997  -11.586  1.00 147.77 ? 402 ALA A CB  1 
ATOM 2817  N N   . GLY A 1 434 ? -47.599  27.831  -12.482  1.00 138.88 ? 403 GLY A N   1 
ATOM 2818  C CA  . GLY A 1 434 ? -48.979  27.511  -12.093  1.00 138.22 ? 403 GLY A CA  1 
ATOM 2819  C C   . GLY A 1 434 ? -50.122  28.122  -12.901  1.00 136.73 ? 403 GLY A C   1 
ATOM 2820  O O   . GLY A 1 434 ? -51.081  27.426  -13.277  1.00 134.04 ? 403 GLY A O   1 
ATOM 2821  N N   . SER A 1 435 ? -50.027  29.427  -13.143  1.00 138.85 ? 404 SER A N   1 
ATOM 2822  C CA  . SER A 1 435 ? -51.062  30.162  -13.852  1.00 138.30 ? 404 SER A CA  1 
ATOM 2823  C C   . SER A 1 435 ? -50.774  30.166  -15.340  1.00 136.65 ? 404 SER A C   1 
ATOM 2824  O O   . SER A 1 435 ? -49.621  30.326  -15.750  1.00 137.53 ? 404 SER A O   1 
ATOM 2825  C CB  . SER A 1 435 ? -51.140  31.599  -13.326  1.00 142.02 ? 404 SER A CB  1 
ATOM 2826  O OG  . SER A 1 435 ? -49.867  32.223  -13.364  1.00 144.47 ? 404 SER A OG  1 
ATOM 2827  N N   . LEU A 1 436 ? -51.821  29.979  -16.142  1.00 134.55 ? 405 LEU A N   1 
ATOM 2828  C CA  . LEU A 1 436 ? -51.703  30.133  -17.595  1.00 133.76 ? 405 LEU A CA  1 
ATOM 2829  C C   . LEU A 1 436 ? -52.653  31.170  -18.182  1.00 135.41 ? 405 LEU A C   1 
ATOM 2830  O O   . LEU A 1 436 ? -53.790  31.320  -17.723  1.00 135.56 ? 405 LEU A O   1 
ATOM 2831  C CB  . LEU A 1 436 ? -51.837  28.802  -18.324  1.00 129.89 ? 405 LEU A CB  1 
ATOM 2832  C CG  . LEU A 1 436 ? -52.688  27.758  -17.645  1.00 126.61 ? 405 LEU A CG  1 
ATOM 2833  C CD1 . LEU A 1 436 ? -54.113  28.145  -17.826  1.00 126.47 ? 405 LEU A CD1 1 
ATOM 2834  C CD2 . LEU A 1 436 ? -52.411  26.425  -18.276  1.00 122.89 ? 405 LEU A CD2 1 
ATOM 2835  N N   . THR A 1 437 ? -52.161  31.872  -19.201  1.00 137.40 ? 406 THR A N   1 
ATOM 2836  C CA  . THR A 1 437 ? -52.860  32.988  -19.832  1.00 140.04 ? 406 THR A CA  1 
ATOM 2837  C C   . THR A 1 437 ? -52.531  33.036  -21.332  1.00 140.40 ? 406 THR A C   1 
ATOM 2838  O O   . THR A 1 437 ? -51.571  32.406  -21.788  1.00 139.46 ? 406 THR A O   1 
ATOM 2839  C CB  . THR A 1 437 ? -52.489  34.314  -19.163  1.00 144.20 ? 406 THR A CB  1 
ATOM 2840  O OG1 . THR A 1 437 ? -51.066  34.387  -19.039  1.00 145.87 ? 406 THR A OG1 1 
ATOM 2841  C CG2 . THR A 1 437 ? -53.105  34.412  -17.763  1.00 144.97 ? 406 THR A CG2 1 
ATOM 2842  N N   . MET A 1 438 ? -53.334  33.776  -22.094  1.00 142.44 ? 407 MET A N   1 
ATOM 2843  C CA  . MET A 1 438 ? -53.315  33.681  -23.553  1.00 142.84 ? 407 MET A CA  1 
ATOM 2844  C C   . MET A 1 438 ? -52.170  34.480  -24.179  1.00 145.95 ? 407 MET A C   1 
ATOM 2845  O O   . MET A 1 438 ? -52.305  35.671  -24.470  1.00 149.66 ? 407 MET A O   1 
ATOM 2846  C CB  . MET A 1 438 ? -54.673  34.101  -24.125  1.00 143.59 ? 407 MET A CB  1 
ATOM 2847  C CG  . MET A 1 438 ? -54.894  33.719  -25.588  1.00 144.71 ? 407 MET A CG  1 
ATOM 2848  S SD  . MET A 1 438 ? -55.940  34.902  -26.481  1.00 153.45 ? 407 MET A SD  1 
ATOM 2849  C CE  . MET A 1 438 ? -54.992  36.458  -26.373  1.00 158.14 ? 407 MET A CE  1 
ATOM 2850  N N   . SER A 1 439 ? -51.049  33.804  -24.406  1.00 145.10 ? 408 SER A N   1 
ATOM 2851  C CA  . SER A 1 439 ? -49.816  34.486  -24.780  1.00 148.44 ? 408 SER A CA  1 
ATOM 2852  C C   . SER A 1 439 ? -49.846  35.122  -26.146  1.00 150.47 ? 408 SER A C   1 
ATOM 2853  O O   . SER A 1 439 ? -50.078  34.461  -27.144  1.00 148.23 ? 408 SER A O   1 
ATOM 2854  C CB  . SER A 1 439 ? -48.596  33.560  -24.653  1.00 147.42 ? 408 SER A CB  1 
ATOM 2855  O OG  . SER A 1 439 ? -47.819  33.860  -23.489  1.00 149.36 ? 408 SER A OG  1 
ATOM 2856  N N   . GLU A 1 440 ? -49.608  36.423  -26.161  1.00 155.27 ? 409 GLU A N   1 
ATOM 2857  C CA  . GLU A 1 440 ? -49.351  37.151  -27.383  1.00 159.14 ? 409 GLU A CA  1 
ATOM 2858  C C   . GLU A 1 440 ? -47.945  36.789  -27.854  1.00 159.64 ? 409 GLU A C   1 
ATOM 2859  O O   . GLU A 1 440 ? -47.096  36.522  -27.016  1.00 159.64 ? 409 GLU A O   1 
ATOM 2860  C CB  . GLU A 1 440 ? -49.461  38.646  -27.105  1.00 164.54 ? 409 GLU A CB  1 
ATOM 2861  C CG  . GLU A 1 440 ? -50.877  39.068  -26.730  1.00 166.15 ? 409 GLU A CG  1 
ATOM 2862  C CD  . GLU A 1 440 ? -51.325  40.320  -27.465  1.00 173.02 ? 409 GLU A CD  1 
ATOM 2863  O OE1 . GLU A 1 440 ? -50.940  41.436  -27.040  1.00 178.54 ? 409 GLU A OE1 1 
ATOM 2864  O OE2 . GLU A 1 440 ? -52.072  40.183  -28.465  1.00 173.02 ? 409 GLU A OE2 1 
ATOM 2865  N N   . LYS A 1 441 ? -47.671  36.774  -29.161  1.00 160.66 ? 410 LYS A N   1 
ATOM 2866  C CA  . LYS A 1 441 ? -48.607  37.173  -30.202  1.00 161.74 ? 410 LYS A CA  1 
ATOM 2867  C C   . LYS A 1 441 ? -49.661  36.108  -30.435  1.00 156.77 ? 410 LYS A C   1 
ATOM 2868  O O   . LYS A 1 441 ? -49.368  34.918  -30.512  1.00 153.24 ? 410 LYS A O   1 
ATOM 2869  C CB  . LYS A 1 441 ? -47.878  37.507  -31.519  1.00 165.33 ? 410 LYS A CB  1 
ATOM 2870  C CG  . LYS A 1 441 ? -48.777  38.122  -32.623  1.00 168.53 ? 410 LYS A CG  1 
ATOM 2871  C CD  . LYS A 1 441 ? -48.156  38.026  -34.024  1.00 171.14 ? 410 LYS A CD  1 
ATOM 2872  C CE  . LYS A 1 441 ? -49.241  37.996  -35.100  1.00 171.19 ? 410 LYS A CE  1 
ATOM 2873  N NZ  . LYS A 1 441 ? -48.705  37.678  -36.458  1.00 172.61 ? 410 LYS A NZ  1 
ATOM 2874  N N   . ARG A 1 442 ? -50.893  36.585  -30.516  1.00 156.99 ? 411 ARG A N   1 
ATOM 2875  C CA  . ARG A 1 442 ? -52.061  35.819  -30.874  1.00 153.30 ? 411 ARG A CA  1 
ATOM 2876  C C   . ARG A 1 442 ? -52.939  36.932  -31.383  1.00 156.92 ? 411 ARG A C   1 
ATOM 2877  O O   . ARG A 1 442 ? -53.400  37.769  -30.605  1.00 159.01 ? 411 ARG A O   1 
ATOM 2878  C CB  . ARG A 1 442 ? -52.649  35.149  -29.630  1.00 149.51 ? 411 ARG A CB  1 
ATOM 2879  C CG  . ARG A 1 442 ? -54.125  34.808  -29.700  1.00 146.92 ? 411 ARG A CG  1 
ATOM 2880  C CD  . ARG A 1 442 ? -54.436  33.634  -30.591  1.00 142.38 ? 411 ARG A CD  1 
ATOM 2881  N NE  . ARG A 1 442 ? -55.826  33.690  -31.031  1.00 141.30 ? 411 ARG A NE  1 
ATOM 2882  C CZ  . ARG A 1 442 ? -56.366  32.877  -31.931  1.00 139.14 ? 411 ARG A CZ  1 
ATOM 2883  N NH1 . ARG A 1 442 ? -55.640  31.926  -32.491  1.00 138.03 ? 411 ARG A NH1 1 
ATOM 2884  N NH2 . ARG A 1 442 ? -57.636  33.014  -32.273  1.00 138.92 ? 411 ARG A NH2 1 
ATOM 2885  N N   . GLU A 1 443 ? -53.115  36.980  -32.695  1.00 158.23 ? 412 GLU A N   1 
ATOM 2886  C CA  . GLU A 1 443 ? -53.744  38.131  -33.334  1.00 163.00 ? 412 GLU A CA  1 
ATOM 2887  C C   . GLU A 1 443 ? -54.874  38.763  -32.494  1.00 163.59 ? 412 GLU A C   1 
ATOM 2888  O O   . GLU A 1 443 ? -54.671  39.803  -31.876  1.00 167.10 ? 412 GLU A O   1 
ATOM 2889  C CB  . GLU A 1 443 ? -54.197  37.794  -34.773  1.00 163.69 ? 412 GLU A CB  1 
ATOM 2890  C CG  . GLU A 1 443 ? -53.040  37.476  -35.767  1.00 165.57 ? 412 GLU A CG  1 
ATOM 2891  C CD  . GLU A 1 443 ? -53.256  38.009  -37.205  1.00 170.03 ? 412 GLU A CD  1 
ATOM 2892  O OE1 . GLU A 1 443 ? -54.290  38.660  -37.477  1.00 172.35 ? 412 GLU A OE1 1 
ATOM 2893  O OE2 . GLU A 1 443 ? -52.371  37.783  -38.066  1.00 171.15 ? 412 GLU A OE2 1 
ATOM 2894  N N   . PHE A 1 444 ? -56.034  38.113  -32.441  1.00 160.39 ? 413 PHE A N   1 
ATOM 2895  C CA  . PHE A 1 444 ? -57.225  38.664  -31.787  1.00 161.32 ? 413 PHE A CA  1 
ATOM 2896  C C   . PHE A 1 444 ? -57.539  37.923  -30.493  1.00 156.97 ? 413 PHE A C   1 
ATOM 2897  O O   . PHE A 1 444 ? -57.089  36.796  -30.309  1.00 152.89 ? 413 PHE A O   1 
ATOM 2898  C CB  . PHE A 1 444 ? -58.417  38.569  -32.731  1.00 161.90 ? 413 PHE A CB  1 
ATOM 2899  C CG  . PHE A 1 444 ? -58.160  39.159  -34.084  1.00 166.49 ? 413 PHE A CG  1 
ATOM 2900  C CD1 . PHE A 1 444 ? -58.576  40.454  -34.379  1.00 172.53 ? 413 PHE A CD1 1 
ATOM 2901  C CD2 . PHE A 1 444 ? -57.501  38.421  -35.070  1.00 165.25 ? 413 PHE A CD2 1 
ATOM 2902  C CE1 . PHE A 1 444 ? -58.342  41.008  -35.638  1.00 176.93 ? 413 PHE A CE1 1 
ATOM 2903  C CE2 . PHE A 1 444 ? -57.255  38.970  -36.325  1.00 169.50 ? 413 PHE A CE2 1 
ATOM 2904  C CZ  . PHE A 1 444 ? -57.678  40.265  -36.611  1.00 175.33 ? 413 PHE A CZ  1 
ATOM 2905  N N   . PRO A 1 445 ? -58.335  38.537  -29.600  1.00 158.26 ? 414 PRO A N   1 
ATOM 2906  C CA  . PRO A 1 445 ? -58.534  37.943  -28.261  1.00 154.79 ? 414 PRO A CA  1 
ATOM 2907  C C   . PRO A 1 445 ? -59.470  36.721  -28.177  1.00 149.92 ? 414 PRO A C   1 
ATOM 2908  O O   . PRO A 1 445 ? -59.566  36.110  -27.110  1.00 147.24 ? 414 PRO A O   1 
ATOM 2909  C CB  . PRO A 1 445 ? -59.101  39.108  -27.442  1.00 158.90 ? 414 PRO A CB  1 
ATOM 2910  C CG  . PRO A 1 445 ? -59.770  40.005  -28.457  1.00 163.36 ? 414 PRO A CG  1 
ATOM 2911  C CD  . PRO A 1 445 ? -59.063  39.813  -29.771  1.00 163.39 ? 414 PRO A CD  1 
ATOM 2912  N N   . THR A 1 446 ? -60.124  36.368  -29.289  1.00 148.96 ? 415 THR A N   1 
ATOM 2913  C CA  . THR A 1 446 ? -61.151  35.301  -29.349  1.00 144.97 ? 415 THR A CA  1 
ATOM 2914  C C   . THR A 1 446 ? -60.644  33.873  -29.053  1.00 139.74 ? 415 THR A C   1 
ATOM 2915  O O   . THR A 1 446 ? -59.629  33.440  -29.596  1.00 138.80 ? 415 THR A O   1 
ATOM 2916  C CB  . THR A 1 446 ? -61.884  35.305  -30.725  1.00 146.29 ? 415 THR A CB  1 
ATOM 2917  O OG1 . THR A 1 446 ? -60.926  35.377  -31.790  1.00 147.23 ? 415 THR A OG1 1 
ATOM 2918  C CG2 . THR A 1 446 ? -62.841  36.497  -30.839  1.00 151.13 ? 415 THR A CG2 1 
ATOM 2919  N N   . VAL A 1 447 ? -61.361  33.147  -28.195  1.00 136.54 ? 416 VAL A N   1 
ATOM 2920  C CA  . VAL A 1 447 ? -60.988  31.768  -27.841  1.00 131.96 ? 416 VAL A CA  1 
ATOM 2921  C C   . VAL A 1 447 ? -61.500  30.828  -28.912  1.00 129.31 ? 416 VAL A C   1 
ATOM 2922  O O   . VAL A 1 447 ? -62.710  30.715  -29.093  1.00 129.71 ? 416 VAL A O   1 
ATOM 2923  C CB  . VAL A 1 447 ? -61.586  31.313  -26.470  1.00 130.88 ? 416 VAL A CB  1 
ATOM 2924  C CG1 . VAL A 1 447 ? -61.328  29.811  -26.206  1.00 127.17 ? 416 VAL A CG1 1 
ATOM 2925  C CG2 . VAL A 1 447 ? -61.074  32.190  -25.304  1.00 133.28 ? 416 VAL A CG2 1 
ATOM 2926  N N   . PRO A 1 448 ? -60.589  30.133  -29.605  1.00 126.96 ? 417 PRO A N   1 
ATOM 2927  C CA  . PRO A 1 448 ? -60.880  29.259  -30.740  1.00 125.32 ? 417 PRO A CA  1 
ATOM 2928  C C   . PRO A 1 448 ? -61.749  28.057  -30.364  1.00 122.41 ? 417 PRO A C   1 
ATOM 2929  O O   . PRO A 1 448 ? -61.568  27.484  -29.294  1.00 120.96 ? 417 PRO A O   1 
ATOM 2930  C CB  . PRO A 1 448 ? -59.497  28.778  -31.154  1.00 124.45 ? 417 PRO A CB  1 
ATOM 2931  C CG  . PRO A 1 448 ? -58.566  29.743  -30.559  1.00 126.22 ? 417 PRO A CG  1 
ATOM 2932  C CD  . PRO A 1 448 ? -59.164  30.106  -29.274  1.00 126.35 ? 417 PRO A CD  1 
ATOM 2933  N N   . LEU A 1 449 ? -62.682  27.681  -31.236  1.00 121.98 ? 418 LEU A N   1 
ATOM 2934  C CA  . LEU A 1 449 ? -63.611  26.577  -30.954  1.00 119.67 ? 418 LEU A CA  1 
ATOM 2935  C C   . LEU A 1 449 ? -63.002  25.193  -31.201  1.00 117.02 ? 418 LEU A C   1 
ATOM 2936  O O   . LEU A 1 449 ? -62.416  24.957  -32.256  1.00 117.55 ? 418 LEU A O   1 
ATOM 2937  C CB  . LEU A 1 449 ? -64.869  26.710  -31.820  1.00 121.30 ? 418 LEU A CB  1 
ATOM 2938  C CG  . LEU A 1 449 ? -66.076  27.571  -31.448  1.00 123.39 ? 418 LEU A CG  1 
ATOM 2939  C CD1 . LEU A 1 449 ? -67.046  27.524  -32.648  1.00 126.03 ? 418 LEU A CD1 1 
ATOM 2940  C CD2 . LEU A 1 449 ? -66.765  27.116  -30.132  1.00 120.94 ? 418 LEU A CD2 1 
ATOM 2941  N N   . VAL A 1 450 ? -63.163  24.267  -30.257  1.00 114.37 ? 419 VAL A N   1 
ATOM 2942  C CA  . VAL A 1 450 ? -62.700  22.886  -30.479  1.00 111.95 ? 419 VAL A CA  1 
ATOM 2943  C C   . VAL A 1 450 ? -63.740  21.810  -30.150  1.00 110.53 ? 419 VAL A C   1 
ATOM 2944  O O   . VAL A 1 450 ? -64.236  21.717  -29.007  1.00 110.34 ? 419 VAL A O   1 
ATOM 2945  C CB  . VAL A 1 450 ? -61.371  22.602  -29.750  1.00 111.08 ? 419 VAL A CB  1 
ATOM 2946  C CG1 . VAL A 1 450 ? -61.122  21.109  -29.618  1.00 109.72 ? 419 VAL A CG1 1 
ATOM 2947  C CG2 . VAL A 1 450 ? -60.239  23.246  -30.505  1.00 112.25 ? 419 VAL A CG2 1 
ATOM 2948  N N   . LYS A 1 451 ? -64.043  21.000  -31.169  1.00 109.29 ? 420 LYS A N   1 
ATOM 2949  C CA  . LYS A 1 451 ? -64.977  19.879  -31.067  1.00 107.67 ? 420 LYS A CA  1 
ATOM 2950  C C   . LYS A 1 451 ? -64.245  18.613  -31.524  1.00 106.55 ? 420 LYS A C   1 
ATOM 2951  O O   . LYS A 1 451 ? -64.253  18.253  -32.701  1.00 107.26 ? 420 LYS A O   1 
ATOM 2952  C CB  . LYS A 1 451 ? -66.232  20.190  -31.903  1.00 109.19 ? 420 LYS A CB  1 
ATOM 2953  C CG  . LYS A 1 451 ? -67.240  19.042  -32.225  1.00 108.64 ? 420 LYS A CG  1 
ATOM 2954  C CD  . LYS A 1 451 ? -68.246  19.413  -33.434  1.00 105.80 ? 420 LYS A CD  1 
ATOM 2955  C CE  . LYS A 1 451 ? -69.664  19.840  -33.011  1.00 100.61 ? 420 LYS A CE  1 
ATOM 2956  N NZ  . LYS A 1 451 ? -70.010  20.839  -33.963  1.00 97.63  ? 420 LYS A NZ  1 
ATOM 2957  N N   . LEU A 1 452 ? -63.557  17.973  -30.587  1.00 104.63 ? 421 LEU A N   1 
ATOM 2958  C CA  . LEU A 1 452 ? -62.898  16.711  -30.861  1.00 103.89 ? 421 LEU A CA  1 
ATOM 2959  C C   . LEU A 1 452 ? -63.901  15.582  -30.733  1.00 104.38 ? 421 LEU A C   1 
ATOM 2960  O O   . LEU A 1 452 ? -64.796  15.636  -29.885  1.00 104.41 ? 421 LEU A O   1 
ATOM 2961  C CB  . LEU A 1 452 ? -61.760  16.479  -29.888  1.00 103.04 ? 421 LEU A CB  1 
ATOM 2962  C CG  . LEU A 1 452 ? -60.549  17.381  -30.010  1.00 102.19 ? 421 LEU A CG  1 
ATOM 2963  C CD1 . LEU A 1 452 ? -60.087  17.655  -28.647  1.00 103.22 ? 421 LEU A CD1 1 
ATOM 2964  C CD2 . LEU A 1 452 ? -59.463  16.685  -30.740  1.00 102.62 ? 421 LEU A CD2 1 
ATOM 2965  N N   . GLY A 1 453 ? -63.717  14.550  -31.559  1.00 105.05 ? 422 GLY A N   1 
ATOM 2966  C CA  . GLY A 1 453 ? -64.668  13.440  -31.718  1.00 105.65 ? 422 GLY A CA  1 
ATOM 2967  C C   . GLY A 1 453 ? -65.087  12.669  -30.480  1.00 105.49 ? 422 GLY A C   1 
ATOM 2968  O O   . GLY A 1 453 ? -64.772  13.037  -29.337  1.00 104.32 ? 422 GLY A O   1 
ATOM 2969  N N   . SER A 1 454 ? -65.837  11.600  -30.722  1.00 106.84 ? 423 SER A N   1 
ATOM 2970  C CA  . SER A 1 454 ? -66.248  10.687  -29.659  1.00 107.48 ? 423 SER A CA  1 
ATOM 2971  C C   . SER A 1 454 ? -65.164  9.639   -29.525  1.00 107.88 ? 423 SER A C   1 
ATOM 2972  O O   . SER A 1 454 ? -65.118  8.883   -28.560  1.00 109.16 ? 423 SER A O   1 
ATOM 2973  C CB  . SER A 1 454 ? -67.605  10.047  -29.980  1.00 109.61 ? 423 SER A CB  1 
ATOM 2974  O OG  . SER A 1 454 ? -67.686  9.649   -31.340  1.00 111.37 ? 423 SER A OG  1 
ATOM 2975  N N   . SER A 1 455 ? -64.288  9.630   -30.521  1.00 107.05 ? 424 SER A N   1 
ATOM 2976  C CA  . SER A 1 455 ? -63.120  8.783   -30.565  1.00 107.23 ? 424 SER A CA  1 
ATOM 2977  C C   . SER A 1 455 ? -61.987  9.469   -29.790  1.00 105.04 ? 424 SER A C   1 
ATOM 2978  O O   . SER A 1 455 ? -60.884  8.942   -29.646  1.00 105.79 ? 424 SER A O   1 
ATOM 2979  C CB  . SER A 1 455 ? -62.765  8.514   -32.039  1.00 108.43 ? 424 SER A CB  1 
ATOM 2980  O OG  . SER A 1 455 ? -63.398  9.438   -32.928  1.00 106.48 ? 424 SER A OG  1 
ATOM 2981  N N   . PHE A 1 456 ? -62.305  10.645  -29.267  1.00 102.49 ? 425 PHE A N   1 
ATOM 2982  C CA  . PHE A 1 456 ? -61.380  11.458  -28.497  1.00 100.55 ? 425 PHE A CA  1 
ATOM 2983  C C   . PHE A 1 456 ? -61.820  11.726  -27.049  1.00 100.50 ? 425 PHE A C   1 
ATOM 2984  O O   . PHE A 1 456 ? -61.213  12.562  -26.382  1.00 99.75  ? 425 PHE A O   1 
ATOM 2985  C CB  . PHE A 1 456 ? -61.225  12.823  -29.161  1.00 98.52  ? 425 PHE A CB  1 
ATOM 2986  C CG  . PHE A 1 456 ? -60.262  12.851  -30.255  1.00 96.49  ? 425 PHE A CG  1 
ATOM 2987  C CD1 . PHE A 1 456 ? -58.984  13.276  -30.033  1.00 94.97  ? 425 PHE A CD1 1 
ATOM 2988  C CD2 . PHE A 1 456 ? -60.632  12.479  -31.521  1.00 96.31  ? 425 PHE A CD2 1 
ATOM 2989  C CE1 . PHE A 1 456 ? -58.071  13.312  -31.064  1.00 95.78  ? 425 PHE A CE1 1 
ATOM 2990  C CE2 . PHE A 1 456 ? -59.725  12.516  -32.558  1.00 96.82  ? 425 PHE A CE2 1 
ATOM 2991  C CZ  . PHE A 1 456 ? -58.442  12.930  -32.330  1.00 95.98  ? 425 PHE A CZ  1 
ATOM 2992  N N   . THR A 1 457 ? -62.865  11.081  -26.541  1.00 101.61 ? 426 THR A N   1 
ATOM 2993  C CA  . THR A 1 457 ? -63.284  11.457  -25.196  1.00 101.35 ? 426 THR A CA  1 
ATOM 2994  C C   . THR A 1 457 ? -62.331  10.928  -24.139  1.00 102.77 ? 426 THR A C   1 
ATOM 2995  O O   . THR A 1 457 ? -61.631  11.719  -23.510  1.00 101.74 ? 426 THR A O   1 
ATOM 2996  C CB  . THR A 1 457 ? -64.729  11.107  -24.864  1.00 102.24 ? 426 THR A CB  1 
ATOM 2997  O OG1 . THR A 1 457 ? -65.543  11.282  -26.028  1.00 101.82 ? 426 THR A OG1 1 
ATOM 2998  C CG2 . THR A 1 457 ? -65.221  12.028  -23.750  1.00 100.80 ? 426 THR A CG2 1 
ATOM 2999  N N   . LYS A 1 458 ? -62.283  9.605   -23.968  1.00 105.71 ? 427 LYS A N   1 
ATOM 3000  C CA  . LYS A 1 458 ? -61.486  8.992   -22.905  1.00 108.36 ? 427 LYS A CA  1 
ATOM 3001  C C   . LYS A 1 458 ? -60.056  9.532   -22.973  1.00 108.38 ? 427 LYS A C   1 
ATOM 3002  O O   . LYS A 1 458 ? -59.393  9.371   -23.991  1.00 108.94 ? 427 LYS A O   1 
ATOM 3003  C CB  . LYS A 1 458 ? -61.517  7.460   -23.004  1.00 110.98 ? 427 LYS A CB  1 
ATOM 3004  N N   . VAL A 1 459 ? -59.591  10.199  -21.913  1.00 108.93 ? 428 VAL A N   1 
ATOM 3005  C CA  . VAL A 1 459 ? -58.259  10.838  -21.908  1.00 108.80 ? 428 VAL A CA  1 
ATOM 3006  C C   . VAL A 1 459 ? -57.169  9.956   -22.501  1.00 111.04 ? 428 VAL A C   1 
ATOM 3007  O O   . VAL A 1 459 ? -56.512  10.365  -23.448  1.00 110.21 ? 428 VAL A O   1 
ATOM 3008  C CB  . VAL A 1 459 ? -57.819  11.316  -20.508  1.00 109.06 ? 428 VAL A CB  1 
ATOM 3009  C CG1 . VAL A 1 459 ? -56.443  11.912  -20.571  1.00 108.20 ? 428 VAL A CG1 1 
ATOM 3010  C CG2 . VAL A 1 459 ? -58.757  12.360  -19.994  1.00 108.03 ? 428 VAL A CG2 1 
ATOM 3011  N N   . GLN A 1 460 ? -56.987  8.748   -21.971  1.00 114.84 ? 429 GLN A N   1 
ATOM 3012  C CA  . GLN A 1 460 ? -55.919  7.878   -22.476  1.00 118.15 ? 429 GLN A CA  1 
ATOM 3013  C C   . GLN A 1 460 ? -55.978  7.671   -23.999  1.00 117.81 ? 429 GLN A C   1 
ATOM 3014  O O   . GLN A 1 460 ? -54.946  7.401   -24.617  1.00 119.15 ? 429 GLN A O   1 
ATOM 3015  C CB  . GLN A 1 460 ? -55.812  6.546   -21.708  1.00 122.22 ? 429 GLN A CB  1 
ATOM 3016  C CG  . GLN A 1 460 ? -57.062  5.645   -21.738  1.00 126.63 ? 429 GLN A CG  1 
ATOM 3017  C CD  . GLN A 1 460 ? -56.847  4.255   -21.083  1.00 134.42 ? 429 GLN A CD  1 
ATOM 3018  O OE1 . GLN A 1 460 ? -56.124  4.116   -20.081  1.00 137.05 ? 429 GLN A OE1 1 
ATOM 3019  N NE2 . GLN A 1 460 ? -57.494  3.227   -21.651  1.00 137.60 ? 429 GLN A NE2 1 
ATOM 3020  N N   . ASP A 1 461 ? -57.166  7.813   -24.594  1.00 116.67 ? 430 ASP A N   1 
ATOM 3021  C CA  . ASP A 1 461 ? -57.317  7.778   -26.050  1.00 116.24 ? 430 ASP A CA  1 
ATOM 3022  C C   . ASP A 1 461 ? -56.791  9.050   -26.626  1.00 113.29 ? 430 ASP A C   1 
ATOM 3023  O O   . ASP A 1 461 ? -56.020  9.023   -27.574  1.00 113.95 ? 430 ASP A O   1 
ATOM 3024  C CB  . ASP A 1 461 ? -58.778  7.679   -26.470  1.00 116.47 ? 430 ASP A CB  1 
ATOM 3025  C CG  . ASP A 1 461 ? -59.283  6.257   -26.524  1.00 121.66 ? 430 ASP A CG  1 
ATOM 3026  O OD1 . ASP A 1 461 ? -60.524  6.091   -26.578  1.00 123.94 ? 430 ASP A OD1 1 
ATOM 3027  O OD2 . ASP A 1 461 ? -58.456  5.310   -26.517  1.00 126.72 ? 430 ASP A OD2 1 
ATOM 3028  N N   . TYR A 1 462 ? -57.237  10.162  -26.047  1.00 110.69 ? 431 TYR A N   1 
ATOM 3029  C CA  . TYR A 1 462 ? -56.909  11.508  -26.502  1.00 108.28 ? 431 TYR A CA  1 
ATOM 3030  C C   . TYR A 1 462 ? -55.427  11.729  -26.559  1.00 108.93 ? 431 TYR A C   1 
ATOM 3031  O O   . TYR A 1 462 ? -54.910  12.361  -27.484  1.00 108.35 ? 431 TYR A O   1 
ATOM 3032  C CB  . TYR A 1 462 ? -57.465  12.518  -25.523  1.00 106.63 ? 431 TYR A CB  1 
ATOM 3033  C CG  . TYR A 1 462 ? -56.761  13.852  -25.542  1.00 103.91 ? 431 TYR A CG  1 
ATOM 3034  C CD1 . TYR A 1 462 ? -56.972  14.746  -26.577  1.00 102.51 ? 431 TYR A CD1 1 
ATOM 3035  C CD2 . TYR A 1 462 ? -55.905  14.225  -24.524  1.00 102.34 ? 431 TYR A CD2 1 
ATOM 3036  C CE1 . TYR A 1 462 ? -56.364  15.965  -26.594  1.00 100.97 ? 431 TYR A CE1 1 
ATOM 3037  C CE2 . TYR A 1 462 ? -55.286  15.443  -24.540  1.00 101.06 ? 431 TYR A CE2 1 
ATOM 3038  C CZ  . TYR A 1 462 ? -55.525  16.304  -25.580  1.00 100.92 ? 431 TYR A CZ  1 
ATOM 3039  O OH  . TYR A 1 462 ? -54.923  17.526  -25.627  1.00 102.61 ? 431 TYR A OH  1 
ATOM 3040  N N   . LEU A 1 463 ? -54.765  11.233  -25.524  1.00 110.42 ? 432 LEU A N   1 
ATOM 3041  C CA  . LEU A 1 463 ? -53.342  11.332  -25.412  1.00 111.56 ? 432 LEU A CA  1 
ATOM 3042  C C   . LEU A 1 463 ? -52.692  10.509  -26.507  1.00 113.53 ? 432 LEU A C   1 
ATOM 3043  O O   . LEU A 1 463 ? -51.680  10.927  -27.053  1.00 114.41 ? 432 LEU A O   1 
ATOM 3044  C CB  . LEU A 1 463 ? -52.885  10.864  -24.036  1.00 112.99 ? 432 LEU A CB  1 
ATOM 3045  C CG  . LEU A 1 463 ? -53.154  11.800  -22.856  1.00 111.67 ? 432 LEU A CG  1 
ATOM 3046  C CD1 . LEU A 1 463 ? -52.827  11.100  -21.540  1.00 113.30 ? 432 LEU A CD1 1 
ATOM 3047  C CD2 . LEU A 1 463 ? -52.382  13.122  -22.985  1.00 110.62 ? 432 LEU A CD2 1 
ATOM 3048  N N   . ARG A 1 464 ? -53.282  9.364   -26.846  1.00 115.07 ? 433 ARG A N   1 
ATOM 3049  C CA  . ARG A 1 464 ? -52.684  8.463   -27.830  1.00 117.35 ? 433 ARG A CA  1 
ATOM 3050  C C   . ARG A 1 464 ? -52.824  8.989   -29.250  1.00 116.20 ? 433 ARG A C   1 
ATOM 3051  O O   . ARG A 1 464 ? -51.908  8.844   -30.048  1.00 117.63 ? 433 ARG A O   1 
ATOM 3052  C CB  . ARG A 1 464 ? -53.289  7.072   -27.721  1.00 120.01 ? 433 ARG A CB  1 
ATOM 3053  C CG  . ARG A 1 464 ? -52.533  6.003   -28.472  1.00 124.03 ? 433 ARG A CG  1 
ATOM 3054  C CD  . ARG A 1 464 ? -53.499  5.195   -29.302  1.00 127.40 ? 433 ARG A CD  1 
ATOM 3055  N NE  . ARG A 1 464 ? -54.696  4.844   -28.538  1.00 129.73 ? 433 ARG A NE  1 
ATOM 3056  C CZ  . ARG A 1 464 ? -55.834  4.419   -29.082  1.00 132.24 ? 433 ARG A CZ  1 
ATOM 3057  N NH1 . ARG A 1 464 ? -55.939  4.285   -30.406  1.00 133.56 ? 433 ARG A NH1 1 
ATOM 3058  N NH2 . ARG A 1 464 ? -56.870  4.120   -28.304  1.00 133.29 ? 433 ARG A NH2 1 
ATOM 3059  N N   . ARG A 1 465 ? -53.965  9.598   -29.550  1.00 114.17 ? 434 ARG A N   1 
ATOM 3060  C CA  . ARG A 1 465 ? -54.208  10.230  -30.837  1.00 113.69 ? 434 ARG A CA  1 
ATOM 3061  C C   . ARG A 1 465 ? -53.238  11.373  -31.136  1.00 113.26 ? 434 ARG A C   1 
ATOM 3062  O O   . ARG A 1 465 ? -52.943  11.653  -32.299  1.00 113.85 ? 434 ARG A O   1 
ATOM 3063  C CB  . ARG A 1 465 ? -55.613  10.821  -30.867  1.00 112.08 ? 434 ARG A CB  1 
ATOM 3064  C CG  . ARG A 1 465 ? -56.765  9.834   -30.836  1.00 112.97 ? 434 ARG A CG  1 
ATOM 3065  C CD  . ARG A 1 465 ? -57.155  9.406   -32.229  1.00 113.57 ? 434 ARG A CD  1 
ATOM 3066  N NE  . ARG A 1 465 ? -58.427  8.710   -32.243  1.00 113.11 ? 434 ARG A NE  1 
ATOM 3067  C CZ  . ARG A 1 465 ? -58.590  7.457   -31.847  1.00 115.87 ? 434 ARG A CZ  1 
ATOM 3068  N NH1 . ARG A 1 465 ? -57.568  6.755   -31.403  1.00 118.40 ? 434 ARG A NH1 1 
ATOM 3069  N NH2 . ARG A 1 465 ? -59.781  6.900   -31.889  1.00 118.39 ? 434 ARG A NH2 1 
ATOM 3070  N N   . PHE A 1 466 ? -52.776  12.058  -30.095  1.00 112.62 ? 435 PHE A N   1 
ATOM 3071  C CA  . PHE A 1 466 ? -51.848  13.166  -30.273  1.00 112.66 ? 435 PHE A CA  1 
ATOM 3072  C C   . PHE A 1 466 ? -50.434  12.801  -29.890  1.00 114.92 ? 435 PHE A C   1 
ATOM 3073  O O   . PHE A 1 466 ? -50.071  12.878  -28.707  1.00 115.43 ? 435 PHE A O   1 
ATOM 3074  C CB  . PHE A 1 466 ? -52.276  14.350  -29.427  1.00 110.68 ? 435 PHE A CB  1 
ATOM 3075  C CG  . PHE A 1 466 ? -53.418  15.080  -29.982  1.00 109.50 ? 435 PHE A CG  1 
ATOM 3076  C CD1 . PHE A 1 466 ? -53.292  15.770  -31.174  1.00 110.24 ? 435 PHE A CD1 1 
ATOM 3077  C CD2 . PHE A 1 466 ? -54.632  15.079  -29.331  1.00 109.09 ? 435 PHE A CD2 1 
ATOM 3078  C CE1 . PHE A 1 466 ? -54.363  16.461  -31.719  1.00 109.74 ? 435 PHE A CE1 1 
ATOM 3079  C CE2 . PHE A 1 466 ? -55.713  15.767  -29.862  1.00 109.07 ? 435 PHE A CE2 1 
ATOM 3080  C CZ  . PHE A 1 466 ? -55.576  16.457  -31.069  1.00 109.37 ? 435 PHE A CZ  1 
ATOM 3081  N N   . GLU A 1 467 ? -49.617  12.426  -30.870  1.00 117.06 ? 436 GLU A N   1 
ATOM 3082  C CA  . GLU A 1 467 ? -48.217  12.161  -30.564  1.00 119.42 ? 436 GLU A CA  1 
ATOM 3083  C C   . GLU A 1 467 ? -47.440  13.461  -30.269  1.00 118.02 ? 436 GLU A C   1 
ATOM 3084  O O   . GLU A 1 467 ? -46.278  13.433  -29.902  1.00 119.78 ? 436 GLU A O   1 
ATOM 3085  C CB  . GLU A 1 467 ? -47.554  11.266  -31.625  1.00 122.53 ? 436 GLU A CB  1 
ATOM 3086  C CG  . GLU A 1 467 ? -47.378  11.881  -33.027  1.00 127.08 ? 436 GLU A CG  1 
ATOM 3087  C CD  . GLU A 1 467 ? -46.095  11.392  -33.779  1.00 135.35 ? 436 GLU A CD  1 
ATOM 3088  O OE1 . GLU A 1 467 ? -45.303  10.602  -33.186  1.00 139.48 ? 436 GLU A OE1 1 
ATOM 3089  O OE2 . GLU A 1 467 ? -45.868  11.809  -34.959  1.00 136.95 ? 436 GLU A OE2 1 
ATOM 3090  N N   . SER A 1 468 ? -48.118  14.591  -30.391  1.00 115.36 ? 437 SER A N   1 
ATOM 3091  C CA  . SER A 1 468 ? -47.587  15.885  -30.032  1.00 114.63 ? 437 SER A CA  1 
ATOM 3092  C C   . SER A 1 468 ? -48.806  16.770  -30.032  1.00 112.48 ? 437 SER A C   1 
ATOM 3093  O O   . SER A 1 468 ? -49.701  16.554  -30.833  1.00 112.18 ? 437 SER A O   1 
ATOM 3094  C CB  . SER A 1 468 ? -46.617  16.348  -31.108  1.00 116.41 ? 437 SER A CB  1 
ATOM 3095  O OG  . SER A 1 468 ? -46.547  17.760  -31.183  1.00 117.15 ? 437 SER A OG  1 
ATOM 3096  N N   . ILE A 1 469 ? -48.879  17.754  -29.146  1.00 111.51 ? 438 ILE A N   1 
ATOM 3097  C CA  . ILE A 1 469 ? -50.048  18.644  -29.136  1.00 109.76 ? 438 ILE A CA  1 
ATOM 3098  C C   . ILE A 1 469 ? -49.733  19.838  -30.055  1.00 110.73 ? 438 ILE A C   1 
ATOM 3099  O O   . ILE A 1 469 ? -48.809  20.618  -29.792  1.00 112.09 ? 438 ILE A O   1 
ATOM 3100  C CB  . ILE A 1 469 ? -50.474  19.071  -27.705  1.00 108.83 ? 438 ILE A CB  1 
ATOM 3101  C CG1 . ILE A 1 469 ? -50.374  17.905  -26.708  1.00 109.55 ? 438 ILE A CG1 1 
ATOM 3102  C CG2 . ILE A 1 469 ? -51.872  19.562  -27.701  1.00 106.58 ? 438 ILE A CG2 1 
ATOM 3103  C CD1 . ILE A 1 469 ? -48.983  17.755  -25.943  1.00 112.09 ? 438 ILE A CD1 1 
ATOM 3104  N N   . PRO A 1 470 ? -50.498  19.978  -31.149  1.00 110.44 ? 439 PRO A N   1 
ATOM 3105  C CA  . PRO A 1 470 ? -50.054  20.740  -32.309  1.00 111.81 ? 439 PRO A CA  1 
ATOM 3106  C C   . PRO A 1 470 ? -50.202  22.267  -32.210  1.00 112.42 ? 439 PRO A C   1 
ATOM 3107  O O   . PRO A 1 470 ? -50.861  22.776  -31.308  1.00 111.41 ? 439 PRO A O   1 
ATOM 3108  C CB  . PRO A 1 470 ? -50.922  20.177  -33.432  1.00 111.57 ? 439 PRO A CB  1 
ATOM 3109  C CG  . PRO A 1 470 ? -52.075  19.491  -32.761  1.00 109.73 ? 439 PRO A CG  1 
ATOM 3110  C CD  . PRO A 1 470 ? -51.905  19.582  -31.284  1.00 109.11 ? 439 PRO A CD  1 
ATOM 3111  N N   . ASP A 1 471 ? -49.562  22.967  -33.145  1.00 114.46 ? 440 ASP A N   1 
ATOM 3112  C CA  . ASP A 1 471 ? -49.557  24.419  -33.216  1.00 116.22 ? 440 ASP A CA  1 
ATOM 3113  C C   . ASP A 1 471 ? -50.963  24.961  -33.434  1.00 115.76 ? 440 ASP A C   1 
ATOM 3114  O O   . ASP A 1 471 ? -51.709  24.446  -34.259  1.00 115.91 ? 440 ASP A O   1 
ATOM 3115  C CB  . ASP A 1 471 ? -48.650  24.858  -34.363  1.00 119.15 ? 440 ASP A CB  1 
ATOM 3116  C CG  . ASP A 1 471 ? -48.481  26.368  -34.442  1.00 122.50 ? 440 ASP A CG  1 
ATOM 3117  O OD1 . ASP A 1 471 ? -48.992  27.081  -33.555  1.00 122.90 ? 440 ASP A OD1 1 
ATOM 3118  O OD2 . ASP A 1 471 ? -47.826  26.849  -35.398  1.00 126.43 ? 440 ASP A OD2 1 
ATOM 3119  N N   . MET A 1 472 ? -51.324  26.009  -32.703  1.00 115.94 ? 441 MET A N   1 
ATOM 3120  C CA  . MET A 1 472 ? -52.698  26.509  -32.714  1.00 115.16 ? 441 MET A CA  1 
ATOM 3121  C C   . MET A 1 472 ? -52.768  28.024  -32.764  1.00 117.42 ? 441 MET A C   1 
ATOM 3122  O O   . MET A 1 472 ? -53.779  28.569  -33.161  1.00 118.02 ? 441 MET A O   1 
ATOM 3123  C CB  . MET A 1 472 ? -53.465  26.013  -31.472  1.00 112.85 ? 441 MET A CB  1 
ATOM 3124  C CG  . MET A 1 472 ? -53.348  24.498  -31.186  1.00 111.28 ? 441 MET A CG  1 
ATOM 3125  S SD  . MET A 1 472 ? -54.814  23.443  -31.379  1.00 109.32 ? 441 MET A SD  1 
ATOM 3126  C CE  . MET A 1 472 ? -55.589  23.673  -29.786  1.00 107.85 ? 441 MET A CE  1 
ATOM 3127  N N   . LEU A 1 473 ? -51.695  28.704  -32.364  1.00 119.18 ? 442 LEU A N   1 
ATOM 3128  C CA  . LEU A 1 473 ? -51.750  30.152  -32.088  1.00 121.70 ? 442 LEU A CA  1 
ATOM 3129  C C   . LEU A 1 473 ? -52.503  30.933  -33.182  1.00 124.02 ? 442 LEU A C   1 
ATOM 3130  O O   . LEU A 1 473 ? -52.907  32.083  -32.945  1.00 126.69 ? 442 LEU A O   1 
ATOM 3131  C CB  . LEU A 1 473 ? -50.359  30.755  -31.767  1.00 123.28 ? 442 LEU A CB  1 
ATOM 3132  N N   . GLU A 1 474 ? -52.720  30.313  -34.352  1.00 123.23 ? 443 GLU A N   1 
ATOM 3133  C CA  . GLU A 1 474 ? -53.465  30.987  -35.415  1.00 125.56 ? 443 GLU A CA  1 
ATOM 3134  C C   . GLU A 1 474 ? -54.657  30.232  -36.007  1.00 123.14 ? 443 GLU A C   1 
ATOM 3135  O O   . GLU A 1 474 ? -55.077  30.466  -37.143  1.00 125.12 ? 443 GLU A O   1 
ATOM 3136  C CB  . GLU A 1 474 ? -52.520  31.579  -36.465  1.00 129.58 ? 443 GLU A CB  1 
ATOM 3137  C CG  . GLU A 1 474 ? -52.004  32.964  -35.992  1.00 135.79 ? 443 GLU A CG  1 
ATOM 3138  C CD  . GLU A 1 474 ? -51.272  33.800  -37.047  1.00 143.87 ? 443 GLU A CD  1 
ATOM 3139  O OE1 . GLU A 1 474 ? -51.380  33.487  -38.261  1.00 146.65 ? 443 GLU A OE1 1 
ATOM 3140  O OE2 . GLU A 1 474 ? -50.596  34.788  -36.643  1.00 147.63 ? 443 GLU A OE2 1 
ATOM 3141  N N   . LEU A 1 475 ? -55.226  29.359  -35.186  1.00 119.15 ? 444 LEU A N   1 
ATOM 3142  C CA  . LEU A 1 475 ? -56.419  28.590  -35.523  1.00 116.77 ? 444 LEU A CA  1 
ATOM 3143  C C   . LEU A 1 475 ? -57.618  29.280  -34.935  1.00 117.24 ? 444 LEU A C   1 
ATOM 3144  O O   . LEU A 1 475 ? -57.516  29.982  -33.937  1.00 117.58 ? 444 LEU A O   1 
ATOM 3145  C CB  . LEU A 1 475 ? -56.291  27.190  -34.948  1.00 113.09 ? 444 LEU A CB  1 
ATOM 3146  C CG  . LEU A 1 475 ? -57.409  26.240  -34.571  1.00 109.18 ? 444 LEU A CG  1 
ATOM 3147  C CD1 . LEU A 1 475 ? -56.744  24.923  -34.390  1.00 107.65 ? 444 LEU A CD1 1 
ATOM 3148  C CD2 . LEU A 1 475 ? -58.018  26.634  -33.272  1.00 106.61 ? 444 LEU A CD2 1 
ATOM 3149  N N   . ASP A 1 476 ? -58.764  29.073  -35.560  1.00 117.68 ? 445 ASP A N   1 
ATOM 3150  C CA  . ASP A 1 476 ? -59.969  29.774  -35.175  1.00 118.90 ? 445 ASP A CA  1 
ATOM 3151  C C   . ASP A 1 476 ? -61.086  28.778  -34.917  1.00 116.18 ? 445 ASP A C   1 
ATOM 3152  O O   . ASP A 1 476 ? -61.881  28.970  -34.007  1.00 116.04 ? 445 ASP A O   1 
ATOM 3153  C CB  . ASP A 1 476 ? -60.348  30.833  -36.226  1.00 123.31 ? 445 ASP A CB  1 
ATOM 3154  C CG  . ASP A 1 476 ? -59.423  32.086  -36.189  1.00 127.99 ? 445 ASP A CG  1 
ATOM 3155  O OD1 . ASP A 1 476 ? -58.210  31.980  -36.502  1.00 130.24 ? 445 ASP A OD1 1 
ATOM 3156  O OD2 . ASP A 1 476 ? -59.914  33.195  -35.870  1.00 131.71 ? 445 ASP A OD2 1 
ATOM 3157  N N   . HIS A 1 477 ? -61.125  27.698  -35.682  1.00 114.65 ? 446 HIS A N   1 
ATOM 3158  C CA  . HIS A 1 477 ? -62.060  26.624  -35.408  1.00 112.91 ? 446 HIS A CA  1 
ATOM 3159  C C   . HIS A 1 477 ? -61.501  25.277  -35.872  1.00 111.17 ? 446 HIS A C   1 
ATOM 3160  O O   . HIS A 1 477 ? -60.849  25.190  -36.905  1.00 112.92 ? 446 HIS A O   1 
ATOM 3161  C CB  . HIS A 1 477 ? -63.396  26.937  -36.072  1.00 115.28 ? 446 HIS A CB  1 
ATOM 3162  C CG  . HIS A 1 477 ? -64.357  25.786  -36.103  1.00 116.08 ? 446 HIS A CG  1 
ATOM 3163  N ND1 . HIS A 1 477 ? -65.357  25.631  -35.164  1.00 117.11 ? 446 HIS A ND1 1 
ATOM 3164  C CD2 . HIS A 1 477 ? -64.491  24.754  -36.975  1.00 116.59 ? 446 HIS A CD2 1 
ATOM 3165  C CE1 . HIS A 1 477 ? -66.054  24.542  -35.447  1.00 116.82 ? 446 HIS A CE1 1 
ATOM 3166  N NE2 . HIS A 1 477 ? -65.548  23.992  -36.539  1.00 116.33 ? 446 HIS A NE2 1 
ATOM 3167  N N   . LEU A 1 478 ? -61.741  24.228  -35.092  1.00 108.46 ? 447 LEU A N   1 
ATOM 3168  C CA  . LEU A 1 478 ? -61.313  22.869  -35.435  1.00 106.68 ? 447 LEU A CA  1 
ATOM 3169  C C   . LEU A 1 478 ? -62.378  21.916  -34.960  1.00 105.25 ? 447 LEU A C   1 
ATOM 3170  O O   . LEU A 1 478 ? -62.892  22.026  -33.823  1.00 104.29 ? 447 LEU A O   1 
ATOM 3171  C CB  . LEU A 1 478 ? -59.996  22.493  -34.740  1.00 105.57 ? 447 LEU A CB  1 
ATOM 3172  C CG  . LEU A 1 478 ? -59.562  21.012  -34.700  1.00 104.12 ? 447 LEU A CG  1 
ATOM 3173  C CD1 . LEU A 1 478 ? -58.612  20.714  -35.841  1.00 105.64 ? 447 LEU A CD1 1 
ATOM 3174  C CD2 . LEU A 1 478 ? -58.928  20.615  -33.369  1.00 100.87 ? 447 LEU A CD2 1 
ATOM 3175  N N   . THR A 1 479 ? -62.695  20.966  -35.820  1.00 104.94 ? 448 THR A N   1 
ATOM 3176  C CA  . THR A 1 479 ? -63.620  19.922  -35.451  1.00 103.65 ? 448 THR A CA  1 
ATOM 3177  C C   . THR A 1 479 ? -63.100  18.685  -36.108  1.00 103.17 ? 448 THR A C   1 
ATOM 3178  O O   . THR A 1 479 ? -62.831  18.683  -37.309  1.00 104.79 ? 448 THR A O   1 
ATOM 3179  C CB  . THR A 1 479 ? -65.062  20.253  -35.906  1.00 105.09 ? 448 THR A CB  1 
ATOM 3180  O OG1 . THR A 1 479 ? -65.881  19.088  -35.832  1.00 104.95 ? 448 THR A OG1 1 
ATOM 3181  C CG2 . THR A 1 479 ? -65.071  20.746  -37.332  1.00 108.14 ? 448 THR A CG2 1 
ATOM 3182  N N   . VAL A 1 480 ? -62.888  17.648  -35.323  1.00 98.08  ? 449 VAL A N   1 
ATOM 3183  C CA  . VAL A 1 480 ? -62.472  16.417  -35.925  1.00 97.01  ? 449 VAL A CA  1 
ATOM 3184  C C   . VAL A 1 480 ? -63.428  15.388  -35.439  1.00 98.49  ? 449 VAL A C   1 
ATOM 3185  O O   . VAL A 1 480 ? -63.850  15.455  -34.306  1.00 100.06 ? 449 VAL A O   1 
ATOM 3186  C CB  . VAL A 1 480 ? -61.005  16.047  -35.587  1.00 96.31  ? 449 VAL A CB  1 
ATOM 3187  C CG1 . VAL A 1 480 ? -60.136  17.287  -35.505  1.00 95.76  ? 449 VAL A CG1 1 
ATOM 3188  C CG2 . VAL A 1 480 ? -60.909  15.300  -34.289  1.00 98.29  ? 449 VAL A CG2 1 
ATOM 3189  N N   . SER A 1 481 ? -63.807  14.463  -36.303  1.00 98.73  ? 450 SER A N   1 
ATOM 3190  C CA  . SER A 1 481 ? -64.566  13.314  -35.853  1.00 101.79 ? 450 SER A CA  1 
ATOM 3191  C C   . SER A 1 481 ? -64.200  12.096  -36.655  1.00 101.78 ? 450 SER A C   1 
ATOM 3192  O O   . SER A 1 481 ? -63.851  12.184  -37.840  1.00 99.77  ? 450 SER A O   1 
ATOM 3193  C CB  . SER A 1 481 ? -66.070  13.556  -35.927  1.00 104.02 ? 450 SER A CB  1 
ATOM 3194  O OG  . SER A 1 481 ? -66.502  13.552  -37.273  1.00 104.43 ? 450 SER A OG  1 
ATOM 3195  N N   . GLY A 1 482 ? -64.299  10.955  -35.987  1.00 104.59 ? 451 GLY A N   1 
ATOM 3196  C CA  . GLY A 1 482 ? -63.881  9.688   -36.563  1.00 105.48 ? 451 GLY A CA  1 
ATOM 3197  C C   . GLY A 1 482 ? -62.500  9.311   -36.089  1.00 104.72 ? 451 GLY A C   1 
ATOM 3198  O O   . GLY A 1 482 ? -61.876  10.048  -35.343  1.00 103.87 ? 451 GLY A O   1 
ATOM 3199  N N   . ASP A 1 483 ? -62.027  8.155   -36.525  1.00 105.59 ? 452 ASP A N   1 
ATOM 3200  C CA  . ASP A 1 483 ? -60.709  7.707   -36.172  1.00 105.66 ? 452 ASP A CA  1 
ATOM 3201  C C   . ASP A 1 483 ? -59.649  8.583   -36.844  1.00 102.50 ? 452 ASP A C   1 
ATOM 3202  O O   . ASP A 1 483 ? -59.075  8.220   -37.874  1.00 102.37 ? 452 ASP A O   1 
ATOM 3203  C CB  . ASP A 1 483 ? -60.545  6.253   -36.570  1.00 108.14 ? 452 ASP A CB  1 
ATOM 3204  C CG  . ASP A 1 483 ? -59.446  5.579   -35.803  1.00 111.73 ? 452 ASP A CG  1 
ATOM 3205  O OD1 . ASP A 1 483 ? -59.017  6.144   -34.758  1.00 113.51 ? 452 ASP A OD1 1 
ATOM 3206  O OD2 . ASP A 1 483 ? -59.007  4.490   -36.249  1.00 115.72 ? 452 ASP A OD2 1 
ATOM 3207  N N   . VAL A 1 484 ? -59.409  9.752   -36.268  1.00 100.58 ? 453 VAL A N   1 
ATOM 3208  C CA  . VAL A 1 484 ? -58.441  10.681  -36.805  1.00 98.04  ? 453 VAL A CA  1 
ATOM 3209  C C   . VAL A 1 484 ? -57.271  10.702  -35.869  1.00 98.65  ? 453 VAL A C   1 
ATOM 3210  O O   . VAL A 1 484 ? -57.465  10.591  -34.673  1.00 100.38 ? 453 VAL A O   1 
ATOM 3211  C CB  . VAL A 1 484 ? -59.076  12.045  -36.996  1.00 96.35  ? 453 VAL A CB  1 
ATOM 3212  C CG1 . VAL A 1 484 ? -58.147  13.169  -36.643  1.00 95.16  ? 453 VAL A CG1 1 
ATOM 3213  C CG2 . VAL A 1 484 ? -59.482  12.159  -38.423  1.00 96.18  ? 453 VAL A CG2 1 
ATOM 3214  N N   . THR A 1 485 ? -56.058  10.813  -36.400  1.00 98.10  ? 454 THR A N   1 
ATOM 3215  C CA  . THR A 1 485 ? -54.879  10.744  -35.551  1.00 99.06  ? 454 THR A CA  1 
ATOM 3216  C C   . THR A 1 485 ? -53.681  11.556  -36.039  1.00 98.73  ? 454 THR A C   1 
ATOM 3217  O O   . THR A 1 485 ? -53.277  11.435  -37.188  1.00 99.08  ? 454 THR A O   1 
ATOM 3218  C CB  . THR A 1 485 ? -54.487  9.284   -35.279  1.00 101.08 ? 454 THR A CB  1 
ATOM 3219  O OG1 . THR A 1 485 ? -53.231  9.272   -34.606  1.00 103.09 ? 454 THR A OG1 1 
ATOM 3220  C CG2 . THR A 1 485 ? -54.396  8.463   -36.559  1.00 100.21 ? 454 THR A CG2 1 
ATOM 3221  N N   . PHE A 1 486 ? -53.097  12.351  -35.143  1.00 99.09  ? 455 PHE A N   1 
ATOM 3222  C CA  . PHE A 1 486 ? -52.088  13.357  -35.515  1.00 99.18  ? 455 PHE A CA  1 
ATOM 3223  C C   . PHE A 1 486 ? -50.611  13.016  -35.351  1.00 100.95 ? 455 PHE A C   1 
ATOM 3224  O O   . PHE A 1 486 ? -50.225  12.195  -34.511  1.00 102.20 ? 455 PHE A O   1 
ATOM 3225  C CB  . PHE A 1 486 ? -52.310  14.619  -34.718  1.00 98.95  ? 455 PHE A CB  1 
ATOM 3226  C CG  . PHE A 1 486 ? -53.560  15.341  -35.060  1.00 98.17  ? 455 PHE A CG  1 
ATOM 3227  C CD1 . PHE A 1 486 ? -53.521  16.446  -35.887  1.00 98.42  ? 455 PHE A CD1 1 
ATOM 3228  C CD2 . PHE A 1 486 ? -54.766  14.951  -34.517  1.00 98.37  ? 455 PHE A CD2 1 
ATOM 3229  C CE1 . PHE A 1 486 ? -54.661  17.132  -36.186  1.00 97.86  ? 455 PHE A CE1 1 
ATOM 3230  C CE2 . PHE A 1 486 ? -55.907  15.642  -34.800  1.00 98.14  ? 455 PHE A CE2 1 
ATOM 3231  C CZ  . PHE A 1 486 ? -55.860  16.730  -35.638  1.00 97.77  ? 455 PHE A CZ  1 
ATOM 3232  N N   . GLY A 1 487 ? -49.800  13.721  -36.143  1.00 101.36 ? 456 GLY A N   1 
ATOM 3233  C CA  . GLY A 1 487 ? -48.346  13.605  -36.120  1.00 103.77 ? 456 GLY A CA  1 
ATOM 3234  C C   . GLY A 1 487 ? -47.716  14.618  -35.184  1.00 104.74 ? 456 GLY A C   1 
ATOM 3235  O O   . GLY A 1 487 ? -48.430  15.343  -34.483  1.00 103.93 ? 456 GLY A O   1 
ATOM 3236  N N   . LYS A 1 488 ? -46.383  14.649  -35.156  1.00 107.00 ? 457 LYS A N   1 
ATOM 3237  C CA  . LYS A 1 488 ? -45.635  15.656  -34.409  1.00 108.26 ? 457 LYS A CA  1 
ATOM 3238  C C   . LYS A 1 488 ? -45.517  16.927  -35.224  1.00 108.31 ? 457 LYS A C   1 
ATOM 3239  O O   . LYS A 1 488 ? -45.477  16.890  -36.453  1.00 108.55 ? 457 LYS A O   1 
ATOM 3240  C CB  . LYS A 1 488 ? -44.240  15.151  -34.114  1.00 111.66 ? 457 LYS A CB  1 
ATOM 3241  C CG  . LYS A 1 488 ? -44.144  14.191  -32.948  1.00 113.93 ? 457 LYS A CG  1 
ATOM 3242  C CD  . LYS A 1 488 ? -42.811  13.399  -32.972  1.00 119.39 ? 457 LYS A CD  1 
ATOM 3243  C CE  . LYS A 1 488 ? -42.528  12.691  -31.643  1.00 120.91 ? 457 LYS A CE  1 
ATOM 3244  N NZ  . LYS A 1 488 ? -42.195  11.262  -31.911  1.00 122.63 ? 457 LYS A NZ  1 
ATOM 3245  N N   . ASN A 1 489 ? -45.460  18.056  -34.540  1.00 108.49 ? 458 ASN A N   1 
ATOM 3246  C CA  . ASN A 1 489 ? -45.280  19.347  -35.210  1.00 109.64 ? 458 ASN A CA  1 
ATOM 3247  C C   . ASN A 1 489 ? -46.313  19.693  -36.305  1.00 107.01 ? 458 ASN A C   1 
ATOM 3248  O O   . ASN A 1 489 ? -45.980  20.357  -37.301  1.00 108.69 ? 458 ASN A O   1 
ATOM 3249  C CB  . ASN A 1 489 ? -43.844  19.479  -35.744  1.00 113.89 ? 458 ASN A CB  1 
ATOM 3250  C CG  . ASN A 1 489 ? -42.784  19.389  -34.634  1.00 118.11 ? 458 ASN A CG  1 
ATOM 3251  O OD1 . ASN A 1 489 ? -42.922  19.984  -33.557  1.00 119.22 ? 458 ASN A OD1 1 
ATOM 3252  N ND2 . ASN A 1 489 ? -41.710  18.651  -34.908  1.00 123.31 ? 458 ASN A ND2 1 
ATOM 3253  N N   . VAL A 1 490 ? -47.559  19.258  -36.095  1.00 102.98 ? 459 VAL A N   1 
ATOM 3254  C CA  . VAL A 1 490 ? -48.682  19.631  -36.957  1.00 100.37 ? 459 VAL A CA  1 
ATOM 3255  C C   . VAL A 1 490 ? -49.068  21.075  -36.709  1.00 100.07 ? 459 VAL A C   1 
ATOM 3256  O O   . VAL A 1 490 ? -48.960  21.587  -35.603  1.00 100.45 ? 459 VAL A O   1 
ATOM 3257  C CB  . VAL A 1 490 ? -49.946  18.815  -36.660  1.00 97.93  ? 459 VAL A CB  1 
ATOM 3258  C CG1 . VAL A 1 490 ? -50.836  18.711  -37.909  1.00 96.23  ? 459 VAL A CG1 1 
ATOM 3259  C CG2 . VAL A 1 490 ? -49.598  17.449  -36.109  1.00 98.33  ? 459 VAL A CG2 1 
ATOM 3260  N N   . SER A 1 491 ? -49.554  21.728  -37.739  1.00 99.31  ? 460 SER A N   1 
ATOM 3261  C CA  . SER A 1 491 ? -49.954  23.091  -37.592  1.00 99.83  ? 460 SER A CA  1 
ATOM 3262  C C   . SER A 1 491 ? -51.397  23.263  -38.078  1.00 97.85  ? 460 SER A C   1 
ATOM 3263  O O   . SER A 1 491 ? -51.701  23.093  -39.262  1.00 98.42  ? 460 SER A O   1 
ATOM 3264  C CB  . SER A 1 491 ? -49.005  23.955  -38.399  1.00 103.51 ? 460 SER A CB  1 
ATOM 3265  O OG  . SER A 1 491 ? -49.056  25.299  -37.976  1.00 106.58 ? 460 SER A OG  1 
ATOM 3266  N N   . LEU A 1 492 ? -52.302  23.589  -37.167  1.00 95.82  ? 461 LEU A N   1 
ATOM 3267  C CA  . LEU A 1 492 ? -53.668  23.859  -37.554  1.00 93.47  ? 461 LEU A CA  1 
ATOM 3268  C C   . LEU A 1 492 ? -53.795  25.348  -37.517  1.00 96.04  ? 461 LEU A C   1 
ATOM 3269  O O   . LEU A 1 492 ? -53.680  25.940  -36.453  1.00 97.14  ? 461 LEU A O   1 
ATOM 3270  C CB  . LEU A 1 492 ? -54.619  23.249  -36.555  1.00 90.68  ? 461 LEU A CB  1 
ATOM 3271  C CG  . LEU A 1 492 ? -54.126  21.940  -35.999  1.00 87.63  ? 461 LEU A CG  1 
ATOM 3272  C CD1 . LEU A 1 492 ? -55.083  21.563  -34.968  1.00 85.20  ? 461 LEU A CD1 1 
ATOM 3273  C CD2 . LEU A 1 492 ? -53.981  20.850  -37.076  1.00 85.24  ? 461 LEU A CD2 1 
ATOM 3274  N N   . LYS A 1 493 ? -53.970  25.954  -38.684  1.00 97.69  ? 462 LYS A N   1 
ATOM 3275  C CA  . LYS A 1 493 ? -54.216  27.380  -38.784  1.00 100.77 ? 462 LYS A CA  1 
ATOM 3276  C C   . LYS A 1 493 ? -55.620  27.531  -39.352  1.00 100.49 ? 462 LYS A C   1 
ATOM 3277  O O   . LYS A 1 493 ? -56.031  26.703  -40.153  1.00 98.86  ? 462 LYS A O   1 
ATOM 3278  C CB  . LYS A 1 493 ? -53.160  28.042  -39.683  1.00 103.89 ? 462 LYS A CB  1 
ATOM 3279  N N   . GLY A 1 494 ? -56.364  28.550  -38.916  1.00 102.66 ? 463 GLY A N   1 
ATOM 3280  C CA  . GLY A 1 494 ? -57.659  28.918  -39.551  1.00 104.06 ? 463 GLY A CA  1 
ATOM 3281  C C   . GLY A 1 494 ? -58.882  28.089  -39.155  1.00 101.93 ? 463 GLY A C   1 
ATOM 3282  O O   . GLY A 1 494 ? -59.149  27.930  -37.960  1.00 102.40 ? 463 GLY A O   1 
ATOM 3283  N N   . THR A 1 495 ? -59.643  27.575  -40.127  1.00 100.55 ? 464 THR A N   1 
ATOM 3284  C CA  . THR A 1 495 ? -60.705  26.597  -39.819  1.00 98.05  ? 464 THR A CA  1 
ATOM 3285  C C   . THR A 1 495 ? -60.365  25.216  -40.363  1.00 95.10  ? 464 THR A C   1 
ATOM 3286  O O   . THR A 1 495 ? -60.061  25.054  -41.522  1.00 95.74  ? 464 THR A O   1 
ATOM 3287  C CB  . THR A 1 495 ? -62.107  27.047  -40.301  1.00 99.57  ? 464 THR A CB  1 
ATOM 3288  O OG1 . THR A 1 495 ? -61.976  27.974  -41.389  1.00 104.00 ? 464 THR A OG1 1 
ATOM 3289  C CG2 . THR A 1 495 ? -62.877  27.730  -39.187  1.00 101.09 ? 464 THR A CG2 1 
ATOM 3290  N N   . VAL A 1 496 ? -60.397  24.202  -39.528  1.00 92.87  ? 465 VAL A N   1 
ATOM 3291  C CA  . VAL A 1 496 ? -59.945  22.904  -39.977  1.00 90.60  ? 465 VAL A CA  1 
ATOM 3292  C C   . VAL A 1 496 ? -60.913  21.794  -39.593  1.00 89.70  ? 465 VAL A C   1 
ATOM 3293  O O   . VAL A 1 496 ? -61.229  21.576  -38.396  1.00 89.77  ? 465 VAL A O   1 
ATOM 3294  C CB  . VAL A 1 496 ? -58.546  22.642  -39.457  1.00 89.96  ? 465 VAL A CB  1 
ATOM 3295  C CG1 . VAL A 1 496 ? -58.222  21.171  -39.478  1.00 88.31  ? 465 VAL A CG1 1 
ATOM 3296  C CG2 . VAL A 1 496 ? -57.578  23.393  -40.298  1.00 91.10  ? 465 VAL A CG2 1 
ATOM 3297  N N   . ILE A 1 497 ? -61.382  21.094  -40.621  1.00 88.85  ? 466 ILE A N   1 
ATOM 3298  C CA  . ILE A 1 497 ? -62.381  20.059  -40.427  1.00 88.29  ? 466 ILE A CA  1 
ATOM 3299  C C   . ILE A 1 497 ? -61.905  18.707  -40.944  1.00 86.98  ? 466 ILE A C   1 
ATOM 3300  O O   . ILE A 1 497 ? -61.780  18.482  -42.144  1.00 86.70  ? 466 ILE A O   1 
ATOM 3301  C CB  . ILE A 1 497 ? -63.726  20.471  -41.065  1.00 89.75  ? 466 ILE A CB  1 
ATOM 3302  C CG1 . ILE A 1 497 ? -64.042  21.938  -40.741  1.00 91.46  ? 466 ILE A CG1 1 
ATOM 3303  C CG2 . ILE A 1 497 ? -64.856  19.560  -40.585  1.00 90.24  ? 466 ILE A CG2 1 
ATOM 3304  C CD1 . ILE A 1 497 ? -65.017  22.588  -41.694  1.00 94.02  ? 466 ILE A CD1 1 
ATOM 3305  N N   . ILE A 1 498 ? -61.633  17.808  -40.016  1.00 86.50  ? 467 ILE A N   1 
ATOM 3306  C CA  . ILE A 1 498 ? -61.129  16.507  -40.379  1.00 86.41  ? 467 ILE A CA  1 
ATOM 3307  C C   . ILE A 1 498 ? -62.150  15.454  -39.985  1.00 87.47  ? 467 ILE A C   1 
ATOM 3308  O O   . ILE A 1 498 ? -62.427  15.265  -38.800  1.00 88.09  ? 467 ILE A O   1 
ATOM 3309  C CB  . ILE A 1 498 ? -59.777  16.245  -39.715  1.00 85.99  ? 467 ILE A CB  1 
ATOM 3310  C CG1 . ILE A 1 498 ? -58.835  17.408  -39.985  1.00 85.68  ? 467 ILE A CG1 1 
ATOM 3311  C CG2 . ILE A 1 498 ? -59.137  15.013  -40.288  1.00 86.49  ? 467 ILE A CG2 1 
ATOM 3312  C CD1 . ILE A 1 498 ? -57.678  17.442  -39.067  1.00 85.11  ? 467 ILE A CD1 1 
ATOM 3313  N N   . ILE A 1 499 ? -62.723  14.777  -40.980  1.00 88.36  ? 468 ILE A N   1 
ATOM 3314  C CA  . ILE A 1 499 ? -63.794  13.826  -40.710  1.00 90.37  ? 468 ILE A CA  1 
ATOM 3315  C C   . ILE A 1 499 ? -63.597  12.464  -41.335  1.00 91.33  ? 468 ILE A C   1 
ATOM 3316  O O   . ILE A 1 499 ? -63.563  12.325  -42.556  1.00 91.21  ? 468 ILE A O   1 
ATOM 3317  C CB  . ILE A 1 499 ? -65.155  14.370  -41.141  1.00 91.44  ? 468 ILE A CB  1 
ATOM 3318  C CG1 . ILE A 1 499 ? -65.369  15.738  -40.513  1.00 92.30  ? 468 ILE A CG1 1 
ATOM 3319  C CG2 . ILE A 1 499 ? -66.269  13.436  -40.681  1.00 93.58  ? 468 ILE A CG2 1 
ATOM 3320  C CD1 . ILE A 1 499 ? -66.556  16.473  -41.024  1.00 95.40  ? 468 ILE A CD1 1 
ATOM 3321  N N   . ALA A 1 500 ? -63.499  11.463  -40.467  1.00 93.15  ? 469 ALA A N   1 
ATOM 3322  C CA  . ALA A 1 500 ? -63.485  10.061  -40.861  1.00 95.37  ? 469 ALA A CA  1 
ATOM 3323  C C   . ALA A 1 500 ? -64.843  9.421   -40.592  1.00 98.50  ? 469 ALA A C   1 
ATOM 3324  O O   . ALA A 1 500 ? -65.383  9.545   -39.491  1.00 99.97  ? 469 ALA A O   1 
ATOM 3325  C CB  . ALA A 1 500 ? -62.444  9.351   -40.070  1.00 95.71  ? 469 ALA A CB  1 
ATOM 3326  N N   . ASN A 1 501 ? -65.401  8.724   -41.573  1.00 100.30 ? 470 ASN A N   1 
ATOM 3327  C CA  . ASN A 1 501 ? -66.712  8.101   -41.340  1.00 103.90 ? 470 ASN A CA  1 
ATOM 3328  C C   . ASN A 1 501 ? -66.605  6.624   -40.902  1.00 107.32 ? 470 ASN A C   1 
ATOM 3329  O O   . ASN A 1 501 ? -65.594  5.985   -41.182  1.00 107.13 ? 470 ASN A O   1 
ATOM 3330  C CB  . ASN A 1 501 ? -67.644  8.346   -42.538  1.00 104.20 ? 470 ASN A CB  1 
ATOM 3331  C CG  . ASN A 1 501 ? -67.901  9.839   -42.770  1.00 101.65 ? 470 ASN A CG  1 
ATOM 3332  O OD1 . ASN A 1 501 ? -68.184  10.293  -43.892  1.00 99.02  ? 470 ASN A OD1 1 
ATOM 3333  N ND2 . ASN A 1 501 ? -67.789  10.612  -41.694  1.00 100.57 ? 470 ASN A ND2 1 
ATOM 3334  N N   . HIS A 1 502 ? -67.624  6.111   -40.194  1.00 111.40 ? 471 HIS A N   1 
ATOM 3335  C CA  . HIS A 1 502 ? -67.588  4.799   -39.496  1.00 115.65 ? 471 HIS A CA  1 
ATOM 3336  C C   . HIS A 1 502 ? -66.770  3.766   -40.265  1.00 115.95 ? 471 HIS A C   1 
ATOM 3337  O O   . HIS A 1 502 ? -67.054  3.496   -41.428  1.00 116.01 ? 471 HIS A O   1 
ATOM 3338  C CB  . HIS A 1 502 ? -69.017  4.294   -39.179  1.00 120.49 ? 471 HIS A CB  1 
ATOM 3339  C CG  . HIS A 1 502 ? -69.085  2.885   -38.648  1.00 126.75 ? 471 HIS A CG  1 
ATOM 3340  N ND1 . HIS A 1 502 ? -69.513  1.812   -39.410  1.00 131.08 ? 471 HIS A ND1 1 
ATOM 3341  C CD2 . HIS A 1 502 ? -68.809  2.379   -37.420  1.00 130.67 ? 471 HIS A CD2 1 
ATOM 3342  C CE1 . HIS A 1 502 ? -69.483  0.708   -38.681  1.00 135.35 ? 471 HIS A CE1 1 
ATOM 3343  N NE2 . HIS A 1 502 ? -69.059  1.025   -37.469  1.00 135.48 ? 471 HIS A NE2 1 
ATOM 3344  N N   . GLY A 1 503 ? -65.744  3.215   -39.612  1.00 116.69 ? 472 GLY A N   1 
ATOM 3345  C CA  . GLY A 1 503 ? -64.762  2.340   -40.273  1.00 116.98 ? 472 GLY A CA  1 
ATOM 3346  C C   . GLY A 1 503 ? -63.477  3.062   -40.681  1.00 113.06 ? 472 GLY A C   1 
ATOM 3347  O O   . GLY A 1 503 ? -62.424  2.855   -40.076  1.00 113.23 ? 472 GLY A O   1 
ATOM 3348  N N   . ASP A 1 504 ? -63.577  3.917   -41.699  1.00 110.05 ? 473 ASP A N   1 
ATOM 3349  C CA  . ASP A 1 504 ? -62.455  4.686   -42.254  1.00 106.67 ? 473 ASP A CA  1 
ATOM 3350  C C   . ASP A 1 504 ? -61.622  5.458   -41.254  1.00 103.95 ? 473 ASP A C   1 
ATOM 3351  O O   . ASP A 1 504 ? -62.088  5.746   -40.146  1.00 104.30 ? 473 ASP A O   1 
ATOM 3352  C CB  . ASP A 1 504 ? -62.980  5.669   -43.291  1.00 105.50 ? 473 ASP A CB  1 
ATOM 3353  C CG  . ASP A 1 504 ? -63.197  5.019   -44.646  1.00 108.83 ? 473 ASP A CG  1 
ATOM 3354  O OD1 . ASP A 1 504 ? -62.731  3.862   -44.846  1.00 111.83 ? 473 ASP A OD1 1 
ATOM 3355  O OD2 . ASP A 1 504 ? -63.823  5.679   -45.515  1.00 110.66 ? 473 ASP A OD2 1 
ATOM 3356  N N   . ARG A 1 505 ? -60.409  5.824   -41.685  1.00 101.28 ? 474 ARG A N   1 
ATOM 3357  C CA  . ARG A 1 505 ? -59.403  6.440   -40.824  1.00 99.07  ? 474 ARG A CA  1 
ATOM 3358  C C   . ARG A 1 505 ? -58.541  7.481   -41.521  1.00 96.33  ? 474 ARG A C   1 
ATOM 3359  O O   . ARG A 1 505 ? -58.113  7.282   -42.644  1.00 96.90  ? 474 ARG A O   1 
ATOM 3360  C CB  . ARG A 1 505 ? -58.511  5.355   -40.292  1.00 101.06 ? 474 ARG A CB  1 
ATOM 3361  C CG  . ARG A 1 505 ? -57.511  5.847   -39.349  1.00 101.08 ? 474 ARG A CG  1 
ATOM 3362  C CD  . ARG A 1 505 ? -56.724  4.687   -38.879  1.00 105.96 ? 474 ARG A CD  1 
ATOM 3363  N NE  . ARG A 1 505 ? -55.880  5.048   -37.760  1.00 107.18 ? 474 ARG A NE  1 
ATOM 3364  C CZ  . ARG A 1 505 ? -55.227  4.159   -37.040  1.00 111.27 ? 474 ARG A CZ  1 
ATOM 3365  N NH1 . ARG A 1 505 ? -55.326  2.869   -37.339  1.00 115.89 ? 474 ARG A NH1 1 
ATOM 3366  N NH2 . ARG A 1 505 ? -54.479  4.561   -36.035  1.00 112.41 ? 474 ARG A NH2 1 
ATOM 3367  N N   . ILE A 1 506 ? -58.287  8.596   -40.861  1.00 94.06  ? 475 ILE A N   1 
ATOM 3368  C CA  . ILE A 1 506 ? -57.461  9.626   -41.447  1.00 92.46  ? 475 ILE A CA  1 
ATOM 3369  C C   . ILE A 1 506 ? -56.361  9.832   -40.467  1.00 93.02  ? 475 ILE A C   1 
ATOM 3370  O O   . ILE A 1 506 ? -56.623  10.343  -39.382  1.00 93.18  ? 475 ILE A O   1 
ATOM 3371  C CB  . ILE A 1 506 ? -58.159  11.001  -41.484  1.00 90.44  ? 475 ILE A CB  1 
ATOM 3372  C CG1 . ILE A 1 506 ? -59.450  10.966  -42.242  1.00 89.46  ? 475 ILE A CG1 1 
ATOM 3373  C CG2 . ILE A 1 506 ? -57.291  12.024  -42.158  1.00 89.80  ? 475 ILE A CG2 1 
ATOM 3374  C CD1 . ILE A 1 506 ? -60.068  12.295  -42.317  1.00 87.43  ? 475 ILE A CD1 1 
ATOM 3375  N N   . ASP A 1 507 ? -55.134  9.453   -40.797  1.00 94.10  ? 476 ASP A N   1 
ATOM 3376  C CA  . ASP A 1 507 ? -54.022  9.922   -39.960  1.00 94.32  ? 476 ASP A CA  1 
ATOM 3377  C C   . ASP A 1 507 ? -53.313  11.093  -40.610  1.00 93.56  ? 476 ASP A C   1 
ATOM 3378  O O   . ASP A 1 507 ? -52.768  10.974  -41.694  1.00 94.68  ? 476 ASP A O   1 
ATOM 3379  C CB  . ASP A 1 507 ? -53.045  8.809   -39.491  1.00 96.69  ? 476 ASP A CB  1 
ATOM 3380  C CG  . ASP A 1 507 ? -53.255  7.464   -40.199  1.00 98.50  ? 476 ASP A CG  1 
ATOM 3381  O OD1 . ASP A 1 507 ? -52.977  7.383   -41.415  1.00 99.15  ? 476 ASP A OD1 1 
ATOM 3382  O OD2 . ASP A 1 507 ? -53.653  6.480   -39.522  1.00 99.32  ? 476 ASP A OD2 1 
ATOM 3383  N N   . ILE A 1 508 ? -53.356  12.241  -39.959  1.00 92.22  ? 477 ILE A N   1 
ATOM 3384  C CA  . ILE A 1 508 ? -52.673  13.393  -40.481  1.00 92.64  ? 477 ILE A CA  1 
ATOM 3385  C C   . ILE A 1 508 ? -51.149  13.250  -40.225  1.00 94.57  ? 477 ILE A C   1 
ATOM 3386  O O   . ILE A 1 508 ? -50.746  12.961  -39.092  1.00 94.92  ? 477 ILE A O   1 
ATOM 3387  C CB  . ILE A 1 508 ? -53.288  14.668  -39.903  1.00 91.33  ? 477 ILE A CB  1 
ATOM 3388  C CG1 . ILE A 1 508 ? -53.649  15.620  -41.022  1.00 91.87  ? 477 ILE A CG1 1 
ATOM 3389  C CG2 . ILE A 1 508 ? -52.361  15.342  -38.949  1.00 93.00  ? 477 ILE A CG2 1 
ATOM 3390  C CD1 . ILE A 1 508 ? -54.896  15.214  -41.747  1.00 92.68  ? 477 ILE A CD1 1 
ATOM 3391  N N   . PRO A 1 509 ? -50.301  13.412  -41.284  1.00 96.36  ? 478 PRO A N   1 
ATOM 3392  C CA  . PRO A 1 509 ? -48.864  13.122  -41.170  1.00 98.66  ? 478 PRO A CA  1 
ATOM 3393  C C   . PRO A 1 509 ? -48.134  14.200  -40.390  1.00 99.15  ? 478 PRO A C   1 
ATOM 3394  O O   . PRO A 1 509 ? -48.664  15.323  -40.256  1.00 98.52  ? 478 PRO A O   1 
ATOM 3395  C CB  . PRO A 1 509 ? -48.364  13.123  -42.628  1.00 100.37 ? 478 PRO A CB  1 
ATOM 3396  C CG  . PRO A 1 509 ? -49.545  13.173  -43.456  1.00 99.22  ? 478 PRO A CG  1 
ATOM 3397  C CD  . PRO A 1 509 ? -50.608  13.869  -42.645  1.00 96.89  ? 478 PRO A CD  1 
ATOM 3398  N N   . PRO A 1 510 ? -46.930  13.861  -39.874  1.00 100.64 ? 479 PRO A N   1 
ATOM 3399  C CA  . PRO A 1 510 ? -46.121  14.764  -39.084  1.00 101.33 ? 479 PRO A CA  1 
ATOM 3400  C C   . PRO A 1 510 ? -45.756  16.002  -39.887  1.00 102.73 ? 479 PRO A C   1 
ATOM 3401  O O   . PRO A 1 510 ? -45.456  15.913  -41.076  1.00 104.47 ? 479 PRO A O   1 
ATOM 3402  C CB  . PRO A 1 510 ? -44.880  13.931  -38.799  1.00 104.04 ? 479 PRO A CB  1 
ATOM 3403  C CG  . PRO A 1 510 ? -45.351  12.538  -38.883  1.00 103.30 ? 479 PRO A CG  1 
ATOM 3404  C CD  . PRO A 1 510 ? -46.277  12.547  -40.013  1.00 102.04 ? 479 PRO A CD  1 
ATOM 3405  N N   . GLY A 1 511 ? -45.825  17.161  -39.255  1.00 102.40 ? 480 GLY A N   1 
ATOM 3406  C CA  . GLY A 1 511 ? -45.395  18.383  -39.923  1.00 104.79 ? 480 GLY A CA  1 
ATOM 3407  C C   . GLY A 1 511 ? -46.406  19.072  -40.826  1.00 103.41 ? 480 GLY A C   1 
ATOM 3408  O O   . GLY A 1 511 ? -46.148  20.201  -41.293  1.00 106.28 ? 480 GLY A O   1 
ATOM 3409  N N   . ALA A 1 512 ? -47.545  18.407  -41.062  1.00 99.55  ? 481 ALA A N   1 
ATOM 3410  C CA  . ALA A 1 512 ? -48.652  18.953  -41.854  1.00 97.10  ? 481 ALA A CA  1 
ATOM 3411  C C   . ALA A 1 512 ? -49.075  20.318  -41.325  1.00 96.17  ? 481 ALA A C   1 
ATOM 3412  O O   . ALA A 1 512 ? -49.058  20.546  -40.112  1.00 94.85  ? 481 ALA A O   1 
ATOM 3413  C CB  . ALA A 1 512 ? -49.823  17.986  -41.847  1.00 94.07  ? 481 ALA A CB  1 
ATOM 3414  N N   . VAL A 1 513 ? -49.401  21.225  -42.245  1.00 96.57  ? 482 VAL A N   1 
ATOM 3415  C CA  . VAL A 1 513 ? -49.914  22.558  -41.908  1.00 97.57  ? 482 VAL A CA  1 
ATOM 3416  C C   . VAL A 1 513 ? -51.273  22.779  -42.571  1.00 97.51  ? 482 VAL A C   1 
ATOM 3417  O O   . VAL A 1 513 ? -51.342  23.258  -43.706  1.00 100.28 ? 482 VAL A O   1 
ATOM 3418  C CB  . VAL A 1 513 ? -48.987  23.695  -42.385  1.00 100.60 ? 482 VAL A CB  1 
ATOM 3419  C CG1 . VAL A 1 513 ? -49.585  25.072  -42.010  1.00 101.81 ? 482 VAL A CG1 1 
ATOM 3420  C CG2 . VAL A 1 513 ? -47.583  23.517  -41.826  1.00 101.80 ? 482 VAL A CG2 1 
ATOM 3421  N N   . LEU A 1 514 ? -52.358  22.450  -41.879  1.00 95.17  ? 483 LEU A N   1 
ATOM 3422  C CA  . LEU A 1 514 ? -53.675  22.590  -42.482  1.00 94.35  ? 483 LEU A CA  1 
ATOM 3423  C C   . LEU A 1 514 ? -54.228  23.990  -42.221  1.00 97.00  ? 483 LEU A C   1 
ATOM 3424  O O   . LEU A 1 514 ? -54.605  24.322  -41.091  1.00 97.30  ? 483 LEU A O   1 
ATOM 3425  C CB  . LEU A 1 514 ? -54.606  21.514  -41.953  1.00 91.27  ? 483 LEU A CB  1 
ATOM 3426  C CG  . LEU A 1 514 ? -53.960  20.150  -41.847  1.00 87.03  ? 483 LEU A CG  1 
ATOM 3427  C CD1 . LEU A 1 514 ? -54.809  19.325  -40.975  1.00 84.35  ? 483 LEU A CD1 1 
ATOM 3428  C CD2 . LEU A 1 514 ? -53.804  19.513  -43.189  1.00 85.32  ? 483 LEU A CD2 1 
ATOM 3429  N N   . GLU A 1 515 ? -54.233  24.818  -43.263  1.00 99.35  ? 484 GLU A N   1 
ATOM 3430  C CA  . GLU A 1 515 ? -54.739  26.173  -43.156  1.00 102.56 ? 484 GLU A CA  1 
ATOM 3431  C C   . GLU A 1 515 ? -56.103  26.177  -43.849  1.00 103.32 ? 484 GLU A C   1 
ATOM 3432  O O   . GLU A 1 515 ? -56.192  25.790  -45.018  1.00 104.61 ? 484 GLU A O   1 
ATOM 3433  C CB  . GLU A 1 515 ? -53.763  27.140  -43.833  1.00 105.79 ? 484 GLU A CB  1 
ATOM 3434  C CG  . GLU A 1 515 ? -53.974  28.607  -43.497  1.00 110.22 ? 484 GLU A CG  1 
ATOM 3435  C CD  . GLU A 1 515 ? -53.020  29.539  -44.241  1.00 114.54 ? 484 GLU A CD  1 
ATOM 3436  N N   . ASN A 1 516 ? -57.163  26.578  -43.137  1.00 103.43 ? 485 ASN A N   1 
ATOM 3437  C CA  . ASN A 1 516 ? -58.539  26.643  -43.686  1.00 103.27 ? 485 ASN A CA  1 
ATOM 3438  C C   . ASN A 1 516 ? -58.925  25.516  -44.644  1.00 100.38 ? 485 ASN A C   1 
ATOM 3439  O O   . ASN A 1 516 ? -59.114  25.741  -45.813  1.00 102.06 ? 485 ASN A O   1 
ATOM 3440  C CB  . ASN A 1 516 ? -58.780  28.007  -44.320  1.00 108.12 ? 485 ASN A CB  1 
ATOM 3441  C CG  . ASN A 1 516 ? -59.184  29.050  -43.299  1.00 112.24 ? 485 ASN A CG  1 
ATOM 3442  O OD1 . ASN A 1 516 ? -58.416  29.393  -42.401  1.00 112.63 ? 485 ASN A OD1 1 
ATOM 3443  N ND2 . ASN A 1 516 ? -60.410  29.558  -43.428  1.00 117.43 ? 485 ASN A ND2 1 
ATOM 3444  N N   . LYS A 1 517 ? -59.036  24.298  -44.140  1.00 96.80  ? 486 LYS A N   1 
ATOM 3445  C CA  . LYS A 1 517 ? -59.134  23.143  -45.009  1.00 95.70  ? 486 LYS A CA  1 
ATOM 3446  C C   . LYS A 1 517 ? -60.013  22.053  -44.461  1.00 93.07  ? 486 LYS A C   1 
ATOM 3447  O O   . LYS A 1 517 ? -60.126  21.891  -43.236  1.00 91.65  ? 486 LYS A O   1 
ATOM 3448  C CB  . LYS A 1 517 ? -57.746  22.577  -45.268  1.00 95.33  ? 486 LYS A CB  1 
ATOM 3449  C CG  . LYS A 1 517 ? -57.001  23.327  -46.354  1.00 101.12 ? 486 LYS A CG  1 
ATOM 3450  C CD  . LYS A 1 517 ? -55.608  22.799  -46.555  1.00 106.01 ? 486 LYS A CD  1 
ATOM 3451  C CE  . LYS A 1 517 ? -55.205  22.949  -48.027  1.00 113.07 ? 486 LYS A CE  1 
ATOM 3452  N NZ  . LYS A 1 517 ? -54.370  21.772  -48.519  1.00 116.07 ? 486 LYS A NZ  1 
ATOM 3453  N N   . ILE A 1 518 ? -60.624  21.308  -45.387  1.00 93.08  ? 487 ILE A N   1 
ATOM 3454  C CA  . ILE A 1 518 ? -61.580  20.230  -45.077  1.00 91.47  ? 487 ILE A CA  1 
ATOM 3455  C C   . ILE A 1 518 ? -61.008  18.875  -45.441  1.00 91.05  ? 487 ILE A C   1 
ATOM 3456  O O   . ILE A 1 518 ? -61.048  18.448  -46.606  1.00 92.54  ? 487 ILE A O   1 
ATOM 3457  C CB  . ILE A 1 518 ? -62.935  20.410  -45.798  1.00 92.66  ? 487 ILE A CB  1 
ATOM 3458  C CG1 . ILE A 1 518 ? -63.689  21.591  -45.215  1.00 93.20  ? 487 ILE A CG1 1 
ATOM 3459  C CG2 . ILE A 1 518 ? -63.777  19.170  -45.656  1.00 90.58  ? 487 ILE A CG2 1 
ATOM 3460  C CD1 . ILE A 1 518 ? -64.249  22.521  -46.237  1.00 95.13  ? 487 ILE A CD1 1 
ATOM 3461  N N   . VAL A 1 519 ? -60.480  18.204  -44.425  1.00 90.02  ? 488 VAL A N   1 
ATOM 3462  C CA  . VAL A 1 519 ? -59.866  16.887  -44.586  1.00 90.27  ? 488 VAL A CA  1 
ATOM 3463  C C   . VAL A 1 519 ? -60.944  15.827  -44.393  1.00 90.14  ? 488 VAL A C   1 
ATOM 3464  O O   . VAL A 1 519 ? -61.614  15.780  -43.346  1.00 89.34  ? 488 VAL A O   1 
ATOM 3465  C CB  . VAL A 1 519 ? -58.658  16.672  -43.603  1.00 89.14  ? 488 VAL A CB  1 
ATOM 3466  C CG1 . VAL A 1 519 ? -57.938  15.356  -43.872  1.00 88.98  ? 488 VAL A CG1 1 
ATOM 3467  C CG2 . VAL A 1 519 ? -57.675  17.811  -43.738  1.00 90.55  ? 488 VAL A CG2 1 
ATOM 3468  N N   . SER A 1 520 ? -61.121  15.001  -45.420  1.00 91.50  ? 489 SER A N   1 
ATOM 3469  C CA  . SER A 1 520 ? -62.109  13.948  -45.378  1.00 92.30  ? 489 SER A CA  1 
ATOM 3470  C C   . SER A 1 520 ? -61.695  12.864  -46.326  1.00 94.18  ? 489 SER A C   1 
ATOM 3471  O O   . SER A 1 520 ? -60.926  13.116  -47.245  1.00 95.87  ? 489 SER A O   1 
ATOM 3472  C CB  . SER A 1 520 ? -63.472  14.489  -45.789  1.00 93.74  ? 489 SER A CB  1 
ATOM 3473  O OG  . SER A 1 520 ? -64.508  13.624  -45.353  1.00 95.36  ? 489 SER A OG  1 
ATOM 3474  N N   . GLY A 1 521 ? -62.228  11.665  -46.115  1.00 94.90  ? 490 GLY A N   1 
ATOM 3475  C CA  . GLY A 1 521 ? -61.810  10.478  -46.855  1.00 97.71  ? 490 GLY A CA  1 
ATOM 3476  C C   . GLY A 1 521 ? -61.031  9.574   -45.920  1.00 97.34  ? 490 GLY A C   1 
ATOM 3477  O O   . GLY A 1 521 ? -60.908  9.862   -44.739  1.00 95.07  ? 490 GLY A O   1 
ATOM 3478  N N   . ASN A 1 522 ? -60.496  8.485   -46.446  1.00 100.27 ? 491 ASN A N   1 
ATOM 3479  C CA  . ASN A 1 522 ? -59.772  7.528   -45.644  1.00 100.88 ? 491 ASN A CA  1 
ATOM 3480  C C   . ASN A 1 522 ? -58.352  7.517   -46.120  1.00 102.72 ? 491 ASN A C   1 
ATOM 3481  O O   . ASN A 1 522 ? -58.115  7.151   -47.275  1.00 106.85 ? 491 ASN A O   1 
ATOM 3482  C CB  . ASN A 1 522 ? -60.377  6.158   -45.875  1.00 104.46 ? 491 ASN A CB  1 
ATOM 3483  C CG  . ASN A 1 522 ? -59.488  5.041   -45.420  1.00 107.10 ? 491 ASN A CG  1 
ATOM 3484  O OD1 . ASN A 1 522 ? -59.372  4.770   -44.221  1.00 106.20 ? 491 ASN A OD1 1 
ATOM 3485  N ND2 . ASN A 1 522 ? -58.867  4.357   -46.382  1.00 111.95 ? 491 ASN A ND2 1 
ATOM 3486  N N   . LEU A 1 523 ? -57.412  7.930   -45.265  1.00 100.79 ? 492 LEU A N   1 
ATOM 3487  C CA  . LEU A 1 523 ? -55.973  7.809   -45.566  1.00 102.52 ? 492 LEU A CA  1 
ATOM 3488  C C   . LEU A 1 523 ? -55.270  7.178   -44.399  1.00 103.03 ? 492 LEU A C   1 
ATOM 3489  O O   . LEU A 1 523 ? -55.333  7.686   -43.274  1.00 99.75  ? 492 LEU A O   1 
ATOM 3490  C CB  . LEU A 1 523 ? -55.325  9.150   -45.932  1.00 100.41 ? 492 LEU A CB  1 
ATOM 3491  C CG  . LEU A 1 523 ? -53.813  9.269   -46.109  1.00 100.37 ? 492 LEU A CG  1 
ATOM 3492  C CD1 . LEU A 1 523 ? -53.469  10.421  -46.975  1.00 99.89  ? 492 LEU A CD1 1 
ATOM 3493  C CD2 . LEU A 1 523 ? -53.193  9.512   -44.797  1.00 98.08  ? 492 LEU A CD2 1 
ATOM 3494  N N   . ARG A 1 524 ? -54.608  6.066   -44.695  1.00 108.07 ? 493 ARG A N   1 
ATOM 3495  C CA  . ARG A 1 524 ? -53.897  5.293   -43.707  1.00 110.68 ? 493 ARG A CA  1 
ATOM 3496  C C   . ARG A 1 524 ? -52.396  5.401   -43.955  1.00 113.11 ? 493 ARG A C   1 
ATOM 3497  O O   . ARG A 1 524 ? -51.959  5.506   -45.102  1.00 115.63 ? 493 ARG A O   1 
ATOM 3498  C CB  . ARG A 1 524 ? -54.390  3.842   -43.710  1.00 114.99 ? 493 ARG A CB  1 
ATOM 3499  C CG  . ARG A 1 524 ? -55.914  3.732   -43.565  1.00 115.37 ? 493 ARG A CG  1 
ATOM 3500  C CD  . ARG A 1 524 ? -56.385  2.468   -42.819  1.00 121.86 ? 493 ARG A CD  1 
ATOM 3501  N NE  . ARG A 1 524 ? -57.721  2.641   -42.213  1.00 121.22 ? 493 ARG A NE  1 
ATOM 3502  C CZ  . ARG A 1 524 ? -58.538  1.651   -41.832  1.00 124.80 ? 493 ARG A CZ  1 
ATOM 3503  N NH1 . ARG A 1 524 ? -58.205  0.374   -41.989  1.00 130.43 ? 493 ARG A NH1 1 
ATOM 3504  N NH2 . ARG A 1 524 ? -59.708  1.944   -41.290  1.00 122.95 ? 493 ARG A NH2 1 
ATOM 3505  N N   . ILE A 1 525 ? -51.630  5.415   -42.860  1.00 113.39 ? 494 ILE A N   1 
ATOM 3506  C CA  . ILE A 1 525 ? -50.161  5.529   -42.855  1.00 115.73 ? 494 ILE A CA  1 
ATOM 3507  C C   . ILE A 1 525 ? -49.530  4.492   -41.927  1.00 119.59 ? 494 ILE A C   1 
ATOM 3508  O O   . ILE A 1 525 ? -49.554  4.665   -40.715  1.00 117.56 ? 494 ILE A O   1 
ATOM 3509  C CB  . ILE A 1 525 ? -49.714  6.925   -42.381  1.00 111.24 ? 494 ILE A CB  1 
ATOM 3510  C CG1 . ILE A 1 525 ? -49.646  7.889   -43.563  1.00 110.56 ? 494 ILE A CG1 1 
ATOM 3511  C CG2 . ILE A 1 525 ? -48.370  6.842   -41.697  1.00 112.29 ? 494 ILE A CG2 1 
ATOM 3512  C CD1 . ILE A 1 525 ? -49.447  9.359   -43.184  1.00 105.90 ? 494 ILE A CD1 1 
ATOM 3513  N N   . LEU A 1 526 ? -48.964  3.430   -42.490  1.00 126.49 ? 495 LEU A N   1 
ATOM 3514  C CA  . LEU A 1 526 ? -48.249  2.428   -41.702  1.00 132.06 ? 495 LEU A CA  1 
ATOM 3515  C C   . LEU A 1 526 ? -46.703  2.631   -41.645  1.00 134.92 ? 495 LEU A C   1 
ATOM 3516  O O   . LEU A 1 526 ? -46.191  3.571   -42.238  1.00 133.38 ? 495 LEU A O   1 
ATOM 3517  C CB  . LEU A 1 526 ? -48.651  1.047   -42.205  1.00 138.00 ? 495 LEU A CB  1 
ATOM 3518  C CG  . LEU A 1 526 ? -49.898  0.468   -41.529  1.00 138.60 ? 495 LEU A CG  1 
ATOM 3519  C CD1 . LEU A 1 526 ? -50.490  -0.649  -42.404  1.00 145.29 ? 495 LEU A CD1 1 
ATOM 3520  C CD2 . LEU A 1 526 ? -49.638  -0.012  -40.031  1.00 139.46 ? 495 LEU A CD2 1 
ATOM 3521  N N   . ASP A 1 527 ? -45.964  1.773   -40.939  1.00 113.60 ? 496 ASP A N   1 
ATOM 3522  C CA  . ASP A 1 527 ? -44.519  1.991   -40.759  1.00 118.16 ? 496 ASP A CA  1 
ATOM 3523  C C   . ASP A 1 527 ? -43.556  1.037   -41.463  1.00 120.50 ? 496 ASP A C   1 
ATOM 3524  O O   . ASP A 1 527 ? -42.832  1.422   -42.408  1.00 121.03 ? 496 ASP A O   1 
ATOM 3525  C CB  . ASP A 1 527 ? -44.179  1.968   -39.277  1.00 121.99 ? 496 ASP A CB  1 
ATOM 3526  C CG  . ASP A 1 527 ? -44.460  3.282   -38.594  1.00 125.06 ? 496 ASP A CG  1 
ATOM 3527  O OD1 . ASP A 1 527 ? -44.876  4.249   -39.301  1.00 124.92 ? 496 ASP A OD1 1 
ATOM 3528  O OD2 . ASP A 1 527 ? -44.247  3.338   -37.349  1.00 130.39 ? 496 ASP A OD2 1 
ATOM 3529  N N   . HIS A 1 528 ? -43.519  -0.194  -40.947  1.00 123.14 ? 497 HIS A N   1 
ATOM 3530  C CA  . HIS A 1 528 ? -42.609  -1.262  -41.422  1.00 126.39 ? 497 HIS A CA  1 
ATOM 3531  C C   . HIS A 1 528 ? -42.492  -2.496  -40.473  1.00 129.65 ? 497 HIS A C   1 
ATOM 3532  O O   . HIS A 1 528 ? -42.511  -2.415  -39.212  1.00 132.22 ? 497 HIS A O   1 
ATOM 3533  C CB  . HIS A 1 528 ? -41.217  -0.695  -41.814  1.00 128.85 ? 497 HIS A CB  1 
ATOM 3534  C CG  . HIS A 1 528 ? -40.258  -0.527  -40.670  1.00 132.11 ? 497 HIS A CG  1 
ATOM 3535  N ND1 . HIS A 1 528 ? -40.163  0.640   -39.941  1.00 131.95 ? 497 HIS A ND1 1 
ATOM 3536  C CD2 . HIS A 1 528 ? -39.331  -1.373  -40.153  1.00 134.61 ? 497 HIS A CD2 1 
ATOM 3537  C CE1 . HIS A 1 528 ? -39.230  0.499   -39.018  1.00 136.38 ? 497 HIS A CE1 1 
ATOM 3538  N NE2 . HIS A 1 528 ? -38.713  -0.714  -39.123  1.00 137.73 ? 497 HIS A NE2 1 
ATOM 3539  O OXT . HIS A 1 528 ? -42.368  -3.629  -40.983  1.00 130.63 ? 497 HIS A OXT 1 
ATOM 3540  N N   . GLN B 1 41  ? -32.198  -21.100 -101.748 1.00 98.74  ? 10  GLN B N   1 
ATOM 3541  C CA  . GLN B 1 41  ? -32.813  -19.859 -101.162 1.00 98.75  ? 10  GLN B CA  1 
ATOM 3542  C C   . GLN B 1 41  ? -31.901  -18.648 -101.327 1.00 98.81  ? 10  GLN B C   1 
ATOM 3543  O O   . GLN B 1 41  ? -32.084  -17.634 -100.650 1.00 98.72  ? 10  GLN B O   1 
ATOM 3544  C CB  . GLN B 1 41  ? -33.166  -20.065 -99.673  1.00 98.64  ? 10  GLN B CB  1 
ATOM 3545  N N   . GLU B 1 42  ? -30.937  -18.761 -102.243 1.00 99.01  ? 11  GLU B N   1 
ATOM 3546  C CA  . GLU B 1 42  ? -29.901  -17.738 -102.448 1.00 99.17  ? 11  GLU B CA  1 
ATOM 3547  C C   . GLU B 1 42  ? -30.115  -16.862 -103.699 1.00 99.20  ? 11  GLU B C   1 
ATOM 3548  O O   . GLU B 1 42  ? -29.650  -15.714 -103.744 1.00 99.25  ? 11  GLU B O   1 
ATOM 3549  C CB  . GLU B 1 42  ? -28.506  -18.380 -102.455 1.00 99.16  ? 11  GLU B CB  1 
ATOM 3550  N N   . VAL B 1 43  ? -30.800  -17.409 -104.707 1.00 99.19  ? 12  VAL B N   1 
ATOM 3551  C CA  . VAL B 1 43  ? -31.277  -16.619 -105.856 1.00 99.03  ? 12  VAL B CA  1 
ATOM 3552  C C   . VAL B 1 43  ? -32.681  -16.086 -105.507 1.00 98.86  ? 12  VAL B C   1 
ATOM 3553  O O   . VAL B 1 43  ? -33.224  -15.204 -106.185 1.00 98.82  ? 12  VAL B O   1 
ATOM 3554  C CB  . VAL B 1 43  ? -31.239  -17.430 -107.194 1.00 99.06  ? 12  VAL B CB  1 
ATOM 3555  C CG1 . VAL B 1 43  ? -31.622  -16.552 -108.384 1.00 99.07  ? 12  VAL B CG1 1 
ATOM 3556  C CG2 . VAL B 1 43  ? -29.849  -18.033 -107.423 1.00 98.77  ? 12  VAL B CG2 1 
ATOM 3557  N N   . ILE B 1 44  ? -33.240  -16.634 -104.426 1.00 98.55  ? 13  ILE B N   1 
ATOM 3558  C CA  . ILE B 1 44  ? -34.418  -16.087 -103.761 1.00 98.35  ? 13  ILE B CA  1 
ATOM 3559  C C   . ILE B 1 44  ? -34.099  -14.703 -103.175 1.00 98.17  ? 13  ILE B C   1 
ATOM 3560  O O   . ILE B 1 44  ? -34.867  -13.758 -103.364 1.00 98.09  ? 13  ILE B O   1 
ATOM 3561  C CB  . ILE B 1 44  ? -34.945  -17.064 -102.651 1.00 98.51  ? 13  ILE B CB  1 
ATOM 3562  C CG1 . ILE B 1 44  ? -35.616  -18.303 -103.293 1.00 98.68  ? 13  ILE B CG1 1 
ATOM 3563  C CG2 . ILE B 1 44  ? -35.864  -16.331 -101.642 1.00 98.40  ? 13  ILE B CG2 1 
ATOM 3564  C CD1 . ILE B 1 44  ? -36.212  -19.363 -102.314 1.00 98.27  ? 13  ILE B CD1 1 
ATOM 3565  N N   . ARG B 1 45  ? -32.954  -14.595 -102.493 1.00 97.97  ? 14  ARG B N   1 
ATOM 3566  C CA  . ARG B 1 45  ? -32.523  -13.359 -101.819 1.00 97.78  ? 14  ARG B CA  1 
ATOM 3567  C C   . ARG B 1 45  ? -32.074  -12.237 -102.766 1.00 97.72  ? 14  ARG B C   1 
ATOM 3568  O O   . ARG B 1 45  ? -32.376  -11.068 -102.523 1.00 97.64  ? 14  ARG B O   1 
ATOM 3569  C CB  . ARG B 1 45  ? -31.412  -13.658 -100.804 1.00 97.67  ? 14  ARG B CB  1 
ATOM 3570  N N   . GLN B 1 46  ? -31.353  -12.597 -103.831 1.00 97.70  ? 15  GLN B N   1 
ATOM 3571  C CA  . GLN B 1 46  ? -30.817  -11.630 -104.803 1.00 97.58  ? 15  GLN B CA  1 
ATOM 3572  C C   . GLN B 1 46  ? -31.911  -10.871 -105.561 1.00 97.54  ? 15  GLN B C   1 
ATOM 3573  O O   . GLN B 1 46  ? -31.746  -9.691  -105.877 1.00 97.39  ? 15  GLN B O   1 
ATOM 3574  C CB  . GLN B 1 46  ? -29.862  -12.322 -105.784 1.00 97.46  ? 15  GLN B CB  1 
ATOM 3575  N N   . GLU B 1 47  ? -33.021  -11.559 -105.837 1.00 97.67  ? 16  GLU B N   1 
ATOM 3576  C CA  . GLU B 1 47  ? -34.190  -10.981 -106.524 1.00 97.74  ? 16  GLU B CA  1 
ATOM 3577  C C   . GLU B 1 47  ? -35.026  -10.019 -105.659 1.00 97.73  ? 16  GLU B C   1 
ATOM 3578  O O   . GLU B 1 47  ? -35.615  -9.068  -106.186 1.00 97.70  ? 16  GLU B O   1 
ATOM 3579  C CB  . GLU B 1 47  ? -35.086  -12.092 -107.087 1.00 97.74  ? 16  GLU B CB  1 
ATOM 3580  N N   . LEU B 1 48  ? -35.081  -10.280 -104.348 1.00 97.63  ? 17  LEU B N   1 
ATOM 3581  C CA  . LEU B 1 48  ? -35.754  -9.401  -103.369 1.00 97.42  ? 17  LEU B CA  1 
ATOM 3582  C C   . LEU B 1 48  ? -35.047  -8.052  -103.166 1.00 97.15  ? 17  LEU B C   1 
ATOM 3583  O O   . LEU B 1 48  ? -35.699  -7.046  -102.877 1.00 96.92  ? 17  LEU B O   1 
ATOM 3584  C CB  . LEU B 1 48  ? -35.889  -10.102 -102.012 1.00 97.53  ? 17  LEU B CB  1 
ATOM 3585  C CG  . LEU B 1 48  ? -36.803  -11.324 -101.874 1.00 98.05  ? 17  LEU B CG  1 
ATOM 3586  C CD1 . LEU B 1 48  ? -36.332  -12.206 -100.722 1.00 98.35  ? 17  LEU B CD1 1 
ATOM 3587  C CD2 . LEU B 1 48  ? -38.274  -10.934 -101.690 1.00 98.60  ? 17  LEU B CD2 1 
ATOM 3588  N N   . GLU B 1 49  ? -33.717  -8.049  -103.295 1.00 180.16 ? 18  GLU B N   1 
ATOM 3589  C CA  . GLU B 1 49  ? -32.912  -6.826  -103.207 1.00 178.61 ? 18  GLU B CA  1 
ATOM 3590  C C   . GLU B 1 49  ? -33.066  -5.988  -104.473 1.00 178.72 ? 18  GLU B C   1 
ATOM 3591  O O   . GLU B 1 49  ? -33.250  -4.770  -104.394 1.00 178.10 ? 18  GLU B O   1 
ATOM 3592  C CB  . GLU B 1 49  ? -31.436  -7.154  -102.957 1.00 178.31 ? 18  GLU B CB  1 
ATOM 3593  N N   . LEU B 1 50  ? -33.007  -6.656  -105.629 1.00 179.80 ? 19  LEU B N   1 
ATOM 3594  C CA  . LEU B 1 50  ? -33.166  -6.015  -106.942 1.00 180.56 ? 19  LEU B CA  1 
ATOM 3595  C C   . LEU B 1 50  ? -34.560  -5.415  -107.131 1.00 180.86 ? 19  LEU B C   1 
ATOM 3596  O O   . LEU B 1 50  ? -34.747  -4.518  -107.960 1.00 181.68 ? 19  LEU B O   1 
ATOM 3597  C CB  . LEU B 1 50  ? -32.853  -7.004  -108.071 1.00 182.17 ? 19  LEU B CB  1 
ATOM 3598  N N   . SER B 1 51  ? -35.524  -5.913  -106.355 1.00 180.47 ? 20  SER B N   1 
ATOM 3599  C CA  . SER B 1 51  ? -36.898  -5.402  -106.355 1.00 180.92 ? 20  SER B CA  1 
ATOM 3600  C C   . SER B 1 51  ? -36.992  -4.049  -105.659 1.00 179.68 ? 20  SER B C   1 
ATOM 3601  O O   . SER B 1 51  ? -37.630  -3.124  -106.159 1.00 180.34 ? 20  SER B O   1 
ATOM 3602  C CB  . SER B 1 51  ? -37.831  -6.389  -105.652 1.00 181.56 ? 20  SER B CB  1 
ATOM 3603  O OG  . SER B 1 51  ? -37.688  -6.302  -104.242 1.00 180.51 ? 20  SER B OG  1 
ATOM 3604  N N   . VAL B 1 52  ? -36.357  -3.953  -104.497 1.00 178.08 ? 21  VAL B N   1 
ATOM 3605  C CA  . VAL B 1 52  ? -36.382  -2.741  -103.687 1.00 177.24 ? 21  VAL B CA  1 
ATOM 3606  C C   . VAL B 1 52  ? -35.642  -1.606  -104.389 1.00 177.00 ? 21  VAL B C   1 
ATOM 3607  O O   . VAL B 1 52  ? -36.166  -0.494  -104.497 1.00 177.37 ? 21  VAL B O   1 
ATOM 3608  C CB  . VAL B 1 52  ? -35.779  -2.992  -102.280 1.00 176.24 ? 21  VAL B CB  1 
ATOM 3609  C CG1 . VAL B 1 52  ? -35.929  -1.769  -101.387 1.00 175.56 ? 21  VAL B CG1 1 
ATOM 3610  C CG2 . VAL B 1 52  ? -36.447  -4.193  -101.625 1.00 177.16 ? 21  VAL B CG2 1 
ATOM 3611  N N   . LYS B 1 53  ? -34.436  -1.907  -104.873 1.00 176.65 ? 22  LYS B N   1 
ATOM 3612  C CA  . LYS B 1 53  ? -33.590  -0.939  -105.582 1.00 176.97 ? 22  LYS B CA  1 
ATOM 3613  C C   . LYS B 1 53  ? -34.322  -0.276  -106.747 1.00 178.72 ? 22  LYS B C   1 
ATOM 3614  O O   . LYS B 1 53  ? -34.202  0.936   -106.956 1.00 179.14 ? 22  LYS B O   1 
ATOM 3615  C CB  . LYS B 1 53  ? -32.302  -1.608  -106.078 1.00 176.96 ? 22  LYS B CB  1 
ATOM 3616  N N   . LYS B 1 54  ? -35.082  -1.088  -107.486 1.00 180.06 ? 23  LYS B N   1 
ATOM 3617  C CA  . LYS B 1 54  ? -35.876  -0.636  -108.634 1.00 182.29 ? 23  LYS B CA  1 
ATOM 3618  C C   . LYS B 1 54  ? -37.109  0.155   -108.201 1.00 182.85 ? 23  LYS B C   1 
ATOM 3619  O O   . LYS B 1 54  ? -37.565  1.042   -108.927 1.00 184.75 ? 23  LYS B O   1 
ATOM 3620  C CB  . LYS B 1 54  ? -36.294  -1.822  -109.510 1.00 183.44 ? 23  LYS B CB  1 
ATOM 3621  N N   . GLU B 1 55  ? -37.645  -0.172  -107.025 1.00 181.70 ? 24  GLU B N   1 
ATOM 3622  C CA  . GLU B 1 55  ? -38.797  0.546   -106.469 1.00 182.38 ? 24  GLU B CA  1 
ATOM 3623  C C   . GLU B 1 55  ? -38.376  1.909   -105.928 1.00 181.74 ? 24  GLU B C   1 
ATOM 3624  O O   . GLU B 1 55  ? -39.024  2.926   -106.194 1.00 183.25 ? 24  GLU B O   1 
ATOM 3625  C CB  . GLU B 1 55  ? -39.479  -0.275  -105.361 1.00 181.92 ? 24  GLU B CB  1 
ATOM 3626  C CG  . GLU B 1 55  ? -40.862  0.250   -104.907 1.00 183.54 ? 24  GLU B CG  1 
ATOM 3627  C CD  . GLU B 1 55  ? -40.774  1.503   -104.044 1.00 183.57 ? 24  GLU B CD  1 
ATOM 3628  O OE1 . GLU B 1 55  ? -40.112  1.459   -102.985 1.00 182.43 ? 24  GLU B OE1 1 
ATOM 3629  O OE2 . GLU B 1 55  ? -41.361  2.536   -104.427 1.00 185.38 ? 24  GLU B OE2 1 
ATOM 3630  N N   . LEU B 1 56  ? -37.292  1.917   -105.162 1.00 179.69 ? 25  LEU B N   1 
ATOM 3631  C CA  . LEU B 1 56  ? -36.790  3.144   -104.574 1.00 179.16 ? 25  LEU B CA  1 
ATOM 3632  C C   . LEU B 1 56  ? -36.309  4.126   -105.644 1.00 180.59 ? 25  LEU B C   1 
ATOM 3633  O O   . LEU B 1 56  ? -36.172  5.323   -105.372 1.00 181.18 ? 25  LEU B O   1 
ATOM 3634  C CB  . LEU B 1 56  ? -35.682  2.830   -103.568 1.00 177.22 ? 25  LEU B CB  1 
ATOM 3635  C CG  . LEU B 1 56  ? -36.112  2.176   -102.251 1.00 175.65 ? 25  LEU B CG  1 
ATOM 3636  C CD1 . LEU B 1 56  ? -35.013  1.295   -101.703 1.00 173.63 ? 25  LEU B CD1 1 
ATOM 3637  C CD2 . LEU B 1 56  ? -36.492  3.228   -101.232 1.00 175.43 ? 25  LEU B CD2 1 
ATOM 3638  N N   . GLU B 1 57  ? -36.078  3.614   -106.857 1.00 181.47 ? 26  GLU B N   1 
ATOM 3639  C CA  . GLU B 1 57  ? -35.681  4.428   -108.009 1.00 183.46 ? 26  GLU B CA  1 
ATOM 3640  C C   . GLU B 1 57  ? -36.715  5.494   -108.372 1.00 185.81 ? 26  GLU B C   1 
ATOM 3641  O O   . GLU B 1 57  ? -36.346  6.589   -108.809 1.00 187.32 ? 26  GLU B O   1 
ATOM 3642  C CB  . GLU B 1 57  ? -35.401  3.543   -109.223 1.00 184.34 ? 26  GLU B CB  1 
ATOM 3643  N N   . LYS B 1 58  ? -37.998  5.166   -108.176 1.00 186.53 ? 27  LYS B N   1 
ATOM 3644  C CA  . LYS B 1 58  ? -39.135  6.051   -108.512 1.00 189.16 ? 27  LYS B CA  1 
ATOM 3645  C C   . LYS B 1 58  ? -39.367  7.213   -107.522 1.00 189.20 ? 27  LYS B C   1 
ATOM 3646  O O   . LYS B 1 58  ? -39.980  8.223   -107.885 1.00 191.64 ? 27  LYS B O   1 
ATOM 3647  C CB  . LYS B 1 58  ? -40.428  5.235   -108.696 1.00 189.94 ? 27  LYS B CB  1 
ATOM 3648  N N   . ILE B 1 59  ? -38.874  7.068   -106.289 1.00 186.85 ? 28  ILE B N   1 
ATOM 3649  C CA  . ILE B 1 59  ? -39.037  8.096   -105.250 1.00 186.84 ? 28  ILE B CA  1 
ATOM 3650  C C   . ILE B 1 59  ? -37.978  9.185   -105.401 1.00 187.27 ? 28  ILE B C   1 
ATOM 3651  O O   . ILE B 1 59  ? -38.265  10.370  -105.233 1.00 188.78 ? 28  ILE B O   1 
ATOM 3652  C CB  . ILE B 1 59  ? -39.000  7.496   -103.816 1.00 184.58 ? 28  ILE B CB  1 
ATOM 3653  C CG1 . ILE B 1 59  ? -39.475  6.037   -103.840 1.00 183.65 ? 28  ILE B CG1 1 
ATOM 3654  C CG2 . ILE B 1 59  ? -39.857  8.342   -102.856 1.00 185.58 ? 28  ILE B CG2 1 
ATOM 3655  C CD1 . ILE B 1 59  ? -39.255  5.278   -102.561 1.00 181.54 ? 28  ILE B CD1 1 
ATOM 3656  N N   . LEU B 1 60  ? -36.763  8.765   -105.741 1.00 186.27 ? 29  LEU B N   1 
ATOM 3657  C CA  . LEU B 1 60  ? -35.638  9.666   -106.011 1.00 187.25 ? 29  LEU B CA  1 
ATOM 3658  C C   . LEU B 1 60  ? -36.012  10.861  -106.894 1.00 190.69 ? 29  LEU B C   1 
ATOM 3659  O O   . LEU B 1 60  ? -35.402  11.928  -106.798 1.00 191.89 ? 29  LEU B O   1 
ATOM 3660  C CB  . LEU B 1 60  ? -34.482  8.881   -106.653 1.00 186.46 ? 29  LEU B CB  1 
ATOM 3661  C CG  . LEU B 1 60  ? -33.580  8.044   -105.733 1.00 183.59 ? 29  LEU B CG  1 
ATOM 3662  C CD1 . LEU B 1 60  ? -33.142  6.734   -106.386 1.00 182.54 ? 29  LEU B CD1 1 
ATOM 3663  C CD2 . LEU B 1 60  ? -32.371  8.853   -105.279 1.00 183.41 ? 29  LEU B CD2 1 
ATOM 3664  N N   . THR B 1 61  ? -37.021  10.671  -107.742 1.00 192.64 ? 30  THR B N   1 
ATOM 3665  C CA  . THR B 1 61  ? -37.451  11.684  -108.711 1.00 196.34 ? 30  THR B CA  1 
ATOM 3666  C C   . THR B 1 61  ? -38.584  12.600  -108.201 1.00 198.10 ? 30  THR B C   1 
ATOM 3667  O O   . THR B 1 61  ? -39.077  13.467  -108.938 1.00 201.41 ? 30  THR B O   1 
ATOM 3668  C CB  . THR B 1 61  ? -37.832  11.027  -110.055 1.00 198.17 ? 30  THR B CB  1 
ATOM 3669  O OG1 . THR B 1 61  ? -38.409  9.738   -109.806 1.00 196.21 ? 30  THR B OG1 1 
ATOM 3670  C CG2 . THR B 1 61  ? -36.594  10.861  -110.935 1.00 198.67 ? 30  THR B CG2 1 
ATOM 3671  N N   . THR B 1 62  ? -38.980  12.407  -106.939 1.00 196.09 ? 31  THR B N   1 
ATOM 3672  C CA  . THR B 1 62  ? -39.924  13.306  -106.253 1.00 197.63 ? 31  THR B CA  1 
ATOM 3673  C C   . THR B 1 62  ? -39.164  14.394  -105.501 1.00 197.63 ? 31  THR B C   1 
ATOM 3674  O O   . THR B 1 62  ? -39.760  15.330  -104.965 1.00 199.35 ? 31  THR B O   1 
ATOM 3675  C CB  . THR B 1 62  ? -40.811  12.563  -105.227 1.00 196.07 ? 31  THR B CB  1 
ATOM 3676  O OG1 . THR B 1 62  ? -40.886  11.169  -105.555 1.00 194.44 ? 31  THR B OG1 1 
ATOM 3677  C CG2 . THR B 1 62  ? -42.220  13.184  -105.168 1.00 198.77 ? 31  THR B CG2 1 
ATOM 3678  N N   . ALA B 1 63  ? -37.843  14.250  -105.463 1.00 195.91 ? 32  ALA B N   1 
ATOM 3679  C CA  . ALA B 1 63  ? -36.953  15.189  -104.789 1.00 196.11 ? 32  ALA B CA  1 
ATOM 3680  C C   . ALA B 1 63  ? -36.922  16.556  -105.470 1.00 199.98 ? 32  ALA B C   1 
ATOM 3681  O O   . ALA B 1 63  ? -36.478  16.679  -106.614 1.00 201.66 ? 32  ALA B O   1 
ATOM 3682  C CB  . ALA B 1 63  ? -35.555  14.604  -104.714 1.00 193.76 ? 32  ALA B CB  1 
ATOM 3683  N N   . SER B 1 64  ? -37.376  17.579  -104.748 1.00 201.84 ? 33  SER B N   1 
ATOM 3684  C CA  . SER B 1 64  ? -37.522  18.928  -105.301 1.00 206.23 ? 33  SER B CA  1 
ATOM 3685  C C   . SER B 1 64  ? -36.196  19.623  -105.649 1.00 207.50 ? 33  SER B C   1 
ATOM 3686  O O   . SER B 1 64  ? -35.488  20.122  -104.769 1.00 206.72 ? 33  SER B O   1 
ATOM 3687  C CB  . SER B 1 64  ? -38.383  19.805  -104.380 1.00 207.95 ? 33  SER B CB  1 
ATOM 3688  O OG  . SER B 1 64  ? -37.831  19.885  -103.079 1.00 205.92 ? 33  SER B OG  1 
ATOM 3689  N N   . SER B 1 65  ? -35.891  19.636  -106.950 1.00 209.93 ? 34  SER B N   1 
ATOM 3690  C CA  . SER B 1 65  ? -34.747  20.344  -107.563 1.00 212.56 ? 34  SER B CA  1 
ATOM 3691  C C   . SER B 1 65  ? -33.434  20.321  -106.771 1.00 210.73 ? 34  SER B C   1 
ATOM 3692  O O   . SER B 1 65  ? -32.720  19.318  -106.803 1.00 208.12 ? 34  SER B O   1 
ATOM 3693  C CB  . SER B 1 65  ? -35.127  21.777  -107.966 1.00 217.43 ? 34  SER B CB  1 
ATOM 3694  O OG  . SER B 1 65  ? -35.342  22.599  -106.832 1.00 217.68 ? 34  SER B OG  1 
ATOM 3695  N N   . HIS B 1 66  ? -33.133  21.428  -106.076 1.00 212.78 ? 35  HIS B N   1 
ATOM 3696  C CA  . HIS B 1 66  ? -31.878  21.633  -105.310 1.00 211.92 ? 35  HIS B CA  1 
ATOM 3697  C C   . HIS B 1 66  ? -31.656  20.576  -104.235 1.00 207.44 ? 35  HIS B C   1 
ATOM 3698  O O   . HIS B 1 66  ? -30.525  20.268  -103.851 1.00 205.84 ? 35  HIS B O   1 
ATOM 3699  C CB  . HIS B 1 66  ? -31.860  23.026  -104.660 1.00 214.87 ? 35  HIS B CB  1 
ATOM 3700  C CG  . HIS B 1 66  ? -32.980  23.256  -103.690 1.00 215.16 ? 35  HIS B CG  1 
ATOM 3701  N ND1 . HIS B 1 66  ? -34.214  23.735  -104.078 1.00 218.35 ? 35  HIS B ND1 1 
ATOM 3702  C CD2 . HIS B 1 66  ? -33.055  23.065  -102.351 1.00 213.35 ? 35  HIS B CD2 1 
ATOM 3703  C CE1 . HIS B 1 66  ? -35.000  23.831  -103.021 1.00 217.85 ? 35  HIS B CE1 1 
ATOM 3704  N NE2 . HIS B 1 66  ? -34.321  23.430  -101.960 1.00 215.14 ? 35  HIS B NE2 1 
ATOM 3705  N N   . GLU B 1 67  ? -32.762  20.046  -103.741 1.00 205.91 ? 36  GLU B N   1 
ATOM 3706  C CA  . GLU B 1 67  ? -32.740  18.956  -102.812 1.00 202.22 ? 36  GLU B CA  1 
ATOM 3707  C C   . GLU B 1 67  ? -32.866  17.668  -103.643 1.00 200.13 ? 36  GLU B C   1 
ATOM 3708  O O   . GLU B 1 67  ? -33.962  17.286  -104.057 1.00 200.54 ? 36  GLU B O   1 
ATOM 3709  C CB  . GLU B 1 67  ? -33.893  19.158  -101.830 1.00 202.37 ? 36  GLU B CB  1 
ATOM 3710  C CG  . GLU B 1 67  ? -33.700  18.523  -100.479 1.00 200.72 ? 36  GLU B CG  1 
ATOM 3711  C CD  . GLU B 1 67  ? -34.545  17.279  -100.310 1.00 200.23 ? 36  GLU B CD  1 
ATOM 3712  O OE1 . GLU B 1 67  ? -35.773  17.367  -100.560 1.00 201.98 ? 36  GLU B OE1 1 
ATOM 3713  O OE2 . GLU B 1 67  ? -33.985  16.224  -99.924  1.00 198.43 ? 36  GLU B OE2 1 
ATOM 3714  N N   . PHE B 1 68  ? -31.724  17.053  -103.942 1.00 198.34 ? 37  PHE B N   1 
ATOM 3715  C CA  . PHE B 1 68  ? -31.648  15.779  -104.667 1.00 196.34 ? 37  PHE B CA  1 
ATOM 3716  C C   . PHE B 1 68  ? -30.282  15.212  -104.350 1.00 194.31 ? 37  PHE B C   1 
ATOM 3717  O O   . PHE B 1 68  ? -30.083  13.993  -104.361 1.00 192.08 ? 37  PHE B O   1 
ATOM 3718  C CB  . PHE B 1 68  ? -31.823  15.973  -106.184 1.00 199.01 ? 37  PHE B CB  1 
ATOM 3719  C CG  . PHE B 1 68  ? -31.617  14.707  -107.015 1.00 198.25 ? 37  PHE B CG  1 
ATOM 3720  C CD1 . PHE B 1 68  ? -32.631  13.754  -107.142 1.00 197.32 ? 37  PHE B CD1 1 
ATOM 3721  C CD2 . PHE B 1 68  ? -30.416  14.491  -107.705 1.00 199.26 ? 37  PHE B CD2 1 
ATOM 3722  C CE1 . PHE B 1 68  ? -32.441  12.593  -107.926 1.00 196.50 ? 37  PHE B CE1 1 
ATOM 3723  C CE2 . PHE B 1 68  ? -30.217  13.334  -108.491 1.00 198.24 ? 37  PHE B CE2 1 
ATOM 3724  C CZ  . PHE B 1 68  ? -31.231  12.388  -108.598 1.00 196.94 ? 37  PHE B CZ  1 
ATOM 3725  N N   . GLU B 1 69  ? -29.348  16.117  -104.060 1.00 195.30 ? 38  GLU B N   1 
ATOM 3726  C CA  . GLU B 1 69  ? -27.997  15.747  -103.680 1.00 193.78 ? 38  GLU B CA  1 
ATOM 3727  C C   . GLU B 1 69  ? -28.049  14.714  -102.552 1.00 190.27 ? 38  GLU B C   1 
ATOM 3728  O O   . GLU B 1 69  ? -27.829  13.521  -102.792 1.00 188.52 ? 38  GLU B O   1 
ATOM 3729  C CB  . GLU B 1 69  ? -27.186  16.985  -103.277 1.00 195.83 ? 38  GLU B CB  1 
ATOM 3730  N N   . HIS B 1 70  ? -28.395  15.160  -101.342 1.00 189.41 ? 39  HIS B N   1 
ATOM 3731  C CA  . HIS B 1 70  ? -28.257  14.311  -100.147 1.00 186.52 ? 39  HIS B CA  1 
ATOM 3732  C C   . HIS B 1 70  ? -29.251  13.143  -100.061 1.00 183.74 ? 39  HIS B C   1 
ATOM 3733  O O   . HIS B 1 70  ? -28.989  12.165  -99.361  1.00 181.89 ? 39  HIS B O   1 
ATOM 3734  C CB  . HIS B 1 70  ? -28.184  15.142  -98.837  1.00 187.39 ? 39  HIS B CB  1 
ATOM 3735  C CG  . HIS B 1 70  ? -29.475  15.792  -98.437  1.00 189.42 ? 39  HIS B CG  1 
ATOM 3736  N ND1 . HIS B 1 70  ? -30.149  16.681  -99.248  1.00 192.87 ? 39  HIS B ND1 1 
ATOM 3737  C CD2 . HIS B 1 70  ? -30.200  15.700  -97.296  1.00 189.75 ? 39  HIS B CD2 1 
ATOM 3738  C CE1 . HIS B 1 70  ? -31.244  17.094  -98.633  1.00 193.85 ? 39  HIS B CE1 1 
ATOM 3739  N NE2 . HIS B 1 70  ? -31.300  16.513  -97.448  1.00 192.20 ? 39  HIS B NE2 1 
ATOM 3740  N N   . THR B 1 71  ? -30.360  13.222  -100.793 1.00 183.43 ? 40  THR B N   1 
ATOM 3741  C CA  . THR B 1 71  ? -31.362  12.156  -100.757 1.00 181.02 ? 40  THR B CA  1 
ATOM 3742  C C   . THR B 1 71  ? -30.872  10.944  -101.528 1.00 179.50 ? 40  THR B C   1 
ATOM 3743  O O   . THR B 1 71  ? -31.183  9.806   -101.170 1.00 177.68 ? 40  THR B O   1 
ATOM 3744  C CB  . THR B 1 71  ? -32.705  12.600  -101.337 1.00 182.38 ? 40  THR B CB  1 
ATOM 3745  O OG1 . THR B 1 71  ? -32.832  14.019  -101.212 1.00 184.22 ? 40  THR B OG1 1 
ATOM 3746  C CG2 . THR B 1 71  ? -33.838  11.930  -100.597 1.00 180.75 ? 40  THR B CG2 1 
ATOM 3747  N N   . LYS B 1 72  ? -30.111  11.208  -102.591 1.00 180.35 ? 41  LYS B N   1 
ATOM 3748  C CA  . LYS B 1 72  ? -29.465  10.164  -103.372 1.00 179.37 ? 41  LYS B CA  1 
ATOM 3749  C C   . LYS B 1 72  ? -28.434  9.479   -102.498 1.00 177.60 ? 41  LYS B C   1 
ATOM 3750  O O   . LYS B 1 72  ? -28.280  8.260   -102.555 1.00 176.33 ? 41  LYS B O   1 
ATOM 3751  C CB  . LYS B 1 72  ? -28.807  10.746  -104.622 1.00 181.48 ? 41  LYS B CB  1 
ATOM 3752  N N   . LYS B 1 73  ? -27.755  10.274  -101.671 1.00 177.82 ? 42  LYS B N   1 
ATOM 3753  C CA  . LYS B 1 73  ? -26.751  9.770   -100.732 1.00 176.69 ? 42  LYS B CA  1 
ATOM 3754  C C   . LYS B 1 73  ? -27.365  8.823   -99.709  1.00 175.07 ? 42  LYS B C   1 
ATOM 3755  O O   . LYS B 1 73  ? -26.786  7.777   -99.404  1.00 174.08 ? 42  LYS B O   1 
ATOM 3756  C CB  . LYS B 1 73  ? -26.029  10.926  -100.020 1.00 177.77 ? 42  LYS B CB  1 
ATOM 3757  C CG  . LYS B 1 73  ? -25.405  11.943  -100.969 1.00 179.52 ? 42  LYS B CG  1 
ATOM 3758  C CD  . LYS B 1 73  ? -24.334  12.793  -100.305 1.00 179.42 ? 42  LYS B CD  1 
ATOM 3759  C CE  . LYS B 1 73  ? -23.549  13.574  -101.351 1.00 181.00 ? 42  LYS B CE  1 
ATOM 3760  N NZ  . LYS B 1 73  ? -22.262  14.086  -100.820 1.00 181.57 ? 42  LYS B NZ  1 
ATOM 3761  N N   . ASP B 1 74  ? -28.547  9.190   -99.209  1.00 175.20 ? 43  ASP B N   1 
ATOM 3762  C CA  . ASP B 1 74  ? -29.212  8.470   -98.123  1.00 174.31 ? 43  ASP B CA  1 
ATOM 3763  C C   . ASP B 1 74  ? -29.562  7.035   -98.466  1.00 173.15 ? 43  ASP B C   1 
ATOM 3764  O O   . ASP B 1 74  ? -29.235  6.118   -97.715  1.00 172.44 ? 43  ASP B O   1 
ATOM 3765  C CB  . ASP B 1 74  ? -30.465  9.220   -97.662  1.00 175.14 ? 43  ASP B CB  1 
ATOM 3766  C CG  . ASP B 1 74  ? -30.139  10.497  -96.901  1.00 177.10 ? 43  ASP B CG  1 
ATOM 3767  O OD1 . ASP B 1 74  ? -28.953  10.880  -96.850  1.00 178.41 ? 43  ASP B OD1 1 
ATOM 3768  O OD2 . ASP B 1 74  ? -31.068  11.129  -96.353  1.00 178.72 ? 43  ASP B OD2 1 
ATOM 3769  N N   . LEU B 1 75  ? -30.211  6.835   -99.605  1.00 173.45 ? 44  LEU B N   1 
ATOM 3770  C CA  . LEU B 1 75  ? -30.681  5.503   -99.962  1.00 172.83 ? 44  LEU B CA  1 
ATOM 3771  C C   . LEU B 1 75  ? -29.531  4.515   -100.167 1.00 172.31 ? 44  LEU B C   1 
ATOM 3772  O O   . LEU B 1 75  ? -29.651  3.333   -99.843  1.00 171.59 ? 44  LEU B O   1 
ATOM 3773  C CB  . LEU B 1 75  ? -31.605  5.553   -101.186 1.00 173.66 ? 44  LEU B CB  1 
ATOM 3774  C CG  . LEU B 1 75  ? -32.888  6.416   -101.180 1.00 174.90 ? 44  LEU B CG  1 
ATOM 3775  C CD1 . LEU B 1 75  ? -33.896  5.849   -102.179 1.00 176.07 ? 44  LEU B CD1 1 
ATOM 3776  C CD2 . LEU B 1 75  ? -33.568  6.565   -99.822  1.00 173.92 ? 44  LEU B CD2 1 
ATOM 3777  N N   . ASP B 1 76  ? -28.412  5.012   -100.681 1.00 173.10 ? 45  ASP B N   1 
ATOM 3778  C CA  . ASP B 1 76  ? -27.239  4.176   -100.921 1.00 173.22 ? 45  ASP B CA  1 
ATOM 3779  C C   . ASP B 1 76  ? -26.762  3.500   -99.647  1.00 172.39 ? 45  ASP B C   1 
ATOM 3780  O O   . ASP B 1 76  ? -26.458  2.303   -99.654  1.00 172.09 ? 45  ASP B O   1 
ATOM 3781  C CB  . ASP B 1 76  ? -26.114  4.995   -101.551 1.00 174.66 ? 45  ASP B CB  1 
ATOM 3782  C CG  . ASP B 1 76  ? -26.485  5.533   -102.920 1.00 176.48 ? 45  ASP B CG  1 
ATOM 3783  O OD1 . ASP B 1 76  ? -27.365  4.949   -103.600 1.00 176.72 ? 45  ASP B OD1 1 
ATOM 3784  O OD2 . ASP B 1 76  ? -25.886  6.549   -103.317 1.00 178.93 ? 45  ASP B OD2 1 
ATOM 3785  N N   . GLY B 1 77  ? -26.710  4.278   -98.565  1.00 172.31 ? 46  GLY B N   1 
ATOM 3786  C CA  . GLY B 1 77  ? -26.429  3.754   -97.234  1.00 171.87 ? 46  GLY B CA  1 
ATOM 3787  C C   . GLY B 1 77  ? -27.453  2.700   -96.867  1.00 171.12 ? 46  GLY B C   1 
ATOM 3788  O O   . GLY B 1 77  ? -27.106  1.669   -96.282  1.00 171.19 ? 46  GLY B O   1 
ATOM 3789  N N   . PHE B 1 78  ? -28.711  2.954   -97.232  1.00 170.61 ? 47  PHE B N   1 
ATOM 3790  C CA  . PHE B 1 78  ? -29.793  2.021   -96.959  1.00 170.20 ? 47  PHE B CA  1 
ATOM 3791  C C   . PHE B 1 78  ? -29.513  0.705   -97.658  1.00 170.07 ? 47  PHE B C   1 
ATOM 3792  O O   . PHE B 1 78  ? -29.427  -0.331  -97.013  1.00 170.07 ? 47  PHE B O   1 
ATOM 3793  C CB  . PHE B 1 78  ? -31.146  2.589   -97.392  1.00 170.15 ? 47  PHE B CB  1 
ATOM 3794  C CG  . PHE B 1 78  ? -32.325  1.918   -96.738  1.00 170.18 ? 47  PHE B CG  1 
ATOM 3795  C CD1 . PHE B 1 78  ? -33.114  2.612   -95.832  1.00 170.64 ? 47  PHE B CD1 1 
ATOM 3796  C CD2 . PHE B 1 78  ? -32.646  0.591   -97.020  1.00 169.99 ? 47  PHE B CD2 1 
ATOM 3797  C CE1 . PHE B 1 78  ? -34.205  2.002   -95.214  1.00 171.41 ? 47  PHE B CE1 1 
ATOM 3798  C CE2 . PHE B 1 78  ? -33.735  -0.029  -96.405  1.00 170.52 ? 47  PHE B CE2 1 
ATOM 3799  C CZ  . PHE B 1 78  ? -34.518  0.681   -95.503  1.00 171.35 ? 47  PHE B CZ  1 
ATOM 3800  N N   . ARG B 1 79  ? -29.351  0.748   -98.974  1.00 170.47 ? 48  ARG B N   1 
ATOM 3801  C CA  . ARG B 1 79  ? -29.024  -0.460  -99.727  1.00 171.16 ? 48  ARG B CA  1 
ATOM 3802  C C   . ARG B 1 79  ? -27.748  -1.116  -99.192  1.00 171.51 ? 48  ARG B C   1 
ATOM 3803  O O   . ARG B 1 79  ? -27.615  -2.347  -99.214  1.00 172.00 ? 48  ARG B O   1 
ATOM 3804  C CB  . ARG B 1 79  ? -28.868  -0.164  -101.222 1.00 171.84 ? 48  ARG B CB  1 
ATOM 3805  C CG  . ARG B 1 79  ? -30.145  -0.225  -102.051 1.00 172.37 ? 48  ARG B CG  1 
ATOM 3806  C CD  . ARG B 1 79  ? -29.794  -0.022  -103.519 1.00 174.71 ? 48  ARG B CD  1 
ATOM 3807  N NE  . ARG B 1 79  ? -30.559  1.077   -104.106 1.00 176.64 ? 48  ARG B NE  1 
ATOM 3808  C CZ  . ARG B 1 79  ? -30.054  2.012   -104.912 1.00 177.87 ? 48  ARG B CZ  1 
ATOM 3809  N NH1 . ARG B 1 79  ? -28.759  1.998   -105.232 1.00 177.77 ? 48  ARG B NH1 1 
ATOM 3810  N NH2 . ARG B 1 79  ? -30.851  2.973   -105.385 1.00 178.48 ? 48  ARG B NH2 1 
ATOM 3811  N N   . LYS B 1 80  ? -26.813  -0.296  -98.719  1.00 171.61 ? 49  LYS B N   1 
ATOM 3812  C CA  . LYS B 1 80  ? -25.621  -0.828  -98.090  1.00 172.09 ? 49  LYS B CA  1 
ATOM 3813  C C   . LYS B 1 80  ? -26.012  -1.591  -96.835  1.00 172.13 ? 49  LYS B C   1 
ATOM 3814  O O   . LYS B 1 80  ? -25.475  -2.671  -96.593  1.00 173.06 ? 49  LYS B O   1 
ATOM 3815  C CB  . LYS B 1 80  ? -24.595  0.266   -97.799  1.00 172.66 ? 49  LYS B CB  1 
ATOM 3816  C CG  . LYS B 1 80  ? -23.708  0.584   -99.002  1.00 173.81 ? 49  LYS B CG  1 
ATOM 3817  C CD  . LYS B 1 80  ? -22.782  1.770   -98.754  1.00 174.60 ? 49  LYS B CD  1 
ATOM 3818  C CE  . LYS B 1 80  ? -22.002  2.118   -100.012 1.00 175.46 ? 49  LYS B CE  1 
ATOM 3819  N NZ  . LYS B 1 80  ? -21.239  3.374   -99.838  1.00 176.16 ? 49  LYS B NZ  1 
ATOM 3820  N N   . LEU B 1 81  ? -26.970  -1.054  -96.073  1.00 171.52 ? 50  LEU B N   1 
ATOM 3821  C CA  . LEU B 1 81  ? -27.481  -1.724  -94.867  1.00 171.83 ? 50  LEU B CA  1 
ATOM 3822  C C   . LEU B 1 81  ? -28.371  -2.921  -95.199  1.00 172.16 ? 50  LEU B C   1 
ATOM 3823  O O   . LEU B 1 81  ? -28.407  -3.913  -94.466  1.00 173.12 ? 50  LEU B O   1 
ATOM 3824  C CB  . LEU B 1 81  ? -28.244  -0.743  -93.973  1.00 171.57 ? 50  LEU B CB  1 
ATOM 3825  C CG  . LEU B 1 81  ? -27.451  0.284   -93.165  1.00 171.22 ? 50  LEU B CG  1 
ATOM 3826  C CD1 . LEU B 1 81  ? -28.367  1.322   -92.563  1.00 170.18 ? 50  LEU B CD1 1 
ATOM 3827  C CD2 . LEU B 1 81  ? -26.637  -0.381  -92.079  1.00 172.10 ? 50  LEU B CD2 1 
ATOM 3828  N N   . PHE B 1 82  ? -29.084  -2.827  -96.313  1.00 171.78 ? 51  PHE B N   1 
ATOM 3829  C CA  . PHE B 1 82  ? -30.027  -3.863  -96.695  1.00 172.41 ? 51  PHE B CA  1 
ATOM 3830  C C   . PHE B 1 82  ? -29.305  -5.133  -97.147  1.00 173.04 ? 51  PHE B C   1 
ATOM 3831  O O   . PHE B 1 82  ? -29.430  -6.178  -96.512  1.00 173.90 ? 51  PHE B O   1 
ATOM 3832  C CB  . PHE B 1 82  ? -30.975  -3.347  -97.782  1.00 172.03 ? 51  PHE B CB  1 
ATOM 3833  C CG  . PHE B 1 82  ? -32.320  -4.010  -97.772  1.00 173.06 ? 51  PHE B CG  1 
ATOM 3834  C CD1 . PHE B 1 82  ? -33.402  -3.394  -97.159  1.00 173.68 ? 51  PHE B CD1 1 
ATOM 3835  C CD2 . PHE B 1 82  ? -32.505  -5.258  -98.365  1.00 174.14 ? 51  PHE B CD2 1 
ATOM 3836  C CE1 . PHE B 1 82  ? -34.651  -4.007  -97.140  1.00 175.13 ? 51  PHE B CE1 1 
ATOM 3837  C CE2 . PHE B 1 82  ? -33.748  -5.879  -98.350  1.00 175.32 ? 51  PHE B CE2 1 
ATOM 3838  C CZ  . PHE B 1 82  ? -34.824  -5.253  -97.737  1.00 175.86 ? 51  PHE B CZ  1 
ATOM 3839  N N   . HIS B 1 83  ? -28.547  -5.032  -98.238  1.00 172.97 ? 52  HIS B N   1 
ATOM 3840  C CA  . HIS B 1 83  ? -27.771  -6.158  -98.752  1.00 174.01 ? 52  HIS B CA  1 
ATOM 3841  C C   . HIS B 1 83  ? -27.090  -6.887  -97.597  1.00 174.89 ? 52  HIS B C   1 
ATOM 3842  O O   . HIS B 1 83  ? -26.915  -8.108  -97.623  1.00 176.08 ? 52  HIS B O   1 
ATOM 3843  C CB  . HIS B 1 83  ? -26.725  -5.681  -99.769  1.00 174.15 ? 52  HIS B CB  1 
ATOM 3844  C CG  . HIS B 1 83  ? -25.640  -6.680  -100.013 1.00 176.30 ? 52  HIS B CG  1 
ATOM 3845  N ND1 . HIS B 1 83  ? -25.855  -7.851  -100.706 1.00 178.10 ? 52  HIS B ND1 1 
ATOM 3846  C CD2 . HIS B 1 83  ? -24.346  -6.711  -99.614  1.00 177.97 ? 52  HIS B CD2 1 
ATOM 3847  C CE1 . HIS B 1 83  ? -24.735  -8.552  -100.742 1.00 179.83 ? 52  HIS B CE1 1 
ATOM 3848  N NE2 . HIS B 1 83  ? -23.803  -7.882  -100.088 1.00 179.79 ? 52  HIS B NE2 1 
ATOM 3849  N N   . ARG B 1 84  ? -26.727  -6.105  -96.585  1.00 174.60 ? 53  ARG B N   1 
ATOM 3850  C CA  . ARG B 1 84  ? -26.018  -6.575  -95.406  1.00 175.81 ? 53  ARG B CA  1 
ATOM 3851  C C   . ARG B 1 84  ? -26.973  -7.211  -94.403  1.00 176.48 ? 53  ARG B C   1 
ATOM 3852  O O   . ARG B 1 84  ? -26.564  -8.025  -93.572  1.00 178.25 ? 53  ARG B O   1 
ATOM 3853  C CB  . ARG B 1 84  ? -25.298  -5.392  -94.763  1.00 175.71 ? 53  ARG B CB  1 
ATOM 3854  C CG  . ARG B 1 84  ? -24.242  -5.717  -93.719  1.00 177.62 ? 53  ARG B CG  1 
ATOM 3855  C CD  . ARG B 1 84  ? -24.021  -4.472  -92.889  1.00 177.74 ? 53  ARG B CD  1 
ATOM 3856  N NE  . ARG B 1 84  ? -22.699  -4.401  -92.288  1.00 179.21 ? 53  ARG B NE  1 
ATOM 3857  C CZ  . ARG B 1 84  ? -22.076  -3.259  -92.013  1.00 179.41 ? 53  ARG B CZ  1 
ATOM 3858  N NH1 . ARG B 1 84  ? -22.649  -2.092  -92.296  1.00 177.28 ? 53  ARG B NH1 1 
ATOM 3859  N NH2 . ARG B 1 84  ? -20.872  -3.281  -91.461  1.00 182.02 ? 53  ARG B NH2 1 
ATOM 3860  N N   . PHE B 1 85  ? -28.242  -6.830  -94.478  1.00 175.34 ? 54  PHE B N   1 
ATOM 3861  C CA  . PHE B 1 85  ? -29.264  -7.399  -93.612  1.00 176.33 ? 54  PHE B CA  1 
ATOM 3862  C C   . PHE B 1 85  ? -29.659  -8.822  -94.048  1.00 177.17 ? 54  PHE B C   1 
ATOM 3863  O O   . PHE B 1 85  ? -30.072  -9.642  -93.221  1.00 178.98 ? 54  PHE B O   1 
ATOM 3864  C CB  . PHE B 1 85  ? -30.478  -6.463  -93.565  1.00 175.56 ? 54  PHE B CB  1 
ATOM 3865  C CG  . PHE B 1 85  ? -31.615  -6.970  -92.721  1.00 177.66 ? 54  PHE B CG  1 
ATOM 3866  C CD1 . PHE B 1 85  ? -32.914  -6.952  -93.211  1.00 177.69 ? 54  PHE B CD1 1 
ATOM 3867  C CD2 . PHE B 1 85  ? -31.392  -7.463  -91.433  1.00 180.60 ? 54  PHE B CD2 1 
ATOM 3868  C CE1 . PHE B 1 85  ? -33.978  -7.414  -92.436  1.00 179.74 ? 54  PHE B CE1 1 
ATOM 3869  C CE2 . PHE B 1 85  ? -32.450  -7.933  -90.649  1.00 182.65 ? 54  PHE B CE2 1 
ATOM 3870  C CZ  . PHE B 1 85  ? -33.745  -7.906  -91.156  1.00 182.26 ? 54  PHE B CZ  1 
ATOM 3871  N N   . LEU B 1 86  ? -29.505  -9.113  -95.339  1.00 176.02 ? 55  LEU B N   1 
ATOM 3872  C CA  . LEU B 1 86  ? -29.906  -10.407 -95.904  1.00 176.66 ? 55  LEU B CA  1 
ATOM 3873  C C   . LEU B 1 86  ? -28.744  -11.404 -95.993  1.00 177.82 ? 55  LEU B C   1 
ATOM 3874  O O   . LEU B 1 86  ? -28.934  -12.556 -96.389  1.00 179.08 ? 55  LEU B O   1 
ATOM 3875  C CB  . LEU B 1 86  ? -30.539  -10.208 -97.286  1.00 175.46 ? 55  LEU B CB  1 
ATOM 3876  C CG  . LEU B 1 86  ? -31.350  -8.931  -97.537  1.00 173.64 ? 55  LEU B CG  1 
ATOM 3877  C CD1 . LEU B 1 86  ? -31.567  -8.739  -99.023  1.00 173.28 ? 55  LEU B CD1 1 
ATOM 3878  C CD2 . LEU B 1 86  ? -32.679  -8.935  -96.797  1.00 173.97 ? 55  LEU B CD2 1 
ATOM 3879  N N   . GLN B 1 87  ? -27.549  -10.948 -95.620  1.00 177.46 ? 56  GLN B N   1 
ATOM 3880  C CA  . GLN B 1 87  ? -26.334  -11.755 -95.684  1.00 178.69 ? 56  GLN B CA  1 
ATOM 3881  C C   . GLN B 1 87  ? -25.653  -11.816 -94.316  1.00 180.04 ? 56  GLN B C   1 
ATOM 3882  O O   . GLN B 1 87  ? -26.288  -12.132 -93.307  1.00 180.88 ? 56  GLN B O   1 
ATOM 3883  C CB  . GLN B 1 87  ? -25.378  -11.194 -96.744  1.00 177.56 ? 56  GLN B CB  1 
ATOM 3884  N N   . GLY B 1 96  ? -19.874  -15.695 -81.554  1.00 208.70 ? 65  GLY B N   1 
ATOM 3885  C CA  . GLY B 1 96  ? -19.191  -16.284 -80.400  1.00 214.77 ? 65  GLY B CA  1 
ATOM 3886  C C   . GLY B 1 96  ? -19.004  -17.791 -80.513  1.00 218.71 ? 65  GLY B C   1 
ATOM 3887  O O   . GLY B 1 96  ? -19.327  -18.373 -81.542  1.00 216.98 ? 65  GLY B O   1 
ATOM 3888  N N   . LYS B 1 97  ? -18.467  -18.435 -79.478  1.00 224.48 ? 66  LYS B N   1 
ATOM 3889  C CA  . LYS B 1 97  ? -17.963  -17.758 -78.301  1.00 227.26 ? 66  LYS B CA  1 
ATOM 3890  C C   . LYS B 1 97  ? -16.448  -17.868 -78.309  1.00 229.97 ? 66  LYS B C   1 
ATOM 3891  O O   . LYS B 1 97  ? -15.911  -18.933 -78.604  1.00 232.63 ? 66  LYS B O   1 
ATOM 3892  C CB  . LYS B 1 97  ? -18.564  -18.369 -77.037  1.00 232.58 ? 66  LYS B CB  1 
ATOM 3893  C CG  . LYS B 1 97  ? -20.043  -18.048 -76.856  1.00 229.93 ? 66  LYS B CG  1 
ATOM 3894  C CD  . LYS B 1 97  ? -20.444  -18.131 -75.399  1.00 233.92 ? 66  LYS B CD  1 
ATOM 3895  C CE  . LYS B 1 97  ? -21.435  -17.045 -75.051  1.00 230.14 ? 66  LYS B CE  1 
ATOM 3896  N NZ  . LYS B 1 97  ? -21.577  -16.951 -73.583  1.00 234.91 ? 66  LYS B NZ  1 
ATOM 3897  N N   . ILE B 1 98  ? -15.766  -16.760 -78.019  1.00 229.61 ? 67  ILE B N   1 
ATOM 3898  C CA  . ILE B 1 98  ? -14.299  -16.730 -78.064  1.00 232.36 ? 67  ILE B CA  1 
ATOM 3899  C C   . ILE B 1 98  ? -13.657  -16.488 -76.686  1.00 238.12 ? 67  ILE B C   1 
ATOM 3900  O O   . ILE B 1 98  ? -13.084  -17.431 -76.126  1.00 243.99 ? 67  ILE B O   1 
ATOM 3901  C CB  . ILE B 1 98  ? -13.721  -15.767 -79.162  1.00 227.25 ? 67  ILE B CB  1 
ATOM 3902  C CG1 . ILE B 1 98  ? -14.546  -15.843 -80.456  1.00 222.49 ? 67  ILE B CG1 1 
ATOM 3903  C CG2 . ILE B 1 98  ? -12.258  -16.115 -79.469  1.00 229.51 ? 67  ILE B CG2 1 
ATOM 3904  C CD1 . ILE B 1 98  ? -14.669  -14.514 -81.229  1.00 217.44 ? 67  ILE B CD1 1 
ATOM 3905  N N   . GLN B 1 99  ? -13.761  -15.267 -76.132  1.00 83.34  ? 68  GLN B N   1 
ATOM 3906  C CA  . GLN B 1 99  ? -12.975  -14.895 -74.917  1.00 83.50  ? 68  GLN B CA  1 
ATOM 3907  C C   . GLN B 1 99  ? -13.454  -13.719 -74.049  1.00 83.13  ? 68  GLN B C   1 
ATOM 3908  O O   . GLN B 1 99  ? -14.310  -12.933 -74.470  1.00 83.10  ? 68  GLN B O   1 
ATOM 3909  C CB  . GLN B 1 99  ? -11.503  -14.645 -75.290  1.00 83.80  ? 68  GLN B CB  1 
ATOM 3910  C CG  . GLN B 1 99  ? -10.590  -15.855 -75.107  1.00 84.66  ? 68  GLN B CG  1 
ATOM 3911  C CD  . GLN B 1 99  ? -9.224   -15.651 -75.719  1.00 85.90  ? 68  GLN B CD  1 
ATOM 3912  O OE1 . GLN B 1 99  ? -8.821   -14.516 -76.011  1.00 86.64  ? 68  GLN B OE1 1 
ATOM 3913  N NE2 . GLN B 1 99  ? -8.494   -16.752 -75.916  1.00 86.10  ? 68  GLN B NE2 1 
ATOM 3914  N N   . ARG B 1 100 ? -12.859  -13.621 -72.849  1.00 82.70  ? 69  ARG B N   1 
ATOM 3915  C CA  . ARG B 1 100 ? -13.019  -12.496 -71.906  1.00 82.47  ? 69  ARG B CA  1 
ATOM 3916  C C   . ARG B 1 100 ? -12.292  -11.224 -72.412  1.00 82.41  ? 69  ARG B C   1 
ATOM 3917  O O   . ARG B 1 100 ? -11.726  -11.255 -73.507  1.00 82.53  ? 69  ARG B O   1 
ATOM 3918  C CB  . ARG B 1 100 ? -12.509  -12.910 -70.518  1.00 82.27  ? 69  ARG B CB  1 
ATOM 3919  N N   . PRO B 1 101 ? -12.342  -10.092 -71.655  1.00 82.29  ? 70  PRO B N   1 
ATOM 3920  C CA  . PRO B 1 101 ? -11.511  -8.898  -71.988  1.00 82.07  ? 70  PRO B CA  1 
ATOM 3921  C C   . PRO B 1 101 ? -10.233  -8.743  -71.133  1.00 82.10  ? 70  PRO B C   1 
ATOM 3922  O O   . PRO B 1 101 ? -10.263  -9.058  -69.941  1.00 82.01  ? 70  PRO B O   1 
ATOM 3923  C CB  . PRO B 1 101 ? -12.460  -7.716  -71.746  1.00 81.80  ? 70  PRO B CB  1 
ATOM 3924  C CG  . PRO B 1 101 ? -13.640  -8.280  -70.947  1.00 82.27  ? 70  PRO B CG  1 
ATOM 3925  C CD  . PRO B 1 101 ? -13.404  -9.752  -70.689  1.00 82.38  ? 70  PRO B CD  1 
ATOM 3926  N N   . PRO B 1 102 ? -9.116   -8.247  -71.734  1.00 82.27  ? 71  PRO B N   1 
ATOM 3927  C CA  . PRO B 1 102 ? -7.799   -8.230  -71.060  1.00 82.15  ? 71  PRO B CA  1 
ATOM 3928  C C   . PRO B 1 102 ? -7.649   -7.120  -70.031  1.00 82.07  ? 71  PRO B C   1 
ATOM 3929  O O   . PRO B 1 102 ? -8.163   -6.011  -70.222  1.00 82.15  ? 71  PRO B O   1 
ATOM 3930  C CB  . PRO B 1 102 ? -6.808   -8.007  -72.207  1.00 81.90  ? 71  PRO B CB  1 
ATOM 3931  C CG  . PRO B 1 102 ? -7.560   -7.242  -73.209  1.00 82.15  ? 71  PRO B CG  1 
ATOM 3932  C CD  . PRO B 1 102 ? -9.044   -7.581  -73.051  1.00 82.50  ? 71  PRO B CD  1 
ATOM 3933  N N   . GLU B 1 103 ? -6.912   -7.424  -68.966  1.00 81.89  ? 72  GLU B N   1 
ATOM 3934  C CA  . GLU B 1 103 ? -6.831   -6.569  -67.779  1.00 81.70  ? 72  GLU B CA  1 
ATOM 3935  C C   . GLU B 1 103 ? -6.272   -5.159  -68.033  1.00 81.05  ? 72  GLU B C   1 
ATOM 3936  O O   . GLU B 1 103 ? -6.606   -4.219  -67.302  1.00 80.94  ? 72  GLU B O   1 
ATOM 3937  C CB  . GLU B 1 103 ? -6.074   -7.304  -66.662  1.00 82.05  ? 72  GLU B CB  1 
ATOM 3938  C CG  . GLU B 1 103 ? -6.825   -8.576  -66.167  1.00 83.59  ? 72  GLU B CG  1 
ATOM 3939  C CD  . GLU B 1 103 ? -5.991   -9.516  -65.275  1.00 85.25  ? 72  GLU B CD  1 
ATOM 3940  O OE1 . GLU B 1 103 ? -4.896   -9.119  -64.800  1.00 86.06  ? 72  GLU B OE1 1 
ATOM 3941  O OE2 . GLU B 1 103 ? -6.448   -10.664 -65.046  1.00 85.12  ? 72  GLU B OE2 1 
ATOM 3942  N N   . ASP B 1 104 ? -5.464   -5.021  -69.091  1.00 80.28  ? 73  ASP B N   1 
ATOM 3943  C CA  . ASP B 1 104 ? -4.810   -3.748  -69.493  1.00 79.07  ? 73  ASP B CA  1 
ATOM 3944  C C   . ASP B 1 104 ? -5.683   -2.799  -70.337  1.00 78.10  ? 73  ASP B C   1 
ATOM 3945  O O   . ASP B 1 104 ? -5.394   -1.600  -70.400  1.00 77.80  ? 73  ASP B O   1 
ATOM 3946  C CB  . ASP B 1 104 ? -3.524   -4.031  -70.294  1.00 79.15  ? 73  ASP B CB  1 
ATOM 3947  C CG  . ASP B 1 104 ? -2.648   -5.110  -69.664  1.00 79.35  ? 73  ASP B CG  1 
ATOM 3948  O OD1 . ASP B 1 104 ? -3.175   -6.188  -69.288  1.00 79.35  ? 73  ASP B OD1 1 
ATOM 3949  O OD2 . ASP B 1 104 ? -1.420   -4.876  -69.570  1.00 79.51  ? 73  ASP B OD2 1 
ATOM 3950  N N   . SER B 1 105 ? -6.719   -3.353  -70.988  1.00 76.84  ? 74  SER B N   1 
ATOM 3951  C CA  . SER B 1 105 ? -7.555   -2.657  -71.983  1.00 75.33  ? 74  SER B CA  1 
ATOM 3952  C C   . SER B 1 105 ? -8.634   -1.793  -71.366  1.00 74.49  ? 74  SER B C   1 
ATOM 3953  O O   . SER B 1 105 ? -9.031   -0.785  -71.951  1.00 74.39  ? 74  SER B O   1 
ATOM 3954  C CB  . SER B 1 105 ? -8.240   -3.663  -72.897  1.00 75.30  ? 74  SER B CB  1 
ATOM 3955  O OG  . SER B 1 105 ? -7.314   -4.321  -73.730  1.00 75.24  ? 74  SER B OG  1 
ATOM 3956  N N   . ILE B 1 106 ? -9.147   -2.227  -70.217  1.00 73.35  ? 75  ILE B N   1 
ATOM 3957  C CA  . ILE B 1 106 ? -10.022  -1.395  -69.398  1.00 72.11  ? 75  ILE B CA  1 
ATOM 3958  C C   . ILE B 1 106 ? -9.192   -0.930  -68.209  1.00 71.54  ? 75  ILE B C   1 
ATOM 3959  O O   . ILE B 1 106 ? -8.726   -1.754  -67.412  1.00 71.56  ? 75  ILE B O   1 
ATOM 3960  C CB  . ILE B 1 106 ? -11.280  -2.143  -68.889  1.00 71.93  ? 75  ILE B CB  1 
ATOM 3961  C CG1 . ILE B 1 106 ? -11.813  -3.125  -69.929  1.00 71.76  ? 75  ILE B CG1 1 
ATOM 3962  C CG2 . ILE B 1 106 ? -12.359  -1.157  -68.523  1.00 71.24  ? 75  ILE B CG2 1 
ATOM 3963  C CD1 . ILE B 1 106 ? -12.486  -4.352  -69.322  1.00 71.84  ? 75  ILE B CD1 1 
ATOM 3964  N N   . GLN B 1 107 ? -8.986   0.381   -68.105  1.00 128.43 ? 76  GLN B N   1 
ATOM 3965  C CA  . GLN B 1 107 ? -8.195   0.944   -67.019  1.00 128.24 ? 76  GLN B CA  1 
ATOM 3966  C C   . GLN B 1 107 ? -9.092   1.688   -66.068  1.00 126.36 ? 76  GLN B C   1 
ATOM 3967  O O   . GLN B 1 107 ? -9.844   2.555   -66.492  1.00 124.86 ? 76  GLN B O   1 
ATOM 3968  C CB  . GLN B 1 107 ? -7.170   1.926   -67.544  1.00 128.41 ? 76  GLN B CB  1 
ATOM 3969  C CG  . GLN B 1 107 ? -6.427   1.483   -68.764  1.00 130.43 ? 76  GLN B CG  1 
ATOM 3970  C CD  . GLN B 1 107 ? -5.299   2.427   -69.070  1.00 132.80 ? 76  GLN B CD  1 
ATOM 3971  O OE1 . GLN B 1 107 ? -4.601   2.861   -68.155  1.00 135.07 ? 76  GLN B OE1 1 
ATOM 3972  N NE2 . GLN B 1 107 ? -5.113   2.769   -70.351  1.00 132.73 ? 76  GLN B NE2 1 
ATOM 3973  N N   . PRO B 1 108 ? -9.016   1.365   -64.774  1.00 126.66 ? 77  PRO B N   1 
ATOM 3974  C CA  . PRO B 1 108 ? -9.815   2.108   -63.803  1.00 125.46 ? 77  PRO B CA  1 
ATOM 3975  C C   . PRO B 1 108 ? -9.434   3.588   -63.766  1.00 124.25 ? 77  PRO B C   1 
ATOM 3976  O O   . PRO B 1 108 ? -8.257   3.925   -63.624  1.00 125.12 ? 77  PRO B O   1 
ATOM 3977  C CB  . PRO B 1 108 ? -9.492   1.421   -62.475  1.00 127.36 ? 77  PRO B CB  1 
ATOM 3978  C CG  . PRO B 1 108 ? -8.228   0.636   -62.736  1.00 129.33 ? 77  PRO B CG  1 
ATOM 3979  C CD  . PRO B 1 108 ? -8.292   0.241   -64.163  1.00 128.50 ? 77  PRO B CD  1 
ATOM 3980  N N   . TYR B 1 109 ? -10.447  4.446   -63.905  1.00 122.20 ? 78  TYR B N   1 
ATOM 3981  C CA  . TYR B 1 109 ? -10.311  5.911   -63.965  1.00 120.61 ? 78  TYR B CA  1 
ATOM 3982  C C   . TYR B 1 109 ? -9.501   6.494   -62.832  1.00 122.28 ? 78  TYR B C   1 
ATOM 3983  O O   . TYR B 1 109 ? -8.931   7.552   -62.981  1.00 122.50 ? 78  TYR B O   1 
ATOM 3984  C CB  . TYR B 1 109 ? -11.695  6.564   -63.974  1.00 118.54 ? 78  TYR B CB  1 
ATOM 3985  C CG  . TYR B 1 109 ? -11.742  8.068   -63.820  1.00 114.89 ? 78  TYR B CG  1 
ATOM 3986  C CD1 . TYR B 1 109 ? -11.767  8.894   -64.929  1.00 111.34 ? 78  TYR B CD1 1 
ATOM 3987  C CD2 . TYR B 1 109 ? -11.819  8.657   -62.562  1.00 113.19 ? 78  TYR B CD2 1 
ATOM 3988  C CE1 . TYR B 1 109 ? -11.844  10.269  -64.796  1.00 109.85 ? 78  TYR B CE1 1 
ATOM 3989  C CE2 . TYR B 1 109 ? -11.895  10.031  -62.417  1.00 111.75 ? 78  TYR B CE2 1 
ATOM 3990  C CZ  . TYR B 1 109 ? -11.908  10.837  -63.539  1.00 110.16 ? 78  TYR B CZ  1 
ATOM 3991  O OH  . TYR B 1 109 ? -11.984  12.209  -63.398  1.00 109.16 ? 78  TYR B OH  1 
ATOM 3992  N N   . GLU B 1 110 ? -9.456   5.825   -61.693  1.00 123.85 ? 79  GLU B N   1 
ATOM 3993  C CA  . GLU B 1 110 ? -8.665   6.347   -60.601  1.00 125.85 ? 79  GLU B CA  1 
ATOM 3994  C C   . GLU B 1 110 ? -7.179   6.312   -60.947  1.00 126.50 ? 79  GLU B C   1 
ATOM 3995  O O   . GLU B 1 110 ? -6.435   7.220   -60.557  1.00 127.35 ? 79  GLU B O   1 
ATOM 3996  C CB  . GLU B 1 110 ? -8.989   5.623   -59.297  1.00 127.84 ? 79  GLU B CB  1 
ATOM 3997  C CG  . GLU B 1 110 ? -10.398  5.943   -58.749  1.00 130.31 ? 79  GLU B CG  1 
ATOM 3998  C CD  . GLU B 1 110 ? -10.619  7.439   -58.431  1.00 134.08 ? 79  GLU B CD  1 
ATOM 3999  O OE1 . GLU B 1 110 ? -9.764   8.048   -57.719  1.00 136.44 ? 79  GLU B OE1 1 
ATOM 4000  O OE2 . GLU B 1 110 ? -11.663  7.989   -58.888  1.00 133.92 ? 79  GLU B OE2 1 
ATOM 4001  N N   . LYS B 1 111 ? -6.766   5.292   -61.708  1.00 126.21 ? 80  LYS B N   1 
ATOM 4002  C CA  . LYS B 1 111 ? -5.405   5.224   -62.260  1.00 126.89 ? 80  LYS B CA  1 
ATOM 4003  C C   . LYS B 1 111 ? -5.113   6.518   -63.030  1.00 125.60 ? 80  LYS B C   1 
ATOM 4004  O O   . LYS B 1 111 ? -4.333   7.363   -62.576  1.00 126.18 ? 80  LYS B O   1 
ATOM 4005  C CB  . LYS B 1 111 ? -5.224   3.971   -63.147  1.00 127.18 ? 80  LYS B CB  1 
ATOM 4006  C CG  . LYS B 1 111 ? -3.762   3.576   -63.448  1.00 129.09 ? 80  LYS B CG  1 
ATOM 4007  C CD  . LYS B 1 111 ? -3.650   2.199   -64.111  1.00 128.79 ? 80  LYS B CD  1 
ATOM 4008  N N   . ILE B 1 112 ? -5.794   6.676   -64.162  1.00 123.51 ? 81  ILE B N   1 
ATOM 4009  C CA  . ILE B 1 112 ? -5.702   7.868   -64.992  1.00 122.54 ? 81  ILE B CA  1 
ATOM 4010  C C   . ILE B 1 112 ? -5.881   9.186   -64.223  1.00 122.88 ? 81  ILE B C   1 
ATOM 4011  O O   . ILE B 1 112 ? -5.060   10.078  -64.357  1.00 124.19 ? 81  ILE B O   1 
ATOM 4012  C CB  . ILE B 1 112 ? -6.668   7.788   -66.194  1.00 120.42 ? 81  ILE B CB  1 
ATOM 4013  C CG1 . ILE B 1 112 ? -6.326   6.561   -67.038  1.00 120.77 ? 81  ILE B CG1 1 
ATOM 4014  C CG2 . ILE B 1 112 ? -6.605   9.052   -67.045  1.00 119.21 ? 81  ILE B CG2 1 
ATOM 4015  C CD1 . ILE B 1 112 ? -7.243   6.333   -68.230  1.00 119.26 ? 81  ILE B CD1 1 
ATOM 4016  N N   . LYS B 1 113 ? -6.917   9.314   -63.402  1.00 122.63 ? 82  LYS B N   1 
ATOM 4017  C CA  . LYS B 1 113 ? -7.214   10.608  -62.766  1.00 122.84 ? 82  LYS B CA  1 
ATOM 4018  C C   . LYS B 1 113 ? -6.047   11.122  -61.995  1.00 124.97 ? 82  LYS B C   1 
ATOM 4019  O O   . LYS B 1 113 ? -5.905   12.326  -61.879  1.00 125.42 ? 82  LYS B O   1 
ATOM 4020  C CB  . LYS B 1 113 ? -8.413   10.549  -61.814  1.00 122.64 ? 82  LYS B CB  1 
ATOM 4021  N N   . ALA B 1 114 ? -5.234   10.218  -61.447  1.00 126.80 ? 83  ALA B N   1 
ATOM 4022  C CA  . ALA B 1 114 ? -4.068   10.620  -60.661  1.00 129.31 ? 83  ALA B CA  1 
ATOM 4023  C C   . ALA B 1 114 ? -2.804   10.407  -61.476  1.00 130.48 ? 83  ALA B C   1 
ATOM 4024  O O   . ALA B 1 114 ? -2.214   9.328   -61.461  1.00 131.73 ? 83  ALA B O   1 
ATOM 4025  C CB  . ALA B 1 114 ? -4.014   9.871   -59.333  1.00 130.73 ? 83  ALA B CB  1 
ATOM 4026  N N   . ARG B 1 115 ? -2.409   11.446  -62.206  1.00 130.43 ? 84  ARG B N   1 
ATOM 4027  C CA  . ARG B 1 115 ? -1.295   11.346  -63.146  1.00 131.52 ? 84  ARG B CA  1 
ATOM 4028  C C   . ARG B 1 115 ? -0.543   12.648  -63.497  1.00 132.80 ? 84  ARG B C   1 
ATOM 4029  O O   . ARG B 1 115 ? 0.654    12.597  -63.834  1.00 134.97 ? 84  ARG B O   1 
ATOM 4030  C CB  . ARG B 1 115 ? -1.724   10.618  -64.412  1.00 129.77 ? 84  ARG B CB  1 
ATOM 4031  C CG  . ARG B 1 115 ? -1.257   9.203   -64.412  1.00 130.66 ? 84  ARG B CG  1 
ATOM 4032  C CD  . ARG B 1 115 ? -1.504   8.569   -65.738  1.00 130.94 ? 84  ARG B CD  1 
ATOM 4033  N NE  . ARG B 1 115 ? -0.526   7.518   -65.986  1.00 133.56 ? 84  ARG B NE  1 
ATOM 4034  C CZ  . ARG B 1 115 ? -0.631   6.606   -66.946  1.00 134.11 ? 84  ARG B CZ  1 
ATOM 4035  N NH1 . ARG B 1 115 ? -1.691   6.602   -67.762  1.00 132.33 ? 84  ARG B NH1 1 
ATOM 4036  N NH2 . ARG B 1 115 ? 0.330    5.698   -67.086  1.00 136.10 ? 84  ARG B NH2 1 
ATOM 4037  N N   . GLY B 1 116 ? -1.201   13.805  -63.445  1.00 131.69 ? 85  GLY B N   1 
ATOM 4038  C CA  . GLY B 1 116 ? -2.609   13.933  -63.215  1.00 129.11 ? 85  GLY B CA  1 
ATOM 4039  C C   . GLY B 1 116 ? -3.068   14.736  -64.387  1.00 127.65 ? 85  GLY B C   1 
ATOM 4040  O O   . GLY B 1 116 ? -3.274   14.194  -65.463  1.00 126.25 ? 85  GLY B O   1 
ATOM 4041  N N   . LEU B 1 117 ? -3.185   16.039  -64.182  1.00 128.23 ? 86  LEU B N   1 
ATOM 4042  C CA  . LEU B 1 117 ? -3.805   16.892  -65.175  1.00 127.71 ? 86  LEU B CA  1 
ATOM 4043  C C   . LEU B 1 117 ? -2.775   17.576  -66.048  1.00 129.49 ? 86  LEU B C   1 
ATOM 4044  O O   . LEU B 1 117 ? -1.697   17.893  -65.575  1.00 131.70 ? 86  LEU B O   1 
ATOM 4045  C CB  . LEU B 1 117 ? -4.803   17.874  -64.540  1.00 126.98 ? 86  LEU B CB  1 
ATOM 4046  C CG  . LEU B 1 117 ? -4.557   18.818  -63.367  1.00 128.61 ? 86  LEU B CG  1 
ATOM 4047  C CD1 . LEU B 1 117 ? -5.897   19.492  -63.108  1.00 127.20 ? 86  LEU B CD1 1 
ATOM 4048  C CD2 . LEU B 1 117 ? -4.000   18.159  -62.083  1.00 129.78 ? 86  LEU B CD2 1 
ATOM 4049  N N   . PRO B 1 118 ? -3.099   17.790  -67.331  1.00 129.15 ? 87  PRO B N   1 
ATOM 4050  C CA  . PRO B 1 118 ? -2.144   18.348  -68.276  1.00 131.44 ? 87  PRO B CA  1 
ATOM 4051  C C   . PRO B 1 118 ? -1.607   19.687  -67.781  1.00 134.09 ? 87  PRO B C   1 
ATOM 4052  O O   . PRO B 1 118 ? -2.406   20.543  -67.381  1.00 133.80 ? 87  PRO B O   1 
ATOM 4053  C CB  . PRO B 1 118 ? -2.994   18.547  -69.536  1.00 130.10 ? 87  PRO B CB  1 
ATOM 4054  C CG  . PRO B 1 118 ? -4.408   18.568  -69.060  1.00 127.08 ? 87  PRO B CG  1 
ATOM 4055  C CD  . PRO B 1 118 ? -4.432   17.630  -67.937  1.00 126.82 ? 87  PRO B CD  1 
ATOM 4056  N N   . ASP B 1 119 ? -0.286   19.876  -67.786  1.00 137.09 ? 88  ASP B N   1 
ATOM 4057  C CA  . ASP B 1 119 ? 0.259    21.089  -67.152  1.00 139.96 ? 88  ASP B CA  1 
ATOM 4058  C C   . ASP B 1 119 ? 0.264    22.328  -68.056  1.00 140.82 ? 88  ASP B C   1 
ATOM 4059  O O   . ASP B 1 119 ? 0.150    23.461  -67.564  1.00 141.97 ? 88  ASP B O   1 
ATOM 4060  C CB  . ASP B 1 119 ? 1.618    20.857  -66.451  1.00 142.67 ? 88  ASP B CB  1 
ATOM 4061  C CG  . ASP B 1 119 ? 2.783    20.765  -67.423  1.00 145.22 ? 88  ASP B CG  1 
ATOM 4062  O OD1 . ASP B 1 119 ? 3.623    21.698  -67.454  1.00 147.86 ? 88  ASP B OD1 1 
ATOM 4063  O OD2 . ASP B 1 119 ? 2.859    19.753  -68.152  1.00 146.10 ? 88  ASP B OD2 1 
ATOM 4064  N N   . ASN B 1 120 ? 0.391    22.114  -69.365  1.00 140.77 ? 89  ASN B N   1 
ATOM 4065  C CA  . ASN B 1 120 ? 0.354    23.217  -70.344  1.00 141.47 ? 89  ASN B CA  1 
ATOM 4066  C C   . ASN B 1 120 ? -0.873   22.983  -71.232  1.00 138.64 ? 89  ASN B C   1 
ATOM 4067  O O   . ASN B 1 120 ? -1.188   21.838  -71.559  1.00 136.83 ? 89  ASN B O   1 
ATOM 4068  C CB  . ASN B 1 120 ? 1.659    23.322  -71.223  1.00 144.22 ? 89  ASN B CB  1 
ATOM 4069  C CG  . ASN B 1 120 ? 2.939    23.834  -70.447  1.00 147.02 ? 89  ASN B CG  1 
ATOM 4070  O OD1 . ASN B 1 120 ? 3.017    24.996  -70.018  1.00 148.45 ? 89  ASN B OD1 1 
ATOM 4071  N ND2 . ASN B 1 120 ? 3.955    22.962  -70.340  1.00 147.00 ? 89  ASN B ND2 1 
ATOM 4072  N N   . ILE B 1 121 ? -1.621   24.039  -71.534  1.00 138.15 ? 90  ILE B N   1 
ATOM 4073  C CA  . ILE B 1 121 ? -1.609   25.289  -70.752  1.00 139.35 ? 90  ILE B CA  1 
ATOM 4074  C C   . ILE B 1 121 ? -2.946   25.503  -69.948  1.00 137.55 ? 90  ILE B C   1 
ATOM 4075  O O   . ILE B 1 121 ? -2.900   26.035  -68.817  1.00 138.66 ? 90  ILE B O   1 
ATOM 4076  C CB  . ILE B 1 121 ? -1.243   26.582  -71.594  1.00 141.12 ? 90  ILE B CB  1 
ATOM 4077  C CG1 . ILE B 1 121 ? -0.270   26.277  -72.743  1.00 142.08 ? 90  ILE B CG1 1 
ATOM 4078  C CG2 . ILE B 1 121 ? -0.704   27.702  -70.672  1.00 143.16 ? 90  ILE B CG2 1 
ATOM 4079  C CD1 . ILE B 1 121 ? -0.256   27.354  -73.843  1.00 143.28 ? 90  ILE B CD1 1 
ATOM 4080  N N   . SER B 1 122 ? -4.123   25.093  -70.469  1.00 134.51 ? 91  SER B N   1 
ATOM 4081  C CA  . SER B 1 122 ? -4.341   24.347  -71.726  1.00 132.01 ? 91  SER B CA  1 
ATOM 4082  C C   . SER B 1 122 ? -5.023   25.297  -72.720  1.00 131.47 ? 91  SER B C   1 
ATOM 4083  O O   . SER B 1 122 ? -5.469   26.350  -72.285  1.00 131.33 ? 91  SER B O   1 
ATOM 4084  C CB  . SER B 1 122 ? -5.240   23.136  -71.426  1.00 129.55 ? 91  SER B CB  1 
ATOM 4085  O OG  . SER B 1 122 ? -5.128   22.710  -70.063  1.00 127.79 ? 91  SER B OG  1 
ATOM 4086  N N   . SER B 1 123 ? -5.031   25.063  -74.041  1.00 131.35 ? 92  SER B N   1 
ATOM 4087  C CA  . SER B 1 123 ? -4.021   24.371  -74.914  1.00 132.81 ? 92  SER B CA  1 
ATOM 4088  C C   . SER B 1 123 ? -4.151   22.909  -75.307  1.00 131.31 ? 92  SER B C   1 
ATOM 4089  O O   . SER B 1 123 ? -3.669   22.508  -76.373  1.00 131.79 ? 92  SER B O   1 
ATOM 4090  C CB  . SER B 1 123 ? -2.557   24.686  -74.551  1.00 135.61 ? 92  SER B CB  1 
ATOM 4091  O OG  . SER B 1 123 ? -1.916   25.450  -75.574  1.00 138.12 ? 92  SER B OG  1 
ATOM 4092  N N   . VAL B 1 124 ? -4.752   22.114  -74.435  1.00 129.58 ? 93  VAL B N   1 
ATOM 4093  C CA  . VAL B 1 124 ? -5.062   20.725  -74.751  1.00 128.19 ? 93  VAL B CA  1 
ATOM 4094  C C   . VAL B 1 124 ? -6.506   20.702  -75.194  1.00 126.40 ? 93  VAL B C   1 
ATOM 4095  O O   . VAL B 1 124 ? -6.956   19.759  -75.839  1.00 125.56 ? 93  VAL B O   1 
ATOM 4096  C CB  . VAL B 1 124 ? -4.880   19.809  -73.536  1.00 127.59 ? 93  VAL B CB  1 
ATOM 4097  C CG1 . VAL B 1 124 ? -5.184   18.357  -73.886  1.00 125.88 ? 93  VAL B CG1 1 
ATOM 4098  C CG2 . VAL B 1 124 ? -3.470   19.930  -73.016  1.00 130.38 ? 93  VAL B CG2 1 
ATOM 4099  N N   . LEU B 1 125 ? -7.221   21.769  -74.848  1.00 125.99 ? 94  LEU B N   1 
ATOM 4100  C CA  . LEU B 1 125 ? -8.618   21.939  -75.220  1.00 124.41 ? 94  LEU B CA  1 
ATOM 4101  C C   . LEU B 1 125 ? -8.746   22.386  -76.679  1.00 125.14 ? 94  LEU B C   1 
ATOM 4102  O O   . LEU B 1 125 ? -9.664   21.968  -77.394  1.00 124.33 ? 94  LEU B O   1 
ATOM 4103  C CB  . LEU B 1 125 ? -9.290   22.935  -74.270  1.00 123.99 ? 94  LEU B CB  1 
ATOM 4104  C CG  . LEU B 1 125 ? -9.134   22.567  -72.793  1.00 123.06 ? 94  LEU B CG  1 
ATOM 4105  C CD1 . LEU B 1 125 ? -9.315   23.777  -71.884  1.00 123.47 ? 94  LEU B CD1 1 
ATOM 4106  C CD2 . LEU B 1 125 ? -10.085  21.457  -72.420  1.00 120.36 ? 94  LEU B CD2 1 
ATOM 4107  N N   . ASN B 1 126 ? -7.810   23.217  -77.121  1.00 126.83 ? 95  ASN B N   1 
ATOM 4108  C CA  . ASN B 1 126 ? -7.789   23.677  -78.497  1.00 127.93 ? 95  ASN B CA  1 
ATOM 4109  C C   . ASN B 1 126 ? -7.530   22.560  -79.467  1.00 127.45 ? 95  ASN B C   1 
ATOM 4110  O O   . ASN B 1 126 ? -7.078   22.803  -80.582  1.00 129.28 ? 95  ASN B O   1 
ATOM 4111  C CB  . ASN B 1 126 ? -6.716   24.729  -78.674  1.00 130.65 ? 95  ASN B CB  1 
ATOM 4112  C CG  . ASN B 1 126 ? -6.955   25.915  -77.808  1.00 132.59 ? 95  ASN B CG  1 
ATOM 4113  O OD1 . ASN B 1 126 ? -6.266   26.100  -76.804  1.00 135.67 ? 95  ASN B OD1 1 
ATOM 4114  N ND2 . ASN B 1 126 ? -7.965   26.716  -78.155  1.00 133.42 ? 95  ASN B ND2 1 
ATOM 4115  N N   . LYS B 1 127 ? -7.796   21.334  -79.029  1.00 125.28 ? 96  LYS B N   1 
ATOM 4116  C CA  . LYS B 1 127 ? -7.686   20.145  -79.876  1.00 124.36 ? 96  LYS B CA  1 
ATOM 4117  C C   . LYS B 1 127 ? -8.910   19.241  -79.685  1.00 121.87 ? 96  LYS B C   1 
ATOM 4118  O O   . LYS B 1 127 ? -8.989   18.139  -80.248  1.00 121.75 ? 96  LYS B O   1 
ATOM 4119  C CB  . LYS B 1 127 ? -6.371   19.394  -79.594  1.00 125.29 ? 96  LYS B CB  1 
ATOM 4120  C CG  . LYS B 1 127 ? -5.135   20.165  -80.005  1.00 126.24 ? 96  LYS B CG  1 
ATOM 4121  C CD  . LYS B 1 127 ? -3.872   19.487  -79.606  1.00 125.44 ? 96  LYS B CD  1 
ATOM 4122  C CE  . LYS B 1 127 ? -2.815   20.536  -79.480  1.00 127.15 ? 96  LYS B CE  1 
ATOM 4123  N NZ  . LYS B 1 127 ? -1.474   19.976  -79.685  1.00 129.66 ? 96  LYS B NZ  1 
ATOM 4124  N N   . LEU B 1 128 ? -9.864   19.730  -78.898  1.00 119.57 ? 97  LEU B N   1 
ATOM 4125  C CA  . LEU B 1 128 ? -11.064  18.984  -78.603  1.00 116.99 ? 97  LEU B CA  1 
ATOM 4126  C C   . LEU B 1 128 ? -12.314  19.611  -79.217  1.00 116.34 ? 97  LEU B C   1 
ATOM 4127  O O   . LEU B 1 128 ? -12.469  20.838  -79.240  1.00 116.75 ? 97  LEU B O   1 
ATOM 4128  C CB  . LEU B 1 128 ? -11.234  18.846  -77.095  1.00 115.76 ? 97  LEU B CB  1 
ATOM 4129  C CG  . LEU B 1 128 ? -12.489  18.083  -76.675  1.00 113.85 ? 97  LEU B CG  1 
ATOM 4130  C CD1 . LEU B 1 128 ? -12.362  16.614  -77.015  1.00 113.99 ? 97  LEU B CD1 1 
ATOM 4131  C CD2 . LEU B 1 128 ? -12.776  18.257  -75.219  1.00 112.15 ? 97  LEU B CD2 1 
ATOM 4132  N N   . VAL B 1 129 ? -13.191  18.743  -79.721  1.00 115.28 ? 98  VAL B N   1 
ATOM 4133  C CA  . VAL B 1 129 ? -14.538  19.117  -80.143  1.00 114.48 ? 98  VAL B CA  1 
ATOM 4134  C C   . VAL B 1 129 ? -15.603  18.383  -79.291  1.00 113.02 ? 98  VAL B C   1 
ATOM 4135  O O   . VAL B 1 129 ? -15.588  17.145  -79.181  1.00 112.66 ? 98  VAL B O   1 
ATOM 4136  C CB  . VAL B 1 129 ? -14.752  18.835  -81.631  1.00 115.22 ? 98  VAL B CB  1 
ATOM 4137  C CG1 . VAL B 1 129 ? -16.197  19.088  -82.004  1.00 114.96 ? 98  VAL B CG1 1 
ATOM 4138  C CG2 . VAL B 1 129 ? -13.829  19.708  -82.468  1.00 116.59 ? 98  VAL B CG2 1 
ATOM 4139  N N   . VAL B 1 130 ? -16.502  19.155  -78.673  1.00 112.04 ? 99  VAL B N   1 
ATOM 4140  C CA  . VAL B 1 130 ? -17.582  18.607  -77.862  1.00 110.29 ? 99  VAL B CA  1 
ATOM 4141  C C   . VAL B 1 130 ? -18.791  18.453  -78.772  1.00 110.57 ? 99  VAL B C   1 
ATOM 4142  O O   . VAL B 1 130 ? -19.351  19.445  -79.256  1.00 111.07 ? 99  VAL B O   1 
ATOM 4143  C CB  . VAL B 1 130 ? -17.903  19.518  -76.669  1.00 109.73 ? 99  VAL B CB  1 
ATOM 4144  C CG1 . VAL B 1 130 ? -19.061  19.007  -75.895  1.00 108.56 ? 99  VAL B CG1 1 
ATOM 4145  C CG2 . VAL B 1 130 ? -16.740  19.576  -75.761  1.00 109.74 ? 99  VAL B CG2 1 
ATOM 4146  N N   . VAL B 1 131 ? -19.156  17.198  -79.033  1.00 110.35 ? 100 VAL B N   1 
ATOM 4147  C CA  . VAL B 1 131 ? -20.302  16.866  -79.879  1.00 110.55 ? 100 VAL B CA  1 
ATOM 4148  C C   . VAL B 1 131 ? -21.390  16.185  -79.058  1.00 109.99 ? 100 VAL B C   1 
ATOM 4149  O O   . VAL B 1 131 ? -21.151  15.172  -78.393  1.00 109.62 ? 100 VAL B O   1 
ATOM 4150  C CB  . VAL B 1 131 ? -19.898  16.017  -81.104  1.00 111.13 ? 100 VAL B CB  1 
ATOM 4151  C CG1 . VAL B 1 131 ? -21.097  15.374  -81.735  1.00 111.54 ? 100 VAL B CG1 1 
ATOM 4152  C CG2 . VAL B 1 131 ? -19.227  16.888  -82.130  1.00 112.52 ? 100 VAL B CG2 1 
ATOM 4153  N N   . LYS B 1 132 ? -22.581  16.775  -79.115  1.00 110.28 ? 101 LYS B N   1 
ATOM 4154  C CA  . LYS B 1 132 ? -23.738  16.337  -78.359  1.00 109.92 ? 101 LYS B CA  1 
ATOM 4155  C C   . LYS B 1 132 ? -24.782  15.735  -79.301  1.00 110.96 ? 101 LYS B C   1 
ATOM 4156  O O   . LYS B 1 132 ? -25.259  16.412  -80.214  1.00 111.84 ? 101 LYS B O   1 
ATOM 4157  C CB  . LYS B 1 132 ? -24.322  17.544  -77.624  1.00 109.83 ? 101 LYS B CB  1 
ATOM 4158  C CG  . LYS B 1 132 ? -23.474  18.088  -76.484  1.00 108.60 ? 101 LYS B CG  1 
ATOM 4159  C CD  . LYS B 1 132 ? -23.189  16.997  -75.469  1.00 107.70 ? 101 LYS B CD  1 
ATOM 4160  C CE  . LYS B 1 132 ? -23.163  17.517  -74.056  1.00 107.25 ? 101 LYS B CE  1 
ATOM 4161  N NZ  . LYS B 1 132 ? -22.813  16.412  -73.143  1.00 107.78 ? 101 LYS B NZ  1 
ATOM 4162  N N   . LEU B 1 133 ? -25.133  14.471  -79.096  1.00 111.18 ? 102 LEU B N   1 
ATOM 4163  C CA  . LEU B 1 133 ? -26.109  13.833  -79.966  1.00 112.89 ? 102 LEU B CA  1 
ATOM 4164  C C   . LEU B 1 133 ? -27.498  14.331  -79.640  1.00 113.91 ? 102 LEU B C   1 
ATOM 4165  O O   . LEU B 1 133 ? -27.996  14.075  -78.557  1.00 114.08 ? 102 LEU B O   1 
ATOM 4166  C CB  . LEU B 1 133 ? -26.086  12.327  -79.777  1.00 112.90 ? 102 LEU B CB  1 
ATOM 4167  C CG  . LEU B 1 133 ? -24.763  11.565  -79.790  1.00 113.03 ? 102 LEU B CG  1 
ATOM 4168  C CD1 . LEU B 1 133 ? -24.967  10.111  -79.313  1.00 113.28 ? 102 LEU B CD1 1 
ATOM 4169  C CD2 . LEU B 1 133 ? -24.146  11.601  -81.182  1.00 114.05 ? 102 LEU B CD2 1 
ATOM 4170  N N   . ASN B 1 134 ? -28.131  15.027  -80.576  1.00 115.85 ? 103 ASN B N   1 
ATOM 4171  C CA  . ASN B 1 134 ? -29.423  15.690  -80.328  1.00 117.31 ? 103 ASN B CA  1 
ATOM 4172  C C   . ASN B 1 134 ? -30.602  15.114  -81.114  1.00 119.19 ? 103 ASN B C   1 
ATOM 4173  O O   . ASN B 1 134 ? -31.729  15.583  -80.968  1.00 120.05 ? 103 ASN B O   1 
ATOM 4174  C CB  . ASN B 1 134 ? -29.304  17.203  -80.584  1.00 117.74 ? 103 ASN B CB  1 
ATOM 4175  C CG  . ASN B 1 134 ? -30.516  17.983  -80.112  1.00 118.46 ? 103 ASN B CG  1 
ATOM 4176  O OD1 . ASN B 1 134 ? -31.192  17.590  -79.168  1.00 118.95 ? 103 ASN B OD1 1 
ATOM 4177  N ND2 . ASN B 1 134 ? -30.793  19.095  -80.773  1.00 119.63 ? 103 ASN B ND2 1 
ATOM 4178  N N   . GLY B 1 135 ? -30.350  14.102  -81.941  1.00 120.48 ? 104 GLY B N   1 
ATOM 4179  C CA  . GLY B 1 135 ? -31.421  13.470  -82.717  1.00 123.23 ? 104 GLY B CA  1 
ATOM 4180  C C   . GLY B 1 135 ? -32.332  12.641  -81.821  1.00 124.16 ? 104 GLY B C   1 
ATOM 4181  O O   . GLY B 1 135 ? -31.946  11.553  -81.372  1.00 124.45 ? 104 GLY B O   1 
ATOM 4182  N N   . GLY B 1 136 ? -33.531  13.144  -81.534  1.00 125.00 ? 105 GLY B N   1 
ATOM 4183  C CA  . GLY B 1 136 ? -34.403  12.450  -80.596  1.00 125.14 ? 105 GLY B CA  1 
ATOM 4184  C C   . GLY B 1 136 ? -35.327  13.392  -79.865  1.00 125.63 ? 105 GLY B C   1 
ATOM 4185  O O   . GLY B 1 136 ? -34.897  14.446  -79.380  1.00 125.01 ? 105 GLY B O   1 
ATOM 4186  N N   . LEU B 1 137 ? -36.593  12.982  -79.778  1.00 126.88 ? 106 LEU B N   1 
ATOM 4187  C CA  . LEU B 1 137 ? -37.681  13.814  -79.292  1.00 127.73 ? 106 LEU B CA  1 
ATOM 4188  C C   . LEU B 1 137 ? -38.046  13.544  -77.847  1.00 127.90 ? 106 LEU B C   1 
ATOM 4189  O O   . LEU B 1 137 ? -37.693  12.503  -77.281  1.00 127.68 ? 106 LEU B O   1 
ATOM 4190  C CB  . LEU B 1 137 ? -38.902  13.569  -80.153  1.00 129.49 ? 106 LEU B CB  1 
ATOM 4191  C CG  . LEU B 1 137 ? -38.701  14.030  -81.580  1.00 129.90 ? 106 LEU B CG  1 
ATOM 4192  C CD1 . LEU B 1 137 ? -39.758  13.418  -82.461  1.00 131.88 ? 106 LEU B CD1 1 
ATOM 4193  C CD2 . LEU B 1 137 ? -38.718  15.557  -81.629  1.00 129.89 ? 106 LEU B CD2 1 
ATOM 4194  N N   . GLY B 1 138 ? -38.768  14.486  -77.249  1.00 128.88 ? 107 GLY B N   1 
ATOM 4195  C CA  . GLY B 1 138 ? -39.318  14.290  -75.912  1.00 129.35 ? 107 GLY B CA  1 
ATOM 4196  C C   . GLY B 1 138 ? -40.776  13.865  -75.935  1.00 131.55 ? 107 GLY B C   1 
ATOM 4197  O O   . GLY B 1 138 ? -41.585  14.387  -75.189  1.00 132.86 ? 107 GLY B O   1 
ATOM 4198  N N   . THR B 1 139 ? -41.121  12.926  -76.804  1.00 132.45 ? 108 THR B N   1 
ATOM 4199  C CA  . THR B 1 139 ? -42.467  12.371  -76.821  1.00 134.65 ? 108 THR B CA  1 
ATOM 4200  C C   . THR B 1 139 ? -42.495  11.245  -75.786  1.00 134.97 ? 108 THR B C   1 
ATOM 4201  O O   . THR B 1 139 ? -43.478  11.034  -75.082  1.00 136.65 ? 108 THR B O   1 
ATOM 4202  C CB  . THR B 1 139 ? -42.860  11.890  -78.230  1.00 135.81 ? 108 THR B CB  1 
ATOM 4203  O OG1 . THR B 1 139 ? -42.033  10.781  -78.620  1.00 134.37 ? 108 THR B OG1 1 
ATOM 4204  C CG2 . THR B 1 139 ? -42.721  13.043  -79.243  1.00 135.14 ? 108 THR B CG2 1 
ATOM 4205  N N   . SER B 1 140 ? -41.374  10.547  -75.708  1.00 133.65 ? 109 SER B N   1 
ATOM 4206  C CA  . SER B 1 140 ? -41.004  9.674   -74.612  1.00 133.62 ? 109 SER B CA  1 
ATOM 4207  C C   . SER B 1 140 ? -41.448  10.126  -73.194  1.00 134.01 ? 109 SER B C   1 
ATOM 4208  O O   . SER B 1 140 ? -41.893  9.302   -72.409  1.00 134.62 ? 109 SER B O   1 
ATOM 4209  C CB  . SER B 1 140 ? -39.479  9.530   -74.682  1.00 131.67 ? 109 SER B CB  1 
ATOM 4210  O OG  . SER B 1 140 ? -38.959  8.753   -73.624  1.00 132.68 ? 109 SER B OG  1 
ATOM 4211  N N   . MET B 1 141 ? -41.294  11.414  -72.865  1.00 133.94 ? 110 MET B N   1 
ATOM 4212  C CA  . MET B 1 141 ? -41.743  11.986  -71.568  1.00 135.00 ? 110 MET B CA  1 
ATOM 4213  C C   . MET B 1 141 ? -42.969  12.901  -71.725  1.00 136.96 ? 110 MET B C   1 
ATOM 4214  O O   . MET B 1 141 ? -43.369  13.556  -70.765  1.00 137.80 ? 110 MET B O   1 
ATOM 4215  C CB  . MET B 1 141 ? -40.643  12.810  -70.837  1.00 133.57 ? 110 MET B CB  1 
ATOM 4216  C CG  . MET B 1 141 ? -39.154  12.363  -70.959  1.00 132.49 ? 110 MET B CG  1 
ATOM 4217  S SD  . MET B 1 141 ? -37.978  12.948  -69.667  1.00 131.46 ? 110 MET B SD  1 
ATOM 4218  C CE  . MET B 1 141 ? -38.282  14.703  -69.600  1.00 131.54 ? 110 MET B CE  1 
ATOM 4219  N N   . GLY B 1 142 ? -43.541  12.966  -72.929  1.00 137.97 ? 111 GLY B N   1 
ATOM 4220  C CA  . GLY B 1 142 ? -44.698  13.825  -73.212  1.00 140.23 ? 111 GLY B CA  1 
ATOM 4221  C C   . GLY B 1 142 ? -44.361  15.287  -73.469  1.00 139.90 ? 111 GLY B C   1 
ATOM 4222  O O   . GLY B 1 142 ? -44.641  16.152  -72.638  1.00 140.58 ? 111 GLY B O   1 
ATOM 4223  N N   . CYS B 1 143 ? -43.765  15.562  -74.628  1.00 139.19 ? 112 CYS B N   1 
ATOM 4224  C CA  . CYS B 1 143 ? -43.390  16.923  -75.030  1.00 139.16 ? 112 CYS B CA  1 
ATOM 4225  C C   . CYS B 1 143 ? -43.434  17.132  -76.525  1.00 139.48 ? 112 CYS B C   1 
ATOM 4226  O O   . CYS B 1 143 ? -42.919  16.316  -77.302  1.00 138.60 ? 112 CYS B O   1 
ATOM 4227  C CB  . CYS B 1 143 ? -41.982  17.274  -74.564  1.00 136.87 ? 112 CYS B CB  1 
ATOM 4228  S SG  . CYS B 1 143 ? -41.947  18.318  -73.131  1.00 138.98 ? 112 CYS B SG  1 
ATOM 4229  N N   . LYS B 1 144 ? -44.044  18.245  -76.918  1.00 140.95 ? 113 LYS B N   1 
ATOM 4230  C CA  . LYS B 1 144 ? -43.952  18.722  -78.284  1.00 141.28 ? 113 LYS B CA  1 
ATOM 4231  C C   . LYS B 1 144 ? -42.522  19.251  -78.473  1.00 138.89 ? 113 LYS B C   1 
ATOM 4232  O O   . LYS B 1 144 ? -42.098  20.189  -77.786  1.00 138.71 ? 113 LYS B O   1 
ATOM 4233  C CB  . LYS B 1 144 ? -45.006  19.809  -78.553  1.00 143.65 ? 113 LYS B CB  1 
ATOM 4234  N N   . GLY B 1 145 ? -41.763  18.611  -79.361  1.00 137.27 ? 114 GLY B N   1 
ATOM 4235  C CA  . GLY B 1 145 ? -40.392  19.039  -79.645  1.00 134.54 ? 114 GLY B CA  1 
ATOM 4236  C C   . GLY B 1 145 ? -39.268  18.247  -78.988  1.00 131.59 ? 114 GLY B C   1 
ATOM 4237  O O   . GLY B 1 145 ? -39.516  17.316  -78.226  1.00 131.28 ? 114 GLY B O   1 
ATOM 4238  N N   . PRO B 1 146 ? -38.013  18.644  -79.264  1.00 129.66 ? 115 PRO B N   1 
ATOM 4239  C CA  . PRO B 1 146 ? -36.781  17.960  -78.880  1.00 127.19 ? 115 PRO B CA  1 
ATOM 4240  C C   . PRO B 1 146 ? -36.610  17.855  -77.379  1.00 125.74 ? 115 PRO B C   1 
ATOM 4241  O O   . PRO B 1 146 ? -36.765  18.847  -76.660  1.00 126.18 ? 115 PRO B O   1 
ATOM 4242  C CB  . PRO B 1 146 ? -35.671  18.873  -79.419  1.00 126.39 ? 115 PRO B CB  1 
ATOM 4243  C CG  . PRO B 1 146 ? -36.330  19.857  -80.267  1.00 128.50 ? 115 PRO B CG  1 
ATOM 4244  C CD  . PRO B 1 146 ? -37.732  19.980  -79.804  1.00 130.27 ? 115 PRO B CD  1 
ATOM 4245  N N   . LYS B 1 147 ? -36.261  16.653  -76.929  1.00 123.94 ? 116 LYS B N   1 
ATOM 4246  C CA  . LYS B 1 147 ? -35.989  16.362  -75.537  1.00 122.07 ? 116 LYS B CA  1 
ATOM 4247  C C   . LYS B 1 147 ? -35.109  17.433  -74.951  1.00 120.63 ? 116 LYS B C   1 
ATOM 4248  O O   . LYS B 1 147 ? -35.258  17.825  -73.804  1.00 120.56 ? 116 LYS B O   1 
ATOM 4249  C CB  . LYS B 1 147 ? -35.268  15.039  -75.469  1.00 120.97 ? 116 LYS B CB  1 
ATOM 4250  C CG  . LYS B 1 147 ? -35.123  14.499  -74.110  1.00 120.79 ? 116 LYS B CG  1 
ATOM 4251  C CD  . LYS B 1 147 ? -34.873  13.039  -74.226  1.00 121.94 ? 116 LYS B CD  1 
ATOM 4252  C CE  . LYS B 1 147 ? -34.460  12.495  -72.901  1.00 123.49 ? 116 LYS B CE  1 
ATOM 4253  N NZ  . LYS B 1 147 ? -34.266  11.030  -72.997  1.00 125.42 ? 116 LYS B NZ  1 
ATOM 4254  N N   . SER B 1 148 ? -34.207  17.917  -75.785  1.00 119.59 ? 117 SER B N   1 
ATOM 4255  C CA  . SER B 1 148 ? -33.192  18.870  -75.394  1.00 118.69 ? 117 SER B CA  1 
ATOM 4256  C C   . SER B 1 148 ? -33.740  20.264  -75.113  1.00 119.28 ? 117 SER B C   1 
ATOM 4257  O O   . SER B 1 148 ? -33.000  21.243  -75.220  1.00 119.31 ? 117 SER B O   1 
ATOM 4258  C CB  . SER B 1 148 ? -32.140  18.960  -76.505  1.00 118.31 ? 117 SER B CB  1 
ATOM 4259  O OG  . SER B 1 148 ? -31.457  17.724  -76.640  1.00 117.81 ? 117 SER B OG  1 
ATOM 4260  N N   . LEU B 1 149 ? -35.019  20.371  -74.773  1.00 119.73 ? 118 LEU B N   1 
ATOM 4261  C CA  . LEU B 1 149 ? -35.569  21.677  -74.438  1.00 120.57 ? 118 LEU B CA  1 
ATOM 4262  C C   . LEU B 1 149 ? -36.424  21.631  -73.188  1.00 121.37 ? 118 LEU B C   1 
ATOM 4263  O O   . LEU B 1 149 ? -36.901  22.662  -72.705  1.00 122.52 ? 118 LEU B O   1 
ATOM 4264  C CB  . LEU B 1 149 ? -36.328  22.277  -75.617  1.00 121.82 ? 118 LEU B CB  1 
ATOM 4265  C CG  . LEU B 1 149 ? -35.508  22.573  -76.874  1.00 121.32 ? 118 LEU B CG  1 
ATOM 4266  C CD1 . LEU B 1 149 ? -36.449  22.889  -78.012  1.00 123.84 ? 118 LEU B CD1 1 
ATOM 4267  C CD2 . LEU B 1 149 ? -34.491  23.701  -76.685  1.00 120.21 ? 118 LEU B CD2 1 
ATOM 4268  N N   . ILE B 1 150 ? -36.604  20.420  -72.673  1.00 120.92 ? 119 ILE B N   1 
ATOM 4269  C CA  . ILE B 1 150 ? -37.277  20.185  -71.408  1.00 121.82 ? 119 ILE B CA  1 
ATOM 4270  C C   . ILE B 1 150 ? -36.544  20.945  -70.304  1.00 122.32 ? 119 ILE B C   1 
ATOM 4271  O O   . ILE B 1 150 ? -35.310  20.946  -70.260  1.00 121.27 ? 119 ILE B O   1 
ATOM 4272  C CB  . ILE B 1 150 ? -37.316  18.686  -71.117  1.00 120.77 ? 119 ILE B CB  1 
ATOM 4273  C CG1 . ILE B 1 150 ? -38.383  18.048  -72.002  1.00 121.51 ? 119 ILE B CG1 1 
ATOM 4274  C CG2 . ILE B 1 150 ? -37.566  18.421  -69.635  1.00 120.50 ? 119 ILE B CG2 1 
ATOM 4275  C CD1 . ILE B 1 150 ? -38.100  16.635  -72.407  1.00 120.87 ? 119 ILE B CD1 1 
ATOM 4276  N N   . GLY B 1 151 ? -37.290  21.618  -69.431  1.00 124.46 ? 120 GLY B N   1 
ATOM 4277  C CA  . GLY B 1 151 ? -36.659  22.415  -68.379  1.00 124.93 ? 120 GLY B CA  1 
ATOM 4278  C C   . GLY B 1 151 ? -36.230  21.579  -67.189  1.00 124.58 ? 120 GLY B C   1 
ATOM 4279  O O   . GLY B 1 151 ? -37.084  21.177  -66.376  1.00 126.05 ? 120 GLY B O   1 
ATOM 4280  N N   . VAL B 1 152 ? -34.923  21.306  -67.076  1.00 122.89 ? 121 VAL B N   1 
ATOM 4281  C CA  . VAL B 1 152 ? -34.432  20.549  -65.917  1.00 122.66 ? 121 VAL B CA  1 
ATOM 4282  C C   . VAL B 1 152 ? -34.499  21.424  -64.672  1.00 124.85 ? 121 VAL B C   1 
ATOM 4283  O O   . VAL B 1 152 ? -35.426  21.286  -63.881  1.00 127.06 ? 121 VAL B O   1 
ATOM 4284  C CB  . VAL B 1 152 ? -33.015  19.924  -66.060  1.00 120.47 ? 121 VAL B CB  1 
ATOM 4285  C CG1 . VAL B 1 152 ? -32.692  19.124  -64.818  1.00 119.56 ? 121 VAL B CG1 1 
ATOM 4286  C CG2 . VAL B 1 152 ? -32.905  19.036  -67.277  1.00 118.26 ? 121 VAL B CG2 1 
ATOM 4287  N N   . ARG B 1 153 ? -33.567  22.352  -64.505  1.00 124.96 ? 122 ARG B N   1 
ATOM 4288  C CA  . ARG B 1 153 ? -33.533  23.077  -63.254  1.00 126.86 ? 122 ARG B CA  1 
ATOM 4289  C C   . ARG B 1 153 ? -33.480  24.591  -63.388  1.00 128.33 ? 122 ARG B C   1 
ATOM 4290  O O   . ARG B 1 153 ? -32.547  25.142  -63.975  1.00 127.50 ? 122 ARG B O   1 
ATOM 4291  C CB  . ARG B 1 153 ? -32.388  22.550  -62.386  1.00 126.00 ? 122 ARG B CB  1 
ATOM 4292  C CG  . ARG B 1 153 ? -32.507  22.989  -60.947  1.00 128.22 ? 122 ARG B CG  1 
ATOM 4293  C CD  . ARG B 1 153 ? -31.207  22.876  -60.184  1.00 127.01 ? 122 ARG B CD  1 
ATOM 4294  N NE  . ARG B 1 153 ? -31.042  21.543  -59.624  1.00 126.00 ? 122 ARG B NE  1 
ATOM 4295  C CZ  . ARG B 1 153 ? -30.567  21.294  -58.407  1.00 126.58 ? 122 ARG B CZ  1 
ATOM 4296  N NH1 . ARG B 1 153 ? -30.211  22.289  -57.599  1.00 127.46 ? 122 ARG B NH1 1 
ATOM 4297  N NH2 . ARG B 1 153 ? -30.459  20.042  -57.992  1.00 126.29 ? 122 ARG B NH2 1 
ATOM 4298  N N   . ASN B 1 154 ? -34.504  25.256  -62.854  1.00 131.07 ? 123 ASN B N   1 
ATOM 4299  C CA  . ASN B 1 154 ? -34.464  26.712  -62.606  1.00 133.65 ? 123 ASN B CA  1 
ATOM 4300  C C   . ASN B 1 154 ? -34.750  27.755  -63.734  1.00 134.34 ? 123 ASN B C   1 
ATOM 4301  O O   . ASN B 1 154 ? -34.383  28.914  -63.571  1.00 135.79 ? 123 ASN B O   1 
ATOM 4302  C CB  . ASN B 1 154 ? -33.150  27.095  -61.881  1.00 133.70 ? 123 ASN B CB  1 
ATOM 4303  C CG  . ASN B 1 154 ? -33.328  27.287  -60.373  1.00 136.78 ? 123 ASN B CG  1 
ATOM 4304  O OD1 . ASN B 1 154 ? -34.140  28.109  -59.930  1.00 139.69 ? 123 ASN B OD1 1 
ATOM 4305  N ND2 . ASN B 1 154 ? -32.536  26.550  -59.577  1.00 137.33 ? 123 ASN B ND2 1 
ATOM 4306  N N   . GLU B 1 155 ? -35.361  27.406  -64.864  1.00 133.77 ? 124 GLU B N   1 
ATOM 4307  C CA  . GLU B 1 155 ? -35.550  26.061  -65.326  1.00 132.51 ? 124 GLU B CA  1 
ATOM 4308  C C   . GLU B 1 155 ? -34.737  26.126  -66.609  1.00 130.22 ? 124 GLU B C   1 
ATOM 4309  O O   . GLU B 1 155 ? -35.247  26.479  -67.668  1.00 130.63 ? 124 GLU B O   1 
ATOM 4310  C CB  . GLU B 1 155 ? -37.043  25.763  -65.574  1.00 134.36 ? 124 GLU B CB  1 
ATOM 4311  C CG  . GLU B 1 155 ? -37.546  24.365  -65.078  1.00 136.16 ? 124 GLU B CG  1 
ATOM 4312  C CD  . GLU B 1 155 ? -38.942  23.950  -65.640  1.00 140.02 ? 124 GLU B CD  1 
ATOM 4313  O OE1 . GLU B 1 155 ? -39.072  23.657  -66.867  1.00 139.25 ? 124 GLU B OE1 1 
ATOM 4314  O OE2 . GLU B 1 155 ? -39.913  23.902  -64.839  1.00 142.77 ? 124 GLU B OE2 1 
ATOM 4315  N N   . ASN B 1 156 ? -33.440  25.865  -66.482  1.00 128.14 ? 125 ASN B N   1 
ATOM 4316  C CA  . ASN B 1 156 ? -32.531  25.805  -67.625  1.00 125.72 ? 125 ASN B CA  1 
ATOM 4317  C C   . ASN B 1 156 ? -32.763  24.506  -68.375  1.00 123.91 ? 125 ASN B C   1 
ATOM 4318  O O   . ASN B 1 156 ? -33.145  23.502  -67.771  1.00 123.72 ? 125 ASN B O   1 
ATOM 4319  C CB  . ASN B 1 156 ? -31.078  25.866  -67.159  1.00 124.70 ? 125 ASN B CB  1 
ATOM 4320  C CG  . ASN B 1 156 ? -30.764  27.118  -66.370  1.00 125.54 ? 125 ASN B CG  1 
ATOM 4321  O OD1 . ASN B 1 156 ? -31.590  27.617  -65.604  1.00 126.45 ? 125 ASN B OD1 1 
ATOM 4322  N ND2 . ASN B 1 156 ? -29.551  27.625  -66.546  1.00 125.11 ? 125 ASN B ND2 1 
ATOM 4323  N N   . THR B 1 157 ? -32.555  24.518  -69.686  1.00 122.52 ? 126 THR B N   1 
ATOM 4324  C CA  . THR B 1 157 ? -32.788  23.309  -70.456  1.00 120.92 ? 126 THR B CA  1 
ATOM 4325  C C   . THR B 1 157 ? -31.579  22.429  -70.455  1.00 118.53 ? 126 THR B C   1 
ATOM 4326  O O   . THR B 1 157 ? -30.524  22.822  -69.992  1.00 117.79 ? 126 THR B O   1 
ATOM 4327  C CB  . THR B 1 157 ? -33.174  23.562  -71.926  1.00 121.41 ? 126 THR B CB  1 
ATOM 4328  O OG1 . THR B 1 157 ? -33.093  22.317  -72.633  1.00 120.92 ? 126 THR B OG1 1 
ATOM 4329  C CG2 . THR B 1 157 ? -32.234  24.546  -72.598  1.00 121.06 ? 126 THR B CG2 1 
ATOM 4330  N N   . PHE B 1 158 ? -31.762  21.232  -70.989  1.00 117.32 ? 127 PHE B N   1 
ATOM 4331  C CA  . PHE B 1 158 ? -30.669  20.358  -71.345  1.00 115.89 ? 127 PHE B CA  1 
ATOM 4332  C C   . PHE B 1 158 ? -29.582  21.061  -72.149  1.00 115.54 ? 127 PHE B C   1 
ATOM 4333  O O   . PHE B 1 158 ? -28.383  20.826  -71.909  1.00 114.80 ? 127 PHE B O   1 
ATOM 4334  C CB  . PHE B 1 158 ? -31.203  19.184  -72.144  1.00 115.54 ? 127 PHE B CB  1 
ATOM 4335  C CG  . PHE B 1 158 ? -31.801  18.124  -71.301  1.00 115.11 ? 127 PHE B CG  1 
ATOM 4336  C CD1 . PHE B 1 158 ? -31.116  16.949  -71.064  1.00 114.02 ? 127 PHE B CD1 1 
ATOM 4337  C CD2 . PHE B 1 158 ? -33.039  18.301  -70.732  1.00 115.76 ? 127 PHE B CD2 1 
ATOM 4338  C CE1 . PHE B 1 158 ? -31.662  15.964  -70.283  1.00 114.56 ? 127 PHE B CE1 1 
ATOM 4339  C CE2 . PHE B 1 158 ? -33.590  17.323  -69.961  1.00 116.25 ? 127 PHE B CE2 1 
ATOM 4340  C CZ  . PHE B 1 158 ? -32.901  16.153  -69.726  1.00 115.50 ? 127 PHE B CZ  1 
ATOM 4341  N N   . LEU B 1 159 ? -30.003  21.909  -73.095  1.00 116.10 ? 128 LEU B N   1 
ATOM 4342  C CA  . LEU B 1 159 ? -29.078  22.691  -73.912  1.00 115.60 ? 128 LEU B CA  1 
ATOM 4343  C C   . LEU B 1 159 ? -28.357  23.740  -73.090  1.00 116.21 ? 128 LEU B C   1 
ATOM 4344  O O   . LEU B 1 159 ? -27.123  23.806  -73.109  1.00 115.57 ? 128 LEU B O   1 
ATOM 4345  C CB  . LEU B 1 159 ? -29.783  23.362  -75.082  1.00 116.26 ? 128 LEU B CB  1 
ATOM 4346  C CG  . LEU B 1 159 ? -28.758  23.656  -76.172  1.00 115.18 ? 128 LEU B CG  1 
ATOM 4347  C CD1 . LEU B 1 159 ? -28.269  22.344  -76.710  1.00 114.60 ? 128 LEU B CD1 1 
ATOM 4348  C CD2 . LEU B 1 159 ? -29.275  24.510  -77.304  1.00 115.19 ? 128 LEU B CD2 1 
ATOM 4349  N N   . ASP B 1 160 ? -29.126  24.550  -72.362  1.00 117.72 ? 129 ASP B N   1 
ATOM 4350  C CA  . ASP B 1 160 ? -28.561  25.585  -71.488  1.00 118.96 ? 129 ASP B CA  1 
ATOM 4351  C C   . ASP B 1 160 ? -27.512  25.023  -70.555  1.00 117.65 ? 129 ASP B C   1 
ATOM 4352  O O   . ASP B 1 160 ? -26.578  25.714  -70.198  1.00 118.02 ? 129 ASP B O   1 
ATOM 4353  C CB  . ASP B 1 160 ? -29.632  26.240  -70.620  1.00 121.05 ? 129 ASP B CB  1 
ATOM 4354  C CG  . ASP B 1 160 ? -30.666  26.987  -71.423  1.00 124.54 ? 129 ASP B CG  1 
ATOM 4355  O OD1 . ASP B 1 160 ? -30.444  27.205  -72.635  1.00 126.52 ? 129 ASP B OD1 1 
ATOM 4356  O OD2 . ASP B 1 160 ? -31.716  27.350  -70.831  1.00 128.68 ? 129 ASP B OD2 1 
ATOM 4357  N N   . LEU B 1 161 ? -27.687  23.773  -70.143  1.00 116.31 ? 130 LEU B N   1 
ATOM 4358  C CA  . LEU B 1 161 ? -26.770  23.168  -69.208  1.00 115.06 ? 130 LEU B CA  1 
ATOM 4359  C C   . LEU B 1 161 ? -25.478  22.885  -69.908  1.00 114.00 ? 130 LEU B C   1 
ATOM 4360  O O   . LEU B 1 161 ? -24.410  23.160  -69.365  1.00 114.19 ? 130 LEU B O   1 
ATOM 4361  C CB  . LEU B 1 161 ? -27.351  21.899  -68.590  1.00 114.44 ? 130 LEU B CB  1 
ATOM 4362  C CG  . LEU B 1 161 ? -28.382  22.197  -67.495  1.00 115.15 ? 130 LEU B CG  1 
ATOM 4363  C CD1 . LEU B 1 161 ? -28.466  21.020  -66.582  1.00 114.47 ? 130 LEU B CD1 1 
ATOM 4364  C CD2 . LEU B 1 161 ? -28.055  23.458  -66.685  1.00 115.95 ? 130 LEU B CD2 1 
ATOM 4365  N N   . THR B 1 162 ? -25.577  22.365  -71.126  1.00 113.05 ? 131 THR B N   1 
ATOM 4366  C CA  . THR B 1 162 ? -24.390  22.062  -71.896  1.00 112.12 ? 131 THR B CA  1 
ATOM 4367  C C   . THR B 1 162 ? -23.668  23.344  -72.247  1.00 112.47 ? 131 THR B C   1 
ATOM 4368  O O   . THR B 1 162 ? -22.470  23.426  -72.050  1.00 112.57 ? 131 THR B O   1 
ATOM 4369  C CB  . THR B 1 162 ? -24.694  21.199  -73.126  1.00 111.75 ? 131 THR B CB  1 
ATOM 4370  O OG1 . THR B 1 162 ? -24.986  19.863  -72.698  1.00 111.90 ? 131 THR B OG1 1 
ATOM 4371  C CG2 . THR B 1 162 ? -23.510  21.134  -74.040  1.00 111.72 ? 131 THR B CG2 1 
ATOM 4372  N N   . VAL B 1 163 ? -24.373  24.365  -72.706  1.00 113.07 ? 132 VAL B N   1 
ATOM 4373  C CA  . VAL B 1 163 ? -23.657  25.594  -73.012  1.00 114.15 ? 132 VAL B CA  1 
ATOM 4374  C C   . VAL B 1 163 ? -23.252  26.397  -71.788  1.00 115.40 ? 132 VAL B C   1 
ATOM 4375  O O   . VAL B 1 163 ? -22.393  27.243  -71.881  1.00 116.20 ? 132 VAL B O   1 
ATOM 4376  C CB  . VAL B 1 163 ? -24.371  26.483  -74.018  1.00 114.91 ? 132 VAL B CB  1 
ATOM 4377  C CG1 . VAL B 1 163 ? -24.730  25.687  -75.246  1.00 113.95 ? 132 VAL B CG1 1 
ATOM 4378  C CG2 . VAL B 1 163 ? -25.581  27.111  -73.397  1.00 116.30 ? 132 VAL B CG2 1 
ATOM 4379  N N   . GLN B 1 164 ? -23.858  26.136  -70.641  1.00 116.44 ? 133 GLN B N   1 
ATOM 4380  C CA  . GLN B 1 164 ? -23.394  26.754  -69.400  1.00 118.51 ? 133 GLN B CA  1 
ATOM 4381  C C   . GLN B 1 164 ? -22.030  26.169  -69.055  1.00 117.96 ? 133 GLN B C   1 
ATOM 4382  O O   . GLN B 1 164 ? -21.178  26.866  -68.513  1.00 118.82 ? 133 GLN B O   1 
ATOM 4383  C CB  . GLN B 1 164 ? -24.349  26.468  -68.228  1.00 119.57 ? 133 GLN B CB  1 
ATOM 4384  C CG  . GLN B 1 164 ? -25.768  27.099  -68.251  1.00 123.11 ? 133 GLN B CG  1 
ATOM 4385  C CD  . GLN B 1 164 ? -25.832  28.503  -67.657  1.00 127.98 ? 133 GLN B CD  1 
ATOM 4386  O OE1 . GLN B 1 164 ? -25.277  28.773  -66.578  1.00 129.00 ? 133 GLN B OE1 1 
ATOM 4387  N NE2 . GLN B 1 164 ? -26.534  29.404  -68.358  1.00 130.43 ? 133 GLN B NE2 1 
ATOM 4388  N N   . GLN B 1 165 ? -21.852  24.878  -69.364  1.00 117.02 ? 134 GLN B N   1 
ATOM 4389  C CA  . GLN B 1 165 ? -20.630  24.111  -69.055  1.00 116.67 ? 134 GLN B CA  1 
ATOM 4390  C C   . GLN B 1 165 ? -19.476  24.567  -69.903  1.00 116.82 ? 134 GLN B C   1 
ATOM 4391  O O   . GLN B 1 165 ? -18.433  24.946  -69.378  1.00 117.80 ? 134 GLN B O   1 
ATOM 4392  C CB  . GLN B 1 165 ? -20.833  22.599  -69.258  1.00 115.56 ? 134 GLN B CB  1 
ATOM 4393  C CG  . GLN B 1 165 ? -21.703  21.923  -68.185  1.00 116.11 ? 134 GLN B CG  1 
ATOM 4394  C CD  . GLN B 1 165 ? -21.882  20.420  -68.379  1.00 116.26 ? 134 GLN B CD  1 
ATOM 4395  O OE1 . GLN B 1 165 ? -21.285  19.796  -69.259  1.00 116.80 ? 134 GLN B OE1 1 
ATOM 4396  N NE2 . GLN B 1 165 ? -22.716  19.834  -67.546  1.00 117.35 ? 134 GLN B NE2 1 
ATOM 4397  N N   . ILE B 1 166 ? -19.674  24.535  -71.215  1.00 116.35 ? 135 ILE B N   1 
ATOM 4398  C CA  . ILE B 1 166 ? -18.659  24.978  -72.142  1.00 116.90 ? 135 ILE B CA  1 
ATOM 4399  C C   . ILE B 1 166 ? -18.260  26.425  -71.860  1.00 118.68 ? 135 ILE B C   1 
ATOM 4400  O O   . ILE B 1 166 ? -17.085  26.685  -71.662  1.00 119.49 ? 135 ILE B O   1 
ATOM 4401  C CB  . ILE B 1 166 ? -19.069  24.772  -73.613  1.00 116.48 ? 135 ILE B CB  1 
ATOM 4402  C CG1 . ILE B 1 166 ? -19.596  23.345  -73.858  1.00 115.22 ? 135 ILE B CG1 1 
ATOM 4403  C CG2 . ILE B 1 166 ? -17.896  25.051  -74.527  1.00 117.47 ? 135 ILE B CG2 1 
ATOM 4404  C CD1 . ILE B 1 166 ? -18.631  22.177  -73.551  1.00 113.31 ? 135 ILE B CD1 1 
ATOM 4405  N N   . GLU B 1 167 ? -19.221  27.347  -71.790  1.00 119.84 ? 136 GLU B N   1 
ATOM 4406  C CA  . GLU B 1 167 ? -18.924  28.763  -71.512  1.00 122.10 ? 136 GLU B CA  1 
ATOM 4407  C C   . GLU B 1 167 ? -18.027  28.958  -70.296  1.00 122.64 ? 136 GLU B C   1 
ATOM 4408  O O   . GLU B 1 167 ? -17.229  29.905  -70.261  1.00 124.38 ? 136 GLU B O   1 
ATOM 4409  C CB  . GLU B 1 167 ? -20.203  29.542  -71.273  1.00 123.11 ? 136 GLU B CB  1 
ATOM 4410  C CG  . GLU B 1 167 ? -20.276  30.871  -72.045  1.00 127.66 ? 136 GLU B CG  1 
ATOM 4411  C CD  . GLU B 1 167 ? -21.408  31.769  -71.518  1.00 133.08 ? 136 GLU B CD  1 
ATOM 4412  O OE1 . GLU B 1 167 ? -21.178  32.401  -70.459  1.00 135.27 ? 136 GLU B OE1 1 
ATOM 4413  O OE2 . GLU B 1 167 ? -22.511  31.845  -72.143  1.00 134.48 ? 136 GLU B OE2 1 
ATOM 4414  N N   . HIS B 1 168 ? -18.166  28.067  -69.307  1.00 121.53 ? 137 HIS B N   1 
ATOM 4415  C CA  . HIS B 1 168 ? -17.351  28.105  -68.081  1.00 121.78 ? 137 HIS B CA  1 
ATOM 4416  C C   . HIS B 1 168 ? -15.938  27.536  -68.228  1.00 120.69 ? 137 HIS B C   1 
ATOM 4417  O O   . HIS B 1 168 ? -15.062  27.883  -67.435  1.00 122.10 ? 137 HIS B O   1 
ATOM 4418  C CB  . HIS B 1 168 ? -18.056  27.442  -66.894  1.00 121.84 ? 137 HIS B CB  1 
ATOM 4419  C CG  . HIS B 1 168 ? -17.360  27.669  -65.586  1.00 124.38 ? 137 HIS B CG  1 
ATOM 4420  N ND1 . HIS B 1 168 ? -16.486  26.752  -65.038  1.00 125.39 ? 137 HIS B ND1 1 
ATOM 4421  C CD2 . HIS B 1 168 ? -17.383  28.723  -64.735  1.00 126.99 ? 137 HIS B CD2 1 
ATOM 4422  C CE1 . HIS B 1 168 ? -16.015  27.223  -63.897  1.00 127.35 ? 137 HIS B CE1 1 
ATOM 4423  N NE2 . HIS B 1 168 ? -16.544  28.417  -63.691  1.00 128.88 ? 137 HIS B NE2 1 
ATOM 4424  N N   . LEU B 1 169 ? -15.706  26.665  -69.211  1.00 118.10 ? 138 LEU B N   1 
ATOM 4425  C CA  . LEU B 1 169 ? -14.327  26.349  -69.587  1.00 117.09 ? 138 LEU B CA  1 
ATOM 4426  C C   . LEU B 1 169 ? -13.712  27.598  -70.193  1.00 118.23 ? 138 LEU B C   1 
ATOM 4427  O O   . LEU B 1 169 ? -12.899  28.277  -69.573  1.00 119.59 ? 138 LEU B O   1 
ATOM 4428  C CB  . LEU B 1 169 ? -14.243  25.203  -70.594  1.00 115.23 ? 138 LEU B CB  1 
ATOM 4429  C CG  . LEU B 1 169 ? -14.770  23.817  -70.239  1.00 112.86 ? 138 LEU B CG  1 
ATOM 4430  C CD1 . LEU B 1 169 ? -14.077  22.736  -71.093  1.00 109.71 ? 138 LEU B CD1 1 
ATOM 4431  C CD2 . LEU B 1 169 ? -14.671  23.515  -68.725  1.00 112.77 ? 138 LEU B CD2 1 
ATOM 4432  N N   . ASN B 1 170 ? -14.152  27.899  -71.403  1.00 117.74 ? 139 ASN B N   1 
ATOM 4433  C CA  . ASN B 1 170 ? -13.721  29.051  -72.165  1.00 119.09 ? 139 ASN B CA  1 
ATOM 4434  C C   . ASN B 1 170 ? -13.488  30.319  -71.365  1.00 120.78 ? 139 ASN B C   1 
ATOM 4435  O O   . ASN B 1 170 ? -12.522  31.036  -71.628  1.00 122.43 ? 139 ASN B O   1 
ATOM 4436  C CB  . ASN B 1 170 ? -14.722  29.297  -73.291  1.00 118.91 ? 139 ASN B CB  1 
ATOM 4437  C CG  . ASN B 1 170 ? -14.748  28.154  -74.299  1.00 117.74 ? 139 ASN B CG  1 
ATOM 4438  O OD1 . ASN B 1 170 ? -13.786  27.376  -74.402  1.00 117.20 ? 139 ASN B OD1 1 
ATOM 4439  N ND2 . ASN B 1 170 ? -15.845  28.046  -75.049  1.00 116.23 ? 139 ASN B ND2 1 
ATOM 4440  N N   . LYS B 1 171 ? -14.359  30.597  -70.396  1.00 120.55 ? 140 LYS B N   1 
ATOM 4441  C CA  . LYS B 1 171 ? -14.176  31.764  -69.529  1.00 122.30 ? 140 LYS B CA  1 
ATOM 4442  C C   . LYS B 1 171 ? -12.916  31.624  -68.647  1.00 123.03 ? 140 LYS B C   1 
ATOM 4443  O O   . LYS B 1 171 ? -12.055  32.511  -68.638  1.00 124.61 ? 140 LYS B O   1 
ATOM 4444  C CB  . LYS B 1 171 ? -15.441  32.051  -68.698  1.00 122.04 ? 140 LYS B CB  1 
ATOM 4445  N N   . THR B 1 172 ? -12.803  30.482  -67.960  1.00 121.81 ? 141 THR B N   1 
ATOM 4446  C CA  . THR B 1 172 ? -11.771  30.245  -66.934  1.00 122.53 ? 141 THR B CA  1 
ATOM 4447  C C   . THR B 1 172 ? -10.482  29.612  -67.458  1.00 122.47 ? 141 THR B C   1 
ATOM 4448  O O   . THR B 1 172 ? -9.603   29.292  -66.669  1.00 123.19 ? 141 THR B O   1 
ATOM 4449  C CB  . THR B 1 172 ? -12.301  29.372  -65.725  1.00 121.75 ? 141 THR B CB  1 
ATOM 4450  O OG1 . THR B 1 172 ? -12.566  28.028  -66.152  1.00 118.80 ? 141 THR B OG1 1 
ATOM 4451  C CG2 . THR B 1 172 ? -13.565  29.980  -65.057  1.00 121.94 ? 141 THR B CG2 1 
ATOM 4452  N N   . TYR B 1 173 ? -10.383  29.424  -68.773  1.00 121.90 ? 142 TYR B N   1 
ATOM 4453  C CA  . TYR B 1 173 ? -9.185   28.864  -69.420  1.00 122.39 ? 142 TYR B CA  1 
ATOM 4454  C C   . TYR B 1 173 ? -8.780   29.617  -70.682  1.00 124.32 ? 142 TYR B C   1 
ATOM 4455  O O   . TYR B 1 173 ? -8.066   29.063  -71.516  1.00 124.59 ? 142 TYR B O   1 
ATOM 4456  C CB  . TYR B 1 173 ? -9.391   27.389  -69.790  1.00 119.77 ? 142 TYR B CB  1 
ATOM 4457  C CG  . TYR B 1 173 ? -9.365   26.483  -68.609  1.00 118.24 ? 142 TYR B CG  1 
ATOM 4458  C CD1 . TYR B 1 173 ? -8.178   25.897  -68.187  1.00 118.83 ? 142 TYR B CD1 1 
ATOM 4459  C CD2 . TYR B 1 173 ? -10.521  26.229  -67.887  1.00 116.54 ? 142 TYR B CD2 1 
ATOM 4460  C CE1 . TYR B 1 173 ? -8.144   25.070  -67.064  1.00 118.12 ? 142 TYR B CE1 1 
ATOM 4461  C CE2 . TYR B 1 173 ? -10.505  25.406  -66.776  1.00 115.95 ? 142 TYR B CE2 1 
ATOM 4462  C CZ  . TYR B 1 173 ? -9.316   24.830  -66.367  1.00 116.66 ? 142 TYR B CZ  1 
ATOM 4463  O OH  . TYR B 1 173 ? -9.309   24.016  -65.262  1.00 115.85 ? 142 TYR B OH  1 
ATOM 4464  N N   . ASN B 1 174 ? -9.238   30.865  -70.823  1.00 126.46 ? 143 ASN B N   1 
ATOM 4465  C CA  . ASN B 1 174 ? -9.103   31.672  -72.072  1.00 128.29 ? 143 ASN B CA  1 
ATOM 4466  C C   . ASN B 1 174 ? -8.840   30.894  -73.384  1.00 127.41 ? 143 ASN B C   1 
ATOM 4467  O O   . ASN B 1 174 ? -7.909   31.178  -74.153  1.00 128.63 ? 143 ASN B O   1 
ATOM 4468  C CB  . ASN B 1 174 ? -8.157   32.870  -71.876  1.00 131.44 ? 143 ASN B CB  1 
ATOM 4469  C CG  . ASN B 1 174 ? -8.855   34.062  -71.203  1.00 133.87 ? 143 ASN B CG  1 
ATOM 4470  O OD1 . ASN B 1 174 ? -8.944   35.145  -71.781  1.00 136.72 ? 143 ASN B OD1 1 
ATOM 4471  N ND2 . ASN B 1 174 ? -9.368   33.855  -69.986  1.00 134.78 ? 143 ASN B ND2 1 
ATOM 4472  N N   . THR B 1 175 ? -9.700   29.901  -73.596  1.00 125.29 ? 144 THR B N   1 
ATOM 4473  C CA  . THR B 1 175 ? -9.721   29.080  -74.797  1.00 124.35 ? 144 THR B CA  1 
ATOM 4474  C C   . THR B 1 175 ? -11.156  29.060  -75.336  1.00 122.78 ? 144 THR B C   1 
ATOM 4475  O O   . THR B 1 175 ? -12.068  29.557  -74.680  1.00 121.93 ? 144 THR B O   1 
ATOM 4476  C CB  . THR B 1 175 ? -9.185   27.639  -74.529  1.00 123.22 ? 144 THR B CB  1 
ATOM 4477  O OG1 . THR B 1 175 ? -9.207   26.873  -75.742  1.00 122.67 ? 144 THR B OG1 1 
ATOM 4478  C CG2 . THR B 1 175 ? -10.017  26.925  -73.468  1.00 121.62 ? 144 THR B CG2 1 
ATOM 4479  N N   . ASP B 1 176 ? -11.330  28.521  -76.539  1.00 122.23 ? 145 ASP B N   1 
ATOM 4480  C CA  . ASP B 1 176 ? -12.628  28.474  -77.179  1.00 121.60 ? 145 ASP B CA  1 
ATOM 4481  C C   . ASP B 1 176 ? -12.896  27.119  -77.800  1.00 119.68 ? 145 ASP B C   1 
ATOM 4482  O O   . ASP B 1 176 ? -12.574  26.869  -78.961  1.00 120.32 ? 145 ASP B O   1 
ATOM 4483  C CB  . ASP B 1 176 ? -12.772  29.589  -78.209  1.00 123.89 ? 145 ASP B CB  1 
ATOM 4484  C CG  . ASP B 1 176 ? -12.946  30.961  -77.559  1.00 127.57 ? 145 ASP B CG  1 
ATOM 4485  O OD1 . ASP B 1 176 ? -11.932  31.517  -77.060  1.00 131.49 ? 145 ASP B OD1 1 
ATOM 4486  O OD2 . ASP B 1 176 ? -14.095  31.482  -77.547  1.00 129.37 ? 145 ASP B OD2 1 
ATOM 4487  N N   . VAL B 1 177 ? -13.492  26.247  -76.993  1.00 117.45 ? 146 VAL B N   1 
ATOM 4488  C CA  . VAL B 1 177 ? -13.892  24.918  -77.424  1.00 115.20 ? 146 VAL B CA  1 
ATOM 4489  C C   . VAL B 1 177 ? -15.235  25.018  -78.149  1.00 114.17 ? 146 VAL B C   1 
ATOM 4490  O O   . VAL B 1 177 ? -16.173  25.645  -77.661  1.00 113.78 ? 146 VAL B O   1 
ATOM 4491  C CB  . VAL B 1 177 ? -13.997  23.948  -76.230  1.00 113.83 ? 146 VAL B CB  1 
ATOM 4492  C CG1 . VAL B 1 177 ? -13.971  22.512  -76.705  1.00 112.65 ? 146 VAL B CG1 1 
ATOM 4493  C CG2 . VAL B 1 177 ? -12.861  24.194  -75.253  1.00 114.32 ? 146 VAL B CG2 1 
ATOM 4494  N N   . PRO B 1 178 ? -15.315  24.416  -79.333  1.00 113.56 ? 147 PRO B N   1 
ATOM 4495  C CA  . PRO B 1 178 ? -16.530  24.444  -80.118  1.00 113.04 ? 147 PRO B CA  1 
ATOM 4496  C C   . PRO B 1 178 ? -17.518  23.395  -79.647  1.00 111.30 ? 147 PRO B C   1 
ATOM 4497  O O   . PRO B 1 178 ? -17.096  22.328  -79.185  1.00 110.32 ? 147 PRO B O   1 
ATOM 4498  C CB  . PRO B 1 178 ? -16.031  24.059  -81.502  1.00 114.11 ? 147 PRO B CB  1 
ATOM 4499  C CG  . PRO B 1 178 ? -14.864  23.160  -81.232  1.00 113.97 ? 147 PRO B CG  1 
ATOM 4500  C CD  . PRO B 1 178 ? -14.208  23.732  -80.027  1.00 113.99 ? 147 PRO B CD  1 
ATOM 4501  N N   . LEU B 1 179 ? -18.816  23.691  -79.777  1.00 111.05 ? 148 LEU B N   1 
ATOM 4502  C CA  . LEU B 1 179 ? -19.888  22.694  -79.570  1.00 109.65 ? 148 LEU B CA  1 
ATOM 4503  C C   . LEU B 1 179 ? -20.577  22.309  -80.876  1.00 110.12 ? 148 LEU B C   1 
ATOM 4504  O O   . LEU B 1 179 ? -20.961  23.162  -81.669  1.00 111.33 ? 148 LEU B O   1 
ATOM 4505  C CB  . LEU B 1 179 ? -20.936  23.202  -78.582  1.00 109.08 ? 148 LEU B CB  1 
ATOM 4506  C CG  . LEU B 1 179 ? -21.726  22.151  -77.794  1.00 107.82 ? 148 LEU B CG  1 
ATOM 4507  C CD1 . LEU B 1 179 ? -22.600  22.846  -76.798  1.00 108.14 ? 148 LEU B CD1 1 
ATOM 4508  C CD2 . LEU B 1 179 ? -22.598  21.268  -78.652  1.00 107.91 ? 148 LEU B CD2 1 
ATOM 4509  N N   . VAL B 1 180 ? -20.742  21.018  -81.102  1.00 109.49 ? 149 VAL B N   1 
ATOM 4510  C CA  . VAL B 1 180 ? -21.420  20.578  -82.302  1.00 110.51 ? 149 VAL B CA  1 
ATOM 4511  C C   . VAL B 1 180 ? -22.594  19.694  -81.934  1.00 110.33 ? 149 VAL B C   1 
ATOM 4512  O O   . VAL B 1 180 ? -22.399  18.645  -81.315  1.00 109.79 ? 149 VAL B O   1 
ATOM 4513  C CB  . VAL B 1 180 ? -20.473  19.821  -83.210  1.00 110.85 ? 149 VAL B CB  1 
ATOM 4514  C CG1 . VAL B 1 180 ? -21.200  19.283  -84.421  1.00 111.46 ? 149 VAL B CG1 1 
ATOM 4515  C CG2 . VAL B 1 180 ? -19.370  20.726  -83.634  1.00 112.34 ? 149 VAL B CG2 1 
ATOM 4516  N N   . LEU B 1 181 ? -23.804  20.126  -82.310  1.00 111.20 ? 150 LEU B N   1 
ATOM 4517  C CA  . LEU B 1 181 ? -25.048  19.388  -82.051  1.00 110.92 ? 150 LEU B CA  1 
ATOM 4518  C C   . LEU B 1 181 ? -25.396  18.488  -83.220  1.00 112.31 ? 150 LEU B C   1 
ATOM 4519  O O   . LEU B 1 181 ? -25.531  18.969  -84.344  1.00 113.72 ? 150 LEU B O   1 
ATOM 4520  C CB  . LEU B 1 181 ? -26.187  20.372  -81.846  1.00 111.13 ? 150 LEU B CB  1 
ATOM 4521  C CG  . LEU B 1 181 ? -26.063  21.271  -80.636  1.00 109.94 ? 150 LEU B CG  1 
ATOM 4522  C CD1 . LEU B 1 181 ? -27.094  22.362  -80.665  1.00 110.63 ? 150 LEU B CD1 1 
ATOM 4523  C CD2 . LEU B 1 181 ? -26.269  20.409  -79.442  1.00 109.15 ? 150 LEU B CD2 1 
ATOM 4524  N N   . MET B 1 182 ? -25.534  17.189  -82.984  1.00 112.50 ? 151 MET B N   1 
ATOM 4525  C CA  . MET B 1 182 ? -25.877  16.310  -84.090  1.00 114.72 ? 151 MET B CA  1 
ATOM 4526  C C   . MET B 1 182 ? -27.329  15.956  -84.073  1.00 115.78 ? 151 MET B C   1 
ATOM 4527  O O   . MET B 1 182 ? -27.693  14.933  -83.508  1.00 115.98 ? 151 MET B O   1 
ATOM 4528  C CB  . MET B 1 182 ? -25.092  15.011  -84.074  1.00 114.49 ? 151 MET B CB  1 
ATOM 4529  C CG  . MET B 1 182 ? -25.481  14.140  -85.269  1.00 117.25 ? 151 MET B CG  1 
ATOM 4530  S SD  . MET B 1 182 ? -25.122  12.390  -85.126  1.00 121.28 ? 151 MET B SD  1 
ATOM 4531  C CE  . MET B 1 182 ? -26.371  11.827  -83.965  1.00 118.92 ? 151 MET B CE  1 
ATOM 4532  N N   . ASN B 1 183 ? -28.165  16.761  -84.710  1.00 117.56 ? 152 ASN B N   1 
ATOM 4533  C CA  . ASN B 1 183 ? -29.597  16.503  -84.659  1.00 118.81 ? 152 ASN B CA  1 
ATOM 4534  C C   . ASN B 1 183 ? -30.158  15.798  -85.906  1.00 121.08 ? 152 ASN B C   1 
ATOM 4535  O O   . ASN B 1 183 ? -29.388  15.395  -86.789  1.00 121.41 ? 152 ASN B O   1 
ATOM 4536  C CB  . ASN B 1 183 ? -30.361  17.779  -84.287  1.00 118.95 ? 152 ASN B CB  1 
ATOM 4537  C CG  . ASN B 1 183 ? -29.776  19.007  -84.923  1.00 119.18 ? 152 ASN B CG  1 
ATOM 4538  O OD1 . ASN B 1 183 ? -29.708  19.112  -86.144  1.00 120.16 ? 152 ASN B OD1 1 
ATOM 4539  N ND2 . ASN B 1 183 ? -29.349  19.952  -84.099  1.00 118.23 ? 152 ASN B ND2 1 
ATOM 4540  N N   . SER B 1 184 ? -31.489  15.615  -85.921  1.00 123.01 ? 153 SER B N   1 
ATOM 4541  C CA  . SER B 1 184 ? -32.254  15.013  -87.028  1.00 125.62 ? 153 SER B CA  1 
ATOM 4542  C C   . SER B 1 184 ? -33.389  15.915  -87.455  1.00 127.71 ? 153 SER B C   1 
ATOM 4543  O O   . SER B 1 184 ? -33.692  16.886  -86.768  1.00 127.24 ? 153 SER B O   1 
ATOM 4544  C CB  . SER B 1 184 ? -32.855  13.669  -86.635  1.00 125.59 ? 153 SER B CB  1 
ATOM 4545  O OG  . SER B 1 184 ? -33.484  13.100  -87.772  1.00 127.55 ? 153 SER B OG  1 
ATOM 4546  N N   . PHE B 1 185 ? -34.031  15.566  -88.572  1.00 130.68 ? 154 PHE B N   1 
ATOM 4547  C CA  . PHE B 1 185 ? -35.084  16.402  -89.172  1.00 133.64 ? 154 PHE B CA  1 
ATOM 4548  C C   . PHE B 1 185 ? -36.154  16.822  -88.192  1.00 134.21 ? 154 PHE B C   1 
ATOM 4549  O O   . PHE B 1 185 ? -36.707  17.909  -88.329  1.00 135.19 ? 154 PHE B O   1 
ATOM 4550  C CB  . PHE B 1 185 ? -35.729  15.741  -90.391  1.00 135.98 ? 154 PHE B CB  1 
ATOM 4551  C CG  . PHE B 1 185 ? -36.091  14.299  -90.187  1.00 136.27 ? 154 PHE B CG  1 
ATOM 4552  C CD1 . PHE B 1 185 ? -37.247  13.942  -89.512  1.00 136.07 ? 154 PHE B CD1 1 
ATOM 4553  C CD2 . PHE B 1 185 ? -35.276  13.292  -90.693  1.00 137.11 ? 154 PHE B CD2 1 
ATOM 4554  C CE1 . PHE B 1 185 ? -37.579  12.606  -89.329  1.00 136.65 ? 154 PHE B CE1 1 
ATOM 4555  C CE2 . PHE B 1 185 ? -35.603  11.950  -90.519  1.00 137.05 ? 154 PHE B CE2 1 
ATOM 4556  C CZ  . PHE B 1 185 ? -36.756  11.607  -89.835  1.00 136.88 ? 154 PHE B CZ  1 
ATOM 4557  N N   . ASN B 1 186 ? -36.429  15.956  -87.212  1.00 134.35 ? 155 ASN B N   1 
ATOM 4558  C CA  . ASN B 1 186 ? -37.358  16.243  -86.103  1.00 135.31 ? 155 ASN B CA  1 
ATOM 4559  C C   . ASN B 1 186 ? -36.887  17.441  -85.268  1.00 134.77 ? 155 ASN B C   1 
ATOM 4560  O O   . ASN B 1 186 ? -37.650  18.351  -84.913  1.00 135.45 ? 155 ASN B O   1 
ATOM 4561  C CB  . ASN B 1 186 ? -37.497  15.007  -85.189  1.00 134.20 ? 155 ASN B CB  1 
ATOM 4562  C CG  . ASN B 1 186 ? -38.373  13.898  -85.794  1.00 136.28 ? 155 ASN B CG  1 
ATOM 4563  O OD1 . ASN B 1 186 ? -39.269  14.155  -86.606  1.00 139.71 ? 155 ASN B OD1 1 
ATOM 4564  N ND2 . ASN B 1 186 ? -38.130  12.659  -85.370  1.00 135.16 ? 155 ASN B ND2 1 
ATOM 4565  N N   . THR B 1 187 ? -35.594  17.434  -84.997  1.00 134.04 ? 156 THR B N   1 
ATOM 4566  C CA  . THR B 1 187 ? -35.008  18.301  -84.010  1.00 133.54 ? 156 THR B CA  1 
ATOM 4567  C C   . THR B 1 187 ? -34.346  19.546  -84.591  1.00 134.70 ? 156 THR B C   1 
ATOM 4568  O O   . THR B 1 187 ? -34.118  20.499  -83.851  1.00 134.28 ? 156 THR B O   1 
ATOM 4569  C CB  . THR B 1 187 ? -34.012  17.499  -83.181  1.00 131.30 ? 156 THR B CB  1 
ATOM 4570  O OG1 . THR B 1 187 ? -33.567  16.393  -83.967  1.00 131.65 ? 156 THR B OG1 1 
ATOM 4571  C CG2 . THR B 1 187 ? -34.694  16.923  -81.976  1.00 130.67 ? 156 THR B CG2 1 
ATOM 4572  N N   . ASP B 1 188 ? -34.049  19.567  -85.895  1.00 136.78 ? 157 ASP B N   1 
ATOM 4573  C CA  . ASP B 1 188 ? -33.281  20.703  -86.446  1.00 138.14 ? 157 ASP B CA  1 
ATOM 4574  C C   . ASP B 1 188 ? -34.124  21.962  -86.625  1.00 139.84 ? 157 ASP B C   1 
ATOM 4575  O O   . ASP B 1 188 ? -33.778  23.016  -86.078  1.00 139.69 ? 157 ASP B O   1 
ATOM 4576  C CB  . ASP B 1 188 ? -32.481  20.367  -87.728  1.00 139.24 ? 157 ASP B CB  1 
ATOM 4577  C CG  . ASP B 1 188 ? -31.237  21.301  -87.937  1.00 140.55 ? 157 ASP B CG  1 
ATOM 4578  O OD1 . ASP B 1 188 ? -31.312  22.535  -87.694  1.00 142.37 ? 157 ASP B OD1 1 
ATOM 4579  O OD2 . ASP B 1 188 ? -30.166  20.797  -88.359  1.00 141.87 ? 157 ASP B OD2 1 
ATOM 4580  N N   . GLU B 1 189 ? -35.219  21.872  -87.373  1.00 141.85 ? 158 GLU B N   1 
ATOM 4581  C CA  . GLU B 1 189 ? -36.031  23.065  -87.585  1.00 143.81 ? 158 GLU B CA  1 
ATOM 4582  C C   . GLU B 1 189 ? -36.252  23.712  -86.219  1.00 142.92 ? 158 GLU B C   1 
ATOM 4583  O O   . GLU B 1 189 ? -35.921  24.894  -86.021  1.00 143.26 ? 158 GLU B O   1 
ATOM 4584  C CB  . GLU B 1 189 ? -37.364  22.745  -88.280  1.00 146.04 ? 158 GLU B CB  1 
ATOM 4585  N N   . ASP B 1 190 ? -36.743  22.906  -85.271  1.00 141.80 ? 159 ASP B N   1 
ATOM 4586  C CA  . ASP B 1 190 ? -37.147  23.399  -83.955  1.00 141.09 ? 159 ASP B CA  1 
ATOM 4587  C C   . ASP B 1 190 ? -35.996  24.097  -83.205  1.00 139.45 ? 159 ASP B C   1 
ATOM 4588  O O   . ASP B 1 190 ? -36.130  25.268  -82.823  1.00 140.10 ? 159 ASP B O   1 
ATOM 4589  C CB  . ASP B 1 190 ? -37.795  22.276  -83.129  1.00 140.19 ? 159 ASP B CB  1 
ATOM 4590  N N   . THR B 1 191 ? -34.866  23.395  -83.052  1.00 137.49 ? 160 THR B N   1 
ATOM 4591  C CA  . THR B 1 191 ? -33.733  23.863  -82.225  1.00 135.74 ? 160 THR B CA  1 
ATOM 4592  C C   . THR B 1 191 ? -32.974  25.043  -82.808  1.00 136.32 ? 160 THR B C   1 
ATOM 4593  O O   . THR B 1 191 ? -32.611  25.958  -82.060  1.00 136.24 ? 160 THR B O   1 
ATOM 4594  C CB  . THR B 1 191 ? -32.690  22.747  -81.893  1.00 133.69 ? 160 THR B CB  1 
ATOM 4595  O OG1 . THR B 1 191 ? -32.114  22.231  -83.094  1.00 133.29 ? 160 THR B OG1 1 
ATOM 4596  C CG2 . THR B 1 191 ? -33.318  21.611  -81.108  1.00 133.30 ? 160 THR B CG2 1 
ATOM 4597  N N   . LYS B 1 192 ? -32.722  25.013  -84.123  1.00 136.91 ? 161 LYS B N   1 
ATOM 4598  C CA  . LYS B 1 192 ? -31.977  26.084  -84.783  1.00 137.47 ? 161 LYS B CA  1 
ATOM 4599  C C   . LYS B 1 192 ? -32.721  27.403  -84.569  1.00 139.09 ? 161 LYS B C   1 
ATOM 4600  O O   . LYS B 1 192 ? -32.084  28.442  -84.363  1.00 139.60 ? 161 LYS B O   1 
ATOM 4601  C CB  . LYS B 1 192 ? -31.709  25.783  -86.263  1.00 138.17 ? 161 LYS B CB  1 
ATOM 4602  N N   . LYS B 1 193 ? -34.060  27.343  -84.552  1.00 140.04 ? 162 LYS B N   1 
ATOM 4603  C CA  . LYS B 1 193 ? -34.899  28.503  -84.202  1.00 141.51 ? 162 LYS B CA  1 
ATOM 4604  C C   . LYS B 1 193 ? -34.571  29.072  -82.805  1.00 140.47 ? 162 LYS B C   1 
ATOM 4605  O O   . LYS B 1 193 ? -34.882  30.221  -82.514  1.00 142.02 ? 162 LYS B O   1 
ATOM 4606  C CB  . LYS B 1 193 ? -36.396  28.167  -84.323  1.00 142.53 ? 162 LYS B CB  1 
ATOM 4607  N N   . ILE B 1 194 ? -33.907  28.282  -81.964  1.00 138.16 ? 163 ILE B N   1 
ATOM 4608  C CA  . ILE B 1 194 ? -33.697  28.639  -80.558  1.00 137.30 ? 163 ILE B CA  1 
ATOM 4609  C C   . ILE B 1 194 ? -32.261  28.992  -80.195  1.00 136.22 ? 163 ILE B C   1 
ATOM 4610  O O   . ILE B 1 194 ? -32.020  29.561  -79.127  1.00 136.31 ? 163 ILE B O   1 
ATOM 4611  C CB  . ILE B 1 194 ? -34.279  27.546  -79.620  1.00 136.24 ? 163 ILE B CB  1 
ATOM 4612  C CG1 . ILE B 1 194 ? -35.556  28.077  -78.958  1.00 138.66 ? 163 ILE B CG1 1 
ATOM 4613  C CG2 . ILE B 1 194 ? -33.301  27.121  -78.549  1.00 133.48 ? 163 ILE B CG2 1 
ATOM 4614  C CD1 . ILE B 1 194 ? -36.818  27.212  -79.192  1.00 140.74 ? 163 ILE B CD1 1 
ATOM 4615  N N   . LEU B 1 195 ? -31.316  28.679  -81.083  1.00 135.46 ? 164 LEU B N   1 
ATOM 4616  C CA  . LEU B 1 195 ? -29.904  28.991  -80.845  1.00 134.26 ? 164 LEU B CA  1 
ATOM 4617  C C   . LEU B 1 195 ? -29.680  30.492  -80.744  1.00 135.86 ? 164 LEU B C   1 
ATOM 4618  O O   . LEU B 1 195 ? -28.721  30.934  -80.114  1.00 135.48 ? 164 LEU B O   1 
ATOM 4619  C CB  . LEU B 1 195 ? -29.001  28.381  -81.921  1.00 133.67 ? 164 LEU B CB  1 
ATOM 4620  C CG  . LEU B 1 195 ? -28.911  26.853  -82.016  1.00 131.52 ? 164 LEU B CG  1 
ATOM 4621  C CD1 . LEU B 1 195 ? -28.035  26.420  -83.182  1.00 130.78 ? 164 LEU B CD1 1 
ATOM 4622  C CD2 . LEU B 1 195 ? -28.404  26.246  -80.723  1.00 129.77 ? 164 LEU B CD2 1 
ATOM 4623  N N   . GLN B 1 196 ? -30.579  31.262  -81.358  1.00 137.82 ? 165 GLN B N   1 
ATOM 4624  C CA  . GLN B 1 196 ? -30.647  32.718  -81.185  1.00 139.77 ? 165 GLN B CA  1 
ATOM 4625  C C   . GLN B 1 196 ? -30.283  33.218  -79.763  1.00 139.47 ? 165 GLN B C   1 
ATOM 4626  O O   . GLN B 1 196 ? -29.676  34.283  -79.601  1.00 140.29 ? 165 GLN B O   1 
ATOM 4627  C CB  . GLN B 1 196 ? -32.047  33.209  -81.579  1.00 141.60 ? 165 GLN B CB  1 
ATOM 4628  N N   . LYS B 1 197 ? -30.643  32.426  -78.753  1.00 138.36 ? 166 LYS B N   1 
ATOM 4629  C CA  . LYS B 1 197 ? -30.517  32.799  -77.343  1.00 138.65 ? 166 LYS B CA  1 
ATOM 4630  C C   . LYS B 1 197 ? -29.082  32.912  -76.862  1.00 138.29 ? 166 LYS B C   1 
ATOM 4631  O O   . LYS B 1 197 ? -28.807  33.672  -75.933  1.00 139.11 ? 166 LYS B O   1 
ATOM 4632  C CB  . LYS B 1 197 ? -31.254  31.793  -76.451  1.00 137.29 ? 166 LYS B CB  1 
ATOM 4633  N N   . TYR B 1 198 ? -28.178  32.151  -77.486  1.00 137.62 ? 167 TYR B N   1 
ATOM 4634  C CA  . TYR B 1 198 ? -26.782  32.022  -77.016  1.00 137.20 ? 167 TYR B CA  1 
ATOM 4635  C C   . TYR B 1 198 ? -25.807  32.951  -77.734  1.00 139.07 ? 167 TYR B C   1 
ATOM 4636  O O   . TYR B 1 198 ? -24.591  32.765  -77.701  1.00 138.39 ? 167 TYR B O   1 
ATOM 4637  C CB  . TYR B 1 198 ? -26.303  30.565  -77.086  1.00 135.01 ? 167 TYR B CB  1 
ATOM 4638  C CG  . TYR B 1 198 ? -27.268  29.551  -76.485  1.00 133.38 ? 167 TYR B CG  1 
ATOM 4639  C CD1 . TYR B 1 198 ? -27.734  29.683  -75.170  1.00 132.77 ? 167 TYR B CD1 1 
ATOM 4640  C CD2 . TYR B 1 198 ? -27.706  28.457  -77.231  1.00 131.32 ? 167 TYR B CD2 1 
ATOM 4641  C CE1 . TYR B 1 198 ? -28.615  28.767  -74.628  1.00 131.14 ? 167 TYR B CE1 1 
ATOM 4642  C CE2 . TYR B 1 198 ? -28.578  27.538  -76.698  1.00 129.68 ? 167 TYR B CE2 1 
ATOM 4643  C CZ  . TYR B 1 198 ? -29.030  27.695  -75.399  1.00 130.29 ? 167 TYR B CZ  1 
ATOM 4644  O OH  . TYR B 1 198 ? -29.899  26.772  -74.869  1.00 130.54 ? 167 TYR B OH  1 
ATOM 4645  N N   . ASN B 1 199 ? -26.371  33.948  -78.401  1.00 142.02 ? 168 ASN B N   1 
ATOM 4646  C CA  . ASN B 1 199 ? -25.662  35.163  -78.745  1.00 144.62 ? 168 ASN B CA  1 
ATOM 4647  C C   . ASN B 1 199 ? -25.129  35.840  -77.488  1.00 145.54 ? 168 ASN B C   1 
ATOM 4648  O O   . ASN B 1 199 ? -25.642  35.622  -76.383  1.00 144.96 ? 168 ASN B O   1 
ATOM 4649  C CB  . ASN B 1 199 ? -26.614  36.117  -79.456  1.00 146.88 ? 168 ASN B CB  1 
ATOM 4650  C CG  . ASN B 1 199 ? -26.315  36.221  -80.923  1.00 148.49 ? 168 ASN B CG  1 
ATOM 4651  O OD1 . ASN B 1 199 ? -26.245  35.210  -81.632  1.00 147.85 ? 168 ASN B OD1 1 
ATOM 4652  N ND2 . ASN B 1 199 ? -26.121  37.453  -81.399  1.00 151.83 ? 168 ASN B ND2 1 
ATOM 4653  N N   . HIS B 1 200 ? -24.109  36.672  -77.657  1.00 147.51 ? 169 HIS B N   1 
ATOM 4654  C CA  . HIS B 1 200 ? -23.456  37.336  -76.524  1.00 149.07 ? 169 HIS B CA  1 
ATOM 4655  C C   . HIS B 1 200 ? -22.872  36.314  -75.525  1.00 147.03 ? 169 HIS B C   1 
ATOM 4656  O O   . HIS B 1 200 ? -22.744  36.613  -74.334  1.00 147.46 ? 169 HIS B O   1 
ATOM 4657  C CB  . HIS B 1 200 ? -24.423  38.295  -75.799  1.00 151.05 ? 169 HIS B CB  1 
ATOM 4658  C CG  . HIS B 1 200 ? -25.021  39.355  -76.678  1.00 155.00 ? 169 HIS B CG  1 
ATOM 4659  N ND1 . HIS B 1 200 ? -24.392  40.557  -76.932  1.00 158.53 ? 169 HIS B ND1 1 
ATOM 4660  C CD2 . HIS B 1 200 ? -26.205  39.406  -77.337  1.00 156.77 ? 169 HIS B CD2 1 
ATOM 4661  C CE1 . HIS B 1 200 ? -25.157  41.297  -77.719  1.00 160.69 ? 169 HIS B CE1 1 
ATOM 4662  N NE2 . HIS B 1 200 ? -26.263  40.622  -77.979  1.00 159.81 ? 169 HIS B NE2 1 
ATOM 4663  N N   . CYS B 1 201 ? -22.526  35.118  -76.023  1.00 154.38 ? 170 CYS B N   1 
ATOM 4664  C CA  . CYS B 1 201 ? -21.920  34.028  -75.220  1.00 151.68 ? 170 CYS B CA  1 
ATOM 4665  C C   . CYS B 1 201 ? -20.684  33.394  -75.878  1.00 148.60 ? 170 CYS B C   1 
ATOM 4666  O O   . CYS B 1 201 ? -20.668  33.139  -77.095  1.00 147.46 ? 170 CYS B O   1 
ATOM 4667  C CB  . CYS B 1 201 ? -22.938  32.918  -74.954  1.00 150.60 ? 170 CYS B CB  1 
ATOM 4668  S SG  . CYS B 1 201 ? -24.296  33.387  -73.902  1.00 154.46 ? 170 CYS B SG  1 
ATOM 4669  N N   . ARG B 1 202 ? -19.671  33.105  -75.060  1.00 147.19 ? 171 ARG B N   1 
ATOM 4670  C CA  . ARG B 1 202 ? -18.405  32.569  -75.563  1.00 144.53 ? 171 ARG B CA  1 
ATOM 4671  C C   . ARG B 1 202 ? -18.457  31.058  -75.878  1.00 141.25 ? 171 ARG B C   1 
ATOM 4672  O O   . ARG B 1 202 ? -17.774  30.250  -75.241  1.00 140.17 ? 171 ARG B O   1 
ATOM 4673  C CB  . ARG B 1 202 ? -17.244  32.930  -74.613  1.00 145.44 ? 171 ARG B CB  1 
ATOM 4674  C CG  . ARG B 1 202 ? -15.866  33.012  -75.286  1.00 144.33 ? 171 ARG B CG  1 
ATOM 4675  C CD  . ARG B 1 202 ? -14.772  33.439  -74.309  1.00 144.96 ? 171 ARG B CD  1 
ATOM 4676  N NE  . ARG B 1 202 ? -13.439  33.045  -74.774  1.00 144.26 ? 171 ARG B NE  1 
ATOM 4677  C CZ  . ARG B 1 202 ? -12.296  33.279  -74.123  1.00 144.93 ? 171 ARG B CZ  1 
ATOM 4678  N NH1 . ARG B 1 202 ? -12.300  33.922  -72.961  1.00 146.95 ? 171 ARG B NH1 1 
ATOM 4679  N NH2 . ARG B 1 202 ? -11.140  32.872  -74.638  1.00 143.30 ? 171 ARG B NH2 1 
ATOM 4680  N N   . VAL B 1 203 ? -19.291  30.696  -76.852  1.00 139.59 ? 172 VAL B N   1 
ATOM 4681  C CA  . VAL B 1 203 ? -19.263  29.372  -77.476  1.00 136.78 ? 172 VAL B CA  1 
ATOM 4682  C C   . VAL B 1 203 ? -19.607  29.510  -78.947  1.00 136.45 ? 172 VAL B C   1 
ATOM 4683  O O   . VAL B 1 203 ? -20.500  30.280  -79.304  1.00 138.05 ? 172 VAL B O   1 
ATOM 4684  C CB  . VAL B 1 203 ? -20.286  28.393  -76.866  1.00 136.02 ? 172 VAL B CB  1 
ATOM 4685  C CG1 . VAL B 1 203 ? -20.282  27.060  -77.624  1.00 133.56 ? 172 VAL B CG1 1 
ATOM 4686  C CG2 . VAL B 1 203 ? -20.009  28.153  -75.399  1.00 136.98 ? 172 VAL B CG2 1 
ATOM 4687  N N   . LYS B 1 204 ? -18.896  28.776  -79.799  1.00 134.85 ? 173 LYS B N   1 
ATOM 4688  C CA  . LYS B 1 204 ? -19.313  28.605  -81.187  1.00 134.34 ? 173 LYS B CA  1 
ATOM 4689  C C   . LYS B 1 204 ? -20.094  27.297  -81.233  1.00 132.40 ? 173 LYS B C   1 
ATOM 4690  O O   . LYS B 1 204 ? -19.561  26.245  -80.857  1.00 131.24 ? 173 LYS B O   1 
ATOM 4691  C CB  . LYS B 1 204 ? -18.106  28.565  -82.131  1.00 134.48 ? 173 LYS B CB  1 
ATOM 4692  N N   . ILE B 1 205 ? -21.368  27.375  -81.630  1.00 132.13 ? 174 ILE B N   1 
ATOM 4693  C CA  . ILE B 1 205 ? -22.217  26.184  -81.776  1.00 130.10 ? 174 ILE B CA  1 
ATOM 4694  C C   . ILE B 1 205 ? -22.403  25.867  -83.240  1.00 129.92 ? 174 ILE B C   1 
ATOM 4695  O O   . ILE B 1 205 ? -22.812  26.718  -84.016  1.00 131.44 ? 174 ILE B O   1 
ATOM 4696  C CB  . ILE B 1 205 ? -23.624  26.295  -81.098  1.00 130.39 ? 174 ILE B CB  1 
ATOM 4697  C CG1 . ILE B 1 205 ? -24.152  27.743  -81.085  1.00 132.84 ? 174 ILE B CG1 1 
ATOM 4698  C CG2 . ILE B 1 205 ? -23.625  25.636  -79.732  1.00 129.35 ? 174 ILE B CG2 1 
ATOM 4699  C CD1 . ILE B 1 205 ? -23.846  28.573  -79.844  1.00 133.53 ? 174 ILE B CD1 1 
ATOM 4700  N N   . TYR B 1 206 ? -22.077  24.642  -83.618  1.00 128.58 ? 175 TYR B N   1 
ATOM 4701  C CA  . TYR B 1 206 ? -22.254  24.190  -84.986  1.00 128.87 ? 175 TYR B CA  1 
ATOM 4702  C C   . TYR B 1 206 ? -23.279  23.079  -84.951  1.00 127.76 ? 175 TYR B C   1 
ATOM 4703  O O   . TYR B 1 206 ? -23.266  22.258  -84.024  1.00 126.77 ? 175 TYR B O   1 
ATOM 4704  C CB  . TYR B 1 206 ? -20.947  23.621  -85.538  1.00 128.97 ? 175 TYR B CB  1 
ATOM 4705  C CG  . TYR B 1 206 ? -19.782  24.588  -85.617  1.00 130.39 ? 175 TYR B CG  1 
ATOM 4706  C CD1 . TYR B 1 206 ? -19.428  25.186  -86.823  1.00 132.37 ? 175 TYR B CD1 1 
ATOM 4707  C CD2 . TYR B 1 206 ? -19.013  24.880  -84.491  1.00 130.32 ? 175 TYR B CD2 1 
ATOM 4708  C CE1 . TYR B 1 206 ? -18.352  26.063  -86.901  1.00 133.97 ? 175 TYR B CE1 1 
ATOM 4709  C CE2 . TYR B 1 206 ? -17.935  25.756  -84.561  1.00 131.55 ? 175 TYR B CE2 1 
ATOM 4710  C CZ  . TYR B 1 206 ? -17.611  26.340  -85.766  1.00 133.37 ? 175 TYR B CZ  1 
ATOM 4711  O OH  . TYR B 1 206 ? -16.546  27.203  -85.831  1.00 135.35 ? 175 TYR B OH  1 
ATOM 4712  N N   . THR B 1 207 ? -24.169  23.049  -85.939  1.00 128.01 ? 176 THR B N   1 
ATOM 4713  C CA  . THR B 1 207 ? -25.142  21.959  -86.024  1.00 127.02 ? 176 THR B CA  1 
ATOM 4714  C C   . THR B 1 207 ? -24.947  21.204  -87.305  1.00 126.86 ? 176 THR B C   1 
ATOM 4715  O O   . THR B 1 207 ? -24.268  21.691  -88.199  1.00 128.01 ? 176 THR B O   1 
ATOM 4716  C CB  . THR B 1 207 ? -26.616  22.449  -85.984  1.00 127.90 ? 176 THR B CB  1 
ATOM 4717  O OG1 . THR B 1 207 ? -26.793  23.540  -86.891  1.00 130.35 ? 176 THR B OG1 1 
ATOM 4718  C CG2 . THR B 1 207 ? -27.019  22.892  -84.584  1.00 128.17 ? 176 THR B CG2 1 
ATOM 4719  N N   . PHE B 1 208 ? -25.534  20.015  -87.377  1.00 125.83 ? 177 PHE B N   1 
ATOM 4720  C CA  . PHE B 1 208 ? -25.740  19.323  -88.645  1.00 126.50 ? 177 PHE B CA  1 
ATOM 4721  C C   . PHE B 1 208 ? -26.853  18.296  -88.541  1.00 126.68 ? 177 PHE B C   1 
ATOM 4722  O O   . PHE B 1 208 ? -27.222  17.901  -87.444  1.00 126.11 ? 177 PHE B O   1 
ATOM 4723  C CB  . PHE B 1 208 ? -24.443  18.694  -89.159  1.00 126.37 ? 177 PHE B CB  1 
ATOM 4724  C CG  . PHE B 1 208 ? -23.958  17.517  -88.370  1.00 122.53 ? 177 PHE B CG  1 
ATOM 4725  C CD1 . PHE B 1 208 ? -23.854  16.273  -88.975  1.00 121.18 ? 177 PHE B CD1 1 
ATOM 4726  C CD2 . PHE B 1 208 ? -23.564  17.651  -87.057  1.00 119.45 ? 177 PHE B CD2 1 
ATOM 4727  C CE1 . PHE B 1 208 ? -23.392  15.174  -88.280  1.00 120.32 ? 177 PHE B CE1 1 
ATOM 4728  C CE2 . PHE B 1 208 ? -23.092  16.552  -86.355  1.00 119.13 ? 177 PHE B CE2 1 
ATOM 4729  C CZ  . PHE B 1 208 ? -23.010  15.308  -86.968  1.00 119.04 ? 177 PHE B CZ  1 
ATOM 4730  N N   . ASN B 1 209 ? -27.392  17.862  -89.675  1.00 128.28 ? 178 ASN B N   1 
ATOM 4731  C CA  . ASN B 1 209 ? -28.443  16.845  -89.665  1.00 128.69 ? 178 ASN B CA  1 
ATOM 4732  C C   . ASN B 1 209 ? -27.944  15.416  -89.905  1.00 129.07 ? 178 ASN B C   1 
ATOM 4733  O O   . ASN B 1 209 ? -27.119  15.176  -90.786  1.00 129.90 ? 178 ASN B O   1 
ATOM 4734  C CB  . ASN B 1 209 ? -29.527  17.187  -90.698  1.00 130.36 ? 178 ASN B CB  1 
ATOM 4735  C CG  . ASN B 1 209 ? -30.600  18.128  -90.155  1.00 130.44 ? 178 ASN B CG  1 
ATOM 4736  O OD1 . ASN B 1 209 ? -31.444  17.726  -89.357  1.00 129.71 ? 178 ASN B OD1 1 
ATOM 4737  N ND2 . ASN B 1 209 ? -30.591  19.374  -90.620  1.00 132.06 ? 178 ASN B ND2 1 
ATOM 4738  N N   . GLN B 1 210 ? -28.455  14.469  -89.122  1.00 129.22 ? 179 GLN B N   1 
ATOM 4739  C CA  . GLN B 1 210 ? -28.373  13.062  -89.491  1.00 131.04 ? 179 GLN B CA  1 
ATOM 4740  C C   . GLN B 1 210 ? -29.209  12.863  -90.740  1.00 132.79 ? 179 GLN B C   1 
ATOM 4741  O O   . GLN B 1 210 ? -29.981  13.745  -91.144  1.00 133.41 ? 179 GLN B O   1 
ATOM 4742  C CB  . GLN B 1 210 ? -28.994  12.139  -88.448  1.00 130.75 ? 179 GLN B CB  1 
ATOM 4743  C CG  . GLN B 1 210 ? -28.634  12.344  -87.005  1.00 131.71 ? 179 GLN B CG  1 
ATOM 4744  C CD  . GLN B 1 210 ? -29.304  11.292  -86.116  1.00 134.44 ? 179 GLN B CD  1 
ATOM 4745  O OE1 . GLN B 1 210 ? -29.469  10.135  -86.524  1.00 136.29 ? 179 GLN B OE1 1 
ATOM 4746  N NE2 . GLN B 1 210 ? -29.695  11.690  -84.900  1.00 134.39 ? 179 GLN B NE2 1 
ATOM 4747  N N   . SER B 1 211 ? -29.097  11.667  -91.306  1.00 134.28 ? 180 SER B N   1 
ATOM 4748  C CA  . SER B 1 211 ? -29.850  11.281  -92.496  1.00 136.06 ? 180 SER B CA  1 
ATOM 4749  C C   . SER B 1 211 ? -31.351  11.048  -92.257  1.00 136.06 ? 180 SER B C   1 
ATOM 4750  O O   . SER B 1 211 ? -31.821  10.993  -91.114  1.00 134.87 ? 180 SER B O   1 
ATOM 4751  C CB  . SER B 1 211 ? -29.204  10.043  -93.107  1.00 137.44 ? 180 SER B CB  1 
ATOM 4752  O OG  . SER B 1 211 ? -28.371  9.424   -92.143  1.00 137.08 ? 180 SER B OG  1 
ATOM 4753  N N   . ARG B 1 212 ? -32.082  10.965  -93.368  1.00 137.94 ? 181 ARG B N   1 
ATOM 4754  C CA  . ARG B 1 212 ? -33.469  10.511  -93.442  1.00 138.56 ? 181 ARG B CA  1 
ATOM 4755  C C   . ARG B 1 212 ? -33.413  9.099   -93.985  1.00 140.09 ? 181 ARG B C   1 
ATOM 4756  O O   . ARG B 1 212 ? -32.691  8.830   -94.941  1.00 141.78 ? 181 ARG B O   1 
ATOM 4757  C CB  . ARG B 1 212 ? -34.228  11.338  -94.478  1.00 140.04 ? 181 ARG B CB  1 
ATOM 4758  C CG  . ARG B 1 212 ? -35.068  12.495  -93.975  1.00 139.83 ? 181 ARG B CG  1 
ATOM 4759  C CD  . ARG B 1 212 ? -35.920  13.066  -95.135  1.00 142.51 ? 181 ARG B CD  1 
ATOM 4760  N NE  . ARG B 1 212 ? -37.136  13.724  -94.656  1.00 142.19 ? 181 ARG B NE  1 
ATOM 4761  C CZ  . ARG B 1 212 ? -38.333  13.145  -94.543  1.00 142.19 ? 181 ARG B CZ  1 
ATOM 4762  N NH1 . ARG B 1 212 ? -38.531  11.866  -94.889  1.00 141.36 ? 181 ARG B NH1 1 
ATOM 4763  N NH2 . ARG B 1 212 ? -39.344  13.863  -94.075  1.00 142.80 ? 181 ARG B NH2 1 
ATOM 4764  N N   . TYR B 1 213 ? -34.173  8.192   -93.403  1.00 140.23 ? 182 TYR B N   1 
ATOM 4765  C CA  . TYR B 1 213 ? -34.224  6.841   -93.919  1.00 142.50 ? 182 TYR B CA  1 
ATOM 4766  C C   . TYR B 1 213 ? -35.677  6.418   -93.891  1.00 143.65 ? 182 TYR B C   1 
ATOM 4767  O O   . TYR B 1 213 ? -36.390  6.741   -92.937  1.00 142.71 ? 182 TYR B O   1 
ATOM 4768  C CB  . TYR B 1 213 ? -33.404  5.902   -93.036  1.00 142.45 ? 182 TYR B CB  1 
ATOM 4769  C CG  . TYR B 1 213 ? -31.945  5.672   -93.409  1.00 143.48 ? 182 TYR B CG  1 
ATOM 4770  C CD1 . TYR B 1 213 ? -31.480  4.388   -93.684  1.00 145.61 ? 182 TYR B CD1 1 
ATOM 4771  C CD2 . TYR B 1 213 ? -31.019  6.723   -93.435  1.00 142.76 ? 182 TYR B CD2 1 
ATOM 4772  C CE1 . TYR B 1 213 ? -30.140  4.157   -94.009  1.00 146.71 ? 182 TYR B CE1 1 
ATOM 4773  C CE2 . TYR B 1 213 ? -29.672  6.500   -93.761  1.00 143.19 ? 182 TYR B CE2 1 
ATOM 4774  C CZ  . TYR B 1 213 ? -29.243  5.214   -94.042  1.00 145.17 ? 182 TYR B CZ  1 
ATOM 4775  O OH  . TYR B 1 213 ? -27.925  4.981   -94.361  1.00 145.99 ? 182 TYR B OH  1 
ATOM 4776  N N   . PRO B 1 214 ? -36.135  5.701   -94.932  1.00 146.23 ? 183 PRO B N   1 
ATOM 4777  C CA  . PRO B 1 214 ? -37.531  5.278   -94.975  1.00 147.52 ? 183 PRO B CA  1 
ATOM 4778  C C   . PRO B 1 214 ? -37.762  3.887   -94.370  1.00 148.60 ? 183 PRO B C   1 
ATOM 4779  O O   . PRO B 1 214 ? -36.985  2.950   -94.603  1.00 149.74 ? 183 PRO B O   1 
ATOM 4780  C CB  . PRO B 1 214 ? -37.851  5.305   -96.472  1.00 149.64 ? 183 PRO B CB  1 
ATOM 4781  C CG  . PRO B 1 214 ? -36.533  5.057   -97.151  1.00 150.42 ? 183 PRO B CG  1 
ATOM 4782  C CD  . PRO B 1 214 ? -35.419  5.326   -96.162  1.00 148.32 ? 183 PRO B CD  1 
ATOM 4783  N N   . ARG B 1 215 ? -38.842  3.772   -93.608  1.00 148.77 ? 184 ARG B N   1 
ATOM 4784  C CA  . ARG B 1 215 ? -39.113  2.587   -92.811  1.00 150.20 ? 184 ARG B CA  1 
ATOM 4785  C C   . ARG B 1 215 ? -39.689  1.475   -93.679  1.00 153.09 ? 184 ARG B C   1 
ATOM 4786  O O   . ARG B 1 215 ? -40.499  1.721   -94.581  1.00 154.09 ? 184 ARG B O   1 
ATOM 4787  C CB  . ARG B 1 215 ? -40.050  2.948   -91.655  1.00 149.46 ? 184 ARG B CB  1 
ATOM 4788  C CG  . ARG B 1 215 ? -39.953  4.420   -91.208  1.00 147.92 ? 184 ARG B CG  1 
ATOM 4789  C CD  . ARG B 1 215 ? -40.684  5.362   -92.183  1.00 148.56 ? 184 ARG B CD  1 
ATOM 4790  N NE  . ARG B 1 215 ? -39.946  6.589   -92.485  1.00 147.37 ? 184 ARG B NE  1 
ATOM 4791  C CZ  . ARG B 1 215 ? -40.519  7.718   -92.893  1.00 147.99 ? 184 ARG B CZ  1 
ATOM 4792  N NH1 . ARG B 1 215 ? -41.847  7.782   -93.026  1.00 149.11 ? 184 ARG B NH1 1 
ATOM 4793  N NH2 . ARG B 1 215 ? -39.769  8.787   -93.153  1.00 147.14 ? 184 ARG B NH2 1 
ATOM 4794  N N   . ILE B 1 216 ? -39.260  0.252   -93.403  1.00 155.16 ? 185 ILE B N   1 
ATOM 4795  C CA  . ILE B 1 216 ? -39.578  -0.886  -94.259  1.00 158.70 ? 185 ILE B CA  1 
ATOM 4796  C C   . ILE B 1 216 ? -40.771  -1.731  -93.702  1.00 160.73 ? 185 ILE B C   1 
ATOM 4797  O O   . ILE B 1 216 ? -41.005  -1.743  -92.493  1.00 160.32 ? 185 ILE B O   1 
ATOM 4798  C CB  . ILE B 1 216 ? -38.257  -1.687  -94.564  1.00 160.02 ? 185 ILE B CB  1 
ATOM 4799  C CG1 . ILE B 1 216 ? -38.392  -2.582  -95.792  1.00 163.48 ? 185 ILE B CG1 1 
ATOM 4800  C CG2 . ILE B 1 216 ? -37.759  -2.464  -93.367  1.00 160.44 ? 185 ILE B CG2 1 
ATOM 4801  C CD1 . ILE B 1 216 ? -37.782  -1.988  -97.033  1.00 164.62 ? 185 ILE B CD1 1 
ATOM 4802  N N   . ASN B 1 217 ? -41.544  -2.383  -94.584  1.00 163.49 ? 186 ASN B N   1 
ATOM 4803  C CA  . ASN B 1 217 ? -42.683  -3.253  -94.197  1.00 165.92 ? 186 ASN B CA  1 
ATOM 4804  C C   . ASN B 1 217 ? -42.231  -4.514  -93.499  1.00 168.15 ? 186 ASN B C   1 
ATOM 4805  O O   . ASN B 1 217 ? -41.278  -5.144  -93.955  1.00 169.77 ? 186 ASN B O   1 
ATOM 4806  C CB  . ASN B 1 217 ? -43.450  -3.714  -95.435  1.00 168.20 ? 186 ASN B CB  1 
ATOM 4807  C CG  . ASN B 1 217 ? -44.577  -2.782  -95.819  1.00 168.35 ? 186 ASN B CG  1 
ATOM 4808  O OD1 . ASN B 1 217 ? -44.361  -1.608  -96.134  1.00 168.12 ? 186 ASN B OD1 1 
ATOM 4809  N ND2 . ASN B 1 217 ? -45.793  -3.311  -95.826  1.00 170.39 ? 186 ASN B ND2 1 
ATOM 4810  N N   . LYS B 1 218 ? -42.919  -4.920  -92.432  1.00 169.18 ? 187 LYS B N   1 
ATOM 4811  C CA  . LYS B 1 218 ? -42.525  -6.149  -91.726  1.00 171.97 ? 187 LYS B CA  1 
ATOM 4812  C C   . LYS B 1 218 ? -42.803  -7.414  -92.537  1.00 175.70 ? 187 LYS B C   1 
ATOM 4813  O O   . LYS B 1 218 ? -42.001  -8.354  -92.512  1.00 178.14 ? 187 LYS B O   1 
ATOM 4814  C CB  . LYS B 1 218 ? -43.158  -6.252  -90.341  1.00 172.37 ? 187 LYS B CB  1 
ATOM 4815  N N   . GLU B 1 219 ? -43.924  -7.431  -93.260  1.00 176.68 ? 188 GLU B N   1 
ATOM 4816  C CA  . GLU B 1 219 ? -44.283  -8.587  -94.078  1.00 180.22 ? 188 GLU B CA  1 
ATOM 4817  C C   . GLU B 1 219 ? -43.470  -8.609  -95.372  1.00 180.77 ? 188 GLU B C   1 
ATOM 4818  O O   . GLU B 1 219 ? -42.558  -9.427  -95.530  1.00 182.66 ? 188 GLU B O   1 
ATOM 4819  C CB  . GLU B 1 219 ? -45.791  -8.609  -94.367  1.00 181.19 ? 188 GLU B CB  1 
ATOM 4820  N N   . SER B 1 220 ? -43.784  -7.678  -96.271  1.00 179.49 ? 189 SER B N   1 
ATOM 4821  C CA  . SER B 1 220 ? -43.241  -7.677  -97.636  1.00 180.90 ? 189 SER B CA  1 
ATOM 4822  C C   . SER B 1 220 ? -41.764  -7.303  -97.701  1.00 179.72 ? 189 SER B C   1 
ATOM 4823  O O   . SER B 1 220 ? -41.051  -7.753  -98.602  1.00 181.98 ? 189 SER B O   1 
ATOM 4824  C CB  . SER B 1 220 ? -44.062  -6.756  -98.560  1.00 180.17 ? 189 SER B CB  1 
ATOM 4825  O OG  . SER B 1 220 ? -43.975  -5.390  -98.171  1.00 177.17 ? 189 SER B OG  1 
ATOM 4826  N N   . LEU B 1 221 ? -41.321  -6.501  -96.729  1.00 176.50 ? 190 LEU B N   1 
ATOM 4827  C CA  . LEU B 1 221 ? -40.012  -5.831  -96.742  1.00 174.70 ? 190 LEU B CA  1 
ATOM 4828  C C   . LEU B 1 221 ? -39.951  -4.753  -97.830  1.00 173.42 ? 190 LEU B C   1 
ATOM 4829  O O   . LEU B 1 221 ? -38.959  -4.624  -98.547  1.00 174.21 ? 190 LEU B O   1 
ATOM 4830  C CB  . LEU B 1 221 ? -38.836  -6.818  -96.854  1.00 177.42 ? 190 LEU B CB  1 
ATOM 4831  C CG  . LEU B 1 221 ? -38.708  -7.929  -95.808  1.00 179.70 ? 190 LEU B CG  1 
ATOM 4832  C CD1 . LEU B 1 221 ? -39.241  -9.267  -96.359  1.00 184.61 ? 190 LEU B CD1 1 
ATOM 4833  C CD2 . LEU B 1 221 ? -37.258  -8.061  -95.365  1.00 179.64 ? 190 LEU B CD2 1 
ATOM 4834  N N   . LEU B 1 222 ? -41.017  -3.967  -97.926  1.00 171.78 ? 191 LEU B N   1 
ATOM 4835  C CA  . LEU B 1 222 ? -41.103  -2.900  -98.913  1.00 171.07 ? 191 LEU B CA  1 
ATOM 4836  C C   . LEU B 1 222 ? -41.039  -1.525  -98.233  1.00 167.44 ? 191 LEU B C   1 
ATOM 4837  O O   . LEU B 1 222 ? -41.584  -1.333  -97.147  1.00 165.84 ? 191 LEU B O   1 
ATOM 4838  C CB  . LEU B 1 222 ? -42.393  -3.047  -99.739  1.00 173.01 ? 191 LEU B CB  1 
ATOM 4839  C CG  . LEU B 1 222 ? -42.339  -2.804  -101.256 1.00 175.74 ? 191 LEU B CG  1 
ATOM 4840  C CD1 . LEU B 1 222 ? -41.357  -3.768  -101.945 1.00 178.74 ? 191 LEU B CD1 1 
ATOM 4841  C CD2 . LEU B 1 222 ? -43.733  -2.864  -101.915 1.00 177.08 ? 191 LEU B CD2 1 
ATOM 4842  N N   . PRO B 1 223 ? -40.351  -0.564  -98.860  1.00 166.52 ? 192 PRO B N   1 
ATOM 4843  C CA  . PRO B 1 223 ? -40.329  0.796   -98.337  1.00 163.77 ? 192 PRO B CA  1 
ATOM 4844  C C   . PRO B 1 223 ? -41.715  1.398   -98.413  1.00 163.80 ? 192 PRO B C   1 
ATOM 4845  O O   . PRO B 1 223 ? -42.488  1.009   -99.282  1.00 166.15 ? 192 PRO B O   1 
ATOM 4846  C CB  . PRO B 1 223 ? -39.423  1.529   -99.322  1.00 164.26 ? 192 PRO B CB  1 
ATOM 4847  C CG  . PRO B 1 223 ? -38.632  0.468   -99.977  1.00 166.85 ? 192 PRO B CG  1 
ATOM 4848  C CD  . PRO B 1 223 ? -39.513  -0.709  -100.059 1.00 168.65 ? 192 PRO B CD  1 
ATOM 4849  N N   . VAL B 1 224 ? -42.031  2.345   -97.535  1.00 161.84 ? 193 VAL B N   1 
ATOM 4850  C CA  . VAL B 1 224 ? -43.346  3.000   -97.581  1.00 162.39 ? 193 VAL B CA  1 
ATOM 4851  C C   . VAL B 1 224 ? -43.305  4.432   -98.175  1.00 162.37 ? 193 VAL B C   1 
ATOM 4852  O O   . VAL B 1 224 ? -42.907  5.379   -97.495  1.00 160.29 ? 193 VAL B O   1 
ATOM 4853  C CB  . VAL B 1 224 ? -44.038  2.976   -96.202  1.00 161.24 ? 193 VAL B CB  1 
ATOM 4854  C CG1 . VAL B 1 224 ? -45.554  3.069   -96.377  1.00 162.81 ? 193 VAL B CG1 1 
ATOM 4855  C CG2 . VAL B 1 224 ? -43.663  1.703   -95.432  1.00 160.98 ? 193 VAL B CG2 1 
ATOM 4856  N N   . ALA B 1 225 ? -43.739  4.565   -99.437  1.00 165.18 ? 194 ALA B N   1 
ATOM 4857  C CA  . ALA B 1 225 ? -43.585  5.802   -100.259 1.00 166.36 ? 194 ALA B CA  1 
ATOM 4858  C C   . ALA B 1 225 ? -44.544  6.942   -99.913  1.00 166.32 ? 194 ALA B C   1 
ATOM 4859  O O   . ALA B 1 225 ? -45.220  6.910   -98.887  1.00 165.34 ? 194 ALA B O   1 
ATOM 4860  C CB  . ALA B 1 225 ? -43.682  5.481   -101.765 1.00 169.52 ? 194 ALA B CB  1 
ATOM 4861  N N   . TYR B 1 239 ? -37.844  8.069   -90.335  1.00 133.21 ? 208 TYR B N   1 
ATOM 4862  C CA  . TYR B 1 239 ? -36.910  7.814   -89.233  1.00 132.84 ? 208 TYR B CA  1 
ATOM 4863  C C   . TYR B 1 239 ? -35.470  8.189   -89.543  1.00 132.30 ? 208 TYR B C   1 
ATOM 4864  O O   . TYR B 1 239 ? -35.092  8.193   -90.713  1.00 133.14 ? 208 TYR B O   1 
ATOM 4865  C CB  . TYR B 1 239 ? -36.954  6.339   -88.807  1.00 133.96 ? 208 TYR B CB  1 
ATOM 4866  C CG  . TYR B 1 239 ? -35.989  5.364   -89.494  1.00 134.12 ? 208 TYR B CG  1 
ATOM 4867  C CD1 . TYR B 1 239 ? -34.717  5.114   -88.980  1.00 133.63 ? 208 TYR B CD1 1 
ATOM 4868  C CD2 . TYR B 1 239 ? -36.381  4.638   -90.612  1.00 135.93 ? 208 TYR B CD2 1 
ATOM 4869  C CE1 . TYR B 1 239 ? -33.846  4.193   -89.595  1.00 134.95 ? 208 TYR B CE1 1 
ATOM 4870  C CE2 . TYR B 1 239 ? -35.521  3.711   -91.228  1.00 137.10 ? 208 TYR B CE2 1 
ATOM 4871  C CZ  . TYR B 1 239 ? -34.258  3.493   -90.718  1.00 136.44 ? 208 TYR B CZ  1 
ATOM 4872  O OH  . TYR B 1 239 ? -33.420  2.590   -91.348  1.00 137.28 ? 208 TYR B OH  1 
ATOM 4873  N N   . PRO B 1 240 ? -34.663  8.501   -88.493  1.00 131.63 ? 209 PRO B N   1 
ATOM 4874  C CA  . PRO B 1 240 ? -33.180  8.656   -88.519  1.00 131.22 ? 209 PRO B CA  1 
ATOM 4875  C C   . PRO B 1 240 ? -32.353  7.487   -87.882  1.00 132.01 ? 209 PRO B C   1 
ATOM 4876  O O   . PRO B 1 240 ? -32.517  7.190   -86.696  1.00 132.02 ? 209 PRO B O   1 
ATOM 4877  C CB  . PRO B 1 240 ? -32.962  9.964   -87.755  1.00 129.88 ? 209 PRO B CB  1 
ATOM 4878  C CG  . PRO B 1 240 ? -34.202  10.109  -86.873  1.00 130.23 ? 209 PRO B CG  1 
ATOM 4879  C CD  . PRO B 1 240 ? -35.224  9.068   -87.256  1.00 131.19 ? 209 PRO B CD  1 
ATOM 4880  N N   . PRO B 1 241 ? -31.425  6.881   -88.661  1.00 133.06 ? 210 PRO B N   1 
ATOM 4881  C CA  . PRO B 1 241 ? -30.847  5.513   -88.566  1.00 134.99 ? 210 PRO B CA  1 
ATOM 4882  C C   . PRO B 1 241 ? -29.913  5.177   -87.383  1.00 135.55 ? 210 PRO B C   1 
ATOM 4883  O O   . PRO B 1 241 ? -29.035  4.306   -87.501  1.00 136.52 ? 210 PRO B O   1 
ATOM 4884  C CB  . PRO B 1 241 ? -30.077  5.398   -89.874  1.00 135.98 ? 210 PRO B CB  1 
ATOM 4885  C CG  . PRO B 1 241 ? -29.572  6.787   -90.082  1.00 134.54 ? 210 PRO B CG  1 
ATOM 4886  C CD  . PRO B 1 241 ? -30.685  7.699   -89.639  1.00 132.75 ? 210 PRO B CD  1 
ATOM 4887  N N   . GLY B 1 242 ? -30.132  5.845   -86.255  1.00 135.24 ? 211 GLY B N   1 
ATOM 4888  C CA  . GLY B 1 242 ? -29.365  5.618   -85.020  1.00 136.42 ? 211 GLY B CA  1 
ATOM 4889  C C   . GLY B 1 242 ? -28.407  6.761   -84.740  1.00 135.35 ? 211 GLY B C   1 
ATOM 4890  O O   . GLY B 1 242 ? -28.388  7.762   -85.472  1.00 134.14 ? 211 GLY B O   1 
ATOM 4891  N N   . HIS B 1 243 ? -27.611  6.632   -83.679  1.00 136.09 ? 212 HIS B N   1 
ATOM 4892  C CA  . HIS B 1 243 ? -26.498  7.570   -83.501  1.00 135.13 ? 212 HIS B CA  1 
ATOM 4893  C C   . HIS B 1 243 ? -25.282  7.139   -84.316  1.00 135.59 ? 212 HIS B C   1 
ATOM 4894  O O   . HIS B 1 243 ? -24.585  7.978   -84.884  1.00 134.21 ? 212 HIS B O   1 
ATOM 4895  C CB  . HIS B 1 243 ? -26.160  7.867   -82.021  1.00 135.59 ? 212 HIS B CB  1 
ATOM 4896  C CG  . HIS B 1 243 ? -26.231  6.682   -81.110  1.00 138.27 ? 212 HIS B CG  1 
ATOM 4897  N ND1 . HIS B 1 243 ? -25.282  5.684   -81.109  1.00 140.87 ? 212 HIS B ND1 1 
ATOM 4898  C CD2 . HIS B 1 243 ? -27.116  6.360   -80.137  1.00 140.41 ? 212 HIS B CD2 1 
ATOM 4899  C CE1 . HIS B 1 243 ? -25.592  4.784   -80.192  1.00 143.67 ? 212 HIS B CE1 1 
ATOM 4900  N NE2 . HIS B 1 243 ? -26.701  5.170   -79.587  1.00 143.44 ? 212 HIS B NE2 1 
ATOM 4901  N N   . GLY B 1 244 ? -25.076  5.827   -84.407  1.00 137.64 ? 213 GLY B N   1 
ATOM 4902  C CA  . GLY B 1 244 ? -23.954  5.251   -85.137  1.00 139.64 ? 213 GLY B CA  1 
ATOM 4903  C C   . GLY B 1 244 ? -23.770  5.739   -86.556  1.00 139.55 ? 213 GLY B C   1 
ATOM 4904  O O   . GLY B 1 244 ? -22.833  5.353   -87.248  1.00 141.10 ? 213 GLY B O   1 
ATOM 4905  N N   . ASP B 1 245 ? -24.659  6.605   -87.001  1.00 138.31 ? 214 ASP B N   1 
ATOM 4906  C CA  . ASP B 1 245 ? -24.538  7.124   -88.341  1.00 138.92 ? 214 ASP B CA  1 
ATOM 4907  C C   . ASP B 1 245 ? -23.859  8.465   -88.307  1.00 137.41 ? 214 ASP B C   1 
ATOM 4908  O O   . ASP B 1 245 ? -23.763  9.138   -89.330  1.00 137.41 ? 214 ASP B O   1 
ATOM 4909  C CB  . ASP B 1 245 ? -25.908  7.248   -89.001  1.00 138.97 ? 214 ASP B CB  1 
ATOM 4910  C CG  . ASP B 1 245 ? -25.843  7.022   -90.494  1.00 141.56 ? 214 ASP B CG  1 
ATOM 4911  O OD1 . ASP B 1 245 ? -25.760  5.837   -90.927  1.00 143.83 ? 214 ASP B OD1 1 
ATOM 4912  O OD2 . ASP B 1 245 ? -25.867  8.042   -91.222  1.00 142.80 ? 214 ASP B OD2 1 
ATOM 4913  N N   . ILE B 1 246 ? -23.391  8.844   -87.121  1.00 136.48 ? 215 ILE B N   1 
ATOM 4914  C CA  . ILE B 1 246 ? -22.709  10.120  -86.925  1.00 135.38 ? 215 ILE B CA  1 
ATOM 4915  C C   . ILE B 1 246 ? -21.537  10.295  -87.890  1.00 136.86 ? 215 ILE B C   1 
ATOM 4916  O O   . ILE B 1 246 ? -21.341  11.386  -88.425  1.00 136.72 ? 215 ILE B O   1 
ATOM 4917  C CB  . ILE B 1 246 ? -22.233  10.334  -85.454  1.00 134.70 ? 215 ILE B CB  1 
ATOM 4918  C CG1 . ILE B 1 246 ? -21.730  11.770  -85.267  1.00 133.28 ? 215 ILE B CG1 1 
ATOM 4919  C CG2 . ILE B 1 246 ? -21.171  9.299   -85.038  1.00 136.39 ? 215 ILE B CG2 1 
ATOM 4920  C CD1 . ILE B 1 246 ? -21.420  12.150  -83.840  1.00 132.39 ? 215 ILE B CD1 1 
ATOM 4921  N N   . TYR B 1 247 ? -20.783  9.216   -88.120  1.00 138.74 ? 216 TYR B N   1 
ATOM 4922  C CA  . TYR B 1 247 ? -19.571  9.255   -88.943  1.00 140.07 ? 216 TYR B CA  1 
ATOM 4923  C C   . TYR B 1 247 ? -19.906  9.654   -90.372  1.00 140.66 ? 216 TYR B C   1 
ATOM 4924  O O   . TYR B 1 247 ? -19.569  10.754  -90.812  1.00 140.15 ? 216 TYR B O   1 
ATOM 4925  C CB  . TYR B 1 247 ? -18.859  7.898   -88.910  1.00 142.60 ? 216 TYR B CB  1 
ATOM 4926  C CG  . TYR B 1 247 ? -18.707  7.306   -87.528  1.00 141.98 ? 216 TYR B CG  1 
ATOM 4927  C CD1 . TYR B 1 247 ? -18.093  8.019   -86.503  1.00 140.66 ? 216 TYR B CD1 1 
ATOM 4928  C CD2 . TYR B 1 247 ? -19.168  6.027   -87.251  1.00 143.46 ? 216 TYR B CD2 1 
ATOM 4929  C CE1 . TYR B 1 247 ? -17.954  7.475   -85.234  1.00 141.05 ? 216 TYR B CE1 1 
ATOM 4930  C CE2 . TYR B 1 247 ? -19.028  5.472   -85.986  1.00 143.98 ? 216 TYR B CE2 1 
ATOM 4931  C CZ  . TYR B 1 247 ? -18.422  6.200   -84.985  1.00 142.63 ? 216 TYR B CZ  1 
ATOM 4932  O OH  . TYR B 1 247 ? -18.284  5.650   -83.736  1.00 143.58 ? 216 TYR B OH  1 
ATOM 4933  N N   . ALA B 1 248 ? -20.600  8.760   -91.069  1.00 141.72 ? 217 ALA B N   1 
ATOM 4934  C CA  . ALA B 1 248 ? -21.077  9.004   -92.420  1.00 143.01 ? 217 ALA B CA  1 
ATOM 4935  C C   . ALA B 1 248 ? -21.618  10.423  -92.609  1.00 141.28 ? 217 ALA B C   1 
ATOM 4936  O O   . ALA B 1 248 ? -21.385  11.065  -93.636  1.00 142.79 ? 217 ALA B O   1 
ATOM 4937  C CB  . ALA B 1 248 ? -22.145  7.975   -92.784  1.00 143.77 ? 217 ALA B CB  1 
ATOM 4938  N N   . SER B 1 249 ? -22.335  10.908  -91.607  1.00 138.57 ? 218 SER B N   1 
ATOM 4939  C CA  . SER B 1 249 ? -23.007  12.186  -91.719  1.00 137.36 ? 218 SER B CA  1 
ATOM 4940  C C   . SER B 1 249 ? -22.172  13.339  -91.196  1.00 136.24 ? 218 SER B C   1 
ATOM 4941  O O   . SER B 1 249 ? -22.471  14.481  -91.494  1.00 136.09 ? 218 SER B O   1 
ATOM 4942  C CB  . SER B 1 249 ? -24.388  12.147  -91.041  1.00 135.89 ? 218 SER B CB  1 
ATOM 4943  O OG  . SER B 1 249 ? -24.346  11.538  -89.754  1.00 135.74 ? 218 SER B OG  1 
ATOM 4944  N N   . PHE B 1 250 ? -21.137  13.057  -90.413  1.00 135.90 ? 219 PHE B N   1 
ATOM 4945  C CA  . PHE B 1 250 ? -20.259  14.124  -89.945  1.00 135.36 ? 219 PHE B CA  1 
ATOM 4946  C C   . PHE B 1 250 ? -19.283  14.403  -91.054  1.00 138.17 ? 219 PHE B C   1 
ATOM 4947  O O   . PHE B 1 250 ? -19.055  15.560  -91.423  1.00 138.49 ? 219 PHE B O   1 
ATOM 4948  C CB  . PHE B 1 250 ? -19.503  13.724  -88.679  1.00 134.29 ? 219 PHE B CB  1 
ATOM 4949  C CG  . PHE B 1 250 ? -18.872  14.882  -87.948  1.00 132.59 ? 219 PHE B CG  1 
ATOM 4950  C CD1 . PHE B 1 250 ? -19.428  16.158  -88.003  1.00 131.24 ? 219 PHE B CD1 1 
ATOM 4951  C CD2 . PHE B 1 250 ? -17.735  14.688  -87.167  1.00 132.38 ? 219 PHE B CD2 1 
ATOM 4952  C CE1 . PHE B 1 250 ? -18.844  17.226  -87.300  1.00 130.62 ? 219 PHE B CE1 1 
ATOM 4953  C CE2 . PHE B 1 250 ? -17.143  15.754  -86.465  1.00 131.34 ? 219 PHE B CE2 1 
ATOM 4954  C CZ  . PHE B 1 250 ? -17.698  17.020  -86.534  1.00 130.26 ? 219 PHE B CZ  1 
ATOM 4955  N N   . TYR B 1 251 ? -18.721  13.312  -91.581  1.00 140.70 ? 220 TYR B N   1 
ATOM 4956  C CA  . TYR B 1 251 ? -17.775  13.344  -92.696  1.00 144.11 ? 220 TYR B CA  1 
ATOM 4957  C C   . TYR B 1 251 ? -18.391  14.115  -93.861  1.00 145.26 ? 220 TYR B C   1 
ATOM 4958  O O   . TYR B 1 251 ? -17.850  15.136  -94.300  1.00 146.61 ? 220 TYR B O   1 
ATOM 4959  C CB  . TYR B 1 251 ? -17.380  11.910  -93.116  1.00 146.51 ? 220 TYR B CB  1 
ATOM 4960  C CG  . TYR B 1 251 ? -16.531  11.869  -94.359  1.00 151.24 ? 220 TYR B CG  1 
ATOM 4961  C CD1 . TYR B 1 251 ? -15.206  12.315  -94.333  1.00 153.95 ? 220 TYR B CD1 1 
ATOM 4962  C CD2 . TYR B 1 251 ? -17.052  11.410  -95.566  1.00 154.76 ? 220 TYR B CD2 1 
ATOM 4963  C CE1 . TYR B 1 251 ? -14.414  12.307  -95.478  1.00 159.00 ? 220 TYR B CE1 1 
ATOM 4964  C CE2 . TYR B 1 251 ? -16.267  11.389  -96.723  1.00 160.15 ? 220 TYR B CE2 1 
ATOM 4965  C CZ  . TYR B 1 251 ? -14.948  11.842  -96.672  1.00 162.00 ? 220 TYR B CZ  1 
ATOM 4966  O OH  . TYR B 1 251 ? -14.168  11.832  -97.811  1.00 166.55 ? 220 TYR B OH  1 
ATOM 4967  N N   . ASN B 1 252 ? -19.547  13.624  -94.307  1.00 144.97 ? 221 ASN B N   1 
ATOM 4968  C CA  . ASN B 1 252 ? -20.322  14.191  -95.394  1.00 146.00 ? 221 ASN B CA  1 
ATOM 4969  C C   . ASN B 1 252 ? -20.657  15.671  -95.245  1.00 144.55 ? 221 ASN B C   1 
ATOM 4970  O O   . ASN B 1 252 ? -20.650  16.395  -96.226  1.00 147.16 ? 221 ASN B O   1 
ATOM 4971  C CB  . ASN B 1 252 ? -21.608  13.397  -95.546  1.00 145.50 ? 221 ASN B CB  1 
ATOM 4972  C CG  . ASN B 1 252 ? -21.849  12.971  -96.962  1.00 149.99 ? 221 ASN B CG  1 
ATOM 4973  O OD1 . ASN B 1 252 ? -20.905  12.629  -97.686  1.00 154.21 ? 221 ASN B OD1 1 
ATOM 4974  N ND2 . ASN B 1 252 ? -23.119  12.980  -97.379  1.00 151.23 ? 221 ASN B ND2 1 
ATOM 4975  N N   . SER B 1 253 ? -20.931  16.112  -94.023  1.00 140.97 ? 222 SER B N   1 
ATOM 4976  C CA  . SER B 1 253 ? -21.329  17.486  -93.736  1.00 139.76 ? 222 SER B CA  1 
ATOM 4977  C C   . SER B 1 253 ? -20.253  18.520  -93.993  1.00 141.28 ? 222 SER B C   1 
ATOM 4978  O O   . SER B 1 253 ? -20.545  19.715  -94.005  1.00 141.38 ? 222 SER B O   1 
ATOM 4979  C CB  . SER B 1 253 ? -21.662  17.602  -92.267  1.00 136.91 ? 222 SER B CB  1 
ATOM 4980  O OG  . SER B 1 253 ? -20.468  17.538  -91.497  1.00 136.32 ? 222 SER B OG  1 
ATOM 4981  N N   . GLY B 1 254 ? -19.009  18.063  -94.137  1.00 142.68 ? 223 GLY B N   1 
ATOM 4982  C CA  . GLY B 1 254 ? -17.844  18.947  -94.306  1.00 144.44 ? 223 GLY B CA  1 
ATOM 4983  C C   . GLY B 1 254 ? -17.559  19.735  -93.040  1.00 142.04 ? 223 GLY B C   1 
ATOM 4984  O O   . GLY B 1 254 ? -17.962  20.897  -92.911  1.00 141.86 ? 223 GLY B O   1 
ATOM 4985  N N   . LEU B 1 255 ? -16.872  19.090  -92.104  1.00 140.47 ? 224 LEU B N   1 
ATOM 4986  C CA  . LEU B 1 255 ? -16.695  19.608  -90.751  1.00 138.08 ? 224 LEU B CA  1 
ATOM 4987  C C   . LEU B 1 255 ? -15.578  18.824  -90.100  1.00 138.20 ? 224 LEU B C   1 
ATOM 4988  O O   . LEU B 1 255 ? -14.746  19.376  -89.383  1.00 138.04 ? 224 LEU B O   1 
ATOM 4989  C CB  . LEU B 1 255 ? -17.969  19.415  -89.913  1.00 135.34 ? 224 LEU B CB  1 
ATOM 4990  C CG  . LEU B 1 255 ? -19.039  20.479  -89.658  1.00 133.74 ? 224 LEU B CG  1 
ATOM 4991  C CD1 . LEU B 1 255 ? -19.935  19.963  -88.569  1.00 129.99 ? 224 LEU B CD1 1 
ATOM 4992  C CD2 . LEU B 1 255 ? -18.464  21.823  -89.237  1.00 134.04 ? 224 LEU B CD2 1 
ATOM 4993  N N   . LEU B 1 256 ? -15.603  17.517  -90.333  1.00 138.80 ? 225 LEU B N   1 
ATOM 4994  C CA  . LEU B 1 256 ? -14.518  16.638  -89.975  1.00 139.94 ? 225 LEU B CA  1 
ATOM 4995  C C   . LEU B 1 256 ? -13.266  17.187  -90.647  1.00 143.08 ? 225 LEU B C   1 
ATOM 4996  O O   . LEU B 1 256 ? -12.207  17.320  -90.013  1.00 143.75 ? 225 LEU B O   1 
ATOM 4997  C CB  . LEU B 1 256 ? -14.816  15.252  -90.517  1.00 140.79 ? 225 LEU B CB  1 
ATOM 4998  C CG  . LEU B 1 256 ? -13.919  14.143  -90.006  1.00 141.92 ? 225 LEU B CG  1 
ATOM 4999  C CD1 . LEU B 1 256 ? -14.597  13.475  -88.840  1.00 140.00 ? 225 LEU B CD1 1 
ATOM 5000  C CD2 . LEU B 1 256 ? -13.650  13.148  -91.111  1.00 145.28 ? 225 LEU B CD2 1 
ATOM 5001  N N   . ASP B 1 257 ? -13.421  17.513  -91.935  1.00 145.46 ? 226 ASP B N   1 
ATOM 5002  C CA  . ASP B 1 257 ? -12.383  18.126  -92.761  1.00 148.63 ? 226 ASP B CA  1 
ATOM 5003  C C   . ASP B 1 257 ? -12.092  19.547  -92.286  1.00 147.37 ? 226 ASP B C   1 
ATOM 5004  O O   . ASP B 1 257 ? -10.937  19.928  -92.165  1.00 148.92 ? 226 ASP B O   1 
ATOM 5005  C CB  . ASP B 1 257 ? -12.808  18.142  -94.250  1.00 152.15 ? 226 ASP B CB  1 
ATOM 5006  C CG  . ASP B 1 257 ? -12.435  16.846  -95.018  1.00 156.09 ? 226 ASP B CG  1 
ATOM 5007  O OD1 . ASP B 1 257 ? -12.137  15.805  -94.381  1.00 156.79 ? 226 ASP B OD1 1 
ATOM 5008  O OD2 . ASP B 1 257 ? -12.455  16.869  -96.277  1.00 160.35 ? 226 ASP B OD2 1 
ATOM 5009  N N   . THR B 1 258 ? -13.137  20.329  -92.020  1.00 144.86 ? 227 THR B N   1 
ATOM 5010  C CA  . THR B 1 258 ? -12.962  21.715  -91.590  1.00 144.26 ? 227 THR B CA  1 
ATOM 5011  C C   . THR B 1 258 ? -12.125  21.751  -90.333  1.00 142.45 ? 227 THR B C   1 
ATOM 5012  O O   . THR B 1 258 ? -11.107  22.435  -90.294  1.00 144.16 ? 227 THR B O   1 
ATOM 5013  C CB  . THR B 1 258 ? -14.306  22.433  -91.341  1.00 142.51 ? 227 THR B CB  1 
ATOM 5014  O OG1 . THR B 1 258 ? -15.072  22.427  -92.548  1.00 144.78 ? 227 THR B OG1 1 
ATOM 5015  C CG2 . THR B 1 258 ? -14.093  23.883  -90.911  1.00 142.58 ? 227 THR B CG2 1 
ATOM 5016  N N   . PHE B 1 259 ? -12.547  20.988  -89.328  1.00 139.41 ? 228 PHE B N   1 
ATOM 5017  C CA  . PHE B 1 259 ? -11.880  20.957  -88.032  1.00 137.76 ? 228 PHE B CA  1 
ATOM 5018  C C   . PHE B 1 259 ? -10.485  20.374  -88.070  1.00 139.22 ? 228 PHE B C   1 
ATOM 5019  O O   . PHE B 1 259 ? -9.587   20.921  -87.442  1.00 139.64 ? 228 PHE B O   1 
ATOM 5020  C CB  . PHE B 1 259 ? -12.710  20.208  -86.992  1.00 135.43 ? 228 PHE B CB  1 
ATOM 5021  C CG  . PHE B 1 259 ? -13.880  20.990  -86.465  1.00 134.45 ? 228 PHE B CG  1 
ATOM 5022  C CD1 . PHE B 1 259 ? -13.847  22.388  -86.411  1.00 136.05 ? 228 PHE B CD1 1 
ATOM 5023  C CD2 . PHE B 1 259 ? -15.009  20.331  -85.995  1.00 132.73 ? 228 PHE B CD2 1 
ATOM 5024  C CE1 . PHE B 1 259 ? -14.935  23.118  -85.910  1.00 134.80 ? 228 PHE B CE1 1 
ATOM 5025  C CE2 . PHE B 1 259 ? -16.095  21.049  -85.491  1.00 131.60 ? 228 PHE B CE2 1 
ATOM 5026  C CZ  . PHE B 1 259 ? -16.057  22.445  -85.448  1.00 132.42 ? 228 PHE B CZ  1 
ATOM 5027  N N   . ILE B 1 260 ? -10.286  19.271  -88.785  1.00 140.25 ? 229 ILE B N   1 
ATOM 5028  C CA  . ILE B 1 260 ? -8.940   18.724  -88.877  1.00 142.45 ? 229 ILE B CA  1 
ATOM 5029  C C   . ILE B 1 260 ? -7.955   19.836  -89.283  1.00 144.28 ? 229 ILE B C   1 
ATOM 5030  O O   . ILE B 1 260 ? -6.905   19.981  -88.669  1.00 145.11 ? 229 ILE B O   1 
ATOM 5031  C CB  . ILE B 1 260 ? -8.846   17.418  -89.746  1.00 144.77 ? 229 ILE B CB  1 
ATOM 5032  C CG1 . ILE B 1 260 ? -7.546   16.657  -89.462  1.00 147.83 ? 229 ILE B CG1 1 
ATOM 5033  C CG2 . ILE B 1 260 ? -8.941   17.697  -91.240  1.00 147.71 ? 229 ILE B CG2 1 
ATOM 5034  C CD1 . ILE B 1 260 ? -7.399   16.128  -88.026  1.00 147.73 ? 229 ILE B CD1 1 
ATOM 5035  N N   . GLY B 1 261 ? -8.342   20.658  -90.257  1.00 145.14 ? 230 GLY B N   1 
ATOM 5036  C CA  . GLY B 1 261 ? -7.523   21.775  -90.733  1.00 147.14 ? 230 GLY B CA  1 
ATOM 5037  C C   . GLY B 1 261 ? -7.636   23.064  -89.931  1.00 145.09 ? 230 GLY B C   1 
ATOM 5038  O O   . GLY B 1 261 ? -7.146   24.107  -90.356  1.00 147.27 ? 230 GLY B O   1 
ATOM 5039  N N   . GLU B 1 262 ? -8.299   23.000  -88.782  1.00 141.36 ? 231 GLU B N   1 
ATOM 5040  C CA  . GLU B 1 262 ? -8.289   24.103  -87.815  1.00 139.84 ? 231 GLU B CA  1 
ATOM 5041  C C   . GLU B 1 262 ? -7.442   23.704  -86.620  1.00 137.79 ? 231 GLU B C   1 
ATOM 5042  O O   . GLU B 1 262 ? -7.273   24.490  -85.688  1.00 136.80 ? 231 GLU B O   1 
ATOM 5043  C CB  . GLU B 1 262 ? -9.700   24.468  -87.335  1.00 137.83 ? 231 GLU B CB  1 
ATOM 5044  C CG  . GLU B 1 262 ? -10.583  25.201  -88.365  1.00 142.02 ? 231 GLU B CG  1 
ATOM 5045  C CD  . GLU B 1 262 ? -11.971  25.570  -87.800  1.00 143.28 ? 231 GLU B CD  1 
ATOM 5046  O OE1 . GLU B 1 262 ? -12.028  26.463  -86.920  1.00 143.76 ? 231 GLU B OE1 1 
ATOM 5047  O OE2 . GLU B 1 262 ? -12.999  24.976  -88.234  1.00 143.70 ? 231 GLU B OE2 1 
ATOM 5048  N N   . GLY B 1 263 ? -6.941   22.470  -86.653  1.00 137.13 ? 232 GLY B N   1 
ATOM 5049  C CA  . GLY B 1 263 ? -5.981   21.983  -85.676  1.00 135.75 ? 232 GLY B CA  1 
ATOM 5050  C C   . GLY B 1 263 ? -6.545   21.176  -84.528  1.00 132.33 ? 232 GLY B C   1 
ATOM 5051  O O   . GLY B 1 263 ? -5.861   20.959  -83.539  1.00 132.52 ? 232 GLY B O   1 
ATOM 5052  N N   . LYS B 1 264 ? -7.786   20.726  -84.646  1.00 129.59 ? 233 LYS B N   1 
ATOM 5053  C CA  . LYS B 1 264 ? -8.401   19.910  -83.602  1.00 126.84 ? 233 LYS B CA  1 
ATOM 5054  C C   . LYS B 1 264 ? -7.946   18.464  -83.751  1.00 128.03 ? 233 LYS B C   1 
ATOM 5055  O O   . LYS B 1 264 ? -7.520   18.049  -84.828  1.00 130.10 ? 233 LYS B O   1 
ATOM 5056  C CB  . LYS B 1 264 ? -9.925   20.008  -83.675  1.00 124.55 ? 233 LYS B CB  1 
ATOM 5057  C CG  . LYS B 1 264 ? -10.464  21.431  -83.810  1.00 122.88 ? 233 LYS B CG  1 
ATOM 5058  C CD  . LYS B 1 264 ? -10.063  22.297  -82.631  1.00 120.72 ? 233 LYS B CD  1 
ATOM 5059  C CE  . LYS B 1 264 ? -10.470  23.738  -82.846  1.00 120.37 ? 233 LYS B CE  1 
ATOM 5060  N NZ  . LYS B 1 264 ? -10.105  24.583  -81.667  1.00 119.94 ? 233 LYS B NZ  1 
ATOM 5061  N N   . GLU B 1 265 ? -8.022   17.695  -82.676  1.00 127.03 ? 234 GLU B N   1 
ATOM 5062  C CA  . GLU B 1 265 ? -7.571   16.315  -82.741  1.00 128.71 ? 234 GLU B CA  1 
ATOM 5063  C C   . GLU B 1 265 ? -8.668   15.296  -82.417  1.00 127.56 ? 234 GLU B C   1 
ATOM 5064  O O   . GLU B 1 265 ? -8.696   14.215  -83.013  1.00 129.22 ? 234 GLU B O   1 
ATOM 5065  C CB  . GLU B 1 265 ? -6.340   16.108  -81.849  1.00 130.48 ? 234 GLU B CB  1 
ATOM 5066  N N   . TYR B 1 266 ? -9.581   15.653  -81.506  1.00 125.00 ? 235 TYR B N   1 
ATOM 5067  C CA  . TYR B 1 266 ? -10.503  14.690  -80.896  1.00 124.02 ? 235 TYR B CA  1 
ATOM 5068  C C   . TYR B 1 266 ? -11.944  15.162  -80.737  1.00 121.31 ? 235 TYR B C   1 
ATOM 5069  O O   . TYR B 1 266 ? -12.179  16.280  -80.292  1.00 119.61 ? 235 TYR B O   1 
ATOM 5070  C CB  . TYR B 1 266 ? -9.983   14.320  -79.507  1.00 125.35 ? 235 TYR B CB  1 
ATOM 5071  C CG  . TYR B 1 266 ? -8.910   13.261  -79.491  1.00 128.62 ? 235 TYR B CG  1 
ATOM 5072  C CD1 . TYR B 1 266 ? -9.242   11.914  -79.572  1.00 130.08 ? 235 TYR B CD1 1 
ATOM 5073  C CD2 . TYR B 1 266 ? -7.566   13.607  -79.385  1.00 130.84 ? 235 TYR B CD2 1 
ATOM 5074  C CE1 . TYR B 1 266 ? -8.278   10.942  -79.560  1.00 133.99 ? 235 TYR B CE1 1 
ATOM 5075  C CE2 . TYR B 1 266 ? -6.584   12.639  -79.376  1.00 134.91 ? 235 TYR B CE2 1 
ATOM 5076  C CZ  . TYR B 1 266 ? -6.952   11.304  -79.463  1.00 136.86 ? 235 TYR B CZ  1 
ATOM 5077  O OH  . TYR B 1 266 ? -5.993   10.318  -79.448  1.00 141.96 ? 235 TYR B OH  1 
ATOM 5078  N N   . ILE B 1 267 ? -12.907  14.296  -81.068  1.00 121.11 ? 236 ILE B N   1 
ATOM 5079  C CA  . ILE B 1 267 ? -14.312  14.543  -80.699  1.00 119.26 ? 236 ILE B CA  1 
ATOM 5080  C C   . ILE B 1 267 ? -14.697  13.826  -79.417  1.00 119.75 ? 236 ILE B C   1 
ATOM 5081  O O   . ILE B 1 267 ? -14.369  12.646  -79.218  1.00 121.16 ? 236 ILE B O   1 
ATOM 5082  C CB  . ILE B 1 267 ? -15.385  14.071  -81.719  1.00 118.52 ? 236 ILE B CB  1 
ATOM 5083  C CG1 . ILE B 1 267 ? -14.808  13.300  -82.894  1.00 120.45 ? 236 ILE B CG1 1 
ATOM 5084  C CG2 . ILE B 1 267 ? -16.202  15.251  -82.214  1.00 116.65 ? 236 ILE B CG2 1 
ATOM 5085  C CD1 . ILE B 1 267 ? -15.918  12.659  -83.696  1.00 120.94 ? 236 ILE B CD1 1 
ATOM 5086  N N   . PHE B 1 268 ? -15.426  14.554  -78.573  1.00 118.70 ? 237 PHE B N   1 
ATOM 5087  C CA  . PHE B 1 268 ? -16.064  13.987  -77.404  1.00 119.55 ? 237 PHE B CA  1 
ATOM 5088  C C   . PHE B 1 268 ? -17.571  13.895  -77.547  1.00 118.86 ? 237 PHE B C   1 
ATOM 5089  O O   . PHE B 1 268 ? -18.292  14.876  -77.339  1.00 117.88 ? 237 PHE B O   1 
ATOM 5090  C CB  . PHE B 1 268 ? -15.766  14.808  -76.180  1.00 119.82 ? 237 PHE B CB  1 
ATOM 5091  C CG  . PHE B 1 268 ? -16.453  14.307  -74.956  1.00 120.43 ? 237 PHE B CG  1 
ATOM 5092  C CD1 . PHE B 1 268 ? -16.501  12.949  -74.689  1.00 120.86 ? 237 PHE B CD1 1 
ATOM 5093  C CD2 . PHE B 1 268 ? -17.040  15.199  -74.065  1.00 120.54 ? 237 PHE B CD2 1 
ATOM 5094  C CE1 . PHE B 1 268 ? -17.114  12.486  -73.562  1.00 123.82 ? 237 PHE B CE1 1 
ATOM 5095  C CE2 . PHE B 1 268 ? -17.658  14.753  -72.920  1.00 122.23 ? 237 PHE B CE2 1 
ATOM 5096  C CZ  . PHE B 1 268 ? -17.697  13.390  -72.661  1.00 124.78 ? 237 PHE B CZ  1 
ATOM 5097  N N   . VAL B 1 269 ? -18.035  12.695  -77.863  1.00 119.80 ? 238 VAL B N   1 
ATOM 5098  C CA  . VAL B 1 269 ? -19.439  12.452  -78.122  1.00 119.14 ? 238 VAL B CA  1 
ATOM 5099  C C   . VAL B 1 269 ? -20.147  12.015  -76.845  1.00 120.95 ? 238 VAL B C   1 
ATOM 5100  O O   . VAL B 1 269 ? -19.654  11.148  -76.122  1.00 123.57 ? 238 VAL B O   1 
ATOM 5101  C CB  . VAL B 1 269 ? -19.612  11.455  -79.296  1.00 119.09 ? 238 VAL B CB  1 
ATOM 5102  C CG1 . VAL B 1 269 ? -20.569  10.312  -78.971  1.00 120.10 ? 238 VAL B CG1 1 
ATOM 5103  C CG2 . VAL B 1 269 ? -20.047  12.198  -80.526  1.00 116.99 ? 238 VAL B CG2 1 
ATOM 5104  N N   . SER B 1 270 ? -21.281  12.655  -76.566  1.00 120.36 ? 239 SER B N   1 
ATOM 5105  C CA  . SER B 1 270 ? -22.147  12.313  -75.439  1.00 121.90 ? 239 SER B CA  1 
ATOM 5106  C C   . SER B 1 270 ? -23.618  12.515  -75.828  1.00 121.55 ? 239 SER B C   1 
ATOM 5107  O O   . SER B 1 270 ? -23.922  13.187  -76.832  1.00 119.47 ? 239 SER B O   1 
ATOM 5108  C CB  . SER B 1 270 ? -21.782  13.161  -74.216  1.00 122.59 ? 239 SER B CB  1 
ATOM 5109  O OG  . SER B 1 270 ? -21.246  14.420  -74.595  1.00 120.04 ? 239 SER B OG  1 
ATOM 5110  N N   . ASN B 1 271 ? -24.529  11.917  -75.055  1.00 123.82 ? 240 ASN B N   1 
ATOM 5111  C CA  . ASN B 1 271 ? -25.960  12.201  -75.211  1.00 123.96 ? 240 ASN B CA  1 
ATOM 5112  C C   . ASN B 1 271 ? -26.228  13.555  -74.604  1.00 123.91 ? 240 ASN B C   1 
ATOM 5113  O O   . ASN B 1 271 ? -25.551  13.970  -73.660  1.00 124.79 ? 240 ASN B O   1 
ATOM 5114  C CB  . ASN B 1 271 ? -26.837  11.161  -74.509  1.00 126.61 ? 240 ASN B CB  1 
ATOM 5115  C CG  . ASN B 1 271 ? -26.865  9.800   -75.222  1.00 128.12 ? 240 ASN B CG  1 
ATOM 5116  O OD1 . ASN B 1 271 ? -26.841  9.707   -76.452  1.00 126.92 ? 240 ASN B OD1 1 
ATOM 5117  N ND2 . ASN B 1 271 ? -26.948  8.733   -74.432  1.00 132.88 ? 240 ASN B ND2 1 
ATOM 5118  N N   . ILE B 1 272 ? -27.204  14.265  -75.136  1.00 123.27 ? 241 ILE B N   1 
ATOM 5119  C CA  . ILE B 1 272 ? -27.561  15.516  -74.506  1.00 124.59 ? 241 ILE B CA  1 
ATOM 5120  C C   . ILE B 1 272 ? -28.331  15.154  -73.225  1.00 128.41 ? 241 ILE B C   1 
ATOM 5121  O O   . ILE B 1 272 ? -28.510  15.991  -72.343  1.00 130.10 ? 241 ILE B O   1 
ATOM 5122  C CB  . ILE B 1 272 ? -28.314  16.478  -75.490  1.00 122.99 ? 241 ILE B CB  1 
ATOM 5123  C CG1 . ILE B 1 272 ? -28.669  17.829  -74.841  1.00 123.25 ? 241 ILE B CG1 1 
ATOM 5124  C CG2 . ILE B 1 272 ? -29.543  15.807  -76.071  1.00 123.53 ? 241 ILE B CG2 1 
ATOM 5125  C CD1 . ILE B 1 272 ? -27.665  18.921  -75.046  1.00 119.60 ? 241 ILE B CD1 1 
ATOM 5126  N N   . ASP B 1 273 ? -28.732  13.880  -73.122  1.00 126.22 ? 242 ASP B N   1 
ATOM 5127  C CA  . ASP B 1 273 ? -29.457  13.331  -71.953  1.00 127.65 ? 242 ASP B CA  1 
ATOM 5128  C C   . ASP B 1 273 ? -28.614  13.327  -70.724  1.00 126.05 ? 242 ASP B C   1 
ATOM 5129  O O   . ASP B 1 273 ? -29.062  13.757  -69.668  1.00 127.66 ? 242 ASP B O   1 
ATOM 5130  C CB  . ASP B 1 273 ? -29.831  11.873  -72.167  1.00 127.69 ? 242 ASP B CB  1 
ATOM 5131  C CG  . ASP B 1 273 ? -30.476  11.641  -73.490  1.00 131.68 ? 242 ASP B CG  1 
ATOM 5132  O OD1 . ASP B 1 273 ? -31.702  11.367  -73.481  1.00 135.46 ? 242 ASP B OD1 1 
ATOM 5133  O OD2 . ASP B 1 273 ? -29.764  11.761  -74.532  1.00 133.64 ? 242 ASP B OD2 1 
ATOM 5134  N N   . ASN B 1 274 ? -27.403  12.789  -70.876  1.00 123.68 ? 243 ASN B N   1 
ATOM 5135  C CA  . ASN B 1 274 ? -26.456  12.571  -69.787  1.00 121.64 ? 243 ASN B CA  1 
ATOM 5136  C C   . ASN B 1 274 ? -25.846  13.854  -69.213  1.00 121.69 ? 243 ASN B C   1 
ATOM 5137  O O   . ASN B 1 274 ? -24.887  14.408  -69.748  1.00 120.67 ? 243 ASN B O   1 
ATOM 5138  C CB  . ASN B 1 274 ? -25.365  11.619  -70.246  1.00 119.29 ? 243 ASN B CB  1 
ATOM 5139  C CG  . ASN B 1 274 ? -24.464  11.219  -69.133  1.00 117.87 ? 243 ASN B CG  1 
ATOM 5140  O OD1 . ASN B 1 274 ? -24.473  11.817  -68.060  1.00 118.27 ? 243 ASN B OD1 1 
ATOM 5141  N ND2 . ASN B 1 274 ? -23.663  10.205  -69.373  1.00 117.17 ? 243 ASN B ND2 1 
ATOM 5142  N N   . LEU B 1 275 ? -26.413  14.293  -68.096  1.00 123.07 ? 244 LEU B N   1 
ATOM 5143  C CA  . LEU B 1 275 ? -26.098  15.569  -67.491  1.00 123.98 ? 244 LEU B CA  1 
ATOM 5144  C C   . LEU B 1 275 ? -24.717  15.583  -66.893  1.00 122.84 ? 244 LEU B C   1 
ATOM 5145  O O   . LEU B 1 275 ? -24.138  16.650  -66.653  1.00 123.24 ? 244 LEU B O   1 
ATOM 5146  C CB  . LEU B 1 275 ? -27.100  15.834  -66.386  1.00 126.05 ? 244 LEU B CB  1 
ATOM 5147  C CG  . LEU B 1 275 ? -28.463  16.289  -66.848  1.00 127.25 ? 244 LEU B CG  1 
ATOM 5148  C CD1 . LEU B 1 275 ? -29.185  16.829  -65.658  1.00 129.03 ? 244 LEU B CD1 1 
ATOM 5149  C CD2 . LEU B 1 275 ? -28.272  17.367  -67.879  1.00 127.73 ? 244 LEU B CD2 1 
ATOM 5150  N N   . GLY B 1 276 ? -24.216  14.379  -66.633  1.00 121.77 ? 245 GLY B N   1 
ATOM 5151  C CA  . GLY B 1 276 ? -22.926  14.178  -65.986  1.00 121.22 ? 245 GLY B CA  1 
ATOM 5152  C C   . GLY B 1 276 ? -21.803  13.805  -66.932  1.00 119.52 ? 245 GLY B C   1 
ATOM 5153  O O   . GLY B 1 276 ? -20.659  13.649  -66.497  1.00 118.54 ? 245 GLY B O   1 
ATOM 5154  N N   . ALA B 1 277 ? -22.145  13.655  -68.215  1.00 119.60 ? 246 ALA B N   1 
ATOM 5155  C CA  . ALA B 1 277 ? -21.170  13.486  -69.295  1.00 118.75 ? 246 ALA B CA  1 
ATOM 5156  C C   . ALA B 1 277 ? -20.407  14.786  -69.522  1.00 119.22 ? 246 ALA B C   1 
ATOM 5157  O O   . ALA B 1 277 ? -20.550  15.445  -70.562  1.00 119.74 ? 246 ALA B O   1 
ATOM 5158  C CB  . ALA B 1 277 ? -21.850  13.050  -70.573  1.00 118.97 ? 246 ALA B CB  1 
ATOM 5159  N N   . THR B 1 278 ? -19.597  15.129  -68.522  1.00 119.40 ? 247 THR B N   1 
ATOM 5160  C CA  . THR B 1 278 ? -18.763  16.320  -68.502  1.00 119.73 ? 247 THR B CA  1 
ATOM 5161  C C   . THR B 1 278 ? -17.416  16.075  -69.215  1.00 118.14 ? 247 THR B C   1 
ATOM 5162  O O   . THR B 1 278 ? -16.966  14.924  -69.349  1.00 117.21 ? 247 THR B O   1 
ATOM 5163  C CB  . THR B 1 278 ? -18.568  16.794  -67.022  1.00 120.93 ? 247 THR B CB  1 
ATOM 5164  O OG1 . THR B 1 278 ? -18.751  18.216  -66.941  1.00 123.74 ? 247 THR B OG1 1 
ATOM 5165  C CG2 . THR B 1 278 ? -17.187  16.335  -66.402  1.00 119.70 ? 247 THR B CG2 1 
ATOM 5166  N N   . VAL B 1 279 ? -16.799  17.158  -69.691  1.00 117.95 ? 248 VAL B N   1 
ATOM 5167  C CA  . VAL B 1 279 ? -15.432  17.126  -70.228  1.00 116.49 ? 248 VAL B CA  1 
ATOM 5168  C C   . VAL B 1 279 ? -14.453  16.975  -69.082  1.00 115.87 ? 248 VAL B C   1 
ATOM 5169  O O   . VAL B 1 279 ? -14.451  17.779  -68.140  1.00 116.69 ? 248 VAL B O   1 
ATOM 5170  C CB  . VAL B 1 279 ? -15.072  18.432  -70.929  1.00 117.34 ? 248 VAL B CB  1 
ATOM 5171  C CG1 . VAL B 1 279 ? -13.842  18.233  -71.787  1.00 115.98 ? 248 VAL B CG1 1 
ATOM 5172  C CG2 . VAL B 1 279 ? -16.263  18.952  -71.738  1.00 118.83 ? 248 VAL B CG2 1 
ATOM 5173  N N   . ASP B 1 280 ? -13.611  15.955  -69.156  1.00 114.41 ? 249 ASP B N   1 
ATOM 5174  C CA  . ASP B 1 280 ? -12.745  15.670  -68.022  1.00 114.15 ? 249 ASP B CA  1 
ATOM 5175  C C   . ASP B 1 280 ? -11.269  15.756  -68.339  1.00 113.10 ? 249 ASP B C   1 
ATOM 5176  O O   . ASP B 1 280 ? -10.767  15.030  -69.194  1.00 112.78 ? 249 ASP B O   1 
ATOM 5177  C CB  . ASP B 1 280 ? -13.064  14.311  -67.413  1.00 114.31 ? 249 ASP B CB  1 
ATOM 5178  C CG  . ASP B 1 280 ? -12.044  13.904  -66.375  1.00 116.34 ? 249 ASP B CG  1 
ATOM 5179  O OD1 . ASP B 1 280 ? -11.718  14.738  -65.491  1.00 118.70 ? 249 ASP B OD1 1 
ATOM 5180  O OD2 . ASP B 1 280 ? -11.549  12.760  -66.462  1.00 117.92 ? 249 ASP B OD2 1 
ATOM 5181  N N   . LEU B 1 281 ? -10.568  16.614  -67.615  1.00 112.53 ? 250 LEU B N   1 
ATOM 5182  C CA  . LEU B 1 281 ? -9.223   16.958  -68.008  1.00 111.82 ? 250 LEU B CA  1 
ATOM 5183  C C   . LEU B 1 281 ? -8.264   15.774  -67.995  1.00 111.40 ? 250 LEU B C   1 
ATOM 5184  O O   . LEU B 1 281 ? -7.494   15.585  -68.935  1.00 111.20 ? 250 LEU B O   1 
ATOM 5185  C CB  . LEU B 1 281 ? -8.713   18.115  -67.170  1.00 113.00 ? 250 LEU B CB  1 
ATOM 5186  C CG  . LEU B 1 281 ? -9.404   19.438  -67.504  1.00 112.56 ? 250 LEU B CG  1 
ATOM 5187  C CD1 . LEU B 1 281 ? -8.692   20.576  -66.796  1.00 113.92 ? 250 LEU B CD1 1 
ATOM 5188  C CD2 . LEU B 1 281 ? -9.467   19.692  -69.009  1.00 110.01 ? 250 LEU B CD2 1 
ATOM 5189  N N   . TYR B 1 282 ? -8.345   14.964  -66.947  1.00 111.24 ? 251 TYR B N   1 
ATOM 5190  C CA  . TYR B 1 282 ? -7.477   13.800  -66.781  1.00 111.28 ? 251 TYR B CA  1 
ATOM 5191  C C   . TYR B 1 282 ? -7.607   12.807  -67.933  1.00 109.81 ? 251 TYR B C   1 
ATOM 5192  O O   . TYR B 1 282 ? -6.614   12.276  -68.413  1.00 110.51 ? 251 TYR B O   1 
ATOM 5193  C CB  . TYR B 1 282 ? -7.746   13.126  -65.428  1.00 112.28 ? 251 TYR B CB  1 
ATOM 5194  C CG  . TYR B 1 282 ? -7.653   14.102  -64.277  1.00 115.37 ? 251 TYR B CG  1 
ATOM 5195  C CD1 . TYR B 1 282 ? -6.428   14.474  -63.771  1.00 118.63 ? 251 TYR B CD1 1 
ATOM 5196  C CD2 . TYR B 1 282 ? -8.794   14.694  -63.722  1.00 118.07 ? 251 TYR B CD2 1 
ATOM 5197  C CE1 . TYR B 1 282 ? -6.320   15.389  -62.724  1.00 121.34 ? 251 TYR B CE1 1 
ATOM 5198  C CE2 . TYR B 1 282 ? -8.694   15.626  -62.667  1.00 120.28 ? 251 TYR B CE2 1 
ATOM 5199  C CZ  . TYR B 1 282 ? -7.443   15.959  -62.183  1.00 121.52 ? 251 TYR B CZ  1 
ATOM 5200  O OH  . TYR B 1 282 ? -7.276   16.855  -61.159  1.00 124.28 ? 251 TYR B OH  1 
ATOM 5201  N N   . ILE B 1 283 ? -8.829   12.577  -68.398  1.00 108.06 ? 252 ILE B N   1 
ATOM 5202  C CA  . ILE B 1 283 ? -9.059   11.587  -69.447  1.00 106.83 ? 252 ILE B CA  1 
ATOM 5203  C C   . ILE B 1 283 ? -8.725   12.159  -70.816  1.00 106.18 ? 252 ILE B C   1 
ATOM 5204  O O   . ILE B 1 283 ? -8.825   11.482  -71.831  1.00 105.76 ? 252 ILE B O   1 
ATOM 5205  C CB  . ILE B 1 283 ? -10.505  10.950  -69.369  1.00 106.26 ? 252 ILE B CB  1 
ATOM 5206  C CG1 . ILE B 1 283 ? -10.592  9.665   -70.216  1.00 105.84 ? 252 ILE B CG1 1 
ATOM 5207  C CG2 . ILE B 1 283 ? -11.605  11.971  -69.696  1.00 105.55 ? 252 ILE B CG2 1 
ATOM 5208  C CD1 . ILE B 1 283 ? -11.861  8.927   -70.061  1.00 103.94 ? 252 ILE B CD1 1 
ATOM 5209  N N   . LEU B 1 284 ? -8.301   13.412  -70.820  1.00 106.23 ? 253 LEU B N   1 
ATOM 5210  C CA  . LEU B 1 284 ? -7.949   14.121  -72.047  1.00 106.48 ? 253 LEU B CA  1 
ATOM 5211  C C   . LEU B 1 284 ? -6.435   14.234  -72.109  1.00 107.53 ? 253 LEU B C   1 
ATOM 5212  O O   . LEU B 1 284 ? -5.804   14.335  -73.171  1.00 107.56 ? 253 LEU B O   1 
ATOM 5213  C CB  . LEU B 1 284 ? -8.582   15.516  -72.007  1.00 106.23 ? 253 LEU B CB  1 
ATOM 5214  C CG  . LEU B 1 284 ? -8.553   16.440  -73.221  1.00 105.65 ? 253 LEU B CG  1 
ATOM 5215  C CD1 . LEU B 1 284 ? -9.479   15.957  -74.349  1.00 103.81 ? 253 LEU B CD1 1 
ATOM 5216  C CD2 . LEU B 1 284 ? -8.945   17.819  -72.735  1.00 105.37 ? 253 LEU B CD2 1 
ATOM 5217  N N   . ASN B 1 285 ? -5.880   14.217  -70.916  1.00 108.40 ? 254 ASN B N   1 
ATOM 5218  C CA  . ASN B 1 285 ? -4.482   14.142  -70.713  1.00 110.21 ? 254 ASN B CA  1 
ATOM 5219  C C   . ASN B 1 285 ? -3.952   12.818  -71.212  1.00 111.71 ? 254 ASN B C   1 
ATOM 5220  O O   . ASN B 1 285 ? -2.778   12.716  -71.556  1.00 113.39 ? 254 ASN B O   1 
ATOM 5221  C CB  . ASN B 1 285 ? -4.244   14.221  -69.233  1.00 110.65 ? 254 ASN B CB  1 
ATOM 5222  C CG  . ASN B 1 285 ? -2.875   14.615  -68.909  1.00 111.33 ? 254 ASN B CG  1 
ATOM 5223  O OD1 . ASN B 1 285 ? -2.277   15.411  -69.602  1.00 111.51 ? 254 ASN B OD1 1 
ATOM 5224  N ND2 . ASN B 1 285 ? -2.358   14.078  -67.836  1.00 113.07 ? 254 ASN B ND2 1 
ATOM 5225  N N   . HIS B 1 286 ? -4.812   11.801  -71.239  1.00 111.88 ? 255 HIS B N   1 
ATOM 5226  C CA  . HIS B 1 286 ? -4.392   10.466  -71.641  1.00 113.65 ? 255 HIS B CA  1 
ATOM 5227  C C   . HIS B 1 286 ? -4.611   10.264  -73.122  1.00 114.39 ? 255 HIS B C   1 
ATOM 5228  O O   . HIS B 1 286 ? -4.269   9.215   -73.673  1.00 115.37 ? 255 HIS B O   1 
ATOM 5229  C CB  . HIS B 1 286 ? -5.126   9.398   -70.839  1.00 113.24 ? 255 HIS B CB  1 
ATOM 5230  C CG  . HIS B 1 286 ? -4.646   8.004   -71.108  1.00 115.04 ? 255 HIS B CG  1 
ATOM 5231  N ND1 . HIS B 1 286 ? -3.689   7.382   -70.330  1.00 116.92 ? 255 HIS B ND1 1 
ATOM 5232  C CD2 . HIS B 1 286 ? -4.994   7.109   -72.066  1.00 115.12 ? 255 HIS B CD2 1 
ATOM 5233  C CE1 . HIS B 1 286 ? -3.472   6.164   -70.796  1.00 118.23 ? 255 HIS B CE1 1 
ATOM 5234  N NE2 . HIS B 1 286 ? -4.250   5.974   -71.850  1.00 117.62 ? 255 HIS B NE2 1 
ATOM 5235  N N   . LEU B 1 287 ? -5.178   11.281  -73.766  1.00 114.83 ? 256 LEU B N   1 
ATOM 5236  C CA  . LEU B 1 287 ? -5.443   11.223  -75.204  1.00 116.42 ? 256 LEU B CA  1 
ATOM 5237  C C   . LEU B 1 287 ? -4.472   12.083  -75.992  1.00 118.43 ? 256 LEU B C   1 
ATOM 5238  O O   . LEU B 1 287 ? -3.850   11.613  -76.950  1.00 119.84 ? 256 LEU B O   1 
ATOM 5239  C CB  . LEU B 1 287 ? -6.890   11.598  -75.509  1.00 114.97 ? 256 LEU B CB  1 
ATOM 5240  C CG  . LEU B 1 287 ? -7.893   10.542  -75.065  1.00 114.02 ? 256 LEU B CG  1 
ATOM 5241  C CD1 . LEU B 1 287 ? -9.234   11.197  -75.001  1.00 113.49 ? 256 LEU B CD1 1 
ATOM 5242  C CD2 . LEU B 1 287 ? -7.893   9.331   -76.003  1.00 114.32 ? 256 LEU B CD2 1 
ATOM 5243  N N   . MET B 1 288 ? -4.363   13.347  -75.587  1.00 119.36 ? 257 MET B N   1 
ATOM 5244  C CA  . MET B 1 288 ? -3.218   14.175  -75.951  1.00 122.04 ? 257 MET B CA  1 
ATOM 5245  C C   . MET B 1 288 ? -2.027   13.671  -75.137  1.00 123.34 ? 257 MET B C   1 
ATOM 5246  O O   . MET B 1 288 ? -2.186   12.745  -74.326  1.00 123.35 ? 257 MET B O   1 
ATOM 5247  C CB  . MET B 1 288 ? -3.506   15.647  -75.649  1.00 122.02 ? 257 MET B CB  1 
ATOM 5248  C CG  . MET B 1 288 ? -3.916   16.460  -76.868  1.00 125.16 ? 257 MET B CG  1 
ATOM 5249  S SD  . MET B 1 288 ? -5.504   15.973  -77.603  1.00 129.40 ? 257 MET B SD  1 
ATOM 5250  C CE  . MET B 1 288 ? -6.637   16.854  -76.533  1.00 127.69 ? 257 MET B CE  1 
ATOM 5251  N N   . ASN B 1 289 ? -0.846   14.262  -75.332  1.00 124.88 ? 258 ASN B N   1 
ATOM 5252  C CA  . ASN B 1 289 ? 0.368    13.770  -74.654  1.00 126.51 ? 258 ASN B CA  1 
ATOM 5253  C C   . ASN B 1 289 ? 0.144    12.411  -73.922  1.00 126.51 ? 258 ASN B C   1 
ATOM 5254  O O   . ASN B 1 289 ? -0.004   12.348  -72.695  1.00 125.70 ? 258 ASN B O   1 
ATOM 5255  C CB  . ASN B 1 289 ? 1.018    14.865  -73.774  1.00 126.99 ? 258 ASN B CB  1 
ATOM 5256  C CG  . ASN B 1 289 ? 0.039    15.518  -72.803  1.00 124.60 ? 258 ASN B CG  1 
ATOM 5257  O OD1 . ASN B 1 289 ? -0.694   14.832  -72.098  1.00 123.34 ? 258 ASN B OD1 1 
ATOM 5258  N ND2 . ASN B 1 289 ? 0.049    16.850  -72.745  1.00 123.22 ? 258 ASN B ND2 1 
ATOM 5259  N N   . PRO B 1 290 ? 0.074    11.320  -74.704  1.00 127.37 ? 259 PRO B N   1 
ATOM 5260  C CA  . PRO B 1 290 ? -0.284   10.053  -74.118  1.00 127.60 ? 259 PRO B CA  1 
ATOM 5261  C C   . PRO B 1 290 ? 0.958    9.283   -73.714  1.00 130.47 ? 259 PRO B C   1 
ATOM 5262  O O   . PRO B 1 290 ? 2.004    9.410   -74.369  1.00 132.25 ? 259 PRO B O   1 
ATOM 5263  C CB  . PRO B 1 290 ? -1.024   9.338   -75.254  1.00 127.38 ? 259 PRO B CB  1 
ATOM 5264  C CG  . PRO B 1 290 ? -0.769   10.169  -76.516  1.00 127.74 ? 259 PRO B CG  1 
ATOM 5265  C CD  . PRO B 1 290 ? 0.239    11.204  -76.164  1.00 128.33 ? 259 PRO B CD  1 
ATOM 5266  N N   . PRO B 1 291 ? 0.842    8.494   -72.628  1.00 131.08 ? 260 PRO B N   1 
ATOM 5267  C CA  . PRO B 1 291 ? 1.928    7.735   -72.008  1.00 133.95 ? 260 PRO B CA  1 
ATOM 5268  C C   . PRO B 1 291 ? 2.537    6.642   -72.880  1.00 136.42 ? 260 PRO B C   1 
ATOM 5269  O O   . PRO B 1 291 ? 1.852    5.657   -73.216  1.00 136.09 ? 260 PRO B O   1 
ATOM 5270  C CB  . PRO B 1 291 ? 1.259    7.103   -70.778  1.00 133.24 ? 260 PRO B CB  1 
ATOM 5271  C CG  . PRO B 1 291 ? 0.146    8.016   -70.469  1.00 130.59 ? 260 PRO B CG  1 
ATOM 5272  C CD  . PRO B 1 291 ? -0.380   8.427   -71.808  1.00 129.02 ? 260 PRO B CD  1 
ATOM 5273  N N   . ASN B 1 292 ? 3.816    6.844   -73.227  1.00 138.81 ? 261 ASN B N   1 
ATOM 5274  C CA  . ASN B 1 292 ? 4.701    5.795   -73.750  1.00 142.05 ? 261 ASN B CA  1 
ATOM 5275  C C   . ASN B 1 292 ? 4.830    5.764   -75.267  1.00 142.76 ? 261 ASN B C   1 
ATOM 5276  O O   . ASN B 1 292 ? 5.858    5.338   -75.821  1.00 146.12 ? 261 ASN B O   1 
ATOM 5277  C CB  . ASN B 1 292 ? 4.245    4.422   -73.260  1.00 142.87 ? 261 ASN B CB  1 
ATOM 5278  C CG  . ASN B 1 292 ? 5.374    3.605   -72.709  1.00 146.52 ? 261 ASN B CG  1 
ATOM 5279  O OD1 . ASN B 1 292 ? 6.059    4.027   -71.771  1.00 146.15 ? 261 ASN B OD1 1 
ATOM 5280  N ND2 . ASN B 1 292 ? 5.576    2.417   -73.278  1.00 149.64 ? 261 ASN B ND2 1 
ATOM 5281  N N   . GLY B 1 293 ? 3.775    6.202   -75.940  1.00 139.82 ? 262 GLY B N   1 
ATOM 5282  C CA  . GLY B 1 293 ? 3.738    6.125   -77.388  1.00 140.44 ? 262 GLY B CA  1 
ATOM 5283  C C   . GLY B 1 293 ? 2.345    5.966   -77.953  1.00 137.68 ? 262 GLY B C   1 
ATOM 5284  O O   . GLY B 1 293 ? 1.850    6.894   -78.579  1.00 136.03 ? 262 GLY B O   1 
ATOM 5285  N N   . LYS B 1 294 ? 1.733    4.791   -77.757  1.00 137.53 ? 263 LYS B N   1 
ATOM 5286  C CA  . LYS B 1 294 ? 0.340    4.552   -78.130  1.00 135.16 ? 263 LYS B CA  1 
ATOM 5287  C C   . LYS B 1 294 ? -0.410   5.764   -77.578  1.00 132.20 ? 263 LYS B C   1 
ATOM 5288  O O   . LYS B 1 294 ? -0.413   5.908   -76.355  1.00 131.63 ? 263 LYS B O   1 
ATOM 5289  C CB  . LYS B 1 294 ? -0.183   3.277   -77.452  1.00 135.08 ? 263 LYS B CB  1 
ATOM 5290  C CG  . LYS B 1 294 ? 0.756    2.088   -77.416  1.00 137.68 ? 263 LYS B CG  1 
ATOM 5291  N N   . ARG B 1 295 ? -1.040   6.660   -78.373  1.00 130.91 ? 264 ARG B N   1 
ATOM 5292  C CA  . ARG B 1 295 ? -1.501   6.571   -79.782  1.00 131.40 ? 264 ARG B CA  1 
ATOM 5293  C C   . ARG B 1 295 ? -2.804   5.807   -79.789  1.00 130.48 ? 264 ARG B C   1 
ATOM 5294  O O   . ARG B 1 295 ? -2.821   4.591   -79.568  1.00 131.84 ? 264 ARG B O   1 
ATOM 5295  C CB  . ARG B 1 295 ? -0.495   5.953   -80.753  1.00 134.97 ? 264 ARG B CB  1 
ATOM 5296  N N   . CYS B 1 296 ? -3.896   6.535   -80.027  1.00 128.33 ? 265 CYS B N   1 
ATOM 5297  C CA  . CYS B 1 296 ? -5.263   6.006   -79.915  1.00 126.77 ? 265 CYS B CA  1 
ATOM 5298  C C   . CYS B 1 296 ? -6.142   7.123   -79.361  1.00 123.39 ? 265 CYS B C   1 
ATOM 5299  O O   . CYS B 1 296 ? -5.900   7.586   -78.235  1.00 122.32 ? 265 CYS B O   1 
ATOM 5300  C CB  . CYS B 1 296 ? -5.296   4.771   -78.999  1.00 127.32 ? 265 CYS B CB  1 
ATOM 5301  S SG  . CYS B 1 296 ? -6.781   4.551   -78.016  1.00 126.81 ? 265 CYS B SG  1 
ATOM 5302  N N   . GLU B 1 297 ? -7.166   7.572   -80.090  1.00 121.66 ? 266 GLU B N   1 
ATOM 5303  C CA  . GLU B 1 297 ? -7.762   7.007   -81.309  1.00 122.16 ? 266 GLU B CA  1 
ATOM 5304  C C   . GLU B 1 297 ? -9.240   6.712   -81.026  1.00 120.36 ? 266 GLU B C   1 
ATOM 5305  O O   . GLU B 1 297 ? -10.119  7.220   -81.730  1.00 120.53 ? 266 GLU B O   1 
ATOM 5306  C CB  . GLU B 1 297 ? -7.056   5.784   -81.884  1.00 124.61 ? 266 GLU B CB  1 
ATOM 5307  C CG  . GLU B 1 297 ? -7.798   5.227   -83.098  1.00 127.75 ? 266 GLU B CG  1 
ATOM 5308  C CD  . GLU B 1 297 ? -6.900   4.567   -84.149  1.00 133.23 ? 266 GLU B CD  1 
ATOM 5309  O OE1 . GLU B 1 297 ? -6.068   3.705   -83.786  1.00 135.57 ? 266 GLU B OE1 1 
ATOM 5310  O OE2 . GLU B 1 297 ? -7.040   4.899   -85.353  1.00 134.21 ? 266 GLU B OE2 1 
ATOM 5311  N N   . PHE B 1 298 ? -9.511   5.914   -79.987  1.00 118.70 ? 267 PHE B N   1 
ATOM 5312  C CA  . PHE B 1 298 ? -10.888  5.581   -79.577  1.00 116.51 ? 267 PHE B CA  1 
ATOM 5313  C C   . PHE B 1 298 ? -11.005  5.109   -78.124  1.00 114.93 ? 267 PHE B C   1 
ATOM 5314  O O   . PHE B 1 298 ? -10.697  3.945   -77.800  1.00 115.73 ? 267 PHE B O   1 
ATOM 5315  C CB  . PHE B 1 298 ? -11.463  4.514   -80.500  1.00 118.33 ? 267 PHE B CB  1 
ATOM 5316  C CG  . PHE B 1 298 ? -12.968  4.405   -80.468  1.00 116.95 ? 267 PHE B CG  1 
ATOM 5317  C CD1 . PHE B 1 298 ? -13.726  4.840   -81.546  1.00 116.98 ? 267 PHE B CD1 1 
ATOM 5318  C CD2 . PHE B 1 298 ? -13.620  3.829   -79.388  1.00 114.62 ? 267 PHE B CD2 1 
ATOM 5319  C CE1 . PHE B 1 298 ? -15.101  4.726   -81.533  1.00 115.49 ? 267 PHE B CE1 1 
ATOM 5320  C CE2 . PHE B 1 298 ? -14.980  3.725   -79.378  1.00 112.58 ? 267 PHE B CE2 1 
ATOM 5321  C CZ  . PHE B 1 298 ? -15.719  4.168   -80.453  1.00 113.70 ? 267 PHE B CZ  1 
ATOM 5322  N N   . VAL B 1 299 ? -11.485  6.022   -77.274  1.00 112.42 ? 268 VAL B N   1 
ATOM 5323  C CA  . VAL B 1 299 ? -11.697  5.785   -75.847  1.00 110.71 ? 268 VAL B CA  1 
ATOM 5324  C C   . VAL B 1 299 ? -13.166  5.868   -75.582  1.00 109.32 ? 268 VAL B C   1 
ATOM 5325  O O   . VAL B 1 299 ? -13.782  6.879   -75.900  1.00 108.74 ? 268 VAL B O   1 
ATOM 5326  C CB  . VAL B 1 299 ? -10.998  6.853   -74.983  1.00 109.89 ? 268 VAL B CB  1 
ATOM 5327  C CG1 . VAL B 1 299 ? -11.582  6.917   -73.578  1.00 108.38 ? 268 VAL B CG1 1 
ATOM 5328  C CG2 . VAL B 1 299 ? -9.499   6.582   -74.921  1.00 111.95 ? 268 VAL B CG2 1 
ATOM 5329  N N   . MET B 1 300 ? -13.714  4.802   -75.005  1.00 108.95 ? 269 MET B N   1 
ATOM 5330  C CA  . MET B 1 300 ? -15.134  4.712   -74.644  1.00 107.88 ? 269 MET B CA  1 
ATOM 5331  C C   . MET B 1 300 ? -15.307  4.451   -73.163  1.00 106.99 ? 269 MET B C   1 
ATOM 5332  O O   . MET B 1 300 ? -15.075  3.334   -72.714  1.00 107.73 ? 269 MET B O   1 
ATOM 5333  C CB  . MET B 1 300 ? -15.810  3.584   -75.430  1.00 109.29 ? 269 MET B CB  1 
ATOM 5334  C CG  . MET B 1 300 ? -16.973  2.847   -74.731  1.00 108.83 ? 269 MET B CG  1 
ATOM 5335  S SD  . MET B 1 300 ? -17.563  1.461   -75.735  1.00 110.34 ? 269 MET B SD  1 
ATOM 5336  C CE  . MET B 1 300 ? -18.675  0.637   -74.642  1.00 111.96 ? 269 MET B CE  1 
ATOM 5337  N N   . GLU B 1 301 ? -15.725  5.475   -72.419  1.00 105.58 ? 270 GLU B N   1 
ATOM 5338  C CA  . GLU B 1 301 ? -16.031  5.356   -70.992  1.00 105.17 ? 270 GLU B CA  1 
ATOM 5339  C C   . GLU B 1 301 ? -16.910  4.140   -70.726  1.00 105.93 ? 270 GLU B C   1 
ATOM 5340  O O   . GLU B 1 301 ? -17.645  3.716   -71.600  1.00 106.96 ? 270 GLU B O   1 
ATOM 5341  C CB  . GLU B 1 301 ? -16.710  6.617   -70.497  1.00 104.18 ? 270 GLU B CB  1 
ATOM 5342  C CG  . GLU B 1 301 ? -15.818  7.812   -70.581  1.00 104.65 ? 270 GLU B CG  1 
ATOM 5343  C CD  . GLU B 1 301 ? -16.386  9.021   -69.878  1.00 107.49 ? 270 GLU B CD  1 
ATOM 5344  O OE1 . GLU B 1 301 ? -16.601  8.960   -68.639  1.00 109.05 ? 270 GLU B OE1 1 
ATOM 5345  O OE2 . GLU B 1 301 ? -16.605  10.049  -70.562  1.00 108.72 ? 270 GLU B OE2 1 
ATOM 5346  N N   . VAL B 1 302 ? -16.809  3.563   -69.536  1.00 106.06 ? 271 VAL B N   1 
ATOM 5347  C CA  . VAL B 1 302 ? -17.505  2.337   -69.193  1.00 106.76 ? 271 VAL B CA  1 
ATOM 5348  C C   . VAL B 1 302 ? -17.720  2.404   -67.698  1.00 107.77 ? 271 VAL B C   1 
ATOM 5349  O O   . VAL B 1 302 ? -16.864  2.915   -66.981  1.00 107.94 ? 271 VAL B O   1 
ATOM 5350  C CB  . VAL B 1 302 ? -16.638  1.110   -69.506  1.00 107.29 ? 271 VAL B CB  1 
ATOM 5351  C CG1 . VAL B 1 302 ? -17.380  -0.134  -69.251  1.00 108.18 ? 271 VAL B CG1 1 
ATOM 5352  C CG2 . VAL B 1 302 ? -16.273  1.097   -70.921  1.00 107.34 ? 271 VAL B CG2 1 
ATOM 5353  N N   . THR B 1 303 ? -18.846  1.894   -67.206  1.00 109.09 ? 272 THR B N   1 
ATOM 5354  C CA  . THR B 1 303 ? -19.003  1.728   -65.751  1.00 110.49 ? 272 THR B CA  1 
ATOM 5355  C C   . THR B 1 303 ? -19.260  0.273   -65.356  1.00 112.36 ? 272 THR B C   1 
ATOM 5356  O O   . THR B 1 303 ? -19.303  -0.618  -66.220  1.00 112.77 ? 272 THR B O   1 
ATOM 5357  C CB  . THR B 1 303 ? -20.103  2.622   -65.184  1.00 110.31 ? 272 THR B CB  1 
ATOM 5358  O OG1 . THR B 1 303 ? -20.152  3.828   -65.944  1.00 110.37 ? 272 THR B OG1 1 
ATOM 5359  C CG2 . THR B 1 303 ? -19.820  2.964   -63.732  1.00 110.61 ? 272 THR B CG2 1 
ATOM 5360  N N   . ASN B 1 304 ? -19.390  0.045   -64.045  1.00 113.84 ? 273 ASN B N   1 
ATOM 5361  C CA  . ASN B 1 304 ? -19.772  -1.258  -63.474  1.00 115.86 ? 273 ASN B CA  1 
ATOM 5362  C C   . ASN B 1 304 ? -21.271  -1.552  -63.626  1.00 116.70 ? 273 ASN B C   1 
ATOM 5363  O O   . ASN B 1 304 ? -22.085  -0.626  -63.695  1.00 115.74 ? 273 ASN B O   1 
ATOM 5364  C CB  . ASN B 1 304 ? -19.330  -1.343  -62.013  1.00 116.85 ? 273 ASN B CB  1 
ATOM 5365  C CG  . ASN B 1 304 ? -17.829  -1.257  -61.862  1.00 116.36 ? 273 ASN B CG  1 
ATOM 5366  O OD1 . ASN B 1 304 ? -17.125  -2.219  -62.130  1.00 117.17 ? 273 ASN B OD1 1 
ATOM 5367  N ND2 . ASN B 1 304 ? -17.330  -0.104  -61.437  1.00 115.58 ? 273 ASN B ND2 1 
ATOM 5368  N N   . LYS B 1 305 ? -21.633  -2.830  -63.709  1.00 118.78 ? 274 LYS B N   1 
ATOM 5369  C CA  . LYS B 1 305 ? -23.036  -3.175  -63.947  1.00 120.63 ? 274 LYS B CA  1 
ATOM 5370  C C   . LYS B 1 305 ? -23.828  -3.269  -62.616  1.00 122.75 ? 274 LYS B C   1 
ATOM 5371  O O   . LYS B 1 305 ? -23.424  -3.983  -61.705  1.00 124.31 ? 274 LYS B O   1 
ATOM 5372  C CB  . LYS B 1 305 ? -23.182  -4.436  -64.830  1.00 121.31 ? 274 LYS B CB  1 
ATOM 5373  N N   . THR B 1 306 ? -24.917  -2.493  -62.503  1.00 123.48 ? 275 THR B N   1 
ATOM 5374  C CA  . THR B 1 306 ? -25.876  -2.581  -61.398  1.00 125.60 ? 275 THR B CA  1 
ATOM 5375  C C   . THR B 1 306 ? -26.878  -3.658  -61.780  1.00 127.59 ? 275 THR B C   1 
ATOM 5376  O O   . THR B 1 306 ? -26.809  -4.223  -62.879  1.00 127.44 ? 275 THR B O   1 
ATOM 5377  C CB  . THR B 1 306 ? -26.701  -1.275  -61.216  1.00 125.34 ? 275 THR B CB  1 
ATOM 5378  O OG1 . THR B 1 306 ? -25.903  -0.131  -61.516  1.00 123.91 ? 275 THR B OG1 1 
ATOM 5379  C CG2 . THR B 1 306 ? -27.254  -1.148  -59.794  1.00 127.51 ? 275 THR B CG2 1 
ATOM 5380  N N   . ARG B 1 307 ? -27.821  -3.930  -60.881  1.00 129.82 ? 276 ARG B N   1 
ATOM 5381  C CA  . ARG B 1 307 ? -28.969  -4.726  -61.242  1.00 131.67 ? 276 ARG B CA  1 
ATOM 5382  C C   . ARG B 1 307 ? -29.831  -3.868  -62.154  1.00 131.44 ? 276 ARG B C   1 
ATOM 5383  O O   . ARG B 1 307 ? -30.540  -4.387  -63.010  1.00 132.12 ? 276 ARG B O   1 
ATOM 5384  C CB  . ARG B 1 307 ? -29.739  -5.173  -60.007  1.00 133.91 ? 276 ARG B CB  1 
ATOM 5385  C CG  . ARG B 1 307 ? -30.707  -6.315  -60.295  1.00 135.79 ? 276 ARG B CG  1 
ATOM 5386  C CD  . ARG B 1 307 ? -31.483  -6.734  -59.060  1.00 137.81 ? 276 ARG B CD  1 
ATOM 5387  N NE  . ARG B 1 307 ? -30.620  -7.296  -58.023  1.00 137.87 ? 276 ARG B NE  1 
ATOM 5388  C CZ  . ARG B 1 307 ? -29.980  -8.459  -58.126  1.00 138.66 ? 276 ARG B CZ  1 
ATOM 5389  N NH1 . ARG B 1 307 ? -30.085  -9.192  -59.233  1.00 138.54 ? 276 ARG B NH1 1 
ATOM 5390  N NH2 . ARG B 1 307 ? -29.225  -8.889  -57.121  1.00 139.49 ? 276 ARG B NH2 1 
ATOM 5391  N N   . ALA B 1 308 ? -29.727  -2.552  -61.974  1.00 130.97 ? 277 ALA B N   1 
ATOM 5392  C CA  . ALA B 1 308 ? -30.455  -1.560  -62.768  1.00 131.45 ? 277 ALA B CA  1 
ATOM 5393  C C   . ALA B 1 308 ? -30.431  -1.783  -64.300  1.00 131.37 ? 277 ALA B C   1 
ATOM 5394  O O   . ALA B 1 308 ? -31.453  -1.622  -64.983  1.00 132.25 ? 277 ALA B O   1 
ATOM 5395  C CB  . ALA B 1 308 ? -29.962  -0.142  -62.411  1.00 130.06 ? 277 ALA B CB  1 
ATOM 5396  N N   . ASP B 1 309 ? -29.272  -2.170  -64.831  1.00 131.02 ? 278 ASP B N   1 
ATOM 5397  C CA  . ASP B 1 309 ? -29.050  -2.189  -66.288  1.00 131.07 ? 278 ASP B CA  1 
ATOM 5398  C C   . ASP B 1 309 ? -28.267  -3.402  -66.779  1.00 131.48 ? 278 ASP B C   1 
ATOM 5399  O O   . ASP B 1 309 ? -27.313  -3.259  -67.544  1.00 130.18 ? 278 ASP B O   1 
ATOM 5400  C CB  . ASP B 1 309 ? -28.336  -0.902  -66.729  1.00 129.40 ? 278 ASP B CB  1 
ATOM 5401  C CG  . ASP B 1 309 ? -27.381  -0.358  -65.661  1.00 128.54 ? 278 ASP B CG  1 
ATOM 5402  O OD1 . ASP B 1 309 ? -26.712  -1.164  -64.971  1.00 127.74 ? 278 ASP B OD1 1 
ATOM 5403  O OD2 . ASP B 1 309 ? -27.317  0.883   -65.513  1.00 128.73 ? 278 ASP B OD2 1 
ATOM 5404  N N   . VAL B 1 310 ? -28.694  -4.592  -66.354  1.00 133.74 ? 279 VAL B N   1 
ATOM 5405  C CA  . VAL B 1 310 ? -28.045  -5.866  -66.733  1.00 134.83 ? 279 VAL B CA  1 
ATOM 5406  C C   . VAL B 1 310 ? -28.296  -6.190  -68.214  1.00 135.41 ? 279 VAL B C   1 
ATOM 5407  O O   . VAL B 1 310 ? -27.940  -7.280  -68.694  1.00 136.61 ? 279 VAL B O   1 
ATOM 5408  C CB  . VAL B 1 310 ? -28.497  -7.083  -65.831  1.00 137.18 ? 279 VAL B CB  1 
ATOM 5409  C CG1 . VAL B 1 310 ? -27.379  -8.109  -65.710  1.00 137.57 ? 279 VAL B CG1 1 
ATOM 5410  C CG2 . VAL B 1 310 ? -28.924  -6.632  -64.433  1.00 137.43 ? 279 VAL B CG2 1 
ATOM 5411  N N   . LYS B 1 311 ? -28.918  -5.235  -68.915  1.00 134.78 ? 280 LYS B N   1 
ATOM 5412  C CA  . LYS B 1 311 ? -29.168  -5.319  -70.358  1.00 135.24 ? 280 LYS B CA  1 
ATOM 5413  C C   . LYS B 1 311 ? -28.393  -4.267  -71.171  1.00 133.49 ? 280 LYS B C   1 
ATOM 5414  O O   . LYS B 1 311 ? -28.924  -3.690  -72.137  1.00 134.11 ? 280 LYS B O   1 
ATOM 5415  C CB  . LYS B 1 311 ? -30.671  -5.235  -70.654  1.00 136.74 ? 280 LYS B CB  1 
ATOM 5416  C CG  . LYS B 1 311 ? -31.374  -6.565  -70.588  1.00 137.98 ? 280 LYS B CG  1 
ATOM 5417  C CD  . LYS B 1 311 ? -32.474  -6.614  -71.621  1.00 137.92 ? 280 LYS B CD  1 
ATOM 5418  C CE  . LYS B 1 311 ? -33.289  -7.851  -71.421  1.00 139.82 ? 280 LYS B CE  1 
ATOM 5419  N NZ  . LYS B 1 311 ? -33.780  -7.820  -70.007  1.00 140.11 ? 280 LYS B NZ  1 
ATOM 5420  N N   . GLY B 1 312 ? -27.141  -4.029  -70.775  1.00 131.52 ? 281 GLY B N   1 
ATOM 5421  C CA  . GLY B 1 312 ? -26.285  -3.077  -71.464  1.00 129.63 ? 281 GLY B CA  1 
ATOM 5422  C C   . GLY B 1 312 ? -25.402  -3.805  -72.449  1.00 130.22 ? 281 GLY B C   1 
ATOM 5423  O O   . GLY B 1 312 ? -25.508  -5.034  -72.592  1.00 131.94 ? 281 GLY B O   1 
ATOM 5424  N N   . GLY B 1 313 ? -24.541  -3.044  -73.130  1.00 128.94 ? 282 GLY B N   1 
ATOM 5425  C CA  . GLY B 1 313 ? -23.536  -3.599  -74.039  1.00 129.42 ? 282 GLY B CA  1 
ATOM 5426  C C   . GLY B 1 313 ? -22.150  -3.615  -73.424  1.00 128.21 ? 282 GLY B C   1 
ATOM 5427  O O   . GLY B 1 313 ? -21.664  -2.587  -72.961  1.00 126.38 ? 282 GLY B O   1 
ATOM 5428  N N   . THR B 1 314 ? -21.516  -4.782  -73.407  1.00 129.59 ? 283 THR B N   1 
ATOM 5429  C CA  . THR B 1 314 ? -20.196  -4.901  -72.803  1.00 129.50 ? 283 THR B CA  1 
ATOM 5430  C C   . THR B 1 314 ? -19.128  -4.969  -73.862  1.00 130.29 ? 283 THR B C   1 
ATOM 5431  O O   . THR B 1 314 ? -19.429  -5.142  -75.046  1.00 131.60 ? 283 THR B O   1 
ATOM 5432  C CB  . THR B 1 314 ? -20.045  -6.148  -71.930  1.00 131.15 ? 283 THR B CB  1 
ATOM 5433  O OG1 . THR B 1 314 ? -20.186  -7.321  -72.744  1.00 134.10 ? 283 THR B OG1 1 
ATOM 5434  C CG2 . THR B 1 314 ? -21.074  -6.143  -70.822  1.00 131.04 ? 283 THR B CG2 1 
ATOM 5435  N N   . LEU B 1 315 ? -17.882  -4.840  -73.413  1.00 129.89 ? 284 LEU B N   1 
ATOM 5436  C CA  . LEU B 1 315 ? -16.730  -4.844  -74.281  1.00 130.71 ? 284 LEU B CA  1 
ATOM 5437  C C   . LEU B 1 315 ? -15.984  -6.129  -74.029  1.00 134.14 ? 284 LEU B C   1 
ATOM 5438  O O   . LEU B 1 315 ? -15.319  -6.264  -73.017  1.00 134.54 ? 284 LEU B O   1 
ATOM 5439  C CB  . LEU B 1 315 ? -15.826  -3.648  -73.960  1.00 127.95 ? 284 LEU B CB  1 
ATOM 5440  C CG  . LEU B 1 315 ? -16.305  -2.232  -74.265  1.00 123.67 ? 284 LEU B CG  1 
ATOM 5441  C CD1 . LEU B 1 315 ? -15.521  -1.245  -73.497  1.00 120.27 ? 284 LEU B CD1 1 
ATOM 5442  C CD2 . LEU B 1 315 ? -16.175  -1.918  -75.723  1.00 122.69 ? 284 LEU B CD2 1 
ATOM 5443  N N   . THR B 1 316 ? -16.107  -7.099  -74.918  1.00 137.70 ? 285 THR B N   1 
ATOM 5444  C CA  . THR B 1 316 ? -15.239  -8.265  -74.803  1.00 141.85 ? 285 THR B CA  1 
ATOM 5445  C C   . THR B 1 316 ? -14.128  -8.147  -75.831  1.00 143.77 ? 285 THR B C   1 
ATOM 5446  O O   . THR B 1 316 ? -14.186  -7.283  -76.711  1.00 142.81 ? 285 THR B O   1 
ATOM 5447  C CB  . THR B 1 316 ? -15.995  -9.626  -74.928  1.00 144.72 ? 285 THR B CB  1 
ATOM 5448  O OG1 . THR B 1 316 ? -16.963  -9.557  -75.979  1.00 145.64 ? 285 THR B OG1 1 
ATOM 5449  C CG2 . THR B 1 316 ? -16.700  -10.000 -73.611  1.00 144.60 ? 285 THR B CG2 1 
ATOM 5450  N N   . GLN B 1 317 ? -13.104  -8.985  -75.693  1.00 147.20 ? 286 GLN B N   1 
ATOM 5451  C CA  . GLN B 1 317 ? -12.054  -9.064  -76.694  1.00 150.12 ? 286 GLN B CA  1 
ATOM 5452  C C   . GLN B 1 317 ? -12.293  -10.334 -77.510  1.00 154.34 ? 286 GLN B C   1 
ATOM 5453  O O   . GLN B 1 317 ? -12.374  -11.441 -76.951  1.00 156.44 ? 286 GLN B O   1 
ATOM 5454  C CB  . GLN B 1 317 ? -10.666  -9.056  -76.043  1.00 151.06 ? 286 GLN B CB  1 
ATOM 5455  C CG  . GLN B 1 317 ? -9.542   -8.522  -76.933  1.00 152.49 ? 286 GLN B CG  1 
ATOM 5456  C CD  . GLN B 1 317 ? -8.228   -9.258  -76.709  1.00 157.07 ? 286 GLN B CD  1 
ATOM 5457  O OE1 . GLN B 1 317 ? -7.749   -9.350  -75.581  1.00 157.74 ? 286 GLN B OE1 1 
ATOM 5458  N NE2 . GLN B 1 317 ? -7.646   -9.796  -77.785  1.00 160.69 ? 286 GLN B NE2 1 
ATOM 5459  N N   . TYR B 1 318 ? -12.442  -10.146 -78.824  1.00 155.66 ? 287 TYR B N   1 
ATOM 5460  C CA  . TYR B 1 318 ? -12.712  -11.230 -79.769  1.00 158.07 ? 287 TYR B CA  1 
ATOM 5461  C C   . TYR B 1 318 ? -11.753  -11.125 -80.945  1.00 159.28 ? 287 TYR B C   1 
ATOM 5462  O O   . TYR B 1 318 ? -11.580  -10.040 -81.508  1.00 158.62 ? 287 TYR B O   1 
ATOM 5463  C CB  . TYR B 1 318 ? -14.162  -11.170 -80.263  1.00 158.02 ? 287 TYR B CB  1 
ATOM 5464  N N   . GLU B 1 319 ? -11.135  -12.259 -81.294  1.00 161.45 ? 288 GLU B N   1 
ATOM 5465  C CA  . GLU B 1 319 ? -10.120  -12.378 -82.368  1.00 162.96 ? 288 GLU B CA  1 
ATOM 5466  C C   . GLU B 1 319 ? -8.767   -11.739 -82.025  1.00 162.36 ? 288 GLU B C   1 
ATOM 5467  O O   . GLU B 1 319 ? -7.715   -12.358 -82.228  1.00 164.16 ? 288 GLU B O   1 
ATOM 5468  C CB  . GLU B 1 319 ? -10.640  -11.886 -83.735  1.00 163.26 ? 288 GLU B CB  1 
ATOM 5469  N N   . GLY B 1 320 ? -8.803   -10.510 -81.509  1.00 160.01 ? 289 GLY B N   1 
ATOM 5470  C CA  . GLY B 1 320 ? -7.594   -9.768  -81.163  1.00 158.97 ? 289 GLY B CA  1 
ATOM 5471  C C   . GLY B 1 320 ? -7.867   -8.375  -80.632  1.00 156.52 ? 289 GLY B C   1 
ATOM 5472  O O   . GLY B 1 320 ? -7.121   -7.879  -79.788  1.00 155.58 ? 289 GLY B O   1 
ATOM 5473  N N   . LYS B 1 321 ? -8.933   -7.745  -81.128  1.00 155.53 ? 290 LYS B N   1 
ATOM 5474  C CA  . LYS B 1 321 ? -9.325   -6.391  -80.709  1.00 153.22 ? 290 LYS B CA  1 
ATOM 5475  C C   . LYS B 1 321 ? -10.593  -6.348  -79.852  1.00 151.79 ? 290 LYS B C   1 
ATOM 5476  O O   . LYS B 1 321 ? -11.333  -7.340  -79.753  1.00 152.50 ? 290 LYS B O   1 
ATOM 5477  C CB  . LYS B 1 321 ? -9.519   -5.494  -81.930  1.00 153.23 ? 290 LYS B CB  1 
ATOM 5478  C CG  . LYS B 1 321 ? -8.233   -5.005  -82.527  1.00 154.43 ? 290 LYS B CG  1 
ATOM 5479  C CD  . LYS B 1 321 ? -8.488   -4.158  -83.747  1.00 155.62 ? 290 LYS B CD  1 
ATOM 5480  C CE  . LYS B 1 321 ? -7.196   -3.528  -84.233  1.00 156.75 ? 290 LYS B CE  1 
ATOM 5481  N NZ  . LYS B 1 321 ? -7.432   -2.695  -85.443  1.00 157.86 ? 290 LYS B NZ  1 
ATOM 5482  N N   . LEU B 1 322 ? -10.830  -5.183  -79.243  1.00 149.67 ? 291 LEU B N   1 
ATOM 5483  C CA  . LEU B 1 322 ? -12.069  -4.895  -78.505  1.00 148.05 ? 291 LEU B CA  1 
ATOM 5484  C C   . LEU B 1 322 ? -13.294  -4.858  -79.431  1.00 148.60 ? 291 LEU B C   1 
ATOM 5485  O O   . LEU B 1 322 ? -13.210  -4.358  -80.561  1.00 149.21 ? 291 LEU B O   1 
ATOM 5486  C CB  . LEU B 1 322 ? -11.951  -3.564  -77.753  1.00 145.65 ? 291 LEU B CB  1 
ATOM 5487  C CG  . LEU B 1 322 ? -11.226  -3.574  -76.414  1.00 143.56 ? 291 LEU B CG  1 
ATOM 5488  C CD1 . LEU B 1 322 ? -11.074  -2.166  -75.894  1.00 140.09 ? 291 LEU B CD1 1 
ATOM 5489  C CD2 . LEU B 1 322 ? -11.987  -4.428  -75.427  1.00 142.88 ? 291 LEU B CD2 1 
ATOM 5490  N N   . ARG B 1 323 ? -14.419  -5.394  -78.951  1.00 148.49 ? 292 ARG B N   1 
ATOM 5491  C CA  . ARG B 1 323 ? -15.680  -5.390  -79.694  1.00 148.69 ? 292 ARG B CA  1 
ATOM 5492  C C   . ARG B 1 323 ? -16.819  -5.113  -78.733  1.00 147.27 ? 292 ARG B C   1 
ATOM 5493  O O   . ARG B 1 323 ? -16.839  -5.655  -77.629  1.00 147.09 ? 292 ARG B O   1 
ATOM 5494  C CB  . ARG B 1 323 ? -15.903  -6.738  -80.400  1.00 150.93 ? 292 ARG B CB  1 
ATOM 5495  C CG  . ARG B 1 323 ? -17.031  -6.749  -81.466  1.00 153.23 ? 292 ARG B CG  1 
ATOM 5496  C CD  . ARG B 1 323 ? -17.090  -8.082  -82.237  1.00 157.64 ? 292 ARG B CD  1 
ATOM 5497  N NE  . ARG B 1 323 ? -15.839  -8.372  -82.956  1.00 160.67 ? 292 ARG B NE  1 
ATOM 5498  C CZ  . ARG B 1 323 ? -15.354  -9.593  -83.207  1.00 163.53 ? 292 ARG B CZ  1 
ATOM 5499  N NH1 . ARG B 1 323 ? -15.991  -10.690 -82.798  1.00 165.28 ? 292 ARG B NH1 1 
ATOM 5500  N NH2 . ARG B 1 323 ? -14.209  -9.723  -83.864  1.00 164.57 ? 292 ARG B NH2 1 
ATOM 5501  N N   . LEU B 1 324 ? -17.752  -4.257  -79.148  1.00 146.26 ? 293 LEU B N   1 
ATOM 5502  C CA  . LEU B 1 324 ? -18.989  -4.043  -78.400  1.00 145.26 ? 293 LEU B CA  1 
ATOM 5503  C C   . LEU B 1 324 ? -19.958  -5.168  -78.683  1.00 146.91 ? 293 LEU B C   1 
ATOM 5504  O O   . LEU B 1 324 ? -20.164  -5.564  -79.828  1.00 148.27 ? 293 LEU B O   1 
ATOM 5505  C CB  . LEU B 1 324 ? -19.638  -2.709  -78.755  1.00 144.01 ? 293 LEU B CB  1 
ATOM 5506  C CG  . LEU B 1 324 ? -20.933  -2.384  -78.012  1.00 142.80 ? 293 LEU B CG  1 
ATOM 5507  C CD1 . LEU B 1 324 ? -20.712  -2.372  -76.519  1.00 141.86 ? 293 LEU B CD1 1 
ATOM 5508  C CD2 . LEU B 1 324 ? -21.482  -1.057  -78.453  1.00 141.48 ? 293 LEU B CD2 1 
ATOM 5509  N N   . VAL B 1 325 ? -20.548  -5.690  -77.628  1.00 147.12 ? 294 VAL B N   1 
ATOM 5510  C CA  . VAL B 1 325 ? -21.487  -6.771  -77.767  1.00 148.95 ? 294 VAL B CA  1 
ATOM 5511  C C   . VAL B 1 325 ? -22.745  -6.340  -77.034  1.00 149.35 ? 294 VAL B C   1 
ATOM 5512  O O   . VAL B 1 325 ? -22.678  -5.961  -75.862  1.00 148.68 ? 294 VAL B O   1 
ATOM 5513  C CB  . VAL B 1 325 ? -20.886  -8.078  -77.215  1.00 149.69 ? 294 VAL B CB  1 
ATOM 5514  C CG1 . VAL B 1 325 ? -21.957  -9.041  -76.797  1.00 150.99 ? 294 VAL B CG1 1 
ATOM 5515  C CG2 . VAL B 1 325 ? -19.991  -8.712  -78.254  1.00 150.11 ? 294 VAL B CG2 1 
ATOM 5516  N N   . GLU B 1 326 ? -23.877  -6.356  -77.738  1.00 150.77 ? 295 GLU B N   1 
ATOM 5517  C CA  . GLU B 1 326 ? -25.163  -5.966  -77.160  1.00 151.58 ? 295 GLU B CA  1 
ATOM 5518  C C   . GLU B 1 326 ? -26.013  -7.207  -76.951  1.00 153.82 ? 295 GLU B C   1 
ATOM 5519  O O   . GLU B 1 326 ? -25.796  -8.219  -77.618  1.00 155.32 ? 295 GLU B O   1 
ATOM 5520  C CB  . GLU B 1 326 ? -25.890  -4.989  -78.073  1.00 151.49 ? 295 GLU B CB  1 
ATOM 5521  C CG  . GLU B 1 326 ? -25.047  -3.791  -78.507  1.00 151.05 ? 295 GLU B CG  1 
ATOM 5522  C CD  . GLU B 1 326 ? -25.264  -2.549  -77.653  1.00 150.73 ? 295 GLU B CD  1 
ATOM 5523  O OE1 . GLU B 1 326 ? -25.142  -2.627  -76.403  1.00 149.80 ? 295 GLU B OE1 1 
ATOM 5524  O OE2 . GLU B 1 326 ? -25.547  -1.484  -78.254  1.00 150.89 ? 295 GLU B OE2 1 
ATOM 5525  N N   . ILE B 1 327 ? -26.984  -7.116  -76.040  1.00 154.50 ? 296 ILE B N   1 
ATOM 5526  C CA  . ILE B 1 327 ? -27.809  -8.255  -75.595  1.00 156.49 ? 296 ILE B CA  1 
ATOM 5527  C C   . ILE B 1 327 ? -28.339  -9.124  -76.722  1.00 158.38 ? 296 ILE B C   1 
ATOM 5528  O O   . ILE B 1 327 ? -28.630  -10.297 -76.509  1.00 159.84 ? 296 ILE B O   1 
ATOM 5529  C CB  . ILE B 1 327 ? -29.050  -7.805  -74.793  1.00 156.93 ? 296 ILE B CB  1 
ATOM 5530  C CG1 . ILE B 1 327 ? -28.953  -6.327  -74.341  1.00 155.85 ? 296 ILE B CG1 1 
ATOM 5531  C CG2 . ILE B 1 327 ? -29.307  -8.789  -73.653  1.00 157.77 ? 296 ILE B CG2 1 
ATOM 5532  C CD1 . ILE B 1 327 ? -29.504  -5.262  -75.359  1.00 155.05 ? 296 ILE B CD1 1 
ATOM 5533  N N   . ALA B 1 328 ? -28.449  -8.529  -77.910  1.00 158.52 ? 297 ALA B N   1 
ATOM 5534  C CA  . ALA B 1 328 ? -29.123  -9.121  -79.071  1.00 160.69 ? 297 ALA B CA  1 
ATOM 5535  C C   . ALA B 1 328 ? -28.291  -10.096 -79.916  1.00 161.87 ? 297 ALA B C   1 
ATOM 5536  O O   . ALA B 1 328 ? -28.782  -11.156 -80.299  1.00 163.78 ? 297 ALA B O   1 
ATOM 5537  C CB  . ALA B 1 328 ? -29.708  -8.017  -79.960  1.00 160.22 ? 297 ALA B CB  1 
ATOM 5538  N N   . GLN B 1 329 ? -27.047  -9.733  -80.220  1.00 161.19 ? 298 GLN B N   1 
ATOM 5539  C CA  . GLN B 1 329 ? -26.168  -10.575 -81.048  1.00 162.49 ? 298 GLN B CA  1 
ATOM 5540  C C   . GLN B 1 329 ? -25.685  -11.805 -80.272  1.00 163.68 ? 298 GLN B C   1 
ATOM 5541  O O   . GLN B 1 329 ? -24.797  -12.538 -80.728  1.00 164.42 ? 298 GLN B O   1 
ATOM 5542  C CB  . GLN B 1 329 ? -24.975  -9.769  -81.566  1.00 160.91 ? 298 GLN B CB  1 
ATOM 5543  C CG  . GLN B 1 329 ? -25.353  -8.491  -82.294  1.00 160.48 ? 298 GLN B CG  1 
ATOM 5544  C CD  . GLN B 1 329 ? -24.695  -7.255  -81.690  1.00 159.24 ? 298 GLN B CD  1 
ATOM 5545  O OE1 . GLN B 1 329 ? -23.728  -7.352  -80.934  1.00 158.73 ? 298 GLN B OE1 1 
ATOM 5546  N NE2 . GLN B 1 329 ? -25.226  -6.081  -82.019  1.00 159.01 ? 298 GLN B NE2 1 
ATOM 5547  N N   . VAL B 1 330 ? -26.292  -12.024 -79.106  1.00 164.17 ? 299 VAL B N   1 
ATOM 5548  C CA  . VAL B 1 330 ? -25.946  -13.132 -78.232  1.00 165.39 ? 299 VAL B CA  1 
ATOM 5549  C C   . VAL B 1 330 ? -26.848  -14.347 -78.491  1.00 168.22 ? 299 VAL B C   1 
ATOM 5550  O O   . VAL B 1 330 ? -28.080  -14.217 -78.524  1.00 169.09 ? 299 VAL B O   1 
ATOM 5551  C CB  . VAL B 1 330 ? -26.047  -12.727 -76.748  1.00 164.34 ? 299 VAL B CB  1 
ATOM 5552  C CG1 . VAL B 1 330 ? -25.368  -13.766 -75.875  1.00 165.29 ? 299 VAL B CG1 1 
ATOM 5553  C CG2 . VAL B 1 330 ? -25.431  -11.353 -76.511  1.00 161.69 ? 299 VAL B CG2 1 
ATOM 5554  N N   . PRO B 1 331 ? -26.229  -15.526 -78.694  1.00 169.88 ? 300 PRO B N   1 
ATOM 5555  C CA  . PRO B 1 331 ? -26.881  -16.847 -78.809  1.00 172.76 ? 300 PRO B CA  1 
ATOM 5556  C C   . PRO B 1 331 ? -27.724  -17.277 -77.586  1.00 174.07 ? 300 PRO B C   1 
ATOM 5557  O O   . PRO B 1 331 ? -27.198  -17.370 -76.466  1.00 173.57 ? 300 PRO B O   1 
ATOM 5558  C CB  . PRO B 1 331 ? -25.697  -17.794 -79.006  1.00 173.50 ? 300 PRO B CB  1 
ATOM 5559  C CG  . PRO B 1 331 ? -24.669  -16.945 -79.679  1.00 171.54 ? 300 PRO B CG  1 
ATOM 5560  C CD  . PRO B 1 331 ? -24.806  -15.585 -79.076  1.00 169.03 ? 300 PRO B CD  1 
ATOM 5561  N N   . LYS B 1 332 ? -29.006  -17.571 -77.840  1.00 175.99 ? 301 LYS B N   1 
ATOM 5562  C CA  . LYS B 1 332 ? -30.048  -17.794 -76.816  1.00 177.31 ? 301 LYS B CA  1 
ATOM 5563  C C   . LYS B 1 332 ? -29.639  -18.658 -75.625  1.00 178.18 ? 301 LYS B C   1 
ATOM 5564  O O   . LYS B 1 332 ? -29.973  -18.328 -74.485  1.00 177.78 ? 301 LYS B O   1 
ATOM 5565  C CB  . LYS B 1 332 ? -31.325  -18.370 -77.455  1.00 179.68 ? 301 LYS B CB  1 
ATOM 5566  C CG  . LYS B 1 332 ? -32.642  -17.971 -76.763  1.00 180.60 ? 301 LYS B CG  1 
ATOM 5567  C CD  . LYS B 1 332 ? -33.306  -16.761 -77.432  1.00 180.43 ? 301 LYS B CD  1 
ATOM 5568  C CE  . LYS B 1 332 ? -32.615  -15.445 -77.066  1.00 178.43 ? 301 LYS B CE  1 
ATOM 5569  N NZ  . LYS B 1 332 ? -32.790  -14.393 -78.105  1.00 177.87 ? 301 LYS B NZ  1 
ATOM 5570  N N   . ALA B 1 333 ? -28.921  -19.751 -75.892  1.00 179.53 ? 302 ALA B N   1 
ATOM 5571  C CA  . ALA B 1 333 ? -28.475  -20.682 -74.847  1.00 180.73 ? 302 ALA B CA  1 
ATOM 5572  C C   . ALA B 1 333 ? -27.547  -20.018 -73.831  1.00 178.93 ? 302 ALA B C   1 
ATOM 5573  O O   . ALA B 1 333 ? -27.298  -20.557 -72.749  1.00 179.37 ? 302 ALA B O   1 
ATOM 5574  C CB  . ALA B 1 333 ? -27.794  -21.892 -75.473  1.00 182.24 ? 302 ALA B CB  1 
ATOM 5575  N N   . HIS B 1 334 ? -27.056  -18.834 -74.185  1.00 177.03 ? 303 HIS B N   1 
ATOM 5576  C CA  . HIS B 1 334 ? -26.050  -18.153 -73.393  1.00 175.47 ? 303 HIS B CA  1 
ATOM 5577  C C   . HIS B 1 334 ? -26.369  -16.704 -73.050  1.00 173.31 ? 303 HIS B C   1 
ATOM 5578  O O   . HIS B 1 334 ? -25.481  -15.966 -72.645  1.00 171.37 ? 303 HIS B O   1 
ATOM 5579  C CB  . HIS B 1 334 ? -24.691  -18.249 -74.089  1.00 174.98 ? 303 HIS B CB  1 
ATOM 5580  C CG  . HIS B 1 334 ? -24.106  -19.628 -74.083  1.00 178.12 ? 303 HIS B CG  1 
ATOM 5581  N ND1 . HIS B 1 334 ? -24.160  -20.458 -72.980  1.00 180.53 ? 303 HIS B ND1 1 
ATOM 5582  C CD2 . HIS B 1 334 ? -23.444  -20.319 -75.041  1.00 179.99 ? 303 HIS B CD2 1 
ATOM 5583  C CE1 . HIS B 1 334 ? -23.564  -21.603 -73.263  1.00 182.46 ? 303 HIS B CE1 1 
ATOM 5584  N NE2 . HIS B 1 334 ? -23.120  -21.545 -74.507  1.00 182.66 ? 303 HIS B NE2 1 
ATOM 5585  N N   . VAL B 1 335 ? -27.625  -16.293 -73.191  1.00 173.85 ? 304 VAL B N   1 
ATOM 5586  C CA  . VAL B 1 335 ? -28.038  -14.978 -72.687  1.00 172.45 ? 304 VAL B CA  1 
ATOM 5587  C C   . VAL B 1 335 ? -28.113  -15.029 -71.159  1.00 172.98 ? 304 VAL B C   1 
ATOM 5588  O O   . VAL B 1 335 ? -28.030  -13.994 -70.486  1.00 171.46 ? 304 VAL B O   1 
ATOM 5589  C CB  . VAL B 1 335 ? -29.379  -14.491 -73.286  1.00 172.94 ? 304 VAL B CB  1 
ATOM 5590  C CG1 . VAL B 1 335 ? -29.683  -13.060 -72.844  1.00 170.72 ? 304 VAL B CG1 1 
ATOM 5591  C CG2 . VAL B 1 335 ? -29.344  -14.562 -74.805  1.00 173.15 ? 304 VAL B CG2 1 
ATOM 5592  N N   . ASP B 1 336 ? -28.262  -16.245 -70.628  1.00 175.48 ? 305 ASP B N   1 
ATOM 5593  C CA  . ASP B 1 336 ? -28.136  -16.517 -69.190  1.00 176.43 ? 305 ASP B CA  1 
ATOM 5594  C C   . ASP B 1 336 ? -26.767  -16.050 -68.663  1.00 174.56 ? 305 ASP B C   1 
ATOM 5595  O O   . ASP B 1 336 ? -26.654  -15.546 -67.545  1.00 174.01 ? 305 ASP B O   1 
ATOM 5596  C CB  . ASP B 1 336 ? -28.317  -18.025 -68.894  1.00 179.23 ? 305 ASP B CB  1 
ATOM 5597  C CG  . ASP B 1 336 ? -29.794  -18.463 -68.827  1.00 182.00 ? 305 ASP B CG  1 
ATOM 5598  O OD1 . ASP B 1 336 ? -30.574  -18.133 -69.748  1.00 182.65 ? 305 ASP B OD1 1 
ATOM 5599  O OD2 . ASP B 1 336 ? -30.170  -19.171 -67.859  1.00 183.92 ? 305 ASP B OD2 1 
ATOM 5600  N N   . GLU B 1 337 ? -25.737  -16.213 -69.489  1.00 173.73 ? 306 GLU B N   1 
ATOM 5601  C CA  . GLU B 1 337 ? -24.363  -15.978 -69.072  1.00 172.19 ? 306 GLU B CA  1 
ATOM 5602  C C   . GLU B 1 337 ? -23.888  -14.574 -69.386  1.00 169.45 ? 306 GLU B C   1 
ATOM 5603  O O   . GLU B 1 337 ? -22.798  -14.183 -68.980  1.00 168.13 ? 306 GLU B O   1 
ATOM 5604  C CB  . GLU B 1 337 ? -23.435  -16.983 -69.750  1.00 173.16 ? 306 GLU B CB  1 
ATOM 5605  C CG  . GLU B 1 337 ? -23.923  -18.422 -69.680  1.00 176.75 ? 306 GLU B CG  1 
ATOM 5606  C CD  . GLU B 1 337 ? -22.798  -19.430 -69.830  1.00 179.02 ? 306 GLU B CD  1 
ATOM 5607  O OE1 . GLU B 1 337 ? -23.047  -20.508 -70.421  1.00 181.34 ? 306 GLU B OE1 1 
ATOM 5608  O OE2 . GLU B 1 337 ? -21.670  -19.146 -69.354  1.00 178.42 ? 306 GLU B OE2 1 
ATOM 5609  N N   . PHE B 1 338 ? -24.694  -13.818 -70.123  1.00 168.67 ? 307 PHE B N   1 
ATOM 5610  C CA  . PHE B 1 338 ? -24.284  -12.487 -70.560  1.00 166.22 ? 307 PHE B CA  1 
ATOM 5611  C C   . PHE B 1 338 ? -24.650  -11.448 -69.513  1.00 165.20 ? 307 PHE B C   1 
ATOM 5612  O O   . PHE B 1 338 ? -23.949  -10.438 -69.354  1.00 163.48 ? 307 PHE B O   1 
ATOM 5613  C CB  . PHE B 1 338 ? -24.900  -12.149 -71.916  1.00 166.02 ? 307 PHE B CB  1 
ATOM 5614  C CG  . PHE B 1 338 ? -24.433  -10.850 -72.488  1.00 163.03 ? 307 PHE B CG  1 
ATOM 5615  C CD1 . PHE B 1 338 ? -23.100  -10.658 -72.798  1.00 161.39 ? 307 PHE B CD1 1 
ATOM 5616  C CD2 . PHE B 1 338 ? -25.338  -9.822  -72.731  1.00 161.92 ? 307 PHE B CD2 1 
ATOM 5617  C CE1 . PHE B 1 338 ? -22.675  -9.455  -73.327  1.00 159.91 ? 307 PHE B CE1 1 
ATOM 5618  C CE2 . PHE B 1 338 ? -24.926  -8.615  -73.259  1.00 159.57 ? 307 PHE B CE2 1 
ATOM 5619  C CZ  . PHE B 1 338 ? -23.594  -8.429  -73.559  1.00 158.92 ? 307 PHE B CZ  1 
ATOM 5620  N N   . LYS B 1 339 ? -25.746  -11.708 -68.803  1.00 166.25 ? 308 LYS B N   1 
ATOM 5621  C CA  . LYS B 1 339 ? -26.127  -10.897 -67.663  1.00 165.55 ? 308 LYS B CA  1 
ATOM 5622  C C   . LYS B 1 339 ? -25.193  -11.146 -66.462  1.00 165.27 ? 308 LYS B C   1 
ATOM 5623  O O   . LYS B 1 339 ? -24.611  -10.212 -65.911  1.00 163.60 ? 308 LYS B O   1 
ATOM 5624  C CB  . LYS B 1 339 ? -27.609  -11.104 -67.319  1.00 167.37 ? 308 LYS B CB  1 
ATOM 5625  C CG  . LYS B 1 339 ? -28.081  -12.566 -67.109  1.00 170.16 ? 308 LYS B CG  1 
ATOM 5626  C CD  . LYS B 1 339 ? -29.481  -12.640 -66.429  1.00 171.02 ? 308 LYS B CD  1 
ATOM 5627  C CE  . LYS B 1 339 ? -29.969  -14.074 -66.222  1.00 172.49 ? 308 LYS B CE  1 
ATOM 5628  N NZ  . LYS B 1 339 ? -29.227  -14.769 -65.132  1.00 172.16 ? 308 LYS B NZ  1 
ATOM 5629  N N   . SER B 1 340 ? -25.028  -12.410 -66.086  1.00 167.03 ? 309 SER B N   1 
ATOM 5630  C CA  . SER B 1 340 ? -24.097  -12.795 -65.020  1.00 167.31 ? 309 SER B CA  1 
ATOM 5631  C C   . SER B 1 340 ? -22.660  -12.875 -65.592  1.00 166.32 ? 309 SER B C   1 
ATOM 5632  O O   . SER B 1 340 ? -22.464  -12.532 -66.758  1.00 165.81 ? 309 SER B O   1 
ATOM 5633  C CB  . SER B 1 340 ? -24.554  -14.119 -64.363  1.00 169.81 ? 309 SER B CB  1 
ATOM 5634  O OG  . SER B 1 340 ? -24.574  -15.209 -65.274  1.00 171.26 ? 309 SER B OG  1 
ATOM 5635  N N   . VAL B 1 341 ? -21.644  -13.250 -64.803  1.00 166.17 ? 310 VAL B N   1 
ATOM 5636  C CA  . VAL B 1 341 ? -21.719  -13.352 -63.347  1.00 166.62 ? 310 VAL B CA  1 
ATOM 5637  C C   . VAL B 1 341 ? -21.445  -11.948 -62.848  1.00 163.74 ? 310 VAL B C   1 
ATOM 5638  O O   . VAL B 1 341 ? -21.774  -11.582 -61.715  1.00 164.06 ? 310 VAL B O   1 
ATOM 5639  C CB  . VAL B 1 341 ? -20.668  -14.345 -62.760  1.00 167.97 ? 310 VAL B CB  1 
ATOM 5640  C CG1 . VAL B 1 341 ? -21.052  -14.788 -61.311  1.00 170.21 ? 310 VAL B CG1 1 
ATOM 5641  C CG2 . VAL B 1 341 ? -20.481  -15.568 -63.684  1.00 169.72 ? 310 VAL B CG2 1 
ATOM 5642  N N   . SER B 1 342 ? -20.859  -11.163 -63.739  1.00 160.88 ? 311 SER B N   1 
ATOM 5643  C CA  . SER B 1 342 ? -20.451  -9.816  -63.428  1.00 157.88 ? 311 SER B CA  1 
ATOM 5644  C C   . SER B 1 342 ? -19.483  -9.849  -62.214  1.00 157.47 ? 311 SER B C   1 
ATOM 5645  O O   . SER B 1 342 ? -19.932  -9.610  -61.086  1.00 158.11 ? 311 SER B O   1 
ATOM 5646  C CB  . SER B 1 342 ? -21.697  -8.959  -63.178  1.00 157.20 ? 311 SER B CB  1 
ATOM 5647  O OG  . SER B 1 342 ? -22.770  -9.436  -63.970  1.00 157.02 ? 311 SER B OG  1 
ATOM 5648  N N   . LYS B 1 343 ? -18.181  -10.164 -62.390  1.00 156.21 ? 312 LYS B N   1 
ATOM 5649  C CA  . LYS B 1 343 ? -17.468  -10.536 -63.659  1.00 154.88 ? 312 LYS B CA  1 
ATOM 5650  C C   . LYS B 1 343 ? -17.408  -9.453  -64.785  1.00 151.95 ? 312 LYS B C   1 
ATOM 5651  O O   . LYS B 1 343 ? -16.653  -8.479  -64.646  1.00 150.51 ? 312 LYS B O   1 
ATOM 5652  C CB  . LYS B 1 343 ? -17.833  -11.961 -64.155  1.00 157.14 ? 312 LYS B CB  1 
ATOM 5653  C CG  . LYS B 1 343 ? -17.478  -13.038 -63.127  1.00 159.40 ? 312 LYS B CG  1 
ATOM 5654  C CD  . LYS B 1 343 ? -17.147  -14.384 -63.755  1.00 162.53 ? 312 LYS B CD  1 
ATOM 5655  C CE  . LYS B 1 343 ? -16.648  -15.361 -62.687  1.00 164.49 ? 312 LYS B CE  1 
ATOM 5656  N NZ  . LYS B 1 343 ? -17.107  -16.767 -62.916  1.00 167.11 ? 312 LYS B NZ  1 
ATOM 5657  N N   . PHE B 1 344 ? -18.184  -9.635  -65.867  1.00 150.38 ? 313 PHE B N   1 
ATOM 5658  C CA  . PHE B 1 344 ? -18.338  -8.663  -66.971  1.00 146.99 ? 313 PHE B CA  1 
ATOM 5659  C C   . PHE B 1 344 ? -18.806  -7.280  -66.531  1.00 144.33 ? 313 PHE B C   1 
ATOM 5660  O O   . PHE B 1 344 ? -19.467  -6.595  -67.300  1.00 143.50 ? 313 PHE B O   1 
ATOM 5661  C CB  . PHE B 1 344 ? -19.382  -9.172  -67.963  1.00 147.86 ? 313 PHE B CB  1 
ATOM 5662  C CG  . PHE B 1 344 ? -19.043  -10.470 -68.596  1.00 148.83 ? 313 PHE B CG  1 
ATOM 5663  C CD1 . PHE B 1 344 ? -19.126  -10.604 -69.980  1.00 148.82 ? 313 PHE B CD1 1 
ATOM 5664  C CD2 . PHE B 1 344 ? -18.654  -11.562 -67.817  1.00 149.41 ? 313 PHE B CD2 1 
ATOM 5665  C CE1 . PHE B 1 344 ? -18.822  -11.793 -70.590  1.00 150.35 ? 313 PHE B CE1 1 
ATOM 5666  C CE2 . PHE B 1 344 ? -18.342  -12.755 -68.402  1.00 151.62 ? 313 PHE B CE2 1 
ATOM 5667  C CZ  . PHE B 1 344 ? -18.425  -12.879 -69.803  1.00 152.55 ? 313 PHE B CZ  1 
ATOM 5668  N N   . LYS B 1 345 ? -18.454  -6.864  -65.316  1.00 142.53 ? 314 LYS B N   1 
ATOM 5669  C CA  . LYS B 1 345 ? -19.052  -5.692  -64.673  1.00 140.49 ? 314 LYS B CA  1 
ATOM 5670  C C   . LYS B 1 345 ? -18.849  -4.394  -65.448  1.00 138.05 ? 314 LYS B C   1 
ATOM 5671  O O   . LYS B 1 345 ? -19.111  -3.321  -64.935  1.00 137.28 ? 314 LYS B O   1 
ATOM 5672  C CB  . LYS B 1 345 ? -18.571  -5.549  -63.219  1.00 140.35 ? 314 LYS B CB  1 
ATOM 5673  N N   . ILE B 1 346 ? -18.395  -4.499  -66.686  1.00 136.68 ? 315 ILE B N   1 
ATOM 5674  C CA  . ILE B 1 346 ? -18.316  -3.348  -67.566  1.00 134.72 ? 315 ILE B CA  1 
ATOM 5675  C C   . ILE B 1 346 ? -19.587  -3.218  -68.416  1.00 134.07 ? 315 ILE B C   1 
ATOM 5676  O O   . ILE B 1 346 ? -20.165  -4.216  -68.854  1.00 135.26 ? 315 ILE B O   1 
ATOM 5677  C CB  . ILE B 1 346 ? -17.078  -3.423  -68.477  1.00 134.89 ? 315 ILE B CB  1 
ATOM 5678  C CG1 . ILE B 1 346 ? -16.842  -4.866  -68.957  1.00 138.06 ? 315 ILE B CG1 1 
ATOM 5679  C CG2 . ILE B 1 346 ? -15.859  -2.907  -67.736  1.00 134.28 ? 315 ILE B CG2 1 
ATOM 5680  C CD1 . ILE B 1 346 ? -16.279  -4.989  -70.375  1.00 139.66 ? 315 ILE B CD1 1 
ATOM 5681  N N   . PHE B 1 347 ? -20.016  -1.981  -68.648  1.00 131.78 ? 316 PHE B N   1 
ATOM 5682  C CA  . PHE B 1 347 ? -21.256  -1.695  -69.379  1.00 130.79 ? 316 PHE B CA  1 
ATOM 5683  C C   . PHE B 1 347 ? -21.171  -0.304  -69.996  1.00 128.74 ? 316 PHE B C   1 
ATOM 5684  O O   . PHE B 1 347 ? -20.697  0.632   -69.362  1.00 127.58 ? 316 PHE B O   1 
ATOM 5685  C CB  . PHE B 1 347 ? -22.459  -1.891  -68.442  1.00 131.70 ? 316 PHE B CB  1 
ATOM 5686  C CG  . PHE B 1 347 ? -23.300  -0.668  -68.234  1.00 130.39 ? 316 PHE B CG  1 
ATOM 5687  C CD1 . PHE B 1 347 ? -24.327  -0.375  -69.107  1.00 130.78 ? 316 PHE B CD1 1 
ATOM 5688  C CD2 . PHE B 1 347 ? -23.098  0.161   -67.125  1.00 128.78 ? 316 PHE B CD2 1 
ATOM 5689  C CE1 . PHE B 1 347 ? -25.125  0.749   -68.899  1.00 130.82 ? 316 PHE B CE1 1 
ATOM 5690  C CE2 . PHE B 1 347 ? -23.886  1.285   -66.914  1.00 127.66 ? 316 PHE B CE2 1 
ATOM 5691  C CZ  . PHE B 1 347 ? -24.901  1.581   -67.800  1.00 128.70 ? 316 PHE B CZ  1 
ATOM 5692  N N   . ASN B 1 348 ? -21.602  -0.188  -71.245  1.00 127.96 ? 317 ASN B N   1 
ATOM 5693  C CA  . ASN B 1 348 ? -21.344  0.999   -72.048  1.00 126.23 ? 317 ASN B CA  1 
ATOM 5694  C C   . ASN B 1 348 ? -21.947  2.267   -71.472  1.00 124.94 ? 317 ASN B C   1 
ATOM 5695  O O   . ASN B 1 348 ? -23.006  2.223   -70.878  1.00 125.69 ? 317 ASN B O   1 
ATOM 5696  C CB  . ASN B 1 348 ? -21.880  0.774   -73.451  1.00 127.21 ? 317 ASN B CB  1 
ATOM 5697  C CG  . ASN B 1 348 ? -21.504  1.889   -74.422  1.00 127.25 ? 317 ASN B CG  1 
ATOM 5698  O OD1 . ASN B 1 348 ? -20.858  2.879   -74.058  1.00 126.14 ? 317 ASN B OD1 1 
ATOM 5699  N ND2 . ASN B 1 348 ? -21.909  1.724   -75.679  1.00 129.52 ? 317 ASN B ND2 1 
ATOM 5700  N N   . THR B 1 349 ? -21.275  3.396   -71.667  1.00 123.22 ? 318 THR B N   1 
ATOM 5701  C CA  . THR B 1 349 ? -21.733  4.691   -71.165  1.00 122.22 ? 318 THR B CA  1 
ATOM 5702  C C   . THR B 1 349 ? -22.198  5.552   -72.300  1.00 122.11 ? 318 THR B C   1 
ATOM 5703  O O   . THR B 1 349 ? -22.930  6.536   -72.119  1.00 121.56 ? 318 THR B O   1 
ATOM 5704  C CB  . THR B 1 349 ? -20.583  5.452   -70.570  1.00 120.99 ? 318 THR B CB  1 
ATOM 5705  O OG1 . THR B 1 349 ? -19.917  4.620   -69.619  1.00 121.98 ? 318 THR B OG1 1 
ATOM 5706  C CG2 . THR B 1 349 ? -21.073  6.710   -69.896  1.00 120.28 ? 318 THR B CG2 1 
ATOM 5707  N N   . ASN B 1 350 ? -21.729  5.186   -73.483  1.00 122.65 ? 319 ASN B N   1 
ATOM 5708  C CA  . ASN B 1 350 ? -21.942  5.976   -74.667  1.00 122.95 ? 319 ASN B CA  1 
ATOM 5709  C C   . ASN B 1 350 ? -21.461  7.410   -74.451  1.00 121.75 ? 319 ASN B C   1 
ATOM 5710  O O   . ASN B 1 350 ? -22.112  8.389   -74.872  1.00 121.72 ? 319 ASN B O   1 
ATOM 5711  C CB  . ASN B 1 350 ? -23.391  5.914   -75.118  1.00 124.02 ? 319 ASN B CB  1 
ATOM 5712  C CG  . ASN B 1 350 ? -23.501  5.813   -76.604  1.00 125.95 ? 319 ASN B CG  1 
ATOM 5713  O OD1 . ASN B 1 350 ? -23.296  4.738   -77.195  1.00 126.63 ? 319 ASN B OD1 1 
ATOM 5714  N ND2 . ASN B 1 350 ? -23.789  6.945   -77.241  1.00 128.15 ? 319 ASN B ND2 1 
ATOM 5715  N N   . ASN B 1 351 ? -20.330  7.485   -73.735  1.00 120.61 ? 320 ASN B N   1 
ATOM 5716  C CA  . ASN B 1 351 ? -19.422  8.630   -73.695  1.00 118.94 ? 320 ASN B CA  1 
ATOM 5717  C C   . ASN B 1 351 ? -18.165  8.227   -74.427  1.00 118.62 ? 320 ASN B C   1 
ATOM 5718  O O   . ASN B 1 351 ? -17.433  7.355   -73.958  1.00 119.20 ? 320 ASN B O   1 
ATOM 5719  C CB  . ASN B 1 351 ? -19.040  8.955   -72.266  1.00 117.90 ? 320 ASN B CB  1 
ATOM 5720  C CG  . ASN B 1 351 ? -20.123  9.644   -71.538  1.00 118.23 ? 320 ASN B CG  1 
ATOM 5721  O OD1 . ASN B 1 351 ? -20.063  9.793   -70.328  1.00 118.62 ? 320 ASN B OD1 1 
ATOM 5722  N ND2 . ASN B 1 351 ? -21.142  10.075  -72.263  1.00 120.68 ? 320 ASN B ND2 1 
ATOM 5723  N N   . LEU B 1 352 ? -17.910  8.827   -75.581  1.00 117.72 ? 321 LEU B N   1 
ATOM 5724  C CA  . LEU B 1 352 ? -16.775  8.404   -76.357  1.00 117.10 ? 321 LEU B CA  1 
ATOM 5725  C C   . LEU B 1 352 ? -15.883  9.568   -76.646  1.00 116.22 ? 321 LEU B C   1 
ATOM 5726  O O   . LEU B 1 352 ? -16.347  10.716  -76.682  1.00 115.80 ? 321 LEU B O   1 
ATOM 5727  C CB  . LEU B 1 352 ? -17.214  7.734   -77.643  1.00 118.08 ? 321 LEU B CB  1 
ATOM 5728  C CG  . LEU B 1 352 ? -18.062  6.524   -77.308  1.00 119.06 ? 321 LEU B CG  1 
ATOM 5729  C CD1 . LEU B 1 352 ? -19.511  6.913   -77.371  1.00 120.51 ? 321 LEU B CD1 1 
ATOM 5730  C CD2 . LEU B 1 352 ? -17.796  5.427   -78.267  1.00 121.23 ? 321 LEU B CD2 1 
ATOM 5731  N N   . TRP B 1 353 ? -14.595  9.244   -76.797  1.00 115.70 ? 322 TRP B N   1 
ATOM 5732  C CA  . TRP B 1 353 ? -13.562  10.133  -77.301  1.00 114.52 ? 322 TRP B CA  1 
ATOM 5733  C C   . TRP B 1 353 ? -13.055  9.476   -78.556  1.00 115.85 ? 322 TRP B C   1 
ATOM 5734  O O   . TRP B 1 353 ? -12.636  8.311   -78.522  1.00 116.26 ? 322 TRP B O   1 
ATOM 5735  C CB  . TRP B 1 353 ? -12.427  10.228  -76.307  1.00 113.36 ? 322 TRP B CB  1 
ATOM 5736  C CG  . TRP B 1 353 ? -12.854  10.721  -74.981  1.00 110.69 ? 322 TRP B CG  1 
ATOM 5737  C CD1 . TRP B 1 353 ? -13.352  9.975   -73.954  1.00 109.42 ? 322 TRP B CD1 1 
ATOM 5738  C CD2 . TRP B 1 353 ? -12.828  12.079  -74.518  1.00 107.95 ? 322 TRP B CD2 1 
ATOM 5739  N NE1 . TRP B 1 353 ? -13.643  10.782  -72.881  1.00 107.88 ? 322 TRP B NE1 1 
ATOM 5740  C CE2 . TRP B 1 353 ? -13.328  12.079  -73.200  1.00 107.05 ? 322 TRP B CE2 1 
ATOM 5741  C CE3 . TRP B 1 353 ? -12.431  13.294  -75.088  1.00 106.43 ? 322 TRP B CE3 1 
ATOM 5742  C CZ2 . TRP B 1 353 ? -13.441  13.251  -72.441  1.00 105.59 ? 322 TRP B CZ2 1 
ATOM 5743  C CZ3 . TRP B 1 353 ? -12.544  14.450  -74.335  1.00 104.88 ? 322 TRP B CZ3 1 
ATOM 5744  C CH2 . TRP B 1 353 ? -13.044  14.422  -73.024  1.00 104.42 ? 322 TRP B CH2 1 
ATOM 5745  N N   . ILE B 1 354 ? -13.131  10.197  -79.672  1.00 116.50 ? 323 ILE B N   1 
ATOM 5746  C CA  . ILE B 1 354 ? -12.667  9.652   -80.939  1.00 117.95 ? 323 ILE B CA  1 
ATOM 5747  C C   . ILE B 1 354 ? -11.800  10.638  -81.685  1.00 118.94 ? 323 ILE B C   1 
ATOM 5748  O O   . ILE B 1 354 ? -12.024  11.840  -81.632  1.00 118.39 ? 323 ILE B O   1 
ATOM 5749  C CB  . ILE B 1 354 ? -13.805  9.226   -81.850  1.00 118.53 ? 323 ILE B CB  1 
ATOM 5750  C CG1 . ILE B 1 354 ? -14.982  8.673   -81.039  1.00 117.37 ? 323 ILE B CG1 1 
ATOM 5751  C CG2 . ILE B 1 354 ? -13.277  8.195   -82.817  1.00 119.92 ? 323 ILE B CG2 1 
ATOM 5752  C CD1 . ILE B 1 354 ? -16.301  8.668   -81.757  1.00 115.94 ? 323 ILE B CD1 1 
ATOM 5753  N N   . SER B 1 355 ? -10.816  10.102  -82.392  1.00 120.92 ? 324 SER B N   1 
ATOM 5754  C CA  . SER B 1 355 ? -9.797   10.889  -83.072  1.00 122.52 ? 324 SER B CA  1 
ATOM 5755  C C   . SER B 1 355 ? -10.179  11.191  -84.520  1.00 124.25 ? 324 SER B C   1 
ATOM 5756  O O   . SER B 1 355 ? -10.152  10.296  -85.363  1.00 125.86 ? 324 SER B O   1 
ATOM 5757  C CB  . SER B 1 355 ? -8.467   10.129  -83.021  1.00 123.38 ? 324 SER B CB  1 
ATOM 5758  O OG  . SER B 1 355 ? -7.677   10.356  -84.174  1.00 125.60 ? 324 SER B OG  1 
ATOM 5759  N N   . LEU B 1 356 ? -10.521  12.449  -84.803  1.00 124.35 ? 325 LEU B N   1 
ATOM 5760  C CA  . LEU B 1 356 ? -10.841  12.908  -86.161  1.00 125.93 ? 325 LEU B CA  1 
ATOM 5761  C C   . LEU B 1 356 ? -9.859   12.372  -87.174  1.00 128.14 ? 325 LEU B C   1 
ATOM 5762  O O   . LEU B 1 356 ? -10.241  11.795  -88.192  1.00 129.47 ? 325 LEU B O   1 
ATOM 5763  C CB  . LEU B 1 356 ? -10.796  14.420  -86.213  1.00 125.46 ? 325 LEU B CB  1 
ATOM 5764  C CG  . LEU B 1 356 ? -11.648  15.017  -85.114  1.00 123.69 ? 325 LEU B CG  1 
ATOM 5765  C CD1 . LEU B 1 356 ? -11.154  16.416  -84.783  1.00 123.63 ? 325 LEU B CD1 1 
ATOM 5766  C CD2 . LEU B 1 356 ? -13.088  15.007  -85.572  1.00 123.59 ? 325 LEU B CD2 1 
ATOM 5767  N N   . ALA B 1 357 ? -8.583   12.573  -86.883  1.00 128.88 ? 326 ALA B N   1 
ATOM 5768  C CA  . ALA B 1 357 ? -7.522   11.969  -87.653  1.00 131.41 ? 326 ALA B CA  1 
ATOM 5769  C C   . ALA B 1 357 ? -7.935   10.563  -88.123  1.00 132.62 ? 326 ALA B C   1 
ATOM 5770  O O   . ALA B 1 357 ? -7.812   10.217  -89.301  1.00 134.28 ? 326 ALA B O   1 
ATOM 5771  C CB  . ALA B 1 357 ? -6.245   11.919  -86.797  1.00 131.23 ? 326 ALA B CB  1 
ATOM 5772  N N   . ALA B 1 358 ? -8.469   9.789   -87.184  1.00 132.01 ? 327 ALA B N   1 
ATOM 5773  C CA  . ALA B 1 358 ? -8.754   8.376   -87.374  1.00 133.52 ? 327 ALA B CA  1 
ATOM 5774  C C   . ALA B 1 358 ? -10.103  8.114   -88.054  1.00 134.46 ? 327 ALA B C   1 
ATOM 5775  O O   . ALA B 1 358 ? -10.339  7.023   -88.578  1.00 135.93 ? 327 ALA B O   1 
ATOM 5776  C CB  . ALA B 1 358 ? -8.661   7.642   -86.027  1.00 132.07 ? 327 ALA B CB  1 
ATOM 5777  N N   . VAL B 1 359 ? -10.992  9.102   -88.055  1.00 134.20 ? 328 VAL B N   1 
ATOM 5778  C CA  . VAL B 1 359 ? -12.238  8.967   -88.799  1.00 135.18 ? 328 VAL B CA  1 
ATOM 5779  C C   . VAL B 1 359 ? -11.908  9.009   -90.303  1.00 138.42 ? 328 VAL B C   1 
ATOM 5780  O O   . VAL B 1 359 ? -12.157  8.045   -91.040  1.00 139.79 ? 328 VAL B O   1 
ATOM 5781  C CB  . VAL B 1 359 ? -13.248  10.053  -88.419  1.00 133.39 ? 328 VAL B CB  1 
ATOM 5782  C CG1 . VAL B 1 359 ? -14.576  9.745   -89.016  1.00 133.42 ? 328 VAL B CG1 1 
ATOM 5783  C CG2 . VAL B 1 359 ? -13.386  10.127  -86.935  1.00 130.86 ? 328 VAL B CG2 1 
ATOM 5784  N N   . LYS B 1 360 ? -11.313  10.119  -90.732  1.00 139.96 ? 329 LYS B N   1 
ATOM 5785  C CA  . LYS B 1 360 ? -10.873  10.293  -92.102  1.00 143.15 ? 329 LYS B CA  1 
ATOM 5786  C C   . LYS B 1 360 ? -10.335  9.010   -92.711  1.00 145.48 ? 329 LYS B C   1 
ATOM 5787  O O   . LYS B 1 360 ? -10.965  8.458   -93.599  1.00 147.03 ? 329 LYS B O   1 
ATOM 5788  C CB  . LYS B 1 360 ? -9.817   11.385  -92.178  1.00 143.58 ? 329 LYS B CB  1 
ATOM 5789  C CG  . LYS B 1 360 ? -10.313  12.643  -92.817  1.00 144.62 ? 329 LYS B CG  1 
ATOM 5790  C CD  . LYS B 1 360 ? -9.199   13.272  -93.622  1.00 147.82 ? 329 LYS B CD  1 
ATOM 5791  C CE  . LYS B 1 360 ? -9.755   14.256  -94.625  1.00 149.84 ? 329 LYS B CE  1 
ATOM 5792  N NZ  . LYS B 1 360 ? -8.690   14.882  -95.452  1.00 153.27 ? 329 LYS B NZ  1 
ATOM 5793  N N   . ARG B 1 361 ? -9.190   8.533   -92.224  1.00 146.42 ? 330 ARG B N   1 
ATOM 5794  C CA  . ARG B 1 361 ? -8.547   7.333   -92.760  1.00 149.03 ? 330 ARG B CA  1 
ATOM 5795  C C   . ARG B 1 361 ? -9.549   6.245   -93.066  1.00 149.72 ? 330 ARG B C   1 
ATOM 5796  O O   . ARG B 1 361 ? -9.387   5.527   -94.064  1.00 151.86 ? 330 ARG B O   1 
ATOM 5797  C CB  . ARG B 1 361 ? -7.553   6.753   -91.759  1.00 148.69 ? 330 ARG B CB  1 
ATOM 5798  C CG  . ARG B 1 361 ? -6.120   7.274   -91.837  1.00 150.85 ? 330 ARG B CG  1 
ATOM 5799  C CD  . ARG B 1 361 ? -5.149   6.373   -91.033  1.00 152.18 ? 330 ARG B CD  1 
ATOM 5800  N NE  . ARG B 1 361 ? -5.513   6.261   -89.614  1.00 150.32 ? 330 ARG B NE  1 
ATOM 5801  C CZ  . ARG B 1 361 ? -6.324   5.334   -89.097  1.00 149.11 ? 330 ARG B CZ  1 
ATOM 5802  N NH1 . ARG B 1 361 ? -6.882   4.407   -89.873  1.00 149.94 ? 330 ARG B NH1 1 
ATOM 5803  N NH2 . ARG B 1 361 ? -6.581   5.338   -87.794  1.00 146.53 ? 330 ARG B NH2 1 
ATOM 5804  N N   . LEU B 1 362 ? -10.578  6.152   -92.206  1.00 148.08 ? 331 LEU B N   1 
ATOM 5805  C CA  . LEU B 1 362 ? -11.540  5.034   -92.172  1.00 148.43 ? 331 LEU B CA  1 
ATOM 5806  C C   . LEU B 1 362 ? -12.847  5.166   -92.997  1.00 149.69 ? 331 LEU B C   1 
ATOM 5807  O O   . LEU B 1 362 ? -13.282  4.188   -93.626  1.00 151.03 ? 331 LEU B O   1 
ATOM 5808  C CB  . LEU B 1 362 ? -11.860  4.680   -90.722  1.00 145.92 ? 331 LEU B CB  1 
ATOM 5809  C CG  . LEU B 1 362 ? -10.815  3.872   -89.956  1.00 145.03 ? 331 LEU B CG  1 
ATOM 5810  C CD1 . LEU B 1 362 ? -11.003  4.041   -88.472  1.00 142.30 ? 331 LEU B CD1 1 
ATOM 5811  C CD2 . LEU B 1 362 ? -10.899  2.406   -90.306  1.00 145.84 ? 331 LEU B CD2 1 
ATOM 5812  N N   . GLN B 1 363 ? -13.468  6.349   -92.996  1.00 149.61 ? 332 GLN B N   1 
ATOM 5813  C CA  . GLN B 1 363 ? -14.695  6.578   -93.789  1.00 151.13 ? 332 GLN B CA  1 
ATOM 5814  C C   . GLN B 1 363 ? -14.418  6.722   -95.303  1.00 154.17 ? 332 GLN B C   1 
ATOM 5815  O O   . GLN B 1 363 ? -15.080  6.078   -96.120  1.00 155.71 ? 332 GLN B O   1 
ATOM 5816  C CB  . GLN B 1 363 ? -15.512  7.764   -93.239  1.00 149.41 ? 332 GLN B CB  1 
ATOM 5817  C CG  . GLN B 1 363 ? -16.991  7.843   -93.712  1.00 149.60 ? 332 GLN B CG  1 
ATOM 5818  C CD  . GLN B 1 363 ? -17.919  6.791   -93.081  1.00 148.68 ? 332 GLN B CD  1 
ATOM 5819  O OE1 . GLN B 1 363 ? -17.610  6.206   -92.053  1.00 147.83 ? 332 GLN B OE1 1 
ATOM 5820  N NE2 . GLN B 1 363 ? -19.066  6.563   -93.704  1.00 149.66 ? 332 GLN B NE2 1 
ATOM 5821  N N   . GLU B 1 364 ? -13.442  7.554   -95.668  1.00 155.50 ? 333 GLU B N   1 
ATOM 5822  C CA  . GLU B 1 364 ? -12.972  7.670   -97.056  1.00 158.79 ? 333 GLU B CA  1 
ATOM 5823  C C   . GLU B 1 364 ? -12.580  6.308   -97.651  1.00 160.96 ? 333 GLU B C   1 
ATOM 5824  O O   . GLU B 1 364 ? -12.152  6.222   -98.817  1.00 163.54 ? 333 GLU B O   1 
ATOM 5825  C CB  . GLU B 1 364 ? -11.775  8.625   -97.140  1.00 159.17 ? 333 GLU B CB  1 
ATOM 5826  C CG  . GLU B 1 364 ? -11.978  9.953   -96.423  1.00 158.79 ? 333 GLU B CG  1 
ATOM 5827  C CD  . GLU B 1 364 ? -10.827  10.954  -96.617  1.00 161.43 ? 333 GLU B CD  1 
ATOM 5828  O OE1 . GLU B 1 364 ? -9.643   10.538  -96.655  1.00 162.94 ? 333 GLU B OE1 1 
ATOM 5829  O OE2 . GLU B 1 364 ? -11.115  12.174  -96.713  1.00 161.63 ? 333 GLU B OE2 1 
ATOM 5830  N N   . GLN B 1 365 ? -12.727  5.255   -96.842  1.00 160.19 ? 334 GLN B N   1 
ATOM 5831  C CA  . GLN B 1 365 ? -12.323  3.905   -97.217  1.00 161.95 ? 334 GLN B CA  1 
ATOM 5832  C C   . GLN B 1 365 ? -13.339  2.839   -96.806  1.00 161.29 ? 334 GLN B C   1 
ATOM 5833  O O   . GLN B 1 365 ? -13.072  1.644   -96.944  1.00 162.37 ? 334 GLN B O   1 
ATOM 5834  C CB  . GLN B 1 365 ? -10.934  3.593   -96.649  1.00 162.02 ? 334 GLN B CB  1 
ATOM 5835  C CG  . GLN B 1 365 ? -9.818   4.437   -97.270  1.00 164.10 ? 334 GLN B CG  1 
ATOM 5836  C CD  . GLN B 1 365 ? -8.434   3.930   -96.939  1.00 165.83 ? 334 GLN B CD  1 
ATOM 5837  O OE1 . GLN B 1 365 ? -8.208   3.362   -95.866  1.00 164.94 ? 334 GLN B OE1 1 
ATOM 5838  N NE2 . GLN B 1 365 ? -7.490   4.139   -97.860  1.00 168.08 ? 334 GLN B NE2 1 
ATOM 5839  N N   . ASN B 1 366 ? -14.506  3.285   -96.333  1.00 159.78 ? 335 ASN B N   1 
ATOM 5840  C CA  . ASN B 1 366 ? -15.627  2.404   -95.935  1.00 159.35 ? 335 ASN B CA  1 
ATOM 5841  C C   . ASN B 1 366 ? -15.149  1.229   -95.089  1.00 158.79 ? 335 ASN B C   1 
ATOM 5842  O O   . ASN B 1 366 ? -15.121  0.078   -95.548  1.00 160.26 ? 335 ASN B O   1 
ATOM 5843  C CB  . ASN B 1 366 ? -16.435  1.901   -97.154  1.00 161.52 ? 335 ASN B CB  1 
ATOM 5844  C CG  . ASN B 1 366 ? -17.300  2.994   -97.810  1.00 161.78 ? 335 ASN B CG  1 
ATOM 5845  O OD1 . ASN B 1 366 ? -17.208  4.178   -97.478  1.00 161.03 ? 335 ASN B OD1 1 
ATOM 5846  N ND2 . ASN B 1 366 ? -18.139  2.584   -98.760  1.00 162.88 ? 335 ASN B ND2 1 
ATOM 5847  N N   . ALA B 1 367 ? -14.774  1.533   -93.851  1.00 156.58 ? 336 ALA B N   1 
ATOM 5848  C CA  . ALA B 1 367 ? -14.052  0.578   -93.028  1.00 156.03 ? 336 ALA B CA  1 
ATOM 5849  C C   . ALA B 1 367 ? -14.567  0.435   -91.592  1.00 153.81 ? 336 ALA B C   1 
ATOM 5850  O O   . ALA B 1 367 ? -14.015  -0.356  -90.825  1.00 153.86 ? 336 ALA B O   1 
ATOM 5851  C CB  . ALA B 1 367 ? -12.569  0.918   -93.033  1.00 156.32 ? 336 ALA B CB  1 
ATOM 5852  N N   . ILE B 1 368 ? -15.620  1.174   -91.241  1.00 152.07 ? 337 ILE B N   1 
ATOM 5853  C CA  . ILE B 1 368 ? -16.189  1.166   -89.885  1.00 149.75 ? 337 ILE B CA  1 
ATOM 5854  C C   . ILE B 1 368 ? -17.310  0.108   -89.750  1.00 150.53 ? 337 ILE B C   1 
ATOM 5855  O O   . ILE B 1 368 ? -18.448  0.358   -90.143  1.00 150.88 ? 337 ILE B O   1 
ATOM 5856  C CB  . ILE B 1 368 ? -16.730  2.573   -89.503  1.00 147.89 ? 337 ILE B CB  1 
ATOM 5857  C CG1 . ILE B 1 368 ? -15.887  3.691   -90.108  1.00 147.21 ? 337 ILE B CG1 1 
ATOM 5858  C CG2 . ILE B 1 368 ? -16.753  2.749   -88.020  1.00 145.86 ? 337 ILE B CG2 1 
ATOM 5859  C CD1 . ILE B 1 368 ? -16.085  3.876   -91.587  1.00 148.94 ? 337 ILE B CD1 1 
ATOM 5860  N N   . ASP B 1 369 ? -16.998  -1.066  -89.201  1.00 151.05 ? 338 ASP B N   1 
ATOM 5861  C CA  . ASP B 1 369 ? -17.965  -2.169  -89.178  1.00 152.33 ? 338 ASP B CA  1 
ATOM 5862  C C   . ASP B 1 369 ? -18.847  -2.153  -87.955  1.00 151.15 ? 338 ASP B C   1 
ATOM 5863  O O   . ASP B 1 369 ? -18.453  -2.612  -86.885  1.00 150.37 ? 338 ASP B O   1 
ATOM 5864  C CB  . ASP B 1 369 ? -17.278  -3.526  -89.301  1.00 153.89 ? 338 ASP B CB  1 
ATOM 5865  C CG  . ASP B 1 369 ? -16.992  -3.906  -90.742  1.00 156.83 ? 338 ASP B CG  1 
ATOM 5866  O OD1 . ASP B 1 369 ? -17.917  -3.838  -91.584  1.00 157.71 ? 338 ASP B OD1 1 
ATOM 5867  O OD2 . ASP B 1 369 ? -15.834  -4.283  -91.033  1.00 159.28 ? 338 ASP B OD2 1 
ATOM 5868  N N   . MET B 1 370 ? -20.055  -1.631  -88.137  1.00 151.48 ? 339 MET B N   1 
ATOM 5869  C CA  . MET B 1 370 ? -21.021  -1.503  -87.055  1.00 150.74 ? 339 MET B CA  1 
ATOM 5870  C C   . MET B 1 370 ? -22.128  -2.539  -87.157  1.00 152.50 ? 339 MET B C   1 
ATOM 5871  O O   . MET B 1 370 ? -22.752  -2.703  -88.210  1.00 153.85 ? 339 MET B O   1 
ATOM 5872  C CB  . MET B 1 370 ? -21.632  -0.106  -87.039  1.00 149.54 ? 339 MET B CB  1 
ATOM 5873  C CG  . MET B 1 370 ? -20.641  1.011   -86.791  1.00 147.60 ? 339 MET B CG  1 
ATOM 5874  S SD  . MET B 1 370 ? -21.382  2.624   -87.079  1.00 146.03 ? 339 MET B SD  1 
ATOM 5875  C CE  . MET B 1 370 ? -22.030  2.447   -88.755  1.00 149.02 ? 339 MET B CE  1 
ATOM 5876  N N   . GLU B 1 371 ? -22.352  -3.230  -86.041  1.00 152.78 ? 340 GLU B N   1 
ATOM 5877  C CA  . GLU B 1 371 ? -23.437  -4.184  -85.882  1.00 154.56 ? 340 GLU B CA  1 
ATOM 5878  C C   . GLU B 1 371 ? -24.736  -3.515  -86.283  1.00 154.95 ? 340 GLU B C   1 
ATOM 5879  O O   . GLU B 1 371 ? -24.948  -2.335  -85.979  1.00 153.89 ? 340 GLU B O   1 
ATOM 5880  C CB  . GLU B 1 371 ? -23.501  -4.655  -84.427  1.00 153.92 ? 340 GLU B CB  1 
ATOM 5881  C CG  . GLU B 1 371 ? -22.704  -5.934  -84.116  1.00 156.58 ? 340 GLU B CG  1 
ATOM 5882  C CD  . GLU B 1 371 ? -21.180  -5.781  -84.219  1.00 158.83 ? 340 GLU B CD  1 
ATOM 5883  O OE1 . GLU B 1 371 ? -20.672  -5.623  -85.357  1.00 160.51 ? 340 GLU B OE1 1 
ATOM 5884  O OE2 . GLU B 1 371 ? -20.488  -5.856  -83.166  1.00 158.72 ? 340 GLU B OE2 1 
ATOM 5885  N N   . ILE B 1 372 ? -25.588  -4.264  -86.979  1.00 156.90 ? 341 ILE B N   1 
ATOM 5886  C CA  . ILE B 1 372 ? -26.831  -3.725  -87.528  1.00 157.62 ? 341 ILE B CA  1 
ATOM 5887  C C   . ILE B 1 372 ? -28.040  -4.045  -86.644  1.00 158.26 ? 341 ILE B C   1 
ATOM 5888  O O   . ILE B 1 372 ? -28.408  -5.207  -86.477  1.00 159.48 ? 341 ILE B O   1 
ATOM 5889  C CB  . ILE B 1 372 ? -27.031  -4.186  -88.983  1.00 159.34 ? 341 ILE B CB  1 
ATOM 5890  C CG1 . ILE B 1 372 ? -28.081  -3.325  -89.662  1.00 159.72 ? 341 ILE B CG1 1 
ATOM 5891  C CG2 . ILE B 1 372 ? -27.358  -5.674  -89.068  1.00 160.72 ? 341 ILE B CG2 1 
ATOM 5892  C CD1 . ILE B 1 372 ? -27.942  -3.311  -91.151  1.00 161.91 ? 341 ILE B CD1 1 
ATOM 5893  N N   . ILE B 1 373 ? -28.636  -3.009  -86.063  1.00 157.77 ? 342 ILE B N   1 
ATOM 5894  C CA  . ILE B 1 373 ? -29.723  -3.203  -85.118  1.00 158.81 ? 342 ILE B CA  1 
ATOM 5895  C C   . ILE B 1 373 ? -31.029  -3.376  -85.871  1.00 161.56 ? 342 ILE B C   1 
ATOM 5896  O O   . ILE B 1 373 ? -31.403  -2.501  -86.660  1.00 161.83 ? 342 ILE B O   1 
ATOM 5897  C CB  . ILE B 1 373 ? -29.896  -2.026  -84.155  1.00 156.93 ? 342 ILE B CB  1 
ATOM 5898  C CG1 . ILE B 1 373 ? -28.581  -1.299  -83.898  1.00 154.57 ? 342 ILE B CG1 1 
ATOM 5899  C CG2 . ILE B 1 373 ? -30.481  -2.527  -82.853  1.00 157.54 ? 342 ILE B CG2 1 
ATOM 5900  C CD1 . ILE B 1 373 ? -28.765  0.089   -83.301  1.00 151.96 ? 342 ILE B CD1 1 
ATOM 5901  N N   . VAL B 1 374 ? -31.719  -4.492  -85.607  1.00 164.12 ? 343 VAL B N   1 
ATOM 5902  C CA  . VAL B 1 374 ? -32.947  -4.879  -86.328  1.00 167.06 ? 343 VAL B CA  1 
ATOM 5903  C C   . VAL B 1 374 ? -34.128  -3.980  -85.949  1.00 167.75 ? 343 VAL B C   1 
ATOM 5904  O O   . VAL B 1 374 ? -34.712  -3.332  -86.813  1.00 168.31 ? 343 VAL B O   1 
ATOM 5905  C CB  . VAL B 1 374 ? -33.278  -6.390  -86.135  1.00 168.80 ? 343 VAL B CB  1 
ATOM 5906  C CG1 . VAL B 1 374 ? -34.680  -6.727  -86.649  1.00 171.26 ? 343 VAL B CG1 1 
ATOM 5907  C CG2 . VAL B 1 374 ? -32.227  -7.264  -86.824  1.00 169.04 ? 343 VAL B CG2 1 
ATOM 5908  N N   . ASN B 1 375 ? -34.472  -3.952  -84.664  1.00 168.20 ? 344 ASN B N   1 
ATOM 5909  C CA  . ASN B 1 375 ? -35.387  -2.956  -84.121  1.00 169.08 ? 344 ASN B CA  1 
ATOM 5910  C C   . ASN B 1 375 ? -36.767  -2.873  -84.778  1.00 172.00 ? 344 ASN B C   1 
ATOM 5911  O O   . ASN B 1 375 ? -37.058  -1.891  -85.473  1.00 172.04 ? 344 ASN B O   1 
ATOM 5912  C CB  . ASN B 1 375 ? -34.722  -1.580  -84.171  1.00 166.95 ? 344 ASN B CB  1 
ATOM 5913  C CG  . ASN B 1 375 ? -35.106  -0.718  -82.995  1.00 166.28 ? 344 ASN B CG  1 
ATOM 5914  O OD1 . ASN B 1 375 ? -35.213  -1.199  -81.863  1.00 167.01 ? 344 ASN B OD1 1 
ATOM 5915  N ND2 . ASN B 1 375 ? -35.314  0.567   -83.248  1.00 165.48 ? 344 ASN B ND2 1 
ATOM 5916  N N   . ALA B 1 376 ? -37.606  -3.891  -84.552  1.00 175.08 ? 345 ALA B N   1 
ATOM 5917  C CA  . ALA B 1 376 ? -39.001  -3.896  -85.045  1.00 178.23 ? 345 ALA B CA  1 
ATOM 5918  C C   . ALA B 1 376 ? -39.876  -2.904  -84.258  1.00 178.75 ? 345 ALA B C   1 
ATOM 5919  O O   . ALA B 1 376 ? -39.644  -2.668  -83.066  1.00 177.65 ? 345 ALA B O   1 
ATOM 5920  C CB  . ALA B 1 376 ? -39.594  -5.312  -85.017  1.00 180.33 ? 345 ALA B CB  1 
ATOM 5921  N N   . LYS B 1 377 ? -40.865  -2.315  -84.933  1.00 180.80 ? 346 LYS B N   1 
ATOM 5922  C CA  . LYS B 1 377 ? -41.599  -1.182  -84.381  1.00 181.33 ? 346 LYS B CA  1 
ATOM 5923  C C   . LYS B 1 377 ? -42.993  -1.102  -84.967  1.00 184.74 ? 346 LYS B C   1 
ATOM 5924  O O   . LYS B 1 377 ? -43.144  -0.980  -86.186  1.00 185.72 ? 346 LYS B O   1 
ATOM 5925  C CB  . LYS B 1 377 ? -40.850  0.117   -84.689  1.00 178.97 ? 346 LYS B CB  1 
ATOM 5926  C CG  . LYS B 1 377 ? -41.434  1.349   -84.029  1.00 177.56 ? 346 LYS B CG  1 
ATOM 5927  C CD  . LYS B 1 377 ? -40.831  1.580   -82.651  1.00 174.05 ? 346 LYS B CD  1 
ATOM 5928  C CE  . LYS B 1 377 ? -39.551  2.390   -82.731  1.00 169.69 ? 346 LYS B CE  1 
ATOM 5929  N NZ  . LYS B 1 377 ? -39.391  3.145   -81.477  1.00 167.00 ? 346 LYS B NZ  1 
ATOM 5930  N N   . THR B 1 378 ? -44.002  -1.150  -84.093  1.00 187.20 ? 347 THR B N   1 
ATOM 5931  C CA  . THR B 1 378 ? -45.418  -1.090  -84.516  1.00 190.83 ? 347 THR B CA  1 
ATOM 5932  C C   . THR B 1 378 ? -46.152  0.230   -84.163  1.00 191.69 ? 347 THR B C   1 
ATOM 5933  O O   . THR B 1 378 ? -46.270  0.610   -82.990  1.00 191.21 ? 347 THR B O   1 
ATOM 5934  C CB  . THR B 1 378 ? -46.223  -2.345  -84.068  1.00 193.00 ? 347 THR B CB  1 
ATOM 5935  O OG1 . THR B 1 378 ? -47.568  -2.242  -84.550  1.00 195.73 ? 347 THR B OG1 1 
ATOM 5936  C CG2 . THR B 1 378 ? -46.211  -2.521  -82.538  1.00 192.19 ? 347 THR B CG2 1 
ATOM 5937  N N   . LEU B 1 379 ? -46.636  0.909   -85.204  1.00 193.43 ? 348 LEU B N   1 
ATOM 5938  C CA  . LEU B 1 379 ? -47.166  2.265   -85.105  1.00 194.26 ? 348 LEU B CA  1 
ATOM 5939  C C   . LEU B 1 379 ? -47.739  2.642   -86.464  1.00 196.18 ? 348 LEU B C   1 
ATOM 5940  O O   . LEU B 1 379 ? -46.997  2.695   -87.446  1.00 195.33 ? 348 LEU B O   1 
ATOM 5941  C CB  . LEU B 1 379 ? -46.045  3.251   -84.732  1.00 191.55 ? 348 LEU B CB  1 
ATOM 5942  C CG  . LEU B 1 379 ? -46.380  4.677   -84.279  1.00 191.81 ? 348 LEU B CG  1 
ATOM 5943  C CD1 . LEU B 1 379 ? -47.112  4.664   -82.919  1.00 193.48 ? 348 LEU B CD1 1 
ATOM 5944  C CD2 . LEU B 1 379 ? -45.115  5.551   -84.232  1.00 188.40 ? 348 LEU B CD2 1 
ATOM 5945  N N   . ASP B 1 380 ? -49.047  2.888   -86.539  1.00 199.15 ? 349 ASP B N   1 
ATOM 5946  C CA  . ASP B 1 380 ? -49.960  2.750   -85.405  1.00 200.99 ? 349 ASP B CA  1 
ATOM 5947  C C   . ASP B 1 380 ? -51.178  1.912   -85.820  1.00 204.23 ? 349 ASP B C   1 
ATOM 5948  O O   . ASP B 1 380 ? -51.554  0.955   -85.133  1.00 205.43 ? 349 ASP B O   1 
ATOM 5949  C CB  . ASP B 1 380 ? -50.395  4.132   -84.861  1.00 200.97 ? 349 ASP B CB  1 
ATOM 5950  C CG  . ASP B 1 380 ? -51.618  4.710   -85.597  1.00 204.42 ? 349 ASP B CG  1 
ATOM 5951  O OD1 . ASP B 1 380 ? -51.496  5.030   -86.803  1.00 205.27 ? 349 ASP B OD1 1 
ATOM 5952  O OD2 . ASP B 1 380 ? -52.704  4.833   -84.972  1.00 206.92 ? 349 ASP B OD2 1 
ATOM 5953  N N   . GLY B 1 381 ? -51.769  2.274   -86.958  1.00 205.66 ? 350 GLY B N   1 
ATOM 5954  C CA  . GLY B 1 381 ? -53.044  1.722   -87.381  1.00 208.82 ? 350 GLY B CA  1 
ATOM 5955  C C   . GLY B 1 381 ? -52.935  0.809   -88.581  1.00 209.73 ? 350 GLY B C   1 
ATOM 5956  O O   . GLY B 1 381 ? -53.871  0.723   -89.382  1.00 212.39 ? 350 GLY B O   1 
ATOM 5957  N N   . GLY B 1 382 ? -51.798  0.123   -88.708  1.00 207.53 ? 351 GLY B N   1 
ATOM 5958  C CA  . GLY B 1 382 ? -51.603  -0.833  -89.798  1.00 208.02 ? 351 GLY B CA  1 
ATOM 5959  C C   . GLY B 1 382 ? -51.038  -2.159  -89.335  1.00 207.20 ? 351 GLY B C   1 
ATOM 5960  O O   . GLY B 1 382 ? -51.567  -2.785  -88.413  1.00 208.34 ? 351 GLY B O   1 
ATOM 5961  N N   . LEU B 1 383 ? -49.969  -2.589  -90.003  1.00 205.38 ? 352 LEU B N   1 
ATOM 5962  C CA  . LEU B 1 383 ? -49.187  -3.767  -89.604  1.00 203.92 ? 352 LEU B CA  1 
ATOM 5963  C C   . LEU B 1 383 ? -47.737  -3.322  -89.272  1.00 199.99 ? 352 LEU B C   1 
ATOM 5964  O O   . LEU B 1 383 ? -47.401  -2.142  -89.432  1.00 198.30 ? 352 LEU B O   1 
ATOM 5965  C CB  . LEU B 1 383 ? -49.259  -4.873  -90.687  1.00 205.87 ? 352 LEU B CB  1 
ATOM 5966  C CG  . LEU B 1 383 ? -50.614  -5.332  -91.288  1.00 208.63 ? 352 LEU B CG  1 
ATOM 5967  C CD1 . LEU B 1 383 ? -50.388  -6.161  -92.545  1.00 209.18 ? 352 LEU B CD1 1 
ATOM 5968  C CD2 . LEU B 1 383 ? -51.508  -6.099  -90.306  1.00 209.69 ? 352 LEU B CD2 1 
ATOM 5969  N N   . ASN B 1 384 ? -46.896  -4.241  -88.796  1.00 198.26 ? 353 ASN B N   1 
ATOM 5970  C CA  . ASN B 1 384 ? -45.566  -3.872  -88.266  1.00 194.75 ? 353 ASN B CA  1 
ATOM 5971  C C   . ASN B 1 384 ? -44.567  -3.278  -89.280  1.00 192.52 ? 353 ASN B C   1 
ATOM 5972  O O   . ASN B 1 384 ? -44.765  -3.372  -90.502  1.00 194.07 ? 353 ASN B O   1 
ATOM 5973  C CB  . ASN B 1 384 ? -44.916  -5.054  -87.527  1.00 194.55 ? 353 ASN B CB  1 
ATOM 5974  C CG  . ASN B 1 384 ? -45.732  -5.533  -86.347  1.00 196.01 ? 353 ASN B CG  1 
ATOM 5975  O OD1 . ASN B 1 384 ? -46.849  -5.066  -86.113  1.00 197.73 ? 353 ASN B OD1 1 
ATOM 5976  N ND2 . ASN B 1 384 ? -45.173  -6.475  -85.592  1.00 196.08 ? 353 ASN B ND2 1 
ATOM 5977  N N   . VAL B 1 385 ? -43.492  -2.683  -88.756  1.00 188.57 ? 354 VAL B N   1 
ATOM 5978  C CA  . VAL B 1 385 ? -42.500  -1.979  -89.562  1.00 185.58 ? 354 VAL B CA  1 
ATOM 5979  C C   . VAL B 1 385 ? -41.086  -2.136  -88.976  1.00 182.41 ? 354 VAL B C   1 
ATOM 5980  O O   . VAL B 1 385 ? -40.865  -1.852  -87.793  1.00 181.00 ? 354 VAL B O   1 
ATOM 5981  C CB  . VAL B 1 385 ? -42.890  -0.479  -89.722  1.00 184.94 ? 354 VAL B CB  1 
ATOM 5982  C CG1 . VAL B 1 385 ? -41.669  0.406   -89.845  1.00 182.44 ? 354 VAL B CG1 1 
ATOM 5983  C CG2 . VAL B 1 385 ? -43.807  -0.287  -90.924  1.00 186.92 ? 354 VAL B CG2 1 
ATOM 5984  N N   . ILE B 1 386 ? -40.148  -2.612  -89.808  1.00 180.97 ? 355 ILE B N   1 
ATOM 5985  C CA  . ILE B 1 386 ? -38.715  -2.664  -89.471  1.00 177.39 ? 355 ILE B CA  1 
ATOM 5986  C C   . ILE B 1 386 ? -38.041  -1.351  -89.881  1.00 175.00 ? 355 ILE B C   1 
ATOM 5987  O O   . ILE B 1 386 ? -38.271  -0.820  -90.972  1.00 175.76 ? 355 ILE B O   1 
ATOM 5988  C CB  . ILE B 1 386 ? -37.959  -3.837  -90.163  1.00 177.98 ? 355 ILE B CB  1 
ATOM 5989  C CG1 . ILE B 1 386 ? -38.756  -5.136  -90.139  1.00 180.17 ? 355 ILE B CG1 1 
ATOM 5990  C CG2 . ILE B 1 386 ? -36.621  -4.078  -89.501  1.00 175.99 ? 355 ILE B CG2 1 
ATOM 5991  C CD1 . ILE B 1 386 ? -38.329  -6.129  -91.222  1.00 181.73 ? 355 ILE B CD1 1 
ATOM 5992  N N   . GLN B 1 387 ? -37.202  -0.845  -88.989  1.00 171.76 ? 356 GLN B N   1 
ATOM 5993  C CA  . GLN B 1 387 ? -36.505  0.417   -89.168  1.00 169.12 ? 356 GLN B CA  1 
ATOM 5994  C C   . GLN B 1 387 ? -35.041  0.163   -88.818  1.00 166.71 ? 356 GLN B C   1 
ATOM 5995  O O   . GLN B 1 387 ? -34.729  -0.133  -87.663  1.00 166.01 ? 356 GLN B O   1 
ATOM 5996  C CB  . GLN B 1 387 ? -37.161  1.454   -88.247  1.00 168.39 ? 356 GLN B CB  1 
ATOM 5997  C CG  . GLN B 1 387 ? -36.258  2.494   -87.605  1.00 166.01 ? 356 GLN B CG  1 
ATOM 5998  C CD  . GLN B 1 387 ? -37.012  3.408   -86.646  1.00 165.81 ? 356 GLN B CD  1 
ATOM 5999  O OE1 . GLN B 1 387 ? -38.186  3.717   -86.856  1.00 167.81 ? 356 GLN B OE1 1 
ATOM 6000  N NE2 . GLN B 1 387 ? -36.337  3.847   -85.589  1.00 163.89 ? 356 GLN B NE2 1 
ATOM 6001  N N   . LEU B 1 388 ? -34.148  0.244   -89.805  1.00 165.39 ? 357 LEU B N   1 
ATOM 6002  C CA  . LEU B 1 388 ? -32.760  -0.207  -89.616  1.00 163.01 ? 357 LEU B CA  1 
ATOM 6003  C C   . LEU B 1 388 ? -31.829  0.822   -88.959  1.00 160.42 ? 357 LEU B C   1 
ATOM 6004  O O   . LEU B 1 388 ? -31.798  1.988   -89.358  1.00 159.95 ? 357 LEU B O   1 
ATOM 6005  C CB  . LEU B 1 388 ? -32.183  -0.664  -90.948  1.00 163.91 ? 357 LEU B CB  1 
ATOM 6006  C CG  . LEU B 1 388 ? -32.664  -2.002  -91.487  1.00 165.08 ? 357 LEU B CG  1 
ATOM 6007  C CD1 . LEU B 1 388 ? -32.489  -2.044  -92.985  1.00 166.41 ? 357 LEU B CD1 1 
ATOM 6008  C CD2 . LEU B 1 388 ? -31.901  -3.123  -90.839  1.00 163.78 ? 357 LEU B CD2 1 
ATOM 6009  N N   . GLU B 1 389 ? -31.059  0.383   -87.963  1.00 140.83 ? 358 GLU B N   1 
ATOM 6010  C CA  . GLU B 1 389 ? -30.141  1.279   -87.231  1.00 138.43 ? 358 GLU B CA  1 
ATOM 6011  C C   . GLU B 1 389 ? -28.766  0.664   -86.952  1.00 136.79 ? 358 GLU B C   1 
ATOM 6012  O O   . GLU B 1 389 ? -28.583  -0.551  -87.096  1.00 137.94 ? 358 GLU B O   1 
ATOM 6013  C CB  . GLU B 1 389 ? -30.762  1.704   -85.899  1.00 137.71 ? 358 GLU B CB  1 
ATOM 6014  C CG  . GLU B 1 389 ? -31.887  2.720   -86.013  1.00 140.30 ? 358 GLU B CG  1 
ATOM 6015  C CD  . GLU B 1 389 ? -32.666  2.881   -84.706  1.00 143.27 ? 358 GLU B CD  1 
ATOM 6016  O OE1 . GLU B 1 389 ? -33.671  2.146   -84.499  1.00 145.64 ? 358 GLU B OE1 1 
ATOM 6017  O OE2 . GLU B 1 389 ? -32.275  3.754   -83.887  1.00 143.52 ? 358 GLU B OE2 1 
ATOM 6018  N N   . THR B 1 390 ? -27.809  1.508   -86.552  1.00 133.86 ? 359 THR B N   1 
ATOM 6019  C CA  . THR B 1 390 ? -26.505  1.049   -86.052  1.00 131.71 ? 359 THR B CA  1 
ATOM 6020  C C   . THR B 1 390 ? -25.966  1.971   -84.969  1.00 129.26 ? 359 THR B C   1 
ATOM 6021  O O   . THR B 1 390 ? -26.188  3.182   -85.015  1.00 128.78 ? 359 THR B O   1 
ATOM 6022  C CB  . THR B 1 390 ? -25.476  1.062   -87.130  1.00 132.60 ? 359 THR B CB  1 
ATOM 6023  O OG1 . THR B 1 390 ? -25.387  2.397   -87.637  1.00 132.54 ? 359 THR B OG1 1 
ATOM 6024  C CG2 . THR B 1 390 ? -25.845  0.092   -88.234  1.00 134.29 ? 359 THR B CG2 1 
ATOM 6025  N N   . ALA B 1 391 ? -25.213  1.399   -84.031  1.00 127.43 ? 360 ALA B N   1 
ATOM 6026  C CA  . ALA B 1 391 ? -24.748  2.117   -82.836  1.00 125.19 ? 360 ALA B CA  1 
ATOM 6027  C C   . ALA B 1 391 ? -23.375  2.798   -82.989  1.00 124.39 ? 360 ALA B C   1 
ATOM 6028  O O   . ALA B 1 391 ? -22.540  2.327   -83.752  1.00 125.72 ? 360 ALA B O   1 
ATOM 6029  C CB  . ALA B 1 391 ? -24.719  1.159   -81.664  1.00 124.98 ? 360 ALA B CB  1 
ATOM 6030  N N   . VAL B 1 392 ? -23.131  3.897   -82.266  1.00 122.33 ? 361 VAL B N   1 
ATOM 6031  C CA  . VAL B 1 392 ? -21.807  4.539   -82.273  1.00 120.97 ? 361 VAL B CA  1 
ATOM 6032  C C   . VAL B 1 392 ? -20.768  3.543   -81.821  1.00 120.35 ? 361 VAL B C   1 
ATOM 6033  O O   . VAL B 1 392 ? -19.889  3.201   -82.579  1.00 121.40 ? 361 VAL B O   1 
ATOM 6034  C CB  . VAL B 1 392 ? -21.740  5.824   -81.413  1.00 120.26 ? 361 VAL B CB  1 
ATOM 6035  C CG1 . VAL B 1 392 ? -20.485  5.871   -80.621  1.00 119.94 ? 361 VAL B CG1 1 
ATOM 6036  C CG2 . VAL B 1 392 ? -21.764  7.025   -82.291  1.00 120.91 ? 361 VAL B CG2 1 
ATOM 6037  N N   . GLY B 1 393 ? -20.909  3.044   -80.604  1.00 118.75 ? 362 GLY B N   1 
ATOM 6038  C CA  . GLY B 1 393 ? -19.944  2.131   -80.027  1.00 118.21 ? 362 GLY B CA  1 
ATOM 6039  C C   . GLY B 1 393 ? -19.470  0.970   -80.885  1.00 118.81 ? 362 GLY B C   1 
ATOM 6040  O O   . GLY B 1 393 ? -18.312  0.591   -80.817  1.00 119.75 ? 362 GLY B O   1 
ATOM 6041  N N   . ALA B 1 394 ? -20.334  0.391   -81.703  1.00 118.84 ? 363 ALA B N   1 
ATOM 6042  C CA  . ALA B 1 394 ? -19.955  -0.842  -82.394  1.00 119.90 ? 363 ALA B CA  1 
ATOM 6043  C C   . ALA B 1 394 ? -18.695  -0.668  -83.218  1.00 120.96 ? 363 ALA B C   1 
ATOM 6044  O O   . ALA B 1 394 ? -18.029  -1.654  -83.538  1.00 122.30 ? 363 ALA B O   1 
ATOM 6045  C CB  . ALA B 1 394 ? -21.080  -1.338  -83.255  1.00 120.74 ? 363 ALA B CB  1 
ATOM 6046  N N   . ALA B 1 395 ? -18.381  0.597   -83.523  1.00 120.70 ? 364 ALA B N   1 
ATOM 6047  C CA  . ALA B 1 395 ? -17.245  1.023   -84.354  1.00 121.91 ? 364 ALA B CA  1 
ATOM 6048  C C   . ALA B 1 395 ? -15.860  0.685   -83.793  1.00 122.63 ? 364 ALA B C   1 
ATOM 6049  O O   . ALA B 1 395 ? -14.899  0.568   -84.559  1.00 124.74 ? 364 ALA B O   1 
ATOM 6050  C CB  . ALA B 1 395 ? -17.335  2.519   -84.645  1.00 121.57 ? 364 ALA B CB  1 
ATOM 6051  N N   . ILE B 1 396 ? -15.746  0.537   -82.476  1.00 121.26 ? 365 ILE B N   1 
ATOM 6052  C CA  . ILE B 1 396 ? -14.473  0.195   -81.860  1.00 121.84 ? 365 ILE B CA  1 
ATOM 6053  C C   . ILE B 1 396 ? -13.684  -0.823  -82.681  1.00 123.97 ? 365 ILE B C   1 
ATOM 6054  O O   . ILE B 1 396 ? -12.534  -0.583  -83.050  1.00 125.43 ? 365 ILE B O   1 
ATOM 6055  C CB  . ILE B 1 396 ? -14.682  -0.329  -80.461  1.00 120.41 ? 365 ILE B CB  1 
ATOM 6056  C CG1 . ILE B 1 396 ? -14.962  0.836   -79.552  1.00 118.52 ? 365 ILE B CG1 1 
ATOM 6057  C CG2 . ILE B 1 396 ? -13.445  -1.033  -79.950  1.00 122.01 ? 365 ILE B CG2 1 
ATOM 6058  C CD1 . ILE B 1 396 ? -14.575  0.579   -78.151  1.00 118.70 ? 365 ILE B CD1 1 
ATOM 6059  N N   . LYS B 1 397 ? -14.326  -1.944  -82.977  1.00 124.50 ? 366 LYS B N   1 
ATOM 6060  C CA  . LYS B 1 397 ? -13.738  -3.027  -83.745  1.00 127.02 ? 366 LYS B CA  1 
ATOM 6061  C C   . LYS B 1 397 ? -12.655  -2.565  -84.729  1.00 129.29 ? 366 LYS B C   1 
ATOM 6062  O O   . LYS B 1 397 ? -11.539  -3.099  -84.741  1.00 131.04 ? 366 LYS B O   1 
ATOM 6063  C CB  . LYS B 1 397 ? -14.851  -3.746  -84.504  1.00 127.30 ? 366 LYS B CB  1 
ATOM 6064  C CG  . LYS B 1 397 ? -14.819  -5.270  -84.411  1.00 129.30 ? 366 LYS B CG  1 
ATOM 6065  C CD  . LYS B 1 397 ? -15.920  -5.882  -85.268  1.00 131.35 ? 366 LYS B CD  1 
ATOM 6066  C CE  . LYS B 1 397 ? -17.285  -5.264  -84.950  1.00 130.67 ? 366 LYS B CE  1 
ATOM 6067  N NZ  . LYS B 1 397 ? -18.103  -5.086  -86.193  1.00 132.66 ? 366 LYS B NZ  1 
ATOM 6068  N N   . SER B 1 398 ? -12.983  -1.554  -85.529  1.00 129.78 ? 367 SER B N   1 
ATOM 6069  C CA  . SER B 1 398 ? -12.173  -1.174  -86.693  1.00 132.54 ? 367 SER B CA  1 
ATOM 6070  C C   . SER B 1 398 ? -11.068  -0.130  -86.445  1.00 133.63 ? 367 SER B C   1 
ATOM 6071  O O   . SER B 1 398 ? -10.257  0.162   -87.342  1.00 136.04 ? 367 SER B O   1 
ATOM 6072  C CB  . SER B 1 398 ? -13.097  -0.728  -87.819  1.00 132.90 ? 367 SER B CB  1 
ATOM 6073  O OG  . SER B 1 398 ? -14.254  -0.114  -87.281  1.00 130.80 ? 367 SER B OG  1 
ATOM 6074  N N   . PHE B 1 399 ? -11.055  0.423   -85.233  1.00 132.01 ? 368 PHE B N   1 
ATOM 6075  C CA  . PHE B 1 399 ? -10.005  1.335   -84.776  1.00 132.91 ? 368 PHE B CA  1 
ATOM 6076  C C   . PHE B 1 399 ? -8.853   0.549   -84.163  1.00 134.38 ? 368 PHE B C   1 
ATOM 6077  O O   . PHE B 1 399 ? -9.016   -0.634  -83.844  1.00 134.08 ? 368 PHE B O   1 
ATOM 6078  C CB  . PHE B 1 399 ? -10.577  2.281   -83.730  1.00 130.44 ? 368 PHE B CB  1 
ATOM 6079  C CG  . PHE B 1 399 ? -11.496  3.310   -84.292  1.00 128.74 ? 368 PHE B CG  1 
ATOM 6080  C CD1 . PHE B 1 399 ? -11.128  4.644   -84.308  1.00 129.38 ? 368 PHE B CD1 1 
ATOM 6081  C CD2 . PHE B 1 399 ? -12.722  2.960   -84.814  1.00 125.98 ? 368 PHE B CD2 1 
ATOM 6082  C CE1 . PHE B 1 399 ? -11.967  5.617   -84.835  1.00 127.78 ? 368 PHE B CE1 1 
ATOM 6083  C CE2 . PHE B 1 399 ? -13.555  3.925   -85.337  1.00 125.30 ? 368 PHE B CE2 1 
ATOM 6084  C CZ  . PHE B 1 399 ? -13.171  5.258   -85.348  1.00 125.68 ? 368 PHE B CZ  1 
ATOM 6085  N N   . GLU B 1 400 ? -7.694   1.196   -83.997  1.00 136.53 ? 369 GLU B N   1 
ATOM 6086  C CA  . GLU B 1 400 ? -6.549   0.552   -83.318  1.00 137.77 ? 369 GLU B CA  1 
ATOM 6087  C C   . GLU B 1 400 ? -6.147   1.151   -81.971  1.00 137.01 ? 369 GLU B C   1 
ATOM 6088  O O   . GLU B 1 400 ? -6.314   2.350   -81.709  1.00 136.41 ? 369 GLU B O   1 
ATOM 6089  C CB  . GLU B 1 400 ? -5.309   0.337   -84.222  1.00 141.32 ? 369 GLU B CB  1 
ATOM 6090  C CG  . GLU B 1 400 ? -5.061   1.346   -85.314  1.00 144.00 ? 369 GLU B CG  1 
ATOM 6091  C CD  . GLU B 1 400 ? -5.727   0.943   -86.618  1.00 145.83 ? 369 GLU B CD  1 
ATOM 6092  O OE1 . GLU B 1 400 ? -6.973   0.846   -86.658  1.00 143.95 ? 369 GLU B OE1 1 
ATOM 6093  O OE2 . GLU B 1 400 ? -5.010   0.725   -87.618  1.00 150.07 ? 369 GLU B OE2 1 
ATOM 6094  N N   . ASN B 1 401 ? -5.622   0.272   -81.121  1.00 137.00 ? 370 ASN B N   1 
ATOM 6095  C CA  . ASN B 1 401 ? -5.245   0.604   -79.755  1.00 136.58 ? 370 ASN B CA  1 
ATOM 6096  C C   . ASN B 1 401 ? -6.453   0.992   -78.886  1.00 133.74 ? 370 ASN B C   1 
ATOM 6097  O O   . ASN B 1 401 ? -6.338   1.106   -77.655  1.00 133.47 ? 370 ASN B O   1 
ATOM 6098  C CB  . ASN B 1 401 ? -4.133   1.651   -79.752  1.00 138.97 ? 370 ASN B CB  1 
ATOM 6099  C CG  . ASN B 1 401 ? -2.874   1.140   -80.420  1.00 142.53 ? 370 ASN B CG  1 
ATOM 6100  O OD1 . ASN B 1 401 ? -2.420   0.032   -80.133  1.00 143.22 ? 370 ASN B OD1 1 
ATOM 6101  N ND2 . ASN B 1 401 ? -2.308   1.935   -81.327  1.00 145.85 ? 370 ASN B ND2 1 
ATOM 6102  N N   . SER B 1 402 ? -7.605   1.157   -79.549  1.00 131.74 ? 371 SER B N   1 
ATOM 6103  C CA  . SER B 1 402 ? -8.914   1.337   -78.929  1.00 128.59 ? 371 SER B CA  1 
ATOM 6104  C C   . SER B 1 402 ? -8.954   0.919   -77.506  1.00 127.13 ? 371 SER B C   1 
ATOM 6105  O O   . SER B 1 402 ? -8.699   -0.247  -77.228  1.00 127.60 ? 371 SER B O   1 
ATOM 6106  C CB  . SER B 1 402 ? -9.906   0.447   -79.635  1.00 127.55 ? 371 SER B CB  1 
ATOM 6107  O OG  . SER B 1 402 ? -10.913  1.251   -80.176  1.00 127.96 ? 371 SER B OG  1 
ATOM 6108  N N   . LEU B 1 403 ? -9.291   1.831   -76.598  1.00 125.56 ? 372 LEU B N   1 
ATOM 6109  C CA  . LEU B 1 403 ? -9.385   1.421   -75.201  1.00 124.10 ? 372 LEU B CA  1 
ATOM 6110  C C   . LEU B 1 403 ? -10.479  2.037   -74.386  1.00 121.69 ? 372 LEU B C   1 
ATOM 6111  O O   . LEU B 1 403 ? -10.788  3.219   -74.530  1.00 121.02 ? 372 LEU B O   1 
ATOM 6112  C CB  . LEU B 1 403 ? -8.044   1.520   -74.471  1.00 126.05 ? 372 LEU B CB  1 
ATOM 6113  C CG  . LEU B 1 403 ? -7.485   2.852   -74.008  1.00 127.48 ? 372 LEU B CG  1 
ATOM 6114  C CD1 . LEU B 1 403 ? -8.144   3.323   -72.732  1.00 125.26 ? 372 LEU B CD1 1 
ATOM 6115  C CD2 . LEU B 1 403 ? -5.986   2.652   -73.795  1.00 131.94 ? 372 LEU B CD2 1 
ATOM 6116  N N   . GLY B 1 404 ? -11.032  1.198   -73.511  1.00 120.27 ? 373 GLY B N   1 
ATOM 6117  C CA  . GLY B 1 404 ? -12.099  1.575   -72.592  1.00 118.24 ? 373 GLY B CA  1 
ATOM 6118  C C   . GLY B 1 404 ? -11.615  1.838   -71.177  1.00 118.16 ? 373 GLY B C   1 
ATOM 6119  O O   . GLY B 1 404 ? -10.875  1.035   -70.606  1.00 119.09 ? 373 GLY B O   1 
ATOM 6120  N N   . ILE B 1 405 ? -12.038  2.972   -70.620  1.00 116.95 ? 374 ILE B N   1 
ATOM 6121  C CA  . ILE B 1 405 ? -11.642  3.372   -69.284  1.00 117.23 ? 374 ILE B CA  1 
ATOM 6122  C C   . ILE B 1 405 ? -12.889  3.349   -68.388  1.00 116.21 ? 374 ILE B C   1 
ATOM 6123  O O   . ILE B 1 405 ? -13.888  3.963   -68.718  1.00 115.33 ? 374 ILE B O   1 
ATOM 6124  C CB  . ILE B 1 405 ? -10.865  4.749   -69.283  1.00 118.27 ? 374 ILE B CB  1 
ATOM 6125  C CG1 . ILE B 1 405 ? -11.733  5.924   -68.882  1.00 117.71 ? 374 ILE B CG1 1 
ATOM 6126  C CG2 . ILE B 1 405 ? -10.271  5.076   -70.626  1.00 118.42 ? 374 ILE B CG2 1 
ATOM 6127  C CD1 . ILE B 1 405 ? -11.347  6.521   -67.570  1.00 119.25 ? 374 ILE B CD1 1 
ATOM 6128  N N   . ASN B 1 406 ? -12.835  2.596   -67.291  1.00 116.60 ? 375 ASN B N   1 
ATOM 6129  C CA  . ASN B 1 406 ? -13.938  2.465   -66.341  1.00 116.11 ? 375 ASN B CA  1 
ATOM 6130  C C   . ASN B 1 406 ? -14.129  3.764   -65.555  1.00 116.60 ? 375 ASN B C   1 
ATOM 6131  O O   . ASN B 1 406 ? -13.167  4.332   -65.069  1.00 117.99 ? 375 ASN B O   1 
ATOM 6132  C CB  . ASN B 1 406 ? -13.631  1.298   -65.411  1.00 117.32 ? 375 ASN B CB  1 
ATOM 6133  C CG  . ASN B 1 406 ? -14.727  1.029   -64.412  1.00 118.20 ? 375 ASN B CG  1 
ATOM 6134  O OD1 . ASN B 1 406 ? -14.810  1.673   -63.359  1.00 120.84 ? 375 ASN B OD1 1 
ATOM 6135  N ND2 . ASN B 1 406 ? -15.552  0.039   -64.709  1.00 117.65 ? 375 ASN B ND2 1 
ATOM 6136  N N   . VAL B 1 407 ? -15.365  4.235   -65.429  1.00 115.87 ? 376 VAL B N   1 
ATOM 6137  C CA  . VAL B 1 407 ? -15.632  5.563   -64.860  1.00 116.42 ? 376 VAL B CA  1 
ATOM 6138  C C   . VAL B 1 407 ? -16.414  5.439   -63.577  1.00 117.37 ? 376 VAL B C   1 
ATOM 6139  O O   . VAL B 1 407 ? -17.091  4.436   -63.376  1.00 117.34 ? 376 VAL B O   1 
ATOM 6140  C CB  . VAL B 1 407 ? -16.514  6.415   -65.795  1.00 115.15 ? 376 VAL B CB  1 
ATOM 6141  C CG1 . VAL B 1 407 ? -16.178  7.879   -65.667  1.00 115.68 ? 376 VAL B CG1 1 
ATOM 6142  C CG2 . VAL B 1 407 ? -16.345  5.998   -67.222  1.00 114.63 ? 376 VAL B CG2 1 
ATOM 6143  N N   . PRO B 1 408 ? -16.350  6.464   -62.708  1.00 118.71 ? 377 PRO B N   1 
ATOM 6144  C CA  . PRO B 1 408 ? -17.315  6.514   -61.631  1.00 120.03 ? 377 PRO B CA  1 
ATOM 6145  C C   . PRO B 1 408 ? -18.681  6.721   -62.264  1.00 119.32 ? 377 PRO B C   1 
ATOM 6146  O O   . PRO B 1 408 ? -18.749  7.111   -63.424  1.00 118.20 ? 377 PRO B O   1 
ATOM 6147  C CB  . PRO B 1 408 ? -16.894  7.762   -60.849  1.00 121.49 ? 377 PRO B CB  1 
ATOM 6148  C CG  . PRO B 1 408 ? -16.177  8.601   -61.831  1.00 120.36 ? 377 PRO B CG  1 
ATOM 6149  C CD  . PRO B 1 408 ? -15.432  7.612   -62.656  1.00 119.71 ? 377 PRO B CD  1 
ATOM 6150  N N   . ARG B 1 409 ? -19.758  6.457   -61.535  1.00 120.57 ? 378 ARG B N   1 
ATOM 6151  C CA  . ARG B 1 409 ? -21.078  6.693   -62.090  1.00 120.15 ? 378 ARG B CA  1 
ATOM 6152  C C   . ARG B 1 409 ? -21.414  8.166   -62.163  1.00 120.46 ? 378 ARG B C   1 
ATOM 6153  O O   . ARG B 1 409 ? -22.200  8.582   -62.995  1.00 119.34 ? 378 ARG B O   1 
ATOM 6154  C CB  . ARG B 1 409 ? -22.139  5.958   -61.300  1.00 121.55 ? 378 ARG B CB  1 
ATOM 6155  C CG  . ARG B 1 409 ? -22.514  4.657   -61.929  1.00 121.23 ? 378 ARG B CG  1 
ATOM 6156  C CD  . ARG B 1 409 ? -24.004  4.584   -62.124  1.00 121.65 ? 378 ARG B CD  1 
ATOM 6157  N NE  . ARG B 1 409 ? -24.325  3.440   -62.958  1.00 121.99 ? 378 ARG B NE  1 
ATOM 6158  C CZ  . ARG B 1 409 ? -25.546  3.113   -63.367  1.00 123.00 ? 378 ARG B CZ  1 
ATOM 6159  N NH1 . ARG B 1 409 ? -26.598  3.842   -63.029  1.00 124.28 ? 378 ARG B NH1 1 
ATOM 6160  N NH2 . ARG B 1 409 ? -25.715  2.042   -64.125  1.00 123.57 ? 378 ARG B NH2 1 
ATOM 6161  N N   . SER B 1 410 ? -20.813  8.950   -61.283  1.00 122.51 ? 379 SER B N   1 
ATOM 6162  C CA  . SER B 1 410 ? -20.950  10.395  -61.314  1.00 123.77 ? 379 SER B CA  1 
ATOM 6163  C C   . SER B 1 410 ? -20.833  10.995  -62.727  1.00 122.42 ? 379 SER B C   1 
ATOM 6164  O O   . SER B 1 410 ? -21.143  12.171  -62.930  1.00 122.71 ? 379 SER B O   1 
ATOM 6165  C CB  . SER B 1 410 ? -19.901  11.008  -60.391  1.00 125.93 ? 379 SER B CB  1 
ATOM 6166  O OG  . SER B 1 410 ? -18.592  10.626  -60.794  1.00 126.79 ? 379 SER B OG  1 
ATOM 6167  N N   . ARG B 1 411 ? -20.379  10.184  -63.686  1.00 121.52 ? 380 ARG B N   1 
ATOM 6168  C CA  . ARG B 1 411 ? -20.280  10.576  -65.104  1.00 120.79 ? 380 ARG B CA  1 
ATOM 6169  C C   . ARG B 1 411 ? -21.340  9.878   -65.975  1.00 119.62 ? 380 ARG B C   1 
ATOM 6170  O O   . ARG B 1 411 ? -21.118  9.677   -67.173  1.00 118.51 ? 380 ARG B O   1 
ATOM 6171  C CB  . ARG B 1 411 ? -18.884  10.262  -65.689  1.00 120.71 ? 380 ARG B CB  1 
ATOM 6172  C CG  . ARG B 1 411 ? -17.656  10.874  -64.975  1.00 122.70 ? 380 ARG B CG  1 
ATOM 6173  C CD  . ARG B 1 411 ? -17.209  12.241  -65.519  1.00 123.07 ? 380 ARG B CD  1 
ATOM 6174  N NE  . ARG B 1 411 ? -17.486  12.449  -66.947  1.00 119.96 ? 380 ARG B NE  1 
ATOM 6175  C CZ  . ARG B 1 411 ? -16.710  12.037  -67.940  1.00 117.24 ? 380 ARG B CZ  1 
ATOM 6176  N NH1 . ARG B 1 411 ? -15.608  11.372  -67.665  1.00 118.14 ? 380 ARG B NH1 1 
ATOM 6177  N NH2 . ARG B 1 411 ? -17.044  12.285  -69.200  1.00 114.06 ? 380 ARG B NH2 1 
ATOM 6178  N N   . PHE B 1 412 ? -22.482  9.519   -65.379  1.00 120.36 ? 381 PHE B N   1 
ATOM 6179  C CA  . PHE B 1 412 ? -23.570  8.809   -66.086  1.00 119.79 ? 381 PHE B CA  1 
ATOM 6180  C C   . PHE B 1 412 ? -24.967  8.997   -65.441  1.00 120.97 ? 381 PHE B C   1 
ATOM 6181  O O   . PHE B 1 412 ? -25.395  8.207   -64.600  1.00 122.04 ? 381 PHE B O   1 
ATOM 6182  C CB  . PHE B 1 412 ? -23.215  7.316   -66.240  1.00 119.34 ? 381 PHE B CB  1 
ATOM 6183  C CG  . PHE B 1 412 ? -24.250  6.516   -66.965  1.00 118.49 ? 381 PHE B CG  1 
ATOM 6184  C CD1 . PHE B 1 412 ? -24.337  6.557   -68.342  1.00 117.70 ? 381 PHE B CD1 1 
ATOM 6185  C CD2 . PHE B 1 412 ? -25.134  5.715   -66.271  1.00 119.88 ? 381 PHE B CD2 1 
ATOM 6186  C CE1 . PHE B 1 412 ? -25.301  5.822   -69.024  1.00 117.61 ? 381 PHE B CE1 1 
ATOM 6187  C CE2 . PHE B 1 412 ? -26.098  4.971   -66.943  1.00 120.34 ? 381 PHE B CE2 1 
ATOM 6188  C CZ  . PHE B 1 412 ? -26.180  5.027   -68.325  1.00 118.84 ? 381 PHE B CZ  1 
ATOM 6189  N N   . LEU B 1 413 ? -25.672  10.052  -65.833  1.00 121.43 ? 382 LEU B N   1 
ATOM 6190  C CA  . LEU B 1 413 ? -27.028  10.298  -65.328  1.00 122.85 ? 382 LEU B CA  1 
ATOM 6191  C C   . LEU B 1 413 ? -27.980  10.415  -66.503  1.00 122.27 ? 382 LEU B C   1 
ATOM 6192  O O   . LEU B 1 413 ? -28.421  11.511  -66.852  1.00 122.29 ? 382 LEU B O   1 
ATOM 6193  C CB  . LEU B 1 413 ? -27.109  11.580  -64.490  1.00 124.17 ? 382 LEU B CB  1 
ATOM 6194  C CG  . LEU B 1 413 ? -25.911  12.075  -63.686  1.00 125.16 ? 382 LEU B CG  1 
ATOM 6195  C CD1 . LEU B 1 413 ? -26.115  13.544  -63.327  1.00 125.80 ? 382 LEU B CD1 1 
ATOM 6196  C CD2 . LEU B 1 413 ? -25.664  11.193  -62.443  1.00 127.41 ? 382 LEU B CD2 1 
ATOM 6197  N N   . PRO B 1 414 ? -28.308  9.287   -67.129  1.00 122.06 ? 383 PRO B N   1 
ATOM 6198  C CA  . PRO B 1 414 ? -29.239  9.451   -68.212  1.00 121.81 ? 383 PRO B CA  1 
ATOM 6199  C C   . PRO B 1 414 ? -30.620  9.838   -67.632  1.00 123.45 ? 383 PRO B C   1 
ATOM 6200  O O   . PRO B 1 414 ? -31.257  9.033   -66.923  1.00 125.03 ? 383 PRO B O   1 
ATOM 6201  C CB  . PRO B 1 414 ? -29.256  8.063   -68.857  1.00 121.47 ? 383 PRO B CB  1 
ATOM 6202  C CG  . PRO B 1 414 ? -29.060  7.126   -67.705  1.00 122.55 ? 383 PRO B CG  1 
ATOM 6203  C CD  . PRO B 1 414 ? -28.173  7.878   -66.715  1.00 122.75 ? 383 PRO B CD  1 
ATOM 6204  N N   . VAL B 1 415 ? -31.037  11.080  -67.902  1.00 123.28 ? 384 VAL B N   1 
ATOM 6205  C CA  . VAL B 1 415 ? -32.385  11.575  -67.592  1.00 123.94 ? 384 VAL B CA  1 
ATOM 6206  C C   . VAL B 1 415 ? -33.393  11.101  -68.666  1.00 123.80 ? 384 VAL B C   1 
ATOM 6207  O O   . VAL B 1 415 ? -33.592  11.756  -69.693  1.00 122.91 ? 384 VAL B O   1 
ATOM 6208  C CB  . VAL B 1 415 ? -32.363  13.102  -67.426  1.00 123.91 ? 384 VAL B CB  1 
ATOM 6209  C CG1 . VAL B 1 415 ? -33.728  13.625  -67.083  1.00 125.64 ? 384 VAL B CG1 1 
ATOM 6210  C CG2 . VAL B 1 415 ? -31.392  13.468  -66.333  1.00 123.81 ? 384 VAL B CG2 1 
ATOM 6211  N N   . LYS B 1 416 ? -33.999  9.942   -68.408  1.00 124.77 ? 385 LYS B N   1 
ATOM 6212  C CA  . LYS B 1 416 ? -34.888  9.261   -69.350  1.00 125.28 ? 385 LYS B CA  1 
ATOM 6213  C C   . LYS B 1 416 ? -36.370  9.556   -69.094  1.00 127.28 ? 385 LYS B C   1 
ATOM 6214  O O   . LYS B 1 416 ? -37.151  9.716   -70.035  1.00 127.60 ? 385 LYS B O   1 
ATOM 6215  C CB  . LYS B 1 416 ? -34.732  7.746   -69.224  1.00 125.96 ? 385 LYS B CB  1 
ATOM 6216  C CG  . LYS B 1 416 ? -33.413  7.142   -69.613  1.00 124.69 ? 385 LYS B CG  1 
ATOM 6217  C CD  . LYS B 1 416 ? -33.383  5.696   -69.096  1.00 127.09 ? 385 LYS B CD  1 
ATOM 6218  N N   . THR B 1 417 ? -36.761  9.575   -67.820  1.00 128.81 ? 386 THR B N   1 
ATOM 6219  C CA  . THR B 1 417 ? -38.163  9.683   -67.437  1.00 130.84 ? 386 THR B CA  1 
ATOM 6220  C C   . THR B 1 417 ? -38.345  10.778  -66.391  1.00 132.11 ? 386 THR B C   1 
ATOM 6221  O O   . THR B 1 417 ? -37.372  11.222  -65.763  1.00 131.34 ? 386 THR B O   1 
ATOM 6222  C CB  . THR B 1 417 ? -38.646  8.362   -66.863  1.00 132.86 ? 386 THR B CB  1 
ATOM 6223  O OG1 . THR B 1 417 ? -37.971  8.110   -65.624  1.00 133.06 ? 386 THR B OG1 1 
ATOM 6224  C CG2 . THR B 1 417 ? -38.340  7.229   -67.834  1.00 131.72 ? 386 THR B CG2 1 
ATOM 6225  N N   . THR B 1 418 ? -39.589  11.208  -66.192  1.00 134.08 ? 387 THR B N   1 
ATOM 6226  C CA  . THR B 1 418 ? -39.870  12.292  -65.236  1.00 135.55 ? 387 THR B CA  1 
ATOM 6227  C C   . THR B 1 418 ? -39.548  11.934  -63.795  1.00 136.75 ? 387 THR B C   1 
ATOM 6228  O O   . THR B 1 418 ? -39.581  12.801  -62.930  1.00 137.85 ? 387 THR B O   1 
ATOM 6229  C CB  . THR B 1 418 ? -41.330  12.763  -65.274  1.00 137.97 ? 387 THR B CB  1 
ATOM 6230  O OG1 . THR B 1 418 ? -42.184  11.673  -64.929  1.00 141.12 ? 387 THR B OG1 1 
ATOM 6231  C CG2 . THR B 1 418 ? -41.696  13.266  -66.650  1.00 137.11 ? 387 THR B CG2 1 
ATOM 6232  N N   . SER B 1 419 ? -39.268  10.658  -63.545  1.00 136.70 ? 388 SER B N   1 
ATOM 6233  C CA  . SER B 1 419 ? -38.781  10.216  -62.246  1.00 137.94 ? 388 SER B CA  1 
ATOM 6234  C C   . SER B 1 419 ? -37.368  10.761  -62.030  1.00 135.60 ? 388 SER B C   1 
ATOM 6235  O O   . SER B 1 419 ? -37.061  11.410  -61.018  1.00 136.68 ? 388 SER B O   1 
ATOM 6236  C CB  . SER B 1 419 ? -38.802  8.686   -62.159  1.00 138.86 ? 388 SER B CB  1 
ATOM 6237  O OG  . SER B 1 419 ? -40.130  8.197   -62.057  1.00 141.53 ? 388 SER B OG  1 
ATOM 6238  N N   . ASP B 1 420 ? -36.525  10.512  -63.018  1.00 132.40 ? 389 ASP B N   1 
ATOM 6239  C CA  . ASP B 1 420 ? -35.147  10.958  -62.991  1.00 130.27 ? 389 ASP B CA  1 
ATOM 6240  C C   . ASP B 1 420 ? -35.100  12.468  -62.935  1.00 128.84 ? 389 ASP B C   1 
ATOM 6241  O O   . ASP B 1 420 ? -34.346  13.045  -62.162  1.00 128.76 ? 389 ASP B O   1 
ATOM 6242  C CB  . ASP B 1 420 ? -34.408  10.458  -64.240  1.00 128.59 ? 389 ASP B CB  1 
ATOM 6243  C CG  . ASP B 1 420 ? -34.509  8.923   -64.437  1.00 131.23 ? 389 ASP B CG  1 
ATOM 6244  O OD1 . ASP B 1 420 ? -34.835  8.173   -63.461  1.00 135.28 ? 389 ASP B OD1 1 
ATOM 6245  O OD2 . ASP B 1 420 ? -34.247  8.479   -65.591  1.00 131.69 ? 389 ASP B OD2 1 
ATOM 6246  N N   . LEU B 1 421 ? -35.918  13.095  -63.767  1.00 127.35 ? 390 LEU B N   1 
ATOM 6247  C CA  . LEU B 1 421 ? -36.062  14.524  -63.742  1.00 127.00 ? 390 LEU B CA  1 
ATOM 6248  C C   . LEU B 1 421 ? -36.301  15.090  -62.343  1.00 129.09 ? 390 LEU B C   1 
ATOM 6249  O O   . LEU B 1 421 ? -35.855  16.195  -62.055  1.00 129.18 ? 390 LEU B O   1 
ATOM 6250  C CB  . LEU B 1 421 ? -37.197  14.958  -64.656  1.00 127.35 ? 390 LEU B CB  1 
ATOM 6251  C CG  . LEU B 1 421 ? -36.885  15.909  -65.808  1.00 126.01 ? 390 LEU B CG  1 
ATOM 6252  C CD1 . LEU B 1 421 ? -38.145  16.679  -66.242  1.00 127.10 ? 390 LEU B CD1 1 
ATOM 6253  C CD2 . LEU B 1 421 ? -35.782  16.885  -65.425  1.00 125.77 ? 390 LEU B CD2 1 
ATOM 6254  N N   . LEU B 1 422 ? -37.010  14.358  -61.482  1.00 130.76 ? 391 LEU B N   1 
ATOM 6255  C CA  . LEU B 1 422 ? -37.307  14.866  -60.142  1.00 133.05 ? 391 LEU B CA  1 
ATOM 6256  C C   . LEU B 1 422 ? -36.014  14.919  -59.382  1.00 132.94 ? 391 LEU B C   1 
ATOM 6257  O O   . LEU B 1 422 ? -35.477  15.997  -59.108  1.00 132.90 ? 391 LEU B O   1 
ATOM 6258  C CB  . LEU B 1 422 ? -38.294  13.973  -59.413  1.00 135.40 ? 391 LEU B CB  1 
ATOM 6259  C CG  . LEU B 1 422 ? -38.212  14.021  -57.889  1.00 138.20 ? 391 LEU B CG  1 
ATOM 6260  C CD1 . LEU B 1 422 ? -39.039  15.140  -57.259  1.00 139.67 ? 391 LEU B CD1 1 
ATOM 6261  C CD2 . LEU B 1 422 ? -38.656  12.691  -57.381  1.00 141.00 ? 391 LEU B CD2 1 
ATOM 6262  N N   . LEU B 1 423 ? -35.524  13.726  -59.060  1.00 101.61 ? 392 LEU B N   1 
ATOM 6263  C CA  . LEU B 1 423 ? -34.181  13.512  -58.555  1.00 102.43 ? 392 LEU B CA  1 
ATOM 6264  C C   . LEU B 1 423 ? -33.212  14.651  -58.906  1.00 102.53 ? 392 LEU B C   1 
ATOM 6265  O O   . LEU B 1 423 ? -32.620  15.282  -58.039  1.00 103.67 ? 392 LEU B O   1 
ATOM 6266  C CB  . LEU B 1 423 ? -33.657  12.203  -59.145  1.00 102.69 ? 392 LEU B CB  1 
ATOM 6267  C CG  . LEU B 1 423 ? -32.743  11.376  -58.252  1.00 104.80 ? 392 LEU B CG  1 
ATOM 6268  C CD1 . LEU B 1 423 ? -33.460  11.073  -56.929  1.00 106.02 ? 392 LEU B CD1 1 
ATOM 6269  C CD2 . LEU B 1 423 ? -32.285  10.096  -58.976  1.00 105.72 ? 392 LEU B CD2 1 
ATOM 6270  N N   . VAL B 1 424 ? -33.095  14.926  -60.191  1.00 101.58 ? 393 VAL B N   1 
ATOM 6271  C CA  . VAL B 1 424 ? -32.055  15.779  -60.695  1.00 102.05 ? 393 VAL B CA  1 
ATOM 6272  C C   . VAL B 1 424 ? -32.385  17.278  -60.547  1.00 102.17 ? 393 VAL B C   1 
ATOM 6273  O O   . VAL B 1 424 ? -31.608  18.130  -60.946  1.00 103.17 ? 393 VAL B O   1 
ATOM 6274  C CB  . VAL B 1 424 ? -31.696  15.314  -62.141  1.00 102.14 ? 393 VAL B CB  1 
ATOM 6275  C CG1 . VAL B 1 424 ? -32.600  15.926  -63.186  1.00 102.10 ? 393 VAL B CG1 1 
ATOM 6276  C CG2 . VAL B 1 424 ? -30.235  15.541  -62.451  1.00 104.26 ? 393 VAL B CG2 1 
ATOM 6277  N N   . MET B 1 425 ? -33.529  17.592  -59.949  1.00 101.61 ? 394 MET B N   1 
ATOM 6278  C CA  . MET B 1 425 ? -33.854  18.985  -59.604  1.00 102.68 ? 394 MET B CA  1 
ATOM 6279  C C   . MET B 1 425 ? -34.295  19.153  -58.142  1.00 103.13 ? 394 MET B C   1 
ATOM 6280  O O   . MET B 1 425 ? -34.788  20.210  -57.743  1.00 103.54 ? 394 MET B O   1 
ATOM 6281  C CB  . MET B 1 425 ? -34.871  19.596  -60.580  1.00 102.69 ? 394 MET B CB  1 
ATOM 6282  C CG  . MET B 1 425 ? -36.271  18.961  -60.563  1.00 102.07 ? 394 MET B CG  1 
ATOM 6283  S SD  . MET B 1 425 ? -37.532  19.758  -61.614  1.00 103.32 ? 394 MET B SD  1 
ATOM 6284  C CE  . MET B 1 425 ? -37.529  18.777  -63.126  1.00 100.58 ? 394 MET B CE  1 
ATOM 6285  N N   . SER B 1 426 ? -34.097  18.090  -57.364  1.00 103.24 ? 395 SER B N   1 
ATOM 6286  C CA  . SER B 1 426 ? -34.239  18.104  -55.907  1.00 105.09 ? 395 SER B CA  1 
ATOM 6287  C C   . SER B 1 426 ? -33.146  18.950  -55.310  1.00 107.50 ? 395 SER B C   1 
ATOM 6288  O O   . SER B 1 426 ? -32.363  19.563  -56.034  1.00 108.28 ? 395 SER B O   1 
ATOM 6289  C CB  . SER B 1 426 ? -34.040  16.707  -55.327  1.00 104.80 ? 395 SER B CB  1 
ATOM 6290  O OG  . SER B 1 426 ? -34.478  15.701  -56.211  1.00 103.97 ? 395 SER B OG  1 
ATOM 6291  N N   . ASN B 1 427 ? -33.060  18.947  -53.983  1.00 109.53 ? 396 ASN B N   1 
ATOM 6292  C CA  . ASN B 1 427 ? -31.888  19.491  -53.308  1.00 112.22 ? 396 ASN B CA  1 
ATOM 6293  C C   . ASN B 1 427 ? -30.885  18.368  -53.079  1.00 112.52 ? 396 ASN B C   1 
ATOM 6294  O O   . ASN B 1 427 ? -29.949  18.501  -52.283  1.00 114.83 ? 396 ASN B O   1 
ATOM 6295  C CB  . ASN B 1 427 ? -32.259  20.211  -52.005  1.00 114.87 ? 396 ASN B CB  1 
ATOM 6296  C CG  . ASN B 1 427 ? -32.773  19.264  -50.919  1.00 116.57 ? 396 ASN B CG  1 
ATOM 6297  O OD1 . ASN B 1 427 ? -33.433  18.247  -51.197  1.00 116.15 ? 396 ASN B OD1 1 
ATOM 6298  N ND2 . ASN B 1 427 ? -32.483  19.611  -49.665  1.00 120.05 ? 396 ASN B ND2 1 
ATOM 6299  N N   . LEU B 1 428 ? -31.101  17.266  -53.800  1.00 110.45 ? 397 LEU B N   1 
ATOM 6300  C CA  . LEU B 1 428 ? -30.199  16.117  -53.808  1.00 110.92 ? 397 LEU B CA  1 
ATOM 6301  C C   . LEU B 1 428 ? -28.940  16.366  -54.672  1.00 111.83 ? 397 LEU B C   1 
ATOM 6302  O O   . LEU B 1 428 ? -27.930  15.673  -54.541  1.00 113.17 ? 397 LEU B O   1 
ATOM 6303  C CB  . LEU B 1 428 ? -30.956  14.880  -54.286  1.00 108.62 ? 397 LEU B CB  1 
ATOM 6304  C CG  . LEU B 1 428 ? -30.835  13.654  -53.382  1.00 109.50 ? 397 LEU B CG  1 
ATOM 6305  C CD1 . LEU B 1 428 ? -31.934  12.688  -53.662  1.00 107.62 ? 397 LEU B CD1 1 
ATOM 6306  C CD2 . LEU B 1 428 ? -29.520  12.965  -53.573  1.00 111.82 ? 397 LEU B CD2 1 
ATOM 6307  N N   . TYR B 1 429 ? -29.023  17.361  -55.552  1.00 111.67 ? 398 TYR B N   1 
ATOM 6308  C CA  . TYR B 1 429 ? -27.916  17.819  -56.381  1.00 112.92 ? 398 TYR B CA  1 
ATOM 6309  C C   . TYR B 1 429 ? -27.861  19.330  -56.223  1.00 115.04 ? 398 TYR B C   1 
ATOM 6310  O O   . TYR B 1 429 ? -28.878  19.961  -55.902  1.00 114.66 ? 398 TYR B O   1 
ATOM 6311  C CB  . TYR B 1 429 ? -28.180  17.452  -57.848  1.00 110.89 ? 398 TYR B CB  1 
ATOM 6312  C CG  . TYR B 1 429 ? -28.043  15.976  -58.150  1.00 109.73 ? 398 TYR B CG  1 
ATOM 6313  C CD1 . TYR B 1 429 ? -27.145  15.522  -59.106  1.00 110.01 ? 398 TYR B CD1 1 
ATOM 6314  C CD2 . TYR B 1 429 ? -28.804  15.029  -57.470  1.00 108.82 ? 398 TYR B CD2 1 
ATOM 6315  C CE1 . TYR B 1 429 ? -27.013  14.159  -59.375  1.00 110.01 ? 398 TYR B CE1 1 
ATOM 6316  C CE2 . TYR B 1 429 ? -28.673  13.671  -57.722  1.00 108.52 ? 398 TYR B CE2 1 
ATOM 6317  C CZ  . TYR B 1 429 ? -27.780  13.236  -58.675  1.00 108.93 ? 398 TYR B CZ  1 
ATOM 6318  O OH  . TYR B 1 429 ? -27.654  11.882  -58.914  1.00 108.61 ? 398 TYR B OH  1 
ATOM 6319  N N   . SER B 1 430 ? -26.690  19.924  -56.426  1.00 117.92 ? 399 SER B N   1 
ATOM 6320  C CA  . SER B 1 430 ? -26.618  21.386  -56.506  1.00 120.45 ? 399 SER B CA  1 
ATOM 6321  C C   . SER B 1 430 ? -26.045  21.805  -57.848  1.00 121.23 ? 399 SER B C   1 
ATOM 6322  O O   . SER B 1 430 ? -25.297  21.044  -58.476  1.00 121.18 ? 399 SER B O   1 
ATOM 6323  C CB  . SER B 1 430 ? -25.825  21.988  -55.345  1.00 123.80 ? 399 SER B CB  1 
ATOM 6324  O OG  . SER B 1 430 ? -24.449  21.678  -55.448  1.00 126.35 ? 399 SER B OG  1 
ATOM 6325  N N   . LEU B 1 431 ? -26.408  23.006  -58.288  1.00 122.60 ? 400 LEU B N   1 
ATOM 6326  C CA  . LEU B 1 431 ? -26.046  23.461  -59.626  1.00 123.92 ? 400 LEU B CA  1 
ATOM 6327  C C   . LEU B 1 431 ? -24.952  24.509  -59.588  1.00 128.20 ? 400 LEU B C   1 
ATOM 6328  O O   . LEU B 1 431 ? -25.097  25.546  -58.939  1.00 130.18 ? 400 LEU B O   1 
ATOM 6329  C CB  . LEU B 1 431 ? -27.265  24.030  -60.349  1.00 122.62 ? 400 LEU B CB  1 
ATOM 6330  C CG  . LEU B 1 431 ? -26.962  24.702  -61.682  1.00 123.56 ? 400 LEU B CG  1 
ATOM 6331  C CD1 . LEU B 1 431 ? -27.418  23.809  -62.815  1.00 120.21 ? 400 LEU B CD1 1 
ATOM 6332  C CD2 . LEU B 1 431 ? -27.622  26.071  -61.725  1.00 125.25 ? 400 LEU B CD2 1 
ATOM 6333  N N   . ASN B 1 432 ? -23.867  24.244  -60.305  1.00 130.27 ? 401 ASN B N   1 
ATOM 6334  C CA  . ASN B 1 432 ? -22.762  25.183  -60.361  1.00 135.23 ? 401 ASN B CA  1 
ATOM 6335  C C   . ASN B 1 432 ? -22.184  25.326  -61.754  1.00 136.70 ? 401 ASN B C   1 
ATOM 6336  O O   . ASN B 1 432 ? -21.419  24.479  -62.220  1.00 137.14 ? 401 ASN B O   1 
ATOM 6337  C CB  . ASN B 1 432 ? -21.675  24.772  -59.379  1.00 137.78 ? 401 ASN B CB  1 
ATOM 6338  C CG  . ASN B 1 432 ? -22.228  24.464  -58.007  1.00 138.29 ? 401 ASN B CG  1 
ATOM 6339  O OD1 . ASN B 1 432 ? -22.401  25.364  -57.177  1.00 142.10 ? 401 ASN B OD1 1 
ATOM 6340  N ND2 . ASN B 1 432 ? -22.521  23.185  -57.761  1.00 136.84 ? 401 ASN B ND2 1 
ATOM 6341  N N   . ALA B 1 433 ? -22.563  26.411  -62.415  1.00 138.25 ? 402 ALA B N   1 
ATOM 6342  C CA  . ALA B 1 433 ? -22.046  26.751  -63.736  1.00 140.40 ? 402 ALA B CA  1 
ATOM 6343  C C   . ALA B 1 433 ? -22.192  25.619  -64.744  1.00 138.06 ? 402 ALA B C   1 
ATOM 6344  O O   . ALA B 1 433 ? -21.215  25.201  -65.365  1.00 139.57 ? 402 ALA B O   1 
ATOM 6345  C CB  . ALA B 1 433 ? -20.586  27.228  -63.644  1.00 144.88 ? 402 ALA B CB  1 
ATOM 6346  N N   . GLY B 1 434 ? -23.414  25.120  -64.887  1.00 134.69 ? 403 GLY B N   1 
ATOM 6347  C CA  . GLY B 1 434 ? -23.726  24.224  -65.981  1.00 133.49 ? 403 GLY B CA  1 
ATOM 6348  C C   . GLY B 1 434 ? -23.767  22.769  -65.623  1.00 131.00 ? 403 GLY B C   1 
ATOM 6349  O O   . GLY B 1 434 ? -24.631  22.045  -66.092  1.00 128.78 ? 403 GLY B O   1 
ATOM 6350  N N   . SER B 1 435 ? -22.826  22.322  -64.811  1.00 132.21 ? 404 SER B N   1 
ATOM 6351  C CA  . SER B 1 435 ? -22.872  20.942  -64.363  1.00 130.70 ? 404 SER B CA  1 
ATOM 6352  C C   . SER B 1 435 ? -23.493  20.816  -62.979  1.00 129.22 ? 404 SER B C   1 
ATOM 6353  O O   . SER B 1 435 ? -23.373  21.709  -62.136  1.00 130.43 ? 404 SER B O   1 
ATOM 6354  C CB  . SER B 1 435 ? -21.490  20.279  -64.422  1.00 132.93 ? 404 SER B CB  1 
ATOM 6355  O OG  . SER B 1 435 ? -20.554  20.962  -63.616  1.00 135.86 ? 404 SER B OG  1 
ATOM 6356  N N   . LEU B 1 436 ? -24.183  19.709  -62.758  1.00 127.13 ? 405 LEU B N   1 
ATOM 6357  C CA  . LEU B 1 436 ? -24.674  19.424  -61.428  1.00 126.68 ? 405 LEU B CA  1 
ATOM 6358  C C   . LEU B 1 436 ? -24.217  18.059  -60.931  1.00 127.02 ? 405 LEU B C   1 
ATOM 6359  O O   . LEU B 1 436 ? -24.177  17.081  -61.704  1.00 126.28 ? 405 LEU B O   1 
ATOM 6360  C CB  . LEU B 1 436 ? -26.193  19.629  -61.319  1.00 124.26 ? 405 LEU B CB  1 
ATOM 6361  C CG  . LEU B 1 436 ? -27.188  19.331  -62.446  1.00 121.85 ? 405 LEU B CG  1 
ATOM 6362  C CD1 . LEU B 1 436 ? -27.600  17.877  -62.464  1.00 119.05 ? 405 LEU B CD1 1 
ATOM 6363  C CD2 . LEU B 1 436 ? -28.407  20.196  -62.241  1.00 120.61 ? 405 LEU B CD2 1 
ATOM 6364  N N   . THR B 1 437 ? -23.861  18.027  -59.639  1.00 128.73 ? 406 THR B N   1 
ATOM 6365  C CA  . THR B 1 437 ? -23.241  16.877  -58.963  1.00 130.04 ? 406 THR B CA  1 
ATOM 6366  C C   . THR B 1 437 ? -23.802  16.769  -57.553  1.00 130.20 ? 406 THR B C   1 
ATOM 6367  O O   . THR B 1 437 ? -24.254  17.767  -56.991  1.00 130.47 ? 406 THR B O   1 
ATOM 6368  C CB  . THR B 1 437 ? -21.724  17.059  -58.840  1.00 133.52 ? 406 THR B CB  1 
ATOM 6369  O OG1 . THR B 1 437 ? -21.458  18.347  -58.273  1.00 135.46 ? 406 THR B OG1 1 
ATOM 6370  C CG2 . THR B 1 437 ? -21.028  16.939  -60.207  1.00 134.08 ? 406 THR B CG2 1 
ATOM 6371  N N   . MET B 1 438 ? -23.735  15.572  -56.973  1.00 130.77 ? 407 MET B N   1 
ATOM 6372  C CA  . MET B 1 438 ? -24.538  15.247  -55.792  1.00 131.09 ? 407 MET B CA  1 
ATOM 6373  C C   . MET B 1 438 ? -23.986  15.737  -54.466  1.00 134.15 ? 407 MET B C   1 
ATOM 6374  O O   . MET B 1 438 ? -23.267  15.026  -53.779  1.00 136.58 ? 407 MET B O   1 
ATOM 6375  C CB  . MET B 1 438 ? -24.789  13.753  -55.722  1.00 130.58 ? 407 MET B CB  1 
ATOM 6376  C CG  . MET B 1 438 ? -25.800  13.383  -54.677  1.00 131.23 ? 407 MET B CG  1 
ATOM 6377  S SD  . MET B 1 438 ? -25.646  11.656  -54.237  1.00 136.73 ? 407 MET B SD  1 
ATOM 6378  C CE  . MET B 1 438 ? -24.091  11.651  -53.296  1.00 139.87 ? 407 MET B CE  1 
ATOM 6379  N N   . SER B 1 439 ? -24.396  16.939  -54.090  1.00 134.86 ? 408 SER B N   1 
ATOM 6380  C CA  . SER B 1 439 ? -23.771  17.689  -53.011  1.00 138.84 ? 408 SER B CA  1 
ATOM 6381  C C   . SER B 1 439 ? -23.846  17.006  -51.674  1.00 141.00 ? 408 SER B C   1 
ATOM 6382  O O   . SER B 1 439 ? -24.712  16.162  -51.455  1.00 139.37 ? 408 SER B O   1 
ATOM 6383  C CB  . SER B 1 439 ? -24.468  19.033  -52.846  1.00 138.90 ? 408 SER B CB  1 
ATOM 6384  O OG  . SER B 1 439 ? -25.585  18.900  -51.980  1.00 138.20 ? 408 SER B OG  1 
ATOM 6385  N N   . GLU B 1 440 ? -22.941  17.408  -50.786  1.00 145.20 ? 409 GLU B N   1 
ATOM 6386  C CA  . GLU B 1 440 ? -23.055  17.131  -49.365  1.00 148.26 ? 409 GLU B CA  1 
ATOM 6387  C C   . GLU B 1 440 ? -23.953  18.219  -48.739  1.00 147.96 ? 409 GLU B C   1 
ATOM 6388  O O   . GLU B 1 440 ? -24.075  19.298  -49.304  1.00 147.57 ? 409 GLU B O   1 
ATOM 6389  C CB  . GLU B 1 440 ? -21.668  17.137  -48.751  1.00 153.21 ? 409 GLU B CB  1 
ATOM 6390  C CG  . GLU B 1 440 ? -20.725  16.161  -49.430  1.00 156.19 ? 409 GLU B CG  1 
ATOM 6391  C CD  . GLU B 1 440 ? -19.298  16.694  -49.516  1.00 164.32 ? 409 GLU B CD  1 
ATOM 6392  O OE1 . GLU B 1 440 ? -19.095  17.702  -50.238  1.00 165.57 ? 409 GLU B OE1 1 
ATOM 6393  O OE2 . GLU B 1 440 ? -18.380  16.111  -48.872  1.00 169.61 ? 409 GLU B OE2 1 
ATOM 6394  N N   . LYS B 1 441 ? -24.602  17.955  -47.607  1.00 148.49 ? 410 LYS B N   1 
ATOM 6395  C CA  . LYS B 1 441 ? -24.511  16.690  -46.908  1.00 149.19 ? 410 LYS B CA  1 
ATOM 6396  C C   . LYS B 1 441 ? -25.474  15.705  -47.520  1.00 144.67 ? 410 LYS B C   1 
ATOM 6397  O O   . LYS B 1 441 ? -26.672  15.925  -47.534  1.00 142.80 ? 410 LYS B O   1 
ATOM 6398  C CB  . LYS B 1 441 ? -24.826  16.864  -45.415  1.00 153.11 ? 410 LYS B CB  1 
ATOM 6399  N N   . ARG B 1 442 ? -24.932  14.632  -48.057  1.00 143.19 ? 411 ARG B N   1 
ATOM 6400  C CA  . ARG B 1 442 ? -25.721  13.497  -48.431  1.00 140.06 ? 411 ARG B CA  1 
ATOM 6401  C C   . ARG B 1 442 ? -24.839  12.406  -47.908  1.00 143.26 ? 411 ARG B C   1 
ATOM 6402  O O   . ARG B 1 442 ? -23.884  12.000  -48.561  1.00 143.94 ? 411 ARG B O   1 
ATOM 6403  C CB  . ARG B 1 442 ? -25.866  13.446  -49.944  1.00 136.09 ? 411 ARG B CB  1 
ATOM 6404  C CG  . ARG B 1 442 ? -26.199  12.092  -50.516  1.00 133.36 ? 411 ARG B CG  1 
ATOM 6405  C CD  . ARG B 1 442 ? -27.660  11.800  -50.506  1.00 128.77 ? 411 ARG B CD  1 
ATOM 6406  N NE  . ARG B 1 442 ? -27.863  10.372  -50.686  1.00 128.34 ? 411 ARG B NE  1 
ATOM 6407  C CZ  . ARG B 1 442 ? -29.034  9.764   -50.564  1.00 127.63 ? 411 ARG B CZ  1 
ATOM 6408  N NH1 . ARG B 1 442 ? -30.114  10.475  -50.278  1.00 127.37 ? 411 ARG B NH1 1 
ATOM 6409  N NH2 . ARG B 1 442 ? -29.130  8.450   -50.730  1.00 127.73 ? 411 ARG B NH2 1 
ATOM 6410  N N   . GLU B 1 443 ? -25.128  11.959  -46.699  1.00 145.98 ? 412 GLU B N   1 
ATOM 6411  C CA  . GLU B 1 443 ? -24.119  11.261  -45.915  1.00 150.60 ? 412 GLU B CA  1 
ATOM 6412  C C   . GLU B 1 443 ? -23.721  9.894   -46.448  1.00 150.10 ? 412 GLU B C   1 
ATOM 6413  O O   . GLU B 1 443 ? -22.613  9.443   -46.212  1.00 153.66 ? 412 GLU B O   1 
ATOM 6414  C CB  . GLU B 1 443 ? -24.536  11.189  -44.450  1.00 154.67 ? 412 GLU B CB  1 
ATOM 6415  C CG  . GLU B 1 443 ? -24.631  12.556  -43.773  1.00 157.77 ? 412 GLU B CG  1 
ATOM 6416  C CD  . GLU B 1 443 ? -25.715  12.596  -42.715  1.00 161.22 ? 412 GLU B CD  1 
ATOM 6417  O OE1 . GLU B 1 443 ? -26.716  13.324  -42.927  1.00 159.74 ? 412 GLU B OE1 1 
ATOM 6418  O OE2 . GLU B 1 443 ? -25.575  11.879  -41.693  1.00 166.16 ? 412 GLU B OE2 1 
ATOM 6419  N N   . PHE B 1 444 ? -24.610  9.247   -47.181  1.00 146.18 ? 413 PHE B N   1 
ATOM 6420  C CA  . PHE B 1 444 ? -24.327  7.928   -47.709  1.00 146.12 ? 413 PHE B CA  1 
ATOM 6421  C C   . PHE B 1 444 ? -24.294  8.019   -49.216  1.00 142.62 ? 413 PHE B C   1 
ATOM 6422  O O   . PHE B 1 444 ? -25.139  8.671   -49.809  1.00 139.23 ? 413 PHE B O   1 
ATOM 6423  C CB  . PHE B 1 444 ? -25.385  6.953   -47.221  1.00 145.97 ? 413 PHE B CB  1 
ATOM 6424  C CG  . PHE B 1 444 ? -25.625  7.045   -45.752  1.00 148.65 ? 413 PHE B CG  1 
ATOM 6425  C CD1 . PHE B 1 444 ? -25.165  6.067   -44.902  1.00 152.85 ? 413 PHE B CD1 1 
ATOM 6426  C CD2 . PHE B 1 444 ? -26.279  8.141   -45.211  1.00 147.55 ? 413 PHE B CD2 1 
ATOM 6427  C CE1 . PHE B 1 444 ? -25.369  6.167   -43.531  1.00 157.11 ? 413 PHE B CE1 1 
ATOM 6428  C CE2 . PHE B 1 444 ? -26.484  8.251   -43.847  1.00 151.54 ? 413 PHE B CE2 1 
ATOM 6429  C CZ  . PHE B 1 444 ? -26.029  7.262   -43.003  1.00 156.24 ? 413 PHE B CZ  1 
ATOM 6430  N N   . PRO B 1 445 ? -23.316  7.363   -49.851  1.00 144.13 ? 414 PRO B N   1 
ATOM 6431  C CA  . PRO B 1 445 ? -23.062  7.581   -51.285  1.00 141.56 ? 414 PRO B CA  1 
ATOM 6432  C C   . PRO B 1 445 ? -24.256  7.240   -52.190  1.00 137.68 ? 414 PRO B C   1 
ATOM 6433  O O   . PRO B 1 445 ? -24.395  7.826   -53.261  1.00 135.04 ? 414 PRO B O   1 
ATOM 6434  C CB  . PRO B 1 445 ? -21.900  6.631   -51.575  1.00 144.64 ? 414 PRO B CB  1 
ATOM 6435  C CG  . PRO B 1 445 ? -22.075  5.506   -50.560  1.00 147.58 ? 414 PRO B CG  1 
ATOM 6436  C CD  . PRO B 1 445 ? -22.592  6.188   -49.324  1.00 148.27 ? 414 PRO B CD  1 
ATOM 6437  N N   . THR B 1 446 ? -25.076  6.284   -51.745  1.00 137.85 ? 415 THR B N   1 
ATOM 6438  C CA  . THR B 1 446 ? -26.336  5.832   -52.372  1.00 134.73 ? 415 THR B CA  1 
ATOM 6439  C C   . THR B 1 446 ? -27.030  6.812   -53.342  1.00 130.26 ? 415 THR B C   1 
ATOM 6440  O O   . THR B 1 446 ? -27.288  7.972   -53.001  1.00 129.35 ? 415 THR B O   1 
ATOM 6441  C CB  . THR B 1 446 ? -27.353  5.438   -51.231  1.00 136.08 ? 415 THR B CB  1 
ATOM 6442  O OG1 . THR B 1 446 ? -26.701  4.587   -50.268  1.00 140.72 ? 415 THR B OG1 1 
ATOM 6443  C CG2 . THR B 1 446 ? -28.659  4.773   -51.773  1.00 133.81 ? 415 THR B CG2 1 
ATOM 6444  N N   . VAL B 1 447 ? -27.341  6.350   -54.548  1.00 127.65 ? 416 VAL B N   1 
ATOM 6445  C CA  . VAL B 1 447 ? -28.309  7.087   -55.356  1.00 123.69 ? 416 VAL B CA  1 
ATOM 6446  C C   . VAL B 1 447 ? -29.715  6.574   -55.023  1.00 122.37 ? 416 VAL B C   1 
ATOM 6447  O O   . VAL B 1 447 ? -29.990  5.366   -55.095  1.00 123.45 ? 416 VAL B O   1 
ATOM 6448  C CB  . VAL B 1 447 ? -28.011  7.083   -56.889  1.00 122.45 ? 416 VAL B CB  1 
ATOM 6449  C CG1 . VAL B 1 447 ? -28.514  5.800   -57.588  1.00 122.37 ? 416 VAL B CG1 1 
ATOM 6450  C CG2 . VAL B 1 447 ? -28.611  8.323   -57.545  1.00 119.50 ? 416 VAL B CG2 1 
ATOM 6451  N N   . PRO B 1 448 ? -30.599  7.493   -54.618  1.00 120.26 ? 417 PRO B N   1 
ATOM 6452  C CA  . PRO B 1 448 ? -31.985  7.174   -54.296  1.00 119.03 ? 417 PRO B CA  1 
ATOM 6453  C C   . PRO B 1 448 ? -32.733  6.641   -55.509  1.00 116.87 ? 417 PRO B C   1 
ATOM 6454  O O   . PRO B 1 448 ? -32.650  7.213   -56.600  1.00 115.11 ? 417 PRO B O   1 
ATOM 6455  C CB  . PRO B 1 448 ? -32.564  8.521   -53.867  1.00 117.97 ? 417 PRO B CB  1 
ATOM 6456  C CG  . PRO B 1 448 ? -31.624  9.536   -54.404  1.00 117.49 ? 417 PRO B CG  1 
ATOM 6457  C CD  . PRO B 1 448 ? -30.287  8.911   -54.386  1.00 119.68 ? 417 PRO B CD  1 
ATOM 6458  N N   . LEU B 1 449 ? -33.451  5.541   -55.316  1.00 117.29 ? 418 LEU B N   1 
ATOM 6459  C CA  . LEU B 1 449 ? -34.255  4.952   -56.392  1.00 115.68 ? 418 LEU B CA  1 
ATOM 6460  C C   . LEU B 1 449 ? -35.728  5.445   -56.352  1.00 113.33 ? 418 LEU B C   1 
ATOM 6461  O O   . LEU B 1 449 ? -36.420  5.326   -55.325  1.00 114.11 ? 418 LEU B O   1 
ATOM 6462  C CB  . LEU B 1 449 ? -34.115  3.415   -56.391  1.00 118.33 ? 418 LEU B CB  1 
ATOM 6463  C CG  . LEU B 1 449 ? -34.883  2.533   -55.387  1.00 121.62 ? 418 LEU B CG  1 
ATOM 6464  C CD1 . LEU B 1 449 ? -36.047  1.908   -56.132  1.00 122.42 ? 418 LEU B CD1 1 
ATOM 6465  C CD2 . LEU B 1 449 ? -34.031  1.428   -54.706  1.00 125.02 ? 418 LEU B CD2 1 
ATOM 6466  N N   . VAL B 1 450 ? -36.175  6.012   -57.475  1.00 109.96 ? 419 VAL B N   1 
ATOM 6467  C CA  . VAL B 1 450 ? -37.478  6.662   -57.577  1.00 107.24 ? 419 VAL B CA  1 
ATOM 6468  C C   . VAL B 1 450 ? -38.309  6.105   -58.750  1.00 106.57 ? 419 VAL B C   1 
ATOM 6469  O O   . VAL B 1 450 ? -37.995  6.333   -59.920  1.00 105.62 ? 419 VAL B O   1 
ATOM 6470  C CB  . VAL B 1 450 ? -37.302  8.191   -57.670  1.00 105.37 ? 419 VAL B CB  1 
ATOM 6471  C CG1 . VAL B 1 450 ? -38.604  8.877   -57.915  1.00 103.98 ? 419 VAL B CG1 1 
ATOM 6472  C CG2 . VAL B 1 450 ? -36.712  8.700   -56.399  1.00 105.42 ? 419 VAL B CG2 1 
ATOM 6473  N N   . LYS B 1 451 ? -39.347  5.337   -58.417  1.00 107.06 ? 420 LYS B N   1 
ATOM 6474  C CA  . LYS B 1 451 ? -40.363  4.918   -59.390  1.00 106.56 ? 420 LYS B CA  1 
ATOM 6475  C C   . LYS B 1 451 ? -41.461  5.954   -59.325  1.00 105.36 ? 420 LYS B C   1 
ATOM 6476  O O   . LYS B 1 451 ? -41.917  6.287   -58.246  1.00 105.57 ? 420 LYS B O   1 
ATOM 6477  C CB  . LYS B 1 451 ? -41.032  3.566   -59.023  1.00 109.03 ? 420 LYS B CB  1 
ATOM 6478  C CG  . LYS B 1 451 ? -40.217  2.223   -59.003  1.00 108.89 ? 420 LYS B CG  1 
ATOM 6479  C CD  . LYS B 1 451 ? -41.202  1.008   -59.147  1.00 105.67 ? 420 LYS B CD  1 
ATOM 6480  C CE  . LYS B 1 451 ? -40.762  -0.251  -58.453  1.00 104.19 ? 420 LYS B CE  1 
ATOM 6481  N NZ  . LYS B 1 451 ? -40.784  -0.030  -56.991  1.00 100.93 ? 420 LYS B NZ  1 
ATOM 6482  N N   . LEU B 1 452 ? -41.914  6.455   -60.459  1.00 104.42 ? 421 LEU B N   1 
ATOM 6483  C CA  . LEU B 1 452 ? -43.131  7.259   -60.443  1.00 104.18 ? 421 LEU B CA  1 
ATOM 6484  C C   . LEU B 1 452 ? -44.220  6.671   -61.345  1.00 105.96 ? 421 LEU B C   1 
ATOM 6485  O O   . LEU B 1 452 ? -43.936  6.094   -62.411  1.00 106.35 ? 421 LEU B O   1 
ATOM 6486  C CB  . LEU B 1 452 ? -42.850  8.735   -60.762  1.00 102.21 ? 421 LEU B CB  1 
ATOM 6487  C CG  . LEU B 1 452 ? -42.463  9.639   -59.592  1.00 100.12 ? 421 LEU B CG  1 
ATOM 6488  C CD1 . LEU B 1 452 ? -42.543  11.103  -59.959  1.00 97.73  ? 421 LEU B CD1 1 
ATOM 6489  C CD2 . LEU B 1 452 ? -43.374  9.385   -58.431  1.00 100.32 ? 421 LEU B CD2 1 
ATOM 6490  N N   . GLY B 1 453 ? -45.466  6.817   -60.900  1.00 107.30 ? 422 GLY B N   1 
ATOM 6491  C CA  . GLY B 1 453 ? -46.622  6.249   -61.599  1.00 109.53 ? 422 GLY B CA  1 
ATOM 6492  C C   . GLY B 1 453 ? -46.895  6.786   -62.997  1.00 109.49 ? 422 GLY B C   1 
ATOM 6493  O O   . GLY B 1 453 ? -46.336  7.802   -63.419  1.00 108.27 ? 422 GLY B O   1 
ATOM 6494  N N   . SER B 1 454 ? -47.773  6.096   -63.712  1.00 111.33 ? 423 SER B N   1 
ATOM 6495  C CA  . SER B 1 454 ? -48.179  6.508   -65.037  1.00 111.84 ? 423 SER B CA  1 
ATOM 6496  C C   . SER B 1 454 ? -48.858  7.869   -64.999  1.00 111.38 ? 423 SER B C   1 
ATOM 6497  O O   . SER B 1 454 ? -48.973  8.526   -66.022  1.00 112.40 ? 423 SER B O   1 
ATOM 6498  C CB  . SER B 1 454 ? -49.147  5.484   -65.578  1.00 114.96 ? 423 SER B CB  1 
ATOM 6499  O OG  . SER B 1 454 ? -50.076  5.178   -64.555  1.00 116.86 ? 423 SER B OG  1 
ATOM 6500  N N   . SER B 1 455 ? -49.303  8.298   -63.822  1.00 110.51 ? 424 SER B N   1 
ATOM 6501  C CA  . SER B 1 455 ? -49.994  9.586   -63.674  1.00 110.22 ? 424 SER B CA  1 
ATOM 6502  C C   . SER B 1 455 ? -49.034  10.762  -63.551  1.00 107.13 ? 424 SER B C   1 
ATOM 6503  O O   . SER B 1 455 ? -49.447  11.916  -63.454  1.00 107.18 ? 424 SER B O   1 
ATOM 6504  C CB  . SER B 1 455 ? -50.962  9.535   -62.483  1.00 111.95 ? 424 SER B CB  1 
ATOM 6505  O OG  . SER B 1 455 ? -50.531  8.597   -61.504  1.00 112.65 ? 424 SER B OG  1 
ATOM 6506  N N   . PHE B 1 456 ? -47.746  10.443  -63.580  1.00 104.60 ? 425 PHE B N   1 
ATOM 6507  C CA  . PHE B 1 456 ? -46.680  11.407  -63.377  1.00 101.94 ? 425 PHE B CA  1 
ATOM 6508  C C   . PHE B 1 456 ? -45.785  11.557  -64.612  1.00 101.55 ? 425 PHE B C   1 
ATOM 6509  O O   . PHE B 1 456 ? -44.880  12.395  -64.629  1.00 100.37 ? 425 PHE B O   1 
ATOM 6510  C CB  . PHE B 1 456 ? -45.835  10.976  -62.180  1.00 100.11 ? 425 PHE B CB  1 
ATOM 6511  C CG  . PHE B 1 456 ? -46.434  11.317  -60.851  1.00 98.63  ? 425 PHE B CG  1 
ATOM 6512  C CD1 . PHE B 1 456 ? -46.251  12.580  -60.291  1.00 97.18  ? 425 PHE B CD1 1 
ATOM 6513  C CD2 . PHE B 1 456 ? -47.148  10.378  -60.139  1.00 98.31  ? 425 PHE B CD2 1 
ATOM 6514  C CE1 . PHE B 1 456 ? -46.790  12.914  -59.037  1.00 96.81  ? 425 PHE B CE1 1 
ATOM 6515  C CE2 . PHE B 1 456 ? -47.689  10.700  -58.886  1.00 99.22  ? 425 PHE B CE2 1 
ATOM 6516  C CZ  . PHE B 1 456 ? -47.503  11.977  -58.335  1.00 97.81  ? 425 PHE B CZ  1 
ATOM 6517  N N   . THR B 1 457 ? -46.057  10.753  -65.636  1.00 102.98 ? 426 THR B N   1 
ATOM 6518  C CA  . THR B 1 457 ? -45.269  10.700  -66.876  1.00 103.50 ? 426 THR B CA  1 
ATOM 6519  C C   . THR B 1 457 ? -45.180  12.005  -67.725  1.00 105.12 ? 426 THR B C   1 
ATOM 6520  O O   . THR B 1 457 ? -44.079  12.483  -67.989  1.00 104.18 ? 426 THR B O   1 
ATOM 6521  C CB  . THR B 1 457 ? -45.742  9.532   -67.724  1.00 104.96 ? 426 THR B CB  1 
ATOM 6522  O OG1 . THR B 1 457 ? -45.927  8.404   -66.873  1.00 103.88 ? 426 THR B OG1 1 
ATOM 6523  C CG2 . THR B 1 457 ? -44.736  9.185   -68.765  1.00 104.78 ? 426 THR B CG2 1 
ATOM 6524  N N   . LYS B 1 458 ? -46.303  12.573  -68.164  1.00 108.28 ? 427 LYS B N   1 
ATOM 6525  C CA  . LYS B 1 458 ? -46.259  13.874  -68.861  1.00 110.73 ? 427 LYS B CA  1 
ATOM 6526  C C   . LYS B 1 458 ? -45.645  14.965  -67.983  1.00 109.63 ? 427 LYS B C   1 
ATOM 6527  O O   . LYS B 1 458 ? -46.179  15.287  -66.922  1.00 109.47 ? 427 LYS B O   1 
ATOM 6528  C CB  . LYS B 1 458 ? -47.651  14.331  -69.315  1.00 113.86 ? 427 LYS B CB  1 
ATOM 6529  C CG  . LYS B 1 458 ? -47.931  14.220  -70.801  1.00 118.09 ? 427 LYS B CG  1 
ATOM 6530  C CD  . LYS B 1 458 ? -49.391  14.528  -71.077  1.00 124.15 ? 427 LYS B CD  1 
ATOM 6531  C CE  . LYS B 1 458 ? -50.087  13.307  -71.696  1.00 129.22 ? 427 LYS B CE  1 
ATOM 6532  N NZ  . LYS B 1 458 ? -50.822  13.629  -72.982  1.00 136.09 ? 427 LYS B NZ  1 
ATOM 6533  N N   . VAL B 1 459 ? -44.536  15.542  -68.440  1.00 109.89 ? 428 VAL B N   1 
ATOM 6534  C CA  . VAL B 1 459 ? -43.800  16.554  -67.674  1.00 109.18 ? 428 VAL B CA  1 
ATOM 6535  C C   . VAL B 1 459 ? -44.718  17.631  -67.133  1.00 111.05 ? 428 VAL B C   1 
ATOM 6536  O O   . VAL B 1 459 ? -44.607  18.012  -65.971  1.00 110.13 ? 428 VAL B O   1 
ATOM 6537  C CB  . VAL B 1 459 ? -42.702  17.241  -68.501  1.00 109.38 ? 428 VAL B CB  1 
ATOM 6538  C CG1 . VAL B 1 459 ? -41.698  17.889  -67.576  1.00 106.98 ? 428 VAL B CG1 1 
ATOM 6539  C CG2 . VAL B 1 459 ? -42.012  16.243  -69.427  1.00 109.62 ? 428 VAL B CG2 1 
ATOM 6540  N N   . GLN B 1 460 ? -45.626  18.112  -67.975  1.00 114.50 ? 429 GLN B N   1 
ATOM 6541  C CA  . GLN B 1 460 ? -46.512  19.192  -67.584  1.00 117.37 ? 429 GLN B CA  1 
ATOM 6542  C C   . GLN B 1 460 ? -47.454  18.755  -66.468  1.00 117.03 ? 429 GLN B C   1 
ATOM 6543  O O   . GLN B 1 460 ? -47.888  19.586  -65.664  1.00 117.60 ? 429 GLN B O   1 
ATOM 6544  C CB  . GLN B 1 460 ? -47.277  19.729  -68.786  1.00 120.98 ? 429 GLN B CB  1 
ATOM 6545  C CG  . GLN B 1 460 ? -47.952  18.661  -69.625  1.00 125.34 ? 429 GLN B CG  1 
ATOM 6546  C CD  . GLN B 1 460 ? -49.409  19.005  -69.927  1.00 132.76 ? 429 GLN B CD  1 
ATOM 6547  O OE1 . GLN B 1 460 ? -50.018  19.845  -69.238  1.00 134.60 ? 429 GLN B OE1 1 
ATOM 6548  N NE2 . GLN B 1 460 ? -49.981  18.353  -70.956  1.00 136.32 ? 429 GLN B NE2 1 
ATOM 6549  N N   . ASP B 1 461 ? -47.744  17.451  -66.427  1.00 116.85 ? 430 ASP B N   1 
ATOM 6550  C CA  . ASP B 1 461 ? -48.490  16.824  -65.323  1.00 117.31 ? 430 ASP B CA  1 
ATOM 6551  C C   . ASP B 1 461 ? -47.631  16.770  -64.079  1.00 114.95 ? 430 ASP B C   1 
ATOM 6552  O O   . ASP B 1 461 ? -48.071  17.202  -63.005  1.00 115.87 ? 430 ASP B O   1 
ATOM 6553  C CB  . ASP B 1 461 ? -48.956  15.397  -65.663  1.00 118.04 ? 430 ASP B CB  1 
ATOM 6554  C CG  . ASP B 1 461 ? -50.411  15.339  -66.169  1.00 123.16 ? 430 ASP B CG  1 
ATOM 6555  O OD1 . ASP B 1 461 ? -51.232  16.232  -65.828  1.00 125.71 ? 430 ASP B OD1 1 
ATOM 6556  O OD2 . ASP B 1 461 ? -50.734  14.377  -66.912  1.00 127.01 ? 430 ASP B OD2 1 
ATOM 6557  N N   . TYR B 1 462 ? -46.414  16.238  -64.242  1.00 112.55 ? 431 TYR B N   1 
ATOM 6558  C CA  . TYR B 1 462 ? -45.400  16.149  -63.189  1.00 109.85 ? 431 TYR B CA  1 
ATOM 6559  C C   . TYR B 1 462 ? -45.151  17.473  -62.471  1.00 109.64 ? 431 TYR B C   1 
ATOM 6560  O O   . TYR B 1 462 ? -45.105  17.516  -61.255  1.00 109.05 ? 431 TYR B O   1 
ATOM 6561  C CB  . TYR B 1 462 ? -44.096  15.599  -63.764  1.00 108.53 ? 431 TYR B CB  1 
ATOM 6562  C CG  . TYR B 1 462 ? -42.897  15.986  -62.948  1.00 107.97 ? 431 TYR B CG  1 
ATOM 6563  C CD1 . TYR B 1 462 ? -42.531  15.249  -61.831  1.00 108.08 ? 431 TYR B CD1 1 
ATOM 6564  C CD2 . TYR B 1 462 ? -42.135  17.109  -63.270  1.00 108.65 ? 431 TYR B CD2 1 
ATOM 6565  C CE1 . TYR B 1 462 ? -41.433  15.617  -61.057  1.00 106.73 ? 431 TYR B CE1 1 
ATOM 6566  C CE2 . TYR B 1 462 ? -41.034  17.480  -62.499  1.00 107.06 ? 431 TYR B CE2 1 
ATOM 6567  C CZ  . TYR B 1 462 ? -40.700  16.728  -61.398  1.00 105.90 ? 431 TYR B CZ  1 
ATOM 6568  O OH  . TYR B 1 462 ? -39.638  17.074  -60.619  1.00 105.90 ? 431 TYR B OH  1 
ATOM 6569  N N   . LEU B 1 463 ? -44.993  18.554  -63.221  1.00 110.57 ? 432 LEU B N   1 
ATOM 6570  C CA  . LEU B 1 463 ? -44.859  19.878  -62.621  1.00 111.67 ? 432 LEU B CA  1 
ATOM 6571  C C   . LEU B 1 463 ? -46.070  20.248  -61.768  1.00 113.26 ? 432 LEU B C   1 
ATOM 6572  O O   . LEU B 1 463 ? -45.905  20.653  -60.621  1.00 113.63 ? 432 LEU B O   1 
ATOM 6573  C CB  . LEU B 1 463 ? -44.628  20.947  -63.692  1.00 113.28 ? 432 LEU B CB  1 
ATOM 6574  C CG  . LEU B 1 463 ? -43.374  20.813  -64.569  1.00 112.31 ? 432 LEU B CG  1 
ATOM 6575  C CD1 . LEU B 1 463 ? -43.448  21.766  -65.767  1.00 114.61 ? 432 LEU B CD1 1 
ATOM 6576  C CD2 . LEU B 1 463 ? -42.094  21.030  -63.765  1.00 110.26 ? 432 LEU B CD2 1 
ATOM 6577  N N   . ARG B 1 464 ? -47.272  20.085  -62.330  1.00 114.73 ? 433 ARG B N   1 
ATOM 6578  C CA  . ARG B 1 464 ? -48.542  20.448  -61.681  1.00 116.76 ? 433 ARG B CA  1 
ATOM 6579  C C   . ARG B 1 464 ? -48.825  19.741  -60.358  1.00 116.10 ? 433 ARG B C   1 
ATOM 6580  O O   . ARG B 1 464 ? -49.346  20.361  -59.428  1.00 117.40 ? 433 ARG B O   1 
ATOM 6581  C CB  . ARG B 1 464 ? -49.696  20.187  -62.638  1.00 118.75 ? 433 ARG B CB  1 
ATOM 6582  C CG  . ARG B 1 464 ? -51.029  20.739  -62.174  1.00 122.40 ? 433 ARG B CG  1 
ATOM 6583  C CD  . ARG B 1 464 ? -52.138  20.436  -63.179  1.00 125.73 ? 433 ARG B CD  1 
ATOM 6584  N NE  . ARG B 1 464 ? -52.177  19.024  -63.573  1.00 125.86 ? 433 ARG B NE  1 
ATOM 6585  C CZ  . ARG B 1 464 ? -52.659  18.024  -62.825  1.00 126.80 ? 433 ARG B CZ  1 
ATOM 6586  N NH1 . ARG B 1 464 ? -53.153  18.245  -61.605  1.00 127.74 ? 433 ARG B NH1 1 
ATOM 6587  N NH2 . ARG B 1 464 ? -52.650  16.780  -63.300  1.00 126.28 ? 433 ARG B NH2 1 
ATOM 6588  N N   . ARG B 1 465 ? -48.487  18.450  -60.300  1.00 114.47 ? 434 ARG B N   1 
ATOM 6589  C CA  . ARG B 1 465 ? -48.645  17.601  -59.105  1.00 114.42 ? 434 ARG B CA  1 
ATOM 6590  C C   . ARG B 1 465 ? -47.689  17.887  -57.925  1.00 114.26 ? 434 ARG B C   1 
ATOM 6591  O O   . ARG B 1 465 ? -48.052  17.617  -56.771  1.00 115.67 ? 434 ARG B O   1 
ATOM 6592  C CB  . ARG B 1 465 ? -48.510  16.121  -59.458  1.00 112.91 ? 434 ARG B CB  1 
ATOM 6593  C CG  . ARG B 1 465 ? -49.488  15.585  -60.443  1.00 113.91 ? 434 ARG B CG  1 
ATOM 6594  C CD  . ARG B 1 465 ? -49.950  14.242  -59.946  1.00 115.85 ? 434 ARG B CD  1 
ATOM 6595  N NE  . ARG B 1 465 ? -50.517  13.372  -60.975  1.00 119.22 ? 434 ARG B NE  1 
ATOM 6596  C CZ  . ARG B 1 465 ? -51.783  13.401  -61.409  1.00 124.03 ? 434 ARG B CZ  1 
ATOM 6597  N NH1 . ARG B 1 465 ? -52.672  14.287  -60.942  1.00 126.83 ? 434 ARG B NH1 1 
ATOM 6598  N NH2 . ARG B 1 465 ? -52.165  12.542  -62.347  1.00 125.75 ? 434 ARG B NH2 1 
ATOM 6599  N N   . PHE B 1 466 ? -46.474  18.385  -58.198  1.00 113.17 ? 435 PHE B N   1 
ATOM 6600  C CA  . PHE B 1 466 ? -45.536  18.780  -57.135  1.00 113.13 ? 435 PHE B CA  1 
ATOM 6601  C C   . PHE B 1 466 ? -45.519  20.278  -56.960  1.00 115.66 ? 435 PHE B C   1 
ATOM 6602  O O   . PHE B 1 466 ? -44.818  20.984  -57.697  1.00 115.64 ? 435 PHE B O   1 
ATOM 6603  C CB  . PHE B 1 466 ? -44.135  18.371  -57.484  1.00 110.52 ? 435 PHE B CB  1 
ATOM 6604  C CG  . PHE B 1 466 ? -43.888  16.930  -57.370  1.00 108.63 ? 435 PHE B CG  1 
ATOM 6605  C CD1 . PHE B 1 466 ? -43.686  16.352  -56.134  1.00 109.22 ? 435 PHE B CD1 1 
ATOM 6606  C CD2 . PHE B 1 466 ? -43.814  16.135  -58.507  1.00 107.27 ? 435 PHE B CD2 1 
ATOM 6607  C CE1 . PHE B 1 466 ? -43.424  14.985  -56.033  1.00 108.86 ? 435 PHE B CE1 1 
ATOM 6608  C CE2 . PHE B 1 466 ? -43.554  14.760  -58.424  1.00 106.05 ? 435 PHE B CE2 1 
ATOM 6609  C CZ  . PHE B 1 466 ? -43.362  14.186  -57.189  1.00 107.32 ? 435 PHE B CZ  1 
ATOM 6610  N N   . GLU B 1 467 ? -46.263  20.766  -55.971  1.00 118.78 ? 436 GLU B N   1 
ATOM 6611  C CA  . GLU B 1 467 ? -46.489  22.216  -55.806  1.00 122.01 ? 436 GLU B CA  1 
ATOM 6612  C C   . GLU B 1 467 ? -45.239  22.963  -55.311  1.00 122.04 ? 436 GLU B C   1 
ATOM 6613  O O   . GLU B 1 467 ? -45.278  24.169  -55.018  1.00 124.22 ? 436 GLU B O   1 
ATOM 6614  C CB  . GLU B 1 467 ? -47.695  22.470  -54.887  1.00 125.25 ? 436 GLU B CB  1 
ATOM 6615  C CG  . GLU B 1 467 ? -49.029  21.864  -55.388  1.00 127.64 ? 436 GLU B CG  1 
ATOM 6616  C CD  . GLU B 1 467 ? -50.202  22.115  -54.436  1.00 133.06 ? 436 GLU B CD  1 
ATOM 6617  O OE1 . GLU B 1 467 ? -50.004  22.732  -53.353  1.00 135.19 ? 436 GLU B OE1 1 
ATOM 6618  O OE2 . GLU B 1 467 ? -51.327  21.689  -54.785  1.00 135.19 ? 436 GLU B OE2 1 
ATOM 6619  N N   . SER B 1 468 ? -44.145  22.204  -55.255  1.00 119.90 ? 437 SER B N   1 
ATOM 6620  C CA  . SER B 1 468 ? -42.820  22.594  -54.795  1.00 119.65 ? 437 SER B CA  1 
ATOM 6621  C C   . SER B 1 468 ? -42.110  21.264  -54.783  1.00 117.16 ? 437 SER B C   1 
ATOM 6622  O O   . SER B 1 468 ? -42.633  20.296  -54.254  1.00 117.07 ? 437 SER B O   1 
ATOM 6623  C CB  . SER B 1 468 ? -42.859  23.155  -53.369  1.00 122.27 ? 437 SER B CB  1 
ATOM 6624  O OG  . SER B 1 468 ? -41.626  22.949  -52.700  1.00 122.36 ? 437 SER B OG  1 
ATOM 6625  N N   . ILE B 1 469 ? -40.936  21.186  -55.377  1.00 115.61 ? 438 ILE B N   1 
ATOM 6626  C CA  . ILE B 1 469 ? -40.223  19.922  -55.390  1.00 113.90 ? 438 ILE B CA  1 
ATOM 6627  C C   . ILE B 1 469 ? -39.950  19.587  -53.932  1.00 115.08 ? 438 ILE B C   1 
ATOM 6628  O O   . ILE B 1 469 ? -39.666  20.489  -53.156  1.00 117.25 ? 438 ILE B O   1 
ATOM 6629  C CB  . ILE B 1 469 ? -38.925  20.024  -56.183  1.00 113.11 ? 438 ILE B CB  1 
ATOM 6630  C CG1 . ILE B 1 469 ? -39.166  20.732  -57.531  1.00 113.73 ? 438 ILE B CG1 1 
ATOM 6631  C CG2 . ILE B 1 469 ? -38.343  18.650  -56.408  1.00 111.17 ? 438 ILE B CG2 1 
ATOM 6632  C CD1 . ILE B 1 469 ? -39.313  22.295  -57.459  1.00 117.76 ? 438 ILE B CD1 1 
ATOM 6633  N N   . PRO B 1 470 ? -40.069  18.307  -53.537  1.00 114.35 ? 439 PRO B N   1 
ATOM 6634  C CA  . PRO B 1 470 ? -39.986  18.060  -52.104  1.00 116.01 ? 439 PRO B CA  1 
ATOM 6635  C C   . PRO B 1 470 ? -38.537  17.883  -51.617  1.00 116.40 ? 439 PRO B C   1 
ATOM 6636  O O   . PRO B 1 470 ? -37.628  17.726  -52.425  1.00 115.14 ? 439 PRO B O   1 
ATOM 6637  C CB  . PRO B 1 470 ? -40.794  16.776  -51.943  1.00 115.52 ? 439 PRO B CB  1 
ATOM 6638  C CG  . PRO B 1 470 ? -40.572  16.049  -53.222  1.00 113.51 ? 439 PRO B CG  1 
ATOM 6639  C CD  . PRO B 1 470 ? -40.206  17.049  -54.291  1.00 112.50 ? 439 PRO B CD  1 
ATOM 6640  N N   . ASP B 1 471 ? -38.335  17.945  -50.304  1.00 118.70 ? 440 ASP B N   1 
ATOM 6641  C CA  . ASP B 1 471 ? -37.039  17.674  -49.685  1.00 119.75 ? 440 ASP B CA  1 
ATOM 6642  C C   . ASP B 1 471 ? -36.657  16.209  -49.859  1.00 118.41 ? 440 ASP B C   1 
ATOM 6643  O O   . ASP B 1 471 ? -37.527  15.344  -49.829  1.00 118.11 ? 440 ASP B O   1 
ATOM 6644  C CB  . ASP B 1 471 ? -37.102  17.995  -48.193  1.00 123.40 ? 440 ASP B CB  1 
ATOM 6645  C CG  . ASP B 1 471 ? -35.834  17.612  -47.461  1.00 125.92 ? 440 ASP B CG  1 
ATOM 6646  O OD1 . ASP B 1 471 ? -34.751  17.686  -48.077  1.00 125.96 ? 440 ASP B OD1 1 
ATOM 6647  O OD2 . ASP B 1 471 ? -35.907  17.238  -46.275  1.00 129.65 ? 440 ASP B OD2 1 
ATOM 6648  N N   . MET B 1 472 ? -35.362  15.927  -50.026  1.00 117.90 ? 441 MET B N   1 
ATOM 6649  C CA  . MET B 1 472 ? -34.909  14.545  -50.239  1.00 116.76 ? 441 MET B CA  1 
ATOM 6650  C C   . MET B 1 472 ? -33.760  14.132  -49.314  1.00 118.84 ? 441 MET B C   1 
ATOM 6651  O O   . MET B 1 472 ? -34.007  13.716  -48.187  1.00 121.64 ? 441 MET B O   1 
ATOM 6652  C CB  . MET B 1 472 ? -34.569  14.337  -51.702  1.00 114.23 ? 441 MET B CB  1 
ATOM 6653  C CG  . MET B 1 472 ? -35.574  15.001  -52.655  1.00 112.75 ? 441 MET B CG  1 
ATOM 6654  S SD  . MET B 1 472 ? -37.072  14.047  -53.030  1.00 112.85 ? 441 MET B SD  1 
ATOM 6655  C CE  . MET B 1 472 ? -36.532  13.206  -54.522  1.00 108.99 ? 441 MET B CE  1 
ATOM 6656  N N   . LEU B 1 473 ? -32.522  14.238  -49.781  1.00 117.94 ? 442 LEU B N   1 
ATOM 6657  C CA  . LEU B 1 473 ? -31.335  14.091  -48.929  1.00 120.29 ? 442 LEU B CA  1 
ATOM 6658  C C   . LEU B 1 473 ? -31.244  12.826  -48.105  1.00 122.62 ? 442 LEU B C   1 
ATOM 6659  O O   . LEU B 1 473 ? -30.217  12.157  -48.114  1.00 124.07 ? 442 LEU B O   1 
ATOM 6660  C CB  . LEU B 1 473 ? -31.213  15.257  -47.969  1.00 122.28 ? 442 LEU B CB  1 
ATOM 6661  C CG  . LEU B 1 473 ? -30.893  16.616  -48.531  1.00 120.62 ? 442 LEU B CG  1 
ATOM 6662  C CD1 . LEU B 1 473 ? -30.532  17.488  -47.363  1.00 123.97 ? 442 LEU B CD1 1 
ATOM 6663  C CD2 . LEU B 1 473 ? -29.748  16.521  -49.498  1.00 118.96 ? 442 LEU B CD2 1 
ATOM 6664  N N   . GLU B 1 474 ? -32.291  12.537  -47.342  1.00 123.73 ? 443 GLU B N   1 
ATOM 6665  C CA  . GLU B 1 474 ? -32.352  11.327  -46.540  1.00 126.62 ? 443 GLU B CA  1 
ATOM 6666  C C   . GLU B 1 474 ? -33.114  10.219  -47.282  1.00 124.48 ? 443 GLU B C   1 
ATOM 6667  O O   . GLU B 1 474 ? -33.499  9.206   -46.693  1.00 126.25 ? 443 GLU B O   1 
ATOM 6668  C CB  . GLU B 1 474 ? -33.015  11.620  -45.192  1.00 130.07 ? 443 GLU B CB  1 
ATOM 6669  C CG  . GLU B 1 474 ? -32.085  12.024  -44.029  1.00 136.13 ? 443 GLU B CG  1 
ATOM 6670  C CD  . GLU B 1 474 ? -32.772  11.938  -42.638  1.00 142.36 ? 443 GLU B CD  1 
ATOM 6671  O OE1 . GLU B 1 474 ? -32.934  10.802  -42.110  1.00 145.11 ? 443 GLU B OE1 1 
ATOM 6672  O OE2 . GLU B 1 474 ? -33.140  13.006  -42.071  1.00 144.03 ? 443 GLU B OE2 1 
ATOM 6673  N N   . LEU B 1 475 ? -33.310  10.401  -48.584  1.00 121.27 ? 444 LEU B N   1 
ATOM 6674  C CA  . LEU B 1 475 ? -34.166  9.498   -49.347  1.00 119.56 ? 444 LEU B CA  1 
ATOM 6675  C C   . LEU B 1 475 ? -33.521  8.202   -49.795  1.00 119.93 ? 444 LEU B C   1 
ATOM 6676  O O   . LEU B 1 475 ? -32.449  8.184   -50.381  1.00 119.55 ? 444 LEU B O   1 
ATOM 6677  C CB  . LEU B 1 475 ? -34.763  10.202  -50.558  1.00 116.36 ? 444 LEU B CB  1 
ATOM 6678  C CG  . LEU B 1 475 ? -36.049  9.493   -50.969  1.00 114.95 ? 444 LEU B CG  1 
ATOM 6679  C CD1 . LEU B 1 475 ? -37.142  9.928   -50.009  1.00 115.55 ? 444 LEU B CD1 1 
ATOM 6680  C CD2 . LEU B 1 475 ? -36.383  9.813   -52.412  1.00 111.46 ? 444 LEU B CD2 1 
ATOM 6681  N N   . ASP B 1 476 ? -34.225  7.117   -49.564  1.00 121.17 ? 445 ASP B N   1 
ATOM 6682  C CA  . ASP B 1 476 ? -33.678  5.826   -49.855  1.00 123.04 ? 445 ASP B CA  1 
ATOM 6683  C C   . ASP B 1 476 ? -34.395  5.173   -51.053  1.00 120.16 ? 445 ASP B C   1 
ATOM 6684  O O   . ASP B 1 476 ? -33.745  4.730   -52.025  1.00 119.01 ? 445 ASP B O   1 
ATOM 6685  C CB  . ASP B 1 476 ? -33.777  4.987   -48.581  1.00 127.95 ? 445 ASP B CB  1 
ATOM 6686  C CG  . ASP B 1 476 ? -32.579  4.063   -48.389  1.00 134.29 ? 445 ASP B CG  1 
ATOM 6687  O OD1 . ASP B 1 476 ? -32.816  2.828   -48.365  1.00 141.16 ? 445 ASP B OD1 1 
ATOM 6688  O OD2 . ASP B 1 476 ? -31.414  4.552   -48.269  1.00 137.69 ? 445 ASP B OD2 1 
ATOM 6689  N N   . HIS B 1 477 ? -35.733  5.148   -50.956  1.00 118.98 ? 446 HIS B N   1 
ATOM 6690  C CA  . HIS B 1 477 ? -36.665  4.614   -51.958  1.00 116.30 ? 446 HIS B CA  1 
ATOM 6691  C C   . HIS B 1 477 ? -37.870  5.513   -51.927  1.00 113.90 ? 446 HIS B C   1 
ATOM 6692  O O   . HIS B 1 477 ? -38.280  5.944   -50.864  1.00 114.78 ? 446 HIS B O   1 
ATOM 6693  C CB  . HIS B 1 477 ? -37.123  3.226   -51.541  1.00 119.39 ? 446 HIS B CB  1 
ATOM 6694  C CG  . HIS B 1 477 ? -37.850  2.465   -52.604  1.00 119.19 ? 446 HIS B CG  1 
ATOM 6695  N ND1 . HIS B 1 477 ? -37.498  1.181   -52.965  1.00 121.53 ? 446 HIS B ND1 1 
ATOM 6696  C CD2 . HIS B 1 477 ? -38.925  2.787   -53.361  1.00 118.34 ? 446 HIS B CD2 1 
ATOM 6697  C CE1 . HIS B 1 477 ? -38.320  0.747   -53.902  1.00 121.08 ? 446 HIS B CE1 1 
ATOM 6698  N NE2 . HIS B 1 477 ? -39.191  1.706   -54.166  1.00 119.62 ? 446 HIS B NE2 1 
ATOM 6699  N N   . LEU B 1 478 ? -38.415  5.812   -53.100  1.00 110.83 ? 447 LEU B N   1 
ATOM 6700  C CA  . LEU B 1 478 ? -39.676  6.557   -53.237  1.00 108.87 ? 447 LEU B CA  1 
ATOM 6701  C C   . LEU B 1 478 ? -40.478  5.985   -54.375  1.00 108.32 ? 447 LEU B C   1 
ATOM 6702  O O   . LEU B 1 478 ? -40.063  6.034   -55.539  1.00 106.84 ? 447 LEU B O   1 
ATOM 6703  C CB  . LEU B 1 478 ? -39.451  8.031   -53.544  1.00 106.32 ? 447 LEU B CB  1 
ATOM 6704  C CG  . LEU B 1 478 ? -40.730  8.738   -53.957  1.00 102.40 ? 447 LEU B CG  1 
ATOM 6705  C CD1 . LEU B 1 478 ? -41.540  8.881   -52.739  1.00 103.81 ? 447 LEU B CD1 1 
ATOM 6706  C CD2 . LEU B 1 478 ? -40.440  10.078  -54.522  1.00 98.79  ? 447 LEU B CD2 1 
ATOM 6707  N N   . THR B 1 479 ? -41.638  5.447   -54.043  1.00 109.84 ? 448 THR B N   1 
ATOM 6708  C CA  . THR B 1 479 ? -42.471  4.844   -55.063  1.00 109.62 ? 448 THR B CA  1 
ATOM 6709  C C   . THR B 1 479 ? -43.919  5.332   -54.911  1.00 110.12 ? 448 THR B C   1 
ATOM 6710  O O   . THR B 1 479 ? -44.553  5.207   -53.848  1.00 112.09 ? 448 THR B O   1 
ATOM 6711  C CB  . THR B 1 479 ? -42.269  3.309   -55.129  1.00 111.49 ? 448 THR B CB  1 
ATOM 6712  O OG1 . THR B 1 479 ? -43.090  2.743   -56.158  1.00 111.46 ? 448 THR B OG1 1 
ATOM 6713  C CG2 . THR B 1 479 ? -42.567  2.675   -53.780  1.00 114.74 ? 448 THR B CG2 1 
ATOM 6714  N N   . VAL B 1 480 ? -44.386  5.962   -55.983  1.00 108.41 ? 449 VAL B N   1 
ATOM 6715  C CA  . VAL B 1 480 ? -45.685  6.562   -56.029  1.00 108.78 ? 449 VAL B CA  1 
ATOM 6716  C C   . VAL B 1 480 ? -46.338  5.947   -57.244  1.00 109.75 ? 449 VAL B C   1 
ATOM 6717  O O   . VAL B 1 480 ? -45.724  5.856   -58.315  1.00 108.10 ? 449 VAL B O   1 
ATOM 6718  C CB  . VAL B 1 480 ? -45.611  8.111   -56.150  1.00 106.71 ? 449 VAL B CB  1 
ATOM 6719  C CG1 . VAL B 1 480 ? -46.969  8.712   -56.048  1.00 108.03 ? 449 VAL B CG1 1 
ATOM 6720  C CG2 . VAL B 1 480 ? -44.781  8.703   -55.061  1.00 105.56 ? 449 VAL B CG2 1 
ATOM 6721  N N   . SER B 1 481 ? -47.557  5.457   -57.035  1.00 112.94 ? 450 SER B N   1 
ATOM 6722  C CA  . SER B 1 481 ? -48.484  5.129   -58.118  1.00 115.03 ? 450 SER B CA  1 
ATOM 6723  C C   . SER B 1 481 ? -49.898  5.513   -57.660  1.00 117.65 ? 450 SER B C   1 
ATOM 6724  O O   . SER B 1 481 ? -50.208  5.452   -56.442  1.00 119.29 ? 450 SER B O   1 
ATOM 6725  C CB  . SER B 1 481 ? -48.416  3.647   -58.506  1.00 116.68 ? 450 SER B CB  1 
ATOM 6726  O OG  . SER B 1 481 ? -48.720  2.838   -57.384  1.00 119.15 ? 450 SER B OG  1 
ATOM 6727  N N   . GLY B 1 482 ? -50.731  5.906   -58.639  1.00 118.35 ? 451 GLY B N   1 
ATOM 6728  C CA  . GLY B 1 482 ? -52.086  6.424   -58.406  1.00 120.14 ? 451 GLY B CA  1 
ATOM 6729  C C   . GLY B 1 482 ? -52.093  7.938   -58.502  1.00 118.64 ? 451 GLY B C   1 
ATOM 6730  O O   . GLY B 1 482 ? -51.032  8.572   -58.481  1.00 116.05 ? 451 GLY B O   1 
ATOM 6731  N N   . ASP B 1 483 ? -53.289  8.512   -58.619  1.00 110.20 ? 452 ASP B N   1 
ATOM 6732  C CA  . ASP B 1 483 ? -53.506  9.962   -58.592  1.00 110.57 ? 452 ASP B CA  1 
ATOM 6733  C C   . ASP B 1 483 ? -53.027  10.487  -57.240  1.00 107.28 ? 452 ASP B C   1 
ATOM 6734  O O   . ASP B 1 483 ? -53.668  10.227  -56.212  1.00 107.29 ? 452 ASP B O   1 
ATOM 6735  C CB  . ASP B 1 483 ? -55.011  10.239  -58.742  1.00 114.26 ? 452 ASP B CB  1 
ATOM 6736  C CG  . ASP B 1 483 ? -55.323  11.569  -59.428  1.00 118.41 ? 452 ASP B CG  1 
ATOM 6737  O OD1 . ASP B 1 483 ? -54.518  12.525  -59.366  1.00 118.99 ? 452 ASP B OD1 1 
ATOM 6738  O OD2 . ASP B 1 483 ? -56.414  11.661  -60.032  1.00 124.45 ? 452 ASP B OD2 1 
ATOM 6739  N N   . VAL B 1 484 ? -51.899  11.194  -57.216  1.00 104.77 ? 453 VAL B N   1 
ATOM 6740  C CA  . VAL B 1 484 ? -51.360  11.699  -55.952  1.00 101.66 ? 453 VAL B CA  1 
ATOM 6741  C C   . VAL B 1 484 ? -51.062  13.171  -56.077  1.00 102.10 ? 453 VAL B C   1 
ATOM 6742  O O   . VAL B 1 484 ? -50.875  13.653  -57.164  1.00 104.03 ? 453 VAL B O   1 
ATOM 6743  C CB  . VAL B 1 484 ? -50.094  10.957  -55.577  1.00 99.21  ? 453 VAL B CB  1 
ATOM 6744  C CG1 . VAL B 1 484 ? -49.503  11.559  -54.359  1.00 98.00  ? 453 VAL B CG1 1 
ATOM 6745  C CG2 . VAL B 1 484 ? -50.402  9.505   -55.310  1.00 98.67  ? 453 VAL B CG2 1 
ATOM 6746  N N   . THR B 1 485 ? -51.043  13.905  -54.985  1.00 101.18 ? 454 THR B N   1 
ATOM 6747  C CA  . THR B 1 485 ? -50.585  15.264  -55.084  1.00 102.99 ? 454 THR B CA  1 
ATOM 6748  C C   . THR B 1 485 ? -49.723  15.619  -53.888  1.00 101.95 ? 454 THR B C   1 
ATOM 6749  O O   . THR B 1 485 ? -49.986  15.164  -52.777  1.00 101.27 ? 454 THR B O   1 
ATOM 6750  C CB  . THR B 1 485 ? -51.753  16.270  -55.259  1.00 105.94 ? 454 THR B CB  1 
ATOM 6751  O OG1 . THR B 1 485 ? -51.237  17.503  -55.759  1.00 108.93 ? 454 THR B OG1 1 
ATOM 6752  C CG2 . THR B 1 485 ? -52.417  16.587  -53.958  1.00 106.12 ? 454 THR B CG2 1 
ATOM 6753  N N   . PHE B 1 486 ? -48.687  16.422  -54.108  1.00 102.93 ? 455 PHE B N   1 
ATOM 6754  C CA  . PHE B 1 486 ? -47.911  16.955  -52.991  1.00 102.80 ? 455 PHE B CA  1 
ATOM 6755  C C   . PHE B 1 486 ? -48.078  18.468  -52.856  1.00 105.89 ? 455 PHE B C   1 
ATOM 6756  O O   . PHE B 1 486 ? -48.243  19.171  -53.861  1.00 108.05 ? 455 PHE B O   1 
ATOM 6757  C CB  . PHE B 1 486 ? -46.440  16.610  -53.143  1.00 101.81 ? 455 PHE B CB  1 
ATOM 6758  C CG  . PHE B 1 486 ? -46.168  15.153  -53.216  1.00 99.91  ? 455 PHE B CG  1 
ATOM 6759  C CD1 . PHE B 1 486 ? -46.181  14.371  -52.068  1.00 99.01  ? 455 PHE B CD1 1 
ATOM 6760  C CD2 . PHE B 1 486 ? -45.889  14.554  -54.436  1.00 100.57 ? 455 PHE B CD2 1 
ATOM 6761  C CE1 . PHE B 1 486 ? -45.911  12.993  -52.136  1.00 98.33  ? 455 PHE B CE1 1 
ATOM 6762  C CE2 . PHE B 1 486 ? -45.617  13.187  -54.527  1.00 99.67  ? 455 PHE B CE2 1 
ATOM 6763  C CZ  . PHE B 1 486 ? -45.627  12.400  -53.375  1.00 98.45  ? 455 PHE B CZ  1 
ATOM 6764  N N   . GLY B 1 487 ? -48.028  18.954  -51.612  1.00 106.46 ? 456 GLY B N   1 
ATOM 6765  C CA  . GLY B 1 487 ? -48.177  20.382  -51.313  1.00 110.11 ? 456 GLY B CA  1 
ATOM 6766  C C   . GLY B 1 487 ? -46.819  21.029  -51.262  1.00 111.49 ? 456 GLY B C   1 
ATOM 6767  O O   . GLY B 1 487 ? -45.855  20.443  -51.727  1.00 110.15 ? 456 GLY B O   1 
ATOM 6768  N N   . LYS B 1 488 ? -46.726  22.228  -50.699  1.00 115.02 ? 457 LYS B N   1 
ATOM 6769  C CA  . LYS B 1 488 ? -45.410  22.868  -50.520  1.00 117.46 ? 457 LYS B CA  1 
ATOM 6770  C C   . LYS B 1 488 ? -44.597  22.278  -49.346  1.00 116.10 ? 457 LYS B C   1 
ATOM 6771  O O   . LYS B 1 488 ? -45.163  21.880  -48.323  1.00 115.52 ? 457 LYS B O   1 
ATOM 6772  C CB  . LYS B 1 488 ? -45.556  24.380  -50.370  1.00 121.54 ? 457 LYS B CB  1 
ATOM 6773  C CG  . LYS B 1 488 ? -46.192  25.004  -51.568  1.00 125.32 ? 457 LYS B CG  1 
ATOM 6774  C CD  . LYS B 1 488 ? -45.671  26.399  -51.793  1.00 131.99 ? 457 LYS B CD  1 
ATOM 6775  C CE  . LYS B 1 488 ? -46.220  26.995  -53.097  1.00 136.29 ? 457 LYS B CE  1 
ATOM 6776  N NZ  . LYS B 1 488 ? -46.097  28.495  -53.126  1.00 142.44 ? 457 LYS B NZ  1 
ATOM 6777  N N   . ASN B 1 489 ? -43.274  22.212  -49.493  1.00 116.57 ? 458 ASN B N   1 
ATOM 6778  C CA  . ASN B 1 489 ? -42.402  21.827  -48.376  1.00 116.06 ? 458 ASN B CA  1 
ATOM 6779  C C   . ASN B 1 489 ? -42.626  20.412  -47.849  1.00 112.24 ? 458 ASN B C   1 
ATOM 6780  O O   . ASN B 1 489 ? -42.479  20.162  -46.648  1.00 112.28 ? 458 ASN B O   1 
ATOM 6781  C CB  . ASN B 1 489 ? -42.510  22.844  -47.217  1.00 119.07 ? 458 ASN B CB  1 
ATOM 6782  C CG  . ASN B 1 489 ? -41.721  24.130  -47.478  1.00 124.82 ? 458 ASN B CG  1 
ATOM 6783  O OD1 . ASN B 1 489 ? -41.994  24.871  -48.432  1.00 129.12 ? 458 ASN B OD1 1 
ATOM 6784  N ND2 . ASN B 1 489 ? -40.738  24.401  -46.622  1.00 128.04 ? 458 ASN B ND2 1 
ATOM 6785  N N   . VAL B 1 490 ? -42.982  19.486  -48.733  1.00 109.47 ? 459 VAL B N   1 
ATOM 6786  C CA  . VAL B 1 490 ? -43.057  18.093  -48.322  1.00 106.53 ? 459 VAL B CA  1 
ATOM 6787  C C   . VAL B 1 490 ? -41.642  17.640  -48.132  1.00 106.46 ? 459 VAL B C   1 
ATOM 6788  O O   . VAL B 1 490 ? -40.796  17.916  -48.968  1.00 107.92 ? 459 VAL B O   1 
ATOM 6789  C CB  . VAL B 1 490 ? -43.678  17.188  -49.382  1.00 105.00 ? 459 VAL B CB  1 
ATOM 6790  C CG1 . VAL B 1 490 ? -43.705  15.714  -48.899  1.00 101.86 ? 459 VAL B CG1 1 
ATOM 6791  C CG2 . VAL B 1 490 ? -45.075  17.687  -49.737  1.00 106.37 ? 459 VAL B CG2 1 
ATOM 6792  N N   . SER B 1 491 ? -41.384  16.958  -47.026  1.00 105.47 ? 460 SER B N   1 
ATOM 6793  C CA  . SER B 1 491 ? -40.072  16.387  -46.759  1.00 105.48 ? 460 SER B CA  1 
ATOM 6794  C C   . SER B 1 491 ? -40.133  14.863  -46.766  1.00 103.06 ? 460 SER B C   1 
ATOM 6795  O O   . SER B 1 491 ? -40.834  14.241  -45.979  1.00 102.07 ? 460 SER B O   1 
ATOM 6796  C CB  . SER B 1 491 ? -39.541  16.903  -45.427  1.00 107.72 ? 460 SER B CB  1 
ATOM 6797  O OG  . SER B 1 491 ? -38.218  16.462  -45.222  1.00 109.95 ? 460 SER B OG  1 
ATOM 6798  N N   . LEU B 1 492 ? -39.401  14.255  -47.674  1.00 102.63 ? 461 LEU B N   1 
ATOM 6799  C CA  . LEU B 1 492 ? -39.378  12.800  -47.739  1.00 101.24 ? 461 LEU B CA  1 
ATOM 6800  C C   . LEU B 1 492 ? -38.002  12.311  -47.281  1.00 102.81 ? 461 LEU B C   1 
ATOM 6801  O O   . LEU B 1 492 ? -36.967  12.945  -47.552  1.00 104.97 ? 461 LEU B O   1 
ATOM 6802  C CB  . LEU B 1 492 ? -39.653  12.293  -49.167  1.00 100.66 ? 461 LEU B CB  1 
ATOM 6803  C CG  . LEU B 1 492 ? -40.822  12.711  -50.074  1.00 98.93  ? 461 LEU B CG  1 
ATOM 6804  C CD1 . LEU B 1 492 ? -40.555  12.373  -51.556  1.00 96.64  ? 461 LEU B CD1 1 
ATOM 6805  C CD2 . LEU B 1 492 ? -42.071  12.046  -49.590  1.00 98.00  ? 461 LEU B CD2 1 
ATOM 6806  N N   . LYS B 1 493 ? -38.001  11.189  -46.573  1.00 101.68 ? 462 LYS B N   1 
ATOM 6807  C CA  . LYS B 1 493 ? -36.774  10.591  -46.112  1.00 103.04 ? 462 LYS B CA  1 
ATOM 6808  C C   . LYS B 1 493 ? -37.002  9.146   -45.761  1.00 102.53 ? 462 LYS B C   1 
ATOM 6809  O O   . LYS B 1 493 ? -38.057  8.784   -45.275  1.00 101.04 ? 462 LYS B O   1 
ATOM 6810  C CB  . LYS B 1 493 ? -36.155  11.361  -44.935  1.00 105.28 ? 462 LYS B CB  1 
ATOM 6811  C CG  . LYS B 1 493 ? -37.065  12.129  -44.023  1.00 103.92 ? 462 LYS B CG  1 
ATOM 6812  C CD  . LYS B 1 493 ? -36.242  12.739  -42.908  1.00 108.25 ? 462 LYS B CD  1 
ATOM 6813  C CE  . LYS B 1 493 ? -37.103  13.422  -41.859  1.00 110.88 ? 462 LYS B CE  1 
ATOM 6814  N NZ  . LYS B 1 493 ? -36.896  12.872  -40.459  1.00 115.69 ? 462 LYS B NZ  1 
ATOM 6815  N N   . GLY B 1 494 ? -35.995  8.323   -46.016  1.00 104.25 ? 463 GLY B N   1 
ATOM 6816  C CA  . GLY B 1 494 ? -36.097  6.890   -45.809  1.00 104.42 ? 463 GLY B CA  1 
ATOM 6817  C C   . GLY B 1 494 ? -36.799  6.304   -47.005  1.00 101.87 ? 463 GLY B C   1 
ATOM 6818  O O   . GLY B 1 494 ? -36.625  6.780   -48.125  1.00 101.45 ? 463 GLY B O   1 
ATOM 6819  N N   . THR B 1 495 ? -37.587  5.268   -46.776  1.00 100.87 ? 464 THR B N   1 
ATOM 6820  C CA  . THR B 1 495 ? -38.396  4.713   -47.837  1.00 99.01  ? 464 THR B CA  1 
ATOM 6821  C C   . THR B 1 495 ? -39.830  5.205   -47.625  1.00 96.20  ? 464 THR B C   1 
ATOM 6822  O O   . THR B 1 495 ? -40.324  5.222   -46.512  1.00 96.47  ? 464 THR B O   1 
ATOM 6823  C CB  . THR B 1 495 ? -38.284  3.182   -47.899  1.00 101.24 ? 464 THR B CB  1 
ATOM 6824  O OG1 . THR B 1 495 ? -38.543  2.629   -46.609  1.00 103.12 ? 464 THR B OG1 1 
ATOM 6825  C CG2 . THR B 1 495 ? -36.879  2.772   -48.301  1.00 104.23 ? 464 THR B CG2 1 
ATOM 6826  N N   . VAL B 1 496 ? -40.467  5.663   -48.696  1.00 94.12  ? 465 VAL B N   1 
ATOM 6827  C CA  . VAL B 1 496 ? -41.789  6.263   -48.650  1.00 91.56  ? 465 VAL B CA  1 
ATOM 6828  C C   . VAL B 1 496 ? -42.526  5.621   -49.794  1.00 91.83  ? 465 VAL B C   1 
ATOM 6829  O O   . VAL B 1 496 ? -42.136  5.791   -50.957  1.00 91.99  ? 465 VAL B O   1 
ATOM 6830  C CB  . VAL B 1 496 ? -41.725  7.778   -48.909  1.00 89.86  ? 465 VAL B CB  1 
ATOM 6831  C CG1 . VAL B 1 496 ? -43.014  8.270   -49.393  1.00 88.51  ? 465 VAL B CG1 1 
ATOM 6832  C CG2 . VAL B 1 496 ? -41.387  8.523   -47.672  1.00 90.01  ? 465 VAL B CG2 1 
ATOM 6833  N N   . ILE B 1 497 ? -43.572  4.863   -49.475  1.00 92.65  ? 466 ILE B N   1 
ATOM 6834  C CA  . ILE B 1 497 ? -44.417  4.261   -50.507  1.00 93.24  ? 466 ILE B CA  1 
ATOM 6835  C C   . ILE B 1 497 ? -45.778  4.911   -50.501  1.00 92.82  ? 466 ILE B C   1 
ATOM 6836  O O   . ILE B 1 497 ? -46.454  4.839   -49.488  1.00 93.68  ? 466 ILE B O   1 
ATOM 6837  C CB  . ILE B 1 497 ? -44.628  2.786   -50.239  1.00 94.80  ? 466 ILE B CB  1 
ATOM 6838  C CG1 . ILE B 1 497 ? -43.294  2.073   -50.239  1.00 96.33  ? 466 ILE B CG1 1 
ATOM 6839  C CG2 . ILE B 1 497 ? -45.484  2.197   -51.315  1.00 95.45  ? 466 ILE B CG2 1 
ATOM 6840  C CD1 . ILE B 1 497 ? -43.432  0.616   -50.319  1.00 98.63  ? 466 ILE B CD1 1 
ATOM 6841  N N   . ILE B 1 498 ? -46.191  5.547   -51.597  1.00 92.75  ? 467 ILE B N   1 
ATOM 6842  C CA  . ILE B 1 498 ? -47.560  6.079   -51.657  1.00 93.51  ? 467 ILE B CA  1 
ATOM 6843  C C   . ILE B 1 498 ? -48.425  5.473   -52.776  1.00 96.22  ? 467 ILE B C   1 
ATOM 6844  O O   . ILE B 1 498 ? -48.202  5.702   -53.977  1.00 97.11  ? 467 ILE B O   1 
ATOM 6845  C CB  . ILE B 1 498 ? -47.602  7.580   -51.778  1.00 92.07  ? 467 ILE B CB  1 
ATOM 6846  C CG1 . ILE B 1 498 ? -46.585  8.220   -50.862  1.00 91.38  ? 467 ILE B CG1 1 
ATOM 6847  C CG2 . ILE B 1 498 ? -48.945  8.057   -51.391  1.00 91.92  ? 467 ILE B CG2 1 
ATOM 6848  C CD1 . ILE B 1 498 ? -46.166  9.586   -51.339  1.00 91.67  ? 467 ILE B CD1 1 
ATOM 6849  N N   . ILE B 1 499 ? -49.431  4.705   -52.381  1.00 98.68  ? 468 ILE B N   1 
ATOM 6850  C CA  . ILE B 1 499 ? -50.265  4.040   -53.354  1.00 101.60 ? 468 ILE B CA  1 
ATOM 6851  C C   . ILE B 1 499 ? -51.692  4.469   -53.167  1.00 103.71 ? 468 ILE B C   1 
ATOM 6852  O O   . ILE B 1 499 ? -52.237  4.365   -52.066  1.00 104.83 ? 468 ILE B O   1 
ATOM 6853  C CB  . ILE B 1 499 ? -50.160  2.537   -53.203  1.00 103.17 ? 468 ILE B CB  1 
ATOM 6854  C CG1 . ILE B 1 499 ? -48.790  2.094   -53.678  1.00 103.29 ? 468 ILE B CG1 1 
ATOM 6855  C CG2 . ILE B 1 499 ? -51.222  1.836   -54.027  1.00 106.27 ? 468 ILE B CG2 1 
ATOM 6856  C CD1 . ILE B 1 499 ? -48.603  0.628   -53.632  1.00 106.79 ? 468 ILE B CD1 1 
ATOM 6857  N N   . ALA B 1 500 ? -52.295  4.965   -54.239  1.00 105.70 ? 469 ALA B N   1 
ATOM 6858  C CA  . ALA B 1 500 ? -53.740  5.187   -54.257  1.00 109.00 ? 469 ALA B CA  1 
ATOM 6859  C C   . ALA B 1 500 ? -54.373  4.347   -55.378  1.00 112.34 ? 469 ALA B C   1 
ATOM 6860  O O   . ALA B 1 500 ? -53.997  4.510   -56.556  1.00 112.81 ? 469 ALA B O   1 
ATOM 6861  C CB  . ALA B 1 500 ? -54.036  6.663   -54.445  1.00 108.76 ? 469 ALA B CB  1 
ATOM 6862  N N   . ASN B 1 501 ? -55.311  3.456   -55.022  1.00 115.20 ? 470 ASN B N   1 
ATOM 6863  C CA  . ASN B 1 501 ? -55.907  2.517   -55.993  1.00 119.01 ? 470 ASN B CA  1 
ATOM 6864  C C   . ASN B 1 501 ? -56.688  3.186   -57.132  1.00 121.16 ? 470 ASN B C   1 
ATOM 6865  O O   . ASN B 1 501 ? -56.905  4.406   -57.115  1.00 120.46 ? 470 ASN B O   1 
ATOM 6866  C CB  . ASN B 1 501 ? -56.812  1.520   -55.286  1.00 122.47 ? 470 ASN B CB  1 
ATOM 6867  C CG  . ASN B 1 501 ? -56.046  0.513   -54.460  1.00 123.11 ? 470 ASN B CG  1 
ATOM 6868  O OD1 . ASN B 1 501 ? -54.805  0.457   -54.487  1.00 121.35 ? 470 ASN B OD1 1 
ATOM 6869  N ND2 . ASN B 1 501 ? -56.795  -0.312  -53.715  1.00 127.45 ? 470 ASN B ND2 1 
ATOM 6870  N N   . HIS B 1 502 ? -57.118  2.407   -58.126  1.00 124.27 ? 471 HIS B N   1 
ATOM 6871  C CA  . HIS B 1 502 ? -57.773  3.045   -59.253  1.00 126.74 ? 471 HIS B CA  1 
ATOM 6872  C C   . HIS B 1 502 ? -58.966  3.812   -58.734  1.00 127.90 ? 471 HIS B C   1 
ATOM 6873  O O   . HIS B 1 502 ? -59.764  3.291   -57.954  1.00 129.66 ? 471 HIS B O   1 
ATOM 6874  C CB  . HIS B 1 502 ? -58.188  2.065   -60.349  1.00 131.30 ? 471 HIS B CB  1 
ATOM 6875  C CG  . HIS B 1 502 ? -58.824  2.729   -61.539  1.00 136.08 ? 471 HIS B CG  1 
ATOM 6876  N ND1 . HIS B 1 502 ? -60.191  2.877   -61.671  1.00 142.38 ? 471 HIS B ND1 1 
ATOM 6877  C CD2 . HIS B 1 502 ? -58.277  3.302   -62.638  1.00 137.17 ? 471 HIS B CD2 1 
ATOM 6878  C CE1 . HIS B 1 502 ? -60.459  3.503   -62.803  1.00 145.55 ? 471 HIS B CE1 1 
ATOM 6879  N NE2 . HIS B 1 502 ? -59.314  3.771   -63.410  1.00 142.95 ? 471 HIS B NE2 1 
ATOM 6880  N N   . GLY B 1 503 ? -59.043  5.069   -59.140  1.00 127.18 ? 472 GLY B N   1 
ATOM 6881  C CA  . GLY B 1 503 ? -60.226  5.868   -58.906  1.00 129.44 ? 472 GLY B CA  1 
ATOM 6882  C C   . GLY B 1 503 ? -59.945  7.013   -57.975  1.00 126.01 ? 472 GLY B C   1 
ATOM 6883  O O   . GLY B 1 503 ? -60.433  8.125   -58.174  1.00 128.14 ? 472 GLY B O   1 
ATOM 6884  N N   . ASP B 1 504 ? -59.135  6.742   -56.965  1.00 121.31 ? 473 ASP B N   1 
ATOM 6885  C CA  . ASP B 1 504 ? -59.011  7.663   -55.854  1.00 118.61 ? 473 ASP B CA  1 
ATOM 6886  C C   . ASP B 1 504 ? -57.757  8.508   -55.902  1.00 113.35 ? 473 ASP B C   1 
ATOM 6887  O O   . ASP B 1 504 ? -56.856  8.260   -56.690  1.00 111.77 ? 473 ASP B O   1 
ATOM 6888  C CB  . ASP B 1 504 ? -59.140  6.922   -54.515  1.00 118.99 ? 473 ASP B CB  1 
ATOM 6889  C CG  . ASP B 1 504 ? -58.880  5.408   -54.628  1.00 121.49 ? 473 ASP B CG  1 
ATOM 6890  O OD1 . ASP B 1 504 ? -59.863  4.652   -54.874  1.00 127.02 ? 473 ASP B OD1 1 
ATOM 6891  O OD2 . ASP B 1 504 ? -57.704  4.976   -54.429  1.00 120.93 ? 473 ASP B OD2 1 
ATOM 6892  N N   . ARG B 1 505 ? -57.724  9.524   -55.062  1.00 110.79 ? 474 ARG B N   1 
ATOM 6893  C CA  . ARG B 1 505 ? -56.601  10.418  -55.034  1.00 106.67 ? 474 ARG B CA  1 
ATOM 6894  C C   . ARG B 1 505 ? -56.069  10.583  -53.614  1.00 103.56 ? 474 ARG B C   1 
ATOM 6895  O O   . ARG B 1 505 ? -56.834  10.515  -52.652  1.00 105.20 ? 474 ARG B O   1 
ATOM 6896  C CB  . ARG B 1 505 ? -57.015  11.763  -55.595  1.00 108.78 ? 474 ARG B CB  1 
ATOM 6897  C CG  . ARG B 1 505 ? -55.836  12.606  -55.902  1.00 106.59 ? 474 ARG B CG  1 
ATOM 6898  C CD  . ARG B 1 505 ? -56.172  14.030  -55.876  1.00 108.80 ? 474 ARG B CD  1 
ATOM 6899  N NE  . ARG B 1 505 ? -56.953  14.381  -57.031  1.00 114.29 ? 474 ARG B NE  1 
ATOM 6900  C CZ  . ARG B 1 505 ? -57.519  15.562  -57.177  1.00 120.38 ? 474 ARG B CZ  1 
ATOM 6901  N NH1 . ARG B 1 505 ? -57.370  16.488  -56.226  1.00 120.68 ? 474 ARG B NH1 1 
ATOM 6902  N NH2 . ARG B 1 505 ? -58.239  15.811  -58.268  1.00 126.20 ? 474 ARG B NH2 1 
ATOM 6903  N N   . ILE B 1 506 ? -54.763  10.795  -53.478  1.00 99.14  ? 475 ILE B N   1 
ATOM 6904  C CA  . ILE B 1 506 ? -54.177  11.051  -52.179  1.00 95.70  ? 475 ILE B CA  1 
ATOM 6905  C C   . ILE B 1 506 ? -53.523  12.392  -52.254  1.00 95.05  ? 475 ILE B C   1 
ATOM 6906  O O   . ILE B 1 506 ? -52.652  12.606  -53.078  1.00 94.18  ? 475 ILE B O   1 
ATOM 6907  C CB  . ILE B 1 506 ? -53.160  9.986   -51.805  1.00 92.93  ? 475 ILE B CB  1 
ATOM 6908  C CG1 . ILE B 1 506 ? -53.855  8.626   -51.776  1.00 93.27  ? 475 ILE B CG1 1 
ATOM 6909  C CG2 . ILE B 1 506 ? -52.522  10.331  -50.485  1.00 90.53  ? 475 ILE B CG2 1 
ATOM 6910  C CD1 . ILE B 1 506 ? -53.090  7.524   -51.144  1.00 91.34  ? 475 ILE B CD1 1 
ATOM 6911  N N   . ASP B 1 507 ? -53.982  13.312  -51.424  1.00 96.39  ? 476 ASP B N   1 
ATOM 6912  C CA  . ASP B 1 507 ? -53.384  14.636  -51.340  1.00 97.14  ? 476 ASP B CA  1 
ATOM 6913  C C   . ASP B 1 507 ? -52.494  14.639  -50.136  1.00 94.85  ? 476 ASP B C   1 
ATOM 6914  O O   . ASP B 1 507 ? -52.920  14.219  -49.058  1.00 95.65  ? 476 ASP B O   1 
ATOM 6915  C CB  . ASP B 1 507 ? -54.446  15.720  -51.136  1.00 101.30 ? 476 ASP B CB  1 
ATOM 6916  C CG  . ASP B 1 507 ? -55.304  15.978  -52.388  1.00 107.03 ? 476 ASP B CG  1 
ATOM 6917  O OD1 . ASP B 1 507 ? -55.013  15.394  -53.459  1.00 109.97 ? 476 ASP B OD1 1 
ATOM 6918  O OD2 . ASP B 1 507 ? -56.282  16.774  -52.303  1.00 113.08 ? 476 ASP B OD2 1 
ATOM 6919  N N   . ILE B 1 508 ? -51.263  15.105  -50.292  1.00 92.67  ? 477 ILE B N   1 
ATOM 6920  C CA  . ILE B 1 508 ? -50.363  15.174  -49.146  1.00 90.61  ? 477 ILE B CA  1 
ATOM 6921  C C   . ILE B 1 508 ? -50.222  16.628  -48.727  1.00 91.41  ? 477 ILE B C   1 
ATOM 6922  O O   . ILE B 1 508 ? -49.930  17.482  -49.565  1.00 92.90  ? 477 ILE B O   1 
ATOM 6923  C CB  . ILE B 1 508 ? -49.022  14.489  -49.427  1.00 88.42  ? 477 ILE B CB  1 
ATOM 6924  C CG1 . ILE B 1 508 ? -49.131  13.010  -49.078  1.00 86.59  ? 477 ILE B CG1 1 
ATOM 6925  C CG2 . ILE B 1 508 ? -47.911  15.112  -48.618  1.00 89.11  ? 477 ILE B CG2 1 
ATOM 6926  C CD1 . ILE B 1 508 ? -49.035  12.136  -50.263  1.00 84.35  ? 477 ILE B CD1 1 
ATOM 6927  N N   . PRO B 1 509 ? -50.438  16.910  -47.434  1.00 91.04  ? 478 PRO B N   1 
ATOM 6928  C CA  . PRO B 1 509 ? -50.643  18.252  -46.882  1.00 92.71  ? 478 PRO B CA  1 
ATOM 6929  C C   . PRO B 1 509 ? -49.389  19.138  -46.835  1.00 91.98  ? 478 PRO B C   1 
ATOM 6930  O O   . PRO B 1 509 ? -48.324  18.654  -46.478  1.00 90.36  ? 478 PRO B O   1 
ATOM 6931  C CB  . PRO B 1 509 ? -51.110  17.962  -45.455  1.00 93.99  ? 478 PRO B CB  1 
ATOM 6932  C CG  . PRO B 1 509 ? -51.314  16.476  -45.380  1.00 92.48  ? 478 PRO B CG  1 
ATOM 6933  C CD  . PRO B 1 509 ? -50.441  15.879  -46.389  1.00 89.74  ? 478 PRO B CD  1 
ATOM 6934  N N   . PRO B 1 510 ? -49.517  20.435  -47.164  1.00 93.69  ? 479 PRO B N   1 
ATOM 6935  C CA  . PRO B 1 510 ? -48.344  21.272  -47.076  1.00 94.16  ? 479 PRO B CA  1 
ATOM 6936  C C   . PRO B 1 510 ? -47.604  21.021  -45.764  1.00 93.72  ? 479 PRO B C   1 
ATOM 6937  O O   . PRO B 1 510 ? -48.217  21.075  -44.692  1.00 95.00  ? 479 PRO B O   1 
ATOM 6938  C CB  . PRO B 1 510 ? -48.930  22.678  -47.086  1.00 97.85  ? 479 PRO B CB  1 
ATOM 6939  C CG  . PRO B 1 510 ? -50.152  22.553  -47.852  1.00 98.75  ? 479 PRO B CG  1 
ATOM 6940  C CD  . PRO B 1 510 ? -50.713  21.216  -47.511  1.00 96.58  ? 479 PRO B CD  1 
ATOM 6941  N N   . GLY B 1 511 ? -46.310  20.702  -45.869  1.00 92.36  ? 480 GLY B N   1 
ATOM 6942  C CA  . GLY B 1 511 ? -45.406  20.587  -44.719  1.00 92.46  ? 480 GLY B CA  1 
ATOM 6943  C C   . GLY B 1 511 ? -45.123  19.175  -44.229  1.00 90.01  ? 480 GLY B C   1 
ATOM 6944  O O   . GLY B 1 511 ? -44.272  18.978  -43.346  1.00 91.04  ? 480 GLY B O   1 
ATOM 6945  N N   . ALA B 1 512 ? -45.827  18.195  -44.799  1.00 87.37  ? 481 ALA B N   1 
ATOM 6946  C CA  . ALA B 1 512 ? -45.757  16.799  -44.345  1.00 85.14  ? 481 ALA B CA  1 
ATOM 6947  C C   . ALA B 1 512 ? -44.376  16.194  -44.531  1.00 83.57  ? 481 ALA B C   1 
ATOM 6948  O O   . ALA B 1 512 ? -43.734  16.417  -45.555  1.00 83.41  ? 481 ALA B O   1 
ATOM 6949  C CB  . ALA B 1 512 ? -46.783  15.961  -45.060  1.00 84.01  ? 481 ALA B CB  1 
ATOM 6950  N N   . VAL B 1 513 ? -43.961  15.410  -43.538  1.00 82.72  ? 482 VAL B N   1 
ATOM 6951  C CA  . VAL B 1 513 ? -42.609  14.902  -43.397  1.00 81.86  ? 482 VAL B CA  1 
ATOM 6952  C C   . VAL B 1 513 ? -42.677  13.400  -43.233  1.00 80.74  ? 482 VAL B C   1 
ATOM 6953  O O   . VAL B 1 513 ? -43.000  12.907  -42.163  1.00 82.24  ? 482 VAL B O   1 
ATOM 6954  C CB  . VAL B 1 513 ? -42.000  15.436  -42.112  1.00 84.37  ? 482 VAL B CB  1 
ATOM 6955  C CG1 . VAL B 1 513 ? -40.558  14.978  -41.977  1.00 85.17  ? 482 VAL B CG1 1 
ATOM 6956  C CG2 . VAL B 1 513 ? -42.156  16.960  -42.020  1.00 86.13  ? 482 VAL B CG2 1 
ATOM 6957  N N   . LEU B 1 514 ? -42.359  12.654  -44.275  1.00 78.98  ? 483 LEU B N   1 
ATOM 6958  C CA  . LEU B 1 514 ? -42.582  11.205  -44.248  1.00 78.14  ? 483 LEU B CA  1 
ATOM 6959  C C   . LEU B 1 514 ? -41.294  10.385  -44.080  1.00 79.17  ? 483 LEU B C   1 
ATOM 6960  O O   . LEU B 1 514 ? -40.438  10.405  -44.973  1.00 79.30  ? 483 LEU B O   1 
ATOM 6961  C CB  . LEU B 1 514 ? -43.311  10.793  -45.533  1.00 76.30  ? 483 LEU B CB  1 
ATOM 6962  C CG  . LEU B 1 514 ? -44.788  11.170  -45.651  1.00 75.15  ? 483 LEU B CG  1 
ATOM 6963  C CD1 . LEU B 1 514 ? -45.209  11.473  -47.080  1.00 72.85  ? 483 LEU B CD1 1 
ATOM 6964  C CD2 . LEU B 1 514 ? -45.606  10.036  -45.090  1.00 76.62  ? 483 LEU B CD2 1 
ATOM 6965  N N   . GLU B 1 515 ? -41.154  9.667   -42.960  1.00 80.29  ? 484 GLU B N   1 
ATOM 6966  C CA  . GLU B 1 515 ? -39.982  8.802   -42.756  1.00 81.99  ? 484 GLU B CA  1 
ATOM 6967  C C   . GLU B 1 515 ? -40.315  7.305   -42.611  1.00 82.85  ? 484 GLU B C   1 
ATOM 6968  O O   . GLU B 1 515 ? -40.775  6.855   -41.575  1.00 84.97  ? 484 GLU B O   1 
ATOM 6969  C CB  . GLU B 1 515 ? -39.132  9.288   -41.575  1.00 84.50  ? 484 GLU B CB  1 
ATOM 6970  N N   . ASN B 1 516 ? -40.076  6.531   -43.658  1.00 82.19  ? 485 ASN B N   1 
ATOM 6971  C CA  . ASN B 1 516 ? -40.232  5.076   -43.598  1.00 83.78  ? 485 ASN B CA  1 
ATOM 6972  C C   . ASN B 1 516 ? -41.656  4.581   -43.456  1.00 83.40  ? 485 ASN B C   1 
ATOM 6973  O O   . ASN B 1 516 ? -41.944  3.670   -42.673  1.00 85.61  ? 485 ASN B O   1 
ATOM 6974  C CB  . ASN B 1 516 ? -39.309  4.457   -42.556  1.00 87.31  ? 485 ASN B CB  1 
ATOM 6975  C CG  . ASN B 1 516 ? -37.911  4.290   -43.077  1.00 88.80  ? 485 ASN B CG  1 
ATOM 6976  O OD1 . ASN B 1 516 ? -37.649  3.481   -43.971  1.00 89.25  ? 485 ASN B OD1 1 
ATOM 6977  N ND2 . ASN B 1 516 ? -37.001  5.074   -42.543  1.00 90.94  ? 485 ASN B ND2 1 
ATOM 6978  N N   . LYS B 1 517 ? -42.517  5.170   -44.286  1.00 81.31  ? 486 LYS B N   1 
ATOM 6979  C CA  . LYS B 1 517 ? -43.963  4.927   -44.284  1.00 81.26  ? 486 LYS B CA  1 
ATOM 6980  C C   . LYS B 1 517 ? -44.584  4.421   -45.594  1.00 80.05  ? 486 LYS B C   1 
ATOM 6981  O O   . LYS B 1 517 ? -44.121  4.711   -46.700  1.00 78.49  ? 486 LYS B O   1 
ATOM 6982  C CB  . LYS B 1 517 ? -44.682  6.200   -43.841  1.00 80.16  ? 486 LYS B CB  1 
ATOM 6983  C CG  . LYS B 1 517 ? -44.508  6.468   -42.376  1.00 82.98  ? 486 LYS B CG  1 
ATOM 6984  C CD  . LYS B 1 517 ? -44.245  7.920   -42.150  1.00 84.16  ? 486 LYS B CD  1 
ATOM 6985  C CE  . LYS B 1 517 ? -44.089  8.218   -40.666  1.00 88.42  ? 486 LYS B CE  1 
ATOM 6986  N NZ  . LYS B 1 517 ? -43.679  9.649   -40.499  1.00 89.36  ? 486 LYS B NZ  1 
ATOM 6987  N N   . ILE B 1 518 ? -45.646  3.651   -45.437  1.00 81.43  ? 487 ILE B N   1 
ATOM 6988  C CA  . ILE B 1 518 ? -46.541  3.355   -46.531  1.00 81.61  ? 487 ILE B CA  1 
ATOM 6989  C C   . ILE B 1 518 ? -47.766  4.257   -46.384  1.00 81.47  ? 487 ILE B C   1 
ATOM 6990  O O   . ILE B 1 518 ? -48.412  4.250   -45.351  1.00 83.85  ? 487 ILE B O   1 
ATOM 6991  C CB  . ILE B 1 518 ? -47.018  1.894   -46.461  1.00 84.20  ? 487 ILE B CB  1 
ATOM 6992  C CG1 . ILE B 1 518 ? -45.844  0.931   -46.675  1.00 85.95  ? 487 ILE B CG1 1 
ATOM 6993  C CG2 . ILE B 1 518 ? -48.166  1.654   -47.452  1.00 83.90  ? 487 ILE B CG2 1 
ATOM 6994  C CD1 . ILE B 1 518 ? -46.027  -0.460  -46.055  1.00 88.73  ? 487 ILE B CD1 1 
ATOM 6995  N N   . VAL B 1 519 ? -48.091  5.048   -47.392  1.00 80.02  ? 488 VAL B N   1 
ATOM 6996  C CA  . VAL B 1 519 ? -49.352  5.750   -47.381  1.00 80.41  ? 488 VAL B CA  1 
ATOM 6997  C C   . VAL B 1 519 ? -50.272  5.023   -48.343  1.00 82.22  ? 488 VAL B C   1 
ATOM 6998  O O   . VAL B 1 519 ? -49.896  4.770   -49.485  1.00 81.82  ? 488 VAL B O   1 
ATOM 6999  C CB  . VAL B 1 519 ? -49.187  7.177   -47.847  1.00 78.53  ? 488 VAL B CB  1 
ATOM 7000  C CG1 . VAL B 1 519 ? -50.504  7.895   -47.763  1.00 79.82  ? 488 VAL B CG1 1 
ATOM 7001  C CG2 . VAL B 1 519 ? -48.176  7.875   -47.006  1.00 77.87  ? 488 VAL B CG2 1 
ATOM 7002  N N   . SER B 1 520 ? -51.469  4.665   -47.883  1.00 85.39  ? 489 SER B N   1 
ATOM 7003  C CA  . SER B 1 520 ? -52.528  4.125   -48.768  1.00 87.78  ? 489 SER B CA  1 
ATOM 7004  C C   . SER B 1 520 ? -53.865  4.838   -48.544  1.00 89.74  ? 489 SER B C   1 
ATOM 7005  O O   . SER B 1 520 ? -53.981  5.675   -47.648  1.00 89.82  ? 489 SER B O   1 
ATOM 7006  C CB  . SER B 1 520 ? -52.674  2.589   -48.630  1.00 90.32  ? 489 SER B CB  1 
ATOM 7007  O OG  . SER B 1 520 ? -53.159  2.186   -47.356  1.00 92.48  ? 489 SER B OG  1 
ATOM 7008  N N   . GLY B 1 521 ? -54.862  4.531   -49.367  1.00 111.28 ? 490 GLY B N   1 
ATOM 7009  C CA  . GLY B 1 521 ? -56.224  4.978   -49.073  1.00 112.71 ? 490 GLY B CA  1 
ATOM 7010  C C   . GLY B 1 521 ? -56.737  6.048   -50.006  1.00 112.51 ? 490 GLY B C   1 
ATOM 7011  O O   . GLY B 1 521 ? -56.950  5.762   -51.171  1.00 112.46 ? 490 GLY B O   1 
ATOM 7012  N N   . ASN B 1 522 ? -56.929  7.268   -49.493  1.00 113.36 ? 491 ASN B N   1 
ATOM 7013  C CA  . ASN B 1 522 ? -57.428  8.403   -50.275  1.00 114.35 ? 491 ASN B CA  1 
ATOM 7014  C C   . ASN B 1 522 ? -58.098  9.528   -49.468  1.00 116.83 ? 491 ASN B C   1 
ATOM 7015  O O   . ASN B 1 522 ? -59.106  9.287   -48.798  1.00 118.92 ? 491 ASN B O   1 
ATOM 7016  C CB  . ASN B 1 522 ? -58.359  7.884   -51.382  1.00 114.34 ? 491 ASN B CB  1 
ATOM 7017  C CG  . ASN B 1 522 ? -59.640  8.699   -51.552  1.00 116.66 ? 491 ASN B CG  1 
ATOM 7018  O OD1 . ASN B 1 522 ? -59.628  9.940   -51.621  1.00 119.31 ? 491 ASN B OD1 1 
ATOM 7019  N ND2 . ASN B 1 522 ? -60.758  7.987   -51.672  1.00 116.54 ? 491 ASN B ND2 1 
ATOM 7020  N N   . LEU B 1 523 ? -57.539  10.744  -49.547  1.00 117.64 ? 492 LEU B N   1 
ATOM 7021  C CA  . LEU B 1 523 ? -58.203  11.987  -49.113  1.00 120.50 ? 492 LEU B CA  1 
ATOM 7022  C C   . LEU B 1 523 ? -58.080  12.979  -50.205  1.00 122.05 ? 492 LEU B C   1 
ATOM 7023  O O   . LEU B 1 523 ? -57.036  13.047  -50.825  1.00 121.41 ? 492 LEU B O   1 
ATOM 7024  C CB  . LEU B 1 523 ? -57.444  12.654  -48.003  1.00 120.69 ? 492 LEU B CB  1 
ATOM 7025  C CG  . LEU B 1 523 ? -57.159  11.813  -46.814  1.00 120.22 ? 492 LEU B CG  1 
ATOM 7026  C CD1 . LEU B 1 523 ? -55.966  12.433  -46.179  1.00 121.69 ? 492 LEU B CD1 1 
ATOM 7027  C CD2 . LEU B 1 523 ? -58.356  11.869  -45.909  1.00 124.43 ? 492 LEU B CD2 1 
ATOM 7028  N N   . ARG B 1 524 ? -59.093  13.798  -50.417  1.00 125.52 ? 493 ARG B N   1 
ATOM 7029  C CA  . ARG B 1 524 ? -58.852  15.043  -51.136  1.00 128.79 ? 493 ARG B CA  1 
ATOM 7030  C C   . ARG B 1 524 ? -58.946  16.191  -50.130  1.00 132.28 ? 493 ARG B C   1 
ATOM 7031  O O   . ARG B 1 524 ? -59.924  16.279  -49.392  1.00 135.25 ? 493 ARG B O   1 
ATOM 7032  C CB  . ARG B 1 524 ? -59.843  15.231  -52.290  1.00 130.97 ? 493 ARG B CB  1 
ATOM 7033  C CG  . ARG B 1 524 ? -60.213  13.950  -53.011  1.00 129.87 ? 493 ARG B CG  1 
ATOM 7034  C CD  . ARG B 1 524 ? -60.656  14.230  -54.435  1.00 134.20 ? 493 ARG B CD  1 
ATOM 7035  N NE  . ARG B 1 524 ? -60.607  13.010  -55.246  1.00 133.24 ? 493 ARG B NE  1 
ATOM 7036  C CZ  . ARG B 1 524 ? -60.880  12.959  -56.548  1.00 135.49 ? 493 ARG B CZ  1 
ATOM 7037  N NH1 . ARG B 1 524 ? -61.228  14.064  -57.214  1.00 140.06 ? 493 ARG B NH1 1 
ATOM 7038  N NH2 . ARG B 1 524 ? -60.810  11.798  -57.187  1.00 133.54 ? 493 ARG B NH2 1 
ATOM 7039  N N   . ILE B 1 525 ? -57.947  17.060  -50.051  1.00 133.00 ? 494 ILE B N   1 
ATOM 7040  C CA  . ILE B 1 525 ? -58.096  18.211  -49.155  1.00 136.92 ? 494 ILE B CA  1 
ATOM 7041  C C   . ILE B 1 525 ? -58.783  19.330  -49.912  1.00 141.84 ? 494 ILE B C   1 
ATOM 7042  O O   . ILE B 1 525 ? -58.384  19.662  -51.016  1.00 142.57 ? 494 ILE B O   1 
ATOM 7043  C CB  . ILE B 1 525 ? -56.761  18.722  -48.559  1.00 136.26 ? 494 ILE B CB  1 
ATOM 7044  C CG1 . ILE B 1 525 ? -55.869  17.565  -48.133  1.00 131.49 ? 494 ILE B CG1 1 
ATOM 7045  C CG2 . ILE B 1 525 ? -57.021  19.599  -47.344  1.00 139.59 ? 494 ILE B CG2 1 
ATOM 7046  C CD1 . ILE B 1 525 ? -54.411  17.992  -48.017  1.00 131.61 ? 494 ILE B CD1 1 
ATOM 7047  N N   . LEU B 1 526 ? -59.811  19.917  -49.326  1.00 146.16 ? 495 LEU B N   1 
ATOM 7048  C CA  . LEU B 1 526 ? -60.505  20.973  -50.020  1.00 152.19 ? 495 LEU B CA  1 
ATOM 7049  C C   . LEU B 1 526 ? -60.450  22.299  -49.282  1.00 158.76 ? 495 LEU B C   1 
ATOM 7050  O O   . LEU B 1 526 ? -60.506  22.350  -48.054  1.00 159.51 ? 495 LEU B O   1 
ATOM 7051  C CB  . LEU B 1 526 ? -61.935  20.546  -50.269  1.00 153.52 ? 495 LEU B CB  1 
ATOM 7052  C CG  . LEU B 1 526 ? -62.100  19.108  -50.759  1.00 147.39 ? 495 LEU B CG  1 
ATOM 7053  C CD1 . LEU B 1 526 ? -63.445  18.515  -50.294  1.00 148.67 ? 495 LEU B CD1 1 
ATOM 7054  C CD2 . LEU B 1 526 ? -61.930  19.021  -52.284  1.00 146.05 ? 495 LEU B CD2 1 
ATOM 7055  N N   . ASP B 1 527 ? -60.356  23.372  -50.052  1.00 164.49 ? 496 ASP B N   1 
ATOM 7056  C CA  . ASP B 1 527 ? -60.168  24.722  -49.525  1.00 172.35 ? 496 ASP B CA  1 
ATOM 7057  C C   . ASP B 1 527 ? -61.327  25.288  -48.662  1.00 178.75 ? 496 ASP B C   1 
ATOM 7058  O O   . ASP B 1 527 ? -62.448  24.840  -48.776  1.00 179.49 ? 496 ASP B O   1 
ATOM 7059  C CB  . ASP B 1 527 ? -59.864  25.661  -50.700  1.00 177.61 ? 496 ASP B CB  1 
ATOM 7060  C CG  . ASP B 1 527 ? -58.767  26.672  -50.378  1.00 183.07 ? 496 ASP B CG  1 
ATOM 7061  O OD1 . ASP B 1 527 ? -57.828  26.284  -49.624  1.00 181.13 ? 496 ASP B OD1 1 
ATOM 7062  O OD2 . ASP B 1 527 ? -58.842  27.836  -50.878  1.00 192.21 ? 496 ASP B OD2 1 
ATOM 7063  N N   . HIS B 1 528 ? -61.025  26.306  -47.851  1.00 114.30 ? 497 HIS B N   1 
ATOM 7064  C CA  . HIS B 1 528 ? -61.885  26.899  -46.787  1.00 114.59 ? 497 HIS B CA  1 
ATOM 7065  C C   . HIS B 1 528 ? -63.124  26.161  -46.327  1.00 110.66 ? 497 HIS B C   1 
ATOM 7066  O O   . HIS B 1 528 ? -63.293  25.824  -45.146  1.00 109.14 ? 497 HIS B O   1 
ATOM 7067  C CB  . HIS B 1 528 ? -62.207  28.401  -47.010  1.00 119.01 ? 497 HIS B CB  1 
ATOM 7068  C CG  . HIS B 1 528 ? -62.687  28.753  -48.390  1.00 123.45 ? 497 HIS B CG  1 
ATOM 7069  N ND1 . HIS B 1 528 ? -63.654  28.027  -49.058  1.00 123.44 ? 497 HIS B ND1 1 
ATOM 7070  C CD2 . HIS B 1 528 ? -62.368  29.794  -49.206  1.00 130.75 ? 497 HIS B CD2 1 
ATOM 7071  C CE1 . HIS B 1 528 ? -63.881  28.583  -50.241  1.00 127.88 ? 497 HIS B CE1 1 
ATOM 7072  N NE2 . HIS B 1 528 ? -63.118  29.659  -50.355  1.00 132.16 ? 497 HIS B NE2 1 
ATOM 7073  O OXT . HIS B 1 528 ? -63.992  25.896  -47.140  1.00 109.92 ? 497 HIS B OXT 1 
ATOM 7074  N N   . GLN C 1 46  ? -37.497  56.285  -70.996  1.00 86.15  ? 15  GLN C N   1 
ATOM 7075  C CA  . GLN C 1 46  ? -37.128  57.553  -71.681  1.00 86.23  ? 15  GLN C CA  1 
ATOM 7076  C C   . GLN C 1 46  ? -37.168  57.388  -73.189  1.00 86.61  ? 15  GLN C C   1 
ATOM 7077  O O   . GLN C 1 46  ? -38.077  57.897  -73.842  1.00 86.70  ? 15  GLN C O   1 
ATOM 7078  C CB  . GLN C 1 46  ? -35.742  58.019  -71.245  1.00 86.03  ? 15  GLN C CB  1 
ATOM 7079  C CG  . GLN C 1 46  ? -35.702  58.613  -69.860  1.00 85.24  ? 15  GLN C CG  1 
ATOM 7080  C CD  . GLN C 1 46  ? -34.304  58.646  -69.292  1.00 84.20  ? 15  GLN C CD  1 
ATOM 7081  O OE1 . GLN C 1 46  ? -33.393  57.996  -69.804  1.00 83.69  ? 15  GLN C OE1 1 
ATOM 7082  N NE2 . GLN C 1 46  ? -34.126  59.400  -68.220  1.00 83.91  ? 15  GLN C NE2 1 
ATOM 7083  N N   . GLU C 1 47  ? -36.179  56.683  -73.737  1.00 87.10  ? 16  GLU C N   1 
ATOM 7084  C CA  . GLU C 1 47  ? -36.120  56.409  -75.175  1.00 87.61  ? 16  GLU C CA  1 
ATOM 7085  C C   . GLU C 1 47  ? -37.099  55.299  -75.584  1.00 88.01  ? 16  GLU C C   1 
ATOM 7086  O O   . GLU C 1 47  ? -37.636  55.318  -76.696  1.00 88.00  ? 16  GLU C O   1 
ATOM 7087  C CB  . GLU C 1 47  ? -34.690  56.063  -75.604  1.00 87.52  ? 16  GLU C CB  1 
ATOM 7088  N N   . LEU C 1 48  ? -37.330  54.347  -74.678  1.00 88.55  ? 17  LEU C N   1 
ATOM 7089  C CA  . LEU C 1 48  ? -38.280  53.245  -74.896  1.00 89.06  ? 17  LEU C CA  1 
ATOM 7090  C C   . LEU C 1 48  ? -39.742  53.686  -74.749  1.00 89.53  ? 17  LEU C C   1 
ATOM 7091  O O   . LEU C 1 48  ? -40.657  53.011  -75.235  1.00 89.49  ? 17  LEU C O   1 
ATOM 7092  C CB  . LEU C 1 48  ? -37.984  52.088  -73.933  1.00 88.96  ? 17  LEU C CB  1 
ATOM 7093  C CG  . LEU C 1 48  ? -36.790  51.178  -74.237  1.00 88.78  ? 17  LEU C CG  1 
ATOM 7094  C CD1 . LEU C 1 48  ? -36.309  50.493  -72.967  1.00 88.45  ? 17  LEU C CD1 1 
ATOM 7095  C CD2 . LEU C 1 48  ? -37.131  50.153  -75.320  1.00 88.48  ? 17  LEU C CD2 1 
ATOM 7096  N N   . GLU C 1 49  ? -39.938  54.821  -74.077  1.00 90.18  ? 18  GLU C N   1 
ATOM 7097  C CA  . GLU C 1 49  ? -41.256  55.416  -73.815  1.00 90.73  ? 18  GLU C CA  1 
ATOM 7098  C C   . GLU C 1 49  ? -41.851  56.124  -75.047  1.00 91.10  ? 18  GLU C C   1 
ATOM 7099  O O   . GLU C 1 49  ? -43.052  56.421  -75.086  1.00 91.09  ? 18  GLU C O   1 
ATOM 7100  C CB  . GLU C 1 49  ? -41.134  56.400  -72.644  1.00 90.71  ? 18  GLU C CB  1 
ATOM 7101  C CG  . GLU C 1 49  ? -42.445  56.969  -72.115  1.00 90.96  ? 18  GLU C CG  1 
ATOM 7102  C CD  . GLU C 1 49  ? -42.240  58.207  -71.256  1.00 91.36  ? 18  GLU C CD  1 
ATOM 7103  O OE1 . GLU C 1 49  ? -41.128  58.783  -71.287  1.00 91.60  ? 18  GLU C OE1 1 
ATOM 7104  O OE2 . GLU C 1 49  ? -43.195  58.609  -70.554  1.00 91.44  ? 18  GLU C OE2 1 
ATOM 7105  N N   . LEU C 1 50  ? -41.003  56.390  -76.042  1.00 91.61  ? 19  LEU C N   1 
ATOM 7106  C CA  . LEU C 1 50  ? -41.418  57.049  -77.283  1.00 92.08  ? 19  LEU C CA  1 
ATOM 7107  C C   . LEU C 1 50  ? -41.716  56.058  -78.424  1.00 92.41  ? 19  LEU C C   1 
ATOM 7108  O O   . LEU C 1 50  ? -41.998  56.473  -79.555  1.00 92.53  ? 19  LEU C O   1 
ATOM 7109  C CB  . LEU C 1 50  ? -40.372  58.085  -77.721  1.00 92.05  ? 19  LEU C CB  1 
ATOM 7110  N N   . SER C 1 51  ? -41.647  54.758  -78.122  1.00 92.75  ? 20  SER C N   1 
ATOM 7111  C CA  . SER C 1 51  ? -42.054  53.702  -79.063  1.00 93.02  ? 20  SER C CA  1 
ATOM 7112  C C   . SER C 1 51  ? -43.491  53.249  -78.785  1.00 93.23  ? 20  SER C C   1 
ATOM 7113  O O   . SER C 1 51  ? -44.211  52.822  -79.692  1.00 93.13  ? 20  SER C O   1 
ATOM 7114  C CB  . SER C 1 51  ? -41.086  52.514  -79.013  1.00 92.98  ? 20  SER C CB  1 
ATOM 7115  O OG  . SER C 1 51  ? -40.986  51.984  -77.703  1.00 92.95  ? 20  SER C OG  1 
ATOM 7116  N N   . VAL C 1 52  ? -43.888  53.342  -77.517  1.00 93.62  ? 21  VAL C N   1 
ATOM 7117  C CA  . VAL C 1 52  ? -45.279  53.171  -77.097  1.00 94.03  ? 21  VAL C CA  1 
ATOM 7118  C C   . VAL C 1 52  ? -46.083  54.447  -77.411  1.00 94.40  ? 21  VAL C C   1 
ATOM 7119  O O   . VAL C 1 52  ? -47.241  54.369  -77.824  1.00 94.42  ? 21  VAL C O   1 
ATOM 7120  C CB  . VAL C 1 52  ? -45.366  52.754  -75.587  1.00 93.99  ? 21  VAL C CB  1 
ATOM 7121  C CG1 . VAL C 1 52  ? -46.629  53.282  -74.906  1.00 93.87  ? 21  VAL C CG1 1 
ATOM 7122  C CG2 . VAL C 1 52  ? -45.266  51.235  -75.442  1.00 93.85  ? 21  VAL C CG2 1 
ATOM 7123  N N   . LYS C 1 53  ? -45.451  55.610  -77.232  1.00 94.87  ? 22  LYS C N   1 
ATOM 7124  C CA  . LYS C 1 53  ? -46.051  56.911  -77.570  1.00 95.30  ? 22  LYS C CA  1 
ATOM 7125  C C   . LYS C 1 53  ? -46.353  57.078  -79.063  1.00 95.67  ? 22  LYS C C   1 
ATOM 7126  O O   . LYS C 1 53  ? -47.304  57.769  -79.433  1.00 95.62  ? 22  LYS C O   1 
ATOM 7127  C CB  . LYS C 1 53  ? -45.150  58.057  -77.103  1.00 95.24  ? 22  LYS C CB  1 
ATOM 7128  N N   . LYS C 1 54  ? -45.530  56.457  -79.909  1.00 96.23  ? 23  LYS C N   1 
ATOM 7129  C CA  . LYS C 1 54  ? -45.731  56.455  -81.362  1.00 96.70  ? 23  LYS C CA  1 
ATOM 7130  C C   . LYS C 1 54  ? -46.882  55.526  -81.764  1.00 97.08  ? 23  LYS C C   1 
ATOM 7131  O O   . LYS C 1 54  ? -47.450  55.667  -82.851  1.00 97.08  ? 23  LYS C O   1 
ATOM 7132  C CB  . LYS C 1 54  ? -44.437  56.059  -82.087  1.00 96.59  ? 23  LYS C CB  1 
ATOM 7133  N N   . GLU C 1 55  ? -47.217  54.586  -80.877  1.00 97.62  ? 24  GLU C N   1 
ATOM 7134  C CA  . GLU C 1 55  ? -48.347  53.667  -81.068  1.00 98.09  ? 24  GLU C CA  1 
ATOM 7135  C C   . GLU C 1 55  ? -49.695  54.272  -80.631  1.00 98.50  ? 24  GLU C C   1 
ATOM 7136  O O   . GLU C 1 55  ? -50.758  53.837  -81.101  1.00 98.40  ? 24  GLU C O   1 
ATOM 7137  C CB  . GLU C 1 55  ? -48.092  52.327  -80.356  1.00 98.01  ? 24  GLU C CB  1 
ATOM 7138  C CG  . GLU C 1 55  ? -46.952  51.500  -80.948  1.00 97.77  ? 24  GLU C CG  1 
ATOM 7139  C CD  . GLU C 1 55  ? -47.059  51.347  -82.457  1.00 97.76  ? 24  GLU C CD  1 
ATOM 7140  O OE1 . GLU C 1 55  ? -48.108  50.870  -82.940  1.00 97.78  ? 24  GLU C OE1 1 
ATOM 7141  O OE2 . GLU C 1 55  ? -46.094  51.709  -83.161  1.00 97.71  ? 24  GLU C OE2 1 
ATOM 7142  N N   . LEU C 1 56  ? -49.630  55.266  -79.736  1.00 99.07  ? 25  LEU C N   1 
ATOM 7143  C CA  . LEU C 1 56  ? -50.797  56.051  -79.273  1.00 99.58  ? 25  LEU C CA  1 
ATOM 7144  C C   . LEU C 1 56  ? -51.516  56.737  -80.437  1.00 99.88  ? 25  LEU C C   1 
ATOM 7145  O O   . LEU C 1 56  ? -52.743  56.638  -80.582  1.00 99.86  ? 25  LEU C O   1 
ATOM 7146  C CB  . LEU C 1 56  ? -50.365  57.143  -78.272  1.00 99.59  ? 25  LEU C CB  1 
ATOM 7147  C CG  . LEU C 1 56  ? -49.875  56.897  -76.839  1.00 99.69  ? 25  LEU C CG  1 
ATOM 7148  C CD1 . LEU C 1 56  ? -49.190  58.149  -76.301  1.00 99.43  ? 25  LEU C CD1 1 
ATOM 7149  C CD2 . LEU C 1 56  ? -51.014  56.480  -75.912  1.00 99.86  ? 25  LEU C CD2 1 
ATOM 7150  N N   . GLU C 1 57  ? -50.728  57.448  -81.245  1.00 238.99 ? 26  GLU C N   1 
ATOM 7151  C CA  . GLU C 1 57  ? -51.206  58.173  -82.417  1.00 240.14 ? 26  GLU C CA  1 
ATOM 7152  C C   . GLU C 1 57  ? -51.256  57.263  -83.648  1.00 241.17 ? 26  GLU C C   1 
ATOM 7153  O O   . GLU C 1 57  ? -51.640  57.705  -84.735  1.00 242.48 ? 26  GLU C O   1 
ATOM 7154  C CB  . GLU C 1 57  ? -50.306  59.383  -82.694  1.00 240.25 ? 26  GLU C CB  1 
ATOM 7155  C CG  . GLU C 1 57  ? -50.219  60.389  -81.548  1.00 239.88 ? 26  GLU C CG  1 
ATOM 7156  C CD  . GLU C 1 57  ? -48.941  61.219  -81.582  1.00 240.35 ? 26  GLU C CD  1 
ATOM 7157  O OE1 . GLU C 1 57  ? -48.089  60.985  -82.470  1.00 241.16 ? 26  GLU C OE1 1 
ATOM 7158  O OE2 . GLU C 1 57  ? -48.787  62.106  -80.715  1.00 240.09 ? 26  GLU C OE2 1 
ATOM 7159  N N   . LYS C 1 58  ? -50.861  55.998  -83.471  1.00 240.89 ? 27  LYS C N   1 
ATOM 7160  C CA  . LYS C 1 58  ? -50.919  54.993  -84.537  1.00 241.82 ? 27  LYS C CA  1 
ATOM 7161  C C   . LYS C 1 58  ? -52.259  54.254  -84.552  1.00 241.96 ? 27  LYS C C   1 
ATOM 7162  O O   . LYS C 1 58  ? -52.573  53.538  -85.508  1.00 243.02 ? 27  LYS C O   1 
ATOM 7163  C CB  . LYS C 1 58  ? -49.763  53.995  -84.413  1.00 241.67 ? 27  LYS C CB  1 
ATOM 7164  N N   . ILE C 1 59  ? -53.047  54.437  -83.494  1.00 241.13 ? 28  ILE C N   1 
ATOM 7165  C CA  . ILE C 1 59  ? -54.367  53.810  -83.401  1.00 241.40 ? 28  ILE C CA  1 
ATOM 7166  C C   . ILE C 1 59  ? -55.532  54.821  -83.456  1.00 242.30 ? 28  ILE C C   1 
ATOM 7167  O O   . ILE C 1 59  ? -56.694  54.433  -83.603  1.00 243.06 ? 28  ILE C O   1 
ATOM 7168  C CB  . ILE C 1 59  ? -54.459  52.843  -82.179  1.00 240.31 ? 28  ILE C CB  1 
ATOM 7169  C CG1 . ILE C 1 59  ? -55.776  52.047  -82.202  1.00 240.56 ? 28  ILE C CG1 1 
ATOM 7170  C CG2 . ILE C 1 59  ? -54.255  53.603  -80.865  1.00 239.40 ? 28  ILE C CG2 1 
ATOM 7171  C CD1 . ILE C 1 59  ? -55.641  50.581  -81.832  1.00 239.61 ? 28  ILE C CD1 1 
ATOM 7172  N N   . LEU C 1 60  ? -55.216  56.111  -83.360  1.00 242.40 ? 29  LEU C N   1 
ATOM 7173  C CA  . LEU C 1 60  ? -56.220  57.160  -83.551  1.00 243.70 ? 29  LEU C CA  1 
ATOM 7174  C C   . LEU C 1 60  ? -56.626  57.320  -85.021  1.00 245.69 ? 29  LEU C C   1 
ATOM 7175  O O   . LEU C 1 60  ? -57.717  57.820  -85.316  1.00 247.13 ? 29  LEU C O   1 
ATOM 7176  C CB  . LEU C 1 60  ? -55.729  58.489  -82.977  1.00 243.16 ? 29  LEU C CB  1 
ATOM 7177  C CG  . LEU C 1 60  ? -56.017  58.699  -81.492  1.00 242.32 ? 29  LEU C CG  1 
ATOM 7178  C CD1 . LEU C 1 60  ? -54.975  59.612  -80.858  1.00 241.31 ? 29  LEU C CD1 1 
ATOM 7179  C CD2 . LEU C 1 60  ? -57.433  59.241  -81.293  1.00 243.62 ? 29  LEU C CD2 1 
ATOM 7180  N N   . THR C 1 61  ? -55.740  56.895  -85.928  1.00 246.17 ? 30  THR C N   1 
ATOM 7181  C CA  . THR C 1 61  ? -56.014  56.863  -87.377  1.00 248.38 ? 30  THR C CA  1 
ATOM 7182  C C   . THR C 1 61  ? -57.050  55.790  -87.727  1.00 249.56 ? 30  THR C C   1 
ATOM 7183  O O   . THR C 1 61  ? -57.787  55.923  -88.710  1.00 251.68 ? 30  THR C O   1 
ATOM 7184  C CB  . THR C 1 61  ? -54.714  56.676  -88.236  1.00 248.67 ? 30  THR C CB  1 
ATOM 7185  O OG1 . THR C 1 61  ? -55.030  56.780  -89.630  1.00 250.93 ? 30  THR C OG1 1 
ATOM 7186  C CG2 . THR C 1 61  ? -54.035  55.325  -87.972  1.00 247.49 ? 30  THR C CG2 1 
ATOM 7187  N N   . THR C 1 62  ? -57.087  54.734  -86.912  1.00 248.39 ? 31  THR C N   1 
ATOM 7188  C CA  . THR C 1 62  ? -58.087  53.675  -87.030  1.00 249.13 ? 31  THR C CA  1 
ATOM 7189  C C   . THR C 1 62  ? -59.216  53.884  -86.004  1.00 249.18 ? 31  THR C C   1 
ATOM 7190  O O   . THR C 1 62  ? -59.695  52.935  -85.384  1.00 248.56 ? 31  THR C O   1 
ATOM 7191  C CB  . THR C 1 62  ? -57.443  52.242  -86.976  1.00 248.06 ? 31  THR C CB  1 
ATOM 7192  O OG1 . THR C 1 62  ? -58.463  51.241  -87.069  1.00 248.44 ? 31  THR C OG1 1 
ATOM 7193  C CG2 . THR C 1 62  ? -56.632  52.019  -85.705  1.00 245.72 ? 31  THR C CG2 1 
ATOM 7194  N N   . ALA C 1 63  ? -59.629  55.145  -85.845  1.00 250.21 ? 32  ALA C N   1 
ATOM 7195  C CA  . ALA C 1 63  ? -60.777  55.515  -85.013  1.00 251.16 ? 32  ALA C CA  1 
ATOM 7196  C C   . ALA C 1 63  ? -62.096  55.297  -85.767  1.00 254.00 ? 32  ALA C C   1 
ATOM 7197  O O   . ALA C 1 63  ? -62.135  54.566  -86.761  1.00 254.91 ? 32  ALA C O   1 
ATOM 7198  C CB  . ALA C 1 63  ? -60.650  56.962  -84.534  1.00 251.02 ? 32  ALA C CB  1 
ATOM 7199  N N   . SER C 1 64  ? -63.171  55.929  -85.297  1.00 255.93 ? 33  SER C N   1 
ATOM 7200  C CA  . SER C 1 64  ? -64.499  55.743  -85.893  1.00 259.24 ? 33  SER C CA  1 
ATOM 7201  C C   . SER C 1 64  ? -65.034  56.992  -86.608  1.00 262.26 ? 33  SER C C   1 
ATOM 7202  O O   . SER C 1 64  ? -66.145  56.976  -87.159  1.00 265.04 ? 33  SER C O   1 
ATOM 7203  C CB  . SER C 1 64  ? -65.494  55.276  -84.824  1.00 259.47 ? 33  SER C CB  1 
ATOM 7204  O OG  . SER C 1 64  ? -66.774  55.036  -85.386  1.00 262.37 ? 33  SER C OG  1 
ATOM 7205  N N   . SER C 1 65  ? -64.227  58.055  -86.602  1.00 262.06 ? 34  SER C N   1 
ATOM 7206  C CA  . SER C 1 65  ? -64.582  59.371  -87.157  1.00 264.80 ? 34  SER C CA  1 
ATOM 7207  C C   . SER C 1 65  ? -65.420  60.222  -86.183  1.00 266.21 ? 34  SER C C   1 
ATOM 7208  O O   . SER C 1 65  ? -64.935  61.247  -85.691  1.00 265.38 ? 34  SER C O   1 
ATOM 7209  C CB  . SER C 1 65  ? -65.238  59.258  -88.543  1.00 267.87 ? 34  SER C CB  1 
ATOM 7210  O OG  . SER C 1 65  ? -65.116  60.469  -89.267  1.00 269.54 ? 34  SER C OG  1 
ATOM 7211  N N   . HIS C 1 66  ? -66.655  59.799  -85.895  1.00 268.70 ? 35  HIS C N   1 
ATOM 7212  C CA  . HIS C 1 66  ? -67.528  60.533  -84.957  1.00 270.66 ? 35  HIS C CA  1 
ATOM 7213  C C   . HIS C 1 66  ? -67.085  60.406  -83.490  1.00 268.54 ? 35  HIS C C   1 
ATOM 7214  O O   . HIS C 1 66  ? -67.218  61.354  -82.713  1.00 268.94 ? 35  HIS C O   1 
ATOM 7215  C CB  . HIS C 1 66  ? -69.016  60.171  -85.139  1.00 273.95 ? 35  HIS C CB  1 
ATOM 7216  C CG  . HIS C 1 66  ? -69.374  58.784  -84.697  1.00 273.35 ? 35  HIS C CG  1 
ATOM 7217  N ND1 . HIS C 1 66  ? -69.436  57.718  -85.569  1.00 273.69 ? 35  HIS C ND1 1 
ATOM 7218  C CD2 . HIS C 1 66  ? -69.710  58.293  -83.479  1.00 272.66 ? 35  HIS C CD2 1 
ATOM 7219  C CE1 . HIS C 1 66  ? -69.784  56.629  -84.906  1.00 272.91 ? 35  HIS C CE1 1 
ATOM 7220  N NE2 . HIS C 1 66  ? -69.955  56.950  -83.636  1.00 272.33 ? 35  HIS C NE2 1 
ATOM 7221  N N   . GLU C 1 67  ? -66.566  59.234  -83.123  1.00 266.74 ? 36  GLU C N   1 
ATOM 7222  C CA  . GLU C 1 67  ? -65.944  59.036  -81.819  1.00 264.89 ? 36  GLU C CA  1 
ATOM 7223  C C   . GLU C 1 67  ? -64.505  59.560  -81.863  1.00 262.98 ? 36  GLU C C   1 
ATOM 7224  O O   . GLU C 1 67  ? -63.609  58.921  -82.431  1.00 261.42 ? 36  GLU C O   1 
ATOM 7225  C CB  . GLU C 1 67  ? -65.997  57.563  -81.401  1.00 263.56 ? 36  GLU C CB  1 
ATOM 7226  N N   . PHE C 1 68  ? -64.307  60.738  -81.273  1.00 263.58 ? 37  PHE C N   1 
ATOM 7227  C CA  . PHE C 1 68  ? -63.022  61.441  -81.279  1.00 262.20 ? 37  PHE C CA  1 
ATOM 7228  C C   . PHE C 1 68  ? -62.904  62.338  -80.040  1.00 262.22 ? 37  PHE C C   1 
ATOM 7229  O O   . PHE C 1 68  ? -61.800  62.571  -79.538  1.00 260.29 ? 37  PHE C O   1 
ATOM 7230  C CB  . PHE C 1 68  ? -62.887  62.269  -82.569  1.00 263.39 ? 37  PHE C CB  1 
ATOM 7231  C CG  . PHE C 1 68  ? -61.457  62.549  -82.993  1.00 261.65 ? 37  PHE C CG  1 
ATOM 7232  C CD1 . PHE C 1 68  ? -60.454  61.584  -82.838  1.00 259.45 ? 37  PHE C CD1 1 
ATOM 7233  C CD2 . PHE C 1 68  ? -61.128  63.770  -83.593  1.00 262.31 ? 37  PHE C CD2 1 
ATOM 7234  C CE1 . PHE C 1 68  ? -59.145  61.844  -83.245  1.00 258.09 ? 37  PHE C CE1 1 
ATOM 7235  C CE2 . PHE C 1 68  ? -59.824  64.038  -84.006  1.00 260.75 ? 37  PHE C CE2 1 
ATOM 7236  C CZ  . PHE C 1 68  ? -58.830  63.074  -83.830  1.00 258.85 ? 37  PHE C CZ  1 
ATOM 7237  N N   . GLU C 1 69  ? -64.053  62.812  -79.548  1.00 264.83 ? 38  GLU C N   1 
ATOM 7238  C CA  . GLU C 1 69  ? -64.127  63.719  -78.395  1.00 265.66 ? 38  GLU C CA  1 
ATOM 7239  C C   . GLU C 1 69  ? -63.964  63.028  -77.030  1.00 265.08 ? 38  GLU C C   1 
ATOM 7240  O O   . GLU C 1 69  ? -64.053  63.683  -75.987  1.00 265.76 ? 38  GLU C O   1 
ATOM 7241  C CB  . GLU C 1 69  ? -65.437  64.522  -78.431  1.00 268.79 ? 38  GLU C CB  1 
ATOM 7242  N N   . HIS C 1 70  ? -63.729  61.714  -77.039  1.00 264.28 ? 39  HIS C N   1 
ATOM 7243  C CA  . HIS C 1 70  ? -63.505  60.950  -75.800  1.00 263.93 ? 39  HIS C CA  1 
ATOM 7244  C C   . HIS C 1 70  ? -62.444  59.838  -75.907  1.00 262.00 ? 39  HIS C C   1 
ATOM 7245  O O   . HIS C 1 70  ? -62.206  59.113  -74.932  1.00 261.53 ? 39  HIS C O   1 
ATOM 7246  C CB  . HIS C 1 70  ? -64.828  60.396  -75.232  1.00 265.90 ? 39  HIS C CB  1 
ATOM 7247  C CG  . HIS C 1 70  ? -65.365  59.209  -75.972  1.00 265.45 ? 39  HIS C CG  1 
ATOM 7248  N ND1 . HIS C 1 70  ? -66.162  59.328  -77.090  1.00 266.63 ? 39  HIS C ND1 1 
ATOM 7249  C CD2 . HIS C 1 70  ? -65.231  57.880  -75.745  1.00 263.75 ? 39  HIS C CD2 1 
ATOM 7250  C CE1 . HIS C 1 70  ? -66.489  58.125  -77.526  1.00 266.11 ? 39  HIS C CE1 1 
ATOM 7251  N NE2 . HIS C 1 70  ? -65.938  57.229  -76.727  1.00 264.33 ? 39  HIS C NE2 1 
ATOM 7252  N N   . THR C 1 71  ? -61.816  59.697  -77.077  1.00 261.48 ? 40  THR C N   1 
ATOM 7253  C CA  . THR C 1 71  ? -60.702  58.748  -77.233  1.00 259.85 ? 40  THR C CA  1 
ATOM 7254  C C   . THR C 1 71  ? -59.362  59.480  -77.112  1.00 258.72 ? 40  THR C C   1 
ATOM 7255  O O   . THR C 1 71  ? -58.412  58.943  -76.535  1.00 257.36 ? 40  THR C O   1 
ATOM 7256  C CB  . THR C 1 71  ? -60.770  57.938  -78.558  1.00 259.80 ? 40  THR C CB  1 
ATOM 7257  O OG1 . THR C 1 71  ? -62.138  57.706  -78.914  1.00 261.99 ? 40  THR C OG1 1 
ATOM 7258  C CG2 . THR C 1 71  ? -60.065  56.584  -78.398  1.00 257.93 ? 40  THR C CG2 1 
ATOM 7259  N N   . LYS C 1 72  ? -59.305  60.706  -77.645  1.00 259.62 ? 41  LYS C N   1 
ATOM 7260  C CA  . LYS C 1 72  ? -58.143  61.598  -77.489  1.00 258.88 ? 41  LYS C CA  1 
ATOM 7261  C C   . LYS C 1 72  ? -57.937  62.014  -76.020  1.00 259.05 ? 41  LYS C C   1 
ATOM 7262  O O   . LYS C 1 72  ? -56.830  62.411  -75.625  1.00 258.06 ? 41  LYS C O   1 
ATOM 7263  C CB  . LYS C 1 72  ? -58.286  62.847  -78.378  1.00 259.65 ? 41  LYS C CB  1 
ATOM 7264  C CG  . LYS C 1 72  ? -58.276  62.572  -79.878  1.00 259.79 ? 41  LYS C CG  1 
ATOM 7265  N N   . LYS C 1 73  ? -59.012  61.912  -75.229  1.00 260.63 ? 42  LYS C N   1 
ATOM 7266  C CA  . LYS C 1 73  ? -59.016  62.259  -73.803  1.00 261.37 ? 42  LYS C CA  1 
ATOM 7267  C C   . LYS C 1 73  ? -58.615  61.081  -72.909  1.00 260.90 ? 42  LYS C C   1 
ATOM 7268  O O   . LYS C 1 73  ? -57.936  61.268  -71.896  1.00 260.83 ? 42  LYS C O   1 
ATOM 7269  C CB  . LYS C 1 73  ? -60.391  62.795  -73.385  1.00 263.60 ? 42  LYS C CB  1 
ATOM 7270  N N   . ASP C 1 74  ? -59.044  59.875  -73.283  1.00 260.90 ? 43  ASP C N   1 
ATOM 7271  C CA  . ASP C 1 74  ? -58.693  58.658  -72.546  1.00 260.41 ? 43  ASP C CA  1 
ATOM 7272  C C   . ASP C 1 74  ? -57.225  58.262  -72.769  1.00 258.66 ? 43  ASP C C   1 
ATOM 7273  O O   . ASP C 1 74  ? -56.516  57.939  -71.809  1.00 258.49 ? 43  ASP C O   1 
ATOM 7274  C CB  . ASP C 1 74  ? -59.640  57.506  -72.909  1.00 260.75 ? 43  ASP C CB  1 
ATOM 7275  N N   . LEU C 1 75  ? -56.774  58.308  -74.024  1.00 257.70 ? 44  LEU C N   1 
ATOM 7276  C CA  . LEU C 1 75  ? -55.392  57.971  -74.371  1.00 256.42 ? 44  LEU C CA  1 
ATOM 7277  C C   . LEU C 1 75  ? -54.379  58.879  -73.680  1.00 256.35 ? 44  LEU C C   1 
ATOM 7278  O O   . LEU C 1 75  ? -53.316  58.417  -73.256  1.00 255.86 ? 44  LEU C O   1 
ATOM 7279  C CB  . LEU C 1 75  ? -55.180  58.018  -75.884  1.00 255.93 ? 44  LEU C CB  1 
ATOM 7280  C CG  . LEU C 1 75  ? -55.920  57.026  -76.785  1.00 256.09 ? 44  LEU C CG  1 
ATOM 7281  C CD1 . LEU C 1 75  ? -55.254  57.007  -78.156  1.00 255.98 ? 44  LEU C CD1 1 
ATOM 7282  C CD2 . LEU C 1 75  ? -55.965  55.624  -76.187  1.00 255.27 ? 44  LEU C CD2 1 
ATOM 7283  N N   . ASP C 1 76  ? -54.719  60.164  -73.572  1.00 257.10 ? 45  ASP C N   1 
ATOM 7284  C CA  . ASP C 1 76  ? -53.879  61.148  -72.883  1.00 257.23 ? 45  ASP C CA  1 
ATOM 7285  C C   . ASP C 1 76  ? -54.031  61.081  -71.353  1.00 258.33 ? 45  ASP C C   1 
ATOM 7286  O O   . ASP C 1 76  ? -53.392  61.845  -70.625  1.00 258.77 ? 45  ASP C O   1 
ATOM 7287  C CB  . ASP C 1 76  ? -54.149  62.565  -73.408  1.00 257.47 ? 45  ASP C CB  1 
ATOM 7288  N N   . GLY C 1 77  ? -54.882  60.171  -70.876  1.00 259.07 ? 46  GLY C N   1 
ATOM 7289  C CA  . GLY C 1 77  ? -54.935  59.833  -69.456  1.00 260.28 ? 46  GLY C CA  1 
ATOM 7290  C C   . GLY C 1 77  ? -53.807  58.874  -69.111  1.00 259.76 ? 46  GLY C C   1 
ATOM 7291  O O   . GLY C 1 77  ? -53.145  59.023  -68.077  1.00 260.57 ? 46  GLY C O   1 
ATOM 7292  N N   . PHE C 1 78  ? -53.586  57.907  -70.006  1.00 258.63 ? 47  PHE C N   1 
ATOM 7293  C CA  . PHE C 1 78  ? -52.567  56.855  -69.872  1.00 258.15 ? 47  PHE C CA  1 
ATOM 7294  C C   . PHE C 1 78  ? -51.126  57.378  -69.773  1.00 257.71 ? 47  PHE C C   1 
ATOM 7295  O O   . PHE C 1 78  ? -50.290  56.775  -69.093  1.00 258.13 ? 47  PHE C O   1 
ATOM 7296  C CB  . PHE C 1 78  ? -52.690  55.888  -71.055  1.00 257.22 ? 47  PHE C CB  1 
ATOM 7297  C CG  . PHE C 1 78  ? -51.887  54.629  -70.903  1.00 257.68 ? 47  PHE C CG  1 
ATOM 7298  C CD1 . PHE C 1 78  ? -52.453  53.499  -70.320  1.00 258.61 ? 47  PHE C CD1 1 
ATOM 7299  C CD2 . PHE C 1 78  ? -50.570  54.567  -71.357  1.00 257.91 ? 47  PHE C CD2 1 
ATOM 7300  C CE1 . PHE C 1 78  ? -51.719  52.322  -70.180  1.00 259.09 ? 47  PHE C CE1 1 
ATOM 7301  C CE2 . PHE C 1 78  ? -49.822  53.398  -71.219  1.00 258.60 ? 47  PHE C CE2 1 
ATOM 7302  C CZ  . PHE C 1 78  ? -50.401  52.269  -70.630  1.00 259.10 ? 47  PHE C CZ  1 
ATOM 7303  N N   . ARG C 1 79  ? -50.850  58.485  -70.463  1.00 257.02 ? 48  ARG C N   1 
ATOM 7304  C CA  . ARG C 1 79  ? -49.528  59.127  -70.465  1.00 256.76 ? 48  ARG C CA  1 
ATOM 7305  C C   . ARG C 1 79  ? -49.151  59.689  -69.083  1.00 258.06 ? 48  ARG C C   1 
ATOM 7306  O O   . ARG C 1 79  ? -47.985  59.630  -68.682  1.00 258.48 ? 48  ARG C O   1 
ATOM 7307  C CB  . ARG C 1 79  ? -49.468  60.227  -71.545  1.00 255.93 ? 48  ARG C CB  1 
ATOM 7308  C CG  . ARG C 1 79  ? -48.059  60.721  -71.939  1.00 255.16 ? 48  ARG C CG  1 
ATOM 7309  C CD  . ARG C 1 79  ? -47.348  59.755  -72.886  1.00 253.69 ? 48  ARG C CD  1 
ATOM 7310  N NE  . ARG C 1 79  ? -46.035  60.236  -73.310  1.00 252.64 ? 48  ARG C NE  1 
ATOM 7311  C CZ  . ARG C 1 79  ? -45.082  59.461  -73.820  1.00 252.49 ? 48  ARG C CZ  1 
ATOM 7312  N NH1 . ARG C 1 79  ? -45.281  58.156  -73.963  1.00 252.25 ? 48  ARG C NH1 1 
ATOM 7313  N NH2 . ARG C 1 79  ? -43.921  59.988  -74.181  1.00 252.73 ? 48  ARG C NH2 1 
ATOM 7314  N N   . LYS C 1 80  ? -50.137  60.224  -68.362  1.00 259.01 ? 49  LYS C N   1 
ATOM 7315  C CA  . LYS C 1 80  ? -49.929  60.718  -66.999  1.00 260.68 ? 49  LYS C CA  1 
ATOM 7316  C C   . LYS C 1 80  ? -49.544  59.580  -66.045  1.00 261.97 ? 49  LYS C C   1 
ATOM 7317  O O   . LYS C 1 80  ? -48.885  59.808  -65.026  1.00 263.44 ? 49  LYS C O   1 
ATOM 7318  C CB  . LYS C 1 80  ? -51.184  61.437  -66.496  1.00 261.66 ? 49  LYS C CB  1 
ATOM 7319  N N   . LEU C 1 81  ? -49.948  58.359  -66.399  1.00 261.65 ? 50  LEU C N   1 
ATOM 7320  C CA  . LEU C 1 81  ? -49.694  57.160  -65.593  1.00 262.92 ? 50  LEU C CA  1 
ATOM 7321  C C   . LEU C 1 81  ? -48.425  56.411  -66.008  1.00 262.51 ? 50  LEU C C   1 
ATOM 7322  O O   . LEU C 1 81  ? -47.675  55.936  -65.150  1.00 263.91 ? 50  LEU C O   1 
ATOM 7323  C CB  . LEU C 1 81  ? -50.889  56.196  -65.662  1.00 262.92 ? 50  LEU C CB  1 
ATOM 7324  C CG  . LEU C 1 81  ? -52.311  56.675  -65.346  1.00 263.83 ? 50  LEU C CG  1 
ATOM 7325  C CD1 . LEU C 1 81  ? -53.322  55.602  -65.740  1.00 263.32 ? 50  LEU C CD1 1 
ATOM 7326  C CD2 . LEU C 1 81  ? -52.484  57.074  -63.878  1.00 266.31 ? 50  LEU C CD2 1 
ATOM 7327  N N   . PHE C 1 82  ? -48.203  56.293  -67.318  1.00 226.89 ? 51  PHE C N   1 
ATOM 7328  C CA  . PHE C 1 82  ? -47.039  55.582  -67.863  1.00 228.18 ? 51  PHE C CA  1 
ATOM 7329  C C   . PHE C 1 82  ? -45.710  56.276  -67.531  1.00 230.34 ? 51  PHE C C   1 
ATOM 7330  O O   . PHE C 1 82  ? -44.670  55.618  -67.460  1.00 230.95 ? 51  PHE C O   1 
ATOM 7331  C CB  . PHE C 1 82  ? -47.180  55.379  -69.376  1.00 229.07 ? 51  PHE C CB  1 
ATOM 7332  N N   . HIS C 1 83  ? -45.758  57.597  -67.332  1.00 231.72 ? 52  HIS C N   1 
ATOM 7333  C CA  . HIS C 1 83  ? -44.600  58.400  -66.896  1.00 233.75 ? 52  HIS C CA  1 
ATOM 7334  C C   . HIS C 1 83  ? -44.390  58.248  -65.382  1.00 232.69 ? 52  HIS C C   1 
ATOM 7335  O O   . HIS C 1 83  ? -43.281  58.442  -64.869  1.00 233.81 ? 52  HIS C O   1 
ATOM 7336  C CB  . HIS C 1 83  ? -44.800  59.877  -67.277  1.00 235.43 ? 52  HIS C CB  1 
ATOM 7337  C CG  . HIS C 1 83  ? -43.566  60.723  -67.148  1.00 237.76 ? 52  HIS C CG  1 
ATOM 7338  N ND1 . HIS C 1 83  ? -42.699  60.942  -68.197  1.00 239.99 ? 52  HIS C ND1 1 
ATOM 7339  C CD2 . HIS C 1 83  ? -43.071  61.427  -66.101  1.00 238.30 ? 52  HIS C CD2 1 
ATOM 7340  C CE1 . HIS C 1 83  ? -41.717  61.732  -67.799  1.00 241.82 ? 52  HIS C CE1 1 
ATOM 7341  N NE2 . HIS C 1 83  ? -41.919  62.041  -66.531  1.00 240.72 ? 52  HIS C NE2 1 
ATOM 7342  N N   . ARG C 1 84  ? -45.467  57.896  -64.681  1.00 230.61 ? 53  ARG C N   1 
ATOM 7343  C CA  . ARG C 1 84  ? -45.415  57.603  -63.251  1.00 229.44 ? 53  ARG C CA  1 
ATOM 7344  C C   . ARG C 1 84  ? -45.010  56.145  -62.978  1.00 228.40 ? 53  ARG C C   1 
ATOM 7345  O O   . ARG C 1 84  ? -44.857  55.751  -61.819  1.00 227.54 ? 53  ARG C O   1 
ATOM 7346  C CB  . ARG C 1 84  ? -46.764  57.924  -62.594  1.00 227.72 ? 53  ARG C CB  1 
ATOM 7347  N N   . PHE C 1 85  ? -44.822  55.362  -64.046  1.00 228.71 ? 54  PHE C N   1 
ATOM 7348  C CA  . PHE C 1 85  ? -44.480  53.930  -63.958  1.00 227.83 ? 54  PHE C CA  1 
ATOM 7349  C C   . PHE C 1 85  ? -43.014  53.655  -63.550  1.00 229.16 ? 54  PHE C C   1 
ATOM 7350  O O   . PHE C 1 85  ? -42.773  53.136  -62.453  1.00 228.26 ? 54  PHE C O   1 
ATOM 7351  C CB  . PHE C 1 85  ? -44.837  53.220  -65.275  1.00 227.85 ? 54  PHE C CB  1 
ATOM 7352  C CG  . PHE C 1 85  ? -44.687  51.717  -65.235  1.00 226.98 ? 54  PHE C CG  1 
ATOM 7353  C CD1 . PHE C 1 85  ? -45.789  50.901  -64.998  1.00 224.73 ? 54  PHE C CD1 1 
ATOM 7354  C CD2 . PHE C 1 85  ? -43.447  51.114  -65.466  1.00 228.72 ? 54  PHE C CD2 1 
ATOM 7355  C CE1 . PHE C 1 85  ? -45.660  49.504  -64.973  1.00 223.94 ? 54  PHE C CE1 1 
ATOM 7356  C CE2 . PHE C 1 85  ? -43.304  49.719  -65.438  1.00 227.98 ? 54  PHE C CE2 1 
ATOM 7357  C CZ  . PHE C 1 85  ? -44.415  48.914  -65.193  1.00 225.51 ? 54  PHE C CZ  1 
ATOM 7358  N N   . LEU C 1 86  ? -42.052  53.982  -64.424  1.00 231.34 ? 55  LEU C N   1 
ATOM 7359  C CA  . LEU C 1 86  ? -40.608  53.808  -64.119  1.00 232.86 ? 55  LEU C CA  1 
ATOM 7360  C C   . LEU C 1 86  ? -39.997  54.993  -63.336  1.00 234.01 ? 55  LEU C C   1 
ATOM 7361  O O   . LEU C 1 86  ? -38.783  55.239  -63.398  1.00 235.95 ? 55  LEU C O   1 
ATOM 7362  C CB  . LEU C 1 86  ? -39.769  53.490  -65.384  1.00 234.84 ? 55  LEU C CB  1 
ATOM 7363  C CG  . LEU C 1 86  ? -39.463  52.063  -65.899  1.00 234.53 ? 55  LEU C CG  1 
ATOM 7364  C CD1 . LEU C 1 86  ? -38.420  52.114  -67.021  1.00 236.80 ? 55  LEU C CD1 1 
ATOM 7365  C CD2 . LEU C 1 86  ? -38.997  51.090  -64.814  1.00 233.36 ? 55  LEU C CD2 1 
ATOM 7366  N N   . GLN C 1 87  ? -40.853  55.717  -62.608  1.00 232.82 ? 56  GLN C N   1 
ATOM 7367  C CA  . GLN C 1 87  ? -40.431  56.748  -61.655  1.00 233.46 ? 56  GLN C CA  1 
ATOM 7368  C C   . GLN C 1 87  ? -40.559  56.227  -60.209  1.00 231.73 ? 56  GLN C C   1 
ATOM 7369  O O   . GLN C 1 87  ? -40.751  57.005  -59.268  1.00 231.66 ? 56  GLN C O   1 
ATOM 7370  C CB  . GLN C 1 87  ? -41.241  58.036  -61.860  1.00 233.73 ? 56  GLN C CB  1 
ATOM 7371  N N   . GLU C 1 88  ? -40.447  54.902  -60.063  1.00 230.37 ? 57  GLU C N   1 
ATOM 7372  C CA  . GLU C 1 88  ? -40.476  54.185  -58.777  1.00 228.80 ? 57  GLU C CA  1 
ATOM 7373  C C   . GLU C 1 88  ? -41.556  54.638  -57.800  1.00 227.24 ? 57  GLU C C   1 
ATOM 7374  O O   . GLU C 1 88  ? -42.684  54.923  -58.197  1.00 226.30 ? 57  GLU C O   1 
ATOM 7375  C CB  . GLU C 1 88  ? -39.100  54.208  -58.105  1.00 230.18 ? 57  GLU C CB  1 
ATOM 7376  N N   . GLY C 1 96  ? -42.463  56.152  -45.688  1.00 213.31 ? 65  GLY C N   1 
ATOM 7377  C CA  . GLY C 1 96  ? -42.368  56.168  -44.227  1.00 213.73 ? 65  GLY C CA  1 
ATOM 7378  C C   . GLY C 1 96  ? -41.007  55.750  -43.677  1.00 215.07 ? 65  GLY C C   1 
ATOM 7379  O O   . GLY C 1 96  ? -40.043  55.619  -44.435  1.00 216.10 ? 65  GLY C O   1 
ATOM 7380  N N   . LYS C 1 97  ? -40.915  55.529  -42.364  1.00 215.23 ? 66  LYS C N   1 
ATOM 7381  C CA  . LYS C 1 97  ? -42.054  55.616  -41.449  1.00 214.26 ? 66  LYS C CA  1 
ATOM 7382  C C   . LYS C 1 97  ? -41.878  56.725  -40.413  1.00 215.71 ? 66  LYS C C   1 
ATOM 7383  O O   . LYS C 1 97  ? -40.902  56.744  -39.660  1.00 217.00 ? 66  LYS C O   1 
ATOM 7384  C CB  . LYS C 1 97  ? -42.278  54.277  -40.737  1.00 213.12 ? 66  LYS C CB  1 
ATOM 7385  C CG  . LYS C 1 97  ? -42.676  53.122  -41.654  1.00 211.60 ? 66  LYS C CG  1 
ATOM 7386  C CD  . LYS C 1 97  ? -41.747  51.936  -41.449  1.00 211.53 ? 66  LYS C CD  1 
ATOM 7387  C CE  . LYS C 1 97  ? -40.390  52.218  -42.075  1.00 212.87 ? 66  LYS C CE  1 
ATOM 7388  N NZ  . LYS C 1 97  ? -39.288  51.775  -41.193  1.00 214.13 ? 66  LYS C NZ  1 
ATOM 7389  N N   . ILE C 1 98  ? -42.828  57.655  -40.403  1.00 215.60 ? 67  ILE C N   1 
ATOM 7390  C CA  . ILE C 1 98  ? -42.961  58.660  -39.353  1.00 216.77 ? 67  ILE C CA  1 
ATOM 7391  C C   . ILE C 1 98  ? -44.438  58.716  -38.972  1.00 215.61 ? 67  ILE C C   1 
ATOM 7392  O O   . ILE C 1 98  ? -44.822  59.364  -37.993  1.00 216.18 ? 67  ILE C O   1 
ATOM 7393  C CB  . ILE C 1 98  ? -42.490  60.045  -39.828  1.00 218.44 ? 67  ILE C CB  1 
ATOM 7394  N N   . GLN C 1 99  ? -45.243  57.999  -39.761  1.00 214.10 ? 68  GLN C N   1 
ATOM 7395  C CA  . GLN C 1 99  ? -46.703  57.957  -39.653  1.00 212.96 ? 68  GLN C CA  1 
ATOM 7396  C C   . GLN C 1 99  ? -47.221  57.243  -38.398  1.00 212.54 ? 68  GLN C C   1 
ATOM 7397  O O   . GLN C 1 99  ? -46.993  56.043  -38.222  1.00 211.76 ? 68  GLN C O   1 
ATOM 7398  C CB  . GLN C 1 99  ? -47.292  57.296  -40.906  1.00 211.05 ? 68  GLN C CB  1 
ATOM 7399  N N   . ARG C 1 100 ? -47.916  57.996  -37.540  1.00 213.37 ? 69  ARG C N   1 
ATOM 7400  C CA  . ARG C 1 100 ? -48.615  57.458  -36.360  1.00 213.08 ? 69  ARG C CA  1 
ATOM 7401  C C   . ARG C 1 100 ? -50.064  58.004  -36.294  1.00 212.71 ? 69  ARG C C   1 
ATOM 7402  O O   . ARG C 1 100 ? -50.263  59.192  -35.994  1.00 214.18 ? 69  ARG C O   1 
ATOM 7403  C CB  . ARG C 1 100 ? -47.839  57.788  -35.074  1.00 214.58 ? 69  ARG C CB  1 
ATOM 7404  N N   . PRO C 1 101 ? -51.079  57.141  -36.562  1.00 210.91 ? 70  PRO C N   1 
ATOM 7405  C CA  . PRO C 1 101 ? -52.467  57.620  -36.717  1.00 210.30 ? 70  PRO C CA  1 
ATOM 7406  C C   . PRO C 1 101 ? -53.066  58.141  -35.400  1.00 211.31 ? 70  PRO C C   1 
ATOM 7407  O O   . PRO C 1 101 ? -53.223  57.366  -34.451  1.00 211.06 ? 70  PRO C O   1 
ATOM 7408  C CB  . PRO C 1 101 ? -53.227  56.383  -37.216  1.00 208.18 ? 70  PRO C CB  1 
ATOM 7409  C CG  . PRO C 1 101 ? -52.225  55.258  -37.263  1.00 207.81 ? 70  PRO C CG  1 
ATOM 7410  C CD  . PRO C 1 101 ? -51.012  55.670  -36.513  1.00 209.44 ? 70  PRO C CD  1 
ATOM 7411  N N   . PRO C 1 102 ? -53.403  59.450  -35.347  1.00 212.62 ? 71  PRO C N   1 
ATOM 7412  C CA  . PRO C 1 102 ? -53.747  60.144  -34.099  1.00 213.96 ? 71  PRO C CA  1 
ATOM 7413  C C   . PRO C 1 102 ? -55.219  60.023  -33.664  1.00 213.22 ? 71  PRO C C   1 
ATOM 7414  O O   . PRO C 1 102 ? -56.104  59.815  -34.500  1.00 211.84 ? 71  PRO C O   1 
ATOM 7415  C CB  . PRO C 1 102 ? -53.381  61.600  -34.407  1.00 215.68 ? 71  PRO C CB  1 
ATOM 7416  C CG  . PRO C 1 102 ? -53.533  61.732  -35.900  1.00 214.89 ? 71  PRO C CG  1 
ATOM 7417  C CD  . PRO C 1 102 ? -53.520  60.347  -36.513  1.00 212.94 ? 71  PRO C CD  1 
ATOM 7418  N N   . GLU C 1 103 ? -55.453  60.171  -32.358  1.00 214.22 ? 72  GLU C N   1 
ATOM 7419  C CA  . GLU C 1 103 ? -56.752  59.893  -31.722  1.00 213.78 ? 72  GLU C CA  1 
ATOM 7420  C C   . GLU C 1 103 ? -57.764  61.049  -31.770  1.00 214.67 ? 72  GLU C C   1 
ATOM 7421  O O   . GLU C 1 103 ? -58.666  61.136  -30.923  1.00 215.11 ? 72  GLU C O   1 
ATOM 7422  C CB  . GLU C 1 103 ? -56.543  59.429  -30.273  1.00 214.54 ? 72  GLU C CB  1 
ATOM 7423  N N   . ASP C 1 104 ? -57.618  61.917  -32.769  1.00 215.01 ? 73  ASP C N   1 
ATOM 7424  C CA  . ASP C 1 104 ? -58.540  63.037  -32.981  1.00 215.95 ? 73  ASP C CA  1 
ATOM 7425  C C   . ASP C 1 104 ? -59.203  62.999  -34.372  1.00 214.49 ? 73  ASP C C   1 
ATOM 7426  O O   . ASP C 1 104 ? -60.357  63.420  -34.536  1.00 214.30 ? 73  ASP C O   1 
ATOM 7427  C CB  . ASP C 1 104 ? -57.828  64.384  -32.730  1.00 218.36 ? 73  ASP C CB  1 
ATOM 7428  C CG  . ASP C 1 104 ? -56.461  64.484  -33.424  1.00 218.76 ? 73  ASP C CG  1 
ATOM 7429  O OD1 . ASP C 1 104 ? -55.704  63.486  -33.437  1.00 217.72 ? 73  ASP C OD1 1 
ATOM 7430  O OD2 . ASP C 1 104 ? -56.140  65.578  -33.946  1.00 220.25 ? 73  ASP C OD2 1 
ATOM 7431  N N   . SER C 1 105 ? -58.461  62.476  -35.354  1.00 213.41 ? 74  SER C N   1 
ATOM 7432  C CA  . SER C 1 105 ? -58.902  62.375  -36.754  1.00 212.15 ? 74  SER C CA  1 
ATOM 7433  C C   . SER C 1 105 ? -60.111  61.447  -36.934  1.00 210.42 ? 74  SER C C   1 
ATOM 7434  O O   . SER C 1 105 ? -60.911  61.633  -37.855  1.00 209.89 ? 74  SER C O   1 
ATOM 7435  C CB  . SER C 1 105 ? -57.753  61.871  -37.647  1.00 211.46 ? 74  SER C CB  1 
ATOM 7436  O OG  . SER C 1 105 ? -56.527  62.533  -37.382  1.00 212.71 ? 74  SER C OG  1 
ATOM 7437  N N   . ILE C 1 106 ? -60.219  60.447  -36.056  1.00 209.65 ? 75  ILE C N   1 
ATOM 7438  C CA  . ILE C 1 106 ? -61.243  59.395  -36.135  1.00 207.71 ? 75  ILE C CA  1 
ATOM 7439  C C   . ILE C 1 106 ? -62.091  59.380  -34.859  1.00 208.31 ? 75  ILE C C   1 
ATOM 7440  O O   . ILE C 1 106 ? -61.562  59.448  -33.746  1.00 209.29 ? 75  ILE C O   1 
ATOM 7441  C CB  . ILE C 1 106 ? -60.599  57.995  -36.384  1.00 206.09 ? 75  ILE C CB  1 
ATOM 7442  C CG1 . ILE C 1 106 ? -59.679  58.031  -37.613  1.00 205.55 ? 75  ILE C CG1 1 
ATOM 7443  C CG2 . ILE C 1 106 ? -61.665  56.922  -36.557  1.00 204.11 ? 75  ILE C CG2 1 
ATOM 7444  C CD1 . ILE C 1 106 ? -58.348  57.312  -37.423  1.00 205.03 ? 75  ILE C CD1 1 
ATOM 7445  N N   . GLN C 1 107 ? -63.408  59.298  -35.035  1.00 207.82 ? 76  GLN C N   1 
ATOM 7446  C CA  . GLN C 1 107 ? -64.366  59.375  -33.925  1.00 208.71 ? 76  GLN C CA  1 
ATOM 7447  C C   . GLN C 1 107 ? -65.355  58.195  -33.948  1.00 207.26 ? 76  GLN C C   1 
ATOM 7448  O O   . GLN C 1 107 ? -65.695  57.705  -35.027  1.00 205.87 ? 76  GLN C O   1 
ATOM 7449  C CB  . GLN C 1 107 ? -65.136  60.703  -33.994  1.00 210.11 ? 76  GLN C CB  1 
ATOM 7450  C CG  . GLN C 1 107 ? -64.281  61.954  -33.790  1.00 211.63 ? 76  GLN C CG  1 
ATOM 7451  C CD  . GLN C 1 107 ? -64.872  63.184  -34.455  1.00 211.99 ? 76  GLN C CD  1 
ATOM 7452  O OE1 . GLN C 1 107 ? -65.133  63.195  -35.660  1.00 210.56 ? 76  GLN C OE1 1 
ATOM 7453  N NE2 . GLN C 1 107 ? -65.070  64.235  -33.672  1.00 213.85 ? 76  GLN C NE2 1 
ATOM 7454  N N   . PRO C 1 108 ? -65.825  57.734  -32.763  1.00 207.75 ? 77  PRO C N   1 
ATOM 7455  C CA  . PRO C 1 108 ? -66.854  56.690  -32.781  1.00 206.51 ? 77  PRO C CA  1 
ATOM 7456  C C   . PRO C 1 108 ? -68.137  57.201  -33.422  1.00 206.65 ? 77  PRO C C   1 
ATOM 7457  O O   . PRO C 1 108 ? -68.541  58.335  -33.147  1.00 208.10 ? 77  PRO C O   1 
ATOM 7458  C CB  . PRO C 1 108 ? -67.091  56.400  -31.292  1.00 207.42 ? 77  PRO C CB  1 
ATOM 7459  C CG  . PRO C 1 108 ? -66.589  57.604  -30.569  1.00 209.45 ? 77  PRO C CG  1 
ATOM 7460  C CD  . PRO C 1 108 ? -65.435  58.094  -31.386  1.00 209.45 ? 77  PRO C CD  1 
ATOM 7461  N N   . TYR C 1 109 ? -68.758  56.386  -34.279  1.00 205.40 ? 78  TYR C N   1 
ATOM 7462  C CA  . TYR C 1 109 ? -70.079  56.710  -34.834  1.00 205.74 ? 78  TYR C CA  1 
ATOM 7463  C C   . TYR C 1 109 ? -71.097  56.778  -33.688  1.00 207.19 ? 78  TYR C C   1 
ATOM 7464  O O   . TYR C 1 109 ? -72.314  56.749  -33.910  1.00 207.09 ? 78  TYR C O   1 
ATOM 7465  C CB  . TYR C 1 109 ? -70.511  55.696  -35.905  1.00 203.47 ? 78  TYR C CB  1 
ATOM 7466  N N   . GLU C 1 110 ? -70.562  56.879  -32.468  1.00 208.94 ? 79  GLU C N   1 
ATOM 7467  C CA  . GLU C 1 110 ? -71.325  56.998  -31.224  1.00 210.76 ? 79  GLU C CA  1 
ATOM 7468  C C   . GLU C 1 110 ? -71.356  58.441  -30.719  1.00 213.11 ? 79  GLU C C   1 
ATOM 7469  O O   . GLU C 1 110 ? -72.402  58.925  -30.272  1.00 214.27 ? 79  GLU C O   1 
ATOM 7470  C CB  . GLU C 1 110 ? -70.701  56.130  -30.133  1.00 210.97 ? 79  GLU C CB  1 
ATOM 7471  C CG  . GLU C 1 110 ? -70.443  54.688  -30.516  1.00 209.77 ? 79  GLU C CG  1 
ATOM 7472  C CD  . GLU C 1 110 ? -69.908  53.882  -29.348  1.00 211.16 ? 79  GLU C CD  1 
ATOM 7473  O OE1 . GLU C 1 110 ? -68.876  54.285  -28.761  1.00 212.50 ? 79  GLU C OE1 1 
ATOM 7474  O OE2 . GLU C 1 110 ? -70.523  52.844  -29.014  1.00 211.01 ? 79  GLU C OE2 1 
ATOM 7475  N N   . LYS C 1 111 ? -70.199  59.106  -30.768  1.00 214.02 ? 80  LYS C N   1 
ATOM 7476  C CA  . LYS C 1 111 ? -70.089  60.517  -30.398  1.00 216.34 ? 80  LYS C CA  1 
ATOM 7477  C C   . LYS C 1 111 ? -71.003  61.380  -31.279  1.00 216.82 ? 80  LYS C C   1 
ATOM 7478  O O   . LYS C 1 111 ? -71.451  62.450  -30.858  1.00 218.77 ? 80  LYS C O   1 
ATOM 7479  C CB  . LYS C 1 111 ? -68.634  60.990  -30.491  1.00 216.73 ? 80  LYS C CB  1 
ATOM 7480  N N   . ILE C 1 112 ? -71.295  60.882  -32.484  1.00 215.26 ? 81  ILE C N   1 
ATOM 7481  C CA  . ILE C 1 112 ? -72.116  61.591  -33.485  1.00 215.55 ? 81  ILE C CA  1 
ATOM 7482  C C   . ILE C 1 112 ? -73.635  61.311  -33.371  1.00 215.52 ? 81  ILE C C   1 
ATOM 7483  O O   . ILE C 1 112 ? -74.454  62.207  -33.610  1.00 216.68 ? 81  ILE C O   1 
ATOM 7484  C CB  . ILE C 1 112 ? -71.627  61.319  -34.951  1.00 213.87 ? 81  ILE C CB  1 
ATOM 7485  C CG1 . ILE C 1 112 ? -70.168  60.843  -34.978  1.00 212.82 ? 81  ILE C CG1 1 
ATOM 7486  C CG2 . ILE C 1 112 ? -71.817  62.570  -35.824  1.00 215.00 ? 81  ILE C CG2 1 
ATOM 7487  C CD1 . ILE C 1 112 ? -69.727  60.266  -36.306  1.00 210.67 ? 81  ILE C CD1 1 
ATOM 7488  N N   . LYS C 1 113 ? -73.994  60.074  -33.011  1.00 214.32 ? 82  LYS C N   1 
ATOM 7489  C CA  . LYS C 1 113 ? -75.394  59.678  -32.792  1.00 214.30 ? 82  LYS C CA  1 
ATOM 7490  C C   . LYS C 1 113 ? -75.917  60.083  -31.400  1.00 216.49 ? 82  LYS C C   1 
ATOM 7491  O O   . LYS C 1 113 ? -77.000  59.650  -30.978  1.00 216.63 ? 82  LYS C O   1 
ATOM 7492  C CB  . LYS C 1 113 ? -75.575  58.173  -33.027  1.00 212.02 ? 82  LYS C CB  1 
ATOM 7493  N N   . ALA C 1 114 ? -75.131  60.906  -30.698  1.00 218.35 ? 83  ALA C N   1 
ATOM 7494  C CA  . ALA C 1 114 ? -75.537  61.528  -29.436  1.00 220.73 ? 83  ALA C CA  1 
ATOM 7495  C C   . ALA C 1 114 ? -75.588  63.056  -29.581  1.00 222.92 ? 83  ALA C C   1 
ATOM 7496  O O   . ALA C 1 114 ? -76.235  63.740  -28.779  1.00 225.02 ? 83  ALA C O   1 
ATOM 7497  C CB  . ALA C 1 114 ? -74.587  61.122  -28.314  1.00 221.07 ? 83  ALA C CB  1 
ATOM 7498  N N   . ARG C 1 115 ? -74.916  63.567  -30.620  1.00 222.55 ? 84  ARG C N   1 
ATOM 7499  C CA  . ARG C 1 115 ? -74.815  65.008  -30.908  1.00 224.49 ? 84  ARG C CA  1 
ATOM 7500  C C   . ARG C 1 115 ? -76.166  65.747  -30.974  1.00 226.00 ? 84  ARG C C   1 
ATOM 7501  O O   . ARG C 1 115 ? -76.331  66.764  -30.292  1.00 228.49 ? 84  ARG C O   1 
ATOM 7502  C CB  . ARG C 1 115 ? -73.986  65.265  -32.178  1.00 223.33 ? 84  ARG C CB  1 
ATOM 7503  N N   . GLY C 1 116 ? -77.132  65.256  -31.760  1.00 224.70 ? 85  GLY C N   1 
ATOM 7504  C CA  . GLY C 1 116 ? -77.006  64.043  -32.566  1.00 221.93 ? 85  GLY C CA  1 
ATOM 7505  C C   . GLY C 1 116 ? -77.805  64.040  -33.854  1.00 221.04 ? 85  GLY C C   1 
ATOM 7506  O O   . GLY C 1 116 ? -77.468  63.317  -34.789  1.00 219.06 ? 85  GLY C O   1 
ATOM 7507  N N   . LEU C 1 117 ? -78.857  64.849  -33.916  1.00 222.65 ? 86  LEU C N   1 
ATOM 7508  C CA  . LEU C 1 117 ? -79.772  64.815  -35.057  1.00 221.96 ? 86  LEU C CA  1 
ATOM 7509  C C   . LEU C 1 117 ? -80.015  66.206  -35.681  1.00 223.89 ? 86  LEU C C   1 
ATOM 7510  O O   . LEU C 1 117 ? -80.283  67.176  -34.958  1.00 226.24 ? 86  LEU C O   1 
ATOM 7511  C CB  . LEU C 1 117 ? -81.090  64.154  -34.633  1.00 221.70 ? 86  LEU C CB  1 
ATOM 7512  C CG  . LEU C 1 117 ? -81.855  63.279  -35.626  1.00 219.36 ? 86  LEU C CG  1 
ATOM 7513  C CD1 . LEU C 1 117 ? -82.496  62.117  -34.880  1.00 217.96 ? 86  LEU C CD1 1 
ATOM 7514  C CD2 . LEU C 1 117 ? -82.894  64.094  -36.398  1.00 219.86 ? 86  LEU C CD2 1 
ATOM 7515  N N   . PRO C 1 118 ? -79.897  66.308  -37.028  1.00 222.97 ? 87  PRO C N   1 
ATOM 7516  C CA  . PRO C 1 118 ? -80.212  67.556  -37.730  1.00 224.59 ? 87  PRO C CA  1 
ATOM 7517  C C   . PRO C 1 118 ? -81.679  67.631  -38.198  1.00 224.82 ? 87  PRO C C   1 
ATOM 7518  O O   . PRO C 1 118 ? -81.970  67.506  -39.398  1.00 223.88 ? 87  PRO C O   1 
ATOM 7519  C CB  . PRO C 1 118 ? -79.238  67.545  -38.921  1.00 223.45 ? 87  PRO C CB  1 
ATOM 7520  C CG  . PRO C 1 118 ? -78.857  66.091  -39.126  1.00 220.57 ? 87  PRO C CG  1 
ATOM 7521  C CD  . PRO C 1 118 ? -79.355  65.286  -37.949  1.00 220.37 ? 87  PRO C CD  1 
ATOM 7522  N N   . ASP C 1 119 ? -82.589  67.830  -37.245  1.00 226.04 ? 88  ASP C N   1 
ATOM 7523  C CA  . ASP C 1 119 ? -84.001  68.011  -37.560  1.00 226.54 ? 88  ASP C CA  1 
ATOM 7524  C C   . ASP C 1 119 ? -84.201  69.315  -38.349  1.00 228.08 ? 88  ASP C C   1 
ATOM 7525  O O   . ASP C 1 119 ? -83.525  70.309  -38.083  1.00 229.74 ? 88  ASP C O   1 
ATOM 7526  C CB  . ASP C 1 119 ? -84.876  67.957  -36.286  1.00 228.08 ? 88  ASP C CB  1 
ATOM 7527  C CG  . ASP C 1 119 ? -84.970  69.303  -35.555  1.00 231.54 ? 88  ASP C CG  1 
ATOM 7528  O OD1 . ASP C 1 119 ? -83.919  69.884  -35.203  1.00 232.85 ? 88  ASP C OD1 1 
ATOM 7529  O OD2 . ASP C 1 119 ? -86.107  69.771  -35.314  1.00 233.42 ? 88  ASP C OD2 1 
ATOM 7530  N N   . ASN C 1 120 ? -85.078  69.303  -39.351  1.00 227.42 ? 89  ASN C N   1 
ATOM 7531  C CA  . ASN C 1 120 ? -85.766  68.096  -39.813  1.00 224.93 ? 89  ASN C CA  1 
ATOM 7532  C C   . ASN C 1 120 ? -85.852  68.026  -41.345  1.00 223.42 ? 89  ASN C C   1 
ATOM 7533  O O   . ASN C 1 120 ? -85.067  67.312  -41.979  1.00 221.20 ? 89  ASN C O   1 
ATOM 7534  C CB  . ASN C 1 120 ? -87.150  67.914  -39.134  1.00 226.02 ? 89  ASN C CB  1 
ATOM 7535  C CG  . ASN C 1 120 ? -87.804  69.241  -38.713  1.00 229.44 ? 89  ASN C CG  1 
ATOM 7536  O OD1 . ASN C 1 120 ? -88.365  69.968  -39.537  1.00 231.05 ? 89  ASN C OD1 1 
ATOM 7537  N ND2 . ASN C 1 120 ? -87.758  69.536  -37.416  1.00 230.97 ? 89  ASN C ND2 1 
ATOM 7538  N N   . ILE C 1 121 ? -86.796  68.782  -41.916  1.00 224.49 ? 90  ILE C N   1 
ATOM 7539  C CA  . ILE C 1 121 ? -87.033  68.857  -43.367  1.00 223.29 ? 90  ILE C CA  1 
ATOM 7540  C C   . ILE C 1 121 ? -86.160  69.961  -44.012  1.00 224.02 ? 90  ILE C C   1 
ATOM 7541  O O   . ILE C 1 121 ? -86.388  71.157  -43.788  1.00 226.51 ? 90  ILE C O   1 
ATOM 7542  C CB  . ILE C 1 121 ? -88.592  68.993  -43.717  1.00 224.32 ? 90  ILE C CB  1 
ATOM 7543  C CG1 . ILE C 1 121 ? -88.861  68.829  -45.226  1.00 223.22 ? 90  ILE C CG1 1 
ATOM 7544  C CG2 . ILE C 1 121 ? -89.216  70.291  -43.136  1.00 227.17 ? 90  ILE C CG2 1 
ATOM 7545  C CD1 . ILE C 1 121 ? -90.329  68.604  -45.596  1.00 222.76 ? 90  ILE C CD1 1 
ATOM 7546  N N   . SER C 1 122 ? -85.144  69.568  -44.783  1.00 221.60 ? 91  SER C N   1 
ATOM 7547  C CA  . SER C 1 122 ? -84.784  68.162  -45.012  1.00 217.96 ? 91  SER C CA  1 
ATOM 7548  C C   . SER C 1 122 ? -83.358  67.780  -44.560  1.00 216.27 ? 91  SER C C   1 
ATOM 7549  O O   . SER C 1 122 ? -83.158  66.663  -44.083  1.00 214.29 ? 91  SER C O   1 
ATOM 7550  C CB  . SER C 1 122 ? -85.019  67.763  -46.478  1.00 216.82 ? 91  SER C CB  1 
ATOM 7551  O OG  . SER C 1 122 ? -84.302  68.596  -47.378  1.00 217.57 ? 91  SER C OG  1 
ATOM 7552  N N   . SER C 1 123 ? -82.371  68.674  -44.697  1.00 216.66 ? 92  SER C N   1 
ATOM 7553  C CA  . SER C 1 123 ? -82.537  70.027  -45.260  1.00 218.15 ? 92  SER C CA  1 
ATOM 7554  C C   . SER C 1 123 ? -81.849  70.330  -46.619  1.00 217.42 ? 92  SER C C   1 
ATOM 7555  O O   . SER C 1 123 ? -82.554  70.773  -47.525  1.00 218.03 ? 92  SER C O   1 
ATOM 7556  C CB  . SER C 1 123 ? -82.245  71.124  -44.216  1.00 220.55 ? 92  SER C CB  1 
ATOM 7557  O OG  . SER C 1 123 ? -83.043  70.961  -43.054  1.00 220.83 ? 92  SER C OG  1 
ATOM 7558  N N   . VAL C 1 124 ? -80.546  70.086  -46.845  1.00 215.87 ? 93  VAL C N   1 
ATOM 7559  C CA  . VAL C 1 124 ? -79.578  69.203  -46.131  1.00 213.68 ? 93  VAL C CA  1 
ATOM 7560  C C   . VAL C 1 124 ? -79.647  67.756  -46.648  1.00 210.45 ? 93  VAL C C   1 
ATOM 7561  O O   . VAL C 1 124 ? -78.626  67.182  -47.036  1.00 208.97 ? 93  VAL C O   1 
ATOM 7562  C CB  . VAL C 1 124 ? -79.540  69.332  -44.561  1.00 214.62 ? 93  VAL C CB  1 
ATOM 7563  C CG1 . VAL C 1 124 ? -78.760  68.182  -43.923  1.00 212.53 ? 93  VAL C CG1 1 
ATOM 7564  C CG2 . VAL C 1 124 ? -78.938  70.681  -44.141  1.00 217.13 ? 93  VAL C CG2 1 
ATOM 7565  N N   . LEU C 1 125 ? -80.848  67.183  -46.674  1.00 209.21 ? 94  LEU C N   1 
ATOM 7566  C CA  . LEU C 1 125 ? -81.083  65.933  -47.399  1.00 206.36 ? 94  LEU C CA  1 
ATOM 7567  C C   . LEU C 1 125 ? -81.278  66.225  -48.892  1.00 206.11 ? 94  LEU C C   1 
ATOM 7568  O O   . LEU C 1 125 ? -81.344  65.295  -49.706  1.00 204.29 ? 94  LEU C O   1 
ATOM 7569  C CB  . LEU C 1 125 ? -82.296  65.184  -46.835  1.00 205.54 ? 94  LEU C CB  1 
ATOM 7570  N N   . ASN C 1 126 ? -81.358  67.520  -49.230  1.00 207.73 ? 95  ASN C N   1 
ATOM 7571  C CA  . ASN C 1 126 ? -81.605  67.998  -50.603  1.00 207.71 ? 95  ASN C CA  1 
ATOM 7572  C C   . ASN C 1 126 ? -80.313  68.298  -51.400  1.00 207.40 ? 95  ASN C C   1 
ATOM 7573  O O   . ASN C 1 126 ? -80.207  67.928  -52.576  1.00 206.58 ? 95  ASN C O   1 
ATOM 7574  C CB  . ASN C 1 126 ? -82.551  69.221  -50.592  1.00 210.08 ? 95  ASN C CB  1 
ATOM 7575  C CG  . ASN C 1 126 ? -83.476  69.283  -51.821  1.00 209.92 ? 95  ASN C CG  1 
ATOM 7576  O OD1 . ASN C 1 126 ? -83.508  68.369  -52.647  1.00 207.39 ? 95  ASN C OD1 1 
ATOM 7577  N ND2 . ASN C 1 126 ? -84.241  70.367  -51.929  1.00 211.86 ? 95  ASN C ND2 1 
ATOM 7578  N N   . LYS C 1 127 ? -79.336  68.946  -50.757  1.00 207.78 ? 96  LYS C N   1 
ATOM 7579  C CA  . LYS C 1 127 ? -78.077  69.330  -51.419  1.00 207.37 ? 96  LYS C CA  1 
ATOM 7580  C C   . LYS C 1 127 ? -77.080  68.165  -51.575  1.00 204.64 ? 96  LYS C C   1 
ATOM 7581  O O   . LYS C 1 127 ? -75.875  68.385  -51.727  1.00 204.76 ? 96  LYS C O   1 
ATOM 7582  C CB  . LYS C 1 127 ? -77.427  70.514  -50.688  1.00 209.47 ? 96  LYS C CB  1 
ATOM 7583  N N   . LEU C 1 128 ? -77.594  66.935  -51.550  1.00 201.99 ? 97  LEU C N   1 
ATOM 7584  C CA  . LEU C 1 128 ? -76.772  65.725  -51.677  1.00 199.30 ? 97  LEU C CA  1 
ATOM 7585  C C   . LEU C 1 128 ? -77.200  64.819  -52.845  1.00 197.26 ? 97  LEU C C   1 
ATOM 7586  O O   . LEU C 1 128 ? -78.393  64.575  -53.057  1.00 196.93 ? 97  LEU C O   1 
ATOM 7587  C CB  . LEU C 1 128 ? -76.756  64.934  -50.352  1.00 198.28 ? 97  LEU C CB  1 
ATOM 7588  C CG  . LEU C 1 128 ? -76.308  63.456  -50.287  1.00 195.98 ? 97  LEU C CG  1 
ATOM 7589  C CD1 . LEU C 1 128 ? -74.836  63.244  -50.645  1.00 195.35 ? 97  LEU C CD1 1 
ATOM 7590  C CD2 . LEU C 1 128 ? -76.592  62.867  -48.914  1.00 195.35 ? 97  LEU C CD2 1 
ATOM 7591  N N   . VAL C 1 129 ? -76.204  64.335  -53.589  1.00 195.62 ? 98  VAL C N   1 
ATOM 7592  C CA  . VAL C 1 129 ? -76.399  63.334  -54.636  1.00 193.17 ? 98  VAL C CA  1 
ATOM 7593  C C   . VAL C 1 129 ? -75.580  62.081  -54.324  1.00 190.60 ? 98  VAL C C   1 
ATOM 7594  O O   . VAL C 1 129 ? -74.465  62.165  -53.791  1.00 190.65 ? 98  VAL C O   1 
ATOM 7595  C CB  . VAL C 1 129 ? -76.008  63.874  -56.024  1.00 194.14 ? 98  VAL C CB  1 
ATOM 7596  N N   . VAL C 1 130 ? -76.145  60.925  -54.666  1.00 188.01 ? 99  VAL C N   1 
ATOM 7597  C CA  . VAL C 1 130 ? -75.563  59.623  -54.331  1.00 185.20 ? 99  VAL C CA  1 
ATOM 7598  C C   . VAL C 1 130 ? -75.008  58.927  -55.573  1.00 183.55 ? 99  VAL C C   1 
ATOM 7599  O O   . VAL C 1 130 ? -75.660  58.892  -56.619  1.00 183.52 ? 99  VAL C O   1 
ATOM 7600  C CB  . VAL C 1 130 ? -76.610  58.699  -53.634  1.00 184.03 ? 99  VAL C CB  1 
ATOM 7601  C CG1 . VAL C 1 130 ? -75.992  57.372  -53.219  1.00 182.26 ? 99  VAL C CG1 1 
ATOM 7602  C CG2 . VAL C 1 130 ? -77.220  59.391  -52.421  1.00 185.14 ? 99  VAL C CG2 1 
ATOM 7603  N N   . VAL C 1 131 ? -73.799  58.383  -55.447  1.00 181.91 ? 100 VAL C N   1 
ATOM 7604  C CA  . VAL C 1 131 ? -73.181  57.591  -56.510  1.00 180.10 ? 100 VAL C CA  1 
ATOM 7605  C C   . VAL C 1 131 ? -73.019  56.149  -56.047  1.00 177.64 ? 100 VAL C C   1 
ATOM 7606  O O   . VAL C 1 131 ? -72.759  55.889  -54.871  1.00 177.23 ? 100 VAL C O   1 
ATOM 7607  C CB  . VAL C 1 131 ? -71.797  58.156  -56.931  1.00 181.14 ? 100 VAL C CB  1 
ATOM 7608  C CG1 . VAL C 1 131 ? -71.203  57.360  -58.097  1.00 180.13 ? 100 VAL C CG1 1 
ATOM 7609  C CG2 . VAL C 1 131 ? -71.913  59.619  -57.306  1.00 183.16 ? 100 VAL C CG2 1 
ATOM 7610  N N   . LYS C 1 132 ? -73.189  55.216  -56.975  1.00 175.76 ? 101 LYS C N   1 
ATOM 7611  C CA  . LYS C 1 132 ? -72.860  53.827  -56.725  1.00 173.43 ? 101 LYS C CA  1 
ATOM 7612  C C   . LYS C 1 132 ? -71.906  53.350  -57.806  1.00 173.18 ? 101 LYS C C   1 
ATOM 7613  O O   . LYS C 1 132 ? -72.137  53.595  -58.994  1.00 173.56 ? 101 LYS C O   1 
ATOM 7614  C CB  . LYS C 1 132 ? -74.123  52.966  -56.711  1.00 172.08 ? 101 LYS C CB  1 
ATOM 7615  C CG  . LYS C 1 132 ? -75.017  53.157  -55.493  1.00 171.03 ? 101 LYS C CG  1 
ATOM 7616  C CD  . LYS C 1 132 ? -74.686  52.180  -54.380  1.00 168.48 ? 101 LYS C CD  1 
ATOM 7617  C CE  . LYS C 1 132 ? -75.582  52.400  -53.179  1.00 167.63 ? 101 LYS C CE  1 
ATOM 7618  N NZ  . LYS C 1 132 ? -75.053  51.737  -51.964  1.00 166.46 ? 101 LYS C NZ  1 
ATOM 7619  N N   . LEU C 1 133 ? -70.823  52.695  -57.389  1.00 172.48 ? 102 LEU C N   1 
ATOM 7620  C CA  . LEU C 1 133 ? -69.908  52.042  -58.323  1.00 172.27 ? 102 LEU C CA  1 
ATOM 7621  C C   . LEU C 1 133 ? -70.612  50.884  -59.007  1.00 171.09 ? 102 LEU C C   1 
ATOM 7622  O O   . LEU C 1 133 ? -71.417  50.206  -58.378  1.00 170.37 ? 102 LEU C O   1 
ATOM 7623  C CB  . LEU C 1 133 ? -68.676  51.539  -57.587  1.00 171.98 ? 102 LEU C CB  1 
ATOM 7624  C CG  . LEU C 1 133 ? -67.413  52.334  -57.906  1.00 173.64 ? 102 LEU C CG  1 
ATOM 7625  C CD1 . LEU C 1 133 ? -66.463  52.369  -56.715  1.00 174.16 ? 102 LEU C CD1 1 
ATOM 7626  C CD2 . LEU C 1 133 ? -66.730  51.760  -59.152  1.00 174.04 ? 102 LEU C CD2 1 
ATOM 7627  N N   . ASN C 1 134 ? -70.330  50.652  -60.285  1.00 171.11 ? 103 ASN C N   1 
ATOM 7628  C CA  . ASN C 1 134 ? -71.093  49.639  -61.010  1.00 170.03 ? 103 ASN C CA  1 
ATOM 7629  C C   . ASN C 1 134 ? -70.275  48.700  -61.893  1.00 169.82 ? 103 ASN C C   1 
ATOM 7630  O O   . ASN C 1 134 ? -70.700  47.578  -62.165  1.00 168.97 ? 103 ASN C O   1 
ATOM 7631  C CB  . ASN C 1 134 ? -72.233  50.292  -61.808  1.00 170.44 ? 103 ASN C CB  1 
ATOM 7632  C CG  . ASN C 1 134 ? -73.249  49.278  -62.334  1.00 169.28 ? 103 ASN C CG  1 
ATOM 7633  O OD1 . ASN C 1 134 ? -73.471  48.228  -61.737  1.00 167.87 ? 103 ASN C OD1 1 
ATOM 7634  N ND2 . ASN C 1 134 ? -73.875  49.601  -63.455  1.00 169.98 ? 103 ASN C ND2 1 
ATOM 7635  N N   . GLY C 1 135 ? -69.094  49.145  -62.307  1.00 170.75 ? 104 GLY C N   1 
ATOM 7636  C CA  . GLY C 1 135 ? -68.325  48.463  -63.359  1.00 170.82 ? 104 GLY C CA  1 
ATOM 7637  C C   . GLY C 1 135 ? -67.869  47.023  -63.158  1.00 169.47 ? 104 GLY C C   1 
ATOM 7638  O O   . GLY C 1 135 ? -66.873  46.600  -63.760  1.00 169.94 ? 104 GLY C O   1 
ATOM 7639  N N   . GLY C 1 136 ? -68.599  46.272  -62.335  1.00 167.84 ? 105 GLY C N   1 
ATOM 7640  C CA  . GLY C 1 136 ? -68.257  44.888  -62.039  1.00 166.58 ? 105 GLY C CA  1 
ATOM 7641  C C   . GLY C 1 136 ? -69.134  43.876  -62.746  1.00 165.54 ? 105 GLY C C   1 
ATOM 7642  O O   . GLY C 1 136 ? -70.355  43.903  -62.606  1.00 164.94 ? 105 GLY C O   1 
ATOM 7643  N N   . LEU C 1 137 ? -68.504  42.989  -63.514  1.00 165.44 ? 106 LEU C N   1 
ATOM 7644  C CA  . LEU C 1 137 ? -69.173  41.820  -64.086  1.00 164.52 ? 106 LEU C CA  1 
ATOM 7645  C C   . LEU C 1 137 ? -69.510  40.786  -62.995  1.00 163.31 ? 106 LEU C C   1 
ATOM 7646  O O   . LEU C 1 137 ? -68.694  40.523  -62.102  1.00 163.59 ? 106 LEU C O   1 
ATOM 7647  C CB  . LEU C 1 137 ? -68.262  41.140  -65.115  1.00 165.12 ? 106 LEU C CB  1 
ATOM 7648  C CG  . LEU C 1 137 ? -68.115  41.530  -66.587  1.00 165.58 ? 106 LEU C CG  1 
ATOM 7649  C CD1 . LEU C 1 137 ? -67.084  40.586  -67.190  1.00 165.56 ? 106 LEU C CD1 1 
ATOM 7650  C CD2 . LEU C 1 137 ? -69.436  41.391  -67.337  1.00 165.05 ? 106 LEU C CD2 1 
ATOM 7651  N N   . GLY C 1 138 ? -70.691  40.181  -63.079  1.00 162.08 ? 107 GLY C N   1 
ATOM 7652  C CA  . GLY C 1 138 ? -71.051  39.112  -62.160  1.00 160.57 ? 107 GLY C CA  1 
ATOM 7653  C C   . GLY C 1 138 ? -70.620  37.765  -62.696  1.00 160.32 ? 107 GLY C C   1 
ATOM 7654  O O   . GLY C 1 138 ? -71.251  36.760  -62.388  1.00 159.61 ? 107 GLY C O   1 
ATOM 7655  N N   . THR C 1 139 ? -69.552  37.747  -63.501  1.00 161.16 ? 108 THR C N   1 
ATOM 7656  C CA  . THR C 1 139 ? -69.029  36.517  -64.131  1.00 161.22 ? 108 THR C CA  1 
ATOM 7657  C C   . THR C 1 139 ? -68.311  35.630  -63.130  1.00 161.02 ? 108 THR C C   1 
ATOM 7658  O O   . THR C 1 139 ? -68.081  34.445  -63.380  1.00 160.67 ? 108 THR C O   1 
ATOM 7659  C CB  . THR C 1 139 ? -68.056  36.812  -65.300  1.00 162.38 ? 108 THR C CB  1 
ATOM 7660  O OG1 . THR C 1 139 ? -67.122  37.829  -64.916  1.00 162.58 ? 108 THR C OG1 1 
ATOM 7661  C CG2 . THR C 1 139 ? -68.813  37.257  -66.543  1.00 162.91 ? 108 THR C CG2 1 
ATOM 7662  N N   . SER C 1 140 ? -67.966  36.232  -61.996  1.00 161.38 ? 109 SER C N   1 
ATOM 7663  C CA  . SER C 1 140 ? -67.278  35.567  -60.895  1.00 161.73 ? 109 SER C CA  1 
ATOM 7664  C C   . SER C 1 140 ? -68.182  34.539  -60.206  1.00 160.93 ? 109 SER C C   1 
ATOM 7665  O O   . SER C 1 140 ? -67.749  33.427  -59.875  1.00 160.90 ? 109 SER C O   1 
ATOM 7666  C CB  . SER C 1 140 ? -66.826  36.625  -59.889  1.00 161.89 ? 109 SER C CB  1 
ATOM 7667  O OG  . SER C 1 140 ? -65.476  36.409  -59.519  1.00 163.14 ? 109 SER C OG  1 
ATOM 7668  N N   . MET C 1 141 ? -69.439  34.945  -60.012  1.00 160.55 ? 110 MET C N   1 
ATOM 7669  C CA  . MET C 1 141 ? -70.516  34.150  -59.413  1.00 159.63 ? 110 MET C CA  1 
ATOM 7670  C C   . MET C 1 141 ? -71.194  33.250  -60.434  1.00 159.56 ? 110 MET C C   1 
ATOM 7671  O O   . MET C 1 141 ? -72.088  32.488  -60.091  1.00 158.78 ? 110 MET C O   1 
ATOM 7672  C CB  . MET C 1 141 ? -71.580  35.088  -58.854  1.00 159.07 ? 110 MET C CB  1 
ATOM 7673  C CG  . MET C 1 141 ? -71.042  36.176  -57.966  1.00 159.46 ? 110 MET C CG  1 
ATOM 7674  S SD  . MET C 1 141 ? -71.715  36.049  -56.318  1.00 158.79 ? 110 MET C SD  1 
ATOM 7675  C CE  . MET C 1 141 ? -72.844  37.433  -56.319  1.00 158.30 ? 110 MET C CE  1 
ATOM 7676  N N   . GLY C 1 142 ? -70.786  33.364  -61.692  1.00 160.61 ? 111 GLY C N   1 
ATOM 7677  C CA  . GLY C 1 142 ? -71.379  32.590  -62.771  1.00 161.18 ? 111 GLY C CA  1 
ATOM 7678  C C   . GLY C 1 142 ? -72.102  33.453  -63.789  1.00 161.89 ? 111 GLY C C   1 
ATOM 7679  O O   . GLY C 1 142 ? -72.018  33.197  -64.992  1.00 162.61 ? 111 GLY C O   1 
ATOM 7680  N N   . CYS C 1 143 ? -72.793  34.486  -63.313  1.00 161.99 ? 112 CYS C N   1 
ATOM 7681  C CA  . CYS C 1 143 ? -73.669  35.308  -64.161  1.00 162.83 ? 112 CYS C CA  1 
ATOM 7682  C C   . CYS C 1 143 ? -72.939  36.190  -65.182  1.00 163.83 ? 112 CYS C C   1 
ATOM 7683  O O   . CYS C 1 143 ? -72.513  37.305  -64.856  1.00 164.32 ? 112 CYS C O   1 
ATOM 7684  C CB  . CYS C 1 143 ? -74.577  36.190  -63.294  1.00 162.61 ? 112 CYS C CB  1 
ATOM 7685  S SG  . CYS C 1 143 ? -75.395  35.344  -61.912  1.00 163.11 ? 112 CYS C SG  1 
ATOM 7686  N N   . LYS C 1 144 ? -72.815  35.700  -66.416  1.00 164.30 ? 113 LYS C N   1 
ATOM 7687  C CA  . LYS C 1 144 ? -72.285  36.513  -67.514  1.00 165.32 ? 113 LYS C CA  1 
ATOM 7688  C C   . LYS C 1 144 ? -73.215  37.715  -67.766  1.00 165.32 ? 113 LYS C C   1 
ATOM 7689  O O   . LYS C 1 144 ? -74.131  37.653  -68.588  1.00 165.49 ? 113 LYS C O   1 
ATOM 7690  C CB  . LYS C 1 144 ? -72.074  35.666  -68.780  1.00 165.95 ? 113 LYS C CB  1 
ATOM 7691  N N   . GLY C 1 145 ? -72.965  38.792  -67.020  1.00 165.10 ? 114 GLY C N   1 
ATOM 7692  C CA  . GLY C 1 145 ? -73.779  40.010  -67.011  1.00 164.83 ? 114 GLY C CA  1 
ATOM 7693  C C   . GLY C 1 145 ? -73.206  40.926  -65.939  1.00 164.63 ? 114 GLY C C   1 
ATOM 7694  O O   . GLY C 1 145 ? -72.157  40.615  -65.372  1.00 164.73 ? 114 GLY C O   1 
ATOM 7695  N N   . PRO C 1 146 ? -73.866  42.066  -65.660  1.00 164.53 ? 115 PRO C N   1 
ATOM 7696  C CA  . PRO C 1 146 ? -73.428  42.957  -64.564  1.00 164.32 ? 115 PRO C CA  1 
ATOM 7697  C C   . PRO C 1 146 ? -73.871  42.443  -63.184  1.00 162.85 ? 115 PRO C C   1 
ATOM 7698  O O   . PRO C 1 146 ? -75.005  41.968  -63.043  1.00 162.29 ? 115 PRO C O   1 
ATOM 7699  C CB  . PRO C 1 146 ? -74.120  44.292  -64.887  1.00 165.13 ? 115 PRO C CB  1 
ATOM 7700  C CG  . PRO C 1 146 ? -74.666  44.139  -66.286  1.00 165.86 ? 115 PRO C CG  1 
ATOM 7701  C CD  . PRO C 1 146 ? -74.940  42.676  -66.457  1.00 165.00 ? 115 PRO C CD  1 
ATOM 7702  N N   . LYS C 1 147 ? -72.992  42.538  -62.180  1.00 162.15 ? 116 LYS C N   1 
ATOM 7703  C CA  . LYS C 1 147 ? -73.263  41.957  -60.856  1.00 160.50 ? 116 LYS C CA  1 
ATOM 7704  C C   . LYS C 1 147 ? -74.480  42.598  -60.236  1.00 159.97 ? 116 LYS C C   1 
ATOM 7705  O O   . LYS C 1 147 ? -75.166  41.980  -59.437  1.00 159.03 ? 116 LYS C O   1 
ATOM 7706  C CB  . LYS C 1 147 ? -72.058  42.074  -59.916  1.00 160.54 ? 116 LYS C CB  1 
ATOM 7707  N N   . SER C 1 148 ? -74.756  43.831  -60.645  1.00 160.68 ? 117 SER C N   1 
ATOM 7708  C CA  . SER C 1 148 ? -75.876  44.614  -60.123  1.00 160.94 ? 117 SER C CA  1 
ATOM 7709  C C   . SER C 1 148 ? -77.251  44.010  -60.414  1.00 160.28 ? 117 SER C C   1 
ATOM 7710  O O   . SER C 1 148 ? -78.258  44.418  -59.824  1.00 160.21 ? 117 SER C O   1 
ATOM 7711  C CB  . SER C 1 148 ? -75.808  46.040  -60.667  1.00 162.24 ? 117 SER C CB  1 
ATOM 7712  O OG  . SER C 1 148 ? -74.710  46.736  -60.102  1.00 163.12 ? 117 SER C OG  1 
ATOM 7713  N N   . LEU C 1 149 ? -77.278  43.032  -61.316  1.00 159.83 ? 118 LEU C N   1 
ATOM 7714  C CA  . LEU C 1 149 ? -78.519  42.389  -61.747  1.00 159.15 ? 118 LEU C CA  1 
ATOM 7715  C C   . LEU C 1 149 ? -78.520  40.900  -61.410  1.00 157.91 ? 118 LEU C C   1 
ATOM 7716  O O   . LEU C 1 149 ? -78.642  40.047  -62.288  1.00 157.69 ? 118 LEU C O   1 
ATOM 7717  C CB  . LEU C 1 149 ? -78.743  42.625  -63.243  1.00 159.72 ? 118 LEU C CB  1 
ATOM 7718  C CG  . LEU C 1 149 ? -78.765  44.114  -63.588  1.00 160.97 ? 118 LEU C CG  1 
ATOM 7719  C CD1 . LEU C 1 149 ? -77.969  44.386  -64.843  1.00 161.86 ? 118 LEU C CD1 1 
ATOM 7720  C CD2 . LEU C 1 149 ? -80.200  44.639  -63.689  1.00 162.05 ? 118 LEU C CD2 1 
ATOM 7721  N N   . ILE C 1 150 ? -78.363  40.600  -60.126  1.00 157.09 ? 119 ILE C N   1 
ATOM 7722  C CA  . ILE C 1 150 ? -78.434  39.230  -59.651  1.00 156.04 ? 119 ILE C CA  1 
ATOM 7723  C C   . ILE C 1 150 ? -79.552  39.159  -58.636  1.00 155.66 ? 119 ILE C C   1 
ATOM 7724  O O   . ILE C 1 150 ? -79.716  40.078  -57.835  1.00 156.01 ? 119 ILE C O   1 
ATOM 7725  C CB  . ILE C 1 150 ? -77.113  38.771  -59.017  1.00 155.88 ? 119 ILE C CB  1 
ATOM 7726  C CG1 . ILE C 1 150 ? -75.978  38.874  -60.036  1.00 156.63 ? 119 ILE C CG1 1 
ATOM 7727  C CG2 . ILE C 1 150 ? -77.226  37.337  -58.523  1.00 154.87 ? 119 ILE C CG2 1 
ATOM 7728  C CD1 . ILE C 1 150 ? -74.590  38.778  -59.436  1.00 157.35 ? 119 ILE C CD1 1 
ATOM 7729  N N   . GLY C 1 151 ? -80.325  38.075  -58.687  1.00 155.07 ? 120 GLY C N   1 
ATOM 7730  C CA  . GLY C 1 151 ? -81.463  37.889  -57.793  1.00 154.77 ? 120 GLY C CA  1 
ATOM 7731  C C   . GLY C 1 151 ? -81.005  37.803  -56.354  1.00 154.67 ? 120 GLY C C   1 
ATOM 7732  O O   . GLY C 1 151 ? -80.521  36.754  -55.934  1.00 154.35 ? 120 GLY C O   1 
ATOM 7733  N N   . VAL C 1 152 ? -81.132  38.917  -55.619  1.00 155.07 ? 121 VAL C N   1 
ATOM 7734  C CA  . VAL C 1 152 ? -80.817  38.992  -54.178  1.00 154.93 ? 121 VAL C CA  1 
ATOM 7735  C C   . VAL C 1 152 ? -81.982  38.433  -53.339  1.00 154.96 ? 121 VAL C C   1 
ATOM 7736  O O   . VAL C 1 152 ? -82.193  37.223  -53.317  1.00 154.60 ? 121 VAL C O   1 
ATOM 7737  C CB  . VAL C 1 152 ? -80.417  40.427  -53.739  1.00 155.46 ? 121 VAL C CB  1 
ATOM 7738  C CG1 . VAL C 1 152 ? -80.126  40.492  -52.249  1.00 155.39 ? 121 VAL C CG1 1 
ATOM 7739  C CG2 . VAL C 1 152 ? -79.206  40.878  -54.496  1.00 155.34 ? 121 VAL C CG2 1 
ATOM 7740  N N   . ARG C 1 153 ? -82.740  39.284  -52.656  1.00 155.59 ? 122 ARG C N   1 
ATOM 7741  C CA  . ARG C 1 153 ? -83.896  38.795  -51.923  1.00 155.80 ? 122 ARG C CA  1 
ATOM 7742  C C   . ARG C 1 153 ? -85.109  38.786  -52.842  1.00 156.23 ? 122 ARG C C   1 
ATOM 7743  O O   . ARG C 1 153 ? -85.273  39.706  -53.652  1.00 156.73 ? 122 ARG C O   1 
ATOM 7744  C CB  . ARG C 1 153 ? -84.156  39.646  -50.688  1.00 156.35 ? 122 ARG C CB  1 
ATOM 7745  C CG  . ARG C 1 153 ? -85.251  39.081  -49.812  1.00 156.12 ? 122 ARG C CG  1 
ATOM 7746  C CD  . ARG C 1 153 ? -85.367  39.818  -48.496  1.00 156.34 ? 122 ARG C CD  1 
ATOM 7747  N NE  . ARG C 1 153 ? -84.306  39.448  -47.568  1.00 154.60 ? 122 ARG C NE  1 
ATOM 7748  C CZ  . ARG C 1 153 ? -84.498  39.186  -46.281  1.00 154.17 ? 122 ARG C CZ  1 
ATOM 7749  N NH1 . ARG C 1 153 ? -85.710  39.232  -45.747  1.00 154.55 ? 122 ARG C NH1 1 
ATOM 7750  N NH2 . ARG C 1 153 ? -83.468  38.860  -45.530  1.00 154.41 ? 122 ARG C NH2 1 
ATOM 7751  N N   . ASN C 1 154 ? -85.949  37.755  -52.723  1.00 156.31 ? 123 ASN C N   1 
ATOM 7752  C CA  . ASN C 1 154 ? -87.149  37.647  -53.564  1.00 156.82 ? 123 ASN C CA  1 
ATOM 7753  C C   . ASN C 1 154 ? -87.855  39.004  -53.789  1.00 157.62 ? 123 ASN C C   1 
ATOM 7754  O O   . ASN C 1 154 ? -88.385  39.615  -52.855  1.00 158.26 ? 123 ASN C O   1 
ATOM 7755  C CB  . ASN C 1 154 ? -88.131  36.586  -53.025  1.00 156.88 ? 123 ASN C CB  1 
ATOM 7756  C CG  . ASN C 1 154 ? -89.200  37.175  -52.087  1.00 158.49 ? 123 ASN C CG  1 
ATOM 7757  O OD1 . ASN C 1 154 ? -90.378  37.293  -52.456  1.00 159.11 ? 123 ASN C OD1 1 
ATOM 7758  N ND2 . ASN C 1 154 ? -88.783  37.568  -50.882  1.00 159.45 ? 123 ASN C ND2 1 
ATOM 7759  N N   . GLU C 1 155 ? -87.809  39.507  -55.015  1.00 157.74 ? 124 GLU C N   1 
ATOM 7760  C CA  . GLU C 1 155 ? -86.999  38.948  -56.087  1.00 157.28 ? 124 GLU C CA  1 
ATOM 7761  C C   . GLU C 1 155 ? -86.133  40.112  -56.574  1.00 157.45 ? 124 GLU C C   1 
ATOM 7762  O O   . GLU C 1 155 ? -85.402  40.009  -57.564  1.00 157.41 ? 124 GLU C O   1 
ATOM 7763  C CB  . GLU C 1 155 ? -87.902  38.396  -57.206  1.00 157.41 ? 124 GLU C CB  1 
ATOM 7764  C CG  . GLU C 1 155 ? -87.546  36.972  -57.700  1.00 157.74 ? 124 GLU C CG  1 
ATOM 7765  C CD  . GLU C 1 155 ? -86.650  36.951  -58.947  1.00 158.91 ? 124 GLU C CD  1 
ATOM 7766  O OE1 . GLU C 1 155 ? -87.148  37.272  -60.051  1.00 159.48 ? 124 GLU C OE1 1 
ATOM 7767  O OE2 . GLU C 1 155 ? -85.452  36.595  -58.826  1.00 158.87 ? 124 GLU C OE2 1 
ATOM 7768  N N   . ASN C 1 156 ? -86.225  41.219  -55.841  1.00 157.60 ? 125 ASN C N   1 
ATOM 7769  C CA  . ASN C 1 156 ? -85.542  42.451  -56.175  1.00 157.89 ? 125 ASN C CA  1 
ATOM 7770  C C   . ASN C 1 156 ? -84.043  42.275  -56.269  1.00 157.31 ? 125 ASN C C   1 
ATOM 7771  O O   . ASN C 1 156 ? -83.445  41.683  -55.378  1.00 157.01 ? 125 ASN C O   1 
ATOM 7772  C CB  . ASN C 1 156 ? -85.869  43.498  -55.122  1.00 158.79 ? 125 ASN C CB  1 
ATOM 7773  C CG  . ASN C 1 156 ? -87.149  44.252  -55.432  1.00 160.18 ? 125 ASN C CG  1 
ATOM 7774  O OD1 . ASN C 1 156 ? -87.937  43.840  -56.286  1.00 160.53 ? 125 ASN C OD1 1 
ATOM 7775  N ND2 . ASN C 1 156 ? -87.358  45.373  -54.745  1.00 161.71 ? 125 ASN C ND2 1 
ATOM 7776  N N   . THR C 1 157 ? -83.443  42.778  -57.349  1.00 157.26 ? 126 THR C N   1 
ATOM 7777  C CA  . THR C 1 157 ? -81.986  42.702  -57.542  1.00 156.75 ? 126 THR C CA  1 
ATOM 7778  C C   . THR C 1 157 ? -81.227  43.849  -56.842  1.00 157.54 ? 126 THR C C   1 
ATOM 7779  O O   . THR C 1 157 ? -81.835  44.655  -56.133  1.00 157.96 ? 126 THR C O   1 
ATOM 7780  C CB  . THR C 1 157 ? -81.596  42.567  -59.041  1.00 156.70 ? 126 THR C CB  1 
ATOM 7781  O OG1 . THR C 1 157 ? -80.188  42.330  -59.145  1.00 156.03 ? 126 THR C OG1 1 
ATOM 7782  C CG2 . THR C 1 157 ? -81.967  43.811  -59.834  1.00 157.49 ? 126 THR C CG2 1 
ATOM 7783  N N   . PHE C 1 158 ? -79.905  43.905  -57.027  1.00 157.68 ? 127 PHE C N   1 
ATOM 7784  C CA  . PHE C 1 158 ? -79.049  44.853  -56.297  1.00 158.38 ? 127 PHE C CA  1 
ATOM 7785  C C   . PHE C 1 158 ? -79.476  46.270  -56.532  1.00 159.67 ? 127 PHE C C   1 
ATOM 7786  O O   . PHE C 1 158 ? -79.557  47.065  -55.600  1.00 160.15 ? 127 PHE C O   1 
ATOM 7787  C CB  . PHE C 1 158 ? -77.586  44.713  -56.708  1.00 158.32 ? 127 PHE C CB  1 
ATOM 7788  C CG  . PHE C 1 158 ? -76.895  43.553  -56.076  1.00 157.19 ? 127 PHE C CG  1 
ATOM 7789  C CD1 . PHE C 1 158 ? -76.450  43.628  -54.763  1.00 156.94 ? 127 PHE C CD1 1 
ATOM 7790  C CD2 . PHE C 1 158 ? -76.693  42.379  -56.787  1.00 156.23 ? 127 PHE C CD2 1 
ATOM 7791  C CE1 . PHE C 1 158 ? -75.815  42.548  -54.165  1.00 156.25 ? 127 PHE C CE1 1 
ATOM 7792  C CE2 . PHE C 1 158 ? -76.052  41.294  -56.199  1.00 155.60 ? 127 PHE C CE2 1 
ATOM 7793  C CZ  . PHE C 1 158 ? -75.613  41.377  -54.883  1.00 155.42 ? 127 PHE C CZ  1 
ATOM 7794  N N   . LEU C 1 159 ? -79.741  46.557  -57.803  1.00 160.47 ? 128 LEU C N   1 
ATOM 7795  C CA  . LEU C 1 159 ? -80.207  47.855  -58.268  1.00 161.99 ? 128 LEU C CA  1 
ATOM 7796  C C   . LEU C 1 159 ? -81.629  48.144  -57.799  1.00 162.64 ? 128 LEU C C   1 
ATOM 7797  O O   . LEU C 1 159 ? -81.913  49.243  -57.323  1.00 163.60 ? 128 LEU C O   1 
ATOM 7798  C CB  . LEU C 1 159 ? -80.135  47.900  -59.794  1.00 162.13 ? 128 LEU C CB  1 
ATOM 7799  C CG  . LEU C 1 159 ? -80.321  49.232  -60.510  1.00 162.85 ? 128 LEU C CG  1 
ATOM 7800  C CD1 . LEU C 1 159 ? -79.306  50.235  -60.014  1.00 162.87 ? 128 LEU C CD1 1 
ATOM 7801  C CD2 . LEU C 1 159 ? -80.192  49.024  -62.015  1.00 162.67 ? 128 LEU C CD2 1 
ATOM 7802  N N   . ASP C 1 160 ? -82.509  47.150  -57.931  1.00 162.35 ? 129 ASP C N   1 
ATOM 7803  C CA  . ASP C 1 160 ? -83.890  47.249  -57.460  1.00 163.19 ? 129 ASP C CA  1 
ATOM 7804  C C   . ASP C 1 160 ? -83.962  47.690  -56.007  1.00 163.58 ? 129 ASP C C   1 
ATOM 7805  O O   . ASP C 1 160 ? -84.965  48.252  -55.575  1.00 164.21 ? 129 ASP C O   1 
ATOM 7806  C CB  . ASP C 1 160 ? -84.606  45.901  -57.591  1.00 162.45 ? 129 ASP C CB  1 
ATOM 7807  C CG  . ASP C 1 160 ? -85.315  45.718  -58.932  1.00 164.00 ? 129 ASP C CG  1 
ATOM 7808  O OD1 . ASP C 1 160 ? -85.938  46.680  -59.455  1.00 166.24 ? 129 ASP C OD1 1 
ATOM 7809  O OD2 . ASP C 1 160 ? -85.273  44.579  -59.450  1.00 165.07 ? 129 ASP C OD2 1 
ATOM 7810  N N   . LEU C 1 161 ? -82.894  47.424  -55.262  1.00 163.48 ? 130 LEU C N   1 
ATOM 7811  C CA  . LEU C 1 161 ? -82.873  47.674  -53.832  1.00 164.16 ? 130 LEU C CA  1 
ATOM 7812  C C   . LEU C 1 161 ? -82.181  48.965  -53.484  1.00 165.44 ? 130 LEU C C   1 
ATOM 7813  O O   . LEU C 1 161 ? -82.179  49.370  -52.323  1.00 166.04 ? 130 LEU C O   1 
ATOM 7814  C CB  . LEU C 1 161 ? -82.191  46.522  -53.098  1.00 163.31 ? 130 LEU C CB  1 
ATOM 7815  C CG  . LEU C 1 161 ? -83.009  45.247  -52.895  1.00 163.01 ? 130 LEU C CG  1 
ATOM 7816  C CD1 . LEU C 1 161 ? -82.103  44.143  -52.377  1.00 162.82 ? 130 LEU C CD1 1 
ATOM 7817  C CD2 . LEU C 1 161 ? -84.211  45.466  -51.957  1.00 163.81 ? 130 LEU C CD2 1 
ATOM 7818  N N   . THR C 1 162 ? -81.580  49.601  -54.482  1.00 166.19 ? 131 THR C N   1 
ATOM 7819  C CA  . THR C 1 162 ? -80.958  50.898  -54.281  1.00 167.84 ? 131 THR C CA  1 
ATOM 7820  C C   . THR C 1 162 ? -81.981  51.995  -54.549  1.00 169.59 ? 131 THR C C   1 
ATOM 7821  O O   . THR C 1 162 ? -82.075  52.960  -53.783  1.00 170.79 ? 131 THR C O   1 
ATOM 7822  C CB  . THR C 1 162 ? -79.746  51.081  -55.178  1.00 167.79 ? 131 THR C CB  1 
ATOM 7823  O OG1 . THR C 1 162 ? -78.943  49.899  -55.130  1.00 166.60 ? 131 THR C OG1 1 
ATOM 7824  C CG2 . THR C 1 162 ? -78.923  52.252  -54.706  1.00 169.11 ? 131 THR C CG2 1 
ATOM 7825  N N   . VAL C 1 163 ? -82.749  51.832  -55.629  1.00 170.06 ? 132 VAL C N   1 
ATOM 7826  C CA  . VAL C 1 163 ? -83.876  52.722  -55.935  1.00 171.63 ? 132 VAL C CA  1 
ATOM 7827  C C   . VAL C 1 163 ? -84.971  52.602  -54.872  1.00 172.16 ? 132 VAL C C   1 
ATOM 7828  O O   . VAL C 1 163 ? -85.709  53.548  -54.640  1.00 173.73 ? 132 VAL C O   1 
ATOM 7829  C CB  . VAL C 1 163 ? -84.486  52.503  -57.365  1.00 171.43 ? 132 VAL C CB  1 
ATOM 7830  C CG1 . VAL C 1 163 ? -83.409  52.545  -58.444  1.00 171.10 ? 132 VAL C CG1 1 
ATOM 7831  C CG2 . VAL C 1 163 ? -85.304  51.216  -57.448  1.00 170.07 ? 132 VAL C CG2 1 
ATOM 7832  N N   . GLN C 1 164 ? -85.062  51.437  -54.234  1.00 171.35 ? 133 GLN C N   1 
ATOM 7833  C CA  . GLN C 1 164 ? -85.969  51.219  -53.113  1.00 171.97 ? 133 GLN C CA  1 
ATOM 7834  C C   . GLN C 1 164 ? -85.636  52.116  -51.909  1.00 173.36 ? 133 GLN C C   1 
ATOM 7835  O O   . GLN C 1 164 ? -86.532  52.528  -51.176  1.00 174.33 ? 133 GLN C O   1 
ATOM 7836  C CB  . GLN C 1 164 ? -85.929  49.750  -52.691  1.00 170.61 ? 133 GLN C CB  1 
ATOM 7837  C CG  . GLN C 1 164 ? -86.662  48.785  -53.607  1.00 170.14 ? 133 GLN C CG  1 
ATOM 7838  C CD  . GLN C 1 164 ? -88.091  48.553  -53.182  1.00 171.29 ? 133 GLN C CD  1 
ATOM 7839  O OE1 . GLN C 1 164 ? -88.969  49.372  -53.448  1.00 173.01 ? 133 GLN C OE1 1 
ATOM 7840  N NE2 . GLN C 1 164 ? -88.335  47.427  -52.517  1.00 170.68 ? 133 GLN C NE2 1 
ATOM 7841  N N   . GLN C 1 165 ? -84.352  52.416  -51.713  1.00 173.83 ? 134 GLN C N   1 
ATOM 7842  C CA  . GLN C 1 165 ? -83.909  53.272  -50.608  1.00 175.47 ? 134 GLN C CA  1 
ATOM 7843  C C   . GLN C 1 165 ? -84.152  54.746  -50.908  1.00 177.60 ? 134 GLN C C   1 
ATOM 7844  O O   . GLN C 1 165 ? -84.643  55.487  -50.050  1.00 178.94 ? 134 GLN C O   1 
ATOM 7845  C CB  . GLN C 1 165 ? -82.425  53.057  -50.317  1.00 175.00 ? 134 GLN C CB  1 
ATOM 7846  C CG  . GLN C 1 165 ? -82.070  51.670  -49.820  1.00 173.88 ? 134 GLN C CG  1 
ATOM 7847  C CD  . GLN C 1 165 ? -80.575  51.470  -49.708  1.00 173.60 ? 134 GLN C CD  1 
ATOM 7848  O OE1 . GLN C 1 165 ? -79.971  51.777  -48.678  1.00 174.41 ? 134 GLN C OE1 1 
ATOM 7849  N NE2 . GLN C 1 165 ? -79.967  50.955  -50.772  1.00 172.62 ? 134 GLN C NE2 1 
ATOM 7850  N N   . ILE C 1 166 ? -83.789  55.153  -52.126  1.00 178.19 ? 135 ILE C N   1 
ATOM 7851  C CA  . ILE C 1 166 ? -83.996  56.512  -52.638  1.00 180.24 ? 135 ILE C CA  1 
ATOM 7852  C C   . ILE C 1 166 ? -85.481  56.913  -52.622  1.00 181.57 ? 135 ILE C C   1 
ATOM 7853  O O   . ILE C 1 166 ? -85.834  57.986  -52.127  1.00 183.18 ? 135 ILE C O   1 
ATOM 7854  C CB  . ILE C 1 166 ? -83.438  56.649  -54.083  1.00 179.99 ? 135 ILE C CB  1 
ATOM 7855  C CG1 . ILE C 1 166 ? -81.997  56.122  -54.188  1.00 178.71 ? 135 ILE C CG1 1 
ATOM 7856  C CG2 . ILE C 1 166 ? -83.545  58.080  -54.577  1.00 182.30 ? 135 ILE C CG2 1 
ATOM 7857  C CD1 . ILE C 1 166 ? -80.967  56.861  -53.344  1.00 179.10 ? 135 ILE C CD1 1 
ATOM 7858  N N   . GLU C 1 167 ? -86.330  56.045  -53.174  1.00 181.16 ? 136 GLU C N   1 
ATOM 7859  C CA  . GLU C 1 167 ? -87.786  56.189  -53.114  1.00 182.35 ? 136 GLU C CA  1 
ATOM 7860  C C   . GLU C 1 167 ? -88.241  56.592  -51.721  1.00 183.62 ? 136 GLU C C   1 
ATOM 7861  O O   . GLU C 1 167 ? -88.818  57.666  -51.552  1.00 185.52 ? 136 GLU C O   1 
ATOM 7862  C CB  . GLU C 1 167 ? -88.485  54.873  -53.488  1.00 180.93 ? 136 GLU C CB  1 
ATOM 7863  C CG  . GLU C 1 167 ? -88.867  54.694  -54.963  1.00 180.86 ? 136 GLU C CG  1 
ATOM 7864  C CD  . GLU C 1 167 ? -89.499  53.323  -55.242  1.00 179.57 ? 136 GLU C CD  1 
ATOM 7865  O OE1 . GLU C 1 167 ? -90.093  52.728  -54.314  1.00 178.90 ? 136 GLU C OE1 1 
ATOM 7866  O OE2 . GLU C 1 167 ? -89.402  52.838  -56.390  1.00 179.25 ? 136 GLU C OE2 1 
ATOM 7867  N N   . HIS C 1 168 ? -87.963  55.736  -50.734  1.00 182.91 ? 137 HIS C N   1 
ATOM 7868  C CA  . HIS C 1 168 ? -88.483  55.911  -49.378  1.00 184.22 ? 137 HIS C CA  1 
ATOM 7869  C C   . HIS C 1 168 ? -88.009  57.182  -48.675  1.00 186.14 ? 137 HIS C C   1 
ATOM 7870  O O   . HIS C 1 168 ? -88.712  57.708  -47.810  1.00 187.79 ? 137 HIS C O   1 
ATOM 7871  C CB  . HIS C 1 168 ? -88.191  54.688  -48.506  1.00 182.90 ? 137 HIS C CB  1 
ATOM 7872  C CG  . HIS C 1 168 ? -88.955  54.673  -47.215  1.00 184.32 ? 137 HIS C CG  1 
ATOM 7873  N ND1 . HIS C 1 168 ? -90.237  54.170  -47.113  1.00 184.66 ? 137 HIS C ND1 1 
ATOM 7874  C CD2 . HIS C 1 168 ? -88.621  55.104  -45.974  1.00 185.62 ? 137 HIS C CD2 1 
ATOM 7875  C CE1 . HIS C 1 168 ? -90.657  54.291  -45.866  1.00 185.71 ? 137 HIS C CE1 1 
ATOM 7876  N NE2 . HIS C 1 168 ? -89.697  54.855  -45.155  1.00 186.45 ? 137 HIS C NE2 1 
ATOM 7877  N N   . LEU C 1 169 ? -86.834  57.682  -49.049  1.00 186.28 ? 138 LEU C N   1 
ATOM 7878  C CA  . LEU C 1 169 ? -86.309  58.915  -48.455  1.00 188.02 ? 138 LEU C CA  1 
ATOM 7879  C C   . LEU C 1 169 ? -86.825  60.177  -49.158  1.00 189.88 ? 138 LEU C C   1 
ATOM 7880  O O   . LEU C 1 169 ? -86.889  61.253  -48.559  1.00 191.59 ? 138 LEU C O   1 
ATOM 7881  C CB  . LEU C 1 169 ? -84.782  58.876  -48.413  1.00 187.42 ? 138 LEU C CB  1 
ATOM 7882  C CG  . LEU C 1 169 ? -84.198  57.636  -47.723  1.00 185.58 ? 138 LEU C CG  1 
ATOM 7883  C CD1 . LEU C 1 169 ? -82.709  57.506  -48.025  1.00 184.66 ? 138 LEU C CD1 1 
ATOM 7884  C CD2 . LEU C 1 169 ? -84.479  57.617  -46.210  1.00 185.68 ? 138 LEU C CD2 1 
ATOM 7885  N N   . ASN C 1 170 ? -87.198  60.029  -50.425  1.00 189.67 ? 139 ASN C N   1 
ATOM 7886  C CA  . ASN C 1 170 ? -87.867  61.095  -51.167  1.00 191.63 ? 139 ASN C CA  1 
ATOM 7887  C C   . ASN C 1 170 ? -89.343  61.218  -50.785  1.00 192.56 ? 139 ASN C C   1 
ATOM 7888  O O   . ASN C 1 170 ? -89.805  62.306  -50.438  1.00 194.69 ? 139 ASN C O   1 
ATOM 7889  C CB  . ASN C 1 170 ? -87.712  60.888  -52.678  1.00 191.09 ? 139 ASN C CB  1 
ATOM 7890  C CG  . ASN C 1 170 ? -86.296  61.167  -53.171  1.00 191.35 ? 139 ASN C CG  1 
ATOM 7891  O OD1 . ASN C 1 170 ? -85.477  61.763  -52.460  1.00 192.52 ? 139 ASN C OD1 1 
ATOM 7892  N ND2 . ASN C 1 170 ? -86.005  60.742  -54.401  1.00 190.70 ? 139 ASN C ND2 1 
ATOM 7893  N N   . LYS C 1 171 ? -90.071  60.100  -50.835  1.00 191.11 ? 140 LYS C N   1 
ATOM 7894  C CA  . LYS C 1 171 ? -91.486  60.066  -50.450  1.00 191.83 ? 140 LYS C CA  1 
ATOM 7895  C C   . LYS C 1 171 ? -91.686  60.051  -48.923  1.00 192.37 ? 140 LYS C C   1 
ATOM 7896  O O   . LYS C 1 171 ? -92.523  59.306  -48.400  1.00 191.92 ? 140 LYS C O   1 
ATOM 7897  C CB  . LYS C 1 171 ? -92.209  58.892  -51.128  1.00 190.21 ? 140 LYS C CB  1 
ATOM 7898  N N   . THR C 1 172 ? -90.898  60.874  -48.225  1.00 193.42 ? 141 THR C N   1 
ATOM 7899  C CA  . THR C 1 172 ? -91.107  61.198  -46.803  1.00 194.60 ? 141 THR C CA  1 
ATOM 7900  C C   . THR C 1 172 ? -90.634  62.623  -46.437  1.00 196.71 ? 141 THR C C   1 
ATOM 7901  O O   . THR C 1 172 ? -91.039  63.165  -45.401  1.00 198.29 ? 141 THR C O   1 
ATOM 7902  C CB  . THR C 1 172 ? -90.460  60.157  -45.822  1.00 193.08 ? 141 THR C CB  1 
ATOM 7903  O OG1 . THR C 1 172 ? -89.166  59.769  -46.297  1.00 191.69 ? 141 THR C OG1 1 
ATOM 7904  C CG2 . THR C 1 172 ? -91.335  58.913  -45.653  1.00 191.46 ? 141 THR C CG2 1 
ATOM 7905  N N   . TYR C 1 173 ? -89.802  63.232  -47.285  1.00 196.80 ? 142 TYR C N   1 
ATOM 7906  C CA  . TYR C 1 173 ? -89.177  64.525  -46.951  1.00 198.75 ? 142 TYR C CA  1 
ATOM 7907  C C   . TYR C 1 173 ? -89.308  65.638  -48.014  1.00 200.17 ? 142 TYR C C   1 
ATOM 7908  O O   . TYR C 1 173 ? -88.688  66.702  -47.884  1.00 201.78 ? 142 TYR C O   1 
ATOM 7909  C CB  . TYR C 1 173 ? -87.705  64.312  -46.548  1.00 197.86 ? 142 TYR C CB  1 
ATOM 7910  C CG  . TYR C 1 173 ? -87.527  63.479  -45.289  1.00 197.16 ? 142 TYR C CG  1 
ATOM 7911  C CD1 . TYR C 1 173 ? -87.669  64.053  -44.024  1.00 199.08 ? 142 TYR C CD1 1 
ATOM 7912  C CD2 . TYR C 1 173 ? -87.223  62.114  -45.360  1.00 194.69 ? 142 TYR C CD2 1 
ATOM 7913  C CE1 . TYR C 1 173 ? -87.513  63.287  -42.858  1.00 198.05 ? 142 TYR C CE1 1 
ATOM 7914  C CE2 . TYR C 1 173 ? -87.067  61.340  -44.197  1.00 193.49 ? 142 TYR C CE2 1 
ATOM 7915  C CZ  . TYR C 1 173 ? -87.213  61.938  -42.954  1.00 194.98 ? 142 TYR C CZ  1 
ATOM 7916  O OH  . TYR C 1 173 ? -87.064  61.201  -41.806  1.00 193.68 ? 142 TYR C OH  1 
ATOM 7917  N N   . ASN C 1 174 ? -90.128  65.398  -49.040  1.00 199.62 ? 143 ASN C N   1 
ATOM 7918  C CA  . ASN C 1 174 ? -90.310  66.330  -50.173  1.00 200.79 ? 143 ASN C CA  1 
ATOM 7919  C C   . ASN C 1 174 ? -89.044  66.595  -50.985  1.00 200.11 ? 143 ASN C C   1 
ATOM 7920  O O   . ASN C 1 174 ? -89.061  67.409  -51.912  1.00 201.36 ? 143 ASN C O   1 
ATOM 7921  C CB  . ASN C 1 174 ? -90.932  67.660  -49.722  1.00 203.82 ? 143 ASN C CB  1 
ATOM 7922  C CG  . ASN C 1 174 ? -92.405  67.771  -50.081  1.00 205.06 ? 143 ASN C CG  1 
ATOM 7923  O OD1 . ASN C 1 174 ? -92.780  67.693  -51.256  1.00 204.57 ? 143 ASN C OD1 1 
ATOM 7924  N ND2 . ASN C 1 174 ? -93.248  67.974  -49.069  1.00 206.74 ? 143 ASN C ND2 1 
ATOM 7925  N N   . THR C 1 175 ? -87.964  65.897  -50.631  1.00 198.13 ? 144 THR C N   1 
ATOM 7926  C CA  . THR C 1 175 ? -86.642  66.076  -51.244  1.00 197.38 ? 144 THR C CA  1 
ATOM 7927  C C   . THR C 1 175 ? -86.430  65.238  -52.516  1.00 195.41 ? 144 THR C C   1 
ATOM 7928  O O   . THR C 1 175 ? -87.121  64.238  -52.736  1.00 193.93 ? 144 THR C O   1 
ATOM 7929  C CB  . THR C 1 175 ? -85.498  65.799  -50.221  1.00 196.59 ? 144 THR C CB  1 
ATOM 7930  O OG1 . THR C 1 175 ? -84.228  65.856  -50.884  1.00 196.14 ? 144 THR C OG1 1 
ATOM 7931  C CG2 . THR C 1 175 ? -85.657  64.428  -49.573  1.00 194.43 ? 144 THR C CG2 1 
ATOM 7932  N N   . ASP C 1 176 ? -85.479  65.671  -53.346  1.00 195.36 ? 145 ASP C N   1 
ATOM 7933  C CA  . ASP C 1 176 ? -85.063  64.935  -54.542  1.00 193.59 ? 145 ASP C CA  1 
ATOM 7934  C C   . ASP C 1 176 ? -83.568  64.628  -54.494  1.00 192.33 ? 145 ASP C C   1 
ATOM 7935  O O   . ASP C 1 176 ? -82.746  65.539  -54.393  1.00 193.69 ? 145 ASP C O   1 
ATOM 7936  C CB  . ASP C 1 176 ? -85.384  65.725  -55.819  1.00 195.02 ? 145 ASP C CB  1 
ATOM 7937  C CG  . ASP C 1 176 ? -86.825  65.556  -56.279  1.00 195.40 ? 145 ASP C CG  1 
ATOM 7938  O OD1 . ASP C 1 176 ? -87.596  64.818  -55.618  1.00 194.68 ? 145 ASP C OD1 1 
ATOM 7939  O OD2 . ASP C 1 176 ? -87.180  66.165  -57.316  1.00 196.58 ? 145 ASP C OD2 1 
ATOM 7940  N N   . VAL C 1 177 ? -83.227  63.341  -54.548  1.00 189.69 ? 146 VAL C N   1 
ATOM 7941  C CA  . VAL C 1 177 ? -81.838  62.897  -54.641  1.00 188.21 ? 146 VAL C CA  1 
ATOM 7942  C C   . VAL C 1 177 ? -81.725  61.963  -55.849  1.00 186.76 ? 146 VAL C C   1 
ATOM 7943  O O   . VAL C 1 177 ? -82.575  61.086  -56.025  1.00 185.57 ? 146 VAL C O   1 
ATOM 7944  C CB  . VAL C 1 177 ? -81.374  62.187  -53.350  1.00 186.91 ? 146 VAL C CB  1 
ATOM 7945  C CG1 . VAL C 1 177 ? -79.906  61.810  -53.437  1.00 185.72 ? 146 VAL C CG1 1 
ATOM 7946  C CG2 . VAL C 1 177 ? -81.612  63.071  -52.136  1.00 188.17 ? 146 VAL C CG2 1 
ATOM 7947  N N   . PRO C 1 178 ? -80.698  62.165  -56.705  1.00 186.93 ? 147 PRO C N   1 
ATOM 7948  C CA  . PRO C 1 178 ? -80.551  61.337  -57.898  1.00 185.75 ? 147 PRO C CA  1 
ATOM 7949  C C   . PRO C 1 178 ? -79.480  60.255  -57.759  1.00 184.00 ? 147 PRO C C   1 
ATOM 7950  O O   . PRO C 1 178 ? -78.362  60.541  -57.317  1.00 184.20 ? 147 PRO C O   1 
ATOM 7951  C CB  . PRO C 1 178 ? -80.133  62.354  -58.964  1.00 187.39 ? 147 PRO C CB  1 
ATOM 7952  C CG  . PRO C 1 178 ? -79.396  63.431  -58.197  1.00 188.92 ? 147 PRO C CG  1 
ATOM 7953  C CD  . PRO C 1 178 ? -79.739  63.285  -56.719  1.00 188.55 ? 147 PRO C CD  1 
ATOM 7954  N N   . LEU C 1 179 ? -79.826  59.024  -58.131  1.00 182.40 ? 148 LEU C N   1 
ATOM 7955  C CA  . LEU C 1 179 ? -78.839  57.945  -58.195  1.00 180.98 ? 148 LEU C CA  1 
ATOM 7956  C C   . LEU C 1 179 ? -78.018  58.087  -59.478  1.00 181.47 ? 148 LEU C C   1 
ATOM 7957  O O   . LEU C 1 179 ? -78.541  58.466  -60.537  1.00 182.18 ? 148 LEU C O   1 
ATOM 7958  C CB  . LEU C 1 179 ? -79.487  56.556  -58.089  1.00 179.02 ? 148 LEU C CB  1 
ATOM 7959  N N   . VAL C 1 180 ? -76.723  57.806  -59.350  1.00 181.13 ? 149 VAL C N   1 
ATOM 7960  C CA  . VAL C 1 180 ? -75.749  57.952  -60.428  1.00 181.54 ? 149 VAL C CA  1 
ATOM 7961  C C   . VAL C 1 180 ? -74.856  56.717  -60.437  1.00 180.11 ? 149 VAL C C   1 
ATOM 7962  O O   . VAL C 1 180 ? -74.428  56.250  -59.381  1.00 179.35 ? 149 VAL C O   1 
ATOM 7963  C CB  . VAL C 1 180 ? -74.870  59.200  -60.224  1.00 183.18 ? 149 VAL C CB  1 
ATOM 7964  C CG1 . VAL C 1 180 ? -74.116  59.529  -61.502  1.00 184.32 ? 149 VAL C CG1 1 
ATOM 7965  C CG2 . VAL C 1 180 ? -75.707  60.392  -59.766  1.00 184.23 ? 149 VAL C CG2 1 
ATOM 7966  N N   . LEU C 1 181 ? -74.560  56.192  -61.620  1.00 179.89 ? 150 LEU C N   1 
ATOM 7967  C CA  . LEU C 1 181 ? -73.926  54.877  -61.694  1.00 178.65 ? 150 LEU C CA  1 
ATOM 7968  C C   . LEU C 1 181 ? -72.640  54.801  -62.519  1.00 179.41 ? 150 LEU C C   1 
ATOM 7969  O O   . LEU C 1 181 ? -72.687  54.687  -63.745  1.00 179.83 ? 150 LEU C O   1 
ATOM 7970  C CB  . LEU C 1 181 ? -74.950  53.846  -62.175  1.00 177.36 ? 150 LEU C CB  1 
ATOM 7971  C CG  . LEU C 1 181 ? -75.964  53.409  -61.118  1.00 175.77 ? 150 LEU C CG  1 
ATOM 7972  C CD1 . LEU C 1 181 ? -77.266  53.015  -61.762  1.00 174.59 ? 150 LEU C CD1 1 
ATOM 7973  C CD2 . LEU C 1 181 ? -75.394  52.258  -60.304  1.00 174.47 ? 150 LEU C CD2 1 
ATOM 7974  N N   . MET C 1 182 ? -71.496  54.828  -61.832  1.00 179.70 ? 151 MET C N   1 
ATOM 7975  C CA  . MET C 1 182 ? -70.180  54.878  -62.488  1.00 180.69 ? 151 MET C CA  1 
ATOM 7976  C C   . MET C 1 182 ? -69.766  53.549  -63.121  1.00 179.83 ? 151 MET C C   1 
ATOM 7977  O O   . MET C 1 182 ? -68.701  52.999  -62.806  1.00 179.73 ? 151 MET C O   1 
ATOM 7978  C CB  . MET C 1 182 ? -69.103  55.368  -61.513  1.00 181.09 ? 151 MET C CB  1 
ATOM 7979  N N   . ASN C 1 183 ? -70.606  53.053  -64.028  1.00 179.51 ? 152 ASN C N   1 
ATOM 7980  C CA  . ASN C 1 183 ? -70.367  51.780  -64.710  1.00 178.70 ? 152 ASN C CA  1 
ATOM 7981  C C   . ASN C 1 183 ? -69.291  51.821  -65.806  1.00 180.01 ? 152 ASN C C   1 
ATOM 7982  O O   . ASN C 1 183 ? -69.050  52.864  -66.419  1.00 181.59 ? 152 ASN C O   1 
ATOM 7983  C CB  . ASN C 1 183 ? -71.681  51.189  -65.251  1.00 177.77 ? 152 ASN C CB  1 
ATOM 7984  C CG  . ASN C 1 183 ? -72.722  52.242  -65.557  1.00 177.72 ? 152 ASN C CG  1 
ATOM 7985  O OD1 . ASN C 1 183 ? -72.530  53.086  -66.424  1.00 178.67 ? 152 ASN C OD1 1 
ATOM 7986  N ND2 . ASN C 1 183 ? -73.838  52.190  -64.849  1.00 175.86 ? 152 ASN C ND2 1 
ATOM 7987  N N   . SER C 1 184 ? -68.643  50.677  -66.024  1.00 179.54 ? 153 SER C N   1 
ATOM 7988  C CA  . SER C 1 184 ? -67.663  50.518  -67.095  1.00 180.79 ? 153 SER C CA  1 
ATOM 7989  C C   . SER C 1 184 ? -68.372  50.195  -68.413  1.00 181.24 ? 153 SER C C   1 
ATOM 7990  O O   . SER C 1 184 ? -69.607  50.169  -68.469  1.00 180.71 ? 153 SER C O   1 
ATOM 7991  C CB  . SER C 1 184 ? -66.630  49.436  -66.733  1.00 180.19 ? 153 SER C CB  1 
ATOM 7992  O OG  . SER C 1 184 ? -67.218  48.149  -66.597  1.00 178.90 ? 153 SER C OG  1 
ATOM 7993  N N   . PHE C 1 185 ? -67.591  49.968  -69.469  1.00 189.03 ? 154 PHE C N   1 
ATOM 7994  C CA  . PHE C 1 185 ? -68.139  49.634  -70.791  1.00 189.79 ? 154 PHE C CA  1 
ATOM 7995  C C   . PHE C 1 185 ? -68.892  48.300  -70.809  1.00 189.11 ? 154 PHE C C   1 
ATOM 7996  O O   . PHE C 1 185 ? -69.915  48.162  -71.493  1.00 189.27 ? 154 PHE C O   1 
ATOM 7997  C CB  . PHE C 1 185 ? -67.048  49.666  -71.876  1.00 191.07 ? 154 PHE C CB  1 
ATOM 7998  C CG  . PHE C 1 185 ? -65.767  48.971  -71.490  1.00 191.28 ? 154 PHE C CG  1 
ATOM 7999  C CD1 . PHE C 1 185 ? -65.615  47.596  -71.678  1.00 191.13 ? 154 PHE C CD1 1 
ATOM 8000  C CD2 . PHE C 1 185 ? -64.702  49.699  -70.959  1.00 191.89 ? 154 PHE C CD2 1 
ATOM 8001  C CE1 . PHE C 1 185 ? -64.427  46.951  -71.328  1.00 191.63 ? 154 PHE C CE1 1 
ATOM 8002  C CE2 . PHE C 1 185 ? -63.509  49.068  -70.606  1.00 192.44 ? 154 PHE C CE2 1 
ATOM 8003  C CZ  . PHE C 1 185 ? -63.370  47.690  -70.792  1.00 192.34 ? 154 PHE C CZ  1 
ATOM 8004  N N   . ASN C 1 186 ? -68.391  47.338  -70.033  1.00 188.54 ? 155 ASN C N   1 
ATOM 8005  C CA  . ASN C 1 186 ? -68.962  45.996  -69.961  1.00 187.88 ? 155 ASN C CA  1 
ATOM 8006  C C   . ASN C 1 186 ? -70.286  45.907  -69.184  1.00 186.74 ? 155 ASN C C   1 
ATOM 8007  O O   . ASN C 1 186 ? -71.003  44.904  -69.259  1.00 186.27 ? 155 ASN C O   1 
ATOM 8008  C CB  . ASN C 1 186 ? -67.933  45.033  -69.369  1.00 187.80 ? 155 ASN C CB  1 
ATOM 8009  C CG  . ASN C 1 186 ? -68.076  43.622  -69.911  1.00 188.58 ? 155 ASN C CG  1 
ATOM 8010  O OD1 . ASN C 1 186 ? -69.047  43.293  -70.602  1.00 189.43 ? 155 ASN C OD1 1 
ATOM 8011  N ND2 . ASN C 1 186 ? -67.099  42.778  -69.607  1.00 189.46 ? 155 ASN C ND2 1 
ATOM 8012  N N   . THR C 1 187 ? -70.609  46.963  -68.449  1.00 186.28 ? 156 THR C N   1 
ATOM 8013  C CA  . THR C 1 187 ? -71.823  46.981  -67.652  1.00 185.33 ? 156 THR C CA  1 
ATOM 8014  C C   . THR C 1 187 ? -72.872  47.977  -68.160  1.00 185.89 ? 156 THR C C   1 
ATOM 8015  O O   . THR C 1 187 ? -74.062  47.788  -67.910  1.00 185.74 ? 156 THR C O   1 
ATOM 8016  C CB  . THR C 1 187 ? -71.509  47.219  -66.166  1.00 184.58 ? 156 THR C CB  1 
ATOM 8017  O OG1 . THR C 1 187 ? -70.708  48.392  -66.030  1.00 184.43 ? 156 THR C OG1 1 
ATOM 8018  C CG2 . THR C 1 187 ? -70.733  46.048  -65.601  1.00 184.24 ? 156 THR C CG2 1 
ATOM 8019  N N   . ASP C 1 188 ? -72.446  49.013  -68.886  1.00 186.73 ? 157 ASP C N   1 
ATOM 8020  C CA  . ASP C 1 188 ? -73.374  50.054  -69.365  1.00 187.40 ? 157 ASP C CA  1 
ATOM 8021  C C   . ASP C 1 188 ? -74.307  49.596  -70.495  1.00 187.97 ? 157 ASP C C   1 
ATOM 8022  O O   . ASP C 1 188 ? -75.443  50.080  -70.602  1.00 188.30 ? 157 ASP C O   1 
ATOM 8023  C CB  . ASP C 1 188 ? -72.627  51.334  -69.769  1.00 188.22 ? 157 ASP C CB  1 
ATOM 8024  C CG  . ASP C 1 188 ? -73.570  52.510  -70.055  1.00 188.82 ? 157 ASP C CG  1 
ATOM 8025  O OD1 . ASP C 1 188 ? -74.611  52.649  -69.374  1.00 188.17 ? 157 ASP C OD1 1 
ATOM 8026  O OD2 . ASP C 1 188 ? -73.266  53.308  -70.966  1.00 189.74 ? 157 ASP C OD2 1 
ATOM 8027  N N   . GLU C 1 189 ? -73.830  48.671  -71.329  1.00 188.20 ? 158 GLU C N   1 
ATOM 8028  C CA  . GLU C 1 189 ? -74.640  48.123  -72.421  1.00 188.74 ? 158 GLU C CA  1 
ATOM 8029  C C   . GLU C 1 189 ? -75.990  47.569  -71.928  1.00 188.31 ? 158 GLU C C   1 
ATOM 8030  O O   . GLU C 1 189 ? -77.042  47.882  -72.506  1.00 189.07 ? 158 GLU C O   1 
ATOM 8031  C CB  . GLU C 1 189 ? -73.858  47.057  -73.199  1.00 188.73 ? 158 GLU C CB  1 
ATOM 8032  N N   . ASP C 1 190 ? -75.951  46.791  -70.839  1.00 187.24 ? 159 ASP C N   1 
ATOM 8033  C CA  . ASP C 1 190 ? -77.120  46.049  -70.329  1.00 186.59 ? 159 ASP C CA  1 
ATOM 8034  C C   . ASP C 1 190 ? -77.905  46.709  -69.190  1.00 186.29 ? 159 ASP C C   1 
ATOM 8035  O O   . ASP C 1 190 ? -79.055  46.330  -68.944  1.00 186.48 ? 159 ASP C O   1 
ATOM 8036  C CB  . ASP C 1 190 ? -76.708  44.645  -69.889  1.00 185.77 ? 159 ASP C CB  1 
ATOM 8037  C CG  . ASP C 1 190 ? -75.897  43.936  -70.931  1.00 185.98 ? 159 ASP C CG  1 
ATOM 8038  O OD1 . ASP C 1 190 ? -76.490  43.468  -71.922  1.00 186.44 ? 159 ASP C OD1 1 
ATOM 8039  O OD2 . ASP C 1 190 ? -74.664  43.854  -70.760  1.00 185.87 ? 159 ASP C OD2 1 
ATOM 8040  N N   . THR C 1 191 ? -77.295  47.666  -68.487  1.00 185.82 ? 160 THR C N   1 
ATOM 8041  C CA  . THR C 1 191 ? -77.983  48.367  -67.395  1.00 185.32 ? 160 THR C CA  1 
ATOM 8042  C C   . THR C 1 191 ? -78.882  49.460  -67.939  1.00 186.05 ? 160 THR C C   1 
ATOM 8043  O O   . THR C 1 191 ? -80.016  49.619  -67.485  1.00 186.21 ? 160 THR C O   1 
ATOM 8044  C CB  . THR C 1 191 ? -77.012  48.981  -66.373  1.00 184.82 ? 160 THR C CB  1 
ATOM 8045  O OG1 . THR C 1 191 ? -76.057  49.801  -67.054  1.00 185.14 ? 160 THR C OG1 1 
ATOM 8046  C CG2 . THR C 1 191 ? -76.286  47.889  -65.590  1.00 184.27 ? 160 THR C CG2 1 
ATOM 8047  N N   . LYS C 1 192 ? -78.365  50.205  -68.917  1.00 186.58 ? 161 LYS C N   1 
ATOM 8048  C CA  . LYS C 1 192 ? -79.137  51.227  -69.611  1.00 187.53 ? 161 LYS C CA  1 
ATOM 8049  C C   . LYS C 1 192 ? -80.376  50.593  -70.232  1.00 187.86 ? 161 LYS C C   1 
ATOM 8050  O O   . LYS C 1 192 ? -81.453  51.192  -70.237  1.00 188.60 ? 161 LYS C O   1 
ATOM 8051  C CB  . LYS C 1 192 ? -78.285  51.926  -70.673  1.00 188.32 ? 161 LYS C CB  1 
ATOM 8052  N N   . LYS C 1 193 ? -80.214  49.364  -70.721  1.00 187.32 ? 162 LYS C N   1 
ATOM 8053  C CA  . LYS C 1 193 ? -81.306  48.589  -71.305  1.00 187.61 ? 162 LYS C CA  1 
ATOM 8054  C C   . LYS C 1 193 ? -82.408  48.236  -70.292  1.00 187.44 ? 162 LYS C C   1 
ATOM 8055  O O   . LYS C 1 193 ? -83.532  47.939  -70.688  1.00 188.10 ? 162 LYS C O   1 
ATOM 8056  C CB  . LYS C 1 193 ? -80.758  47.329  -72.001  1.00 187.16 ? 162 LYS C CB  1 
ATOM 8057  C CG  . LYS C 1 193 ? -81.802  46.515  -72.751  1.00 187.31 ? 162 LYS C CG  1 
ATOM 8058  C CD  . LYS C 1 193 ? -81.198  45.451  -73.648  1.00 186.61 ? 162 LYS C CD  1 
ATOM 8059  C CE  . LYS C 1 193 ? -82.306  44.557  -74.201  1.00 187.05 ? 162 LYS C CE  1 
ATOM 8060  N NZ  . LYS C 1 193 ? -81.965  43.907  -75.499  1.00 187.43 ? 162 LYS C NZ  1 
ATOM 8061  N N   . ILE C 1 194 ? -82.096  48.282  -68.996  1.00 186.79 ? 163 ILE C N   1 
ATOM 8062  C CA  . ILE C 1 194 ? -83.073  47.917  -67.955  1.00 186.93 ? 163 ILE C CA  1 
ATOM 8063  C C   . ILE C 1 194 ? -83.622  49.131  -67.191  1.00 187.64 ? 163 ILE C C   1 
ATOM 8064  O O   . ILE C 1 194 ? -84.649  49.033  -66.518  1.00 187.87 ? 163 ILE C O   1 
ATOM 8065  C CB  . ILE C 1 194 ? -82.521  46.818  -66.977  1.00 185.84 ? 163 ILE C CB  1 
ATOM 8066  C CG1 . ILE C 1 194 ? -82.126  45.551  -67.754  1.00 185.54 ? 163 ILE C CG1 1 
ATOM 8067  C CG2 . ILE C 1 194 ? -83.545  46.469  -65.888  1.00 185.87 ? 163 ILE C CG2 1 
ATOM 8068  C CD1 . ILE C 1 194 ? -81.862  44.304  -66.902  1.00 184.27 ? 163 ILE C CD1 1 
ATOM 8069  N N   . LEU C 1 195 ? -82.950  50.273  -67.326  1.00 188.26 ? 164 LEU C N   1 
ATOM 8070  C CA  . LEU C 1 195 ? -83.352  51.519  -66.656  1.00 189.24 ? 164 LEU C CA  1 
ATOM 8071  C C   . LEU C 1 195 ? -84.753  51.991  -67.049  1.00 190.95 ? 164 LEU C C   1 
ATOM 8072  O O   . LEU C 1 195 ? -85.324  52.878  -66.405  1.00 191.45 ? 164 LEU C O   1 
ATOM 8073  C CB  . LEU C 1 195 ? -82.332  52.631  -66.933  1.00 189.40 ? 164 LEU C CB  1 
ATOM 8074  C CG  . LEU C 1 195 ? -80.953  52.560  -66.261  1.00 188.30 ? 164 LEU C CG  1 
ATOM 8075  C CD1 . LEU C 1 195 ? -79.960  53.494  -66.942  1.00 188.53 ? 164 LEU C CD1 1 
ATOM 8076  C CD2 . LEU C 1 195 ? -81.042  52.876  -64.775  1.00 187.57 ? 164 LEU C CD2 1 
ATOM 8077  N N   . GLN C 1 196 ? -85.291  51.384  -68.108  1.00 192.09 ? 165 GLN C N   1 
ATOM 8078  C CA  . GLN C 1 196 ? -86.634  51.683  -68.602  1.00 194.10 ? 165 GLN C CA  1 
ATOM 8079  C C   . GLN C 1 196 ? -87.739  51.169  -67.671  1.00 194.71 ? 165 GLN C C   1 
ATOM 8080  O O   . GLN C 1 196 ? -88.871  51.652  -67.726  1.00 196.23 ? 165 GLN C O   1 
ATOM 8081  C CB  . GLN C 1 196 ? -86.830  51.155  -70.037  1.00 194.66 ? 165 GLN C CB  1 
ATOM 8082  C CG  . GLN C 1 196 ? -86.902  49.625  -70.189  1.00 194.01 ? 165 GLN C CG  1 
ATOM 8083  C CD  . GLN C 1 196 ? -87.248  49.172  -71.613  1.00 194.87 ? 165 GLN C CD  1 
ATOM 8084  O OE1 . GLN C 1 196 ? -86.901  49.831  -72.596  1.00 195.57 ? 165 GLN C OE1 1 
ATOM 8085  N NE2 . GLN C 1 196 ? -87.929  48.037  -71.720  1.00 194.89 ? 165 GLN C NE2 1 
ATOM 8086  N N   . LYS C 1 197 ? -87.406  50.201  -66.819  1.00 194.06 ? 166 LYS C N   1 
ATOM 8087  C CA  . LYS C 1 197 ? -88.359  49.659  -65.847  1.00 194.71 ? 166 LYS C CA  1 
ATOM 8088  C C   . LYS C 1 197 ? -88.362  50.428  -64.512  1.00 194.94 ? 166 LYS C C   1 
ATOM 8089  O O   . LYS C 1 197 ? -89.068  50.050  -63.576  1.00 194.99 ? 166 LYS C O   1 
ATOM 8090  C CB  . LYS C 1 197 ? -88.099  48.163  -65.621  1.00 193.77 ? 166 LYS C CB  1 
ATOM 8091  N N   . TYR C 1 198 ? -87.586  51.511  -64.440  1.00 195.35 ? 167 TYR C N   1 
ATOM 8092  C CA  . TYR C 1 198 ? -87.486  52.331  -63.227  1.00 195.98 ? 167 TYR C CA  1 
ATOM 8093  C C   . TYR C 1 198 ? -88.182  53.664  -63.385  1.00 197.83 ? 167 TYR C C   1 
ATOM 8094  O O   . TYR C 1 198 ? -88.287  54.429  -62.432  1.00 198.04 ? 167 TYR C O   1 
ATOM 8095  C CB  . TYR C 1 198 ? -86.024  52.529  -62.825  1.00 194.74 ? 167 TYR C CB  1 
ATOM 8096  C CG  . TYR C 1 198 ? -85.386  51.230  -62.406  1.00 194.10 ? 167 TYR C CG  1 
ATOM 8097  C CD1 . TYR C 1 198 ? -85.509  50.762  -61.096  1.00 193.81 ? 167 TYR C CD1 1 
ATOM 8098  C CD2 . TYR C 1 198 ? -84.699  50.441  -63.329  1.00 193.82 ? 167 TYR C CD2 1 
ATOM 8099  C CE1 . TYR C 1 198 ? -84.948  49.553  -60.712  1.00 192.81 ? 167 TYR C CE1 1 
ATOM 8100  C CE2 . TYR C 1 198 ? -84.137  49.229  -62.954  1.00 192.97 ? 167 TYR C CE2 1 
ATOM 8101  C CZ  . TYR C 1 198 ? -84.264  48.792  -61.646  1.00 192.51 ? 167 TYR C CZ  1 
ATOM 8102  O OH  . TYR C 1 198 ? -83.701  47.593  -61.275  1.00 192.19 ? 167 TYR C OH  1 
ATOM 8103  N N   . ASN C 1 199 ? -88.654  53.918  -64.604  1.00 199.66 ? 168 ASN C N   1 
ATOM 8104  C CA  . ASN C 1 199 ? -89.465  55.084  -64.963  1.00 202.00 ? 168 ASN C CA  1 
ATOM 8105  C C   . ASN C 1 199 ? -90.685  55.278  -64.052  1.00 203.51 ? 168 ASN C C   1 
ATOM 8106  O O   . ASN C 1 199 ? -91.210  54.309  -63.501  1.00 203.39 ? 168 ASN C O   1 
ATOM 8107  C CB  . ASN C 1 199 ? -89.940  54.918  -66.409  1.00 202.98 ? 168 ASN C CB  1 
ATOM 8108  C CG  . ASN C 1 199 ? -89.612  56.110  -67.271  1.00 203.99 ? 168 ASN C CG  1 
ATOM 8109  O OD1 . ASN C 1 199 ? -88.442  56.469  -67.436  1.00 203.07 ? 168 ASN C OD1 1 
ATOM 8110  N ND2 . ASN C 1 199 ? -90.643  56.722  -67.847  1.00 206.12 ? 168 ASN C ND2 1 
ATOM 8111  N N   . HIS C 1 200 ? -91.133  56.526  -63.903  1.00 205.36 ? 169 HIS C N   1 
ATOM 8112  C CA  . HIS C 1 200 ? -92.303  56.872  -63.071  1.00 207.34 ? 169 HIS C CA  1 
ATOM 8113  C C   . HIS C 1 200 ? -92.021  56.822  -61.557  1.00 206.74 ? 169 HIS C C   1 
ATOM 8114  O O   . HIS C 1 200 ? -92.728  57.468  -60.774  1.00 207.87 ? 169 HIS C O   1 
ATOM 8115  C CB  . HIS C 1 200 ? -93.545  56.020  -63.431  1.00 208.60 ? 169 HIS C CB  1 
ATOM 8116  C CG  . HIS C 1 200 ? -94.346  56.547  -64.589  1.00 210.96 ? 169 HIS C CG  1 
ATOM 8117  N ND1 . HIS C 1 200 ? -95.568  57.168  -64.429  1.00 213.47 ? 169 HIS C ND1 1 
ATOM 8118  C CD2 . HIS C 1 200 ? -94.110  56.527  -65.924  1.00 211.60 ? 169 HIS C CD2 1 
ATOM 8119  C CE1 . HIS C 1 200 ? -96.044  57.519  -65.611  1.00 214.88 ? 169 HIS C CE1 1 
ATOM 8120  N NE2 . HIS C 1 200 ? -95.178  57.142  -66.535  1.00 214.04 ? 169 HIS C NE2 1 
ATOM 8121  N N   . CYS C 1 201 ? -91.000  56.060  -61.152  1.00 205.31 ? 170 CYS C N   1 
ATOM 8122  C CA  . CYS C 1 201 ? -90.551  56.004  -59.750  1.00 204.79 ? 170 CYS C CA  1 
ATOM 8123  C C   . CYS C 1 201 ? -90.103  57.393  -59.313  1.00 205.23 ? 170 CYS C C   1 
ATOM 8124  O O   . CYS C 1 201 ? -89.823  58.246  -60.159  1.00 205.80 ? 170 CYS C O   1 
ATOM 8125  C CB  . CYS C 1 201 ? -89.372  55.038  -59.579  1.00 202.94 ? 170 CYS C CB  1 
ATOM 8126  S SG  . CYS C 1 201 ? -89.732  53.262  -59.688  1.00 202.77 ? 170 CYS C SG  1 
ATOM 8127  N N   . ARG C 1 202 ? -90.017  57.619  -58.003  1.00 205.20 ? 171 ARG C N   1 
ATOM 8128  C CA  . ARG C 1 202 ? -89.582  58.925  -57.510  1.00 205.66 ? 171 ARG C CA  1 
ATOM 8129  C C   . ARG C 1 202 ? -88.048  59.034  -57.409  1.00 204.27 ? 171 ARG C C   1 
ATOM 8130  O O   . ARG C 1 202 ? -87.490  59.227  -56.323  1.00 203.61 ? 171 ARG C O   1 
ATOM 8131  C CB  . ARG C 1 202 ? -90.289  59.308  -56.198  1.00 206.36 ? 171 ARG C CB  1 
ATOM 8132  C CG  . ARG C 1 202 ? -90.622  60.801  -56.134  1.00 207.56 ? 171 ARG C CG  1 
ATOM 8133  C CD  . ARG C 1 202 ? -90.835  61.320  -54.724  1.00 207.39 ? 171 ARG C CD  1 
ATOM 8134  N NE  . ARG C 1 202 ? -90.433  62.724  -54.617  1.00 207.44 ? 171 ARG C NE  1 
ATOM 8135  C CZ  . ARG C 1 202 ? -90.738  63.525  -53.600  1.00 208.21 ? 171 ARG C CZ  1 
ATOM 8136  N NH1 . ARG C 1 202 ? -91.466  63.078  -52.586  1.00 208.85 ? 171 ARG C NH1 1 
ATOM 8137  N NH2 . ARG C 1 202 ? -90.320  64.784  -53.600  1.00 208.57 ? 171 ARG C NH2 1 
ATOM 8138  N N   . VAL C 1 203 ? -87.383  58.905  -58.561  1.00 204.08 ? 172 VAL C N   1 
ATOM 8139  C CA  . VAL C 1 203 ? -85.922  58.989  -58.662  1.00 203.09 ? 172 VAL C CA  1 
ATOM 8140  C C   . VAL C 1 203 ? -85.470  59.609  -59.992  1.00 203.73 ? 172 VAL C C   1 
ATOM 8141  O O   . VAL C 1 203 ? -85.853  59.140  -61.066  1.00 204.20 ? 172 VAL C O   1 
ATOM 8142  C CB  . VAL C 1 203 ? -85.244  57.592  -58.556  1.00 201.63 ? 172 VAL C CB  1 
ATOM 8143  C CG1 . VAL C 1 203 ? -83.748  57.746  -58.290  1.00 200.56 ? 172 VAL C CG1 1 
ATOM 8144  C CG2 . VAL C 1 203 ? -85.894  56.719  -57.483  1.00 201.44 ? 172 VAL C CG2 1 
ATOM 8145  N N   . LYS C 1 204 ? -84.649  60.656  -59.916  1.00 203.92 ? 173 LYS C N   1 
ATOM 8146  C CA  . LYS C 1 204 ? -83.949  61.161  -61.097  1.00 204.31 ? 173 LYS C CA  1 
ATOM 8147  C C   . LYS C 1 204 ? -82.803  60.204  -61.413  1.00 203.01 ? 173 LYS C C   1 
ATOM 8148  O O   . LYS C 1 204 ? -82.152  59.676  -60.505  1.00 201.89 ? 173 LYS C O   1 
ATOM 8149  C CB  . LYS C 1 204 ? -83.420  62.579  -60.861  1.00 204.89 ? 173 LYS C CB  1 
ATOM 8150  N N   . ILE C 1 205 ? -82.561  59.970  -62.696  1.00 203.33 ? 174 ILE C N   1 
ATOM 8151  C CA  . ILE C 1 205 ? -81.572  58.970  -63.095  1.00 202.23 ? 174 ILE C CA  1 
ATOM 8152  C C   . ILE C 1 205 ? -80.463  59.533  -64.008  1.00 202.44 ? 174 ILE C C   1 
ATOM 8153  O O   . ILE C 1 205 ? -80.741  60.302  -64.934  1.00 203.79 ? 174 ILE C O   1 
ATOM 8154  C CB  . ILE C 1 205 ? -82.275  57.687  -63.683  1.00 202.13 ? 174 ILE C CB  1 
ATOM 8155  C CG1 . ILE C 1 205 ? -81.366  56.458  -63.572  1.00 200.69 ? 174 ILE C CG1 1 
ATOM 8156  C CG2 . ILE C 1 205 ? -82.839  57.905  -65.112  1.00 203.29 ? 174 ILE C CG2 1 
ATOM 8157  C CD1 . ILE C 1 205 ? -81.165  55.979  -62.148  1.00 199.17 ? 174 ILE C CD1 1 
ATOM 8158  N N   . TYR C 1 206 ? -79.211  59.170  -63.722  1.00 201.24 ? 175 TYR C N   1 
ATOM 8159  C CA  . TYR C 1 206 ? -78.078  59.572  -64.567  1.00 201.44 ? 175 TYR C CA  1 
ATOM 8160  C C   . TYR C 1 206 ? -76.909  58.587  -64.513  1.00 200.24 ? 175 TYR C C   1 
ATOM 8161  O O   . TYR C 1 206 ? -76.411  58.245  -63.439  1.00 199.25 ? 175 TYR C O   1 
ATOM 8162  C CB  . TYR C 1 206 ? -77.601  60.987  -64.224  1.00 202.21 ? 175 TYR C CB  1 
ATOM 8163  N N   . THR C 1 207 ? -76.485  58.133  -65.688  1.00 200.32 ? 176 THR C N   1 
ATOM 8164  C CA  . THR C 1 207 ? -75.381  57.187  -65.802  1.00 199.33 ? 176 THR C CA  1 
ATOM 8165  C C   . THR C 1 207 ? -74.322  57.712  -66.768  1.00 200.16 ? 176 THR C C   1 
ATOM 8166  O O   . THR C 1 207 ? -74.585  58.619  -67.564  1.00 201.40 ? 176 THR C O   1 
ATOM 8167  C CB  . THR C 1 207 ? -75.859  55.772  -66.240  1.00 198.67 ? 176 THR C CB  1 
ATOM 8168  O OG1 . THR C 1 207 ? -76.301  55.792  -67.602  1.00 199.42 ? 176 THR C OG1 1 
ATOM 8169  C CG2 . THR C 1 207 ? -76.992  55.282  -65.358  1.00 198.02 ? 176 THR C CG2 1 
ATOM 8170  N N   . PHE C 1 208 ? -73.126  57.135  -66.679  1.00 199.61 ? 177 PHE C N   1 
ATOM 8171  C CA  . PHE C 1 208 ? -71.989  57.535  -67.496  1.00 200.40 ? 177 PHE C CA  1 
ATOM 8172  C C   . PHE C 1 208 ? -70.917  56.463  -67.476  1.00 199.75 ? 177 PHE C C   1 
ATOM 8173  O O   . PHE C 1 208 ? -70.653  55.847  -66.444  1.00 198.65 ? 177 PHE C O   1 
ATOM 8174  C CB  . PHE C 1 208 ? -71.402  58.865  -67.003  1.00 201.15 ? 177 PHE C CB  1 
ATOM 8175  C CG  . PHE C 1 208 ? -70.863  58.819  -65.589  1.00 200.28 ? 177 PHE C CG  1 
ATOM 8176  C CD1 . PHE C 1 208 ? -69.493  58.671  -65.357  1.00 200.24 ? 177 PHE C CD1 1 
ATOM 8177  C CD2 . PHE C 1 208 ? -71.719  58.945  -64.491  1.00 199.34 ? 177 PHE C CD2 1 
ATOM 8178  C CE1 . PHE C 1 208 ? -68.983  58.637  -64.059  1.00 199.35 ? 177 PHE C CE1 1 
ATOM 8179  C CE2 . PHE C 1 208 ? -71.217  58.910  -63.190  1.00 198.47 ? 177 PHE C CE2 1 
ATOM 8180  C CZ  . PHE C 1 208 ? -69.846  58.758  -62.974  1.00 198.57 ? 177 PHE C CZ  1 
ATOM 8181  N N   . ASN C 1 209 ? -70.286  56.259  -68.620  1.00 200.55 ? 178 ASN C N   1 
ATOM 8182  C CA  . ASN C 1 209 ? -69.206  55.299  -68.730  1.00 200.42 ? 178 ASN C CA  1 
ATOM 8183  C C   . ASN C 1 209 ? -67.961  55.710  -67.928  1.00 200.56 ? 178 ASN C C   1 
ATOM 8184  O O   . ASN C 1 209 ? -67.873  56.833  -67.436  1.00 200.85 ? 178 ASN C O   1 
ATOM 8185  C CB  . ASN C 1 209 ? -68.856  55.111  -70.208  1.00 201.59 ? 178 ASN C CB  1 
ATOM 8186  C CG  . ASN C 1 209 ? -68.097  53.825  -70.473  1.00 201.52 ? 178 ASN C CG  1 
ATOM 8187  O OD1 . ASN C 1 209 ? -68.025  52.946  -69.616  1.00 200.92 ? 178 ASN C OD1 1 
ATOM 8188  N ND2 . ASN C 1 209 ? -67.525  53.710  -71.668  1.00 202.80 ? 178 ASN C ND2 1 
ATOM 8189  N N   . GLN C 1 210 ? -67.030  54.773  -67.762  1.00 200.52 ? 179 GLN C N   1 
ATOM 8190  C CA  . GLN C 1 210 ? -65.644  55.085  -67.387  1.00 201.40 ? 179 GLN C CA  1 
ATOM 8191  C C   . GLN C 1 210 ? -64.717  54.641  -68.534  1.00 202.61 ? 179 GLN C C   1 
ATOM 8192  O O   . GLN C 1 210 ? -64.857  53.528  -69.055  1.00 202.43 ? 179 GLN C O   1 
ATOM 8193  C CB  . GLN C 1 210 ? -65.250  54.460  -66.029  1.00 200.36 ? 179 GLN C CB  1 
ATOM 8194  C CG  . GLN C 1 210 ? -65.112  52.929  -65.994  1.00 199.78 ? 179 GLN C CG  1 
ATOM 8195  C CD  . GLN C 1 210 ? -64.892  52.363  -64.591  1.00 198.84 ? 179 GLN C CD  1 
ATOM 8196  O OE1 . GLN C 1 210 ? -65.511  52.805  -63.615  1.00 197.65 ? 179 GLN C OE1 1 
ATOM 8197  N NE2 . GLN C 1 210 ? -64.018  51.362  -64.490  1.00 198.94 ? 179 GLN C NE2 1 
ATOM 8198  N N   . SER C 1 211 ? -63.790  55.514  -68.929  1.00 204.00 ? 180 SER C N   1 
ATOM 8199  C CA  . SER C 1 211 ? -62.988  55.329  -70.155  1.00 205.42 ? 180 SER C CA  1 
ATOM 8200  C C   . SER C 1 211 ? -62.275  53.962  -70.313  1.00 205.12 ? 180 SER C C   1 
ATOM 8201  O O   . SER C 1 211 ? -61.895  53.327  -69.324  1.00 204.33 ? 180 SER C O   1 
ATOM 8202  C CB  . SER C 1 211 ? -61.997  56.492  -70.320  1.00 207.13 ? 180 SER C CB  1 
ATOM 8203  O OG  . SER C 1 211 ? -61.307  56.755  -69.107  1.00 207.22 ? 180 SER C OG  1 
ATOM 8204  N N   . ARG C 1 212 ? -62.121  53.525  -71.568  1.00 205.74 ? 181 ARG C N   1 
ATOM 8205  C CA  . ARG C 1 212 ? -61.407  52.288  -71.925  1.00 205.58 ? 181 ARG C CA  1 
ATOM 8206  C C   . ARG C 1 212 ? -59.894  52.477  -71.782  1.00 206.75 ? 181 ARG C C   1 
ATOM 8207  O O   . ARG C 1 212 ? -59.408  53.606  -71.823  1.00 207.95 ? 181 ARG C O   1 
ATOM 8208  C CB  . ARG C 1 212 ? -61.738  51.889  -73.370  1.00 206.24 ? 181 ARG C CB  1 
ATOM 8209  C CG  . ARG C 1 212 ? -61.509  50.418  -73.671  1.00 205.93 ? 181 ARG C CG  1 
ATOM 8210  C CD  . ARG C 1 212 ? -61.015  50.161  -75.090  1.00 207.22 ? 181 ARG C CD  1 
ATOM 8211  N NE  . ARG C 1 212 ? -60.573  48.771  -75.230  1.00 207.25 ? 181 ARG C NE  1 
ATOM 8212  C CZ  . ARG C 1 212 ? -60.025  48.241  -76.323  1.00 208.21 ? 181 ARG C CZ  1 
ATOM 8213  N NH1 . ARG C 1 212 ? -59.833  48.976  -77.412  1.00 209.72 ? 181 ARG C NH1 1 
ATOM 8214  N NH2 . ARG C 1 212 ? -59.665  46.963  -76.321  1.00 207.73 ? 181 ARG C NH2 1 
ATOM 8215  N N   . TYR C 1 213 ? -59.154  51.381  -71.618  1.00 206.54 ? 182 TYR C N   1 
ATOM 8216  C CA  . TYR C 1 213 ? -57.688  51.430  -71.553  1.00 207.84 ? 182 TYR C CA  1 
ATOM 8217  C C   . TYR C 1 213 ? -57.043  50.269  -72.311  1.00 208.68 ? 182 TYR C C   1 
ATOM 8218  O O   . TYR C 1 213 ? -57.672  49.228  -72.501  1.00 207.69 ? 182 TYR C O   1 
ATOM 8219  C CB  . TYR C 1 213 ? -57.200  51.461  -70.101  1.00 207.16 ? 182 TYR C CB  1 
ATOM 8220  C CG  . TYR C 1 213 ? -57.018  52.852  -69.519  1.00 207.33 ? 182 TYR C CG  1 
ATOM 8221  C CD1 . TYR C 1 213 ? -58.109  53.580  -69.039  1.00 205.75 ? 182 TYR C CD1 1 
ATOM 8222  C CD2 . TYR C 1 213 ? -55.752  53.433  -69.429  1.00 208.88 ? 182 TYR C CD2 1 
ATOM 8223  C CE1 . TYR C 1 213 ? -57.950  54.854  -68.497  1.00 205.79 ? 182 TYR C CE1 1 
ATOM 8224  C CE2 . TYR C 1 213 ? -55.580  54.709  -68.882  1.00 209.03 ? 182 TYR C CE2 1 
ATOM 8225  C CZ  . TYR C 1 213 ? -56.686  55.408  -68.418  1.00 207.51 ? 182 TYR C CZ  1 
ATOM 8226  O OH  . TYR C 1 213 ? -56.538  56.662  -67.879  1.00 207.78 ? 182 TYR C OH  1 
ATOM 8227  N N   . PRO C 1 214 ? -55.782  50.447  -72.747  1.00 210.70 ? 183 PRO C N   1 
ATOM 8228  C CA  . PRO C 1 214 ? -55.100  49.455  -73.578  1.00 211.96 ? 183 PRO C CA  1 
ATOM 8229  C C   . PRO C 1 214 ? -54.158  48.518  -72.821  1.00 212.19 ? 183 PRO C C   1 
ATOM 8230  O O   . PRO C 1 214 ? -53.384  48.950  -71.960  1.00 212.52 ? 183 PRO C O   1 
ATOM 8231  C CB  . PRO C 1 214 ? -54.307  50.319  -74.559  1.00 214.30 ? 183 PRO C CB  1 
ATOM 8232  C CG  . PRO C 1 214 ? -54.089  51.644  -73.829  1.00 214.61 ? 183 PRO C CG  1 
ATOM 8233  C CD  . PRO C 1 214 ? -54.973  51.671  -72.605  1.00 212.19 ? 183 PRO C CD  1 
ATOM 8234  N N   . ARG C 1 215 ? -54.223  47.241  -73.178  1.00 212.15 ? 184 ARG C N   1 
ATOM 8235  C CA  . ARG C 1 215 ? -53.465  46.196  -72.507  1.00 212.58 ? 184 ARG C CA  1 
ATOM 8236  C C   . ARG C 1 215 ? -52.085  45.962  -73.135  1.00 215.15 ? 184 ARG C C   1 
ATOM 8237  O O   . ARG C 1 215 ? -51.978  45.378  -74.219  1.00 216.11 ? 184 ARG C O   1 
ATOM 8238  C CB  . ARG C 1 215 ? -54.284  44.900  -72.488  1.00 211.17 ? 184 ARG C CB  1 
ATOM 8239  N N   . ILE C 1 216 ? -51.038  46.423  -72.448  1.00 216.44 ? 185 ILE C N   1 
ATOM 8240  C CA  . ILE C 1 216 ? -49.652  46.218  -72.900  1.00 219.06 ? 185 ILE C CA  1 
ATOM 8241  C C   . ILE C 1 216 ? -49.030  44.952  -72.288  1.00 219.36 ? 185 ILE C C   1 
ATOM 8242  O O   . ILE C 1 216 ? -49.215  44.652  -71.103  1.00 217.97 ? 185 ILE C O   1 
ATOM 8243  C CB  . ILE C 1 216 ? -48.746  47.500  -72.687  1.00 220.73 ? 185 ILE C CB  1 
ATOM 8244  C CG1 . ILE C 1 216 ? -47.382  47.378  -73.409  1.00 223.45 ? 185 ILE C CG1 1 
ATOM 8245  C CG2 . ILE C 1 216 ? -48.597  47.850  -71.191  1.00 219.61 ? 185 ILE C CG2 1 
ATOM 8246  C CD1 . ILE C 1 216 ? -47.415  47.613  -74.928  1.00 223.79 ? 185 ILE C CD1 1 
ATOM 8247  N N   . ASN C 1 217 ? -48.308  44.210  -73.123  1.00 221.29 ? 186 ASN C N   1 
ATOM 8248  C CA  . ASN C 1 217 ? -47.625  42.992  -72.704  1.00 222.10 ? 186 ASN C CA  1 
ATOM 8249  C C   . ASN C 1 217 ? -46.357  43.285  -71.881  1.00 223.86 ? 186 ASN C C   1 
ATOM 8250  O O   . ASN C 1 217 ? -45.614  44.229  -72.188  1.00 225.79 ? 186 ASN C O   1 
ATOM 8251  C CB  . ASN C 1 217 ? -47.289  42.144  -73.936  1.00 223.62 ? 186 ASN C CB  1 
ATOM 8252  C CG  . ASN C 1 217 ? -47.177  40.662  -73.616  1.00 223.62 ? 186 ASN C CG  1 
ATOM 8253  O OD1 . ASN C 1 217 ? -47.984  40.112  -72.860  1.00 221.53 ? 186 ASN C OD1 1 
ATOM 8254  N ND2 . ASN C 1 217 ? -46.177  40.005  -74.199  1.00 226.10 ? 186 ASN C ND2 1 
ATOM 8255  N N   . LYS C 1 218 ? -46.117  42.470  -70.846  1.00 223.33 ? 187 LYS C N   1 
ATOM 8256  C CA  . LYS C 1 218 ? -44.954  42.620  -69.942  1.00 224.54 ? 187 LYS C CA  1 
ATOM 8257  C C   . LYS C 1 218 ? -43.627  42.096  -70.512  1.00 227.33 ? 187 LYS C C   1 
ATOM 8258  O O   . LYS C 1 218 ? -42.582  42.231  -69.874  1.00 228.91 ? 187 LYS C O   1 
ATOM 8259  C CB  . LYS C 1 218 ? -45.233  41.959  -68.587  1.00 223.03 ? 187 LYS C CB  1 
ATOM 8260  N N   . GLU C 1 219 ? -43.685  41.490  -71.697  1.00 227.91 ? 188 GLU C N   1 
ATOM 8261  C CA  . GLU C 1 219 ? -42.495  41.074  -72.442  1.00 230.83 ? 188 GLU C CA  1 
ATOM 8262  C C   . GLU C 1 219 ? -42.019  42.195  -73.377  1.00 232.66 ? 188 GLU C C   1 
ATOM 8263  O O   . GLU C 1 219 ? -40.811  42.391  -73.559  1.00 235.52 ? 188 GLU C O   1 
ATOM 8264  C CB  . GLU C 1 219 ? -42.780  39.797  -73.241  1.00 230.81 ? 188 GLU C CB  1 
ATOM 8265  C CG  . GLU C 1 219 ? -42.790  38.509  -72.412  1.00 229.95 ? 188 GLU C CG  1 
ATOM 8266  C CD  . GLU C 1 219 ? -41.449  37.776  -72.406  1.00 232.47 ? 188 GLU C CD  1 
ATOM 8267  O OE1 . GLU C 1 219 ? -40.848  37.599  -73.488  1.00 234.41 ? 188 GLU C OE1 1 
ATOM 8268  O OE2 . GLU C 1 219 ? -41.003  37.355  -71.318  1.00 232.37 ? 188 GLU C OE2 1 
ATOM 8269  N N   . SER C 1 220 ? -42.981  42.916  -73.962  1.00 231.07 ? 189 SER C N   1 
ATOM 8270  C CA  . SER C 1 220 ? -42.729  44.051  -74.859  1.00 232.41 ? 189 SER C CA  1 
ATOM 8271  C C   . SER C 1 220 ? -44.001  44.887  -75.036  1.00 230.06 ? 189 SER C C   1 
ATOM 8272  O O   . SER C 1 220 ? -44.162  45.950  -74.425  1.00 229.34 ? 189 SER C O   1 
ATOM 8273  C CB  . SER C 1 220 ? -42.249  43.566  -76.233  1.00 234.65 ? 189 SER C CB  1 
ATOM 8274  O OG  . SER C 1 220 ? -40.992  42.913  -76.152  1.00 237.01 ? 189 SER C OG  1 
ATOM 8275  N N   . TYR C 1 239 ? -59.482  46.659  -71.163  1.00 99.71  ? 208 TYR C N   1 
ATOM 8276  C CA  . TYR C 1 239 ? -59.761  46.592  -69.728  1.00 99.91  ? 208 TYR C CA  1 
ATOM 8277  C C   . TYR C 1 239 ? -60.029  47.989  -69.117  1.00 99.77  ? 208 TYR C C   1 
ATOM 8278  O O   . TYR C 1 239 ? -59.511  48.985  -69.628  1.00 99.81  ? 208 TYR C O   1 
ATOM 8279  C CB  . TYR C 1 239 ? -58.608  45.881  -69.001  1.00 100.05 ? 208 TYR C CB  1 
ATOM 8280  C CG  . TYR C 1 239 ? -57.305  46.659  -68.973  1.00 100.93 ? 208 TYR C CG  1 
ATOM 8281  C CD1 . TYR C 1 239 ? -57.026  47.561  -67.939  1.00 101.52 ? 208 TYR C CD1 1 
ATOM 8282  C CD2 . TYR C 1 239 ? -56.347  46.492  -69.972  1.00 101.50 ? 208 TYR C CD2 1 
ATOM 8283  C CE1 . TYR C 1 239 ? -55.835  48.288  -67.908  1.00 101.77 ? 208 TYR C CE1 1 
ATOM 8284  C CE2 . TYR C 1 239 ? -55.152  47.207  -69.944  1.00 101.79 ? 208 TYR C CE2 1 
ATOM 8285  C CZ  . TYR C 1 239 ? -54.901  48.102  -68.914  1.00 101.94 ? 208 TYR C CZ  1 
ATOM 8286  O OH  . TYR C 1 239 ? -53.717  48.804  -68.898  1.00 102.03 ? 208 TYR C OH  1 
ATOM 8287  N N   . PRO C 1 240 ? -60.841  48.064  -68.028  1.00 99.66  ? 209 PRO C N   1 
ATOM 8288  C CA  . PRO C 1 240 ? -61.105  49.314  -67.288  1.00 99.51  ? 209 PRO C CA  1 
ATOM 8289  C C   . PRO C 1 240 ? -59.860  49.934  -66.639  1.00 99.46  ? 209 PRO C C   1 
ATOM 8290  O O   . PRO C 1 240 ? -58.759  49.406  -66.786  1.00 99.36  ? 209 PRO C O   1 
ATOM 8291  C CB  . PRO C 1 240 ? -62.096  48.877  -66.196  1.00 99.42  ? 209 PRO C CB  1 
ATOM 8292  C CG  . PRO C 1 240 ? -62.751  47.686  -66.734  1.00 99.56  ? 209 PRO C CG  1 
ATOM 8293  C CD  . PRO C 1 240 ? -61.698  46.968  -67.536  1.00 99.68  ? 209 PRO C CD  1 
ATOM 8294  N N   . PRO C 1 241 ? -60.027  51.069  -65.939  1.00 99.54  ? 210 PRO C N   1 
ATOM 8295  C CA  . PRO C 1 241 ? -58.903  51.671  -65.233  1.00 99.63  ? 210 PRO C CA  1 
ATOM 8296  C C   . PRO C 1 241 ? -59.049  51.579  -63.714  1.00 99.69  ? 210 PRO C C   1 
ATOM 8297  O O   . PRO C 1 241 ? -58.501  52.411  -62.983  1.00 99.64  ? 210 PRO C O   1 
ATOM 8298  C CB  . PRO C 1 241 ? -58.982  53.133  -65.672  1.00 99.67  ? 210 PRO C CB  1 
ATOM 8299  C CG  . PRO C 1 241 ? -60.436  53.328  -66.170  1.00 99.69  ? 210 PRO C CG  1 
ATOM 8300  C CD  . PRO C 1 241 ? -61.146  52.019  -66.041  1.00 99.53  ? 210 PRO C CD  1 
ATOM 8301  N N   . GLY C 1 242 ? -59.785  50.570  -63.252  1.00 99.77  ? 211 GLY C N   1 
ATOM 8302  C CA  . GLY C 1 242 ? -60.085  50.413  -61.833  1.00 99.78  ? 211 GLY C CA  1 
ATOM 8303  C C   . GLY C 1 242 ? -61.117  51.428  -61.392  1.00 99.77  ? 211 GLY C C   1 
ATOM 8304  O O   . GLY C 1 242 ? -61.560  52.261  -62.188  1.00 99.75  ? 211 GLY C O   1 
ATOM 8305  N N   . HIS C 1 243 ? -61.502  51.358  -60.120  1.00 99.80  ? 212 HIS C N   1 
ATOM 8306  C CA  . HIS C 1 243 ? -62.495  52.280  -59.561  1.00 99.83  ? 212 HIS C CA  1 
ATOM 8307  C C   . HIS C 1 243 ? -61.915  53.677  -59.291  1.00 99.74  ? 212 HIS C C   1 
ATOM 8308  O O   . HIS C 1 243 ? -62.656  54.659  -59.208  1.00 99.67  ? 212 HIS C O   1 
ATOM 8309  C CB  . HIS C 1 243 ? -63.174  51.688  -58.311  1.00 99.79  ? 212 HIS C CB  1 
ATOM 8310  C CG  . HIS C 1 243 ? -62.220  51.204  -57.264  1.00 100.17 ? 212 HIS C CG  1 
ATOM 8311  N ND1 . HIS C 1 243 ? -62.141  51.771  -56.010  1.00 100.39 ? 212 HIS C ND1 1 
ATOM 8312  C CD2 . HIS C 1 243 ? -61.309  50.200  -57.281  1.00 100.58 ? 212 HIS C CD2 1 
ATOM 8313  C CE1 . HIS C 1 243 ? -61.219  51.143  -55.301  1.00 100.80 ? 212 HIS C CE1 1 
ATOM 8314  N NE2 . HIS C 1 243 ? -60.699  50.185  -56.050  1.00 100.91 ? 212 HIS C NE2 1 
ATOM 8315  N N   . GLY C 1 244 ? -60.591  53.759  -59.184  1.00 99.70  ? 213 GLY C N   1 
ATOM 8316  C CA  . GLY C 1 244 ? -59.907  55.024  -58.947  1.00 99.62  ? 213 GLY C CA  1 
ATOM 8317  C C   . GLY C 1 244 ? -60.219  56.071  -59.990  1.00 99.60  ? 213 GLY C C   1 
ATOM 8318  O O   . GLY C 1 244 ? -60.427  57.235  -59.658  1.00 99.63  ? 213 GLY C O   1 
ATOM 8319  N N   . ASP C 1 245 ? -60.251  55.652  -61.252  1.00 99.66  ? 214 ASP C N   1 
ATOM 8320  C CA  . ASP C 1 245 ? -60.614  56.532  -62.355  1.00 99.79  ? 214 ASP C CA  1 
ATOM 8321  C C   . ASP C 1 245 ? -62.077  56.923  -62.228  1.00 99.91  ? 214 ASP C C   1 
ATOM 8322  O O   . ASP C 1 245 ? -62.964  56.226  -62.715  1.00 100.00 ? 214 ASP C O   1 
ATOM 8323  C CB  . ASP C 1 245 ? -60.357  55.842  -63.700  1.00 99.78  ? 214 ASP C CB  1 
ATOM 8324  C CG  . ASP C 1 245 ? -60.814  56.677  -64.898  1.00 99.75  ? 214 ASP C CG  1 
ATOM 8325  O OD1 . ASP C 1 245 ? -60.232  57.758  -65.134  1.00 99.88  ? 214 ASP C OD1 1 
ATOM 8326  O OD2 . ASP C 1 245 ? -61.744  56.239  -65.613  1.00 99.29  ? 214 ASP C OD2 1 
ATOM 8327  N N   . ILE C 1 246 ? -62.323  58.033  -61.547  1.00 100.11 ? 215 ILE C N   1 
ATOM 8328  C CA  . ILE C 1 246 ? -63.675  58.546  -61.397  1.00 100.42 ? 215 ILE C CA  1 
ATOM 8329  C C   . ILE C 1 246 ? -63.661  60.064  -61.272  1.00 100.91 ? 215 ILE C C   1 
ATOM 8330  O O   . ILE C 1 246 ? -64.592  60.733  -61.701  1.00 101.02 ? 215 ILE C O   1 
ATOM 8331  C CB  . ILE C 1 246 ? -64.432  57.868  -60.223  1.00 100.28 ? 215 ILE C CB  1 
ATOM 8332  C CG1 . ILE C 1 246 ? -65.946  58.015  -60.408  1.00 100.12 ? 215 ILE C CG1 1 
ATOM 8333  C CG2 . ILE C 1 246 ? -63.951  58.388  -58.865  1.00 100.16 ? 215 ILE C CG2 1 
ATOM 8334  C CD1 . ILE C 1 246 ? -66.748  56.878  -59.830  1.00 99.90  ? 215 ILE C CD1 1 
ATOM 8335  N N   . TYR C 1 247 ? -62.591  60.600  -60.696  1.00 101.53 ? 216 TYR C N   1 
ATOM 8336  C CA  . TYR C 1 247 ? -62.391  62.041  -60.636  1.00 102.14 ? 216 TYR C CA  1 
ATOM 8337  C C   . TYR C 1 247 ? -62.052  62.566  -62.033  1.00 102.41 ? 216 TYR C C   1 
ATOM 8338  O O   . TYR C 1 247 ? -62.363  63.716  -62.374  1.00 102.47 ? 216 TYR C O   1 
ATOM 8339  C CB  . TYR C 1 247 ? -61.259  62.377  -59.662  1.00 102.29 ? 216 TYR C CB  1 
ATOM 8340  C CG  . TYR C 1 247 ? -61.349  61.687  -58.312  1.00 102.70 ? 216 TYR C CG  1 
ATOM 8341  C CD1 . TYR C 1 247 ? -62.388  61.975  -57.425  1.00 103.07 ? 216 TYR C CD1 1 
ATOM 8342  C CD2 . TYR C 1 247 ? -60.380  60.764  -57.913  1.00 103.04 ? 216 TYR C CD2 1 
ATOM 8343  C CE1 . TYR C 1 247 ? -62.468  61.351  -56.181  1.00 103.39 ? 216 TYR C CE1 1 
ATOM 8344  C CE2 . TYR C 1 247 ? -60.451  60.134  -56.670  1.00 103.37 ? 216 TYR C CE2 1 
ATOM 8345  C CZ  . TYR C 1 247 ? -61.498  60.434  -55.811  1.00 103.60 ? 216 TYR C CZ  1 
ATOM 8346  O OH  . TYR C 1 247 ? -61.580  59.823  -54.580  1.00 104.10 ? 216 TYR C OH  1 
ATOM 8347  N N   . ALA C 1 248 ? -61.419  61.699  -62.828  1.00 102.70 ? 217 ALA C N   1 
ATOM 8348  C CA  . ALA C 1 248 ? -60.985  62.010  -64.190  1.00 102.92 ? 217 ALA C CA  1 
ATOM 8349  C C   . ALA C 1 248 ? -62.072  61.770  -65.249  1.00 103.07 ? 217 ALA C C   1 
ATOM 8350  O O   . ALA C 1 248 ? -62.040  62.384  -66.318  1.00 103.09 ? 217 ALA C O   1 
ATOM 8351  C CB  . ALA C 1 248 ? -59.710  61.225  -64.534  1.00 102.85 ? 217 ALA C CB  1 
ATOM 8352  N N   . SER C 1 249 ? -63.018  60.873  -64.956  1.00 103.28 ? 218 SER C N   1 
ATOM 8353  C CA  . SER C 1 249 ? -64.138  60.590  -65.873  1.00 103.47 ? 218 SER C CA  1 
ATOM 8354  C C   . SER C 1 249 ? -65.506  61.051  -65.339  1.00 103.54 ? 218 SER C C   1 
ATOM 8355  O O   . SER C 1 249 ? -66.544  60.794  -65.954  1.00 103.48 ? 218 SER C O   1 
ATOM 8356  C CB  . SER C 1 249 ? -64.161  59.119  -66.320  1.00 103.48 ? 218 SER C CB  1 
ATOM 8357  O OG  . SER C 1 249 ? -63.946  58.235  -65.234  1.00 103.88 ? 218 SER C OG  1 
ATOM 8358  N N   . PHE C 1 250 ? -65.489  61.720  -64.189  1.00 215.63 ? 219 PHE C N   1 
ATOM 8359  C CA  . PHE C 1 250 ? -66.632  62.486  -63.713  1.00 215.62 ? 219 PHE C CA  1 
ATOM 8360  C C   . PHE C 1 250 ? -66.571  63.827  -64.436  1.00 218.24 ? 219 PHE C C   1 
ATOM 8361  O O   . PHE C 1 250 ? -67.591  64.362  -64.880  1.00 219.10 ? 219 PHE C O   1 
ATOM 8362  C CB  . PHE C 1 250 ? -66.533  62.696  -62.202  1.00 214.20 ? 219 PHE C CB  1 
ATOM 8363  C CG  . PHE C 1 250 ? -67.859  62.884  -61.515  1.00 213.04 ? 219 PHE C CG  1 
ATOM 8364  C CD1 . PHE C 1 250 ? -68.681  61.790  -61.243  1.00 210.88 ? 219 PHE C CD1 1 
ATOM 8365  C CD2 . PHE C 1 250 ? -68.275  64.152  -61.109  1.00 213.68 ? 219 PHE C CD2 1 
ATOM 8366  C CE1 . PHE C 1 250 ? -69.904  61.962  -60.594  1.00 209.78 ? 219 PHE C CE1 1 
ATOM 8367  C CE2 . PHE C 1 250 ? -69.497  64.334  -60.459  1.00 212.50 ? 219 PHE C CE2 1 
ATOM 8368  C CZ  . PHE C 1 250 ? -70.312  63.237  -60.201  1.00 210.55 ? 219 PHE C CZ  1 
ATOM 8369  N N   . TYR C 1 251 ? -65.351  64.351  -64.556  1.00 219.80 ? 220 TYR C N   1 
ATOM 8370  C CA  . TYR C 1 251 ? -65.074  65.549  -65.343  1.00 222.72 ? 220 TYR C CA  1 
ATOM 8371  C C   . TYR C 1 251 ? -65.190  65.266  -66.851  1.00 224.47 ? 220 TYR C C   1 
ATOM 8372  O O   . TYR C 1 251 ? -65.492  66.172  -67.634  1.00 226.83 ? 220 TYR C O   1 
ATOM 8373  C CB  . TYR C 1 251 ? -63.687  66.113  -64.987  1.00 223.56 ? 220 TYR C CB  1 
ATOM 8374  C CG  . TYR C 1 251 ? -63.433  67.491  -65.547  1.00 226.84 ? 220 TYR C CG  1 
ATOM 8375  C CD1 . TYR C 1 251 ? -64.152  68.596  -65.081  1.00 228.29 ? 220 TYR C CD1 1 
ATOM 8376  C CD2 . TYR C 1 251 ? -62.485  67.691  -66.548  1.00 229.14 ? 220 TYR C CD2 1 
ATOM 8377  C CE1 . TYR C 1 251 ? -63.935  69.862  -65.598  1.00 231.45 ? 220 TYR C CE1 1 
ATOM 8378  C CE2 . TYR C 1 251 ? -62.258  68.955  -67.073  1.00 232.50 ? 220 TYR C CE2 1 
ATOM 8379  C CZ  . TYR C 1 251 ? -62.986  70.035  -66.593  1.00 233.67 ? 220 TYR C CZ  1 
ATOM 8380  O OH  . TYR C 1 251 ? -62.763  71.290  -67.106  1.00 237.35 ? 220 TYR C OH  1 
ATOM 8381  N N   . ASN C 1 252 ? -64.966  64.002  -67.229  1.00 223.63 ? 221 ASN C N   1 
ATOM 8382  C CA  . ASN C 1 252 ? -65.016  63.524  -68.624  1.00 225.32 ? 221 ASN C CA  1 
ATOM 8383  C C   . ASN C 1 252 ? -66.401  63.703  -69.262  1.00 225.80 ? 221 ASN C C   1 
ATOM 8384  O O   . ASN C 1 252 ? -66.516  64.244  -70.364  1.00 228.43 ? 221 ASN C O   1 
ATOM 8385  C CB  . ASN C 1 252 ? -64.583  62.041  -68.698  1.00 224.29 ? 221 ASN C CB  1 
ATOM 8386  C CG  . ASN C 1 252 ? -63.558  61.746  -69.819  1.00 227.09 ? 221 ASN C CG  1 
ATOM 8387  O OD1 . ASN C 1 252 ? -63.029  62.652  -70.473  1.00 230.42 ? 221 ASN C OD1 1 
ATOM 8388  N ND2 . ASN C 1 252 ? -63.263  60.458  -70.017  1.00 226.81 ? 221 ASN C ND2 1 
ATOM 8389  N N   . SER C 1 253 ? -67.447  63.259  -68.564  1.00 223.35 ? 222 SER C N   1 
ATOM 8390  C CA  . SER C 1 253 ? -68.820  63.434  -69.038  1.00 223.40 ? 222 SER C CA  1 
ATOM 8391  C C   . SER C 1 253 ? -69.251  64.893  -68.913  1.00 224.49 ? 222 SER C C   1 
ATOM 8392  O O   . SER C 1 253 ? -70.148  65.349  -69.622  1.00 225.95 ? 222 SER C O   1 
ATOM 8393  C CB  . SER C 1 253 ? -69.779  62.543  -68.251  1.00 220.79 ? 222 SER C CB  1 
ATOM 8394  O OG  . SER C 1 253 ? -69.985  63.062  -66.949  1.00 219.49 ? 222 SER C OG  1 
ATOM 8395  N N   . GLY C 1 254 ? -68.607  65.614  -68.000  1.00 223.82 ? 223 GLY C N   1 
ATOM 8396  C CA  . GLY C 1 254 ? -68.916  67.013  -67.766  1.00 225.02 ? 223 GLY C CA  1 
ATOM 8397  C C   . GLY C 1 254 ? -70.032  67.196  -66.759  1.00 223.23 ? 223 GLY C C   1 
ATOM 8398  O O   . GLY C 1 254 ? -70.306  68.317  -66.330  1.00 224.43 ? 223 GLY C O   1 
ATOM 8399  N N   . LEU C 1 255 ? -70.674  66.097  -66.370  1.00 220.55 ? 224 LEU C N   1 
ATOM 8400  C CA  . LEU C 1 255 ? -71.757  66.150  -65.389  1.00 218.82 ? 224 LEU C CA  1 
ATOM 8401  C C   . LEU C 1 255 ? -71.278  66.652  -64.017  1.00 217.97 ? 224 LEU C C   1 
ATOM 8402  O O   . LEU C 1 255 ? -72.086  66.859  -63.106  1.00 217.11 ? 224 LEU C O   1 
ATOM 8403  C CB  . LEU C 1 255 ? -72.462  64.790  -65.272  1.00 216.54 ? 224 LEU C CB  1 
ATOM 8404  C CG  . LEU C 1 255 ? -73.118  64.174  -66.520  1.00 217.15 ? 224 LEU C CG  1 
ATOM 8405  C CD1 . LEU C 1 255 ? -73.818  62.859  -66.162  1.00 214.64 ? 224 LEU C CD1 1 
ATOM 8406  C CD2 . LEU C 1 255 ? -74.086  65.139  -67.225  1.00 219.00 ? 224 LEU C CD2 1 
ATOM 8407  N N   . LEU C 1 256 ? -69.964  66.854  -63.893  1.00 218.37 ? 225 LEU C N   1 
ATOM 8408  C CA  . LEU C 1 256 ? -69.346  67.443  -62.701  1.00 218.02 ? 225 LEU C CA  1 
ATOM 8409  C C   . LEU C 1 256 ? -69.841  68.879  -62.514  1.00 219.95 ? 225 LEU C C   1 
ATOM 8410  O O   . LEU C 1 256 ? -70.394  69.215  -61.460  1.00 219.41 ? 225 LEU C O   1 
ATOM 8411  C CB  . LEU C 1 256 ? -67.810  67.404  -62.814  1.00 218.47 ? 225 LEU C CB  1 
ATOM 8412  C CG  . LEU C 1 256 ? -66.918  67.572  -61.573  1.00 217.83 ? 225 LEU C CG  1 
ATOM 8413  C CD1 . LEU C 1 256 ? -65.568  66.895  -61.793  1.00 217.44 ? 225 LEU C CD1 1 
ATOM 8414  C CD2 . LEU C 1 256 ? -66.718  69.035  -61.177  1.00 220.08 ? 225 LEU C CD2 1 
ATOM 8415  N N   . ASP C 1 257 ? -69.650  69.705  -63.549  1.00 222.33 ? 226 ASP C N   1 
ATOM 8416  C CA  . ASP C 1 257 ? -70.098  71.106  -63.553  1.00 224.63 ? 226 ASP C CA  1 
ATOM 8417  C C   . ASP C 1 257 ? -71.627  71.239  -63.670  1.00 224.52 ? 226 ASP C C   1 
ATOM 8418  O O   . ASP C 1 257 ? -72.170  72.339  -63.527  1.00 226.56 ? 226 ASP C O   1 
ATOM 8419  C CB  . ASP C 1 257 ? -69.386  71.917  -64.653  1.00 227.64 ? 226 ASP C CB  1 
ATOM 8420  C CG  . ASP C 1 257 ? -68.071  72.538  -64.180  1.00 228.46 ? 226 ASP C CG  1 
ATOM 8421  O OD1 . ASP C 1 257 ? -68.031  73.778  -64.027  1.00 230.65 ? 226 ASP C OD1 1 
ATOM 8422  O OD2 . ASP C 1 257 ? -67.084  71.798  -63.966  1.00 226.63 ? 226 ASP C OD2 1 
ATOM 8423  N N   . THR C 1 258 ? -72.305  70.118  -63.922  1.00 222.21 ? 227 THR C N   1 
ATOM 8424  C CA  . THR C 1 258 ? -73.770  70.061  -63.923  1.00 221.54 ? 227 THR C CA  1 
ATOM 8425  C C   . THR C 1 258 ? -74.319  70.050  -62.491  1.00 219.82 ? 227 THR C C   1 
ATOM 8426  O O   . THR C 1 258 ? -75.262  70.781  -62.180  1.00 220.72 ? 227 THR C O   1 
ATOM 8427  C CB  . THR C 1 258 ? -74.304  68.822  -64.703  1.00 220.03 ? 227 THR C CB  1 
ATOM 8428  O OG1 . THR C 1 258 ? -73.748  68.797  -66.024  1.00 221.70 ? 227 THR C OG1 1 
ATOM 8429  C CG2 . THR C 1 258 ? -75.829  68.841  -64.804  1.00 219.69 ? 227 THR C CG2 1 
ATOM 8430  N N   . PHE C 1 259 ? -73.715  69.230  -61.629  1.00 217.49 ? 228 PHE C N   1 
ATOM 8431  C CA  . PHE C 1 259 ? -74.214  69.015  -60.264  1.00 215.81 ? 228 PHE C CA  1 
ATOM 8432  C C   . PHE C 1 259 ? -74.044  70.219  -59.331  1.00 217.38 ? 228 PHE C C   1 
ATOM 8433  O O   . PHE C 1 259 ? -74.975  70.571  -58.597  1.00 217.60 ? 228 PHE C O   1 
ATOM 8434  C CB  . PHE C 1 259 ? -73.584  67.762  -59.644  1.00 213.23 ? 228 PHE C CB  1 
ATOM 8435  N N   . ILE C 1 260 ? -72.869  70.851  -59.370  1.00 218.60 ? 229 ILE C N   1 
ATOM 8436  C CA  . ILE C 1 260 ? -72.547  71.974  -58.474  1.00 220.12 ? 229 ILE C CA  1 
ATOM 8437  C C   . ILE C 1 260 ? -73.396  73.227  -58.740  1.00 222.67 ? 229 ILE C C   1 
ATOM 8438  O O   . ILE C 1 260 ? -73.674  73.997  -57.817  1.00 223.95 ? 229 ILE C O   1 
ATOM 8439  C CB  . ILE C 1 260 ? -71.011  72.305  -58.470  1.00 220.98 ? 229 ILE C CB  1 
ATOM 8440  C CG1 . ILE C 1 260 ? -70.649  73.314  -57.370  1.00 222.51 ? 229 ILE C CG1 1 
ATOM 8441  C CG2 . ILE C 1 260 ? -70.537  72.793  -59.840  1.00 222.97 ? 229 ILE C CG2 1 
ATOM 8442  C CD1 . ILE C 1 260 ? -70.486  72.715  -55.988  1.00 220.40 ? 229 ILE C CD1 1 
ATOM 8443  N N   . GLY C 1 261 ? -73.822  73.408  -59.990  1.00 223.57 ? 230 GLY C N   1 
ATOM 8444  C CA  . GLY C 1 261 ? -74.594  74.587  -60.395  1.00 226.25 ? 230 GLY C CA  1 
ATOM 8445  C C   . GLY C 1 261 ? -76.041  74.642  -59.920  1.00 225.69 ? 230 GLY C C   1 
ATOM 8446  O O   . GLY C 1 261 ? -76.715  75.666  -60.090  1.00 228.29 ? 230 GLY C O   1 
ATOM 8447  N N   . GLU C 1 262 ? -76.518  73.548  -59.323  1.00 222.39 ? 231 GLU C N   1 
ATOM 8448  C CA  . GLU C 1 262 ? -77.905  73.452  -58.853  1.00 221.41 ? 231 GLU C CA  1 
ATOM 8449  C C   . GLU C 1 262 ? -78.021  73.511  -57.336  1.00 220.62 ? 231 GLU C C   1 
ATOM 8450  O O   . GLU C 1 262 ? -79.131  73.525  -56.795  1.00 220.31 ? 231 GLU C O   1 
ATOM 8451  C CB  . GLU C 1 262 ? -78.555  72.172  -59.370  1.00 218.73 ? 231 GLU C CB  1 
ATOM 8452  C CG  . GLU C 1 262 ? -78.892  72.224  -60.845  1.00 219.80 ? 231 GLU C CG  1 
ATOM 8453  C CD  . GLU C 1 262 ? -78.526  70.948  -61.570  1.00 217.85 ? 231 GLU C CD  1 
ATOM 8454  O OE1 . GLU C 1 262 ? -77.880  70.068  -60.962  1.00 215.61 ? 231 GLU C OE1 1 
ATOM 8455  O OE2 . GLU C 1 262 ? -78.878  70.831  -62.761  1.00 218.93 ? 231 GLU C OE2 1 
ATOM 8456  N N   . GLY C 1 263 ? -76.871  73.537  -56.661  1.00 220.30 ? 232 GLY C N   1 
ATOM 8457  C CA  . GLY C 1 263 ? -76.814  73.666  -55.206  1.00 219.90 ? 232 GLY C CA  1 
ATOM 8458  C C   . GLY C 1 263 ? -76.097  72.546  -54.463  1.00 217.09 ? 232 GLY C C   1 
ATOM 8459  O O   . GLY C 1 263 ? -75.683  72.738  -53.314  1.00 217.57 ? 232 GLY C O   1 
ATOM 8460  N N   . LYS C 1 264 ? -75.954  71.381  -55.107  1.00 214.28 ? 233 LYS C N   1 
ATOM 8461  C CA  . LYS C 1 264 ? -75.339  70.199  -54.477  1.00 211.43 ? 233 LYS C CA  1 
ATOM 8462  C C   . LYS C 1 264 ? -73.903  70.478  -54.019  1.00 211.72 ? 233 LYS C C   1 
ATOM 8463  O O   . LYS C 1 264 ? -73.128  71.126  -54.731  1.00 213.05 ? 233 LYS C O   1 
ATOM 8464  C CB  . LYS C 1 264 ? -75.393  68.976  -55.407  1.00 209.19 ? 233 LYS C CB  1 
ATOM 8465  N N   . GLU C 1 265 ? -73.568  69.997  -52.822  1.00 210.35 ? 234 GLU C N   1 
ATOM 8466  C CA  . GLU C 1 265 ? -72.262  70.251  -52.207  1.00 210.51 ? 234 GLU C CA  1 
ATOM 8467  C C   . GLU C 1 265 ? -71.463  68.971  -51.906  1.00 207.96 ? 234 GLU C C   1 
ATOM 8468  O O   . GLU C 1 265 ? -70.230  69.013  -51.809  1.00 208.18 ? 234 GLU C O   1 
ATOM 8469  C CB  . GLU C 1 265 ? -72.431  71.085  -50.933  1.00 212.33 ? 234 GLU C CB  1 
ATOM 8470  N N   . TYR C 1 266 ? -72.167  67.841  -51.777  1.00 205.43 ? 235 TYR C N   1 
ATOM 8471  C CA  . TYR C 1 266 ? -71.551  66.555  -51.400  1.00 202.87 ? 235 TYR C CA  1 
ATOM 8472  C C   . TYR C 1 266 ? -71.928  65.338  -52.266  1.00 200.39 ? 235 TYR C C   1 
ATOM 8473  O O   . TYR C 1 266 ? -73.048  65.243  -52.781  1.00 199.98 ? 235 TYR C O   1 
ATOM 8474  C CB  . TYR C 1 266 ? -71.850  66.244  -49.936  1.00 202.83 ? 235 TYR C CB  1 
ATOM 8475  C CG  . TYR C 1 266 ? -71.034  67.049  -48.966  1.00 204.42 ? 235 TYR C CG  1 
ATOM 8476  C CD1 . TYR C 1 266 ? -69.650  66.901  -48.904  1.00 204.37 ? 235 TYR C CD1 1 
ATOM 8477  C CD2 . TYR C 1 266 ? -71.644  67.947  -48.097  1.00 206.31 ? 235 TYR C CD2 1 
ATOM 8478  C CE1 . TYR C 1 266 ? -68.892  67.637  -48.010  1.00 206.31 ? 235 TYR C CE1 1 
ATOM 8479  C CE2 . TYR C 1 266 ? -70.897  68.686  -47.195  1.00 208.40 ? 235 TYR C CE2 1 
ATOM 8480  C CZ  . TYR C 1 266 ? -69.522  68.527  -47.157  1.00 208.28 ? 235 TYR C CZ  1 
ATOM 8481  O OH  . TYR C 1 266 ? -68.778  69.257  -46.262  1.00 210.37 ? 235 TYR C OH  1 
ATOM 8482  N N   . ILE C 1 267 ? -70.984  64.403  -52.399  1.00 198.50 ? 236 ILE C N   1 
ATOM 8483  C CA  . ILE C 1 267 ? -71.182  63.193  -53.200  1.00 196.11 ? 236 ILE C CA  1 
ATOM 8484  C C   . ILE C 1 267 ? -70.897  61.937  -52.393  1.00 194.30 ? 236 ILE C C   1 
ATOM 8485  O O   . ILE C 1 267 ? -69.742  61.664  -52.046  1.00 194.25 ? 236 ILE C O   1 
ATOM 8486  C CB  . ILE C 1 267 ? -70.265  63.167  -54.432  1.00 196.39 ? 236 ILE C CB  1 
ATOM 8487  C CG1 . ILE C 1 267 ? -70.414  64.452  -55.247  1.00 197.99 ? 236 ILE C CG1 1 
ATOM 8488  C CG2 . ILE C 1 267 ? -70.565  61.941  -55.282  1.00 194.93 ? 236 ILE C CG2 1 
ATOM 8489  C CD1 . ILE C 1 267 ? -69.125  64.910  -55.880  1.00 199.06 ? 236 ILE C CD1 1 
ATOM 8490  N N   . PHE C 1 268 ? -71.948  61.169  -52.115  1.00 192.57 ? 237 PHE C N   1 
ATOM 8491  C CA  . PHE C 1 268 ? -71.808  59.917  -51.375  1.00 190.92 ? 237 PHE C CA  1 
ATOM 8492  C C   . PHE C 1 268 ? -71.492  58.753  -52.293  1.00 189.43 ? 237 PHE C C   1 
ATOM 8493  O O   . PHE C 1 268 ? -72.387  58.158  -52.900  1.00 188.68 ? 237 PHE C O   1 
ATOM 8494  C CB  . PHE C 1 268 ? -73.055  59.602  -50.547  1.00 190.63 ? 237 PHE C CB  1 
ATOM 8495  C CG  . PHE C 1 268 ? -73.044  58.226  -49.935  1.00 189.50 ? 237 PHE C CG  1 
ATOM 8496  C CD1 . PHE C 1 268 ? -72.068  57.865  -49.017  1.00 189.65 ? 237 PHE C CD1 1 
ATOM 8497  C CD2 . PHE C 1 268 ? -74.008  57.292  -50.285  1.00 188.34 ? 237 PHE C CD2 1 
ATOM 8498  C CE1 . PHE C 1 268 ? -72.057  56.602  -48.451  1.00 189.44 ? 237 PHE C CE1 1 
ATOM 8499  C CE2 . PHE C 1 268 ? -74.007  56.025  -49.725  1.00 188.05 ? 237 PHE C CE2 1 
ATOM 8500  C CZ  . PHE C 1 268 ? -73.031  55.678  -48.804  1.00 188.63 ? 237 PHE C CZ  1 
ATOM 8501  N N   . VAL C 1 269 ? -70.210  58.426  -52.379  1.00 188.83 ? 238 VAL C N   1 
ATOM 8502  C CA  . VAL C 1 269 ? -69.786  57.312  -53.201  1.00 187.51 ? 238 VAL C CA  1 
ATOM 8503  C C   . VAL C 1 269 ? -69.649  56.077  -52.343  1.00 186.49 ? 238 VAL C C   1 
ATOM 8504  O O   . VAL C 1 269 ? -68.929  56.069  -51.343  1.00 186.82 ? 238 VAL C O   1 
ATOM 8505  C CB  . VAL C 1 269 ? -68.480  57.600  -53.967  1.00 188.15 ? 238 VAL C CB  1 
ATOM 8506  C CG1 . VAL C 1 269 ? -68.085  56.398  -54.825  1.00 187.64 ? 238 VAL C CG1 1 
ATOM 8507  C CG2 . VAL C 1 269 ? -68.649  58.834  -54.842  1.00 189.01 ? 238 VAL C CG2 1 
ATOM 8508  N N   . SER C 1 270 ? -70.377  55.047  -52.749  1.00 185.14 ? 239 SER C N   1 
ATOM 8509  C CA  . SER C 1 270 ? -70.292  53.732  -52.152  1.00 184.28 ? 239 SER C CA  1 
ATOM 8510  C C   . SER C 1 270 ? -70.061  52.707  -53.248  1.00 183.57 ? 239 SER C C   1 
ATOM 8511  O O   . SER C 1 270 ? -69.820  53.051  -54.410  1.00 183.56 ? 239 SER C O   1 
ATOM 8512  C CB  . SER C 1 270 ? -71.585  53.412  -51.403  1.00 184.04 ? 239 SER C CB  1 
ATOM 8513  O OG  . SER C 1 270 ? -72.717  53.631  -52.225  1.00 183.55 ? 239 SER C OG  1 
ATOM 8514  N N   . ASN C 1 271 ? -70.129  51.443  -52.870  1.00 182.89 ? 240 ASN C N   1 
ATOM 8515  C CA  . ASN C 1 271 ? -70.113  50.383  -53.842  1.00 182.46 ? 240 ASN C CA  1 
ATOM 8516  C C   . ASN C 1 271 ? -71.545  49.890  -54.031  1.00 181.55 ? 240 ASN C C   1 
ATOM 8517  O O   . ASN C 1 271 ? -72.427  50.247  -53.247  1.00 181.00 ? 240 ASN C O   1 
ATOM 8518  C CB  . ASN C 1 271 ? -69.200  49.264  -53.354  1.00 183.28 ? 240 ASN C CB  1 
ATOM 8519  C CG  . ASN C 1 271 ? -68.598  48.464  -54.489  1.00 183.87 ? 240 ASN C CG  1 
ATOM 8520  O OD1 . ASN C 1 271 ? -69.141  48.412  -55.597  1.00 183.61 ? 240 ASN C OD1 1 
ATOM 8521  N ND2 . ASN C 1 271 ? -67.465  47.828  -54.216  1.00 184.76 ? 240 ASN C ND2 1 
ATOM 8522  N N   . ILE C 1 272 ? -71.780  49.099  -55.076  1.00 181.23 ? 241 ILE C N   1 
ATOM 8523  C CA  . ILE C 1 272 ? -73.086  48.472  -55.291  1.00 180.47 ? 241 ILE C CA  1 
ATOM 8524  C C   . ILE C 1 272 ? -73.169  47.095  -54.614  1.00 181.02 ? 241 ILE C C   1 
ATOM 8525  O O   . ILE C 1 272 ? -74.261  46.582  -54.359  1.00 180.73 ? 241 ILE C O   1 
ATOM 8526  C CB  . ILE C 1 272 ? -73.455  48.390  -56.802  1.00 180.52 ? 241 ILE C CB  1 
ATOM 8527  C CG1 . ILE C 1 272 ? -74.956  48.164  -56.994  1.00 179.63 ? 241 ILE C CG1 1 
ATOM 8528  C CG2 . ILE C 1 272 ? -72.633  47.326  -57.526  1.00 181.46 ? 241 ILE C CG2 1 
ATOM 8529  C CD1 . ILE C 1 272 ? -75.812  49.288  -56.476  1.00 178.01 ? 241 ILE C CD1 1 
ATOM 8530  N N   . ASP C 1 273 ? -72.005  46.512  -54.325  1.00 181.81 ? 242 ASP C N   1 
ATOM 8531  C CA  . ASP C 1 273 ? -71.914  45.242  -53.608  1.00 182.66 ? 242 ASP C CA  1 
ATOM 8532  C C   . ASP C 1 273 ? -72.333  45.415  -52.155  1.00 182.50 ? 242 ASP C C   1 
ATOM 8533  O O   . ASP C 1 273 ? -73.093  44.605  -51.630  1.00 182.99 ? 242 ASP C O   1 
ATOM 8534  C CB  . ASP C 1 273 ? -70.486  44.680  -53.650  1.00 183.79 ? 242 ASP C CB  1 
ATOM 8535  C CG  . ASP C 1 273 ? -70.000  44.388  -55.060  1.00 184.44 ? 242 ASP C CG  1 
ATOM 8536  O OD1 . ASP C 1 273 ? -70.688  43.663  -55.814  1.00 185.03 ? 242 ASP C OD1 1 
ATOM 8537  O OD2 . ASP C 1 273 ? -68.904  44.872  -55.409  1.00 184.85 ? 242 ASP C OD2 1 
ATOM 8538  N N   . ASN C 1 274 ? -71.830  46.472  -51.515  1.00 182.13 ? 243 ASN C N   1 
ATOM 8539  C CA  . ASN C 1 274 ? -72.060  46.710  -50.092  1.00 182.43 ? 243 ASN C CA  1 
ATOM 8540  C C   . ASN C 1 274 ? -73.520  46.983  -49.780  1.00 182.03 ? 243 ASN C C   1 
ATOM 8541  O O   . ASN C 1 274 ? -74.050  48.040  -50.109  1.00 181.10 ? 243 ASN C O   1 
ATOM 8542  C CB  . ASN C 1 274 ? -71.186  47.851  -49.565  1.00 182.23 ? 243 ASN C CB  1 
ATOM 8543  C CG  . ASN C 1 274 ? -71.231  47.966  -48.052  1.00 182.80 ? 243 ASN C CG  1 
ATOM 8544  O OD1 . ASN C 1 274 ? -71.428  46.976  -47.351  1.00 183.82 ? 243 ASN C OD1 1 
ATOM 8545  N ND2 . ASN C 1 274 ? -71.042  49.173  -47.542  1.00 182.32 ? 243 ASN C ND2 1 
ATOM 8546  N N   . LEU C 1 275 ? -74.158  46.013  -49.137  1.00 183.09 ? 244 LEU C N   1 
ATOM 8547  C CA  . LEU C 1 275 ? -75.579  46.092  -48.844  1.00 182.96 ? 244 LEU C CA  1 
ATOM 8548  C C   . LEU C 1 275 ? -75.867  46.848  -47.560  1.00 183.65 ? 244 LEU C C   1 
ATOM 8549  O O   . LEU C 1 275 ? -77.014  47.172  -47.269  1.00 183.33 ? 244 LEU C O   1 
ATOM 8550  C CB  . LEU C 1 275 ? -76.199  44.697  -48.814  1.00 183.61 ? 244 LEU C CB  1 
ATOM 8551  C CG  . LEU C 1 275 ? -76.469  44.103  -50.197  1.00 183.01 ? 244 LEU C CG  1 
ATOM 8552  C CD1 . LEU C 1 275 ? -77.291  42.847  -50.067  1.00 183.80 ? 244 LEU C CD1 1 
ATOM 8553  C CD2 . LEU C 1 275 ? -77.183  45.102  -51.104  1.00 181.63 ? 244 LEU C CD2 1 
ATOM 8554  N N   . GLY C 1 276 ? -74.817  47.131  -46.799  1.00 185.00 ? 245 GLY C N   1 
ATOM 8555  C CA  . GLY C 1 276 ? -74.922  48.009  -45.643  1.00 186.26 ? 245 GLY C CA  1 
ATOM 8556  C C   . GLY C 1 276 ? -74.750  49.473  -46.016  1.00 185.97 ? 245 GLY C C   1 
ATOM 8557  O O   . GLY C 1 276 ? -75.039  50.357  -45.206  1.00 186.44 ? 245 GLY C O   1 
ATOM 8558  N N   . ALA C 1 277 ? -74.294  49.727  -47.246  1.00 185.60 ? 246 ALA C N   1 
ATOM 8559  C CA  . ALA C 1 277 ? -74.000  51.087  -47.735  1.00 185.60 ? 246 ALA C CA  1 
ATOM 8560  C C   . ALA C 1 277 ? -75.235  51.985  -47.894  1.00 185.37 ? 246 ALA C C   1 
ATOM 8561  O O   . ALA C 1 277 ? -75.667  52.300  -49.007  1.00 184.48 ? 246 ALA C O   1 
ATOM 8562  C CB  . ALA C 1 277 ? -73.216  51.021  -49.039  1.00 185.12 ? 246 ALA C CB  1 
ATOM 8563  N N   . THR C 1 278 ? -75.785  52.401  -46.762  1.00 186.58 ? 247 THR C N   1 
ATOM 8564  C CA  . THR C 1 278 ? -76.982  53.217  -46.745  1.00 186.94 ? 247 THR C CA  1 
ATOM 8565  C C   . THR C 1 278 ? -76.615  54.660  -46.418  1.00 188.10 ? 247 THR C C   1 
ATOM 8566  O O   . THR C 1 278 ? -75.468  54.941  -46.062  1.00 188.86 ? 247 THR C O   1 
ATOM 8567  C CB  . THR C 1 278 ? -78.026  52.655  -45.745  1.00 187.42 ? 247 THR C CB  1 
ATOM 8568  O OG1 . THR C 1 278 ? -79.198  53.478  -45.760  1.00 187.59 ? 247 THR C OG1 1 
ATOM 8569  C CG2 . THR C 1 278 ? -77.466  52.584  -44.322  1.00 188.69 ? 247 THR C CG2 1 
ATOM 8570  N N   . VAL C 1 279 ? -77.580  55.569  -46.556  1.00 188.67 ? 248 VAL C N   1 
ATOM 8571  C CA  . VAL C 1 279 ? -77.362  56.970  -46.203  1.00 190.16 ? 248 VAL C CA  1 
ATOM 8572  C C   . VAL C 1 279 ? -77.619  57.178  -44.718  1.00 192.10 ? 248 VAL C C   1 
ATOM 8573  O O   . VAL C 1 279 ? -78.705  56.875  -44.213  1.00 192.21 ? 248 VAL C O   1 
ATOM 8574  C CB  . VAL C 1 279 ? -78.236  57.942  -47.023  1.00 189.77 ? 248 VAL C CB  1 
ATOM 8575  C CG1 . VAL C 1 279 ? -77.687  59.361  -46.899  1.00 190.90 ? 248 VAL C CG1 1 
ATOM 8576  C CG2 . VAL C 1 279 ? -78.287  57.522  -48.486  1.00 188.41 ? 248 VAL C CG2 1 
ATOM 8577  N N   . ASP C 1 280 ? -76.602  57.694  -44.034  1.00 194.00 ? 249 ASP C N   1 
ATOM 8578  C CA  . ASP C 1 280 ? -76.658  57.918  -42.596  1.00 196.51 ? 249 ASP C CA  1 
ATOM 8579  C C   . ASP C 1 280 ? -76.823  59.402  -42.262  1.00 198.28 ? 249 ASP C C   1 
ATOM 8580  O O   . ASP C 1 280 ? -75.908  60.208  -42.482  1.00 198.85 ? 249 ASP C O   1 
ATOM 8581  C CB  . ASP C 1 280 ? -75.407  57.342  -41.921  1.00 197.33 ? 249 ASP C CB  1 
ATOM 8582  C CG  . ASP C 1 280 ? -75.427  57.503  -40.410  1.00 199.77 ? 249 ASP C CG  1 
ATOM 8583  O OD1 . ASP C 1 280 ? -76.429  57.126  -39.771  1.00 200.85 ? 249 ASP C OD1 1 
ATOM 8584  O OD2 . ASP C 1 280 ? -74.431  58.002  -39.856  1.00 201.24 ? 249 ASP C OD2 1 
ATOM 8585  N N   . LEU C 1 281 ? -77.995  59.743  -41.723  1.00 199.47 ? 250 LEU C N   1 
ATOM 8586  C CA  . LEU C 1 281 ? -78.330  61.121  -41.369  1.00 201.53 ? 250 LEU C CA  1 
ATOM 8587  C C   . LEU C 1 281 ? -77.582  61.610  -40.119  1.00 204.22 ? 250 LEU C C   1 
ATOM 8588  O O   . LEU C 1 281 ? -77.674  62.791  -39.753  1.00 206.19 ? 250 LEU C O   1 
ATOM 8589  C CB  . LEU C 1 281 ? -79.844  61.274  -41.201  1.00 201.63 ? 250 LEU C CB  1 
ATOM 8590  N N   . TYR C 1 282 ? -76.852  60.698  -39.472  1.00 204.69 ? 251 TYR C N   1 
ATOM 8591  C CA  . TYR C 1 282 ? -75.969  61.044  -38.357  1.00 207.20 ? 251 TYR C CA  1 
ATOM 8592  C C   . TYR C 1 282 ? -74.579  61.381  -38.881  1.00 206.89 ? 251 TYR C C   1 
ATOM 8593  O O   . TYR C 1 282 ? -73.776  61.992  -38.178  1.00 208.64 ? 251 TYR C O   1 
ATOM 8594  C CB  . TYR C 1 282 ? -75.902  59.909  -37.328  1.00 208.08 ? 251 TYR C CB  1 
ATOM 8595  C CG  . TYR C 1 282 ? -77.239  59.574  -36.709  1.00 209.31 ? 251 TYR C CG  1 
ATOM 8596  C CD1 . TYR C 1 282 ? -77.731  60.305  -35.631  1.00 212.60 ? 251 TYR C CD1 1 
ATOM 8597  C CD2 . TYR C 1 282 ? -78.021  58.533  -37.211  1.00 208.01 ? 251 TYR C CD2 1 
ATOM 8598  C CE1 . TYR C 1 282 ? -78.973  60.010  -35.061  1.00 214.05 ? 251 TYR C CE1 1 
ATOM 8599  C CE2 . TYR C 1 282 ? -79.263  58.224  -36.648  1.00 209.35 ? 251 TYR C CE2 1 
ATOM 8600  C CZ  . TYR C 1 282 ? -79.733  58.966  -35.572  1.00 212.33 ? 251 TYR C CZ  1 
ATOM 8601  O OH  . TYR C 1 282 ? -80.960  58.667  -35.009  1.00 213.45 ? 251 TYR C OH  1 
ATOM 8602  N N   . ILE C 1 283 ? -74.311  60.978  -40.120  1.00 204.95 ? 252 ILE C N   1 
ATOM 8603  C CA  . ILE C 1 283 ? -73.070  61.324  -40.809  1.00 204.81 ? 252 ILE C CA  1 
ATOM 8604  C C   . ILE C 1 283 ? -73.217  62.634  -41.587  1.00 205.36 ? 252 ILE C C   1 
ATOM 8605  O O   . ILE C 1 283 ? -72.241  63.359  -41.801  1.00 205.93 ? 252 ILE C O   1 
ATOM 8606  C CB  . ILE C 1 283 ? -72.599  60.180  -41.729  1.00 202.63 ? 252 ILE C CB  1 
ATOM 8607  C CG1 . ILE C 1 283 ? -71.725  59.211  -40.927  1.00 203.08 ? 252 ILE C CG1 1 
ATOM 8608  C CG2 . ILE C 1 283 ? -71.826  60.734  -42.917  1.00 201.77 ? 252 ILE C CG2 1 
ATOM 8609  C CD1 . ILE C 1 283 ? -71.666  57.805  -41.475  1.00 201.52 ? 252 ILE C CD1 1 
ATOM 8610  N N   . LEU C 1 284 ? -74.443  62.935  -41.996  1.00 205.45 ? 253 LEU C N   1 
ATOM 8611  C CA  . LEU C 1 284 ? -74.738  64.194  -42.664  1.00 206.64 ? 253 LEU C CA  1 
ATOM 8612  C C   . LEU C 1 284 ? -74.739  65.391  -41.702  1.00 209.72 ? 253 LEU C C   1 
ATOM 8613  O O   . LEU C 1 284 ? -74.589  66.537  -42.138  1.00 210.95 ? 253 LEU C O   1 
ATOM 8614  C CB  . LEU C 1 284 ? -76.067  64.102  -43.416  1.00 205.63 ? 253 LEU C CB  1 
ATOM 8615  C CG  . LEU C 1 284 ? -76.147  63.158  -44.623  1.00 203.81 ? 253 LEU C CG  1 
ATOM 8616  C CD1 . LEU C 1 284 ? -77.571  63.097  -45.173  1.00 203.47 ? 253 LEU C CD1 1 
ATOM 8617  C CD2 . LEU C 1 284 ? -75.161  63.547  -45.723  1.00 203.78 ? 253 LEU C CD2 1 
ATOM 8618  N N   . ASN C 1 285 ? -74.913  65.124  -40.405  1.00 211.48 ? 254 ASN C N   1 
ATOM 8619  C CA  . ASN C 1 285 ? -74.832  66.166  -39.369  1.00 214.72 ? 254 ASN C CA  1 
ATOM 8620  C C   . ASN C 1 285 ? -73.394  66.635  -39.127  1.00 215.96 ? 254 ASN C C   1 
ATOM 8621  O O   . ASN C 1 285 ? -73.165  67.763  -38.681  1.00 218.54 ? 254 ASN C O   1 
ATOM 8622  C CB  . ASN C 1 285 ? -75.468  65.700  -38.055  1.00 216.21 ? 254 ASN C CB  1 
ATOM 8623  C CG  . ASN C 1 285 ? -75.641  66.836  -37.049  1.00 219.80 ? 254 ASN C CG  1 
ATOM 8624  O OD1 . ASN C 1 285 ? -76.228  67.877  -37.357  1.00 220.95 ? 254 ASN C OD1 1 
ATOM 8625  N ND2 . ASN C 1 285 ? -75.131  66.633  -35.836  1.00 221.84 ? 254 ASN C ND2 1 
ATOM 8626  N N   . HIS C 1 286 ? -72.434  65.759  -39.414  1.00 200.01 ? 255 HIS C N   1 
ATOM 8627  C CA  . HIS C 1 286 ? -71.037  66.157  -39.492  1.00 200.00 ? 255 HIS C CA  1 
ATOM 8628  C C   . HIS C 1 286 ? -70.690  66.558  -40.938  1.00 200.54 ? 255 HIS C C   1 
ATOM 8629  O O   . HIS C 1 286 ? -69.566  66.332  -41.398  1.00 200.08 ? 255 HIS C O   1 
ATOM 8630  C CB  . HIS C 1 286 ? -70.120  65.044  -38.970  1.00 198.25 ? 255 HIS C CB  1 
ATOM 8631  N N   . LEU C 1 287 ? -71.669  67.149  -41.638  1.00 201.90 ? 256 LEU C N   1 
ATOM 8632  C CA  . LEU C 1 287 ? -71.509  67.691  -43.004  1.00 202.92 ? 256 LEU C CA  1 
ATOM 8633  C C   . LEU C 1 287 ? -72.411  68.903  -43.270  1.00 205.04 ? 256 LEU C C   1 
ATOM 8634  O O   . LEU C 1 287 ? -72.703  69.700  -42.376  1.00 206.12 ? 256 LEU C O   1 
ATOM 8635  C CB  . LEU C 1 287 ? -71.797  66.620  -44.066  1.00 201.99 ? 256 LEU C CB  1 
ATOM 8636  C CG  . LEU C 1 287 ? -70.854  65.419  -44.224  1.00 200.63 ? 256 LEU C CG  1 
ATOM 8637  C CD1 . LEU C 1 287 ? -71.520  64.299  -45.012  1.00 199.87 ? 256 LEU C CD1 1 
ATOM 8638  C CD2 . LEU C 1 287 ? -69.524  65.824  -44.861  1.00 201.47 ? 256 LEU C CD2 1 
ATOM 8639  N N   . CYS C 1 296 ? -66.745  68.605  -43.761  1.00 201.38 ? 265 CYS C N   1 
ATOM 8640  C CA  . CYS C 1 296 ? -65.315  68.496  -44.026  1.00 201.42 ? 265 CYS C CA  1 
ATOM 8641  C C   . CYS C 1 296 ? -65.049  68.279  -45.520  1.00 201.70 ? 265 CYS C C   1 
ATOM 8642  O O   . CYS C 1 296 ? -65.972  68.004  -46.292  1.00 201.53 ? 265 CYS C O   1 
ATOM 8643  C CB  . CYS C 1 296 ? -64.709  67.362  -43.191  1.00 199.96 ? 265 CYS C CB  1 
ATOM 8644  S SG  . CYS C 1 296 ? -62.992  67.639  -42.679  1.00 200.72 ? 265 CYS C SG  1 
ATOM 8645  N N   . GLU C 1 297 ? -63.788  68.404  -45.924  1.00 202.30 ? 266 GLU C N   1 
ATOM 8646  C CA  . GLU C 1 297 ? -63.422  68.288  -47.336  1.00 203.03 ? 266 GLU C CA  1 
ATOM 8647  C C   . GLU C 1 297 ? -63.466  66.839  -47.878  1.00 201.31 ? 266 GLU C C   1 
ATOM 8648  O O   . GLU C 1 297 ? -63.637  66.636  -49.086  1.00 201.73 ? 266 GLU C O   1 
ATOM 8649  C CB  . GLU C 1 297 ? -62.058  68.958  -47.587  1.00 204.77 ? 266 GLU C CB  1 
ATOM 8650  C CG  . GLU C 1 297 ? -61.883  69.561  -48.993  1.00 207.31 ? 266 GLU C CG  1 
ATOM 8651  C CD  . GLU C 1 297 ? -60.857  70.702  -49.063  1.00 209.91 ? 266 GLU C CD  1 
ATOM 8652  O OE1 . GLU C 1 297 ? -60.733  71.474  -48.082  1.00 210.30 ? 266 GLU C OE1 1 
ATOM 8653  O OE2 . GLU C 1 297 ? -60.188  70.842  -50.117  1.00 211.46 ? 266 GLU C OE2 1 
ATOM 8654  N N   . PHE C 1 298 ? -63.331  65.846  -46.989  1.00 199.39 ? 267 PHE C N   1 
ATOM 8655  C CA  . PHE C 1 298 ? -63.314  64.418  -47.379  1.00 197.62 ? 267 PHE C CA  1 
ATOM 8656  C C   . PHE C 1 298 ? -63.354  63.435  -46.198  1.00 195.52 ? 267 PHE C C   1 
ATOM 8657  O O   . PHE C 1 298 ? -62.517  63.482  -45.291  1.00 195.42 ? 267 PHE C O   1 
ATOM 8658  C CB  . PHE C 1 298 ? -62.099  64.117  -48.267  1.00 198.73 ? 267 PHE C CB  1 
ATOM 8659  C CG  . PHE C 1 298 ? -62.092  62.732  -48.857  1.00 198.03 ? 267 PHE C CG  1 
ATOM 8660  C CD1 . PHE C 1 298 ? -62.826  62.448  -50.010  1.00 198.24 ? 267 PHE C CD1 1 
ATOM 8661  C CD2 . PHE C 1 298 ? -61.328  61.722  -48.277  1.00 197.43 ? 267 PHE C CD2 1 
ATOM 8662  C CE1 . PHE C 1 298 ? -62.810  61.177  -50.568  1.00 197.59 ? 267 PHE C CE1 1 
ATOM 8663  C CE2 . PHE C 1 298 ? -61.305  60.451  -48.825  1.00 196.93 ? 267 PHE C CE2 1 
ATOM 8664  C CZ  . PHE C 1 298 ? -62.048  60.177  -49.976  1.00 197.11 ? 267 PHE C CZ  1 
ATOM 8665  N N   . VAL C 1 299 ? -64.321  62.525  -46.250  1.00 193.68 ? 268 VAL C N   1 
ATOM 8666  C CA  . VAL C 1 299 ? -64.553  61.555  -45.184  1.00 191.72 ? 268 VAL C CA  1 
ATOM 8667  C C   . VAL C 1 299 ? -64.473  60.120  -45.709  1.00 190.32 ? 268 VAL C C   1 
ATOM 8668  O O   . VAL C 1 299 ? -64.985  59.810  -46.790  1.00 190.15 ? 268 VAL C O   1 
ATOM 8669  C CB  . VAL C 1 299 ? -65.943  61.762  -44.524  1.00 191.26 ? 268 VAL C CB  1 
ATOM 8670  C CG1 . VAL C 1 299 ? -66.096  60.886  -43.278  1.00 189.86 ? 268 VAL C CG1 1 
ATOM 8671  C CG2 . VAL C 1 299 ? -66.178  63.239  -44.190  1.00 192.55 ? 268 VAL C CG2 1 
ATOM 8672  N N   . MET C 1 300 ? -63.826  59.255  -44.931  1.00 189.19 ? 269 MET C N   1 
ATOM 8673  C CA  . MET C 1 300 ? -63.807  57.818  -45.203  1.00 187.71 ? 269 MET C CA  1 
ATOM 8674  C C   . MET C 1 300 ? -64.320  57.026  -43.995  1.00 186.08 ? 269 MET C C   1 
ATOM 8675  O O   . MET C 1 300 ? -63.741  57.094  -42.902  1.00 186.28 ? 269 MET C O   1 
ATOM 8676  C CB  . MET C 1 300 ? -62.401  57.344  -45.600  1.00 188.53 ? 269 MET C CB  1 
ATOM 8677  N N   . GLU C 1 301 ? -65.422  56.302  -44.203  1.00 184.40 ? 270 GLU C N   1 
ATOM 8678  C CA  . GLU C 1 301 ? -65.941  55.327  -43.241  1.00 182.57 ? 270 GLU C CA  1 
ATOM 8679  C C   . GLU C 1 301 ? -64.884  54.237  -43.026  1.00 182.19 ? 270 GLU C C   1 
ATOM 8680  O O   . GLU C 1 301 ? -64.229  53.818  -43.986  1.00 182.75 ? 270 GLU C O   1 
ATOM 8681  C CB  . GLU C 1 301 ? -67.227  54.687  -43.785  1.00 181.66 ? 270 GLU C CB  1 
ATOM 8682  C CG  . GLU C 1 301 ? -68.475  55.571  -43.772  1.00 181.14 ? 270 GLU C CG  1 
ATOM 8683  C CD  . GLU C 1 301 ? -69.743  54.819  -44.191  1.00 179.84 ? 270 GLU C CD  1 
ATOM 8684  O OE1 . GLU C 1 301 ? -70.144  53.843  -43.517  1.00 178.78 ? 270 GLU C OE1 1 
ATOM 8685  O OE2 . GLU C 1 301 ? -70.355  55.211  -45.201  1.00 179.92 ? 270 GLU C OE2 1 
ATOM 8686  N N   . VAL C 1 302 ? -64.700  53.778  -41.788  1.00 181.25 ? 271 VAL C N   1 
ATOM 8687  C CA  . VAL C 1 302 ? -63.727  52.706  -41.518  1.00 180.74 ? 271 VAL C CA  1 
ATOM 8688  C C   . VAL C 1 302 ? -64.209  51.741  -40.449  1.00 179.57 ? 271 VAL C C   1 
ATOM 8689  O O   . VAL C 1 302 ? -65.100  52.078  -39.673  1.00 179.22 ? 271 VAL C O   1 
ATOM 8690  C CB  . VAL C 1 302 ? -62.344  53.252  -41.115  1.00 182.15 ? 271 VAL C CB  1 
ATOM 8691  C CG1 . VAL C 1 302 ? -61.542  53.659  -42.347  1.00 183.11 ? 271 VAL C CG1 1 
ATOM 8692  C CG2 . VAL C 1 302 ? -62.482  54.407  -40.126  1.00 182.55 ? 271 VAL C CG2 1 
ATOM 8693  N N   . THR C 1 303 ? -63.611  50.549  -40.414  1.00 178.98 ? 272 THR C N   1 
ATOM 8694  C CA  . THR C 1 303 ? -63.970  49.504  -39.440  1.00 177.95 ? 272 THR C CA  1 
ATOM 8695  C C   . THR C 1 303 ? -62.749  48.693  -39.016  1.00 178.38 ? 272 THR C C   1 
ATOM 8696  O O   . THR C 1 303 ? -61.875  48.421  -39.837  1.00 179.26 ? 272 THR C O   1 
ATOM 8697  C CB  . THR C 1 303 ? -65.000  48.525  -40.032  1.00 176.89 ? 272 THR C CB  1 
ATOM 8698  O OG1 . THR C 1 303 ? -65.986  49.262  -40.760  1.00 176.73 ? 272 THR C OG1 1 
ATOM 8699  C CG2 . THR C 1 303 ? -65.691  47.712  -38.932  1.00 176.42 ? 272 THR C CG2 1 
ATOM 8700  N N   . ASN C 1 304 ? -62.707  48.290  -37.743  1.00 177.81 ? 273 ASN C N   1 
ATOM 8701  C CA  . ASN C 1 304 ? -61.628  47.449  -37.208  1.00 178.08 ? 273 ASN C CA  1 
ATOM 8702  C C   . ASN C 1 304 ? -61.355  46.222  -38.074  1.00 177.56 ? 273 ASN C C   1 
ATOM 8703  O O   . ASN C 1 304 ? -62.225  45.771  -38.819  1.00 176.34 ? 273 ASN C O   1 
ATOM 8704  C CB  . ASN C 1 304 ? -61.943  47.012  -35.777  1.00 178.13 ? 273 ASN C CB  1 
ATOM 8705  C CG  . ASN C 1 304 ? -62.727  48.053  -35.008  1.00 177.84 ? 273 ASN C CG  1 
ATOM 8706  O OD1 . ASN C 1 304 ? -62.391  49.238  -35.011  1.00 178.44 ? 273 ASN C OD1 1 
ATOM 8707  N ND2 . ASN C 1 304 ? -63.789  47.614  -34.347  1.00 177.53 ? 273 ASN C ND2 1 
ATOM 8708  N N   . LYS C 1 305 ? -60.139  45.698  -37.989  1.00 178.44 ? 274 LYS C N   1 
ATOM 8709  C CA  . LYS C 1 305 ? -59.781  44.501  -38.730  1.00 178.36 ? 274 LYS C CA  1 
ATOM 8710  C C   . LYS C 1 305 ? -60.311  43.265  -38.013  1.00 177.82 ? 274 LYS C C   1 
ATOM 8711  O O   . LYS C 1 305 ? -60.397  43.246  -36.791  1.00 178.01 ? 274 LYS C O   1 
ATOM 8712  C CB  . LYS C 1 305 ? -58.268  44.417  -38.887  1.00 180.38 ? 274 LYS C CB  1 
ATOM 8713  N N   . THR C 1 306 ? -60.684  42.245  -38.780  1.00 177.25 ? 275 THR C N   1 
ATOM 8714  C CA  . THR C 1 306 ? -61.157  40.970  -38.230  1.00 177.14 ? 275 THR C CA  1 
ATOM 8715  C C   . THR C 1 306 ? -60.321  39.842  -38.811  1.00 178.59 ? 275 THR C C   1 
ATOM 8716  O O   . THR C 1 306 ? -59.761  39.990  -39.896  1.00 179.16 ? 275 THR C O   1 
ATOM 8717  C CB  . THR C 1 306 ? -62.649  40.729  -38.571  1.00 175.24 ? 275 THR C CB  1 
ATOM 8718  O OG1 . THR C 1 306 ? -63.455  41.634  -37.815  1.00 174.35 ? 275 THR C OG1 1 
ATOM 8719  C CG2 . THR C 1 306 ? -63.090  39.293  -38.248  1.00 175.19 ? 275 THR C CG2 1 
ATOM 8720  N N   . ARG C 1 307 ? -60.241  38.716  -38.101  1.00 179.51 ? 276 ARG C N   1 
ATOM 8721  C CA  . ARG C 1 307 ? -59.514  37.546  -38.591  1.00 181.30 ? 276 ARG C CA  1 
ATOM 8722  C C   . ARG C 1 307 ? -59.872  37.270  -40.042  1.00 180.91 ? 276 ARG C C   1 
ATOM 8723  O O   . ARG C 1 307 ? -59.031  36.810  -40.817  1.00 182.41 ? 276 ARG C O   1 
ATOM 8724  C CB  . ARG C 1 307 ? -59.806  36.313  -37.731  1.00 181.54 ? 276 ARG C CB  1 
ATOM 8725  N N   . ALA C 1 308 ? -61.115  37.600  -40.395  1.00 179.41 ? 277 ALA C N   1 
ATOM 8726  C CA  . ALA C 1 308 ? -61.704  37.304  -41.703  1.00 179.12 ? 277 ALA C CA  1 
ATOM 8727  C C   . ALA C 1 308 ? -61.017  37.956  -42.916  1.00 180.25 ? 277 ALA C C   1 
ATOM 8728  O O   . ALA C 1 308 ? -60.797  37.291  -43.928  1.00 180.91 ? 277 ALA C O   1 
ATOM 8729  C CB  . ALA C 1 308 ? -63.213  37.615  -41.689  1.00 177.07 ? 277 ALA C CB  1 
ATOM 8730  N N   . ASP C 1 309 ? -60.683  39.243  -42.816  1.00 180.91 ? 278 ASP C N   1 
ATOM 8731  C CA  . ASP C 1 309 ? -60.126  39.988  -43.957  1.00 182.23 ? 278 ASP C CA  1 
ATOM 8732  C C   . ASP C 1 309 ? -58.615  40.225  -43.845  1.00 185.04 ? 278 ASP C C   1 
ATOM 8733  O O   . ASP C 1 309 ? -58.182  41.274  -43.376  1.00 185.19 ? 278 ASP C O   1 
ATOM 8734  C CB  . ASP C 1 309 ? -60.912  41.295  -44.241  1.00 180.73 ? 278 ASP C CB  1 
ATOM 8735  C CG  . ASP C 1 309 ? -61.376  42.020  -42.969  1.00 179.49 ? 278 ASP C CG  1 
ATOM 8736  O OD1 . ASP C 1 309 ? -61.884  41.374  -42.031  1.00 178.77 ? 278 ASP C OD1 1 
ATOM 8737  O OD2 . ASP C 1 309 ? -61.261  43.259  -42.918  1.00 179.09 ? 278 ASP C OD2 1 
ATOM 8738  N N   . VAL C 1 310 ? -57.828  39.252  -44.313  1.00 187.80 ? 279 VAL C N   1 
ATOM 8739  C CA  . VAL C 1 310 ? -56.360  39.205  -44.084  1.00 191.54 ? 279 VAL C CA  1 
ATOM 8740  C C   . VAL C 1 310 ? -55.551  40.450  -44.548  1.00 193.50 ? 279 VAL C C   1 
ATOM 8741  O O   . VAL C 1 310 ? -54.794  41.029  -43.754  1.00 194.86 ? 279 VAL C O   1 
ATOM 8742  C CB  . VAL C 1 310 ? -55.694  37.855  -44.599  1.00 193.48 ? 279 VAL C CB  1 
ATOM 8743  C CG1 . VAL C 1 310 ? -54.191  37.792  -44.253  1.00 196.19 ? 279 VAL C CG1 1 
ATOM 8744  C CG2 . VAL C 1 310 ? -56.414  36.616  -44.038  1.00 192.32 ? 279 VAL C CG2 1 
ATOM 8745  N N   . LYS C 1 311 ? -55.696  40.854  -45.811  1.00 194.18 ? 280 LYS C N   1 
ATOM 8746  C CA  . LYS C 1 311 ? -54.977  42.035  -46.317  1.00 195.99 ? 280 LYS C CA  1 
ATOM 8747  C C   . LYS C 1 311 ? -55.918  43.230  -46.507  1.00 194.46 ? 280 LYS C C   1 
ATOM 8748  O O   . LYS C 1 311 ? -57.117  43.145  -46.195  1.00 192.40 ? 280 LYS C O   1 
ATOM 8749  C CB  . LYS C 1 311 ? -54.240  41.710  -47.623  1.00 198.09 ? 280 LYS C CB  1 
ATOM 8750  C CG  . LYS C 1 311 ? -53.186  40.627  -47.491  1.00 200.84 ? 280 LYS C CG  1 
ATOM 8751  C CD  . LYS C 1 311 ? -52.892  39.985  -48.835  1.00 202.98 ? 280 LYS C CD  1 
ATOM 8752  C CE  . LYS C 1 311 ? -52.049  38.731  -48.666  1.00 205.68 ? 280 LYS C CE  1 
ATOM 8753  N NZ  . LYS C 1 311 ? -51.947  37.946  -49.930  1.00 207.28 ? 280 LYS C NZ  1 
ATOM 8754  N N   . GLY C 1 312 ? -55.370  44.339  -47.009  1.00 195.86 ? 281 GLY C N   1 
ATOM 8755  C CA  . GLY C 1 312 ? -56.172  45.517  -47.342  1.00 194.87 ? 281 GLY C CA  1 
ATOM 8756  C C   . GLY C 1 312 ? -55.490  46.820  -46.991  1.00 196.12 ? 281 GLY C C   1 
ATOM 8757  O O   . GLY C 1 312 ? -54.362  46.829  -46.496  1.00 197.90 ? 281 GLY C O   1 
ATOM 8758  N N   . GLY C 1 313 ? -56.184  47.925  -47.246  1.00 195.39 ? 282 GLY C N   1 
ATOM 8759  C CA  . GLY C 1 313 ? -55.649  49.251  -46.972  1.00 196.66 ? 282 GLY C CA  1 
ATOM 8760  C C   . GLY C 1 313 ? -55.873  49.672  -45.540  1.00 196.11 ? 282 GLY C C   1 
ATOM 8761  O O   . GLY C 1 313 ? -56.929  49.393  -44.965  1.00 194.14 ? 282 GLY C O   1 
ATOM 8762  N N   . THR C 1 314 ? -54.871  50.341  -44.969  1.00 198.20 ? 283 THR C N   1 
ATOM 8763  C CA  . THR C 1 314 ? -54.940  50.877  -43.602  1.00 198.38 ? 283 THR C CA  1 
ATOM 8764  C C   . THR C 1 314 ? -54.665  52.389  -43.573  1.00 199.48 ? 283 THR C C   1 
ATOM 8765  O O   . THR C 1 314 ? -53.668  52.858  -44.130  1.00 201.43 ? 283 THR C O   1 
ATOM 8766  C CB  . THR C 1 314 ? -53.958  50.153  -42.644  1.00 199.81 ? 283 THR C CB  1 
ATOM 8767  O OG1 . THR C 1 314 ? -52.649  50.152  -43.221  1.00 202.61 ? 283 THR C OG1 1 
ATOM 8768  C CG2 . THR C 1 314 ? -54.394  48.705  -42.381  1.00 198.84 ? 283 THR C CG2 1 
ATOM 8769  N N   . LEU C 1 315 ? -55.555  53.141  -42.926  1.00 198.65 ? 284 LEU C N   1 
ATOM 8770  C CA  . LEU C 1 315 ? -55.443  54.598  -42.871  1.00 199.97 ? 284 LEU C CA  1 
ATOM 8771  C C   . LEU C 1 315 ? -54.631  55.075  -41.668  1.00 201.84 ? 284 LEU C C   1 
ATOM 8772  O O   . LEU C 1 315 ? -55.075  54.979  -40.521  1.00 201.23 ? 284 LEU C O   1 
ATOM 8773  C CB  . LEU C 1 315 ? -56.828  55.269  -42.880  1.00 198.09 ? 284 LEU C CB  1 
ATOM 8774  C CG  . LEU C 1 315 ? -57.705  55.238  -44.141  1.00 197.32 ? 284 LEU C CG  1 
ATOM 8775  C CD1 . LEU C 1 315 ? -58.894  56.195  -44.014  1.00 196.25 ? 284 LEU C CD1 1 
ATOM 8776  C CD2 . LEU C 1 315 ? -56.908  55.561  -45.387  1.00 198.91 ? 284 LEU C CD2 1 
ATOM 8777  N N   . THR C 1 316 ? -53.436  55.588  -41.951  1.00 204.70 ? 285 THR C N   1 
ATOM 8778  C CA  . THR C 1 316 ? -52.554  56.173  -40.942  1.00 206.86 ? 285 THR C CA  1 
ATOM 8779  C C   . THR C 1 316 ? -52.300  57.641  -41.314  1.00 208.25 ? 285 THR C C   1 
ATOM 8780  O O   . THR C 1 316 ? -52.642  58.068  -42.425  1.00 208.00 ? 285 THR C O   1 
ATOM 8781  C CB  . THR C 1 316 ? -51.214  55.401  -40.862  1.00 209.17 ? 285 THR C CB  1 
ATOM 8782  O OG1 . THR C 1 316 ? -50.616  55.348  -42.164  1.00 210.69 ? 285 THR C OG1 1 
ATOM 8783  C CG2 . THR C 1 316 ? -51.427  53.969  -40.351  1.00 208.25 ? 285 THR C CG2 1 
ATOM 8784  N N   . GLN C 1 317 ? -51.721  58.417  -40.398  1.00 210.05 ? 286 GLN C N   1 
ATOM 8785  C CA  . GLN C 1 317 ? -51.365  59.803  -40.718  1.00 211.84 ? 286 GLN C CA  1 
ATOM 8786  C C   . GLN C 1 317 ? -49.866  59.985  -40.939  1.00 215.07 ? 286 GLN C C   1 
ATOM 8787  O O   . GLN C 1 317 ? -49.078  59.940  -39.993  1.00 216.64 ? 286 GLN C O   1 
ATOM 8788  C CB  . GLN C 1 317 ? -51.879  60.793  -39.664  1.00 211.35 ? 286 GLN C CB  1 
ATOM 8789  C CG  . GLN C 1 317 ? -51.617  62.249  -40.033  1.00 212.70 ? 286 GLN C CG  1 
ATOM 8790  C CD  . GLN C 1 317 ? -52.417  63.220  -39.206  1.00 212.20 ? 286 GLN C CD  1 
ATOM 8791  O OE1 . GLN C 1 317 ? -51.969  63.679  -38.154  1.00 213.38 ? 286 GLN C OE1 1 
ATOM 8792  N NE2 . GLN C 1 317 ? -53.607  63.558  -39.688  1.00 210.74 ? 286 GLN C NE2 1 
ATOM 8793  N N   . TYR C 1 318 ? -49.486  60.186  -42.198  1.00 216.44 ? 287 TYR C N   1 
ATOM 8794  C CA  . TYR C 1 318 ? -48.127  60.580  -42.533  1.00 219.76 ? 287 TYR C CA  1 
ATOM 8795  C C   . TYR C 1 318 ? -48.114  62.061  -42.893  1.00 220.66 ? 287 TYR C C   1 
ATOM 8796  O O   . TYR C 1 318 ? -48.788  62.487  -43.835  1.00 219.77 ? 287 TYR C O   1 
ATOM 8797  C CB  . TYR C 1 318 ? -47.561  59.723  -43.676  1.00 221.02 ? 287 TYR C CB  1 
ATOM 8798  C CG  . TYR C 1 318 ? -46.083  59.942  -43.947  1.00 224.67 ? 287 TYR C CG  1 
ATOM 8799  C CD1 . TYR C 1 318 ? -45.110  59.407  -43.098  1.00 226.77 ? 287 TYR C CD1 1 
ATOM 8800  C CD2 . TYR C 1 318 ? -45.659  60.679  -45.055  1.00 226.26 ? 287 TYR C CD2 1 
ATOM 8801  C CE1 . TYR C 1 318 ? -43.751  59.608  -43.342  1.00 230.49 ? 287 TYR C CE1 1 
ATOM 8802  C CE2 . TYR C 1 318 ? -44.305  60.885  -45.308  1.00 229.95 ? 287 TYR C CE2 1 
ATOM 8803  C CZ  . TYR C 1 318 ? -43.356  60.348  -44.450  1.00 232.04 ? 287 TYR C CZ  1 
ATOM 8804  O OH  . TYR C 1 318 ? -42.017  60.552  -44.703  1.00 235.64 ? 287 TYR C OH  1 
ATOM 8805  N N   . GLU C 1 319 ? -47.372  62.833  -42.099  1.00 222.60 ? 288 GLU C N   1 
ATOM 8806  C CA  . GLU C 1 319 ? -47.086  64.246  -42.362  1.00 224.22 ? 288 GLU C CA  1 
ATOM 8807  C C   . GLU C 1 319 ? -48.336  65.125  -42.462  1.00 222.37 ? 288 GLU C C   1 
ATOM 8808  O O   . GLU C 1 319 ? -48.834  65.391  -43.556  1.00 221.95 ? 288 GLU C O   1 
ATOM 8809  C CB  . GLU C 1 319 ? -46.220  64.381  -43.619  1.00 226.50 ? 288 GLU C CB  1 
ATOM 8810  C CG  . GLU C 1 319 ? -45.405  65.653  -43.701  1.00 229.02 ? 288 GLU C CG  1 
ATOM 8811  C CD  . GLU C 1 319 ? -44.463  65.642  -44.887  1.00 231.88 ? 288 GLU C CD  1 
ATOM 8812  O OE1 . GLU C 1 319 ? -44.443  64.631  -45.625  1.00 231.78 ? 288 GLU C OE1 1 
ATOM 8813  O OE2 . GLU C 1 319 ? -43.742  66.642  -45.081  1.00 234.54 ? 288 GLU C OE2 1 
ATOM 8814  N N   . GLY C 1 320 ? -48.840  65.563  -41.310  1.00 221.66 ? 289 GLY C N   1 
ATOM 8815  C CA  . GLY C 1 320 ? -49.925  66.540  -41.256  1.00 220.62 ? 289 GLY C CA  1 
ATOM 8816  C C   . GLY C 1 320 ? -51.287  65.993  -41.639  1.00 218.21 ? 289 GLY C C   1 
ATOM 8817  O O   . GLY C 1 320 ? -52.210  65.997  -40.821  1.00 216.68 ? 289 GLY C O   1 
ATOM 8818  N N   . LYS C 1 321 ? -51.412  65.534  -42.884  1.00 218.14 ? 290 LYS C N   1 
ATOM 8819  C CA  . LYS C 1 321 ? -52.676  65.005  -43.406  1.00 216.09 ? 290 LYS C CA  1 
ATOM 8820  C C   . LYS C 1 321 ? -52.666  63.467  -43.524  1.00 215.27 ? 290 LYS C C   1 
ATOM 8821  O O   . LYS C 1 321 ? -51.705  62.809  -43.104  1.00 216.30 ? 290 LYS C O   1 
ATOM 8822  C CB  . LYS C 1 321 ? -53.026  65.675  -44.744  1.00 216.40 ? 290 LYS C CB  1 
ATOM 8823  N N   . LEU C 1 322 ? -53.735  62.911  -44.104  1.00 213.67 ? 291 LEU C N   1 
ATOM 8824  C CA  . LEU C 1 322 ? -53.970  61.458  -44.147  1.00 212.44 ? 291 LEU C CA  1 
ATOM 8825  C C   . LEU C 1 322 ? -53.556  60.813  -45.476  1.00 213.38 ? 291 LEU C C   1 
ATOM 8826  O O   . LEU C 1 322 ? -53.628  61.442  -46.532  1.00 214.02 ? 291 LEU C O   1 
ATOM 8827  C CB  . LEU C 1 322 ? -55.451  61.152  -43.878  1.00 209.91 ? 291 LEU C CB  1 
ATOM 8828  C CG  . LEU C 1 322 ? -56.351  62.140  -43.124  1.00 208.75 ? 291 LEU C CG  1 
ATOM 8829  C CD1 . LEU C 1 322 ? -57.776  61.659  -43.220  1.00 206.42 ? 291 LEU C CD1 1 
ATOM 8830  C CD2 . LEU C 1 322 ? -55.950  62.323  -41.664  1.00 208.63 ? 291 LEU C CD2 1 
ATOM 8831  N N   . ARG C 1 323 ? -53.139  59.550  -45.414  1.00 213.69 ? 292 ARG C N   1 
ATOM 8832  C CA  . ARG C 1 323 ? -52.728  58.810  -46.608  1.00 214.98 ? 292 ARG C CA  1 
ATOM 8833  C C   . ARG C 1 323 ? -53.026  57.314  -46.501  1.00 214.06 ? 292 ARG C C   1 
ATOM 8834  O O   . ARG C 1 323 ? -52.641  56.659  -45.530  1.00 214.07 ? 292 ARG C O   1 
ATOM 8835  C CB  . ARG C 1 323 ? -51.239  59.034  -46.895  1.00 217.81 ? 292 ARG C CB  1 
ATOM 8836  N N   . LEU C 1 324 ? -53.715  56.784  -47.510  1.00 213.63 ? 293 LEU C N   1 
ATOM 8837  C CA  . LEU C 1 324 ? -53.994  55.351  -47.602  1.00 213.09 ? 293 LEU C CA  1 
ATOM 8838  C C   . LEU C 1 324 ? -52.745  54.579  -48.004  1.00 215.62 ? 293 LEU C C   1 
ATOM 8839  O O   . LEU C 1 324 ? -52.092  54.899  -49.003  1.00 217.60 ? 293 LEU C O   1 
ATOM 8840  C CB  . LEU C 1 324 ? -55.127  55.067  -48.601  1.00 211.75 ? 293 LEU C CB  1 
ATOM 8841  C CG  . LEU C 1 324 ? -55.420  53.609  -48.999  1.00 211.05 ? 293 LEU C CG  1 
ATOM 8842  C CD1 . LEU C 1 324 ? -56.129  52.839  -47.892  1.00 209.09 ? 293 LEU C CD1 1 
ATOM 8843  C CD2 . LEU C 1 324 ? -56.234  53.544  -50.281  1.00 210.64 ? 293 LEU C CD2 1 
ATOM 8844  N N   . VAL C 1 325 ? -52.429  53.557  -47.219  1.00 215.95 ? 294 VAL C N   1 
ATOM 8845  C CA  . VAL C 1 325 ? -51.283  52.699  -47.489  1.00 218.63 ? 294 VAL C CA  1 
ATOM 8846  C C   . VAL C 1 325 ? -51.782  51.304  -47.856  1.00 217.95 ? 294 VAL C C   1 
ATOM 8847  O O   . VAL C 1 325 ? -52.742  50.805  -47.262  1.00 215.65 ? 294 VAL C O   1 
ATOM 8848  C CB  . VAL C 1 325 ? -50.321  52.639  -46.281  1.00 220.08 ? 294 VAL C CB  1 
ATOM 8849  C CG1 . VAL C 1 325 ? -48.956  52.110  -46.715  1.00 223.38 ? 294 VAL C CG1 1 
ATOM 8850  C CG2 . VAL C 1 325 ? -50.176  54.026  -45.626  1.00 220.06 ? 294 VAL C CG2 1 
ATOM 8851  N N   . GLU C 1 326 ? -51.123  50.680  -48.831  1.00 220.30 ? 295 GLU C N   1 
ATOM 8852  C CA  . GLU C 1 326 ? -51.644  49.457  -49.446  1.00 220.12 ? 295 GLU C CA  1 
ATOM 8853  C C   . GLU C 1 326 ? -50.771  48.199  -49.257  1.00 221.94 ? 295 GLU C C   1 
ATOM 8854  O O   . GLU C 1 326 ? -49.728  48.240  -48.590  1.00 223.80 ? 295 GLU C O   1 
ATOM 8855  C CB  . GLU C 1 326 ? -51.962  49.702  -50.933  1.00 220.74 ? 295 GLU C CB  1 
ATOM 8856  C CG  . GLU C 1 326 ? -52.963  50.852  -51.209  1.00 220.21 ? 295 GLU C CG  1 
ATOM 8857  C CD  . GLU C 1 326 ? -54.440  50.439  -51.111  1.00 218.75 ? 295 GLU C CD  1 
ATOM 8858  O OE1 . GLU C 1 326 ? -54.825  49.752  -50.135  1.00 217.85 ? 295 GLU C OE1 1 
ATOM 8859  O OE2 . GLU C 1 326 ? -55.225  50.825  -52.011  1.00 218.58 ? 295 GLU C OE2 1 
ATOM 8860  N N   . ILE C 1 327 ? -51.226  47.092  -49.852  1.00 221.59 ? 296 ILE C N   1 
ATOM 8861  C CA  . ILE C 1 327 ? -50.630  45.759  -49.671  1.00 223.05 ? 296 ILE C CA  1 
ATOM 8862  C C   . ILE C 1 327 ? -49.195  45.669  -50.220  1.00 226.81 ? 296 ILE C C   1 
ATOM 8863  O O   . ILE C 1 327 ? -48.266  45.388  -49.467  1.00 228.57 ? 296 ILE C O   1 
ATOM 8864  C CB  . ILE C 1 327 ? -51.521  44.601  -50.288  1.00 221.80 ? 296 ILE C CB  1 
ATOM 8865  C CG1 . ILE C 1 327 ? -53.017  44.975  -50.346  1.00 218.17 ? 296 ILE C CG1 1 
ATOM 8866  C CG2 . ILE C 1 327 ? -51.296  43.280  -49.534  1.00 222.19 ? 296 ILE C CG2 1 
ATOM 8867  C CD1 . ILE C 1 327 ? -53.838  44.128  -51.318  1.00 216.45 ? 296 ILE C CD1 1 
ATOM 8868  N N   . ALA C 1 328 ? -49.030  45.929  -51.520  1.00 228.21 ? 297 ALA C N   1 
ATOM 8869  C CA  . ALA C 1 328 ? -47.748  45.750  -52.221  1.00 232.20 ? 297 ALA C CA  1 
ATOM 8870  C C   . ALA C 1 328 ? -46.871  47.012  -52.334  1.00 234.46 ? 297 ALA C C   1 
ATOM 8871  O O   . ALA C 1 328 ? -45.792  46.962  -52.935  1.00 237.98 ? 297 ALA C O   1 
ATOM 8872  C CB  . ALA C 1 328 ? -47.982  45.133  -53.604  1.00 232.97 ? 297 ALA C CB  1 
ATOM 8873  N N   . GLN C 1 329 ? -47.330  48.129  -51.761  1.00 232.72 ? 298 GLN C N   1 
ATOM 8874  C CA  . GLN C 1 329 ? -46.537  49.369  -51.683  1.00 234.64 ? 298 GLN C CA  1 
ATOM 8875  C C   . GLN C 1 329 ? -45.419  49.290  -50.633  1.00 236.89 ? 298 GLN C C   1 
ATOM 8876  O O   . GLN C 1 329 ? -44.513  50.125  -50.623  1.00 239.36 ? 298 GLN C O   1 
ATOM 8877  C CB  . GLN C 1 329 ? -47.432  50.580  -51.382  1.00 231.96 ? 298 GLN C CB  1 
ATOM 8878  C CG  . GLN C 1 329 ? -48.140  51.190  -52.591  1.00 231.39 ? 298 GLN C CG  1 
ATOM 8879  C CD  . GLN C 1 329 ? -49.045  52.365  -52.216  1.00 229.14 ? 298 GLN C CD  1 
ATOM 8880  O OE1 . GLN C 1 329 ? -48.627  53.292  -51.520  1.00 229.56 ? 298 GLN C OE1 1 
ATOM 8881  N NE2 . GLN C 1 329 ? -50.289  52.328  -52.682  1.00 226.56 ? 298 GLN C NE2 1 
ATOM 8882  N N   . VAL C 1 330 ? -45.492  48.286  -49.756  1.00 236.33 ? 299 VAL C N   1 
ATOM 8883  C CA  . VAL C 1 330 ? -44.536  48.093  -48.654  1.00 238.35 ? 299 VAL C CA  1 
ATOM 8884  C C   . VAL C 1 330 ? -43.226  47.444  -49.150  1.00 242.81 ? 299 VAL C C   1 
ATOM 8885  O O   . VAL C 1 330 ? -43.257  46.661  -50.105  1.00 243.60 ? 299 VAL C O   1 
ATOM 8886  C CB  . VAL C 1 330 ? -45.163  47.213  -47.520  1.00 236.08 ? 299 VAL C CB  1 
ATOM 8887  C CG1 . VAL C 1 330 ? -44.480  47.458  -46.179  1.00 237.15 ? 299 VAL C CG1 1 
ATOM 8888  C CG2 . VAL C 1 330 ? -46.665  47.472  -47.387  1.00 231.98 ? 299 VAL C CG2 1 
ATOM 8889  N N   . PRO C 1 331 ? -42.068  47.792  -48.529  1.00 213.97 ? 300 PRO C N   1 
ATOM 8890  C CA  . PRO C 1 331 ? -40.839  46.988  -48.704  1.00 215.49 ? 300 PRO C CA  1 
ATOM 8891  C C   . PRO C 1 331 ? -40.868  45.692  -47.859  1.00 216.32 ? 300 PRO C C   1 
ATOM 8892  O O   . PRO C 1 331 ? -41.134  45.763  -46.656  1.00 216.58 ? 300 PRO C O   1 
ATOM 8893  C CB  . PRO C 1 331 ? -39.724  47.933  -48.220  1.00 216.47 ? 300 PRO C CB  1 
ATOM 8894  C CG  . PRO C 1 331 ? -40.343  49.303  -48.177  1.00 215.38 ? 300 PRO C CG  1 
ATOM 8895  C CD  . PRO C 1 331 ? -41.779  49.075  -47.856  1.00 214.12 ? 300 PRO C CD  1 
ATOM 8896  N N   . LYS C 1 332 ? -40.577  44.538  -48.480  1.00 216.94 ? 301 LYS C N   1 
ATOM 8897  C CA  . LYS C 1 332 ? -40.795  43.194  -47.880  1.00 217.55 ? 301 LYS C CA  1 
ATOM 8898  C C   . LYS C 1 332 ? -40.114  42.923  -46.532  1.00 219.13 ? 301 LYS C C   1 
ATOM 8899  O O   . LYS C 1 332 ? -40.158  41.800  -46.028  1.00 219.81 ? 301 LYS C O   1 
ATOM 8900  C CB  . LYS C 1 332 ? -40.441  42.082  -48.879  1.00 218.00 ? 301 LYS C CB  1 
ATOM 8901  N N   . ALA C 1 333 ? -39.487  43.957  -45.967  1.00 219.98 ? 302 ALA C N   1 
ATOM 8902  C CA  . ALA C 1 333 ? -38.942  43.932  -44.604  1.00 221.64 ? 302 ALA C CA  1 
ATOM 8903  C C   . ALA C 1 333 ? -40.038  44.124  -43.546  1.00 221.14 ? 302 ALA C C   1 
ATOM 8904  O O   . ALA C 1 333 ? -39.859  43.738  -42.385  1.00 222.29 ? 302 ALA C O   1 
ATOM 8905  C CB  . ALA C 1 333 ? -37.842  44.993  -44.441  1.00 222.42 ? 302 ALA C CB  1 
ATOM 8906  N N   . HIS C 1 334 ? -41.161  44.727  -43.952  1.00 219.72 ? 303 HIS C N   1 
ATOM 8907  C CA  . HIS C 1 334 ? -42.331  44.927  -43.078  1.00 218.98 ? 303 HIS C CA  1 
ATOM 8908  C C   . HIS C 1 334 ? -43.503  44.016  -43.480  1.00 218.08 ? 303 HIS C C   1 
ATOM 8909  O O   . HIS C 1 334 ? -44.652  44.466  -43.613  1.00 216.50 ? 303 HIS C O   1 
ATOM 8910  C CB  . HIS C 1 334 ? -42.770  46.400  -43.059  1.00 217.97 ? 303 HIS C CB  1 
ATOM 8911  C CG  . HIS C 1 334 ? -41.713  47.346  -42.580  1.00 218.89 ? 303 HIS C CG  1 
ATOM 8912  N ND1 . HIS C 1 334 ? -41.225  47.329  -41.291  1.00 219.86 ? 303 HIS C ND1 1 
ATOM 8913  C CD2 . HIS C 1 334 ? -41.061  48.347  -43.216  1.00 218.90 ? 303 HIS C CD2 1 
ATOM 8914  C CE1 . HIS C 1 334 ? -40.312  48.272  -41.155  1.00 220.85 ? 303 HIS C CE1 1 
ATOM 8915  N NE2 . HIS C 1 334 ? -40.194  48.905  -42.308  1.00 220.51 ? 303 HIS C NE2 1 
ATOM 8916  N N   . VAL C 1 335 ? -43.182  42.733  -43.668  1.00 219.25 ? 304 VAL C N   1 
ATOM 8917  C CA  . VAL C 1 335 ? -44.156  41.678  -43.983  1.00 218.90 ? 304 VAL C CA  1 
ATOM 8918  C C   . VAL C 1 335 ? -45.147  41.493  -42.817  1.00 218.65 ? 304 VAL C C   1 
ATOM 8919  O O   . VAL C 1 335 ? -46.360  41.696  -42.973  1.00 217.26 ? 304 VAL C O   1 
ATOM 8920  C CB  . VAL C 1 335 ? -43.438  40.311  -44.349  1.00 220.26 ? 304 VAL C CB  1 
ATOM 8921  C CG1 . VAL C 1 335 ? -44.440  39.168  -44.542  1.00 219.71 ? 304 VAL C CG1 1 
ATOM 8922  C CG2 . VAL C 1 335 ? -42.574  40.454  -45.600  1.00 220.35 ? 304 VAL C CG2 1 
ATOM 8923  N N   . ASP C 1 336 ? -44.612  41.138  -41.650  1.00 220.07 ? 305 ASP C N   1 
ATOM 8924  C CA  . ASP C 1 336 ? -45.426  40.809  -40.483  1.00 220.08 ? 305 ASP C CA  1 
ATOM 8925  C C   . ASP C 1 336 ? -45.714  42.018  -39.582  1.00 219.71 ? 305 ASP C C   1 
ATOM 8926  O O   . ASP C 1 336 ? -46.589  41.951  -38.715  1.00 219.42 ? 305 ASP C O   1 
ATOM 8927  C CB  . ASP C 1 336 ? -44.775  39.666  -39.690  1.00 221.92 ? 305 ASP C CB  1 
ATOM 8928  C CG  . ASP C 1 336 ? -44.445  38.450  -40.562  1.00 222.49 ? 305 ASP C CG  1 
ATOM 8929  O OD1 . ASP C 1 336 ? -45.089  38.250  -41.616  1.00 221.09 ? 305 ASP C OD1 1 
ATOM 8930  O OD2 . ASP C 1 336 ? -43.536  37.683  -40.187  1.00 224.37 ? 305 ASP C OD2 1 
ATOM 8931  N N   . GLU C 1 337 ? -44.983  43.117  -39.797  1.00 219.83 ? 306 GLU C N   1 
ATOM 8932  C CA  . GLU C 1 337 ? -45.229  44.390  -39.098  1.00 219.41 ? 306 GLU C CA  1 
ATOM 8933  C C   . GLU C 1 337 ? -46.524  45.043  -39.567  1.00 217.54 ? 306 GLU C C   1 
ATOM 8934  O O   . GLU C 1 337 ? -47.066  45.926  -38.900  1.00 217.09 ? 306 GLU C O   1 
ATOM 8935  C CB  . GLU C 1 337 ? -44.062  45.361  -39.291  1.00 220.16 ? 306 GLU C CB  1 
ATOM 8936  C CG  . GLU C 1 337 ? -43.037  45.343  -38.162  1.00 222.02 ? 306 GLU C CG  1 
ATOM 8937  C CD  . GLU C 1 337 ? -41.924  46.368  -38.347  1.00 222.63 ? 306 GLU C CD  1 
ATOM 8938  O OE1 . GLU C 1 337 ? -42.105  47.330  -39.123  1.00 221.18 ? 306 GLU C OE1 1 
ATOM 8939  O OE2 . GLU C 1 337 ? -40.858  46.213  -37.711  1.00 224.73 ? 306 GLU C OE2 1 
ATOM 8940  N N   . PHE C 1 338 ? -46.989  44.610  -40.733  1.00 216.61 ? 307 PHE C N   1 
ATOM 8941  C CA  . PHE C 1 338 ? -48.309  44.943  -41.237  1.00 214.99 ? 307 PHE C CA  1 
ATOM 8942  C C   . PHE C 1 338 ? -49.314  43.939  -40.668  1.00 214.37 ? 307 PHE C C   1 
ATOM 8943  O O   . PHE C 1 338 ? -48.938  42.826  -40.286  1.00 215.36 ? 307 PHE C O   1 
ATOM 8944  C CB  . PHE C 1 338 ? -48.290  44.884  -42.761  1.00 214.59 ? 307 PHE C CB  1 
ATOM 8945  C CG  . PHE C 1 338 ? -49.470  45.529  -43.413  1.00 213.93 ? 307 PHE C CG  1 
ATOM 8946  C CD1 . PHE C 1 338 ? -49.555  46.919  -43.506  1.00 214.06 ? 307 PHE C CD1 1 
ATOM 8947  C CD2 . PHE C 1 338 ? -50.483  44.747  -43.964  1.00 214.03 ? 307 PHE C CD2 1 
ATOM 8948  C CE1 . PHE C 1 338 ? -50.641  47.524  -44.126  1.00 213.72 ? 307 PHE C CE1 1 
ATOM 8949  C CE2 . PHE C 1 338 ? -51.579  45.337  -44.588  1.00 213.77 ? 307 PHE C CE2 1 
ATOM 8950  C CZ  . PHE C 1 338 ? -51.660  46.732  -44.668  1.00 213.62 ? 307 PHE C CZ  1 
ATOM 8951  N N   . LYS C 1 339 ? -50.581  44.348  -40.607  1.00 212.68 ? 308 LYS C N   1 
ATOM 8952  C CA  . LYS C 1 339 ? -51.685  43.549  -40.044  1.00 211.84 ? 308 LYS C CA  1 
ATOM 8953  C C   . LYS C 1 339 ? -51.596  43.327  -38.531  1.00 212.38 ? 308 LYS C C   1 
ATOM 8954  O O   . LYS C 1 339 ? -52.616  43.324  -37.848  1.00 211.76 ? 308 LYS C O   1 
ATOM 8955  C CB  . LYS C 1 339 ? -51.922  42.222  -40.816  1.00 211.89 ? 308 LYS C CB  1 
ATOM 8956  C CG  . LYS C 1 339 ? -51.115  40.988  -40.362  1.00 213.28 ? 308 LYS C CG  1 
ATOM 8957  C CD  . LYS C 1 339 ? -51.605  39.698  -41.029  1.00 213.05 ? 308 LYS C CD  1 
ATOM 8958  C CE  . LYS C 1 339 ? -50.691  38.518  -40.715  1.00 214.27 ? 308 LYS C CE  1 
ATOM 8959  N NZ  . LYS C 1 339 ? -51.251  37.233  -41.220  1.00 214.13 ? 308 LYS C NZ  1 
ATOM 8960  N N   . SER C 1 340 ? -50.381  43.185  -38.011  1.00 213.51 ? 309 SER C N   1 
ATOM 8961  C CA  . SER C 1 340 ? -50.184  42.738  -36.632  1.00 214.56 ? 309 SER C CA  1 
ATOM 8962  C C   . SER C 1 340 ? -49.350  43.693  -35.755  1.00 215.23 ? 309 SER C C   1 
ATOM 8963  O O   . SER C 1 340 ? -48.324  44.209  -36.202  1.00 215.76 ? 309 SER C O   1 
ATOM 8964  C CB  . SER C 1 340 ? -49.553  41.339  -36.630  1.00 215.92 ? 309 SER C CB  1 
ATOM 8965  O OG  . SER C 1 340 ? -50.293  40.434  -37.437  1.00 215.25 ? 309 SER C OG  1 
ATOM 8966  N N   . VAL C 1 341 ? -49.780  43.943  -34.514  1.00 215.08 ? 310 VAL C N   1 
ATOM 8967  C CA  . VAL C 1 341 ? -51.064  43.486  -33.970  1.00 213.84 ? 310 VAL C CA  1 
ATOM 8968  C C   . VAL C 1 341 ? -51.984  44.701  -34.016  1.00 211.99 ? 310 VAL C C   1 
ATOM 8969  O O   . VAL C 1 341 ? -52.901  44.785  -34.838  1.00 210.40 ? 310 VAL C O   1 
ATOM 8970  C CB  . VAL C 1 341 ? -50.928  42.982  -32.492  1.00 215.40 ? 310 VAL C CB  1 
ATOM 8971  C CG1 . VAL C 1 341 ? -52.210  42.301  -32.027  1.00 214.80 ? 310 VAL C CG1 1 
ATOM 8972  C CG2 . VAL C 1 341 ? -49.721  42.046  -32.315  1.00 217.12 ? 310 VAL C CG2 1 
ATOM 8973  N N   . SER C 1 342 ? -51.701  45.636  -33.112  1.00 212.08 ? 311 SER C N   1 
ATOM 8974  C CA  . SER C 1 342 ? -52.255  46.981  -33.111  1.00 210.60 ? 311 SER C CA  1 
ATOM 8975  C C   . SER C 1 342 ? -51.209  47.893  -32.452  1.00 211.36 ? 311 SER C C   1 
ATOM 8976  O O   . SER C 1 342 ? -51.245  48.068  -31.230  1.00 212.23 ? 311 SER C O   1 
ATOM 8977  C CB  . SER C 1 342 ? -53.592  47.028  -32.352  1.00 210.08 ? 311 SER C CB  1 
ATOM 8978  O OG  . SER C 1 342 ? -53.459  46.566  -31.015  1.00 211.22 ? 311 SER C OG  1 
ATOM 8979  N N   . LYS C 1 343 ? -50.263  48.472  -33.207  1.00 210.85 ? 312 LYS C N   1 
ATOM 8980  C CA  . LYS C 1 343 ? -50.130  48.460  -34.684  1.00 209.28 ? 312 LYS C CA  1 
ATOM 8981  C C   . LYS C 1 343 ? -51.232  49.216  -35.454  1.00 207.40 ? 312 LYS C C   1 
ATOM 8982  O O   . LYS C 1 343 ? -51.191  50.445  -35.549  1.00 207.21 ? 312 LYS C O   1 
ATOM 8983  C CB  . LYS C 1 343 ? -49.853  47.065  -35.257  1.00 209.27 ? 312 LYS C CB  1 
ATOM 8984  N N   . PHE C 1 344 ? -52.193  48.480  -36.016  1.00 206.01 ? 313 PHE C N   1 
ATOM 8985  C CA  . PHE C 1 344 ? -53.294  49.077  -36.788  1.00 204.13 ? 313 PHE C CA  1 
ATOM 8986  C C   . PHE C 1 344 ? -54.602  48.305  -36.601  1.00 202.83 ? 313 PHE C C   1 
ATOM 8987  O O   . PHE C 1 344 ? -54.613  47.071  -36.651  1.00 202.88 ? 313 PHE C O   1 
ATOM 8988  C CB  . PHE C 1 344 ? -52.959  49.136  -38.287  1.00 203.67 ? 313 PHE C CB  1 
ATOM 8989  C CG  . PHE C 1 344 ? -51.493  48.991  -38.598  1.00 205.08 ? 313 PHE C CG  1 
ATOM 8990  C CD1 . PHE C 1 344 ? -50.632  50.090  -38.526  1.00 205.77 ? 313 PHE C CD1 1 
ATOM 8991  C CD2 . PHE C 1 344 ? -50.973  47.752  -38.971  1.00 205.70 ? 313 PHE C CD2 1 
ATOM 8992  C CE1 . PHE C 1 344 ? -49.278  49.950  -38.809  1.00 206.67 ? 313 PHE C CE1 1 
ATOM 8993  C CE2 . PHE C 1 344 ? -49.624  47.606  -39.261  1.00 206.66 ? 313 PHE C CE2 1 
ATOM 8994  C CZ  . PHE C 1 344 ? -48.773  48.706  -39.179  1.00 207.21 ? 313 PHE C CZ  1 
ATOM 8995  N N   . LYS C 1 345 ? -55.691  49.046  -36.389  1.00 201.48 ? 314 LYS C N   1 
ATOM 8996  C CA  . LYS C 1 345 ? -57.052  48.492  -36.312  1.00 199.99 ? 314 LYS C CA  1 
ATOM 8997  C C   . LYS C 1 345 ? -57.967  49.135  -37.373  1.00 198.34 ? 314 LYS C C   1 
ATOM 8998  O O   . LYS C 1 345 ? -59.176  49.294  -37.172  1.00 197.63 ? 314 LYS C O   1 
ATOM 8999  C CB  . LYS C 1 345 ? -57.625  48.686  -34.901  1.00 200.35 ? 314 LYS C CB  1 
ATOM 9000  N N   . ILE C 1 346 ? -57.367  49.484  -38.510  1.00 197.55 ? 315 ILE C N   1 
ATOM 9001  C CA  . ILE C 1 346 ? -57.999  50.322  -39.527  1.00 196.03 ? 315 ILE C CA  1 
ATOM 9002  C C   . ILE C 1 346 ? -58.247  49.505  -40.784  1.00 194.84 ? 315 ILE C C   1 
ATOM 9003  O O   . ILE C 1 346 ? -57.638  48.451  -40.976  1.00 194.99 ? 315 ILE C O   1 
ATOM 9004  C CB  . ILE C 1 346 ? -57.107  51.546  -39.890  1.00 196.60 ? 315 ILE C CB  1 
ATOM 9005  C CG1 . ILE C 1 346 ? -56.021  51.785  -38.820  1.00 197.92 ? 315 ILE C CG1 1 
ATOM 9006  C CG2 . ILE C 1 346 ? -57.974  52.788  -40.108  1.00 195.93 ? 315 ILE C CG2 1 
ATOM 9007  C CD1 . ILE C 1 346 ? -54.623  52.092  -39.367  1.00 198.31 ? 315 ILE C CD1 1 
ATOM 9008  N N   . PHE C 1 347 ? -59.132  50.002  -41.642  1.00 193.49 ? 316 PHE C N   1 
ATOM 9009  C CA  . PHE C 1 347 ? -59.571  49.254  -42.806  1.00 192.54 ? 316 PHE C CA  1 
ATOM 9010  C C   . PHE C 1 347 ? -60.512  50.102  -43.661  1.00 191.55 ? 316 PHE C C   1 
ATOM 9011  O O   . PHE C 1 347 ? -61.466  50.703  -43.157  1.00 191.02 ? 316 PHE C O   1 
ATOM 9012  C CB  . PHE C 1 347 ? -60.232  47.949  -42.338  1.00 192.59 ? 316 PHE C CB  1 
ATOM 9013  C CG  . PHE C 1 347 ? -60.764  47.089  -43.438  1.00 192.58 ? 316 PHE C CG  1 
ATOM 9014  C CD1 . PHE C 1 347 ? -60.017  46.857  -44.595  1.00 193.22 ? 316 PHE C CD1 1 
ATOM 9015  C CD2 . PHE C 1 347 ? -62.007  46.472  -43.298  1.00 192.25 ? 316 PHE C CD2 1 
ATOM 9016  C CE1 . PHE C 1 347 ? -60.517  46.047  -45.614  1.00 193.52 ? 316 PHE C CE1 1 
ATOM 9017  C CE2 . PHE C 1 347 ? -62.518  45.660  -44.307  1.00 192.56 ? 316 PHE C CE2 1 
ATOM 9018  C CZ  . PHE C 1 347 ? -61.771  45.442  -45.469  1.00 193.14 ? 316 PHE C CZ  1 
ATOM 9019  N N   . ASN C 1 348 ? -60.219  50.151  -44.958  1.00 191.12 ? 317 ASN C N   1 
ATOM 9020  C CA  . ASN C 1 348 ? -60.985  50.953  -45.907  1.00 190.59 ? 317 ASN C CA  1 
ATOM 9021  C C   . ASN C 1 348 ? -62.357  50.351  -46.172  1.00 190.23 ? 317 ASN C C   1 
ATOM 9022  O O   . ASN C 1 348 ? -62.458  49.192  -46.568  1.00 190.27 ? 317 ASN C O   1 
ATOM 9023  C CB  . ASN C 1 348 ? -60.215  51.092  -47.224  1.00 190.59 ? 317 ASN C CB  1 
ATOM 9024  C CG  . ASN C 1 348 ? -60.823  52.130  -48.151  1.00 189.93 ? 317 ASN C CG  1 
ATOM 9025  O OD1 . ASN C 1 348 ? -61.011  53.290  -47.772  1.00 189.46 ? 317 ASN C OD1 1 
ATOM 9026  N ND2 . ASN C 1 348 ? -61.123  51.721  -49.377  1.00 189.11 ? 317 ASN C ND2 1 
ATOM 9027  N N   . THR C 1 349 ? -63.406  51.140  -45.954  1.00 190.11 ? 318 THR C N   1 
ATOM 9028  C CA  . THR C 1 349 ? -64.786  50.686  -46.157  1.00 189.87 ? 318 THR C CA  1 
ATOM 9029  C C   . THR C 1 349 ? -65.195  50.766  -47.618  1.00 190.08 ? 318 THR C C   1 
ATOM 9030  O O   . THR C 1 349 ? -66.053  50.011  -48.074  1.00 189.93 ? 318 THR C O   1 
ATOM 9031  C CB  . THR C 1 349 ? -65.767  51.524  -45.326  1.00 189.67 ? 318 THR C CB  1 
ATOM 9032  O OG1 . THR C 1 349 ? -65.328  51.543  -43.967  1.00 190.05 ? 318 THR C OG1 1 
ATOM 9033  C CG2 . THR C 1 349 ? -67.159  50.940  -45.366  1.00 189.35 ? 318 THR C CG2 1 
ATOM 9034  N N   . ASN C 1 350 ? -64.560  51.682  -48.341  1.00 190.77 ? 319 ASN C N   1 
ATOM 9035  C CA  . ASN C 1 350 ? -64.937  52.032  -49.706  1.00 191.42 ? 319 ASN C CA  1 
ATOM 9036  C C   . ASN C 1 350 ? -66.163  52.947  -49.712  1.00 191.66 ? 319 ASN C C   1 
ATOM 9037  O O   . ASN C 1 350 ? -66.538  53.493  -50.748  1.00 191.95 ? 319 ASN C O   1 
ATOM 9038  C CB  . ASN C 1 350 ? -65.157  50.781  -50.567  1.00 191.52 ? 319 ASN C CB  1 
ATOM 9039  C CG  . ASN C 1 350 ? -64.982  51.053  -52.048  1.00 192.52 ? 319 ASN C CG  1 
ATOM 9040  O OD1 . ASN C 1 350 ? -63.990  51.659  -52.476  1.00 193.21 ? 319 ASN C OD1 1 
ATOM 9041  N ND2 . ASN C 1 350 ? -65.947  50.599  -52.847  1.00 193.12 ? 319 ASN C ND2 1 
ATOM 9042  N N   . ASN C 1 351 ? -66.775  53.112  -48.541  1.00 191.81 ? 320 ASN C N   1 
ATOM 9043  C CA  . ASN C 1 351 ? -67.845  54.080  -48.350  1.00 192.46 ? 320 ASN C CA  1 
ATOM 9044  C C   . ASN C 1 351 ? -67.246  55.434  -48.029  1.00 193.17 ? 320 ASN C C   1 
ATOM 9045  O O   . ASN C 1 351 ? -66.563  55.574  -47.013  1.00 193.34 ? 320 ASN C O   1 
ATOM 9046  C CB  . ASN C 1 351 ? -68.739  53.667  -47.186  1.00 192.15 ? 320 ASN C CB  1 
ATOM 9047  C CG  . ASN C 1 351 ? -69.525  52.404  -47.457  1.00 192.35 ? 320 ASN C CG  1 
ATOM 9048  O OD1 . ASN C 1 351 ? -70.040  51.777  -46.527  1.00 192.40 ? 320 ASN C OD1 1 
ATOM 9049  N ND2 . ASN C 1 351 ? -69.633  52.023  -48.726  1.00 193.22 ? 320 ASN C ND2 1 
ATOM 9050  N N   . LEU C 1 352 ? -67.491  56.431  -48.879  1.00 193.99 ? 321 LEU C N   1 
ATOM 9051  C CA  . LEU C 1 352 ? -66.925  57.765  -48.657  1.00 194.74 ? 321 LEU C CA  1 
ATOM 9052  C C   . LEU C 1 352 ? -67.921  58.890  -48.911  1.00 195.61 ? 321 LEU C C   1 
ATOM 9053  O O   . LEU C 1 352 ? -69.011  58.667  -49.438  1.00 195.60 ? 321 LEU C O   1 
ATOM 9054  C CB  . LEU C 1 352 ? -65.658  57.977  -49.497  1.00 194.91 ? 321 LEU C CB  1 
ATOM 9055  C CG  . LEU C 1 352 ? -64.833  56.735  -49.836  1.00 194.44 ? 321 LEU C CG  1 
ATOM 9056  C CD1 . LEU C 1 352 ? -64.961  56.445  -51.312  1.00 194.59 ? 321 LEU C CD1 1 
ATOM 9057  C CD2 . LEU C 1 352 ? -63.379  56.900  -49.452  1.00 194.68 ? 321 LEU C CD2 1 
ATOM 9058  N N   . TRP C 1 353 ? -67.527  60.097  -48.515  1.00 196.66 ? 322 TRP C N   1 
ATOM 9059  C CA  . TRP C 1 353 ? -68.285  61.311  -48.787  1.00 197.99 ? 322 TRP C CA  1 
ATOM 9060  C C   . TRP C 1 353 ? -67.363  62.407  -49.327  1.00 199.10 ? 322 TRP C C   1 
ATOM 9061  O O   . TRP C 1 353 ? -66.370  62.766  -48.685  1.00 199.26 ? 322 TRP C O   1 
ATOM 9062  C CB  . TRP C 1 353 ? -68.999  61.781  -47.525  1.00 198.08 ? 322 TRP C CB  1 
ATOM 9063  C CG  . TRP C 1 353 ? -70.370  61.215  -47.363  1.00 198.07 ? 322 TRP C CG  1 
ATOM 9064  C CD1 . TRP C 1 353 ? -71.510  61.636  -47.990  1.00 199.02 ? 322 TRP C CD1 1 
ATOM 9065  C CD2 . TRP C 1 353 ? -70.760  60.139  -46.510  1.00 197.47 ? 322 TRP C CD2 1 
ATOM 9066  N NE1 . TRP C 1 353 ? -72.589  60.885  -47.582  1.00 198.57 ? 322 TRP C NE1 1 
ATOM 9067  C CE2 . TRP C 1 353 ? -72.157  59.961  -46.670  1.00 197.69 ? 322 TRP C CE2 1 
ATOM 9068  C CE3 . TRP C 1 353 ? -70.069  59.309  -45.624  1.00 196.93 ? 322 TRP C CE3 1 
ATOM 9069  C CZ2 . TRP C 1 353 ? -72.874  58.985  -45.978  1.00 197.05 ? 322 TRP C CZ2 1 
ATOM 9070  C CZ3 . TRP C 1 353 ? -70.782  58.336  -44.940  1.00 196.84 ? 322 TRP C CZ3 1 
ATOM 9071  C CH2 . TRP C 1 353 ? -72.174  58.182  -45.123  1.00 196.67 ? 322 TRP C CH2 1 
ATOM 9072  N N   . ILE C 1 354 ? -67.696  62.938  -50.503  1.00 200.18 ? 323 ILE C N   1 
ATOM 9073  C CA  . ILE C 1 354 ? -66.768  63.802  -51.240  1.00 201.39 ? 323 ILE C CA  1 
ATOM 9074  C C   . ILE C 1 354 ? -67.272  65.241  -51.456  1.00 202.86 ? 323 ILE C C   1 
ATOM 9075  O O   . ILE C 1 354 ? -68.438  65.455  -51.803  1.00 203.28 ? 323 ILE C O   1 
ATOM 9076  C CB  . ILE C 1 354 ? -66.347  63.156  -52.593  1.00 201.29 ? 323 ILE C CB  1 
ATOM 9077  C CG1 . ILE C 1 354 ? -65.967  61.684  -52.392  1.00 200.26 ? 323 ILE C CG1 1 
ATOM 9078  C CG2 . ILE C 1 354 ? -65.184  63.927  -53.225  1.00 202.15 ? 323 ILE C CG2 1 
ATOM 9079  C CD1 . ILE C 1 354 ? -65.725  60.914  -53.669  1.00 200.17 ? 323 ILE C CD1 1 
ATOM 9080  N N   . SER C 1 355 ? -66.370  66.207  -51.245  1.00 203.90 ? 324 SER C N   1 
ATOM 9081  C CA  . SER C 1 355 ? -66.634  67.639  -51.449  1.00 205.45 ? 324 SER C CA  1 
ATOM 9082  C C   . SER C 1 355 ? -66.604  68.003  -52.926  1.00 206.39 ? 324 SER C C   1 
ATOM 9083  O O   . SER C 1 355 ? -65.587  67.828  -53.603  1.00 206.12 ? 324 SER C O   1 
ATOM 9084  C CB  . SER C 1 355 ? -65.624  68.505  -50.673  1.00 205.94 ? 324 SER C CB  1 
ATOM 9085  O OG  . SER C 1 355 ? -65.824  69.895  -50.898  1.00 207.22 ? 324 SER C OG  1 
ATOM 9086  N N   . LEU C 1 356 ? -67.734  68.513  -53.404  1.00 207.55 ? 325 LEU C N   1 
ATOM 9087  C CA  . LEU C 1 356 ? -67.874  68.964  -54.779  1.00 209.03 ? 325 LEU C CA  1 
ATOM 9088  C C   . LEU C 1 356 ? -66.996  70.177  -55.092  1.00 210.46 ? 325 LEU C C   1 
ATOM 9089  O O   . LEU C 1 356 ? -66.332  70.215  -56.133  1.00 210.96 ? 325 LEU C O   1 
ATOM 9090  C CB  . LEU C 1 356 ? -69.344  69.264  -55.089  1.00 209.83 ? 325 LEU C CB  1 
ATOM 9091  C CG  . LEU C 1 356 ? -70.123  68.133  -55.762  1.00 209.30 ? 325 LEU C CG  1 
ATOM 9092  C CD1 . LEU C 1 356 ? -71.596  68.170  -55.404  1.00 209.73 ? 325 LEU C CD1 1 
ATOM 9093  C CD2 . LEU C 1 356 ? -69.933  68.151  -57.280  1.00 210.42 ? 325 LEU C CD2 1 
ATOM 9094  N N   . ALA C 1 357 ? -66.993  71.155  -54.185  1.00 211.33 ? 326 ALA C N   1 
ATOM 9095  C CA  . ALA C 1 357 ? -66.177  72.364  -54.326  1.00 212.81 ? 326 ALA C CA  1 
ATOM 9096  C C   . ALA C 1 357 ? -64.702  72.059  -54.642  1.00 212.61 ? 326 ALA C C   1 
ATOM 9097  O O   . ALA C 1 357 ? -64.119  72.646  -55.562  1.00 213.53 ? 326 ALA C O   1 
ATOM 9098  C CB  . ALA C 1 357 ? -66.295  73.226  -53.068  1.00 213.25 ? 326 ALA C CB  1 
ATOM 9099  N N   . ALA C 1 358 ? -64.122  71.124  -53.889  1.00 211.57 ? 327 ALA C N   1 
ATOM 9100  C CA  . ALA C 1 358 ? -62.707  70.759  -54.020  1.00 211.35 ? 327 ALA C CA  1 
ATOM 9101  C C   . ALA C 1 358 ? -62.365  69.888  -55.246  1.00 211.05 ? 327 ALA C C   1 
ATOM 9102  O O   . ALA C 1 358 ? -61.203  69.837  -55.661  1.00 211.18 ? 327 ALA C O   1 
ATOM 9103  C CB  . ALA C 1 358 ? -62.213  70.103  -52.735  1.00 210.26 ? 327 ALA C CB  1 
ATOM 9104  N N   . VAL C 1 359 ? -63.363  69.214  -55.823  1.00 210.81 ? 328 VAL C N   1 
ATOM 9105  C CA  . VAL C 1 359 ? -63.161  68.414  -57.046  1.00 210.64 ? 328 VAL C CA  1 
ATOM 9106  C C   . VAL C 1 359 ? -62.913  69.310  -58.279  1.00 212.18 ? 328 VAL C C   1 
ATOM 9107  O O   . VAL C 1 359 ? -62.248  68.890  -59.236  1.00 212.29 ? 328 VAL C O   1 
ATOM 9108  C CB  . VAL C 1 359 ? -64.335  67.421  -57.309  1.00 209.93 ? 328 VAL C CB  1 
ATOM 9109  C CG1 . VAL C 1 359 ? -63.984  66.432  -58.418  1.00 209.47 ? 328 VAL C CG1 1 
ATOM 9110  C CG2 . VAL C 1 359 ? -64.679  66.657  -56.051  1.00 208.51 ? 328 VAL C CG2 1 
ATOM 9111  N N   . LYS C 1 360 ? -63.442  70.537  -58.236  1.00 213.51 ? 329 LYS C N   1 
ATOM 9112  C CA  . LYS C 1 360 ? -63.229  71.544  -59.290  1.00 215.10 ? 329 LYS C CA  1 
ATOM 9113  C C   . LYS C 1 360 ? -61.797  72.099  -59.300  1.00 215.46 ? 329 LYS C C   1 
ATOM 9114  O O   . LYS C 1 360 ? -61.291  72.512  -60.348  1.00 216.34 ? 329 LYS C O   1 
ATOM 9115  C CB  . LYS C 1 360 ? -64.246  72.685  -59.165  1.00 216.39 ? 329 LYS C CB  1 
ATOM 9116  N N   . ARG C 1 361 ? -61.157  72.112  -58.132  1.00 214.85 ? 330 ARG C N   1 
ATOM 9117  C CA  . ARG C 1 361 ? -59.744  72.472  -58.028  1.00 215.07 ? 330 ARG C CA  1 
ATOM 9118  C C   . ARG C 1 361 ? -58.881  71.332  -58.561  1.00 214.50 ? 330 ARG C C   1 
ATOM 9119  O O   . ARG C 1 361 ? -58.059  71.528  -59.460  1.00 215.09 ? 330 ARG C O   1 
ATOM 9120  C CB  . ARG C 1 361 ? -59.342  72.743  -56.572  1.00 214.50 ? 330 ARG C CB  1 
ATOM 9121  C CG  . ARG C 1 361 ? -60.151  73.779  -55.830  1.00 213.97 ? 330 ARG C CG  1 
ATOM 9122  C CD  . ARG C 1 361 ? -59.942  73.579  -54.351  1.00 211.06 ? 330 ARG C CD  1 
ATOM 9123  N NE  . ARG C 1 361 ? -60.671  74.547  -53.546  1.00 210.36 ? 330 ARG C NE  1 
ATOM 9124  C CZ  . ARG C 1 361 ? -61.060  74.336  -52.294  1.00 209.05 ? 330 ARG C CZ  1 
ATOM 9125  N NH1 . ARG C 1 361 ? -60.810  73.178  -51.695  1.00 206.98 ? 330 ARG C NH1 1 
ATOM 9126  N NH2 . ARG C 1 361 ? -61.712  75.285  -51.641  1.00 209.90 ? 330 ARG C NH2 1 
ATOM 9127  N N   . LEU C 1 362 ? -59.111  70.140  -58.009  1.00 213.49 ? 331 LEU C N   1 
ATOM 9128  C CA  . LEU C 1 362 ? -58.173  69.020  -58.090  1.00 213.05 ? 331 LEU C CA  1 
ATOM 9129  C C   . LEU C 1 362 ? -58.066  68.339  -59.447  1.00 213.54 ? 331 LEU C C   1 
ATOM 9130  O O   . LEU C 1 362 ? -56.967  67.977  -59.871  1.00 213.48 ? 331 LEU C O   1 
ATOM 9131  C CB  . LEU C 1 362 ? -58.501  67.985  -57.014  1.00 211.60 ? 331 LEU C CB  1 
ATOM 9132  C CG  . LEU C 1 362 ? -58.430  68.481  -55.569  1.00 211.55 ? 331 LEU C CG  1 
ATOM 9133  C CD1 . LEU C 1 362 ? -59.120  67.491  -54.663  1.00 210.66 ? 331 LEU C CD1 1 
ATOM 9134  C CD2 . LEU C 1 362 ? -56.998  68.735  -55.106  1.00 211.76 ? 331 LEU C CD2 1 
ATOM 9135  N N   . GLN C 1 363 ? -59.200  68.151  -60.115  1.00 214.41 ? 332 GLN C N   1 
ATOM 9136  C CA  . GLN C 1 363 ? -59.216  67.526  -61.439  1.00 215.34 ? 332 GLN C CA  1 
ATOM 9137  C C   . GLN C 1 363 ? -58.564  68.422  -62.508  1.00 217.22 ? 332 GLN C C   1 
ATOM 9138  O O   . GLN C 1 363 ? -57.835  67.929  -63.378  1.00 217.43 ? 332 GLN C O   1 
ATOM 9139  C CB  . GLN C 1 363 ? -60.648  67.137  -61.840  1.00 215.24 ? 332 GLN C CB  1 
ATOM 9140  N N   . GLU C 1 364 ? -58.816  69.732  -62.417  1.00 218.92 ? 333 GLU C N   1 
ATOM 9141  C CA  . GLU C 1 364 ? -58.345  70.719  -63.406  1.00 220.85 ? 333 GLU C CA  1 
ATOM 9142  C C   . GLU C 1 364 ? -56.869  71.090  -63.240  1.00 221.21 ? 333 GLU C C   1 
ATOM 9143  O O   . GLU C 1 364 ? -56.116  71.089  -64.219  1.00 221.79 ? 333 GLU C O   1 
ATOM 9144  C CB  . GLU C 1 364 ? -59.223  71.980  -63.380  1.00 222.25 ? 333 GLU C CB  1 
ATOM 9145  C CG  . GLU C 1 364 ? -60.632  71.771  -63.932  1.00 223.02 ? 333 GLU C CG  1 
ATOM 9146  C CD  . GLU C 1 364 ? -61.536  72.976  -63.731  1.00 225.13 ? 333 GLU C CD  1 
ATOM 9147  O OE1 . GLU C 1 364 ? -61.257  74.046  -64.321  1.00 227.20 ? 333 GLU C OE1 1 
ATOM 9148  O OE2 . GLU C 1 364 ? -62.537  72.845  -62.993  1.00 224.99 ? 333 GLU C OE2 1 
ATOM 9149  N N   . GLN C 1 365 ? -56.468  71.406  -62.006  1.00 221.07 ? 334 GLN C N   1 
ATOM 9150  C CA  . GLN C 1 365 ? -55.067  71.725  -61.678  1.00 221.49 ? 334 GLN C CA  1 
ATOM 9151  C C   . GLN C 1 365 ? -54.190  70.463  -61.541  1.00 220.36 ? 334 GLN C C   1 
ATOM 9152  O O   . GLN C 1 365 ? -53.085  70.521  -60.981  1.00 220.27 ? 334 GLN C O   1 
ATOM 9153  C CB  . GLN C 1 365 ? -54.991  72.592  -60.408  1.00 221.77 ? 334 GLN C CB  1 
ATOM 9154  C CG  . GLN C 1 365 ? -55.575  74.002  -60.571  1.00 223.49 ? 334 GLN C CG  1 
ATOM 9155  C CD  . GLN C 1 365 ? -55.428  74.871  -59.327  1.00 224.05 ? 334 GLN C CD  1 
ATOM 9156  O OE1 . GLN C 1 365 ? -55.710  74.432  -58.206  1.00 222.97 ? 334 GLN C OE1 1 
ATOM 9157  N NE2 . GLN C 1 365 ? -54.996  76.118  -59.524  1.00 225.57 ? 334 GLN C NE2 1 
ATOM 9158  N N   . ASN C 1 366 ? -54.702  69.345  -62.076  1.00 219.61 ? 335 ASN C N   1 
ATOM 9159  C CA  . ASN C 1 366 ? -54.084  68.003  -62.019  1.00 218.44 ? 335 ASN C CA  1 
ATOM 9160  C C   . ASN C 1 366 ? -53.485  67.610  -60.665  1.00 217.79 ? 335 ASN C C   1 
ATOM 9161  O O   . ASN C 1 366 ? -52.451  66.938  -60.606  1.00 217.56 ? 335 ASN C O   1 
ATOM 9162  C CB  . ASN C 1 366 ? -53.066  67.804  -63.157  1.00 218.79 ? 335 ASN C CB  1 
ATOM 9163  C CG  . ASN C 1 366 ? -53.631  67.003  -64.317  1.00 218.09 ? 335 ASN C CG  1 
ATOM 9164  O OD1 . ASN C 1 366 ? -53.104  65.950  -64.669  1.00 216.52 ? 335 ASN C OD1 1 
ATOM 9165  N ND2 . ASN C 1 366 ? -54.712  67.495  -64.911  1.00 218.40 ? 335 ASN C ND2 1 
ATOM 9166  N N   . ALA C 1 367 ? -54.163  68.007  -59.588  1.00 217.65 ? 336 ALA C N   1 
ATOM 9167  C CA  . ALA C 1 367 ? -53.615  67.912  -58.231  1.00 217.31 ? 336 ALA C CA  1 
ATOM 9168  C C   . ALA C 1 367 ? -53.945  66.620  -57.459  1.00 216.11 ? 336 ALA C C   1 
ATOM 9169  O O   . ALA C 1 367 ? -53.517  66.458  -56.312  1.00 215.74 ? 336 ALA C O   1 
ATOM 9170  C CB  . ALA C 1 367 ? -54.012  69.152  -57.421  1.00 217.92 ? 336 ALA C CB  1 
ATOM 9171  N N   . ILE C 1 368 ? -54.683  65.703  -58.090  1.00 215.66 ? 337 ILE C N   1 
ATOM 9172  C CA  . ILE C 1 368 ? -55.056  64.420  -57.468  1.00 214.58 ? 337 ILE C CA  1 
ATOM 9173  C C   . ILE C 1 368 ? -53.917  63.387  -57.531  1.00 214.36 ? 337 ILE C C   1 
ATOM 9174  O O   . ILE C 1 368 ? -53.536  62.940  -58.620  1.00 214.69 ? 337 ILE C O   1 
ATOM 9175  C CB  . ILE C 1 368 ? -56.324  63.772  -58.124  1.00 214.13 ? 337 ILE C CB  1 
ATOM 9176  C CG1 . ILE C 1 368 ? -56.944  64.662  -59.216  1.00 215.17 ? 337 ILE C CG1 1 
ATOM 9177  C CG2 . ILE C 1 368 ? -57.329  63.367  -57.050  1.00 213.18 ? 337 ILE C CG2 1 
ATOM 9178  C CD1 . ILE C 1 368 ? -57.627  63.887  -60.364  1.00 214.90 ? 337 ILE C CD1 1 
ATOM 9179  N N   . ASP C 1 369 ? -53.374  63.011  -56.371  1.00 213.98 ? 338 ASP C N   1 
ATOM 9180  C CA  . ASP C 1 369 ? -52.434  61.884  -56.293  1.00 213.65 ? 338 ASP C CA  1 
ATOM 9181  C C   . ASP C 1 369 ? -53.220  60.577  -56.151  1.00 212.64 ? 338 ASP C C   1 
ATOM 9182  O O   . ASP C 1 369 ? -54.209  60.519  -55.410  1.00 212.23 ? 338 ASP C O   1 
ATOM 9183  C CB  . ASP C 1 369 ? -51.429  62.053  -55.135  1.00 213.96 ? 338 ASP C CB  1 
ATOM 9184  C CG  . ASP C 1 369 ? -52.004  61.638  -53.767  1.00 213.64 ? 338 ASP C CG  1 
ATOM 9185  O OD1 . ASP C 1 369 ? -52.965  62.283  -53.296  1.00 213.85 ? 338 ASP C OD1 1 
ATOM 9186  O OD2 . ASP C 1 369 ? -51.492  60.671  -53.157  1.00 213.41 ? 338 ASP C OD2 1 
ATOM 9187  N N   . MET C 1 370 ? -52.797  59.542  -56.876  1.00 212.27 ? 339 MET C N   1 
ATOM 9188  C CA  . MET C 1 370 ? -53.417  58.219  -56.780  1.00 211.29 ? 339 MET C CA  1 
ATOM 9189  C C   . MET C 1 370 ? -52.413  57.138  -57.146  1.00 211.21 ? 339 MET C C   1 
ATOM 9190  O O   . MET C 1 370 ? -52.021  57.005  -58.310  1.00 211.58 ? 339 MET C O   1 
ATOM 9191  C CB  . MET C 1 370 ? -54.673  58.117  -57.661  1.00 211.19 ? 339 MET C CB  1 
ATOM 9192  C CG  . MET C 1 370 ? -55.970  58.571  -56.979  1.00 210.90 ? 339 MET C CG  1 
ATOM 9193  S SD  . MET C 1 370 ? -57.418  58.638  -58.061  1.00 211.21 ? 339 MET C SD  1 
ATOM 9194  C CE  . MET C 1 370 ? -56.992  59.993  -59.163  1.00 212.44 ? 339 MET C CE  1 
ATOM 9195  N N   . GLU C 1 371 ? -51.990  56.378  -56.139  1.00 210.74 ? 340 GLU C N   1 
ATOM 9196  C CA  . GLU C 1 371 ? -51.035  55.294  -56.344  1.00 210.78 ? 340 GLU C CA  1 
ATOM 9197  C C   . GLU C 1 371 ? -51.610  54.289  -57.332  1.00 210.57 ? 340 GLU C C   1 
ATOM 9198  O O   . GLU C 1 371 ? -52.791  53.933  -57.269  1.00 210.04 ? 340 GLU C O   1 
ATOM 9199  C CB  . GLU C 1 371 ? -50.657  54.612  -55.024  1.00 210.56 ? 340 GLU C CB  1 
ATOM 9200  C CG  . GLU C 1 371 ? -49.977  55.523  -54.006  1.00 210.66 ? 340 GLU C CG  1 
ATOM 9201  C CD  . GLU C 1 371 ? -50.971  56.359  -53.216  1.00 210.20 ? 340 GLU C CD  1 
ATOM 9202  O OE1 . GLU C 1 371 ? -51.824  55.771  -52.513  1.00 209.82 ? 340 GLU C OE1 1 
ATOM 9203  O OE2 . GLU C 1 371 ? -50.901  57.603  -53.298  1.00 210.17 ? 340 GLU C OE2 1 
ATOM 9204  N N   . ILE C 1 372 ? -50.763  53.853  -58.254  1.00 211.09 ? 341 ILE C N   1 
ATOM 9205  C CA  . ILE C 1 372 ? -51.180  53.010  -59.365  1.00 211.28 ? 341 ILE C CA  1 
ATOM 9206  C C   . ILE C 1 372 ? -50.790  51.546  -59.103  1.00 211.27 ? 341 ILE C C   1 
ATOM 9207  O O   . ILE C 1 372 ? -49.619  51.248  -58.867  1.00 211.82 ? 341 ILE C O   1 
ATOM 9208  C CB  . ILE C 1 372 ? -50.570  53.537  -60.692  1.00 212.06 ? 341 ILE C CB  1 
ATOM 9209  C CG1 . ILE C 1 372 ? -50.715  55.065  -60.773  1.00 212.18 ? 341 ILE C CG1 1 
ATOM 9210  C CG2 . ILE C 1 372 ? -51.214  52.847  -61.899  1.00 212.56 ? 341 ILE C CG2 1 
ATOM 9211  C CD1 . ILE C 1 372 ? -49.700  55.752  -61.667  1.00 213.10 ? 341 ILE C CD1 1 
ATOM 9212  N N   . ILE C 1 373 ? -51.770  50.640  -59.142  1.00 210.80 ? 342 ILE C N   1 
ATOM 9213  C CA  . ILE C 1 373 ? -51.551  49.240  -58.737  1.00 210.83 ? 342 ILE C CA  1 
ATOM 9214  C C   . ILE C 1 373 ? -50.811  48.408  -59.788  1.00 211.41 ? 342 ILE C C   1 
ATOM 9215  O O   . ILE C 1 373 ? -51.030  48.575  -60.993  1.00 211.58 ? 342 ILE C O   1 
ATOM 9216  C CB  . ILE C 1 373 ? -52.882  48.509  -58.374  1.00 210.36 ? 342 ILE C CB  1 
ATOM 9217  C CG1 . ILE C 1 373 ? -53.901  49.470  -57.744  1.00 209.93 ? 342 ILE C CG1 1 
ATOM 9218  C CG2 . ILE C 1 373 ? -52.613  47.296  -57.464  1.00 210.36 ? 342 ILE C CG2 1 
ATOM 9219  C CD1 . ILE C 1 373 ? -55.338  48.940  -57.738  1.00 209.76 ? 342 ILE C CD1 1 
ATOM 9220  N N   . VAL C 1 374 ? -49.946  47.512  -59.305  1.00 211.69 ? 343 VAL C N   1 
ATOM 9221  C CA  . VAL C 1 374 ? -49.230  46.529  -60.130  1.00 212.44 ? 343 VAL C CA  1 
ATOM 9222  C C   . VAL C 1 374 ? -50.192  45.779  -61.085  1.00 212.56 ? 343 VAL C C   1 
ATOM 9223  O O   . VAL C 1 374 ? -50.282  46.125  -62.267  1.00 212.93 ? 343 VAL C O   1 
ATOM 9224  C CB  . VAL C 1 374 ? -48.396  45.534  -59.241  1.00 212.83 ? 343 VAL C CB  1 
ATOM 9225  C CG1 . VAL C 1 374 ? -47.474  44.670  -60.091  1.00 213.64 ? 343 VAL C CG1 1 
ATOM 9226  C CG2 . VAL C 1 374 ? -47.589  46.285  -58.181  1.00 212.45 ? 343 VAL C CG2 1 
ATOM 9227  N N   . ASN C 1 375 ? -50.910  44.779  -60.559  1.00 212.32 ? 344 ASN C N   1 
ATOM 9228  C CA  . ASN C 1 375 ? -51.918  43.988  -61.303  1.00 212.25 ? 344 ASN C CA  1 
ATOM 9229  C C   . ASN C 1 375 ? -51.382  43.086  -62.429  1.00 213.19 ? 344 ASN C C   1 
ATOM 9230  O O   . ASN C 1 375 ? -51.688  43.298  -63.609  1.00 213.49 ? 344 ASN C O   1 
ATOM 9231  C CB  . ASN C 1 375 ? -53.073  44.871  -61.813  1.00 211.71 ? 344 ASN C CB  1 
ATOM 9232  C CG  . ASN C 1 375 ? -54.167  45.063  -60.783  1.00 210.77 ? 344 ASN C CG  1 
ATOM 9233  O OD1 . ASN C 1 375 ? -54.850  44.113  -60.403  1.00 210.74 ? 344 ASN C OD1 1 
ATOM 9234  N ND2 . ASN C 1 375 ? -54.355  46.302  -60.344  1.00 209.99 ? 344 ASN C ND2 1 
ATOM 9235  N N   . ALA C 1 376 ? -50.588  42.084  -62.051  1.00 213.66 ? 345 ALA C N   1 
ATOM 9236  C CA  . ALA C 1 376 ? -50.115  41.076  -62.997  1.00 214.64 ? 345 ALA C CA  1 
ATOM 9237  C C   . ALA C 1 376 ? -51.071  39.879  -63.017  1.00 214.68 ? 345 ALA C C   1 
ATOM 9238  O O   . ALA C 1 376 ? -51.290  39.227  -61.989  1.00 214.49 ? 345 ALA C O   1 
ATOM 9239  C CB  . ALA C 1 376 ? -48.693  40.640  -62.657  1.00 215.47 ? 345 ALA C CB  1 
ATOM 9240  N N   . LYS C 1 377 ? -51.657  39.617  -64.185  1.00 214.91 ? 346 LYS C N   1 
ATOM 9241  C CA  . LYS C 1 377 ? -52.649  38.554  -64.355  1.00 214.94 ? 346 LYS C CA  1 
ATOM 9242  C C   . LYS C 1 377 ? -52.564  38.002  -65.774  1.00 216.11 ? 346 LYS C C   1 
ATOM 9243  O O   . LYS C 1 377 ? -52.359  38.752  -66.729  1.00 216.25 ? 346 LYS C O   1 
ATOM 9244  C CB  . LYS C 1 377 ? -54.065  39.090  -64.119  1.00 213.89 ? 346 LYS C CB  1 
ATOM 9245  C CG  . LYS C 1 377 ? -54.259  39.988  -62.893  1.00 212.31 ? 346 LYS C CG  1 
ATOM 9246  C CD  . LYS C 1 377 ? -55.308  41.068  -63.180  1.00 210.98 ? 346 LYS C CD  1 
ATOM 9247  C CE  . LYS C 1 377 ? -55.790  41.757  -61.920  1.00 209.38 ? 346 LYS C CE  1 
ATOM 9248  N NZ  . LYS C 1 377 ? -56.500  40.813  -60.996  1.00 209.38 ? 346 LYS C NZ  1 
ATOM 9249  N N   . THR C 1 378 ? -52.724  36.690  -65.914  1.00 217.07 ? 347 THR C N   1 
ATOM 9250  C CA  . THR C 1 378 ? -52.736  36.065  -67.241  1.00 218.47 ? 347 THR C CA  1 
ATOM 9251  C C   . THR C 1 378 ? -53.958  35.169  -67.457  1.00 218.93 ? 347 THR C C   1 
ATOM 9252  O O   . THR C 1 378 ? -54.006  34.022  -66.992  1.00 219.52 ? 347 THR C O   1 
ATOM 9253  C CB  . THR C 1 378 ? -51.400  35.327  -67.587  1.00 219.75 ? 347 THR C CB  1 
ATOM 9254  O OG1 . THR C 1 378 ? -51.575  34.533  -68.768  1.00 220.85 ? 347 THR C OG1 1 
ATOM 9255  C CG2 . THR C 1 378 ? -50.923  34.435  -66.436  1.00 219.99 ? 347 THR C CG2 1 
ATOM 9256  N N   . LEU C 1 379 ? -54.951  35.718  -68.153  1.00 218.79 ? 348 LEU C N   1 
ATOM 9257  C CA  . LEU C 1 379 ? -56.132  34.966  -68.583  1.00 219.35 ? 348 LEU C CA  1 
ATOM 9258  C C   . LEU C 1 379 ? -56.452  35.352  -70.036  1.00 220.10 ? 348 LEU C C   1 
ATOM 9259  O O   . LEU C 1 379 ? -56.540  36.543  -70.347  1.00 219.62 ? 348 LEU C O   1 
ATOM 9260  C CB  . LEU C 1 379 ? -57.345  35.248  -67.671  1.00 218.22 ? 348 LEU C CB  1 
ATOM 9261  C CG  . LEU C 1 379 ? -57.354  34.956  -66.159  1.00 217.39 ? 348 LEU C CG  1 
ATOM 9262  C CD1 . LEU C 1 379 ? -58.649  35.480  -65.538  1.00 216.09 ? 348 LEU C CD1 1 
ATOM 9263  C CD2 . LEU C 1 379 ? -57.165  33.468  -65.828  1.00 218.30 ? 348 LEU C CD2 1 
ATOM 9264  N N   . ASP C 1 380 ? -56.624  34.373  -70.928  1.00 221.33 ? 349 ASP C N   1 
ATOM 9265  C CA  . ASP C 1 380 ? -56.592  32.946  -70.600  1.00 221.89 ? 349 ASP C CA  1 
ATOM 9266  C C   . ASP C 1 380 ? -55.354  32.285  -71.198  1.00 222.94 ? 349 ASP C C   1 
ATOM 9267  O O   . ASP C 1 380 ? -54.321  32.187  -70.534  1.00 222.76 ? 349 ASP C O   1 
ATOM 9268  C CB  . ASP C 1 380 ? -57.874  32.265  -71.090  1.00 222.67 ? 349 ASP C CB  1 
ATOM 9269  C CG  . ASP C 1 380 ? -59.124  33.056  -70.735  1.00 221.80 ? 349 ASP C CG  1 
ATOM 9270  O OD1 . ASP C 1 380 ? -59.388  33.250  -69.526  1.00 220.90 ? 349 ASP C OD1 1 
ATOM 9271  O OD2 . ASP C 1 380 ? -59.837  33.492  -71.667  1.00 222.36 ? 349 ASP C OD2 1 
ATOM 9272  N N   . GLY C 1 381 ? -55.449  31.855  -72.454  1.00 224.05 ? 350 GLY C N   1 
ATOM 9273  C CA  . GLY C 1 381 ? -54.313  31.255  -73.143  1.00 225.10 ? 350 GLY C CA  1 
ATOM 9274  C C   . GLY C 1 381 ? -53.333  32.293  -73.661  1.00 224.68 ? 350 GLY C C   1 
ATOM 9275  O O   . GLY C 1 381 ? -52.702  32.084  -74.698  1.00 226.13 ? 350 GLY C O   1 
ATOM 9276  N N   . GLY C 1 382 ? -53.200  33.406  -72.936  1.00 222.82 ? 351 GLY C N   1 
ATOM 9277  C CA  . GLY C 1 382 ? -52.347  34.525  -73.352  1.00 222.13 ? 351 GLY C CA  1 
ATOM 9278  C C   . GLY C 1 382 ? -51.431  35.046  -72.261  1.00 220.75 ? 351 GLY C C   1 
ATOM 9279  O O   . GLY C 1 382 ? -51.747  34.936  -71.075  1.00 219.63 ? 351 GLY C O   1 
ATOM 9280  N N   . LEU C 1 383 ? -50.310  35.637  -72.677  1.00 220.80 ? 352 LEU C N   1 
ATOM 9281  C CA  . LEU C 1 383 ? -49.237  36.059  -71.764  1.00 219.95 ? 352 LEU C CA  1 
ATOM 9282  C C   . LEU C 1 383 ? -49.665  37.067  -70.678  1.00 218.17 ? 352 LEU C C   1 
ATOM 9283  O O   . LEU C 1 383 ? -50.689  37.750  -70.813  1.00 217.37 ? 352 LEU C O   1 
ATOM 9284  C CB  . LEU C 1 383 ? -48.019  36.582  -72.553  1.00 220.64 ? 352 LEU C CB  1 
ATOM 9285  C CG  . LEU C 1 383 ? -47.139  35.609  -73.358  1.00 222.06 ? 352 LEU C CG  1 
ATOM 9286  C CD1 . LEU C 1 383 ? -46.100  36.383  -74.156  1.00 222.17 ? 352 LEU C CD1 1 
ATOM 9287  C CD2 . LEU C 1 383 ? -46.456  34.549  -72.487  1.00 222.10 ? 352 LEU C CD2 1 
ATOM 9288  N N   . ASN C 1 384 ? -48.865  37.135  -69.608  1.00 217.55 ? 353 ASN C N   1 
ATOM 9289  C CA  . ASN C 1 384 ? -49.129  37.989  -68.440  1.00 215.82 ? 353 ASN C CA  1 
ATOM 9290  C C   . ASN C 1 384 ? -49.104  39.484  -68.750  1.00 214.98 ? 353 ASN C C   1 
ATOM 9291  O O   . ASN C 1 384 ? -48.064  40.148  -68.677  1.00 215.01 ? 353 ASN C O   1 
ATOM 9292  C CB  . ASN C 1 384 ? -48.184  37.651  -67.276  1.00 215.68 ? 353 ASN C CB  1 
ATOM 9293  N N   . VAL C 1 385 ? -50.277  39.993  -69.109  1.00 214.19 ? 354 VAL C N   1 
ATOM 9294  C CA  . VAL C 1 385 ? -50.500  41.416  -69.301  1.00 213.36 ? 354 VAL C CA  1 
ATOM 9295  C C   . VAL C 1 385 ? -50.435  42.110  -67.944  1.00 212.01 ? 354 VAL C C   1 
ATOM 9296  O O   . VAL C 1 385 ? -50.734  41.495  -66.916  1.00 211.63 ? 354 VAL C O   1 
ATOM 9297  C CB  . VAL C 1 385 ? -51.894  41.655  -69.912  1.00 213.27 ? 354 VAL C CB  1 
ATOM 9298  C CG1 . VAL C 1 385 ? -52.122  43.137  -70.210  1.00 212.84 ? 354 VAL C CG1 1 
ATOM 9299  C CG2 . VAL C 1 385 ? -52.077  40.807  -71.170  1.00 214.59 ? 354 VAL C CG2 1 
ATOM 9300  N N   . ILE C 1 386 ? -50.042  43.382  -67.937  1.00 211.33 ? 355 ILE C N   1 
ATOM 9301  C CA  . ILE C 1 386 ? -50.041  44.174  -66.704  1.00 209.96 ? 355 ILE C CA  1 
ATOM 9302  C C   . ILE C 1 386 ? -51.038  45.349  -66.799  1.00 208.92 ? 355 ILE C C   1 
ATOM 9303  O O   . ILE C 1 386 ? -50.753  46.378  -67.419  1.00 209.15 ? 355 ILE C O   1 
ATOM 9304  C CB  . ILE C 1 386 ? -48.592  44.619  -66.294  1.00 210.29 ? 355 ILE C CB  1 
ATOM 9305  C CG1 . ILE C 1 386 ? -47.696  43.387  -66.042  1.00 210.89 ? 355 ILE C CG1 1 
ATOM 9306  C CG2 . ILE C 1 386 ? -48.627  45.535  -65.066  1.00 209.53 ? 355 ILE C CG2 1 
ATOM 9307  C CD1 . ILE C 1 386 ? -46.226  43.685  -65.702  1.00 210.78 ? 355 ILE C CD1 1 
ATOM 9308  N N   . GLN C 1 387 ? -52.210  45.168  -66.190  1.00 207.73 ? 356 GLN C N   1 
ATOM 9309  C CA  . GLN C 1 387 ? -53.280  46.171  -66.216  1.00 206.80 ? 356 GLN C CA  1 
ATOM 9310  C C   . GLN C 1 387 ? -53.043  47.271  -65.178  1.00 205.77 ? 356 GLN C C   1 
ATOM 9311  O O   . GLN C 1 387 ? -52.679  46.982  -64.036  1.00 205.33 ? 356 GLN C O   1 
ATOM 9312  C CB  . GLN C 1 387 ? -54.643  45.505  -65.987  1.00 206.43 ? 356 GLN C CB  1 
ATOM 9313  N N   . LEU C 1 388 ? -53.249  48.527  -65.578  1.00 205.41 ? 357 LEU C N   1 
ATOM 9314  C CA  . LEU C 1 388 ? -52.996  49.677  -64.695  1.00 204.47 ? 357 LEU C CA  1 
ATOM 9315  C C   . LEU C 1 388 ? -54.290  50.313  -64.188  1.00 203.43 ? 357 LEU C C   1 
ATOM 9316  O O   . LEU C 1 388 ? -55.212  50.584  -64.962  1.00 203.59 ? 357 LEU C O   1 
ATOM 9317  C CB  . LEU C 1 388 ? -52.121  50.741  -65.383  1.00 205.18 ? 357 LEU C CB  1 
ATOM 9318  C CG  . LEU C 1 388 ? -50.868  50.392  -66.212  1.00 206.21 ? 357 LEU C CG  1 
ATOM 9319  C CD1 . LEU C 1 388 ? -50.143  51.670  -66.639  1.00 206.64 ? 357 LEU C CD1 1 
ATOM 9320  C CD2 . LEU C 1 388 ? -49.900  49.446  -65.495  1.00 206.18 ? 357 LEU C CD2 1 
ATOM 9321  N N   . GLU C 1 389 ? -54.339  50.552  -62.881  1.00 202.26 ? 358 GLU C N   1 
ATOM 9322  C CA  . GLU C 1 389 ? -55.534  51.070  -62.228  1.00 201.29 ? 358 GLU C CA  1 
ATOM 9323  C C   . GLU C 1 389 ? -55.171  51.829  -60.958  1.00 200.56 ? 358 GLU C C   1 
ATOM 9324  O O   . GLU C 1 389 ? -54.132  51.569  -60.347  1.00 200.49 ? 358 GLU C O   1 
ATOM 9325  C CB  . GLU C 1 389 ? -56.489  49.921  -61.891  1.00 200.93 ? 358 GLU C CB  1 
ATOM 9326  N N   . THR C 1 390 ? -56.032  52.764  -60.566  1.00 199.96 ? 359 THR C N   1 
ATOM 9327  C CA  . THR C 1 390 ? -55.837  53.522  -59.330  1.00 199.30 ? 359 THR C CA  1 
ATOM 9328  C C   . THR C 1 390 ? -56.966  53.260  -58.326  1.00 198.47 ? 359 THR C C   1 
ATOM 9329  O O   . THR C 1 390 ? -57.916  52.526  -58.623  1.00 198.16 ? 359 THR C O   1 
ATOM 9330  C CB  . THR C 1 390 ? -55.703  55.039  -59.595  1.00 199.68 ? 359 THR C CB  1 
ATOM 9331  O OG1 . THR C 1 390 ? -56.879  55.517  -60.256  1.00 199.94 ? 359 THR C OG1 1 
ATOM 9332  C CG2 . THR C 1 390 ? -54.481  55.341  -60.457  1.00 200.18 ? 359 THR C CG2 1 
ATOM 9333  N N   . ALA C 1 391 ? -56.843  53.854  -57.140  1.00 198.06 ? 360 ALA C N   1 
ATOM 9334  C CA  . ALA C 1 391 ? -57.824  53.694  -56.070  1.00 197.38 ? 360 ALA C CA  1 
ATOM 9335  C C   . ALA C 1 391 ? -58.583  54.993  -55.826  1.00 197.42 ? 360 ALA C C   1 
ATOM 9336  O O   . ALA C 1 391 ? -58.203  56.045  -56.338  1.00 198.03 ? 360 ALA C O   1 
ATOM 9337  C CB  . ALA C 1 391 ? -57.141  53.228  -54.794  1.00 197.09 ? 360 ALA C CB  1 
ATOM 9338  N N   . VAL C 1 392 ? -59.661  54.910  -55.050  1.00 196.99 ? 361 VAL C N   1 
ATOM 9339  C CA  . VAL C 1 392 ? -60.484  56.076  -54.714  1.00 197.13 ? 361 VAL C CA  1 
ATOM 9340  C C   . VAL C 1 392 ? -60.051  56.694  -53.384  1.00 197.05 ? 361 VAL C C   1 
ATOM 9341  O O   . VAL C 1 392 ? -59.945  57.917  -53.257  1.00 197.50 ? 361 VAL C O   1 
ATOM 9342  C CB  . VAL C 1 392 ? -61.975  55.703  -54.629  1.00 196.83 ? 361 VAL C CB  1 
ATOM 9343  C CG1 . VAL C 1 392 ? -62.829  56.941  -54.366  1.00 197.07 ? 361 VAL C CG1 1 
ATOM 9344  C CG2 . VAL C 1 392 ? -62.419  55.010  -55.905  1.00 197.28 ? 361 VAL C CG2 1 
ATOM 9345  N N   . GLY C 1 393 ? -59.816  55.832  -52.398  1.00 196.66 ? 362 GLY C N   1 
ATOM 9346  C CA  . GLY C 1 393 ? -59.295  56.238  -51.098  1.00 196.59 ? 362 GLY C CA  1 
ATOM 9347  C C   . GLY C 1 393 ? -57.847  56.675  -51.185  1.00 197.15 ? 362 GLY C C   1 
ATOM 9348  O O   . GLY C 1 393 ? -57.387  57.453  -50.352  1.00 197.45 ? 362 GLY C O   1 
ATOM 9349  N N   . ALA C 1 394 ? -57.131  56.181  -52.198  1.00 197.43 ? 363 ALA C N   1 
ATOM 9350  C CA  . ALA C 1 394 ? -55.759  56.623  -52.479  1.00 198.11 ? 363 ALA C CA  1 
ATOM 9351  C C   . ALA C 1 394 ? -55.686  58.149  -52.603  1.00 198.66 ? 363 ALA C C   1 
ATOM 9352  O O   . ALA C 1 394 ? -54.614  58.746  -52.457  1.00 199.39 ? 363 ALA C O   1 
ATOM 9353  C CB  . ALA C 1 394 ? -55.215  55.947  -53.739  1.00 198.20 ? 363 ALA C CB  1 
ATOM 9354  N N   . ALA C 1 395 ? -56.839  58.767  -52.859  1.00 198.45 ? 364 ALA C N   1 
ATOM 9355  C CA  . ALA C 1 395 ? -56.956  60.212  -52.897  1.00 198.95 ? 364 ALA C CA  1 
ATOM 9356  C C   . ALA C 1 395 ? -57.509  60.792  -51.579  1.00 198.92 ? 364 ALA C C   1 
ATOM 9357  O O   . ALA C 1 395 ? -58.685  61.157  -51.490  1.00 198.80 ? 364 ALA C O   1 
ATOM 9358  C CB  . ALA C 1 395 ? -57.801  60.638  -54.094  1.00 199.09 ? 364 ALA C CB  1 
ATOM 9359  N N   . ILE C 1 396 ? -56.657  60.835  -50.553  1.00 199.17 ? 365 ILE C N   1 
ATOM 9360  C CA  . ILE C 1 396 ? -56.878  61.682  -49.366  1.00 199.52 ? 365 ILE C CA  1 
ATOM 9361  C C   . ILE C 1 396 ? -55.717  62.671  -49.244  1.00 200.49 ? 365 ILE C C   1 
ATOM 9362  O O   . ILE C 1 396 ? -55.891  63.805  -48.779  1.00 201.08 ? 365 ILE C O   1 
ATOM 9363  C CB  . ILE C 1 396 ? -56.923  60.906  -48.025  1.00 199.11 ? 365 ILE C CB  1 
ATOM 9364  C CG1 . ILE C 1 396 ? -57.257  59.432  -48.221  1.00 198.22 ? 365 ILE C CG1 1 
ATOM 9365  C CG2 . ILE C 1 396 ? -57.878  61.599  -47.038  1.00 199.16 ? 365 ILE C CG2 1 
ATOM 9366  C CD1 . ILE C 1 396 ? -56.584  58.546  -47.198  1.00 198.17 ? 365 ILE C CD1 1 
ATOM 9367  N N   . LYS C 1 397 ? -54.530  62.211  -49.645  1.00 200.63 ? 366 LYS C N   1 
ATOM 9368  C CA  . LYS C 1 397 ? -53.314  63.014  -49.628  1.00 201.42 ? 366 LYS C CA  1 
ATOM 9369  C C   . LYS C 1 397 ? -53.504  64.316  -50.406  1.00 202.03 ? 366 LYS C C   1 
ATOM 9370  O O   . LYS C 1 397 ? -52.962  65.354  -50.026  1.00 202.93 ? 366 LYS C O   1 
ATOM 9371  C CB  . LYS C 1 397 ? -52.138  62.206  -50.186  1.00 201.45 ? 366 LYS C CB  1 
ATOM 9372  N N   . SER C 1 398 ? -54.298  64.251  -51.476  1.00 201.68 ? 367 SER C N   1 
ATOM 9373  C CA  . SER C 1 398 ? -54.605  65.419  -52.310  1.00 202.41 ? 367 SER C CA  1 
ATOM 9374  C C   . SER C 1 398 ? -55.697  66.328  -51.724  1.00 202.61 ? 367 SER C C   1 
ATOM 9375  O O   . SER C 1 398 ? -55.947  67.426  -52.239  1.00 203.49 ? 367 SER C O   1 
ATOM 9376  C CB  . SER C 1 398 ? -54.972  64.988  -53.737  1.00 202.23 ? 367 SER C CB  1 
ATOM 9377  O OG  . SER C 1 398 ? -56.069  64.091  -53.746  1.00 201.50 ? 367 SER C OG  1 
ATOM 9378  N N   . PHE C 1 399 ? -56.342  65.868  -50.654  1.00 201.81 ? 368 PHE C N   1 
ATOM 9379  C CA  . PHE C 1 399 ? -57.338  66.675  -49.953  1.00 201.86 ? 368 PHE C CA  1 
ATOM 9380  C C   . PHE C 1 399 ? -56.760  67.305  -48.694  1.00 202.12 ? 368 PHE C C   1 
ATOM 9381  O O   . PHE C 1 399 ? -55.926  66.712  -47.999  1.00 201.86 ? 368 PHE C O   1 
ATOM 9382  C CB  . PHE C 1 399 ? -58.578  65.847  -49.597  1.00 201.07 ? 368 PHE C CB  1 
ATOM 9383  C CG  . PHE C 1 399 ? -59.558  65.684  -50.732  1.00 201.20 ? 368 PHE C CG  1 
ATOM 9384  C CD1 . PHE C 1 399 ? -60.550  66.638  -50.957  1.00 202.14 ? 368 PHE C CD1 1 
ATOM 9385  C CD2 . PHE C 1 399 ? -59.503  64.565  -51.563  1.00 200.81 ? 368 PHE C CD2 1 
ATOM 9386  C CE1 . PHE C 1 399 ? -61.468  66.487  -52.003  1.00 202.42 ? 368 PHE C CE1 1 
ATOM 9387  C CE2 . PHE C 1 399 ? -60.415  64.404  -52.613  1.00 200.99 ? 368 PHE C CE2 1 
ATOM 9388  C CZ  . PHE C 1 399 ? -61.399  65.368  -52.832  1.00 201.81 ? 368 PHE C CZ  1 
ATOM 9389  N N   . GLU C 1 400 ? -57.207  68.523  -48.422  1.00 202.57 ? 369 GLU C N   1 
ATOM 9390  C CA  . GLU C 1 400 ? -56.898  69.206  -47.179  1.00 202.91 ? 369 GLU C CA  1 
ATOM 9391  C C   . GLU C 1 400 ? -58.110  69.107  -46.250  1.00 202.25 ? 369 GLU C C   1 
ATOM 9392  O O   . GLU C 1 400 ? -59.239  68.919  -46.713  1.00 201.56 ? 369 GLU C O   1 
ATOM 9393  C CB  . GLU C 1 400 ? -56.518  70.660  -47.450  1.00 204.30 ? 369 GLU C CB  1 
ATOM 9394  C CG  . GLU C 1 400 ? -57.357  71.309  -48.534  1.00 204.75 ? 369 GLU C CG  1 
ATOM 9395  C CD  . GLU C 1 400 ? -57.041  72.766  -48.724  1.00 206.47 ? 369 GLU C CD  1 
ATOM 9396  O OE1 . GLU C 1 400 ? -56.838  73.469  -47.712  1.00 207.30 ? 369 GLU C OE1 1 
ATOM 9397  O OE2 . GLU C 1 400 ? -57.006  73.212  -49.890  1.00 207.55 ? 369 GLU C OE2 1 
ATOM 9398  N N   . ASN C 1 401 ? -57.854  69.244  -44.948  1.00 202.26 ? 370 ASN C N   1 
ATOM 9399  C CA  . ASN C 1 401 ? -58.820  68.960  -43.867  1.00 201.47 ? 370 ASN C CA  1 
ATOM 9400  C C   . ASN C 1 401 ? -59.694  67.723  -44.114  1.00 199.79 ? 370 ASN C C   1 
ATOM 9401  O O   . ASN C 1 401 ? -60.738  67.796  -44.773  1.00 199.42 ? 370 ASN C O   1 
ATOM 9402  C CB  . ASN C 1 401 ? -59.661  70.198  -43.507  1.00 202.46 ? 370 ASN C CB  1 
ATOM 9403  C CG  . ASN C 1 401 ? -60.061  70.234  -42.028  1.00 202.57 ? 370 ASN C CG  1 
ATOM 9404  O OD1 . ASN C 1 401 ? -60.477  69.223  -41.453  1.00 201.37 ? 370 ASN C OD1 1 
ATOM 9405  N ND2 . ASN C 1 401 ? -59.939  71.408  -41.411  1.00 203.65 ? 370 ASN C ND2 1 
ATOM 9406  N N   . SER C 1 402 ? -59.234  66.592  -43.576  1.00 198.61 ? 371 SER C N   1 
ATOM 9407  C CA  . SER C 1 402 ? -59.847  65.285  -43.802  1.00 196.93 ? 371 SER C CA  1 
ATOM 9408  C C   . SER C 1 402 ? -59.976  64.518  -42.490  1.00 196.17 ? 371 SER C C   1 
ATOM 9409  O O   . SER C 1 402 ? -58.980  64.289  -41.796  1.00 196.56 ? 371 SER C O   1 
ATOM 9410  C CB  . SER C 1 402 ? -59.008  64.459  -44.787  1.00 196.51 ? 371 SER C CB  1 
ATOM 9411  O OG  . SER C 1 402 ? -58.619  65.213  -45.921  1.00 197.14 ? 371 SER C OG  1 
ATOM 9412  N N   . LEU C 1 403 ? -61.205  64.127  -42.156  1.00 195.00 ? 372 LEU C N   1 
ATOM 9413  C CA  . LEU C 1 403 ? -61.474  63.287  -40.985  1.00 193.97 ? 372 LEU C CA  1 
ATOM 9414  C C   . LEU C 1 403 ? -62.262  62.030  -41.373  1.00 192.46 ? 372 LEU C C   1 
ATOM 9415  O O   . LEU C 1 403 ? -63.266  62.109  -42.086  1.00 192.16 ? 372 LEU C O   1 
ATOM 9416  C CB  . LEU C 1 403 ? -62.184  64.085  -39.872  1.00 194.58 ? 372 LEU C CB  1 
ATOM 9417  C CG  . LEU C 1 403 ? -63.565  64.737  -40.059  1.00 194.55 ? 372 LEU C CG  1 
ATOM 9418  C CD1 . LEU C 1 403 ? -64.685  63.830  -39.563  1.00 193.45 ? 372 LEU C CD1 1 
ATOM 9419  C CD2 . LEU C 1 403 ? -63.631  66.071  -39.326  1.00 196.01 ? 372 LEU C CD2 1 
ATOM 9420  N N   . GLY C 1 404 ? -61.784  60.872  -40.916  1.00 191.41 ? 373 GLY C N   1 
ATOM 9421  C CA  . GLY C 1 404 ? -62.447  59.589  -41.172  1.00 189.50 ? 373 GLY C CA  1 
ATOM 9422  C C   . GLY C 1 404 ? -63.071  59.035  -39.907  1.00 188.65 ? 373 GLY C C   1 
ATOM 9423  O O   . GLY C 1 404 ? -62.573  59.284  -38.809  1.00 189.15 ? 373 GLY C O   1 
ATOM 9424  N N   . ILE C 1 405 ? -64.158  58.282  -40.051  1.00 195.99 ? 374 ILE C N   1 
ATOM 9425  C CA  . ILE C 1 405 ? -64.913  57.820  -38.879  1.00 195.39 ? 374 ILE C CA  1 
ATOM 9426  C C   . ILE C 1 405 ? -65.135  56.303  -38.776  1.00 193.60 ? 374 ILE C C   1 
ATOM 9427  O O   . ILE C 1 405 ? -65.273  55.606  -39.788  1.00 191.85 ? 374 ILE C O   1 
ATOM 9428  C CB  . ILE C 1 405 ? -66.249  58.609  -38.692  1.00 195.37 ? 374 ILE C CB  1 
ATOM 9429  C CG1 . ILE C 1 405 ? -67.075  58.634  -39.981  1.00 193.67 ? 374 ILE C CG1 1 
ATOM 9430  C CG2 . ILE C 1 405 ? -65.972  60.030  -38.204  1.00 197.15 ? 374 ILE C CG2 1 
ATOM 9431  C CD1 . ILE C 1 405 ? -68.181  57.600  -40.031  1.00 191.91 ? 374 ILE C CD1 1 
ATOM 9432  N N   . ASN C 1 406 ? -65.152  55.815  -37.531  1.00 193.80 ? 375 ASN C N   1 
ATOM 9433  C CA  . ASN C 1 406 ? -65.341  54.399  -37.198  1.00 192.10 ? 375 ASN C CA  1 
ATOM 9434  C C   . ASN C 1 406 ? -66.804  53.990  -37.328  1.00 190.52 ? 375 ASN C C   1 
ATOM 9435  O O   . ASN C 1 406 ? -67.700  54.619  -36.751  1.00 191.07 ? 375 ASN C O   1 
ATOM 9436  C CB  . ASN C 1 406 ? -64.820  54.101  -35.780  1.00 193.56 ? 375 ASN C CB  1 
ATOM 9437  C CG  . ASN C 1 406 ? -64.539  52.617  -35.543  1.00 192.21 ? 375 ASN C CG  1 
ATOM 9438  O OD1 . ASN C 1 406 ? -64.250  51.865  -36.469  1.00 190.38 ? 375 ASN C OD1 1 
ATOM 9439  N ND2 . ASN C 1 406 ? -64.608  52.201  -34.287  1.00 192.64 ? 375 ASN C ND2 1 
ATOM 9440  N N   . VAL C 1 407 ? -67.025  52.931  -38.102  1.00 188.43 ? 376 VAL C N   1 
ATOM 9441  C CA  . VAL C 1 407 ? -68.360  52.425  -38.425  1.00 186.66 ? 376 VAL C CA  1 
ATOM 9442  C C   . VAL C 1 407 ? -68.498  50.964  -37.983  1.00 185.52 ? 376 VAL C C   1 
ATOM 9443  O O   . VAL C 1 407 ? -67.594  50.153  -38.213  1.00 185.01 ? 376 VAL C O   1 
ATOM 9444  C CB  . VAL C 1 407 ? -68.634  52.502  -39.947  1.00 185.19 ? 376 VAL C CB  1 
ATOM 9445  C CG1 . VAL C 1 407 ? -70.126  52.398  -40.241  1.00 184.21 ? 376 VAL C CG1 1 
ATOM 9446  C CG2 . VAL C 1 407 ? -68.074  53.778  -40.521  1.00 186.10 ? 376 VAL C CG2 1 
ATOM 9447  N N   . PRO C 1 408 ? -69.627  50.620  -37.338  1.00 185.07 ? 377 PRO C N   1 
ATOM 9448  C CA  . PRO C 1 408 ? -69.881  49.206  -37.071  1.00 183.69 ? 377 PRO C CA  1 
ATOM 9449  C C   . PRO C 1 408 ? -70.189  48.456  -38.366  1.00 181.14 ? 377 PRO C C   1 
ATOM 9450  O O   . PRO C 1 408 ? -70.380  49.085  -39.407  1.00 180.54 ? 377 PRO C O   1 
ATOM 9451  C CB  . PRO C 1 408 ? -71.111  49.235  -36.150  1.00 184.51 ? 377 PRO C CB  1 
ATOM 9452  C CG  . PRO C 1 408 ? -71.131  50.623  -35.566  1.00 186.54 ? 377 PRO C CG  1 
ATOM 9453  C CD  . PRO C 1 408 ? -70.611  51.493  -36.670  1.00 186.25 ? 377 PRO C CD  1 
ATOM 9454  N N   . ARG C 1 409 ? -70.235  47.127  -38.299  1.00 179.51 ? 378 ARG C N   1 
ATOM 9455  C CA  . ARG C 1 409 ? -70.491  46.297  -39.483  1.00 177.02 ? 378 ARG C CA  1 
ATOM 9456  C C   . ARG C 1 409 ? -71.926  46.339  -40.026  1.00 175.75 ? 378 ARG C C   1 
ATOM 9457  O O   . ARG C 1 409 ? -72.155  45.945  -41.171  1.00 174.34 ? 378 ARG C O   1 
ATOM 9458  C CB  . ARG C 1 409 ? -70.052  44.855  -39.247  1.00 176.34 ? 378 ARG C CB  1 
ATOM 9459  C CG  . ARG C 1 409 ? -68.660  44.553  -39.757  1.00 175.86 ? 378 ARG C CG  1 
ATOM 9460  C CD  . ARG C 1 409 ? -68.357  43.071  -39.632  1.00 174.40 ? 378 ARG C CD  1 
ATOM 9461  N NE  . ARG C 1 409 ? -67.455  42.593  -40.678  1.00 172.93 ? 378 ARG C NE  1 
ATOM 9462  C CZ  . ARG C 1 409 ? -66.136  42.769  -40.678  1.00 173.08 ? 378 ARG C CZ  1 
ATOM 9463  N NH1 . ARG C 1 409 ? -65.545  43.431  -39.693  1.00 174.64 ? 378 ARG C NH1 1 
ATOM 9464  N NH2 . ARG C 1 409 ? -65.407  42.287  -41.670  1.00 171.86 ? 378 ARG C NH2 1 
ATOM 9465  N N   . SER C 1 410 ? -72.880  46.796  -39.209  1.00 175.98 ? 379 SER C N   1 
ATOM 9466  C CA  . SER C 1 410 ? -74.243  47.115  -39.675  1.00 174.96 ? 379 SER C CA  1 
ATOM 9467  C C   . SER C 1 410 ? -74.211  47.724  -41.078  1.00 173.76 ? 379 SER C C   1 
ATOM 9468  O O   . SER C 1 410 ? -74.999  47.366  -41.961  1.00 172.77 ? 379 SER C O   1 
ATOM 9469  C CB  . SER C 1 410 ? -74.917  48.123  -38.733  1.00 176.49 ? 379 SER C CB  1 
ATOM 9470  O OG  . SER C 1 410 ? -75.199  47.553  -37.473  1.00 177.23 ? 379 SER C OG  1 
ATOM 9471  N N   . ARG C 1 411 ? -73.265  48.638  -41.264  1.00 173.57 ? 380 ARG C N   1 
ATOM 9472  C CA  . ARG C 1 411 ? -73.162  49.441  -42.467  1.00 172.35 ? 380 ARG C CA  1 
ATOM 9473  C C   . ARG C 1 411 ? -71.998  48.954  -43.334  1.00 170.49 ? 380 ARG C C   1 
ATOM 9474  O O   . ARG C 1 411 ? -71.446  49.711  -44.144  1.00 170.61 ? 380 ARG C O   1 
ATOM 9475  C CB  . ARG C 1 411 ? -73.003  50.919  -42.079  1.00 174.16 ? 380 ARG C CB  1 
ATOM 9476  C CG  . ARG C 1 411 ? -74.128  51.482  -41.163  1.00 175.58 ? 380 ARG C CG  1 
ATOM 9477  C CD  . ARG C 1 411 ? -75.045  52.486  -41.882  1.00 176.41 ? 380 ARG C CD  1 
ATOM 9478  N NE  . ARG C 1 411 ? -74.342  53.218  -42.943  1.00 176.67 ? 380 ARG C NE  1 
ATOM 9479  C CZ  . ARG C 1 411 ? -73.436  54.177  -42.750  1.00 177.41 ? 380 ARG C CZ  1 
ATOM 9480  N NH1 . ARG C 1 411 ? -73.099  54.557  -41.526  1.00 178.88 ? 380 ARG C NH1 1 
ATOM 9481  N NH2 . ARG C 1 411 ? -72.857  54.757  -43.789  1.00 177.15 ? 380 ARG C NH2 1 
ATOM 9482  N N   . PHE C 1 412 ? -71.631  47.686  -43.145  1.00 168.20 ? 381 PHE C N   1 
ATOM 9483  C CA  . PHE C 1 412 ? -70.700  47.012  -44.043  1.00 166.18 ? 381 PHE C CA  1 
ATOM 9484  C C   . PHE C 1 412 ? -70.949  45.513  -44.144  1.00 163.82 ? 381 PHE C C   1 
ATOM 9485  O O   . PHE C 1 412 ? -70.483  44.741  -43.305  1.00 164.03 ? 381 PHE C O   1 
ATOM 9486  C CB  . PHE C 1 412 ? -69.250  47.263  -43.637  1.00 167.29 ? 381 PHE C CB  1 
ATOM 9487  C CG  . PHE C 1 412 ? -68.242  46.703  -44.612  1.00 167.32 ? 381 PHE C CG  1 
ATOM 9488  C CD1 . PHE C 1 412 ? -67.990  47.348  -45.824  1.00 168.20 ? 381 PHE C CD1 1 
ATOM 9489  C CD2 . PHE C 1 412 ? -67.542  45.534  -44.319  1.00 167.46 ? 381 PHE C CD2 1 
ATOM 9490  C CE1 . PHE C 1 412 ? -67.053  46.837  -46.733  1.00 168.17 ? 381 PHE C CE1 1 
ATOM 9491  C CE2 . PHE C 1 412 ? -66.605  45.013  -45.218  1.00 167.33 ? 381 PHE C CE2 1 
ATOM 9492  C CZ  . PHE C 1 412 ? -66.359  45.667  -46.428  1.00 167.67 ? 381 PHE C CZ  1 
ATOM 9493  N N   . LEU C 1 413 ? -71.683  45.114  -45.179  1.00 161.23 ? 382 LEU C N   1 
ATOM 9494  C CA  . LEU C 1 413 ? -71.887  43.710  -45.512  1.00 158.31 ? 382 LEU C CA  1 
ATOM 9495  C C   . LEU C 1 413 ? -71.693  43.618  -47.010  1.00 156.30 ? 382 LEU C C   1 
ATOM 9496  O O   . LEU C 1 413 ? -72.623  43.885  -47.764  1.00 156.22 ? 382 LEU C O   1 
ATOM 9497  C CB  . LEU C 1 413 ? -73.301  43.229  -45.145  1.00 158.04 ? 382 LEU C CB  1 
ATOM 9498  C CG  . LEU C 1 413 ? -73.895  43.364  -43.732  1.00 159.20 ? 382 LEU C CG  1 
ATOM 9499  C CD1 . LEU C 1 413 ? -75.420  43.311  -43.810  1.00 159.25 ? 382 LEU C CD1 1 
ATOM 9500  C CD2 . LEU C 1 413 ? -73.354  42.324  -42.731  1.00 158.73 ? 382 LEU C CD2 1 
ATOM 9501  N N   . PRO C 1 414 ? -70.478  43.270  -47.452  1.00 154.73 ? 383 PRO C N   1 
ATOM 9502  C CA  . PRO C 1 414 ? -70.225  43.122  -48.875  1.00 153.17 ? 383 PRO C CA  1 
ATOM 9503  C C   . PRO C 1 414 ? -70.755  41.782  -49.345  1.00 150.85 ? 383 PRO C C   1 
ATOM 9504  O O   . PRO C 1 414 ? -70.772  40.828  -48.571  1.00 150.39 ? 383 PRO C O   1 
ATOM 9505  C CB  . PRO C 1 414 ? -68.707  43.116  -48.946  1.00 153.62 ? 383 PRO C CB  1 
ATOM 9506  C CG  . PRO C 1 414 ? -68.306  42.447  -47.685  1.00 154.27 ? 383 PRO C CG  1 
ATOM 9507  C CD  . PRO C 1 414 ? -69.305  42.895  -46.647  1.00 155.09 ? 383 PRO C CD  1 
ATOM 9508  N N   . VAL C 1 415 ? -71.194  41.706  -50.594  1.00 149.16 ? 384 VAL C N   1 
ATOM 9509  C CA  . VAL C 1 415 ? -71.645  40.436  -51.142  1.00 146.86 ? 384 VAL C CA  1 
ATOM 9510  C C   . VAL C 1 415 ? -70.714  40.016  -52.266  1.00 145.94 ? 384 VAL C C   1 
ATOM 9511  O O   . VAL C 1 415 ? -70.730  40.601  -53.346  1.00 146.32 ? 384 VAL C O   1 
ATOM 9512  C CB  . VAL C 1 415 ? -73.085  40.510  -51.654  1.00 146.67 ? 384 VAL C CB  1 
ATOM 9513  C CG1 . VAL C 1 415 ? -73.667  39.105  -51.805  1.00 145.43 ? 384 VAL C CG1 1 
ATOM 9514  C CG2 . VAL C 1 415 ? -73.927  41.333  -50.708  1.00 147.14 ? 384 VAL C CG2 1 
ATOM 9515  N N   . LYS C 1 416 ? -69.898  39.003  -52.003  1.00 144.35 ? 385 LYS C N   1 
ATOM 9516  C CA  . LYS C 1 416 ? -68.897  38.584  -52.964  1.00 143.26 ? 385 LYS C CA  1 
ATOM 9517  C C   . LYS C 1 416 ? -69.235  37.245  -53.589  1.00 141.45 ? 385 LYS C C   1 
ATOM 9518  O O   . LYS C 1 416 ? -68.938  37.019  -54.756  1.00 141.28 ? 385 LYS C O   1 
ATOM 9519  C CB  . LYS C 1 416 ? -67.522  38.532  -52.302  1.00 143.93 ? 385 LYS C CB  1 
ATOM 9520  N N   . THR C 1 417 ? -69.865  36.365  -52.815  1.00 139.76 ? 386 THR C N   1 
ATOM 9521  C CA  . THR C 1 417 ? -70.085  34.980  -53.230  1.00 138.06 ? 386 THR C CA  1 
ATOM 9522  C C   . THR C 1 417 ? -71.411  34.433  -52.734  1.00 136.56 ? 386 THR C C   1 
ATOM 9523  O O   . THR C 1 417 ? -71.953  34.928  -51.750  1.00 136.57 ? 386 THR C O   1 
ATOM 9524  C CB  . THR C 1 417 ? -69.014  34.083  -52.641  1.00 138.05 ? 386 THR C CB  1 
ATOM 9525  O OG1 . THR C 1 417 ? -68.927  34.336  -51.231  1.00 139.07 ? 386 THR C OG1 1 
ATOM 9526  C CG2 . THR C 1 417 ? -67.664  34.350  -53.298  1.00 139.00 ? 386 THR C CG2 1 
ATOM 9527  N N   . THR C 1 418 ? -71.907  33.381  -53.387  1.00 134.97 ? 387 THR C N   1 
ATOM 9528  C CA  . THR C 1 418 ? -73.197  32.803  -53.013  1.00 133.79 ? 387 THR C CA  1 
ATOM 9529  C C   . THR C 1 418 ? -73.283  32.521  -51.530  1.00 133.14 ? 387 THR C C   1 
ATOM 9530  O O   . THR C 1 418 ? -74.368  32.509  -50.974  1.00 133.18 ? 387 THR C O   1 
ATOM 9531  C CB  . THR C 1 418 ? -73.573  31.523  -53.809  1.00 132.95 ? 387 THR C CB  1 
ATOM 9532  O OG1 . THR C 1 418 ? -72.577  30.519  -53.641  1.00 132.36 ? 387 THR C OG1 1 
ATOM 9533  C CG2 . THR C 1 418 ? -73.711  31.824  -55.276  1.00 133.49 ? 387 THR C CG2 1 
ATOM 9534  N N   . SER C 1 419 ? -72.139  32.322  -50.892  1.00 132.77 ? 388 SER C N   1 
ATOM 9535  C CA  . SER C 1 419 ? -72.108  32.117  -49.458  1.00 132.71 ? 388 SER C CA  1 
ATOM 9536  C C   . SER C 1 419 ? -72.477  33.354  -48.669  1.00 133.80 ? 388 SER C C   1 
ATOM 9537  O O   . SER C 1 419 ? -72.905  33.260  -47.536  1.00 133.94 ? 388 SER C O   1 
ATOM 9538  C CB  . SER C 1 419 ? -70.760  31.589  -49.018  1.00 132.66 ? 388 SER C CB  1 
ATOM 9539  O OG  . SER C 1 419 ? -70.777  30.183  -49.049  1.00 131.32 ? 388 SER C OG  1 
ATOM 9540  N N   . ASP C 1 420 ? -72.316  34.524  -49.261  1.00 134.85 ? 389 ASP C N   1 
ATOM 9541  C CA  . ASP C 1 420 ? -72.802  35.729  -48.607  1.00 136.22 ? 389 ASP C CA  1 
ATOM 9542  C C   . ASP C 1 420 ? -74.266  35.974  -48.933  1.00 135.95 ? 389 ASP C C   1 
ATOM 9543  O O   . ASP C 1 420 ? -74.990  36.557  -48.125  1.00 136.68 ? 389 ASP C O   1 
ATOM 9544  C CB  . ASP C 1 420 ? -71.953  36.946  -48.972  1.00 137.54 ? 389 ASP C CB  1 
ATOM 9545  C CG  . ASP C 1 420 ? -70.792  37.162  -48.004  1.00 139.43 ? 389 ASP C CG  1 
ATOM 9546  O OD1 . ASP C 1 420 ? -70.970  36.949  -46.773  1.00 140.13 ? 389 ASP C OD1 1 
ATOM 9547  O OD2 . ASP C 1 420 ? -69.703  37.559  -48.486  1.00 141.57 ? 389 ASP C OD2 1 
ATOM 9548  N N   . LEU C 1 421 ? -74.689  35.533  -50.119  1.00 134.98 ? 390 LEU C N   1 
ATOM 9549  C CA  . LEU C 1 421 ? -76.089  35.610  -50.533  1.00 134.34 ? 390 LEU C CA  1 
ATOM 9550  C C   . LEU C 1 421 ? -76.963  34.879  -49.548  1.00 133.60 ? 390 LEU C C   1 
ATOM 9551  O O   . LEU C 1 421 ? -77.858  35.471  -48.943  1.00 134.45 ? 390 LEU C O   1 
ATOM 9552  C CB  . LEU C 1 421 ? -76.297  34.975  -51.901  1.00 133.68 ? 390 LEU C CB  1 
ATOM 9553  C CG  . LEU C 1 421 ? -76.041  35.814  -53.140  1.00 134.48 ? 390 LEU C CG  1 
ATOM 9554  C CD1 . LEU C 1 421 ? -76.640  35.080  -54.324  1.00 134.00 ? 390 LEU C CD1 1 
ATOM 9555  C CD2 . LEU C 1 421 ? -76.627  37.212  -53.007  1.00 135.69 ? 390 LEU C CD2 1 
ATOM 9556  N N   . LEU C 1 422 ? -76.691  33.584  -49.394  1.00 131.91 ? 391 LEU C N   1 
ATOM 9557  C CA  . LEU C 1 422 ? -77.467  32.729  -48.514  1.00 130.86 ? 391 LEU C CA  1 
ATOM 9558  C C   . LEU C 1 422 ? -77.667  33.416  -47.186  1.00 131.94 ? 391 LEU C C   1 
ATOM 9559  O O   . LEU C 1 422 ? -78.738  33.352  -46.611  1.00 132.39 ? 391 LEU C O   1 
ATOM 9560  C CB  . LEU C 1 422 ? -76.777  31.388  -48.315  1.00 129.36 ? 391 LEU C CB  1 
ATOM 9561  C CG  . LEU C 1 422 ? -77.496  30.480  -47.341  1.00 127.45 ? 391 LEU C CG  1 
ATOM 9562  C CD1 . LEU C 1 422 ? -78.588  29.799  -48.068  1.00 126.38 ? 391 LEU C CD1 1 
ATOM 9563  C CD2 . LEU C 1 422 ? -76.522  29.497  -46.835  1.00 125.92 ? 391 LEU C CD2 1 
ATOM 9564  N N   . LEU C 1 423 ? -76.623  34.091  -46.723  1.00 132.51 ? 392 LEU C N   1 
ATOM 9565  C CA  . LEU C 1 423 ? -76.654  34.838  -45.484  1.00 133.50 ? 392 LEU C CA  1 
ATOM 9566  C C   . LEU C 1 423 ? -77.721  35.908  -45.591  1.00 134.03 ? 392 LEU C C   1 
ATOM 9567  O O   . LEU C 1 423 ? -78.587  36.031  -44.721  1.00 134.55 ? 392 LEU C O   1 
ATOM 9568  C CB  . LEU C 1 423 ? -75.291  35.499  -45.291  1.00 134.18 ? 392 LEU C CB  1 
ATOM 9569  C CG  . LEU C 1 423 ? -74.655  35.579  -43.913  1.00 135.53 ? 392 LEU C CG  1 
ATOM 9570  C CD1 . LEU C 1 423 ? -74.575  34.187  -43.295  1.00 134.90 ? 392 LEU C CD1 1 
ATOM 9571  C CD2 . LEU C 1 423 ? -73.272  36.250  -44.032  1.00 136.77 ? 392 LEU C CD2 1 
ATOM 9572  N N   . VAL C 1 424 ? -77.663  36.646  -46.698  1.00 133.78 ? 393 VAL C N   1 
ATOM 9573  C CA  . VAL C 1 424 ? -78.386  37.899  -46.848  1.00 134.43 ? 393 VAL C CA  1 
ATOM 9574  C C   . VAL C 1 424 ? -79.824  37.733  -47.294  1.00 134.37 ? 393 VAL C C   1 
ATOM 9575  O O   . VAL C 1 424 ? -80.636  38.629  -47.103  1.00 135.50 ? 393 VAL C O   1 
ATOM 9576  C CB  . VAL C 1 424 ? -77.644  38.878  -47.780  1.00 134.61 ? 393 VAL C CB  1 
ATOM 9577  C CG1 . VAL C 1 424 ? -78.050  38.673  -49.238  1.00 133.67 ? 393 VAL C CG1 1 
ATOM 9578  C CG2 . VAL C 1 424 ? -77.900  40.307  -47.330  1.00 135.89 ? 393 VAL C CG2 1 
ATOM 9579  N N   . MET C 1 425 ? -80.155  36.602  -47.888  1.00 133.20 ? 394 MET C N   1 
ATOM 9580  C CA  . MET C 1 425 ? -81.529  36.412  -48.252  1.00 133.49 ? 394 MET C CA  1 
ATOM 9581  C C   . MET C 1 425 ? -82.198  35.436  -47.314  1.00 133.45 ? 394 MET C C   1 
ATOM 9582  O O   . MET C 1 425 ? -83.193  34.827  -47.655  1.00 133.56 ? 394 MET C O   1 
ATOM 9583  C CB  . MET C 1 425 ? -81.664  36.020  -49.719  1.00 132.98 ? 394 MET C CB  1 
ATOM 9584  C CG  . MET C 1 425 ? -81.264  34.613  -50.076  1.00 132.52 ? 394 MET C CG  1 
ATOM 9585  S SD  . MET C 1 425 ? -81.321  34.364  -51.869  1.00 134.25 ? 394 MET C SD  1 
ATOM 9586  C CE  . MET C 1 425 ? -79.944  35.398  -52.375  1.00 133.64 ? 394 MET C CE  1 
ATOM 9587  N N   . SER C 1 426 ? -81.648  35.304  -46.117  1.00 133.85 ? 395 SER C N   1 
ATOM 9588  C CA  . SER C 1 426 ? -82.207  34.409  -45.114  1.00 134.30 ? 395 SER C CA  1 
ATOM 9589  C C   . SER C 1 426 ? -83.056  35.239  -44.210  1.00 135.66 ? 395 SER C C   1 
ATOM 9590  O O   . SER C 1 426 ? -83.075  36.451  -44.341  1.00 136.69 ? 395 SER C O   1 
ATOM 9591  C CB  . SER C 1 426 ? -81.098  33.805  -44.266  1.00 134.19 ? 395 SER C CB  1 
ATOM 9592  O OG  . SER C 1 426 ? -81.613  32.962  -43.248  1.00 135.64 ? 395 SER C OG  1 
ATOM 9593  N N   . ASN C 1 427 ? -83.725  34.597  -43.261  1.00 136.10 ? 396 ASN C N   1 
ATOM 9594  C CA  . ASN C 1 427 ? -84.474  35.331  -42.259  1.00 137.77 ? 396 ASN C CA  1 
ATOM 9595  C C   . ASN C 1 427 ? -83.571  35.964  -41.223  1.00 138.95 ? 396 ASN C C   1 
ATOM 9596  O O   . ASN C 1 427 ? -84.034  36.344  -40.168  1.00 140.07 ? 396 ASN C O   1 
ATOM 9597  C CB  . ASN C 1 427 ? -85.472  34.422  -41.575  1.00 137.87 ? 396 ASN C CB  1 
ATOM 9598  C CG  . ASN C 1 427 ? -84.817  33.240  -40.952  1.00 136.45 ? 396 ASN C CG  1 
ATOM 9599  O OD1 . ASN C 1 427 ? -84.559  32.241  -41.611  1.00 134.37 ? 396 ASN C OD1 1 
ATOM 9600  N ND2 . ASN C 1 427 ? -84.527  33.344  -39.673  1.00 137.67 ? 396 ASN C ND2 1 
ATOM 9601  N N   . LEU C 1 428 ? -82.282  36.063  -41.529  1.00 139.41 ? 397 LEU C N   1 
ATOM 9602  C CA  . LEU C 1 428 ? -81.315  36.740  -40.662  1.00 141.47 ? 397 LEU C CA  1 
ATOM 9603  C C   . LEU C 1 428 ? -81.323  38.233  -40.888  1.00 143.74 ? 397 LEU C C   1 
ATOM 9604  O O   . LEU C 1 428 ? -80.718  38.995  -40.135  1.00 144.91 ? 397 LEU C O   1 
ATOM 9605  C CB  . LEU C 1 428 ? -79.903  36.214  -40.891  1.00 140.09 ? 397 LEU C CB  1 
ATOM 9606  C CG  . LEU C 1 428 ? -79.300  35.369  -39.775  1.00 139.24 ? 397 LEU C CG  1 
ATOM 9607  C CD1 . LEU C 1 428 ? -78.103  34.634  -40.324  1.00 137.48 ? 397 LEU C CD1 1 
ATOM 9608  C CD2 . LEU C 1 428 ? -78.910  36.229  -38.587  1.00 139.25 ? 397 LEU C CD2 1 
ATOM 9609  N N   . TYR C 1 429 ? -82.001  38.649  -41.942  1.00 145.20 ? 398 TYR C N   1 
ATOM 9610  C CA  . TYR C 1 429 ? -82.210  40.053  -42.176  1.00 147.95 ? 398 TYR C CA  1 
ATOM 9611  C C   . TYR C 1 429 ? -83.695  40.354  -42.361  1.00 149.91 ? 398 TYR C C   1 
ATOM 9612  O O   . TYR C 1 429 ? -84.503  39.453  -42.595  1.00 149.66 ? 398 TYR C O   1 
ATOM 9613  C CB  . TYR C 1 429 ? -81.385  40.505  -43.370  1.00 147.29 ? 398 TYR C CB  1 
ATOM 9614  C CG  . TYR C 1 429 ? -79.903  40.337  -43.157  1.00 147.76 ? 398 TYR C CG  1 
ATOM 9615  C CD1 . TYR C 1 429 ? -79.200  41.208  -42.331  1.00 150.23 ? 398 TYR C CD1 1 
ATOM 9616  C CD2 . TYR C 1 429 ? -79.204  39.316  -43.780  1.00 147.22 ? 398 TYR C CD2 1 
ATOM 9617  C CE1 . TYR C 1 429 ? -77.833  41.068  -42.126  1.00 151.28 ? 398 TYR C CE1 1 
ATOM 9618  C CE2 . TYR C 1 429 ? -77.834  39.167  -43.592  1.00 148.58 ? 398 TYR C CE2 1 
ATOM 9619  C CZ  . TYR C 1 429 ? -77.151  40.045  -42.761  1.00 150.49 ? 398 TYR C CZ  1 
ATOM 9620  O OH  . TYR C 1 429 ? -75.790  39.902  -42.558  1.00 151.47 ? 398 TYR C OH  1 
ATOM 9621  N N   . SER C 1 430 ? -84.054  41.623  -42.213  1.00 152.66 ? 399 SER C N   1 
ATOM 9622  C CA  . SER C 1 430 ? -85.429  42.056  -42.399  1.00 155.15 ? 399 SER C CA  1 
ATOM 9623  C C   . SER C 1 430 ? -85.444  43.194  -43.408  1.00 156.29 ? 399 SER C C   1 
ATOM 9624  O O   . SER C 1 430 ? -84.614  44.112  -43.343  1.00 156.60 ? 399 SER C O   1 
ATOM 9625  C CB  . SER C 1 430 ? -86.073  42.467  -41.067  1.00 156.85 ? 399 SER C CB  1 
ATOM 9626  O OG  . SER C 1 430 ? -85.409  43.578  -40.480  1.00 158.41 ? 399 SER C OG  1 
ATOM 9627  N N   . LEU C 1 431 ? -86.384  43.108  -44.345  1.00 157.49 ? 400 LEU C N   1 
ATOM 9628  C CA  . LEU C 1 431 ? -86.464  44.036  -45.461  1.00 158.83 ? 400 LEU C CA  1 
ATOM 9629  C C   . LEU C 1 431 ? -87.313  45.261  -45.093  1.00 161.23 ? 400 LEU C C   1 
ATOM 9630  O O   . LEU C 1 431 ? -88.541  45.185  -45.038  1.00 162.44 ? 400 LEU C O   1 
ATOM 9631  C CB  . LEU C 1 431 ? -87.013  43.311  -46.693  1.00 158.14 ? 400 LEU C CB  1 
ATOM 9632  C CG  . LEU C 1 431 ? -86.491  43.835  -48.028  1.00 158.32 ? 400 LEU C CG  1 
ATOM 9633  C CD1 . LEU C 1 431 ? -85.064  43.353  -48.256  1.00 156.89 ? 400 LEU C CD1 1 
ATOM 9634  C CD2 . LEU C 1 431 ? -87.399  43.410  -49.178  1.00 159.03 ? 400 LEU C CD2 1 
ATOM 9635  N N   . ASN C 1 432 ? -86.649  46.383  -44.829  1.00 162.42 ? 401 ASN C N   1 
ATOM 9636  C CA  . ASN C 1 432 ? -87.328  47.574  -44.321  1.00 164.81 ? 401 ASN C CA  1 
ATOM 9637  C C   . ASN C 1 432 ? -87.012  48.835  -45.123  1.00 165.79 ? 401 ASN C C   1 
ATOM 9638  O O   . ASN C 1 432 ? -86.100  49.594  -44.775  1.00 166.08 ? 401 ASN C O   1 
ATOM 9639  C CB  . ASN C 1 432 ? -87.011  47.784  -42.831  1.00 165.45 ? 401 ASN C CB  1 
ATOM 9640  C CG  . ASN C 1 432 ? -88.164  47.398  -41.923  1.00 166.16 ? 401 ASN C CG  1 
ATOM 9641  O OD1 . ASN C 1 432 ? -88.527  46.229  -41.815  1.00 164.70 ? 401 ASN C OD1 1 
ATOM 9642  N ND2 . ASN C 1 432 ? -88.737  48.388  -41.253  1.00 167.65 ? 401 ASN C ND2 1 
ATOM 9643  N N   . ALA C 1 433 ? -87.774  49.053  -46.194  1.00 166.78 ? 402 ALA C N   1 
ATOM 9644  C CA  . ALA C 1 433 ? -87.604  50.224  -47.073  1.00 167.75 ? 402 ALA C CA  1 
ATOM 9645  C C   . ALA C 1 433 ? -86.470  50.051  -48.101  1.00 166.65 ? 402 ALA C C   1 
ATOM 9646  O O   . ALA C 1 433 ? -85.677  50.976  -48.339  1.00 166.69 ? 402 ALA C O   1 
ATOM 9647  C CB  . ALA C 1 433 ? -87.411  51.517  -46.241  1.00 168.89 ? 402 ALA C CB  1 
ATOM 9648  N N   . GLY C 1 434 ? -86.407  48.865  -48.710  1.00 165.72 ? 403 GLY C N   1 
ATOM 9649  C CA  . GLY C 1 434 ? -85.328  48.536  -49.638  1.00 164.76 ? 403 GLY C CA  1 
ATOM 9650  C C   . GLY C 1 434 ? -84.057  48.067  -48.948  1.00 163.80 ? 403 GLY C C   1 
ATOM 9651  O O   . GLY C 1 434 ? -83.601  46.954  -49.197  1.00 162.71 ? 403 GLY C O   1 
ATOM 9652  N N   . SER C 1 435 ? -83.479  48.918  -48.095  1.00 164.30 ? 404 SER C N   1 
ATOM 9653  C CA  . SER C 1 435 ? -82.311  48.560  -47.277  1.00 163.45 ? 404 SER C CA  1 
ATOM 9654  C C   . SER C 1 435 ? -82.666  47.511  -46.211  1.00 163.14 ? 404 SER C C   1 
ATOM 9655  O O   . SER C 1 435 ? -83.765  47.554  -45.637  1.00 163.92 ? 404 SER C O   1 
ATOM 9656  C CB  . SER C 1 435 ? -81.705  49.809  -46.631  1.00 164.37 ? 404 SER C CB  1 
ATOM 9657  O OG  . SER C 1 435 ? -82.708  50.745  -46.262  1.00 165.57 ? 404 SER C OG  1 
ATOM 9658  N N   . LEU C 1 436 ? -81.744  46.567  -45.967  1.00 161.90 ? 405 LEU C N   1 
ATOM 9659  C CA  . LEU C 1 436 ? -81.982  45.442  -45.038  1.00 161.20 ? 405 LEU C CA  1 
ATOM 9660  C C   . LEU C 1 436 ? -81.062  45.439  -43.833  1.00 161.51 ? 405 LEU C C   1 
ATOM 9661  O O   . LEU C 1 436 ? -79.954  45.967  -43.883  1.00 161.40 ? 405 LEU C O   1 
ATOM 9662  C CB  . LEU C 1 436 ? -81.933  44.078  -45.738  1.00 159.40 ? 405 LEU C CB  1 
ATOM 9663  C CG  . LEU C 1 436 ? -80.731  43.669  -46.586  1.00 157.53 ? 405 LEU C CG  1 
ATOM 9664  C CD1 . LEU C 1 436 ? -79.488  43.437  -45.762  1.00 156.84 ? 405 LEU C CD1 1 
ATOM 9665  C CD2 . LEU C 1 436 ? -81.087  42.414  -47.355  1.00 156.35 ? 405 LEU C CD2 1 
ATOM 9666  N N   . THR C 1 437 ? -81.540  44.814  -42.761  1.00 162.01 ? 406 THR C N   1 
ATOM 9667  C CA  . THR C 1 437 ? -80.925  44.912  -41.445  1.00 162.92 ? 406 THR C CA  1 
ATOM 9668  C C   . THR C 1 437 ? -81.139  43.634  -40.634  1.00 162.92 ? 406 THR C C   1 
ATOM 9669  O O   . THR C 1 437 ? -82.207  43.031  -40.699  1.00 163.02 ? 406 THR C O   1 
ATOM 9670  C CB  . THR C 1 437 ? -81.519  46.095  -40.660  1.00 164.63 ? 406 THR C CB  1 
ATOM 9671  O OG1 . THR C 1 437 ? -82.897  46.274  -41.034  1.00 164.75 ? 406 THR C OG1 1 
ATOM 9672  C CG2 . THR C 1 437 ? -80.730  47.377  -40.942  1.00 165.00 ? 406 THR C CG2 1 
ATOM 9673  N N   . MET C 1 438 ? -80.119  43.237  -39.870  1.00 163.11 ? 407 MET C N   1 
ATOM 9674  C CA  . MET C 1 438 ? -80.165  42.048  -39.008  1.00 163.04 ? 407 MET C CA  1 
ATOM 9675  C C   . MET C 1 438 ? -81.354  42.133  -38.063  1.00 164.03 ? 407 MET C C   1 
ATOM 9676  O O   . MET C 1 438 ? -81.555  43.135  -37.378  1.00 165.36 ? 407 MET C O   1 
ATOM 9677  C CB  . MET C 1 438 ? -78.854  41.903  -38.222  1.00 163.64 ? 407 MET C CB  1 
ATOM 9678  C CG  . MET C 1 438 ? -78.582  40.504  -37.645  1.00 164.40 ? 407 MET C CG  1 
ATOM 9679  S SD  . MET C 1 438 ? -77.422  40.465  -36.238  1.00 167.98 ? 407 MET C SD  1 
ATOM 9680  C CE  . MET C 1 438 ? -78.439  41.163  -34.923  1.00 169.76 ? 407 MET C CE  1 
ATOM 9681  N N   . SER C 1 439 ? -82.146  41.076  -38.037  1.00 163.42 ? 408 SER C N   1 
ATOM 9682  C CA  . SER C 1 439 ? -83.427  41.159  -37.376  1.00 164.96 ? 408 SER C CA  1 
ATOM 9683  C C   . SER C 1 439 ? -83.387  40.694  -35.930  1.00 166.26 ? 408 SER C C   1 
ATOM 9684  O O   . SER C 1 439 ? -82.336  40.347  -35.401  1.00 166.14 ? 408 SER C O   1 
ATOM 9685  C CB  . SER C 1 439 ? -84.483  40.386  -38.164  1.00 164.21 ? 408 SER C CB  1 
ATOM 9686  O OG  . SER C 1 439 ? -84.271  38.997  -38.047  1.00 163.05 ? 408 SER C OG  1 
ATOM 9687  N N   . GLU C 1 440 ? -84.559  40.728  -35.304  1.00 167.89 ? 409 GLU C N   1 
ATOM 9688  C CA  . GLU C 1 440 ? -84.796  40.231  -33.961  1.00 169.35 ? 409 GLU C CA  1 
ATOM 9689  C C   . GLU C 1 440 ? -85.369  38.821  -34.052  1.00 168.66 ? 409 GLU C C   1 
ATOM 9690  O O   . GLU C 1 440 ? -85.942  38.443  -35.071  1.00 167.69 ? 409 GLU C O   1 
ATOM 9691  C CB  . GLU C 1 440 ? -85.816  41.132  -33.261  1.00 171.64 ? 409 GLU C CB  1 
ATOM 9692  C CG  . GLU C 1 440 ? -85.561  42.606  -33.438  1.00 172.98 ? 409 GLU C CG  1 
ATOM 9693  C CD  . GLU C 1 440 ? -84.188  42.971  -32.961  1.00 174.44 ? 409 GLU C CD  1 
ATOM 9694  O OE1 . GLU C 1 440 ? -83.204  42.540  -33.606  1.00 173.30 ? 409 GLU C OE1 1 
ATOM 9695  O OE2 . GLU C 1 440 ? -84.093  43.672  -31.935  1.00 177.52 ? 409 GLU C OE2 1 
ATOM 9696  N N   . LYS C 1 441 ? -85.209  38.031  -33.002  1.00 169.47 ? 410 LYS C N   1 
ATOM 9697  C CA  . LYS C 1 441 ? -84.354  38.382  -31.891  1.00 170.93 ? 410 LYS C CA  1 
ATOM 9698  C C   . LYS C 1 441 ? -83.108  37.517  -32.017  1.00 169.58 ? 410 LYS C C   1 
ATOM 9699  O O   . LYS C 1 441 ? -82.907  36.549  -31.270  1.00 169.99 ? 410 LYS C O   1 
ATOM 9700  C CB  . LYS C 1 441 ? -85.070  38.176  -30.547  1.00 173.23 ? 410 LYS C CB  1 
ATOM 9701  N N   . ARG C 1 442 ? -82.296  37.848  -33.012  1.00 167.99 ? 411 ARG C N   1 
ATOM 9702  C CA  . ARG C 1 442 ? -80.960  37.310  -33.109  1.00 166.82 ? 411 ARG C CA  1 
ATOM 9703  C C   . ARG C 1 442 ? -80.255  37.728  -31.808  1.00 168.89 ? 411 ARG C C   1 
ATOM 9704  O O   . ARG C 1 442 ? -79.727  38.843  -31.697  1.00 169.82 ? 411 ARG C O   1 
ATOM 9705  C CB  . ARG C 1 442 ? -80.285  37.878  -34.359  1.00 165.22 ? 411 ARG C CB  1 
ATOM 9706  C CG  . ARG C 1 442 ? -78.844  37.482  -34.572  1.00 163.67 ? 411 ARG C CG  1 
ATOM 9707  C CD  . ARG C 1 442 ? -78.689  36.045  -34.994  1.00 160.52 ? 411 ARG C CD  1 
ATOM 9708  N NE  . ARG C 1 442 ? -77.310  35.617  -34.802  1.00 158.94 ? 411 ARG C NE  1 
ATOM 9709  C CZ  . ARG C 1 442 ? -76.828  34.443  -35.178  1.00 156.85 ? 411 ARG C CZ  1 
ATOM 9710  N NH1 . ARG C 1 442 ? -77.609  33.561  -35.785  1.00 154.90 ? 411 ARG C NH1 1 
ATOM 9711  N NH2 . ARG C 1 442 ? -75.556  34.157  -34.949  1.00 157.17 ? 411 ARG C NH2 1 
ATOM 9712  N N   . GLU C 1 443 ? -80.300  36.833  -30.819  1.00 169.74 ? 412 GLU C N   1 
ATOM 9713  C CA  . GLU C 1 443 ? -79.824  37.099  -29.460  1.00 171.89 ? 412 GLU C CA  1 
ATOM 9714  C C   . GLU C 1 443 ? -78.528  37.881  -29.463  1.00 171.83 ? 412 GLU C C   1 
ATOM 9715  O O   . GLU C 1 443 ? -78.477  38.997  -28.972  1.00 173.30 ? 412 GLU C O   1 
ATOM 9716  C CB  . GLU C 1 443 ? -79.606  35.787  -28.708  1.00 172.45 ? 412 GLU C CB  1 
ATOM 9717  C CG  . GLU C 1 443 ? -80.672  34.725  -28.938  1.00 173.43 ? 412 GLU C CG  1 
ATOM 9718  C CD  . GLU C 1 443 ? -81.988  35.051  -28.254  1.00 177.48 ? 412 GLU C CD  1 
ATOM 9719  O OE1 . GLU C 1 443 ? -81.984  35.830  -27.269  1.00 180.44 ? 412 GLU C OE1 1 
ATOM 9720  O OE2 . GLU C 1 443 ? -83.028  34.519  -28.704  1.00 177.85 ? 412 GLU C OE2 1 
ATOM 9721  N N   . PHE C 1 444 ? -77.487  37.285  -30.034  1.00 170.32 ? 413 PHE C N   1 
ATOM 9722  C CA  . PHE C 1 444 ? -76.169  37.900  -30.107  1.00 170.52 ? 413 PHE C CA  1 
ATOM 9723  C C   . PHE C 1 444 ? -75.958  38.510  -31.489  1.00 168.66 ? 413 PHE C C   1 
ATOM 9724  O O   . PHE C 1 444 ? -75.932  37.793  -32.494  1.00 166.65 ? 413 PHE C O   1 
ATOM 9725  C CB  . PHE C 1 444 ? -75.071  36.871  -29.813  1.00 170.46 ? 413 PHE C CB  1 
ATOM 9726  C CG  . PHE C 1 444 ? -75.253  36.131  -28.516  1.00 172.41 ? 413 PHE C CG  1 
ATOM 9727  C CD1 . PHE C 1 444 ? -74.508  36.477  -27.398  1.00 175.04 ? 413 PHE C CD1 1 
ATOM 9728  C CD2 . PHE C 1 444 ? -76.164  35.072  -28.417  1.00 172.44 ? 413 PHE C CD2 1 
ATOM 9729  C CE1 . PHE C 1 444 ? -74.672  35.788  -26.197  1.00 177.46 ? 413 PHE C CE1 1 
ATOM 9730  C CE2 . PHE C 1 444 ? -76.342  34.376  -27.221  1.00 173.98 ? 413 PHE C CE2 1 
ATOM 9731  C CZ  . PHE C 1 444 ? -75.596  34.732  -26.110  1.00 176.82 ? 413 PHE C CZ  1 
ATOM 9732  N N   . PRO C 1 445 ? -75.799  39.839  -31.547  1.00 169.34 ? 414 PRO C N   1 
ATOM 9733  C CA  . PRO C 1 445 ? -75.641  40.503  -32.830  1.00 167.99 ? 414 PRO C CA  1 
ATOM 9734  C C   . PRO C 1 445 ? -74.305  40.177  -33.494  1.00 166.90 ? 414 PRO C C   1 
ATOM 9735  O O   . PRO C 1 445 ? -73.495  41.082  -33.721  1.00 167.54 ? 414 PRO C O   1 
ATOM 9736  C CB  . PRO C 1 445 ? -75.728  41.993  -32.466  1.00 169.62 ? 414 PRO C CB  1 
ATOM 9737  C CG  . PRO C 1 445 ? -75.301  42.069  -31.044  1.00 171.70 ? 414 PRO C CG  1 
ATOM 9738  C CD  . PRO C 1 445 ? -75.754  40.785  -30.415  1.00 171.71 ? 414 PRO C CD  1 
ATOM 9739  N N   . THR C 1 446 ? -74.070  38.897  -33.788  1.00 165.46 ? 415 THR C N   1 
ATOM 9740  C CA  . THR C 1 446 ? -72.888  38.501  -34.569  1.00 164.22 ? 415 THR C CA  1 
ATOM 9741  C C   . THR C 1 446 ? -73.300  37.786  -35.842  1.00 161.81 ? 415 THR C C   1 
ATOM 9742  O O   . THR C 1 446 ? -74.038  36.805  -35.811  1.00 160.79 ? 415 THR C O   1 
ATOM 9743  C CB  . THR C 1 446 ? -71.837  37.642  -33.781  1.00 164.87 ? 415 THR C CB  1 
ATOM 9744  O OG1 . THR C 1 446 ? -72.402  36.376  -33.425  1.00 164.89 ? 415 THR C OG1 1 
ATOM 9745  C CG2 . THR C 1 446 ? -71.306  38.370  -32.522  1.00 166.82 ? 415 THR C CG2 1 
ATOM 9746  N N   . VAL C 1 447 ? -72.824  38.319  -36.959  1.00 160.94 ? 416 VAL C N   1 
ATOM 9747  C CA  . VAL C 1 447 ? -73.035  37.731  -38.268  1.00 159.30 ? 416 VAL C CA  1 
ATOM 9748  C C   . VAL C 1 447 ? -72.387  36.351  -38.273  1.00 158.27 ? 416 VAL C C   1 
ATOM 9749  O O   . VAL C 1 447 ? -71.183  36.238  -38.018  1.00 159.33 ? 416 VAL C O   1 
ATOM 9750  C CB  . VAL C 1 447 ? -72.383  38.599  -39.359  1.00 159.18 ? 416 VAL C CB  1 
ATOM 9751  C CG1 . VAL C 1 447 ? -72.667  38.029  -40.760  1.00 157.57 ? 416 VAL C CG1 1 
ATOM 9752  C CG2 . VAL C 1 447 ? -72.833  40.073  -39.224  1.00 160.78 ? 416 VAL C CG2 1 
ATOM 9753  N N   . PRO C 1 448 ? -73.173  35.296  -38.551  1.00 156.52 ? 417 PRO C N   1 
ATOM 9754  C CA  . PRO C 1 448 ? -72.676  33.938  -38.399  1.00 155.28 ? 417 PRO C CA  1 
ATOM 9755  C C   . PRO C 1 448 ? -72.187  33.394  -39.720  1.00 153.16 ? 417 PRO C C   1 
ATOM 9756  O O   . PRO C 1 448 ? -72.988  33.101  -40.583  1.00 151.98 ? 417 PRO C O   1 
ATOM 9757  C CB  . PRO C 1 448 ? -73.917  33.175  -37.939  1.00 155.08 ? 417 PRO C CB  1 
ATOM 9758  C CG  . PRO C 1 448 ? -75.097  34.011  -38.402  1.00 155.35 ? 417 PRO C CG  1 
ATOM 9759  C CD  . PRO C 1 448 ? -74.578  35.302  -38.975  1.00 155.89 ? 417 PRO C CD  1 
ATOM 9760  N N   . LEU C 1 449 ? -70.883  33.247  -39.883  1.00 152.80 ? 418 LEU C N   1 
ATOM 9761  C CA  . LEU C 1 449 ? -70.390  32.933  -41.206  1.00 151.38 ? 418 LEU C CA  1 
ATOM 9762  C C   . LEU C 1 449 ? -70.709  31.537  -41.719  1.00 148.78 ? 418 LEU C C   1 
ATOM 9763  O O   . LEU C 1 449 ? -70.741  30.567  -40.955  1.00 148.22 ? 418 LEU C O   1 
ATOM 9764  C CB  . LEU C 1 449 ? -68.908  33.311  -41.398  1.00 152.83 ? 418 LEU C CB  1 
ATOM 9765  C CG  . LEU C 1 449 ? -68.647  34.587  -42.264  1.00 155.23 ? 418 LEU C CG  1 
ATOM 9766  C CD1 . LEU C 1 449 ? -67.159  34.681  -42.766  1.00 156.62 ? 418 LEU C CD1 1 
ATOM 9767  C CD2 . LEU C 1 449 ? -69.653  34.787  -43.470  1.00 154.66 ? 418 LEU C CD2 1 
ATOM 9768  N N   . VAL C 1 450 ? -70.982  31.497  -43.028  1.00 146.47 ? 419 VAL C N   1 
ATOM 9769  C CA  . VAL C 1 450 ? -71.207  30.286  -43.802  1.00 143.98 ? 419 VAL C CA  1 
ATOM 9770  C C   . VAL C 1 450 ? -70.227  30.183  -44.961  1.00 143.06 ? 419 VAL C C   1 
ATOM 9771  O O   . VAL C 1 450 ? -69.578  31.158  -45.335  1.00 143.65 ? 419 VAL C O   1 
ATOM 9772  C CB  . VAL C 1 450 ? -72.583  30.258  -44.407  1.00 143.13 ? 419 VAL C CB  1 
ATOM 9773  C CG1 . VAL C 1 450 ? -73.607  30.161  -43.337  1.00 143.75 ? 419 VAL C CG1 1 
ATOM 9774  C CG2 . VAL C 1 450 ? -72.798  31.490  -45.231  1.00 143.56 ? 419 VAL C CG2 1 
ATOM 9775  N N   . LYS C 1 451 ? -70.195  28.998  -45.562  1.00 141.49 ? 420 LYS C N   1 
ATOM 9776  C CA  . LYS C 1 451 ? -69.066  28.505  -46.334  1.00 140.57 ? 420 LYS C CA  1 
ATOM 9777  C C   . LYS C 1 451 ? -69.611  27.317  -47.144  1.00 138.76 ? 420 LYS C C   1 
ATOM 9778  O O   . LYS C 1 451 ? -69.945  26.264  -46.588  1.00 137.97 ? 420 LYS C O   1 
ATOM 9779  C CB  . LYS C 1 451 ? -68.017  28.039  -45.327  1.00 141.35 ? 420 LYS C CB  1 
ATOM 9780  C CG  . LYS C 1 451 ? -66.593  27.794  -45.806  1.00 142.13 ? 420 LYS C CG  1 
ATOM 9781  C CD  . LYS C 1 451 ? -65.786  26.907  -44.744  1.00 142.33 ? 420 LYS C CD  1 
ATOM 9782  C CE  . LYS C 1 451 ? -65.043  27.697  -43.633  1.00 141.87 ? 420 LYS C CE  1 
ATOM 9783  N NZ  . LYS C 1 451 ? -63.703  27.148  -43.342  1.00 138.84 ? 420 LYS C NZ  1 
ATOM 9784  N N   . LEU C 1 452 ? -69.739  27.507  -48.453  1.00 137.79 ? 421 LEU C N   1 
ATOM 9785  C CA  . LEU C 1 452 ? -70.447  26.551  -49.301  1.00 136.00 ? 421 LEU C CA  1 
ATOM 9786  C C   . LEU C 1 452 ? -69.595  26.004  -50.423  1.00 135.58 ? 421 LEU C C   1 
ATOM 9787  O O   . LEU C 1 452 ? -68.796  26.724  -51.031  1.00 136.03 ? 421 LEU C O   1 
ATOM 9788  C CB  . LEU C 1 452 ? -71.702  27.176  -49.893  1.00 135.74 ? 421 LEU C CB  1 
ATOM 9789  C CG  . LEU C 1 452 ? -72.840  27.496  -48.944  1.00 135.35 ? 421 LEU C CG  1 
ATOM 9790  C CD1 . LEU C 1 452 ? -73.513  28.739  -49.426  1.00 136.04 ? 421 LEU C CD1 1 
ATOM 9791  C CD2 . LEU C 1 452 ? -73.817  26.343  -48.876  1.00 133.93 ? 421 LEU C CD2 1 
ATOM 9792  N N   . GLY C 1 453 ? -69.836  24.728  -50.712  1.00 134.71 ? 422 GLY C N   1 
ATOM 9793  C CA  . GLY C 1 453 ? -68.998  23.896  -51.573  1.00 134.51 ? 422 GLY C CA  1 
ATOM 9794  C C   . GLY C 1 453 ? -68.642  24.448  -52.933  1.00 134.90 ? 422 GLY C C   1 
ATOM 9795  O O   . GLY C 1 453 ? -69.186  25.465  -53.374  1.00 135.09 ? 422 GLY C O   1 
ATOM 9796  N N   . SER C 1 454 ? -67.701  23.769  -53.590  1.00 134.99 ? 423 SER C N   1 
ATOM 9797  C CA  . SER C 1 454 ? -67.340  24.105  -54.961  1.00 135.36 ? 423 SER C CA  1 
ATOM 9798  C C   . SER C 1 454 ? -68.625  24.105  -55.776  1.00 134.43 ? 423 SER C C   1 
ATOM 9799  O O   . SER C 1 454 ? -68.915  25.063  -56.473  1.00 135.47 ? 423 SER C O   1 
ATOM 9800  C CB  . SER C 1 454 ? -66.301  23.127  -55.536  1.00 135.46 ? 423 SER C CB  1 
ATOM 9801  O OG  . SER C 1 454 ? -66.859  21.840  -55.758  1.00 135.61 ? 423 SER C OG  1 
ATOM 9802  N N   . SER C 1 455 ? -69.429  23.062  -55.618  1.00 132.76 ? 424 SER C N   1 
ATOM 9803  C CA  . SER C 1 455 ? -70.648  22.908  -56.388  1.00 131.72 ? 424 SER C CA  1 
ATOM 9804  C C   . SER C 1 455 ? -71.785  23.861  -55.969  1.00 131.13 ? 424 SER C C   1 
ATOM 9805  O O   . SER C 1 455 ? -72.954  23.568  -56.202  1.00 131.25 ? 424 SER C O   1 
ATOM 9806  C CB  . SER C 1 455 ? -71.082  21.437  -56.343  1.00 131.00 ? 424 SER C CB  1 
ATOM 9807  O OG  . SER C 1 455 ? -70.801  20.864  -55.068  1.00 130.91 ? 424 SER C OG  1 
ATOM 9808  N N   . PHE C 1 456 ? -71.442  25.004  -55.382  1.00 115.59 ? 425 PHE C N   1 
ATOM 9809  C CA  . PHE C 1 456 ? -72.437  25.986  -54.961  1.00 113.61 ? 425 PHE C CA  1 
ATOM 9810  C C   . PHE C 1 456 ? -72.140  27.388  -55.438  1.00 115.07 ? 425 PHE C C   1 
ATOM 9811  O O   . PHE C 1 456 ? -72.880  28.318  -55.093  1.00 114.03 ? 425 PHE C O   1 
ATOM 9812  C CB  . PHE C 1 456 ? -72.474  26.077  -53.448  1.00 110.85 ? 425 PHE C CB  1 
ATOM 9813  C CG  . PHE C 1 456 ? -73.410  25.134  -52.797  1.00 108.75 ? 425 PHE C CG  1 
ATOM 9814  C CD1 . PHE C 1 456 ? -74.635  25.574  -52.337  1.00 107.20 ? 425 PHE C CD1 1 
ATOM 9815  C CD2 . PHE C 1 456 ? -73.055  23.807  -52.595  1.00 108.46 ? 425 PHE C CD2 1 
ATOM 9816  C CE1 . PHE C 1 456 ? -75.506  24.703  -51.708  1.00 105.73 ? 425 PHE C CE1 1 
ATOM 9817  C CE2 . PHE C 1 456 ? -73.923  22.929  -51.957  1.00 106.57 ? 425 PHE C CE2 1 
ATOM 9818  C CZ  . PHE C 1 456 ? -75.149  23.380  -51.515  1.00 105.19 ? 425 PHE C CZ  1 
ATOM 9819  N N   . THR C 1 457 ? -71.044  27.563  -56.179  1.00 117.55 ? 426 THR C N   1 
ATOM 9820  C CA  . THR C 1 457 ? -70.552  28.918  -56.455  1.00 119.36 ? 426 THR C CA  1 
ATOM 9821  C C   . THR C 1 457 ? -71.386  29.594  -57.496  1.00 122.08 ? 426 THR C C   1 
ATOM 9822  O O   . THR C 1 457 ? -71.582  30.806  -57.413  1.00 123.23 ? 426 THR C O   1 
ATOM 9823  C CB  . THR C 1 457 ? -69.109  29.007  -56.957  1.00 121.39 ? 426 THR C CB  1 
ATOM 9824  O OG1 . THR C 1 457 ? -68.350  27.887  -56.509  1.00 120.30 ? 426 THR C OG1 1 
ATOM 9825  C CG2 . THR C 1 457 ? -68.489  30.298  -56.441  1.00 121.56 ? 426 THR C CG2 1 
ATOM 9826  N N   . LYS C 1 458 ? -71.850  28.815  -58.479  1.00 123.92 ? 427 LYS C N   1 
ATOM 9827  C CA  . LYS C 1 458 ? -72.675  29.330  -59.571  1.00 126.70 ? 427 LYS C CA  1 
ATOM 9828  C C   . LYS C 1 458 ? -74.094  29.654  -59.126  1.00 125.25 ? 427 LYS C C   1 
ATOM 9829  O O   . LYS C 1 458 ? -74.820  28.767  -58.698  1.00 123.61 ? 427 LYS C O   1 
ATOM 9830  C CB  . LYS C 1 458 ? -72.691  28.335  -60.723  1.00 129.64 ? 427 LYS C CB  1 
ATOM 9831  C CG  . LYS C 1 458 ? -71.597  28.586  -61.737  1.00 134.45 ? 427 LYS C CG  1 
ATOM 9832  C CD  . LYS C 1 458 ? -71.641  27.563  -62.854  1.00 139.23 ? 427 LYS C CD  1 
ATOM 9833  C CE  . LYS C 1 458 ? -70.827  28.032  -64.040  1.00 144.63 ? 427 LYS C CE  1 
ATOM 9834  N NZ  . LYS C 1 458 ? -70.508  26.881  -64.914  1.00 148.74 ? 427 LYS C NZ  1 
ATOM 9835  N N   . VAL C 1 459 ? -74.480  30.924  -59.233  1.00 126.35 ? 428 VAL C N   1 
ATOM 9836  C CA  . VAL C 1 459 ? -75.785  31.401  -58.765  1.00 126.05 ? 428 VAL C CA  1 
ATOM 9837  C C   . VAL C 1 459 ? -76.911  30.507  -59.254  1.00 127.82 ? 428 VAL C C   1 
ATOM 9838  O O   . VAL C 1 459 ? -77.908  30.304  -58.556  1.00 126.64 ? 428 VAL C O   1 
ATOM 9839  C CB  . VAL C 1 459 ? -76.064  32.834  -59.224  1.00 128.29 ? 428 VAL C CB  1 
ATOM 9840  C CG1 . VAL C 1 459 ? -77.367  33.328  -58.655  1.00 127.81 ? 428 VAL C CG1 1 
ATOM 9841  C CG2 . VAL C 1 459 ? -74.967  33.731  -58.771  1.00 127.98 ? 428 VAL C CG2 1 
ATOM 9842  N N   . GLN C 1 460 ? -76.743  29.967  -60.456  1.00 131.42 ? 429 GLN C N   1 
ATOM 9843  C CA  . GLN C 1 460 ? -77.715  29.039  -61.019  1.00 133.84 ? 429 GLN C CA  1 
ATOM 9844  C C   . GLN C 1 460 ? -77.819  27.744  -60.200  1.00 130.91 ? 429 GLN C C   1 
ATOM 9845  O O   . GLN C 1 460 ? -78.923  27.291  -59.907  1.00 131.10 ? 429 GLN C O   1 
ATOM 9846  C CB  . GLN C 1 460 ? -77.387  28.740  -62.475  1.00 138.06 ? 429 GLN C CB  1 
ATOM 9847  C CG  . GLN C 1 460 ? -78.596  28.372  -63.270  1.00 142.99 ? 429 GLN C CG  1 
ATOM 9848  C CD  . GLN C 1 460 ? -78.369  28.554  -64.744  1.00 150.74 ? 429 GLN C CD  1 
ATOM 9849  O OE1 . GLN C 1 460 ? -78.566  29.646  -65.289  1.00 154.19 ? 429 GLN C OE1 1 
ATOM 9850  N NE2 . GLN C 1 460 ? -77.951  27.481  -65.412  1.00 154.18 ? 429 GLN C NE2 1 
ATOM 9851  N N   . ASP C 1 461 ? -76.673  27.174  -59.820  1.00 128.89 ? 430 ASP C N   1 
ATOM 9852  C CA  . ASP C 1 461 ? -76.617  25.959  -58.996  1.00 126.08 ? 430 ASP C CA  1 
ATOM 9853  C C   . ASP C 1 461 ? -76.918  26.267  -57.534  1.00 122.10 ? 430 ASP C C   1 
ATOM 9854  O O   . ASP C 1 461 ? -77.164  25.368  -56.733  1.00 120.18 ? 430 ASP C O   1 
ATOM 9855  C CB  . ASP C 1 461 ? -75.245  25.270  -59.102  1.00 126.08 ? 430 ASP C CB  1 
ATOM 9856  C CG  . ASP C 1 461 ? -75.023  24.566  -60.448  1.00 130.99 ? 430 ASP C CG  1 
ATOM 9857  O OD1 . ASP C 1 461 ? -75.957  23.898  -60.967  1.00 133.45 ? 430 ASP C OD1 1 
ATOM 9858  O OD2 . ASP C 1 461 ? -73.890  24.676  -60.976  1.00 133.84 ? 430 ASP C OD2 1 
ATOM 9859  N N   . TYR C 1 462 ? -76.894  27.542  -57.181  1.00 121.24 ? 431 TYR C N   1 
ATOM 9860  C CA  . TYR C 1 462 ? -77.159  27.927  -55.807  1.00 118.20 ? 431 TYR C CA  1 
ATOM 9861  C C   . TYR C 1 462 ? -78.651  27.878  -55.505  1.00 118.34 ? 431 TYR C C   1 
ATOM 9862  O O   . TYR C 1 462 ? -79.053  27.675  -54.360  1.00 116.27 ? 431 TYR C O   1 
ATOM 9863  C CB  . TYR C 1 462 ? -76.567  29.307  -55.518  1.00 118.22 ? 431 TYR C CB  1 
ATOM 9864  C CG  . TYR C 1 462 ? -77.141  29.966  -54.302  1.00 116.74 ? 431 TYR C CG  1 
ATOM 9865  C CD1 . TYR C 1 462 ? -76.937  29.433  -53.053  1.00 114.96 ? 431 TYR C CD1 1 
ATOM 9866  C CD2 . TYR C 1 462 ? -77.892  31.123  -54.409  1.00 119.12 ? 431 TYR C CD2 1 
ATOM 9867  C CE1 . TYR C 1 462 ? -77.465  30.022  -51.948  1.00 115.18 ? 431 TYR C CE1 1 
ATOM 9868  C CE2 . TYR C 1 462 ? -78.427  31.720  -53.307  1.00 118.69 ? 431 TYR C CE2 1 
ATOM 9869  C CZ  . TYR C 1 462 ? -78.205  31.160  -52.081  1.00 116.94 ? 431 TYR C CZ  1 
ATOM 9870  O OH  . TYR C 1 462 ? -78.722  31.724  -50.957  1.00 118.56 ? 431 TYR C OH  1 
ATOM 9871  N N   . LEU C 1 463 ? -79.458  28.056  -56.548  1.00 121.17 ? 432 LEU C N   1 
ATOM 9872  C CA  . LEU C 1 463 ? -80.909  28.023  -56.432  1.00 122.28 ? 432 LEU C CA  1 
ATOM 9873  C C   . LEU C 1 463 ? -81.451  26.641  -56.817  1.00 123.47 ? 432 LEU C C   1 
ATOM 9874  O O   . LEU C 1 463 ? -82.600  26.297  -56.519  1.00 124.62 ? 432 LEU C O   1 
ATOM 9875  C CB  . LEU C 1 463 ? -81.530  29.112  -57.305  1.00 125.50 ? 432 LEU C CB  1 
ATOM 9876  C CG  . LEU C 1 463 ? -80.943  30.520  -57.297  1.00 124.43 ? 432 LEU C CG  1 
ATOM 9877  C CD1 . LEU C 1 463 ? -81.744  31.352  -58.238  1.00 128.91 ? 432 LEU C CD1 1 
ATOM 9878  C CD2 . LEU C 1 463 ? -80.988  31.139  -55.933  1.00 121.63 ? 432 LEU C CD2 1 
ATOM 9879  N N   . ARG C 1 464 ? -80.619  25.859  -57.492  1.00 123.63 ? 433 ARG C N   1 
ATOM 9880  C CA  . ARG C 1 464 ? -80.921  24.475  -57.774  1.00 124.62 ? 433 ARG C CA  1 
ATOM 9881  C C   . ARG C 1 464 ? -80.921  23.794  -56.424  1.00 121.09 ? 433 ARG C C   1 
ATOM 9882  O O   . ARG C 1 464 ? -81.809  23.015  -56.114  1.00 122.06 ? 433 ARG C O   1 
ATOM 9883  C CB  . ARG C 1 464 ? -79.802  23.869  -58.624  1.00 125.71 ? 433 ARG C CB  1 
ATOM 9884  C CG  . ARG C 1 464 ? -80.204  23.005  -59.809  1.00 130.45 ? 433 ARG C CG  1 
ATOM 9885  C CD  . ARG C 1 464 ? -79.223  23.277  -60.975  1.00 135.45 ? 433 ARG C CD  1 
ATOM 9886  N NE  . ARG C 1 464 ? -79.919  23.722  -62.203  1.00 142.65 ? 433 ARG C NE  1 
ATOM 9887  C CZ  . ARG C 1 464 ? -79.451  24.588  -63.116  1.00 144.88 ? 433 ARG C CZ  1 
ATOM 9888  N NH1 . ARG C 1 464 ? -78.250  25.159  -62.984  1.00 142.56 ? 433 ARG C NH1 1 
ATOM 9889  N NH2 . ARG C 1 464 ? -80.204  24.887  -64.172  1.00 149.36 ? 433 ARG C NH2 1 
ATOM 9890  N N   . ARG C 1 465 ? -79.927  24.117  -55.610  1.00 117.73 ? 434 ARG C N   1 
ATOM 9891  C CA  . ARG C 1 465 ? -79.650  23.339  -54.421  1.00 114.96 ? 434 ARG C CA  1 
ATOM 9892  C C   . ARG C 1 465 ? -80.595  23.639  -53.260  1.00 114.30 ? 434 ARG C C   1 
ATOM 9893  O O   . ARG C 1 465 ? -80.900  22.760  -52.454  1.00 112.96 ? 434 ARG C O   1 
ATOM 9894  C CB  . ARG C 1 465 ? -78.200  23.571  -53.979  1.00 113.01 ? 434 ARG C CB  1 
ATOM 9895  C CG  . ARG C 1 465 ? -77.099  22.937  -54.844  1.00 112.67 ? 434 ARG C CG  1 
ATOM 9896  C CD  . ARG C 1 465 ? -77.148  21.405  -54.849  1.00 110.76 ? 434 ARG C CD  1 
ATOM 9897  N NE  . ARG C 1 465 ? -75.839  20.833  -55.140  1.00 108.94 ? 434 ARG C NE  1 
ATOM 9898  C CZ  . ARG C 1 465 ? -75.279  20.803  -56.342  1.00 110.86 ? 434 ARG C CZ  1 
ATOM 9899  N NH1 . ARG C 1 465 ? -75.897  21.306  -57.394  1.00 113.67 ? 434 ARG C NH1 1 
ATOM 9900  N NH2 . ARG C 1 465 ? -74.087  20.267  -56.496  1.00 112.06 ? 434 ARG C NH2 1 
ATOM 9901  N N   . PHE C 1 466 ? -81.038  24.890  -53.172  1.00 115.71 ? 435 PHE C N   1 
ATOM 9902  C CA  . PHE C 1 466 ? -81.849  25.364  -52.047  1.00 115.84 ? 435 PHE C CA  1 
ATOM 9903  C C   . PHE C 1 466 ? -83.334  25.484  -52.366  1.00 119.53 ? 435 PHE C C   1 
ATOM 9904  O O   . PHE C 1 466 ? -84.185  24.799  -51.774  1.00 119.94 ? 435 PHE C O   1 
ATOM 9905  C CB  . PHE C 1 466 ? -81.343  26.731  -51.562  1.00 114.70 ? 435 PHE C CB  1 
ATOM 9906  C CG  . PHE C 1 466 ? -80.135  26.648  -50.694  1.00 111.40 ? 435 PHE C CG  1 
ATOM 9907  C CD1 . PHE C 1 466 ? -80.244  26.222  -49.377  1.00 109.90 ? 435 PHE C CD1 1 
ATOM 9908  C CD2 . PHE C 1 466 ? -78.888  26.979  -51.184  1.00 110.04 ? 435 PHE C CD2 1 
ATOM 9909  C CE1 . PHE C 1 466 ? -79.128  26.132  -48.557  1.00 107.22 ? 435 PHE C CE1 1 
ATOM 9910  C CE2 . PHE C 1 466 ? -77.767  26.893  -50.371  1.00 108.01 ? 435 PHE C CE2 1 
ATOM 9911  C CZ  . PHE C 1 466 ? -77.887  26.462  -49.059  1.00 106.72 ? 435 PHE C CZ  1 
ATOM 9912  N N   . GLU C 1 467 ? -83.628  26.348  -53.333  1.00 123.01 ? 436 GLU C N   1 
ATOM 9913  C CA  . GLU C 1 467 ? -84.945  26.975  -53.413  1.00 126.92 ? 436 GLU C CA  1 
ATOM 9914  C C   . GLU C 1 467 ? -85.897  26.574  -52.266  1.00 126.66 ? 436 GLU C C   1 
ATOM 9915  O O   . GLU C 1 467 ? -86.624  25.552  -52.292  1.00 127.14 ? 436 GLU C O   1 
ATOM 9916  C CB  . GLU C 1 467 ? -85.554  27.017  -54.844  1.00 131.50 ? 436 GLU C CB  1 
ATOM 9917  C CG  . GLU C 1 467 ? -85.229  28.338  -55.654  1.00 133.93 ? 436 GLU C CG  1 
ATOM 9918  C CD  . GLU C 1 467 ? -85.013  29.600  -54.761  1.00 133.39 ? 436 GLU C CD  1 
ATOM 9919  O OE1 . GLU C 1 467 ? -85.910  30.485  -54.718  1.00 136.05 ? 436 GLU C OE1 1 
ATOM 9920  O OE2 . GLU C 1 467 ? -83.943  29.699  -54.104  1.00 129.57 ? 436 GLU C OE2 1 
ATOM 9921  N N   . SER C 1 468 ? -85.790  27.436  -51.255  1.00 125.46 ? 437 SER C N   1 
ATOM 9922  C CA  . SER C 1 468 ? -86.418  27.326  -49.975  1.00 125.42 ? 437 SER C CA  1 
ATOM 9923  C C   . SER C 1 468 ? -85.388  27.751  -48.926  1.00 122.19 ? 437 SER C C   1 
ATOM 9924  O O   . SER C 1 468 ? -85.149  27.031  -47.962  1.00 120.75 ? 437 SER C O   1 
ATOM 9925  C CB  . SER C 1 468 ? -86.887  25.896  -49.735  1.00 125.59 ? 437 SER C CB  1 
ATOM 9926  O OG  . SER C 1 468 ? -88.046  25.887  -48.918  1.00 128.53 ? 437 SER C OG  1 
ATOM 9927  N N   . ILE C 1 469 ? -84.778  28.919  -49.116  1.00 121.75 ? 438 ILE C N   1 
ATOM 9928  C CA  . ILE C 1 469 ? -83.771  29.446  -48.176  1.00 119.23 ? 438 ILE C CA  1 
ATOM 9929  C C   . ILE C 1 469 ? -84.084  29.140  -46.691  1.00 118.40 ? 438 ILE C C   1 
ATOM 9930  O O   . ILE C 1 469 ? -85.084  29.614  -46.149  1.00 120.60 ? 438 ILE C O   1 
ATOM 9931  C CB  . ILE C 1 469 ? -83.562  30.976  -48.365  1.00 120.55 ? 438 ILE C CB  1 
ATOM 9932  C CG1 . ILE C 1 469 ? -83.098  31.323  -49.796  1.00 120.75 ? 438 ILE C CG1 1 
ATOM 9933  C CG2 . ILE C 1 469 ? -82.637  31.537  -47.279  1.00 118.96 ? 438 ILE C CG2 1 
ATOM 9934  C CD1 . ILE C 1 469 ? -81.808  30.654  -50.268  1.00 116.98 ? 438 ILE C CD1 1 
ATOM 9935  N N   . PRO C 1 470 ? -83.223  28.340  -46.043  1.00 115.71 ? 439 PRO C N   1 
ATOM 9936  C CA  . PRO C 1 470 ? -83.405  27.742  -44.728  1.00 115.35 ? 439 PRO C CA  1 
ATOM 9937  C C   . PRO C 1 470 ? -83.549  28.718  -43.567  1.00 116.70 ? 439 PRO C C   1 
ATOM 9938  O O   . PRO C 1 470 ? -83.280  29.903  -43.734  1.00 117.39 ? 439 PRO C O   1 
ATOM 9939  C CB  . PRO C 1 470 ? -82.122  26.936  -44.556  1.00 112.78 ? 439 PRO C CB  1 
ATOM 9940  C CG  . PRO C 1 470 ? -81.726  26.601  -45.905  1.00 111.84 ? 439 PRO C CG  1 
ATOM 9941  C CD  . PRO C 1 470 ? -82.002  27.829  -46.677  1.00 113.62 ? 439 PRO C CD  1 
ATOM 9942  N N   . ASP C 1 471 ? -83.990  28.210  -42.411  1.00 117.66 ? 440 ASP C N   1 
ATOM 9943  C CA  . ASP C 1 471 ? -84.014  28.980  -41.162  1.00 119.62 ? 440 ASP C CA  1 
ATOM 9944  C C   . ASP C 1 471 ? -82.620  29.128  -40.537  1.00 117.75 ? 440 ASP C C   1 
ATOM 9945  O O   . ASP C 1 471 ? -81.907  28.137  -40.296  1.00 116.24 ? 440 ASP C O   1 
ATOM 9946  C CB  . ASP C 1 471 ? -84.961  28.367  -40.117  1.00 122.13 ? 440 ASP C CB  1 
ATOM 9947  C CG  . ASP C 1 471 ? -84.821  29.040  -38.721  1.00 125.77 ? 440 ASP C CG  1 
ATOM 9948  O OD1 . ASP C 1 471 ? -85.189  30.233  -38.609  1.00 129.26 ? 440 ASP C OD1 1 
ATOM 9949  O OD2 . ASP C 1 471 ? -84.335  28.393  -37.747  1.00 127.43 ? 440 ASP C OD2 1 
ATOM 9950  N N   . MET C 1 472 ? -82.272  30.375  -40.233  1.00 118.00 ? 441 MET C N   1 
ATOM 9951  C CA  . MET C 1 472 ? -80.938  30.721  -39.802  1.00 116.24 ? 441 MET C CA  1 
ATOM 9952  C C   . MET C 1 472 ? -80.938  31.765  -38.704  1.00 118.56 ? 441 MET C C   1 
ATOM 9953  O O   . MET C 1 472 ? -79.909  32.372  -38.446  1.00 118.69 ? 441 MET C O   1 
ATOM 9954  C CB  . MET C 1 472 ? -80.128  31.238  -40.993  1.00 114.62 ? 441 MET C CB  1 
ATOM 9955  C CG  . MET C 1 472 ? -80.364  30.478  -42.274  1.00 112.32 ? 441 MET C CG  1 
ATOM 9956  S SD  . MET C 1 472 ? -78.875  30.015  -43.147  1.00 109.55 ? 441 MET C SD  1 
ATOM 9957  C CE  . MET C 1 472 ? -77.984  31.575  -43.199  1.00 111.45 ? 441 MET C CE  1 
ATOM 9958  N N   . LEU C 1 473 ? -82.073  31.997  -38.053  1.00 121.05 ? 442 LEU C N   1 
ATOM 9959  C CA  . LEU C 1 473 ? -82.089  32.981  -36.961  1.00 124.23 ? 442 LEU C CA  1 
ATOM 9960  C C   . LEU C 1 473 ? -81.192  32.473  -35.813  1.00 124.76 ? 442 LEU C C   1 
ATOM 9961  O O   . LEU C 1 473 ? -80.653  33.276  -35.042  1.00 127.28 ? 442 LEU C O   1 
ATOM 9962  C CB  . LEU C 1 473 ? -83.514  33.351  -36.493  1.00 126.72 ? 442 LEU C CB  1 
ATOM 9963  N N   . GLU C 1 474 ? -81.007  31.147  -35.738  1.00 122.96 ? 443 GLU C N   1 
ATOM 9964  C CA  . GLU C 1 474 ? -80.179  30.518  -34.700  1.00 123.32 ? 443 GLU C CA  1 
ATOM 9965  C C   . GLU C 1 474 ? -79.034  29.673  -35.274  1.00 120.06 ? 443 GLU C C   1 
ATOM 9966  O O   . GLU C 1 474 ? -78.672  28.620  -34.732  1.00 119.90 ? 443 GLU C O   1 
ATOM 9967  C CB  . GLU C 1 474 ? -81.041  29.698  -33.750  1.00 125.11 ? 443 GLU C CB  1 
ATOM 9968  C CG  . GLU C 1 474 ? -81.770  30.538  -32.721  1.00 131.47 ? 443 GLU C CG  1 
ATOM 9969  C CD  . GLU C 1 474 ? -83.088  29.904  -32.271  1.00 137.21 ? 443 GLU C CD  1 
ATOM 9970  O OE1 . GLU C 1 474 ? -83.157  28.647  -32.250  1.00 137.56 ? 443 GLU C OE1 1 
ATOM 9971  O OE2 . GLU C 1 474 ? -84.051  30.659  -31.939  1.00 141.33 ? 443 GLU C OE2 1 
ATOM 9972  N N   . LEU C 1 475 ? -78.466  30.155  -36.375  1.00 117.65 ? 444 LEU C N   1 
ATOM 9973  C CA  . LEU C 1 475 ? -77.302  29.546  -36.980  1.00 114.62 ? 444 LEU C CA  1 
ATOM 9974  C C   . LEU C 1 475 ? -76.093  30.173  -36.378  1.00 116.54 ? 444 LEU C C   1 
ATOM 9975  O O   . LEU C 1 475 ? -76.122  31.341  -36.007  1.00 118.87 ? 444 LEU C O   1 
ATOM 9976  C CB  . LEU C 1 475 ? -77.260  29.851  -38.454  1.00 112.25 ? 444 LEU C CB  1 
ATOM 9977  C CG  . LEU C 1 475 ? -76.123  29.176  -39.173  1.00 108.63 ? 444 LEU C CG  1 
ATOM 9978  C CD1 . LEU C 1 475 ? -76.321  27.685  -39.036  1.00 107.23 ? 444 LEU C CD1 1 
ATOM 9979  C CD2 . LEU C 1 475 ? -76.161  29.592  -40.595  1.00 105.94 ? 444 LEU C CD2 1 
ATOM 9980  N N   . ASP C 1 476 ? -75.017  29.398  -36.316  1.00 116.22 ? 445 ASP C N   1 
ATOM 9981  C CA  . ASP C 1 476 ? -73.753  29.859  -35.774  1.00 117.99 ? 445 ASP C CA  1 
ATOM 9982  C C   . ASP C 1 476 ? -72.603  29.706  -36.773  1.00 115.92 ? 445 ASP C C   1 
ATOM 9983  O O   . ASP C 1 476 ? -71.757  30.596  -36.902  1.00 117.01 ? 445 ASP C O   1 
ATOM 9984  C CB  . ASP C 1 476 ? -73.459  29.093  -34.499  1.00 120.36 ? 445 ASP C CB  1 
ATOM 9985  C CG  . ASP C 1 476 ? -72.972  29.989  -33.415  1.00 126.94 ? 445 ASP C CG  1 
ATOM 9986  O OD1 . ASP C 1 476 ? -73.451  31.155  -33.395  1.00 130.33 ? 445 ASP C OD1 1 
ATOM 9987  O OD2 . ASP C 1 476 ? -72.111  29.542  -32.600  1.00 133.10 ? 445 ASP C OD2 1 
ATOM 9988  N N   . HIS C 1 477 ? -72.617  28.578  -37.485  1.00 112.89 ? 446 HIS C N   1 
ATOM 9989  C CA  . HIS C 1 477 ? -71.579  28.174  -38.414  1.00 111.43 ? 446 HIS C CA  1 
ATOM 9990  C C   . HIS C 1 477 ? -72.156  27.095  -39.319  1.00 108.12 ? 446 HIS C C   1 
ATOM 9991  O O   . HIS C 1 477 ? -72.639  26.080  -38.839  1.00 107.43 ? 446 HIS C O   1 
ATOM 9992  C CB  . HIS C 1 477 ? -70.393  27.613  -37.620  1.00 113.96 ? 446 HIS C CB  1 
ATOM 9993  C CG  . HIS C 1 477 ? -69.329  26.983  -38.462  1.00 114.77 ? 446 HIS C CG  1 
ATOM 9994  N ND1 . HIS C 1 477 ? -68.561  27.699  -39.356  1.00 116.77 ? 446 HIS C ND1 1 
ATOM 9995  C CD2 . HIS C 1 477 ? -68.895  25.704  -38.534  1.00 115.26 ? 446 HIS C CD2 1 
ATOM 9996  C CE1 . HIS C 1 477 ? -67.712  26.886  -39.957  1.00 116.69 ? 446 HIS C CE1 1 
ATOM 9997  N NE2 . HIS C 1 477 ? -67.894  25.670  -39.474  1.00 116.45 ? 446 HIS C NE2 1 
ATOM 9998  N N   . LEU C 1 478 ? -72.133  27.324  -40.626  1.00 106.33 ? 447 LEU C N   1 
ATOM 9999  C CA  . LEU C 1 478 ? -72.615  26.322  -41.581  1.00 104.03 ? 447 LEU C CA  1 
ATOM 10000 C C   . LEU C 1 478 ? -71.604  26.087  -42.667  1.00 104.12 ? 447 LEU C C   1 
ATOM 10001 O O   . LEU C 1 478 ? -71.115  27.022  -43.300  1.00 104.80 ? 447 LEU C O   1 
ATOM 10002 C CB  . LEU C 1 478 ? -73.938  26.727  -42.241  1.00 102.92 ? 447 LEU C CB  1 
ATOM 10003 C CG  . LEU C 1 478 ? -74.321  25.942  -43.502  1.00 100.00 ? 447 LEU C CG  1 
ATOM 10004 C CD1 . LEU C 1 478 ? -74.966  24.633  -43.129  1.00 98.48  ? 447 LEU C CD1 1 
ATOM 10005 C CD2 . LEU C 1 478 ? -75.221  26.745  -44.382  1.00 97.37  ? 447 LEU C CD2 1 
ATOM 10006 N N   . THR C 1 479 ? -71.323  24.822  -42.910  1.00 103.72 ? 448 THR C N   1 
ATOM 10007 C CA  . THR C 1 479 ? -70.302  24.477  -43.870  1.00 104.30 ? 448 THR C CA  1 
ATOM 10008 C C   . THR C 1 479 ? -70.738  23.209  -44.612  1.00 103.16 ? 448 THR C C   1 
ATOM 10009 O O   . THR C 1 479 ? -71.076  22.170  -44.017  1.00 102.43 ? 448 THR C O   1 
ATOM 10010 C CB  . THR C 1 479 ? -68.843  24.515  -43.207  1.00 106.49 ? 448 THR C CB  1 
ATOM 10011 O OG1 . THR C 1 479 ? -67.831  24.066  -44.112  1.00 107.40 ? 448 THR C OG1 1 
ATOM 10012 C CG2 . THR C 1 479 ? -68.772  23.707  -41.936  1.00 107.61 ? 448 THR C CG2 1 
ATOM 10013 N N   . VAL C 1 480 ? -70.811  23.359  -45.926  1.00 103.01 ? 449 VAL C N   1 
ATOM 10014 C CA  . VAL C 1 480 ? -71.306  22.329  -46.799  1.00 102.76 ? 449 VAL C CA  1 
ATOM 10015 C C   . VAL C 1 480 ? -70.288  22.117  -47.886  1.00 104.39 ? 449 VAL C C   1 
ATOM 10016 O O   . VAL C 1 480 ? -69.730  23.077  -48.407  1.00 105.37 ? 449 VAL C O   1 
ATOM 10017 C CB  . VAL C 1 480 ? -72.592  22.771  -47.480  1.00 102.01 ? 449 VAL C CB  1 
ATOM 10018 C CG1 . VAL C 1 480 ? -73.387  21.574  -47.885  1.00 102.13 ? 449 VAL C CG1 1 
ATOM 10019 C CG2 . VAL C 1 480 ? -73.420  23.643  -46.558  1.00 101.86 ? 449 VAL C CG2 1 
ATOM 10020 N N   . SER C 1 481 ? -70.029  20.860  -48.221  1.00 105.39 ? 450 SER C N   1 
ATOM 10021 C CA  . SER C 1 481 ? -69.247  20.557  -49.415  1.00 107.70 ? 450 SER C CA  1 
ATOM 10022 C C   . SER C 1 481 ? -69.591  19.195  -50.009  1.00 108.17 ? 450 SER C C   1 
ATOM 10023 O O   . SER C 1 481 ? -69.946  18.239  -49.302  1.00 107.04 ? 450 SER C O   1 
ATOM 10024 C CB  . SER C 1 481 ? -67.732  20.736  -49.186  1.00 109.69 ? 450 SER C CB  1 
ATOM 10025 O OG  . SER C 1 481 ? -67.118  19.545  -48.732  1.00 111.34 ? 450 SER C OG  1 
ATOM 10026 N N   . GLY C 1 482 ? -69.486  19.137  -51.327  1.00 110.05 ? 451 GLY C N   1 
ATOM 10027 C CA  . GLY C 1 482 ? -69.888  17.965  -52.061  1.00 111.60 ? 451 GLY C CA  1 
ATOM 10028 C C   . GLY C 1 482 ? -71.184  18.251  -52.773  1.00 111.50 ? 451 GLY C C   1 
ATOM 10029 O O   . GLY C 1 482 ? -71.573  19.419  -52.927  1.00 111.07 ? 451 GLY C O   1 
ATOM 10030 N N   . ASP C 1 483 ? -71.839  17.177  -53.206  1.00 112.27 ? 452 ASP C N   1 
ATOM 10031 C CA  . ASP C 1 483 ? -73.108  17.259  -53.889  1.00 112.78 ? 452 ASP C CA  1 
ATOM 10032 C C   . ASP C 1 483 ? -74.216  17.293  -52.855  1.00 110.30 ? 452 ASP C C   1 
ATOM 10033 O O   . ASP C 1 483 ? -74.807  16.267  -52.509  1.00 110.39 ? 452 ASP C O   1 
ATOM 10034 C CB  . ASP C 1 483 ? -73.269  16.062  -54.811  1.00 115.64 ? 452 ASP C CB  1 
ATOM 10035 C CG  . ASP C 1 483 ? -74.052  16.391  -56.053  1.00 119.74 ? 452 ASP C CG  1 
ATOM 10036 O OD1 . ASP C 1 483 ? -74.085  17.585  -56.436  1.00 121.53 ? 452 ASP C OD1 1 
ATOM 10037 O OD2 . ASP C 1 483 ? -74.626  15.450  -56.654  1.00 124.76 ? 452 ASP C OD2 1 
ATOM 10038 N N   . VAL C 1 484 ? -74.485  18.479  -52.337  1.00 108.53 ? 453 VAL C N   1 
ATOM 10039 C CA  . VAL C 1 484 ? -75.516  18.610  -51.337  1.00 106.96 ? 453 VAL C CA  1 
ATOM 10040 C C   . VAL C 1 484 ? -76.678  19.462  -51.791  1.00 107.83 ? 453 VAL C C   1 
ATOM 10041 O O   . VAL C 1 484 ? -76.519  20.586  -52.246  1.00 108.41 ? 453 VAL C O   1 
ATOM 10042 C CB  . VAL C 1 484 ? -74.958  19.058  -49.993  1.00 104.94 ? 453 VAL C CB  1 
ATOM 10043 C CG1 . VAL C 1 484 ? -75.995  19.785  -49.156  1.00 103.70 ? 453 VAL C CG1 1 
ATOM 10044 C CG2 . VAL C 1 484 ? -74.513  17.850  -49.260  1.00 105.32 ? 453 VAL C CG2 1 
ATOM 10045 N N   . THR C 1 485 ? -77.859  18.890  -51.660  1.00 108.34 ? 454 THR C N   1 
ATOM 10046 C CA  . THR C 1 485 ? -79.055  19.580  -51.991  1.00 109.34 ? 454 THR C CA  1 
ATOM 10047 C C   . THR C 1 485 ? -79.940  19.627  -50.745  1.00 108.12 ? 454 THR C C   1 
ATOM 10048 O O   . THR C 1 485 ? -79.818  18.778  -49.857  1.00 106.78 ? 454 THR C O   1 
ATOM 10049 C CB  . THR C 1 485 ? -79.719  18.881  -53.148  1.00 112.16 ? 454 THR C CB  1 
ATOM 10050 O OG1 . THR C 1 485 ? -81.143  18.927  -52.968  1.00 115.32 ? 454 THR C OG1 1 
ATOM 10051 C CG2 . THR C 1 485 ? -79.264  17.430  -53.216  1.00 112.02 ? 454 THR C CG2 1 
ATOM 10052 N N   . PHE C 1 486 ? -80.812  20.639  -50.696  1.00 108.81 ? 455 PHE C N   1 
ATOM 10053 C CA  . PHE C 1 486 ? -81.709  20.903  -49.560  1.00 108.35 ? 455 PHE C CA  1 
ATOM 10054 C C   . PHE C 1 486 ? -83.192  20.787  -49.824  1.00 110.86 ? 455 PHE C C   1 
ATOM 10055 O O   . PHE C 1 486 ? -83.647  20.981  -50.941  1.00 113.41 ? 455 PHE C O   1 
ATOM 10056 C CB  . PHE C 1 486 ? -81.456  22.289  -49.051  1.00 107.10 ? 455 PHE C CB  1 
ATOM 10057 C CG  . PHE C 1 486 ? -80.208  22.394  -48.304  1.00 104.98 ? 455 PHE C CG  1 
ATOM 10058 C CD1 . PHE C 1 486 ? -80.112  21.851  -47.033  1.00 103.99 ? 455 PHE C CD1 1 
ATOM 10059 C CD2 . PHE C 1 486 ? -79.105  22.992  -48.871  1.00 104.64 ? 455 PHE C CD2 1 
ATOM 10060 C CE1 . PHE C 1 486 ? -78.949  21.943  -46.319  1.00 102.69 ? 455 PHE C CE1 1 
ATOM 10061 C CE2 . PHE C 1 486 ? -77.924  23.094  -48.166  1.00 103.54 ? 455 PHE C CE2 1 
ATOM 10062 C CZ  . PHE C 1 486 ? -77.843  22.569  -46.889  1.00 102.95 ? 455 PHE C CZ  1 
ATOM 10063 N N   . GLY C 1 487 ? -83.948  20.487  -48.778  1.00 111.01 ? 456 GLY C N   1 
ATOM 10064 C CA  . GLY C 1 487 ? -85.395  20.380  -48.905  1.00 114.22 ? 456 GLY C CA  1 
ATOM 10065 C C   . GLY C 1 487 ? -86.041  21.734  -48.694  1.00 115.56 ? 456 GLY C C   1 
ATOM 10066 O O   . GLY C 1 487 ? -85.348  22.765  -48.689  1.00 114.32 ? 456 GLY C O   1 
ATOM 10067 N N   . LYS C 1 488 ? -87.364  21.735  -48.519  1.00 118.39 ? 457 LYS C N   1 
ATOM 10068 C CA  . LYS C 1 488 ? -88.091  22.960  -48.177  1.00 120.07 ? 457 LYS C CA  1 
ATOM 10069 C C   . LYS C 1 488 ? -88.160  23.178  -46.662  1.00 119.14 ? 457 LYS C C   1 
ATOM 10070 O O   . LYS C 1 488 ? -88.373  22.232  -45.902  1.00 118.82 ? 457 LYS C O   1 
ATOM 10071 C CB  . LYS C 1 488 ? -89.506  22.960  -48.785  1.00 124.59 ? 457 LYS C CB  1 
ATOM 10072 C CG  . LYS C 1 488 ? -89.577  23.194  -50.290  1.00 126.41 ? 457 LYS C CG  1 
ATOM 10073 N N   . ASN C 1 489 ? -87.972  24.425  -46.231  1.00 119.10 ? 458 ASN C N   1 
ATOM 10074 C CA  . ASN C 1 489 ? -88.153  24.809  -44.824  1.00 119.42 ? 458 ASN C CA  1 
ATOM 10075 C C   . ASN C 1 489 ? -87.216  24.065  -43.866  1.00 116.35 ? 458 ASN C C   1 
ATOM 10076 O O   . ASN C 1 489 ? -87.640  23.535  -42.824  1.00 116.83 ? 458 ASN C O   1 
ATOM 10077 C CB  . ASN C 1 489 ? -89.613  24.605  -44.399  1.00 123.48 ? 458 ASN C CB  1 
ATOM 10078 C CG  . ASN C 1 489 ? -90.581  25.452  -45.198  1.00 128.11 ? 458 ASN C CG  1 
ATOM 10079 O OD1 . ASN C 1 489 ? -90.569  25.460  -46.432  1.00 129.97 ? 458 ASN C OD1 1 
ATOM 10080 N ND2 . ASN C 1 489 ? -91.440  26.167  -44.492  1.00 132.81 ? 458 ASN C ND2 1 
ATOM 10081 N N   . VAL C 1 490 ? -85.936  24.020  -44.232  1.00 113.32 ? 459 VAL C N   1 
ATOM 10082 C CA  . VAL C 1 490 ? -84.941  23.379  -43.382  1.00 110.65 ? 459 VAL C CA  1 
ATOM 10083 C C   . VAL C 1 490 ? -84.533  24.359  -42.293  1.00 110.63 ? 459 VAL C C   1 
ATOM 10084 O O   . VAL C 1 490 ? -84.422  25.563  -42.526  1.00 111.26 ? 459 VAL C O   1 
ATOM 10085 C CB  . VAL C 1 490 ? -83.708  22.890  -44.155  1.00 108.01 ? 459 VAL C CB  1 
ATOM 10086 C CG1 . VAL C 1 490 ? -83.371  21.501  -43.712  1.00 106.30 ? 459 VAL C CG1 1 
ATOM 10087 C CG2 . VAL C 1 490 ? -83.971  22.877  -45.637  1.00 108.50 ? 459 VAL C CG2 1 
ATOM 10088 N N   . SER C 1 491 ? -84.356  23.850  -41.089  1.00 110.38 ? 460 SER C N   1 
ATOM 10089 C CA  . SER C 1 491 ? -83.902  24.688  -40.010  1.00 110.63 ? 460 SER C CA  1 
ATOM 10090 C C   . SER C 1 491 ? -82.443  24.319  -39.750  1.00 108.71 ? 460 SER C C   1 
ATOM 10091 O O   . SER C 1 491 ? -82.111  23.137  -39.568  1.00 108.67 ? 460 SER C O   1 
ATOM 10092 C CB  . SER C 1 491 ? -84.770  24.439  -38.783  1.00 112.95 ? 460 SER C CB  1 
ATOM 10093 O OG  . SER C 1 491 ? -84.777  25.550  -37.914  1.00 114.68 ? 460 SER C OG  1 
ATOM 10094 N N   . LEU C 1 492 ? -81.555  25.305  -39.775  1.00 107.57 ? 461 LEU C N   1 
ATOM 10095 C CA  . LEU C 1 492 ? -80.174  25.052  -39.387  1.00 105.73 ? 461 LEU C CA  1 
ATOM 10096 C C   . LEU C 1 492 ? -79.935  25.871  -38.140  1.00 107.69 ? 461 LEU C C   1 
ATOM 10097 O O   . LEU C 1 492 ? -80.300  27.057  -38.087  1.00 109.05 ? 461 LEU C O   1 
ATOM 10098 C CB  . LEU C 1 492 ? -79.225  25.415  -40.513  1.00 103.71 ? 461 LEU C CB  1 
ATOM 10099 C CG  . LEU C 1 492 ? -79.734  24.845  -41.836  1.00 101.79 ? 461 LEU C CG  1 
ATOM 10100 C CD1 . LEU C 1 492 ? -79.002  25.409  -43.023  1.00 100.39 ? 461 LEU C CD1 1 
ATOM 10101 C CD2 . LEU C 1 492 ? -79.652  23.348  -41.830  1.00 100.73 ? 461 LEU C CD2 1 
ATOM 10102 N N   . LYS C 1 493 ? -79.387  25.219  -37.115  1.00 108.21 ? 462 LYS C N   1 
ATOM 10103 C CA  . LYS C 1 493 ? -79.274  25.817  -35.786  1.00 110.42 ? 462 LYS C CA  1 
ATOM 10104 C C   . LYS C 1 493 ? -77.971  25.441  -35.118  1.00 110.36 ? 462 LYS C C   1 
ATOM 10105 O O   . LYS C 1 493 ? -77.851  24.345  -34.585  1.00 110.69 ? 462 LYS C O   1 
ATOM 10106 C CB  . LYS C 1 493 ? -80.417  25.352  -34.878  1.00 112.54 ? 462 LYS C CB  1 
ATOM 10107 C CG  . LYS C 1 493 ? -81.814  25.879  -35.186  1.00 114.39 ? 462 LYS C CG  1 
ATOM 10108 C CD  . LYS C 1 493 ? -82.700  25.686  -33.943  1.00 119.51 ? 462 LYS C CD  1 
ATOM 10109 C CE  . LYS C 1 493 ? -84.054  25.009  -34.246  1.00 121.37 ? 462 LYS C CE  1 
ATOM 10110 N NZ  . LYS C 1 493 ? -84.584  24.139  -33.116  1.00 123.49 ? 462 LYS C NZ  1 
ATOM 10111 N N   . GLY C 1 494 ? -77.003  26.348  -35.134  1.00 110.40 ? 463 GLY C N   1 
ATOM 10112 C CA  . GLY C 1 494 ? -75.743  26.138  -34.402  1.00 111.43 ? 463 GLY C CA  1 
ATOM 10113 C C   . GLY C 1 494 ? -74.558  25.838  -35.295  1.00 109.35 ? 463 GLY C C   1 
ATOM 10114 O O   . GLY C 1 494 ? -74.308  26.558  -36.254  1.00 108.51 ? 463 GLY C O   1 
ATOM 10115 N N   . THR C 1 495 ? -73.805  24.789  -35.002  1.00 109.00 ? 464 THR C N   1 
ATOM 10116 C CA  . THR C 1 495 ? -72.836  24.382  -36.004  1.00 107.02 ? 464 THR C CA  1 
ATOM 10117 C C   . THR C 1 495 ? -73.336  23.190  -36.802  1.00 103.99 ? 464 THR C C   1 
ATOM 10118 O O   . THR C 1 495 ? -73.812  22.199  -36.272  1.00 103.58 ? 464 THR C O   1 
ATOM 10119 C CB  . THR C 1 495 ? -71.371  24.267  -35.498  1.00 109.40 ? 464 THR C CB  1 
ATOM 10120 O OG1 . THR C 1 495 ? -71.120  22.949  -35.008  1.00 111.53 ? 464 THR C OG1 1 
ATOM 10121 C CG2 . THR C 1 495 ? -71.057  25.316  -34.404  1.00 112.59 ? 464 THR C CG2 1 
ATOM 10122 N N   . VAL C 1 496 ? -73.275  23.350  -38.107  1.00 101.88 ? 465 VAL C N   1 
ATOM 10123 C CA  . VAL C 1 496 ? -73.812  22.390  -39.028  1.00 99.76  ? 465 VAL C CA  1 
ATOM 10124 C C   . VAL C 1 496 ? -72.805  22.230  -40.142  1.00 99.08  ? 465 VAL C C   1 
ATOM 10125 O O   . VAL C 1 496 ? -72.401  23.180  -40.832  1.00 98.76  ? 465 VAL C O   1 
ATOM 10126 C CB  . VAL C 1 496 ? -75.163  22.837  -39.583  1.00 98.75  ? 465 VAL C CB  1 
ATOM 10127 C CG1 . VAL C 1 496 ? -75.648  21.891  -40.667  1.00 96.81  ? 465 VAL C CG1 1 
ATOM 10128 C CG2 . VAL C 1 496 ? -76.173  22.908  -38.459  1.00 100.62 ? 465 VAL C CG2 1 
ATOM 10129 N N   . ILE C 1 497 ? -72.418  20.979  -40.290  1.00 98.78  ? 466 ILE C N   1 
ATOM 10130 C CA  . ILE C 1 497 ? -71.397  20.559  -41.190  1.00 98.20  ? 466 ILE C CA  1 
ATOM 10131 C C   . ILE C 1 497 ? -72.028  19.501  -42.096  1.00 97.22  ? 466 ILE C C   1 
ATOM 10132 O O   . ILE C 1 497 ? -72.622  18.531  -41.618  1.00 96.98  ? 466 ILE C O   1 
ATOM 10133 C CB  . ILE C 1 497 ? -70.242  20.028  -40.336  1.00 99.89  ? 466 ILE C CB  1 
ATOM 10134 C CG1 . ILE C 1 497 ? -69.504  21.227  -39.735  1.00 99.83  ? 466 ILE C CG1 1 
ATOM 10135 C CG2 . ILE C 1 497 ? -69.372  19.045  -41.107  1.00 100.57 ? 466 ILE C CG2 1 
ATOM 10136 C CD1 . ILE C 1 497 ? -68.035  21.073  -39.659  1.00 101.51 ? 466 ILE C CD1 1 
ATOM 10137 N N   . ILE C 1 498 ? -71.967  19.712  -43.401  1.00 96.79  ? 467 ILE C N   1 
ATOM 10138 C CA  . ILE C 1 498 ? -72.489  18.694  -44.301  1.00 97.07  ? 467 ILE C CA  1 
ATOM 10139 C C   . ILE C 1 498 ? -71.465  18.327  -45.361  1.00 98.37  ? 467 ILE C C   1 
ATOM 10140 O O   . ILE C 1 498 ? -71.119  19.130  -46.224  1.00 98.92  ? 467 ILE C O   1 
ATOM 10141 C CB  . ILE C 1 498 ? -73.809  19.103  -44.954  1.00 96.24  ? 467 ILE C CB  1 
ATOM 10142 C CG1 . ILE C 1 498 ? -74.801  19.572  -43.901  1.00 96.31  ? 467 ILE C CG1 1 
ATOM 10143 C CG2 . ILE C 1 498 ? -74.415  17.925  -45.675  1.00 96.61  ? 467 ILE C CG2 1 
ATOM 10144 C CD1 . ILE C 1 498 ? -75.816  20.539  -44.442  1.00 96.59  ? 467 ILE C CD1 1 
ATOM 10145 N N   . ILE C 1 499 ? -70.967  17.106  -45.294  1.00 99.60  ? 468 ILE C N   1 
ATOM 10146 C CA  . ILE C 1 499 ? -69.884  16.741  -46.162  1.00 101.43 ? 468 ILE C CA  1 
ATOM 10147 C C   . ILE C 1 499 ? -70.191  15.460  -46.888  1.00 102.74 ? 468 ILE C C   1 
ATOM 10148 O O   . ILE C 1 499 ? -70.375  14.404  -46.284  1.00 103.41 ? 468 ILE C O   1 
ATOM 10149 C CB  . ILE C 1 499 ? -68.562  16.686  -45.384  1.00 102.87 ? 468 ILE C CB  1 
ATOM 10150 C CG1 . ILE C 1 499 ? -68.130  18.110  -45.083  1.00 102.66 ? 468 ILE C CG1 1 
ATOM 10151 C CG2 . ILE C 1 499 ? -67.460  16.009  -46.184  1.00 104.83 ? 468 ILE C CG2 1 
ATOM 10152 C CD1 . ILE C 1 499 ? -67.112  18.222  -44.012  1.00 104.93 ? 468 ILE C CD1 1 
ATOM 10153 N N   . ALA C 1 500 ? -70.269  15.572  -48.202  1.00 103.84 ? 469 ALA C N   1 
ATOM 10154 C CA  . ALA C 1 500 ? -70.300  14.407  -49.048  1.00 105.86 ? 469 ALA C CA  1 
ATOM 10155 C C   . ALA C 1 500 ? -68.993  14.337  -49.843  1.00 108.67 ? 469 ALA C C   1 
ATOM 10156 O O   . ALA C 1 500 ? -68.604  15.311  -50.490  1.00 109.16 ? 469 ALA C O   1 
ATOM 10157 C CB  . ALA C 1 500 ? -71.460  14.516  -49.966  1.00 105.67 ? 469 ALA C CB  1 
ATOM 10158 N N   . ASN C 1 501 ? -68.310  13.199  -49.804  1.00 110.97 ? 470 ASN C N   1 
ATOM 10159 C CA  . ASN C 1 501 ? -67.084  13.057  -50.589  1.00 114.52 ? 470 ASN C CA  1 
ATOM 10160 C C   . ASN C 1 501 ? -67.335  12.976  -52.096  1.00 116.22 ? 470 ASN C C   1 
ATOM 10161 O O   . ASN C 1 501 ? -68.481  13.085  -52.545  1.00 115.36 ? 470 ASN C O   1 
ATOM 10162 C CB  . ASN C 1 501 ? -66.267  11.868  -50.099  1.00 117.08 ? 470 ASN C CB  1 
ATOM 10163 C CG  . ASN C 1 501 ? -65.674  12.106  -48.721  1.00 117.59 ? 470 ASN C CG  1 
ATOM 10164 O OD1 . ASN C 1 501 ? -66.059  13.051  -48.019  1.00 114.90 ? 470 ASN C OD1 1 
ATOM 10165 N ND2 . ASN C 1 501 ? -64.726  11.252  -48.328  1.00 121.45 ? 470 ASN C ND2 1 
ATOM 10166 N N   . HIS C 1 502 ? -66.266  12.807  -52.876  1.00 119.32 ? 471 HIS C N   1 
ATOM 10167 C CA  . HIS C 1 502 ? -66.389  12.727  -54.332  1.00 121.42 ? 471 HIS C CA  1 
ATOM 10168 C C   . HIS C 1 502 ? -67.130  11.454  -54.714  1.00 121.72 ? 471 HIS C C   1 
ATOM 10169 O O   . HIS C 1 502 ? -66.985  10.429  -54.054  1.00 122.14 ? 471 HIS C O   1 
ATOM 10170 C CB  . HIS C 1 502 ? -65.016  12.749  -54.993  1.00 125.62 ? 471 HIS C CB  1 
ATOM 10171 C CG  . HIS C 1 502 ? -65.060  12.935  -56.477  1.00 129.61 ? 471 HIS C CG  1 
ATOM 10172 N ND1 . HIS C 1 502 ? -64.700  11.942  -57.366  1.00 134.77 ? 471 HIS C ND1 1 
ATOM 10173 C CD2 . HIS C 1 502 ? -65.411  14.005  -57.230  1.00 130.71 ? 471 HIS C CD2 1 
ATOM 10174 C CE1 . HIS C 1 502 ? -64.821  12.394  -58.603  1.00 137.65 ? 471 HIS C CE1 1 
ATOM 10175 N NE2 . HIS C 1 502 ? -65.255  13.641  -58.547  1.00 135.73 ? 471 HIS C NE2 1 
ATOM 10176 N N   . GLY C 1 503 ? -67.935  11.537  -55.770  1.00 121.88 ? 472 GLY C N   1 
ATOM 10177 C CA  . GLY C 1 503 ? -68.782  10.422  -56.220  1.00 121.83 ? 472 GLY C CA  1 
ATOM 10178 C C   . GLY C 1 503 ? -70.022  10.235  -55.366  1.00 117.43 ? 472 GLY C C   1 
ATOM 10179 O O   . GLY C 1 503 ? -70.726  9.232   -55.498  1.00 118.40 ? 472 GLY C O   1 
ATOM 10180 N N   . ASP C 1 504 ? -70.284  11.218  -54.510  1.00 112.77 ? 473 ASP C N   1 
ATOM 10181 C CA  . ASP C 1 504 ? -71.264  11.086  -53.462  1.00 109.20 ? 473 ASP C CA  1 
ATOM 10182 C C   . ASP C 1 504 ? -72.156  12.274  -53.371  1.00 105.85 ? 473 ASP C C   1 
ATOM 10183 O O   . ASP C 1 504 ? -71.766  13.366  -53.776  1.00 105.72 ? 473 ASP C O   1 
ATOM 10184 C CB  . ASP C 1 504 ? -70.572  10.938  -52.129  1.00 108.36 ? 473 ASP C CB  1 
ATOM 10185 C CG  . ASP C 1 504 ? -70.353  9.499   -51.750  1.00 112.34 ? 473 ASP C CG  1 
ATOM 10186 O OD1 . ASP C 1 504 ? -70.714  8.590   -52.554  1.00 116.71 ? 473 ASP C OD1 1 
ATOM 10187 O OD2 . ASP C 1 504 ? -69.819  9.286   -50.629  1.00 114.23 ? 473 ASP C OD2 1 
ATOM 10188 N N   . ARG C 1 505 ? -73.329  12.050  -52.774  1.00 102.95 ? 474 ARG C N   1 
ATOM 10189 C CA  . ARG C 1 505 ? -74.442  12.990  -52.779  1.00 100.14 ? 474 ARG C CA  1 
ATOM 10190 C C   . ARG C 1 505 ? -75.179  12.895  -51.465  1.00 97.01  ? 474 ARG C C   1 
ATOM 10191 O O   . ARG C 1 505 ? -75.270  11.824  -50.893  1.00 97.07  ? 474 ARG C O   1 
ATOM 10192 C CB  . ARG C 1 505 ? -75.377  12.596  -53.903  1.00 102.59 ? 474 ARG C CB  1 
ATOM 10193 C CG  . ARG C 1 505 ? -76.438  13.578  -54.272  1.00 102.90 ? 474 ARG C CG  1 
ATOM 10194 C CD  . ARG C 1 505 ? -77.065  13.048  -55.517  1.00 107.68 ? 474 ARG C CD  1 
ATOM 10195 N NE  . ARG C 1 505 ? -78.325  13.678  -55.827  1.00 109.93 ? 474 ARG C NE  1 
ATOM 10196 C CZ  . ARG C 1 505 ? -78.687  13.993  -57.062  1.00 115.22 ? 474 ARG C CZ  1 
ATOM 10197 N NH1 . ARG C 1 505 ? -77.865  13.757  -58.085  1.00 116.92 ? 474 ARG C NH1 1 
ATOM 10198 N NH2 . ARG C 1 505 ? -79.868  14.559  -57.275  1.00 118.82 ? 474 ARG C NH2 1 
ATOM 10199 N N   . ILE C 1 506 ? -75.693  14.012  -50.975  1.00 94.36  ? 475 ILE C N   1 
ATOM 10200 C CA  . ILE C 1 506 ? -76.514  13.989  -49.783  1.00 92.60  ? 475 ILE C CA  1 
ATOM 10201 C C   . ILE C 1 506 ? -77.668  14.923  -50.035  1.00 92.80  ? 475 ILE C C   1 
ATOM 10202 O O   . ILE C 1 506 ? -77.451  16.061  -50.434  1.00 92.52  ? 475 ILE C O   1 
ATOM 10203 C CB  . ILE C 1 506 ? -75.734  14.453  -48.562  1.00 90.63  ? 475 ILE C CB  1 
ATOM 10204 C CG1 . ILE C 1 506 ? -74.914  13.301  -47.988  1.00 91.22  ? 475 ILE C CG1 1 
ATOM 10205 C CG2 . ILE C 1 506 ? -76.676  14.934  -47.491  1.00 89.23  ? 475 ILE C CG2 1 
ATOM 10206 C CD1 . ILE C 1 506 ? -73.833  13.738  -47.025  1.00 90.13  ? 475 ILE C CD1 1 
ATOM 10207 N N   . ASP C 1 507 ? -78.894  14.434  -49.840  1.00 93.90  ? 476 ASP C N   1 
ATOM 10208 C CA  . ASP C 1 507 ? -80.111  15.236  -50.058  1.00 94.91  ? 476 ASP C CA  1 
ATOM 10209 C C   . ASP C 1 507 ? -80.799  15.407  -48.715  1.00 93.43  ? 476 ASP C C   1 
ATOM 10210 O O   . ASP C 1 507 ? -81.236  14.428  -48.123  1.00 94.28  ? 476 ASP C O   1 
ATOM 10211 C CB  . ASP C 1 507 ? -81.117  14.524  -50.988  1.00 98.36  ? 476 ASP C CB  1 
ATOM 10212 C CG  . ASP C 1 507 ? -80.545  14.161  -52.388  1.00 102.84 ? 476 ASP C CG  1 
ATOM 10213 O OD1 . ASP C 1 507 ? -80.252  15.084  -53.210  1.00 105.57 ? 476 ASP C OD1 1 
ATOM 10214 O OD2 . ASP C 1 507 ? -80.455  12.930  -52.687  1.00 105.47 ? 476 ASP C OD2 1 
ATOM 10215 N N   . ILE C 1 508 ? -80.915  16.630  -48.217  1.00 91.68  ? 477 ILE C N   1 
ATOM 10216 C CA  . ILE C 1 508 ? -81.608  16.829  -46.945  1.00 90.42  ? 477 ILE C CA  1 
ATOM 10217 C C   . ILE C 1 508 ? -83.140  16.835  -47.127  1.00 92.02  ? 477 ILE C C   1 
ATOM 10218 O O   . ILE C 1 508 ? -83.674  17.560  -47.969  1.00 93.46  ? 477 ILE C O   1 
ATOM 10219 C CB  . ILE C 1 508 ? -81.113  18.091  -46.226  1.00 88.94  ? 477 ILE C CB  1 
ATOM 10220 C CG1 . ILE C 1 508 ? -79.812  17.792  -45.521  1.00 87.38  ? 477 ILE C CG1 1 
ATOM 10221 C CG2 . ILE C 1 508 ? -82.093  18.554  -45.190  1.00 90.02  ? 477 ILE C CG2 1 
ATOM 10222 C CD1 . ILE C 1 508 ? -78.651  17.901  -46.421  1.00 88.62  ? 477 ILE C CD1 1 
ATOM 10223 N N   . PRO C 1 509 ? -83.847  16.005  -46.347  1.00 92.05  ? 478 PRO C N   1 
ATOM 10224 C CA  . PRO C 1 509 ? -85.290  15.956  -46.323  1.00 93.95  ? 478 PRO C CA  1 
ATOM 10225 C C   . PRO C 1 509 ? -85.869  17.316  -46.024  1.00 94.08  ? 478 PRO C C   1 
ATOM 10226 O O   . PRO C 1 509 ? -85.299  18.060  -45.211  1.00 92.53  ? 478 PRO C O   1 
ATOM 10227 C CB  . PRO C 1 509 ? -85.575  15.058  -45.133  1.00 94.09  ? 478 PRO C CB  1 
ATOM 10228 C CG  . PRO C 1 509 ? -84.446  14.185  -45.070  1.00 92.98  ? 478 PRO C CG  1 
ATOM 10229 C CD  . PRO C 1 509 ? -83.266  14.992  -45.462  1.00 91.19  ? 478 PRO C CD  1 
ATOM 10230 N N   . PRO C 1 510 ? -87.003  17.646  -46.664  1.00 96.40  ? 479 PRO C N   1 
ATOM 10231 C CA  . PRO C 1 510 ? -87.702  18.868  -46.356  1.00 97.26  ? 479 PRO C CA  1 
ATOM 10232 C C   . PRO C 1 510 ? -88.093  18.948  -44.887  1.00 97.46  ? 479 PRO C C   1 
ATOM 10233 O O   . PRO C 1 510 ? -88.620  17.987  -44.303  1.00 98.52  ? 479 PRO C O   1 
ATOM 10234 C CB  . PRO C 1 510 ? -88.946  18.780  -47.232  1.00 100.91 ? 479 PRO C CB  1 
ATOM 10235 C CG  . PRO C 1 510 ? -88.528  17.985  -48.365  1.00 101.31 ? 479 PRO C CG  1 
ATOM 10236 C CD  . PRO C 1 510 ? -87.660  16.929  -47.766  1.00 99.11  ? 479 PRO C CD  1 
ATOM 10237 N N   . GLY C 1 511 ? -87.790  20.097  -44.297  1.00 96.67  ? 480 GLY C N   1 
ATOM 10238 C CA  . GLY C 1 511 ? -88.304  20.459  -42.983  1.00 97.93  ? 480 GLY C CA  1 
ATOM 10239 C C   . GLY C 1 511 ? -87.498  19.952  -41.817  1.00 95.98  ? 480 GLY C C   1 
ATOM 10240 O O   . GLY C 1 511 ? -87.814  20.283  -40.667  1.00 97.34  ? 480 GLY C O   1 
ATOM 10241 N N   . ALA C 1 512 ? -86.469  19.158  -42.128  1.00 93.31  ? 481 ALA C N   1 
ATOM 10242 C CA  . ALA C 1 512 ? -85.521  18.636  -41.152  1.00 91.18  ? 481 ALA C CA  1 
ATOM 10243 C C   . ALA C 1 512 ? -84.795  19.754  -40.386  1.00 90.03  ? 481 ALA C C   1 
ATOM 10244 O O   . ALA C 1 512 ? -84.440  20.792  -40.952  1.00 89.01  ? 481 ALA C O   1 
ATOM 10245 C CB  . ALA C 1 512 ? -84.542  17.713  -41.831  1.00 89.11  ? 481 ALA C CB  1 
ATOM 10246 N N   . VAL C 1 513 ? -84.617  19.539  -39.084  1.00 106.59 ? 482 VAL C N   1 
ATOM 10247 C CA  . VAL C 1 513 ? -83.977  20.506  -38.202  1.00 109.80 ? 482 VAL C CA  1 
ATOM 10248 C C   . VAL C 1 513 ? -82.629  19.974  -37.776  1.00 109.81 ? 482 VAL C C   1 
ATOM 10249 O O   . VAL C 1 513 ? -82.546  18.928  -37.102  1.00 109.62 ? 482 VAL C O   1 
ATOM 10250 C CB  . VAL C 1 513 ? -84.774  20.762  -36.917  1.00 112.68 ? 482 VAL C CB  1 
ATOM 10251 C CG1 . VAL C 1 513 ? -84.214  21.969  -36.201  1.00 116.52 ? 482 VAL C CG1 1 
ATOM 10252 C CG2 . VAL C 1 513 ? -86.227  20.984  -37.225  1.00 113.03 ? 482 VAL C CG2 1 
ATOM 10253 N N   . LEU C 1 514 ? -81.589  20.722  -38.156  1.00 110.49 ? 483 LEU C N   1 
ATOM 10254 C CA  . LEU C 1 514 ? -80.198  20.412  -37.823  1.00 110.26 ? 483 LEU C CA  1 
ATOM 10255 C C   . LEU C 1 514 ? -79.590  21.381  -36.779  1.00 115.17 ? 483 LEU C C   1 
ATOM 10256 O O   . LEU C 1 514 ? -79.291  22.542  -37.087  1.00 117.13 ? 483 LEU C O   1 
ATOM 10257 C CB  . LEU C 1 514 ? -79.378  20.361  -39.106  1.00 106.97 ? 483 LEU C CB  1 
ATOM 10258 C CG  . LEU C 1 514 ? -80.003  19.486  -40.187  1.00 101.23 ? 483 LEU C CG  1 
ATOM 10259 C CD1 . LEU C 1 514 ? -79.166  19.548  -41.414  1.00 99.34  ? 483 LEU C CD1 1 
ATOM 10260 C CD2 . LEU C 1 514 ? -80.125  18.057  -39.756  1.00 98.13  ? 483 LEU C CD2 1 
ATOM 10261 N N   . GLU C 1 515 ? -79.443  20.890  -35.544  1.00 117.61 ? 484 GLU C N   1 
ATOM 10262 C CA  . GLU C 1 515 ? -78.886  21.668  -34.454  1.00 123.19 ? 484 GLU C CA  1 
ATOM 10263 C C   . GLU C 1 515 ? -77.562  21.029  -34.068  1.00 123.58 ? 484 GLU C C   1 
ATOM 10264 O O   . GLU C 1 515 ? -77.557  19.895  -33.581  1.00 123.68 ? 484 GLU C O   1 
ATOM 10265 C CB  . GLU C 1 515 ? -79.825  21.630  -33.265  1.00 126.45 ? 484 GLU C CB  1 
ATOM 10266 C CG  . GLU C 1 515 ? -79.878  22.923  -32.493  1.00 134.62 ? 484 GLU C CG  1 
ATOM 10267 C CD  . GLU C 1 515 ? -81.038  22.940  -31.484  1.00 142.76 ? 484 GLU C CD  1 
ATOM 10268 O OE1 . GLU C 1 515 ? -80.856  23.514  -30.381  1.00 151.38 ? 484 GLU C OE1 1 
ATOM 10269 O OE2 . GLU C 1 515 ? -82.136  22.383  -31.775  1.00 141.16 ? 484 GLU C OE2 1 
ATOM 10270 N N   . ASN C 1 516 ? -76.446  21.732  -34.300  1.00 124.30 ? 485 ASN C N   1 
ATOM 10271 C CA  . ASN C 1 516 ? -75.115  21.229  -33.950  1.00 123.91 ? 485 ASN C CA  1 
ATOM 10272 C C   . ASN C 1 516 ? -74.929  19.769  -34.311  1.00 119.71 ? 485 ASN C C   1 
ATOM 10273 O O   . ASN C 1 516 ? -74.920  18.906  -33.428  1.00 120.65 ? 485 ASN C O   1 
ATOM 10274 C CB  . ASN C 1 516 ? -74.862  21.418  -32.468  1.00 129.52 ? 485 ASN C CB  1 
ATOM 10275 C CG  . ASN C 1 516 ? -75.138  22.819  -32.020  1.00 134.39 ? 485 ASN C CG  1 
ATOM 10276 O OD1 . ASN C 1 516 ? -74.511  23.774  -32.497  1.00 135.73 ? 485 ASN C OD1 1 
ATOM 10277 N ND2 . ASN C 1 516 ? -76.084  22.964  -31.098  1.00 137.64 ? 485 ASN C ND2 1 
ATOM 10278 N N   . LYS C 1 517 ? -74.799  19.506  -35.614  1.00 115.31 ? 486 LYS C N   1 
ATOM 10279 C CA  . LYS C 1 517 ? -74.676  18.151  -36.133  1.00 111.92 ? 486 LYS C CA  1 
ATOM 10280 C C   . LYS C 1 517 ? -73.688  18.044  -37.280  1.00 109.02 ? 486 LYS C C   1 
ATOM 10281 O O   . LYS C 1 517 ? -73.513  18.994  -38.045  1.00 108.19 ? 486 LYS C O   1 
ATOM 10282 C CB  . LYS C 1 517 ? -76.052  17.620  -36.535  1.00 109.90 ? 486 LYS C CB  1 
ATOM 10283 C CG  . LYS C 1 517 ? -76.950  17.413  -35.317  1.00 114.93 ? 486 LYS C CG  1 
ATOM 10284 C CD  . LYS C 1 517 ? -78.233  16.627  -35.554  1.00 116.17 ? 486 LYS C CD  1 
ATOM 10285 C CE  . LYS C 1 517 ? -78.486  15.729  -34.324  1.00 120.44 ? 486 LYS C CE  1 
ATOM 10286 N NZ  . LYS C 1 517 ? -79.851  15.140  -34.308  1.00 121.61 ? 486 LYS C NZ  1 
ATOM 10287 N N   . ILE C 1 518 ? -73.035  16.883  -37.363  1.00 108.22 ? 487 ILE C N   1 
ATOM 10288 C CA  . ILE C 1 518 ? -72.125  16.531  -38.461  1.00 106.45 ? 487 ILE C CA  1 
ATOM 10289 C C   . ILE C 1 518 ? -72.721  15.452  -39.403  1.00 104.21 ? 487 ILE C C   1 
ATOM 10290 O O   . ILE C 1 518 ? -72.789  14.257  -39.072  1.00 104.53 ? 487 ILE C O   1 
ATOM 10291 C CB  . ILE C 1 518 ? -70.781  16.036  -37.934  1.00 107.68 ? 487 ILE C CB  1 
ATOM 10292 C CG1 . ILE C 1 518 ? -70.021  17.157  -37.260  1.00 110.46 ? 487 ILE C CG1 1 
ATOM 10293 C CG2 . ILE C 1 518 ? -69.926  15.507  -39.056  1.00 105.47 ? 487 ILE C CG2 1 
ATOM 10294 C CD1 . ILE C 1 518 ? -68.896  16.628  -36.401  1.00 113.43 ? 487 ILE C CD1 1 
ATOM 10295 N N   . VAL C 1 519 ? -73.138  15.886  -40.588  1.00 103.02 ? 488 VAL C N   1 
ATOM 10296 C CA  . VAL C 1 519 ? -73.774  14.990  -41.549  1.00 101.57 ? 488 VAL C CA  1 
ATOM 10297 C C   . VAL C 1 519 ? -72.816  14.654  -42.687  1.00 100.66 ? 488 VAL C C   1 
ATOM 10298 O O   . VAL C 1 519 ? -72.175  15.538  -43.275  1.00 100.85 ? 488 VAL C O   1 
ATOM 10299 C CB  . VAL C 1 519 ? -75.064  15.582  -42.117  1.00 100.96 ? 488 VAL C CB  1 
ATOM 10300 C CG1 . VAL C 1 519 ? -76.051  14.471  -42.333  1.00 100.37 ? 488 VAL C CG1 1 
ATOM 10301 C CG2 . VAL C 1 519 ? -75.659  16.618  -41.167  1.00 102.65 ? 488 VAL C CG2 1 
ATOM 10302 N N   . SER C 1 520 ? -72.727  13.372  -43.005  1.00 100.41 ? 489 SER C N   1 
ATOM 10303 C CA  . SER C 1 520 ? -71.552  12.874  -43.701  1.00 100.40 ? 489 SER C CA  1 
ATOM 10304 C C   . SER C 1 520 ? -71.814  11.535  -44.348  1.00 100.01 ? 489 SER C C   1 
ATOM 10305 O O   . SER C 1 520 ? -72.092  10.554  -43.660  1.00 101.17 ? 489 SER C O   1 
ATOM 10306 C CB  . SER C 1 520 ? -70.430  12.725  -42.678  1.00 102.41 ? 489 SER C CB  1 
ATOM 10307 O OG  . SER C 1 520 ? -70.958  12.284  -41.408  1.00 105.14 ? 489 SER C OG  1 
ATOM 10308 N N   . GLY C 1 521 ? -71.735  11.483  -45.669  1.00 99.17  ? 490 GLY C N   1 
ATOM 10309 C CA  . GLY C 1 521 ? -71.941  10.220  -46.348  1.00 99.71  ? 490 GLY C CA  1 
ATOM 10310 C C   . GLY C 1 521 ? -72.733  10.288  -47.621  1.00 99.05  ? 490 GLY C C   1 
ATOM 10311 O O   . GLY C 1 521 ? -72.338  10.944  -48.561  1.00 98.86  ? 490 GLY C O   1 
ATOM 10312 N N   . ASN C 1 522 ? -73.855  9.597   -47.643  1.00 99.52  ? 491 ASN C N   1 
ATOM 10313 C CA  . ASN C 1 522 ? -74.503  9.308   -48.881  1.00 100.59 ? 491 ASN C CA  1 
ATOM 10314 C C   . ASN C 1 522 ? -75.999  9.229   -48.699  1.00 101.09 ? 491 ASN C C   1 
ATOM 10315 O O   . ASN C 1 522 ? -76.498  8.233   -48.150  1.00 102.77 ? 491 ASN C O   1 
ATOM 10316 C CB  . ASN C 1 522 ? -74.014  7.962   -49.366  1.00 102.49 ? 491 ASN C CB  1 
ATOM 10317 C CG  . ASN C 1 522 ? -73.935  7.894   -50.850  1.00 104.82 ? 491 ASN C CG  1 
ATOM 10318 O OD1 . ASN C 1 522 ? -74.124  8.894   -51.549  1.00 105.19 ? 491 ASN C OD1 1 
ATOM 10319 N ND2 . ASN C 1 522 ? -73.633  6.712   -51.361  1.00 109.54 ? 491 ASN C ND2 1 
ATOM 10320 N N   . LEU C 1 523 ? -76.725  10.260  -49.149  1.00 100.24 ? 492 LEU C N   1 
ATOM 10321 C CA  . LEU C 1 523 ? -78.185  10.229  -49.059  1.00 99.53  ? 492 LEU C CA  1 
ATOM 10322 C C   . LEU C 1 523 ? -78.855  10.578  -50.357  1.00 100.48 ? 492 LEU C C   1 
ATOM 10323 O O   . LEU C 1 523 ? -78.950  11.731  -50.716  1.00 99.54  ? 492 LEU C O   1 
ATOM 10324 C CB  . LEU C 1 523 ? -78.700  11.102  -47.912  1.00 97.84  ? 492 LEU C CB  1 
ATOM 10325 C CG  . LEU C 1 523 ? -79.970  10.570  -47.241  1.00 96.43  ? 492 LEU C CG  1 
ATOM 10326 C CD1 . LEU C 1 523 ? -80.083  9.049   -47.301  1.00 95.46  ? 492 LEU C CD1 1 
ATOM 10327 C CD2 . LEU C 1 523 ? -80.026  11.063  -45.815  1.00 94.63  ? 492 LEU C CD2 1 
ATOM 10328 N N   . ARG C 1 524 ? -79.319  9.555   -51.054  1.00 102.99 ? 493 ARG C N   1 
ATOM 10329 C CA  . ARG C 1 524 ? -80.103  9.779   -52.250  1.00 105.91 ? 493 ARG C CA  1 
ATOM 10330 C C   . ARG C 1 524 ? -81.610  9.630   -52.024  1.00 106.29 ? 493 ARG C C   1 
ATOM 10331 O O   . ARG C 1 524 ? -82.113  8.535   -51.681  1.00 107.32 ? 493 ARG C O   1 
ATOM 10332 C CB  . ARG C 1 524 ? -79.632  8.885   -53.388  1.00 109.35 ? 493 ARG C CB  1 
ATOM 10333 C CG  . ARG C 1 524 ? -78.169  9.033   -53.646  1.00 111.58 ? 493 ARG C CG  1 
ATOM 10334 C CD  . ARG C 1 524 ? -77.825  9.396   -55.068  1.00 116.46 ? 493 ARG C CD  1 
ATOM 10335 N NE  . ARG C 1 524 ? -76.372  9.429   -55.104  1.00 118.57 ? 493 ARG C NE  1 
ATOM 10336 C CZ  . ARG C 1 524 ? -75.640  9.506   -56.203  1.00 124.13 ? 493 ARG C CZ  1 
ATOM 10337 N NH1 . ARG C 1 524 ? -76.210  9.568   -57.405  1.00 129.89 ? 493 ARG C NH1 1 
ATOM 10338 N NH2 . ARG C 1 524 ? -74.323  9.521   -56.095  1.00 124.92 ? 493 ARG C NH2 1 
ATOM 10339 N N   . ILE C 1 525 ? -82.310  10.745  -52.235  1.00 105.65 ? 494 ILE C N   1 
ATOM 10340 C CA  . ILE C 1 525 ? -83.723  10.859  -51.994  1.00 105.33 ? 494 ILE C CA  1 
ATOM 10341 C C   . ILE C 1 525 ? -84.403  10.961  -53.341  1.00 109.24 ? 494 ILE C C   1 
ATOM 10342 O O   . ILE C 1 525 ? -84.786  12.028  -53.783  1.00 110.47 ? 494 ILE C O   1 
ATOM 10343 C CB  . ILE C 1 525 ? -83.976  12.035  -51.054  1.00 102.62 ? 494 ILE C CB  1 
ATOM 10344 C CG1 . ILE C 1 525 ? -84.193  11.494  -49.649  1.00 99.91  ? 494 ILE C CG1 1 
ATOM 10345 C CG2 . ILE C 1 525 ? -85.144  12.877  -51.491  1.00 103.58 ? 494 ILE C CG2 1 
ATOM 10346 C CD1 . ILE C 1 525 ? -83.826  12.442  -48.539  1.00 95.97  ? 494 ILE C CD1 1 
ATOM 10347 N N   . LEU C 1 526 ? -84.502  9.824   -54.012  1.00 97.94  ? 495 LEU C N   1 
ATOM 10348 C CA  . LEU C 1 526 ? -85.218  9.693   -55.284  1.00 101.79 ? 495 LEU C CA  1 
ATOM 10349 C C   . LEU C 1 526 ? -86.771  9.762   -55.108  1.00 103.36 ? 495 LEU C C   1 
ATOM 10350 O O   . LEU C 1 526 ? -87.254  9.605   -53.982  1.00 102.26 ? 495 LEU C O   1 
ATOM 10351 C CB  . LEU C 1 526 ? -84.822  8.348   -55.890  1.00 102.66 ? 495 LEU C CB  1 
ATOM 10352 C CG  . LEU C 1 526 ? -83.432  8.078   -56.452  1.00 103.18 ? 495 LEU C CG  1 
ATOM 10353 C CD1 . LEU C 1 526 ? -82.997  6.715   -55.947  1.00 102.06 ? 495 LEU C CD1 1 
ATOM 10354 C CD2 . LEU C 1 526 ? -83.463  8.132   -57.999  1.00 106.51 ? 495 LEU C CD2 1 
ATOM 10355 N N   . ASP C 1 527 ? -87.544  9.929   -56.195  1.00 106.91 ? 496 ASP C N   1 
ATOM 10356 C CA  . ASP C 1 527 ? -88.970  10.300  -56.066  1.00 109.77 ? 496 ASP C CA  1 
ATOM 10357 C C   . ASP C 1 527 ? -90.154  9.308   -56.418  1.00 111.56 ? 496 ASP C C   1 
ATOM 10358 O O   . ASP C 1 527 ? -90.770  8.685   -55.536  1.00 110.53 ? 496 ASP C O   1 
ATOM 10359 C CB  . ASP C 1 527 ? -89.173  11.666  -56.720  1.00 112.97 ? 496 ASP C CB  1 
ATOM 10360 C CG  . ASP C 1 527 ? -90.230  12.489  -56.020  1.00 116.41 ? 496 ASP C CG  1 
ATOM 10361 O OD1 . ASP C 1 527 ? -90.213  12.543  -54.761  1.00 116.06 ? 496 ASP C OD1 1 
ATOM 10362 O OD2 . ASP C 1 527 ? -91.080  13.088  -56.727  1.00 123.08 ? 496 ASP C OD2 1 
ATOM 10363 N N   . HIS C 1 528 ? -90.514  9.215   -57.691  1.00 115.30 ? 497 HIS C N   1 
ATOM 10364 C CA  . HIS C 1 528 ? -91.608  8.328   -58.131  1.00 117.72 ? 497 HIS C CA  1 
ATOM 10365 C C   . HIS C 1 528 ? -91.685  8.238   -59.679  1.00 121.40 ? 497 HIS C C   1 
ATOM 10366 O O   . HIS C 1 528 ? -91.115  7.334   -60.319  1.00 121.47 ? 497 HIS C O   1 
ATOM 10367 C CB  . HIS C 1 528 ? -92.967  8.765   -57.529  1.00 119.23 ? 497 HIS C CB  1 
ATOM 10368 C CG  . HIS C 1 528 ? -93.434  10.126  -57.973  1.00 123.56 ? 497 HIS C CG  1 
ATOM 10369 N ND1 . HIS C 1 528 ? -93.402  11.235  -57.147  1.00 123.86 ? 497 HIS C ND1 1 
ATOM 10370 C CD2 . HIS C 1 528 ? -93.956  10.552  -59.152  1.00 128.31 ? 497 HIS C CD2 1 
ATOM 10371 C CE1 . HIS C 1 528 ? -93.875  12.282  -57.799  1.00 128.17 ? 497 HIS C CE1 1 
ATOM 10372 N NE2 . HIS C 1 528 ? -94.213  11.895  -59.018  1.00 131.70 ? 497 HIS C NE2 1 
ATOM 10373 N N   . GLU D 1 42  ? -105.341 -52.875 -39.534  1.00 99.11  ? 11  GLU D N   1 
ATOM 10374 C CA  . GLU D 1 42  ? -106.147 -52.951 -38.278  1.00 99.06  ? 11  GLU D CA  1 
ATOM 10375 C C   . GLU D 1 42  ? -105.312 -53.554 -37.152  1.00 99.11  ? 11  GLU D C   1 
ATOM 10376 O O   . GLU D 1 42  ? -105.599 -53.346 -35.968  1.00 99.07  ? 11  GLU D O   1 
ATOM 10377 C CB  . GLU D 1 42  ? -107.416 -53.793 -38.489  1.00 99.00  ? 11  GLU D CB  1 
ATOM 10378 C CG  . GLU D 1 42  ? -108.383 -53.253 -39.541  1.00 98.73  ? 11  GLU D CG  1 
ATOM 10379 C CD  . GLU D 1 42  ? -108.077 -53.756 -40.944  1.00 98.32  ? 11  GLU D CD  1 
ATOM 10380 O OE1 . GLU D 1 42  ? -108.644 -54.798 -41.340  1.00 97.95  ? 11  GLU D OE1 1 
ATOM 10381 O OE2 . GLU D 1 42  ? -107.281 -53.105 -41.655  1.00 98.23  ? 11  GLU D OE2 1 
ATOM 10382 N N   . VAL D 1 43  ? -104.270 -54.285 -37.548  1.00 99.17  ? 12  VAL D N   1 
ATOM 10383 C CA  . VAL D 1 43  ? -103.478 -55.133 -36.647  1.00 99.12  ? 12  VAL D CA  1 
ATOM 10384 C C   . VAL D 1 43  ? -102.423 -54.375 -35.816  1.00 98.96  ? 12  VAL D C   1 
ATOM 10385 O O   . VAL D 1 43  ? -102.458 -54.408 -34.580  1.00 98.82  ? 12  VAL D O   1 
ATOM 10386 C CB  . VAL D 1 43  ? -102.853 -56.358 -37.419  1.00 99.15  ? 12  VAL D CB  1 
ATOM 10387 C CG1 . VAL D 1 43  ? -103.840 -57.519 -37.483  1.00 99.02  ? 12  VAL D CG1 1 
ATOM 10388 C CG2 . VAL D 1 43  ? -102.412 -55.965 -38.841  1.00 99.04  ? 12  VAL D CG2 1 
ATOM 10389 N N   . ILE D 1 44  ? -101.514 -53.681 -36.504  1.00 98.84  ? 13  ILE D N   1 
ATOM 10390 C CA  . ILE D 1 44  ? -100.395 -52.965 -35.870  1.00 98.70  ? 13  ILE D CA  1 
ATOM 10391 C C   . ILE D 1 44  ? -100.804 -51.677 -35.165  1.00 98.61  ? 13  ILE D C   1 
ATOM 10392 O O   . ILE D 1 44  ? -100.089 -51.189 -34.286  1.00 98.63  ? 13  ILE D O   1 
ATOM 10393 C CB  . ILE D 1 44  ? -99.254  -52.641 -36.881  1.00 98.67  ? 13  ILE D CB  1 
ATOM 10394 C CG1 . ILE D 1 44  ? -99.809  -52.124 -38.217  1.00 98.54  ? 13  ILE D CG1 1 
ATOM 10395 C CG2 . ILE D 1 44  ? -98.369  -53.849 -37.094  1.00 98.77  ? 13  ILE D CG2 1 
ATOM 10396 C CD1 . ILE D 1 44  ? -99.623  -50.642 -38.423  1.00 98.23  ? 13  ILE D CD1 1 
ATOM 10397 N N   . ARG D 1 45  ? -101.957 -51.144 -35.559  1.00 98.45  ? 14  ARG D N   1 
ATOM 10398 C CA  . ARG D 1 45  ? -102.446 -49.845 -35.095  1.00 98.25  ? 14  ARG D CA  1 
ATOM 10399 C C   . ARG D 1 45  ? -103.054 -49.890 -33.680  1.00 97.99  ? 14  ARG D C   1 
ATOM 10400 O O   . ARG D 1 45  ? -102.915 -48.936 -32.911  1.00 97.86  ? 14  ARG D O   1 
ATOM 10401 C CB  . ARG D 1 45  ? -103.425 -49.276 -36.131  1.00 98.35  ? 14  ARG D CB  1 
ATOM 10402 C CG  . ARG D 1 45  ? -102.779 -49.083 -37.512  1.00 98.59  ? 14  ARG D CG  1 
ATOM 10403 C CD  . ARG D 1 45  ? -103.594 -49.703 -38.649  1.00 99.11  ? 14  ARG D CD  1 
ATOM 10404 N NE  . ARG D 1 45  ? -102.729 -50.351 -39.642  1.00 99.23  ? 14  ARG D NE  1 
ATOM 10405 C CZ  . ARG D 1 45  ? -103.118 -50.772 -40.847  1.00 99.19  ? 14  ARG D CZ  1 
ATOM 10406 N NH1 . ARG D 1 45  ? -104.372 -50.616 -41.253  1.00 99.14  ? 14  ARG D NH1 1 
ATOM 10407 N NH2 . ARG D 1 45  ? -102.237 -51.349 -41.656  1.00 99.15  ? 14  ARG D NH2 1 
ATOM 10408 N N   . GLN D 1 46  ? -103.710 -51.005 -33.345  1.00 97.73  ? 15  GLN D N   1 
ATOM 10409 C CA  . GLN D 1 46  ? -104.217 -51.258 -31.985  1.00 97.43  ? 15  GLN D CA  1 
ATOM 10410 C C   . GLN D 1 46  ? -103.066 -51.451 -31.006  1.00 97.09  ? 15  GLN D C   1 
ATOM 10411 O O   . GLN D 1 46  ? -103.213 -51.206 -29.805  1.00 96.94  ? 15  GLN D O   1 
ATOM 10412 C CB  . GLN D 1 46  ? -105.117 -52.503 -31.944  1.00 97.53  ? 15  GLN D CB  1 
ATOM 10413 C CG  . GLN D 1 46  ? -106.499 -52.336 -32.583  1.00 97.81  ? 15  GLN D CG  1 
ATOM 10414 C CD  . GLN D 1 46  ? -107.424 -53.534 -32.352  1.00 97.94  ? 15  GLN D CD  1 
ATOM 10415 O OE1 . GLN D 1 46  ? -107.514 -54.066 -31.242  1.00 97.71  ? 15  GLN D OE1 1 
ATOM 10416 N NE2 . GLN D 1 46  ? -108.128 -53.948 -33.403  1.00 97.97  ? 15  GLN D NE2 1 
ATOM 10417 N N   . GLU D 1 47  ? -101.931 -51.906 -31.541  1.00 96.73  ? 16  GLU D N   1 
ATOM 10418 C CA  . GLU D 1 47  ? -100.718 -52.174 -30.768  1.00 96.32  ? 16  GLU D CA  1 
ATOM 10419 C C   . GLU D 1 47  ? -99.852  -50.922 -30.584  1.00 95.97  ? 16  GLU D C   1 
ATOM 10420 O O   . GLU D 1 47  ? -99.304  -50.697 -29.503  1.00 95.98  ? 16  GLU D O   1 
ATOM 10421 C CB  . GLU D 1 47  ? -99.902  -53.301 -31.419  1.00 96.25  ? 16  GLU D CB  1 
ATOM 10422 N N   . LEU D 1 48  ? -99.735  -50.107 -31.632  1.00 95.44  ? 17  LEU D N   1 
ATOM 10423 C CA  . LEU D 1 48  ? -98.938  -48.883 -31.553  1.00 94.92  ? 17  LEU D CA  1 
ATOM 10424 C C   . LEU D 1 48  ? -99.748  -47.701 -31.021  1.00 94.60  ? 17  LEU D C   1 
ATOM 10425 O O   . LEU D 1 48  ? -99.274  -46.565 -31.018  1.00 94.40  ? 17  LEU D O   1 
ATOM 10426 C CB  . LEU D 1 48  ? -98.263  -48.564 -32.896  1.00 94.92  ? 17  LEU D CB  1 
ATOM 10427 C CG  . LEU D 1 48  ? -97.162  -49.542 -33.343  1.00 94.92  ? 17  LEU D CG  1 
ATOM 10428 C CD1 . LEU D 1 48  ? -96.913  -49.458 -34.852  1.00 94.89  ? 17  LEU D CD1 1 
ATOM 10429 C CD2 . LEU D 1 48  ? -95.852  -49.358 -32.554  1.00 94.48  ? 17  LEU D CD2 1 
ATOM 10430 N N   . GLU D 1 49  ? -100.972 -47.982 -30.580  1.00 94.38  ? 18  GLU D N   1 
ATOM 10431 C CA  . GLU D 1 49  ? -101.734 -47.038 -29.765  1.00 94.29  ? 18  GLU D CA  1 
ATOM 10432 C C   . GLU D 1 49  ? -101.551 -47.406 -28.285  1.00 94.12  ? 18  GLU D C   1 
ATOM 10433 O O   . GLU D 1 49  ? -101.197 -46.550 -27.468  1.00 94.29  ? 18  GLU D O   1 
ATOM 10434 C CB  . GLU D 1 49  ? -103.220 -47.000 -30.162  1.00 94.24  ? 18  GLU D CB  1 
ATOM 10435 N N   . LEU D 1 50  ? -101.758 -48.684 -27.955  1.00 93.73  ? 19  LEU D N   1 
ATOM 10436 C CA  . LEU D 1 50  ? -101.596 -49.188 -26.575  1.00 93.16  ? 19  LEU D CA  1 
ATOM 10437 C C   . LEU D 1 50  ? -100.137 -49.269 -26.110  1.00 92.47  ? 19  LEU D C   1 
ATOM 10438 O O   . LEU D 1 50  ? -99.857  -49.553 -24.944  1.00 92.24  ? 19  LEU D O   1 
ATOM 10439 C CB  . LEU D 1 50  ? -102.300 -50.543 -26.397  1.00 93.34  ? 19  LEU D CB  1 
ATOM 10440 C CG  . LEU D 1 50  ? -103.746 -50.530 -25.880  1.00 93.41  ? 19  LEU D CG  1 
ATOM 10441 C CD1 . LEU D 1 50  ? -104.627 -51.489 -26.686  1.00 93.52  ? 19  LEU D CD1 1 
ATOM 10442 C CD2 . LEU D 1 50  ? -103.805 -50.831 -24.374  1.00 92.97  ? 19  LEU D CD2 1 
ATOM 10443 N N   . SER D 1 51  ? -99.217  -49.019 -27.033  1.00 91.75  ? 20  SER D N   1 
ATOM 10444 C CA  . SER D 1 51  ? -97.822  -48.849 -26.687  1.00 91.23  ? 20  SER D CA  1 
ATOM 10445 C C   . SER D 1 51  ? -97.673  -47.512 -25.992  1.00 90.68  ? 20  SER D C   1 
ATOM 10446 O O   . SER D 1 51  ? -96.892  -47.388 -25.050  1.00 90.74  ? 20  SER D O   1 
ATOM 10447 C CB  . SER D 1 51  ? -96.960  -48.850 -27.939  1.00 91.37  ? 20  SER D CB  1 
ATOM 10448 O OG  . SER D 1 51  ? -97.232  -47.693 -28.706  1.00 91.66  ? 20  SER D OG  1 
ATOM 10449 N N   . VAL D 1 52  ? -98.421  -46.518 -26.475  1.00 89.94  ? 21  VAL D N   1 
ATOM 10450 C CA  . VAL D 1 52  ? -98.401  -45.165 -25.911  1.00 89.22  ? 21  VAL D CA  1 
ATOM 10451 C C   . VAL D 1 52  ? -99.281  -45.079 -24.667  1.00 88.83  ? 21  VAL D C   1 
ATOM 10452 O O   . VAL D 1 52  ? -99.016  -44.277 -23.772  1.00 88.79  ? 21  VAL D O   1 
ATOM 10453 C CB  . VAL D 1 52  ? -98.828  -44.078 -26.931  1.00 89.18  ? 21  VAL D CB  1 
ATOM 10454 C CG1 . VAL D 1 52  ? -98.453  -42.699 -26.425  1.00 88.42  ? 21  VAL D CG1 1 
ATOM 10455 C CG2 . VAL D 1 52  ? -98.180  -44.317 -28.290  1.00 89.30  ? 21  VAL D CG2 1 
ATOM 10456 N N   . LYS D 1 53  ? -100.325 -45.903 -24.619  1.00 162.32 ? 22  LYS D N   1 
ATOM 10457 C CA  . LYS D 1 53  ? -101.141 -46.033 -23.417  1.00 161.37 ? 22  LYS D CA  1 
ATOM 10458 C C   . LYS D 1 53  ? -100.240 -46.429 -22.253  1.00 161.44 ? 22  LYS D C   1 
ATOM 10459 O O   . LYS D 1 53  ? -100.159 -45.708 -21.261  1.00 159.27 ? 22  LYS D O   1 
ATOM 10460 C CB  . LYS D 1 53  ? -102.256 -47.065 -23.615  1.00 164.14 ? 22  LYS D CB  1 
ATOM 10461 N N   . LYS D 1 54  ? -99.534  -47.551 -22.408  1.00 164.11 ? 23  LYS D N   1 
ATOM 10462 C CA  . LYS D 1 54  ? -98.605  -48.055 -21.394  1.00 165.00 ? 23  LYS D CA  1 
ATOM 10463 C C   . LYS D 1 54  ? -97.419  -47.114 -21.181  1.00 162.82 ? 23  LYS D C   1 
ATOM 10464 O O   . LYS D 1 54  ? -96.771  -47.148 -20.134  1.00 162.92 ? 23  LYS D O   1 
ATOM 10465 C CB  . LYS D 1 54  ? -98.110  -49.459 -21.763  1.00 169.26 ? 23  LYS D CB  1 
ATOM 10466 N N   . GLU D 1 55  ? -97.155  -46.267 -22.171  1.00 161.19 ? 24  GLU D N   1 
ATOM 10467 C CA  . GLU D 1 55  ? -96.026  -45.340 -22.130  1.00 159.91 ? 24  GLU D CA  1 
ATOM 10468 C C   . GLU D 1 55  ? -96.301  -44.112 -21.275  1.00 156.32 ? 24  GLU D C   1 
ATOM 10469 O O   . GLU D 1 55  ? -95.412  -43.607 -20.595  1.00 155.70 ? 24  GLU D O   1 
ATOM 10470 C CB  . GLU D 1 55  ? -95.635  -44.915 -23.550  1.00 160.51 ? 24  GLU D CB  1 
ATOM 10471 C CG  . GLU D 1 55  ? -94.579  -43.809 -23.641  1.00 160.86 ? 24  GLU D CG  1 
ATOM 10472 C CD  . GLU D 1 55  ? -93.189  -44.268 -23.225  1.00 164.99 ? 24  GLU D CD  1 
ATOM 10473 O OE1 . GLU D 1 55  ? -92.617  -45.141 -23.920  1.00 168.96 ? 24  GLU D OE1 1 
ATOM 10474 O OE2 . GLU D 1 55  ? -92.667  -43.744 -22.211  1.00 164.62 ? 24  GLU D OE2 1 
ATOM 10475 N N   . LEU D 1 56  ? -97.529  -43.621 -21.321  1.00 154.34 ? 25  LEU D N   1 
ATOM 10476 C CA  . LEU D 1 56  ? -97.872  -42.447 -20.537  1.00 151.75 ? 25  LEU D CA  1 
ATOM 10477 C C   . LEU D 1 56  ? -98.286  -42.838 -19.116  1.00 151.91 ? 25  LEU D C   1 
ATOM 10478 O O   . LEU D 1 56  ? -98.512  -41.976 -18.269  1.00 150.49 ? 25  LEU D O   1 
ATOM 10479 C CB  . LEU D 1 56  ? -98.928  -41.593 -21.255  1.00 150.23 ? 25  LEU D CB  1 
ATOM 10480 C CG  . LEU D 1 56  ? -98.444  -40.872 -22.535  1.00 149.82 ? 25  LEU D CG  1 
ATOM 10481 C CD1 . LEU D 1 56  ? -99.489  -40.900 -23.638  1.00 150.48 ? 25  LEU D CD1 1 
ATOM 10482 C CD2 . LEU D 1 56  ? -97.987  -39.440 -22.291  1.00 147.05 ? 25  LEU D CD2 1 
ATOM 10483 N N   . GLU D 1 57  ? -98.361  -44.144 -18.861  1.00 154.10 ? 26  GLU D N   1 
ATOM 10484 C CA  . GLU D 1 57  ? -98.527  -44.668 -17.506  1.00 154.94 ? 26  GLU D CA  1 
ATOM 10485 C C   . GLU D 1 57  ? -97.230  -44.534 -16.758  1.00 154.91 ? 26  GLU D C   1 
ATOM 10486 O O   . GLU D 1 57  ? -97.224  -44.244 -15.567  1.00 154.43 ? 26  GLU D O   1 
ATOM 10487 C CB  . GLU D 1 57  ? -98.935  -46.139 -17.532  1.00 158.38 ? 26  GLU D CB  1 
ATOM 10488 C CG  . GLU D 1 57  ? -100.335 -46.380 -18.061  1.00 159.76 ? 26  GLU D CG  1 
ATOM 10489 C CD  . GLU D 1 57  ? -101.340 -45.436 -17.445  1.00 158.87 ? 26  GLU D CD  1 
ATOM 10490 O OE1 . GLU D 1 57  ? -101.679 -45.643 -16.258  1.00 160.47 ? 26  GLU D OE1 1 
ATOM 10491 O OE2 . GLU D 1 57  ? -101.771 -44.485 -18.143  1.00 156.95 ? 26  GLU D OE2 1 
ATOM 10492 N N   . LYS D 1 58  ? -96.135  -44.762 -17.479  1.00 155.83 ? 27  LYS D N   1 
ATOM 10493 C CA  . LYS D 1 58  ? -94.778  -44.610 -16.955  1.00 156.55 ? 27  LYS D CA  1 
ATOM 10494 C C   . LYS D 1 58  ? -94.423  -43.142 -16.665  1.00 153.85 ? 27  LYS D C   1 
ATOM 10495 O O   . LYS D 1 58  ? -93.499  -42.866 -15.906  1.00 154.73 ? 27  LYS D O   1 
ATOM 10496 C CB  . LYS D 1 58  ? -93.749  -45.244 -17.908  1.00 158.90 ? 27  LYS D CB  1 
ATOM 10497 N N   . ILE D 1 59  ? -95.149  -42.204 -17.261  1.00 150.97 ? 28  ILE D N   1 
ATOM 10498 C CA  . ILE D 1 59  ? -94.946  -40.803 -16.930  1.00 148.70 ? 28  ILE D CA  1 
ATOM 10499 C C   . ILE D 1 59  ? -95.714  -40.437 -15.660  1.00 147.47 ? 28  ILE D C   1 
ATOM 10500 O O   . ILE D 1 59  ? -95.106  -39.942 -14.706  1.00 147.97 ? 28  ILE D O   1 
ATOM 10501 C CB  . ILE D 1 59  ? -95.307  -39.875 -18.101  1.00 147.37 ? 28  ILE D CB  1 
ATOM 10502 C CG1 . ILE D 1 59  ? -94.345  -40.148 -19.257  1.00 148.82 ? 28  ILE D CG1 1 
ATOM 10503 C CG2 . ILE D 1 59  ? -95.292  -38.378 -17.663  1.00 145.85 ? 28  ILE D CG2 1 
ATOM 10504 C CD1 . ILE D 1 59  ? -94.838  -39.677 -20.595  1.00 148.20 ? 28  ILE D CD1 1 
ATOM 10505 N N   . LEU D 1 60  ? -97.029  -40.699 -15.646  1.00 146.20 ? 29  LEU D N   1 
ATOM 10506 C CA  . LEU D 1 60  ? -97.922  -40.388 -14.503  1.00 144.83 ? 29  LEU D CA  1 
ATOM 10507 C C   . LEU D 1 60  ? -97.322  -40.650 -13.125  1.00 145.62 ? 29  LEU D C   1 
ATOM 10508 O O   . LEU D 1 60  ? -97.339  -39.780 -12.252  1.00 145.07 ? 29  LEU D O   1 
ATOM 10509 C CB  . LEU D 1 60  ? -99.239  -41.157 -14.616  1.00 145.35 ? 29  LEU D CB  1 
ATOM 10510 C CG  . LEU D 1 60  ? -100.458 -40.310 -14.934  1.00 143.61 ? 29  LEU D CG  1 
ATOM 10511 C CD1 . LEU D 1 60  ? -101.584 -41.193 -15.419  1.00 145.30 ? 29  LEU D CD1 1 
ATOM 10512 C CD2 . LEU D 1 60  ? -100.875 -39.535 -13.714  1.00 142.80 ? 29  LEU D CD2 1 
ATOM 10513 N N   . THR D 1 61  ? -96.789  -41.856 -12.950  1.00 146.82 ? 30  THR D N   1 
ATOM 10514 C CA  . THR D 1 61  ? -96.176  -42.278 -11.710  1.00 147.63 ? 30  THR D CA  1 
ATOM 10515 C C   . THR D 1 61  ? -95.161  -41.281 -11.148  1.00 146.63 ? 30  THR D C   1 
ATOM 10516 O O   . THR D 1 61  ? -94.840  -41.352 -9.972   1.00 147.98 ? 30  THR D O   1 
ATOM 10517 C CB  . THR D 1 61  ? -95.526  -43.657 -11.880  1.00 150.43 ? 30  THR D CB  1 
ATOM 10518 O OG1 . THR D 1 61  ? -94.908  -44.046 -10.652  1.00 153.16 ? 30  THR D OG1 1 
ATOM 10519 C CG2 . THR D 1 61  ? -94.477  -43.638 -12.985  1.00 150.30 ? 30  THR D CG2 1 
ATOM 10520 N N   . THR D 1 62  ? -94.667  -40.355 -11.974  1.00 144.56 ? 31  THR D N   1 
ATOM 10521 C CA  . THR D 1 62  ? -93.747  -39.291 -11.508  1.00 143.97 ? 31  THR D CA  1 
ATOM 10522 C C   . THR D 1 62  ? -94.439  -37.950 -11.217  1.00 142.04 ? 31  THR D C   1 
ATOM 10523 O O   . THR D 1 62  ? -93.786  -36.900 -11.161  1.00 141.92 ? 31  THR D O   1 
ATOM 10524 C CB  . THR D 1 62  ? -92.580  -39.025 -12.492  1.00 144.17 ? 31  THR D CB  1 
ATOM 10525 O OG1 . THR D 1 62  ? -93.081  -38.391 -13.670  1.00 142.39 ? 31  THR D OG1 1 
ATOM 10526 C CG2 . THR D 1 62  ? -91.893  -40.305 -12.875  1.00 146.27 ? 31  THR D CG2 1 
ATOM 10527 N N   . ALA D 1 63  ? -95.750  -37.995 -11.014  1.00 140.79 ? 32  ALA D N   1 
ATOM 10528 C CA  . ALA D 1 63  ? -96.528  -36.788 -10.806  1.00 139.43 ? 32  ALA D CA  1 
ATOM 10529 C C   . ALA D 1 63  ? -96.622  -36.351 -9.348   1.00 140.35 ? 32  ALA D C   1 
ATOM 10530 O O   . ALA D 1 63  ? -96.832  -37.158 -8.444   1.00 141.35 ? 32  ALA D O   1 
ATOM 10531 C CB  . ALA D 1 63  ? -97.895  -36.955 -11.386  1.00 138.65 ? 32  ALA D CB  1 
ATOM 10532 N N   . SER D 1 64  ? -96.497  -35.047 -9.155   1.00 140.23 ? 33  SER D N   1 
ATOM 10533 C CA  . SER D 1 64  ? -96.473  -34.435 -7.843   1.00 141.86 ? 33  SER D CA  1 
ATOM 10534 C C   . SER D 1 64  ? -97.924  -34.788 -7.494   1.00 142.12 ? 33  SER D C   1 
ATOM 10535 O O   . SER D 1 64  ? -98.847  -34.389 -8.200   1.00 141.02 ? 33  SER D O   1 
ATOM 10536 C CB  . SER D 1 64  ? -96.177  -32.934 -7.843   1.00 85.62  ? 33  SER D CB  1 
ATOM 10537 O OG  . SER D 1 64  ? -96.217  -32.406 -6.529   1.00 87.35  ? 33  SER D OG  1 
ATOM 10538 N N   . SER D 1 65  ? -98.090  -35.546 -6.405   1.00 144.27 ? 34  SER D N   1 
ATOM 10539 C CA  . SER D 1 65  ? -99.182  -35.707 -5.401   1.00 146.20 ? 34  SER D CA  1 
ATOM 10540 C C   . SER D 1 65  ? -100.518 -35.022 -5.661   1.00 146.27 ? 34  SER D C   1 
ATOM 10541 O O   . SER D 1 65  ? -101.577 -35.608 -5.400   1.00 147.35 ? 34  SER D O   1 
ATOM 10542 C CB  . SER D 1 65  ? -98.709  -35.311 -3.996   1.00 148.24 ? 34  SER D CB  1 
ATOM 10543 O OG  . SER D 1 65  ? -98.626  -33.899 -3.847   1.00 147.91 ? 34  SER D OG  1 
ATOM 10544 N N   . HIS D 1 66  ? -100.455 -33.775 -6.128   1.00 145.93 ? 35  HIS D N   1 
ATOM 10545 C CA  . HIS D 1 66  ? -101.638 -32.946 -6.358   1.00 146.68 ? 35  HIS D CA  1 
ATOM 10546 C C   . HIS D 1 66  ? -101.767 -32.470 -7.810   1.00 145.19 ? 35  HIS D C   1 
ATOM 10547 O O   . HIS D 1 66  ? -102.862 -32.111 -8.264   1.00 145.57 ? 35  HIS D O   1 
ATOM 10548 C CB  . HIS D 1 66  ? -101.635 -31.745 -5.411   1.00 148.48 ? 35  HIS D CB  1 
ATOM 10549 C CG  . HIS D 1 66  ? -101.010 -30.519 -5.991   1.00 147.58 ? 35  HIS D CG  1 
ATOM 10550 N ND1 . HIS D 1 66  ? -101.752 -29.440 -6.425   1.00 147.43 ? 35  HIS D ND1 1 
ATOM 10551 C CD2 . HIS D 1 66  ? -99.714  -30.209 -6.225   1.00 147.06 ? 35  HIS D CD2 1 
ATOM 10552 C CE1 . HIS D 1 66  ? -100.937 -28.513 -6.893   1.00 147.58 ? 35  HIS D CE1 1 
ATOM 10553 N NE2 . HIS D 1 66  ? -99.696  -28.955 -6.783   1.00 147.71 ? 35  HIS D NE2 1 
ATOM 10554 N N   . GLU D 1 67  ? -100.645 -32.447 -8.524   1.00 144.12 ? 36  GLU D N   1 
ATOM 10555 C CA  . GLU D 1 67  ? -100.665 -32.204 -9.956   1.00 142.91 ? 36  GLU D CA  1 
ATOM 10556 C C   . GLU D 1 67  ? -101.155 -33.457 -10.669  1.00 141.59 ? 36  GLU D C   1 
ATOM 10557 O O   . GLU D 1 67  ? -101.111 -33.524 -11.892  1.00 140.91 ? 36  GLU D O   1 
ATOM 10558 C CB  . GLU D 1 67  ? -99.268  -31.867 -10.476  1.00 142.88 ? 36  GLU D CB  1 
ATOM 10559 C CG  . GLU D 1 67  ? -98.686  -30.517 -10.056  1.00 146.26 ? 36  GLU D CG  1 
ATOM 10560 C CD  . GLU D 1 67  ? -97.144  -30.528 -10.048  1.00 148.99 ? 36  GLU D CD  1 
ATOM 10561 O OE1 . GLU D 1 67  ? -96.530  -31.354 -10.779  1.00 147.58 ? 36  GLU D OE1 1 
ATOM 10562 O OE2 . GLU D 1 67  ? -96.548  -29.721 -9.291   1.00 151.70 ? 36  GLU D OE2 1 
ATOM 10563 N N   . PHE D 1 68  ? -101.598 -34.454 -9.908   1.00 141.79 ? 37  PHE D N   1 
ATOM 10564 C CA  . PHE D 1 68  ? -102.114 -35.679 -10.478  1.00 141.12 ? 37  PHE D CA  1 
ATOM 10565 C C   . PHE D 1 68  ? -103.475 -35.415 -11.126  1.00 141.42 ? 37  PHE D C   1 
ATOM 10566 O O   . PHE D 1 68  ? -103.654 -35.686 -12.315  1.00 140.67 ? 37  PHE D O   1 
ATOM 10567 C CB  . PHE D 1 68  ? -102.233 -36.706 -9.378   1.00 142.50 ? 37  PHE D CB  1 
ATOM 10568 C CG  . PHE D 1 68  ? -102.271 -38.115 -9.852   1.00 142.60 ? 37  PHE D CG  1 
ATOM 10569 C CD1 . PHE D 1 68  ? -101.123 -38.896 -9.817   1.00 142.75 ? 37  PHE D CD1 1 
ATOM 10570 C CD2 . PHE D 1 68  ? -103.465 -38.692 -10.273  1.00 143.70 ? 37  PHE D CD2 1 
ATOM 10571 C CE1 . PHE D 1 68  ? -101.151 -40.227 -10.215  1.00 143.93 ? 37  PHE D CE1 1 
ATOM 10572 C CE2 . PHE D 1 68  ? -103.509 -40.021 -10.687  1.00 144.89 ? 37  PHE D CE2 1 
ATOM 10573 C CZ  . PHE D 1 68  ? -102.346 -40.791 -10.656  1.00 145.14 ? 37  PHE D CZ  1 
ATOM 10574 N N   . GLU D 1 69  ? -104.412 -34.858 -10.351  1.00 142.92 ? 38  GLU D N   1 
ATOM 10575 C CA  . GLU D 1 69  ? -105.782 -34.593 -10.807  1.00 143.77 ? 38  GLU D CA  1 
ATOM 10576 C C   . GLU D 1 69  ? -105.834 -34.205 -12.291  1.00 142.63 ? 38  GLU D C   1 
ATOM 10577 O O   . GLU D 1 69  ? -106.073 -35.067 -13.149  1.00 142.23 ? 38  GLU D O   1 
ATOM 10578 C CB  . GLU D 1 69  ? -106.463 -33.540 -9.925   1.00 145.18 ? 38  GLU D CB  1 
ATOM 10579 N N   . HIS D 1 70  ? -105.574 -32.931 -12.598  1.00 142.53 ? 39  HIS D N   1 
ATOM 10580 C CA  . HIS D 1 70  ? -105.721 -32.426 -13.983  1.00 142.20 ? 39  HIS D CA  1 
ATOM 10581 C C   . HIS D 1 70  ? -104.689 -33.032 -14.924  1.00 139.40 ? 39  HIS D C   1 
ATOM 10582 O O   . HIS D 1 70  ? -104.860 -32.980 -16.136  1.00 139.12 ? 39  HIS D O   1 
ATOM 10583 C CB  . HIS D 1 70  ? -105.765 -30.876 -14.081  1.00 143.65 ? 39  HIS D CB  1 
ATOM 10584 C CG  . HIS D 1 70  ? -104.542 -30.205 -13.548  1.00 147.24 ? 39  HIS D CG  1 
ATOM 10585 N ND1 . HIS D 1 70  ? -104.252 -30.144 -12.199  1.00 151.79 ? 39  HIS D ND1 1 
ATOM 10586 C CD2 . HIS D 1 70  ? -103.518 -29.585 -14.181  1.00 150.34 ? 39  HIS D CD2 1 
ATOM 10587 C CE1 . HIS D 1 70  ? -103.101 -29.516 -12.022  1.00 153.29 ? 39  HIS D CE1 1 
ATOM 10588 N NE2 . HIS D 1 70  ? -102.632 -29.169 -13.210  1.00 153.42 ? 39  HIS D NE2 1 
ATOM 10589 N N   . THR D 1 71  ? -103.638 -33.623 -14.371  1.00 137.58 ? 40  THR D N   1 
ATOM 10590 C CA  . THR D 1 71  ? -102.651 -34.280 -15.214  1.00 135.59 ? 40  THR D CA  1 
ATOM 10591 C C   . THR D 1 71  ? -103.071 -35.693 -15.573  1.00 135.68 ? 40  THR D C   1 
ATOM 10592 O O   . THR D 1 71  ? -102.674 -36.207 -16.611  1.00 135.35 ? 40  THR D O   1 
ATOM 10593 C CB  . THR D 1 71  ? -101.229 -34.200 -14.634  1.00 135.14 ? 40  THR D CB  1 
ATOM 10594 O OG1 . THR D 1 71  ? -100.709 -32.893 -14.892  1.00 134.57 ? 40  THR D OG1 1 
ATOM 10595 C CG2 . THR D 1 71  ? -100.297 -35.228 -15.255  1.00 133.63 ? 40  THR D CG2 1 
ATOM 10596 N N   . LYS D 1 72  ? -103.893 -36.329 -14.757  1.00 136.38 ? 41  LYS D N   1 
ATOM 10597 C CA  . LYS D 1 72  ? -104.407 -37.587 -15.226  1.00 137.16 ? 41  LYS D CA  1 
ATOM 10598 C C   . LYS D 1 72  ? -105.368 -37.317 -16.378  1.00 137.49 ? 41  LYS D C   1 
ATOM 10599 O O   . LYS D 1 72  ? -105.282 -37.981 -17.409  1.00 137.65 ? 41  LYS D O   1 
ATOM 10600 C CB  . LYS D 1 72  ? -105.053 -38.424 -14.135  1.00 138.87 ? 41  LYS D CB  1 
ATOM 10601 C CG  . LYS D 1 72  ? -105.105 -39.866 -14.573  1.00 140.57 ? 41  LYS D CG  1 
ATOM 10602 C CD  . LYS D 1 72  ? -105.897 -40.777 -13.674  1.00 144.03 ? 41  LYS D CD  1 
ATOM 10603 C CE  . LYS D 1 72  ? -106.275 -42.018 -14.478  1.00 146.37 ? 41  LYS D CE  1 
ATOM 10604 N NZ  . LYS D 1 72  ? -106.355 -43.228 -13.632  1.00 149.73 ? 41  LYS D NZ  1 
ATOM 10605 N N   . LYS D 1 73  ? -106.239 -36.311 -16.213  1.00 138.03 ? 42  LYS D N   1 
ATOM 10606 C CA  . LYS D 1 73  ? -107.279 -35.956 -17.208  1.00 138.47 ? 42  LYS D CA  1 
ATOM 10607 C C   . LYS D 1 73  ? -106.708 -35.493 -18.551  1.00 137.24 ? 42  LYS D C   1 
ATOM 10608 O O   . LYS D 1 73  ? -107.350 -35.672 -19.584  1.00 138.05 ? 42  LYS D O   1 
ATOM 10609 C CB  . LYS D 1 73  ? -108.260 -34.912 -16.650  1.00 139.32 ? 42  LYS D CB  1 
ATOM 10610 N N   . ASP D 1 74  ? -105.501 -34.923 -18.521  1.00 135.77 ? 43  ASP D N   1 
ATOM 10611 C CA  . ASP D 1 74  ? -104.831 -34.376 -19.708  1.00 135.21 ? 43  ASP D CA  1 
ATOM 10612 C C   . ASP D 1 74  ? -104.400 -35.416 -20.716  1.00 134.94 ? 43  ASP D C   1 
ATOM 10613 O O   . ASP D 1 74  ? -104.645 -35.280 -21.912  1.00 135.30 ? 43  ASP D O   1 
ATOM 10614 C CB  . ASP D 1 74  ? -103.591 -33.584 -19.301  1.00 134.66 ? 43  ASP D CB  1 
ATOM 10615 C CG  . ASP D 1 74  ? -103.894 -32.138 -18.990  1.00 135.96 ? 43  ASP D CG  1 
ATOM 10616 O OD1 . ASP D 1 74  ? -105.065 -31.818 -18.701  1.00 138.27 ? 43  ASP D OD1 1 
ATOM 10617 O OD2 . ASP D 1 74  ? -102.955 -31.314 -19.029  1.00 136.97 ? 43  ASP D OD2 1 
ATOM 10618 N N   . LEU D 1 75  ? -103.730 -36.444 -20.227  1.00 134.69 ? 44  LEU D N   1 
ATOM 10619 C CA  . LEU D 1 75  ? -103.170 -37.442 -21.104  1.00 135.32 ? 44  LEU D CA  1 
ATOM 10620 C C   . LEU D 1 75  ? -104.264 -38.373 -21.600  1.00 137.24 ? 44  LEU D C   1 
ATOM 10621 O O   . LEU D 1 75  ? -104.058 -39.110 -22.571  1.00 138.44 ? 44  LEU D O   1 
ATOM 10622 C CB  . LEU D 1 75  ? -102.049 -38.210 -20.404  1.00 135.07 ? 44  LEU D CB  1 
ATOM 10623 C CG  . LEU D 1 75  ? -100.989 -37.432 -19.610  1.00 133.60 ? 44  LEU D CG  1 
ATOM 10624 C CD1 . LEU D 1 75  ? -99.775  -38.313 -19.395  1.00 134.07 ? 44  LEU D CD1 1 
ATOM 10625 C CD2 . LEU D 1 75  ? -100.568 -36.115 -20.249  1.00 131.92 ? 44  LEU D CD2 1 
ATOM 10626 N N   . ASP D 1 76  ? -105.421 -38.328 -20.931  1.00 138.28 ? 45  ASP D N   1 
ATOM 10627 C CA  . ASP D 1 76  ? -106.633 -39.029 -21.372  1.00 140.54 ? 45  ASP D CA  1 
ATOM 10628 C C   . ASP D 1 76  ? -107.303 -38.298 -22.518  1.00 140.58 ? 45  ASP D C   1 
ATOM 10629 O O   . ASP D 1 76  ? -108.027 -38.911 -23.314  1.00 142.56 ? 45  ASP D O   1 
ATOM 10630 C CB  . ASP D 1 76  ? -107.631 -39.178 -20.228  1.00 142.21 ? 45  ASP D CB  1 
ATOM 10631 C CG  . ASP D 1 76  ? -107.683 -40.597 -19.673  1.00 146.29 ? 45  ASP D CG  1 
ATOM 10632 O OD1 . ASP D 1 76  ? -106.642 -41.315 -19.744  1.00 148.66 ? 45  ASP D OD1 1 
ATOM 10633 O OD2 . ASP D 1 76  ? -108.771 -40.987 -19.163  1.00 149.96 ? 45  ASP D OD2 1 
ATOM 10634 N N   . GLY D 1 77  ? -107.071 -36.983 -22.575  1.00 138.92 ? 46  GLY D N   1 
ATOM 10635 C CA  . GLY D 1 77  ? -107.489 -36.138 -23.693  1.00 138.39 ? 46  GLY D CA  1 
ATOM 10636 C C   . GLY D 1 77  ? -106.613 -36.423 -24.886  1.00 137.48 ? 46  GLY D C   1 
ATOM 10637 O O   . GLY D 1 77  ? -107.075 -36.387 -26.013  1.00 138.74 ? 46  GLY D O   1 
ATOM 10638 N N   . PHE D 1 78  ? -105.346 -36.720 -24.620  1.00 135.74 ? 47  PHE D N   1 
ATOM 10639 C CA  . PHE D 1 78  ? -104.408 -37.104 -25.649  1.00 135.72 ? 47  PHE D CA  1 
ATOM 10640 C C   . PHE D 1 78  ? -104.766 -38.453 -26.228  1.00 137.46 ? 47  PHE D C   1 
ATOM 10641 O O   . PHE D 1 78  ? -104.941 -38.561 -27.434  1.00 138.91 ? 47  PHE D O   1 
ATOM 10642 C CB  . PHE D 1 78  ? -103.001 -37.146 -25.098  1.00 134.50 ? 47  PHE D CB  1 
ATOM 10643 C CG  . PHE D 1 78  ? -101.951 -37.067 -26.150  1.00 134.83 ? 47  PHE D CG  1 
ATOM 10644 C CD1 . PHE D 1 78  ? -101.363 -35.858 -26.462  1.00 134.47 ? 47  PHE D CD1 1 
ATOM 10645 C CD2 . PHE D 1 78  ? -101.551 -38.200 -26.843  1.00 136.05 ? 47  PHE D CD2 1 
ATOM 10646 C CE1 . PHE D 1 78  ? -100.383 -35.777 -27.445  1.00 135.82 ? 47  PHE D CE1 1 
ATOM 10647 C CE2 . PHE D 1 78  ? -100.575 -38.128 -27.827  1.00 136.73 ? 47  PHE D CE2 1 
ATOM 10648 C CZ  . PHE D 1 78  ? -99.986  -36.915 -28.126  1.00 136.69 ? 47  PHE D CZ  1 
ATOM 10649 N N   . ARG D 1 79  ? -104.854 -39.477 -25.375  1.00 138.01 ? 48  ARG D N   1 
ATOM 10650 C CA  . ARG D 1 79  ? -105.433 -40.782 -25.745  1.00 140.54 ? 48  ARG D CA  1 
ATOM 10651 C C   . ARG D 1 79  ? -106.608 -40.617 -26.724  1.00 141.98 ? 48  ARG D C   1 
ATOM 10652 O O   . ARG D 1 79  ? -106.726 -41.362 -27.702  1.00 144.01 ? 48  ARG D O   1 
ATOM 10653 C CB  . ARG D 1 79  ? -105.969 -41.516 -24.508  1.00 141.45 ? 48  ARG D CB  1 
ATOM 10654 C CG  . ARG D 1 79  ? -105.000 -42.306 -23.656  1.00 142.30 ? 48  ARG D CG  1 
ATOM 10655 C CD  . ARG D 1 79  ? -105.833 -42.937 -22.535  1.00 145.76 ? 48  ARG D CD  1 
ATOM 10656 N NE  . ARG D 1 79  ? -105.105 -43.897 -21.702  1.00 149.85 ? 48  ARG D NE  1 
ATOM 10657 C CZ  . ARG D 1 79  ? -104.884 -45.179 -22.020  1.00 154.28 ? 48  ARG D CZ  1 
ATOM 10658 N NH1 . ARG D 1 79  ? -105.319 -45.672 -23.175  1.00 157.29 ? 48  ARG D NH1 1 
ATOM 10659 N NH2 . ARG D 1 79  ? -104.216 -45.981 -21.190  1.00 155.46 ? 48  ARG D NH2 1 
ATOM 10660 N N   . LYS D 1 80  ? -107.484 -39.653 -26.431  1.00 141.23 ? 49  LYS D N   1 
ATOM 10661 C CA  . LYS D 1 80  ? -108.597 -39.313 -27.303  1.00 142.60 ? 49  LYS D CA  1 
ATOM 10662 C C   . LYS D 1 80  ? -108.077 -38.791 -28.663  1.00 142.75 ? 49  LYS D C   1 
ATOM 10663 O O   . LYS D 1 80  ? -108.328 -39.423 -29.690  1.00 145.00 ? 49  LYS D O   1 
ATOM 10664 C CB  . LYS D 1 80  ? -109.546 -38.325 -26.611  1.00 142.12 ? 49  LYS D CB  1 
ATOM 10665 N N   . LEU D 1 81  ? -107.328 -37.681 -28.661  1.00 140.78 ? 50  LEU D N   1 
ATOM 10666 C CA  . LEU D 1 81  ? -106.770 -37.073 -29.885  1.00 140.85 ? 50  LEU D CA  1 
ATOM 10667 C C   . LEU D 1 81  ? -105.976 -38.036 -30.752  1.00 142.48 ? 50  LEU D C   1 
ATOM 10668 O O   . LEU D 1 81  ? -106.068 -37.995 -31.972  1.00 144.40 ? 50  LEU D O   1 
ATOM 10669 C CB  . LEU D 1 81  ? -105.878 -35.888 -29.538  1.00 138.64 ? 50  LEU D CB  1 
ATOM 10670 C CG  . LEU D 1 81  ? -106.497 -34.514 -29.729  1.00 137.85 ? 50  LEU D CG  1 
ATOM 10671 C CD1 . LEU D 1 81  ? -105.667 -33.429 -29.082  1.00 135.68 ? 50  LEU D CD1 1 
ATOM 10672 C CD2 . LEU D 1 81  ? -106.625 -34.243 -31.187  1.00 139.37 ? 50  LEU D CD2 1 
ATOM 10673 N N   . PHE D 1 82  ? -105.199 -38.898 -30.110  1.00 142.37 ? 51  PHE D N   1 
ATOM 10674 C CA  . PHE D 1 82  ? -104.369 -39.876 -30.794  1.00 144.51 ? 51  PHE D CA  1 
ATOM 10675 C C   . PHE D 1 82  ? -105.203 -40.968 -31.478  1.00 148.09 ? 51  PHE D C   1 
ATOM 10676 O O   . PHE D 1 82  ? -105.002 -41.245 -32.658  1.00 150.16 ? 51  PHE D O   1 
ATOM 10677 C CB  . PHE D 1 82  ? -103.386 -40.489 -29.799  1.00 143.20 ? 51  PHE D CB  1 
ATOM 10678 C CG  . PHE D 1 82  ? -102.028 -40.740 -30.364  1.00 143.65 ? 51  PHE D CG  1 
ATOM 10679 C CD1 . PHE D 1 82  ? -101.656 -42.012 -30.793  1.00 146.43 ? 51  PHE D CD1 1 
ATOM 10680 C CD2 . PHE D 1 82  ? -101.112 -39.709 -30.463  1.00 142.36 ? 51  PHE D CD2 1 
ATOM 10681 C CE1 . PHE D 1 82  ? -100.378 -42.249 -31.323  1.00 147.86 ? 51  PHE D CE1 1 
ATOM 10682 C CE2 . PHE D 1 82  ? -99.840  -39.931 -30.996  1.00 144.31 ? 51  PHE D CE2 1 
ATOM 10683 C CZ  . PHE D 1 82  ? -99.470  -41.205 -31.426  1.00 146.46 ? 51  PHE D CZ  1 
ATOM 10684 N N   . HIS D 1 83  ? -106.134 -41.579 -30.738  1.00 149.75 ? 52  HIS D N   1 
ATOM 10685 C CA  . HIS D 1 83  ? -107.019 -42.639 -31.265  1.00 154.01 ? 52  HIS D CA  1 
ATOM 10686 C C   . HIS D 1 83  ? -107.871 -42.108 -32.413  1.00 156.32 ? 52  HIS D C   1 
ATOM 10687 O O   . HIS D 1 83  ? -108.402 -42.876 -33.226  1.00 159.64 ? 52  HIS D O   1 
ATOM 10688 C CB  . HIS D 1 83  ? -107.919 -43.201 -30.157  1.00 154.51 ? 52  HIS D CB  1 
ATOM 10689 C CG  . HIS D 1 83  ? -108.827 -44.309 -30.606  1.00 159.02 ? 52  HIS D CG  1 
ATOM 10690 N ND1 . HIS D 1 83  ? -108.432 -45.630 -30.626  1.00 162.35 ? 52  HIS D ND1 1 
ATOM 10691 C CD2 . HIS D 1 83  ? -110.112 -44.294 -31.035  1.00 161.64 ? 52  HIS D CD2 1 
ATOM 10692 C CE1 . HIS D 1 83  ? -109.434 -46.380 -31.051  1.00 165.96 ? 52  HIS D CE1 1 
ATOM 10693 N NE2 . HIS D 1 83  ? -110.464 -45.594 -31.308  1.00 165.65 ? 52  HIS D NE2 1 
ATOM 10694 N N   . ARG D 1 84  ? -107.991 -40.784 -32.461  1.00 155.40 ? 53  ARG D N   1 
ATOM 10695 C CA  . ARG D 1 84  ? -108.704 -40.096 -33.516  1.00 157.68 ? 53  ARG D CA  1 
ATOM 10696 C C   . ARG D 1 84  ? -107.766 -39.871 -34.686  1.00 158.99 ? 53  ARG D C   1 
ATOM 10697 O O   . ARG D 1 84  ? -108.199 -39.801 -35.834  1.00 161.79 ? 53  ARG D O   1 
ATOM 10698 C CB  . ARG D 1 84  ? -109.218 -38.764 -33.000  1.00 156.03 ? 53  ARG D CB  1 
ATOM 10699 C CG  . ARG D 1 84  ? -110.432 -38.320 -33.713  1.00 158.88 ? 53  ARG D CG  1 
ATOM 10700 C CD  . ARG D 1 84  ? -110.804 -36.945 -33.322  1.00 158.86 ? 53  ARG D CD  1 
ATOM 10701 N NE  . ARG D 1 84  ? -111.473 -36.319 -34.448  1.00 163.26 ? 53  ARG D NE  1 
ATOM 10702 C CZ  . ARG D 1 84  ? -112.450 -35.431 -34.331  1.00 165.91 ? 53  ARG D CZ  1 
ATOM 10703 N NH1 . ARG D 1 84  ? -112.875 -35.069 -33.125  1.00 165.04 ? 53  ARG D NH1 1 
ATOM 10704 N NH2 . ARG D 1 84  ? -113.003 -34.908 -35.421  1.00 169.87 ? 53  ARG D NH2 1 
ATOM 10705 N N   . PHE D 1 85  ? -106.477 -39.779 -34.370  1.00 157.79 ? 54  PHE D N   1 
ATOM 10706 C CA  . PHE D 1 85  ? -105.409 -39.517 -35.324  1.00 159.24 ? 54  PHE D CA  1 
ATOM 10707 C C   . PHE D 1 85  ? -105.123 -40.736 -36.183  1.00 162.91 ? 54  PHE D C   1 
ATOM 10708 O O   . PHE D 1 85  ? -104.823 -40.599 -37.360  1.00 165.23 ? 54  PHE D O   1 
ATOM 10709 C CB  . PHE D 1 85  ? -104.175 -39.116 -34.532  1.00 156.70 ? 54  PHE D CB  1 
ATOM 10710 C CG  . PHE D 1 85  ? -103.004 -38.692 -35.357  1.00 157.12 ? 54  PHE D CG  1 
ATOM 10711 C CD1 . PHE D 1 85  ? -103.059 -37.555 -36.145  1.00 157.60 ? 54  PHE D CD1 1 
ATOM 10712 C CD2 . PHE D 1 85  ? -101.809 -39.393 -35.281  1.00 157.10 ? 54  PHE D CD2 1 
ATOM 10713 C CE1 . PHE D 1 85  ? -101.949 -37.149 -36.879  1.00 158.88 ? 54  PHE D CE1 1 
ATOM 10714 C CE2 . PHE D 1 85  ? -100.700 -38.993 -36.005  1.00 158.20 ? 54  PHE D CE2 1 
ATOM 10715 C CZ  . PHE D 1 85  ? -100.770 -37.871 -36.808  1.00 159.11 ? 54  PHE D CZ  1 
ATOM 10716 N N   . LEU D 1 86  ? -105.222 -41.921 -35.592  1.00 164.40 ? 55  LEU D N   1 
ATOM 10717 C CA  . LEU D 1 86  ? -105.112 -43.171 -36.332  1.00 169.11 ? 55  LEU D CA  1 
ATOM 10718 C C   . LEU D 1 86  ? -106.192 -43.311 -37.382  1.00 172.80 ? 55  LEU D C   1 
ATOM 10719 O O   . LEU D 1 86  ? -105.901 -43.464 -38.565  1.00 175.69 ? 55  LEU D O   1 
ATOM 10720 C CB  . LEU D 1 86  ? -105.237 -44.366 -35.391  1.00 169.75 ? 55  LEU D CB  1 
ATOM 10721 C CG  . LEU D 1 86  ? -103.995 -45.072 -34.845  1.00 170.93 ? 55  LEU D CG  1 
ATOM 10722 C CD1 . LEU D 1 86  ? -104.391 -46.103 -33.772  1.00 172.48 ? 55  LEU D CD1 1 
ATOM 10723 C CD2 . LEU D 1 86  ? -103.214 -45.739 -35.971  1.00 175.46 ? 55  LEU D CD2 1 
ATOM 10724 N N   . GLN D 1 87  ? -107.439 -43.261 -36.933  1.00 173.62 ? 56  GLN D N   1 
ATOM 10725 C CA  . GLN D 1 87  ? -108.580 -43.648 -37.752  1.00 178.27 ? 56  GLN D CA  1 
ATOM 10726 C C   . GLN D 1 87  ? -108.702 -42.923 -39.103  1.00 180.68 ? 56  GLN D C   1 
ATOM 10727 O O   . GLN D 1 87  ? -108.672 -43.570 -40.160  1.00 184.44 ? 56  GLN D O   1 
ATOM 10728 C CB  . GLN D 1 87  ? -109.871 -43.544 -36.938  1.00 178.05 ? 56  GLN D CB  1 
ATOM 10729 C CG  . GLN D 1 87  ? -109.905 -44.478 -35.734  1.00 178.80 ? 56  GLN D CG  1 
ATOM 10730 C CD  . GLN D 1 87  ? -111.319 -44.888 -35.342  1.00 183.17 ? 56  GLN D CD  1 
ATOM 10731 O OE1 . GLN D 1 87  ? -112.084 -45.419 -36.162  1.00 188.11 ? 56  GLN D OE1 1 
ATOM 10732 N NE2 . GLN D 1 87  ? -111.672 -44.652 -34.079  1.00 181.66 ? 56  GLN D NE2 1 
ATOM 10733 N N   . GLU D 1 88  ? -108.823 -41.593 -39.058  1.00 179.22 ? 57  GLU D N   1 
ATOM 10734 C CA  . GLU D 1 88  ? -109.002 -40.735 -40.249  1.00 181.58 ? 57  GLU D CA  1 
ATOM 10735 C C   . GLU D 1 88  ? -109.838 -41.373 -41.386  1.00 185.96 ? 57  GLU D C   1 
ATOM 10736 O O   . GLU D 1 88  ? -109.901 -40.867 -42.513  1.00 188.13 ? 57  GLU D O   1 
ATOM 10737 C CB  . GLU D 1 88  ? -107.644 -40.229 -40.765  1.00 181.30 ? 57  GLU D CB  1 
ATOM 10738 C CG  . GLU D 1 88  ? -106.914 -41.206 -41.684  1.00 185.64 ? 57  GLU D CG  1 
ATOM 10739 C CD  . GLU D 1 88  ? -106.325 -40.512 -42.892  1.00 189.28 ? 57  GLU D CD  1 
ATOM 10740 O OE1 . GLU D 1 88  ? -105.280 -39.845 -42.730  1.00 188.64 ? 57  GLU D OE1 1 
ATOM 10741 O OE2 . GLU D 1 88  ? -106.910 -40.631 -43.996  1.00 193.01 ? 57  GLU D OE2 1 
ATOM 10742 N N   . GLY D 1 96  ? -115.417 -33.878 -50.192  1.00 208.54 ? 65  GLY D N   1 
ATOM 10743 C CA  . GLY D 1 96  ? -116.496 -33.420 -51.068  1.00 214.26 ? 65  GLY D CA  1 
ATOM 10744 C C   . GLY D 1 96  ? -116.462 -34.017 -52.472  1.00 219.44 ? 65  GLY D C   1 
ATOM 10745 O O   . GLY D 1 96  ? -116.471 -35.241 -52.626  1.00 220.14 ? 65  GLY D O   1 
ATOM 10746 N N   . LYS D 1 97  ? -116.466 -33.169 -53.504  1.00 223.65 ? 66  LYS D N   1 
ATOM 10747 C CA  . LYS D 1 97  ? -116.654 -31.734 -53.332  1.00 223.94 ? 66  LYS D CA  1 
ATOM 10748 C C   . LYS D 1 97  ? -118.140 -31.352 -53.369  1.00 227.99 ? 66  LYS D C   1 
ATOM 10749 O O   . LYS D 1 97  ? -118.769 -31.242 -54.433  1.00 233.76 ? 66  LYS D O   1 
ATOM 10750 C CB  . LYS D 1 97  ? -115.797 -30.925 -54.311  1.00 226.52 ? 66  LYS D CB  1 
ATOM 10751 C CG  . LYS D 1 97  ? -114.380 -30.740 -53.811  1.00 220.60 ? 66  LYS D CG  1 
ATOM 10752 C CD  . LYS D 1 97  ? -113.834 -29.403 -54.213  1.00 220.21 ? 66  LYS D CD  1 
ATOM 10753 C CE  . LYS D 1 97  ? -112.682 -29.030 -53.326  1.00 213.52 ? 66  LYS D CE  1 
ATOM 10754 N NZ  . LYS D 1 97  ? -112.143 -27.728 -53.747  1.00 215.44 ? 66  LYS D NZ  1 
ATOM 10755 N N   . ILE D 1 98  ? -118.683 -31.182 -52.164  1.00 225.00 ? 67  ILE D N   1 
ATOM 10756 C CA  . ILE D 1 98  ? -120.078 -30.826 -51.950  1.00 228.32 ? 67  ILE D CA  1 
ATOM 10757 C C   . ILE D 1 98  ? -120.160 -29.469 -51.211  1.00 227.01 ? 67  ILE D C   1 
ATOM 10758 O O   . ILE D 1 98  ? -121.215 -29.108 -50.688  1.00 229.01 ? 67  ILE D O   1 
ATOM 10759 C CB  . ILE D 1 98  ? -120.870 -31.964 -51.170  1.00 227.02 ? 67  ILE D CB  1 
ATOM 10760 C CG1 . ILE D 1 98  ? -120.307 -33.370 -51.469  1.00 225.88 ? 67  ILE D CG1 1 
ATOM 10761 C CG2 . ILE D 1 98  ? -122.396 -31.901 -51.456  1.00 232.93 ? 67  ILE D CG2 1 
ATOM 10762 C CD1 . ILE D 1 98  ? -120.736 -34.469 -50.469  1.00 222.99 ? 67  ILE D CD1 1 
ATOM 10763 N N   . GLN D 1 99  ? -119.064 -28.709 -51.194  1.00 224.45 ? 68  GLN D N   1 
ATOM 10764 C CA  . GLN D 1 99  ? -119.001 -27.456 -50.433  1.00 223.09 ? 68  GLN D CA  1 
ATOM 10765 C C   . GLN D 1 99  ? -119.551 -26.219 -51.190  1.00 229.37 ? 68  GLN D C   1 
ATOM 10766 O O   . GLN D 1 99  ? -119.090 -25.955 -52.293  1.00 233.14 ? 68  GLN D O   1 
ATOM 10767 C CB  . GLN D 1 99  ? -117.552 -27.220 -49.993  1.00 217.90 ? 68  GLN D CB  1 
ATOM 10768 N N   . ARG D 1 100 ? -120.520 -25.478 -50.613  1.00 77.94  ? 69  ARG D N   1 
ATOM 10769 C CA  . ARG D 1 100 ? -121.014 -24.168 -51.153  1.00 78.04  ? 69  ARG D CA  1 
ATOM 10770 C C   . ARG D 1 100 ? -122.148 -23.508 -50.326  1.00 78.32  ? 69  ARG D C   1 
ATOM 10771 O O   . ARG D 1 100 ? -123.286 -23.977 -50.393  1.00 78.33  ? 69  ARG D O   1 
ATOM 10772 C CB  . ARG D 1 100 ? -121.488 -24.315 -52.602  1.00 78.05  ? 69  ARG D CB  1 
ATOM 10773 N N   . PRO D 1 101 ? -121.858 -22.391 -49.596  1.00 78.64  ? 70  PRO D N   1 
ATOM 10774 C CA  . PRO D 1 101 ? -122.686 -21.818 -48.476  1.00 78.84  ? 70  PRO D CA  1 
ATOM 10775 C C   . PRO D 1 101 ? -123.788 -20.793 -48.835  1.00 79.06  ? 70  PRO D C   1 
ATOM 10776 O O   . PRO D 1 101 ? -123.488 -19.809 -49.513  1.00 79.17  ? 70  PRO D O   1 
ATOM 10777 C CB  . PRO D 1 101 ? -121.640 -21.115 -47.605  1.00 78.47  ? 70  PRO D CB  1 
ATOM 10778 C CG  . PRO D 1 101 ? -120.618 -20.636 -48.594  1.00 78.80  ? 70  PRO D CG  1 
ATOM 10779 C CD  . PRO D 1 101 ? -120.685 -21.539 -49.856  1.00 78.63  ? 70  PRO D CD  1 
ATOM 10780 N N   . PRO D 1 102 ? -125.041 -20.986 -48.329  1.00 79.27  ? 71  PRO D N   1 
ATOM 10781 C CA  . PRO D 1 102 ? -126.206 -20.174 -48.759  1.00 79.24  ? 71  PRO D CA  1 
ATOM 10782 C C   . PRO D 1 102 ? -126.169 -18.699 -48.351  1.00 79.18  ? 71  PRO D C   1 
ATOM 10783 O O   . PRO D 1 102 ? -125.425 -18.313 -47.438  1.00 78.98  ? 71  PRO D O   1 
ATOM 10784 C CB  . PRO D 1 102 ? -127.420 -20.887 -48.126  1.00 79.02  ? 71  PRO D CB  1 
ATOM 10785 C CG  . PRO D 1 102 ? -126.891 -21.655 -47.011  1.00 79.21  ? 71  PRO D CG  1 
ATOM 10786 C CD  . PRO D 1 102 ? -125.413 -21.937 -47.263  1.00 79.44  ? 71  PRO D CD  1 
ATOM 10787 N N   . GLU D 1 103 ? -126.978 -17.895 -49.041  1.00 79.18  ? 72  GLU D N   1 
ATOM 10788 C CA  . GLU D 1 103 ? -126.981 -16.445 -48.855  1.00 79.21  ? 72  GLU D CA  1 
ATOM 10789 C C   . GLU D 1 103 ? -127.744 -16.038 -47.607  1.00 78.44  ? 72  GLU D C   1 
ATOM 10790 O O   . GLU D 1 103 ? -127.632 -14.896 -47.149  1.00 78.73  ? 72  GLU D O   1 
ATOM 10791 C CB  . GLU D 1 103 ? -127.513 -15.710 -50.097  1.00 79.48  ? 72  GLU D CB  1 
ATOM 10792 C CG  . GLU D 1 103 ? -126.565 -15.807 -51.313  1.00 82.14  ? 72  GLU D CG  1 
ATOM 10793 C CD  . GLU D 1 103 ? -126.317 -14.467 -52.029  1.00 85.32  ? 72  GLU D CD  1 
ATOM 10794 O OE1 . GLU D 1 103 ? -126.707 -13.403 -51.484  1.00 86.58  ? 72  GLU D OE1 1 
ATOM 10795 O OE2 . GLU D 1 103 ? -125.716 -14.484 -53.137  1.00 86.08  ? 72  GLU D OE2 1 
ATOM 10796 N N   . ASP D 1 104 ? -128.493 -16.981 -47.042  1.00 77.29  ? 73  ASP D N   1 
ATOM 10797 C CA  . ASP D 1 104 ? -129.261 -16.718 -45.831  1.00 76.11  ? 73  ASP D CA  1 
ATOM 10798 C C   . ASP D 1 104 ? -128.521 -17.026 -44.519  1.00 74.56  ? 73  ASP D C   1 
ATOM 10799 O O   . ASP D 1 104 ? -128.959 -16.617 -43.439  1.00 73.87  ? 73  ASP D O   1 
ATOM 10800 C CB  . ASP D 1 104 ? -130.572 -17.494 -45.884  1.00 76.87  ? 73  ASP D CB  1 
ATOM 10801 C CG  . ASP D 1 104 ? -131.640 -16.887 -44.991  1.00 78.86  ? 73  ASP D CG  1 
ATOM 10802 O OD1 . ASP D 1 104 ? -131.533 -15.671 -44.690  1.00 81.34  ? 73  ASP D OD1 1 
ATOM 10803 O OD2 . ASP D 1 104 ? -132.583 -17.615 -44.593  1.00 80.56  ? 73  ASP D OD2 1 
ATOM 10804 N N   . SER D 1 105 ? -127.402 -17.744 -44.627  1.00 72.99  ? 74  SER D N   1 
ATOM 10805 C CA  . SER D 1 105 ? -126.658 -18.239 -43.464  1.00 71.22  ? 74  SER D CA  1 
ATOM 10806 C C   . SER D 1 105 ? -125.478 -17.347 -43.050  1.00 70.09  ? 74  SER D C   1 
ATOM 10807 O O   . SER D 1 105 ? -125.117 -17.291 -41.873  1.00 70.23  ? 74  SER D O   1 
ATOM 10808 C CB  . SER D 1 105 ? -126.213 -19.688 -43.684  1.00 71.06  ? 74  SER D CB  1 
ATOM 10809 O OG  . SER D 1 105 ? -125.404 -19.786 -44.835  1.00 70.68  ? 74  SER D OG  1 
ATOM 10810 N N   . ILE D 1 106 ? -124.881 -16.636 -43.997  1.00 68.37  ? 75  ILE D N   1 
ATOM 10811 C CA  . ILE D 1 106 ? -123.953 -15.581 -43.614  1.00 66.72  ? 75  ILE D CA  1 
ATOM 10812 C C   . ILE D 1 106 ? -124.545 -14.177 -43.866  1.00 65.61  ? 75  ILE D C   1 
ATOM 10813 O O   . ILE D 1 106 ? -124.762 -13.754 -45.003  1.00 65.37  ? 75  ILE D O   1 
ATOM 10814 C CB  . ILE D 1 106 ? -122.525 -15.815 -44.165  1.00 66.59  ? 75  ILE D CB  1 
ATOM 10815 C CG1 . ILE D 1 106 ? -121.680 -14.564 -43.953  1.00 66.86  ? 75  ILE D CG1 1 
ATOM 10816 C CG2 . ILE D 1 106 ? -122.555 -16.268 -45.614  1.00 67.04  ? 75  ILE D CG2 1 
ATOM 10817 C CD1 . ILE D 1 106 ? -120.550 -14.395 -44.918  1.00 67.94  ? 75  ILE D CD1 1 
ATOM 10818 N N   . GLN D 1 107 ? -124.839 -13.484 -42.772  1.00 118.86 ? 76  GLN D N   1 
ATOM 10819 C CA  . GLN D 1 107 ? -125.557 -12.214 -42.812  1.00 118.59 ? 76  GLN D CA  1 
ATOM 10820 C C   . GLN D 1 107 ? -124.596 -11.060 -42.843  1.00 116.44 ? 76  GLN D C   1 
ATOM 10821 O O   . GLN D 1 107 ? -123.646 -11.037 -42.091  1.00 115.17 ? 76  GLN D O   1 
ATOM 10822 C CB  . GLN D 1 107 ? -126.403 -12.012 -41.544  1.00 118.79 ? 76  GLN D CB  1 
ATOM 10823 C CG  . GLN D 1 107 ? -127.459 -13.054 -41.234  1.00 122.18 ? 76  GLN D CG  1 
ATOM 10824 C CD  . GLN D 1 107 ? -128.524 -13.101 -42.288  1.00 127.98 ? 76  GLN D CD  1 
ATOM 10825 O OE1 . GLN D 1 107 ? -128.901 -12.063 -42.843  1.00 130.91 ? 76  GLN D OE1 1 
ATOM 10826 N NE2 . GLN D 1 107 ? -129.010 -14.311 -42.598  1.00 130.08 ? 76  GLN D NE2 1 
ATOM 10827 N N   . PRO D 1 108 ? -124.864 -10.060 -43.671  1.00 116.42 ? 77  PRO D N   1 
ATOM 10828 C CA  . PRO D 1 108 ? -124.091 -8.820  -43.592  1.00 115.05 ? 77  PRO D CA  1 
ATOM 10829 C C   . PRO D 1 108 ? -124.387 -8.050  -42.315  1.00 113.37 ? 77  PRO D C   1 
ATOM 10830 O O   . PRO D 1 108 ? -125.543 -7.855  -41.972  1.00 114.08 ? 77  PRO D O   1 
ATOM 10831 C CB  . PRO D 1 108 ? -124.586 -8.026  -44.790  1.00 117.17 ? 77  PRO D CB  1 
ATOM 10832 C CG  . PRO D 1 108 ? -125.927 -8.629  -45.125  1.00 119.05 ? 77  PRO D CG  1 
ATOM 10833 C CD  . PRO D 1 108 ? -125.826 -10.067 -44.779  1.00 118.36 ? 77  PRO D CD  1 
ATOM 10834 N N   . TYR D 1 109 ? -123.346 -7.610  -41.623  1.00 111.31 ? 78  TYR D N   1 
ATOM 10835 C CA  . TYR D 1 109 ? -123.501 -6.889  -40.360  1.00 109.80 ? 78  TYR D CA  1 
ATOM 10836 C C   . TYR D 1 109 ? -124.424 -5.701  -40.551  1.00 111.62 ? 78  TYR D C   1 
ATOM 10837 O O   . TYR D 1 109 ? -125.238 -5.417  -39.693  1.00 112.25 ? 78  TYR D O   1 
ATOM 10838 C CB  . TYR D 1 109 ? -122.130 -6.456  -39.820  1.00 107.86 ? 78  TYR D CB  1 
ATOM 10839 C CG  . TYR D 1 109 ? -122.114 -5.503  -38.650  1.00 104.57 ? 78  TYR D CG  1 
ATOM 10840 C CD1 . TYR D 1 109 ? -122.107 -5.973  -37.345  1.00 101.04 ? 78  TYR D CD1 1 
ATOM 10841 C CD2 . TYR D 1 109 ? -122.048 -4.117  -38.853  1.00 103.73 ? 78  TYR D CD2 1 
ATOM 10842 C CE1 . TYR D 1 109 ? -122.064 -5.077  -36.251  1.00 100.34 ? 78  TYR D CE1 1 
ATOM 10843 C CE2 . TYR D 1 109 ? -122.011 -3.210  -37.776  1.00 102.12 ? 78  TYR D CE2 1 
ATOM 10844 C CZ  . TYR D 1 109 ? -122.015 -3.695  -36.475  1.00 100.78 ? 78  TYR D CZ  1 
ATOM 10845 O OH  . TYR D 1 109 ? -121.975 -2.806  -35.415  1.00 98.97  ? 78  TYR D OH  1 
ATOM 10846 N N   . GLU D 1 110 ? -124.331 -5.022  -41.685  1.00 113.08 ? 79  GLU D N   1 
ATOM 10847 C CA  . GLU D 1 110 ? -125.102 -3.799  -41.858  1.00 115.05 ? 79  GLU D CA  1 
ATOM 10848 C C   . GLU D 1 110 ? -126.584 -4.013  -41.724  1.00 115.68 ? 79  GLU D C   1 
ATOM 10849 O O   . GLU D 1 110 ? -127.270 -3.129  -41.221  1.00 116.60 ? 79  GLU D O   1 
ATOM 10850 C CB  . GLU D 1 110 ? -124.773 -3.093  -43.173  1.00 117.03 ? 79  GLU D CB  1 
ATOM 10851 C CG  . GLU D 1 110 ? -123.379 -2.458  -43.180  1.00 119.01 ? 79  GLU D CG  1 
ATOM 10852 C CD  . GLU D 1 110 ? -123.060 -1.648  -41.905  1.00 121.13 ? 79  GLU D CD  1 
ATOM 10853 O OE1 . GLU D 1 110 ? -123.999 -1.014  -41.328  1.00 123.25 ? 79  GLU D OE1 1 
ATOM 10854 O OE2 . GLU D 1 110 ? -121.860 -1.653  -41.504  1.00 119.52 ? 79  GLU D OE2 1 
ATOM 10855 N N   . LYS D 1 111 ? -127.064 -5.182  -42.165  1.00 115.57 ? 80  LYS D N   1 
ATOM 10856 C CA  . LYS D 1 111 ? -128.476 -5.555  -42.031  1.00 116.58 ? 80  LYS D CA  1 
ATOM 10857 C C   . LYS D 1 111 ? -128.821 -5.541  -40.537  1.00 115.94 ? 80  LYS D C   1 
ATOM 10858 O O   . LYS D 1 111 ? -129.763 -4.865  -40.110  1.00 117.62 ? 80  LYS D O   1 
ATOM 10859 C CB  . LYS D 1 111 ? -128.789 -6.913  -42.692  1.00 116.23 ? 80  LYS D CB  1 
ATOM 10860 N N   . ILE D 1 112 ? -128.007 -6.224  -39.741  1.00 113.96 ? 81  ILE D N   1 
ATOM 10861 C CA  . ILE D 1 112 ? -128.251 -6.380  -38.319  1.00 112.86 ? 81  ILE D CA  1 
ATOM 10862 C C   . ILE D 1 112 ? -128.175 -5.099  -37.507  1.00 113.44 ? 81  ILE D C   1 
ATOM 10863 O O   . ILE D 1 112 ? -129.045 -4.856  -36.701  1.00 114.32 ? 81  ILE D O   1 
ATOM 10864 C CB  . ILE D 1 112 ? -127.364 -7.480  -37.766  1.00 110.83 ? 81  ILE D CB  1 
ATOM 10865 C CG1 . ILE D 1 112 ? -128.004 -8.818  -38.105  1.00 110.93 ? 81  ILE D CG1 1 
ATOM 10866 C CG2 . ILE D 1 112 ? -127.175 -7.336  -36.282  1.00 109.95 ? 81  ILE D CG2 1 
ATOM 10867 C CD1 . ILE D 1 112 ? -127.036 -9.940  -38.233  1.00 110.06 ? 81  ILE D CD1 1 
ATOM 10868 N N   . LYS D 1 113 ? -127.173 -4.260  -37.731  1.00 113.95 ? 82  LYS D N   1 
ATOM 10869 C CA  . LYS D 1 113 ? -127.103 -2.967  -37.035  1.00 115.79 ? 82  LYS D CA  1 
ATOM 10870 C C   . LYS D 1 113 ? -128.359 -2.116  -37.290  1.00 118.71 ? 82  LYS D C   1 
ATOM 10871 O O   . LYS D 1 113 ? -128.772 -1.310  -36.438  1.00 119.84 ? 82  LYS D O   1 
ATOM 10872 C CB  . LYS D 1 113 ? -125.846 -2.165  -37.419  1.00 115.45 ? 82  LYS D CB  1 
ATOM 10873 C CG  . LYS D 1 113 ? -125.762 -0.833  -36.667  1.00 117.40 ? 82  LYS D CG  1 
ATOM 10874 C CD  . LYS D 1 113 ? -124.657 0.121   -37.093  1.00 119.77 ? 82  LYS D CD  1 
ATOM 10875 C CE  . LYS D 1 113 ? -124.969 1.527   -36.534  1.00 122.46 ? 82  LYS D CE  1 
ATOM 10876 N NZ  . LYS D 1 113 ? -123.812 2.231   -35.884  1.00 123.18 ? 82  LYS D NZ  1 
ATOM 10877 N N   . ALA D 1 114 ? -128.947 -2.284  -38.473  1.00 120.38 ? 83  ALA D N   1 
ATOM 10878 C CA  . ALA D 1 114 ? -130.179 -1.614  -38.810  1.00 122.96 ? 83  ALA D CA  1 
ATOM 10879 C C   . ALA D 1 114 ? -131.333 -2.518  -38.393  1.00 123.98 ? 83  ALA D C   1 
ATOM 10880 O O   . ALA D 1 114 ? -132.103 -2.983  -39.222  1.00 125.28 ? 83  ALA D O   1 
ATOM 10881 C CB  . ALA D 1 114 ? -130.215 -1.296  -40.290  1.00 124.06 ? 83  ALA D CB  1 
ATOM 10882 N N   . ARG D 1 115 ? -131.418 -2.793  -37.095  1.00 124.07 ? 84  ARG D N   1 
ATOM 10883 C CA  . ARG D 1 115 ? -132.558 -3.500  -36.520  1.00 125.80 ? 84  ARG D CA  1 
ATOM 10884 C C   . ARG D 1 115 ? -133.176 -2.815  -35.318  1.00 127.39 ? 84  ARG D C   1 
ATOM 10885 O O   . ARG D 1 115 ? -134.395 -2.729  -35.250  1.00 130.04 ? 84  ARG D O   1 
ATOM 10886 C CB  . ARG D 1 115 ? -132.242 -4.943  -36.173  1.00 124.29 ? 84  ARG D CB  1 
ATOM 10887 C CG  . ARG D 1 115 ? -132.383 -5.797  -37.345  1.00 125.86 ? 84  ARG D CG  1 
ATOM 10888 C CD  . ARG D 1 115 ? -132.851 -7.156  -37.002  1.00 129.14 ? 84  ARG D CD  1 
ATOM 10889 N NE  . ARG D 1 115 ? -133.220 -7.799  -38.255  1.00 133.78 ? 84  ARG D NE  1 
ATOM 10890 C CZ  . ARG D 1 115 ? -133.000 -9.077  -38.543  1.00 135.60 ? 84  ARG D CZ  1 
ATOM 10891 N NH1 . ARG D 1 115 ? -132.400 -9.867  -37.650  1.00 135.52 ? 84  ARG D NH1 1 
ATOM 10892 N NH2 . ARG D 1 115 ? -133.372 -9.559  -39.731  1.00 137.01 ? 84  ARG D NH2 1 
ATOM 10893 N N   . GLY D 1 116 ? -132.384 -2.343  -34.357  1.00 126.74 ? 85  GLY D N   1 
ATOM 10894 C CA  . GLY D 1 116 ? -130.954 -2.518  -34.312  1.00 124.92 ? 85  GLY D CA  1 
ATOM 10895 C C   . GLY D 1 116 ? -130.557 -2.735  -32.880  1.00 124.41 ? 85  GLY D C   1 
ATOM 10896 O O   . GLY D 1 116 ? -130.180 -3.840  -32.498  1.00 123.20 ? 85  GLY D O   1 
ATOM 10897 N N   . LEU D 1 117 ? -130.684 -1.678  -32.086  1.00 125.73 ? 86  LEU D N   1 
ATOM 10898 C CA  . LEU D 1 117 ? -130.125 -1.631  -30.738  1.00 125.82 ? 86  LEU D CA  1 
ATOM 10899 C C   . LEU D 1 117 ? -131.094 -2.185  -29.681  1.00 127.56 ? 86  LEU D C   1 
ATOM 10900 O O   . LEU D 1 117 ? -132.221 -1.696  -29.586  1.00 130.02 ? 86  LEU D O   1 
ATOM 10901 C CB  . LEU D 1 117 ? -129.765 -0.176  -30.421  1.00 126.44 ? 86  LEU D CB  1 
ATOM 10902 C CG  . LEU D 1 117 ? -128.568 0.128   -29.529  1.00 124.65 ? 86  LEU D CG  1 
ATOM 10903 C CD1 . LEU D 1 117 ? -127.403 -0.764  -29.871  1.00 121.22 ? 86  LEU D CD1 1 
ATOM 10904 C CD2 . LEU D 1 117 ? -128.191 1.581   -29.707  1.00 125.40 ? 86  LEU D CD2 1 
ATOM 10905 N N   . PRO D 1 118 ? -130.669 -3.189  -28.872  1.00 126.91 ? 87  PRO D N   1 
ATOM 10906 C CA  . PRO D 1 118 ? -131.603 -3.701  -27.873  1.00 128.80 ? 87  PRO D CA  1 
ATOM 10907 C C   . PRO D 1 118 ? -131.988 -2.533  -27.007  1.00 131.42 ? 87  PRO D C   1 
ATOM 10908 O O   . PRO D 1 118 ? -131.116 -1.769  -26.605  1.00 131.04 ? 87  PRO D O   1 
ATOM 10909 C CB  . PRO D 1 118 ? -130.764 -4.679  -27.059  1.00 127.48 ? 87  PRO D CB  1 
ATOM 10910 C CG  . PRO D 1 118 ? -129.504 -4.854  -27.784  1.00 124.64 ? 87  PRO D CG  1 
ATOM 10911 C CD  . PRO D 1 118 ? -129.301 -3.665  -28.631  1.00 124.84 ? 87  PRO D CD  1 
ATOM 10912 N N   . ASP D 1 119 ? -133.276 -2.352  -26.758  1.00 134.74 ? 88  ASP D N   1 
ATOM 10913 C CA  . ASP D 1 119 ? -133.716 -1.123  -26.089  1.00 138.06 ? 88  ASP D CA  1 
ATOM 10914 C C   . ASP D 1 119 ? -133.533 -1.249  -24.583  1.00 138.94 ? 88  ASP D C   1 
ATOM 10915 O O   . ASP D 1 119 ? -133.250 -0.263  -23.883  1.00 140.05 ? 88  ASP D O   1 
ATOM 10916 C CB  . ASP D 1 119 ? -135.184 -0.823  -26.403  1.00 140.82 ? 88  ASP D CB  1 
ATOM 10917 C CG  . ASP D 1 119 ? -136.111 -1.838  -25.781  1.00 143.20 ? 88  ASP D CG  1 
ATOM 10918 O OD1 . ASP D 1 119 ? -135.846 -3.046  -25.996  1.00 143.17 ? 88  ASP D OD1 1 
ATOM 10919 O OD2 . ASP D 1 119 ? -137.060 -1.437  -25.059  1.00 146.79 ? 88  ASP D OD2 1 
ATOM 10920 N N   . ASN D 1 120 ? -133.706 -2.473  -24.094  1.00 138.88 ? 89  ASN D N   1 
ATOM 10921 C CA  . ASN D 1 120 ? -133.683 -2.717  -22.668  1.00 140.01 ? 89  ASN D CA  1 
ATOM 10922 C C   . ASN D 1 120 ? -132.613 -3.706  -22.260  1.00 137.96 ? 89  ASN D C   1 
ATOM 10923 O O   . ASN D 1 120 ? -132.301 -4.655  -22.981  1.00 136.12 ? 89  ASN D O   1 
ATOM 10924 C CB  . ASN D 1 120 ? -135.064 -3.134  -22.131  1.00 142.79 ? 89  ASN D CB  1 
ATOM 10925 N N   . ILE D 1 121 ? -131.977 -3.377  -21.147  1.00 138.27 ? 90  ILE D N   1 
ATOM 10926 C CA  . ILE D 1 121 ? -132.110 -2.001  -20.636  1.00 139.72 ? 90  ILE D CA  1 
ATOM 10927 C C   . ILE D 1 121 ? -130.820 -1.121  -20.829  1.00 137.75 ? 90  ILE D C   1 
ATOM 10928 O O   . ILE D 1 121 ? -130.869 0.103   -20.618  1.00 139.15 ? 90  ILE D O   1 
ATOM 10929 C CB  . ILE D 1 121 ? -132.716 -1.920  -19.167  1.00 142.69 ? 90  ILE D CB  1 
ATOM 10930 C CG1 . ILE D 1 121 ? -133.135 -3.303  -18.626  1.00 143.10 ? 90  ILE D CG1 1 
ATOM 10931 C CG2 . ILE D 1 121 ? -133.870 -0.885  -19.111  1.00 145.13 ? 90  ILE D CG2 1 
ATOM 10932 C CD1 . ILE D 1 121 ? -133.028 -3.429  -17.084  1.00 145.36 ? 90  ILE D CD1 1 
ATOM 10933 N N   . SER D 1 122 ? -129.686 -1.695  -21.257  1.00 134.26 ? 91  SER D N   1 
ATOM 10934 C CA  . SER D 1 122 ? -129.507 -3.088  -21.676  1.00 131.35 ? 91  SER D CA  1 
ATOM 10935 C C   . SER D 1 122 ? -128.072 -3.500  -21.367  1.00 129.19 ? 91  SER D C   1 
ATOM 10936 O O   . SER D 1 122 ? -127.225 -3.298  -22.258  1.00 127.66 ? 91  SER D O   1 
ATOM 10937 C CB  . SER D 1 122 ? -129.679 -3.167  -23.189  1.00 129.83 ? 91  SER D CB  1 
ATOM 10938 O OG  . SER D 1 122 ? -128.784 -2.268  -23.823  1.00 127.40 ? 91  SER D OG  1 
ATOM 10939 N N   . SER D 1 123 ? -127.736 -4.101  -20.202  1.00 128.60 ? 92  SER D N   1 
ATOM 10940 C CA  . SER D 1 123 ? -128.595 -4.775  -19.207  1.00 129.18 ? 92  SER D CA  1 
ATOM 10941 C C   . SER D 1 123 ? -129.287 -6.007  -19.813  1.00 128.71 ? 92  SER D C   1 
ATOM 10942 O O   . SER D 1 123 ? -130.014 -6.755  -19.168  1.00 129.87 ? 92  SER D O   1 
ATOM 10943 C CB  . SER D 1 123 ? -129.501 -3.790  -18.479  1.00 131.58 ? 92  SER D CB  1 
ATOM 10944 O OG  . SER D 1 123 ? -128.774 -2.604  -18.190  1.00 129.67 ? 92  SER D OG  1 
ATOM 10945 N N   . VAL D 1 124 ? -129.012 -6.190  -21.093  1.00 126.88 ? 93  VAL D N   1 
ATOM 10946 C CA  . VAL D 1 124 ? -129.005 -7.480  -21.758  1.00 125.98 ? 93  VAL D CA  1 
ATOM 10947 C C   . VAL D 1 124 ? -127.578 -8.086  -21.615  1.00 124.47 ? 93  VAL D C   1 
ATOM 10948 O O   . VAL D 1 124 ? -127.327 -9.228  -22.038  1.00 124.06 ? 93  VAL D O   1 
ATOM 10949 C CB  . VAL D 1 124 ? -129.371 -7.315  -23.269  1.00 124.93 ? 93  VAL D CB  1 
ATOM 10950 C CG1 . VAL D 1 124 ? -128.242 -6.634  -24.060  1.00 122.29 ? 93  VAL D CG1 1 
ATOM 10951 C CG2 . VAL D 1 124 ? -129.719 -8.648  -23.889  1.00 124.57 ? 93  VAL D CG2 1 
ATOM 10952 N N   . LEU D 1 125 ? -126.659 -7.308  -21.020  1.00 123.58 ? 94  LEU D N   1 
ATOM 10953 C CA  . LEU D 1 125 ? -125.242 -7.676  -20.847  1.00 121.05 ? 94  LEU D CA  1 
ATOM 10954 C C   . LEU D 1 125 ? -124.990 -8.683  -19.705  1.00 121.62 ? 94  LEU D C   1 
ATOM 10955 O O   . LEU D 1 125 ? -124.018 -9.447  -19.737  1.00 120.49 ? 94  LEU D O   1 
ATOM 10956 C CB  . LEU D 1 125 ? -124.403 -6.416  -20.632  1.00 120.46 ? 94  LEU D CB  1 
ATOM 10957 C CG  . LEU D 1 125 ? -124.457 -5.321  -21.694  1.00 118.86 ? 94  LEU D CG  1 
ATOM 10958 C CD1 . LEU D 1 125 ? -123.988 -4.022  -21.105  1.00 119.57 ? 94  LEU D CD1 1 
ATOM 10959 C CD2 . LEU D 1 125 ? -123.603 -5.669  -22.869  1.00 116.71 ? 94  LEU D CD2 1 
ATOM 10960 N N   . ASN D 1 126 ? -125.865 -8.680  -18.701  1.00 123.21 ? 95  ASN D N   1 
ATOM 10961 C CA  . ASN D 1 126 ? -125.792 -9.664  -17.618  1.00 124.15 ? 95  ASN D CA  1 
ATOM 10962 C C   . ASN D 1 126 ? -126.245 -11.051 -18.101  1.00 123.65 ? 95  ASN D C   1 
ATOM 10963 O O   . ASN D 1 126 ? -126.810 -11.843 -17.328  1.00 126.00 ? 95  ASN D O   1 
ATOM 10964 C CB  . ASN D 1 126 ? -126.630 -9.242  -16.394  1.00 127.02 ? 95  ASN D CB  1 
ATOM 10965 C CG  . ASN D 1 126 ? -126.611 -7.735  -16.140  1.00 127.96 ? 95  ASN D CG  1 
ATOM 10966 O OD1 . ASN D 1 126 ? -126.777 -6.931  -17.069  1.00 128.24 ? 95  ASN D OD1 1 
ATOM 10967 N ND2 . ASN D 1 126 ? -126.441 -7.346  -14.874  1.00 129.12 ? 95  ASN D ND2 1 
ATOM 10968 N N   . LYS D 1 127 ? -126.020 -11.331 -19.384  1.00 120.53 ? 96  LYS D N   1 
ATOM 10969 C CA  . LYS D 1 127 ? -126.312 -12.641 -19.926  1.00 119.37 ? 96  LYS D CA  1 
ATOM 10970 C C   . LYS D 1 127 ? -125.118 -13.090 -20.728  1.00 116.25 ? 96  LYS D C   1 
ATOM 10971 O O   . LYS D 1 127 ? -125.171 -14.127 -21.391  1.00 116.17 ? 96  LYS D O   1 
ATOM 10972 C CB  . LYS D 1 127 ? -127.555 -12.587 -20.812  1.00 120.01 ? 96  LYS D CB  1 
ATOM 10973 C CG  . LYS D 1 127 ? -128.526 -13.754 -20.541  1.00 122.88 ? 96  LYS D CG  1 
ATOM 10974 C CD  . LYS D 1 127 ? -129.902 -13.438 -21.114  1.00 124.95 ? 96  LYS D CD  1 
ATOM 10975 C CE  . LYS D 1 127 ? -130.982 -13.933 -20.157  1.00 128.96 ? 96  LYS D CE  1 
ATOM 10976 N NZ  . LYS D 1 127 ? -132.331 -13.386 -20.506  1.00 131.74 ? 96  LYS D NZ  1 
ATOM 10977 N N   . LEU D 1 128 ? -124.034 -12.313 -20.634  1.00 113.59 ? 97  LEU D N   1 
ATOM 10978 C CA  . LEU D 1 128 ? -122.847 -12.467 -21.489  1.00 109.93 ? 97  LEU D CA  1 
ATOM 10979 C C   . LEU D 1 128 ? -121.525 -12.662 -20.748  1.00 109.13 ? 97  LEU D C   1 
ATOM 10980 O O   . LEU D 1 128 ? -121.297 -12.041 -19.702  1.00 109.99 ? 97  LEU D O   1 
ATOM 10981 C CB  . LEU D 1 128 ? -122.708 -11.231 -22.345  1.00 108.21 ? 97  LEU D CB  1 
ATOM 10982 C CG  . LEU D 1 128 ? -121.495 -11.259 -23.231  1.00 104.50 ? 97  LEU D CG  1 
ATOM 10983 C CD1 . LEU D 1 128 ? -121.819 -12.109 -24.435  1.00 101.88 ? 97  LEU D CD1 1 
ATOM 10984 C CD2 . LEU D 1 128 ? -121.180 -9.834  -23.572  1.00 102.68 ? 97  LEU D CD2 1 
ATOM 10985 N N   . VAL D 1 129 ? -120.647 -13.498 -21.311  1.00 107.22 ? 98  VAL D N   1 
ATOM 10986 C CA  . VAL D 1 129 ? -119.293 -13.702 -20.757  1.00 106.14 ? 98  VAL D CA  1 
ATOM 10987 C C   . VAL D 1 129 ? -118.141 -13.495 -21.775  1.00 103.47 ? 98  VAL D C   1 
ATOM 10988 O O   . VAL D 1 129 ? -118.122 -14.148 -22.826  1.00 103.03 ? 98  VAL D O   1 
ATOM 10989 C CB  . VAL D 1 129 ? -119.164 -15.089 -20.133  1.00 107.35 ? 98  VAL D CB  1 
ATOM 10990 C CG1 . VAL D 1 129 ? -117.707 -15.370 -19.779  1.00 107.62 ? 98  VAL D CG1 1 
ATOM 10991 C CG2 . VAL D 1 129 ? -120.017 -15.179 -18.905  1.00 109.25 ? 98  VAL D CG2 1 
ATOM 10992 N N   . VAL D 1 130 ? -117.186 -12.609 -21.465  1.00 101.46 ? 99  VAL D N   1 
ATOM 10993 C CA  . VAL D 1 130 ? -116.087 -12.330 -22.405  1.00 98.69  ? 99  VAL D CA  1 
ATOM 10994 C C   . VAL D 1 130 ? -114.840 -13.177 -22.129  1.00 98.38  ? 99  VAL D C   1 
ATOM 10995 O O   . VAL D 1 130 ? -114.094 -12.938 -21.176  1.00 99.37  ? 99  VAL D O   1 
ATOM 10996 C CB  . VAL D 1 130 ? -115.701 -10.845 -22.454  1.00 97.78  ? 99  VAL D CB  1 
ATOM 10997 C CG1 . VAL D 1 130 ? -114.910 -10.559 -23.713  1.00 95.51  ? 99  VAL D CG1 1 
ATOM 10998 C CG2 . VAL D 1 130 ? -116.923 -10.020 -22.441  1.00 97.82  ? 99  VAL D CG2 1 
ATOM 10999 N N   . VAL D 1 131 ? -114.616 -14.169 -22.973  1.00 96.98  ? 100 VAL D N   1 
ATOM 11000 C CA  . VAL D 1 131 ? -113.424 -14.957 -22.882  1.00 96.23  ? 100 VAL D CA  1 
ATOM 11001 C C   . VAL D 1 131 ? -112.440 -14.365 -23.867  1.00 95.35  ? 100 VAL D C   1 
ATOM 11002 O O   . VAL D 1 131 ? -112.761 -14.236 -25.063  1.00 94.84  ? 100 VAL D O   1 
ATOM 11003 C CB  . VAL D 1 131 ? -113.731 -16.404 -23.176  1.00 96.39  ? 100 VAL D CB  1 
ATOM 11004 C CG1 . VAL D 1 131 ? -112.508 -17.168 -23.447  1.00 95.69  ? 100 VAL D CG1 1 
ATOM 11005 C CG2 . VAL D 1 131 ? -114.356 -16.984 -21.982  1.00 99.11  ? 100 VAL D CG2 1 
ATOM 11006 N N   . LYS D 1 132 ? -111.278 -13.942 -23.336  1.00 95.48  ? 101 LYS D N   1 
ATOM 11007 C CA  . LYS D 1 132 ? -110.087 -13.502 -24.096  1.00 94.03  ? 101 LYS D CA  1 
ATOM 11008 C C   . LYS D 1 132 ? -109.117 -14.664 -24.089  1.00 94.93  ? 101 LYS D C   1 
ATOM 11009 O O   . LYS D 1 132 ? -108.923 -15.294 -23.046  1.00 95.80  ? 101 LYS D O   1 
ATOM 11010 C CB  . LYS D 1 132 ? -109.412 -12.316 -23.405  1.00 93.54  ? 101 LYS D CB  1 
ATOM 11011 C CG  . LYS D 1 132 ? -110.065 -10.981 -23.616  1.00 91.92  ? 101 LYS D CG  1 
ATOM 11012 C CD  . LYS D 1 132 ? -110.149 -10.670 -25.087  1.00 91.25  ? 101 LYS D CD  1 
ATOM 11013 C CE  . LYS D 1 132 ? -110.988 -9.432  -25.340  1.00 93.27  ? 101 LYS D CE  1 
ATOM 11014 N NZ  . LYS D 1 132 ? -111.303 -9.171  -26.784  1.00 92.91  ? 101 LYS D NZ  1 
ATOM 11015 N N   . LEU D 1 133 ? -108.517 -14.976 -25.231  1.00 95.09  ? 102 LEU D N   1 
ATOM 11016 C CA  . LEU D 1 133 ? -107.535 -16.065 -25.257  1.00 96.80  ? 102 LEU D CA  1 
ATOM 11017 C C   . LEU D 1 133 ? -106.113 -15.540 -25.045  1.00 97.88  ? 102 LEU D C   1 
ATOM 11018 O O   . LEU D 1 133 ? -105.560 -14.791 -25.867  1.00 97.70  ? 102 LEU D O   1 
ATOM 11019 C CB  . LEU D 1 133 ? -107.616 -16.868 -26.542  1.00 96.27  ? 102 LEU D CB  1 
ATOM 11020 C CG  . LEU D 1 133 ? -108.958 -17.448 -26.933  1.00 95.17  ? 102 LEU D CG  1 
ATOM 11021 C CD1 . LEU D 1 133 ? -109.050 -17.524 -28.465  1.00 93.63  ? 102 LEU D CD1 1 
ATOM 11022 C CD2 . LEU D 1 133 ? -109.129 -18.792 -26.271  1.00 94.66  ? 102 LEU D CD2 1 
ATOM 11023 N N   . ASN D 1 134 ? -105.528 -15.945 -23.929  1.00 99.85  ? 103 ASN D N   1 
ATOM 11024 C CA  . ASN