data_3RCE
# 
_entry.id   3RCE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3RCE         
RCSB  RCSB064758   
WWPDB D_1000064758 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3RCE 
_pdbx_database_status.recvd_initial_deposition_date   2011-03-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lizak, C.'    1 
'Gerber, S.'   2 
'Numao, S.'    3 
'Aebi, M.'     4 
'Locher, K.P.' 5 
# 
_citation.id                        primary 
_citation.title                     'X-ray structure of a bacterial oligosaccharyltransferase.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            474 
_citation.page_first                350 
_citation.page_last                 355 
_citation.year                      2011 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21677752 
_citation.pdbx_database_id_DOI      10.1038/nature10151 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lizak, C.'    1 
primary 'Gerber, S.'   2 
primary 'Numao, S.'    3 
primary 'Aebi, M.'     4 
primary 'Locher, K.P.' 5 
# 
_cell.entry_id           3RCE 
_cell.length_a           85.060 
_cell.length_b           116.100 
_cell.length_c           175.040 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3RCE 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Oligosaccharide transferase to N-glycosylate proteins' 84411.922 1 ? K2E ? ? 
2 polymer     syn 'Substrate Mimic Peptide'                               853.792   1 ? ?   ? ? 
3 non-polymer syn 'MAGNESIUM ION'                                         24.305    2 ? ?   ? ? 
4 water       nat water                                                   18.015    1 ? ?   ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;MELQQNFTDNNSIKYTCILILIAFAFSVLCRLYWVAWASEFYEFFFNDQLMITTNDGYAFAEGARDMIAGFHQPNDLSYF
GSSLSTLTYWLYSILPFSFESIILYMSTFFASLIVVPIILIAREYKLTTYGFIAALLGSIANSYYNRTMSGYYDTDMLVL
VLPMLILLTFIRLTINKDIFTLLLSPIFIMIYLWWYPSSYSLNFAMIGLFGLYTLVFHRKEKIFYLAIALMIIALSMLAW
QYKLALIVLLFAIFAFKEEKINFYMIWALIFISISILHLSGGLDPVLYQLKFYVFKASDVQNLKDAAFMYFNVNETIMEV
NTIDPEVFMQRISSSVLVFILSFIGFILLCKDHKSMLLALPMLALGFMALRAGLRFTIYAVPVMALGFGYFLYAFFNFLE
KKQIKLSLRNKNILLILIAFFSISPALMHIYYYKSSTVFTSYEASILNDLKNKAQREDYVVAWWDYGYPIRYYSDVKTLI
DGGKHLGKDNFFSSFVLSKEQIPAANMARLSVEYTEKSFKENYPDVLKAMVKDYNQTSAKDFLESLNDKNFKFDTNKTRD
VYIYMPYRMLRIMPVVAQFANTNPDNGEQEKSLFFSQANAIAQDKTTGSVMLDNGVEIINDFRALKVEGASIPLKAFVDI
ESITNGKFYYNEIDSKAQIYLLFLREYKSFVILDESLYNSAYIQMFLLNQYDQDLFEQVTNDTRAKIYRLKREFHHHHHH
HHHH
;
;MELQQNFTDNNSIKYTCILILIAFAFSVLCRLYWVAWASEFYEFFFNDQLMITTNDGYAFAEGARDMIAGFHQPNDLSYF
GSSLSTLTYWLYSILPFSFESIILYMSTFFASLIVVPIILIAREYKLTTYGFIAALLGSIANSYYNRTMSGYYDTDMLVL
VLPMLILLTFIRLTINKDIFTLLLSPIFIMIYLWWYPSSYSLNFAMIGLFGLYTLVFHRKEKIFYLAIALMIIALSMLAW
QYKLALIVLLFAIFAFKEEKINFYMIWALIFISISILHLSGGLDPVLYQLKFYVFKASDVQNLKDAAFMYFNVNETIMEV
NTIDPEVFMQRISSSVLVFILSFIGFILLCKDHKSMLLALPMLALGFMALRAGLRFTIYAVPVMALGFGYFLYAFFNFLE
KKQIKLSLRNKNILLILIAFFSISPALMHIYYYKSSTVFTSYEASILNDLKNKAQREDYVVAWWDYGYPIRYYSDVKTLI
DGGKHLGKDNFFSSFVLSKEQIPAANMARLSVEYTEKSFKENYPDVLKAMVKDYNQTSAKDFLESLNDKNFKFDTNKTRD
VYIYMPYRMLRIMPVVAQFANTNPDNGEQEKSLFFSQANAIAQDKTTGSVMLDNGVEIINDFRALKVEGASIPLKAFVDI
ESITNGKFYYNEIDSKAQIYLLFLREYKSFVILDESLYNSAYIQMFLLNQYDQDLFEQVTNDTRAKIYRLKREFHHHHHH
HHHH
;
A ? 
2 'polypeptide(L)' no yes 'GDQNAT(PPN)G' GDQNATFG B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   LEU n 
1 4   GLN n 
1 5   GLN n 
1 6   ASN n 
1 7   PHE n 
1 8   THR n 
1 9   ASP n 
1 10  ASN n 
1 11  ASN n 
1 12  SER n 
1 13  ILE n 
1 14  LYS n 
1 15  TYR n 
1 16  THR n 
1 17  CYS n 
1 18  ILE n 
1 19  LEU n 
1 20  ILE n 
1 21  LEU n 
1 22  ILE n 
1 23  ALA n 
1 24  PHE n 
1 25  ALA n 
1 26  PHE n 
1 27  SER n 
1 28  VAL n 
1 29  LEU n 
1 30  CYS n 
1 31  ARG n 
1 32  LEU n 
1 33  TYR n 
1 34  TRP n 
1 35  VAL n 
1 36  ALA n 
1 37  TRP n 
1 38  ALA n 
1 39  SER n 
1 40  GLU n 
1 41  PHE n 
1 42  TYR n 
1 43  GLU n 
1 44  PHE n 
1 45  PHE n 
1 46  PHE n 
1 47  ASN n 
1 48  ASP n 
1 49  GLN n 
1 50  LEU n 
1 51  MET n 
1 52  ILE n 
1 53  THR n 
1 54  THR n 
1 55  ASN n 
1 56  ASP n 
1 57  GLY n 
1 58  TYR n 
1 59  ALA n 
1 60  PHE n 
1 61  ALA n 
1 62  GLU n 
1 63  GLY n 
1 64  ALA n 
1 65  ARG n 
1 66  ASP n 
1 67  MET n 
1 68  ILE n 
1 69  ALA n 
1 70  GLY n 
1 71  PHE n 
1 72  HIS n 
1 73  GLN n 
1 74  PRO n 
1 75  ASN n 
1 76  ASP n 
1 77  LEU n 
1 78  SER n 
1 79  TYR n 
1 80  PHE n 
1 81  GLY n 
1 82  SER n 
1 83  SER n 
1 84  LEU n 
1 85  SER n 
1 86  THR n 
1 87  LEU n 
1 88  THR n 
1 89  TYR n 
1 90  TRP n 
1 91  LEU n 
1 92  TYR n 
1 93  SER n 
1 94  ILE n 
1 95  LEU n 
1 96  PRO n 
1 97  PHE n 
1 98  SER n 
1 99  PHE n 
1 100 GLU n 
1 101 SER n 
1 102 ILE n 
1 103 ILE n 
1 104 LEU n 
1 105 TYR n 
1 106 MET n 
1 107 SER n 
1 108 THR n 
1 109 PHE n 
1 110 PHE n 
1 111 ALA n 
1 112 SER n 
1 113 LEU n 
1 114 ILE n 
1 115 VAL n 
1 116 VAL n 
1 117 PRO n 
1 118 ILE n 
1 119 ILE n 
1 120 LEU n 
1 121 ILE n 
1 122 ALA n 
1 123 ARG n 
1 124 GLU n 
1 125 TYR n 
1 126 LYS n 
1 127 LEU n 
1 128 THR n 
1 129 THR n 
1 130 TYR n 
1 131 GLY n 
1 132 PHE n 
1 133 ILE n 
1 134 ALA n 
1 135 ALA n 
1 136 LEU n 
1 137 LEU n 
1 138 GLY n 
1 139 SER n 
1 140 ILE n 
1 141 ALA n 
1 142 ASN n 
1 143 SER n 
1 144 TYR n 
1 145 TYR n 
1 146 ASN n 
1 147 ARG n 
1 148 THR n 
1 149 MET n 
1 150 SER n 
1 151 GLY n 
1 152 TYR n 
1 153 TYR n 
1 154 ASP n 
1 155 THR n 
1 156 ASP n 
1 157 MET n 
1 158 LEU n 
1 159 VAL n 
1 160 LEU n 
1 161 VAL n 
1 162 LEU n 
1 163 PRO n 
1 164 MET n 
1 165 LEU n 
1 166 ILE n 
1 167 LEU n 
1 168 LEU n 
1 169 THR n 
1 170 PHE n 
1 171 ILE n 
1 172 ARG n 
1 173 LEU n 
1 174 THR n 
1 175 ILE n 
1 176 ASN n 
1 177 LYS n 
1 178 ASP n 
1 179 ILE n 
1 180 PHE n 
1 181 THR n 
1 182 LEU n 
1 183 LEU n 
1 184 LEU n 
1 185 SER n 
1 186 PRO n 
1 187 ILE n 
1 188 PHE n 
1 189 ILE n 
1 190 MET n 
1 191 ILE n 
1 192 TYR n 
1 193 LEU n 
1 194 TRP n 
1 195 TRP n 
1 196 TYR n 
1 197 PRO n 
1 198 SER n 
1 199 SER n 
1 200 TYR n 
1 201 SER n 
1 202 LEU n 
1 203 ASN n 
1 204 PHE n 
1 205 ALA n 
1 206 MET n 
1 207 ILE n 
1 208 GLY n 
1 209 LEU n 
1 210 PHE n 
1 211 GLY n 
1 212 LEU n 
1 213 TYR n 
1 214 THR n 
1 215 LEU n 
1 216 VAL n 
1 217 PHE n 
1 218 HIS n 
1 219 ARG n 
1 220 LYS n 
1 221 GLU n 
1 222 LYS n 
1 223 ILE n 
1 224 PHE n 
1 225 TYR n 
1 226 LEU n 
1 227 ALA n 
1 228 ILE n 
1 229 ALA n 
1 230 LEU n 
1 231 MET n 
1 232 ILE n 
1 233 ILE n 
1 234 ALA n 
1 235 LEU n 
1 236 SER n 
1 237 MET n 
1 238 LEU n 
1 239 ALA n 
1 240 TRP n 
1 241 GLN n 
1 242 TYR n 
1 243 LYS n 
1 244 LEU n 
1 245 ALA n 
1 246 LEU n 
1 247 ILE n 
1 248 VAL n 
1 249 LEU n 
1 250 LEU n 
1 251 PHE n 
1 252 ALA n 
1 253 ILE n 
1 254 PHE n 
1 255 ALA n 
1 256 PHE n 
1 257 LYS n 
1 258 GLU n 
1 259 GLU n 
1 260 LYS n 
1 261 ILE n 
1 262 ASN n 
1 263 PHE n 
1 264 TYR n 
1 265 MET n 
1 266 ILE n 
1 267 TRP n 
1 268 ALA n 
1 269 LEU n 
1 270 ILE n 
1 271 PHE n 
1 272 ILE n 
1 273 SER n 
1 274 ILE n 
1 275 SER n 
1 276 ILE n 
1 277 LEU n 
1 278 HIS n 
1 279 LEU n 
1 280 SER n 
1 281 GLY n 
1 282 GLY n 
1 283 LEU n 
1 284 ASP n 
1 285 PRO n 
1 286 VAL n 
1 287 LEU n 
1 288 TYR n 
1 289 GLN n 
1 290 LEU n 
1 291 LYS n 
1 292 PHE n 
1 293 TYR n 
1 294 VAL n 
1 295 PHE n 
1 296 LYS n 
1 297 ALA n 
1 298 SER n 
1 299 ASP n 
1 300 VAL n 
1 301 GLN n 
1 302 ASN n 
1 303 LEU n 
1 304 LYS n 
1 305 ASP n 
1 306 ALA n 
1 307 ALA n 
1 308 PHE n 
1 309 MET n 
1 310 TYR n 
1 311 PHE n 
1 312 ASN n 
1 313 VAL n 
1 314 ASN n 
1 315 GLU n 
1 316 THR n 
1 317 ILE n 
1 318 MET n 
1 319 GLU n 
1 320 VAL n 
1 321 ASN n 
1 322 THR n 
1 323 ILE n 
1 324 ASP n 
1 325 PRO n 
1 326 GLU n 
1 327 VAL n 
1 328 PHE n 
1 329 MET n 
1 330 GLN n 
1 331 ARG n 
1 332 ILE n 
1 333 SER n 
1 334 SER n 
1 335 SER n 
1 336 VAL n 
1 337 LEU n 
1 338 VAL n 
1 339 PHE n 
1 340 ILE n 
1 341 LEU n 
1 342 SER n 
1 343 PHE n 
1 344 ILE n 
1 345 GLY n 
1 346 PHE n 
1 347 ILE n 
1 348 LEU n 
1 349 LEU n 
1 350 CYS n 
1 351 LYS n 
1 352 ASP n 
1 353 HIS n 
1 354 LYS n 
1 355 SER n 
1 356 MET n 
1 357 LEU n 
1 358 LEU n 
1 359 ALA n 
1 360 LEU n 
1 361 PRO n 
1 362 MET n 
1 363 LEU n 
1 364 ALA n 
1 365 LEU n 
1 366 GLY n 
1 367 PHE n 
1 368 MET n 
1 369 ALA n 
1 370 LEU n 
1 371 ARG n 
1 372 ALA n 
1 373 GLY n 
1 374 LEU n 
1 375 ARG n 
1 376 PHE n 
1 377 THR n 
1 378 ILE n 
1 379 TYR n 
1 380 ALA n 
1 381 VAL n 
1 382 PRO n 
1 383 VAL n 
1 384 MET n 
1 385 ALA n 
1 386 LEU n 
1 387 GLY n 
1 388 PHE n 
1 389 GLY n 
1 390 TYR n 
1 391 PHE n 
1 392 LEU n 
1 393 TYR n 
1 394 ALA n 
1 395 PHE n 
1 396 PHE n 
1 397 ASN n 
1 398 PHE n 
1 399 LEU n 
1 400 GLU n 
1 401 LYS n 
1 402 LYS n 
1 403 GLN n 
1 404 ILE n 
1 405 LYS n 
1 406 LEU n 
1 407 SER n 
1 408 LEU n 
1 409 ARG n 
1 410 ASN n 
1 411 LYS n 
1 412 ASN n 
1 413 ILE n 
1 414 LEU n 
1 415 LEU n 
1 416 ILE n 
1 417 LEU n 
1 418 ILE n 
1 419 ALA n 
1 420 PHE n 
1 421 PHE n 
1 422 SER n 
1 423 ILE n 
1 424 SER n 
1 425 PRO n 
1 426 ALA n 
1 427 LEU n 
1 428 MET n 
1 429 HIS n 
1 430 ILE n 
1 431 TYR n 
1 432 TYR n 
1 433 TYR n 
1 434 LYS n 
1 435 SER n 
1 436 SER n 
1 437 THR n 
1 438 VAL n 
1 439 PHE n 
1 440 THR n 
1 441 SER n 
1 442 TYR n 
1 443 GLU n 
1 444 ALA n 
1 445 SER n 
1 446 ILE n 
1 447 LEU n 
1 448 ASN n 
1 449 ASP n 
1 450 LEU n 
1 451 LYS n 
1 452 ASN n 
1 453 LYS n 
1 454 ALA n 
1 455 GLN n 
1 456 ARG n 
1 457 GLU n 
1 458 ASP n 
1 459 TYR n 
1 460 VAL n 
1 461 VAL n 
1 462 ALA n 
1 463 TRP n 
1 464 TRP n 
1 465 ASP n 
1 466 TYR n 
1 467 GLY n 
1 468 TYR n 
1 469 PRO n 
1 470 ILE n 
1 471 ARG n 
1 472 TYR n 
1 473 TYR n 
1 474 SER n 
1 475 ASP n 
1 476 VAL n 
1 477 LYS n 
1 478 THR n 
1 479 LEU n 
1 480 ILE n 
1 481 ASP n 
1 482 GLY n 
1 483 GLY n 
1 484 LYS n 
1 485 HIS n 
1 486 LEU n 
1 487 GLY n 
1 488 LYS n 
1 489 ASP n 
1 490 ASN n 
1 491 PHE n 
1 492 PHE n 
1 493 SER n 
1 494 SER n 
1 495 PHE n 
1 496 VAL n 
1 497 LEU n 
1 498 SER n 
1 499 LYS n 
1 500 GLU n 
1 501 GLN n 
1 502 ILE n 
1 503 PRO n 
1 504 ALA n 
1 505 ALA n 
1 506 ASN n 
1 507 MET n 
1 508 ALA n 
1 509 ARG n 
1 510 LEU n 
1 511 SER n 
1 512 VAL n 
1 513 GLU n 
1 514 TYR n 
1 515 THR n 
1 516 GLU n 
1 517 LYS n 
1 518 SER n 
1 519 PHE n 
1 520 LYS n 
1 521 GLU n 
1 522 ASN n 
1 523 TYR n 
1 524 PRO n 
1 525 ASP n 
1 526 VAL n 
1 527 LEU n 
1 528 LYS n 
1 529 ALA n 
1 530 MET n 
1 531 VAL n 
1 532 LYS n 
1 533 ASP n 
1 534 TYR n 
1 535 ASN n 
1 536 GLN n 
1 537 THR n 
1 538 SER n 
1 539 ALA n 
1 540 LYS n 
1 541 ASP n 
1 542 PHE n 
1 543 LEU n 
1 544 GLU n 
1 545 SER n 
1 546 LEU n 
1 547 ASN n 
1 548 ASP n 
1 549 LYS n 
1 550 ASN n 
1 551 PHE n 
1 552 LYS n 
1 553 PHE n 
1 554 ASP n 
1 555 THR n 
1 556 ASN n 
1 557 LYS n 
1 558 THR n 
1 559 ARG n 
1 560 ASP n 
1 561 VAL n 
1 562 TYR n 
1 563 ILE n 
1 564 TYR n 
1 565 MET n 
1 566 PRO n 
1 567 TYR n 
1 568 ARG n 
1 569 MET n 
1 570 LEU n 
1 571 ARG n 
1 572 ILE n 
1 573 MET n 
1 574 PRO n 
1 575 VAL n 
1 576 VAL n 
1 577 ALA n 
1 578 GLN n 
1 579 PHE n 
1 580 ALA n 
1 581 ASN n 
1 582 THR n 
1 583 ASN n 
1 584 PRO n 
1 585 ASP n 
1 586 ASN n 
1 587 GLY n 
1 588 GLU n 
1 589 GLN n 
1 590 GLU n 
1 591 LYS n 
1 592 SER n 
1 593 LEU n 
1 594 PHE n 
1 595 PHE n 
1 596 SER n 
1 597 GLN n 
1 598 ALA n 
1 599 ASN n 
1 600 ALA n 
1 601 ILE n 
1 602 ALA n 
1 603 GLN n 
1 604 ASP n 
1 605 LYS n 
1 606 THR n 
1 607 THR n 
1 608 GLY n 
1 609 SER n 
1 610 VAL n 
1 611 MET n 
1 612 LEU n 
1 613 ASP n 
1 614 ASN n 
1 615 GLY n 
1 616 VAL n 
1 617 GLU n 
1 618 ILE n 
1 619 ILE n 
1 620 ASN n 
1 621 ASP n 
1 622 PHE n 
1 623 ARG n 
1 624 ALA n 
1 625 LEU n 
1 626 LYS n 
1 627 VAL n 
1 628 GLU n 
1 629 GLY n 
1 630 ALA n 
1 631 SER n 
1 632 ILE n 
1 633 PRO n 
1 634 LEU n 
1 635 LYS n 
1 636 ALA n 
1 637 PHE n 
1 638 VAL n 
1 639 ASP n 
1 640 ILE n 
1 641 GLU n 
1 642 SER n 
1 643 ILE n 
1 644 THR n 
1 645 ASN n 
1 646 GLY n 
1 647 LYS n 
1 648 PHE n 
1 649 TYR n 
1 650 TYR n 
1 651 ASN n 
1 652 GLU n 
1 653 ILE n 
1 654 ASP n 
1 655 SER n 
1 656 LYS n 
1 657 ALA n 
1 658 GLN n 
1 659 ILE n 
1 660 TYR n 
1 661 LEU n 
1 662 LEU n 
1 663 PHE n 
1 664 LEU n 
1 665 ARG n 
1 666 GLU n 
1 667 TYR n 
1 668 LYS n 
1 669 SER n 
1 670 PHE n 
1 671 VAL n 
1 672 ILE n 
1 673 LEU n 
1 674 ASP n 
1 675 GLU n 
1 676 SER n 
1 677 LEU n 
1 678 TYR n 
1 679 ASN n 
1 680 SER n 
1 681 ALA n 
1 682 TYR n 
1 683 ILE n 
1 684 GLN n 
1 685 MET n 
1 686 PHE n 
1 687 LEU n 
1 688 LEU n 
1 689 ASN n 
1 690 GLN n 
1 691 TYR n 
1 692 ASP n 
1 693 GLN n 
1 694 ASP n 
1 695 LEU n 
1 696 PHE n 
1 697 GLU n 
1 698 GLN n 
1 699 VAL n 
1 700 THR n 
1 701 ASN n 
1 702 ASP n 
1 703 THR n 
1 704 ARG n 
1 705 ALA n 
1 706 LYS n 
1 707 ILE n 
1 708 TYR n 
1 709 ARG n 
1 710 LEU n 
1 711 LYS n 
1 712 ARG n 
1 713 GLU n 
1 714 PHE n 
1 715 HIS n 
1 716 HIS n 
1 717 HIS n 
1 718 HIS n 
1 719 HIS n 
1 720 HIS n 
1 721 HIS n 
1 722 HIS n 
1 723 HIS n 
1 724 HIS n 
2 1   GLY n 
2 2   ASP n 
2 3   GLN n 
2 4   ASN n 
2 5   ALA n 
2 6   THR n 
2 7   PPN n 
2 8   GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'pglB, Cla_1253' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Campylobacter lari' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     201 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'Corresponds to glycosylation sequon' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP B9KDD4_CAMLR B9KDD4 1 
;MKLQQNFTDNNSIKYTCILILIAFAFSVLCRLYWVAWASEFYEFFFNDQLMITTNDGYAFAEGARDMIAGFHQPNDLSYF
GSSLSTLTYWLYSILPFSFESIILYMSAFFASLIVVPIILIAREYKLTTYGFIAALLGSIANSYYNRTMSGYYDTDMLVL
VLPMLILLTFIRLTINKDIFTLLLSPVFIMIYLWWYPSSYSLNFAMIGLFGLYTLVFHRKEKIFYLTIALMIIALSMLAW
QYKLALIVLLFAIFAFKEEKINFYMIWALIFISILILHLSGGLDPVLYQLKFYVFKASDVQNLKDAAFMYFNVNETIMEV
NTIDPEVFMQRISSSVLVFILSFIGFILLCKDHKSMLLALPMLALGFMALRAGLRFTIYAVPVMALGFGYFLYAFFNFLE
KKQIKLSLRNKNILLILIAFFSISPALMHIYYYKSSTVFTSYEASILNDLKNKAQREDYVVAWWDYGYPIRYYSDVKTLI
DGGKHLGKDNFFSSFVLSKEQIPAANMARLSVEYTEKSFKENYPDVLKAMVKDYNKTSAKDFLESLNDKDFKFDTNKTRD
VYIYMPYRMLRIMPVVAQFANTNPDNGEQEKSLFFSQANAIAQDKTTGSVMLDNGVEIINDFRALKVEGASIPLKAFVDI
ESITNGKFYYNEIDSKAQIYLLFLREYKSFVILDESLYNSSYIQMFLLNQYDQDLFEQITNDTRAKIYRLKR
;
1 ? 
2 PDB 3RCE         3RCE   2 GDQNATFG ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3RCE A 1 ? 712 ? B9KDD4 1  ? 712 ? 1  712 
2 2 3RCE B 1 ? 8   ? 3RCE   10 ? 17  ? 10 17  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3RCE GLU A 2   ? UNP B9KDD4 LYS 2   'ENGINEERED MUTATION' 2   1  
1 3RCE THR A 108 ? UNP B9KDD4 ALA 108 'SEE REMARK 999'      108 2  
1 3RCE ILE A 187 ? UNP B9KDD4 VAL 187 'SEE REMARK 999'      187 3  
1 3RCE ALA A 227 ? UNP B9KDD4 THR 227 'SEE REMARK 999'      227 4  
1 3RCE SER A 275 ? UNP B9KDD4 LEU 275 'SEE REMARK 999'      275 5  
1 3RCE GLN A 536 ? UNP B9KDD4 LYS 536 'SEE REMARK 999'      536 6  
1 3RCE ASN A 550 ? UNP B9KDD4 ASP 550 'SEE REMARK 999'      550 7  
1 3RCE ALA A 681 ? UNP B9KDD4 SER 681 'SEE REMARK 999'      681 8  
1 3RCE VAL A 699 ? UNP B9KDD4 ILE 699 'SEE REMARK 999'      699 9  
1 3RCE GLU A 713 ? UNP B9KDD4 ?   ?   'EXPRESSION TAG'      713 10 
1 3RCE PHE A 714 ? UNP B9KDD4 ?   ?   'EXPRESSION TAG'      714 11 
1 3RCE HIS A 715 ? UNP B9KDD4 ?   ?   'EXPRESSION TAG'      715 12 
1 3RCE HIS A 716 ? UNP B9KDD4 ?   ?   'EXPRESSION TAG'      716 13 
1 3RCE HIS A 717 ? UNP B9KDD4 ?   ?   'EXPRESSION TAG'      717 14 
1 3RCE HIS A 718 ? UNP B9KDD4 ?   ?   'EXPRESSION TAG'      718 15 
1 3RCE HIS A 719 ? UNP B9KDD4 ?   ?   'EXPRESSION TAG'      719 16 
1 3RCE HIS A 720 ? UNP B9KDD4 ?   ?   'EXPRESSION TAG'      720 17 
1 3RCE HIS A 721 ? UNP B9KDD4 ?   ?   'EXPRESSION TAG'      721 18 
1 3RCE HIS A 722 ? UNP B9KDD4 ?   ?   'EXPRESSION TAG'      722 19 
1 3RCE HIS A 723 ? UNP B9KDD4 ?   ?   'EXPRESSION TAG'      723 20 
1 3RCE HIS A 724 ? UNP B9KDD4 ?   ?   'EXPRESSION TAG'      724 21 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                 ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE              ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE               ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                 ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE               ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                   ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE              ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                 ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                  ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE              ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION'         ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE           ? 'C9 H11 N O2'    165.189 
PPN 'L-peptide linking' n PARA-NITROPHENYLALANINE ? 'C9 H10 N2 O4'   210.187 
PRO 'L-peptide linking' y PROLINE                 ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                  ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE               ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN              ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                  ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3RCE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      5.07 
_exptl_crystal.density_percent_sol   75.73 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          EVAPORATION 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9.4 
_exptl_crystal_grow.pdbx_details    
'0.1M glycine, 50mM magnesium acetate, 6% Dimethyl sulfoxide (DMSO), 23-34% PEG400, pH 9.4, EVAPORATION, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2010-11-12 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111) monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     3RCE 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            3.4 
_reflns.number_obs                   24350 
_reflns.number_all                   24531 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.4 
_reflns_shell.d_res_low              3.6 
_reflns_shell.percent_possible_all   97.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3RCE 
_refine.ls_number_reflns_obs                     23834 
_refine.ls_number_reflns_all                     24531 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.978 
_refine.ls_d_res_high                            3.400 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.2408 
_refine.ls_R_factor_R_work                       0.2379 
_refine.ls_R_factor_R_free                       0.2710 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 8.39 
_refine.ls_number_reflns_R_free                  2000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            1.1787 
_refine.aniso_B[2][2]                            0.4177 
_refine.aniso_B[3][3]                            1.0199 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.255 
_refine.solvent_model_param_bsol                 62.192 
_refine.pdbx_solvent_vdw_probe_radii             0.70 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.38 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.58 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_R_factor_all                          ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5665 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             1 
_refine_hist.number_atoms_total               5668 
_refine_hist.d_res_high                       3.400 
_refine_hist.d_res_low                        29.978 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.011  ? ? 5811 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.475  ? ? 7870 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 17.724 ? ? 2076 ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.093  ? ? 877  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.005  ? ? 969  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 3.40   3.5217  1657 0.3404 75.00  0.4023 . . 152 . . . . 'X-RAY DIFFRACTION' 
. 3.5217 3.6625  2194 0.2918 100.00 0.3886 . . 200 . . . . 'X-RAY DIFFRACTION' 
. 3.6625 3.8288  2213 0.2817 100.00 0.3562 . . 204 . . . . 'X-RAY DIFFRACTION' 
. 3.8288 4.0302  2214 0.2623 100.00 0.3190 . . 203 . . . . 'X-RAY DIFFRACTION' 
. 4.0302 4.2821  2218 0.2284 100.00 0.2713 . . 202 . . . . 'X-RAY DIFFRACTION' 
. 4.2821 4.6116  2226 0.1899 100.00 0.2350 . . 204 . . . . 'X-RAY DIFFRACTION' 
. 4.6116 5.0737  2224 0.1701 100.00 0.2189 . . 204 . . . . 'X-RAY DIFFRACTION' 
. 5.0737 5.8032  2256 0.2181 100.00 0.2691 . . 207 . . . . 'X-RAY DIFFRACTION' 
. 5.8032 7.2940  2283 0.2317 100.00 0.2786 . . 208 . . . . 'X-RAY DIFFRACTION' 
. 7.2940 29.9796 2349 0.2609 99.00  0.2489 . . 216 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3RCE 
_struct.title                     'Bacterial oligosaccharyltransferase PglB' 
_struct.pdbx_descriptor           'Oligosaccharide transferase to N-glycosylate proteins, Substrate Mimic Peptide' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3RCE 
_struct_keywords.pdbx_keywords   Transferase/Peptide 
_struct_keywords.text            
;Oligosaccharyltransferase, Membrane protein, helical bundle, glycosylation, acceptor peptide, Plasma membrane, Transferase-Peptide complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'AS PER THE AUTHORS CHAIN A FUNCTIONS AS A MONOMER IN THE BIOLOGICAL ASSEMBLY' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 12  ? LEU A 32  ? SER A 12  LEU A 32  1 ? 21 
HELX_P HELX_P2  2  LEU A 32  ? SER A 39  ? LEU A 32  SER A 39  1 ? 8  
HELX_P HELX_P3  3  PHE A 41  ? GLU A 43  ? PHE A 41  GLU A 43  5 ? 3  
HELX_P HELX_P4  4  THR A 54  ? GLY A 70  ? THR A 54  GLY A 70  1 ? 17 
HELX_P HELX_P5  5  SER A 82  ? ILE A 94  ? SER A 82  ILE A 94  1 ? 13 
HELX_P HELX_P6  6  SER A 98  ? ALA A 111 ? SER A 98  ALA A 111 1 ? 14 
HELX_P HELX_P7  7  ILE A 114 ? TYR A 125 ? ILE A 114 TYR A 125 1 ? 12 
HELX_P HELX_P8  8  LEU A 127 ? SER A 139 ? LEU A 127 SER A 139 1 ? 13 
HELX_P HELX_P9  9  ALA A 141 ? ARG A 147 ? ALA A 141 ARG A 147 1 ? 7  
HELX_P HELX_P10 10 ASP A 154 ? VAL A 159 ? ASP A 154 VAL A 159 5 ? 6  
HELX_P HELX_P11 11 LEU A 160 ? LYS A 177 ? LEU A 160 LYS A 177 1 ? 18 
HELX_P HELX_P12 12 ILE A 179 ? TRP A 195 ? ILE A 179 TRP A 195 1 ? 17 
HELX_P HELX_P13 13 TYR A 196 ? SER A 198 ? TYR A 196 SER A 198 5 ? 3  
HELX_P HELX_P14 14 SER A 199 ? ARG A 219 ? SER A 199 ARG A 219 1 ? 21 
HELX_P HELX_P15 15 GLU A 221 ? SER A 236 ? GLU A 221 SER A 236 1 ? 16 
HELX_P HELX_P16 16 ALA A 239 ? LYS A 257 ? ALA A 239 LYS A 257 1 ? 19 
HELX_P HELX_P17 17 ASN A 262 ? GLY A 281 ? ASN A 262 GLY A 281 1 ? 20 
HELX_P HELX_P18 18 ILE A 317 ? ASN A 321 ? ILE A 317 ASN A 321 5 ? 5  
HELX_P HELX_P19 19 ASP A 324 ? SER A 334 ? ASP A 324 SER A 334 1 ? 11 
HELX_P HELX_P20 20 SER A 335 ? LYS A 351 ? SER A 335 LYS A 351 1 ? 17 
HELX_P HELX_P21 21 SER A 355 ? LEU A 358 ? SER A 355 LEU A 358 5 ? 4  
HELX_P HELX_P22 22 ALA A 359 ? GLY A 373 ? ALA A 359 GLY A 373 1 ? 15 
HELX_P HELX_P23 23 LEU A 374 ? TYR A 379 ? LEU A 374 TYR A 379 5 ? 6  
HELX_P HELX_P24 24 ALA A 380 ? LYS A 402 ? ALA A 380 LYS A 402 1 ? 23 
HELX_P HELX_P25 25 SER A 407 ? TYR A 433 ? SER A 407 TYR A 433 1 ? 27 
HELX_P HELX_P26 26 THR A 440 ? ASN A 452 ? THR A 440 ASN A 452 1 ? 13 
HELX_P HELX_P27 27 TRP A 463 ? ASP A 475 ? TRP A 463 ASP A 475 1 ? 13 
HELX_P HELX_P28 28 LEU A 486 ? LYS A 499 ? LEU A 486 LYS A 499 1 ? 14 
HELX_P HELX_P29 29 GLU A 500 ? ASN A 522 ? GLU A 500 ASN A 522 1 ? 23 
HELX_P HELX_P30 30 ASP A 525 ? ASP A 533 ? ASP A 525 ASP A 533 1 ? 9  
HELX_P HELX_P31 31 ALA A 539 ? GLU A 544 ? ALA A 539 GLU A 544 1 ? 6  
HELX_P HELX_P32 32 ARG A 568 ? ARG A 571 ? ARG A 568 ARG A 571 5 ? 4  
HELX_P HELX_P33 33 ILE A 572 ? THR A 582 ? ILE A 572 THR A 582 1 ? 11 
HELX_P HELX_P34 34 GLU A 675 ? ASN A 679 ? GLU A 675 ASN A 679 1 ? 5  
HELX_P HELX_P35 35 SER A 680 ? PHE A 686 ? SER A 680 PHE A 686 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? B THR 6   C   ? ? ? 1_555 B PPN 7 N  ? ? B THR 15  B PPN 16  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale2 covale ? ? B PPN 7   C   ? ? ? 1_555 B GLY 8 N  ? ? B PPN 16  B GLY 17  1_555 ? ? ? ? ? ? ? 1.338 ? 
metalc1 metalc ? ? A ASP 56  OD2 ? ? ? 1_555 C MG  . MG ? ? A ASP 56  A MG  725 1_555 ? ? ? ? ? ? ? 2.429 ? 
metalc2 metalc ? ? A GLN 73  OE1 ? ? ? 1_555 D MG  . MG ? ? A GLN 73  A MG  726 1_555 ? ? ? ? ? ? ? 2.580 ? 
metalc3 metalc ? ? A ASP 475 OD1 ? ? ? 1_555 D MG  . MG ? ? A ASP 475 A MG  726 1_555 ? ? ? ? ? ? ? 2.727 ? 
metalc4 metalc ? ? A ASP 154 OD2 ? ? ? 1_555 C MG  . MG ? ? A ASP 154 A MG  725 1_555 ? ? ? ? ? ? ? 2.771 ? 
metalc5 metalc ? ? A ASP 76  OD2 ? ? ? 1_555 D MG  . MG ? ? A ASP 76  A MG  726 1_555 ? ? ? ? ? ? ? 2.778 ? 
metalc6 metalc ? ? A GLU 319 OE2 ? ? ? 1_555 C MG  . MG ? ? A GLU 319 A MG  725 1_555 ? ? ? ? ? ? ? 2.902 ? 
metalc7 metalc ? ? A ASP 154 OD1 ? ? ? 1_555 C MG  . MG ? ? A ASP 154 A MG  725 1_555 ? ? ? ? ? ? ? 2.930 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          PPN 
_struct_mon_prot_cis.label_seq_id           7 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           PPN 
_struct_mon_prot_cis.auth_seq_id            16 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   GLY 
_struct_mon_prot_cis.pdbx_label_seq_id_2    8 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    GLY 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     17 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -1.19 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 8 ? 
D ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
C 6 7 ? anti-parallel 
C 7 8 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? parallel      
D 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 45  ? PHE A 46  ? PHE A 45  PHE A 46  
A 2 GLN A 49  ? LEU A 50  ? GLN A 49  LEU A 50  
B 1 LYS A 477 ? THR A 478 ? LYS A 477 THR A 478 
B 2 TYR A 459 ? VAL A 461 ? TYR A 459 VAL A 461 
B 3 VAL A 561 ? PRO A 566 ? VAL A 561 PRO A 566 
B 4 ALA A 705 ? ARG A 709 ? ALA A 705 ARG A 709 
B 5 GLN A 698 ? ASP A 702 ? GLN A 698 ASP A 702 
C 1 SER A 596 ? ALA A 598 ? SER A 596 ALA A 598 
C 2 SER A 669 ? ASP A 674 ? SER A 669 ASP A 674 
C 3 ILE A 659 ? LEU A 664 ? ILE A 659 LEU A 664 
C 4 SER A 631 ? SER A 642 ? SER A 631 SER A 642 
C 5 ALA A 624 ? VAL A 627 ? ALA A 624 VAL A 627 
C 6 VAL A 616 ? ILE A 619 ? VAL A 616 ILE A 619 
C 7 VAL A 610 ? LEU A 612 ? VAL A 610 LEU A 612 
C 8 ALA A 600 ? ALA A 602 ? ALA A 600 ALA A 602 
D 1 SER A 596 ? ALA A 598 ? SER A 596 ALA A 598 
D 2 SER A 669 ? ASP A 674 ? SER A 669 ASP A 674 
D 3 ILE A 659 ? LEU A 664 ? ILE A 659 LEU A 664 
D 4 SER A 631 ? SER A 642 ? SER A 631 SER A 642 
D 5 LYS A 647 ? GLU A 652 ? LYS A 647 GLU A 652 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 46  ? N PHE A 46  O GLN A 49  ? O GLN A 49  
B 1 2 O LYS A 477 ? O LYS A 477 N VAL A 460 ? N VAL A 460 
B 2 3 N TYR A 459 ? N TYR A 459 O TYR A 562 ? O TYR A 562 
B 3 4 N MET A 565 ? N MET A 565 O LYS A 706 ? O LYS A 706 
B 4 5 O ILE A 707 ? O ILE A 707 N THR A 700 ? N THR A 700 
C 1 2 N ALA A 598 ? N ALA A 598 O PHE A 670 ? O PHE A 670 
C 2 3 O SER A 669 ? O SER A 669 N LEU A 664 ? N LEU A 664 
C 3 4 O LEU A 661 ? O LEU A 661 N VAL A 638 ? N VAL A 638 
C 4 5 O ILE A 632 ? O ILE A 632 N LEU A 625 ? N LEU A 625 
C 5 6 O ALA A 624 ? O ALA A 624 N ILE A 619 ? N ILE A 619 
C 6 7 O ILE A 618 ? O ILE A 618 N VAL A 610 ? N VAL A 610 
C 7 8 O MET A 611 ? O MET A 611 N ILE A 601 ? N ILE A 601 
D 1 2 N ALA A 598 ? N ALA A 598 O PHE A 670 ? O PHE A 670 
D 2 3 O SER A 669 ? O SER A 669 N LEU A 664 ? N LEU A 664 
D 3 4 O LEU A 661 ? O LEU A 661 N VAL A 638 ? N VAL A 638 
D 4 5 N GLU A 641 ? N GLU A 641 O LYS A 647 ? O LYS A 647 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG A 725' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG A 726' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 3 ASP A 56  ? ASP A 56  . ? 1_555 ? 
2 AC1 3 ASP A 154 ? ASP A 154 . ? 1_555 ? 
3 AC1 3 GLU A 319 ? GLU A 319 . ? 1_555 ? 
4 AC2 3 GLN A 73  ? GLN A 73  . ? 1_555 ? 
5 AC2 3 ASP A 76  ? ASP A 76  . ? 1_555 ? 
6 AC2 3 ASP A 475 ? ASP A 475 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3RCE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3RCE 
_atom_sites.fract_transf_matrix[1][1]   0.011756 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008613 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005713 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLU A 1 2   ? 24.265  -40.497 57.258  1.00 282.44 ? 2   GLU A N   1 
ATOM   2    C  CA  . GLU A 1 2   ? 23.885  -40.443 55.854  1.00 252.94 ? 2   GLU A CA  1 
ATOM   3    C  C   . GLU A 1 2   ? 22.388  -40.631 55.652  1.00 225.90 ? 2   GLU A C   1 
ATOM   4    O  O   . GLU A 1 2   ? 21.735  -39.779 55.059  1.00 197.60 ? 2   GLU A O   1 
ATOM   5    C  CB  . GLU A 1 2   ? 24.654  -41.483 55.033  1.00 204.11 ? 2   GLU A CB  1 
ATOM   6    C  CG  . GLU A 1 2   ? 26.060  -41.060 54.630  1.00 217.65 ? 2   GLU A CG  1 
ATOM   7    C  CD  . GLU A 1 2   ? 26.729  -42.062 53.702  1.00 225.06 ? 2   GLU A CD  1 
ATOM   8    O  OE1 . GLU A 1 2   ? 26.015  -42.876 53.082  1.00 208.68 ? 2   GLU A OE1 1 
ATOM   9    O  OE2 . GLU A 1 2   ? 27.972  -42.041 53.595  1.00 248.69 ? 2   GLU A OE2 1 
ATOM   10   N  N   . LEU A 1 3   ? 21.842  -41.740 56.144  1.00 199.23 ? 3   LEU A N   1 
ATOM   11   C  CA  . LEU A 1 3   ? 20.456  -42.092 55.827  1.00 176.20 ? 3   LEU A CA  1 
ATOM   12   C  C   . LEU A 1 3   ? 19.496  -42.136 57.009  1.00 178.83 ? 3   LEU A C   1 
ATOM   13   O  O   . LEU A 1 3   ? 18.288  -42.266 56.815  1.00 156.42 ? 3   LEU A O   1 
ATOM   14   C  CB  . LEU A 1 3   ? 20.393  -43.424 55.075  1.00 161.40 ? 3   LEU A CB  1 
ATOM   15   C  CG  . LEU A 1 3   ? 20.154  -43.345 53.566  1.00 145.33 ? 3   LEU A CG  1 
ATOM   16   C  CD1 . LEU A 1 3   ? 20.330  -44.715 52.935  1.00 158.48 ? 3   LEU A CD1 1 
ATOM   17   C  CD2 . LEU A 1 3   ? 18.780  -42.786 53.257  1.00 112.04 ? 3   LEU A CD2 1 
ATOM   18   N  N   . GLN A 1 4   ? 20.021  -42.032 58.224  1.00 187.52 ? 4   GLN A N   1 
ATOM   19   C  CA  . GLN A 1 4   ? 19.179  -42.110 59.415  1.00 195.67 ? 4   GLN A CA  1 
ATOM   20   C  C   . GLN A 1 4   ? 18.736  -40.731 59.908  1.00 184.83 ? 4   GLN A C   1 
ATOM   21   O  O   . GLN A 1 4   ? 18.030  -40.629 60.910  1.00 190.65 ? 4   GLN A O   1 
ATOM   22   C  CB  . GLN A 1 4   ? 19.902  -42.860 60.533  1.00 126.23 ? 4   GLN A CB  1 
ATOM   23   C  CG  . GLN A 1 4   ? 19.113  -42.964 61.819  1.00 139.97 ? 4   GLN A CG  1 
ATOM   24   C  CD  . GLN A 1 4   ? 19.957  -43.451 62.992  1.00 182.49 ? 4   GLN A CD  1 
ATOM   25   O  OE1 . GLN A 1 4   ? 20.894  -44.232 62.817  1.00 201.70 ? 4   GLN A OE1 1 
ATOM   26   N  NE2 . GLN A 1 4   ? 19.627  -42.985 64.195  1.00 193.19 ? 4   GLN A NE2 1 
ATOM   27   N  N   . GLN A 1 5   ? 19.140  -39.679 59.195  1.00 199.42 ? 5   GLN A N   1 
ATOM   28   C  CA  . GLN A 1 5   ? 18.842  -38.294 59.584  1.00 187.32 ? 5   GLN A CA  1 
ATOM   29   C  C   . GLN A 1 5   ? 17.435  -37.854 59.171  1.00 158.58 ? 5   GLN A C   1 
ATOM   30   O  O   . GLN A 1 5   ? 16.884  -38.350 58.197  1.00 138.14 ? 5   GLN A O   1 
ATOM   31   C  CB  . GLN A 1 5   ? 19.864  -37.338 58.962  1.00 153.73 ? 5   GLN A CB  1 
ATOM   32   C  CG  . GLN A 1 5   ? 21.313  -37.765 59.119  1.00 179.41 ? 5   GLN A CG  1 
ATOM   33   C  CD  . GLN A 1 5   ? 22.232  -37.083 58.126  1.00 169.98 ? 5   GLN A CD  1 
ATOM   34   O  OE1 . GLN A 1 5   ? 21.818  -36.180 57.407  1.00 143.90 ? 5   GLN A OE1 1 
ATOM   35   N  NE2 . GLN A 1 5   ? 23.484  -37.522 58.073  1.00 192.89 ? 5   GLN A NE2 1 
ATOM   36   N  N   . ASN A 1 6   ? 16.865  -36.903 59.902  1.00 175.39 ? 6   ASN A N   1 
ATOM   37   C  CA  . ASN A 1 6   ? 15.547  -36.359 59.564  1.00 150.45 ? 6   ASN A CA  1 
ATOM   38   C  C   . ASN A 1 6   ? 15.608  -35.243 58.502  1.00 125.55 ? 6   ASN A C   1 
ATOM   39   O  O   . ASN A 1 6   ? 16.101  -34.140 58.747  1.00 126.03 ? 6   ASN A O   1 
ATOM   40   C  CB  . ASN A 1 6   ? 14.839  -35.863 60.828  1.00 175.97 ? 6   ASN A CB  1 
ATOM   41   C  CG  . ASN A 1 6   ? 13.358  -35.644 60.621  1.00 155.29 ? 6   ASN A CG  1 
ATOM   42   O  OD1 . ASN A 1 6   ? 12.579  -36.590 60.641  1.00 140.62 ? 6   ASN A OD1 1 
ATOM   43   N  ND2 . ASN A 1 6   ? 12.960  -34.393 60.433  1.00 151.52 ? 6   ASN A ND2 1 
ATOM   44   N  N   . PHE A 1 7   ? 15.112  -35.531 57.310  1.00 167.15 ? 7   PHE A N   1 
ATOM   45   C  CA  . PHE A 1 7   ? 15.223  -34.553 56.249  1.00 145.50 ? 7   PHE A CA  1 
ATOM   46   C  C   . PHE A 1 7   ? 13.923  -33.802 56.073  1.00 123.39 ? 7   PHE A C   1 
ATOM   47   O  O   . PHE A 1 7   ? 13.906  -32.671 55.587  1.00 111.15 ? 7   PHE A O   1 
ATOM   48   C  CB  . PHE A 1 7   ? 15.601  -35.228 54.940  1.00 105.72 ? 7   PHE A CB  1 
ATOM   49   C  CG  . PHE A 1 7   ? 16.946  -35.904 54.958  1.00 125.83 ? 7   PHE A CG  1 
ATOM   50   C  CD1 . PHE A 1 7   ? 17.106  -37.138 55.563  1.00 144.71 ? 7   PHE A CD1 1 
ATOM   51   C  CD2 . PHE A 1 7   ? 18.042  -35.318 54.333  1.00 126.84 ? 7   PHE A CD2 1 
ATOM   52   C  CE1 . PHE A 1 7   ? 18.339  -37.761 55.566  1.00 164.95 ? 7   PHE A CE1 1 
ATOM   53   C  CE2 . PHE A 1 7   ? 19.278  -35.941 54.335  1.00 147.12 ? 7   PHE A CE2 1 
ATOM   54   C  CZ  . PHE A 1 7   ? 19.426  -37.161 54.950  1.00 166.36 ? 7   PHE A CZ  1 
ATOM   55   N  N   . THR A 1 8   ? 12.824  -34.435 56.448  1.00 146.13 ? 8   THR A N   1 
ATOM   56   C  CA  . THR A 1 8   ? 11.536  -33.795 56.273  1.00 126.95 ? 8   THR A CA  1 
ATOM   57   C  C   . THR A 1 8   ? 11.523  -32.447 56.998  1.00 131.14 ? 8   THR A C   1 
ATOM   58   O  O   . THR A 1 8   ? 11.353  -31.407 56.364  1.00 115.27 ? 8   THR A O   1 
ATOM   59   C  CB  . THR A 1 8   ? 10.381  -34.700 56.752  1.00 130.17 ? 8   THR A CB  1 
ATOM   60   O  OG1 . THR A 1 8   ? 10.443  -35.961 56.070  1.00 127.62 ? 8   THR A OG1 1 
ATOM   61   C  CG2 . THR A 1 8   ? 9.022   -34.035 56.495  1.00 111.76 ? 8   THR A CG2 1 
ATOM   62   N  N   . ASP A 1 9   ? 11.745  -32.472 58.313  1.00 159.74 ? 9   ASP A N   1 
ATOM   63   C  CA  . ASP A 1 9   ? 11.566  -31.288 59.166  1.00 167.59 ? 9   ASP A CA  1 
ATOM   64   C  C   . ASP A 1 9   ? 12.665  -30.235 59.044  1.00 167.58 ? 9   ASP A C   1 
ATOM   65   O  O   . ASP A 1 9   ? 12.632  -29.206 59.723  1.00 170.06 ? 9   ASP A O   1 
ATOM   66   C  CB  . ASP A 1 9   ? 11.392  -31.690 60.639  1.00 190.88 ? 9   ASP A CB  1 
ATOM   67   C  CG  . ASP A 1 9   ? 9.965   -32.097 60.977  1.00 191.86 ? 9   ASP A CG  1 
ATOM   68   O  OD1 . ASP A 1 9   ? 9.025   -31.322 60.691  1.00 173.93 ? 9   ASP A OD1 1 
ATOM   69   O  OD2 . ASP A 1 9   ? 9.790   -33.199 61.537  1.00 209.17 ? 9   ASP A OD2 1 
ATOM   70   N  N   . ASN A 1 10  ? 13.639  -30.487 58.183  1.00 150.00 ? 10  ASN A N   1 
ATOM   71   C  CA  . ASN A 1 10  ? 14.682  -29.503 57.940  1.00 150.58 ? 10  ASN A CA  1 
ATOM   72   C  C   . ASN A 1 10  ? 14.220  -28.493 56.898  1.00 128.29 ? 10  ASN A C   1 
ATOM   73   O  O   . ASN A 1 10  ? 13.820  -28.874 55.798  1.00 116.96 ? 10  ASN A O   1 
ATOM   74   C  CB  . ASN A 1 10  ? 15.968  -30.193 57.479  1.00 111.11 ? 10  ASN A CB  1 
ATOM   75   C  CG  . ASN A 1 10  ? 17.166  -29.255 57.451  1.00 121.47 ? 10  ASN A CG  1 
ATOM   76   O  OD1 . ASN A 1 10  ? 17.036  -28.060 57.176  1.00 112.08 ? 10  ASN A OD1 1 
ATOM   77   N  ND2 . ASN A 1 10  ? 18.348  -29.800 57.735  1.00 140.33 ? 10  ASN A ND2 1 
ATOM   78   N  N   . ASN A 1 11  ? 14.261  -27.211 57.251  1.00 134.98 ? 11  ASN A N   1 
ATOM   79   C  CA  . ASN A 1 11  ? 13.895  -26.134 56.331  1.00 116.35 ? 11  ASN A CA  1 
ATOM   80   C  C   . ASN A 1 11  ? 14.927  -25.009 56.359  1.00 121.41 ? 11  ASN A C   1 
ATOM   81   O  O   . ASN A 1 11  ? 14.581  -23.833 56.230  1.00 118.69 ? 11  ASN A O   1 
ATOM   82   C  CB  . ASN A 1 11  ? 12.515  -25.561 56.678  1.00 154.58 ? 11  ASN A CB  1 
ATOM   83   C  CG  . ASN A 1 11  ? 11.390  -26.574 56.515  1.00 148.83 ? 11  ASN A CG  1 
ATOM   84   O  OD1 . ASN A 1 11  ? 10.740  -26.637 55.473  1.00 133.86 ? 11  ASN A OD1 1 
ATOM   85   N  ND2 . ASN A 1 11  ? 11.147  -27.356 57.554  1.00 157.70 ? 11  ASN A ND2 1 
ATOM   86   N  N   . SER A 1 12  ? 16.194  -25.381 56.519  1.00 171.25 ? 12  SER A N   1 
ATOM   87   C  CA  . SER A 1 12  ? 17.269  -24.413 56.722  1.00 176.49 ? 12  SER A CA  1 
ATOM   88   C  C   . SER A 1 12  ? 17.771  -23.777 55.437  1.00 164.72 ? 12  SER A C   1 
ATOM   89   O  O   . SER A 1 12  ? 17.666  -24.353 54.355  1.00 156.41 ? 12  SER A O   1 
ATOM   90   C  CB  . SER A 1 12  ? 18.446  -25.070 57.443  1.00 129.94 ? 12  SER A CB  1 
ATOM   91   O  OG  . SER A 1 12  ? 18.909  -26.204 56.732  1.00 139.09 ? 12  SER A OG  1 
ATOM   92   N  N   . ILE A 1 13  ? 18.329  -22.581 55.579  1.00 156.10 ? 13  ILE A N   1 
ATOM   93   C  CA  . ILE A 1 13  ? 18.995  -21.896 54.484  1.00 148.80 ? 13  ILE A CA  1 
ATOM   94   C  C   . ILE A 1 13  ? 19.909  -22.856 53.724  1.00 153.85 ? 13  ILE A C   1 
ATOM   95   O  O   . ILE A 1 13  ? 19.701  -23.121 52.542  1.00 143.98 ? 13  ILE A O   1 
ATOM   96   C  CB  . ILE A 1 13  ? 19.859  -20.743 55.024  1.00 193.15 ? 13  ILE A CB  1 
ATOM   97   C  CG1 . ILE A 1 13  ? 19.367  -20.321 56.422  1.00 196.13 ? 13  ILE A CG1 1 
ATOM   98   C  CG2 . ILE A 1 13  ? 19.902  -19.589 54.015  1.00 183.27 ? 13  ILE A CG2 1 
ATOM   99   C  CD1 . ILE A 1 13  ? 20.456  -19.781 57.352  1.00 205.51 ? 13  ILE A CD1 1 
ATOM   100  N  N   . LYS A 1 14  ? 20.918  -23.376 54.420  1.00 191.01 ? 14  LYS A N   1 
ATOM   101  C  CA  . LYS A 1 14  ? 21.937  -24.244 53.829  1.00 199.59 ? 14  LYS A CA  1 
ATOM   102  C  C   . LYS A 1 14  ? 21.293  -25.422 53.120  1.00 197.24 ? 14  LYS A C   1 
ATOM   103  O  O   . LYS A 1 14  ? 21.626  -25.744 51.977  1.00 190.06 ? 14  LYS A O   1 
ATOM   104  C  CB  . LYS A 1 14  ? 22.884  -24.745 54.927  1.00 138.18 ? 14  LYS A CB  1 
ATOM   105  C  CG  . LYS A 1 14  ? 24.172  -25.453 54.472  1.00 152.16 ? 14  LYS A CG  1 
ATOM   106  C  CD  . LYS A 1 14  ? 25.086  -25.775 55.683  1.00 172.72 ? 14  LYS A CD  1 
ATOM   107  C  CE  . LYS A 1 14  ? 25.536  -24.494 56.406  1.00 175.90 ? 14  LYS A CE  1 
ATOM   108  N  NZ  . LYS A 1 14  ? 26.201  -24.731 57.721  1.00 194.19 ? 14  LYS A NZ  1 
ATOM   109  N  N   . TYR A 1 15  ? 20.359  -26.059 53.810  1.00 146.16 ? 15  TYR A N   1 
ATOM   110  C  CA  . TYR A 1 15  ? 19.690  -27.225 53.274  1.00 140.74 ? 15  TYR A CA  1 
ATOM   111  C  C   . TYR A 1 15  ? 18.928  -26.874 52.013  1.00 117.99 ? 15  TYR A C   1 
ATOM   112  O  O   . TYR A 1 15  ? 19.130  -27.470 50.953  1.00 113.52 ? 15  TYR A O   1 
ATOM   113  C  CB  . TYR A 1 15  ? 18.723  -27.768 54.302  1.00 130.34 ? 15  TYR A CB  1 
ATOM   114  C  CG  . TYR A 1 15  ? 18.083  -29.072 53.919  1.00 128.93 ? 15  TYR A CG  1 
ATOM   115  C  CD1 . TYR A 1 15  ? 18.831  -30.230 53.807  1.00 145.06 ? 15  TYR A CD1 1 
ATOM   116  C  CD2 . TYR A 1 15  ? 16.719  -29.152 53.699  1.00 113.53 ? 15  TYR A CD2 1 
ATOM   117  C  CE1 . TYR A 1 15  ? 18.237  -31.425 53.477  1.00 145.23 ? 15  TYR A CE1 1 
ATOM   118  C  CE2 . TYR A 1 15  ? 16.117  -30.344 53.370  1.00 110.67 ? 15  TYR A CE2 1 
ATOM   119  C  CZ  . TYR A 1 15  ? 16.877  -31.471 53.262  1.00 125.64 ? 15  TYR A CZ  1 
ATOM   120  O  OH  . TYR A 1 15  ? 16.261  -32.649 52.937  1.00 121.14 ? 15  TYR A OH  1 
ATOM   121  N  N   . THR A 1 16  ? 18.033  -25.908 52.135  1.00 152.52 ? 16  THR A N   1 
ATOM   122  C  CA  . THR A 1 16  ? 17.282  -25.438 50.988  1.00 132.69 ? 16  THR A CA  1 
ATOM   123  C  C   . THR A 1 16  ? 18.193  -25.141 49.790  1.00 129.79 ? 16  THR A C   1 
ATOM   124  O  O   . THR A 1 16  ? 17.862  -25.503 48.668  1.00 118.87 ? 16  THR A O   1 
ATOM   125  C  CB  . THR A 1 16  ? 16.415  -24.218 51.358  1.00 107.64 ? 16  THR A CB  1 
ATOM   126  O  OG1 . THR A 1 16  ? 15.128  -24.667 51.800  1.00 103.07 ? 16  THR A OG1 1 
ATOM   127  C  CG2 . THR A 1 16  ? 16.241  -23.277 50.170  1.00 92.56  ? 16  THR A CG2 1 
ATOM   128  N  N   . CYS A 1 17  ? 19.344  -24.512 50.021  1.00 113.88 ? 17  CYS A N   1 
ATOM   129  C  CA  . CYS A 1 17  ? 20.255  -24.169 48.917  1.00 113.11 ? 17  CYS A CA  1 
ATOM   130  C  C   . CYS A 1 17  ? 21.049  -25.346 48.336  1.00 123.63 ? 17  CYS A C   1 
ATOM   131  O  O   . CYS A 1 17  ? 21.421  -25.335 47.157  1.00 120.40 ? 17  CYS A O   1 
ATOM   132  C  CB  . CYS A 1 17  ? 21.186  -23.021 49.303  1.00 139.19 ? 17  CYS A CB  1 
ATOM   133  S  SG  . CYS A 1 17  ? 20.345  -21.433 49.290  1.00 124.92 ? 17  CYS A SG  1 
ATOM   134  N  N   . ILE A 1 18  ? 21.310  -26.357 49.158  1.00 122.90 ? 18  ILE A N   1 
ATOM   135  C  CA  . ILE A 1 18  ? 21.928  -27.576 48.655  1.00 133.28 ? 18  ILE A CA  1 
ATOM   136  C  C   . ILE A 1 18  ? 20.913  -28.348 47.821  1.00 119.15 ? 18  ILE A C   1 
ATOM   137  O  O   . ILE A 1 18  ? 21.260  -28.944 46.809  1.00 119.75 ? 18  ILE A O   1 
ATOM   138  C  CB  . ILE A 1 18  ? 22.487  -28.460 49.792  1.00 109.53 ? 18  ILE A CB  1 
ATOM   139  C  CG1 . ILE A 1 18  ? 23.815  -27.886 50.306  1.00 126.45 ? 18  ILE A CG1 1 
ATOM   140  C  CG2 . ILE A 1 18  ? 22.673  -29.895 49.317  1.00 118.86 ? 18  ILE A CG2 1 
ATOM   141  C  CD1 . ILE A 1 18  ? 24.629  -28.853 51.139  1.00 150.53 ? 18  ILE A CD1 1 
ATOM   142  N  N   . LEU A 1 19  ? 19.652  -28.318 48.230  1.00 148.03 ? 19  LEU A N   1 
ATOM   143  C  CA  . LEU A 1 19  ? 18.606  -28.986 47.467  1.00 129.11 ? 19  LEU A CA  1 
ATOM   144  C  C   . LEU A 1 19  ? 18.287  -28.238 46.160  1.00 110.85 ? 19  LEU A C   1 
ATOM   145  O  O   . LEU A 1 19  ? 17.947  -28.865 45.152  1.00 101.31 ? 19  LEU A O   1 
ATOM   146  C  CB  . LEU A 1 19  ? 17.348  -29.182 48.322  1.00 105.24 ? 19  LEU A CB  1 
ATOM   147  C  CG  . LEU A 1 19  ? 17.487  -29.940 49.651  1.00 123.39 ? 19  LEU A CG  1 
ATOM   148  C  CD1 . LEU A 1 19  ? 16.134  -30.461 50.159  1.00 114.28 ? 19  LEU A CD1 1 
ATOM   149  C  CD2 . LEU A 1 19  ? 18.476  -31.084 49.498  1.00 138.17 ? 19  LEU A CD2 1 
ATOM   150  N  N   . ILE A 1 20  ? 18.401  -26.907 46.188  1.00 107.76 ? 20  ILE A N   1 
ATOM   151  C  CA  . ILE A 1 20  ? 18.296  -26.072 44.990  1.00 94.55  ? 20  ILE A CA  1 
ATOM   152  C  C   . ILE A 1 20  ? 19.453  -26.358 44.041  1.00 103.29 ? 20  ILE A C   1 
ATOM   153  O  O   . ILE A 1 20  ? 19.266  -26.459 42.823  1.00 93.68  ? 20  ILE A O   1 
ATOM   154  C  CB  . ILE A 1 20  ? 18.327  -24.569 45.326  1.00 103.49 ? 20  ILE A CB  1 
ATOM   155  C  CG1 . ILE A 1 20  ? 16.920  -23.980 45.298  1.00 85.24  ? 20  ILE A CG1 1 
ATOM   156  C  CG2 . ILE A 1 20  ? 19.141  -23.815 44.297  1.00 105.23 ? 20  ILE A CG2 1 
ATOM   157  C  CD1 . ILE A 1 20  ? 16.507  -23.193 46.537  1.00 87.29  ? 20  ILE A CD1 1 
ATOM   158  N  N   . LEU A 1 21  ? 20.653  -26.481 44.606  1.00 107.43 ? 21  LEU A N   1 
ATOM   159  C  CA  . LEU A 1 21  ? 21.838  -26.840 43.830  1.00 118.61 ? 21  LEU A CA  1 
ATOM   160  C  C   . LEU A 1 21  ? 21.705  -28.199 43.150  1.00 118.82 ? 21  LEU A C   1 
ATOM   161  O  O   . LEU A 1 21  ? 21.884  -28.304 41.946  1.00 116.20 ? 21  LEU A O   1 
ATOM   162  C  CB  . LEU A 1 21  ? 23.083  -26.820 44.716  1.00 125.51 ? 21  LEU A CB  1 
ATOM   163  C  CG  . LEU A 1 21  ? 24.000  -25.641 44.422  1.00 125.69 ? 21  LEU A CG  1 
ATOM   164  C  CD1 . LEU A 1 21  ? 25.027  -26.025 43.352  1.00 142.02 ? 21  LEU A CD1 1 
ATOM   165  C  CD2 . LEU A 1 21  ? 23.173  -24.414 44.018  1.00 107.91 ? 21  LEU A CD2 1 
ATOM   166  N  N   . ILE A 1 22  ? 21.400  -29.236 43.926  1.00 118.98 ? 22  ILE A N   1 
ATOM   167  C  CA  . ILE A 1 22  ? 21.213  -30.570 43.367  1.00 119.00 ? 22  ILE A CA  1 
ATOM   168  C  C   . ILE A 1 22  ? 20.110  -30.568 42.323  1.00 97.42  ? 22  ILE A C   1 
ATOM   169  O  O   . ILE A 1 22  ? 20.292  -31.080 41.218  1.00 96.14  ? 22  ILE A O   1 
ATOM   170  C  CB  . ILE A 1 22  ? 20.816  -31.601 44.435  1.00 86.03  ? 22  ILE A CB  1 
ATOM   171  C  CG1 . ILE A 1 22  ? 21.681  -31.448 45.691  1.00 108.85 ? 22  ILE A CG1 1 
ATOM   172  C  CG2 . ILE A 1 22  ? 20.890  -33.019 43.845  1.00 89.59  ? 22  ILE A CG2 1 
ATOM   173  C  CD1 . ILE A 1 22  ? 21.136  -32.151 46.930  1.00 116.13 ? 22  ILE A CD1 1 
ATOM   174  N  N   . ALA A 1 23  ? 18.958  -30.007 42.682  1.00 135.66 ? 23  ALA A N   1 
ATOM   175  C  CA  . ALA A 1 23  ? 17.823  -29.993 41.768  1.00 117.23 ? 23  ALA A CA  1 
ATOM   176  C  C   . ALA A 1 23  ? 18.204  -29.357 40.451  1.00 112.47 ? 23  ALA A C   1 
ATOM   177  O  O   . ALA A 1 23  ? 17.999  -29.934 39.385  1.00 107.46 ? 23  ALA A O   1 
ATOM   178  C  CB  . ALA A 1 23  ? 16.688  -29.253 42.367  1.00 78.16  ? 23  ALA A CB  1 
ATOM   179  N  N   . PHE A 1 24  ? 18.757  -28.157 40.528  1.00 89.85  ? 24  PHE A N   1 
ATOM   180  C  CA  . PHE A 1 24  ? 19.168  -27.431 39.340  1.00 87.29  ? 24  PHE A CA  1 
ATOM   181  C  C   . PHE A 1 24  ? 20.217  -28.185 38.484  1.00 99.59  ? 24  PHE A C   1 
ATOM   182  O  O   . PHE A 1 24  ? 20.096  -28.295 37.247  1.00 94.79  ? 24  PHE A O   1 
ATOM   183  C  CB  . PHE A 1 24  ? 19.710  -26.076 39.755  1.00 95.16  ? 24  PHE A CB  1 
ATOM   184  C  CG  . PHE A 1 24  ? 20.341  -25.334 38.643  1.00 96.71  ? 24  PHE A CG  1 
ATOM   185  C  CD1 . PHE A 1 24  ? 19.610  -24.408 37.923  1.00 83.28  ? 24  PHE A CD1 1 
ATOM   186  C  CD2 . PHE A 1 24  ? 21.662  -25.578 38.291  1.00 113.38 ? 24  PHE A CD2 1 
ATOM   187  C  CE1 . PHE A 1 24  ? 20.188  -23.721 36.876  1.00 86.18  ? 24  PHE A CE1 1 
ATOM   188  C  CE2 . PHE A 1 24  ? 22.256  -24.905 37.247  1.00 116.41 ? 24  PHE A CE2 1 
ATOM   189  C  CZ  . PHE A 1 24  ? 21.525  -23.973 36.533  1.00 102.74 ? 24  PHE A CZ  1 
ATOM   190  N  N   . ALA A 1 25  ? 21.254  -28.699 39.144  1.00 116.39 ? 25  ALA A N   1 
ATOM   191  C  CA  . ALA A 1 25  ? 22.337  -29.410 38.462  1.00 130.99 ? 25  ALA A CA  1 
ATOM   192  C  C   . ALA A 1 25  ? 21.795  -30.621 37.732  1.00 126.64 ? 25  ALA A C   1 
ATOM   193  O  O   . ALA A 1 25  ? 22.191  -30.902 36.615  1.00 128.03 ? 25  ALA A O   1 
ATOM   194  C  CB  . ALA A 1 25  ? 23.408  -29.829 39.450  1.00 97.30  ? 25  ALA A CB  1 
ATOM   195  N  N   . PHE A 1 26  ? 20.890  -31.329 38.391  1.00 110.37 ? 26  PHE A N   1 
ATOM   196  C  CA  . PHE A 1 26  ? 20.174  -32.461 37.817  1.00 105.44 ? 26  PHE A CA  1 
ATOM   197  C  C   . PHE A 1 26  ? 19.327  -32.082 36.588  1.00 90.43  ? 26  PHE A C   1 
ATOM   198  O  O   . PHE A 1 26  ? 19.501  -32.637 35.481  1.00 94.07  ? 26  PHE A O   1 
ATOM   199  C  CB  . PHE A 1 26  ? 19.307  -33.055 38.916  1.00 124.80 ? 26  PHE A CB  1 
ATOM   200  C  CG  . PHE A 1 26  ? 18.209  -33.935 38.429  1.00 112.90 ? 26  PHE A CG  1 
ATOM   201  C  CD1 . PHE A 1 26  ? 18.418  -35.300 38.263  1.00 121.16 ? 26  PHE A CD1 1 
ATOM   202  C  CD2 . PHE A 1 26  ? 16.953  -33.410 38.177  1.00 95.15  ? 26  PHE A CD2 1 
ATOM   203  C  CE1 . PHE A 1 26  ? 17.395  -36.141 37.826  1.00 111.52 ? 26  PHE A CE1 1 
ATOM   204  C  CE2 . PHE A 1 26  ? 15.921  -34.236 37.752  1.00 86.26  ? 26  PHE A CE2 1 
ATOM   205  C  CZ  . PHE A 1 26  ? 16.146  -35.619 37.569  1.00 94.35  ? 26  PHE A CZ  1 
ATOM   206  N  N   . SER A 1 27  ? 18.410  -31.138 36.777  1.00 118.28 ? 27  SER A N   1 
ATOM   207  C  CA  . SER A 1 27  ? 17.665  -30.578 35.653  1.00 106.58 ? 27  SER A CA  1 
ATOM   208  C  C   . SER A 1 27  ? 18.568  -30.127 34.497  1.00 112.86 ? 27  SER A C   1 
ATOM   209  O  O   . SER A 1 27  ? 18.130  -30.074 33.358  1.00 108.82 ? 27  SER A O   1 
ATOM   210  C  CB  . SER A 1 27  ? 16.793  -29.401 36.105  1.00 94.00  ? 27  SER A CB  1 
ATOM   211  O  OG  . SER A 1 27  ? 16.250  -28.694 34.997  1.00 85.91  ? 27  SER A OG  1 
ATOM   212  N  N   . VAL A 1 28  ? 19.820  -29.784 34.768  1.00 75.57  ? 28  VAL A N   1 
ATOM   213  C  CA  . VAL A 1 28  ? 20.696  -29.444 33.651  1.00 84.21  ? 28  VAL A CA  1 
ATOM   214  C  C   . VAL A 1 28  ? 21.330  -30.674 33.002  1.00 97.80  ? 28  VAL A C   1 
ATOM   215  O  O   . VAL A 1 28  ? 21.375  -30.784 31.778  1.00 100.53 ? 28  VAL A O   1 
ATOM   216  C  CB  . VAL A 1 28  ? 21.791  -28.445 34.036  1.00 98.26  ? 28  VAL A CB  1 
ATOM   217  C  CG1 . VAL A 1 28  ? 22.748  -28.266 32.873  1.00 110.56 ? 28  VAL A CG1 1 
ATOM   218  C  CG2 . VAL A 1 28  ? 21.172  -27.110 34.422  1.00 85.54  ? 28  VAL A CG2 1 
ATOM   219  N  N   . LEU A 1 29  ? 21.824  -31.593 33.825  1.00 98.58  ? 29  LEU A N   1 
ATOM   220  C  CA  . LEU A 1 29  ? 22.357  -32.856 33.335  1.00 112.86 ? 29  LEU A CA  1 
ATOM   221  C  C   . LEU A 1 29  ? 21.367  -33.516 32.418  1.00 105.31 ? 29  LEU A C   1 
ATOM   222  O  O   . LEU A 1 29  ? 21.750  -34.044 31.396  1.00 116.12 ? 29  LEU A O   1 
ATOM   223  C  CB  . LEU A 1 29  ? 22.681  -33.812 34.477  1.00 108.68 ? 29  LEU A CB  1 
ATOM   224  C  CG  . LEU A 1 29  ? 23.936  -33.480 35.285  1.00 123.11 ? 29  LEU A CG  1 
ATOM   225  C  CD1 . LEU A 1 29  ? 24.850  -34.699 35.341  1.00 142.96 ? 29  LEU A CD1 1 
ATOM   226  C  CD2 . LEU A 1 29  ? 24.671  -32.243 34.736  1.00 130.95 ? 29  LEU A CD2 1 
ATOM   227  N  N   . CYS A 1 30  ? 20.088  -33.490 32.766  1.00 103.74 ? 30  CYS A N   1 
ATOM   228  C  CA  . CYS A 1 30  ? 19.106  -34.129 31.889  1.00 97.60  ? 30  CYS A CA  1 
ATOM   229  C  C   . CYS A 1 30  ? 18.889  -33.478 30.509  1.00 94.56  ? 30  CYS A C   1 
ATOM   230  O  O   . CYS A 1 30  ? 18.729  -34.195 29.510  1.00 99.95  ? 30  CYS A O   1 
ATOM   231  C  CB  . CYS A 1 30  ? 17.787  -34.282 32.613  1.00 100.72 ? 30  CYS A CB  1 
ATOM   232  S  SG  . CYS A 1 30  ? 18.047  -35.112 34.141  1.00 104.62 ? 30  CYS A SG  1 
ATOM   233  N  N   . ARG A 1 31  ? 18.873  -32.141 30.447  1.00 99.56  ? 31  ARG A N   1 
ATOM   234  C  CA  . ARG A 1 31  ? 18.635  -31.440 29.181  1.00 97.69  ? 31  ARG A CA  1 
ATOM   235  C  C   . ARG A 1 31  ? 19.745  -31.842 28.256  1.00 114.40 ? 31  ARG A C   1 
ATOM   236  O  O   . ARG A 1 31  ? 19.645  -31.699 27.045  1.00 117.51 ? 31  ARG A O   1 
ATOM   237  C  CB  . ARG A 1 31  ? 18.685  -29.909 29.329  1.00 141.52 ? 31  ARG A CB  1 
ATOM   238  C  CG  . ARG A 1 31  ? 17.954  -29.308 30.505  1.00 128.69 ? 31  ARG A CG  1 
ATOM   239  C  CD  . ARG A 1 31  ? 16.559  -28.844 30.160  1.00 115.64 ? 31  ARG A CD  1 
ATOM   240  N  NE  . ARG A 1 31  ? 15.679  -29.029 31.314  1.00 104.68 ? 31  ARG A NE  1 
ATOM   241  C  CZ  . ARG A 1 31  ? 14.369  -28.801 31.316  1.00 93.41  ? 31  ARG A CZ  1 
ATOM   242  N  NH1 . ARG A 1 31  ? 13.772  -28.366 30.220  1.00 91.78  ? 31  ARG A NH1 1 
ATOM   243  N  NH2 . ARG A 1 31  ? 13.653  -28.999 32.413  1.00 86.06  ? 31  ARG A NH2 1 
ATOM   244  N  N   . LEU A 1 32  ? 20.791  -32.382 28.869  1.00 79.10  ? 32  LEU A N   1 
ATOM   245  C  CA  . LEU A 1 32  ? 22.130  -32.470 28.292  1.00 98.19  ? 32  LEU A CA  1 
ATOM   246  C  C   . LEU A 1 32  ? 22.532  -33.857 27.746  1.00 112.21 ? 32  LEU A C   1 
ATOM   247  O  O   . LEU A 1 32  ? 23.654  -34.052 27.297  1.00 130.74 ? 32  LEU A O   1 
ATOM   248  C  CB  . LEU A 1 32  ? 23.120  -32.007 29.355  1.00 71.50  ? 32  LEU A CB  1 
ATOM   249  C  CG  . LEU A 1 32  ? 24.532  -31.685 28.938  1.00 87.78  ? 32  LEU A CG  1 
ATOM   250  C  CD1 . LEU A 1 32  ? 24.869  -30.255 29.310  1.00 78.80  ? 32  LEU A CD1 1 
ATOM   251  C  CD2 . LEU A 1 32  ? 25.457  -32.692 29.610  1.00 105.30 ? 32  LEU A CD2 1 
ATOM   252  N  N   . TYR A 1 33  ? 21.611  -34.813 27.783  1.00 94.67  ? 33  TYR A N   1 
ATOM   253  C  CA  . TYR A 1 33  ? 21.819  -36.102 27.142  1.00 107.78 ? 33  TYR A CA  1 
ATOM   254  C  C   . TYR A 1 33  ? 21.684  -35.953 25.635  1.00 113.50 ? 33  TYR A C   1 
ATOM   255  O  O   . TYR A 1 33  ? 22.488  -36.486 24.866  1.00 131.43 ? 33  TYR A O   1 
ATOM   256  C  CB  . TYR A 1 33  ? 20.807  -37.114 27.675  1.00 96.46  ? 33  TYR A CB  1 
ATOM   257  C  CG  . TYR A 1 33  ? 20.550  -38.307 26.783  1.00 106.39 ? 33  TYR A CG  1 
ATOM   258  C  CD1 . TYR A 1 33  ? 20.573  -39.596 27.293  1.00 114.87 ? 33  TYR A CD1 1 
ATOM   259  C  CD2 . TYR A 1 33  ? 20.237  -38.146 25.450  1.00 108.56 ? 33  TYR A CD2 1 
ATOM   260  C  CE1 . TYR A 1 33  ? 20.326  -40.688 26.484  1.00 124.88 ? 33  TYR A CE1 1 
ATOM   261  C  CE2 . TYR A 1 33  ? 19.989  -39.226 24.640  1.00 119.18 ? 33  TYR A CE2 1 
ATOM   262  C  CZ  . TYR A 1 33  ? 20.030  -40.492 25.157  1.00 126.98 ? 33  TYR A CZ  1 
ATOM   263  O  OH  . TYR A 1 33  ? 19.774  -41.557 24.333  1.00 138.45 ? 33  TYR A OH  1 
ATOM   264  N  N   . TRP A 1 34  ? 20.653  -35.233 25.214  1.00 96.57  ? 34  TRP A N   1 
ATOM   265  C  CA  . TRP A 1 34  ? 20.413  -35.034 23.801  1.00 102.60 ? 34  TRP A CA  1 
ATOM   266  C  C   . TRP A 1 34  ? 21.646  -34.488 23.113  1.00 114.03 ? 34  TRP A C   1 
ATOM   267  O  O   . TRP A 1 34  ? 21.834  -34.708 21.919  1.00 116.67 ? 34  TRP A O   1 
ATOM   268  C  CB  . TRP A 1 34  ? 19.228  -34.111 23.571  1.00 104.99 ? 34  TRP A CB  1 
ATOM   269  C  CG  . TRP A 1 34  ? 18.932  -33.897 22.127  1.00 110.43 ? 34  TRP A CG  1 
ATOM   270  C  CD1 . TRP A 1 34  ? 18.141  -34.663 21.336  1.00 115.39 ? 34  TRP A CD1 1 
ATOM   271  C  CD2 . TRP A 1 34  ? 19.431  -32.846 21.297  1.00 104.59 ? 34  TRP A CD2 1 
ATOM   272  N  NE1 . TRP A 1 34  ? 18.114  -34.160 20.061  1.00 115.53 ? 34  TRP A NE1 1 
ATOM   273  C  CE2 . TRP A 1 34  ? 18.894  -33.038 20.014  1.00 106.42 ? 34  TRP A CE2 1 
ATOM   274  C  CE3 . TRP A 1 34  ? 20.279  -31.756 21.514  1.00 96.96  ? 34  TRP A CE3 1 
ATOM   275  C  CZ2 . TRP A 1 34  ? 19.175  -32.185 18.955  1.00 101.26 ? 34  TRP A CZ2 1 
ATOM   276  C  CZ3 . TRP A 1 34  ? 20.553  -30.906 20.460  1.00 91.69  ? 34  TRP A CZ3 1 
ATOM   277  C  CH2 . TRP A 1 34  ? 20.005  -31.126 19.199  1.00 93.98  ? 34  TRP A CH2 1 
ATOM   278  N  N   . VAL A 1 35  ? 22.494  -33.786 23.860  1.00 100.17 ? 35  VAL A N   1 
ATOM   279  C  CA  . VAL A 1 35  ? 23.788  -33.334 23.324  1.00 101.72 ? 35  VAL A CA  1 
ATOM   280  C  C   . VAL A 1 35  ? 24.774  -34.494 23.278  1.00 121.05 ? 35  VAL A C   1 
ATOM   281  O  O   . VAL A 1 35  ? 25.525  -34.654 22.320  1.00 126.48 ? 35  VAL A O   1 
ATOM   282  C  CB  . VAL A 1 35  ? 24.401  -32.163 24.127  1.00 113.15 ? 35  VAL A CB  1 
ATOM   283  C  CG1 . VAL A 1 35  ? 25.759  -31.790 23.564  1.00 117.09 ? 35  VAL A CG1 1 
ATOM   284  C  CG2 . VAL A 1 35  ? 23.478  -30.962 24.092  1.00 96.30  ? 35  VAL A CG2 1 
ATOM   285  N  N   . ALA A 1 36  ? 24.757  -35.311 24.320  1.00 95.22  ? 36  ALA A N   1 
ATOM   286  C  CA  . ALA A 1 36  ? 25.538  -36.524 24.320  1.00 116.33 ? 36  ALA A CA  1 
ATOM   287  C  C   . ALA A 1 36  ? 25.166  -37.385 23.119  1.00 122.93 ? 36  ALA A C   1 
ATOM   288  O  O   . ALA A 1 36  ? 25.899  -38.310 22.767  1.00 138.75 ? 36  ALA A O   1 
ATOM   289  C  CB  . ALA A 1 36  ? 25.326  -37.294 25.617  1.00 435.97 ? 36  ALA A CB  1 
ATOM   290  N  N   . TRP A 1 37  ? 24.030  -37.101 22.485  1.00 101.54 ? 37  TRP A N   1 
ATOM   291  C  CA  . TRP A 1 37  ? 23.548  -37.980 21.410  1.00 108.65 ? 37  TRP A CA  1 
ATOM   292  C  C   . TRP A 1 37  ? 23.619  -37.401 20.013  1.00 103.42 ? 37  TRP A C   1 
ATOM   293  O  O   . TRP A 1 37  ? 23.867  -38.121 19.052  1.00 116.86 ? 37  TRP A O   1 
ATOM   294  C  CB  . TRP A 1 37  ? 22.121  -38.429 21.688  1.00 110.74 ? 37  TRP A CB  1 
ATOM   295  C  CG  . TRP A 1 37  ? 21.449  -39.079 20.535  1.00 116.40 ? 37  TRP A CG  1 
ATOM   296  C  CD1 . TRP A 1 37  ? 21.471  -40.390 20.223  1.00 130.92 ? 37  TRP A CD1 1 
ATOM   297  C  CD2 . TRP A 1 37  ? 20.626  -38.444 19.556  1.00 108.04 ? 37  TRP A CD2 1 
ATOM   298  N  NE1 . TRP A 1 37  ? 20.722  -40.619 19.107  1.00 133.08 ? 37  TRP A NE1 1 
ATOM   299  C  CE2 . TRP A 1 37  ? 20.191  -39.435 18.677  1.00 119.98 ? 37  TRP A CE2 1 
ATOM   300  C  CE3 . TRP A 1 37  ? 20.214  -37.128 19.342  1.00 92.06  ? 37  TRP A CE3 1 
ATOM   301  C  CZ2 . TRP A 1 37  ? 19.373  -39.160 17.598  1.00 116.95 ? 37  TRP A CZ2 1 
ATOM   302  C  CZ3 . TRP A 1 37  ? 19.397  -36.858 18.272  1.00 88.96  ? 37  TRP A CZ3 1 
ATOM   303  C  CH2 . TRP A 1 37  ? 18.991  -37.869 17.411  1.00 101.57 ? 37  TRP A CH2 1 
ATOM   304  N  N   . ALA A 1 38  ? 23.392  -36.100 19.904  1.00 138.62 ? 38  ALA A N   1 
ATOM   305  C  CA  . ALA A 1 38  ? 23.299  -35.458 18.601  1.00 131.90 ? 38  ALA A CA  1 
ATOM   306  C  C   . ALA A 1 38  ? 24.631  -34.954 18.061  1.00 136.38 ? 38  ALA A C   1 
ATOM   307  O  O   . ALA A 1 38  ? 24.677  -34.317 17.011  1.00 136.68 ? 38  ALA A O   1 
ATOM   308  C  CB  . ALA A 1 38  ? 22.317  -34.325 18.666  1.00 81.33  ? 38  ALA A CB  1 
ATOM   309  N  N   . SER A 1 39  ? 25.711  -35.236 18.779  1.00 112.74 ? 39  SER A N   1 
ATOM   310  C  CA  . SER A 1 39  ? 27.031  -34.754 18.395  1.00 117.03 ? 39  SER A CA  1 
ATOM   311  C  C   . SER A 1 39  ? 27.724  -35.780 17.523  1.00 136.24 ? 39  SER A C   1 
ATOM   312  O  O   . SER A 1 39  ? 28.566  -35.435 16.696  1.00 140.66 ? 39  SER A O   1 
ATOM   313  C  CB  . SER A 1 39  ? 27.873  -34.485 19.635  1.00 105.46 ? 39  SER A CB  1 
ATOM   314  O  OG  . SER A 1 39  ? 27.075  -33.990 20.693  1.00 103.07 ? 39  SER A OG  1 
ATOM   315  N  N   . GLU A 1 40  ? 27.363  -37.046 17.717  1.00 121.82 ? 40  GLU A N   1 
ATOM   316  C  CA  . GLU A 1 40  ? 27.928  -38.135 16.933  1.00 142.31 ? 40  GLU A CA  1 
ATOM   317  C  C   . GLU A 1 40  ? 27.226  -38.217 15.589  1.00 143.84 ? 40  GLU A C   1 
ATOM   318  O  O   . GLU A 1 40  ? 27.333  -39.212 14.878  1.00 160.58 ? 40  GLU A O   1 
ATOM   319  C  CB  . GLU A 1 40  ? 27.823  -39.465 17.685  1.00 171.60 ? 40  GLU A CB  1 
ATOM   320  C  CG  . GLU A 1 40  ? 28.522  -39.458 19.036  1.00 175.09 ? 40  GLU A CG  1 
ATOM   321  C  CD  . GLU A 1 40  ? 29.031  -40.824 19.445  1.00 202.70 ? 40  GLU A CD  1 
ATOM   322  O  OE1 . GLU A 1 40  ? 28.943  -41.765 18.629  1.00 220.26 ? 40  GLU A OE1 1 
ATOM   323  O  OE2 . GLU A 1 40  ? 29.525  -40.956 20.584  1.00 208.37 ? 40  GLU A OE2 1 
ATOM   324  N  N   . PHE A 1 41  ? 26.507  -37.155 15.250  1.00 116.27 ? 41  PHE A N   1 
ATOM   325  C  CA  . PHE A 1 41  ? 25.789  -37.069 13.988  1.00 117.86 ? 41  PHE A CA  1 
ATOM   326  C  C   . PHE A 1 41  ? 26.171  -35.803 13.268  1.00 110.00 ? 41  PHE A C   1 
ATOM   327  O  O   . PHE A 1 41  ? 25.996  -34.704 13.775  1.00 110.49 ? 41  PHE A O   1 
ATOM   328  C  CB  . PHE A 1 41  ? 24.293  -37.097 14.230  1.00 126.36 ? 41  PHE A CB  1 
ATOM   329  C  CG  . PHE A 1 41  ? 23.784  -38.440 14.576  1.00 138.85 ? 41  PHE A CG  1 
ATOM   330  C  CD1 . PHE A 1 41  ? 22.842  -38.597 15.556  1.00 135.31 ? 41  PHE A CD1 1 
ATOM   331  C  CD2 . PHE A 1 41  ? 24.261  -39.553 13.919  1.00 156.07 ? 41  PHE A CD2 1 
ATOM   332  C  CE1 . PHE A 1 41  ? 22.383  -39.835 15.877  1.00 148.62 ? 41  PHE A CE1 1 
ATOM   333  C  CE2 . PHE A 1 41  ? 23.804  -40.797 14.232  1.00 169.71 ? 41  PHE A CE2 1 
ATOM   334  C  CZ  . PHE A 1 41  ? 22.862  -40.942 15.211  1.00 166.06 ? 41  PHE A CZ  1 
ATOM   335  N  N   . TYR A 1 42  ? 26.698  -35.952 12.069  1.00 139.14 ? 42  TYR A N   1 
ATOM   336  C  CA  . TYR A 1 42  ? 27.324  -34.812 11.447  1.00 132.97 ? 42  TYR A CA  1 
ATOM   337  C  C   . TYR A 1 42  ? 26.322  -33.818 10.901  1.00 119.69 ? 42  TYR A C   1 
ATOM   338  O  O   . TYR A 1 42  ? 26.616  -32.630 10.810  1.00 116.65 ? 42  TYR A O   1 
ATOM   339  C  CB  . TYR A 1 42  ? 28.301  -35.233 10.355  1.00 302.42 ? 42  TYR A CB  1 
ATOM   340  C  CG  . TYR A 1 42  ? 29.143  -34.065 9.968   1.00 300.25 ? 42  TYR A CG  1 
ATOM   341  C  CD1 . TYR A 1 42  ? 30.313  -33.781 10.651  1.00 294.21 ? 42  TYR A CD1 1 
ATOM   342  C  CD2 . TYR A 1 42  ? 28.731  -33.195 8.974   1.00 305.94 ? 42  TYR A CD2 1 
ATOM   343  C  CE1 . TYR A 1 42  ? 31.072  -32.687 10.329  1.00 293.91 ? 42  TYR A CE1 1 
ATOM   344  C  CE2 . TYR A 1 42  ? 29.479  -32.098 8.645   1.00 306.12 ? 42  TYR A CE2 1 
ATOM   345  C  CZ  . TYR A 1 42  ? 30.651  -31.847 9.325   1.00 300.12 ? 42  TYR A CZ  1 
ATOM   346  O  OH  . TYR A 1 42  ? 31.410  -30.751 9.003   1.00 301.77 ? 42  TYR A OH  1 
ATOM   347  N  N   . GLU A 1 43  ? 25.144  -34.317 10.541  1.00 153.18 ? 43  GLU A N   1 
ATOM   348  C  CA  . GLU A 1 43  ? 24.121  -33.526 9.871   1.00 140.73 ? 43  GLU A CA  1 
ATOM   349  C  C   . GLU A 1 43  ? 23.527  -32.450 10.782  1.00 128.54 ? 43  GLU A C   1 
ATOM   350  O  O   . GLU A 1 43  ? 22.748  -31.609 10.328  1.00 116.29 ? 43  GLU A O   1 
ATOM   351  C  CB  . GLU A 1 43  ? 23.026  -34.459 9.372   1.00 152.32 ? 43  GLU A CB  1 
ATOM   352  C  CG  . GLU A 1 43  ? 23.554  -35.830 8.973   1.00 166.24 ? 43  GLU A CG  1 
ATOM   353  C  CD  . GLU A 1 43  ? 22.471  -36.755 8.445   1.00 170.43 ? 43  GLU A CD  1 
ATOM   354  O  OE1 . GLU A 1 43  ? 21.299  -36.641 8.878   1.00 167.81 ? 43  GLU A OE1 1 
ATOM   355  O  OE2 . GLU A 1 43  ? 22.798  -37.599 7.585   1.00 177.54 ? 43  GLU A OE2 1 
ATOM   356  N  N   . PHE A 1 44  ? 23.921  -32.484 12.060  1.00 121.10 ? 44  PHE A N   1 
ATOM   357  C  CA  . PHE A 1 44  ? 23.377  -31.631 13.127  1.00 112.73 ? 44  PHE A CA  1 
ATOM   358  C  C   . PHE A 1 44  ? 24.286  -30.481 13.512  1.00 108.09 ? 44  PHE A C   1 
ATOM   359  O  O   . PHE A 1 44  ? 24.032  -29.821 14.511  1.00 105.64 ? 44  PHE A O   1 
ATOM   360  C  CB  . PHE A 1 44  ? 23.179  -32.448 14.403  1.00 88.81  ? 44  PHE A CB  1 
ATOM   361  C  CG  . PHE A 1 44  ? 22.017  -33.372 14.360  1.00 93.22  ? 44  PHE A CG  1 
ATOM   362  C  CD1 . PHE A 1 44  ? 21.968  -34.475 15.186  1.00 106.67 ? 44  PHE A CD1 1 
ATOM   363  C  CD2 . PHE A 1 44  ? 20.968  -33.134 13.510  1.00 85.48  ? 44  PHE A CD2 1 
ATOM   364  C  CE1 . PHE A 1 44  ? 20.893  -35.323 15.161  1.00 112.56 ? 44  PHE A CE1 1 
ATOM   365  C  CE2 . PHE A 1 44  ? 19.901  -33.980 13.479  1.00 90.70  ? 44  PHE A CE2 1 
ATOM   366  C  CZ  . PHE A 1 44  ? 19.861  -35.073 14.311  1.00 104.34 ? 44  PHE A CZ  1 
ATOM   367  N  N   . PHE A 1 45  ? 25.359  -30.266 12.761  1.00 112.62 ? 45  PHE A N   1 
ATOM   368  C  CA  . PHE A 1 45  ? 26.336  -29.243 13.118  1.00 109.00 ? 45  PHE A CA  1 
ATOM   369  C  C   . PHE A 1 45  ? 26.467  -28.139 12.085  1.00 105.62 ? 45  PHE A C   1 
ATOM   370  O  O   . PHE A 1 45  ? 26.350  -28.376 10.884  1.00 105.20 ? 45  PHE A O   1 
ATOM   371  C  CB  . PHE A 1 45  ? 27.717  -29.857 13.319  1.00 95.12  ? 45  PHE A CB  1 
ATOM   372  C  CG  . PHE A 1 45  ? 27.845  -30.681 14.554  1.00 100.57 ? 45  PHE A CG  1 
ATOM   373  C  CD1 . PHE A 1 45  ? 27.682  -32.055 14.500  1.00 115.50 ? 45  PHE A CD1 1 
ATOM   374  C  CD2 . PHE A 1 45  ? 28.144  -30.090 15.768  1.00 92.81  ? 45  PHE A CD2 1 
ATOM   375  C  CE1 . PHE A 1 45  ? 27.804  -32.831 15.642  1.00 122.83 ? 45  PHE A CE1 1 
ATOM   376  C  CE2 . PHE A 1 45  ? 28.253  -30.861 16.911  1.00 99.79  ? 45  PHE A CE2 1 
ATOM   377  C  CZ  . PHE A 1 45  ? 28.086  -32.235 16.847  1.00 114.95 ? 45  PHE A CZ  1 
ATOM   378  N  N   . PHE A 1 46  ? 26.738  -26.935 12.573  1.00 155.08 ? 46  PHE A N   1 
ATOM   379  C  CA  . PHE A 1 46  ? 27.122  -25.820 11.729  1.00 155.68 ? 46  PHE A CA  1 
ATOM   380  C  C   . PHE A 1 46  ? 28.044  -24.967 12.560  1.00 156.35 ? 46  PHE A C   1 
ATOM   381  O  O   . PHE A 1 46  ? 27.943  -24.994 13.781  1.00 149.88 ? 46  PHE A O   1 
ATOM   382  C  CB  . PHE A 1 46  ? 25.910  -25.009 11.354  1.00 114.24 ? 46  PHE A CB  1 
ATOM   383  C  CG  . PHE A 1 46  ? 26.159  -24.038 10.255  1.00 113.67 ? 46  PHE A CG  1 
ATOM   384  C  CD1 . PHE A 1 46  ? 26.004  -24.419 8.934   1.00 112.74 ? 46  PHE A CD1 1 
ATOM   385  C  CD2 . PHE A 1 46  ? 26.535  -22.738 10.534  1.00 116.06 ? 46  PHE A CD2 1 
ATOM   386  C  CE1 . PHE A 1 46  ? 26.222  -23.521 7.904   1.00 114.30 ? 46  PHE A CE1 1 
ATOM   387  C  CE2 . PHE A 1 46  ? 26.750  -21.836 9.512   1.00 117.68 ? 46  PHE A CE2 1 
ATOM   388  C  CZ  . PHE A 1 46  ? 26.593  -22.231 8.191   1.00 116.88 ? 46  PHE A CZ  1 
ATOM   389  N  N   . ASN A 1 47  ? 28.917  -24.202 11.908  1.00 101.63 ? 47  ASN A N   1 
ATOM   390  C  CA  . ASN A 1 47  ? 30.007  -23.484 12.593  1.00 106.68 ? 47  ASN A CA  1 
ATOM   391  C  C   . ASN A 1 47  ? 30.564  -24.201 13.831  1.00 103.22 ? 47  ASN A C   1 
ATOM   392  O  O   . ASN A 1 47  ? 30.632  -23.621 14.922  1.00 105.43 ? 47  ASN A O   1 
ATOM   393  C  CB  . ASN A 1 47  ? 29.630  -22.036 12.935  1.00 126.66 ? 47  ASN A CB  1 
ATOM   394  C  CG  . ASN A 1 47  ? 29.732  -21.109 11.744  1.00 128.63 ? 47  ASN A CG  1 
ATOM   395  O  OD1 . ASN A 1 47  ? 30.388  -21.424 10.752  1.00 129.28 ? 47  ASN A OD1 1 
ATOM   396  N  ND2 . ASN A 1 47  ? 29.088  -19.954 11.837  1.00 131.15 ? 47  ASN A ND2 1 
ATOM   397  N  N   . ASP A 1 48  ? 30.943  -25.466 13.643  1.00 175.68 ? 48  ASP A N   1 
ATOM   398  C  CA  . ASP A 1 48  ? 31.617  -26.275 14.665  1.00 174.71 ? 48  ASP A CA  1 
ATOM   399  C  C   . ASP A 1 48  ? 30.862  -26.409 15.995  1.00 165.11 ? 48  ASP A C   1 
ATOM   400  O  O   . ASP A 1 48  ? 31.480  -26.431 17.066  1.00 166.52 ? 48  ASP A O   1 
ATOM   401  C  CB  . ASP A 1 48  ? 33.036  -25.750 14.891  1.00 202.00 ? 48  ASP A CB  1 
ATOM   402  C  CG  . ASP A 1 48  ? 33.733  -25.389 13.587  1.00 208.42 ? 48  ASP A CG  1 
ATOM   403  O  OD1 . ASP A 1 48  ? 33.428  -26.018 12.552  1.00 216.81 ? 48  ASP A OD1 1 
ATOM   404  O  OD2 . ASP A 1 48  ? 34.579  -24.471 13.593  1.00 206.30 ? 48  ASP A OD2 1 
ATOM   405  N  N   . GLN A 1 49  ? 29.533  -26.516 15.903  1.00 141.63 ? 49  GLN A N   1 
ATOM   406  C  CA  . GLN A 1 49  ? 28.646  -26.648 17.064  1.00 132.16 ? 49  GLN A CA  1 
ATOM   407  C  C   . GLN A 1 49  ? 27.227  -27.043 16.659  1.00 128.75 ? 49  GLN A C   1 
ATOM   408  O  O   . GLN A 1 49  ? 26.745  -26.642 15.602  1.00 129.29 ? 49  GLN A O   1 
ATOM   409  C  CB  . GLN A 1 49  ? 28.605  -25.351 17.881  1.00 129.66 ? 49  GLN A CB  1 
ATOM   410  C  CG  . GLN A 1 49  ? 27.611  -25.365 19.036  1.00 122.04 ? 49  GLN A CG  1 
ATOM   411  C  CD  . GLN A 1 49  ? 27.747  -26.590 19.936  1.00 129.64 ? 49  GLN A CD  1 
ATOM   412  O  OE1 . GLN A 1 49  ? 28.713  -27.339 19.850  1.00 137.12 ? 49  GLN A OE1 1 
ATOM   413  N  NE2 . GLN A 1 49  ? 26.771  -26.794 20.802  1.00 129.14 ? 49  GLN A NE2 1 
ATOM   414  N  N   . LEU A 1 50  ? 26.566  -27.828 17.505  1.00 126.52 ? 50  LEU A N   1 
ATOM   415  C  CA  . LEU A 1 50  ? 25.189  -28.230 17.253  1.00 122.81 ? 50  LEU A CA  1 
ATOM   416  C  C   . LEU A 1 50  ? 24.334  -27.017 16.927  1.00 111.81 ? 50  LEU A C   1 
ATOM   417  O  O   . LEU A 1 50  ? 24.649  -25.912 17.358  1.00 106.80 ? 50  LEU A O   1 
ATOM   418  C  CB  . LEU A 1 50  ? 24.627  -28.933 18.474  1.00 83.26  ? 50  LEU A CB  1 
ATOM   419  C  CG  . LEU A 1 50  ? 24.998  -30.402 18.599  1.00 96.89  ? 50  LEU A CG  1 
ATOM   420  C  CD1 . LEU A 1 50  ? 24.455  -30.971 19.889  1.00 97.06  ? 50  LEU A CD1 1 
ATOM   421  C  CD2 . LEU A 1 50  ? 24.443  -31.168 17.419  1.00 104.07 ? 50  LEU A CD2 1 
ATOM   422  N  N   . MET A 1 51  ? 23.264  -27.200 16.155  1.00 122.42 ? 51  MET A N   1 
ATOM   423  C  CA  . MET A 1 51  ? 22.383  -26.073 15.838  1.00 114.07 ? 51  MET A CA  1 
ATOM   424  C  C   . MET A 1 51  ? 21.060  -26.135 16.615  1.00 105.80 ? 51  MET A C   1 
ATOM   425  O  O   . MET A 1 51  ? 20.753  -27.155 17.230  1.00 107.72 ? 51  MET A O   1 
ATOM   426  C  CB  . MET A 1 51  ? 22.155  -25.901 14.314  1.00 73.95  ? 51  MET A CB  1 
ATOM   427  C  CG  . MET A 1 51  ? 22.565  -27.082 13.416  1.00 87.79  ? 51  MET A CG  1 
ATOM   428  S  SD  . MET A 1 51  ? 22.036  -27.105 11.656  1.00 96.79  ? 51  MET A SD  1 
ATOM   429  C  CE  . MET A 1 51  ? 22.650  -25.557 11.028  1.00 91.19  ? 51  MET A CE  1 
ATOM   430  N  N   . ILE A 1 52  ? 20.324  -25.015 16.585  1.00 93.52  ? 52  ILE A N   1 
ATOM   431  C  CA  . ILE A 1 52  ? 18.999  -24.781 17.201  1.00 85.92  ? 52  ILE A CA  1 
ATOM   432  C  C   . ILE A 1 52  ? 17.899  -25.842 16.923  1.00 88.58  ? 52  ILE A C   1 
ATOM   433  O  O   . ILE A 1 52  ? 17.932  -26.551 15.926  1.00 96.24  ? 52  ILE A O   1 
ATOM   434  C  CB  . ILE A 1 52  ? 18.494  -23.403 16.727  1.00 110.23 ? 52  ILE A CB  1 
ATOM   435  C  CG1 . ILE A 1 52  ? 18.855  -22.315 17.710  1.00 109.11 ? 52  ILE A CG1 1 
ATOM   436  C  CG2 . ILE A 1 52  ? 17.012  -23.355 16.578  1.00 103.91 ? 52  ILE A CG2 1 
ATOM   437  C  CD1 . ILE A 1 52  ? 18.214  -21.010 17.307  1.00 106.71 ? 52  ILE A CD1 1 
ATOM   438  N  N   . THR A 1 53  ? 16.900  -25.940 17.787  1.00 98.48  ? 53  THR A N   1 
ATOM   439  C  CA  . THR A 1 53  ? 15.912  -26.987 17.624  1.00 101.54 ? 53  THR A CA  1 
ATOM   440  C  C   . THR A 1 53  ? 14.474  -26.504 17.413  1.00 96.51  ? 53  THR A C   1 
ATOM   441  O  O   . THR A 1 53  ? 13.545  -27.286 17.471  1.00 98.25  ? 53  THR A O   1 
ATOM   442  C  CB  . THR A 1 53  ? 15.974  -27.925 18.813  1.00 80.27  ? 53  THR A CB  1 
ATOM   443  O  OG1 . THR A 1 53  ? 17.225  -28.592 18.794  1.00 87.48  ? 53  THR A OG1 1 
ATOM   444  C  CG2 . THR A 1 53  ? 14.911  -28.980 18.735  1.00 84.64  ? 53  THR A CG2 1 
ATOM   445  N  N   . THR A 1 54  ? 14.257  -25.223 17.170  1.00 99.89  ? 54  THR A N   1 
ATOM   446  C  CA  . THR A 1 54  ? 12.905  -24.787 16.834  1.00 96.71  ? 54  THR A CA  1 
ATOM   447  C  C   . THR A 1 54  ? 12.958  -23.629 15.892  1.00 97.73  ? 54  THR A C   1 
ATOM   448  O  O   . THR A 1 54  ? 13.678  -22.681 16.146  1.00 96.60  ? 54  THR A O   1 
ATOM   449  C  CB  . THR A 1 54  ? 12.091  -24.318 18.045  1.00 121.81 ? 54  THR A CB  1 
ATOM   450  O  OG1 . THR A 1 54  ? 11.803  -25.430 18.889  1.00 122.60 ? 54  THR A OG1 1 
ATOM   451  C  CG2 . THR A 1 54  ? 10.775  -23.734 17.570  1.00 119.64 ? 54  THR A CG2 1 
ATOM   452  N  N   . ASN A 1 55  ? 12.182  -23.697 14.822  1.00 98.54  ? 55  ASN A N   1 
ATOM   453  C  CA  . ASN A 1 55  ? 12.148  -22.643 13.828  1.00 102.33 ? 55  ASN A CA  1 
ATOM   454  C  C   . ASN A 1 55  ? 12.119  -21.258 14.494  1.00 97.61  ? 55  ASN A C   1 
ATOM   455  O  O   . ASN A 1 55  ? 12.984  -20.400 14.255  1.00 101.28 ? 55  ASN A O   1 
ATOM   456  C  CB  . ASN A 1 55  ? 10.941  -22.888 12.894  1.00 81.50  ? 55  ASN A CB  1 
ATOM   457  C  CG  . ASN A 1 55  ? 10.827  -24.377 12.438  1.00 88.23  ? 55  ASN A CG  1 
ATOM   458  O  OD1 . ASN A 1 55  ? 10.947  -25.299 13.248  1.00 88.29  ? 55  ASN A OD1 1 
ATOM   459  N  ND2 . ASN A 1 55  ? 10.616  -24.597 11.137  1.00 95.75  ? 55  ASN A ND2 1 
ATOM   460  N  N   . ASP A 1 56  ? 11.126  -21.076 15.362  1.00 121.13 ? 56  ASP A N   1 
ATOM   461  C  CA  . ASP A 1 56  ? 10.965  -19.887 16.207  1.00 117.88 ? 56  ASP A CA  1 
ATOM   462  C  C   . ASP A 1 56  ? 12.297  -19.259 16.601  1.00 117.07 ? 56  ASP A C   1 
ATOM   463  O  O   . ASP A 1 56  ? 12.484  -18.068 16.418  1.00 118.42 ? 56  ASP A O   1 
ATOM   464  C  CB  . ASP A 1 56  ? 10.151  -20.220 17.474  1.00 136.91 ? 56  ASP A CB  1 
ATOM   465  C  CG  . ASP A 1 56  ? 8.698   -19.723 17.396  1.00 138.43 ? 56  ASP A CG  1 
ATOM   466  O  OD1 . ASP A 1 56  ? 8.221   -19.437 16.265  1.00 144.15 ? 56  ASP A OD1 1 
ATOM   467  O  OD2 . ASP A 1 56  ? 8.029   -19.621 18.457  1.00 135.05 ? 56  ASP A OD2 1 
ATOM   468  N  N   . GLY A 1 57  ? 13.207  -20.064 17.149  1.00 70.21  ? 57  GLY A N   1 
ATOM   469  C  CA  . GLY A 1 57  ? 14.538  -19.626 17.554  1.00 70.81  ? 57  GLY A CA  1 
ATOM   470  C  C   . GLY A 1 57  ? 15.299  -18.725 16.608  1.00 75.99  ? 57  GLY A C   1 
ATOM   471  O  O   . GLY A 1 57  ? 15.845  -17.727 17.039  1.00 75.97  ? 57  GLY A O   1 
ATOM   472  N  N   . TYR A 1 58  ? 15.328  -19.052 15.319  1.00 85.11  ? 58  TYR A N   1 
ATOM   473  C  CA  . TYR A 1 58  ? 16.133  -18.231 14.403  1.00 92.16  ? 58  TYR A CA  1 
ATOM   474  C  C   . TYR A 1 58  ? 15.608  -16.814 14.322  1.00 92.98  ? 58  TYR A C   1 
ATOM   475  O  O   . TYR A 1 58  ? 16.300  -15.908 13.889  1.00 98.40  ? 58  TYR A O   1 
ATOM   476  C  CB  . TYR A 1 58  ? 16.208  -18.852 13.012  1.00 101.12 ? 58  TYR A CB  1 
ATOM   477  C  CG  . TYR A 1 58  ? 16.982  -20.141 12.969  1.00 102.31 ? 58  TYR A CG  1 
ATOM   478  C  CD1 . TYR A 1 58  ? 16.444  -21.300 13.476  1.00 98.50  ? 58  TYR A CD1 1 
ATOM   479  C  CD2 . TYR A 1 58  ? 18.236  -20.208 12.398  1.00 108.80 ? 58  TYR A CD2 1 
ATOM   480  C  CE1 . TYR A 1 58  ? 17.123  -22.473 13.435  1.00 101.81 ? 58  TYR A CE1 1 
ATOM   481  C  CE2 . TYR A 1 58  ? 18.926  -21.401 12.359  1.00 111.61 ? 58  TYR A CE2 1 
ATOM   482  C  CZ  . TYR A 1 58  ? 18.357  -22.528 12.876  1.00 108.49 ? 58  TYR A CZ  1 
ATOM   483  O  OH  . TYR A 1 58  ? 19.015  -23.734 12.838  1.00 113.67 ? 58  TYR A OH  1 
ATOM   484  N  N   . ALA A 1 59  ? 14.376  -16.633 14.755  1.00 97.50  ? 59  ALA A N   1 
ATOM   485  C  CA  . ALA A 1 59  ? 13.774  -15.321 14.851  1.00 99.70  ? 59  ALA A CA  1 
ATOM   486  C  C   . ALA A 1 59  ? 14.632  -14.442 15.737  1.00 99.26  ? 59  ALA A C   1 
ATOM   487  O  O   . ALA A 1 59  ? 15.018  -13.336 15.349  1.00 105.85 ? 59  ALA A O   1 
ATOM   488  C  CB  . ALA A 1 59  ? 12.376  -15.461 15.461  1.00 74.47  ? 59  ALA A CB  1 
ATOM   489  N  N   . PHE A 1 60  ? 14.940  -14.975 16.923  1.00 102.55 ? 60  PHE A N   1 
ATOM   490  C  CA  . PHE A 1 60  ? 15.732  -14.286 17.935  1.00 102.12 ? 60  PHE A CA  1 
ATOM   491  C  C   . PHE A 1 60  ? 17.197  -14.296 17.567  1.00 105.60 ? 60  PHE A C   1 
ATOM   492  O  O   . PHE A 1 60  ? 17.818  -13.238 17.479  1.00 109.68 ? 60  PHE A O   1 
ATOM   493  C  CB  . PHE A 1 60  ? 15.558  -14.968 19.276  1.00 92.68  ? 60  PHE A CB  1 
ATOM   494  C  CG  . PHE A 1 60  ? 14.131  -15.073 19.710  1.00 89.24  ? 60  PHE A CG  1 
ATOM   495  C  CD1 . PHE A 1 60  ? 13.565  -16.301 19.976  1.00 85.26  ? 60  PHE A CD1 1 
ATOM   496  C  CD2 . PHE A 1 60  ? 13.352  -13.938 19.853  1.00 91.51  ? 60  PHE A CD2 1 
ATOM   497  C  CE1 . PHE A 1 60  ? 12.259  -16.391 20.376  1.00 82.47  ? 60  PHE A CE1 1 
ATOM   498  C  CE2 . PHE A 1 60  ? 12.040  -14.029 20.249  1.00 89.42  ? 60  PHE A CE2 1 
ATOM   499  C  CZ  . PHE A 1 60  ? 11.495  -15.252 20.511  1.00 84.23  ? 60  PHE A CZ  1 
ATOM   500  N  N   . ALA A 1 61  ? 17.742  -15.493 17.365  1.00 93.88  ? 61  ALA A N   1 
ATOM   501  C  CA  . ALA A 1 61  ? 19.074  -15.661 16.806  1.00 98.37  ? 61  ALA A CA  1 
ATOM   502  C  C   . ALA A 1 61  ? 19.338  -14.528 15.831  1.00 106.23 ? 61  ALA A C   1 
ATOM   503  O  O   . ALA A 1 61  ? 20.045  -13.577 16.169  1.00 110.50 ? 61  ALA A O   1 
ATOM   504  C  CB  . ALA A 1 61  ? 19.175  -16.997 16.124  1.00 45.68  ? 61  ALA A CB  1 
ATOM   505  N  N   . GLU A 1 62  ? 18.729  -14.593 14.653  1.00 93.49  ? 62  GLU A N   1 
ATOM   506  C  CA  . GLU A 1 62  ? 18.775  -13.489 13.711  1.00 102.17 ? 62  GLU A CA  1 
ATOM   507  C  C   . GLU A 1 62  ? 18.842  -12.170 14.410  1.00 104.12 ? 62  GLU A C   1 
ATOM   508  O  O   . GLU A 1 62  ? 19.898  -11.556 14.472  1.00 109.96 ? 62  GLU A O   1 
ATOM   509  C  CB  . GLU A 1 62  ? 17.556  -13.465 12.810  1.00 111.48 ? 62  GLU A CB  1 
ATOM   510  C  CG  . GLU A 1 62  ? 17.554  -12.196 11.975  1.00 121.81 ? 62  GLU A CG  1 
ATOM   511  C  CD  . GLU A 1 62  ? 16.278  -12.008 11.183  1.00 126.92 ? 62  GLU A CD  1 
ATOM   512  O  OE1 . GLU A 1 62  ? 15.184  -12.131 11.793  1.00 121.24 ? 62  GLU A OE1 1 
ATOM   513  O  OE2 . GLU A 1 62  ? 16.377  -11.697 9.969   1.00 137.69 ? 62  GLU A OE2 1 
ATOM   514  N  N   . GLY A 1 63  ? 17.719  -11.758 14.988  1.00 121.03 ? 63  GLY A N   1 
ATOM   515  C  CA  . GLY A 1 63  ? 17.657  -10.512 15.736  1.00 124.88 ? 63  GLY A CA  1 
ATOM   516  C  C   . GLY A 1 63  ? 18.918  -10.224 16.516  1.00 124.71 ? 63  GLY A C   1 
ATOM   517  O  O   . GLY A 1 63  ? 19.580  -9.239  16.230  1.00 132.75 ? 63  GLY A O   1 
ATOM   518  N  N   . ALA A 1 64  ? 19.267  -11.104 17.464  1.00 80.31  ? 64  ALA A N   1 
ATOM   519  C  CA  . ALA A 1 64  ? 20.474  -10.955 18.302  1.00 80.31  ? 64  ALA A CA  1 
ATOM   520  C  C   . ALA A 1 64  ? 21.719  -10.744 17.473  1.00 87.47  ? 64  ALA A C   1 
ATOM   521  O  O   . ALA A 1 64  ? 22.465  -9.809  17.745  1.00 93.06  ? 64  ALA A O   1 
ATOM   522  C  CB  . ALA A 1 64  ? 20.644  -12.147 19.228  1.00 66.17  ? 64  ALA A CB  1 
ATOM   523  N  N   . ARG A 1 65  ? 21.969  -11.625 16.504  1.00 90.84  ? 65  ARG A N   1 
ATOM   524  C  CA  . ARG A 1 65  ? 23.067  -11.411 15.583  1.00 99.02  ? 65  ARG A CA  1 
ATOM   525  C  C   . ARG A 1 65  ? 23.053  -9.973  15.103  1.00 109.17 ? 65  ARG A C   1 
ATOM   526  O  O   . ARG A 1 65  ? 24.034  -9.268  15.287  1.00 117.11 ? 65  ARG A O   1 
ATOM   527  C  CB  . ARG A 1 65  ? 22.961  -12.384 14.420  1.00 110.00 ? 65  ARG A CB  1 
ATOM   528  C  CG  . ARG A 1 65  ? 24.015  -12.179 13.372  1.00 118.61 ? 65  ARG A CG  1 
ATOM   529  C  CD  . ARG A 1 65  ? 23.540  -12.699 12.033  1.00 121.07 ? 65  ARG A CD  1 
ATOM   530  N  NE  . ARG A 1 65  ? 22.326  -12.002 11.631  1.00 123.41 ? 65  ARG A NE  1 
ATOM   531  C  CZ  . ARG A 1 65  ? 21.478  -12.462 10.726  1.00 127.90 ? 65  ARG A CZ  1 
ATOM   532  N  NH1 . ARG A 1 65  ? 21.715  -13.624 10.140  1.00 130.53 ? 65  ARG A NH1 1 
ATOM   533  N  NH2 . ARG A 1 65  ? 20.396  -11.764 10.409  1.00 131.35 ? 65  ARG A NH2 1 
ATOM   534  N  N   . ASP A 1 66  ? 21.927  -9.512  14.555  1.00 128.63 ? 66  ASP A N   1 
ATOM   535  C  CA  . ASP A 1 66  ? 21.818  -8.117  14.126  1.00 139.72 ? 66  ASP A CA  1 
ATOM   536  C  C   . ASP A 1 66  ? 22.124  -7.124  15.247  1.00 142.34 ? 66  ASP A C   1 
ATOM   537  O  O   . ASP A 1 66  ? 22.884  -6.189  15.036  1.00 152.81 ? 66  ASP A O   1 
ATOM   538  C  CB  . ASP A 1 66  ? 20.434  -7.861  13.529  1.00 157.12 ? 66  ASP A CB  1 
ATOM   539  C  CG  . ASP A 1 66  ? 20.267  -8.499  12.150  1.00 160.88 ? 66  ASP A CG  1 
ATOM   540  O  OD1 . ASP A 1 66  ? 21.296  -8.762  11.496  1.00 164.50 ? 66  ASP A OD1 1 
ATOM   541  O  OD2 . ASP A 1 66  ? 19.120  -8.728  11.705  1.00 161.04 ? 66  ASP A OD2 1 
ATOM   542  N  N   . MET A 1 67  ? 21.601  -7.362  16.452  1.00 110.94 ? 67  MET A N   1 
ATOM   543  C  CA  . MET A 1 67  ? 21.951  -6.542  17.627  1.00 113.19 ? 67  MET A CA  1 
ATOM   544  C  C   . MET A 1 67  ? 23.452  -6.491  17.887  1.00 116.80 ? 67  MET A C   1 
ATOM   545  O  O   . MET A 1 67  ? 24.002  -5.458  18.271  1.00 125.68 ? 67  MET A O   1 
ATOM   546  C  CB  . MET A 1 67  ? 21.247  -7.077  18.886  1.00 121.90 ? 67  MET A CB  1 
ATOM   547  C  CG  . MET A 1 67  ? 19.743  -6.887  18.937  1.00 120.69 ? 67  MET A CG  1 
ATOM   548  S  SD  . MET A 1 67  ? 19.225  -6.815  20.652  1.00 113.92 ? 67  MET A SD  1 
ATOM   549  C  CE  . MET A 1 67  ? 20.722  -6.152  21.358  1.00 118.59 ? 67  MET A CE  1 
ATOM   550  N  N   . ILE A 1 68  ? 24.108  -7.631  17.679  1.00 104.27 ? 68  ILE A N   1 
ATOM   551  C  CA  . ILE A 1 68  ? 25.552  -7.714  17.816  1.00 108.81 ? 68  ILE A CA  1 
ATOM   552  C  C   . ILE A 1 68  ? 26.241  -6.876  16.751  1.00 121.14 ? 68  ILE A C   1 
ATOM   553  O  O   . ILE A 1 68  ? 27.264  -6.262  17.031  1.00 129.10 ? 68  ILE A O   1 
ATOM   554  C  CB  . ILE A 1 68  ? 25.988  -9.180  17.714  1.00 102.93 ? 68  ILE A CB  1 
ATOM   555  C  CG1 . ILE A 1 68  ? 25.552  -9.955  18.972  1.00 92.83  ? 68  ILE A CG1 1 
ATOM   556  C  CG2 . ILE A 1 68  ? 27.471  -9.272  17.525  1.00 109.40 ? 68  ILE A CG2 1 
ATOM   557  C  CD1 . ILE A 1 68  ? 25.391  -11.459 18.770  1.00 85.56  ? 68  ILE A CD1 1 
ATOM   558  N  N   . ALA A 1 69  ? 25.663  -6.848  15.539  1.00 112.95 ? 69  ALA A N   1 
ATOM   559  C  CA  . ALA A 1 69  ? 26.218  -6.023  14.452  1.00 125.86 ? 69  ALA A CA  1 
ATOM   560  C  C   . ALA A 1 69  ? 26.124  -4.558  14.855  1.00 133.87 ? 69  ALA A C   1 
ATOM   561  O  O   . ALA A 1 69  ? 27.125  -3.848  14.885  1.00 144.88 ? 69  ALA A O   1 
ATOM   562  C  CB  . ALA A 1 69  ? 25.469  -6.241  13.147  1.00 167.62 ? 69  ALA A CB  1 
ATOM   563  N  N   . GLY A 1 70  ? 24.916  -4.101  15.164  1.00 148.45 ? 70  GLY A N   1 
ATOM   564  C  CA  . GLY A 1 70  ? 24.689  -2.684  15.343  1.00 158.42 ? 70  GLY A CA  1 
ATOM   565  C  C   . GLY A 1 70  ? 23.367  -2.295  14.740  1.00 166.40 ? 70  GLY A C   1 
ATOM   566  O  O   . GLY A 1 70  ? 22.631  -1.527  15.348  1.00 175.08 ? 70  GLY A O   1 
ATOM   567  N  N   . PHE A 1 71  ? 23.034  -2.807  13.562  1.00 153.66 ? 71  PHE A N   1 
ATOM   568  C  CA  . PHE A 1 71  ? 21.701  -2.503  13.083  1.00 160.75 ? 71  PHE A CA  1 
ATOM   569  C  C   . PHE A 1 71  ? 21.078  -3.604  12.201  1.00 151.37 ? 71  PHE A C   1 
ATOM   570  O  O   . PHE A 1 71  ? 21.802  -4.435  11.665  1.00 139.97 ? 71  PHE A O   1 
ATOM   571  C  CB  . PHE A 1 71  ? 21.690  -1.111  12.423  1.00 192.32 ? 71  PHE A CB  1 
ATOM   572  C  CG  . PHE A 1 71  ? 20.347  -0.402  12.490  1.00 205.64 ? 71  PHE A CG  1 
ATOM   573  C  CD1 . PHE A 1 71  ? 19.970  0.374   13.588  1.00 207.90 ? 71  PHE A CD1 1 
ATOM   574  C  CD2 . PHE A 1 71  ? 19.466  -0.496  11.431  1.00 217.69 ? 71  PHE A CD2 1 
ATOM   575  C  CE1 . PHE A 1 71  ? 18.723  1.016   13.607  1.00 221.54 ? 71  PHE A CE1 1 
ATOM   576  C  CE2 . PHE A 1 71  ? 18.229  0.147   11.458  1.00 231.61 ? 71  PHE A CE2 1 
ATOM   577  C  CZ  . PHE A 1 71  ? 17.861  0.895   12.534  1.00 233.25 ? 71  PHE A CZ  1 
ATOM   578  N  N   . HIS A 1 72  ? 19.731  -3.609  12.144  1.00 175.76 ? 72  HIS A N   1 
ATOM   579  C  CA  . HIS A 1 72  ? 18.847  -4.481  11.335  1.00 169.63 ? 72  HIS A CA  1 
ATOM   580  C  C   . HIS A 1 72  ? 18.383  -3.637  10.153  1.00 183.22 ? 72  HIS A C   1 
ATOM   581  O  O   . HIS A 1 72  ? 18.355  -2.436  10.276  1.00 195.25 ? 72  HIS A O   1 
ATOM   582  C  CB  . HIS A 1 72  ? 17.623  -4.924  12.171  1.00 160.59 ? 72  HIS A CB  1 
ATOM   583  C  CG  . HIS A 1 72  ? 16.533  -3.890  12.285  1.00 173.36 ? 72  HIS A CG  1 
ATOM   584  N  ND1 . HIS A 1 72  ? 15.580  -3.711  11.302  1.00 185.40 ? 72  HIS A ND1 1 
ATOM   585  C  CD2 . HIS A 1 72  ? 16.222  -3.001  13.262  1.00 176.52 ? 72  HIS A CD2 1 
ATOM   586  C  CE1 . HIS A 1 72  ? 14.748  -2.751  11.656  1.00 197.39 ? 72  HIS A CE1 1 
ATOM   587  N  NE2 . HIS A 1 72  ? 15.113  -2.302  12.844  1.00 191.88 ? 72  HIS A NE2 1 
ATOM   588  N  N   . GLN A 1 73  ? 17.986  -4.203  9.020   1.00 225.33 ? 73  GLN A N   1 
ATOM   589  C  CA  . GLN A 1 73  ? 17.613  -3.299  7.919   1.00 238.98 ? 73  GLN A CA  1 
ATOM   590  C  C   . GLN A 1 73  ? 16.251  -2.653  7.956   1.00 246.65 ? 73  GLN A C   1 
ATOM   591  O  O   . GLN A 1 73  ? 15.393  -2.985  8.757   1.00 237.91 ? 73  GLN A O   1 
ATOM   592  C  CB  . GLN A 1 73  ? 17.765  -3.939  6.558   1.00 169.68 ? 73  GLN A CB  1 
ATOM   593  C  CG  . GLN A 1 73  ? 19.196  -4.050  6.139   1.00 163.83 ? 73  GLN A CG  1 
ATOM   594  C  CD  . GLN A 1 73  ? 19.689  -5.470  6.303   1.00 149.22 ? 73  GLN A CD  1 
ATOM   595  O  OE1 . GLN A 1 73  ? 19.167  -6.242  7.141   1.00 143.42 ? 73  GLN A OE1 1 
ATOM   596  N  NE2 . GLN A 1 73  ? 20.688  -5.842  5.491   1.00 144.40 ? 73  GLN A NE2 1 
ATOM   597  N  N   . PRO A 1 74  ? 16.055  -1.696  7.064   1.00 125.92 ? 74  PRO A N   1 
ATOM   598  C  CA  . PRO A 1 74  ? 14.696  -1.187  6.948   1.00 137.19 ? 74  PRO A CA  1 
ATOM   599  C  C   . PRO A 1 74  ? 13.626  -2.231  6.668   1.00 136.54 ? 74  PRO A C   1 
ATOM   600  O  O   . PRO A 1 74  ? 13.773  -2.973  5.722   1.00 142.97 ? 74  PRO A O   1 
ATOM   601  C  CB  . PRO A 1 74  ? 14.794  -0.203  5.756   1.00 217.78 ? 74  PRO A CB  1 
ATOM   602  C  CG  . PRO A 1 74  ? 16.196  -0.416  5.164   1.00 217.33 ? 74  PRO A CG  1 
ATOM   603  C  CD  . PRO A 1 74  ? 17.007  -0.866  6.311   1.00 197.80 ? 74  PRO A CD  1 
ATOM   604  N  N   . ASN A 1 75  ? 12.566  -2.283  7.463   1.00 142.90 ? 75  ASN A N   1 
ATOM   605  C  CA  . ASN A 1 75  ? 11.371  -2.965  6.999   1.00 143.81 ? 75  ASN A CA  1 
ATOM   606  C  C   . ASN A 1 75  ? 11.525  -4.466  6.703   1.00 129.01 ? 75  ASN A C   1 
ATOM   607  O  O   . ASN A 1 75  ? 10.604  -5.082  6.149   1.00 130.46 ? 75  ASN A O   1 
ATOM   608  C  CB  . ASN A 1 75  ? 10.864  -2.275  5.736   1.00 154.03 ? 75  ASN A CB  1 
ATOM   609  C  CG  . ASN A 1 75  ? 9.526   -1.593  5.932   1.00 161.88 ? 75  ASN A CG  1 
ATOM   610  O  OD1 . ASN A 1 75  ? 8.667   -2.059  6.683   1.00 147.57 ? 75  ASN A OD1 1 
ATOM   611  N  ND2 . ASN A 1 75  ? 9.334   -0.487  5.235   1.00 186.03 ? 75  ASN A ND2 1 
ATOM   612  N  N   . ASP A 1 76  ? 12.679  -5.048  7.019   1.00 205.80 ? 76  ASP A N   1 
ATOM   613  C  CA  . ASP A 1 76  ? 12.796  -6.501  7.089   1.00 190.39 ? 76  ASP A CA  1 
ATOM   614  C  C   . ASP A 1 76  ? 12.426  -6.814  8.526   1.00 175.09 ? 76  ASP A C   1 
ATOM   615  O  O   . ASP A 1 76  ? 12.682  -6.015  9.423   1.00 173.10 ? 76  ASP A O   1 
ATOM   616  C  CB  . ASP A 1 76  ? 14.211  -6.957  6.745   1.00 185.95 ? 76  ASP A CB  1 
ATOM   617  C  CG  . ASP A 1 76  ? 15.101  -7.064  7.959   1.00 174.52 ? 76  ASP A CG  1 
ATOM   618  O  OD1 . ASP A 1 76  ? 14.981  -6.228  8.878   1.00 174.47 ? 76  ASP A OD1 1 
ATOM   619  O  OD2 . ASP A 1 76  ? 15.928  -7.992  7.992   1.00 167.19 ? 76  ASP A OD2 1 
ATOM   620  N  N   . LEU A 1 77  ? 11.794  -7.947  8.761   1.00 140.31 ? 77  LEU A N   1 
ATOM   621  C  CA  . LEU A 1 77  ? 11.060  -8.090  10.008  1.00 130.07 ? 77  LEU A CA  1 
ATOM   622  C  C   . LEU A 1 77  ? 11.884  -8.604  11.199  1.00 115.26 ? 77  LEU A C   1 
ATOM   623  O  O   . LEU A 1 77  ? 11.413  -9.484  11.940  1.00 103.23 ? 77  LEU A O   1 
ATOM   624  C  CB  . LEU A 1 77  ? 9.851   -9.001  9.796   1.00 115.34 ? 77  LEU A CB  1 
ATOM   625  C  CG  . LEU A 1 77  ? 8.714   -8.622  8.852   1.00 128.62 ? 77  LEU A CG  1 
ATOM   626  C  CD1 . LEU A 1 77  ? 7.563   -9.571  9.130   1.00 121.46 ? 77  LEU A CD1 1 
ATOM   627  C  CD2 . LEU A 1 77  ? 8.269   -7.183  9.025   1.00 145.13 ? 77  LEU A CD2 1 
ATOM   628  N  N   . SER A 1 78  ? 13.083  -8.057  11.417  1.00 119.20 ? 78  SER A N   1 
ATOM   629  C  CA  . SER A 1 78  ? 13.988  -8.650  12.416  1.00 106.55 ? 78  SER A CA  1 
ATOM   630  C  C   . SER A 1 78  ? 13.599  -8.371  13.867  1.00 100.21 ? 78  SER A C   1 
ATOM   631  O  O   . SER A 1 78  ? 13.012  -7.339  14.178  1.00 108.34 ? 78  SER A O   1 
ATOM   632  C  CB  . SER A 1 78  ? 15.462  -8.304  12.141  1.00 99.73  ? 78  SER A CB  1 
ATOM   633  O  OG  . SER A 1 78  ? 15.860  -7.123  12.791  1.00 109.96 ? 78  SER A OG  1 
ATOM   634  N  N   . TYR A 1 79  ? 13.916  -9.316  14.744  1.00 131.76 ? 79  TYR A N   1 
ATOM   635  C  CA  . TYR A 1 79  ? 13.585  -9.189  16.162  1.00 125.81 ? 79  TYR A CA  1 
ATOM   636  C  C   . TYR A 1 79  ? 14.690  -8.482  16.948  1.00 128.01 ? 79  TYR A C   1 
ATOM   637  O  O   . TYR A 1 79  ? 14.921  -8.790  18.124  1.00 120.83 ? 79  TYR A O   1 
ATOM   638  C  CB  . TYR A 1 79  ? 13.296  -10.558 16.799  1.00 108.55 ? 79  TYR A CB  1 
ATOM   639  C  CG  . TYR A 1 79  ? 11.888  -11.087 16.586  1.00 106.79 ? 79  TYR A CG  1 
ATOM   640  C  CD1 . TYR A 1 79  ? 11.258  -10.984 15.339  1.00 114.16 ? 79  TYR A CD1 1 
ATOM   641  C  CD2 . TYR A 1 79  ? 11.205  -11.723 17.617  1.00 98.98  ? 79  TYR A CD2 1 
ATOM   642  C  CE1 . TYR A 1 79  ? 9.981   -11.477 15.137  1.00 113.68 ? 79  TYR A CE1 1 
ATOM   643  C  CE2 . TYR A 1 79  ? 9.930   -12.218 17.424  1.00 98.15  ? 79  TYR A CE2 1 
ATOM   644  C  CZ  . TYR A 1 79  ? 9.324   -12.093 16.183  1.00 105.49 ? 79  TYR A CZ  1 
ATOM   645  O  OH  . TYR A 1 79  ? 8.055   -12.590 15.976  1.00 104.86 ? 79  TYR A OH  1 
ATOM   646  N  N   . PHE A 1 80  ? 15.381  -7.557  16.292  1.00 101.04 ? 80  PHE A N   1 
ATOM   647  C  CA  . PHE A 1 80  ? 16.322  -6.676  16.963  1.00 105.88 ? 80  PHE A CA  1 
ATOM   648  C  C   . PHE A 1 80  ? 15.660  -6.021  18.184  1.00 106.64 ? 80  PHE A C   1 
ATOM   649  O  O   . PHE A 1 80  ? 14.653  -5.325  18.066  1.00 114.91 ? 80  PHE A O   1 
ATOM   650  C  CB  . PHE A 1 80  ? 16.769  -5.615  15.957  1.00 120.56 ? 80  PHE A CB  1 
ATOM   651  C  CG  . PHE A 1 80  ? 17.784  -4.647  16.481  1.00 126.87 ? 80  PHE A CG  1 
ATOM   652  C  CD1 . PHE A 1 80  ? 19.093  -5.033  16.658  1.00 121.83 ? 80  PHE A CD1 1 
ATOM   653  C  CD2 . PHE A 1 80  ? 17.433  -3.340  16.756  1.00 139.06 ? 80  PHE A CD2 1 
ATOM   654  C  CE1 . PHE A 1 80  ? 20.023  -4.148  17.124  1.00 127.48 ? 80  PHE A CE1 1 
ATOM   655  C  CE2 . PHE A 1 80  ? 18.364  -2.450  17.222  1.00 144.87 ? 80  PHE A CE2 1 
ATOM   656  C  CZ  . PHE A 1 80  ? 19.660  -2.855  17.410  1.00 138.68 ? 80  PHE A CZ  1 
ATOM   657  N  N   . GLY A 1 81  ? 16.218  -6.260  19.363  1.00 125.67 ? 81  GLY A N   1 
ATOM   658  C  CA  . GLY A 1 81  ? 15.681  -5.669  20.571  1.00 125.80 ? 81  GLY A CA  1 
ATOM   659  C  C   . GLY A 1 81  ? 14.761  -6.586  21.355  1.00 111.58 ? 81  GLY A C   1 
ATOM   660  O  O   . GLY A 1 81  ? 14.480  -6.343  22.524  1.00 100.16 ? 81  GLY A O   1 
ATOM   661  N  N   . SER A 1 82  ? 14.286  -7.652  20.724  1.00 105.20 ? 82  SER A N   1 
ATOM   662  C  CA  . SER A 1 82  ? 13.547  -8.683  21.453  1.00 94.15  ? 82  SER A CA  1 
ATOM   663  C  C   . SER A 1 82  ? 14.152  -8.987  22.829  1.00 81.44  ? 82  SER A C   1 
ATOM   664  O  O   . SER A 1 82  ? 15.356  -8.869  23.047  1.00 85.46  ? 82  SER A O   1 
ATOM   665  C  CB  . SER A 1 82  ? 13.483  -9.981  20.649  1.00 119.30 ? 82  SER A CB  1 
ATOM   666  O  OG  . SER A 1 82  ? 12.546  -10.870 21.227  1.00 121.79 ? 82  SER A OG  1 
ATOM   667  N  N   . SER A 1 83  ? 13.286  -9.375  23.750  1.00 102.67 ? 83  SER A N   1 
ATOM   668  C  CA  . SER A 1 83  ? 13.680  -9.901  25.044  1.00 91.73  ? 83  SER A CA  1 
ATOM   669  C  C   . SER A 1 83  ? 14.857  -10.872 24.940  1.00 96.69  ? 83  SER A C   1 
ATOM   670  O  O   . SER A 1 83  ? 15.972  -10.621 25.444  1.00 101.60 ? 83  SER A O   1 
ATOM   671  C  CB  . SER A 1 83  ? 12.472  -10.638 25.630  1.00 75.09  ? 83  SER A CB  1 
ATOM   672  O  OG  . SER A 1 83  ? 11.390  -10.694 24.696  1.00 78.39  ? 83  SER A OG  1 
ATOM   673  N  N   . LEU A 1 84  ? 14.591  -11.992 24.277  1.00 95.54  ? 84  LEU A N   1 
ATOM   674  C  CA  . LEU A 1 84  ? 15.564  -13.067 24.150  1.00 98.90  ? 84  LEU A CA  1 
ATOM   675  C  C   . LEU A 1 84  ? 16.786  -12.577 23.404  1.00 105.85 ? 84  LEU A C   1 
ATOM   676  O  O   . LEU A 1 84  ? 17.905  -12.860 23.809  1.00 106.64 ? 84  LEU A O   1 
ATOM   677  C  CB  . LEU A 1 84  ? 14.958  -14.294 23.457  1.00 99.36  ? 84  LEU A CB  1 
ATOM   678  C  CG  . LEU A 1 84  ? 15.853  -15.532 23.332  1.00 97.82  ? 84  LEU A CG  1 
ATOM   679  C  CD1 . LEU A 1 84  ? 16.480  -15.909 24.664  1.00 98.53  ? 84  LEU A CD1 1 
ATOM   680  C  CD2 . LEU A 1 84  ? 15.071  -16.692 22.767  1.00 93.88  ? 84  LEU A CD2 1 
ATOM   681  N  N   . SER A 1 85  ? 16.569  -11.835 22.323  1.00 89.10  ? 85  SER A N   1 
ATOM   682  C  CA  . SER A 1 85  ? 17.681  -11.325 21.539  1.00 94.99  ? 85  SER A CA  1 
ATOM   683  C  C   . SER A 1 85  ? 18.600  -10.506 22.433  1.00 99.42  ? 85  SER A C   1 
ATOM   684  O  O   . SER A 1 85  ? 19.820  -10.750 22.528  1.00 102.31 ? 85  SER A O   1 
ATOM   685  C  CB  . SER A 1 85  ? 17.168  -10.473 20.386  1.00 105.12 ? 85  SER A CB  1 
ATOM   686  O  OG  . SER A 1 85  ? 16.525  -11.268 19.411  1.00 104.87 ? 85  SER A OG  1 
ATOM   687  N  N   . THR A 1 86  ? 17.992  -9.535  23.101  1.00 92.57  ? 86  THR A N   1 
ATOM   688  C  CA  . THR A 1 86  ? 18.698  -8.696  24.048  1.00 96.07  ? 86  THR A CA  1 
ATOM   689  C  C   . THR A 1 86  ? 19.505  -9.538  25.019  1.00 90.83  ? 86  THR A C   1 
ATOM   690  O  O   . THR A 1 86  ? 20.711  -9.384  25.092  1.00 94.07  ? 86  THR A O   1 
ATOM   691  C  CB  . THR A 1 86  ? 17.735  -7.793  24.798  1.00 91.78  ? 86  THR A CB  1 
ATOM   692  O  OG1 . THR A 1 86  ? 16.946  -7.060  23.856  1.00 98.44  ? 86  THR A OG1 1 
ATOM   693  C  CG2 . THR A 1 86  ? 18.497  -6.826  25.640  1.00 92.47  ? 86  THR A CG2 1 
ATOM   694  N  N   . LEU A 1 87  ? 18.859  -10.455 25.733  1.00 81.42  ? 87  LEU A N   1 
ATOM   695  C  CA  . LEU A 1 87  ? 19.608  -11.263 26.697  1.00 77.90  ? 87  LEU A CA  1 
ATOM   696  C  C   . LEU A 1 87  ? 20.767  -12.107 26.108  1.00 79.23  ? 87  LEU A C   1 
ATOM   697  O  O   . LEU A 1 87  ? 21.821  -12.311 26.748  1.00 81.28  ? 87  LEU A O   1 
ATOM   698  C  CB  . LEU A 1 87  ? 18.667  -12.142 27.518  1.00 76.63  ? 87  LEU A CB  1 
ATOM   699  C  CG  . LEU A 1 87  ? 19.381  -12.896 28.647  1.00 75.08  ? 87  LEU A CG  1 
ATOM   700  C  CD1 . LEU A 1 87  ? 19.871  -11.911 29.709  1.00 76.60  ? 87  LEU A CD1 1 
ATOM   701  C  CD2 . LEU A 1 87  ? 18.519  -13.978 29.270  1.00 64.24  ? 87  LEU A CD2 1 
ATOM   702  N  N   . THR A 1 88  ? 20.581  -12.606 24.893  1.00 117.49 ? 88  THR A N   1 
ATOM   703  C  CA  . THR A 1 88  ? 21.623  -13.396 24.242  1.00 119.95 ? 88  THR A CA  1 
ATOM   704  C  C   . THR A 1 88  ? 22.793  -12.480 23.964  1.00 127.16 ? 88  THR A C   1 
ATOM   705  O  O   . THR A 1 88  ? 23.943  -12.863 24.104  1.00 130.82 ? 88  THR A O   1 
ATOM   706  C  CB  . THR A 1 88  ? 21.152  -14.015 22.899  1.00 100.23 ? 88  THR A CB  1 
ATOM   707  O  OG1 . THR A 1 88  ? 19.898  -13.443 22.534  1.00 101.36 ? 88  THR A OG1 1 
ATOM   708  C  CG2 . THR A 1 88  ? 20.976  -15.508 23.011  1.00 93.68  ? 88  THR A CG2 1 
ATOM   709  N  N   . TYR A 1 89  ? 22.482  -11.253 23.573  1.00 86.67  ? 89  TYR A N   1 
ATOM   710  C  CA  . TYR A 1 89  ? 23.520  -10.322 23.146  1.00 94.42  ? 89  TYR A CA  1 
ATOM   711  C  C   . TYR A 1 89  ? 24.227  -9.654  24.315  1.00 96.81  ? 89  TYR A C   1 
ATOM   712  O  O   . TYR A 1 89  ? 25.331  -9.137  24.159  1.00 104.04 ? 89  TYR A O   1 
ATOM   713  C  CB  . TYR A 1 89  ? 22.914  -9.300  22.202  1.00 112.31 ? 89  TYR A CB  1 
ATOM   714  C  CG  . TYR A 1 89  ? 23.537  -7.946  22.246  1.00 121.75 ? 89  TYR A CG  1 
ATOM   715  C  CD1 . TYR A 1 89  ? 24.466  -7.564  21.297  1.00 129.36 ? 89  TYR A CD1 1 
ATOM   716  C  CD2 . TYR A 1 89  ? 23.173  -7.032  23.219  1.00 124.47 ? 89  TYR A CD2 1 
ATOM   717  C  CE1 . TYR A 1 89  ? 25.027  -6.303  21.324  1.00 139.45 ? 89  TYR A CE1 1 
ATOM   718  C  CE2 . TYR A 1 89  ? 23.723  -5.774  23.256  1.00 134.92 ? 89  TYR A CE2 1 
ATOM   719  C  CZ  . TYR A 1 89  ? 24.650  -5.410  22.310  1.00 142.41 ? 89  TYR A CZ  1 
ATOM   720  O  OH  . TYR A 1 89  ? 25.193  -4.146  22.352  1.00 154.31 ? 89  TYR A OH  1 
ATOM   721  N  N   . TRP A 1 90  ? 23.575  -9.653  25.477  1.00 94.69  ? 90  TRP A N   1 
ATOM   722  C  CA  . TRP A 1 90  ? 24.265  -9.385  26.733  1.00 96.59  ? 90  TRP A CA  1 
ATOM   723  C  C   . TRP A 1 90  ? 25.175  -10.571 27.003  1.00 96.79  ? 90  TRP A C   1 
ATOM   724  O  O   . TRP A 1 90  ? 26.384  -10.451 26.871  1.00 103.80 ? 90  TRP A O   1 
ATOM   725  C  CB  . TRP A 1 90  ? 23.296  -9.164  27.910  1.00 104.70 ? 90  TRP A CB  1 
ATOM   726  C  CG  . TRP A 1 90  ? 22.476  -7.889  27.830  1.00 108.19 ? 90  TRP A CG  1 
ATOM   727  C  CD1 . TRP A 1 90  ? 22.784  -6.750  27.136  1.00 111.60 ? 90  TRP A CD1 1 
ATOM   728  C  CD2 . TRP A 1 90  ? 21.211  -7.643  28.450  1.00 109.76 ? 90  TRP A CD2 1 
ATOM   729  N  NE1 . TRP A 1 90  ? 21.791  -5.811  27.287  1.00 117.01 ? 90  TRP A NE1 1 
ATOM   730  C  CE2 . TRP A 1 90  ? 20.812  -6.336  28.085  1.00 112.25 ? 90  TRP A CE2 1 
ATOM   731  C  CE3 . TRP A 1 90  ? 20.379  -8.396  29.276  1.00 104.82 ? 90  TRP A CE3 1 
ATOM   732  C  CZ2 . TRP A 1 90  ? 19.625  -5.773  28.515  1.00 105.35 ? 90  TRP A CZ2 1 
ATOM   733  C  CZ3 . TRP A 1 90  ? 19.198  -7.833  29.701  1.00 98.02  ? 90  TRP A CZ3 1 
ATOM   734  C  CH2 . TRP A 1 90  ? 18.831  -6.532  29.319  1.00 98.41  ? 90  TRP A CH2 1 
ATOM   735  N  N   . LEU A 1 91  ? 24.607  -11.727 27.337  1.00 99.58  ? 91  LEU A N   1 
ATOM   736  C  CA  . LEU A 1 91  ? 25.449  -12.879 27.693  1.00 101.82 ? 91  LEU A CA  1 
ATOM   737  C  C   . LEU A 1 91  ? 26.572  -13.205 26.692  1.00 109.61 ? 91  LEU A C   1 
ATOM   738  O  O   . LEU A 1 91  ? 27.490  -13.946 27.006  1.00 114.35 ? 91  LEU A O   1 
ATOM   739  C  CB  . LEU A 1 91  ? 24.590  -14.125 27.875  1.00 110.19 ? 91  LEU A CB  1 
ATOM   740  C  CG  . LEU A 1 91  ? 23.694  -14.235 29.098  1.00 104.68 ? 91  LEU A CG  1 
ATOM   741  C  CD1 . LEU A 1 91  ? 22.332  -14.742 28.645  1.00 97.98  ? 91  LEU A CD1 1 
ATOM   742  C  CD2 . LEU A 1 91  ? 24.314  -15.147 30.164  1.00 108.81 ? 91  LEU A CD2 1 
ATOM   743  N  N   . TYR A 1 92  ? 26.480  -12.664 25.487  1.00 84.56  ? 92  TYR A N   1 
ATOM   744  C  CA  . TYR A 1 92  ? 27.438  -12.939 24.432  1.00 90.43  ? 92  TYR A CA  1 
ATOM   745  C  C   . TYR A 1 92  ? 28.669  -12.075 24.609  1.00 99.67  ? 92  TYR A C   1 
ATOM   746  O  O   . TYR A 1 92  ? 29.811  -12.502 24.404  1.00 106.23 ? 92  TYR A O   1 
ATOM   747  C  CB  . TYR A 1 92  ? 26.803  -12.601 23.094  1.00 105.43 ? 92  TYR A CB  1 
ATOM   748  C  CG  . TYR A 1 92  ? 27.734  -12.725 21.901  1.00 111.30 ? 92  TYR A CG  1 
ATOM   749  C  CD1 . TYR A 1 92  ? 28.483  -13.875 21.698  1.00 113.23 ? 92  TYR A CD1 1 
ATOM   750  C  CD2 . TYR A 1 92  ? 27.833  -11.706 20.964  1.00 116.04 ? 92  TYR A CD2 1 
ATOM   751  C  CE1 . TYR A 1 92  ? 29.316  -14.004 20.603  1.00 119.10 ? 92  TYR A CE1 1 
ATOM   752  C  CE2 . TYR A 1 92  ? 28.662  -11.823 19.870  1.00 122.27 ? 92  TYR A CE2 1 
ATOM   753  C  CZ  . TYR A 1 92  ? 29.406  -12.973 19.693  1.00 124.09 ? 92  TYR A CZ  1 
ATOM   754  O  OH  . TYR A 1 92  ? 30.243  -13.100 18.603  1.00 131.62 ? 92  TYR A OH  1 
ATOM   755  N  N   . SER A 1 93  ? 28.414  -10.833 24.978  1.00 112.84 ? 93  SER A N   1 
ATOM   756  C  CA  . SER A 1 93  ? 29.465  -9.868  25.143  1.00 122.46 ? 93  SER A CA  1 
ATOM   757  C  C   . SER A 1 93  ? 29.964  -9.945  26.573  1.00 124.38 ? 93  SER A C   1 
ATOM   758  O  O   . SER A 1 93  ? 30.751  -9.128  27.008  1.00 133.38 ? 93  SER A O   1 
ATOM   759  C  CB  . SER A 1 93  ? 28.921  -8.484  24.819  1.00 110.95 ? 93  SER A CB  1 
ATOM   760  O  OG  . SER A 1 93  ? 28.247  -8.501  23.572  1.00 107.20 ? 93  SER A OG  1 
ATOM   761  N  N   . ILE A 1 94  ? 29.498  -10.941 27.306  1.00 110.29 ? 94  ILE A N   1 
ATOM   762  C  CA  . ILE A 1 94  ? 29.944  -11.152 28.671  1.00 112.32 ? 94  ILE A CA  1 
ATOM   763  C  C   . ILE A 1 94  ? 30.641  -12.508 28.731  1.00 117.21 ? 94  ILE A C   1 
ATOM   764  O  O   . ILE A 1 94  ? 31.214  -12.872 29.745  1.00 122.77 ? 94  ILE A O   1 
ATOM   765  C  CB  . ILE A 1 94  ? 28.749  -11.125 29.675  1.00 113.83 ? 94  ILE A CB  1 
ATOM   766  C  CG1 . ILE A 1 94  ? 28.175  -9.715  29.819  1.00 114.40 ? 94  ILE A CG1 1 
ATOM   767  C  CG2 . ILE A 1 94  ? 29.151  -11.642 31.041  1.00 114.75 ? 94  ILE A CG2 1 
ATOM   768  C  CD1 . ILE A 1 94  ? 26.979  -9.625  30.788  1.00 106.62 ? 94  ILE A CD1 1 
ATOM   769  N  N   . LEU A 1 95  ? 30.601  -13.258 27.638  1.00 133.89 ? 95  LEU A N   1 
ATOM   770  C  CA  . LEU A 1 95  ? 31.073  -14.640 27.680  1.00 135.46 ? 95  LEU A CA  1 
ATOM   771  C  C   . LEU A 1 95  ? 31.952  -15.023 26.499  1.00 138.82 ? 95  LEU A C   1 
ATOM   772  O  O   . LEU A 1 95  ? 31.805  -14.480 25.402  1.00 137.54 ? 95  LEU A O   1 
ATOM   773  C  CB  . LEU A 1 95  ? 29.892  -15.606 27.784  1.00 117.75 ? 95  LEU A CB  1 
ATOM   774  C  CG  . LEU A 1 95  ? 29.015  -15.445 29.021  1.00 111.88 ? 95  LEU A CG  1 
ATOM   775  C  CD1 . LEU A 1 95  ? 27.646  -16.015 28.736  1.00 103.13 ? 95  LEU A CD1 1 
ATOM   776  C  CD2 . LEU A 1 95  ? 29.652  -16.102 30.226  1.00 116.93 ? 95  LEU A CD2 1 
ATOM   777  N  N   . PRO A 1 96  ? 32.855  -15.990 26.724  1.00 122.19 ? 96  PRO A N   1 
ATOM   778  C  CA  . PRO A 1 96  ? 33.905  -16.398 25.794  1.00 127.07 ? 96  PRO A CA  1 
ATOM   779  C  C   . PRO A 1 96  ? 33.427  -17.509 24.891  1.00 121.11 ? 96  PRO A C   1 
ATOM   780  O  O   . PRO A 1 96  ? 34.249  -18.153 24.245  1.00 123.00 ? 96  PRO A O   1 
ATOM   781  C  CB  . PRO A 1 96  ? 34.964  -16.957 26.735  1.00 92.33  ? 96  PRO A CB  1 
ATOM   782  C  CG  . PRO A 1 96  ? 34.162  -17.633 27.783  1.00 89.29  ? 96  PRO A CG  1 
ATOM   783  C  CD  . PRO A 1 96  ? 32.911  -16.787 27.962  1.00 82.50  ? 96  PRO A CD  1 
ATOM   784  N  N   . PHE A 1 97  ? 32.119  -17.734 24.858  1.00 116.09 ? 97  PHE A N   1 
ATOM   785  C  CA  . PHE A 1 97  ? 31.559  -18.830 24.093  1.00 111.01 ? 97  PHE A CA  1 
ATOM   786  C  C   . PHE A 1 97  ? 30.943  -18.290 22.812  1.00 107.62 ? 97  PHE A C   1 
ATOM   787  O  O   . PHE A 1 97  ? 30.506  -17.139 22.775  1.00 105.16 ? 97  PHE A O   1 
ATOM   788  C  CB  . PHE A 1 97  ? 30.488  -19.534 24.912  1.00 119.72 ? 97  PHE A CB  1 
ATOM   789  C  CG  . PHE A 1 97  ? 30.937  -19.960 26.285  1.00 124.76 ? 97  PHE A CG  1 
ATOM   790  C  CD1 . PHE A 1 97  ? 30.373  -19.399 27.419  1.00 123.81 ? 97  PHE A CD1 1 
ATOM   791  C  CD2 . PHE A 1 97  ? 31.904  -20.939 26.444  1.00 132.11 ? 97  PHE A CD2 1 
ATOM   792  C  CE1 . PHE A 1 97  ? 30.771  -19.802 28.680  1.00 130.11 ? 97  PHE A CE1 1 
ATOM   793  C  CE2 . PHE A 1 97  ? 32.306  -21.343 27.702  1.00 138.60 ? 97  PHE A CE2 1 
ATOM   794  C  CZ  . PHE A 1 97  ? 31.738  -20.775 28.818  1.00 137.59 ? 97  PHE A CZ  1 
ATOM   795  N  N   . SER A 1 98  ? 30.900  -19.119 21.768  1.00 123.23 ? 98  SER A N   1 
ATOM   796  C  CA  . SER A 1 98  ? 30.405  -18.677 20.460  1.00 122.85 ? 98  SER A CA  1 
ATOM   797  C  C   . SER A 1 98  ? 28.893  -18.547 20.426  1.00 114.90 ? 98  SER A C   1 
ATOM   798  O  O   . SER A 1 98  ? 28.163  -19.310 21.074  1.00 108.90 ? 98  SER A O   1 
ATOM   799  C  CB  . SER A 1 98  ? 30.852  -19.622 19.338  1.00 146.51 ? 98  SER A CB  1 
ATOM   800  O  OG  . SER A 1 98  ? 29.899  -20.647 19.103  1.00 146.90 ? 98  SER A OG  1 
ATOM   801  N  N   . PHE A 1 99  ? 28.431  -17.572 19.655  1.00 129.76 ? 99  PHE A N   1 
ATOM   802  C  CA  . PHE A 1 99  ? 27.002  -17.354 19.470  1.00 124.17 ? 99  PHE A CA  1 
ATOM   803  C  C   . PHE A 1 99  ? 26.270  -18.685 19.447  1.00 118.01 ? 99  PHE A C   1 
ATOM   804  O  O   . PHE A 1 99  ? 25.412  -18.932 20.272  1.00 116.38 ? 99  PHE A O   1 
ATOM   805  C  CB  . PHE A 1 99  ? 26.772  -16.597 18.167  1.00 99.14  ? 99  PHE A CB  1 
ATOM   806  C  CG  . PHE A 1 99  ? 25.360  -16.147 17.954  1.00 96.31  ? 99  PHE A CG  1 
ATOM   807  C  CD1 . PHE A 1 99  ? 24.926  -14.927 18.456  1.00 98.17  ? 99  PHE A CD1 1 
ATOM   808  C  CD2 . PHE A 1 99  ? 24.476  -16.926 17.213  1.00 93.60  ? 99  PHE A CD2 1 
ATOM   809  C  CE1 . PHE A 1 99  ? 23.622  -14.503 18.239  1.00 96.16  ? 99  PHE A CE1 1 
ATOM   810  C  CE2 . PHE A 1 99  ? 23.185  -16.510 16.982  1.00 92.25  ? 99  PHE A CE2 1 
ATOM   811  C  CZ  . PHE A 1 99  ? 22.747  -15.304 17.495  1.00 93.30  ? 99  PHE A CZ  1 
ATOM   812  N  N   . GLU A 1 100 ? 26.655  -19.553 18.522  1.00 103.62 ? 100 GLU A N   1 
ATOM   813  C  CA  . GLU A 1 100 ? 25.983  -20.828 18.318  1.00 99.70  ? 100 GLU A CA  1 
ATOM   814  C  C   . GLU A 1 100 ? 25.852  -21.684 19.595  1.00 99.80  ? 100 GLU A C   1 
ATOM   815  O  O   . GLU A 1 100 ? 24.817  -22.356 19.808  1.00 97.97  ? 100 GLU A O   1 
ATOM   816  C  CB  . GLU A 1 100 ? 26.669  -21.625 17.189  1.00 133.11 ? 100 GLU A CB  1 
ATOM   817  C  CG  . GLU A 1 100 ? 26.548  -21.021 15.770  1.00 135.63 ? 100 GLU A CG  1 
ATOM   818  C  CD  . GLU A 1 100 ? 27.716  -20.115 15.405  1.00 136.42 ? 100 GLU A CD  1 
ATOM   819  O  OE1 . GLU A 1 100 ? 28.709  -20.094 16.158  1.00 136.59 ? 100 GLU A OE1 1 
ATOM   820  O  OE2 . GLU A 1 100 ? 27.648  -19.426 14.365  1.00 138.15 ? 100 GLU A OE2 1 
ATOM   821  N  N   . SER A 1 101 ? 26.879  -21.653 20.445  1.00 116.94 ? 101 SER A N   1 
ATOM   822  C  CA  . SER A 1 101 ? 26.875  -22.452 21.670  1.00 118.27 ? 101 SER A CA  1 
ATOM   823  C  C   . SER A 1 101 ? 26.048  -21.799 22.775  1.00 111.39 ? 101 SER A C   1 
ATOM   824  O  O   . SER A 1 101 ? 25.401  -22.493 23.574  1.00 110.42 ? 101 SER A O   1 
ATOM   825  C  CB  . SER A 1 101 ? 28.291  -22.693 22.162  1.00 116.10 ? 101 SER A CB  1 
ATOM   826  O  OG  . SER A 1 101 ? 29.219  -22.393 21.144  1.00 115.97 ? 101 SER A OG  1 
ATOM   827  N  N   . ILE A 1 102 ? 26.071  -20.468 22.817  1.00 104.16 ? 102 ILE A N   1 
ATOM   828  C  CA  . ILE A 1 102 ? 25.175  -19.706 23.691  1.00 98.78  ? 102 ILE A CA  1 
ATOM   829  C  C   . ILE A 1 102 ? 23.708  -19.962 23.331  1.00 91.45  ? 102 ILE A C   1 
ATOM   830  O  O   . ILE A 1 102 ? 22.975  -20.648 24.073  1.00 88.43  ? 102 ILE A O   1 
ATOM   831  C  CB  . ILE A 1 102 ? 25.484  -18.217 23.602  1.00 81.63  ? 102 ILE A CB  1 
ATOM   832  C  CG1 . ILE A 1 102 ? 26.933  -17.999 24.050  1.00 79.44  ? 102 ILE A CG1 1 
ATOM   833  C  CG2 . ILE A 1 102 ? 24.486  -17.418 24.415  1.00 82.85  ? 102 ILE A CG2 1 
ATOM   834  C  CD1 . ILE A 1 102 ? 27.340  -16.554 24.371  1.00 83.24  ? 102 ILE A CD1 1 
ATOM   835  N  N   . ILE A 1 103 ? 23.293  -19.393 22.198  1.00 84.17  ? 103 ILE A N   1 
ATOM   836  C  CA  . ILE A 1 103 ? 22.066  -19.778 21.515  1.00 79.15  ? 103 ILE A CA  1 
ATOM   837  C  C   . ILE A 1 103 ? 21.695  -21.228 21.790  1.00 78.49  ? 103 ILE A C   1 
ATOM   838  O  O   . ILE A 1 103 ? 20.521  -21.540 22.009  1.00 74.06  ? 103 ILE A O   1 
ATOM   839  C  CB  . ILE A 1 103 ? 22.222  -19.652 20.001  1.00 84.85  ? 103 ILE A CB  1 
ATOM   840  C  CG1 . ILE A 1 103 ? 21.516  -18.415 19.478  1.00 85.32  ? 103 ILE A CG1 1 
ATOM   841  C  CG2 . ILE A 1 103 ? 21.669  -20.890 19.285  1.00 82.82  ? 103 ILE A CG2 1 
ATOM   842  C  CD1 . ILE A 1 103 ? 21.217  -18.538 18.010  1.00 87.30  ? 103 ILE A CD1 1 
ATOM   843  N  N   . LEU A 1 104 ? 22.679  -22.127 21.762  1.00 88.52  ? 104 LEU A N   1 
ATOM   844  C  CA  . LEU A 1 104 ? 22.365  -23.523 22.018  1.00 90.72  ? 104 LEU A CA  1 
ATOM   845  C  C   . LEU A 1 104 ? 21.957  -23.834 23.455  1.00 89.23  ? 104 LEU A C   1 
ATOM   846  O  O   . LEU A 1 104 ? 20.841  -24.317 23.669  1.00 85.55  ? 104 LEU A O   1 
ATOM   847  C  CB  . LEU A 1 104 ? 23.493  -24.447 21.616  1.00 67.14  ? 104 LEU A CB  1 
ATOM   848  C  CG  . LEU A 1 104 ? 22.895  -25.848 21.662  1.00 73.62  ? 104 LEU A CG  1 
ATOM   849  C  CD1 . LEU A 1 104 ? 22.511  -26.232 20.262  1.00 74.37  ? 104 LEU A CD1 1 
ATOM   850  C  CD2 . LEU A 1 104 ? 23.815  -26.885 22.245  1.00 79.79  ? 104 LEU A CD2 1 
ATOM   851  N  N   . TYR A 1 105 ? 22.845  -23.572 24.427  1.00 92.82  ? 105 TYR A N   1 
ATOM   852  C  CA  . TYR A 1 105 ? 22.619  -24.002 25.838  1.00 95.27  ? 105 TYR A CA  1 
ATOM   853  C  C   . TYR A 1 105 ? 21.789  -23.067 26.752  1.00 89.57  ? 105 TYR A C   1 
ATOM   854  O  O   . TYR A 1 105 ? 21.408  -23.463 27.867  1.00 92.01  ? 105 TYR A O   1 
ATOM   855  C  CB  . TYR A 1 105 ? 23.944  -24.338 26.542  1.00 89.74  ? 105 TYR A CB  1 
ATOM   856  C  CG  . TYR A 1 105 ? 24.712  -25.509 25.969  1.00 98.58  ? 105 TYR A CG  1 
ATOM   857  C  CD1 . TYR A 1 105 ? 25.430  -25.372 24.801  1.00 99.80  ? 105 TYR A CD1 1 
ATOM   858  C  CD2 . TYR A 1 105 ? 24.737  -26.742 26.619  1.00 107.66 ? 105 TYR A CD2 1 
ATOM   859  C  CE1 . TYR A 1 105 ? 26.142  -26.428 24.278  1.00 109.39 ? 105 TYR A CE1 1 
ATOM   860  C  CE2 . TYR A 1 105 ? 25.447  -27.812 26.107  1.00 117.92 ? 105 TYR A CE2 1 
ATOM   861  C  CZ  . TYR A 1 105 ? 26.153  -27.651 24.926  1.00 118.61 ? 105 TYR A CZ  1 
ATOM   862  O  OH  . TYR A 1 105 ? 26.884  -28.691 24.367  1.00 130.12 ? 105 TYR A OH  1 
ATOM   863  N  N   . MET A 1 106 ? 21.526  -21.842 26.287  1.00 89.63  ? 106 MET A N   1 
ATOM   864  C  CA  . MET A 1 106 ? 20.716  -20.883 27.043  1.00 85.74  ? 106 MET A CA  1 
ATOM   865  C  C   . MET A 1 106 ? 19.430  -21.481 27.619  1.00 81.22  ? 106 MET A C   1 
ATOM   866  O  O   . MET A 1 106 ? 19.125  -21.315 28.789  1.00 75.46  ? 106 MET A O   1 
ATOM   867  C  CB  . MET A 1 106 ? 20.356  -19.698 26.166  1.00 101.98 ? 106 MET A CB  1 
ATOM   868  C  CG  . MET A 1 106 ? 21.430  -18.668 26.023  1.00 105.49 ? 106 MET A CG  1 
ATOM   869  S  SD  . MET A 1 106 ? 20.669  -17.158 25.414  1.00 103.71 ? 106 MET A SD  1 
ATOM   870  C  CE  . MET A 1 106 ? 19.760  -16.620 26.851  1.00 99.58  ? 106 MET A CE  1 
ATOM   871  N  N   . SER A 1 107 ? 18.667  -22.146 26.764  1.00 94.71  ? 107 SER A N   1 
ATOM   872  C  CA  . SER A 1 107 ? 17.486  -22.917 27.140  1.00 86.60  ? 107 SER A CA  1 
ATOM   873  C  C   . SER A 1 107 ? 17.748  -23.819 28.346  1.00 84.71  ? 107 SER A C   1 
ATOM   874  O  O   . SER A 1 107 ? 17.094  -23.719 29.392  1.00 74.40  ? 107 SER A O   1 
ATOM   875  C  CB  . SER A 1 107 ? 17.116  -23.768 25.936  1.00 74.41  ? 107 SER A CB  1 
ATOM   876  O  OG  . SER A 1 107 ? 17.905  -23.357 24.805  1.00 77.07  ? 107 SER A OG  1 
ATOM   877  N  N   . THR A 1 108 ? 18.729  -24.694 28.180  1.00 88.24  ? 108 THR A N   1 
ATOM   878  C  CA  . THR A 1 108 ? 19.221  -25.573 29.237  1.00 90.54  ? 108 THR A CA  1 
ATOM   879  C  C   . THR A 1 108 ? 19.494  -24.841 30.552  1.00 86.57  ? 108 THR A C   1 
ATOM   880  O  O   . THR A 1 108 ? 19.144  -25.321 31.631  1.00 80.89  ? 108 THR A O   1 
ATOM   881  C  CB  . THR A 1 108 ? 20.551  -26.225 28.813  1.00 105.14 ? 108 THR A CB  1 
ATOM   882  O  OG1 . THR A 1 108 ? 20.509  -26.570 27.422  1.00 110.84 ? 108 THR A OG1 1 
ATOM   883  C  CG2 . THR A 1 108 ? 20.842  -27.454 29.662  1.00 109.05 ? 108 THR A CG2 1 
ATOM   884  N  N   . PHE A 1 109 ? 20.163  -23.698 30.479  1.00 119.00 ? 109 PHE A N   1 
ATOM   885  C  CA  . PHE A 1 109 ? 20.465  -23.011 31.720  1.00 117.90 ? 109 PHE A CA  1 
ATOM   886  C  C   . PHE A 1 109 ? 19.208  -22.421 32.296  1.00 102.15 ? 109 PHE A C   1 
ATOM   887  O  O   . PHE A 1 109 ? 18.672  -22.905 33.288  1.00 96.11  ? 109 PHE A O   1 
ATOM   888  C  CB  . PHE A 1 109 ? 21.489  -21.901 31.540  1.00 123.81 ? 109 PHE A CB  1 
ATOM   889  C  CG  . PHE A 1 109 ? 21.777  -21.145 32.814  1.00 122.52 ? 109 PHE A CG  1 
ATOM   890  C  CD1 . PHE A 1 109 ? 22.529  -21.727 33.827  1.00 131.80 ? 109 PHE A CD1 1 
ATOM   891  C  CD2 . PHE A 1 109 ? 21.287  -19.865 33.006  1.00 113.88 ? 109 PHE A CD2 1 
ATOM   892  C  CE1 . PHE A 1 109 ? 22.790  -21.045 34.994  1.00 132.38 ? 109 PHE A CE1 1 
ATOM   893  C  CE2 . PHE A 1 109 ? 21.549  -19.182 34.174  1.00 114.18 ? 109 PHE A CE2 1 
ATOM   894  C  CZ  . PHE A 1 109 ? 22.300  -19.777 35.167  1.00 123.39 ? 109 PHE A CZ  1 
ATOM   895  N  N   . PHE A 1 110 ? 18.737  -21.365 31.660  1.00 128.28 ? 110 PHE A N   1 
ATOM   896  C  CA  . PHE A 1 110 ? 17.616  -20.619 32.187  1.00 115.67 ? 110 PHE A CA  1 
ATOM   897  C  C   . PHE A 1 110 ? 16.421  -21.457 32.573  1.00 105.44 ? 110 PHE A C   1 
ATOM   898  O  O   . PHE A 1 110 ? 15.874  -21.246 33.648  1.00 99.25  ? 110 PHE A O   1 
ATOM   899  C  CB  . PHE A 1 110 ? 17.210  -19.499 31.247  1.00 68.98  ? 110 PHE A CB  1 
ATOM   900  C  CG  . PHE A 1 110 ? 18.194  -18.360 31.229  1.00 77.15  ? 110 PHE A CG  1 
ATOM   901  C  CD1 . PHE A 1 110 ? 19.123  -18.231 30.196  1.00 89.07  ? 110 PHE A CD1 1 
ATOM   902  C  CD2 . PHE A 1 110 ? 18.218  -17.438 32.253  1.00 74.59  ? 110 PHE A CD2 1 
ATOM   903  C  CE1 . PHE A 1 110 ? 20.035  -17.190 30.172  1.00 96.53  ? 110 PHE A CE1 1 
ATOM   904  C  CE2 . PHE A 1 110 ? 19.127  -16.410 32.227  1.00 83.32  ? 110 PHE A CE2 1 
ATOM   905  C  CZ  . PHE A 1 110 ? 20.033  -16.287 31.178  1.00 93.90  ? 110 PHE A CZ  1 
ATOM   906  N  N   . ALA A 1 111 ? 15.999  -22.410 31.744  1.00 101.63 ? 111 ALA A N   1 
ATOM   907  C  CA  . ALA A 1 111 ? 14.780  -23.129 32.133  1.00 92.81  ? 111 ALA A CA  1 
ATOM   908  C  C   . ALA A 1 111 ? 14.979  -24.085 33.274  1.00 93.61  ? 111 ALA A C   1 
ATOM   909  O  O   . ALA A 1 111 ? 14.016  -24.620 33.788  1.00 86.62  ? 111 ALA A O   1 
ATOM   910  C  CB  . ALA A 1 111 ? 14.152  -23.822 31.002  1.00 70.13  ? 111 ALA A CB  1 
ATOM   911  N  N   . SER A 1 112 ? 16.221  -24.292 33.678  1.00 100.56 ? 112 SER A N   1 
ATOM   912  C  CA  . SER A 1 112 ? 16.483  -25.120 34.839  1.00 103.99 ? 112 SER A CA  1 
ATOM   913  C  C   . SER A 1 112 ? 16.286  -24.326 36.133  1.00 100.93 ? 112 SER A C   1 
ATOM   914  O  O   . SER A 1 112 ? 16.415  -24.867 37.229  1.00 104.60 ? 112 SER A O   1 
ATOM   915  C  CB  . SER A 1 112 ? 17.886  -25.730 34.766  1.00 81.36  ? 112 SER A CB  1 
ATOM   916  O  OG  . SER A 1 112 ? 17.839  -27.061 34.276  1.00 84.28  ? 112 SER A OG  1 
ATOM   917  N  N   . LEU A 1 113 ? 15.946  -23.050 36.005  1.00 111.66 ? 113 LEU A N   1 
ATOM   918  C  CA  . LEU A 1 113 ? 15.820  -22.190 37.175  1.00 110.10 ? 113 LEU A CA  1 
ATOM   919  C  C   . LEU A 1 113 ? 14.532  -22.418 37.946  1.00 99.99  ? 113 LEU A C   1 
ATOM   920  O  O   . LEU A 1 113 ? 14.393  -21.976 39.089  1.00 99.34  ? 113 LEU A O   1 
ATOM   921  C  CB  . LEU A 1 113 ? 15.925  -20.718 36.774  1.00 69.31  ? 113 LEU A CB  1 
ATOM   922  C  CG  . LEU A 1 113 ? 17.169  -20.038 37.339  1.00 79.92  ? 113 LEU A CG  1 
ATOM   923  C  CD1 . LEU A 1 113 ? 18.282  -21.068 37.515  1.00 93.06  ? 113 LEU A CD1 1 
ATOM   924  C  CD2 . LEU A 1 113 ? 17.598  -18.869 36.460  1.00 82.38  ? 113 LEU A CD2 1 
ATOM   925  N  N   . ILE A 1 114 ? 13.593  -23.107 37.318  1.00 113.00 ? 114 ILE A N   1 
ATOM   926  C  CA  . ILE A 1 114 ? 12.263  -23.248 37.878  1.00 105.14 ? 114 ILE A CA  1 
ATOM   927  C  C   . ILE A 1 114 ? 12.314  -24.086 39.176  1.00 108.79 ? 114 ILE A C   1 
ATOM   928  O  O   . ILE A 1 114 ? 11.570  -23.865 40.197  1.00 106.17 ? 114 ILE A O   1 
ATOM   929  C  CB  . ILE A 1 114 ? 11.353  -23.854 36.814  1.00 95.37  ? 114 ILE A CB  1 
ATOM   930  C  CG1 . ILE A 1 114 ? 9.948   -23.254 36.913  1.00 88.33  ? 114 ILE A CG1 1 
ATOM   931  C  CG2 . ILE A 1 114 ? 11.400  -25.372 36.867  1.00 98.26  ? 114 ILE A CG2 1 
ATOM   932  C  CD1 . ILE A 1 114 ? 8.836   -24.221 36.528  1.00 85.43  ? 114 ILE A CD1 1 
ATOM   933  N  N   . VAL A 1 115 ? 13.238  -25.036 39.125  1.00 102.12 ? 115 VAL A N   1 
ATOM   934  C  CA  . VAL A 1 115 ? 13.640  -25.831 40.273  1.00 109.88 ? 115 VAL A CA  1 
ATOM   935  C  C   . VAL A 1 115 ? 13.827  -24.955 41.540  1.00 113.09 ? 115 VAL A C   1 
ATOM   936  O  O   . VAL A 1 115 ? 13.778  -25.464 42.665  1.00 117.64 ? 115 VAL A O   1 
ATOM   937  C  CB  . VAL A 1 115 ? 14.924  -26.656 39.909  1.00 94.15  ? 115 VAL A CB  1 
ATOM   938  C  CG1 . VAL A 1 115 ? 16.162  -26.173 40.697  1.00 107.14 ? 115 VAL A CG1 1 
ATOM   939  C  CG2 . VAL A 1 115 ? 14.683  -28.187 40.013  1.00 96.25  ? 115 VAL A CG2 1 
ATOM   940  N  N   . VAL A 1 116 ? 14.004  -23.644 41.354  1.00 106.22 ? 116 VAL A N   1 
ATOM   941  C  CA  . VAL A 1 116 ? 14.164  -22.700 42.477  1.00 110.87 ? 116 VAL A CA  1 
ATOM   942  C  C   . VAL A 1 116 ? 12.840  -22.283 43.160  1.00 103.16 ? 116 VAL A C   1 
ATOM   943  O  O   . VAL A 1 116 ? 12.612  -22.596 44.343  1.00 108.60 ? 116 VAL A O   1 
ATOM   944  C  CB  . VAL A 1 116 ? 15.018  -21.455 42.073  1.00 63.93  ? 116 VAL A CB  1 
ATOM   945  C  CG1 . VAL A 1 116 ? 14.644  -20.253 42.905  1.00 62.71  ? 116 VAL A CG1 1 
ATOM   946  C  CG2 . VAL A 1 116 ? 16.480  -21.759 42.241  1.00 79.26  ? 116 VAL A CG2 1 
ATOM   947  N  N   . PRO A 1 117 ? 11.957  -21.580 42.430  1.00 99.33  ? 117 PRO A N   1 
ATOM   948  C  CA  . PRO A 1 117 ? 10.700  -21.337 43.117  1.00 95.02  ? 117 PRO A CA  1 
ATOM   949  C  C   . PRO A 1 117 ? 10.024  -22.630 43.489  1.00 94.52  ? 117 PRO A C   1 
ATOM   950  O  O   . PRO A 1 117 ? 9.390   -22.607 44.535  1.00 96.56  ? 117 PRO A O   1 
ATOM   951  C  CB  . PRO A 1 117 ? 9.863   -20.559 42.094  1.00 77.32  ? 117 PRO A CB  1 
ATOM   952  C  CG  . PRO A 1 117 ? 10.487  -20.804 40.826  1.00 75.46  ? 117 PRO A CG  1 
ATOM   953  C  CD  . PRO A 1 117 ? 11.955  -20.986 41.088  1.00 84.05  ? 117 PRO A CD  1 
ATOM   954  N  N   . ILE A 1 118 ? 10.135  -23.725 42.730  1.00 118.63 ? 118 ILE A N   1 
ATOM   955  C  CA  . ILE A 1 118 ? 9.409   -24.909 43.253  1.00 119.92 ? 118 ILE A CA  1 
ATOM   956  C  C   . ILE A 1 118 ? 9.708   -25.166 44.753  1.00 128.60 ? 118 ILE A C   1 
ATOM   957  O  O   . ILE A 1 118 ? 8.814   -25.090 45.632  1.00 130.73 ? 118 ILE A O   1 
ATOM   958  C  CB  . ILE A 1 118 ? 9.678   -26.222 42.490  1.00 92.08  ? 118 ILE A CB  1 
ATOM   959  C  CG1 . ILE A 1 118 ? 9.323   -26.100 41.013  1.00 85.39  ? 118 ILE A CG1 1 
ATOM   960  C  CG2 . ILE A 1 118 ? 8.849   -27.334 43.090  1.00 94.76  ? 118 ILE A CG2 1 
ATOM   961  C  CD1 . ILE A 1 118 ? 7.859   -26.248 40.736  1.00 82.08  ? 118 ILE A CD1 1 
ATOM   962  N  N   . ILE A 1 119 ? 10.973  -25.463 45.042  1.00 89.40  ? 119 ILE A N   1 
ATOM   963  C  CA  . ILE A 1 119 ? 11.376  -25.805 46.402  1.00 102.17 ? 119 ILE A CA  1 
ATOM   964  C  C   . ILE A 1 119 ? 11.263  -24.625 47.352  1.00 105.23 ? 119 ILE A C   1 
ATOM   965  O  O   . ILE A 1 119 ? 11.019  -24.824 48.530  1.00 113.21 ? 119 ILE A O   1 
ATOM   966  C  CB  . ILE A 1 119 ? 12.770  -26.519 46.487  1.00 96.18  ? 119 ILE A CB  1 
ATOM   967  C  CG1 . ILE A 1 119 ? 13.936  -25.591 46.191  1.00 102.05 ? 119 ILE A CG1 1 
ATOM   968  C  CG2 . ILE A 1 119 ? 12.859  -27.702 45.520  1.00 93.50  ? 119 ILE A CG2 1 
ATOM   969  C  CD1 . ILE A 1 119 ? 15.161  -26.405 45.795  1.00 113.42 ? 119 ILE A CD1 1 
ATOM   970  N  N   . LEU A 1 120 ? 11.385  -23.403 46.847  1.00 96.27  ? 120 LEU A N   1 
ATOM   971  C  CA  . LEU A 1 120 ? 11.129  -22.242 47.716  1.00 98.88  ? 120 LEU A CA  1 
ATOM   972  C  C   . LEU A 1 120 ? 9.673   -22.135 48.235  1.00 93.25  ? 120 LEU A C   1 
ATOM   973  O  O   . LEU A 1 120 ? 9.428   -21.937 49.442  1.00 101.09 ? 120 LEU A O   1 
ATOM   974  C  CB  . LEU A 1 120 ? 11.572  -20.923 47.060  1.00 81.77  ? 120 LEU A CB  1 
ATOM   975  C  CG  . LEU A 1 120 ? 13.065  -20.618 46.989  1.00 93.28  ? 120 LEU A CG  1 
ATOM   976  C  CD1 . LEU A 1 120 ? 13.206  -19.174 46.620  1.00 90.49  ? 120 LEU A CD1 1 
ATOM   977  C  CD2 . LEU A 1 120 ? 13.745  -20.917 48.316  1.00 109.95 ? 120 LEU A CD2 1 
ATOM   978  N  N   . ILE A 1 121 ? 8.708   -22.254 47.332  1.00 91.76  ? 121 ILE A N   1 
ATOM   979  C  CA  . ILE A 1 121 ? 7.316   -22.251 47.755  1.00 91.15  ? 121 ILE A CA  1 
ATOM   980  C  C   . ILE A 1 121 ? 7.045   -23.444 48.631  1.00 97.85  ? 121 ILE A C   1 
ATOM   981  O  O   . ILE A 1 121 ? 6.430   -23.321 49.689  1.00 104.73 ? 121 ILE A O   1 
ATOM   982  C  CB  . ILE A 1 121 ? 6.373   -22.350 46.587  1.00 92.32  ? 121 ILE A CB  1 
ATOM   983  C  CG1 . ILE A 1 121 ? 6.623   -21.181 45.649  1.00 86.73  ? 121 ILE A CG1 1 
ATOM   984  C  CG2 . ILE A 1 121 ? 4.932   -22.375 47.087  1.00 94.34  ? 121 ILE A CG2 1 
ATOM   985  C  CD1 . ILE A 1 121 ? 5.813   -21.232 44.379  1.00 79.97  ? 121 ILE A CD1 1 
ATOM   986  N  N   . ALA A 1 122 ? 7.484   -24.612 48.172  1.00 95.71  ? 122 ALA A N   1 
ATOM   987  C  CA  . ALA A 1 122 ? 7.382   -25.781 49.023  1.00 104.23 ? 122 ALA A CA  1 
ATOM   988  C  C   . ALA A 1 122 ? 7.795   -25.375 50.444  1.00 116.68 ? 122 ALA A C   1 
ATOM   989  O  O   . ALA A 1 122 ? 7.083   -25.657 51.415  1.00 123.96 ? 122 ALA A O   1 
ATOM   990  C  CB  . ALA A 1 122 ? 8.267   -26.888 48.504  1.00 114.62 ? 122 ALA A CB  1 
ATOM   991  N  N   . ARG A 1 123 ? 8.937   -24.691 50.548  1.00 115.76 ? 123 ARG A N   1 
ATOM   992  C  CA  . ARG A 1 123 ? 9.527   -24.341 51.850  1.00 132.23 ? 123 ARG A CA  1 
ATOM   993  C  C   . ARG A 1 123 ? 8.712   -23.342 52.638  1.00 134.47 ? 123 ARG A C   1 
ATOM   994  O  O   . ARG A 1 123 ? 8.711   -23.375 53.863  1.00 149.21 ? 123 ARG A O   1 
ATOM   995  C  CB  . ARG A 1 123 ? 10.940  -23.799 51.676  1.00 92.25  ? 123 ARG A CB  1 
ATOM   996  C  CG  . ARG A 1 123 ? 11.433  -22.975 52.812  1.00 110.21 ? 123 ARG A CG  1 
ATOM   997  C  CD  . ARG A 1 123 ? 12.696  -22.288 52.397  1.00 114.09 ? 123 ARG A CD  1 
ATOM   998  N  NE  . ARG A 1 123 ? 13.602  -22.188 53.527  1.00 132.88 ? 123 ARG A NE  1 
ATOM   999  C  CZ  . ARG A 1 123 ? 13.742  -21.101 54.274  1.00 139.10 ? 123 ARG A CZ  1 
ATOM   1000 N  NH1 . ARG A 1 123 ? 13.042  -20.009 53.993  1.00 130.26 ? 123 ARG A NH1 1 
ATOM   1001 N  NH2 . ARG A 1 123 ? 14.594  -21.103 55.295  1.00 155.23 ? 123 ARG A NH2 1 
ATOM   1002 N  N   . GLU A 1 124 ? 8.037   -22.434 51.943  1.00 103.95 ? 124 GLU A N   1 
ATOM   1003 C  CA  . GLU A 1 124 ? 7.087   -21.564 52.635  1.00 107.67 ? 124 GLU A CA  1 
ATOM   1004 C  C   . GLU A 1 124 ? 6.083   -22.396 53.416  1.00 112.95 ? 124 GLU A C   1 
ATOM   1005 O  O   . GLU A 1 124 ? 5.677   -22.025 54.513  1.00 124.30 ? 124 GLU A O   1 
ATOM   1006 C  CB  . GLU A 1 124 ? 6.343   -20.664 51.650  1.00 150.58 ? 124 GLU A CB  1 
ATOM   1007 C  CG  . GLU A 1 124 ? 7.226   -19.692 50.919  1.00 146.75 ? 124 GLU A CG  1 
ATOM   1008 C  CD  . GLU A 1 124 ? 8.012   -18.809 51.856  1.00 159.01 ? 124 GLU A CD  1 
ATOM   1009 O  OE1 . GLU A 1 124 ? 8.149   -19.150 53.050  1.00 171.31 ? 124 GLU A OE1 1 
ATOM   1010 O  OE2 . GLU A 1 124 ? 8.495   -17.762 51.390  1.00 157.57 ? 124 GLU A OE2 1 
ATOM   1011 N  N   . TYR A 1 125 ? 5.689   -23.524 52.829  1.00 114.80 ? 125 TYR A N   1 
ATOM   1012 C  CA  . TYR A 1 125 ? 4.688   -24.418 53.404  1.00 120.59 ? 125 TYR A CA  1 
ATOM   1013 C  C   . TYR A 1 125 ? 5.300   -25.407 54.387  1.00 133.14 ? 125 TYR A C   1 
ATOM   1014 O  O   . TYR A 1 125 ? 4.648   -26.359 54.832  1.00 138.46 ? 125 TYR A O   1 
ATOM   1015 C  CB  . TYR A 1 125 ? 3.940   -25.135 52.289  1.00 142.29 ? 125 TYR A CB  1 
ATOM   1016 C  CG  . TYR A 1 125 ? 3.121   -24.170 51.486  1.00 133.76 ? 125 TYR A CG  1 
ATOM   1017 C  CD1 . TYR A 1 125 ? 2.950   -24.334 50.123  1.00 122.65 ? 125 TYR A CD1 1 
ATOM   1018 C  CD2 . TYR A 1 125 ? 2.528   -23.078 52.097  1.00 139.14 ? 125 TYR A CD2 1 
ATOM   1019 C  CE1 . TYR A 1 125 ? 2.201   -23.435 49.389  1.00 117.18 ? 125 TYR A CE1 1 
ATOM   1020 C  CE2 . TYR A 1 125 ? 1.778   -22.180 51.375  1.00 133.44 ? 125 TYR A CE2 1 
ATOM   1021 C  CZ  . TYR A 1 125 ? 1.616   -22.357 50.017  1.00 122.47 ? 125 TYR A CZ  1 
ATOM   1022 O  OH  . TYR A 1 125 ? 0.867   -21.452 49.293  1.00 118.10 ? 125 TYR A OH  1 
ATOM   1023 N  N   . LYS A 1 126 ? 6.555   -25.149 54.733  1.00 105.12 ? 126 LYS A N   1 
ATOM   1024 C  CA  . LYS A 1 126 ? 7.273   -25.946 55.713  1.00 123.23 ? 126 LYS A CA  1 
ATOM   1025 C  C   . LYS A 1 126 ? 7.454   -27.364 55.183  1.00 121.25 ? 126 LYS A C   1 
ATOM   1026 O  O   . LYS A 1 126 ? 7.551   -28.321 55.952  1.00 135.67 ? 126 LYS A O   1 
ATOM   1027 C  CB  . LYS A 1 126 ? 6.564   -25.898 57.075  1.00 133.10 ? 126 LYS A CB  1 
ATOM   1028 C  CG  . LYS A 1 126 ? 6.555   -24.481 57.691  1.00 138.15 ? 126 LYS A CG  1 
ATOM   1029 C  CD  . LYS A 1 126 ? 5.957   -24.405 59.109  1.00 157.16 ? 126 LYS A CD  1 
ATOM   1030 C  CE  . LYS A 1 126 ? 6.142   -23.006 59.732  1.00 165.00 ? 126 LYS A CE  1 
ATOM   1031 N  NZ  . LYS A 1 126 ? 5.574   -22.906 61.111  1.00 184.27 ? 126 LYS A NZ  1 
ATOM   1032 N  N   . LEU A 1 127 ? 7.508   -27.473 53.852  1.00 121.96 ? 127 LEU A N   1 
ATOM   1033 C  CA  . LEU A 1 127 ? 7.711   -28.743 53.168  1.00 119.15 ? 127 LEU A CA  1 
ATOM   1034 C  C   . LEU A 1 127 ? 8.807   -28.635 52.121  1.00 114.18 ? 127 LEU A C   1 
ATOM   1035 O  O   . LEU A 1 127 ? 8.532   -28.752 50.923  1.00 100.38 ? 127 LEU A O   1 
ATOM   1036 C  CB  . LEU A 1 127 ? 6.448   -29.147 52.423  1.00 102.22 ? 127 LEU A CB  1 
ATOM   1037 C  CG  . LEU A 1 127 ? 5.080   -29.059 53.072  1.00 104.75 ? 127 LEU A CG  1 
ATOM   1038 C  CD1 . LEU A 1 127 ? 4.042   -29.705 52.166  1.00 95.99  ? 127 LEU A CD1 1 
ATOM   1039 C  CD2 . LEU A 1 127 ? 5.109   -29.738 54.422  1.00 120.89 ? 127 LEU A CD2 1 
ATOM   1040 N  N   . THR A 1 128 ? 10.046  -28.423 52.541  1.00 142.10 ? 128 THR A N   1 
ATOM   1041 C  CA  . THR A 1 128 ? 11.107  -28.248 51.562  1.00 139.13 ? 128 THR A CA  1 
ATOM   1042 C  C   . THR A 1 128 ? 11.432  -29.539 50.839  1.00 139.38 ? 128 THR A C   1 
ATOM   1043 O  O   . THR A 1 128 ? 11.225  -29.643 49.637  1.00 126.10 ? 128 THR A O   1 
ATOM   1044 C  CB  . THR A 1 128 ? 12.373  -27.705 52.184  1.00 97.20  ? 128 THR A CB  1 
ATOM   1045 O  OG1 . THR A 1 128 ? 12.227  -26.291 52.383  1.00 92.64  ? 128 THR A OG1 1 
ATOM   1046 C  CG2 . THR A 1 128 ? 13.548  -27.962 51.255  1.00 99.69  ? 128 THR A CG2 1 
ATOM   1047 N  N   . THR A 1 129 ? 11.946  -30.515 51.572  1.00 127.83 ? 129 THR A N   1 
ATOM   1048 C  CA  . THR A 1 129 ? 12.275  -31.809 50.991  1.00 129.89 ? 129 THR A CA  1 
ATOM   1049 C  C   . THR A 1 129 ? 11.214  -32.338 50.014  1.00 112.55 ? 129 THR A C   1 
ATOM   1050 O  O   . THR A 1 129 ? 11.559  -32.957 49.021  1.00 108.74 ? 129 THR A O   1 
ATOM   1051 C  CB  . THR A 1 129 ? 12.551  -32.840 52.090  1.00 105.00 ? 129 THR A CB  1 
ATOM   1052 O  OG1 . THR A 1 129 ? 13.515  -32.298 53.004  1.00 123.25 ? 129 THR A OG1 1 
ATOM   1053 C  CG2 . THR A 1 129 ? 13.060  -34.153 51.500  1.00 109.58 ? 129 THR A CG2 1 
ATOM   1054 N  N   . TYR A 1 130 ? 9.932   -32.099 50.268  1.00 126.35 ? 130 TYR A N   1 
ATOM   1055 C  CA  . TYR A 1 130 ? 8.924   -32.480 49.279  1.00 111.46 ? 130 TYR A CA  1 
ATOM   1056 C  C   . TYR A 1 130 ? 8.980   -31.571 48.062  1.00 96.94  ? 130 TYR A C   1 
ATOM   1057 O  O   . TYR A 1 130 ? 8.751   -32.007 46.927  1.00 88.64  ? 130 TYR A O   1 
ATOM   1058 C  CB  . TYR A 1 130 ? 7.523   -32.501 49.869  1.00 87.97  ? 130 TYR A CB  1 
ATOM   1059 C  CG  . TYR A 1 130 ? 7.375   -33.561 50.932  1.00 102.19 ? 130 TYR A CG  1 
ATOM   1060 C  CD1 . TYR A 1 130 ? 7.270   -33.216 52.275  1.00 113.83 ? 130 TYR A CD1 1 
ATOM   1061 C  CD2 . TYR A 1 130 ? 7.366   -34.916 50.598  1.00 105.59 ? 130 TYR A CD2 1 
ATOM   1062 C  CE1 . TYR A 1 130 ? 7.145   -34.185 53.256  1.00 128.72 ? 130 TYR A CE1 1 
ATOM   1063 C  CE2 . TYR A 1 130 ? 7.243   -35.897 51.575  1.00 119.91 ? 130 TYR A CE2 1 
ATOM   1064 C  CZ  . TYR A 1 130 ? 7.134   -35.523 52.902  1.00 131.58 ? 130 TYR A CZ  1 
ATOM   1065 O  OH  . TYR A 1 130 ? 7.011   -36.482 53.880  1.00 147.59 ? 130 TYR A OH  1 
ATOM   1066 N  N   . GLY A 1 131 ? 9.297   -30.304 48.300  1.00 110.57 ? 131 GLY A N   1 
ATOM   1067 C  CA  . GLY A 1 131 ? 9.586   -29.379 47.218  1.00 100.18 ? 131 GLY A CA  1 
ATOM   1068 C  C   . GLY A 1 131 ? 10.698  -29.860 46.297  1.00 103.14 ? 131 GLY A C   1 
ATOM   1069 O  O   . GLY A 1 131 ? 10.586  -29.763 45.073  1.00 93.92  ? 131 GLY A O   1 
ATOM   1070 N  N   . PHE A 1 132 ? 11.778  -30.375 46.884  1.00 115.95 ? 132 PHE A N   1 
ATOM   1071 C  CA  . PHE A 1 132 ? 12.922  -30.886 46.120  1.00 122.05 ? 132 PHE A CA  1 
ATOM   1072 C  C   . PHE A 1 132 ? 12.433  -31.875 45.072  1.00 115.42 ? 132 PHE A C   1 
ATOM   1073 O  O   . PHE A 1 132 ? 12.770  -31.769 43.888  1.00 111.68 ? 132 PHE A O   1 
ATOM   1074 C  CB  . PHE A 1 132 ? 13.928  -31.550 47.068  1.00 86.93  ? 132 PHE A CB  1 
ATOM   1075 C  CG  . PHE A 1 132 ? 15.080  -32.227 46.371  1.00 95.96  ? 132 PHE A CG  1 
ATOM   1076 C  CD1 . PHE A 1 132 ? 16.090  -31.480 45.774  1.00 98.61  ? 132 PHE A CD1 1 
ATOM   1077 C  CD2 . PHE A 1 132 ? 15.168  -33.615 46.337  1.00 103.30 ? 132 PHE A CD2 1 
ATOM   1078 C  CE1 . PHE A 1 132 ? 17.150  -32.104 45.140  1.00 108.77 ? 132 PHE A CE1 1 
ATOM   1079 C  CE2 . PHE A 1 132 ? 16.224  -34.237 45.708  1.00 113.19 ? 132 PHE A CE2 1 
ATOM   1080 C  CZ  . PHE A 1 132 ? 17.215  -33.483 45.107  1.00 116.11 ? 132 PHE A CZ  1 
ATOM   1081 N  N   . ILE A 1 133 ? 11.625  -32.829 45.528  1.00 105.92 ? 133 ILE A N   1 
ATOM   1082 C  CA  . ILE A 1 133 ? 10.949  -33.772 44.644  1.00 100.04 ? 133 ILE A CA  1 
ATOM   1083 C  C   . ILE A 1 133 ? 10.021  -33.091 43.594  1.00 84.55  ? 133 ILE A C   1 
ATOM   1084 O  O   . ILE A 1 133 ? 10.152  -33.329 42.372  1.00 81.44  ? 133 ILE A O   1 
ATOM   1085 C  CB  . ILE A 1 133 ? 10.204  -34.852 45.472  1.00 99.20  ? 133 ILE A CB  1 
ATOM   1086 C  CG1 . ILE A 1 133 ? 11.208  -35.751 46.178  1.00 116.21 ? 133 ILE A CG1 1 
ATOM   1087 C  CG2 . ILE A 1 133 ? 9.320   -35.732 44.598  1.00 94.41  ? 133 ILE A CG2 1 
ATOM   1088 C  CD1 . ILE A 1 133 ? 10.625  -37.092 46.537  1.00 122.74 ? 133 ILE A CD1 1 
ATOM   1089 N  N   . ALA A 1 134 ? 9.108   -32.234 44.056  1.00 121.81 ? 134 ALA A N   1 
ATOM   1090 C  CA  . ALA A 1 134 ? 8.213   -31.538 43.124  1.00 111.88 ? 134 ALA A CA  1 
ATOM   1091 C  C   . ALA A 1 134 ? 8.996   -30.877 41.999  1.00 107.79 ? 134 ALA A C   1 
ATOM   1092 O  O   . ALA A 1 134 ? 8.491   -30.734 40.892  1.00 102.42 ? 134 ALA A O   1 
ATOM   1093 C  CB  . ALA A 1 134 ? 7.356   -30.507 43.840  1.00 66.86  ? 134 ALA A CB  1 
ATOM   1094 N  N   . ALA A 1 135 ? 10.232  -30.482 42.286  1.00 82.79  ? 135 ALA A N   1 
ATOM   1095 C  CA  . ALA A 1 135 ? 11.063  -29.800 41.307  1.00 81.98  ? 135 ALA A CA  1 
ATOM   1096 C  C   . ALA A 1 135 ? 11.932  -30.740 40.435  1.00 88.46  ? 135 ALA A C   1 
ATOM   1097 O  O   . ALA A 1 135 ? 12.138  -30.485 39.238  1.00 86.21  ? 135 ALA A O   1 
ATOM   1098 C  CB  . ALA A 1 135 ? 11.905  -28.744 42.004  1.00 75.56  ? 135 ALA A CB  1 
ATOM   1099 N  N   . LEU A 1 136 ? 12.455  -31.817 41.006  1.00 99.40  ? 136 LEU A N   1 
ATOM   1100 C  CA  . LEU A 1 136 ? 13.067  -32.826 40.154  1.00 106.08 ? 136 LEU A CA  1 
ATOM   1101 C  C   . LEU A 1 136 ? 12.027  -33.201 39.111  1.00 97.70  ? 136 LEU A C   1 
ATOM   1102 O  O   . LEU A 1 136 ? 12.320  -33.202 37.922  1.00 98.58  ? 136 LEU A O   1 
ATOM   1103 C  CB  . LEU A 1 136 ? 13.520  -34.078 40.918  1.00 85.44  ? 136 LEU A CB  1 
ATOM   1104 C  CG  . LEU A 1 136 ? 14.784  -34.020 41.767  1.00 100.07 ? 136 LEU A CG  1 
ATOM   1105 C  CD1 . LEU A 1 136 ? 15.405  -35.407 41.936  1.00 115.38 ? 136 LEU A CD1 1 
ATOM   1106 C  CD2 . LEU A 1 136 ? 15.771  -33.061 41.141  1.00 102.45 ? 136 LEU A CD2 1 
ATOM   1107 N  N   . LEU A 1 137 ? 10.799  -33.481 39.547  1.00 97.50  ? 137 LEU A N   1 
ATOM   1108 C  CA  . LEU A 1 137 ? 9.756   -33.872 38.599  1.00 92.33  ? 137 LEU A CA  1 
ATOM   1109 C  C   . LEU A 1 137 ? 9.404   -32.742 37.645  1.00 84.48  ? 137 LEU A C   1 
ATOM   1110 O  O   . LEU A 1 137 ? 9.292   -32.941 36.433  1.00 84.27  ? 137 LEU A O   1 
ATOM   1111 C  CB  . LEU A 1 137 ? 8.481   -34.302 39.318  1.00 88.95  ? 137 LEU A CB  1 
ATOM   1112 C  CG  . LEU A 1 137 ? 7.346   -34.460 38.302  1.00 84.88  ? 137 LEU A CG  1 
ATOM   1113 C  CD1 . LEU A 1 137 ? 7.580   -35.684 37.470  1.00 91.08  ? 137 LEU A CD1 1 
ATOM   1114 C  CD2 . LEU A 1 137 ? 5.962   -34.496 38.946  1.00 82.53  ? 137 LEU A CD2 1 
ATOM   1115 N  N   . GLY A 1 138 ? 9.197   -31.554 38.200  1.00 98.50  ? 138 GLY A N   1 
ATOM   1116 C  CA  . GLY A 1 138 ? 8.721   -30.434 37.414  1.00 91.67  ? 138 GLY A CA  1 
ATOM   1117 C  C   . GLY A 1 138 ? 9.732   -29.966 36.391  1.00 93.14  ? 138 GLY A C   1 
ATOM   1118 O  O   . GLY A 1 138 ? 9.376   -29.295 35.438  1.00 89.56  ? 138 GLY A O   1 
ATOM   1119 N  N   . SER A 1 139 ? 11.002  -30.311 36.575  1.00 102.42 ? 139 SER A N   1 
ATOM   1120 C  CA  . SER A 1 139 ? 12.027  -29.795 35.664  1.00 106.49 ? 139 SER A CA  1 
ATOM   1121 C  C   . SER A 1 139 ? 12.297  -30.762 34.514  1.00 113.40 ? 139 SER A C   1 
ATOM   1122 O  O   . SER A 1 139 ? 13.256  -30.617 33.753  1.00 120.65 ? 139 SER A O   1 
ATOM   1123 C  CB  . SER A 1 139 ? 13.292  -29.568 36.469  1.00 75.35  ? 139 SER A CB  1 
ATOM   1124 O  OG  . SER A 1 139 ? 13.591  -30.710 37.243  1.00 81.89  ? 139 SER A OG  1 
ATOM   1125 N  N   . ILE A 1 140 ? 11.443  -31.770 34.397  1.00 100.63 ? 140 ILE A N   1 
ATOM   1126 C  CA  . ILE A 1 140 ? 11.690  -32.836 33.448  1.00 108.63 ? 140 ILE A CA  1 
ATOM   1127 C  C   . ILE A 1 140 ? 10.430  -33.233 32.697  1.00 105.77 ? 140 ILE A C   1 
ATOM   1128 O  O   . ILE A 1 140 ? 10.495  -33.601 31.522  1.00 112.98 ? 140 ILE A O   1 
ATOM   1129 C  CB  . ILE A 1 140 ? 12.265  -34.035 34.161  1.00 103.78 ? 140 ILE A CB  1 
ATOM   1130 C  CG1 . ILE A 1 140 ? 13.745  -33.827 34.386  1.00 111.77 ? 140 ILE A CG1 1 
ATOM   1131 C  CG2 . ILE A 1 140 ? 12.140  -35.240 33.318  1.00 111.50 ? 140 ILE A CG2 1 
ATOM   1132 C  CD1 . ILE A 1 140 ? 14.464  -35.140 34.623  1.00 124.54 ? 140 ILE A CD1 1 
ATOM   1133 N  N   . ALA A 1 141 ? 9.288   -33.140 33.373  1.00 112.10 ? 141 ALA A N   1 
ATOM   1134 C  CA  . ALA A 1 141 ? 7.999   -33.462 32.771  1.00 110.86 ? 141 ALA A CA  1 
ATOM   1135 C  C   . ALA A 1 141 ? 7.930   -33.127 31.280  1.00 114.74 ? 141 ALA A C   1 
ATOM   1136 O  O   . ALA A 1 141 ? 8.422   -32.088 30.837  1.00 119.68 ? 141 ALA A O   1 
ATOM   1137 C  CB  . ALA A 1 141 ? 6.894   -32.776 33.515  1.00 75.54  ? 141 ALA A CB  1 
ATOM   1138 N  N   . ASN A 1 142 ? 7.296   -34.019 30.524  1.00 87.58  ? 142 ASN A N   1 
ATOM   1139 C  CA  . ASN A 1 142 ? 7.330   -33.995 29.065  1.00 93.77  ? 142 ASN A CA  1 
ATOM   1140 C  C   . ASN A 1 142 ? 7.231   -32.600 28.460  1.00 92.46  ? 142 ASN A C   1 
ATOM   1141 O  O   . ASN A 1 142 ? 8.246   -32.045 28.080  1.00 95.84  ? 142 ASN A O   1 
ATOM   1142 C  CB  . ASN A 1 142 ? 6.276   -34.944 28.480  1.00 117.90 ? 142 ASN A CB  1 
ATOM   1143 C  CG  . ASN A 1 142 ? 6.463   -36.385 28.941  1.00 113.16 ? 142 ASN A CG  1 
ATOM   1144 O  OD1 . ASN A 1 142 ? 5.496   -37.116 29.140  1.00 111.99 ? 142 ASN A OD1 1 
ATOM   1145 N  ND2 . ASN A 1 142 ? 7.709   -36.794 29.119  1.00 112.54 ? 142 ASN A ND2 1 
ATOM   1146 N  N   . SER A 1 143 ? 6.026   -32.040 28.381  1.00 87.02  ? 143 SER A N   1 
ATOM   1147 C  CA  . SER A 1 143 ? 5.830   -30.672 27.893  1.00 86.42  ? 143 SER A CA  1 
ATOM   1148 C  C   . SER A 1 143 ? 6.987   -29.747 28.228  1.00 87.38  ? 143 SER A C   1 
ATOM   1149 O  O   . SER A 1 143 ? 7.501   -29.047 27.353  1.00 91.30  ? 143 SER A O   1 
ATOM   1150 C  CB  . SER A 1 143 ? 4.558   -30.061 28.473  1.00 82.49  ? 143 SER A CB  1 
ATOM   1151 O  OG  . SER A 1 143 ? 3.482   -30.953 28.314  1.00 87.34  ? 143 SER A OG  1 
ATOM   1152 N  N   . TYR A 1 144 ? 7.397   -29.733 29.496  1.00 75.12  ? 144 TYR A N   1 
ATOM   1153 C  CA  . TYR A 1 144 ? 8.435   -28.805 29.900  1.00 77.80  ? 144 TYR A CA  1 
ATOM   1154 C  C   . TYR A 1 144 ? 9.751   -29.130 29.203  1.00 83.03  ? 144 TYR A C   1 
ATOM   1155 O  O   . TYR A 1 144 ? 10.310  -28.275 28.516  1.00 85.76  ? 144 TYR A O   1 
ATOM   1156 C  CB  . TYR A 1 144 ? 8.592   -28.688 31.427  1.00 75.82  ? 144 TYR A CB  1 
ATOM   1157 C  CG  . TYR A 1 144 ? 9.315   -27.399 31.832  1.00 79.78  ? 144 TYR A CG  1 
ATOM   1158 C  CD1 . TYR A 1 144 ? 8.638   -26.171 31.860  1.00 78.75  ? 144 TYR A CD1 1 
ATOM   1159 C  CD2 . TYR A 1 144 ? 10.673  -27.402 32.168  1.00 86.05  ? 144 TYR A CD2 1 
ATOM   1160 C  CE1 . TYR A 1 144 ? 9.289   -24.998 32.210  1.00 83.61  ? 144 TYR A CE1 1 
ATOM   1161 C  CE2 . TYR A 1 144 ? 11.321  -26.223 32.514  1.00 91.35  ? 144 TYR A CE2 1 
ATOM   1162 C  CZ  . TYR A 1 144 ? 10.622  -25.032 32.531  1.00 89.88  ? 144 TYR A CZ  1 
ATOM   1163 O  OH  . TYR A 1 144 ? 11.258  -23.868 32.868  1.00 96.47  ? 144 TYR A OH  1 
ATOM   1164 N  N   . TYR A 1 145 ? 10.238  -30.359 29.352  1.00 84.28  ? 145 TYR A N   1 
ATOM   1165 C  CA  . TYR A 1 145 ? 11.493  -30.735 28.706  1.00 90.47  ? 145 TYR A CA  1 
ATOM   1166 C  C   . TYR A 1 145 ? 11.441  -30.325 27.244  1.00 93.31  ? 145 TYR A C   1 
ATOM   1167 O  O   . TYR A 1 145 ? 12.324  -29.629 26.739  1.00 99.68  ? 145 TYR A O   1 
ATOM   1168 C  CB  . TYR A 1 145 ? 11.747  -32.241 28.807  1.00 73.30  ? 145 TYR A CB  1 
ATOM   1169 C  CG  . TYR A 1 145 ? 12.923  -32.699 27.978  1.00 85.83  ? 145 TYR A CG  1 
ATOM   1170 C  CD1 . TYR A 1 145 ? 14.205  -32.379 28.346  1.00 92.07  ? 145 TYR A CD1 1 
ATOM   1171 C  CD2 . TYR A 1 145 ? 12.749  -33.442 26.827  1.00 93.56  ? 145 TYR A CD2 1 
ATOM   1172 C  CE1 . TYR A 1 145 ? 15.284  -32.786 27.605  1.00 105.56 ? 145 TYR A CE1 1 
ATOM   1173 C  CE2 . TYR A 1 145 ? 13.827  -33.851 26.076  1.00 106.75 ? 145 TYR A CE2 1 
ATOM   1174 C  CZ  . TYR A 1 145 ? 15.096  -33.519 26.476  1.00 112.70 ? 145 TYR A CZ  1 
ATOM   1175 O  OH  . TYR A 1 145 ? 16.201  -33.917 25.753  1.00 127.76 ? 145 TYR A OH  1 
ATOM   1176 N  N   . ASN A 1 146 ? 10.366  -30.746 26.588  1.00 71.27  ? 146 ASN A N   1 
ATOM   1177 C  CA  . ASN A 1 146 ? 10.209  -30.626 25.162  1.00 76.58  ? 146 ASN A CA  1 
ATOM   1178 C  C   . ASN A 1 146 ? 10.352  -29.237 24.662  1.00 78.03  ? 146 ASN A C   1 
ATOM   1179 O  O   . ASN A 1 146 ? 10.906  -29.040 23.577  1.00 87.33  ? 146 ASN A O   1 
ATOM   1180 C  CB  . ASN A 1 146 ? 8.862   -31.144 24.757  1.00 87.51  ? 146 ASN A CB  1 
ATOM   1181 C  CG  . ASN A 1 146 ? 8.794   -32.616 24.841  1.00 89.92  ? 146 ASN A CG  1 
ATOM   1182 O  OD1 . ASN A 1 146 ? 8.009   -33.242 24.137  1.00 93.66  ? 146 ASN A OD1 1 
ATOM   1183 N  ND2 . ASN A 1 146 ? 9.631   -33.202 25.691  1.00 89.85  ? 146 ASN A ND2 1 
ATOM   1184 N  N   . ARG A 1 147 ? 9.847   -28.275 25.433  1.00 74.79  ? 147 ARG A N   1 
ATOM   1185 C  CA  . ARG A 1 147 ? 9.867   -26.857 25.020  1.00 75.70  ? 147 ARG A CA  1 
ATOM   1186 C  C   . ARG A 1 147 ? 11.077  -26.095 25.561  1.00 77.98  ? 147 ARG A C   1 
ATOM   1187 O  O   . ARG A 1 147 ? 11.142  -24.857 25.519  1.00 79.22  ? 147 ARG A O   1 
ATOM   1188 C  CB  . ARG A 1 147 ? 8.569   -26.162 25.412  1.00 80.74  ? 147 ARG A CB  1 
ATOM   1189 C  CG  . ARG A 1 147 ? 7.352   -26.901 24.949  1.00 85.64  ? 147 ARG A CG  1 
ATOM   1190 C  CD  . ARG A 1 147 ? 6.212   -25.956 24.811  1.00 83.20  ? 147 ARG A CD  1 
ATOM   1191 N  NE  . ARG A 1 147 ? 5.770   -25.876 23.435  1.00 90.32  ? 147 ARG A NE  1 
ATOM   1192 C  CZ  . ARG A 1 147 ? 5.823   -24.768 22.716  1.00 96.95  ? 147 ARG A CZ  1 
ATOM   1193 N  NH1 . ARG A 1 147 ? 6.291   -23.663 23.254  1.00 96.29  ? 147 ARG A NH1 1 
ATOM   1194 N  NH2 . ARG A 1 147 ? 5.412   -24.761 21.463  1.00 98.05  ? 147 ARG A NH2 1 
ATOM   1195 N  N   . THR A 1 148 ? 12.053  -26.878 26.013  1.00 111.49 ? 148 THR A N   1 
ATOM   1196 C  CA  . THR A 1 148 ? 13.138  -26.394 26.825  1.00 114.56 ? 148 THR A CA  1 
ATOM   1197 C  C   . THR A 1 148 ? 14.368  -27.286 26.700  1.00 124.41 ? 148 THR A C   1 
ATOM   1198 O  O   . THR A 1 148 ? 15.242  -27.252 27.560  1.00 124.23 ? 148 THR A O   1 
ATOM   1199 C  CB  . THR A 1 148 ? 12.714  -26.450 28.277  1.00 99.60  ? 148 THR A CB  1 
ATOM   1200 O  OG1 . THR A 1 148 ? 11.432  -25.844 28.432  1.00 91.59  ? 148 THR A OG1 1 
ATOM   1201 C  CG2 . THR A 1 148 ? 13.677  -25.726 29.098  1.00 104.11 ? 148 THR A CG2 1 
ATOM   1202 N  N   . MET A 1 149 ? 14.437  -28.105 25.654  1.00 121.53 ? 149 MET A N   1 
ATOM   1203 C  CA  . MET A 1 149 ? 15.602  -28.978 25.471  1.00 134.04 ? 149 MET A CA  1 
ATOM   1204 C  C   . MET A 1 149 ? 16.852  -28.139 25.395  1.00 140.43 ? 149 MET A C   1 
ATOM   1205 O  O   . MET A 1 149 ? 16.781  -26.914 25.357  1.00 135.98 ? 149 MET A O   1 
ATOM   1206 C  CB  . MET A 1 149 ? 15.548  -29.742 24.161  1.00 104.15 ? 149 MET A CB  1 
ATOM   1207 C  CG  . MET A 1 149 ? 14.330  -30.539 23.893  1.00 100.83 ? 149 MET A CG  1 
ATOM   1208 S  SD  . MET A 1 149 ? 14.302  -30.710 22.110  1.00 114.95 ? 149 MET A SD  1 
ATOM   1209 C  CE  . MET A 1 149 ? 16.056  -30.646 21.740  1.00 124.27 ? 149 MET A CE  1 
ATOM   1210 N  N   . SER A 1 150 ? 18.002  -28.798 25.316  1.00 112.76 ? 150 SER A N   1 
ATOM   1211 C  CA  . SER A 1 150 ? 19.251  -28.074 25.176  1.00 118.09 ? 150 SER A CA  1 
ATOM   1212 C  C   . SER A 1 150 ? 19.238  -27.332 23.860  1.00 111.73 ? 150 SER A C   1 
ATOM   1213 O  O   . SER A 1 150 ? 20.113  -26.525 23.591  1.00 110.96 ? 150 SER A O   1 
ATOM   1214 C  CB  . SER A 1 150 ? 20.456  -29.014 25.237  1.00 128.48 ? 150 SER A CB  1 
ATOM   1215 O  OG  . SER A 1 150 ? 20.716  -29.447 26.561  1.00 135.26 ? 150 SER A OG  1 
ATOM   1216 N  N   . GLY A 1 151 ? 18.242  -27.601 23.035  1.00 101.19 ? 151 GLY A N   1 
ATOM   1217 C  CA  . GLY A 1 151 ? 18.236  -27.008 21.723  1.00 97.94  ? 151 GLY A CA  1 
ATOM   1218 C  C   . GLY A 1 151 ? 17.315  -25.819 21.527  1.00 88.94  ? 151 GLY A C   1 
ATOM   1219 O  O   . GLY A 1 151 ? 17.545  -25.022 20.611  1.00 87.64  ? 151 GLY A O   1 
ATOM   1220 N  N   . TYR A 1 152 ? 16.303  -25.688 22.396  1.00 103.16 ? 152 TYR A N   1 
ATOM   1221 C  CA  . TYR A 1 152 ? 15.088  -24.875 22.161  1.00 96.87  ? 152 TYR A CA  1 
ATOM   1222 C  C   . TYR A 1 152 ? 15.256  -23.378 22.365  1.00 92.25  ? 152 TYR A C   1 
ATOM   1223 O  O   . TYR A 1 152 ? 14.749  -22.827 23.326  1.00 90.42  ? 152 TYR A O   1 
ATOM   1224 C  CB  . TYR A 1 152 ? 13.961  -25.361 23.086  1.00 108.50 ? 152 TYR A CB  1 
ATOM   1225 C  CG  . TYR A 1 152 ? 12.574  -25.329 22.473  1.00 106.21 ? 152 TYR A CG  1 
ATOM   1226 C  CD1 . TYR A 1 152 ? 11.861  -26.494 22.263  1.00 110.47 ? 152 TYR A CD1 1 
ATOM   1227 C  CD2 . TYR A 1 152 ? 11.982  -24.140 22.104  1.00 101.40 ? 152 TYR A CD2 1 
ATOM   1228 C  CE1 . TYR A 1 152 ? 10.605  -26.470 21.702  1.00 109.40 ? 152 TYR A CE1 1 
ATOM   1229 C  CE2 . TYR A 1 152 ? 10.729  -24.114 21.548  1.00 100.64 ? 152 TYR A CE2 1 
ATOM   1230 C  CZ  . TYR A 1 152 ? 10.048  -25.276 21.348  1.00 104.30 ? 152 TYR A CZ  1 
ATOM   1231 O  OH  . TYR A 1 152 ? 8.803   -25.233 20.784  1.00 104.38 ? 152 TYR A OH  1 
ATOM   1232 N  N   . TYR A 1 153 ? 15.940  -22.707 21.457  1.00 98.34  ? 153 TYR A N   1 
ATOM   1233 C  CA  . TYR A 1 153 ? 16.222  -21.288 21.629  1.00 96.34  ? 153 TYR A CA  1 
ATOM   1234 C  C   . TYR A 1 153 ? 14.988  -20.425 21.253  1.00 92.50  ? 153 TYR A C   1 
ATOM   1235 O  O   . TYR A 1 153 ? 14.982  -19.697 20.263  1.00 91.36  ? 153 TYR A O   1 
ATOM   1236 C  CB  . TYR A 1 153 ? 17.511  -20.934 20.857  1.00 81.28  ? 153 TYR A CB  1 
ATOM   1237 C  CG  . TYR A 1 153 ? 17.898  -19.472 20.818  1.00 82.04  ? 153 TYR A CG  1 
ATOM   1238 C  CD1 . TYR A 1 153 ? 18.569  -18.875 21.875  1.00 83.69  ? 153 TYR A CD1 1 
ATOM   1239 C  CD2 . TYR A 1 153 ? 17.622  -18.697 19.704  1.00 83.12  ? 153 TYR A CD2 1 
ATOM   1240 C  CE1 . TYR A 1 153 ? 18.923  -17.548 21.827  1.00 86.25  ? 153 TYR A CE1 1 
ATOM   1241 C  CE2 . TYR A 1 153 ? 17.974  -17.380 19.653  1.00 86.01  ? 153 TYR A CE2 1 
ATOM   1242 C  CZ  . TYR A 1 153 ? 18.620  -16.815 20.711  1.00 87.53  ? 153 TYR A CZ  1 
ATOM   1243 O  OH  . TYR A 1 153 ? 18.960  -15.499 20.636  1.00 91.31  ? 153 TYR A OH  1 
ATOM   1244 N  N   . ASP A 1 154 ? 13.939  -20.539 22.064  1.00 89.25  ? 154 ASP A N   1 
ATOM   1245 C  CA  . ASP A 1 154 ? 12.694  -19.784 21.886  1.00 86.73  ? 154 ASP A CA  1 
ATOM   1246 C  C   . ASP A 1 154 ? 12.304  -19.210 23.254  1.00 84.97  ? 154 ASP A C   1 
ATOM   1247 O  O   . ASP A 1 154 ? 12.822  -19.616 24.305  1.00 81.85  ? 154 ASP A O   1 
ATOM   1248 C  CB  . ASP A 1 154 ? 11.606  -20.658 21.163  1.00 69.99  ? 154 ASP A CB  1 
ATOM   1249 C  CG  . ASP A 1 154 ? 10.110  -20.179 21.358  1.00 70.45  ? 154 ASP A CG  1 
ATOM   1250 O  OD1 . ASP A 1 154 ? 9.613   -19.220 20.701  1.00 70.72  ? 154 ASP A OD1 1 
ATOM   1251 O  OD2 . ASP A 1 154 ? 9.378   -20.850 22.123  1.00 71.86  ? 154 ASP A OD2 1 
ATOM   1252 N  N   . THR A 1 155 ? 11.433  -18.216 23.198  1.00 120.82 ? 155 THR A N   1 
ATOM   1253 C  CA  . THR A 1 155 ? 10.967  -17.446 24.334  1.00 110.32 ? 155 THR A CA  1 
ATOM   1254 C  C   . THR A 1 155 ? 10.553  -18.281 25.520  1.00 99.43  ? 155 THR A C   1 
ATOM   1255 O  O   . THR A 1 155 ? 10.187  -17.742 26.546  1.00 91.89  ? 155 THR A O   1 
ATOM   1256 C  CB  . THR A 1 155 ? 9.741   -16.637 23.893  1.00 96.68  ? 155 THR A CB  1 
ATOM   1257 O  OG1 . THR A 1 155 ? 10.008  -15.248 24.070  1.00 102.49 ? 155 THR A OG1 1 
ATOM   1258 C  CG2 . THR A 1 155 ? 8.480   -17.029 24.671  1.00 86.98  ? 155 THR A CG2 1 
ATOM   1259 N  N   . ASP A 1 156 ? 10.589  -19.597 25.377  1.00 92.15  ? 156 ASP A N   1 
ATOM   1260 C  CA  . ASP A 1 156 ? 9.958   -20.477 26.355  1.00 82.90  ? 156 ASP A CA  1 
ATOM   1261 C  C   . ASP A 1 156 ? 10.798  -20.760 27.586  1.00 77.72  ? 156 ASP A C   1 
ATOM   1262 O  O   . ASP A 1 156 ? 10.330  -21.371 28.517  1.00 71.30  ? 156 ASP A O   1 
ATOM   1263 C  CB  . ASP A 1 156 ? 9.538   -21.796 25.705  1.00 104.90 ? 156 ASP A CB  1 
ATOM   1264 C  CG  . ASP A 1 156 ? 8.141   -21.739 25.148  1.00 108.70 ? 156 ASP A CG  1 
ATOM   1265 O  OD1 . ASP A 1 156 ? 7.772   -20.698 24.564  1.00 112.01 ? 156 ASP A OD1 1 
ATOM   1266 O  OD2 . ASP A 1 156 ? 7.403   -22.732 25.304  1.00 109.80 ? 156 ASP A OD2 1 
ATOM   1267 N  N   . MET A 1 157 ? 12.038  -20.306 27.605  1.00 110.29 ? 157 MET A N   1 
ATOM   1268 C  CA  . MET A 1 157 ? 12.931  -20.730 28.670  1.00 109.04 ? 157 MET A CA  1 
ATOM   1269 C  C   . MET A 1 157 ? 12.644  -20.155 30.059  1.00 100.88 ? 157 MET A C   1 
ATOM   1270 O  O   . MET A 1 157 ? 13.089  -20.714 31.054  1.00 99.96  ? 157 MET A O   1 
ATOM   1271 C  CB  . MET A 1 157 ? 14.396  -20.524 28.281  1.00 79.06  ? 157 MET A CB  1 
ATOM   1272 C  CG  . MET A 1 157 ? 14.734  -19.305 27.452  1.00 84.63  ? 157 MET A CG  1 
ATOM   1273 S  SD  . MET A 1 157 ? 16.504  -19.388 27.177  1.00 98.65  ? 157 MET A SD  1 
ATOM   1274 C  CE  . MET A 1 157 ? 16.486  -19.434 25.400  1.00 106.09 ? 157 MET A CE  1 
ATOM   1275 N  N   . LEU A 1 158 ? 11.919  -19.041 30.122  1.00 104.16 ? 158 LEU A N   1 
ATOM   1276 C  CA  . LEU A 1 158 ? 11.542  -18.412 31.399  1.00 97.92  ? 158 LEU A CA  1 
ATOM   1277 C  C   . LEU A 1 158 ? 10.033  -18.212 31.509  1.00 92.38  ? 158 LEU A C   1 
ATOM   1278 O  O   . LEU A 1 158 ? 9.564   -17.516 32.407  1.00 88.66  ? 158 LEU A O   1 
ATOM   1279 C  CB  . LEU A 1 158 ? 12.194  -17.037 31.565  1.00 58.44  ? 158 LEU A CB  1 
ATOM   1280 C  CG  . LEU A 1 158 ? 13.699  -16.825 31.530  1.00 66.52  ? 158 LEU A CG  1 
ATOM   1281 C  CD1 . LEU A 1 158 ? 14.008  -15.343 31.484  1.00 69.53  ? 158 LEU A CD1 1 
ATOM   1282 C  CD2 . LEU A 1 158 ? 14.339  -17.474 32.727  1.00 67.34  ? 158 LEU A CD2 1 
ATOM   1283 N  N   . VAL A 1 159 ? 9.285   -18.807 30.584  1.00 94.88  ? 159 VAL A N   1 
ATOM   1284 C  CA  . VAL A 1 159 ? 7.848   -18.594 30.483  1.00 92.59  ? 159 VAL A CA  1 
ATOM   1285 C  C   . VAL A 1 159 ? 7.137   -19.151 31.688  1.00 86.51  ? 159 VAL A C   1 
ATOM   1286 O  O   . VAL A 1 159 ? 6.062   -18.670 32.063  1.00 84.42  ? 159 VAL A O   1 
ATOM   1287 C  CB  . VAL A 1 159 ? 7.292   -19.262 29.233  1.00 78.03  ? 159 VAL A CB  1 
ATOM   1288 C  CG1 . VAL A 1 159 ? 5.778   -19.304 29.265  1.00 77.24  ? 159 VAL A CG1 1 
ATOM   1289 C  CG2 . VAL A 1 159 ? 7.780   -18.533 28.018  1.00 85.80  ? 159 VAL A CG2 1 
ATOM   1290 N  N   . LEU A 1 160 ? 7.753   -20.160 32.297  1.00 100.29 ? 160 LEU A N   1 
ATOM   1291 C  CA  . LEU A 1 160 ? 7.225   -20.737 33.525  1.00 95.97  ? 160 LEU A CA  1 
ATOM   1292 C  C   . LEU A 1 160 ? 8.021   -20.429 34.808  1.00 94.89  ? 160 LEU A C   1 
ATOM   1293 O  O   . LEU A 1 160 ? 7.523   -20.622 35.920  1.00 92.51  ? 160 LEU A O   1 
ATOM   1294 C  CB  . LEU A 1 160 ? 7.051   -22.227 33.358  1.00 86.73  ? 160 LEU A CB  1 
ATOM   1295 C  CG  . LEU A 1 160 ? 5.716   -22.515 32.706  1.00 87.59  ? 160 LEU A CG  1 
ATOM   1296 C  CD1 . LEU A 1 160 ? 5.235   -23.869 33.154  1.00 86.80  ? 160 LEU A CD1 1 
ATOM   1297 C  CD2 . LEU A 1 160 ? 4.761   -21.489 33.155  1.00 86.09  ? 160 LEU A CD2 1 
ATOM   1298 N  N   . VAL A 1 161 ? 9.250   -19.948 34.645  1.00 99.54  ? 161 VAL A N   1 
ATOM   1299 C  CA  . VAL A 1 161 ? 10.088  -19.534 35.763  1.00 101.18 ? 161 VAL A CA  1 
ATOM   1300 C  C   . VAL A 1 161 ? 9.550   -18.240 36.363  1.00 99.25  ? 161 VAL A C   1 
ATOM   1301 O  O   . VAL A 1 161 ? 9.415   -18.106 37.576  1.00 98.86  ? 161 VAL A O   1 
ATOM   1302 C  CB  . VAL A 1 161 ? 11.554  -19.330 35.294  1.00 102.08 ? 161 VAL A CB  1 
ATOM   1303 C  CG1 . VAL A 1 161 ? 12.039  -17.927 35.616  1.00 104.65 ? 161 VAL A CG1 1 
ATOM   1304 C  CG2 . VAL A 1 161 ? 12.478  -20.394 35.887  1.00 106.41 ? 161 VAL A CG2 1 
ATOM   1305 N  N   . LEU A 1 162 ? 9.216   -17.294 35.500  1.00 119.43 ? 162 LEU A N   1 
ATOM   1306 C  CA  . LEU A 1 162 ? 8.805   -15.964 35.940  1.00 119.21 ? 162 LEU A CA  1 
ATOM   1307 C  C   . LEU A 1 162 ? 7.471   -15.881 36.737  1.00 115.76 ? 162 LEU A C   1 
ATOM   1308 O  O   . LEU A 1 162 ? 7.442   -15.326 37.846  1.00 117.51 ? 162 LEU A O   1 
ATOM   1309 C  CB  . LEU A 1 162 ? 8.841   -14.985 34.756  1.00 68.81  ? 162 LEU A CB  1 
ATOM   1310 C  CG  . LEU A 1 162 ? 10.216  -14.416 34.374  1.00 74.02  ? 162 LEU A CG  1 
ATOM   1311 C  CD1 . LEU A 1 162 ? 10.247  -14.204 32.901  1.00 78.02  ? 162 LEU A CD1 1 
ATOM   1312 C  CD2 . LEU A 1 162 ? 10.530  -13.100 35.085  1.00 76.08  ? 162 LEU A CD2 1 
ATOM   1313 N  N   . PRO A 1 163 ? 6.373   -16.444 36.202  1.00 123.12 ? 163 PRO A N   1 
ATOM   1314 C  CA  . PRO A 1 163 ? 5.127   -16.344 36.970  1.00 123.55 ? 163 PRO A CA  1 
ATOM   1315 C  C   . PRO A 1 163 ? 5.204   -17.225 38.214  1.00 124.20 ? 163 PRO A C   1 
ATOM   1316 O  O   . PRO A 1 163 ? 4.643   -16.900 39.254  1.00 126.46 ? 163 PRO A O   1 
ATOM   1317 C  CB  . PRO A 1 163 ? 4.068   -16.887 36.006  1.00 118.18 ? 163 PRO A CB  1 
ATOM   1318 C  CG  . PRO A 1 163 ? 4.819   -17.468 34.837  1.00 118.54 ? 163 PRO A CG  1 
ATOM   1319 C  CD  . PRO A 1 163 ? 6.275   -17.456 35.143  1.00 118.57 ? 163 PRO A CD  1 
ATOM   1320 N  N   . MET A 1 164 ? 5.903   -18.343 38.095  1.00 107.44 ? 164 MET A N   1 
ATOM   1321 C  CA  . MET A 1 164 ? 6.181   -19.183 39.245  1.00 109.37 ? 164 MET A CA  1 
ATOM   1322 C  C   . MET A 1 164 ? 7.033   -18.484 40.306  1.00 112.94 ? 164 MET A C   1 
ATOM   1323 O  O   . MET A 1 164 ? 7.011   -18.877 41.470  1.00 116.44 ? 164 MET A O   1 
ATOM   1324 C  CB  . MET A 1 164 ? 6.855   -20.471 38.795  1.00 100.07 ? 164 MET A CB  1 
ATOM   1325 C  CG  . MET A 1 164 ? 5.889   -21.480 38.238  1.00 99.08  ? 164 MET A CG  1 
ATOM   1326 S  SD  . MET A 1 164 ? 4.913   -22.183 39.566  1.00 100.66 ? 164 MET A SD  1 
ATOM   1327 C  CE  . MET A 1 164 ? 6.227   -22.729 40.650  1.00 102.12 ? 164 MET A CE  1 
ATOM   1328 N  N   . LEU A 1 165 ? 7.805   -17.472 39.907  1.00 106.04 ? 165 LEU A N   1 
ATOM   1329 C  CA  . LEU A 1 165 ? 8.505   -16.649 40.890  1.00 110.81 ? 165 LEU A CA  1 
ATOM   1330 C  C   . LEU A 1 165 ? 7.511   -15.695 41.508  1.00 112.22 ? 165 LEU A C   1 
ATOM   1331 O  O   . LEU A 1 165 ? 7.444   -15.544 42.734  1.00 117.17 ? 165 LEU A O   1 
ATOM   1332 C  CB  . LEU A 1 165 ? 9.664   -15.870 40.263  1.00 70.84  ? 165 LEU A CB  1 
ATOM   1333 C  CG  . LEU A 1 165 ? 11.024  -16.579 40.281  1.00 75.26  ? 165 LEU A CG  1 
ATOM   1334 C  CD1 . LEU A 1 165 ? 12.166  -15.713 39.753  1.00 80.38  ? 165 LEU A CD1 1 
ATOM   1335 C  CD2 . LEU A 1 165 ? 11.303  -17.036 41.699  1.00 80.44  ? 165 LEU A CD2 1 
ATOM   1336 N  N   . ILE A 1 166 ? 6.723   -15.066 40.645  1.00 103.59 ? 166 ILE A N   1 
ATOM   1337 C  CA  . ILE A 1 166 ? 5.676   -14.145 41.078  1.00 105.69 ? 166 ILE A CA  1 
ATOM   1338 C  C   . ILE A 1 166 ? 4.750   -14.742 42.151  1.00 108.30 ? 166 ILE A C   1 
ATOM   1339 O  O   . ILE A 1 166 ? 4.348   -14.050 43.094  1.00 113.74 ? 166 ILE A O   1 
ATOM   1340 C  CB  . ILE A 1 166 ? 4.839   -13.672 39.874  1.00 65.02  ? 166 ILE A CB  1 
ATOM   1341 C  CG1 . ILE A 1 166 ? 5.648   -12.687 39.020  1.00 65.88  ? 166 ILE A CG1 1 
ATOM   1342 C  CG2 . ILE A 1 166 ? 3.548   -13.072 40.341  1.00 67.98  ? 166 ILE A CG2 1 
ATOM   1343 C  CD1 . ILE A 1 166 ? 4.902   -12.144 37.818  1.00 65.55  ? 166 ILE A CD1 1 
ATOM   1344 N  N   . LEU A 1 167 ? 4.433   -16.025 42.008  1.00 83.94  ? 167 LEU A N   1 
ATOM   1345 C  CA  . LEU A 1 167 ? 3.527   -16.713 42.913  1.00 87.41  ? 167 LEU A CA  1 
ATOM   1346 C  C   . LEU A 1 167 ? 4.159   -17.005 44.283  1.00 92.66  ? 167 LEU A C   1 
ATOM   1347 O  O   . LEU A 1 167 ? 3.492   -16.919 45.324  1.00 98.54  ? 167 LEU A O   1 
ATOM   1348 C  CB  . LEU A 1 167 ? 3.021   -18.011 42.268  1.00 85.95  ? 167 LEU A CB  1 
ATOM   1349 C  CG  . LEU A 1 167 ? 2.264   -19.049 43.128  1.00 90.00  ? 167 LEU A CG  1 
ATOM   1350 C  CD1 . LEU A 1 167 ? 0.744   -19.039 42.923  1.00 92.38  ? 167 LEU A CD1 1 
ATOM   1351 C  CD2 . LEU A 1 167 ? 2.805   -20.439 42.854  1.00 87.86  ? 167 LEU A CD2 1 
ATOM   1352 N  N   . LEU A 1 168 ? 5.435   -17.372 44.295  1.00 122.57 ? 168 LEU A N   1 
ATOM   1353 C  CA  . LEU A 1 168 ? 6.117   -17.542 45.566  1.00 129.33 ? 168 LEU A CA  1 
ATOM   1354 C  C   . LEU A 1 168 ? 6.192   -16.197 46.217  1.00 135.03 ? 168 LEU A C   1 
ATOM   1355 O  O   . LEU A 1 168 ? 6.143   -16.080 47.427  1.00 142.95 ? 168 LEU A O   1 
ATOM   1356 C  CB  . LEU A 1 168 ? 7.532   -18.047 45.384  1.00 76.65  ? 168 LEU A CB  1 
ATOM   1357 C  CG  . LEU A 1 168 ? 8.422   -17.535 46.506  1.00 85.49  ? 168 LEU A CG  1 
ATOM   1358 C  CD1 . LEU A 1 168 ? 9.272   -18.643 47.123  1.00 91.12  ? 168 LEU A CD1 1 
ATOM   1359 C  CD2 . LEU A 1 168 ? 9.256   -16.377 45.983  1.00 85.13  ? 168 LEU A CD2 1 
ATOM   1360 N  N   . THR A 1 169 ? 6.358   -15.171 45.401  1.00 89.90  ? 169 THR A N   1 
ATOM   1361 C  CA  . THR A 1 169 ? 6.282   -13.815 45.911  1.00 95.41  ? 169 THR A CA  1 
ATOM   1362 C  C   . THR A 1 169 ? 4.945   -13.577 46.653  1.00 99.90  ? 169 THR A C   1 
ATOM   1363 O  O   . THR A 1 169 ? 4.927   -13.198 47.849  1.00 108.93 ? 169 THR A O   1 
ATOM   1364 C  CB  . THR A 1 169 ? 6.481   -12.801 44.760  1.00 80.55  ? 169 THR A CB  1 
ATOM   1365 O  OG1 . THR A 1 169 ? 7.846   -12.342 44.742  1.00 84.48  ? 169 THR A OG1 1 
ATOM   1366 C  CG2 . THR A 1 169 ? 5.533   -11.635 44.908  1.00 83.03  ? 169 THR A CG2 1 
ATOM   1367 N  N   . PHE A 1 170 ? 3.839   -13.818 45.941  1.00 92.31  ? 170 PHE A N   1 
ATOM   1368 C  CA  . PHE A 1 170 ? 2.494   -13.694 46.512  1.00 97.44  ? 170 PHE A CA  1 
ATOM   1369 C  C   . PHE A 1 170 ? 2.424   -14.396 47.847  1.00 104.97 ? 170 PHE A C   1 
ATOM   1370 O  O   . PHE A 1 170 ? 2.094   -13.788 48.867  1.00 114.00 ? 170 PHE A O   1 
ATOM   1371 C  CB  . PHE A 1 170 ? 1.425   -14.307 45.602  1.00 107.60 ? 170 PHE A CB  1 
ATOM   1372 C  CG  . PHE A 1 170 ? 1.019   -13.430 44.440  1.00 104.80 ? 170 PHE A CG  1 
ATOM   1373 C  CD1 . PHE A 1 170 ? 1.734   -12.272 44.122  1.00 103.64 ? 170 PHE A CD1 1 
ATOM   1374 C  CD2 . PHE A 1 170 ? -0.086  -13.766 43.660  1.00 104.62 ? 170 PHE A CD2 1 
ATOM   1375 C  CE1 . PHE A 1 170 ? 1.350   -11.466 43.049  1.00 102.26 ? 170 PHE A CE1 1 
ATOM   1376 C  CE2 . PHE A 1 170 ? -0.480  -12.967 42.584  1.00 103.68 ? 170 PHE A CE2 1 
ATOM   1377 C  CZ  . PHE A 1 170 ? 0.236   -11.814 42.280  1.00 102.45 ? 170 PHE A CZ  1 
ATOM   1378 N  N   . ILE A 1 171 ? 2.735   -15.687 47.839  1.00 89.44  ? 171 ILE A N   1 
ATOM   1379 C  CA  . ILE A 1 171 ? 2.624   -16.498 49.052  1.00 97.20  ? 171 ILE A CA  1 
ATOM   1380 C  C   . ILE A 1 171 ? 3.491   -15.971 50.208  1.00 106.33 ? 171 ILE A C   1 
ATOM   1381 O  O   . ILE A 1 171 ? 3.014   -15.841 51.336  1.00 116.60 ? 171 ILE A O   1 
ATOM   1382 C  CB  . ILE A 1 171 ? 2.865   -17.999 48.739  1.00 93.31  ? 171 ILE A CB  1 
ATOM   1383 C  CG1 . ILE A 1 171 ? 2.049   -18.371 47.496  1.00 86.06  ? 171 ILE A CG1 1 
ATOM   1384 C  CG2 . ILE A 1 171 ? 2.534   -18.890 49.941  1.00 102.19 ? 171 ILE A CG2 1 
ATOM   1385 C  CD1 . ILE A 1 171 ? 1.897   -19.843 47.261  1.00 83.11  ? 171 ILE A CD1 1 
ATOM   1386 N  N   . ARG A 1 172 ? 4.745   -15.634 49.924  1.00 99.76  ? 172 ARG A N   1 
ATOM   1387 C  CA  . ARG A 1 172 ? 5.633   -15.151 50.965  1.00 109.97 ? 172 ARG A CA  1 
ATOM   1388 C  C   . ARG A 1 172 ? 5.014   -13.895 51.550  1.00 118.08 ? 172 ARG A C   1 
ATOM   1389 O  O   . ARG A 1 172 ? 5.086   -13.668 52.766  1.00 130.02 ? 172 ARG A O   1 
ATOM   1390 C  CB  . ARG A 1 172 ? 7.067   -14.913 50.459  1.00 139.00 ? 172 ARG A CB  1 
ATOM   1391 C  CG  . ARG A 1 172 ? 8.114   -14.967 51.578  1.00 147.50 ? 172 ARG A CG  1 
ATOM   1392 C  CD  . ARG A 1 172 ? 9.518   -15.149 51.051  1.00 147.73 ? 172 ARG A CD  1 
ATOM   1393 N  NE  . ARG A 1 172 ? 10.360  -14.030 51.431  1.00 148.94 ? 172 ARG A NE  1 
ATOM   1394 C  CZ  . ARG A 1 172 ? 10.045  -12.760 51.178  1.00 143.27 ? 172 ARG A CZ  1 
ATOM   1395 N  NH1 . ARG A 1 172 ? 8.908   -12.476 50.553  1.00 136.07 ? 172 ARG A NH1 1 
ATOM   1396 N  NH2 . ARG A 1 172 ? 10.857  -11.765 51.541  1.00 147.42 ? 172 ARG A NH2 1 
ATOM   1397 N  N   . LEU A 1 173 ? 4.370   -13.090 50.699  1.00 95.45  ? 173 LEU A N   1 
ATOM   1398 C  CA  . LEU A 1 173 ? 3.603   -11.957 51.242  1.00 103.92 ? 173 LEU A CA  1 
ATOM   1399 C  C   . LEU A 1 173 ? 2.495   -12.424 52.161  1.00 111.74 ? 173 LEU A C   1 
ATOM   1400 O  O   . LEU A 1 173 ? 2.396   -11.935 53.269  1.00 124.00 ? 173 LEU A O   1 
ATOM   1401 C  CB  . LEU A 1 173 ? 3.000   -11.057 50.163  1.00 107.68 ? 173 LEU A CB  1 
ATOM   1402 C  CG  . LEU A 1 173 ? 2.315   -9.834  50.779  1.00 117.91 ? 173 LEU A CG  1 
ATOM   1403 C  CD1 . LEU A 1 173 ? 3.378   -8.971  51.400  1.00 125.35 ? 173 LEU A CD1 1 
ATOM   1404 C  CD2 . LEU A 1 173 ? 1.514   -9.057  49.753  1.00 113.16 ? 173 LEU A CD2 1 
ATOM   1405 N  N   . THR A 1 174 ? 1.663   -13.357 51.704  1.00 110.31 ? 174 THR A N   1 
ATOM   1406 C  CA  . THR A 1 174 ? 0.579   -13.861 52.550  1.00 118.56 ? 174 THR A CA  1 
ATOM   1407 C  C   . THR A 1 174 ? 1.071   -14.248 53.936  1.00 130.36 ? 174 THR A C   1 
ATOM   1408 O  O   . THR A 1 174 ? 0.462   -13.900 54.956  1.00 143.29 ? 174 THR A O   1 
ATOM   1409 C  CB  . THR A 1 174 ? -0.088  -15.139 52.002  1.00 109.84 ? 174 THR A CB  1 
ATOM   1410 O  OG1 . THR A 1 174 ? -0.018  -15.167 50.576  1.00 97.91  ? 174 THR A OG1 1 
ATOM   1411 C  CG2 . THR A 1 174 ? -1.546  -15.218 52.461  1.00 118.10 ? 174 THR A CG2 1 
ATOM   1412 N  N   . ILE A 1 175 ? 2.166   -14.994 53.976  1.00 124.89 ? 175 ILE A N   1 
ATOM   1413 C  CA  . ILE A 1 175 ? 2.607   -15.575 55.234  1.00 136.96 ? 175 ILE A CA  1 
ATOM   1414 C  C   . ILE A 1 175 ? 3.438   -14.627 56.090  1.00 148.66 ? 175 ILE A C   1 
ATOM   1415 O  O   . ILE A 1 175 ? 3.027   -14.263 57.195  1.00 163.26 ? 175 ILE A O   1 
ATOM   1416 C  CB  . ILE A 1 175 ? 3.341   -16.895 55.000  1.00 142.52 ? 175 ILE A CB  1 
ATOM   1417 C  CG1 . ILE A 1 175 ? 2.342   -17.931 54.477  1.00 134.11 ? 175 ILE A CG1 1 
ATOM   1418 C  CG2 . ILE A 1 175 ? 4.036   -17.348 56.277  1.00 157.78 ? 175 ILE A CG2 1 
ATOM   1419 C  CD1 . ILE A 1 175 ? 2.732   -19.361 54.745  1.00 133.97 ? 175 ILE A CD1 1 
ATOM   1420 N  N   . ASN A 1 176 ? 4.593   -14.221 55.571  1.00 132.96 ? 176 ASN A N   1 
ATOM   1421 C  CA  . ASN A 1 176 ? 5.508   -13.385 56.341  1.00 145.26 ? 176 ASN A CA  1 
ATOM   1422 C  C   . ASN A 1 176 ? 5.163   -11.903 56.314  1.00 148.10 ? 176 ASN A C   1 
ATOM   1423 O  O   . ASN A 1 176 ? 5.646   -11.144 57.148  1.00 161.70 ? 176 ASN A O   1 
ATOM   1424 C  CB  . ASN A 1 176 ? 6.950   -13.584 55.879  1.00 190.14 ? 176 ASN A CB  1 
ATOM   1425 C  CG  . ASN A 1 176 ? 7.414   -15.014 56.022  1.00 185.99 ? 176 ASN A CG  1 
ATOM   1426 O  OD1 . ASN A 1 176 ? 8.357   -15.437 55.358  1.00 176.73 ? 176 ASN A OD1 1 
ATOM   1427 N  ND2 . ASN A 1 176 ? 6.746   -15.774 56.883  1.00 193.93 ? 176 ASN A ND2 1 
ATOM   1428 N  N   . LYS A 1 177 ? 4.335   -11.500 55.354  1.00 126.70 ? 177 LYS A N   1 
ATOM   1429 C  CA  . LYS A 1 177 ? 3.922   -10.100 55.201  1.00 130.47 ? 177 LYS A CA  1 
ATOM   1430 C  C   . LYS A 1 177 ? 5.082   -9.102  55.234  1.00 132.38 ? 177 LYS A C   1 
ATOM   1431 O  O   . LYS A 1 177 ? 4.874   -7.911  55.470  1.00 139.91 ? 177 LYS A O   1 
ATOM   1432 C  CB  . LYS A 1 177 ? 2.877   -9.720  56.255  1.00 111.72 ? 177 LYS A CB  1 
ATOM   1433 C  CG  . LYS A 1 177 ? 1.716   -10.699 56.360  1.00 112.03 ? 177 LYS A CG  1 
ATOM   1434 C  CD  . LYS A 1 177 ? 0.587   -10.130 57.184  1.00 125.20 ? 177 LYS A CD  1 
ATOM   1435 C  CE  . LYS A 1 177 ? -0.551  -11.116 57.300  1.00 126.17 ? 177 LYS A CE  1 
ATOM   1436 N  NZ  . LYS A 1 177 ? -1.679  -10.486 58.031  1.00 139.64 ? 177 LYS A NZ  1 
ATOM   1437 N  N   . ASP A 1 178 ? 6.298   -9.591  54.994  1.00 211.62 ? 178 ASP A N   1 
ATOM   1438 C  CA  . ASP A 1 178 ? 7.484   -8.743  55.007  1.00 213.71 ? 178 ASP A CA  1 
ATOM   1439 C  C   . ASP A 1 178 ? 7.499   -7.873  53.763  1.00 209.07 ? 178 ASP A C   1 
ATOM   1440 O  O   . ASP A 1 178 ? 7.071   -8.295  52.691  1.00 199.56 ? 178 ASP A O   1 
ATOM   1441 C  CB  . ASP A 1 178 ? 8.760   -9.585  55.092  1.00 169.89 ? 178 ASP A CB  1 
ATOM   1442 C  CG  . ASP A 1 178 ? 9.139   -10.215 53.761  1.00 171.80 ? 178 ASP A CG  1 
ATOM   1443 O  OD1 . ASP A 1 178 ? 8.235   -10.500 52.946  1.00 176.06 ? 178 ASP A OD1 1 
ATOM   1444 O  OD2 . ASP A 1 178 ? 10.352  -10.420 53.534  1.00 169.81 ? 178 ASP A OD2 1 
ATOM   1445 N  N   . ILE A 1 179 ? 8.002   -6.656  53.908  1.00 193.10 ? 179 ILE A N   1 
ATOM   1446 C  CA  . ILE A 1 179 ? 7.887   -5.673  52.846  1.00 191.17 ? 179 ILE A CA  1 
ATOM   1447 C  C   . ILE A 1 179 ? 8.681   -5.986  51.580  1.00 181.89 ? 179 ILE A C   1 
ATOM   1448 O  O   . ILE A 1 179 ? 8.319   -5.511  50.516  1.00 177.51 ? 179 ILE A O   1 
ATOM   1449 C  CB  . ILE A 1 179 ? 8.255   -4.259  53.329  1.00 179.01 ? 179 ILE A CB  1 
ATOM   1450 C  CG1 . ILE A 1 179 ? 7.569   -3.946  54.659  1.00 189.61 ? 179 ILE A CG1 1 
ATOM   1451 C  CG2 . ILE A 1 179 ? 7.866   -3.227  52.292  1.00 178.14 ? 179 ILE A CG2 1 
ATOM   1452 C  CD1 . ILE A 1 179 ? 7.946   -2.590  55.234  1.00 202.73 ? 179 ILE A CD1 1 
ATOM   1453 N  N   . PHE A 1 180 ? 9.755   -6.762  51.657  1.00 160.29 ? 180 PHE A N   1 
ATOM   1454 C  CA  . PHE A 1 180 ? 10.526  -7.002  50.439  1.00 152.75 ? 180 PHE A CA  1 
ATOM   1455 C  C   . PHE A 1 180 ? 9.655   -7.522  49.281  1.00 142.47 ? 180 PHE A C   1 
ATOM   1456 O  O   . PHE A 1 180 ? 9.900   -7.186  48.116  1.00 137.66 ? 180 PHE A O   1 
ATOM   1457 C  CB  . PHE A 1 180 ? 11.744  -7.899  50.712  1.00 161.22 ? 180 PHE A CB  1 
ATOM   1458 C  CG  . PHE A 1 180 ? 12.918  -7.154  51.315  1.00 172.03 ? 180 PHE A CG  1 
ATOM   1459 C  CD1 . PHE A 1 180 ? 12.756  -6.386  52.465  1.00 182.22 ? 180 PHE A CD1 1 
ATOM   1460 C  CD2 . PHE A 1 180 ? 14.175  -7.201  50.719  1.00 172.10 ? 180 PHE A CD2 1 
ATOM   1461 C  CE1 . PHE A 1 180 ? 13.822  -5.690  53.007  1.00 193.72 ? 180 PHE A CE1 1 
ATOM   1462 C  CE2 . PHE A 1 180 ? 15.242  -6.507  51.262  1.00 183.36 ? 180 PHE A CE2 1 
ATOM   1463 C  CZ  . PHE A 1 180 ? 15.062  -5.751  52.405  1.00 194.57 ? 180 PHE A CZ  1 
ATOM   1464 N  N   . THR A 1 181 ? 8.623   -8.308  49.599  1.00 145.34 ? 181 THR A N   1 
ATOM   1465 C  CA  . THR A 1 181 ? 7.635   -8.751  48.598  1.00 137.98 ? 181 THR A CA  1 
ATOM   1466 C  C   . THR A 1 181 ? 7.095   -7.618  47.723  1.00 138.84 ? 181 THR A C   1 
ATOM   1467 O  O   . THR A 1 181 ? 7.050   -7.750  46.503  1.00 133.08 ? 181 THR A O   1 
ATOM   1468 C  CB  . THR A 1 181 ? 6.447   -9.512  49.232  1.00 140.97 ? 181 THR A CB  1 
ATOM   1469 O  OG1 . THR A 1 181 ? 6.809   -10.880 49.451  1.00 136.94 ? 181 THR A OG1 1 
ATOM   1470 C  CG2 . THR A 1 181 ? 5.248   -9.484  48.312  1.00 137.76 ? 181 THR A CG2 1 
ATOM   1471 N  N   . LEU A 1 182 ? 6.678   -6.519  48.348  1.00 126.10 ? 182 LEU A N   1 
ATOM   1472 C  CA  . LEU A 1 182 ? 6.221   -5.320  47.622  1.00 128.88 ? 182 LEU A CA  1 
ATOM   1473 C  C   . LEU A 1 182 ? 7.172   -4.868  46.507  1.00 126.73 ? 182 LEU A C   1 
ATOM   1474 O  O   . LEU A 1 182 ? 6.738   -4.252  45.534  1.00 127.04 ? 182 LEU A O   1 
ATOM   1475 C  CB  . LEU A 1 182 ? 6.008   -4.133  48.587  1.00 126.45 ? 182 LEU A CB  1 
ATOM   1476 C  CG  . LEU A 1 182 ? 4.776   -3.889  49.459  1.00 131.31 ? 182 LEU A CG  1 
ATOM   1477 C  CD1 . LEU A 1 182 ? 5.077   -2.702  50.334  1.00 141.95 ? 182 LEU A CD1 1 
ATOM   1478 C  CD2 . LEU A 1 182 ? 3.519   -3.656  48.622  1.00 126.13 ? 182 LEU A CD2 1 
ATOM   1479 N  N   . LEU A 1 183 ? 8.473   -5.116  46.670  1.00 114.07 ? 183 LEU A N   1 
ATOM   1480 C  CA  . LEU A 1 183 ? 9.406   -4.676  45.633  1.00 112.16 ? 183 LEU A CA  1 
ATOM   1481 C  C   . LEU A 1 183 ? 9.467   -5.722  44.536  1.00 102.75 ? 183 LEU A C   1 
ATOM   1482 O  O   . LEU A 1 183 ? 9.535   -5.396  43.342  1.00 101.14 ? 183 LEU A O   1 
ATOM   1483 C  CB  . LEU A 1 183 ? 10.801  -4.443  46.207  1.00 109.69 ? 183 LEU A CB  1 
ATOM   1484 C  CG  . LEU A 1 183 ? 11.146  -2.960  46.291  1.00 119.53 ? 183 LEU A CG  1 
ATOM   1485 C  CD1 . LEU A 1 183 ? 12.636  -2.736  46.127  1.00 123.11 ? 183 LEU A CD1 1 
ATOM   1486 C  CD2 . LEU A 1 183 ? 10.379  -2.188  45.226  1.00 120.57 ? 183 LEU A CD2 1 
ATOM   1487 N  N   . LEU A 1 184 ? 9.382   -6.982  44.962  1.00 118.31 ? 184 LEU A N   1 
ATOM   1488 C  CA  . LEU A 1 184 ? 9.604   -8.122  44.084  1.00 110.69 ? 184 LEU A CA  1 
ATOM   1489 C  C   . LEU A 1 184 ? 8.463   -8.412  43.112  1.00 106.80 ? 184 LEU A C   1 
ATOM   1490 O  O   . LEU A 1 184 ? 8.688   -8.444  41.903  1.00 104.70 ? 184 LEU A O   1 
ATOM   1491 C  CB  . LEU A 1 184 ? 10.007  -9.360  44.892  1.00 93.16  ? 184 LEU A CB  1 
ATOM   1492 C  CG  . LEU A 1 184 ? 11.287  -9.091  45.695  1.00 98.68  ? 184 LEU A CG  1 
ATOM   1493 C  CD1 . LEU A 1 184 ? 12.146  -10.328 45.890  1.00 96.54  ? 184 LEU A CD1 1 
ATOM   1494 C  CD2 . LEU A 1 184 ? 12.108  -8.027  44.998  1.00 99.82  ? 184 LEU A CD2 1 
ATOM   1495 N  N   . SER A 1 185 ? 7.243   -8.599  43.602  1.00 105.86 ? 185 SER A N   1 
ATOM   1496 C  CA  . SER A 1 185 ? 6.165   -8.951  42.673  1.00 103.86 ? 185 SER A CA  1 
ATOM   1497 C  C   . SER A 1 185 ? 5.947   -7.933  41.542  1.00 105.71 ? 185 SER A C   1 
ATOM   1498 O  O   . SER A 1 185 ? 5.755   -8.327  40.386  1.00 102.20 ? 185 SER A O   1 
ATOM   1499 C  CB  . SER A 1 185 ? 4.855   -9.269  43.390  1.00 80.70  ? 185 SER A CB  1 
ATOM   1500 O  OG  . SER A 1 185 ? 4.609   -8.304  44.371  1.00 87.92  ? 185 SER A OG  1 
ATOM   1501 N  N   . PRO A 1 186 ? 5.971   -6.621  41.859  1.00 105.77 ? 186 PRO A N   1 
ATOM   1502 C  CA  . PRO A 1 186 ? 5.835   -5.680  40.743  1.00 108.52 ? 186 PRO A CA  1 
ATOM   1503 C  C   . PRO A 1 186 ? 7.091   -5.620  39.885  1.00 106.97 ? 186 PRO A C   1 
ATOM   1504 O  O   . PRO A 1 186 ? 6.974   -5.261  38.719  1.00 108.38 ? 186 PRO A O   1 
ATOM   1505 C  CB  . PRO A 1 186 ? 5.568   -4.348  41.434  1.00 89.44  ? 186 PRO A CB  1 
ATOM   1506 C  CG  . PRO A 1 186 ? 6.142   -4.503  42.773  1.00 90.66  ? 186 PRO A CG  1 
ATOM   1507 C  CD  . PRO A 1 186 ? 5.927   -5.930  43.158  1.00 84.57  ? 186 PRO A CD  1 
ATOM   1508 N  N   . ILE A 1 187 ? 8.252   -5.981  40.434  1.00 100.13 ? 187 ILE A N   1 
ATOM   1509 C  CA  . ILE A 1 187 ? 9.444   -6.205  39.607  1.00 98.69  ? 187 ILE A CA  1 
ATOM   1510 C  C   . ILE A 1 187 ? 9.337   -7.471  38.731  1.00 92.03  ? 187 ILE A C   1 
ATOM   1511 O  O   . ILE A 1 187 ? 9.453   -7.400  37.502  1.00 92.26  ? 187 ILE A O   1 
ATOM   1512 C  CB  . ILE A 1 187 ? 10.718  -6.281  40.453  1.00 94.68  ? 187 ILE A CB  1 
ATOM   1513 C  CG1 . ILE A 1 187 ? 11.242  -4.881  40.728  1.00 102.83 ? 187 ILE A CG1 1 
ATOM   1514 C  CG2 . ILE A 1 187 ? 11.790  -7.147  39.760  1.00 91.06  ? 187 ILE A CG2 1 
ATOM   1515 C  CD1 . ILE A 1 187 ? 12.622  -4.887  41.320  1.00 106.19 ? 187 ILE A CD1 1 
ATOM   1516 N  N   . PHE A 1 188 ? 9.113   -8.624  39.347  1.00 100.08 ? 188 PHE A N   1 
ATOM   1517 C  CA  . PHE A 1 188 ? 8.906   -9.822  38.557  1.00 94.77  ? 188 PHE A CA  1 
ATOM   1518 C  C   . PHE A 1 188 ? 7.844   -9.600  37.478  1.00 95.62  ? 188 PHE A C   1 
ATOM   1519 O  O   . PHE A 1 188 ? 8.147   -9.710  36.283  1.00 95.54  ? 188 PHE A O   1 
ATOM   1520 C  CB  . PHE A 1 188 ? 8.570   -11.009 39.441  1.00 106.25 ? 188 PHE A CB  1 
ATOM   1521 C  CG  . PHE A 1 188 ? 9.747   -11.533 40.190  1.00 105.40 ? 188 PHE A CG  1 
ATOM   1522 C  CD1 . PHE A 1 188 ? 9.588   -12.420 41.241  1.00 105.58 ? 188 PHE A CD1 1 
ATOM   1523 C  CD2 . PHE A 1 188 ? 11.021  -11.132 39.841  1.00 105.78 ? 188 PHE A CD2 1 
ATOM   1524 C  CE1 . PHE A 1 188 ? 10.682  -12.899 41.920  1.00 104.53 ? 188 PHE A CE1 1 
ATOM   1525 C  CE2 . PHE A 1 188 ? 12.118  -11.610 40.515  1.00 105.32 ? 188 PHE A CE2 1 
ATOM   1526 C  CZ  . PHE A 1 188 ? 11.951  -12.492 41.555  1.00 103.70 ? 188 PHE A CZ  1 
ATOM   1527 N  N   . ILE A 1 189 ? 6.622   -9.264  37.896  1.00 103.30 ? 189 ILE A N   1 
ATOM   1528 C  CA  . ILE A 1 189 ? 5.524   -8.905  36.982  1.00 105.65 ? 189 ILE A CA  1 
ATOM   1529 C  C   . ILE A 1 189 ? 5.939   -8.011  35.804  1.00 109.99 ? 189 ILE A C   1 
ATOM   1530 O  O   . ILE A 1 189 ? 5.319   -8.052  34.734  1.00 112.61 ? 189 ILE A O   1 
ATOM   1531 C  CB  . ILE A 1 189 ? 4.420   -8.162  37.730  1.00 99.89  ? 189 ILE A CB  1 
ATOM   1532 C  CG1 . ILE A 1 189 ? 3.177   -9.019  37.848  1.00 98.10  ? 189 ILE A CG1 1 
ATOM   1533 C  CG2 . ILE A 1 189 ? 4.030   -6.931  36.971  1.00 104.95 ? 189 ILE A CG2 1 
ATOM   1534 C  CD1 . ILE A 1 189 ? 2.137   -8.693  36.802  1.00 98.84  ? 189 ILE A CD1 1 
ATOM   1535 N  N   . MET A 1 190 ? 6.969   -7.190  36.015  1.00 97.32  ? 190 MET A N   1 
ATOM   1536 C  CA  . MET A 1 190 ? 7.496   -6.316  34.965  1.00 103.71 ? 190 MET A CA  1 
ATOM   1537 C  C   . MET A 1 190 ? 8.417   -7.081  34.016  1.00 102.69 ? 190 MET A C   1 
ATOM   1538 O  O   . MET A 1 190 ? 8.215   -7.097  32.794  1.00 107.29 ? 190 MET A O   1 
ATOM   1539 C  CB  . MET A 1 190 ? 8.266   -5.143  35.582  1.00 99.55  ? 190 MET A CB  1 
ATOM   1540 C  CG  . MET A 1 190 ? 7.417   -4.080  36.273  1.00 104.43 ? 190 MET A CG  1 
ATOM   1541 S  SD  . MET A 1 190 ? 8.348   -2.547  36.512  1.00 113.42 ? 190 MET A SD  1 
ATOM   1542 C  CE  . MET A 1 190 ? 8.302   -1.883  34.849  1.00 120.88 ? 190 MET A CE  1 
ATOM   1543 N  N   . ILE A 1 191 ? 9.425   -7.719  34.601  1.00 93.17  ? 191 ILE A N   1 
ATOM   1544 C  CA  . ILE A 1 191 ? 10.346  -8.539  33.842  1.00 92.65  ? 191 ILE A CA  1 
ATOM   1545 C  C   . ILE A 1 191 ? 9.589   -9.541  32.989  1.00 90.48  ? 191 ILE A C   1 
ATOM   1546 O  O   . ILE A 1 191 ? 9.806   -9.592  31.777  1.00 94.57  ? 191 ILE A O   1 
ATOM   1547 C  CB  . ILE A 1 191 ? 11.292  -9.295  34.762  1.00 74.14  ? 191 ILE A CB  1 
ATOM   1548 C  CG1 . ILE A 1 191 ? 12.138  -8.292  35.564  1.00 78.84  ? 191 ILE A CG1 1 
ATOM   1549 C  CG2 . ILE A 1 191 ? 12.123  -10.319 33.959  1.00 72.90  ? 191 ILE A CG2 1 
ATOM   1550 C  CD1 . ILE A 1 191 ? 12.822  -8.886  36.815  1.00 76.40  ? 191 ILE A CD1 1 
ATOM   1551 N  N   . TYR A 1 192 ? 8.702   -10.329 33.610  1.00 84.77  ? 192 TYR A N   1 
ATOM   1552 C  CA  . TYR A 1 192 ? 7.838   -11.255 32.863  1.00 83.78  ? 192 TYR A CA  1 
ATOM   1553 C  C   . TYR A 1 192 ? 7.194   -10.541 31.678  1.00 91.42  ? 192 TYR A C   1 
ATOM   1554 O  O   . TYR A 1 192 ? 7.245   -11.018 30.547  1.00 94.66  ? 192 TYR A O   1 
ATOM   1555 C  CB  . TYR A 1 192 ? 6.750   -11.858 33.757  1.00 102.87 ? 192 TYR A CB  1 
ATOM   1556 C  CG  . TYR A 1 192 ? 6.061   -13.081 33.166  1.00 101.17 ? 192 TYR A CG  1 
ATOM   1557 C  CD1 . TYR A 1 192 ? 6.624   -13.783 32.124  1.00 101.97 ? 192 TYR A CD1 1 
ATOM   1558 C  CD2 . TYR A 1 192 ? 4.842   -13.530 33.652  1.00 99.87  ? 192 TYR A CD2 1 
ATOM   1559 C  CE1 . TYR A 1 192 ? 5.996   -14.901 31.578  1.00 101.50 ? 192 TYR A CE1 1 
ATOM   1560 C  CE2 . TYR A 1 192 ? 4.207   -14.640 33.107  1.00 99.40  ? 192 TYR A CE2 1 
ATOM   1561 C  CZ  . TYR A 1 192 ? 4.793   -15.322 32.068  1.00 100.20 ? 192 TYR A CZ  1 
ATOM   1562 O  OH  . TYR A 1 192 ? 4.194   -16.434 31.510  1.00 100.69 ? 192 TYR A OH  1 
ATOM   1563 N  N   . LEU A 1 193 ? 6.620   -9.371  31.946  1.00 75.32  ? 193 LEU A N   1 
ATOM   1564 C  CA  . LEU A 1 193 ? 5.918   -8.590  30.924  1.00 84.21  ? 193 LEU A CA  1 
ATOM   1565 C  C   . LEU A 1 193 ? 6.885   -8.057  29.846  1.00 91.13  ? 193 LEU A C   1 
ATOM   1566 O  O   . LEU A 1 193 ? 6.521   -7.885  28.682  1.00 99.40  ? 193 LEU A O   1 
ATOM   1567 C  CB  . LEU A 1 193 ? 5.126   -7.450  31.601  1.00 84.71  ? 193 LEU A CB  1 
ATOM   1568 C  CG  . LEU A 1 193 ? 3.644   -7.221  31.261  1.00 90.47  ? 193 LEU A CG  1 
ATOM   1569 C  CD1 . LEU A 1 193 ? 2.912   -8.530  31.115  1.00 87.13  ? 193 LEU A CD1 1 
ATOM   1570 C  CD2 . LEU A 1 193 ? 2.979   -6.370  32.318  1.00 94.07  ? 193 LEU A CD2 1 
ATOM   1571 N  N   . TRP A 1 194 ? 8.123   -7.796  30.244  1.00 117.66 ? 194 TRP A N   1 
ATOM   1572 C  CA  . TRP A 1 194 ? 9.135   -7.403  29.282  1.00 124.58 ? 194 TRP A CA  1 
ATOM   1573 C  C   . TRP A 1 194 ? 9.389   -8.550  28.357  1.00 124.97 ? 194 TRP A C   1 
ATOM   1574 O  O   . TRP A 1 194 ? 9.257   -8.434  27.140  1.00 132.38 ? 194 TRP A O   1 
ATOM   1575 C  CB  . TRP A 1 194 ? 10.461  -7.105  29.976  1.00 87.53  ? 194 TRP A CB  1 
ATOM   1576 C  CG  . TRP A 1 194 ? 11.627  -7.023  29.001  1.00 94.32  ? 194 TRP A CG  1 
ATOM   1577 C  CD1 . TRP A 1 194 ? 11.692  -6.278  27.853  1.00 104.82 ? 194 TRP A CD1 1 
ATOM   1578 C  CD2 . TRP A 1 194 ? 12.883  -7.693  29.108  1.00 89.41  ? 194 TRP A CD2 1 
ATOM   1579 N  NE1 . TRP A 1 194 ? 12.908  -6.449  27.248  1.00 106.63 ? 194 TRP A NE1 1 
ATOM   1580 C  CE2 . TRP A 1 194 ? 13.654  -7.315  28.000  1.00 97.25  ? 194 TRP A CE2 1 
ATOM   1581 C  CE3 . TRP A 1 194 ? 13.425  -8.585  30.031  1.00 79.35  ? 194 TRP A CE3 1 
ATOM   1582 C  CZ2 . TRP A 1 194 ? 14.932  -7.800  27.794  1.00 93.28  ? 194 TRP A CZ2 1 
ATOM   1583 C  CZ3 . TRP A 1 194 ? 14.693  -9.056  29.827  1.00 75.39  ? 194 TRP A CZ3 1 
ATOM   1584 C  CH2 . TRP A 1 194 ? 15.432  -8.668  28.718  1.00 82.28  ? 194 TRP A CH2 1 
ATOM   1585 N  N   . TRP A 1 195 ? 9.752   -9.663  28.981  1.00 98.64  ? 195 TRP A N   1 
ATOM   1586 C  CA  . TRP A 1 195 ? 10.427  -10.768 28.329  1.00 93.08  ? 195 TRP A CA  1 
ATOM   1587 C  C   . TRP A 1 195 ? 9.446   -11.788 27.770  1.00 90.87  ? 195 TRP A C   1 
ATOM   1588 O  O   . TRP A 1 195 ? 9.822   -12.911 27.425  1.00 83.15  ? 195 TRP A O   1 
ATOM   1589 C  CB  . TRP A 1 195 ? 11.417  -11.402 29.314  1.00 137.33 ? 195 TRP A CB  1 
ATOM   1590 C  CG  . TRP A 1 195 ? 12.101  -12.656 28.844  1.00 128.60 ? 195 TRP A CG  1 
ATOM   1591 C  CD1 . TRP A 1 195 ? 13.363  -12.784 28.311  1.00 127.33 ? 195 TRP A CD1 1 
ATOM   1592 C  CD2 . TRP A 1 195 ? 11.561  -13.957 28.898  1.00 121.40 ? 195 TRP A CD2 1 
ATOM   1593 N  NE1 . TRP A 1 195 ? 13.623  -14.097 28.025  1.00 119.63 ? 195 TRP A NE1 1 
ATOM   1594 C  CE2 . TRP A 1 195 ? 12.524  -14.835 28.377  1.00 115.74 ? 195 TRP A CE2 1 
ATOM   1595 C  CE3 . TRP A 1 195 ? 10.342  -14.469 29.330  1.00 120.70 ? 195 TRP A CE3 1 
ATOM   1596 C  CZ2 . TRP A 1 195 ? 12.305  -16.181 28.285  1.00 109.24 ? 195 TRP A CZ2 1 
ATOM   1597 C  CZ3 . TRP A 1 195 ? 10.123  -15.792 29.230  1.00 114.68 ? 195 TRP A CZ3 1 
ATOM   1598 C  CH2 . TRP A 1 195 ? 11.094  -16.644 28.718  1.00 108.66 ? 195 TRP A CH2 1 
ATOM   1599 N  N   . TYR A 1 196 ? 8.187   -11.363 27.669  1.00 88.38  ? 196 TYR A N   1 
ATOM   1600 C  CA  . TYR A 1 196 ? 7.118   -12.104 26.998  1.00 90.49  ? 196 TYR A CA  1 
ATOM   1601 C  C   . TYR A 1 196 ? 5.875   -11.225 27.000  1.00 98.36  ? 196 TYR A C   1 
ATOM   1602 O  O   . TYR A 1 196 ? 5.094   -11.246 27.953  1.00 93.33  ? 196 TYR A O   1 
ATOM   1603 C  CB  . TYR A 1 196 ? 6.826   -13.424 27.714  1.00 98.79  ? 196 TYR A CB  1 
ATOM   1604 C  CG  . TYR A 1 196 ? 5.991   -14.412 26.926  1.00 101.38 ? 196 TYR A CG  1 
ATOM   1605 C  CD1 . TYR A 1 196 ? 5.899   -15.722 27.322  1.00 95.73  ? 196 TYR A CD1 1 
ATOM   1606 C  CD2 . TYR A 1 196 ? 5.301   -14.034 25.787  1.00 110.94 ? 196 TYR A CD2 1 
ATOM   1607 C  CE1 . TYR A 1 196 ? 5.145   -16.630 26.614  1.00 99.54  ? 196 TYR A CE1 1 
ATOM   1608 C  CE2 . TYR A 1 196 ? 4.545   -14.939 25.077  1.00 114.94 ? 196 TYR A CE2 1 
ATOM   1609 C  CZ  . TYR A 1 196 ? 4.473   -16.236 25.501  1.00 107.78 ? 196 TYR A CZ  1 
ATOM   1610 O  OH  . TYR A 1 196 ? 3.723   -17.160 24.819  1.00 108.77 ? 196 TYR A OH  1 
ATOM   1611 N  N   . PRO A 1 197 ? 5.673   -10.465 25.918  1.00 87.07  ? 197 PRO A N   1 
ATOM   1612 C  CA  . PRO A 1 197 ? 4.603   -9.470  25.859  1.00 94.60  ? 197 PRO A CA  1 
ATOM   1613 C  C   . PRO A 1 197 ? 3.219   -10.069 26.126  1.00 94.80  ? 197 PRO A C   1 
ATOM   1614 O  O   . PRO A 1 197 ? 2.250   -9.356  26.407  1.00 101.21 ? 197 PRO A O   1 
ATOM   1615 C  CB  . PRO A 1 197 ? 4.668   -8.994  24.406  1.00 143.81 ? 197 PRO A CB  1 
ATOM   1616 C  CG  . PRO A 1 197 ? 5.147   -10.180 23.662  1.00 141.72 ? 197 PRO A CG  1 
ATOM   1617 C  CD  . PRO A 1 197 ? 6.201   -10.763 24.577  1.00 127.07 ? 197 PRO A CD  1 
ATOM   1618 N  N   . SER A 1 198 ? 3.125   -11.383 26.023  1.00 98.34  ? 198 SER A N   1 
ATOM   1619 C  CA  . SER A 1 198 ? 1.828   -12.002 25.920  1.00 101.70 ? 198 SER A CA  1 
ATOM   1620 C  C   . SER A 1 198 ? 1.399   -12.512 27.265  1.00 90.37  ? 198 SER A C   1 
ATOM   1621 O  O   . SER A 1 198 ? 0.244   -12.861 27.467  1.00 92.04  ? 198 SER A O   1 
ATOM   1622 C  CB  . SER A 1 198 ? 1.866   -13.112 24.879  1.00 97.64  ? 198 SER A CB  1 
ATOM   1623 O  OG  . SER A 1 198 ? 2.427   -12.635 23.670  1.00 104.57 ? 198 SER A OG  1 
ATOM   1624 N  N   . SER A 1 199 ? 2.327   -12.532 28.203  1.00 92.98  ? 199 SER A N   1 
ATOM   1625 C  CA  . SER A 1 199 ? 1.982   -12.986 29.530  1.00 84.03  ? 199 SER A CA  1 
ATOM   1626 C  C   . SER A 1 199 ? 0.970   -12.004 30.097  1.00 87.58  ? 199 SER A C   1 
ATOM   1627 O  O   . SER A 1 199 ? 0.492   -12.153 31.217  1.00 82.98  ? 199 SER A O   1 
ATOM   1628 C  CB  . SER A 1 199 ? 3.226   -13.084 30.414  1.00 80.87  ? 199 SER A CB  1 
ATOM   1629 O  OG  . SER A 1 199 ? 3.922   -11.853 30.472  1.00 83.70  ? 199 SER A OG  1 
ATOM   1630 N  N   . TYR A 1 200 ? 0.619   -11.000 29.303  1.00 98.52  ? 200 TYR A N   1 
ATOM   1631 C  CA  . TYR A 1 200 ? -0.292  -9.968  29.776  1.00 103.90 ? 200 TYR A CA  1 
ATOM   1632 C  C   . TYR A 1 200 ? -1.504  -10.538 30.502  1.00 102.60 ? 200 TYR A C   1 
ATOM   1633 O  O   . TYR A 1 200 ? -1.567  -10.495 31.730  1.00 97.33  ? 200 TYR A O   1 
ATOM   1634 C  CB  . TYR A 1 200 ? -0.750  -9.051  28.654  1.00 108.69 ? 200 TYR A CB  1 
ATOM   1635 C  CG  . TYR A 1 200 ? -1.543  -7.907  29.206  1.00 114.79 ? 200 TYR A CG  1 
ATOM   1636 C  CD1 . TYR A 1 200 ? -0.909  -6.818  29.786  1.00 113.64 ? 200 TYR A CD1 1 
ATOM   1637 C  CD2 . TYR A 1 200 ? -2.921  -7.937  29.203  1.00 122.95 ? 200 TYR A CD2 1 
ATOM   1638 C  CE1 . TYR A 1 200 ? -1.628  -5.781  30.316  1.00 119.91 ? 200 TYR A CE1 1 
ATOM   1639 C  CE2 . TYR A 1 200 ? -3.650  -6.904  29.727  1.00 129.61 ? 200 TYR A CE2 1 
ATOM   1640 C  CZ  . TYR A 1 200 ? -3.002  -5.830  30.283  1.00 127.62 ? 200 TYR A CZ  1 
ATOM   1641 O  OH  . TYR A 1 200 ? -3.741  -4.798  30.810  1.00 135.07 ? 200 TYR A OH  1 
ATOM   1642 N  N   . SER A 1 201 ? -2.456  -11.069 29.745  1.00 125.83 ? 201 SER A N   1 
ATOM   1643 C  CA  . SER A 1 201 ? -3.616  -11.703 30.341  1.00 125.56 ? 201 SER A CA  1 
ATOM   1644 C  C   . SER A 1 201 ? -3.283  -12.539 31.580  1.00 113.58 ? 201 SER A C   1 
ATOM   1645 O  O   . SER A 1 201 ? -3.872  -12.297 32.617  1.00 112.15 ? 201 SER A O   1 
ATOM   1646 C  CB  . SER A 1 201 ? -4.346  -12.536 29.313  1.00 119.38 ? 201 SER A CB  1 
ATOM   1647 O  OG  . SER A 1 201 ? -3.400  -13.169 28.491  1.00 118.44 ? 201 SER A OG  1 
ATOM   1648 N  N   . LEU A 1 202 ? -2.360  -13.503 31.485  1.00 98.59  ? 202 LEU A N   1 
ATOM   1649 C  CA  . LEU A 1 202 ? -1.937  -14.307 32.651  1.00 88.69  ? 202 LEU A CA  1 
ATOM   1650 C  C   . LEU A 1 202 ? -1.620  -13.473 33.929  1.00 84.91  ? 202 LEU A C   1 
ATOM   1651 O  O   . LEU A 1 202 ? -2.025  -13.797 35.069  1.00 81.69  ? 202 LEU A O   1 
ATOM   1652 C  CB  . LEU A 1 202 ? -0.738  -15.181 32.258  1.00 93.88  ? 202 LEU A CB  1 
ATOM   1653 C  CG  . LEU A 1 202 ? -0.030  -16.146 33.230  1.00 85.09  ? 202 LEU A CG  1 
ATOM   1654 C  CD1 . LEU A 1 202 ? 0.753   -15.452 34.386  1.00 78.84  ? 202 LEU A CD1 1 
ATOM   1655 C  CD2 . LEU A 1 202 ? -0.971  -17.214 33.770  1.00 84.81  ? 202 LEU A CD2 1 
ATOM   1656 N  N   . ASN A 1 203 ? -0.906  -12.376 33.741  1.00 105.24 ? 203 ASN A N   1 
ATOM   1657 C  CA  . ASN A 1 203 ? -0.604  -11.460 34.833  1.00 103.90 ? 203 ASN A CA  1 
ATOM   1658 C  C   . ASN A 1 203 ? -1.819  -10.738 35.362  1.00 109.88 ? 203 ASN A C   1 
ATOM   1659 O  O   . ASN A 1 203 ? -2.044  -10.624 36.588  1.00 109.90 ? 203 ASN A O   1 
ATOM   1660 C  CB  . ASN A 1 203 ? 0.390   -10.429 34.352  1.00 88.58  ? 203 ASN A CB  1 
ATOM   1661 C  CG  . ASN A 1 203 ? 1.727   -11.041 34.038  1.00 82.93  ? 203 ASN A CG  1 
ATOM   1662 O  OD1 . ASN A 1 203 ? 2.306   -11.727 34.885  1.00 76.02  ? 203 ASN A OD1 1 
ATOM   1663 N  ND2 . ASN A 1 203 ? 2.224   -10.820 32.816  1.00 87.01  ? 203 ASN A ND2 1 
ATOM   1664 N  N   . PHE A 1 204 ? -2.600  -10.229 34.425  1.00 91.63  ? 204 PHE A N   1 
ATOM   1665 C  CA  . PHE A 1 204 ? -3.858  -9.614  34.775  1.00 98.67  ? 204 PHE A CA  1 
ATOM   1666 C  C   . PHE A 1 204 ? -4.581  -10.535 35.730  1.00 95.08  ? 204 PHE A C   1 
ATOM   1667 O  O   . PHE A 1 204 ? -4.767  -10.205 36.879  1.00 94.24  ? 204 PHE A O   1 
ATOM   1668 C  CB  . PHE A 1 204 ? -4.732  -9.376  33.551  1.00 84.77  ? 204 PHE A CB  1 
ATOM   1669 C  CG  . PHE A 1 204 ? -5.942  -8.545  33.841  1.00 94.98  ? 204 PHE A CG  1 
ATOM   1670 C  CD1 . PHE A 1 204 ? -5.850  -7.158  33.912  1.00 101.17 ? 204 PHE A CD1 1 
ATOM   1671 C  CD2 . PHE A 1 204 ? -7.168  -9.144  34.064  1.00 99.64  ? 204 PHE A CD2 1 
ATOM   1672 C  CE1 . PHE A 1 204 ? -6.971  -6.389  34.180  1.00 111.86 ? 204 PHE A CE1 1 
ATOM   1673 C  CE2 . PHE A 1 204 ? -8.289  -8.379  34.330  1.00 111.02 ? 204 PHE A CE2 1 
ATOM   1674 C  CZ  . PHE A 1 204 ? -8.191  -7.001  34.389  1.00 117.02 ? 204 PHE A CZ  1 
ATOM   1675 N  N   . ALA A 1 205 ? -4.968  -11.698 35.230  1.00 117.75 ? 205 ALA A N   1 
ATOM   1676 C  CA  . ALA A 1 205 ? -5.594  -12.766 35.996  1.00 115.79 ? 205 ALA A CA  1 
ATOM   1677 C  C   . ALA A 1 205 ? -4.978  -13.057 37.372  1.00 110.19 ? 205 ALA A C   1 
ATOM   1678 O  O   . ALA A 1 205 ? -5.689  -13.046 38.388  1.00 113.40 ? 205 ALA A O   1 
ATOM   1679 C  CB  . ALA A 1 205 ? -5.623  -14.013 35.165  1.00 64.00  ? 205 ALA A CB  1 
ATOM   1680 N  N   . MET A 1 206 ? -3.678  -13.353 37.419  1.00 119.42 ? 206 MET A N   1 
ATOM   1681 C  CA  . MET A 1 206 ? -3.076  -13.590 38.739  1.00 116.66 ? 206 MET A CA  1 
ATOM   1682 C  C   . MET A 1 206 ? -3.264  -12.432 39.715  1.00 121.40 ? 206 MET A C   1 
ATOM   1683 O  O   . MET A 1 206 ? -3.472  -12.643 40.923  1.00 122.94 ? 206 MET A O   1 
ATOM   1684 C  CB  . MET A 1 206 ? -1.606  -13.912 38.593  1.00 112.32 ? 206 MET A CB  1 
ATOM   1685 C  CG  . MET A 1 206 ? -1.371  -15.321 38.195  1.00 107.87 ? 206 MET A CG  1 
ATOM   1686 S  SD  . MET A 1 206 ? 0.373   -15.606 38.095  1.00 100.57 ? 206 MET A SD  1 
ATOM   1687 C  CE  . MET A 1 206 ? 0.882   -15.252 39.775  1.00 100.61 ? 206 MET A CE  1 
ATOM   1688 N  N   . ILE A 1 207 ? -3.198  -11.204 39.195  1.00 86.03  ? 207 ILE A N   1 
ATOM   1689 C  CA  . ILE A 1 207 ? -3.496  -10.029 40.025  1.00 92.49  ? 207 ILE A CA  1 
ATOM   1690 C  C   . ILE A 1 207 ? -4.969  -9.953  40.461  1.00 99.69  ? 207 ILE A C   1 
ATOM   1691 O  O   . ILE A 1 207 ? -5.242  -9.739  41.632  1.00 104.14 ? 207 ILE A O   1 
ATOM   1692 C  CB  . ILE A 1 207 ? -3.061  -8.738  39.321  1.00 68.56  ? 207 ILE A CB  1 
ATOM   1693 C  CG1 . ILE A 1 207 ? -1.594  -8.863  38.908  1.00 63.20  ? 207 ILE A CG1 1 
ATOM   1694 C  CG2 . ILE A 1 207 ? -3.294  -7.544  40.194  1.00 75.49  ? 207 ILE A CG2 1 
ATOM   1695 C  CD1 . ILE A 1 207 ? -0.970  -7.563  38.508  1.00 65.35  ? 207 ILE A CD1 1 
ATOM   1696 N  N   . GLY A 1 208 ? -5.909  -10.153 39.541  1.00 97.03  ? 208 GLY A N   1 
ATOM   1697 C  CA  . GLY A 1 208 ? -7.312  -10.208 39.890  1.00 103.54 ? 208 GLY A CA  1 
ATOM   1698 C  C   . GLY A 1 208 ? -7.487  -11.155 41.059  1.00 103.31 ? 208 GLY A C   1 
ATOM   1699 O  O   . GLY A 1 208 ? -7.991  -10.780 42.147  1.00 109.23 ? 208 GLY A O   1 
ATOM   1700 N  N   . LEU A 1 209 ? -7.070  -12.398 40.854  1.00 112.16 ? 209 LEU A N   1 
ATOM   1701 C  CA  . LEU A 1 209 ? -7.170  -13.374 41.914  1.00 112.41 ? 209 LEU A CA  1 
ATOM   1702 C  C   . LEU A 1 209 ? -6.604  -12.761 43.174  1.00 113.97 ? 209 LEU A C   1 
ATOM   1703 O  O   . LEU A 1 209 ? -7.337  -12.619 44.127  1.00 121.18 ? 209 LEU A O   1 
ATOM   1704 C  CB  . LEU A 1 209 ? -6.412  -14.644 41.578  1.00 75.61  ? 209 LEU A CB  1 
ATOM   1705 C  CG  . LEU A 1 209 ? -7.128  -15.838 42.177  1.00 76.81  ? 209 LEU A CG  1 
ATOM   1706 C  CD1 . LEU A 1 209 ? -8.493  -15.961 41.514  1.00 77.88  ? 209 LEU A CD1 1 
ATOM   1707 C  CD2 . LEU A 1 209 ? -6.326  -17.151 42.048  1.00 79.01  ? 209 LEU A CD2 1 
ATOM   1708 N  N   . PHE A 1 210 ? -5.317  -12.390 43.152  1.00 102.86 ? 210 PHE A N   1 
ATOM   1709 C  CA  . PHE A 1 210 ? -4.664  -11.849 44.346  1.00 104.50 ? 210 PHE A CA  1 
ATOM   1710 C  C   . PHE A 1 210 ? -5.483  -10.783 45.093  1.00 114.07 ? 210 PHE A C   1 
ATOM   1711 O  O   . PHE A 1 210 ? -5.394  -10.629 46.325  1.00 118.35 ? 210 PHE A O   1 
ATOM   1712 C  CB  . PHE A 1 210 ? -3.310  -11.283 43.988  1.00 105.58 ? 210 PHE A CB  1 
ATOM   1713 C  CG  . PHE A 1 210 ? -2.535  -10.846 45.175  1.00 107.04 ? 210 PHE A CG  1 
ATOM   1714 C  CD1 . PHE A 1 210 ? -1.951  -11.786 46.005  1.00 104.06 ? 210 PHE A CD1 1 
ATOM   1715 C  CD2 . PHE A 1 210 ? -2.403  -9.496  45.483  1.00 112.55 ? 210 PHE A CD2 1 
ATOM   1716 C  CE1 . PHE A 1 210 ? -1.242  -11.391 47.112  1.00 106.64 ? 210 PHE A CE1 1 
ATOM   1717 C  CE2 . PHE A 1 210 ? -1.687  -9.094  46.590  1.00 115.03 ? 210 PHE A CE2 1 
ATOM   1718 C  CZ  . PHE A 1 210 ? -1.108  -10.040 47.410  1.00 112.19 ? 210 PHE A CZ  1 
ATOM   1719 N  N   . GLY A 1 211 ? -6.266  -10.033 44.329  1.00 88.83  ? 211 GLY A N   1 
ATOM   1720 C  CA  . GLY A 1 211 ? -7.150  -9.026  44.880  1.00 98.92  ? 211 GLY A CA  1 
ATOM   1721 C  C   . GLY A 1 211 ? -8.399  -9.602  45.521  1.00 105.16 ? 211 GLY A C   1 
ATOM   1722 O  O   . GLY A 1 211 ? -8.678  -9.282  46.655  1.00 110.60 ? 211 GLY A O   1 
ATOM   1723 N  N   . LEU A 1 212 ? -9.152  -10.431 44.790  1.00 121.09 ? 212 LEU A N   1 
ATOM   1724 C  CA  . LEU A 1 212 ? -10.383 -10.998 45.375  1.00 128.12 ? 212 LEU A CA  1 
ATOM   1725 C  C   . LEU A 1 212 ? -10.012 -11.762 46.635  1.00 127.34 ? 212 LEU A C   1 
ATOM   1726 O  O   . LEU A 1 212 ? -10.770 -11.816 47.611  1.00 135.97 ? 212 LEU A O   1 
ATOM   1727 C  CB  . LEU A 1 212 ? -11.119 -11.920 44.408  1.00 104.84 ? 212 LEU A CB  1 
ATOM   1728 C  CG  . LEU A 1 212 ? -11.476 -11.487 42.980  1.00 105.13 ? 212 LEU A CG  1 
ATOM   1729 C  CD1 . LEU A 1 212 ? -12.673 -12.297 42.509  1.00 110.65 ? 212 LEU A CD1 1 
ATOM   1730 C  CD2 . LEU A 1 212 ? -11.734 -9.956  42.741  1.00 112.07 ? 212 LEU A CD2 1 
ATOM   1731 N  N   . TYR A 1 213 ? -8.813  -12.323 46.601  1.00 128.44 ? 213 TYR A N   1 
ATOM   1732 C  CA  . TYR A 1 213 ? -8.245  -13.092 47.693  1.00 127.08 ? 213 TYR A CA  1 
ATOM   1733 C  C   . TYR A 1 213 ? -7.877  -12.175 48.853  1.00 132.66 ? 213 TYR A C   1 
ATOM   1734 O  O   . TYR A 1 213 ? -8.212  -12.462 50.003  1.00 138.99 ? 213 TYR A O   1 
ATOM   1735 C  CB  . TYR A 1 213 ? -7.012  -13.856 47.208  1.00 129.50 ? 213 TYR A CB  1 
ATOM   1736 C  CG  . TYR A 1 213 ? -6.207  -14.552 48.278  1.00 127.63 ? 213 TYR A CG  1 
ATOM   1737 C  CD1 . TYR A 1 213 ? -6.337  -15.918 48.497  1.00 126.12 ? 213 TYR A CD1 1 
ATOM   1738 C  CD2 . TYR A 1 213 ? -5.286  -13.849 49.035  1.00 128.14 ? 213 TYR A CD2 1 
ATOM   1739 C  CE1 . TYR A 1 213 ? -5.591  -16.551 49.450  1.00 125.28 ? 213 TYR A CE1 1 
ATOM   1740 C  CE2 . TYR A 1 213 ? -4.538  -14.475 49.993  1.00 127.45 ? 213 TYR A CE2 1 
ATOM   1741 C  CZ  . TYR A 1 213 ? -4.691  -15.820 50.200  1.00 126.00 ? 213 TYR A CZ  1 
ATOM   1742 O  OH  . TYR A 1 213 ? -3.927  -16.414 51.174  1.00 126.35 ? 213 TYR A OH  1 
ATOM   1743 N  N   . THR A 1 214 ? -7.201  -11.064 48.554  1.00 107.62 ? 214 THR A N   1 
ATOM   1744 C  CA  . THR A 1 214 ? -6.988  -10.024 49.578  1.00 115.12 ? 214 THR A CA  1 
ATOM   1745 C  C   . THR A 1 214 ? -8.303  -9.610  50.251  1.00 127.24 ? 214 THR A C   1 
ATOM   1746 O  O   . THR A 1 214 ? -8.353  -9.401  51.456  1.00 135.93 ? 214 THR A O   1 
ATOM   1747 C  CB  . THR A 1 214 ? -6.314  -8.755  49.000  1.00 126.47 ? 214 THR A CB  1 
ATOM   1748 O  OG1 . THR A 1 214 ? -4.893  -8.881  49.105  1.00 118.35 ? 214 THR A OG1 1 
ATOM   1749 C  CG2 . THR A 1 214 ? -6.743  -7.513  49.765  1.00 137.28 ? 214 THR A CG2 1 
ATOM   1750 N  N   . LEU A 1 215 ? -9.363  -9.504  49.461  1.00 117.47 ? 215 LEU A N   1 
ATOM   1751 C  CA  . LEU A 1 215 ? -10.689 -9.141  49.936  1.00 129.65 ? 215 LEU A CA  1 
ATOM   1752 C  C   . LEU A 1 215 ? -11.273 -10.198 50.838  1.00 134.49 ? 215 LEU A C   1 
ATOM   1753 O  O   . LEU A 1 215 ? -11.876 -9.890  51.852  1.00 145.31 ? 215 LEU A O   1 
ATOM   1754 C  CB  . LEU A 1 215 ? -11.646 -8.904  48.763  1.00 110.56 ? 215 LEU A CB  1 
ATOM   1755 C  CG  . LEU A 1 215 ? -11.412 -7.592  47.995  1.00 111.48 ? 215 LEU A CG  1 
ATOM   1756 C  CD1 . LEU A 1 215 ? -12.757 -7.018  47.585  1.00 121.34 ? 215 LEU A CD1 1 
ATOM   1757 C  CD2 . LEU A 1 215 ? -10.595 -6.597  48.824  1.00 115.15 ? 215 LEU A CD2 1 
ATOM   1758 N  N   . VAL A 1 216 ? -11.114 -11.455 50.472  1.00 120.36 ? 216 VAL A N   1 
ATOM   1759 C  CA  . VAL A 1 216 ? -11.579 -12.494 51.369  1.00 125.75 ? 216 VAL A CA  1 
ATOM   1760 C  C   . VAL A 1 216 ? -10.675 -12.596 52.590  1.00 126.53 ? 216 VAL A C   1 
ATOM   1761 O  O   . VAL A 1 216 ? -10.975 -12.039 53.646  1.00 135.31 ? 216 VAL A O   1 
ATOM   1762 C  CB  . VAL A 1 216 ? -11.674 -13.874 50.724  1.00 103.53 ? 216 VAL A CB  1 
ATOM   1763 C  CG1 . VAL A 1 216 ? -11.936 -14.912 51.804  1.00 107.08 ? 216 VAL A CG1 1 
ATOM   1764 C  CG2 . VAL A 1 216 ? -12.782 -13.893 49.686  1.00 108.78 ? 216 VAL A CG2 1 
ATOM   1765 N  N   . PHE A 1 217 ? -9.559  -13.291 52.434  1.00 112.25 ? 217 PHE A N   1 
ATOM   1766 C  CA  . PHE A 1 217 ? -8.698  -13.630 53.550  1.00 113.63 ? 217 PHE A CA  1 
ATOM   1767 C  C   . PHE A 1 217 ? -7.972  -12.471 54.216  1.00 119.07 ? 217 PHE A C   1 
ATOM   1768 O  O   . PHE A 1 217 ? -7.322  -12.642 55.250  1.00 124.73 ? 217 PHE A O   1 
ATOM   1769 C  CB  . PHE A 1 217 ? -7.735  -14.691 53.088  1.00 127.30 ? 217 PHE A CB  1 
ATOM   1770 C  CG  . PHE A 1 217 ? -8.431  -15.876 52.561  1.00 126.96 ? 217 PHE A CG  1 
ATOM   1771 C  CD1 . PHE A 1 217 ? -9.049  -15.827 51.325  1.00 123.83 ? 217 PHE A CD1 1 
ATOM   1772 C  CD2 . PHE A 1 217 ? -8.534  -17.020 53.318  1.00 131.27 ? 217 PHE A CD2 1 
ATOM   1773 C  CE1 . PHE A 1 217 ? -9.736  -16.920 50.827  1.00 124.83 ? 217 PHE A CE1 1 
ATOM   1774 C  CE2 . PHE A 1 217 ? -9.208  -18.110 52.833  1.00 132.03 ? 217 PHE A CE2 1 
ATOM   1775 C  CZ  . PHE A 1 217 ? -9.815  -18.063 51.578  1.00 128.83 ? 217 PHE A CZ  1 
ATOM   1776 N  N   . HIS A 1 218 ? -8.113  -11.283 53.650  1.00 148.32 ? 218 HIS A N   1 
ATOM   1777 C  CA  . HIS A 1 218 ? -7.320  -10.172 54.123  1.00 154.61 ? 218 HIS A CA  1 
ATOM   1778 C  C   . HIS A 1 218 ? -7.965  -8.806  53.972  1.00 160.08 ? 218 HIS A C   1 
ATOM   1779 O  O   . HIS A 1 218 ? -7.245  -7.829  53.790  1.00 161.79 ? 218 HIS A O   1 
ATOM   1780 C  CB  . HIS A 1 218 ? -5.969  -10.161 53.397  1.00 163.23 ? 218 HIS A CB  1 
ATOM   1781 C  CG  . HIS A 1 218 ? -5.097  -11.327 53.729  1.00 160.02 ? 218 HIS A CG  1 
ATOM   1782 N  ND1 . HIS A 1 218 ? -4.315  -11.375 54.866  1.00 165.20 ? 218 HIS A ND1 1 
ATOM   1783 C  CD2 . HIS A 1 218 ? -4.879  -12.496 53.080  1.00 153.18 ? 218 HIS A CD2 1 
ATOM   1784 C  CE1 . HIS A 1 218 ? -3.659  -12.517 54.900  1.00 161.53 ? 218 HIS A CE1 1 
ATOM   1785 N  NE2 . HIS A 1 218 ? -3.979  -13.219 53.825  1.00 154.24 ? 218 HIS A NE2 1 
ATOM   1786 N  N   . ARG A 1 219 ? -9.288  -8.690  54.052  1.00 142.81 ? 219 ARG A N   1 
ATOM   1787 C  CA  . ARG A 1 219 ? -9.854  -7.375  53.742  1.00 142.09 ? 219 ARG A CA  1 
ATOM   1788 C  C   . ARG A 1 219 ? -9.437  -6.254  54.698  1.00 140.87 ? 219 ARG A C   1 
ATOM   1789 O  O   . ARG A 1 219 ? -9.819  -5.108  54.503  1.00 136.93 ? 219 ARG A O   1 
ATOM   1790 C  CB  . ARG A 1 219 ? -11.364 -7.385  53.451  1.00 177.28 ? 219 ARG A CB  1 
ATOM   1791 C  CG  . ARG A 1 219 ? -12.272 -8.023  54.466  1.00 178.77 ? 219 ARG A CG  1 
ATOM   1792 C  CD  . ARG A 1 219 ? -13.686 -8.061  53.883  1.00 184.75 ? 219 ARG A CD  1 
ATOM   1793 N  NE  . ARG A 1 219 ? -14.577 -9.000  54.567  1.00 191.03 ? 219 ARG A NE  1 
ATOM   1794 C  CZ  . ARG A 1 219 ? -15.598 -9.630  53.988  1.00 198.56 ? 219 ARG A CZ  1 
ATOM   1795 N  NH1 . ARG A 1 219 ? -15.864 -9.438  52.702  1.00 200.14 ? 219 ARG A NH1 1 
ATOM   1796 N  NH2 . ARG A 1 219 ? -16.356 -10.461 54.694  1.00 205.39 ? 219 ARG A NH2 1 
ATOM   1797 N  N   . LYS A 1 220 ? -8.612  -6.580  55.691  1.00 132.99 ? 220 LYS A N   1 
ATOM   1798 C  CA  . LYS A 1 220 ? -8.186  -5.610  56.703  1.00 133.43 ? 220 LYS A CA  1 
ATOM   1799 C  C   . LYS A 1 220 ? -6.719  -5.204  56.598  1.00 129.51 ? 220 LYS A C   1 
ATOM   1800 O  O   . LYS A 1 220 ? -6.377  -4.069  56.929  1.00 127.49 ? 220 LYS A O   1 
ATOM   1801 C  CB  . LYS A 1 220 ? -8.443  -6.145  58.113  1.00 177.62 ? 220 LYS A CB  1 
ATOM   1802 C  CG  . LYS A 1 220 ? -9.772  -5.740  58.715  1.00 183.21 ? 220 LYS A CG  1 
ATOM   1803 C  CD  . LYS A 1 220 ? -10.113 -6.648  59.896  1.00 190.54 ? 220 LYS A CD  1 
ATOM   1804 C  CE  . LYS A 1 220 ? -11.474 -6.325  60.513  1.00 196.49 ? 220 LYS A CE  1 
ATOM   1805 N  NZ  . LYS A 1 220 ? -11.843 -7.303  61.583  1.00 204.12 ? 220 LYS A NZ  1 
ATOM   1806 N  N   . GLU A 1 221 ? -5.856  -6.125  56.153  1.00 141.62 ? 221 GLU A N   1 
ATOM   1807 C  CA  . GLU A 1 221 ? -4.395  -5.927  56.200  1.00 139.57 ? 221 GLU A CA  1 
ATOM   1808 C  C   . GLU A 1 221 ? -3.949  -4.806  55.274  1.00 134.39 ? 221 GLU A C   1 
ATOM   1809 O  O   . GLU A 1 221 ? -4.513  -4.622  54.201  1.00 131.97 ? 221 GLU A O   1 
ATOM   1810 C  CB  . GLU A 1 221 ? -3.630  -7.217  55.869  1.00 191.98 ? 221 GLU A CB  1 
ATOM   1811 C  CG  . GLU A 1 221 ? -3.673  -8.306  56.939  1.00 198.17 ? 221 GLU A CG  1 
ATOM   1812 C  CD  . GLU A 1 221 ? -4.852  -9.253  56.768  1.00 199.41 ? 221 GLU A CD  1 
ATOM   1813 O  OE1 . GLU A 1 221 ? -5.732  -8.961  55.937  1.00 195.29 ? 221 GLU A OE1 1 
ATOM   1814 O  OE2 . GLU A 1 221 ? -4.904  -10.293 57.460  1.00 204.98 ? 221 GLU A OE2 1 
ATOM   1815 N  N   . LYS A 1 222 ? -2.934  -4.056  55.686  1.00 145.55 ? 222 LYS A N   1 
ATOM   1816 C  CA  . LYS A 1 222 ? -2.526  -2.884  54.914  1.00 142.02 ? 222 LYS A CA  1 
ATOM   1817 C  C   . LYS A 1 222 ? -1.678  -3.251  53.716  1.00 141.33 ? 222 LYS A C   1 
ATOM   1818 O  O   . LYS A 1 222 ? -2.113  -3.084  52.573  1.00 138.91 ? 222 LYS A O   1 
ATOM   1819 C  CB  . LYS A 1 222 ? -1.806  -1.851  55.793  1.00 136.65 ? 222 LYS A CB  1 
ATOM   1820 C  CG  . LYS A 1 222 ? -2.652  -0.606  56.080  1.00 136.54 ? 222 LYS A CG  1 
ATOM   1821 C  CD  . LYS A 1 222 ? -2.338  0.000   57.433  1.00 138.08 ? 222 LYS A CD  1 
ATOM   1822 C  CE  . LYS A 1 222 ? -3.456  0.929   57.844  1.00 137.78 ? 222 LYS A CE  1 
ATOM   1823 N  NZ  . LYS A 1 222 ? -3.326  1.390   59.249  1.00 139.46 ? 222 LYS A NZ  1 
ATOM   1824 N  N   . ILE A 1 223 ? -0.476  -3.753  53.991  1.00 157.77 ? 223 ILE A N   1 
ATOM   1825 C  CA  . ILE A 1 223 ? 0.476   -4.097  52.944  1.00 157.99 ? 223 ILE A CA  1 
ATOM   1826 C  C   . ILE A 1 223 ? -0.221  -4.574  51.676  1.00 156.37 ? 223 ILE A C   1 
ATOM   1827 O  O   . ILE A 1 223 ? 0.194   -4.234  50.571  1.00 155.61 ? 223 ILE A O   1 
ATOM   1828 C  CB  . ILE A 1 223 ? 1.476   -5.178  53.398  1.00 112.23 ? 223 ILE A CB  1 
ATOM   1829 C  CG1 . ILE A 1 223 ? 2.520   -4.591  54.348  1.00 114.45 ? 223 ILE A CG1 1 
ATOM   1830 C  CG2 . ILE A 1 223 ? 2.193   -5.726  52.207  1.00 112.51 ? 223 ILE A CG2 1 
ATOM   1831 C  CD1 . ILE A 1 223 ? 3.957   -4.825  53.903  1.00 117.62 ? 223 ILE A CD1 1 
ATOM   1832 N  N   . PHE A 1 224 ? -1.294  -5.339  51.851  1.00 128.85 ? 224 PHE A N   1 
ATOM   1833 C  CA  . PHE A 1 224 ? -1.989  -5.969  50.731  1.00 128.17 ? 224 PHE A CA  1 
ATOM   1834 C  C   . PHE A 1 224 ? -2.586  -5.056  49.658  1.00 125.05 ? 224 PHE A C   1 
ATOM   1835 O  O   . PHE A 1 224 ? -2.427  -5.311  48.469  1.00 125.01 ? 224 PHE A O   1 
ATOM   1836 C  CB  . PHE A 1 224 ? -3.033  -6.942  51.252  1.00 127.22 ? 224 PHE A CB  1 
ATOM   1837 C  CG  . PHE A 1 224 ? -2.436  -8.168  51.850  1.00 130.98 ? 224 PHE A CG  1 
ATOM   1838 C  CD1 . PHE A 1 224 ? -1.503  -8.068  52.867  1.00 132.84 ? 224 PHE A CD1 1 
ATOM   1839 C  CD2 . PHE A 1 224 ? -2.782  -9.420  51.387  1.00 133.13 ? 224 PHE A CD2 1 
ATOM   1840 C  CE1 . PHE A 1 224 ? -0.945  -9.191  53.422  1.00 136.85 ? 224 PHE A CE1 1 
ATOM   1841 C  CE2 . PHE A 1 224 ? -2.223  -10.544 51.939  1.00 137.02 ? 224 PHE A CE2 1 
ATOM   1842 C  CZ  . PHE A 1 224 ? -1.305  -10.430 52.959  1.00 138.89 ? 224 PHE A CZ  1 
ATOM   1843 N  N   . TYR A 1 225 ? -3.271  -3.998  50.052  1.00 148.60 ? 225 TYR A N   1 
ATOM   1844 C  CA  . TYR A 1 225 ? -3.831  -3.115  49.042  1.00 146.19 ? 225 TYR A CA  1 
ATOM   1845 C  C   . TYR A 1 225 ? -2.730  -2.342  48.334  1.00 146.04 ? 225 TYR A C   1 
ATOM   1846 O  O   . TYR A 1 225 ? -2.792  -2.103  47.120  1.00 145.65 ? 225 TYR A O   1 
ATOM   1847 C  CB  . TYR A 1 225 ? -4.857  -2.196  49.671  1.00 126.73 ? 225 TYR A CB  1 
ATOM   1848 C  CG  . TYR A 1 225 ? -5.968  -2.977  50.299  1.00 127.81 ? 225 TYR A CG  1 
ATOM   1849 C  CD1 . TYR A 1 225 ? -5.941  -3.279  51.649  1.00 129.91 ? 225 TYR A CD1 1 
ATOM   1850 C  CD2 . TYR A 1 225 ? -7.027  -3.457  49.535  1.00 127.53 ? 225 TYR A CD2 1 
ATOM   1851 C  CE1 . TYR A 1 225 ? -6.963  -4.013  52.238  1.00 131.88 ? 225 TYR A CE1 1 
ATOM   1852 C  CE2 . TYR A 1 225 ? -8.055  -4.189  50.114  1.00 129.31 ? 225 TYR A CE2 1 
ATOM   1853 C  CZ  . TYR A 1 225 ? -8.012  -4.460  51.468  1.00 131.54 ? 225 TYR A CZ  1 
ATOM   1854 O  OH  . TYR A 1 225 ? -9.008  -5.178  52.070  1.00 134.17 ? 225 TYR A OH  1 
ATOM   1855 N  N   . LEU A 1 226 ? -1.709  -1.975  49.099  1.00 109.20 ? 226 LEU A N   1 
ATOM   1856 C  CA  . LEU A 1 226 ? -0.519  -1.402  48.516  1.00 110.09 ? 226 LEU A CA  1 
ATOM   1857 C  C   . LEU A 1 226 ? -0.013  -2.329  47.428  1.00 111.97 ? 226 LEU A C   1 
ATOM   1858 O  O   . LEU A 1 226 ? 0.285   -1.902  46.310  1.00 112.24 ? 226 LEU A O   1 
ATOM   1859 C  CB  . LEU A 1 226 ? 0.569   -1.217  49.560  1.00 116.06 ? 226 LEU A CB  1 
ATOM   1860 C  CG  . LEU A 1 226 ? 1.434   0.038   49.369  1.00 115.68 ? 226 LEU A CG  1 
ATOM   1861 C  CD1 . LEU A 1 226 ? 2.878   -0.281  49.664  1.00 117.62 ? 226 LEU A CD1 1 
ATOM   1862 C  CD2 . LEU A 1 226 ? 1.317   0.667   47.973  1.00 116.16 ? 226 LEU A CD2 1 
ATOM   1863 N  N   . ALA A 1 227 ? 0.086   -3.611  47.743  1.00 118.69 ? 227 ALA A N   1 
ATOM   1864 C  CA  . ALA A 1 227 ? 0.575   -4.558  46.762  1.00 120.86 ? 227 ALA A CA  1 
ATOM   1865 C  C   . ALA A 1 227 ? -0.337  -4.620  45.541  1.00 119.67 ? 227 ALA A C   1 
ATOM   1866 O  O   . ALA A 1 227 ? 0.140   -4.421  44.439  1.00 120.88 ? 227 ALA A O   1 
ATOM   1867 C  CB  . ALA A 1 227 ? 0.756   -5.900  47.368  1.00 66.57  ? 227 ALA A CB  1 
ATOM   1868 N  N   . ILE A 1 228 ? -1.635  -4.874  45.716  1.00 116.41 ? 228 ILE A N   1 
ATOM   1869 C  CA  . ILE A 1 228 ? -2.530  -4.867  44.558  1.00 116.30 ? 228 ILE A CA  1 
ATOM   1870 C  C   . ILE A 1 228 ? -2.238  -3.651  43.695  1.00 115.79 ? 228 ILE A C   1 
ATOM   1871 O  O   . ILE A 1 228 ? -2.138  -3.753  42.478  1.00 117.39 ? 228 ILE A O   1 
ATOM   1872 C  CB  . ILE A 1 228 ? -4.018  -4.775  44.913  1.00 129.20 ? 228 ILE A CB  1 
ATOM   1873 C  CG1 . ILE A 1 228 ? -4.498  -6.000  45.665  1.00 130.19 ? 228 ILE A CG1 1 
ATOM   1874 C  CG2 . ILE A 1 228 ? -4.855  -4.676  43.647  1.00 130.64 ? 228 ILE A CG2 1 
ATOM   1875 C  CD1 . ILE A 1 228 ? -5.995  -5.960  45.898  1.00 129.40 ? 228 ILE A CD1 1 
ATOM   1876 N  N   . ALA A 1 229 ? -2.106  -2.490  44.326  1.00 118.09 ? 229 ALA A N   1 
ATOM   1877 C  CA  . ALA A 1 229 ? -1.895  -1.264  43.559  1.00 117.97 ? 229 ALA A CA  1 
ATOM   1878 C  C   . ALA A 1 229 ? -0.560  -1.218  42.797  1.00 121.56 ? 229 ALA A C   1 
ATOM   1879 O  O   . ALA A 1 229 ? -0.516  -0.778  41.651  1.00 123.80 ? 229 ALA A O   1 
ATOM   1880 C  CB  . ALA A 1 229 ? -2.054  -0.050  44.451  1.00 95.64  ? 229 ALA A CB  1 
ATOM   1881 N  N   . LEU A 1 230 ? 0.518   -1.671  43.427  1.00 115.53 ? 230 LEU A N   1 
ATOM   1882 C  CA  . LEU A 1 230 ? 1.817   -1.667  42.768  1.00 119.33 ? 230 LEU A CA  1 
ATOM   1883 C  C   . LEU A 1 230 ? 1.893   -2.697  41.634  1.00 119.84 ? 230 LEU A C   1 
ATOM   1884 O  O   . LEU A 1 230 ? 2.471   -2.433  40.579  1.00 120.00 ? 230 LEU A O   1 
ATOM   1885 C  CB  . LEU A 1 230 ? 2.928   -1.941  43.770  1.00 113.10 ? 230 LEU A CB  1 
ATOM   1886 C  CG  . LEU A 1 230 ? 3.062   -1.038  44.986  1.00 113.60 ? 230 LEU A CG  1 
ATOM   1887 C  CD1 . LEU A 1 230 ? 4.148   -1.596  45.887  1.00 113.51 ? 230 LEU A CD1 1 
ATOM   1888 C  CD2 . LEU A 1 230 ? 3.371   0.388   44.584  1.00 113.52 ? 230 LEU A CD2 1 
ATOM   1889 N  N   . MET A 1 231 ? 1.348   -3.883  41.862  1.00 135.43 ? 231 MET A N   1 
ATOM   1890 C  CA  . MET A 1 231 ? 1.234   -4.878  40.816  1.00 136.60 ? 231 MET A CA  1 
ATOM   1891 C  C   . MET A 1 231 ? 0.453   -4.268  39.650  1.00 138.39 ? 231 MET A C   1 
ATOM   1892 O  O   . MET A 1 231 ? 0.890   -4.309  38.495  1.00 139.19 ? 231 MET A O   1 
ATOM   1893 C  CB  . MET A 1 231 ? 0.528   -6.121  41.362  1.00 111.20 ? 231 MET A CB  1 
ATOM   1894 C  CG  . MET A 1 231 ? 1.375   -6.951  42.325  1.00 109.76 ? 231 MET A CG  1 
ATOM   1895 S  SD  . MET A 1 231 ? 0.438   -8.200  43.244  1.00 112.66 ? 231 MET A SD  1 
ATOM   1896 C  CE  . MET A 1 231 ? -0.835  -8.585  42.056  1.00 114.82 ? 231 MET A CE  1 
ATOM   1897 N  N   . ILE A 1 232 ? -0.691  -3.674  39.967  1.00 113.28 ? 232 ILE A N   1 
ATOM   1898 C  CA  . ILE A 1 232 ? -1.550  -3.072  38.953  1.00 113.79 ? 232 ILE A CA  1 
ATOM   1899 C  C   . ILE A 1 232 ? -0.827  -1.994  38.156  1.00 116.54 ? 232 ILE A C   1 
ATOM   1900 O  O   . ILE A 1 232 ? -1.022  -1.879  36.952  1.00 119.93 ? 232 ILE A O   1 
ATOM   1901 C  CB  . ILE A 1 232 ? -2.837  -2.484  39.556  1.00 107.93 ? 232 ILE A CB  1 
ATOM   1902 C  CG1 . ILE A 1 232 ? -3.894  -3.582  39.748  1.00 107.13 ? 232 ILE A CG1 1 
ATOM   1903 C  CG2 . ILE A 1 232 ? -3.387  -1.437  38.638  1.00 108.34 ? 232 ILE A CG2 1 
ATOM   1904 C  CD1 . ILE A 1 232 ? -5.204  -3.101  40.357  1.00 104.13 ? 232 ILE A CD1 1 
ATOM   1905 N  N   . ILE A 1 233 ? 0.006   -1.211  38.833  1.00 107.23 ? 233 ILE A N   1 
ATOM   1906 C  CA  . ILE A 1 233 ? 0.857   -0.205  38.180  1.00 107.33 ? 233 ILE A CA  1 
ATOM   1907 C  C   . ILE A 1 233 ? 1.928   -0.844  37.290  1.00 107.19 ? 233 ILE A C   1 
ATOM   1908 O  O   . ILE A 1 233 ? 2.313   -0.286  36.254  1.00 108.89 ? 233 ILE A O   1 
ATOM   1909 C  CB  . ILE A 1 233 ? 1.546   0.729   39.226  1.00 105.49 ? 233 ILE A CB  1 
ATOM   1910 C  CG1 . ILE A 1 233 ? 0.654   1.922   39.558  1.00 105.02 ? 233 ILE A CG1 1 
ATOM   1911 C  CG2 . ILE A 1 233 ? 2.911   1.215   38.736  1.00 104.78 ? 233 ILE A CG2 1 
ATOM   1912 C  CD1 . ILE A 1 233 ? 1.327   2.920   40.442  1.00 103.92 ? 233 ILE A CD1 1 
ATOM   1913 N  N   . ALA A 1 234 ? 2.402   -2.016  37.710  1.00 106.36 ? 234 ALA A N   1 
ATOM   1914 C  CA  . ALA A 1 234 ? 3.428   -2.755  36.985  1.00 106.57 ? 234 ALA A CA  1 
ATOM   1915 C  C   . ALA A 1 234 ? 2.834   -3.335  35.707  1.00 109.11 ? 234 ALA A C   1 
ATOM   1916 O  O   . ALA A 1 234 ? 3.534   -3.520  34.713  1.00 110.73 ? 234 ALA A O   1 
ATOM   1917 C  CB  . ALA A 1 234 ? 4.007   -3.857  37.873  1.00 66.92  ? 234 ALA A CB  1 
ATOM   1918 N  N   . LEU A 1 235 ? 1.530   -3.598  35.755  1.00 113.10 ? 235 LEU A N   1 
ATOM   1919 C  CA  . LEU A 1 235 ? 0.782   -4.126  34.620  1.00 116.47 ? 235 LEU A CA  1 
ATOM   1920 C  C   . LEU A 1 235 ? 0.659   -3.109  33.486  1.00 118.75 ? 235 LEU A C   1 
ATOM   1921 O  O   . LEU A 1 235 ? 0.927   -3.431  32.337  1.00 119.95 ? 235 LEU A O   1 
ATOM   1922 C  CB  . LEU A 1 235 ? -0.610  -4.568  35.077  1.00 111.67 ? 235 LEU A CB  1 
ATOM   1923 C  CG  . LEU A 1 235 ? -1.299  -5.651  34.244  1.00 114.81 ? 235 LEU A CG  1 
ATOM   1924 C  CD1 . LEU A 1 235 ? -0.473  -6.927  34.244  1.00 114.04 ? 235 LEU A CD1 1 
ATOM   1925 C  CD2 . LEU A 1 235 ? -2.716  -5.926  34.740  1.00 117.20 ? 235 LEU A CD2 1 
ATOM   1926 N  N   . SER A 1 236 ? 0.261   -1.883  33.809  1.00 115.36 ? 236 SER A N   1 
ATOM   1927 C  CA  . SER A 1 236 ? 0.016   -0.856  32.789  1.00 118.74 ? 236 SER A CA  1 
ATOM   1928 C  C   . SER A 1 236 ? 1.261   -0.470  31.981  1.00 121.24 ? 236 SER A C   1 
ATOM   1929 O  O   . SER A 1 236 ? 2.368   -0.943  32.255  1.00 120.33 ? 236 SER A O   1 
ATOM   1930 C  CB  . SER A 1 236 ? -0.606  0.399   33.410  1.00 150.90 ? 236 SER A CB  1 
ATOM   1931 O  OG  . SER A 1 236 ? 0.382   1.171   34.071  1.00 146.97 ? 236 SER A OG  1 
ATOM   1932 N  N   . MET A 1 237 ? 1.050   0.409   30.994  1.00 163.68 ? 237 MET A N   1 
ATOM   1933 C  CA  . MET A 1 237 ? 2.071   0.815   30.013  1.00 165.18 ? 237 MET A CA  1 
ATOM   1934 C  C   . MET A 1 237 ? 2.638   2.210   30.279  1.00 167.15 ? 237 MET A C   1 
ATOM   1935 O  O   . MET A 1 237 ? 2.161   3.200   29.729  1.00 172.01 ? 237 MET A O   1 
ATOM   1936 C  CB  . MET A 1 237 ? 1.480   0.779   28.601  1.00 205.05 ? 237 MET A CB  1 
ATOM   1937 C  CG  . MET A 1 237 ? 0.271   -0.135  28.473  1.00 205.64 ? 237 MET A CG  1 
ATOM   1938 S  SD  . MET A 1 237 ? 0.390   -1.325  27.128  1.00 209.07 ? 237 MET A SD  1 
ATOM   1939 C  CE  . MET A 1 237 ? -0.815  -2.546  27.651  1.00 205.91 ? 237 MET A CE  1 
ATOM   1940 N  N   . LEU A 1 238 ? 3.674   2.269   31.109  1.00 120.21 ? 238 LEU A N   1 
ATOM   1941 C  CA  . LEU A 1 238 ? 4.252   3.525   31.581  1.00 122.48 ? 238 LEU A CA  1 
ATOM   1942 C  C   . LEU A 1 238 ? 5.764   3.433   31.483  1.00 117.70 ? 238 LEU A C   1 
ATOM   1943 O  O   . LEU A 1 238 ? 6.353   2.551   32.111  1.00 110.94 ? 238 LEU A O   1 
ATOM   1944 C  CB  . LEU A 1 238 ? 3.915   3.761   33.068  1.00 128.88 ? 238 LEU A CB  1 
ATOM   1945 C  CG  . LEU A 1 238 ? 2.538   4.148   33.621  1.00 134.36 ? 238 LEU A CG  1 
ATOM   1946 C  CD1 . LEU A 1 238 ? 2.598   4.295   35.126  1.00 133.97 ? 238 LEU A CD1 1 
ATOM   1947 C  CD2 . LEU A 1 238 ? 2.057   5.430   32.995  1.00 141.91 ? 238 LEU A CD2 1 
ATOM   1948 N  N   . ALA A 1 239 ? 6.400   4.340   30.739  1.00 140.79 ? 239 ALA A N   1 
ATOM   1949 C  CA  . ALA A 1 239 ? 7.862   4.345   30.640  1.00 137.57 ? 239 ALA A CA  1 
ATOM   1950 C  C   . ALA A 1 239 ? 8.509   3.732   31.892  1.00 133.31 ? 239 ALA A C   1 
ATOM   1951 O  O   . ALA A 1 239 ? 8.219   4.145   33.012  1.00 130.58 ? 239 ALA A O   1 
ATOM   1952 C  CB  . ALA A 1 239 ? 8.374   5.756   30.407  1.00 337.41 ? 239 ALA A CB  1 
ATOM   1953 N  N   . TRP A 1 240 ? 9.371   2.735   31.697  1.00 159.97 ? 240 TRP A N   1 
ATOM   1954 C  CA  . TRP A 1 240 ? 9.986   1.982   32.800  1.00 156.41 ? 240 TRP A CA  1 
ATOM   1955 C  C   . TRP A 1 240 ? 10.321  2.847   34.039  1.00 154.70 ? 240 TRP A C   1 
ATOM   1956 O  O   . TRP A 1 240 ? 10.203  2.398   35.188  1.00 151.25 ? 240 TRP A O   1 
ATOM   1957 C  CB  . TRP A 1 240 ? 11.243  1.262   32.286  1.00 163.56 ? 240 TRP A CB  1 
ATOM   1958 C  CG  . TRP A 1 240 ? 12.447  2.155   32.241  1.00 166.60 ? 240 TRP A CG  1 
ATOM   1959 C  CD1 . TRP A 1 240 ? 12.575  3.334   31.555  1.00 171.45 ? 240 TRP A CD1 1 
ATOM   1960 C  CD2 . TRP A 1 240 ? 13.687  1.952   32.923  1.00 165.69 ? 240 TRP A CD2 1 
ATOM   1961 N  NE1 . TRP A 1 240 ? 13.817  3.875   31.774  1.00 173.71 ? 240 TRP A NE1 1 
ATOM   1962 C  CE2 . TRP A 1 240 ? 14.520  3.044   32.609  1.00 170.22 ? 240 TRP A CE2 1 
ATOM   1963 C  CE3 . TRP A 1 240 ? 14.175  0.952   33.769  1.00 162.08 ? 240 TRP A CE3 1 
ATOM   1964 C  CZ2 . TRP A 1 240 ? 15.812  3.162   33.112  1.00 171.20 ? 240 TRP A CZ2 1 
ATOM   1965 C  CZ3 . TRP A 1 240 ? 15.455  1.069   34.264  1.00 162.99 ? 240 TRP A CZ3 1 
ATOM   1966 C  CH2 . TRP A 1 240 ? 16.260  2.165   33.936  1.00 167.52 ? 240 TRP A CH2 1 
ATOM   1967 N  N   . GLN A 1 241 ? 10.726  4.091   33.780  1.00 158.04 ? 241 GLN A N   1 
ATOM   1968 C  CA  . GLN A 1 241 ? 11.163  5.036   34.808  1.00 157.49 ? 241 GLN A CA  1 
ATOM   1969 C  C   . GLN A 1 241 ? 10.062  5.394   35.808  1.00 154.48 ? 241 GLN A C   1 
ATOM   1970 O  O   . GLN A 1 241 ? 10.299  5.394   37.018  1.00 152.04 ? 241 GLN A O   1 
ATOM   1971 C  CB  . GLN A 1 241 ? 11.746  6.295   34.147  1.00 199.43 ? 241 GLN A CB  1 
ATOM   1972 C  CG  . GLN A 1 241 ? 11.056  6.704   32.846  1.00 203.31 ? 241 GLN A CG  1 
ATOM   1973 C  CD  . GLN A 1 241 ? 11.877  7.688   32.026  1.00 209.01 ? 241 GLN A CD  1 
ATOM   1974 O  OE1 . GLN A 1 241 ? 13.102  7.733   32.134  1.00 210.97 ? 241 GLN A OE1 1 
ATOM   1975 N  NE2 . GLN A 1 241 ? 11.202  8.479   31.199  1.00 212.32 ? 241 GLN A NE2 1 
ATOM   1976 N  N   . TYR A 1 242 ? 8.869   5.698   35.295  1.00 160.29 ? 242 TYR A N   1 
ATOM   1977 C  CA  . TYR A 1 242 ? 7.692   5.982   36.121  1.00 158.22 ? 242 TYR A CA  1 
ATOM   1978 C  C   . TYR A 1 242 ? 7.342   4.800   37.016  1.00 154.10 ? 242 TYR A C   1 
ATOM   1979 O  O   . TYR A 1 242 ? 6.945   4.972   38.171  1.00 152.25 ? 242 TYR A O   1 
ATOM   1980 C  CB  . TYR A 1 242 ? 6.484   6.331   35.245  1.00 133.18 ? 242 TYR A CB  1 
ATOM   1981 C  CG  . TYR A 1 242 ? 6.613   7.664   34.532  1.00 137.93 ? 242 TYR A CG  1 
ATOM   1982 C  CD1 . TYR A 1 242 ? 5.566   8.174   33.764  1.00 143.06 ? 242 TYR A CD1 1 
ATOM   1983 C  CD2 . TYR A 1 242 ? 7.785   8.418   34.629  1.00 138.05 ? 242 TYR A CD2 1 
ATOM   1984 C  CE1 . TYR A 1 242 ? 5.679   9.382   33.119  1.00 148.08 ? 242 TYR A CE1 1 
ATOM   1985 C  CE2 . TYR A 1 242 ? 7.907   9.623   33.986  1.00 143.07 ? 242 TYR A CE2 1 
ATOM   1986 C  CZ  . TYR A 1 242 ? 6.851   10.093  33.233  1.00 148.07 ? 242 TYR A CZ  1 
ATOM   1987 O  OH  . TYR A 1 242 ? 6.973   11.290  32.593  1.00 153.77 ? 242 TYR A OH  1 
ATOM   1988 N  N   . LYS A 1 243 ? 7.488   3.600   36.465  1.00 116.02 ? 243 LYS A N   1 
ATOM   1989 C  CA  . LYS A 1 243 ? 7.256   2.371   37.206  1.00 112.70 ? 243 LYS A CA  1 
ATOM   1990 C  C   . LYS A 1 243 ? 8.291   2.185   38.326  1.00 110.86 ? 243 LYS A C   1 
ATOM   1991 O  O   . LYS A 1 243 ? 7.952   2.304   39.499  1.00 109.43 ? 243 LYS A O   1 
ATOM   1992 C  CB  . LYS A 1 243 ? 7.242   1.182   36.244  1.00 131.73 ? 243 LYS A CB  1 
ATOM   1993 C  CG  . LYS A 1 243 ? 6.161   1.254   35.156  1.00 134.11 ? 243 LYS A CG  1 
ATOM   1994 C  CD  . LYS A 1 243 ? 5.054   0.227   35.394  1.00 134.40 ? 243 LYS A CD  1 
ATOM   1995 C  CE  . LYS A 1 243 ? 4.577   -0.444  34.100  1.00 136.19 ? 243 LYS A CE  1 
ATOM   1996 N  NZ  . LYS A 1 243 ? 5.589   -1.360  33.498  1.00 136.31 ? 243 LYS A NZ  1 
ATOM   1997 N  N   . LEU A 1 244 ? 9.540   1.907   37.970  1.00 142.96 ? 244 LEU A N   1 
ATOM   1998 C  CA  . LEU A 1 244 ? 10.593  1.794   38.973  1.00 142.04 ? 244 LEU A CA  1 
ATOM   1999 C  C   . LEU A 1 244 ? 10.432  2.867   40.057  1.00 141.80 ? 244 LEU A C   1 
ATOM   2000 O  O   . LEU A 1 244 ? 10.370  2.561   41.247  1.00 140.22 ? 244 LEU A O   1 
ATOM   2001 C  CB  . LEU A 1 244 ? 11.964  1.938   38.312  1.00 126.27 ? 244 LEU A CB  1 
ATOM   2002 C  CG  . LEU A 1 244 ? 12.985  0.817   38.514  1.00 126.33 ? 244 LEU A CG  1 
ATOM   2003 C  CD1 . LEU A 1 244 ? 14.358  1.270   38.038  1.00 129.74 ? 244 LEU A CD1 1 
ATOM   2004 C  CD2 . LEU A 1 244 ? 13.043  0.346   39.968  1.00 124.89 ? 244 LEU A CD2 1 
ATOM   2005 N  N   . ALA A 1 245 ? 10.366  4.125   39.624  1.00 142.81 ? 245 ALA A N   1 
ATOM   2006 C  CA  . ALA A 1 245 ? 10.211  5.273   40.518  1.00 143.39 ? 245 ALA A CA  1 
ATOM   2007 C  C   . ALA A 1 245 ? 9.002   5.165   41.443  1.00 141.63 ? 245 ALA A C   1 
ATOM   2008 O  O   . ALA A 1 245 ? 9.148   4.852   42.627  1.00 140.25 ? 245 ALA A O   1 
ATOM   2009 C  CB  . ALA A 1 245 ? 10.116  6.531   39.701  1.00 98.29  ? 245 ALA A CB  1 
ATOM   2010 N  N   . LEU A 1 246 ? 7.826   5.463   40.891  1.00 137.85 ? 246 LEU A N   1 
ATOM   2011 C  CA  . LEU A 1 246 ? 6.541   5.352   41.585  1.00 136.97 ? 246 LEU A CA  1 
ATOM   2012 C  C   . LEU A 1 246 ? 6.502   4.173   42.581  1.00 134.71 ? 246 LEU A C   1 
ATOM   2013 O  O   . LEU A 1 246 ? 6.106   4.338   43.756  1.00 134.57 ? 246 LEU A O   1 
ATOM   2014 C  CB  . LEU A 1 246 ? 5.414   5.281   40.536  1.00 98.43  ? 246 LEU A CB  1 
ATOM   2015 C  CG  . LEU A 1 246 ? 3.896   5.357   40.797  1.00 98.62  ? 246 LEU A CG  1 
ATOM   2016 C  CD1 . LEU A 1 246 ? 3.535   6.004   42.118  1.00 97.90  ? 246 LEU A CD1 1 
ATOM   2017 C  CD2 . LEU A 1 246 ? 3.148   6.043   39.638  1.00 101.63 ? 246 LEU A CD2 1 
ATOM   2018 N  N   . ILE A 1 247 ? 6.945   3.000   42.128  1.00 147.29 ? 247 ILE A N   1 
ATOM   2019 C  CA  . ILE A 1 247 ? 7.143   1.857   43.028  1.00 145.70 ? 247 ILE A CA  1 
ATOM   2020 C  C   . ILE A 1 247 ? 8.042   2.195   44.210  1.00 145.63 ? 247 ILE A C   1 
ATOM   2021 O  O   . ILE A 1 247 ? 7.605   2.120   45.354  1.00 145.11 ? 247 ILE A O   1 
ATOM   2022 C  CB  . ILE A 1 247 ? 7.770   0.643   42.324  1.00 153.30 ? 247 ILE A CB  1 
ATOM   2023 C  CG1 . ILE A 1 247 ? 6.754   -0.016  41.398  1.00 153.79 ? 247 ILE A CG1 1 
ATOM   2024 C  CG2 . ILE A 1 247 ? 8.278   -0.361  43.354  1.00 152.28 ? 247 ILE A CG2 1 
ATOM   2025 C  CD1 . ILE A 1 247 ? 5.502   -0.480  42.099  1.00 153.89 ? 247 ILE A CD1 1 
ATOM   2026 N  N   . VAL A 1 248 ? 9.297   2.551   43.939  1.00 146.05 ? 248 VAL A N   1 
ATOM   2027 C  CA  . VAL A 1 248 ? 10.246  2.849   45.016  1.00 146.82 ? 248 VAL A CA  1 
ATOM   2028 C  C   . VAL A 1 248 ? 9.762   3.931   46.011  1.00 147.83 ? 248 VAL A C   1 
ATOM   2029 O  O   . VAL A 1 248 ? 9.907   3.748   47.230  1.00 148.22 ? 248 VAL A O   1 
ATOM   2030 C  CB  . VAL A 1 248 ? 11.697  3.117   44.521  1.00 113.59 ? 248 VAL A CB  1 
ATOM   2031 C  CG1 . VAL A 1 248 ? 12.280  4.394   45.165  1.00 116.05 ? 248 VAL A CG1 1 
ATOM   2032 C  CG2 . VAL A 1 248 ? 12.578  1.894   44.833  1.00 113.62 ? 248 VAL A CG2 1 
ATOM   2033 N  N   . LEU A 1 249 ? 9.172   5.032   45.524  1.00 150.31 ? 249 LEU A N   1 
ATOM   2034 C  CA  . LEU A 1 249 ? 8.603   6.035   46.451  1.00 151.78 ? 249 LEU A CA  1 
ATOM   2035 C  C   . LEU A 1 249 ? 7.477   5.411   47.279  1.00 151.30 ? 249 LEU A C   1 
ATOM   2036 O  O   . LEU A 1 249 ? 7.551   5.349   48.523  1.00 152.34 ? 249 LEU A O   1 
ATOM   2037 C  CB  . LEU A 1 249 ? 8.118   7.315   45.741  1.00 144.65 ? 249 LEU A CB  1 
ATOM   2038 C  CG  . LEU A 1 249 ? 8.992   7.970   44.654  1.00 145.90 ? 249 LEU A CG  1 
ATOM   2039 C  CD1 . LEU A 1 249 ? 8.360   9.281   44.177  1.00 148.39 ? 249 LEU A CD1 1 
ATOM   2040 C  CD2 . LEU A 1 249 ? 10.469  8.180   45.060  1.00 146.69 ? 249 LEU A CD2 1 
ATOM   2041 N  N   . LEU A 1 250 ? 6.452   4.923   46.581  1.00 132.72 ? 250 LEU A N   1 
ATOM   2042 C  CA  . LEU A 1 250 ? 5.361   4.210   47.248  1.00 132.24 ? 250 LEU A CA  1 
ATOM   2043 C  C   . LEU A 1 250 ? 5.825   3.060   48.149  1.00 132.34 ? 250 LEU A C   1 
ATOM   2044 O  O   . LEU A 1 250 ? 5.017   2.438   48.838  1.00 130.99 ? 250 LEU A O   1 
ATOM   2045 C  CB  . LEU A 1 250 ? 4.344   3.705   46.219  1.00 129.57 ? 250 LEU A CB  1 
ATOM   2046 C  CG  . LEU A 1 250 ? 3.189   4.679   46.007  1.00 126.87 ? 250 LEU A CG  1 
ATOM   2047 C  CD1 . LEU A 1 250 ? 2.429   4.408   44.719  1.00 126.29 ? 250 LEU A CD1 1 
ATOM   2048 C  CD2 . LEU A 1 250 ? 2.275   4.606   47.215  1.00 123.21 ? 250 LEU A CD2 1 
ATOM   2049 N  N   . PHE A 1 251 ? 7.125   2.784   48.136  1.00 158.70 ? 251 PHE A N   1 
ATOM   2050 C  CA  . PHE A 1 251 ? 7.701   1.737   48.971  1.00 159.01 ? 251 PHE A CA  1 
ATOM   2051 C  C   . PHE A 1 251 ? 8.312   2.352   50.211  1.00 160.95 ? 251 PHE A C   1 
ATOM   2052 O  O   . PHE A 1 251 ? 7.841   2.133   51.331  1.00 162.87 ? 251 PHE A O   1 
ATOM   2053 C  CB  . PHE A 1 251 ? 8.780   0.980   48.198  1.00 152.51 ? 251 PHE A CB  1 
ATOM   2054 C  CG  . PHE A 1 251 ? 9.535   -0.030  49.020  1.00 153.54 ? 251 PHE A CG  1 
ATOM   2055 C  CD1 . PHE A 1 251 ? 9.041   -1.318  49.184  1.00 153.43 ? 251 PHE A CD1 1 
ATOM   2056 C  CD2 . PHE A 1 251 ? 10.752  0.302   49.610  1.00 155.27 ? 251 PHE A CD2 1 
ATOM   2057 C  CE1 . PHE A 1 251 ? 9.740   -2.255  49.927  1.00 155.07 ? 251 PHE A CE1 1 
ATOM   2058 C  CE2 . PHE A 1 251 ? 11.456  -0.631  50.361  1.00 156.92 ? 251 PHE A CE2 1 
ATOM   2059 C  CZ  . PHE A 1 251 ? 10.947  -1.913  50.518  1.00 156.85 ? 251 PHE A CZ  1 
ATOM   2060 N  N   . ALA A 1 252 ? 9.367   3.130   50.011  1.00 185.80 ? 252 ALA A N   1 
ATOM   2061 C  CA  . ALA A 1 252 ? 9.979   3.830   51.124  1.00 188.14 ? 252 ALA A CA  1 
ATOM   2062 C  C   . ALA A 1 252 ? 8.894   4.489   51.990  1.00 190.19 ? 252 ALA A C   1 
ATOM   2063 O  O   . ALA A 1 252 ? 8.879   4.288   53.213  1.00 192.63 ? 252 ALA A O   1 
ATOM   2064 C  CB  . ALA A 1 252 ? 11.025  4.849   50.632  1.00 128.44 ? 252 ALA A CB  1 
ATOM   2065 N  N   . ILE A 1 253 ? 7.965   5.243   51.394  1.00 172.52 ? 253 ILE A N   1 
ATOM   2066 C  CA  . ILE A 1 253 ? 6.971   5.892   52.263  1.00 169.66 ? 253 ILE A CA  1 
ATOM   2067 C  C   . ILE A 1 253 ? 6.322   4.848   53.182  1.00 168.13 ? 253 ILE A C   1 
ATOM   2068 O  O   . ILE A 1 253 ? 6.108   5.130   54.349  1.00 167.86 ? 253 ILE A O   1 
ATOM   2069 C  CB  . ILE A 1 253 ? 5.838   6.709   51.563  1.00 133.74 ? 253 ILE A CB  1 
ATOM   2070 C  CG1 . ILE A 1 253 ? 4.830   5.760   50.903  1.00 130.55 ? 253 ILE A CG1 1 
ATOM   2071 C  CG2 . ILE A 1 253 ? 6.396   7.843   50.662  1.00 129.83 ? 253 ILE A CG2 1 
ATOM   2072 C  CD1 . ILE A 1 253 ? 3.634   6.430   50.292  1.00 130.06 ? 253 ILE A CD1 1 
ATOM   2073 N  N   . PHE A 1 254 ? 6.018   3.650   52.676  1.00 131.78 ? 254 PHE A N   1 
ATOM   2074 C  CA  . PHE A 1 254 ? 5.351   2.623   53.492  1.00 131.17 ? 254 PHE A CA  1 
ATOM   2075 C  C   . PHE A 1 254 ? 6.256   1.955   54.524  1.00 135.41 ? 254 PHE A C   1 
ATOM   2076 O  O   . PHE A 1 254 ? 5.804   1.609   55.606  1.00 135.83 ? 254 PHE A O   1 
ATOM   2077 C  CB  . PHE A 1 254 ? 4.677   1.554   52.633  1.00 159.50 ? 254 PHE A CB  1 
ATOM   2078 C  CG  . PHE A 1 254 ? 3.841   0.582   53.428  1.00 159.06 ? 254 PHE A CG  1 
ATOM   2079 C  CD1 . PHE A 1 254 ? 2.472   0.773   53.557  1.00 156.09 ? 254 PHE A CD1 1 
ATOM   2080 C  CD2 . PHE A 1 254 ? 4.423   -0.514  54.064  1.00 162.40 ? 254 PHE A CD2 1 
ATOM   2081 C  CE1 . PHE A 1 254 ? 1.690   -0.118  54.290  1.00 156.61 ? 254 PHE A CE1 1 
ATOM   2082 C  CE2 . PHE A 1 254 ? 3.645   -1.409  54.803  1.00 162.84 ? 254 PHE A CE2 1 
ATOM   2083 C  CZ  . PHE A 1 254 ? 2.277   -1.208  54.915  1.00 160.05 ? 254 PHE A CZ  1 
ATOM   2084 N  N   . ALA A 1 255 ? 7.529   1.768   54.193  1.00 166.44 ? 255 ALA A N   1 
ATOM   2085 C  CA  . ALA A 1 255 ? 8.453   1.168   55.157  1.00 170.21 ? 255 ALA A CA  1 
ATOM   2086 C  C   . ALA A 1 255 ? 8.801   2.119   56.300  1.00 173.54 ? 255 ALA A C   1 
ATOM   2087 O  O   . ALA A 1 255 ? 8.906   1.702   57.456  1.00 176.36 ? 255 ALA A O   1 
ATOM   2088 C  CB  . ALA A 1 255 ? 9.694   0.663   54.477  1.00 193.12 ? 255 ALA A CB  1 
ATOM   2089 N  N   . PHE A 1 256 ? 9.027   3.390   55.969  1.00 216.51 ? 256 PHE A N   1 
ATOM   2090 C  CA  . PHE A 1 256 ? 9.470   4.338   56.996  1.00 219.62 ? 256 PHE A CA  1 
ATOM   2091 C  C   . PHE A 1 256 ? 8.381   5.248   57.561  1.00 216.93 ? 256 PHE A C   1 
ATOM   2092 O  O   . PHE A 1 256 ? 8.632   5.997   58.501  1.00 220.27 ? 256 PHE A O   1 
ATOM   2093 C  CB  . PHE A 1 256 ? 10.630  5.174   56.472  1.00 186.51 ? 256 PHE A CB  1 
ATOM   2094 C  CG  . PHE A 1 256 ? 11.791  4.356   55.992  1.00 184.76 ? 256 PHE A CG  1 
ATOM   2095 C  CD1 . PHE A 1 256 ? 11.959  4.079   54.639  1.00 181.06 ? 256 PHE A CD1 1 
ATOM   2096 C  CD2 . PHE A 1 256 ? 12.724  3.874   56.890  1.00 187.46 ? 256 PHE A CD2 1 
ATOM   2097 C  CE1 . PHE A 1 256 ? 13.037  3.333   54.195  1.00 180.06 ? 256 PHE A CE1 1 
ATOM   2098 C  CE2 . PHE A 1 256 ? 13.804  3.127   56.451  1.00 186.43 ? 256 PHE A CE2 1 
ATOM   2099 C  CZ  . PHE A 1 256 ? 13.961  2.856   55.105  1.00 182.70 ? 256 PHE A CZ  1 
ATOM   2100 N  N   . LYS A 1 257 ? 7.183   5.205   56.981  1.00 168.15 ? 257 LYS A N   1 
ATOM   2101 C  CA  . LYS A 1 257 ? 6.028   5.895   57.580  1.00 165.86 ? 257 LYS A CA  1 
ATOM   2102 C  C   . LYS A 1 257 ? 5.232   4.955   58.452  1.00 165.71 ? 257 LYS A C   1 
ATOM   2103 O  O   . LYS A 1 257 ? 4.017   5.105   58.586  1.00 163.67 ? 257 LYS A O   1 
ATOM   2104 C  CB  . LYS A 1 257 ? 5.104   6.525   56.545  1.00 161.35 ? 257 LYS A CB  1 
ATOM   2105 C  CG  . LYS A 1 257 ? 5.769   7.632   55.766  1.00 161.63 ? 257 LYS A CG  1 
ATOM   2106 C  CD  . LYS A 1 257 ? 6.310   8.740   56.635  1.00 162.16 ? 257 LYS A CD  1 
ATOM   2107 C  CE  . LYS A 1 257 ? 7.264   9.564   55.780  1.00 162.68 ? 257 LYS A CE  1 
ATOM   2108 N  NZ  . LYS A 1 257 ? 7.492   10.950  56.290  1.00 163.50 ? 257 LYS A NZ  1 
ATOM   2109 N  N   . GLU A 1 258 ? 5.934   3.984   59.029  1.00 288.64 ? 258 GLU A N   1 
ATOM   2110 C  CA  . GLU A 1 258 ? 5.438   3.249   60.186  1.00 290.85 ? 258 GLU A CA  1 
ATOM   2111 C  C   . GLU A 1 258 ? 4.085   2.567   59.900  1.00 286.08 ? 258 GLU A C   1 
ATOM   2112 O  O   . GLU A 1 258 ? 4.031   1.354   59.671  1.00 283.87 ? 258 GLU A O   1 
ATOM   2113 C  CB  . GLU A 1 258 ? 5.398   4.194   61.419  1.00 205.21 ? 258 GLU A CB  1 
ATOM   2114 C  CG  . GLU A 1 258 ? 6.767   4.887   61.730  1.00 208.79 ? 258 GLU A CG  1 
ATOM   2115 C  CD  . GLU A 1 258 ? 6.695   6.018   62.772  1.00 216.24 ? 258 GLU A CD  1 
ATOM   2116 O  OE1 . GLU A 1 258 ? 5.647   6.163   63.436  1.00 219.90 ? 258 GLU A OE1 1 
ATOM   2117 O  OE2 . GLU A 1 258 ? 7.696   6.761   62.926  1.00 218.88 ? 258 GLU A OE2 1 
ATOM   2118 N  N   . GLU A 1 259 ? 3.004   3.348   59.893  1.00 365.15 ? 259 GLU A N   1 
ATOM   2119 C  CA  . GLU A 1 259 ? 1.653   2.800   59.730  1.00 361.63 ? 259 GLU A CA  1 
ATOM   2120 C  C   . GLU A 1 259 ? 0.632   3.783   59.156  1.00 358.30 ? 259 GLU A C   1 
ATOM   2121 O  O   . GLU A 1 259 ? -0.517  3.413   58.928  1.00 358.08 ? 259 GLU A O   1 
ATOM   2122 C  CB  . GLU A 1 259 ? 1.113   2.277   61.079  1.00 251.22 ? 259 GLU A CB  1 
ATOM   2123 C  CG  . GLU A 1 259 ? 1.497   0.834   61.443  1.00 254.41 ? 259 GLU A CG  1 
ATOM   2124 C  CD  . GLU A 1 259 ? 0.508   0.166   62.396  1.00 259.39 ? 259 GLU A CD  1 
ATOM   2125 O  OE1 . GLU A 1 259 ? -0.587  0.722   62.621  1.00 260.73 ? 259 GLU A OE1 1 
ATOM   2126 O  OE2 . GLU A 1 259 ? 0.827   -0.924  62.918  1.00 262.54 ? 259 GLU A OE2 1 
ATOM   2127 N  N   . LYS A 1 260 ? 1.041   5.020   58.906  1.00 241.79 ? 260 LYS A N   1 
ATOM   2128 C  CA  . LYS A 1 260 ? 0.062   6.097   58.736  1.00 239.90 ? 260 LYS A CA  1 
ATOM   2129 C  C   . LYS A 1 260 ? -0.430  6.373   57.303  1.00 234.85 ? 260 LYS A C   1 
ATOM   2130 O  O   . LYS A 1 260 ? 0.097   7.227   56.577  1.00 231.70 ? 260 LYS A O   1 
ATOM   2131 C  CB  . LYS A 1 260 ? 0.537   7.344   59.483  1.00 182.75 ? 260 LYS A CB  1 
ATOM   2132 C  CG  . LYS A 1 260 ? 0.824   7.011   60.961  1.00 184.57 ? 260 LYS A CG  1 
ATOM   2133 C  CD  . LYS A 1 260 ? 1.130   8.238   61.843  1.00 186.05 ? 260 LYS A CD  1 
ATOM   2134 C  CE  . LYS A 1 260 ? 1.437   7.805   63.285  1.00 188.21 ? 260 LYS A CE  1 
ATOM   2135 N  NZ  . LYS A 1 260 ? 1.776   8.902   64.232  1.00 190.30 ? 260 LYS A NZ  1 
ATOM   2136 N  N   . ILE A 1 261 ? -1.470  5.615   56.945  1.00 183.71 ? 261 ILE A N   1 
ATOM   2137 C  CA  . ILE A 1 261 ? -2.108  5.600   55.635  1.00 179.77 ? 261 ILE A CA  1 
ATOM   2138 C  C   . ILE A 1 261 ? -3.481  4.933   55.811  1.00 178.83 ? 261 ILE A C   1 
ATOM   2139 O  O   . ILE A 1 261 ? -3.553  3.792   56.261  1.00 180.49 ? 261 ILE A O   1 
ATOM   2140 C  CB  . ILE A 1 261 ? -1.270  4.776   54.614  1.00 157.66 ? 261 ILE A CB  1 
ATOM   2141 C  CG1 . ILE A 1 261 ? 0.121   5.395   54.392  1.00 159.39 ? 261 ILE A CG1 1 
ATOM   2142 C  CG2 . ILE A 1 261 ? -1.978  4.699   53.299  1.00 154.38 ? 261 ILE A CG2 1 
ATOM   2143 C  CD1 . ILE A 1 261 ? 0.793   5.040   53.055  1.00 160.26 ? 261 ILE A CD1 1 
ATOM   2144 N  N   . ASN A 1 262 ? -4.565  5.634   55.479  1.00 208.67 ? 262 ASN A N   1 
ATOM   2145 C  CA  . ASN A 1 262 ? -5.908  5.072   55.689  1.00 208.37 ? 262 ASN A CA  1 
ATOM   2146 C  C   . ASN A 1 262 ? -6.506  4.494   54.411  1.00 207.11 ? 262 ASN A C   1 
ATOM   2147 O  O   . ASN A 1 262 ? -6.082  4.840   53.314  1.00 205.65 ? 262 ASN A O   1 
ATOM   2148 C  CB  . ASN A 1 262 ? -6.853  6.070   56.414  1.00 198.83 ? 262 ASN A CB  1 
ATOM   2149 C  CG  . ASN A 1 262 ? -7.616  6.995   55.465  1.00 199.91 ? 262 ASN A CG  1 
ATOM   2150 O  OD1 . ASN A 1 262 ? -7.371  7.025   54.256  1.00 200.86 ? 262 ASN A OD1 1 
ATOM   2151 N  ND2 . ASN A 1 262 ? -8.556  7.758   56.026  1.00 200.45 ? 262 ASN A ND2 1 
ATOM   2152 N  N   . PHE A 1 263 ? -7.464  3.588   54.561  1.00 191.55 ? 263 PHE A N   1 
ATOM   2153 C  CA  . PHE A 1 263 ? -8.003  2.857   53.424  1.00 190.99 ? 263 PHE A CA  1 
ATOM   2154 C  C   . PHE A 1 263 ? -8.423  3.775   52.290  1.00 189.19 ? 263 PHE A C   1 
ATOM   2155 O  O   . PHE A 1 263 ? -8.032  3.553   51.177  1.00 188.44 ? 263 PHE A O   1 
ATOM   2156 C  CB  . PHE A 1 263 ? -9.150  1.926   53.850  1.00 247.43 ? 263 PHE A CB  1 
ATOM   2157 C  CG  . PHE A 1 263 ? -8.765  0.954   54.935  1.00 250.75 ? 263 PHE A CG  1 
ATOM   2158 C  CD1 . PHE A 1 263 ? -8.995  1.270   56.276  1.00 253.88 ? 263 PHE A CD1 1 
ATOM   2159 C  CD2 . PHE A 1 263 ? -8.163  -0.263  54.623  1.00 251.46 ? 263 PHE A CD2 1 
ATOM   2160 C  CE1 . PHE A 1 263 ? -8.640  0.388   57.284  1.00 257.70 ? 263 PHE A CE1 1 
ATOM   2161 C  CE2 . PHE A 1 263 ? -7.806  -1.149  55.621  1.00 255.06 ? 263 PHE A CE2 1 
ATOM   2162 C  CZ  . PHE A 1 263 ? -8.043  -0.828  56.952  1.00 258.22 ? 263 PHE A CZ  1 
ATOM   2163 N  N   . TYR A 1 264 ? -9.186  4.818   52.556  1.00 546.27 ? 264 TYR A N   1 
ATOM   2164 C  CA  . TYR A 1 264 ? -9.661  5.608   51.436  1.00 545.95 ? 264 TYR A CA  1 
ATOM   2165 C  C   . TYR A 1 264 ? -8.541  6.043   50.490  1.00 546.08 ? 264 TYR A C   1 
ATOM   2166 O  O   . TYR A 1 264 ? -8.748  6.021   49.280  1.00 546.05 ? 264 TYR A O   1 
ATOM   2167 C  CB  . TYR A 1 264 ? -10.510 6.789   51.896  1.00 202.82 ? 264 TYR A CB  1 
ATOM   2168 C  CG  . TYR A 1 264 ? -11.662 6.402   52.807  1.00 205.02 ? 264 TYR A CG  1 
ATOM   2169 C  CD1 . TYR A 1 264 ? -11.459 6.229   54.173  1.00 206.95 ? 264 TYR A CD1 1 
ATOM   2170 C  CD2 . TYR A 1 264 ? -12.954 6.223   52.308  1.00 206.01 ? 264 TYR A CD2 1 
ATOM   2171 C  CE1 . TYR A 1 264 ? -12.497 5.889   55.010  1.00 209.97 ? 264 TYR A CE1 1 
ATOM   2172 C  CE2 . TYR A 1 264 ? -14.000 5.882   53.146  1.00 208.85 ? 264 TYR A CE2 1 
ATOM   2173 C  CZ  . TYR A 1 264 ? -13.760 5.716   54.493  1.00 210.90 ? 264 TYR A CZ  1 
ATOM   2174 O  OH  . TYR A 1 264 ? -14.787 5.375   55.336  1.00 214.65 ? 264 TYR A OH  1 
ATOM   2175 N  N   . MET A 1 265 ? -7.360  6.386   51.019  1.00 187.35 ? 265 MET A N   1 
ATOM   2176 C  CA  . MET A 1 265 ? -6.271  6.910   50.166  1.00 187.43 ? 265 MET A CA  1 
ATOM   2177 C  C   . MET A 1 265 ? -5.578  5.791   49.380  1.00 187.18 ? 265 MET A C   1 
ATOM   2178 O  O   . MET A 1 265 ? -5.025  5.987   48.293  1.00 187.39 ? 265 MET A O   1 
ATOM   2179 C  CB  . MET A 1 265 ? -5.248  7.699   50.973  1.00 200.06 ? 265 MET A CB  1 
ATOM   2180 C  CG  . MET A 1 265 ? -4.514  6.868   51.976  1.00 201.03 ? 265 MET A CG  1 
ATOM   2181 S  SD  . MET A 1 265 ? -3.548  7.876   53.095  1.00 206.42 ? 265 MET A SD  1 
ATOM   2182 C  CE  . MET A 1 265 ? -4.845  8.495   54.161  1.00 211.39 ? 265 MET A CE  1 
ATOM   2183 N  N   . ILE A 1 266 ? -5.657  4.601   49.942  1.00 190.87 ? 266 ILE A N   1 
ATOM   2184 C  CA  . ILE A 1 266 ? -5.234  3.419   49.246  1.00 191.04 ? 266 ILE A CA  1 
ATOM   2185 C  C   . ILE A 1 266 ? -6.212  3.047   48.132  1.00 190.40 ? 266 ILE A C   1 
ATOM   2186 O  O   . ILE A 1 266 ? -5.781  2.646   47.087  1.00 190.88 ? 266 ILE A O   1 
ATOM   2187 C  CB  . ILE A 1 266 ? -5.113  2.277   50.216  1.00 104.23 ? 266 ILE A CB  1 
ATOM   2188 C  CG1 . ILE A 1 266 ? -3.980  2.542   51.197  1.00 107.32 ? 266 ILE A CG1 1 
ATOM   2189 C  CG2 . ILE A 1 266 ? -4.809  0.991   49.498  1.00 102.85 ? 266 ILE A CG2 1 
ATOM   2190 C  CD1 . ILE A 1 266 ? -4.001  1.528   52.378  1.00 108.65 ? 266 ILE A CD1 1 
ATOM   2191 N  N   . TRP A 1 267 ? -7.514  3.179   48.353  1.00 193.99 ? 267 TRP A N   1 
ATOM   2192 C  CA  . TRP A 1 267 ? -8.510  2.860   47.343  1.00 193.89 ? 267 TRP A CA  1 
ATOM   2193 C  C   . TRP A 1 267 ? -8.474  3.922   46.266  1.00 194.71 ? 267 TRP A C   1 
ATOM   2194 O  O   . TRP A 1 267 ? -8.915  3.710   45.148  1.00 196.10 ? 267 TRP A O   1 
ATOM   2195 C  CB  . TRP A 1 267 ? -9.905  2.838   47.938  1.00 245.86 ? 267 TRP A CB  1 
ATOM   2196 C  CG  . TRP A 1 267 ? -10.126 1.879   49.083  1.00 246.53 ? 267 TRP A CG  1 
ATOM   2197 C  CD1 . TRP A 1 267 ? -10.137 2.178   50.410  1.00 247.25 ? 267 TRP A CD1 1 
ATOM   2198 C  CD2 . TRP A 1 267 ? -10.418 0.481   48.987  1.00 247.43 ? 267 TRP A CD2 1 
ATOM   2199 N  NE1 . TRP A 1 267 ? -10.406 1.054   51.152  1.00 248.77 ? 267 TRP A NE1 1 
ATOM   2200 C  CE2 . TRP A 1 267 ? -10.581 -0.003  50.301  1.00 248.80 ? 267 TRP A CE2 1 
ATOM   2201 C  CE3 . TRP A 1 267 ? -10.549 -0.408  47.919  1.00 247.77 ? 267 TRP A CE3 1 
ATOM   2202 C  CZ2 . TRP A 1 267 ? -10.867 -1.339  50.571  1.00 250.49 ? 267 TRP A CZ2 1 
ATOM   2203 C  CZ3 . TRP A 1 267 ? -10.832 -1.733  48.189  1.00 249.17 ? 267 TRP A CZ3 1 
ATOM   2204 C  CH2 . TRP A 1 267 ? -10.989 -2.185  49.503  1.00 250.52 ? 267 TRP A CH2 1 
ATOM   2205 N  N   . ALA A 1 268 ? -7.991  5.096   46.636  1.00 150.54 ? 268 ALA A N   1 
ATOM   2206 C  CA  . ALA A 1 268 ? -7.699  6.092   45.632  1.00 151.86 ? 268 ALA A CA  1 
ATOM   2207 C  C   . ALA A 1 268 ? -6.416  5.711   44.867  1.00 153.22 ? 268 ALA A C   1 
ATOM   2208 O  O   . ALA A 1 268 ? -6.384  5.821   43.668  1.00 155.04 ? 268 ALA A O   1 
ATOM   2209 C  CB  . ALA A 1 268 ? -7.592  7.500   46.252  1.00 339.87 ? 268 ALA A CB  1 
ATOM   2210 N  N   . LEU A 1 269 ? -5.383  5.190   45.525  1.00 161.65 ? 269 LEU A N   1 
ATOM   2211 C  CA  . LEU A 1 269 ? -4.244  4.659   44.768  1.00 163.42 ? 269 LEU A CA  1 
ATOM   2212 C  C   . LEU A 1 269 ? -4.655  3.576   43.770  1.00 164.48 ? 269 LEU A C   1 
ATOM   2213 O  O   . LEU A 1 269 ? -4.129  3.496   42.653  1.00 167.09 ? 269 LEU A O   1 
ATOM   2214 C  CB  . LEU A 1 269 ? -3.155  4.112   45.687  1.00 130.43 ? 269 LEU A CB  1 
ATOM   2215 C  CG  . LEU A 1 269 ? -2.236  5.207   46.226  1.00 131.61 ? 269 LEU A CG  1 
ATOM   2216 C  CD1 . LEU A 1 269 ? -1.619  4.765   47.531  1.00 132.49 ? 269 LEU A CD1 1 
ATOM   2217 C  CD2 . LEU A 1 269 ? -1.184  5.553   45.203  1.00 134.03 ? 269 LEU A CD2 1 
ATOM   2218 N  N   . ILE A 1 270 ? -5.561  2.721   44.201  1.00 144.50 ? 270 ILE A N   1 
ATOM   2219 C  CA  . ILE A 1 270 ? -6.117  1.685   43.399  1.00 145.80 ? 270 ILE A CA  1 
ATOM   2220 C  C   . ILE A 1 270 ? -6.902  2.288   42.232  1.00 147.24 ? 270 ILE A C   1 
ATOM   2221 O  O   . ILE A 1 270 ? -6.638  1.991   41.072  1.00 150.35 ? 270 ILE A O   1 
ATOM   2222 C  CB  . ILE A 1 270 ? -6.994  0.762   44.282  1.00 126.75 ? 270 ILE A CB  1 
ATOM   2223 C  CG1 . ILE A 1 270 ? -6.110  -0.191  45.132  1.00 126.20 ? 270 ILE A CG1 1 
ATOM   2224 C  CG2 . ILE A 1 270 ? -7.966  -0.036  43.431  1.00 129.21 ? 270 ILE A CG2 1 
ATOM   2225 C  CD1 . ILE A 1 270 ? -6.874  -1.391  45.692  1.00 127.29 ? 270 ILE A CD1 1 
ATOM   2226 N  N   . PHE A 1 271 ? -7.842  3.170   42.508  1.00 193.51 ? 271 PHE A N   1 
ATOM   2227 C  CA  . PHE A 1 271 ? -8.676  3.740   41.443  1.00 195.23 ? 271 PHE A CA  1 
ATOM   2228 C  C   . PHE A 1 271 ? -7.879  4.524   40.397  1.00 197.50 ? 271 PHE A C   1 
ATOM   2229 O  O   . PHE A 1 271 ? -8.010  4.293   39.191  1.00 200.33 ? 271 PHE A O   1 
ATOM   2230 C  CB  . PHE A 1 271 ? -9.793  4.611   42.044  1.00 193.39 ? 271 PHE A CB  1 
ATOM   2231 C  CG  . PHE A 1 271 ? -10.809 5.090   41.047  1.00 195.50 ? 271 PHE A CG  1 
ATOM   2232 C  CD1 . PHE A 1 271 ? -12.113 4.617   41.084  1.00 196.31 ? 271 PHE A CD1 1 
ATOM   2233 C  CD2 . PHE A 1 271 ? -10.462 6.013   40.074  1.00 197.43 ? 271 PHE A CD2 1 
ATOM   2234 C  CE1 . PHE A 1 271 ? -13.057 5.068   40.172  1.00 198.85 ? 271 PHE A CE1 1 
ATOM   2235 C  CE2 . PHE A 1 271 ? -11.401 6.466   39.157  1.00 200.07 ? 271 PHE A CE2 1 
ATOM   2236 C  CZ  . PHE A 1 271 ? -12.703 5.987   39.210  1.00 200.73 ? 271 PHE A CZ  1 
ATOM   2237 N  N   . ILE A 1 272 ? -7.087  5.464   40.884  1.00 184.76 ? 272 ILE A N   1 
ATOM   2238 C  CA  . ILE A 1 272 ? -6.047  6.172   40.157  1.00 187.26 ? 272 ILE A CA  1 
ATOM   2239 C  C   . ILE A 1 272 ? -5.228  5.259   39.270  1.00 190.34 ? 272 ILE A C   1 
ATOM   2240 O  O   . ILE A 1 272 ? -5.166  5.432   38.038  1.00 193.61 ? 272 ILE A O   1 
ATOM   2241 C  CB  . ILE A 1 272 ? -5.062  6.850   41.149  1.00 113.97 ? 272 ILE A CB  1 
ATOM   2242 C  CG1 . ILE A 1 272 ? -5.534  8.271   41.479  1.00 113.02 ? 272 ILE A CG1 1 
ATOM   2243 C  CG2 . ILE A 1 272 ? -3.639  6.861   40.584  1.00 116.76 ? 272 ILE A CG2 1 
ATOM   2244 C  CD1 . ILE A 1 272 ? -4.599  9.060   42.380  1.00 112.68 ? 272 ILE A CD1 1 
ATOM   2245 N  N   . SER A 1 273 ? -4.587  4.283   39.897  1.00 164.58 ? 273 SER A N   1 
ATOM   2246 C  CA  . SER A 1 273 ? -3.730  3.386   39.155  1.00 167.90 ? 273 SER A CA  1 
ATOM   2247 C  C   . SER A 1 273 ? -4.515  2.688   38.029  1.00 169.65 ? 273 SER A C   1 
ATOM   2248 O  O   . SER A 1 273 ? -4.084  2.645   36.877  1.00 174.04 ? 273 SER A O   1 
ATOM   2249 C  CB  . SER A 1 273 ? -3.031  2.411   40.100  1.00 119.10 ? 273 SER A CB  1 
ATOM   2250 O  OG  . SER A 1 273 ? -3.160  1.113   39.603  1.00 115.75 ? 273 SER A OG  1 
ATOM   2251 N  N   . ILE A 1 274 ? -5.694  2.179   38.337  1.00 169.90 ? 274 ILE A N   1 
ATOM   2252 C  CA  . ILE A 1 274 ? -6.561  1.577   37.317  1.00 172.07 ? 274 ILE A CA  1 
ATOM   2253 C  C   . ILE A 1 274 ? -6.960  2.578   36.208  1.00 175.03 ? 274 ILE A C   1 
ATOM   2254 O  O   . ILE A 1 274 ? -7.308  2.205   35.065  1.00 177.58 ? 274 ILE A O   1 
ATOM   2255 C  CB  . ILE A 1 274 ? -7.787  0.946   37.957  1.00 145.16 ? 274 ILE A CB  1 
ATOM   2256 C  CG1 . ILE A 1 274 ? -7.378  0.096   39.151  1.00 143.34 ? 274 ILE A CG1 1 
ATOM   2257 C  CG2 . ILE A 1 274 ? -8.617  0.183   36.917  1.00 147.78 ? 274 ILE A CG2 1 
ATOM   2258 C  CD1 . ILE A 1 274 ? -8.428  -0.885  39.564  1.00 141.56 ? 274 ILE A CD1 1 
ATOM   2259 N  N   . SER A 1 275 ? -6.888  3.857   36.552  1.00 169.27 ? 275 SER A N   1 
ATOM   2260 C  CA  . SER A 1 275 ? -7.065  4.899   35.560  1.00 173.61 ? 275 SER A CA  1 
ATOM   2261 C  C   . SER A 1 275 ? -5.842  4.946   34.661  1.00 178.20 ? 275 SER A C   1 
ATOM   2262 O  O   . SER A 1 275 ? -5.985  5.106   33.454  1.00 183.96 ? 275 SER A O   1 
ATOM   2263 C  CB  . SER A 1 275 ? -7.311  6.244   36.220  1.00 192.31 ? 275 SER A CB  1 
ATOM   2264 O  OG  . SER A 1 275 ? -8.514  6.214   36.946  1.00 190.15 ? 275 SER A OG  1 
ATOM   2265 N  N   . ILE A 1 276 ? -4.649  4.810   35.252  1.00 142.57 ? 276 ILE A N   1 
ATOM   2266 C  CA  . ILE A 1 276 ? -3.416  4.606   34.456  1.00 147.36 ? 276 ILE A CA  1 
ATOM   2267 C  C   . ILE A 1 276 ? -3.626  3.448   33.459  1.00 151.17 ? 276 ILE A C   1 
ATOM   2268 O  O   . ILE A 1 276 ? -3.540  3.625   32.219  1.00 158.05 ? 276 ILE A O   1 
ATOM   2269 C  CB  . ILE A 1 276 ? -2.170  4.369   35.361  1.00 110.04 ? 276 ILE A CB  1 
ATOM   2270 C  CG1 . ILE A 1 276 ? -2.194  5.303   36.557  1.00 105.49 ? 276 ILE A CG1 1 
ATOM   2271 C  CG2 . ILE A 1 276 ? -0.875  4.504   34.594  1.00 115.98 ? 276 ILE A CG2 1 
ATOM   2272 C  CD1 . ILE A 1 276 ? -0.874  5.383   37.303  1.00 104.00 ? 276 ILE A CD1 1 
ATOM   2273 N  N   . LEU A 1 277 ? -3.917  2.267   34.004  1.00 145.97 ? 277 LEU A N   1 
ATOM   2274 C  CA  . LEU A 1 277 ? -4.420  1.190   33.143  1.00 149.97 ? 277 LEU A CA  1 
ATOM   2275 C  C   . LEU A 1 277 ? -5.304  1.721   32.003  1.00 154.66 ? 277 LEU A C   1 
ATOM   2276 O  O   . LEU A 1 277 ? -4.946  1.529   30.848  1.00 161.04 ? 277 LEU A O   1 
ATOM   2277 C  CB  . LEU A 1 277 ? -5.177  0.133   33.950  1.00 112.57 ? 277 LEU A CB  1 
ATOM   2278 C  CG  . LEU A 1 277 ? -4.604  -1.279  34.111  1.00 113.30 ? 277 LEU A CG  1 
ATOM   2279 C  CD1 . LEU A 1 277 ? -5.703  -2.345  34.248  1.00 114.49 ? 277 LEU A CD1 1 
ATOM   2280 C  CD2 . LEU A 1 277 ? -3.709  -1.614  32.933  1.00 118.87 ? 277 LEU A CD2 1 
ATOM   2281 N  N   . HIS A 1 278 ? -6.416  2.409   32.307  1.00 182.05 ? 278 HIS A N   1 
ATOM   2282 C  CA  . HIS A 1 278 ? -7.357  2.854   31.248  1.00 186.40 ? 278 HIS A CA  1 
ATOM   2283 C  C   . HIS A 1 278 ? -6.754  3.737   30.159  1.00 191.84 ? 278 HIS A C   1 
ATOM   2284 O  O   . HIS A 1 278 ? -6.982  3.512   28.974  1.00 196.09 ? 278 HIS A O   1 
ATOM   2285 C  CB  . HIS A 1 278 ? -8.588  3.547   31.839  1.00 191.54 ? 278 HIS A CB  1 
ATOM   2286 C  CG  . HIS A 1 278 ? -9.799  3.449   30.974  1.00 195.29 ? 278 HIS A CG  1 
ATOM   2287 N  ND1 . HIS A 1 278 ? -10.684 2.396   31.062  1.00 195.25 ? 278 HIS A ND1 1 
ATOM   2288 C  CD2 . HIS A 1 278 ? -10.262 4.245   29.980  1.00 199.82 ? 278 HIS A CD2 1 
ATOM   2289 C  CE1 . HIS A 1 278 ? -11.649 2.559   30.179  1.00 199.54 ? 278 HIS A CE1 1 
ATOM   2290 N  NE2 . HIS A 1 278 ? -11.417 3.675   29.508  1.00 202.41 ? 278 HIS A NE2 1 
ATOM   2291 N  N   . LEU A 1 279 ? -6.012  4.755   30.578  1.00 168.84 ? 279 LEU A N   1 
ATOM   2292 C  CA  . LEU A 1 279 ? -5.257  5.621   29.676  1.00 174.55 ? 279 LEU A CA  1 
ATOM   2293 C  C   . LEU A 1 279 ? -4.314  4.796   28.797  1.00 180.49 ? 279 LEU A C   1 
ATOM   2294 O  O   . LEU A 1 279 ? -4.041  5.163   27.651  1.00 184.38 ? 279 LEU A O   1 
ATOM   2295 C  CB  . LEU A 1 279 ? -4.475  6.650   30.505  1.00 182.03 ? 279 LEU A CB  1 
ATOM   2296 C  CG  . LEU A 1 279 ? -5.324  7.630   31.335  1.00 176.44 ? 279 LEU A CG  1 
ATOM   2297 C  CD1 . LEU A 1 279 ? -4.467  8.715   31.994  1.00 175.10 ? 279 LEU A CD1 1 
ATOM   2298 C  CD2 . LEU A 1 279 ? -6.450  8.278   30.518  1.00 178.52 ? 279 LEU A CD2 1 
ATOM   2299 N  N   . SER A 1 280 ? -3.813  3.676   29.327  1.00 302.19 ? 280 SER A N   1 
ATOM   2300 C  CA  . SER A 1 280 ? -2.890  2.850   28.522  1.00 302.39 ? 280 SER A CA  1 
ATOM   2301 C  C   . SER A 1 280 ? -3.561  1.794   27.622  1.00 306.20 ? 280 SER A C   1 
ATOM   2302 O  O   . SER A 1 280 ? -3.263  1.687   26.437  1.00 310.43 ? 280 SER A O   1 
ATOM   2303 C  CB  . SER A 1 280 ? -1.819  2.212   29.415  1.00 164.44 ? 280 SER A CB  1 
ATOM   2304 O  OG  . SER A 1 280 ? -0.958  3.204   29.940  1.00 162.01 ? 280 SER A OG  1 
ATOM   2305 N  N   . GLY A 1 281 ? -4.469  1.023   28.200  1.00 163.22 ? 281 GLY A N   1 
ATOM   2306 C  CA  . GLY A 1 281 ? -5.145  -0.056  27.504  1.00 166.58 ? 281 GLY A CA  1 
ATOM   2307 C  C   . GLY A 1 281 ? -5.208  -1.218  28.464  1.00 162.51 ? 281 GLY A C   1 
ATOM   2308 O  O   . GLY A 1 281 ? -4.176  -1.649  28.977  1.00 159.54 ? 281 GLY A O   1 
ATOM   2309 N  N   . GLY A 1 282 ? -6.411  -1.710  28.730  1.00 130.45 ? 282 GLY A N   1 
ATOM   2310 C  CA  . GLY A 1 282 ? -6.591  -2.739  29.736  1.00 126.52 ? 282 GLY A CA  1 
ATOM   2311 C  C   . GLY A 1 282 ? -7.968  -3.371  29.687  1.00 125.51 ? 282 GLY A C   1 
ATOM   2312 O  O   . GLY A 1 282 ? -8.888  -2.947  30.385  1.00 121.64 ? 282 GLY A O   1 
ATOM   2313 N  N   . ALA A 1 307 ? -14.527 -8.193  -0.017  1.00 175.74 ? 307 ALA A N   1 
ATOM   2314 C  CA  . ALA A 1 307 ? -14.394 -8.729  1.337   1.00 174.84 ? 307 ALA A CA  1 
ATOM   2315 C  C   . ALA A 1 307 ? -13.117 -9.612  1.586   1.00 163.71 ? 307 ALA A C   1 
ATOM   2316 O  O   . ALA A 1 307 ? -12.535 -9.567  2.674   1.00 150.53 ? 307 ALA A O   1 
ATOM   2317 C  CB  . ALA A 1 307 ? -15.704 -9.440  1.748   1.00 113.26 ? 307 ALA A CB  1 
ATOM   2318 N  N   . PHE A 1 308 ? -12.688 -10.375 0.568   1.00 187.16 ? 308 PHE A N   1 
ATOM   2319 C  CA  . PHE A 1 308 ? -11.426 -11.178 0.550   1.00 177.79 ? 308 PHE A CA  1 
ATOM   2320 C  C   . PHE A 1 308 ? -11.045 -12.059 1.765   1.00 177.92 ? 308 PHE A C   1 
ATOM   2321 O  O   . PHE A 1 308 ? -10.471 -11.572 2.740   1.00 159.69 ? 308 PHE A O   1 
ATOM   2322 C  CB  . PHE A 1 308 ? -10.219 -10.323 0.124   1.00 137.61 ? 308 PHE A CB  1 
ATOM   2323 C  CG  . PHE A 1 308 ? -10.059 -10.174 -1.380  1.00 143.52 ? 308 PHE A CG  1 
ATOM   2324 C  CD1 . PHE A 1 308 ? -11.096 -9.691  -2.162  1.00 155.71 ? 308 PHE A CD1 1 
ATOM   2325 C  CD2 . PHE A 1 308 ? -8.861  -10.489 -1.998  1.00 137.69 ? 308 PHE A CD2 1 
ATOM   2326 C  CE1 . PHE A 1 308 ? -10.948 -9.545  -3.533  1.00 161.57 ? 308 PHE A CE1 1 
ATOM   2327 C  CE2 . PHE A 1 308 ? -8.709  -10.345 -3.353  1.00 143.98 ? 308 PHE A CE2 1 
ATOM   2328 C  CZ  . PHE A 1 308 ? -9.757  -9.871  -4.128  1.00 155.64 ? 308 PHE A CZ  1 
ATOM   2329 N  N   . MET A 1 309 ? -11.319 -13.365 1.642   1.00 119.67 ? 309 MET A N   1 
ATOM   2330 C  CA  . MET A 1 309 ? -11.128 -14.380 2.696   1.00 119.95 ? 309 MET A CA  1 
ATOM   2331 C  C   . MET A 1 309 ? -10.104 -15.445 2.289   1.00 120.03 ? 309 MET A C   1 
ATOM   2332 O  O   . MET A 1 309 ? -10.145 -15.945 1.169   1.00 140.09 ? 309 MET A O   1 
ATOM   2333 C  CB  . MET A 1 309 ? -12.454 -15.105 2.991   1.00 131.39 ? 309 MET A CB  1 
ATOM   2334 C  CG  . MET A 1 309 ? -13.750 -14.329 2.649   1.00 138.38 ? 309 MET A CG  1 
ATOM   2335 S  SD  . MET A 1 309 ? -15.083 -15.298 1.887   1.00 168.84 ? 309 MET A SD  1 
ATOM   2336 C  CE  . MET A 1 309 ? -15.306 -16.655 3.032   1.00 156.15 ? 309 MET A CE  1 
ATOM   2337 N  N   . TYR A 1 310 ? -9.211  -15.815 3.205   1.00 129.14 ? 310 TYR A N   1 
ATOM   2338 C  CA  . TYR A 1 310 ? -8.145  -16.786 2.920   1.00 127.27 ? 310 TYR A CA  1 
ATOM   2339 C  C   . TYR A 1 310 ? -8.216  -17.985 3.881   1.00 134.24 ? 310 TYR A C   1 
ATOM   2340 O  O   . TYR A 1 310 ? -8.760  -17.861 4.967   1.00 126.24 ? 310 TYR A O   1 
ATOM   2341 C  CB  . TYR A 1 310 ? -6.769  -16.113 3.024   1.00 164.44 ? 310 TYR A CB  1 
ATOM   2342 C  CG  . TYR A 1 310 ? -6.650  -14.785 2.291   1.00 154.29 ? 310 TYR A CG  1 
ATOM   2343 C  CD1 . TYR A 1 310 ? -7.116  -13.607 2.860   1.00 138.43 ? 310 TYR A CD1 1 
ATOM   2344 C  CD2 . TYR A 1 310 ? -6.062  -14.706 1.035   1.00 158.78 ? 310 TYR A CD2 1 
ATOM   2345 C  CE1 . TYR A 1 310 ? -7.015  -12.390 2.189   1.00 132.38 ? 310 TYR A CE1 1 
ATOM   2346 C  CE2 . TYR A 1 310 ? -5.950  -13.494 0.367   1.00 154.18 ? 310 TYR A CE2 1 
ATOM   2347 C  CZ  . TYR A 1 310 ? -6.427  -12.346 0.951   1.00 143.70 ? 310 TYR A CZ  1 
ATOM   2348 O  OH  . TYR A 1 310 ? -6.318  -11.151 0.295   1.00 141.27 ? 310 TYR A OH  1 
ATOM   2349 N  N   . PHE A 1 311 ? -7.672  -19.134 3.481   1.00 143.26 ? 311 PHE A N   1 
ATOM   2350 C  CA  . PHE A 1 311 ? -7.657  -20.360 4.301   1.00 141.54 ? 311 PHE A CA  1 
ATOM   2351 C  C   . PHE A 1 311 ? -7.080  -20.090 5.697   1.00 111.27 ? 311 PHE A C   1 
ATOM   2352 O  O   . PHE A 1 311 ? -6.404  -19.097 5.893   1.00 94.87  ? 311 PHE A O   1 
ATOM   2353 C  CB  . PHE A 1 311 ? -6.831  -21.418 3.564   1.00 121.05 ? 311 PHE A CB  1 
ATOM   2354 C  CG  . PHE A 1 311 ? -6.846  -22.788 4.195   1.00 113.65 ? 311 PHE A CG  1 
ATOM   2355 C  CD1 . PHE A 1 311 ? -7.825  -23.699 3.882   1.00 128.95 ? 311 PHE A CD1 1 
ATOM   2356 C  CD2 . PHE A 1 311 ? -5.839  -23.186 5.055   1.00 94.13  ? 311 PHE A CD2 1 
ATOM   2357 C  CE1 . PHE A 1 311 ? -7.816  -24.964 4.445   1.00 124.20 ? 311 PHE A CE1 1 
ATOM   2358 C  CE2 . PHE A 1 311 ? -5.835  -24.452 5.617   1.00 90.22  ? 311 PHE A CE2 1 
ATOM   2359 C  CZ  . PHE A 1 311 ? -6.820  -25.334 5.314   1.00 104.66 ? 311 PHE A CZ  1 
ATOM   2360 N  N   . ASN A 1 312 ? -7.317  -20.948 6.681   1.00 135.60 ? 312 ASN A N   1 
ATOM   2361 C  CA  . ASN A 1 312 ? -6.910  -20.597 8.052   1.00 109.71 ? 312 ASN A CA  1 
ATOM   2362 C  C   . ASN A 1 312 ? -5.607  -21.245 8.537   1.00 100.84 ? 312 ASN A C   1 
ATOM   2363 O  O   . ASN A 1 312 ? -5.510  -22.455 8.580   1.00 105.05 ? 312 ASN A O   1 
ATOM   2364 C  CB  . ASN A 1 312 ? -8.048  -20.913 9.034   1.00 144.47 ? 312 ASN A CB  1 
ATOM   2365 C  CG  . ASN A 1 312 ? -7.798  -20.350 10.419  1.00 121.46 ? 312 ASN A CG  1 
ATOM   2366 O  OD1 . ASN A 1 312 ? -6.695  -19.898 10.730  1.00 112.03 ? 312 ASN A OD1 1 
ATOM   2367 N  ND2 . ASN A 1 312 ? -8.819  -20.385 11.264  1.00 114.34 ? 312 ASN A ND2 1 
ATOM   2368 N  N   . VAL A 1 313 ? -4.610  -20.462 8.936   1.00 113.42 ? 313 VAL A N   1 
ATOM   2369 C  CA  . VAL A 1 313 ? -3.340  -21.068 9.372   1.00 105.89 ? 313 VAL A CA  1 
ATOM   2370 C  C   . VAL A 1 313 ? -3.399  -21.771 10.714  1.00 90.40  ? 313 VAL A C   1 
ATOM   2371 O  O   . VAL A 1 313 ? -2.353  -22.103 11.269  1.00 82.69  ? 313 VAL A O   1 
ATOM   2372 C  CB  . VAL A 1 313 ? -2.187  -20.042 9.520   1.00 115.00 ? 313 VAL A CB  1 
ATOM   2373 C  CG1 . VAL A 1 313 ? -0.949  -20.502 8.756   1.00 111.77 ? 313 VAL A CG1 1 
ATOM   2374 C  CG2 . VAL A 1 313 ? -2.637  -18.664 9.095   1.00 106.76 ? 313 VAL A CG2 1 
ATOM   2375 N  N   . ASN A 1 314 ? -4.587  -21.977 11.262  1.00 123.80 ? 314 ASN A N   1 
ATOM   2376 C  CA  . ASN A 1 314 ? -4.652  -22.499 12.621  1.00 110.32 ? 314 ASN A CA  1 
ATOM   2377 C  C   . ASN A 1 314 ? -4.821  -24.020 12.708  1.00 116.77 ? 314 ASN A C   1 
ATOM   2378 O  O   . ASN A 1 314 ? -4.246  -24.668 13.591  1.00 109.60 ? 314 ASN A O   1 
ATOM   2379 C  CB  . ASN A 1 314 ? -5.690  -21.742 13.456  1.00 139.52 ? 314 ASN A CB  1 
ATOM   2380 C  CG  . ASN A 1 314 ? -5.211  -20.357 13.868  1.00 129.81 ? 314 ASN A CG  1 
ATOM   2381 O  OD1 . ASN A 1 314 ? -4.063  -20.180 14.270  1.00 122.88 ? 314 ASN A OD1 1 
ATOM   2382 N  ND2 . ASN A 1 314 ? -6.091  -19.369 13.762  1.00 130.61 ? 314 ASN A ND2 1 
ATOM   2383 N  N   . GLU A 1 315 ? -5.588  -24.596 11.788  1.00 115.40 ? 315 GLU A N   1 
ATOM   2384 C  CA  . GLU A 1 315 ? -5.656  -26.050 11.697  1.00 125.19 ? 315 GLU A CA  1 
ATOM   2385 C  C   . GLU A 1 315 ? -4.414  -26.565 10.975  1.00 132.69 ? 315 GLU A C   1 
ATOM   2386 O  O   . GLU A 1 315 ? -4.422  -27.637 10.362  1.00 146.39 ? 315 GLU A O   1 
ATOM   2387 C  CB  . GLU A 1 315 ? -6.942  -26.515 10.996  1.00 160.80 ? 315 GLU A CB  1 
ATOM   2388 C  CG  . GLU A 1 315 ? -7.201  -25.902 9.629   1.00 175.50 ? 315 GLU A CG  1 
ATOM   2389 C  CD  . GLU A 1 315 ? -8.235  -24.796 9.678   1.00 173.95 ? 315 GLU A CD  1 
ATOM   2390 O  OE1 . GLU A 1 315 ? -8.801  -24.453 8.619   1.00 190.25 ? 315 GLU A OE1 1 
ATOM   2391 O  OE2 . GLU A 1 315 ? -8.488  -24.269 10.780  1.00 158.16 ? 315 GLU A OE2 1 
ATOM   2392 N  N   . THR A 1 316 ? -3.339  -25.787 11.064  1.00 73.77  ? 316 THR A N   1 
ATOM   2393 C  CA  . THR A 1 316 ? -2.124  -26.064 10.313  1.00 81.39  ? 316 THR A CA  1 
ATOM   2394 C  C   . THR A 1 316 ? -0.876  -26.034 11.183  1.00 71.40  ? 316 THR A C   1 
ATOM   2395 O  O   . THR A 1 316 ? 0.114   -26.584 10.783  1.00 74.47  ? 316 THR A O   1 
ATOM   2396 C  CB  . THR A 1 316 ? -1.989  -25.156 9.012   1.00 75.11  ? 316 THR A CB  1 
ATOM   2397 O  OG1 . THR A 1 316 ? -2.542  -25.844 7.882   1.00 88.15  ? 316 THR A OG1 1 
ATOM   2398 C  CG2 . THR A 1 316 ? -0.533  -24.776 8.692   1.00 73.66  ? 316 THR A CG2 1 
ATOM   2399 N  N   . ILE A 1 317 ? -0.914  -25.453 12.375  1.00 103.51 ? 317 ILE A N   1 
ATOM   2400 C  CA  . ILE A 1 317 ? 0.330   -25.297 13.147  1.00 92.03  ? 317 ILE A CA  1 
ATOM   2401 C  C   . ILE A 1 317 ? 0.639   -26.458 14.093  1.00 88.14  ? 317 ILE A C   1 
ATOM   2402 O  O   . ILE A 1 317 ? -0.193  -26.790 14.905  1.00 83.45  ? 317 ILE A O   1 
ATOM   2403 C  CB  . ILE A 1 317 ? 0.284   -24.015 13.970  1.00 100.78 ? 317 ILE A CB  1 
ATOM   2404 C  CG1 . ILE A 1 317 ? -0.050  -22.834 13.051  1.00 103.29 ? 317 ILE A CG1 1 
ATOM   2405 C  CG2 . ILE A 1 317 ? 1.585   -23.837 14.750  1.00 87.94  ? 317 ILE A CG2 1 
ATOM   2406 C  CD1 . ILE A 1 317 ? 0.837   -21.629 13.247  1.00 81.93  ? 317 ILE A CD1 1 
ATOM   2407 N  N   . MET A 1 318 ? 1.819   -27.068 14.020  1.00 90.07  ? 318 MET A N   1 
ATOM   2408 C  CA  . MET A 1 318 ? 2.045   -28.308 14.784  1.00 90.23  ? 318 MET A CA  1 
ATOM   2409 C  C   . MET A 1 318 ? 1.844   -28.122 16.272  1.00 77.84  ? 318 MET A C   1 
ATOM   2410 O  O   . MET A 1 318 ? 1.162   -28.899 16.954  1.00 79.97  ? 318 MET A O   1 
ATOM   2411 C  CB  . MET A 1 318 ? 3.477   -28.799 14.630  1.00 102.79 ? 318 MET A CB  1 
ATOM   2412 C  CG  . MET A 1 318 ? 3.923   -29.188 13.259  1.00 117.25 ? 318 MET A CG  1 
ATOM   2413 S  SD  . MET A 1 318 ? 5.343   -30.244 13.528  1.00 117.44 ? 318 MET A SD  1 
ATOM   2414 C  CE  . MET A 1 318 ? 4.584   -31.577 14.447  1.00 123.04 ? 318 MET A CE  1 
ATOM   2415 N  N   . GLU A 1 319 ? 2.540   -27.095 16.740  1.00 106.62 ? 319 GLU A N   1 
ATOM   2416 C  CA  . GLU A 1 319 ? 2.642   -26.628 18.108  1.00 100.52 ? 319 GLU A CA  1 
ATOM   2417 C  C   . GLU A 1 319 ? 1.276   -26.424 18.777  1.00 100.19 ? 319 GLU A C   1 
ATOM   2418 O  O   . GLU A 1 319 ? 1.157   -26.312 19.995  1.00 98.86  ? 319 GLU A O   1 
ATOM   2419 C  CB  . GLU A 1 319 ? 3.407   -25.309 18.013  1.00 144.15 ? 319 GLU A CB  1 
ATOM   2420 C  CG  . GLU A 1 319 ? 3.623   -24.551 19.265  1.00 138.48 ? 319 GLU A CG  1 
ATOM   2421 C  CD  . GLU A 1 319 ? 4.165   -23.174 18.984  1.00 122.40 ? 319 GLU A CD  1 
ATOM   2422 O  OE1 . GLU A 1 319 ? 3.535   -22.442 18.186  1.00 119.67 ? 319 GLU A OE1 1 
ATOM   2423 O  OE2 . GLU A 1 319 ? 5.218   -22.826 19.563  1.00 113.84 ? 319 GLU A OE2 1 
ATOM   2424 N  N   . VAL A 1 320 ? 0.233   -26.399 17.971  1.00 111.50 ? 320 VAL A N   1 
ATOM   2425 C  CA  . VAL A 1 320 ? -1.072  -26.032 18.472  1.00 111.28 ? 320 VAL A CA  1 
ATOM   2426 C  C   . VAL A 1 320 ? -2.153  -27.069 18.060  1.00 118.34 ? 320 VAL A C   1 
ATOM   2427 O  O   . VAL A 1 320 ? -3.362  -26.811 18.107  1.00 120.25 ? 320 VAL A O   1 
ATOM   2428 C  CB  . VAL A 1 320 ? -1.368  -24.594 18.034  1.00 97.62  ? 320 VAL A CB  1 
ATOM   2429 C  CG1 . VAL A 1 320 ? -2.301  -24.564 16.836  1.00 100.48 ? 320 VAL A CG1 1 
ATOM   2430 C  CG2 . VAL A 1 320 ? -1.880  -23.791 19.199  1.00 93.00  ? 320 VAL A CG2 1 
ATOM   2431 N  N   . ASN A 1 321 ? -1.678  -28.255 17.676  1.00 122.50 ? 321 ASN A N   1 
ATOM   2432 C  CA  . ASN A 1 321 ? -2.514  -29.418 17.404  1.00 134.71 ? 321 ASN A CA  1 
ATOM   2433 C  C   . ASN A 1 321 ? -3.162  -29.808 18.728  1.00 134.51 ? 321 ASN A C   1 
ATOM   2434 O  O   . ASN A 1 321 ? -2.835  -29.217 19.750  1.00 128.33 ? 321 ASN A O   1 
ATOM   2435 C  CB  . ASN A 1 321 ? -1.631  -30.557 16.866  1.00 121.08 ? 321 ASN A CB  1 
ATOM   2436 C  CG  . ASN A 1 321 ? -2.430  -31.662 16.197  1.00 137.54 ? 321 ASN A CG  1 
ATOM   2437 O  OD1 . ASN A 1 321 ? -3.590  -31.473 15.834  1.00 142.36 ? 321 ASN A OD1 1 
ATOM   2438 N  ND2 . ASN A 1 321 ? -1.806  -32.826 16.026  1.00 147.61 ? 321 ASN A ND2 1 
ATOM   2439 N  N   . THR A 1 322 ? -4.054  -30.797 18.730  1.00 89.32  ? 322 THR A N   1 
ATOM   2440 C  CA  . THR A 1 322 ? -4.792  -31.160 19.947  1.00 92.64  ? 322 THR A CA  1 
ATOM   2441 C  C   . THR A 1 322 ? -4.260  -32.362 20.733  1.00 100.46 ? 322 THR A C   1 
ATOM   2442 O  O   . THR A 1 322 ? -3.166  -32.854 20.476  1.00 99.98  ? 322 THR A O   1 
ATOM   2443 C  CB  . THR A 1 322 ? -6.232  -31.428 19.606  1.00 115.49 ? 322 THR A CB  1 
ATOM   2444 O  OG1 . THR A 1 322 ? -6.501  -30.836 18.333  1.00 114.96 ? 322 THR A OG1 1 
ATOM   2445 C  CG2 . THR A 1 322 ? -7.137  -30.828 20.674  1.00 114.81 ? 322 THR A CG2 1 
ATOM   2446 N  N   . ILE A 1 323 ? -5.021  -32.836 21.712  1.00 93.21  ? 323 ILE A N   1 
ATOM   2447 C  CA  . ILE A 1 323 ? -4.586  -34.051 22.381  1.00 103.51 ? 323 ILE A CA  1 
ATOM   2448 C  C   . ILE A 1 323 ? -5.684  -35.031 22.856  1.00 120.09 ? 323 ILE A C   1 
ATOM   2449 O  O   . ILE A 1 323 ? -6.845  -34.647 23.074  1.00 122.73 ? 323 ILE A O   1 
ATOM   2450 C  CB  . ILE A 1 323 ? -3.640  -33.744 23.545  1.00 129.86 ? 323 ILE A CB  1 
ATOM   2451 C  CG1 . ILE A 1 323 ? -2.689  -32.615 23.198  1.00 114.82 ? 323 ILE A CG1 1 
ATOM   2452 C  CG2 . ILE A 1 323 ? -2.797  -34.944 23.840  1.00 138.85 ? 323 ILE A CG2 1 
ATOM   2453 C  CD1 . ILE A 1 323 ? -1.255  -32.951 23.521  1.00 110.80 ? 323 ILE A CD1 1 
ATOM   2454 N  N   . ASP A 1 324 ? -5.290  -36.306 22.972  1.00 150.31 ? 324 ASP A N   1 
ATOM   2455 C  CA  . ASP A 1 324 ? -6.059  -37.328 23.671  1.00 169.03 ? 324 ASP A CA  1 
ATOM   2456 C  C   . ASP A 1 324 ? -5.674  -37.177 25.114  1.00 171.97 ? 324 ASP A C   1 
ATOM   2457 O  O   . ASP A 1 324 ? -4.500  -37.265 25.443  1.00 168.54 ? 324 ASP A O   1 
ATOM   2458 C  CB  . ASP A 1 324 ? -5.651  -38.735 23.235  1.00 300.27 ? 324 ASP A CB  1 
ATOM   2459 C  CG  . ASP A 1 324 ? -5.555  -38.883 21.740  1.00 301.52 ? 324 ASP A CG  1 
ATOM   2460 O  OD1 . ASP A 1 324 ? -6.283  -38.176 21.016  1.00 296.97 ? 324 ASP A OD1 1 
ATOM   2461 O  OD2 . ASP A 1 324 ? -4.745  -39.718 21.290  1.00 309.35 ? 324 ASP A OD2 1 
ATOM   2462 N  N   . PRO A 1 325 ? -6.660  -36.970 25.987  1.00 119.92 ? 325 PRO A N   1 
ATOM   2463 C  CA  . PRO A 1 325 ? -6.387  -36.689 27.406  1.00 116.77 ? 325 PRO A CA  1 
ATOM   2464 C  C   . PRO A 1 325 ? -5.289  -37.582 27.992  1.00 120.96 ? 325 PRO A C   1 
ATOM   2465 O  O   . PRO A 1 325 ? -4.703  -37.205 29.001  1.00 117.32 ? 325 PRO A O   1 
ATOM   2466 C  CB  . PRO A 1 325 ? -7.743  -36.942 28.096  1.00 75.12  ? 325 PRO A CB  1 
ATOM   2467 C  CG  . PRO A 1 325 ? -8.599  -37.658 27.050  1.00 84.10  ? 325 PRO A CG  1 
ATOM   2468 C  CD  . PRO A 1 325 ? -8.093  -37.185 25.720  1.00 77.92  ? 325 PRO A CD  1 
ATOM   2469 N  N   . GLU A 1 326 ? -5.024  -38.733 27.371  1.00 97.86  ? 326 GLU A N   1 
ATOM   2470 C  CA  . GLU A 1 326 ? -3.907  -39.587 27.761  1.00 102.23 ? 326 GLU A CA  1 
ATOM   2471 C  C   . GLU A 1 326 ? -2.635  -38.766 27.751  1.00 90.63  ? 326 GLU A C   1 
ATOM   2472 O  O   . GLU A 1 326 ? -1.945  -38.630 28.760  1.00 89.03  ? 326 GLU A O   1 
ATOM   2473 C  CB  . GLU A 1 326 ? -3.753  -40.753 26.778  1.00 156.62 ? 326 GLU A CB  1 
ATOM   2474 C  CG  . GLU A 1 326 ? -4.522  -42.018 27.145  1.00 172.43 ? 326 GLU A CG  1 
ATOM   2475 C  CD  . GLU A 1 326 ? -3.608  -43.191 27.483  1.00 182.71 ? 326 GLU A CD  1 
ATOM   2476 O  OE1 . GLU A 1 326 ? -2.373  -43.054 27.337  1.00 177.63 ? 326 GLU A OE1 1 
ATOM   2477 O  OE2 . GLU A 1 326 ? -4.126  -44.251 27.896  1.00 194.01 ? 326 GLU A OE2 1 
ATOM   2478 N  N   . VAL A 1 327 ? -2.332  -38.214 26.586  1.00 107.83 ? 327 VAL A N   1 
ATOM   2479 C  CA  . VAL A 1 327 ? -1.151  -37.394 26.421  1.00 97.45  ? 327 VAL A CA  1 
ATOM   2480 C  C   . VAL A 1 327 ? -1.326  -36.073 27.139  1.00 87.06  ? 327 VAL A C   1 
ATOM   2481 O  O   . VAL A 1 327 ? -0.365  -35.409 27.445  1.00 79.61  ? 327 VAL A O   1 
ATOM   2482 C  CB  . VAL A 1 327 ? -0.845  -37.077 24.943  1.00 93.06  ? 327 VAL A CB  1 
ATOM   2483 C  CG1 . VAL A 1 327 ? 0.647   -37.118 24.703  1.00 89.64  ? 327 VAL A CG1 1 
ATOM   2484 C  CG2 . VAL A 1 327 ? -1.574  -38.023 24.001  1.00 104.31 ? 327 VAL A CG2 1 
ATOM   2485 N  N   . PHE A 1 328 ? -2.550  -35.647 27.379  1.00 112.53 ? 328 PHE A N   1 
ATOM   2486 C  CA  . PHE A 1 328 ? -2.694  -34.447 28.165  1.00 104.37 ? 328 PHE A CA  1 
ATOM   2487 C  C   . PHE A 1 328 ? -1.977  -34.760 29.481  1.00 106.93 ? 328 PHE A C   1 
ATOM   2488 O  O   . PHE A 1 328 ? -0.902  -34.188 29.792  1.00 100.28 ? 328 PHE A O   1 
ATOM   2489 C  CB  . PHE A 1 328 ? -4.167  -34.109 28.365  1.00 101.03 ? 328 PHE A CB  1 
ATOM   2490 C  CG  . PHE A 1 328 ? -4.387  -32.867 29.147  1.00 93.62  ? 328 PHE A CG  1 
ATOM   2491 C  CD1 . PHE A 1 328 ? -3.963  -31.650 28.657  1.00 82.73  ? 328 PHE A CD1 1 
ATOM   2492 C  CD2 . PHE A 1 328 ? -4.999  -32.912 30.384  1.00 98.87  ? 328 PHE A CD2 1 
ATOM   2493 C  CE1 . PHE A 1 328 ? -4.153  -30.497 29.383  1.00 76.72  ? 328 PHE A CE1 1 
ATOM   2494 C  CE2 . PHE A 1 328 ? -5.194  -31.766 31.110  1.00 93.36  ? 328 PHE A CE2 1 
ATOM   2495 C  CZ  . PHE A 1 328 ? -4.766  -30.559 30.607  1.00 82.00  ? 328 PHE A CZ  1 
ATOM   2496 N  N   . MET A 1 329 ? -2.540  -35.711 30.225  1.00 117.86 ? 329 MET A N   1 
ATOM   2497 C  CA  . MET A 1 329 ? -1.944  -36.114 31.483  1.00 117.35 ? 329 MET A CA  1 
ATOM   2498 C  C   . MET A 1 329 ? -0.462  -36.240 31.259  1.00 110.75 ? 329 MET A C   1 
ATOM   2499 O  O   . MET A 1 329 ? 0.289   -35.525 31.887  1.00 101.60 ? 329 MET A O   1 
ATOM   2500 C  CB  . MET A 1 329 ? -2.493  -37.437 32.000  1.00 98.43  ? 329 MET A CB  1 
ATOM   2501 C  CG  . MET A 1 329 ? -3.799  -37.860 31.382  1.00 110.31 ? 329 MET A CG  1 
ATOM   2502 S  SD  . MET A 1 329 ? -5.165  -37.888 32.541  1.00 116.50 ? 329 MET A SD  1 
ATOM   2503 C  CE  . MET A 1 329 ? -4.420  -38.796 33.867  1.00 113.23 ? 329 MET A CE  1 
ATOM   2504 N  N   . GLN A 1 330 ? -0.041  -37.115 30.343  1.00 105.00 ? 330 GLN A N   1 
ATOM   2505 C  CA  . GLN A 1 330 ? 1.399   -37.367 30.124  1.00 100.71 ? 330 GLN A CA  1 
ATOM   2506 C  C   . GLN A 1 330 ? 2.222   -36.102 30.035  1.00 91.11  ? 330 GLN A C   1 
ATOM   2507 O  O   . GLN A 1 330 ? 2.953   -35.786 30.949  1.00 83.36  ? 330 GLN A O   1 
ATOM   2508 C  CB  . GLN A 1 330 ? 1.639   -38.195 28.874  1.00 102.82 ? 330 GLN A CB  1 
ATOM   2509 C  CG  . GLN A 1 330 ? 1.398   -39.665 29.071  1.00 107.85 ? 330 GLN A CG  1 
ATOM   2510 C  CD  . GLN A 1 330 ? 1.223   -40.363 27.761  1.00 122.03 ? 330 GLN A CD  1 
ATOM   2511 O  OE1 . GLN A 1 330 ? 1.852   -39.994 26.772  1.00 121.89 ? 330 GLN A OE1 1 
ATOM   2512 N  NE2 . GLN A 1 330 ? 0.346   -41.363 27.730  1.00 130.98 ? 330 GLN A NE2 1 
ATOM   2513 N  N   . ARG A 1 331 ? 2.129   -35.408 28.912  1.00 96.97  ? 331 ARG A N   1 
ATOM   2514 C  CA  . ARG A 1 331 ? 2.624   -34.042 28.765  1.00 85.89  ? 331 ARG A CA  1 
ATOM   2515 C  C   . ARG A 1 331 ? 2.702   -33.229 30.069  1.00 80.67  ? 331 ARG A C   1 
ATOM   2516 O  O   . ARG A 1 331 ? 3.740   -32.620 30.373  1.00 74.67  ? 331 ARG A O   1 
ATOM   2517 C  CB  . ARG A 1 331 ? 1.779   -33.284 27.740  1.00 79.84  ? 331 ARG A CB  1 
ATOM   2518 C  CG  . ARG A 1 331 ? 2.069   -33.638 26.303  1.00 80.73  ? 331 ARG A CG  1 
ATOM   2519 C  CD  . ARG A 1 331 ? 1.532   -32.566 25.398  1.00 74.64  ? 331 ARG A CD  1 
ATOM   2520 N  NE  . ARG A 1 331 ? 2.523   -31.959 24.493  1.00 70.42  ? 331 ARG A NE  1 
ATOM   2521 C  CZ  . ARG A 1 331 ? 3.005   -30.714 24.606  1.00 62.18  ? 331 ARG A CZ  1 
ATOM   2522 N  NH1 . ARG A 1 331 ? 2.615   -29.962 25.618  1.00 57.08  ? 331 ARG A NH1 1 
ATOM   2523 N  NH2 . ARG A 1 331 ? 3.869   -30.208 23.721  1.00 60.28  ? 331 ARG A NH2 1 
ATOM   2524 N  N   . ILE A 1 332 ? 1.620   -33.193 30.844  1.00 98.83  ? 332 ILE A N   1 
ATOM   2525 C  CA  . ILE A 1 332 ? 1.718   -32.419 32.088  1.00 92.37  ? 332 ILE A CA  1 
ATOM   2526 C  C   . ILE A 1 332 ? 2.581   -33.059 33.192  1.00 89.45  ? 332 ILE A C   1 
ATOM   2527 O  O   . ILE A 1 332 ? 3.304   -32.352 33.891  1.00 81.35  ? 332 ILE A O   1 
ATOM   2528 C  CB  . ILE A 1 332 ? 0.355   -32.013 32.616  1.00 76.35  ? 332 ILE A CB  1 
ATOM   2529 C  CG1 . ILE A 1 332 ? -0.197  -30.896 31.746  1.00 73.85  ? 332 ILE A CG1 1 
ATOM   2530 C  CG2 . ILE A 1 332 ? 0.453   -31.545 34.045  1.00 75.38  ? 332 ILE A CG2 1 
ATOM   2531 C  CD1 . ILE A 1 332 ? -1.696  -30.719 31.864  1.00 77.04  ? 332 ILE A CD1 1 
ATOM   2532 N  N   . SER A 1 333 ? 2.529   -34.386 33.331  1.00 110.48 ? 333 SER A N   1 
ATOM   2533 C  CA  . SER A 1 333 ? 3.283   -35.090 34.383  1.00 105.53 ? 333 SER A CA  1 
ATOM   2534 C  C   . SER A 1 333 ? 4.077   -36.371 33.987  1.00 106.71 ? 333 SER A C   1 
ATOM   2535 O  O   . SER A 1 333 ? 4.834   -36.899 34.797  1.00 102.25 ? 333 SER A O   1 
ATOM   2536 C  CB  . SER A 1 333 ? 2.404   -35.327 35.631  1.00 103.88 ? 333 SER A CB  1 
ATOM   2537 O  OG  . SER A 1 333 ? 1.032   -35.491 35.309  1.00 111.23 ? 333 SER A OG  1 
ATOM   2538 N  N   . SER A 1 334 ? 3.923   -36.852 32.755  1.00 134.83 ? 334 SER A N   1 
ATOM   2539 C  CA  . SER A 1 334 ? 4.670   -38.016 32.267  1.00 137.43 ? 334 SER A CA  1 
ATOM   2540 C  C   . SER A 1 334 ? 4.229   -39.293 32.939  1.00 141.35 ? 334 SER A C   1 
ATOM   2541 O  O   . SER A 1 334 ? 5.076   -40.066 33.376  1.00 138.10 ? 334 SER A O   1 
ATOM   2542 C  CB  . SER A 1 334 ? 6.172   -37.865 32.536  1.00 113.58 ? 334 SER A CB  1 
ATOM   2543 O  OG  . SER A 1 334 ? 6.726   -36.756 31.864  1.00 112.61 ? 334 SER A OG  1 
ATOM   2544 N  N   . SER A 1 335 ? 2.921   -39.513 33.031  1.00 116.55 ? 335 SER A N   1 
ATOM   2545 C  CA  . SER A 1 335 ? 2.394   -40.663 33.767  1.00 121.58 ? 335 SER A CA  1 
ATOM   2546 C  C   . SER A 1 335 ? 0.984   -40.446 34.318  1.00 126.73 ? 335 SER A C   1 
ATOM   2547 O  O   . SER A 1 335 ? 0.819   -39.797 35.351  1.00 121.53 ? 335 SER A O   1 
ATOM   2548 C  CB  . SER A 1 335 ? 3.321   -41.008 34.930  1.00 201.79 ? 335 SER A CB  1 
ATOM   2549 O  OG  . SER A 1 335 ? 2.873   -42.164 35.606  1.00 206.69 ? 335 SER A OG  1 
ATOM   2550 N  N   . VAL A 1 336 ? -0.026  -41.009 33.655  1.00 97.09  ? 336 VAL A N   1 
ATOM   2551 C  CA  . VAL A 1 336 ? -1.418  -40.834 34.093  1.00 104.32 ? 336 VAL A CA  1 
ATOM   2552 C  C   . VAL A 1 336 ? -1.676  -41.061 35.596  1.00 103.23 ? 336 VAL A C   1 
ATOM   2553 O  O   . VAL A 1 336 ? -2.364  -40.282 36.234  1.00 104.41 ? 336 VAL A O   1 
ATOM   2554 C  CB  . VAL A 1 336 ? -2.391  -41.694 33.261  1.00 72.65  ? 336 VAL A CB  1 
ATOM   2555 C  CG1 . VAL A 1 336 ? -3.763  -41.730 33.911  1.00 81.04  ? 336 VAL A CG1 1 
ATOM   2556 C  CG2 . VAL A 1 336 ? -2.485  -41.145 31.863  1.00 76.89  ? 336 VAL A CG2 1 
ATOM   2557 N  N   . LEU A 1 337 ? -1.124  -42.131 36.149  1.00 95.54  ? 337 LEU A N   1 
ATOM   2558 C  CA  . LEU A 1 337 ? -1.267  -42.438 37.570  1.00 96.04  ? 337 LEU A CA  1 
ATOM   2559 C  C   . LEU A 1 337 ? -0.732  -41.267 38.386  1.00 86.28  ? 337 LEU A C   1 
ATOM   2560 O  O   . LEU A 1 337 ? -1.375  -40.801 39.340  1.00 88.86  ? 337 LEU A O   1 
ATOM   2561 C  CB  . LEU A 1 337 ? -0.540  -43.773 37.881  1.00 105.18 ? 337 LEU A CB  1 
ATOM   2562 C  CG  . LEU A 1 337 ? -0.262  -44.417 39.251  1.00 108.63 ? 337 LEU A CG  1 
ATOM   2563 C  CD1 . LEU A 1 337 ? 1.251   -44.363 39.562  1.00 102.17 ? 337 LEU A CD1 1 
ATOM   2564 C  CD2 . LEU A 1 337 ? -1.115  -43.838 40.395  1.00 113.44 ? 337 LEU A CD2 1 
ATOM   2565 N  N   . VAL A 1 338 ? 0.430   -40.770 37.972  1.00 121.98 ? 338 VAL A N   1 
ATOM   2566 C  CA  . VAL A 1 338 ? 1.072   -39.633 38.618  1.00 112.87 ? 338 VAL A CA  1 
ATOM   2567 C  C   . VAL A 1 338 ? 0.249   -38.356 38.449  1.00 113.11 ? 338 VAL A C   1 
ATOM   2568 O  O   . VAL A 1 338 ? 0.278   -37.485 39.297  1.00 110.05 ? 338 VAL A O   1 
ATOM   2569 C  CB  . VAL A 1 338 ? 2.495   -39.417 38.073  1.00 103.18 ? 338 VAL A CB  1 
ATOM   2570 C  CG1 . VAL A 1 338 ? 3.196   -38.335 38.838  1.00 94.52  ? 338 VAL A CG1 1 
ATOM   2571 C  CG2 . VAL A 1 338 ? 3.283   -40.675 38.195  1.00 104.67 ? 338 VAL A CG2 1 
ATOM   2572 N  N   . PHE A 1 339 ? -0.482  -38.251 37.347  1.00 100.43 ? 339 PHE A N   1 
ATOM   2573 C  CA  . PHE A 1 339 ? -1.354  -37.109 37.110  1.00 102.54 ? 339 PHE A CA  1 
ATOM   2574 C  C   . PHE A 1 339 ? -2.513  -37.158 38.089  1.00 110.01 ? 339 PHE A C   1 
ATOM   2575 O  O   . PHE A 1 339 ? -2.877  -36.151 38.677  1.00 108.63 ? 339 PHE A O   1 
ATOM   2576 C  CB  . PHE A 1 339 ? -1.863  -37.153 35.670  1.00 102.69 ? 339 PHE A CB  1 
ATOM   2577 C  CG  . PHE A 1 339 ? -2.704  -35.985 35.281  1.00 105.67 ? 339 PHE A CG  1 
ATOM   2578 C  CD1 . PHE A 1 339 ? -2.126  -34.838 34.823  1.00 98.28  ? 339 PHE A CD1 1 
ATOM   2579 C  CD2 . PHE A 1 339 ? -4.075  -36.049 35.352  1.00 115.89 ? 339 PHE A CD2 1 
ATOM   2580 C  CE1 . PHE A 1 339 ? -2.897  -33.778 34.462  1.00 97.89  ? 339 PHE A CE1 1 
ATOM   2581 C  CE2 . PHE A 1 339 ? -4.850  -34.990 34.986  1.00 115.55 ? 339 PHE A CE2 1 
ATOM   2582 C  CZ  . PHE A 1 339 ? -4.265  -33.857 34.544  1.00 106.55 ? 339 PHE A CZ  1 
ATOM   2583 N  N   . ILE A 1 340 ? -3.086  -38.343 38.268  1.00 105.04 ? 340 ILE A N   1 
ATOM   2584 C  CA  . ILE A 1 340 ? -4.210  -38.512 39.179  1.00 114.56 ? 340 ILE A CA  1 
ATOM   2585 C  C   . ILE A 1 340 ? -3.732  -38.322 40.603  1.00 111.23 ? 340 ILE A C   1 
ATOM   2586 O  O   . ILE A 1 340 ? -4.528  -37.987 41.478  1.00 117.87 ? 340 ILE A O   1 
ATOM   2587 C  CB  . ILE A 1 340 ? -4.886  -39.921 39.107  1.00 79.33  ? 340 ILE A CB  1 
ATOM   2588 C  CG1 . ILE A 1 340 ? -4.449  -40.732 37.869  1.00 79.66  ? 340 ILE A CG1 1 
ATOM   2589 C  CG2 . ILE A 1 340 ? -6.397  -39.791 39.228  1.00 92.68  ? 340 ILE A CG2 1 
ATOM   2590 C  CD1 . ILE A 1 340 ? -5.507  -40.909 36.785  1.00 94.07  ? 340 ILE A CD1 1 
ATOM   2591 N  N   . LEU A 1 341 ? -2.443  -38.564 40.853  1.00 124.70 ? 341 LEU A N   1 
ATOM   2592 C  CA  . LEU A 1 341 ? -1.915  -38.372 42.213  1.00 122.51 ? 341 LEU A CA  1 
ATOM   2593 C  C   . LEU A 1 341 ? -1.675  -36.892 42.492  1.00 114.97 ? 341 LEU A C   1 
ATOM   2594 O  O   . LEU A 1 341 ? -1.931  -36.372 43.590  1.00 117.40 ? 341 LEU A O   1 
ATOM   2595 C  CB  . LEU A 1 341 ? -0.623  -39.173 42.420  1.00 93.55  ? 341 LEU A CB  1 
ATOM   2596 C  CG  . LEU A 1 341 ? -0.792  -40.684 42.642  1.00 102.36 ? 341 LEU A CG  1 
ATOM   2597 C  CD1 . LEU A 1 341 ? 0.485   -41.274 43.192  1.00 98.73  ? 341 LEU A CD1 1 
ATOM   2598 C  CD2 . LEU A 1 341 ? -1.962  -40.950 43.575  1.00 114.50 ? 341 LEU A CD2 1 
ATOM   2599 N  N   . SER A 1 342 ? -1.195  -36.229 41.450  1.00 117.42 ? 342 SER A N   1 
ATOM   2600 C  CA  . SER A 1 342 ? -0.830  -34.826 41.461  1.00 109.95 ? 342 SER A CA  1 
ATOM   2601 C  C   . SER A 1 342 ? -2.061  -33.944 41.589  1.00 116.30 ? 342 SER A C   1 
ATOM   2602 O  O   . SER A 1 342 ? -2.040  -32.998 42.350  1.00 114.72 ? 342 SER A O   1 
ATOM   2603 C  CB  . SER A 1 342 ? -0.053  -34.470 40.186  1.00 107.74 ? 342 SER A CB  1 
ATOM   2604 O  OG  . SER A 1 342 ? 1.241   -35.050 40.170  1.00 101.39 ? 342 SER A OG  1 
ATOM   2605 N  N   . PHE A 1 343 ? -3.125  -34.243 40.849  1.00 109.43 ? 343 PHE A N   1 
ATOM   2606 C  CA  . PHE A 1 343 ? -4.345  -33.444 40.938  1.00 116.56 ? 343 PHE A CA  1 
ATOM   2607 C  C   . PHE A 1 343 ? -4.868  -33.407 42.377  1.00 123.42 ? 343 PHE A C   1 
ATOM   2608 O  O   . PHE A 1 343 ? -5.201  -32.340 42.932  1.00 124.68 ? 343 PHE A O   1 
ATOM   2609 C  CB  . PHE A 1 343 ? -5.405  -33.995 39.997  1.00 105.45 ? 343 PHE A CB  1 
ATOM   2610 C  CG  . PHE A 1 343 ? -6.533  -33.050 39.746  1.00 112.23 ? 343 PHE A CG  1 
ATOM   2611 C  CD1 . PHE A 1 343 ? -6.293  -31.780 39.262  1.00 104.58 ? 343 PHE A CD1 1 
ATOM   2612 C  CD2 . PHE A 1 343 ? -7.842  -33.430 39.975  1.00 125.43 ? 343 PHE A CD2 1 
ATOM   2613 C  CE1 . PHE A 1 343 ? -7.341  -30.903 39.020  1.00 107.57 ? 343 PHE A CE1 1 
ATOM   2614 C  CE2 . PHE A 1 343 ? -8.893  -32.556 39.732  1.00 128.52 ? 343 PHE A CE2 1 
ATOM   2615 C  CZ  . PHE A 1 343 ? -8.641  -31.297 39.255  1.00 119.52 ? 343 PHE A CZ  1 
ATOM   2616 N  N   . ILE A 1 344 ? -4.918  -34.592 42.976  1.00 106.23 ? 344 ILE A N   1 
ATOM   2617 C  CA  . ILE A 1 344 ? -5.310  -34.776 44.370  1.00 114.20 ? 344 ILE A CA  1 
ATOM   2618 C  C   . ILE A 1 344 ? -4.387  -34.005 45.301  1.00 106.88 ? 344 ILE A C   1 
ATOM   2619 O  O   . ILE A 1 344 ? -4.855  -33.245 46.143  1.00 111.23 ? 344 ILE A O   1 
ATOM   2620 C  CB  . ILE A 1 344 ? -5.283  -36.281 44.765  1.00 95.72  ? 344 ILE A CB  1 
ATOM   2621 C  CG1 . ILE A 1 344 ? -6.407  -37.049 44.061  1.00 106.22 ? 344 ILE A CG1 1 
ATOM   2622 C  CG2 . ILE A 1 344 ? -5.365  -36.440 46.282  1.00 103.41 ? 344 ILE A CG2 1 
ATOM   2623 C  CD1 . ILE A 1 344 ? -6.182  -38.519 43.999  1.00 109.60 ? 344 ILE A CD1 1 
ATOM   2624 N  N   . GLY A 1 345 ? -3.079  -34.209 45.146  1.00 146.15 ? 345 GLY A N   1 
ATOM   2625 C  CA  . GLY A 1 345 ? -2.097  -33.502 45.952  1.00 139.27 ? 345 GLY A CA  1 
ATOM   2626 C  C   . GLY A 1 345 ? -2.283  -31.996 45.904  1.00 135.87 ? 345 GLY A C   1 
ATOM   2627 O  O   . GLY A 1 345 ? -2.054  -31.285 46.889  1.00 137.19 ? 345 GLY A O   1 
ATOM   2628 N  N   . PHE A 1 346 ? -2.709  -31.512 44.744  1.00 115.18 ? 346 PHE A N   1 
ATOM   2629 C  CA  . PHE A 1 346 ? -2.958  -30.099 44.520  1.00 112.99 ? 346 PHE A CA  1 
ATOM   2630 C  C   . PHE A 1 346 ? -4.222  -29.651 45.237  1.00 124.74 ? 346 PHE A C   1 
ATOM   2631 O  O   . PHE A 1 346 ? -4.249  -28.588 45.839  1.00 125.67 ? 346 PHE A O   1 
ATOM   2632 C  CB  . PHE A 1 346 ? -3.077  -29.789 43.030  1.00 98.64  ? 346 PHE A CB  1 
ATOM   2633 C  CG  . PHE A 1 346 ? -3.538  -28.396 42.757  1.00 98.12  ? 346 PHE A CG  1 
ATOM   2634 C  CD1 . PHE A 1 346 ? -2.651  -27.338 42.795  1.00 89.67  ? 346 PHE A CD1 1 
ATOM   2635 C  CD2 . PHE A 1 346 ? -4.869  -28.134 42.499  1.00 107.14 ? 346 PHE A CD2 1 
ATOM   2636 C  CE1 . PHE A 1 346 ? -3.083  -26.048 42.566  1.00 89.91  ? 346 PHE A CE1 1 
ATOM   2637 C  CE2 . PHE A 1 346 ? -5.305  -26.834 42.262  1.00 107.47 ? 346 PHE A CE2 1 
ATOM   2638 C  CZ  . PHE A 1 346 ? -4.410  -25.795 42.299  1.00 98.76  ? 346 PHE A CZ  1 
ATOM   2639 N  N   . ILE A 1 347 ? -5.272  -30.464 45.147  1.00 73.68  ? 347 ILE A N   1 
ATOM   2640 C  CA  . ILE A 1 347 ? -6.518  -30.228 45.894  1.00 87.13  ? 347 ILE A CA  1 
ATOM   2641 C  C   . ILE A 1 347 ? -6.334  -30.149 47.406  1.00 92.94  ? 347 ILE A C   1 
ATOM   2642 O  O   . ILE A 1 347 ? -6.794  -29.220 48.051  1.00 100.18 ? 347 ILE A O   1 
ATOM   2643 C  CB  . ILE A 1 347 ? -7.537  -31.338 45.634  1.00 118.59 ? 347 ILE A CB  1 
ATOM   2644 C  CG1 . ILE A 1 347 ? -8.163  -31.168 44.251  1.00 119.64 ? 347 ILE A CG1 1 
ATOM   2645 C  CG2 . ILE A 1 347 ? -8.587  -31.319 46.718  1.00 133.19 ? 347 ILE A CG2 1 
ATOM   2646 C  CD1 . ILE A 1 347 ? -8.663  -29.754 44.000  1.00 124.15 ? 347 ILE A CD1 1 
ATOM   2647 N  N   . LEU A 1 348 ? -5.679  -31.148 47.972  1.00 101.38 ? 348 LEU A N   1 
ATOM   2648 C  CA  . LEU A 1 348 ? -5.405  -31.127 49.393  1.00 108.57 ? 348 LEU A CA  1 
ATOM   2649 C  C   . LEU A 1 348 ? -4.515  -29.933 49.695  1.00 100.75 ? 348 LEU A C   1 
ATOM   2650 O  O   . LEU A 1 348 ? -4.876  -29.093 50.511  1.00 108.29 ? 348 LEU A O   1 
ATOM   2651 C  CB  . LEU A 1 348 ? -4.753  -32.433 49.851  1.00 89.63  ? 348 LEU A CB  1 
ATOM   2652 C  CG  . LEU A 1 348 ? -5.378  -33.744 49.328  1.00 96.29  ? 348 LEU A CG  1 
ATOM   2653 C  CD1 . LEU A 1 348 ? -4.519  -34.996 49.646  1.00 97.45  ? 348 LEU A CD1 1 
ATOM   2654 C  CD2 . LEU A 1 348 ? -6.830  -33.902 49.791  1.00 112.12 ? 348 LEU A CD2 1 
ATOM   2655 N  N   . LEU A 1 349 ? -3.372  -29.831 49.025  1.00 118.99 ? 349 LEU A N   1 
ATOM   2656 C  CA  . LEU A 1 349 ? -2.490  -28.672 49.214  1.00 111.31 ? 349 LEU A CA  1 
ATOM   2657 C  C   . LEU A 1 349 ? -3.242  -27.342 49.280  1.00 114.76 ? 349 LEU A C   1 
ATOM   2658 O  O   . LEU A 1 349 ? -2.961  -26.505 50.137  1.00 118.34 ? 349 LEU A O   1 
ATOM   2659 C  CB  . LEU A 1 349 ? -1.450  -28.596 48.099  1.00 121.61 ? 349 LEU A CB  1 
ATOM   2660 C  CG  . LEU A 1 349 ? -0.489  -27.416 48.246  1.00 113.95 ? 349 LEU A CG  1 
ATOM   2661 C  CD1 . LEU A 1 349 ? 0.261   -27.533 49.556  1.00 117.98 ? 349 LEU A CD1 1 
ATOM   2662 C  CD2 . LEU A 1 349 ? 0.483   -27.350 47.083  1.00 101.54 ? 349 LEU A CD2 1 
ATOM   2663 N  N   . CYS A 1 350 ? -4.180  -27.148 48.354  1.00 90.70  ? 350 CYS A N   1 
ATOM   2664 C  CA  . CYS A 1 350 ? -5.038  -25.966 48.323  1.00 95.71  ? 350 CYS A CA  1 
ATOM   2665 C  C   . CYS A 1 350 ? -5.873  -25.938 49.561  1.00 110.49 ? 350 CYS A C   1 
ATOM   2666 O  O   . CYS A 1 350 ? -5.564  -25.191 50.471  1.00 112.58 ? 350 CYS A O   1 
ATOM   2667 C  CB  . CYS A 1 350 ? -5.942  -25.950 47.097  1.00 132.41 ? 350 CYS A CB  1 
ATOM   2668 S  SG  . CYS A 1 350 ? -5.160  -25.200 45.688  1.00 118.08 ? 350 CYS A SG  1 
ATOM   2669 N  N   . LYS A 1 351 ? -6.913  -26.771 49.609  1.00 113.12 ? 351 LYS A N   1 
ATOM   2670 C  CA  . LYS A 1 351 ? -7.763  -26.842 50.809  1.00 129.61 ? 351 LYS A CA  1 
ATOM   2671 C  C   . LYS A 1 351 ? -6.979  -27.408 51.999  1.00 133.83 ? 351 LYS A C   1 
ATOM   2672 O  O   . LYS A 1 351 ? -7.437  -28.312 52.701  1.00 146.83 ? 351 LYS A O   1 
ATOM   2673 C  CB  . LYS A 1 351 ? -9.049  -27.640 50.556  1.00 192.81 ? 351 LYS A CB  1 
ATOM   2674 C  CG  . LYS A 1 351 ? -9.415  -27.833 49.079  1.00 186.98 ? 351 LYS A CG  1 
ATOM   2675 C  CD  . LYS A 1 351 ? -9.666  -26.532 48.318  1.00 183.00 ? 351 LYS A CD  1 
ATOM   2676 C  CE  . LYS A 1 351 ? -9.740  -26.815 46.818  1.00 174.54 ? 351 LYS A CE  1 
ATOM   2677 N  NZ  . LYS A 1 351 ? -9.995  -25.605 46.007  1.00 175.39 ? 351 LYS A NZ  1 
ATOM   2678 N  N   . ASP A 1 352 ? -5.767  -26.872 52.152  1.00 118.85 ? 352 ASP A N   1 
ATOM   2679 C  CA  . ASP A 1 352 ? -4.907  -27.016 53.314  1.00 121.87 ? 352 ASP A CA  1 
ATOM   2680 C  C   . ASP A 1 352 ? -4.045  -25.754 53.437  1.00 112.96 ? 352 ASP A C   1 
ATOM   2681 O  O   . ASP A 1 352 ? -3.298  -25.611 54.394  1.00 114.88 ? 352 ASP A O   1 
ATOM   2682 C  CB  . ASP A 1 352 ? -3.977  -28.218 53.162  1.00 149.20 ? 352 ASP A CB  1 
ATOM   2683 C  CG  . ASP A 1 352 ? -4.420  -29.412 53.975  1.00 161.40 ? 352 ASP A CG  1 
ATOM   2684 O  OD1 . ASP A 1 352 ? -5.639  -29.589 54.168  1.00 173.67 ? 352 ASP A OD1 1 
ATOM   2685 O  OD2 . ASP A 1 352 ? -3.543  -30.182 54.413  1.00 159.77 ? 352 ASP A OD2 1 
ATOM   2686 N  N   . HIS A 1 353 ? -4.131  -24.841 52.471  1.00 209.35 ? 353 HIS A N   1 
ATOM   2687 C  CA  . HIS A 1 353 ? -3.244  -23.674 52.482  1.00 201.47 ? 353 HIS A CA  1 
ATOM   2688 C  C   . HIS A 1 353 ? -3.786  -22.366 51.894  1.00 198.70 ? 353 HIS A C   1 
ATOM   2689 O  O   . HIS A 1 353 ? -3.379  -21.287 52.318  1.00 197.91 ? 353 HIS A O   1 
ATOM   2690 C  CB  . HIS A 1 353 ? -1.903  -24.029 51.858  1.00 126.85 ? 353 HIS A CB  1 
ATOM   2691 C  CG  . HIS A 1 353 ? -1.015  -24.817 52.772  1.00 129.75 ? 353 HIS A CG  1 
ATOM   2692 N  ND1 . HIS A 1 353 ? 0.055   -24.257 53.432  1.00 130.13 ? 353 HIS A ND1 1 
ATOM   2693 C  CD2 . HIS A 1 353 ? -1.056  -26.116 53.152  1.00 133.06 ? 353 HIS A CD2 1 
ATOM   2694 C  CE1 . HIS A 1 353 ? 0.645   -25.183 54.172  1.00 133.49 ? 353 HIS A CE1 1 
ATOM   2695 N  NE2 . HIS A 1 353 ? -0.009  -26.316 54.023  1.00 135.21 ? 353 HIS A NE2 1 
ATOM   2696 N  N   . LYS A 1 354 ? -4.679  -22.462 50.915  1.00 114.05 ? 354 LYS A N   1 
ATOM   2697 C  CA  . LYS A 1 354 ? -5.429  -21.298 50.423  1.00 114.96 ? 354 LYS A CA  1 
ATOM   2698 C  C   . LYS A 1 354 ? -4.613  -20.440 49.484  1.00 101.42 ? 354 LYS A C   1 
ATOM   2699 O  O   . LYS A 1 354 ? -5.130  -19.967 48.494  1.00 98.25  ? 354 LYS A O   1 
ATOM   2700 C  CB  . LYS A 1 354 ? -5.947  -20.426 51.576  1.00 135.67 ? 354 LYS A CB  1 
ATOM   2701 C  CG  . LYS A 1 354 ? -6.766  -21.152 52.633  1.00 151.08 ? 354 LYS A CG  1 
ATOM   2702 C  CD  . LYS A 1 354 ? -6.832  -20.334 53.930  1.00 162.08 ? 354 LYS A CD  1 
ATOM   2703 C  CE  . LYS A 1 354 ? -7.446  -21.144 55.074  1.00 177.32 ? 354 LYS A CE  1 
ATOM   2704 N  NZ  . LYS A 1 354 ? -7.740  -20.315 56.278  1.00 189.65 ? 354 LYS A NZ  1 
ATOM   2705 N  N   . SER A 1 355 ? -3.347  -20.227 49.818  1.00 144.90 ? 355 SER A N   1 
ATOM   2706 C  CA  . SER A 1 355 ? -2.452  -19.419 48.997  1.00 132.54 ? 355 SER A CA  1 
ATOM   2707 C  C   . SER A 1 355 ? -2.144  -20.131 47.693  1.00 122.93 ? 355 SER A C   1 
ATOM   2708 O  O   . SER A 1 355 ? -1.978  -19.508 46.639  1.00 115.97 ? 355 SER A O   1 
ATOM   2709 C  CB  . SER A 1 355 ? -1.149  -19.188 49.745  1.00 93.85  ? 355 SER A CB  1 
ATOM   2710 O  OG  . SER A 1 355 ? -1.360  -19.388 51.126  1.00 105.18 ? 355 SER A OG  1 
ATOM   2711 N  N   . MET A 1 356 ? -2.050  -21.452 47.788  1.00 126.34 ? 356 MET A N   1 
ATOM   2712 C  CA  . MET A 1 356 ? -1.803  -22.304 46.642  1.00 119.25 ? 356 MET A CA  1 
ATOM   2713 C  C   . MET A 1 356 ? -2.959  -22.137 45.675  1.00 122.49 ? 356 MET A C   1 
ATOM   2714 O  O   . MET A 1 356 ? -2.835  -22.400 44.491  1.00 117.00 ? 356 MET A O   1 
ATOM   2715 C  CB  . MET A 1 356 ? -1.664  -23.748 47.108  1.00 136.92 ? 356 MET A CB  1 
ATOM   2716 C  CG  . MET A 1 356 ? -0.956  -24.650 46.138  1.00 128.74 ? 356 MET A CG  1 
ATOM   2717 S  SD  . MET A 1 356 ? 0.423   -23.887 45.260  1.00 115.57 ? 356 MET A SD  1 
ATOM   2718 C  CE  . MET A 1 356 ? 1.331   -23.144 46.603  1.00 115.87 ? 356 MET A CE  1 
ATOM   2719 N  N   . LEU A 1 357 ? -4.082  -21.673 46.202  1.00 106.80 ? 357 LEU A N   1 
ATOM   2720 C  CA  . LEU A 1 357 ? -5.246  -21.312 45.407  1.00 112.14 ? 357 LEU A CA  1 
ATOM   2721 C  C   . LEU A 1 357 ? -4.826  -20.252 44.390  1.00 104.42 ? 357 LEU A C   1 
ATOM   2722 O  O   . LEU A 1 357 ? -5.324  -20.189 43.262  1.00 103.17 ? 357 LEU A O   1 
ATOM   2723 C  CB  . LEU A 1 357 ? -6.319  -20.760 46.347  1.00 74.02  ? 357 LEU A CB  1 
ATOM   2724 C  CG  . LEU A 1 357 ? -7.793  -20.976 46.079  1.00 84.79  ? 357 LEU A CG  1 
ATOM   2725 C  CD1 . LEU A 1 357 ? -8.041  -22.437 45.784  1.00 89.96  ? 357 LEU A CD1 1 
ATOM   2726 C  CD2 . LEU A 1 357 ? -8.548  -20.528 47.293  1.00 95.56  ? 357 LEU A CD2 1 
ATOM   2727 N  N   . LEU A 1 358 ? -3.874  -19.431 44.797  1.00 143.06 ? 358 LEU A N   1 
ATOM   2728 C  CA  . LEU A 1 358 ? -3.394  -18.370 43.947  1.00 136.83 ? 358 LEU A CA  1 
ATOM   2729 C  C   . LEU A 1 358 ? -2.688  -18.906 42.703  1.00 128.42 ? 358 LEU A C   1 
ATOM   2730 O  O   . LEU A 1 358 ? -2.293  -18.128 41.846  1.00 120.98 ? 358 LEU A O   1 
ATOM   2731 C  CB  . LEU A 1 358 ? -2.467  -17.454 44.736  1.00 79.64  ? 358 LEU A CB  1 
ATOM   2732 C  CG  . LEU A 1 358 ? -3.109  -16.297 45.502  1.00 87.58  ? 358 LEU A CG  1 
ATOM   2733 C  CD1 . LEU A 1 358 ? -2.059  -15.410 46.171  1.00 84.45  ? 358 LEU A CD1 1 
ATOM   2734 C  CD2 . LEU A 1 358 ? -3.976  -15.480 44.565  1.00 90.02  ? 358 LEU A CD2 1 
ATOM   2735 N  N   . ALA A 1 359 ? -2.526  -20.225 42.596  1.00 117.46 ? 359 ALA A N   1 
ATOM   2736 C  CA  . ALA A 1 359 ? -1.943  -20.825 41.393  1.00 110.57 ? 359 ALA A CA  1 
ATOM   2737 C  C   . ALA A 1 359 ? -2.991  -21.071 40.329  1.00 112.04 ? 359 ALA A C   1 
ATOM   2738 O  O   . ALA A 1 359 ? -2.661  -21.203 39.155  1.00 107.22 ? 359 ALA A O   1 
ATOM   2739 C  CB  . ALA A 1 359 ? -1.250  -22.122 41.722  1.00 55.94  ? 359 ALA A CB  1 
ATOM   2740 N  N   . LEU A 1 360 ? -4.255  -21.127 40.729  1.00 100.35 ? 360 LEU A N   1 
ATOM   2741 C  CA  . LEU A 1 360 ? -5.298  -21.545 39.791  1.00 102.23 ? 360 LEU A CA  1 
ATOM   2742 C  C   . LEU A 1 360 ? -5.155  -21.092 38.323  1.00 91.77  ? 360 LEU A C   1 
ATOM   2743 O  O   . LEU A 1 360 ? -5.223  -21.940 37.436  1.00 90.97  ? 360 LEU A O   1 
ATOM   2744 C  CB  . LEU A 1 360 ? -6.714  -21.304 40.334  1.00 86.08  ? 360 LEU A CB  1 
ATOM   2745 C  CG  . LEU A 1 360 ? -7.245  -22.410 41.259  1.00 97.27  ? 360 LEU A CG  1 
ATOM   2746 C  CD1 . LEU A 1 360 ? -8.405  -21.892 42.096  1.00 108.47 ? 360 LEU A CD1 1 
ATOM   2747 C  CD2 . LEU A 1 360 ? -7.632  -23.673 40.478  1.00 98.93  ? 360 LEU A CD2 1 
ATOM   2748 N  N   . PRO A 1 361 ? -4.936  -19.786 38.049  1.00 109.37 ? 361 PRO A N   1 
ATOM   2749 C  CA  . PRO A 1 361 ? -4.771  -19.371 36.641  1.00 99.96  ? 361 PRO A CA  1 
ATOM   2750 C  C   . PRO A 1 361 ? -3.810  -20.276 35.837  1.00 95.45  ? 361 PRO A C   1 
ATOM   2751 O  O   . PRO A 1 361 ? -4.186  -20.841 34.785  1.00 92.54  ? 361 PRO A O   1 
ATOM   2752 C  CB  . PRO A 1 361 ? -4.190  -17.965 36.766  1.00 100.84 ? 361 PRO A CB  1 
ATOM   2753 C  CG  . PRO A 1 361 ? -4.724  -17.462 38.041  1.00 109.35 ? 361 PRO A CG  1 
ATOM   2754 C  CD  . PRO A 1 361 ? -4.783  -18.647 38.968  1.00 117.18 ? 361 PRO A CD  1 
ATOM   2755 N  N   . MET A 1 362 ? -2.591  -20.437 36.354  1.00 91.41  ? 362 MET A N   1 
ATOM   2756 C  CA  . MET A 1 362 ? -1.598  -21.284 35.712  1.00 88.29  ? 362 MET A CA  1 
ATOM   2757 C  C   . MET A 1 362 ? -2.046  -22.726 35.566  1.00 94.27  ? 362 MET A C   1 
ATOM   2758 O  O   . MET A 1 362 ? -1.695  -23.378 34.596  1.00 92.67  ? 362 MET A O   1 
ATOM   2759 C  CB  . MET A 1 362 ? -0.313  -21.262 36.490  1.00 121.15 ? 362 MET A CB  1 
ATOM   2760 C  CG  . MET A 1 362 ? 0.346   -19.943 36.517  1.00 115.53 ? 362 MET A CG  1 
ATOM   2761 S  SD  . MET A 1 362 ? 1.964   -20.289 37.179  1.00 115.47 ? 362 MET A SD  1 
ATOM   2762 C  CE  . MET A 1 362 ? 2.577   -21.432 35.949  1.00 113.00 ? 362 MET A CE  1 
ATOM   2763 N  N   . LEU A 1 363 ? -2.794  -23.246 36.528  1.00 77.51  ? 363 LEU A N   1 
ATOM   2764 C  CA  . LEU A 1 363 ? -3.441  -24.521 36.298  1.00 84.28  ? 363 LEU A CA  1 
ATOM   2765 C  C   . LEU A 1 363 ? -4.353  -24.401 35.072  1.00 83.43  ? 363 LEU A C   1 
ATOM   2766 O  O   . LEU A 1 363 ? -4.151  -25.090 34.062  1.00 82.17  ? 363 LEU A O   1 
ATOM   2767 C  CB  . LEU A 1 363 ? -4.241  -24.956 37.519  1.00 87.98  ? 363 LEU A CB  1 
ATOM   2768 C  CG  . LEU A 1 363 ? -3.886  -26.280 38.209  1.00 91.72  ? 363 LEU A CG  1 
ATOM   2769 C  CD1 . LEU A 1 363 ? -5.155  -27.035 38.601  1.00 102.30 ? 363 LEU A CD1 1 
ATOM   2770 C  CD2 . LEU A 1 363 ? -3.003  -27.153 37.346  1.00 87.08  ? 363 LEU A CD2 1 
ATOM   2771 N  N   . ALA A 1 364 ? -5.321  -23.491 35.142  1.00 97.49  ? 364 ALA A N   1 
ATOM   2772 C  CA  . ALA A 1 364 ? -6.327  -23.364 34.097  1.00 94.39  ? 364 ALA A CA  1 
ATOM   2773 C  C   . ALA A 1 364 ? -5.724  -23.288 32.684  1.00 85.52  ? 364 ALA A C   1 
ATOM   2774 O  O   . ALA A 1 364 ? -6.147  -24.034 31.782  1.00 87.12  ? 364 ALA A O   1 
ATOM   2775 C  CB  . ALA A 1 364 ? -7.210  -22.168 34.369  1.00 58.11  ? 364 ALA A CB  1 
ATOM   2776 N  N   . LEU A 1 365 ? -4.737  -22.406 32.496  1.00 87.34  ? 365 LEU A N   1 
ATOM   2777 C  CA  . LEU A 1 365 ? -3.982  -22.333 31.242  1.00 80.83  ? 365 LEU A CA  1 
ATOM   2778 C  C   . LEU A 1 365 ? -3.552  -23.711 30.676  1.00 84.14  ? 365 LEU A C   1 
ATOM   2779 O  O   . LEU A 1 365 ? -3.847  -24.039 29.512  1.00 84.01  ? 365 LEU A O   1 
ATOM   2780 C  CB  . LEU A 1 365 ? -2.771  -21.434 31.429  1.00 70.23  ? 365 LEU A CB  1 
ATOM   2781 C  CG  . LEU A 1 365 ? -2.835  -20.170 30.591  1.00 64.27  ? 365 LEU A CG  1 
ATOM   2782 C  CD1 . LEU A 1 365 ? -1.620  -19.285 30.808  1.00 59.42  ? 365 LEU A CD1 1 
ATOM   2783 C  CD2 . LEU A 1 365 ? -2.952  -20.587 29.149  1.00 65.04  ? 365 LEU A CD2 1 
ATOM   2784 N  N   . GLY A 1 366 ? -2.889  -24.524 31.505  1.00 67.04  ? 366 GLY A N   1 
ATOM   2785 C  CA  . GLY A 1 366 ? -2.543  -25.885 31.117  1.00 71.75  ? 366 GLY A CA  1 
ATOM   2786 C  C   . GLY A 1 366 ? -3.745  -26.640 30.600  1.00 77.89  ? 366 GLY A C   1 
ATOM   2787 O  O   . GLY A 1 366 ? -3.724  -27.218 29.515  1.00 78.78  ? 366 GLY A O   1 
ATOM   2788 N  N   . PHE A 1 367 ? -4.823  -26.588 31.375  1.00 71.42  ? 367 PHE A N   1 
ATOM   2789 C  CA  . PHE A 1 367 ? -6.066  -27.240 30.998  1.00 78.25  ? 367 PHE A CA  1 
ATOM   2790 C  C   . PHE A 1 367 ? -6.668  -26.615 29.751  1.00 74.00  ? 367 PHE A C   1 
ATOM   2791 O  O   . PHE A 1 367 ? -7.289  -27.317 28.941  1.00 78.79  ? 367 PHE A O   1 
ATOM   2792 C  CB  . PHE A 1 367 ? -7.051  -27.228 32.162  1.00 101.89 ? 367 PHE A CB  1 
ATOM   2793 C  CG  . PHE A 1 367 ? -6.720  -28.224 33.212  1.00 110.77 ? 367 PHE A CG  1 
ATOM   2794 C  CD1 . PHE A 1 367 ? -5.724  -27.961 34.139  1.00 109.88 ? 367 PHE A CD1 1 
ATOM   2795 C  CD2 . PHE A 1 367 ? -7.370  -29.448 33.253  1.00 121.37 ? 367 PHE A CD2 1 
ATOM   2796 C  CE1 . PHE A 1 367 ? -5.397  -28.890 35.105  1.00 116.47 ? 367 PHE A CE1 1 
ATOM   2797 C  CE2 . PHE A 1 367 ? -7.051  -30.378 34.215  1.00 130.87 ? 367 PHE A CE2 1 
ATOM   2798 C  CZ  . PHE A 1 367 ? -6.063  -30.099 35.147  1.00 126.43 ? 367 PHE A CZ  1 
ATOM   2799 N  N   . MET A 1 368 ? -6.461  -25.303 29.579  1.00 99.95  ? 368 MET A N   1 
ATOM   2800 C  CA  . MET A 1 368 ? -7.001  -24.636 28.406  1.00 97.12  ? 368 MET A CA  1 
ATOM   2801 C  C   . MET A 1 368 ? -6.453  -25.402 27.205  1.00 98.34  ? 368 MET A C   1 
ATOM   2802 O  O   . MET A 1 368 ? -7.099  -25.509 26.162  1.00 101.82 ? 368 MET A O   1 
ATOM   2803 C  CB  . MET A 1 368 ? -6.600  -23.162 28.374  1.00 156.82 ? 368 MET A CB  1 
ATOM   2804 C  CG  . MET A 1 368 ? -7.472  -22.333 27.455  1.00 156.31 ? 368 MET A CG  1 
ATOM   2805 S  SD  . MET A 1 368 ? -6.741  -20.775 26.914  1.00 148.84 ? 368 MET A SD  1 
ATOM   2806 C  CE  . MET A 1 368 ? -5.071  -21.281 26.509  1.00 144.89 ? 368 MET A CE  1 
ATOM   2807 N  N   . ALA A 1 369 ? -5.264  -25.975 27.388  1.00 101.72 ? 369 ALA A N   1 
ATOM   2808 C  CA  . ALA A 1 369 ? -4.633  -26.781 26.357  1.00 104.38 ? 369 ALA A CA  1 
ATOM   2809 C  C   . ALA A 1 369 ? -5.658  -27.611 25.603  1.00 112.75 ? 369 ALA A C   1 
ATOM   2810 O  O   . ALA A 1 369 ? -5.743  -27.571 24.373  1.00 114.78 ? 369 ALA A O   1 
ATOM   2811 C  CB  . ALA A 1 369 ? -3.609  -27.688 26.986  1.00 57.03  ? 369 ALA A CB  1 
ATOM   2812 N  N   . LEU A 1 370 ? -6.451  -28.348 26.364  1.00 96.79  ? 370 LEU A N   1 
ATOM   2813 C  CA  . LEU A 1 370 ? -7.365  -29.330 25.805  1.00 106.23 ? 370 LEU A CA  1 
ATOM   2814 C  C   . LEU A 1 370 ? -8.276  -28.826 24.676  1.00 108.90 ? 370 LEU A C   1 
ATOM   2815 O  O   . LEU A 1 370 ? -8.794  -29.640 23.905  1.00 117.43 ? 370 LEU A O   1 
ATOM   2816 C  CB  . LEU A 1 370 ? -8.200  -29.973 26.917  1.00 76.60  ? 370 LEU A CB  1 
ATOM   2817 C  CG  . LEU A 1 370 ? -7.478  -30.874 27.927  1.00 80.80  ? 370 LEU A CG  1 
ATOM   2818 C  CD1 . LEU A 1 370 ? -8.226  -30.839 29.226  1.00 87.91  ? 370 LEU A CD1 1 
ATOM   2819 C  CD2 . LEU A 1 370 ? -7.310  -32.320 27.450  1.00 88.46  ? 370 LEU A CD2 1 
ATOM   2820 N  N   . ARG A 1 371 ? -8.478  -27.509 24.576  1.00 131.41 ? 371 ARG A N   1 
ATOM   2821 C  CA  . ARG A 1 371 ? -9.323  -26.943 23.509  1.00 134.77 ? 371 ARG A CA  1 
ATOM   2822 C  C   . ARG A 1 371 ? -8.610  -25.804 22.795  1.00 128.27 ? 371 ARG A C   1 
ATOM   2823 O  O   . ARG A 1 371 ? -9.087  -25.264 21.795  1.00 131.74 ? 371 ARG A O   1 
ATOM   2824 C  CB  . ARG A 1 371 ? -10.682 -26.473 24.059  1.00 198.73 ? 371 ARG A CB  1 
ATOM   2825 C  CG  . ARG A 1 371 ? -11.588 -25.813 23.024  1.00 205.14 ? 371 ARG A CG  1 
ATOM   2826 C  CD  . ARG A 1 371 ? -13.045 -25.755 23.471  1.00 210.33 ? 371 ARG A CD  1 
ATOM   2827 N  NE  . ARG A 1 371 ? -13.832 -26.885 22.967  1.00 221.24 ? 371 ARG A NE  1 
ATOM   2828 C  CZ  . ARG A 1 371 ? -15.142 -26.843 22.712  1.00 229.21 ? 371 ARG A CZ  1 
ATOM   2829 N  NH1 . ARG A 1 371 ? -15.829 -25.723 22.905  1.00 227.57 ? 371 ARG A NH1 1 
ATOM   2830 N  NH2 . ARG A 1 371 ? -15.771 -27.922 22.256  1.00 239.74 ? 371 ARG A NH2 1 
ATOM   2831 N  N   . ALA A 1 372 ? -7.439  -25.467 23.314  1.00 114.42 ? 372 ALA A N   1 
ATOM   2832 C  CA  . ALA A 1 372 ? -6.744  -24.270 22.890  1.00 108.03 ? 372 ALA A CA  1 
ATOM   2833 C  C   . ALA A 1 372 ? -5.497  -24.639 22.125  1.00 108.61 ? 372 ALA A C   1 
ATOM   2834 O  O   . ALA A 1 372 ? -5.127  -23.995 21.139  1.00 110.18 ? 372 ALA A O   1 
ATOM   2835 C  CB  . ALA A 1 372 ? -6.372  -23.436 24.097  1.00 84.76  ? 372 ALA A CB  1 
ATOM   2836 N  N   . GLY A 1 373 ? -4.839  -25.683 22.599  1.00 111.34 ? 373 GLY A N   1 
ATOM   2837 C  CA  . GLY A 1 373 ? -3.588  -26.072 22.008  1.00 112.99 ? 373 GLY A CA  1 
ATOM   2838 C  C   . GLY A 1 373 ? -2.767  -27.013 22.849  1.00 110.62 ? 373 GLY A C   1 
ATOM   2839 O  O   . GLY A 1 373 ? -2.909  -27.132 24.059  1.00 106.91 ? 373 GLY A O   1 
ATOM   2840 N  N   . LEU A 1 374 ? -1.886  -27.688 22.147  1.00 102.39 ? 374 LEU A N   1 
ATOM   2841 C  CA  . LEU A 1 374 ? -0.950  -28.613 22.711  1.00 102.03 ? 374 LEU A CA  1 
ATOM   2842 C  C   . LEU A 1 374 ? 0.087   -27.885 23.545  1.00 93.47  ? 374 LEU A C   1 
ATOM   2843 O  O   . LEU A 1 374 ? 0.553   -28.401 24.549  1.00 93.01  ? 374 LEU A O   1 
ATOM   2844 C  CB  . LEU A 1 374 ? -0.282  -29.289 21.535  1.00 86.88  ? 374 LEU A CB  1 
ATOM   2845 C  CG  . LEU A 1 374 ? 1.045   -29.962 21.713  1.00 92.56  ? 374 LEU A CG  1 
ATOM   2846 C  CD1 . LEU A 1 374 ? 0.742   -31.384 21.388  1.00 100.36 ? 374 LEU A CD1 1 
ATOM   2847 C  CD2 . LEU A 1 374 ? 2.020   -29.375 20.730  1.00 89.13  ? 374 LEU A CD2 1 
ATOM   2848 N  N   . ARG A 1 375 ? 0.433   -26.672 23.128  1.00 116.01 ? 375 ARG A N   1 
ATOM   2849 C  CA  . ARG A 1 375 ? 1.575   -25.959 23.689  1.00 109.23 ? 375 ARG A CA  1 
ATOM   2850 C  C   . ARG A 1 375 ? 1.279   -25.305 25.023  1.00 103.80 ? 375 ARG A C   1 
ATOM   2851 O  O   . ARG A 1 375 ? 2.139   -24.614 25.577  1.00 98.87  ? 375 ARG A O   1 
ATOM   2852 C  CB  . ARG A 1 375 ? 2.069   -24.894 22.713  1.00 128.87 ? 375 ARG A CB  1 
ATOM   2853 C  CG  . ARG A 1 375 ? 1.732   -23.477 23.119  1.00 121.80 ? 375 ARG A CG  1 
ATOM   2854 C  CD  . ARG A 1 375 ? 1.428   -22.627 21.911  1.00 123.54 ? 375 ARG A CD  1 
ATOM   2855 N  NE  . ARG A 1 375 ? 0.681   -21.442 22.287  1.00 119.69 ? 375 ARG A NE  1 
ATOM   2856 C  CZ  . ARG A 1 375 ? 1.244   -20.314 22.694  1.00 115.07 ? 375 ARG A CZ  1 
ATOM   2857 N  NH1 . ARG A 1 375 ? 2.570   -20.239 22.758  1.00 113.68 ? 375 ARG A NH1 1 
ATOM   2858 N  NH2 . ARG A 1 375 ? 0.486   -19.270 23.041  1.00 112.61 ? 375 ARG A NH2 1 
ATOM   2859 N  N   . PHE A 1 376 ? 0.069   -25.528 25.533  1.00 82.23  ? 376 PHE A N   1 
ATOM   2860 C  CA  . PHE A 1 376 ? -0.364  -24.935 26.801  1.00 79.16  ? 376 PHE A CA  1 
ATOM   2861 C  C   . PHE A 1 376 ? -0.187  -25.814 28.049  1.00 82.94  ? 376 PHE A C   1 
ATOM   2862 O  O   . PHE A 1 376 ? -0.044  -25.299 29.152  1.00 81.17  ? 376 PHE A O   1 
ATOM   2863 C  CB  . PHE A 1 376 ? -1.797  -24.422 26.690  1.00 91.91  ? 376 PHE A CB  1 
ATOM   2864 C  CG  . PHE A 1 376 ? -1.939  -23.272 25.747  1.00 88.95  ? 376 PHE A CG  1 
ATOM   2865 C  CD1 . PHE A 1 376 ? -2.610  -23.412 24.560  1.00 93.33  ? 376 PHE A CD1 1 
ATOM   2866 C  CD2 . PHE A 1 376 ? -1.372  -22.050 26.038  1.00 83.18  ? 376 PHE A CD2 1 
ATOM   2867 C  CE1 . PHE A 1 376 ? -2.737  -22.347 23.698  1.00 92.50  ? 376 PHE A CE1 1 
ATOM   2868 C  CE2 . PHE A 1 376 ? -1.485  -20.992 25.173  1.00 81.90  ? 376 PHE A CE2 1 
ATOM   2869 C  CZ  . PHE A 1 376 ? -2.168  -21.141 24.009  1.00 86.78  ? 376 PHE A CZ  1 
ATOM   2870 N  N   . THR A 1 377 ? -0.182  -27.128 27.866  1.00 96.80  ? 377 THR A N   1 
ATOM   2871 C  CA  . THR A 1 377 ? 0.033   -28.062 28.959  1.00 102.49 ? 377 THR A CA  1 
ATOM   2872 C  C   . THR A 1 377 ? 1.177   -27.632 29.851  1.00 99.35  ? 377 THR A C   1 
ATOM   2873 O  O   . THR A 1 377 ? 1.133   -27.830 31.066  1.00 103.71 ? 377 THR A O   1 
ATOM   2874 C  CB  . THR A 1 377 ? 0.374   -29.429 28.418  1.00 95.16  ? 377 THR A CB  1 
ATOM   2875 O  OG1 . THR A 1 377 ? 0.879   -29.276 27.095  1.00 93.94  ? 377 THR A OG1 1 
ATOM   2876 C  CG2 . THR A 1 377 ? -0.858  -30.301 28.354  1.00 102.18 ? 377 THR A CG2 1 
ATOM   2877 N  N   . ILE A 1 378 ? 2.206   -27.060 29.234  1.00 89.89  ? 378 ILE A N   1 
ATOM   2878 C  CA  . ILE A 1 378 ? 3.357   -26.465 29.935  1.00 86.38  ? 378 ILE A CA  1 
ATOM   2879 C  C   . ILE A 1 378 ? 2.981   -25.697 31.224  1.00 86.12  ? 378 ILE A C   1 
ATOM   2880 O  O   . ILE A 1 378 ? 3.503   -25.978 32.320  1.00 89.03  ? 378 ILE A O   1 
ATOM   2881 C  CB  . ILE A 1 378 ? 4.179   -25.560 28.957  1.00 82.11  ? 378 ILE A CB  1 
ATOM   2882 C  CG1 . ILE A 1 378 ? 5.442   -26.278 28.524  1.00 85.13  ? 378 ILE A CG1 1 
ATOM   2883 C  CG2 . ILE A 1 378 ? 4.557   -24.222 29.588  1.00 77.01  ? 378 ILE A CG2 1 
ATOM   2884 C  CD1 . ILE A 1 378 ? 6.511   -26.229 29.574  1.00 86.82  ? 378 ILE A CD1 1 
ATOM   2885 N  N   . TYR A 1 379 ? 2.056   -24.751 31.077  1.00 101.64 ? 379 TYR A N   1 
ATOM   2886 C  CA  . TYR A 1 379 ? 1.576   -23.924 32.178  1.00 102.12 ? 379 TYR A CA  1 
ATOM   2887 C  C   . TYR A 1 379 ? 1.164   -24.708 33.417  1.00 110.49 ? 379 TYR A C   1 
ATOM   2888 O  O   . TYR A 1 379 ? 1.242   -24.209 34.534  1.00 110.87 ? 379 TYR A O   1 
ATOM   2889 C  CB  . TYR A 1 379 ? 0.409   -23.084 31.696  1.00 109.19 ? 379 TYR A CB  1 
ATOM   2890 C  CG  . TYR A 1 379 ? 0.856   -21.980 30.805  1.00 101.72 ? 379 TYR A CG  1 
ATOM   2891 C  CD1 . TYR A 1 379 ? 0.213   -21.724 29.623  1.00 99.73  ? 379 TYR A CD1 1 
ATOM   2892 C  CD2 . TYR A 1 379 ? 1.934   -21.191 31.148  1.00 98.11  ? 379 TYR A CD2 1 
ATOM   2893 C  CE1 . TYR A 1 379 ? 0.627   -20.705 28.800  1.00 94.86  ? 379 TYR A CE1 1 
ATOM   2894 C  CE2 . TYR A 1 379 ? 2.354   -20.158 30.342  1.00 92.60  ? 379 TYR A CE2 1 
ATOM   2895 C  CZ  . TYR A 1 379 ? 1.697   -19.920 29.164  1.00 91.20  ? 379 TYR A CZ  1 
ATOM   2896 O  OH  . TYR A 1 379 ? 2.095   -18.897 28.327  1.00 87.55  ? 379 TYR A OH  1 
ATOM   2897 N  N   . ALA A 1 380 ? 0.723   -25.941 33.230  1.00 103.63 ? 380 ALA A N   1 
ATOM   2898 C  CA  . ALA A 1 380 ? 0.197   -26.668 34.362  1.00 110.75 ? 380 ALA A CA  1 
ATOM   2899 C  C   . ALA A 1 380 ? 1.200   -27.649 34.943  1.00 111.60 ? 380 ALA A C   1 
ATOM   2900 O  O   . ALA A 1 380 ? 0.871   -28.361 35.876  1.00 114.84 ? 380 ALA A O   1 
ATOM   2901 C  CB  . ALA A 1 380 ? -1.102  -27.356 33.991  1.00 74.29  ? 380 ALA A CB  1 
ATOM   2902 N  N   . VAL A 1 381 ? 2.422   -27.681 34.408  1.00 98.72  ? 381 VAL A N   1 
ATOM   2903 C  CA  . VAL A 1 381 ? 3.462   -28.554 34.981  1.00 97.25  ? 381 VAL A CA  1 
ATOM   2904 C  C   . VAL A 1 381 ? 3.814   -28.183 36.424  1.00 91.79  ? 381 VAL A C   1 
ATOM   2905 O  O   . VAL A 1 381 ? 3.442   -28.912 37.356  1.00 93.16  ? 381 VAL A O   1 
ATOM   2906 C  CB  . VAL A 1 381 ? 4.780   -28.604 34.144  1.00 92.37  ? 381 VAL A CB  1 
ATOM   2907 C  CG1 . VAL A 1 381 ? 5.941   -29.044 35.009  1.00 86.11  ? 381 VAL A CG1 1 
ATOM   2908 C  CG2 . VAL A 1 381 ? 4.645   -29.541 32.956  1.00 97.81  ? 381 VAL A CG2 1 
ATOM   2909 N  N   . PRO A 1 382 ? 4.500   -27.030 36.620  1.00 106.48 ? 382 PRO A N   1 
ATOM   2910 C  CA  . PRO A 1 382 ? 5.094   -26.692 37.923  1.00 101.42 ? 382 PRO A CA  1 
ATOM   2911 C  C   . PRO A 1 382 ? 4.086   -26.775 39.061  1.00 105.14 ? 382 PRO A C   1 
ATOM   2912 O  O   . PRO A 1 382 ? 4.361   -27.454 40.051  1.00 104.48 ? 382 PRO A O   1 
ATOM   2913 C  CB  . PRO A 1 382 ? 5.615   -25.264 37.727  1.00 100.16 ? 382 PRO A CB  1 
ATOM   2914 C  CG  . PRO A 1 382 ? 4.898   -24.739 36.551  1.00 104.33 ? 382 PRO A CG  1 
ATOM   2915 C  CD  . PRO A 1 382 ? 4.595   -25.907 35.671  1.00 108.77 ? 382 PRO A CD  1 
ATOM   2916 N  N   . VAL A 1 383 ? 2.928   -26.140 38.911  1.00 97.60  ? 383 VAL A N   1 
ATOM   2917 C  CA  . VAL A 1 383 ? 1.870   -26.291 39.900  1.00 103.06 ? 383 VAL A CA  1 
ATOM   2918 C  C   . VAL A 1 383 ? 1.545   -27.763 40.188  1.00 107.57 ? 383 VAL A C   1 
ATOM   2919 O  O   . VAL A 1 383 ? 1.662   -28.242 41.333  1.00 109.05 ? 383 VAL A O   1 
ATOM   2920 C  CB  . VAL A 1 383 ? 0.611   -25.563 39.469  1.00 103.21 ? 383 VAL A CB  1 
ATOM   2921 C  CG1 . VAL A 1 383 ? -0.575  -26.061 40.266  1.00 111.54 ? 383 VAL A CG1 1 
ATOM   2922 C  CG2 . VAL A 1 383 ? 0.798   -24.087 39.672  1.00 100.27 ? 383 VAL A CG2 1 
ATOM   2923 N  N   . MET A 1 384 ? 1.188   -28.500 39.143  1.00 100.40 ? 384 MET A N   1 
ATOM   2924 C  CA  . MET A 1 384 ? 0.799   -29.881 39.337  1.00 105.64 ? 384 MET A CA  1 
ATOM   2925 C  C   . MET A 1 384 ? 1.965   -30.695 39.864  1.00 100.96 ? 384 MET A C   1 
ATOM   2926 O  O   . MET A 1 384 ? 1.815   -31.864 40.163  1.00 105.36 ? 384 MET A O   1 
ATOM   2927 C  CB  . MET A 1 384 ? 0.312   -30.468 38.028  1.00 90.90  ? 384 MET A CB  1 
ATOM   2928 C  CG  . MET A 1 384 ? -1.081  -30.090 37.659  1.00 98.89  ? 384 MET A CG  1 
ATOM   2929 S  SD  . MET A 1 384 ? -2.145  -31.447 38.083  1.00 108.88 ? 384 MET A SD  1 
ATOM   2930 C  CE  . MET A 1 384 ? -3.062  -30.734 39.434  1.00 114.86 ? 384 MET A CE  1 
ATOM   2931 N  N   . ALA A 1 385 ? 3.140   -30.088 39.967  1.00 98.36  ? 385 ALA A N   1 
ATOM   2932 C  CA  . ALA A 1 385 ? 4.255   -30.791 40.582  1.00 94.74  ? 385 ALA A CA  1 
ATOM   2933 C  C   . ALA A 1 385 ? 4.228   -30.598 42.105  1.00 96.47  ? 385 ALA A C   1 
ATOM   2934 O  O   . ALA A 1 385 ? 4.325   -31.563 42.860  1.00 100.02 ? 385 ALA A O   1 
ATOM   2935 C  CB  . ALA A 1 385 ? 5.583   -30.355 39.969  1.00 67.86  ? 385 ALA A CB  1 
ATOM   2936 N  N   . LEU A 1 386 ? 4.047   -29.360 42.555  1.00 89.28  ? 386 LEU A N   1 
ATOM   2937 C  CA  . LEU A 1 386 ? 3.955   -29.116 43.992  1.00 93.32  ? 386 LEU A CA  1 
ATOM   2938 C  C   . LEU A 1 386 ? 2.855   -30.018 44.520  1.00 102.65 ? 386 LEU A C   1 
ATOM   2939 O  O   . LEU A 1 386 ? 3.035   -30.702 45.529  1.00 107.26 ? 386 LEU A O   1 
ATOM   2940 C  CB  . LEU A 1 386 ? 3.625   -27.649 44.310  1.00 103.55 ? 386 LEU A CB  1 
ATOM   2941 C  CG  . LEU A 1 386 ? 4.666   -26.565 44.022  1.00 96.51  ? 386 LEU A CG  1 
ATOM   2942 C  CD1 . LEU A 1 386 ? 4.075   -25.179 44.191  1.00 97.95  ? 386 LEU A CD1 1 
ATOM   2943 C  CD2 . LEU A 1 386 ? 5.882   -26.739 44.911  1.00 95.65  ? 386 LEU A CD2 1 
ATOM   2944 N  N   . GLY A 1 387 ? 1.720   -30.013 43.820  1.00 113.25 ? 387 GLY A N   1 
ATOM   2945 C  CA  . GLY A 1 387 ? 0.622   -30.907 44.120  1.00 123.20 ? 387 GLY A CA  1 
ATOM   2946 C  C   . GLY A 1 387 ? 1.178   -32.278 44.414  1.00 124.98 ? 387 GLY A C   1 
ATOM   2947 O  O   . GLY A 1 387 ? 1.073   -32.774 45.540  1.00 132.11 ? 387 GLY A O   1 
ATOM   2948 N  N   . PHE A 1 388 ? 1.799   -32.881 43.404  1.00 97.65  ? 388 PHE A N   1 
ATOM   2949 C  CA  . PHE A 1 388 ? 2.362   -34.200 43.591  1.00 99.25  ? 388 PHE A CA  1 
ATOM   2950 C  C   . PHE A 1 388 ? 3.169   -34.261 44.872  1.00 99.15  ? 388 PHE A C   1 
ATOM   2951 O  O   . PHE A 1 388 ? 2.903   -35.118 45.712  1.00 106.62 ? 388 PHE A O   1 
ATOM   2952 C  CB  . PHE A 1 388 ? 3.205   -34.656 42.408  1.00 96.65  ? 388 PHE A CB  1 
ATOM   2953 C  CG  . PHE A 1 388 ? 3.803   -36.033 42.597  1.00 98.65  ? 388 PHE A CG  1 
ATOM   2954 C  CD1 . PHE A 1 388 ? 2.998   -37.162 42.584  1.00 106.64 ? 388 PHE A CD1 1 
ATOM   2955 C  CD2 . PHE A 1 388 ? 5.165   -36.204 42.802  1.00 93.99  ? 388 PHE A CD2 1 
ATOM   2956 C  CE1 . PHE A 1 388 ? 3.535   -38.421 42.759  1.00 109.13 ? 388 PHE A CE1 1 
ATOM   2957 C  CE2 . PHE A 1 388 ? 5.704   -37.468 42.974  1.00 96.80  ? 388 PHE A CE2 1 
ATOM   2958 C  CZ  . PHE A 1 388 ? 4.887   -38.573 42.949  1.00 104.21 ? 388 PHE A CZ  1 
ATOM   2959 N  N   . GLY A 1 389 ? 4.121   -33.348 45.037  1.00 101.70 ? 389 GLY A N   1 
ATOM   2960 C  CA  . GLY A 1 389 ? 4.922   -33.330 46.243  1.00 103.09 ? 389 GLY A CA  1 
ATOM   2961 C  C   . GLY A 1 389 ? 4.076   -33.399 47.492  1.00 113.09 ? 389 GLY A C   1 
ATOM   2962 O  O   . GLY A 1 389 ? 4.266   -34.262 48.353  1.00 118.89 ? 389 GLY A O   1 
ATOM   2963 N  N   . TYR A 1 390 ? 3.111   -32.503 47.586  1.00 97.55  ? 390 TYR A N   1 
ATOM   2964 C  CA  . TYR A 1 390 ? 2.279   -32.464 48.758  1.00 108.69 ? 390 TYR A CA  1 
ATOM   2965 C  C   . TYR A 1 390 ? 1.700   -33.842 49.031  1.00 118.30 ? 390 TYR A C   1 
ATOM   2966 O  O   . TYR A 1 390 ? 1.732   -34.302 50.169  1.00 128.03 ? 390 TYR A O   1 
ATOM   2967 C  CB  . TYR A 1 390 ? 1.190   -31.393 48.612  1.00 83.94  ? 390 TYR A CB  1 
ATOM   2968 C  CG  . TYR A 1 390 ? 0.539   -31.065 49.936  1.00 96.11  ? 390 TYR A CG  1 
ATOM   2969 C  CD1 . TYR A 1 390 ? 1.292   -30.547 50.988  1.00 98.75  ? 390 TYR A CD1 1 
ATOM   2970 C  CD2 . TYR A 1 390 ? -0.817  -31.297 50.150  1.00 106.55 ? 390 TYR A CD2 1 
ATOM   2971 C  CE1 . TYR A 1 390 ? 0.715   -30.266 52.210  1.00 111.76 ? 390 TYR A CE1 1 
ATOM   2972 C  CE2 . TYR A 1 390 ? -1.404  -31.004 51.371  1.00 119.37 ? 390 TYR A CE2 1 
ATOM   2973 C  CZ  . TYR A 1 390 ? -0.629  -30.489 52.397  1.00 122.09 ? 390 TYR A CZ  1 
ATOM   2974 O  OH  . TYR A 1 390 ? -1.194  -30.190 53.615  1.00 135.51 ? 390 TYR A OH  1 
ATOM   2975 N  N   . PHE A 1 391 ? 1.209   -34.511 47.987  1.00 95.44  ? 391 PHE A N   1 
ATOM   2976 C  CA  . PHE A 1 391 ? 0.551   -35.813 48.139  1.00 105.32 ? 391 PHE A CA  1 
ATOM   2977 C  C   . PHE A 1 391 ? 1.415   -36.836 48.859  1.00 108.94 ? 391 PHE A C   1 
ATOM   2978 O  O   . PHE A 1 391 ? 0.910   -37.753 49.487  1.00 120.58 ? 391 PHE A O   1 
ATOM   2979 C  CB  . PHE A 1 391 ? 0.105   -36.372 46.789  1.00 98.96  ? 391 PHE A CB  1 
ATOM   2980 C  CG  . PHE A 1 391 ? -0.448  -37.761 46.889  1.00 108.46 ? 391 PHE A CG  1 
ATOM   2981 C  CD1 . PHE A 1 391 ? -1.780  -37.963 47.200  1.00 119.56 ? 391 PHE A CD1 1 
ATOM   2982 C  CD2 . PHE A 1 391 ? 0.366   -38.866 46.723  1.00 107.23 ? 391 PHE A CD2 1 
ATOM   2983 C  CE1 . PHE A 1 391 ? -2.288  -39.231 47.321  1.00 129.25 ? 391 PHE A CE1 1 
ATOM   2984 C  CE2 . PHE A 1 391 ? -0.142  -40.130 46.844  1.00 116.62 ? 391 PHE A CE2 1 
ATOM   2985 C  CZ  . PHE A 1 391 ? -1.468  -40.312 47.145  1.00 127.63 ? 391 PHE A CZ  1 
ATOM   2986 N  N   . LEU A 1 392 ? 2.731   -36.698 48.707  1.00 96.01  ? 392 LEU A N   1 
ATOM   2987 C  CA  . LEU A 1 392 ? 3.631   -37.628 49.379  1.00 99.46  ? 392 LEU A CA  1 
ATOM   2988 C  C   . LEU A 1 392 ? 3.561   -37.301 50.861  1.00 109.40 ? 392 LEU A C   1 
ATOM   2989 O  O   . LEU A 1 392 ? 3.227   -38.172 51.663  1.00 121.14 ? 392 LEU A O   1 
ATOM   2990 C  CB  . LEU A 1 392 ? 5.049   -37.495 48.837  1.00 121.08 ? 392 LEU A CB  1 
ATOM   2991 C  CG  . LEU A 1 392 ? 5.131   -37.568 47.314  1.00 111.74 ? 392 LEU A CG  1 
ATOM   2992 C  CD1 . LEU A 1 392 ? 6.577   -37.697 46.827  1.00 103.61 ? 392 LEU A CD1 1 
ATOM   2993 C  CD2 . LEU A 1 392 ? 4.282   -38.698 46.744  1.00 117.64 ? 392 LEU A CD2 1 
ATOM   2994 N  N   . TYR A 1 393 ? 3.815   -36.033 51.209  1.00 119.06 ? 393 TYR A N   1 
ATOM   2995 C  CA  . TYR A 1 393 ? 3.628   -35.541 52.582  1.00 130.15 ? 393 TYR A CA  1 
ATOM   2996 C  C   . TYR A 1 393 ? 2.281   -36.035 53.065  1.00 144.19 ? 393 TYR A C   1 
ATOM   2997 O  O   . TYR A 1 393 ? 2.201   -36.904 53.933  1.00 157.12 ? 393 TYR A O   1 
ATOM   2998 C  CB  . TYR A 1 393 ? 3.692   -34.004 52.641  1.00 112.37 ? 393 TYR A CB  1 
ATOM   2999 C  CG  . TYR A 1 393 ? 3.201   -33.397 53.946  1.00 125.80 ? 393 TYR A CG  1 
ATOM   3000 C  CD1 . TYR A 1 393 ? 3.820   -33.694 55.160  1.00 133.99 ? 393 TYR A CD1 1 
ATOM   3001 C  CD2 . TYR A 1 393 ? 2.125   -32.523 53.963  1.00 130.39 ? 393 TYR A CD2 1 
ATOM   3002 C  CE1 . TYR A 1 393 ? 3.366   -33.137 56.366  1.00 144.94 ? 393 TYR A CE1 1 
ATOM   3003 C  CE2 . TYR A 1 393 ? 1.666   -31.963 55.158  1.00 141.11 ? 393 TYR A CE2 1 
ATOM   3004 C  CZ  . TYR A 1 393 ? 2.290   -32.274 56.354  1.00 148.44 ? 393 TYR A CZ  1 
ATOM   3005 O  OH  . TYR A 1 393 ? 1.837   -31.720 57.531  1.00 160.48 ? 393 TYR A OH  1 
ATOM   3006 N  N   . ALA A 1 394 ? 1.228   -35.478 52.476  1.00 102.65 ? 394 ALA A N   1 
ATOM   3007 C  CA  . ALA A 1 394 ? -0.119  -36.008 52.611  1.00 115.19 ? 394 ALA A CA  1 
ATOM   3008 C  C   . ALA A 1 394 ? -0.084  -37.475 53.024  1.00 124.99 ? 394 ALA A C   1 
ATOM   3009 O  O   . ALA A 1 394 ? -0.420  -37.816 54.165  1.00 141.05 ? 394 ALA A O   1 
ATOM   3010 C  CB  . ALA A 1 394 ? -0.881  -35.847 51.282  1.00 107.62 ? 394 ALA A CB  1 
ATOM   3011 N  N   . PHE A 1 395 ? 0.362   -38.326 52.099  1.00 119.60 ? 395 PHE A N   1 
ATOM   3012 C  CA  . PHE A 1 395 ? 0.340   -39.778 52.282  1.00 127.72 ? 395 PHE A CA  1 
ATOM   3013 C  C   . PHE A 1 395 ? 1.146   -40.260 53.486  1.00 136.71 ? 395 PHE A C   1 
ATOM   3014 O  O   . PHE A 1 395 ? 0.660   -41.056 54.301  1.00 151.88 ? 395 PHE A O   1 
ATOM   3015 C  CB  . PHE A 1 395 ? 0.842   -40.482 51.019  1.00 95.65  ? 395 PHE A CB  1 
ATOM   3016 C  CG  . PHE A 1 395 ? 0.877   -41.999 51.134  1.00 103.52 ? 395 PHE A CG  1 
ATOM   3017 C  CD1 . PHE A 1 395 ? -0.248  -42.762 50.808  1.00 110.73 ? 395 PHE A CD1 1 
ATOM   3018 C  CD2 . PHE A 1 395 ? 2.028   -42.655 51.567  1.00 104.72 ? 395 PHE A CD2 1 
ATOM   3019 C  CE1 . PHE A 1 395 ? -0.220  -44.114 50.909  1.00 118.62 ? 395 PHE A CE1 1 
ATOM   3020 C  CE2 . PHE A 1 395 ? 2.054   -44.010 51.672  1.00 112.59 ? 395 PHE A CE2 1 
ATOM   3021 C  CZ  . PHE A 1 395 ? 0.936   -44.742 51.341  1.00 119.37 ? 395 PHE A CZ  1 
ATOM   3022 N  N   . PHE A 1 396 ? 2.381   -39.780 53.589  1.00 114.08 ? 396 PHE A N   1 
ATOM   3023 C  CA  . PHE A 1 396 ? 3.247   -40.167 54.695  1.00 123.19 ? 396 PHE A CA  1 
ATOM   3024 C  C   . PHE A 1 396 ? 2.649   -39.721 56.025  1.00 139.33 ? 396 PHE A C   1 
ATOM   3025 O  O   . PHE A 1 396 ? 3.132   -40.089 57.091  1.00 151.90 ? 396 PHE A O   1 
ATOM   3026 C  CB  . PHE A 1 396 ? 4.648   -39.596 54.499  1.00 153.01 ? 396 PHE A CB  1 
ATOM   3027 C  CG  . PHE A 1 396 ? 5.539   -40.476 53.696  1.00 143.64 ? 396 PHE A CG  1 
ATOM   3028 C  CD1 . PHE A 1 396 ? 5.062   -41.104 52.568  1.00 134.68 ? 396 PHE A CD1 1 
ATOM   3029 C  CD2 . PHE A 1 396 ? 6.849   -40.685 54.074  1.00 145.23 ? 396 PHE A CD2 1 
ATOM   3030 C  CE1 . PHE A 1 396 ? 5.876   -41.932 51.829  1.00 127.43 ? 396 PHE A CE1 1 
ATOM   3031 C  CE2 . PHE A 1 396 ? 7.670   -41.507 53.340  1.00 137.64 ? 396 PHE A CE2 1 
ATOM   3032 C  CZ  . PHE A 1 396 ? 7.186   -42.133 52.216  1.00 128.70 ? 396 PHE A CZ  1 
ATOM   3033 N  N   . ASN A 1 397 ? 1.595   -38.916 55.941  1.00 143.78 ? 397 ASN A N   1 
ATOM   3034 C  CA  . ASN A 1 397 ? 0.785   -38.600 57.099  1.00 161.55 ? 397 ASN A CA  1 
ATOM   3035 C  C   . ASN A 1 397 ? -0.102  -39.769 57.481  1.00 176.58 ? 397 ASN A C   1 
ATOM   3036 O  O   . ASN A 1 397 ? -0.008  -40.274 58.597  1.00 193.28 ? 397 ASN A O   1 
ATOM   3037 C  CB  . ASN A 1 397 ? -0.074  -37.377 56.839  1.00 141.11 ? 397 ASN A CB  1 
ATOM   3038 C  CG  . ASN A 1 397 ? 0.286   -36.242 57.737  1.00 138.39 ? 397 ASN A CG  1 
ATOM   3039 O  OD1 . ASN A 1 397 ? 1.465   -35.925 57.905  1.00 134.09 ? 397 ASN A OD1 1 
ATOM   3040 N  ND2 . ASN A 1 397 ? -0.719  -35.638 58.357  1.00 141.77 ? 397 ASN A ND2 1 
ATOM   3041 N  N   . PHE A 1 398 ? -0.957  -40.201 56.554  1.00 128.91 ? 398 PHE A N   1 
ATOM   3042 C  CA  . PHE A 1 398 ? -1.866  -41.319 56.811  1.00 142.80 ? 398 PHE A CA  1 
ATOM   3043 C  C   . PHE A 1 398 ? -1.147  -42.325 57.670  1.00 153.31 ? 398 PHE A C   1 
ATOM   3044 O  O   . PHE A 1 398 ? -1.706  -42.854 58.613  1.00 171.91 ? 398 PHE A O   1 
ATOM   3045 C  CB  . PHE A 1 398 ? -2.275  -42.009 55.511  1.00 120.71 ? 398 PHE A CB  1 
ATOM   3046 C  CG  . PHE A 1 398 ? -3.740  -42.351 55.427  1.00 133.95 ? 398 PHE A CG  1 
ATOM   3047 C  CD1 . PHE A 1 398 ? -4.683  -41.630 56.142  1.00 144.67 ? 398 PHE A CD1 1 
ATOM   3048 C  CD2 . PHE A 1 398 ? -4.172  -43.393 54.615  1.00 136.26 ? 398 PHE A CD2 1 
ATOM   3049 C  CE1 . PHE A 1 398 ? -6.028  -41.944 56.045  1.00 157.68 ? 398 PHE A CE1 1 
ATOM   3050 C  CE2 . PHE A 1 398 ? -5.510  -43.709 54.512  1.00 149.21 ? 398 PHE A CE2 1 
ATOM   3051 C  CZ  . PHE A 1 398 ? -6.441  -42.985 55.227  1.00 159.94 ? 398 PHE A CZ  1 
ATOM   3052 N  N   . LEU A 1 399 ? 0.110   -42.577 57.339  1.00 156.23 ? 399 LEU A N   1 
ATOM   3053 C  CA  . LEU A 1 399 ? 0.906   -43.541 58.074  1.00 165.69 ? 399 LEU A CA  1 
ATOM   3054 C  C   . LEU A 1 399 ? 1.209   -43.072 59.496  1.00 181.13 ? 399 LEU A C   1 
ATOM   3055 O  O   . LEU A 1 399 ? 0.688   -43.631 60.459  1.00 201.49 ? 399 LEU A O   1 
ATOM   3056 C  CB  . LEU A 1 399 ? 2.190   -43.842 57.316  1.00 125.06 ? 399 LEU A CB  1 
ATOM   3057 C  CG  . LEU A 1 399 ? 1.997   -44.233 55.852  1.00 111.53 ? 399 LEU A CG  1 
ATOM   3058 C  CD1 . LEU A 1 399 ? 3.112   -45.167 55.477  1.00 104.75 ? 399 LEU A CD1 1 
ATOM   3059 C  CD2 . LEU A 1 399 ? 0.652   -44.903 55.644  1.00 123.52 ? 399 LEU A CD2 1 
ATOM   3060 N  N   . GLU A 1 400 ? 2.041   -42.045 59.631  1.00 180.92 ? 400 GLU A N   1 
ATOM   3061 C  CA  . GLU A 1 400 ? 2.407   -41.537 60.954  1.00 192.32 ? 400 GLU A CA  1 
ATOM   3062 C  C   . GLU A 1 400 ? 1.187   -41.195 61.809  1.00 208.09 ? 400 GLU A C   1 
ATOM   3063 O  O   . GLU A 1 400 ? 1.232   -41.321 63.029  1.00 224.87 ? 400 GLU A O   1 
ATOM   3064 C  CB  . GLU A 1 400 ? 3.335   -40.319 60.845  1.00 261.38 ? 400 GLU A CB  1 
ATOM   3065 C  CG  . GLU A 1 400 ? 4.793   -40.659 60.549  1.00 251.94 ? 400 GLU A CG  1 
ATOM   3066 C  CD  . GLU A 1 400 ? 5.667   -39.425 60.388  1.00 237.94 ? 400 GLU A CD  1 
ATOM   3067 O  OE1 . GLU A 1 400 ? 5.130   -38.297 60.452  1.00 236.16 ? 400 GLU A OE1 1 
ATOM   3068 O  OE2 . GLU A 1 400 ? 6.892   -39.581 60.197  1.00 229.79 ? 400 GLU A OE2 1 
ATOM   3069 N  N   . LYS A 1 401 ? 0.097   -40.783 61.168  1.00 132.06 ? 401 LYS A N   1 
ATOM   3070 C  CA  . LYS A 1 401 ? -1.083  -40.298 61.891  1.00 146.39 ? 401 LYS A CA  1 
ATOM   3071 C  C   . LYS A 1 401 ? -2.211  -41.322 62.033  1.00 165.27 ? 401 LYS A C   1 
ATOM   3072 O  O   . LYS A 1 401 ? -3.094  -41.158 62.873  1.00 183.09 ? 401 LYS A O   1 
ATOM   3073 C  CB  . LYS A 1 401 ? -1.626  -38.997 61.275  1.00 183.00 ? 401 LYS A CB  1 
ATOM   3074 C  CG  . LYS A 1 401 ? -2.310  -38.081 62.287  1.00 195.52 ? 401 LYS A CG  1 
ATOM   3075 C  CD  . LYS A 1 401 ? -3.081  -36.952 61.625  1.00 186.44 ? 401 LYS A CD  1 
ATOM   3076 C  CE  . LYS A 1 401 ? -3.795  -36.109 62.674  1.00 201.75 ? 401 LYS A CE  1 
ATOM   3077 N  NZ  . LYS A 1 401 ? -4.830  -35.222 62.078  1.00 197.31 ? 401 LYS A NZ  1 
ATOM   3078 N  N   . LYS A 1 402 ? -2.192  -42.366 61.212  1.00 176.32 ? 402 LYS A N   1 
ATOM   3079 C  CA  . LYS A 1 402 ? -3.088  -43.501 61.419  1.00 191.98 ? 402 LYS A CA  1 
ATOM   3080 C  C   . LYS A 1 402 ? -2.306  -44.564 62.183  1.00 204.19 ? 402 LYS A C   1 
ATOM   3081 O  O   . LYS A 1 402 ? -2.482  -45.762 61.974  1.00 209.15 ? 402 LYS A O   1 
ATOM   3082 C  CB  . LYS A 1 402 ? -3.592  -44.059 60.087  1.00 133.14 ? 402 LYS A CB  1 
ATOM   3083 C  CG  . LYS A 1 402 ? -4.999  -44.623 60.118  1.00 148.63 ? 402 LYS A CG  1 
ATOM   3084 C  CD  . LYS A 1 402 ? -6.012  -43.632 59.579  1.00 153.39 ? 402 LYS A CD  1 
ATOM   3085 C  CE  . LYS A 1 402 ? -7.375  -44.276 59.453  1.00 169.31 ? 402 LYS A CE  1 
ATOM   3086 N  NZ  . LYS A 1 402 ? -7.812  -44.855 60.754  1.00 195.49 ? 402 LYS A NZ  1 
ATOM   3087 N  N   . GLN A 1 403 ? -1.433  -44.095 63.068  1.00 161.29 ? 403 GLN A N   1 
ATOM   3088 C  CA  . GLN A 1 403 ? -0.550  -44.943 63.864  1.00 174.04 ? 403 GLN A CA  1 
ATOM   3089 C  C   . GLN A 1 403 ? 0.143   -45.992 63.024  1.00 164.44 ? 403 GLN A C   1 
ATOM   3090 O  O   . GLN A 1 403 ? -0.405  -47.052 62.754  1.00 174.91 ? 403 GLN A O   1 
ATOM   3091 C  CB  . GLN A 1 403 ? -1.288  -45.573 65.052  1.00 146.24 ? 403 GLN A CB  1 
ATOM   3092 C  CG  . GLN A 1 403 ? -1.160  -44.780 66.356  1.00 155.75 ? 403 GLN A CG  1 
ATOM   3093 C  CD  . GLN A 1 403 ? -1.831  -45.465 67.534  1.00 185.61 ? 403 GLN A CD  1 
ATOM   3094 O  OE1 . GLN A 1 403 ? -1.632  -46.658 67.782  1.00 200.18 ? 403 GLN A OE1 1 
ATOM   3095 N  NE2 . GLN A 1 403 ? -2.640  -44.709 68.265  1.00 196.10 ? 403 GLN A NE2 1 
ATOM   3096 N  N   . ILE A 1 404 ? 1.360   -45.677 62.610  1.00 208.24 ? 404 ILE A N   1 
ATOM   3097 C  CA  . ILE A 1 404 ? 2.156   -46.590 61.812  1.00 196.99 ? 404 ILE A CA  1 
ATOM   3098 C  C   . ILE A 1 404 ? 3.633   -46.309 62.047  1.00 190.83 ? 404 ILE A C   1 
ATOM   3099 O  O   . ILE A 1 404 ? 4.262   -45.544 61.309  1.00 172.15 ? 404 ILE A O   1 
ATOM   3100 C  CB  . ILE A 1 404 ? 1.809   -46.486 60.309  1.00 140.25 ? 404 ILE A CB  1 
ATOM   3101 C  CG1 . ILE A 1 404 ? 0.471   -47.167 60.026  1.00 149.71 ? 404 ILE A CG1 1 
ATOM   3102 C  CG2 . ILE A 1 404 ? 2.886   -47.123 59.454  1.00 124.60 ? 404 ILE A CG2 1 
ATOM   3103 C  CD1 . ILE A 1 404 ? 0.142   -47.281 58.552  1.00 132.39 ? 404 ILE A CD1 1 
ATOM   3104 N  N   . LYS A 1 405 ? 4.168   -46.913 63.105  1.00 202.69 ? 405 LYS A N   1 
ATOM   3105 C  CA  . LYS A 1 405 ? 5.588   -46.819 63.412  1.00 201.43 ? 405 LYS A CA  1 
ATOM   3106 C  C   . LYS A 1 405 ? 6.391   -47.022 62.131  1.00 178.81 ? 405 LYS A C   1 
ATOM   3107 O  O   . LYS A 1 405 ? 6.408   -48.121 61.567  1.00 177.44 ? 405 LYS A O   1 
ATOM   3108 C  CB  . LYS A 1 405 ? 5.994   -47.870 64.457  1.00 157.01 ? 405 LYS A CB  1 
ATOM   3109 C  CG  . LYS A 1 405 ? 5.325   -47.736 65.829  1.00 177.80 ? 405 LYS A CG  1 
ATOM   3110 C  CD  . LYS A 1 405 ? 5.829   -48.814 66.791  1.00 200.15 ? 405 LYS A CD  1 
ATOM   3111 C  CE  . LYS A 1 405 ? 5.360   -48.574 68.216  1.00 220.11 ? 405 LYS A CE  1 
ATOM   3112 N  NZ  . LYS A 1 405 ? 6.142   -49.385 69.188  1.00 238.45 ? 405 LYS A NZ  1 
ATOM   3113 N  N   . LEU A 1 406 ? 7.033   -45.954 61.664  1.00 175.87 ? 406 LEU A N   1 
ATOM   3114 C  CA  . LEU A 1 406 ? 7.903   -46.024 60.497  1.00 156.14 ? 406 LEU A CA  1 
ATOM   3115 C  C   . LEU A 1 406 ? 9.207   -45.308 60.817  1.00 156.77 ? 406 LEU A C   1 
ATOM   3116 O  O   . LEU A 1 406 ? 9.218   -44.095 60.998  1.00 159.46 ? 406 LEU A O   1 
ATOM   3117 C  CB  . LEU A 1 406 ? 7.231   -45.376 59.283  1.00 133.51 ? 406 LEU A CB  1 
ATOM   3118 C  CG  . LEU A 1 406 ? 7.369   -46.034 57.904  1.00 119.36 ? 406 LEU A CG  1 
ATOM   3119 C  CD1 . LEU A 1 406 ? 7.608   -44.965 56.860  1.00 98.69  ? 406 LEU A CD1 1 
ATOM   3120 C  CD2 . LEU A 1 406 ? 8.481   -47.071 57.875  1.00 119.90 ? 406 LEU A CD2 1 
ATOM   3121 N  N   . SER A 1 407 ? 10.300  -46.061 60.897  1.00 183.40 ? 407 SER A N   1 
ATOM   3122 C  CA  . SER A 1 407 ? 11.603  -45.494 61.227  1.00 184.78 ? 407 SER A CA  1 
ATOM   3123 C  C   . SER A 1 407 ? 12.075  -44.566 60.120  1.00 162.28 ? 407 SER A C   1 
ATOM   3124 O  O   . SER A 1 407 ? 11.390  -44.407 59.111  1.00 146.95 ? 407 SER A O   1 
ATOM   3125 C  CB  . SER A 1 407 ? 12.625  -46.604 61.447  1.00 180.15 ? 407 SER A CB  1 
ATOM   3126 O  OG  . SER A 1 407 ? 12.507  -47.592 60.441  1.00 170.14 ? 407 SER A OG  1 
ATOM   3127 N  N   . LEU A 1 408 ? 13.244  -43.961 60.300  1.00 210.57 ? 408 LEU A N   1 
ATOM   3128 C  CA  . LEU A 1 408 ? 13.730  -42.969 59.341  1.00 191.31 ? 408 LEU A CA  1 
ATOM   3129 C  C   . LEU A 1 408 ? 14.421  -43.573 58.108  1.00 176.57 ? 408 LEU A C   1 
ATOM   3130 O  O   . LEU A 1 408 ? 14.272  -43.065 56.992  1.00 158.76 ? 408 LEU A O   1 
ATOM   3131 C  CB  . LEU A 1 408 ? 14.616  -41.932 60.035  1.00 131.96 ? 408 LEU A CB  1 
ATOM   3132 C  CG  . LEU A 1 408 ? 13.856  -40.907 60.892  1.00 141.79 ? 408 LEU A CG  1 
ATOM   3133 C  CD1 . LEU A 1 408 ? 14.382  -39.481 60.666  1.00 140.65 ? 408 LEU A CD1 1 
ATOM   3134 C  CD2 . LEU A 1 408 ? 12.350  -40.968 60.645  1.00 134.14 ? 408 LEU A CD2 1 
ATOM   3135 N  N   . ARG A 1 409 ? 15.170  -44.653 58.316  1.00 162.42 ? 409 ARG A N   1 
ATOM   3136 C  CA  . ARG A 1 409 ? 15.738  -45.418 57.213  1.00 151.38 ? 409 ARG A CA  1 
ATOM   3137 C  C   . ARG A 1 409 ? 14.620  -45.762 56.245  1.00 140.97 ? 409 ARG A C   1 
ATOM   3138 O  O   . ARG A 1 409 ? 14.689  -45.448 55.061  1.00 125.42 ? 409 ARG A O   1 
ATOM   3139 C  CB  . ARG A 1 409 ? 16.416  -46.694 57.739  1.00 190.92 ? 409 ARG A CB  1 
ATOM   3140 C  CG  . ARG A 1 409 ? 16.667  -47.777 56.700  1.00 182.06 ? 409 ARG A CG  1 
ATOM   3141 C  CD  . ARG A 1 409 ? 17.701  -48.784 57.181  1.00 196.42 ? 409 ARG A CD  1 
ATOM   3142 N  NE  . ARG A 1 409 ? 18.907  -48.749 56.353  1.00 189.20 ? 409 ARG A NE  1 
ATOM   3143 C  CZ  . ARG A 1 409 ? 19.971  -49.528 56.531  1.00 200.82 ? 409 ARG A CZ  1 
ATOM   3144 N  NH1 . ARG A 1 409 ? 19.993  -50.412 57.520  1.00 220.67 ? 409 ARG A NH1 1 
ATOM   3145 N  NH2 . ARG A 1 409 ? 21.019  -49.420 55.719  1.00 193.60 ? 409 ARG A NH2 1 
ATOM   3146 N  N   . ASN A 1 410 ? 13.571  -46.378 56.770  1.00 211.95 ? 410 ASN A N   1 
ATOM   3147 C  CA  . ASN A 1 410 ? 12.457  -46.828 55.953  1.00 205.19 ? 410 ASN A CA  1 
ATOM   3148 C  C   . ASN A 1 410 ? 11.705  -45.688 55.275  1.00 190.82 ? 410 ASN A C   1 
ATOM   3149 O  O   . ASN A 1 410 ? 11.392  -45.776 54.090  1.00 178.64 ? 410 ASN A O   1 
ATOM   3150 C  CB  . ASN A 1 410 ? 11.504  -47.680 56.789  1.00 161.88 ? 410 ASN A CB  1 
ATOM   3151 C  CG  . ASN A 1 410 ? 12.226  -48.773 57.562  1.00 178.27 ? 410 ASN A CG  1 
ATOM   3152 O  OD1 . ASN A 1 410 ? 13.319  -49.210 57.176  1.00 175.26 ? 410 ASN A OD1 1 
ATOM   3153 N  ND2 . ASN A 1 410 ? 11.618  -49.222 58.661  1.00 196.92 ? 410 ASN A ND2 1 
ATOM   3154 N  N   . LYS A 1 411 ? 11.414  -44.622 56.017  1.00 164.96 ? 411 LYS A N   1 
ATOM   3155 C  CA  . LYS A 1 411 ? 10.711  -43.485 55.425  1.00 152.32 ? 411 LYS A CA  1 
ATOM   3156 C  C   . LYS A 1 411 ? 11.525  -42.879 54.291  1.00 135.12 ? 411 LYS A C   1 
ATOM   3157 O  O   . LYS A 1 411 ? 10.985  -42.520 53.249  1.00 124.45 ? 411 LYS A O   1 
ATOM   3158 C  CB  . LYS A 1 411 ? 10.386  -42.402 56.453  1.00 116.89 ? 411 LYS A CB  1 
ATOM   3159 C  CG  . LYS A 1 411 ? 9.598   -41.218 55.844  1.00 106.47 ? 411 LYS A CG  1 
ATOM   3160 C  CD  . LYS A 1 411 ? 9.733   -39.900 56.649  1.00 112.19 ? 411 LYS A CD  1 
ATOM   3161 C  CE  . LYS A 1 411 ? 8.378   -39.313 57.057  1.00 115.18 ? 411 LYS A CE  1 
ATOM   3162 N  NZ  . LYS A 1 411 ? 8.524   -38.181 58.006  1.00 121.31 ? 411 LYS A NZ  1 
ATOM   3163 N  N   . ASN A 1 412 ? 12.829  -42.768 54.493  1.00 147.27 ? 412 ASN A N   1 
ATOM   3164 C  CA  . ASN A 1 412 ? 13.678  -42.187 53.468  1.00 132.83 ? 412 ASN A CA  1 
ATOM   3165 C  C   . ASN A 1 412 ? 13.847  -43.089 52.230  1.00 124.77 ? 412 ASN A C   1 
ATOM   3166 O  O   . ASN A 1 412 ? 13.776  -42.615 51.095  1.00 111.75 ? 412 ASN A O   1 
ATOM   3167 C  CB  . ASN A 1 412 ? 15.014  -41.731 54.067  1.00 152.68 ? 412 ASN A CB  1 
ATOM   3168 C  CG  . ASN A 1 412 ? 14.871  -40.457 54.907  1.00 156.39 ? 412 ASN A CG  1 
ATOM   3169 O  OD1 . ASN A 1 412 ? 13.775  -40.105 55.338  1.00 157.41 ? 412 ASN A OD1 1 
ATOM   3170 N  ND2 . ASN A 1 412 ? 15.980  -39.759 55.129  1.00 159.31 ? 412 ASN A ND2 1 
ATOM   3171 N  N   . ILE A 1 413 ? 14.045  -44.386 52.440  1.00 145.90 ? 413 ILE A N   1 
ATOM   3172 C  CA  . ILE A 1 413 ? 14.098  -45.313 51.315  1.00 140.15 ? 413 ILE A CA  1 
ATOM   3173 C  C   . ILE A 1 413 ? 12.794  -45.222 50.532  1.00 133.11 ? 413 ILE A C   1 
ATOM   3174 O  O   . ILE A 1 413 ? 12.796  -45.121 49.307  1.00 122.41 ? 413 ILE A O   1 
ATOM   3175 C  CB  . ILE A 1 413 ? 14.278  -46.773 51.766  1.00 116.65 ? 413 ILE A CB  1 
ATOM   3176 C  CG1 . ILE A 1 413 ? 15.394  -46.898 52.794  1.00 127.48 ? 413 ILE A CG1 1 
ATOM   3177 C  CG2 . ILE A 1 413 ? 14.574  -47.672 50.576  1.00 110.99 ? 413 ILE A CG2 1 
ATOM   3178 C  CD1 . ILE A 1 413 ? 15.329  -48.201 53.564  1.00 143.15 ? 413 ILE A CD1 1 
ATOM   3179 N  N   . LEU A 1 414 ? 11.677  -45.260 51.251  1.00 144.72 ? 414 LEU A N   1 
ATOM   3180 C  CA  . LEU A 1 414 ? 10.363  -45.174 50.624  1.00 142.09 ? 414 LEU A CA  1 
ATOM   3181 C  C   . LEU A 1 414 ? 10.194  -43.877 49.824  1.00 129.83 ? 414 LEU A C   1 
ATOM   3182 O  O   . LEU A 1 414 ? 9.697   -43.892 48.707  1.00 123.70 ? 414 LEU A O   1 
ATOM   3183 C  CB  . LEU A 1 414 ? 9.238   -45.351 51.660  1.00 105.28 ? 414 LEU A CB  1 
ATOM   3184 C  CG  . LEU A 1 414 ? 8.848   -46.797 51.955  1.00 118.55 ? 414 LEU A CG  1 
ATOM   3185 C  CD1 . LEU A 1 414 ? 7.341   -46.986 51.866  1.00 127.08 ? 414 LEU A CD1 1 
ATOM   3186 C  CD2 . LEU A 1 414 ? 9.554   -47.678 50.957  1.00 112.51 ? 414 LEU A CD2 1 
ATOM   3187 N  N   . LEU A 1 415 ? 10.617  -42.755 50.383  1.00 122.58 ? 415 LEU A N   1 
ATOM   3188 C  CA  . LEU A 1 415 ? 10.544  -41.520 49.629  1.00 111.49 ? 415 LEU A CA  1 
ATOM   3189 C  C   . LEU A 1 415 ? 11.379  -41.610 48.354  1.00 101.72 ? 415 LEU A C   1 
ATOM   3190 O  O   . LEU A 1 415 ? 10.889  -41.313 47.265  1.00 95.26  ? 415 LEU A O   1 
ATOM   3191 C  CB  . LEU A 1 415 ? 10.981  -40.330 50.482  1.00 102.56 ? 415 LEU A CB  1 
ATOM   3192 C  CG  . LEU A 1 415 ? 9.804   -39.559 51.083  1.00 107.98 ? 415 LEU A CG  1 
ATOM   3193 C  CD1 . LEU A 1 415 ? 10.219  -38.679 52.265  1.00 112.72 ? 415 LEU A CD1 1 
ATOM   3194 C  CD2 . LEU A 1 415 ? 9.080   -38.758 49.995  1.00 99.74  ? 415 LEU A CD2 1 
ATOM   3195 N  N   . ILE A 1 416 ? 12.637  -42.026 48.492  1.00 139.06 ? 416 ILE A N   1 
ATOM   3196 C  CA  . ILE A 1 416 ? 13.564  -42.062 47.363  1.00 131.25 ? 416 ILE A CA  1 
ATOM   3197 C  C   . ILE A 1 416 ? 13.035  -42.949 46.251  1.00 130.77 ? 416 ILE A C   1 
ATOM   3198 O  O   . ILE A 1 416 ? 13.139  -42.620 45.070  1.00 125.04 ? 416 ILE A O   1 
ATOM   3199 C  CB  . ILE A 1 416 ? 14.962  -42.543 47.791  1.00 118.97 ? 416 ILE A CB  1 
ATOM   3200 C  CG1 . ILE A 1 416 ? 15.658  -41.455 48.607  1.00 120.48 ? 416 ILE A CG1 1 
ATOM   3201 C  CG2 . ILE A 1 416 ? 15.800  -42.908 46.577  1.00 112.16 ? 416 ILE A CG2 1 
ATOM   3202 C  CD1 . ILE A 1 416 ? 16.951  -41.883 49.232  1.00 125.88 ? 416 ILE A CD1 1 
ATOM   3203 N  N   . LEU A 1 417 ? 12.446  -44.071 46.628  1.00 117.92 ? 417 LEU A N   1 
ATOM   3204 C  CA  . LEU A 1 417 ? 11.881  -44.956 45.633  1.00 118.70 ? 417 LEU A CA  1 
ATOM   3205 C  C   . LEU A 1 417 ? 10.598  -44.391 45.018  1.00 116.52 ? 417 LEU A C   1 
ATOM   3206 O  O   . LEU A 1 417 ? 10.523  -44.265 43.817  1.00 111.95 ? 417 LEU A O   1 
ATOM   3207 C  CB  . LEU A 1 417 ? 11.716  -46.375 46.169  1.00 103.13 ? 417 LEU A CB  1 
ATOM   3208 C  CG  . LEU A 1 417 ? 13.072  -47.082 46.309  1.00 105.22 ? 417 LEU A CG  1 
ATOM   3209 C  CD1 . LEU A 1 417 ? 13.302  -47.544 47.734  1.00 116.81 ? 417 LEU A CD1 1 
ATOM   3210 C  CD2 . LEU A 1 417 ? 13.195  -48.249 45.333  1.00 105.12 ? 417 LEU A CD2 1 
ATOM   3211 N  N   . ILE A 1 418 ? 9.600   -44.024 45.814  1.00 125.34 ? 418 ILE A N   1 
ATOM   3212 C  CA  . ILE A 1 418 ? 8.436   -43.328 45.250  1.00 123.10 ? 418 ILE A CA  1 
ATOM   3213 C  C   . ILE A 1 418 ? 8.900   -42.301 44.187  1.00 112.56 ? 418 ILE A C   1 
ATOM   3214 O  O   . ILE A 1 418 ? 8.383   -42.249 43.064  1.00 109.87 ? 418 ILE A O   1 
ATOM   3215 C  CB  . ILE A 1 418 ? 7.579   -42.644 46.359  1.00 90.14  ? 418 ILE A CB  1 
ATOM   3216 C  CG1 . ILE A 1 418 ? 6.450   -43.569 46.862  1.00 103.11 ? 418 ILE A CG1 1 
ATOM   3217 C  CG2 . ILE A 1 418 ? 6.999   -41.345 45.847  1.00 84.85  ? 418 ILE A CG2 1 
ATOM   3218 C  CD1 . ILE A 1 418 ? 5.195   -43.677 45.941  1.00 107.86 ? 418 ILE A CD1 1 
ATOM   3219 N  N   . ALA A 1 419 ? 9.925   -41.532 44.537  1.00 108.76 ? 419 ALA A N   1 
ATOM   3220 C  CA  . ALA A 1 419 ? 10.464  -40.476 43.679  1.00 99.83  ? 419 ALA A CA  1 
ATOM   3221 C  C   . ALA A 1 419 ? 11.121  -40.942 42.361  1.00 96.86  ? 419 ALA A C   1 
ATOM   3222 O  O   . ALA A 1 419 ? 10.716  -40.516 41.250  1.00 93.67  ? 419 ALA A O   1 
ATOM   3223 C  CB  . ALA A 1 419 ? 11.437  -39.622 44.481  1.00 65.12  ? 419 ALA A CB  1 
ATOM   3224 N  N   . PHE A 1 420 ? 12.154  -41.777 42.475  1.00 129.18 ? 420 PHE A N   1 
ATOM   3225 C  CA  . PHE A 1 420 ? 12.817  -42.285 41.282  1.00 127.90 ? 420 PHE A CA  1 
ATOM   3226 C  C   . PHE A 1 420 ? 11.777  -42.935 40.380  1.00 131.73 ? 420 PHE A C   1 
ATOM   3227 O  O   . PHE A 1 420 ? 11.758  -42.720 39.154  1.00 131.29 ? 420 PHE A O   1 
ATOM   3228 C  CB  . PHE A 1 420 ? 13.905  -43.305 41.617  1.00 150.96 ? 420 PHE A CB  1 
ATOM   3229 C  CG  . PHE A 1 420 ? 14.411  -44.054 40.407  1.00 151.43 ? 420 PHE A CG  1 
ATOM   3230 C  CD1 . PHE A 1 420 ? 15.412  -43.513 39.608  1.00 147.44 ? 420 PHE A CD1 1 
ATOM   3231 C  CD2 . PHE A 1 420 ? 13.867  -45.285 40.051  1.00 157.09 ? 420 PHE A CD2 1 
ATOM   3232 C  CE1 . PHE A 1 420 ? 15.871  -44.188 38.481  1.00 149.55 ? 420 PHE A CE1 1 
ATOM   3233 C  CE2 . PHE A 1 420 ? 14.323  -45.965 38.930  1.00 158.88 ? 420 PHE A CE2 1 
ATOM   3234 C  CZ  . PHE A 1 420 ? 15.325  -45.413 38.144  1.00 155.33 ? 420 PHE A CZ  1 
ATOM   3235 N  N   . PHE A 1 421 ? 10.914  -43.730 41.000  1.00 103.43 ? 421 PHE A N   1 
ATOM   3236 C  CA  . PHE A 1 421 ? 9.819   -44.366 40.309  1.00 108.08 ? 421 PHE A CA  1 
ATOM   3237 C  C   . PHE A 1 421 ? 9.032   -43.334 39.509  1.00 104.74 ? 421 PHE A C   1 
ATOM   3238 O  O   . PHE A 1 421 ? 9.020   -43.407 38.285  1.00 105.11 ? 421 PHE A O   1 
ATOM   3239 C  CB  . PHE A 1 421 ? 8.909   -45.138 41.257  1.00 223.01 ? 421 PHE A CB  1 
ATOM   3240 C  CG  . PHE A 1 421 ? 7.775   -45.819 40.558  1.00 228.86 ? 421 PHE A CG  1 
ATOM   3241 C  CD1 . PHE A 1 421 ? 7.869   -47.151 40.188  1.00 233.82 ? 421 PHE A CD1 1 
ATOM   3242 C  CD2 . PHE A 1 421 ? 6.621   -45.111 40.238  1.00 230.01 ? 421 PHE A CD2 1 
ATOM   3243 C  CE1 . PHE A 1 421 ? 6.824   -47.772 39.531  1.00 240.21 ? 421 PHE A CE1 1 
ATOM   3244 C  CE2 . PHE A 1 421 ? 5.574   -45.723 39.580  1.00 236.52 ? 421 PHE A CE2 1 
ATOM   3245 C  CZ  . PHE A 1 421 ? 5.675   -47.058 39.225  1.00 241.74 ? 421 PHE A CZ  1 
ATOM   3246 N  N   . SER A 1 422 ? 8.416   -42.348 40.164  1.00 125.99 ? 422 SER A N   1 
ATOM   3247 C  CA  . SER A 1 422 ? 7.597   -41.369 39.414  1.00 123.60 ? 422 SER A CA  1 
ATOM   3248 C  C   . SER A 1 422 ? 8.325   -40.450 38.385  1.00 117.77 ? 422 SER A C   1 
ATOM   3249 O  O   . SER A 1 422 ? 7.706   -39.981 37.428  1.00 119.14 ? 422 SER A O   1 
ATOM   3250 C  CB  . SER A 1 422 ? 6.719   -40.550 40.360  1.00 106.85 ? 422 SER A CB  1 
ATOM   3251 O  OG  . SER A 1 422 ? 7.514   -39.815 41.258  1.00 103.17 ? 422 SER A OG  1 
ATOM   3252 N  N   . ILE A 1 423 ? 9.623   -40.212 38.575  1.00 93.17  ? 423 ILE A N   1 
ATOM   3253 C  CA  . ILE A 1 423 ? 10.454  -39.410 37.651  1.00 88.72  ? 423 ILE A CA  1 
ATOM   3254 C  C   . ILE A 1 423 ? 11.006  -40.147 36.379  1.00 92.27  ? 423 ILE A C   1 
ATOM   3255 O  O   . ILE A 1 423 ? 11.170  -39.584 35.232  1.00 92.10  ? 423 ILE A O   1 
ATOM   3256 C  CB  . ILE A 1 423 ? 11.619  -38.857 38.489  1.00 101.70 ? 423 ILE A CB  1 
ATOM   3257 C  CG1 . ILE A 1 423 ? 11.108  -37.733 39.380  1.00 99.08  ? 423 ILE A CG1 1 
ATOM   3258 C  CG2 . ILE A 1 423 ? 12.780  -38.391 37.631  1.00 97.84  ? 423 ILE A CG2 1 
ATOM   3259 C  CD1 . ILE A 1 423 ? 12.082  -36.605 39.480  1.00 93.36  ? 423 ILE A CD1 1 
ATOM   3260 N  N   . SER A 1 424 ? 11.308  -41.421 36.596  1.00 100.12 ? 424 SER A N   1 
ATOM   3261 C  CA  . SER A 1 424 ? 11.862  -42.253 35.542  1.00 104.79 ? 424 SER A CA  1 
ATOM   3262 C  C   . SER A 1 424 ? 11.103  -42.219 34.205  1.00 108.66 ? 424 SER A C   1 
ATOM   3263 O  O   . SER A 1 424 ? 11.713  -42.372 33.172  1.00 109.80 ? 424 SER A O   1 
ATOM   3264 C  CB  . SER A 1 424 ? 11.976  -43.686 36.030  1.00 89.94  ? 424 SER A CB  1 
ATOM   3265 O  OG  . SER A 1 424 ? 10.716  -44.119 36.472  1.00 93.80  ? 424 SER A OG  1 
ATOM   3266 N  N   . PRO A 1 425 ? 9.773   -42.044 34.219  1.00 106.96 ? 425 PRO A N   1 
ATOM   3267 C  CA  . PRO A 1 425 ? 9.030   -41.954 32.956  1.00 112.33 ? 425 PRO A CA  1 
ATOM   3268 C  C   . PRO A 1 425 ? 9.438   -40.753 32.137  1.00 108.92 ? 425 PRO A C   1 
ATOM   3269 O  O   . PRO A 1 425 ? 9.581   -40.817 30.914  1.00 114.08 ? 425 PRO A O   1 
ATOM   3270 C  CB  . PRO A 1 425 ? 7.604   -41.728 33.419  1.00 97.17  ? 425 PRO A CB  1 
ATOM   3271 C  CG  . PRO A 1 425 ? 7.552   -42.334 34.715  1.00 97.33  ? 425 PRO A CG  1 
ATOM   3272 C  CD  . PRO A 1 425 ? 8.863   -42.089 35.366  1.00 91.10  ? 425 PRO A CD  1 
ATOM   3273 N  N   . ALA A 1 426 ? 9.592   -39.636 32.824  1.00 118.31 ? 426 ALA A N   1 
ATOM   3274 C  CA  . ALA A 1 426 ? 10.089  -38.446 32.177  1.00 114.87 ? 426 ALA A CA  1 
ATOM   3275 C  C   . ALA A 1 426 ? 11.529  -38.665 31.724  1.00 114.35 ? 426 ALA A C   1 
ATOM   3276 O  O   . ALA A 1 426 ? 11.893  -38.303 30.578  1.00 117.25 ? 426 ALA A O   1 
ATOM   3277 C  CB  . ALA A 1 426 ? 9.988   -37.298 33.092  1.00 54.65  ? 426 ALA A CB  1 
ATOM   3278 N  N   . LEU A 1 427 ? 12.353  -39.278 32.584  1.00 87.72  ? 427 LEU A N   1 
ATOM   3279 C  CA  . LEU A 1 427 ? 13.694  -39.663 32.055  1.00 89.27  ? 427 LEU A CA  1 
ATOM   3280 C  C   . LEU A 1 427 ? 13.665  -40.424 30.686  1.00 99.11  ? 427 LEU A C   1 
ATOM   3281 O  O   . LEU A 1 427 ? 14.330  -40.034 29.692  1.00 102.44 ? 427 LEU A O   1 
ATOM   3282 C  CB  . LEU A 1 427 ? 14.463  -40.505 33.062  1.00 112.10 ? 427 LEU A CB  1 
ATOM   3283 C  CG  . LEU A 1 427 ? 14.874  -39.877 34.381  1.00 104.26 ? 427 LEU A CG  1 
ATOM   3284 C  CD1 . LEU A 1 427 ? 15.368  -40.977 35.299  1.00 105.56 ? 427 LEU A CD1 1 
ATOM   3285 C  CD2 . LEU A 1 427 ? 15.929  -38.786 34.179  1.00 99.13  ? 427 LEU A CD2 1 
ATOM   3286 N  N   . MET A 1 428 ? 12.900  -41.520 30.673  1.00 96.26  ? 428 MET A N   1 
ATOM   3287 C  CA  . MET A 1 428 ? 12.664  -42.390 29.525  1.00 107.25 ? 428 MET A CA  1 
ATOM   3288 C  C   . MET A 1 428 ? 12.264  -41.543 28.345  1.00 112.20 ? 428 MET A C   1 
ATOM   3289 O  O   . MET A 1 428 ? 12.849  -41.646 27.272  1.00 119.86 ? 428 MET A O   1 
ATOM   3290 C  CB  . MET A 1 428 ? 11.524  -43.369 29.830  1.00 169.16 ? 428 MET A CB  1 
ATOM   3291 C  CG  . MET A 1 428 ? 11.933  -44.828 29.998  1.00 174.17 ? 428 MET A CG  1 
ATOM   3292 S  SD  . MET A 1 428 ? 10.521  -45.959 30.207  1.00 183.11 ? 428 MET A SD  1 
ATOM   3293 C  CE  . MET A 1 428 ? 9.972   -45.626 31.887  1.00 177.23 ? 428 MET A CE  1 
ATOM   3294 N  N   . HIS A 1 429 ? 11.252  -40.704 28.546  1.00 94.96  ? 429 HIS A N   1 
ATOM   3295 C  CA  . HIS A 1 429 ? 10.804  -39.827 27.478  1.00 99.98  ? 429 HIS A CA  1 
ATOM   3296 C  C   . HIS A 1 429 ? 11.938  -38.993 26.924  1.00 99.10  ? 429 HIS A C   1 
ATOM   3297 O  O   . HIS A 1 429 ? 12.040  -38.813 25.713  1.00 107.45 ? 429 HIS A O   1 
ATOM   3298 C  CB  . HIS A 1 429 ? 9.698   -38.896 27.932  1.00 105.98 ? 429 HIS A CB  1 
ATOM   3299 C  CG  . HIS A 1 429 ? 9.337   -37.881 26.898  1.00 110.88 ? 429 HIS A CG  1 
ATOM   3300 N  ND1 . HIS A 1 429 ? 8.497   -38.165 25.844  1.00 122.32 ? 429 HIS A ND1 1 
ATOM   3301 C  CD2 . HIS A 1 429 ? 9.734   -36.599 26.731  1.00 105.53 ? 429 HIS A CD2 1 
ATOM   3302 C  CE1 . HIS A 1 429 ? 8.370   -37.090 25.085  1.00 117.20 ? 429 HIS A CE1 1 
ATOM   3303 N  NE2 . HIS A 1 429 ? 9.116   -36.130 25.598  1.00 108.92 ? 429 HIS A NE2 1 
ATOM   3304 N  N   . ILE A 1 430 ? 12.779  -38.467 27.814  1.00 93.53  ? 430 ILE A N   1 
ATOM   3305 C  CA  . ILE A 1 430 ? 13.923  -37.683 27.343  1.00 92.96  ? 430 ILE A CA  1 
ATOM   3306 C  C   . ILE A 1 430 ? 14.882  -38.512 26.502  1.00 101.57 ? 430 ILE A C   1 
ATOM   3307 O  O   . ILE A 1 430 ? 15.458  -38.002 25.534  1.00 107.61 ? 430 ILE A O   1 
ATOM   3308 C  CB  . ILE A 1 430 ? 14.764  -37.101 28.473  1.00 95.24  ? 430 ILE A CB  1 
ATOM   3309 C  CG1 . ILE A 1 430 ? 13.964  -36.179 29.359  1.00 87.30  ? 430 ILE A CG1 1 
ATOM   3310 C  CG2 . ILE A 1 430 ? 15.891  -36.264 27.911  1.00 96.04  ? 430 ILE A CG2 1 
ATOM   3311 C  CD1 . ILE A 1 430 ? 14.869  -35.555 30.373  1.00 78.11  ? 430 ILE A CD1 1 
ATOM   3312 N  N   . TYR A 1 431 ? 15.095  -39.769 26.900  1.00 89.19  ? 431 TYR A N   1 
ATOM   3313 C  CA  . TYR A 1 431 ? 15.984  -40.651 26.121  1.00 98.43  ? 431 TYR A CA  1 
ATOM   3314 C  C   . TYR A 1 431 ? 15.406  -40.874 24.747  1.00 112.01 ? 431 TYR A C   1 
ATOM   3315 O  O   . TYR A 1 431 ? 16.119  -40.870 23.748  1.00 121.85 ? 431 TYR A O   1 
ATOM   3316 C  CB  . TYR A 1 431 ? 16.165  -42.005 26.811  1.00 90.27  ? 431 TYR A CB  1 
ATOM   3317 C  CG  . TYR A 1 431 ? 16.796  -43.085 25.953  1.00 101.87 ? 431 TYR A CG  1 
ATOM   3318 C  CD1 . TYR A 1 431 ? 18.149  -43.387 26.049  1.00 101.41 ? 431 TYR A CD1 1 
ATOM   3319 C  CD2 . TYR A 1 431 ? 16.026  -43.827 25.062  1.00 114.44 ? 431 TYR A CD2 1 
ATOM   3320 C  CE1 . TYR A 1 431 ? 18.720  -44.394 25.264  1.00 113.02 ? 431 TYR A CE1 1 
ATOM   3321 C  CE2 . TYR A 1 431 ? 16.585  -44.825 24.268  1.00 126.33 ? 431 TYR A CE2 1 
ATOM   3322 C  CZ  . TYR A 1 431 ? 17.927  -45.104 24.374  1.00 125.45 ? 431 TYR A CZ  1 
ATOM   3323 O  OH  . TYR A 1 431 ? 18.457  -46.098 23.585  1.00 138.13 ? 431 TYR A OH  1 
ATOM   3324 N  N   . TYR A 1 432 ? 14.096  -41.072 24.719  1.00 91.54  ? 432 TYR A N   1 
ATOM   3325 C  CA  . TYR A 1 432 ? 13.403  -41.431 23.509  1.00 103.15 ? 432 TYR A CA  1 
ATOM   3326 C  C   . TYR A 1 432 ? 13.135  -40.213 22.664  1.00 101.79 ? 432 TYR A C   1 
ATOM   3327 O  O   . TYR A 1 432 ? 12.762  -40.335 21.514  1.00 105.36 ? 432 TYR A O   1 
ATOM   3328 C  CB  . TYR A 1 432 ? 12.097  -42.161 23.837  1.00 171.52 ? 432 TYR A CB  1 
ATOM   3329 C  CG  . TYR A 1 432 ? 12.269  -43.658 24.035  1.00 177.29 ? 432 TYR A CG  1 
ATOM   3330 C  CD1 . TYR A 1 432 ? 11.396  -44.384 24.837  1.00 174.34 ? 432 TYR A CD1 1 
ATOM   3331 C  CD2 . TYR A 1 432 ? 13.305  -44.342 23.415  1.00 185.56 ? 432 TYR A CD2 1 
ATOM   3332 C  CE1 . TYR A 1 432 ? 11.556  -45.749 25.015  1.00 179.02 ? 432 TYR A CE1 1 
ATOM   3333 C  CE2 . TYR A 1 432 ? 13.473  -45.703 23.589  1.00 191.44 ? 432 TYR A CE2 1 
ATOM   3334 C  CZ  . TYR A 1 432 ? 12.597  -46.402 24.387  1.00 187.32 ? 432 TYR A CZ  1 
ATOM   3335 O  OH  . TYR A 1 432 ? 12.766  -47.756 24.555  1.00 192.53 ? 432 TYR A OH  1 
ATOM   3336 N  N   . TYR A 1 433 ? 13.343  -39.031 23.229  1.00 119.00 ? 433 TYR A N   1 
ATOM   3337 C  CA  . TYR A 1 433 ? 13.019  -37.781 22.529  1.00 112.37 ? 433 TYR A CA  1 
ATOM   3338 C  C   . TYR A 1 433 ? 14.227  -37.128 21.831  1.00 113.20 ? 433 TYR A C   1 
ATOM   3339 O  O   . TYR A 1 433 ? 14.860  -36.208 22.377  1.00 107.75 ? 433 TYR A O   1 
ATOM   3340 C  CB  . TYR A 1 433 ? 12.330  -36.802 23.491  1.00 116.68 ? 433 TYR A CB  1 
ATOM   3341 C  CG  . TYR A 1 433 ? 11.723  -35.579 22.839  1.00 110.39 ? 433 TYR A CG  1 
ATOM   3342 C  CD1 . TYR A 1 433 ? 10.372  -35.524 22.546  1.00 111.81 ? 433 TYR A CD1 1 
ATOM   3343 C  CD2 . TYR A 1 433 ? 12.503  -34.472 22.534  1.00 103.12 ? 433 TYR A CD2 1 
ATOM   3344 C  CE1 . TYR A 1 433 ? 9.819   -34.405 21.958  1.00 106.37 ? 433 TYR A CE1 1 
ATOM   3345 C  CE2 . TYR A 1 433 ? 11.954  -33.351 21.946  1.00 97.26  ? 433 TYR A CE2 1 
ATOM   3346 C  CZ  . TYR A 1 433 ? 10.615  -33.322 21.661  1.00 98.98  ? 433 TYR A CZ  1 
ATOM   3347 O  OH  . TYR A 1 433 ? 10.082  -32.200 21.079  1.00 94.32  ? 433 TYR A OH  1 
ATOM   3348 N  N   . LYS A 1 434 ? 14.513  -37.606 20.618  1.00 109.61 ? 434 LYS A N   1 
ATOM   3349 C  CA  . LYS A 1 434 ? 15.711  -37.224 19.871  1.00 113.68 ? 434 LYS A CA  1 
ATOM   3350 C  C   . LYS A 1 434 ? 15.417  -36.372 18.649  1.00 112.97 ? 434 LYS A C   1 
ATOM   3351 O  O   . LYS A 1 434 ? 15.469  -36.878 17.534  1.00 120.29 ? 434 LYS A O   1 
ATOM   3352 C  CB  . LYS A 1 434 ? 16.446  -38.469 19.377  1.00 108.63 ? 434 LYS A CB  1 
ATOM   3353 C  CG  . LYS A 1 434 ? 16.616  -39.555 20.397  1.00 112.32 ? 434 LYS A CG  1 
ATOM   3354 C  CD  . LYS A 1 434 ? 17.360  -40.717 19.791  1.00 121.07 ? 434 LYS A CD  1 
ATOM   3355 C  CE  . LYS A 1 434 ? 17.692  -41.780 20.819  1.00 124.01 ? 434 LYS A CE  1 
ATOM   3356 N  NZ  . LYS A 1 434 ? 18.911  -41.389 21.577  1.00 122.74 ? 434 LYS A NZ  1 
ATOM   3357 N  N   . SER A 1 435 ? 15.137  -35.086 18.834  1.00 118.24 ? 435 SER A N   1 
ATOM   3358 C  CA  . SER A 1 435 ? 14.859  -34.226 17.682  1.00 118.10 ? 435 SER A CA  1 
ATOM   3359 C  C   . SER A 1 435 ? 16.063  -34.144 16.772  1.00 127.55 ? 435 SER A C   1 
ATOM   3360 O  O   . SER A 1 435 ? 17.192  -34.373 17.198  1.00 132.47 ? 435 SER A O   1 
ATOM   3361 C  CB  . SER A 1 435 ? 14.474  -32.804 18.109  1.00 100.73 ? 435 SER A CB  1 
ATOM   3362 O  OG  . SER A 1 435 ? 14.128  -32.757 19.476  1.00 92.51  ? 435 SER A OG  1 
ATOM   3363 N  N   . SER A 1 436 ? 15.817  -33.819 15.512  1.00 113.74 ? 436 SER A N   1 
ATOM   3364 C  CA  . SER A 1 436 ? 16.895  -33.387 14.658  1.00 122.88 ? 436 SER A CA  1 
ATOM   3365 C  C   . SER A 1 436 ? 16.979  -31.881 14.836  1.00 115.55 ? 436 SER A C   1 
ATOM   3366 O  O   . SER A 1 436 ? 16.556  -31.339 15.841  1.00 102.55 ? 436 SER A O   1 
ATOM   3367 C  CB  . SER A 1 436 ? 16.652  -33.771 13.196  1.00 167.88 ? 436 SER A CB  1 
ATOM   3368 O  OG  . SER A 1 436 ? 15.744  -32.893 12.559  1.00 162.67 ? 436 SER A OG  1 
ATOM   3369 N  N   . THR A 1 437 ? 17.525  -31.198 13.857  1.00 106.34 ? 437 THR A N   1 
ATOM   3370 C  CA  . THR A 1 437 ? 17.649  -29.772 13.945  1.00 99.65  ? 437 THR A CA  1 
ATOM   3371 C  C   . THR A 1 437 ? 16.526  -29.197 13.126  1.00 103.26 ? 437 THR A C   1 
ATOM   3372 O  O   . THR A 1 437 ? 15.941  -29.896 12.307  1.00 115.80 ? 437 THR A O   1 
ATOM   3373 C  CB  . THR A 1 437 ? 18.954  -29.368 13.304  1.00 106.36 ? 437 THR A CB  1 
ATOM   3374 O  OG1 . THR A 1 437 ? 20.034  -30.019 13.981  1.00 104.28 ? 437 THR A OG1 1 
ATOM   3375 C  CG2 . THR A 1 437 ? 19.126  -27.857 13.335  1.00 101.53 ? 437 THR A CG2 1 
ATOM   3376 N  N   . VAL A 1 438 ? 16.209  -27.930 13.335  1.00 95.76  ? 438 VAL A N   1 
ATOM   3377 C  CA  . VAL A 1 438 ? 15.336  -27.242 12.395  1.00 101.26 ? 438 VAL A CA  1 
ATOM   3378 C  C   . VAL A 1 438 ? 15.755  -27.670 10.995  1.00 120.74 ? 438 VAL A C   1 
ATOM   3379 O  O   . VAL A 1 438 ? 14.942  -28.194 10.235  1.00 127.99 ? 438 VAL A O   1 
ATOM   3380 C  CB  . VAL A 1 438 ? 15.442  -25.702 12.543  1.00 72.46  ? 438 VAL A CB  1 
ATOM   3381 C  CG1 . VAL A 1 438 ? 14.581  -24.966 11.510  1.00 80.52  ? 438 VAL A CG1 1 
ATOM   3382 C  CG2 . VAL A 1 438 ? 15.068  -25.304 13.949  1.00 56.98  ? 438 VAL A CG2 1 
ATOM   3383 N  N   . PHE A 1 439 ? 17.038  -27.471 10.686  1.00 83.77  ? 439 PHE A N   1 
ATOM   3384 C  CA  . PHE A 1 439 ? 17.610  -27.793 9.386   1.00 103.87 ? 439 PHE A CA  1 
ATOM   3385 C  C   . PHE A 1 439 ? 18.820  -28.683 9.572   1.00 108.72 ? 439 PHE A C   1 
ATOM   3386 O  O   . PHE A 1 439 ? 19.337  -28.820 10.673  1.00 96.51  ? 439 PHE A O   1 
ATOM   3387 C  CB  . PHE A 1 439 ? 18.093  -26.537 8.678   1.00 89.77  ? 439 PHE A CB  1 
ATOM   3388 C  CG  . PHE A 1 439 ? 17.027  -25.782 7.982   1.00 94.21  ? 439 PHE A CG  1 
ATOM   3389 C  CD1 . PHE A 1 439 ? 15.725  -26.174 8.068   1.00 84.39  ? 439 PHE A CD1 1 
ATOM   3390 C  CD2 . PHE A 1 439 ? 17.332  -24.672 7.231   1.00 108.13 ? 439 PHE A CD2 1 
ATOM   3391 C  CE1 . PHE A 1 439 ? 14.735  -25.467 7.422   1.00 88.39  ? 439 PHE A CE1 1 
ATOM   3392 C  CE2 . PHE A 1 439 ? 16.351  -23.967 6.581   1.00 112.92 ? 439 PHE A CE2 1 
ATOM   3393 C  CZ  . PHE A 1 439 ? 15.050  -24.365 6.679   1.00 102.58 ? 439 PHE A CZ  1 
ATOM   3394 N  N   . THR A 1 440 ? 19.289  -29.271 8.478   1.00 85.91  ? 440 THR A N   1 
ATOM   3395 C  CA  . THR A 1 440 ? 20.534  -30.011 8.487   1.00 98.28  ? 440 THR A CA  1 
ATOM   3396 C  C   . THR A 1 440 ? 21.622  -29.101 7.964   1.00 110.01 ? 440 THR A C   1 
ATOM   3397 O  O   . THR A 1 440 ? 21.350  -28.173 7.208   1.00 111.18 ? 440 THR A O   1 
ATOM   3398 C  CB  . THR A 1 440 ? 20.460  -31.225 7.561   1.00 101.39 ? 440 THR A CB  1 
ATOM   3399 O  OG1 . THR A 1 440 ? 19.729  -30.872 6.376   1.00 107.99 ? 440 THR A OG1 1 
ATOM   3400 C  CG2 . THR A 1 440 ? 19.782  -32.394 8.262   1.00 89.49  ? 440 THR A CG2 1 
ATOM   3401 N  N   . SER A 1 441 ? 22.857  -29.369 8.367   1.00 116.96 ? 441 SER A N   1 
ATOM   3402 C  CA  . SER A 1 441 ? 24.004  -28.702 7.773   1.00 115.60 ? 441 SER A CA  1 
ATOM   3403 C  C   . SER A 1 441 ? 23.713  -28.364 6.326   1.00 113.00 ? 441 SER A C   1 
ATOM   3404 O  O   . SER A 1 441 ? 23.612  -27.206 5.961   1.00 107.54 ? 441 SER A O   1 
ATOM   3405 C  CB  . SER A 1 441 ? 25.227  -29.609 7.840   1.00 87.37  ? 441 SER A CB  1 
ATOM   3406 O  OG  . SER A 1 441 ? 24.818  -30.939 8.089   1.00 93.46  ? 441 SER A OG  1 
ATOM   3407 N  N   . TYR A 1 442 ? 23.559  -29.394 5.512   1.00 116.27 ? 442 TYR A N   1 
ATOM   3408 C  CA  . TYR A 1 442 ? 23.371  -29.223 4.085   1.00 115.07 ? 442 TYR A CA  1 
ATOM   3409 C  C   . TYR A 1 442 ? 22.526  -27.988 3.760   1.00 107.16 ? 442 TYR A C   1 
ATOM   3410 O  O   . TYR A 1 442 ? 22.967  -27.105 3.011   1.00 104.73 ? 442 TYR A O   1 
ATOM   3411 C  CB  . TYR A 1 442 ? 22.755  -30.488 3.499   1.00 120.75 ? 442 TYR A CB  1 
ATOM   3412 C  CG  . TYR A 1 442 ? 23.484  -31.762 3.877   1.00 130.41 ? 442 TYR A CG  1 
ATOM   3413 C  CD1 . TYR A 1 442 ? 23.850  -32.013 5.185   1.00 110.58 ? 442 TYR A CD1 1 
ATOM   3414 C  CD2 . TYR A 1 442 ? 23.792  -32.724 2.928   1.00 112.55 ? 442 TYR A CD2 1 
ATOM   3415 C  CE1 . TYR A 1 442 ? 24.515  -33.179 5.542   1.00 119.95 ? 442 TYR A CE1 1 
ATOM   3416 C  CE2 . TYR A 1 442 ? 24.447  -33.901 3.279   1.00 121.79 ? 442 TYR A CE2 1 
ATOM   3417 C  CZ  . TYR A 1 442 ? 24.812  -34.124 4.593   1.00 125.62 ? 442 TYR A CZ  1 
ATOM   3418 O  OH  . TYR A 1 442 ? 25.468  -35.283 4.969   1.00 135.79 ? 442 TYR A OH  1 
ATOM   3419 N  N   . GLU A 1 443 ? 21.331  -27.914 4.351   1.00 123.91 ? 443 GLU A N   1 
ATOM   3420 C  CA  . GLU A 1 443 ? 20.381  -26.821 4.092   1.00 117.18 ? 443 GLU A CA  1 
ATOM   3421 C  C   . GLU A 1 443 ? 20.895  -25.449 4.564   1.00 111.92 ? 443 GLU A C   1 
ATOM   3422 O  O   . GLU A 1 443 ? 20.893  -24.446 3.819   1.00 107.74 ? 443 GLU A O   1 
ATOM   3423 C  CB  . GLU A 1 443 ? 19.024  -27.148 4.733   1.00 111.88 ? 443 GLU A CB  1 
ATOM   3424 C  CG  . GLU A 1 443 ? 18.603  -28.617 4.607   1.00 118.25 ? 443 GLU A CG  1 
ATOM   3425 C  CD  . GLU A 1 443 ? 17.096  -28.799 4.585   1.00 118.81 ? 443 GLU A CD  1 
ATOM   3426 O  OE1 . GLU A 1 443 ? 16.445  -28.403 5.558   1.00 116.32 ? 443 GLU A OE1 1 
ATOM   3427 O  OE2 . GLU A 1 443 ? 16.550  -29.325 3.594   1.00 121.14 ? 443 GLU A OE2 1 
ATOM   3428 N  N   . ALA A 1 444 ? 21.346  -25.415 5.809   1.00 122.53 ? 444 ALA A N   1 
ATOM   3429 C  CA  . ALA A 1 444 ? 22.012  -24.240 6.330   1.00 118.63 ? 444 ALA A CA  1 
ATOM   3430 C  C   . ALA A 1 444 ? 22.980  -23.739 5.282   1.00 119.01 ? 444 ALA A C   1 
ATOM   3431 O  O   . ALA A 1 444 ? 22.725  -22.727 4.644   1.00 115.38 ? 444 ALA A O   1 
ATOM   3432 C  CB  . ALA A 1 444 ? 22.751  -24.575 7.584   1.00 65.20  ? 444 ALA A CB  1 
ATOM   3433 N  N   . SER A 1 445 ? 24.075  -24.480 5.095   1.00 127.66 ? 445 SER A N   1 
ATOM   3434 C  CA  . SER A 1 445 ? 25.178  -24.082 4.222   1.00 128.81 ? 445 SER A CA  1 
ATOM   3435 C  C   . SER A 1 445 ? 24.724  -23.720 2.816   1.00 127.66 ? 445 SER A C   1 
ATOM   3436 O  O   . SER A 1 445 ? 25.318  -22.855 2.179   1.00 127.32 ? 445 SER A O   1 
ATOM   3437 C  CB  . SER A 1 445 ? 26.274  -25.155 4.189   1.00 152.70 ? 445 SER A CB  1 
ATOM   3438 O  OG  . SER A 1 445 ? 25.741  -26.423 3.861   1.00 157.70 ? 445 SER A OG  1 
ATOM   3439 N  N   . ILE A 1 446 ? 23.680  -24.377 2.326   1.00 123.83 ? 446 ILE A N   1 
ATOM   3440 C  CA  . ILE A 1 446 ? 23.096  -23.949 1.062   1.00 122.77 ? 446 ILE A CA  1 
ATOM   3441 C  C   . ILE A 1 446 ? 22.662  -22.487 1.218   1.00 116.95 ? 446 ILE A C   1 
ATOM   3442 O  O   . ILE A 1 446 ? 22.983  -21.624 0.372   1.00 117.06 ? 446 ILE A O   1 
ATOM   3443 C  CB  . ILE A 1 446 ? 21.921  -24.874 0.608   1.00 75.54  ? 446 ILE A CB  1 
ATOM   3444 C  CG1 . ILE A 1 446 ? 22.467  -26.187 0.034   1.00 91.83  ? 446 ILE A CG1 1 
ATOM   3445 C  CG2 . ILE A 1 446 ? 21.044  -24.179 -0.433  1.00 83.25  ? 446 ILE A CG2 1 
ATOM   3446 C  CD1 . ILE A 1 446 ? 21.492  -27.322 0.055   1.00 84.15  ? 446 ILE A CD1 1 
ATOM   3447 N  N   . LEU A 1 447 ? 21.973  -22.199 2.324   1.00 125.60 ? 447 LEU A N   1 
ATOM   3448 C  CA  . LEU A 1 447 ? 21.503  -20.826 2.571   1.00 120.21 ? 447 LEU A CA  1 
ATOM   3449 C  C   . LEU A 1 447 ? 22.617  -19.792 2.810   1.00 119.44 ? 447 LEU A C   1 
ATOM   3450 O  O   . LEU A 1 447 ? 22.585  -18.686 2.258   1.00 117.71 ? 447 LEU A O   1 
ATOM   3451 C  CB  . LEU A 1 447 ? 20.467  -20.813 3.694   1.00 102.12 ? 447 LEU A CB  1 
ATOM   3452 C  CG  . LEU A 1 447 ? 19.181  -21.523 3.250   1.00 102.48 ? 447 LEU A CG  1 
ATOM   3453 C  CD1 . LEU A 1 447 ? 18.419  -22.074 4.425   1.00 101.03 ? 447 LEU A CD1 1 
ATOM   3454 C  CD2 . LEU A 1 447 ? 18.292  -20.623 2.403   1.00 100.59 ? 447 LEU A CD2 1 
ATOM   3455 N  N   . ASN A 1 448 ? 23.598  -20.157 3.628   1.00 110.23 ? 448 ASN A N   1 
ATOM   3456 C  CA  . ASN A 1 448 ? 24.802  -19.358 3.829   1.00 110.55 ? 448 ASN A CA  1 
ATOM   3457 C  C   . ASN A 1 448 ? 25.467  -19.006 2.501   1.00 113.83 ? 448 ASN A C   1 
ATOM   3458 O  O   . ASN A 1 448 ? 25.738  -17.841 2.215   1.00 111.10 ? 448 ASN A O   1 
ATOM   3459 C  CB  . ASN A 1 448 ? 25.794  -20.118 4.705   1.00 127.34 ? 448 ASN A CB  1 
ATOM   3460 C  CG  . ASN A 1 448 ? 26.855  -19.224 5.277   1.00 126.05 ? 448 ASN A CG  1 
ATOM   3461 O  OD1 . ASN A 1 448 ? 26.574  -18.098 5.707   1.00 119.26 ? 448 ASN A OD1 1 
ATOM   3462 N  ND2 . ASN A 1 448 ? 28.091  -19.711 5.282   1.00 130.27 ? 448 ASN A ND2 1 
ATOM   3463 N  N   . ASP A 1 449 ? 25.739  -20.028 1.699   1.00 132.07 ? 449 ASP A N   1 
ATOM   3464 C  CA  . ASP A 1 449 ? 26.177  -19.826 0.331   1.00 135.90 ? 449 ASP A CA  1 
ATOM   3465 C  C   . ASP A 1 449 ? 25.258  -18.807 -0.350  1.00 133.43 ? 449 ASP A C   1 
ATOM   3466 O  O   . ASP A 1 449 ? 25.739  -17.911 -1.043  1.00 134.26 ? 449 ASP A O   1 
ATOM   3467 C  CB  . ASP A 1 449 ? 26.178  -21.156 -0.427  1.00 193.50 ? 449 ASP A CB  1 
ATOM   3468 C  CG  . ASP A 1 449 ? 27.037  -21.119 -1.677  1.00 200.41 ? 449 ASP A CG  1 
ATOM   3469 O  OD1 . ASP A 1 449 ? 27.290  -20.011 -2.192  1.00 212.02 ? 449 ASP A OD1 1 
ATOM   3470 O  OD2 . ASP A 1 449 ? 27.456  -22.199 -2.146  1.00 215.74 ? 449 ASP A OD2 1 
ATOM   3471 N  N   . LEU A 1 450 ? 23.941  -18.932 -0.144  1.00 133.99 ? 450 LEU A N   1 
ATOM   3472 C  CA  . LEU A 1 450 ? 22.983  -17.961 -0.717  1.00 130.48 ? 450 LEU A CA  1 
ATOM   3473 C  C   . LEU A 1 450 ? 23.230  -16.518 -0.243  1.00 125.18 ? 450 LEU A C   1 
ATOM   3474 O  O   . LEU A 1 450 ? 22.928  -15.555 -0.957  1.00 122.72 ? 450 LEU A O   1 
ATOM   3475 C  CB  . LEU A 1 450 ? 21.520  -18.367 -0.445  1.00 100.33 ? 450 LEU A CB  1 
ATOM   3476 C  CG  . LEU A 1 450 ? 20.416  -17.892 -1.416  1.00 101.11 ? 450 LEU A CG  1 
ATOM   3477 C  CD1 . LEU A 1 450 ? 19.133  -17.503 -0.698  1.00 95.95  ? 450 LEU A CD1 1 
ATOM   3478 C  CD2 . LEU A 1 450 ? 20.872  -16.747 -2.310  1.00 105.21 ? 450 LEU A CD2 1 
ATOM   3479 N  N   . LYS A 1 451 ? 23.770  -16.373 0.965   1.00 136.76 ? 451 LYS A N   1 
ATOM   3480 C  CA  . LYS A 1 451 ? 24.095  -15.048 1.500   1.00 129.33 ? 451 LYS A CA  1 
ATOM   3481 C  C   . LYS A 1 451 ? 25.076  -14.282 0.604   1.00 129.93 ? 451 LYS A C   1 
ATOM   3482 O  O   . LYS A 1 451 ? 24.821  -13.138 0.234   1.00 124.74 ? 451 LYS A O   1 
ATOM   3483 C  CB  . LYS A 1 451 ? 24.665  -15.181 2.910   1.00 112.43 ? 451 LYS A CB  1 
ATOM   3484 C  CG  . LYS A 1 451 ? 24.473  -13.958 3.769   1.00 104.64 ? 451 LYS A CG  1 
ATOM   3485 C  CD  . LYS A 1 451 ? 24.933  -14.209 5.211   1.00 103.39 ? 451 LYS A CD  1 
ATOM   3486 C  CE  . LYS A 1 451 ? 26.455  -14.073 5.375   1.00 104.00 ? 451 LYS A CE  1 
ATOM   3487 N  NZ  . LYS A 1 451 ? 26.946  -14.267 6.781   1.00 102.19 ? 451 LYS A NZ  1 
ATOM   3488 N  N   . ASN A 1 452 ? 26.186  -14.927 0.248   1.00 145.37 ? 452 ASN A N   1 
ATOM   3489 C  CA  . ASN A 1 452 ? 27.248  -14.311 -0.554  1.00 147.35 ? 452 ASN A CA  1 
ATOM   3490 C  C   . ASN A 1 452 ? 26.915  -14.151 -2.028  1.00 150.15 ? 452 ASN A C   1 
ATOM   3491 O  O   . ASN A 1 452 ? 27.765  -13.740 -2.809  1.00 153.67 ? 452 ASN A O   1 
ATOM   3492 C  CB  . ASN A 1 452 ? 28.525  -15.138 -0.453  1.00 123.97 ? 452 ASN A CB  1 
ATOM   3493 C  CG  . ASN A 1 452 ? 28.747  -15.680 0.930   1.00 122.11 ? 452 ASN A CG  1 
ATOM   3494 O  OD1 . ASN A 1 452 ? 28.556  -14.969 1.917   1.00 115.90 ? 452 ASN A OD1 1 
ATOM   3495 N  ND2 . ASN A 1 452 ? 29.137  -16.951 1.020   1.00 127.59 ? 452 ASN A ND2 1 
ATOM   3496 N  N   . LYS A 1 453 ? 25.695  -14.499 -2.412  1.00 130.32 ? 453 LYS A N   1 
ATOM   3497 C  CA  . LYS A 1 453 ? 25.260  -14.343 -3.792  1.00 132.28 ? 453 LYS A CA  1 
ATOM   3498 C  C   . LYS A 1 453 ? 24.212  -13.253 -3.877  1.00 124.11 ? 453 LYS A C   1 
ATOM   3499 O  O   . LYS A 1 453 ? 23.996  -12.656 -4.931  1.00 124.44 ? 453 LYS A O   1 
ATOM   3500 C  CB  . LYS A 1 453 ? 24.635  -15.635 -4.312  1.00 111.00 ? 453 LYS A CB  1 
ATOM   3501 C  CG  . LYS A 1 453 ? 25.545  -16.830 -4.364  1.00 134.67 ? 453 LYS A CG  1 
ATOM   3502 C  CD  . LYS A 1 453 ? 24.885  -17.905 -5.193  1.00 139.25 ? 453 LYS A CD  1 
ATOM   3503 C  CE  . LYS A 1 453 ? 25.730  -19.142 -5.247  1.00 145.75 ? 453 LYS A CE  1 
ATOM   3504 N  NZ  . LYS A 1 453 ? 25.340  -19.957 -6.414  1.00 149.71 ? 453 LYS A NZ  1 
ATOM   3505 N  N   . ALA A 1 454 ? 23.554  -13.007 -2.754  1.00 154.76 ? 454 ALA A N   1 
ATOM   3506 C  CA  . ALA A 1 454 ? 22.354  -12.192 -2.747  1.00 148.54 ? 454 ALA A CA  1 
ATOM   3507 C  C   . ALA A 1 454 ? 22.537  -10.879 -1.995  1.00 140.56 ? 454 ALA A C   1 
ATOM   3508 O  O   . ALA A 1 454 ? 23.399  -10.767 -1.122  1.00 138.31 ? 454 ALA A O   1 
ATOM   3509 C  CB  . ALA A 1 454 ? 21.228  -12.984 -2.149  1.00 46.45  ? 454 ALA A CB  1 
ATOM   3510 N  N   . GLN A 1 455 ? 21.722  -9.885  -2.339  1.00 146.39 ? 455 GLN A N   1 
ATOM   3511 C  CA  . GLN A 1 455 ? 21.778  -8.586  -1.668  1.00 139.31 ? 455 GLN A CA  1 
ATOM   3512 C  C   . GLN A 1 455 ? 20.845  -8.529  -0.450  1.00 134.69 ? 455 GLN A C   1 
ATOM   3513 O  O   . GLN A 1 455 ? 19.763  -9.127  -0.443  1.00 136.48 ? 455 GLN A O   1 
ATOM   3514 C  CB  . GLN A 1 455 ? 21.492  -7.433  -2.647  1.00 143.24 ? 455 GLN A CB  1 
ATOM   3515 C  CG  . GLN A 1 455 ? 22.462  -7.340  -3.829  1.00 147.38 ? 455 GLN A CG  1 
ATOM   3516 C  CD  . GLN A 1 455 ? 23.924  -7.471  -3.419  1.00 165.39 ? 455 GLN A CD  1 
ATOM   3517 O  OE1 . GLN A 1 455 ? 24.319  -7.063  -2.323  1.00 160.44 ? 455 GLN A OE1 1 
ATOM   3518 N  NE2 . GLN A 1 455 ? 24.734  -8.051  -4.300  1.00 171.66 ? 455 GLN A NE2 1 
ATOM   3519 N  N   . ARG A 1 456 ? 21.283  -7.801  0.574   1.00 121.82 ? 456 ARG A N   1 
ATOM   3520 C  CA  . ARG A 1 456 ? 20.609  -7.768  1.870   1.00 117.70 ? 456 ARG A CA  1 
ATOM   3521 C  C   . ARG A 1 456 ? 19.146  -7.345  1.823   1.00 117.36 ? 456 ARG A C   1 
ATOM   3522 O  O   . ARG A 1 456 ? 18.391  -7.593  2.771   1.00 115.99 ? 456 ARG A O   1 
ATOM   3523 C  CB  . ARG A 1 456 ? 21.382  -6.862  2.820   1.00 108.17 ? 456 ARG A CB  1 
ATOM   3524 C  CG  . ARG A 1 456 ? 22.718  -7.424  3.209   1.00 108.54 ? 456 ARG A CG  1 
ATOM   3525 C  CD  . ARG A 1 456 ? 22.532  -8.767  3.851   1.00 111.62 ? 456 ARG A CD  1 
ATOM   3526 N  NE  . ARG A 1 456 ? 23.375  -9.787  3.242   1.00 118.52 ? 456 ARG A NE  1 
ATOM   3527 C  CZ  . ARG A 1 456 ? 22.999  -10.565 2.233   1.00 124.83 ? 456 ARG A CZ  1 
ATOM   3528 N  NH1 . ARG A 1 456 ? 21.789  -10.440 1.711   1.00 124.91 ? 456 ARG A NH1 1 
ATOM   3529 N  NH2 . ARG A 1 456 ? 23.834  -11.473 1.747   1.00 131.67 ? 456 ARG A NH2 1 
ATOM   3530 N  N   . GLU A 1 457 ? 18.763  -6.705  0.722   1.00 83.40  ? 457 GLU A N   1 
ATOM   3531 C  CA  . GLU A 1 457 ? 17.413  -6.186  0.547   1.00 84.33  ? 457 GLU A CA  1 
ATOM   3532 C  C   . GLU A 1 457 ? 16.587  -7.122  -0.377  1.00 90.22  ? 457 GLU A C   1 
ATOM   3533 O  O   . GLU A 1 457 ? 15.396  -6.869  -0.644  1.00 92.53  ? 457 GLU A O   1 
ATOM   3534 C  CB  . GLU A 1 457 ? 17.474  -4.727  0.029   1.00 114.25 ? 457 GLU A CB  1 
ATOM   3535 C  CG  . GLU A 1 457 ? 16.198  -3.866  0.212   1.00 119.35 ? 457 GLU A CG  1 
ATOM   3536 C  CD  . GLU A 1 457 ? 16.058  -3.188  1.595   1.00 117.77 ? 457 GLU A CD  1 
ATOM   3537 O  OE1 . GLU A 1 457 ? 16.939  -3.360  2.474   1.00 111.91 ? 457 GLU A OE1 1 
ATOM   3538 O  OE2 . GLU A 1 457 ? 15.048  -2.475  1.801   1.00 122.45 ? 457 GLU A OE2 1 
ATOM   3539 N  N   . ASP A 1 458 ? 17.225  -8.210  -0.834  1.00 97.07  ? 458 ASP A N   1 
ATOM   3540 C  CA  . ASP A 1 458 ? 16.622  -9.170  -1.768  1.00 102.92 ? 458 ASP A CA  1 
ATOM   3541 C  C   . ASP A 1 458 ? 15.581  -10.050 -1.102  1.00 104.26 ? 458 ASP A C   1 
ATOM   3542 O  O   . ASP A 1 458 ? 15.831  -10.590 -0.035  1.00 102.51 ? 458 ASP A O   1 
ATOM   3543 C  CB  . ASP A 1 458 ? 17.699  -10.079 -2.358  1.00 129.60 ? 458 ASP A CB  1 
ATOM   3544 C  CG  . ASP A 1 458 ? 18.350  -9.489  -3.585  1.00 131.91 ? 458 ASP A CG  1 
ATOM   3545 O  OD1 . ASP A 1 458 ? 17.767  -8.558  -4.176  1.00 132.98 ? 458 ASP A OD1 1 
ATOM   3546 O  OD2 . ASP A 1 458 ? 19.439  -9.963  -3.973  1.00 134.57 ? 458 ASP A OD2 1 
ATOM   3547 N  N   . TYR A 1 459 ? 14.426  -10.228 -1.737  1.00 113.70 ? 459 TYR A N   1 
ATOM   3548 C  CA  . TYR A 1 459 ? 13.410  -11.134 -1.201  1.00 114.33 ? 459 TYR A CA  1 
ATOM   3549 C  C   . TYR A 1 459 ? 13.569  -12.581 -1.625  1.00 118.60 ? 459 TYR A C   1 
ATOM   3550 O  O   . TYR A 1 459 ? 13.867  -12.882 -2.779  1.00 121.79 ? 459 TYR A O   1 
ATOM   3551 C  CB  . TYR A 1 459 ? 12.020  -10.658 -1.570  1.00 144.77 ? 459 TYR A CB  1 
ATOM   3552 C  CG  . TYR A 1 459 ? 11.514  -9.705  -0.561  1.00 141.23 ? 459 TYR A CG  1 
ATOM   3553 C  CD1 . TYR A 1 459 ? 11.942  -8.395  -0.556  1.00 138.79 ? 459 TYR A CD1 1 
ATOM   3554 C  CD2 . TYR A 1 459 ? 10.655  -10.119 0.426   1.00 139.04 ? 459 TYR A CD2 1 
ATOM   3555 C  CE1 . TYR A 1 459 ? 11.498  -7.505  0.396   1.00 136.02 ? 459 TYR A CE1 1 
ATOM   3556 C  CE2 . TYR A 1 459 ? 10.201  -9.243  1.383   1.00 134.08 ? 459 TYR A CE2 1 
ATOM   3557 C  CZ  . TYR A 1 459 ? 10.625  -7.933  1.367   1.00 132.71 ? 459 TYR A CZ  1 
ATOM   3558 O  OH  . TYR A 1 459 ? 10.176  -7.057  2.332   1.00 128.18 ? 459 TYR A OH  1 
ATOM   3559 N  N   . VAL A 1 460 ? 13.354  -13.479 -0.678  1.00 91.18  ? 460 VAL A N   1 
ATOM   3560 C  CA  . VAL A 1 460 ? 13.294  -14.903 -0.983  1.00 95.85  ? 460 VAL A CA  1 
ATOM   3561 C  C   . VAL A 1 460 ? 11.877  -15.478 -0.759  1.00 95.44  ? 460 VAL A C   1 
ATOM   3562 O  O   . VAL A 1 460 ? 11.327  -15.408 0.336   1.00 92.15  ? 460 VAL A O   1 
ATOM   3563 C  CB  . VAL A 1 460 ? 14.401  -15.689 -0.216  1.00 57.65  ? 460 VAL A CB  1 
ATOM   3564 C  CG1 . VAL A 1 460 ? 13.845  -16.593 0.856   1.00 57.88  ? 460 VAL A CG1 1 
ATOM   3565 C  CG2 . VAL A 1 460 ? 15.159  -16.511 -1.171  1.00 61.91  ? 460 VAL A CG2 1 
ATOM   3566 N  N   . VAL A 1 461 ? 11.257  -16.010 -1.803  1.00 100.52 ? 461 VAL A N   1 
ATOM   3567 C  CA  . VAL A 1 461 ? 9.978   -16.679 -1.606  1.00 97.74  ? 461 VAL A CA  1 
ATOM   3568 C  C   . VAL A 1 461 ? 10.242  -18.124 -1.196  1.00 98.08  ? 461 VAL A C   1 
ATOM   3569 O  O   . VAL A 1 461 ? 10.970  -18.857 -1.871  1.00 101.17 ? 461 VAL A O   1 
ATOM   3570 C  CB  . VAL A 1 461 ? 9.066   -16.624 -2.851  1.00 69.93  ? 461 VAL A CB  1 
ATOM   3571 C  CG1 . VAL A 1 461 ? 7.867   -17.521 -2.658  1.00 67.17  ? 461 VAL A CG1 1 
ATOM   3572 C  CG2 . VAL A 1 461 ? 8.616   -15.183 -3.140  1.00 71.04  ? 461 VAL A CG2 1 
ATOM   3573 N  N   . ALA A 1 462 ? 9.678   -18.500 -0.053  1.00 93.86  ? 462 ALA A N   1 
ATOM   3574 C  CA  . ALA A 1 462 ? 9.713   -19.865 0.449   1.00 94.82  ? 462 ALA A CA  1 
ATOM   3575 C  C   . ALA A 1 462 ? 8.453   -20.004 1.277   1.00 90.45  ? 462 ALA A C   1 
ATOM   3576 O  O   . ALA A 1 462 ? 7.648   -19.079 1.322   1.00 85.60  ? 462 ALA A O   1 
ATOM   3577 C  CB  . ALA A 1 462 ? 10.946  -20.101 1.290   1.00 101.81 ? 462 ALA A CB  1 
ATOM   3578 N  N   . TRP A 1 463 ? 8.264   -21.153 1.906   1.00 128.54 ? 463 TRP A N   1 
ATOM   3579 C  CA  . TRP A 1 463 ? 7.129   -21.330 2.795   1.00 121.67 ? 463 TRP A CA  1 
ATOM   3580 C  C   . TRP A 1 463 ? 7.473   -20.632 4.125   1.00 117.18 ? 463 TRP A C   1 
ATOM   3581 O  O   . TRP A 1 463 ? 8.646   -20.314 4.353   1.00 119.50 ? 463 TRP A O   1 
ATOM   3582 C  CB  . TRP A 1 463 ? 6.828   -22.826 2.962   1.00 97.46  ? 463 TRP A CB  1 
ATOM   3583 C  CG  . TRP A 1 463 ? 5.535   -23.115 3.657   1.00 92.12  ? 463 TRP A CG  1 
ATOM   3584 C  CD1 . TRP A 1 463 ? 5.343   -23.920 4.737   1.00 91.02  ? 463 TRP A CD1 1 
ATOM   3585 C  CD2 . TRP A 1 463 ? 4.257   -22.579 3.326   1.00 88.32  ? 463 TRP A CD2 1 
ATOM   3586 N  NE1 . TRP A 1 463 ? 4.027   -23.915 5.101   1.00 85.46  ? 463 TRP A NE1 1 
ATOM   3587 C  CE2 . TRP A 1 463 ? 3.338   -23.096 4.248   1.00 85.36  ? 463 TRP A CE2 1 
ATOM   3588 C  CE3 . TRP A 1 463 ? 3.801   -21.706 2.336   1.00 87.81  ? 463 TRP A CE3 1 
ATOM   3589 C  CZ2 . TRP A 1 463 ? 1.983   -22.767 4.210   1.00 80.77  ? 463 TRP A CZ2 1 
ATOM   3590 C  CZ3 . TRP A 1 463 ? 2.456   -21.385 2.298   1.00 84.04  ? 463 TRP A CZ3 1 
ATOM   3591 C  CH2 . TRP A 1 463 ? 1.561   -21.912 3.229   1.00 81.39  ? 463 TRP A CH2 1 
ATOM   3592 N  N   . TRP A 1 464 ? 6.473   -20.366 4.979   1.00 88.98  ? 464 TRP A N   1 
ATOM   3593 C  CA  . TRP A 1 464 ? 6.698   -19.709 6.295   1.00 84.52  ? 464 TRP A CA  1 
ATOM   3594 C  C   . TRP A 1 464 ? 7.453   -20.516 7.401   1.00 84.80  ? 464 TRP A C   1 
ATOM   3595 O  O   . TRP A 1 464 ? 8.136   -19.916 8.245   1.00 82.53  ? 464 TRP A O   1 
ATOM   3596 C  CB  . TRP A 1 464 ? 5.384   -19.148 6.851   1.00 108.27 ? 464 TRP A CB  1 
ATOM   3597 C  CG  . TRP A 1 464 ? 4.437   -20.180 7.383   1.00 104.51 ? 464 TRP A CG  1 
ATOM   3598 C  CD1 . TRP A 1 464 ? 3.387   -20.755 6.726   1.00 104.85 ? 464 TRP A CD1 1 
ATOM   3599 C  CD2 . TRP A 1 464 ? 4.449   -20.751 8.683   1.00 100.24 ? 464 TRP A CD2 1 
ATOM   3600 N  NE1 . TRP A 1 464 ? 2.754   -21.653 7.540   1.00 101.40 ? 464 TRP A NE1 1 
ATOM   3601 C  CE2 . TRP A 1 464 ? 3.393   -21.668 8.751   1.00 98.69  ? 464 TRP A CE2 1 
ATOM   3602 C  CE3 . TRP A 1 464 ? 5.256   -20.585 9.796   1.00 98.02  ? 464 TRP A CE3 1 
ATOM   3603 C  CZ2 . TRP A 1 464 ? 3.127   -22.408 9.893   1.00 95.47  ? 464 TRP A CZ2 1 
ATOM   3604 C  CZ3 . TRP A 1 464 ? 4.989   -21.321 10.922  1.00 94.45  ? 464 TRP A CZ3 1 
ATOM   3605 C  CH2 . TRP A 1 464 ? 3.939   -22.215 10.968  1.00 93.46  ? 464 TRP A CH2 1 
ATOM   3606 N  N   . ASP A 1 465 ? 7.312   -21.849 7.392   1.00 82.05  ? 465 ASP A N   1 
ATOM   3607 C  CA  . ASP A 1 465 ? 8.069   -22.744 8.258   1.00 83.41  ? 465 ASP A CA  1 
ATOM   3608 C  C   . ASP A 1 465 ? 9.539   -22.432 8.174   1.00 89.15  ? 465 ASP A C   1 
ATOM   3609 O  O   . ASP A 1 465 ? 10.283  -22.593 9.138   1.00 87.32  ? 465 ASP A O   1 
ATOM   3610 C  CB  . ASP A 1 465 ? 7.943   -24.180 7.792   1.00 117.95 ? 465 ASP A CB  1 
ATOM   3611 C  CG  . ASP A 1 465 ? 6.667   -24.818 8.211   1.00 113.93 ? 465 ASP A CG  1 
ATOM   3612 O  OD1 . ASP A 1 465 ? 6.716   -25.982 8.676   1.00 115.05 ? 465 ASP A OD1 1 
ATOM   3613 O  OD2 . ASP A 1 465 ? 5.618   -24.165 8.050   1.00 111.77 ? 465 ASP A OD2 1 
ATOM   3614 N  N   . TYR A 1 466 ? 9.964   -22.015 6.994   1.00 92.76  ? 466 TYR A N   1 
ATOM   3615 C  CA  . TYR A 1 466 ? 11.372  -21.908 6.688   1.00 97.79  ? 466 TYR A CA  1 
ATOM   3616 C  C   . TYR A 1 466 ? 11.937  -20.511 6.911   1.00 94.36  ? 466 TYR A C   1 
ATOM   3617 O  O   . TYR A 1 466 ? 13.126  -20.362 7.254   1.00 95.54  ? 466 TYR A O   1 
ATOM   3618 C  CB  . TYR A 1 466 ? 11.556  -22.332 5.243   1.00 81.39  ? 466 TYR A CB  1 
ATOM   3619 C  CG  . TYR A 1 466 ? 11.045  -23.722 5.001   1.00 84.22  ? 466 TYR A CG  1 
ATOM   3620 C  CD1 . TYR A 1 466 ? 11.286  -24.725 5.927   1.00 84.84  ? 466 TYR A CD1 1 
ATOM   3621 C  CD2 . TYR A 1 466 ? 10.326  -24.032 3.857   1.00 86.34  ? 466 TYR A CD2 1 
ATOM   3622 C  CE1 . TYR A 1 466 ? 10.836  -25.993 5.725   1.00 87.42  ? 466 TYR A CE1 1 
ATOM   3623 C  CE2 . TYR A 1 466 ? 9.870   -25.300 3.639   1.00 88.56  ? 466 TYR A CE2 1 
ATOM   3624 C  CZ  . TYR A 1 466 ? 10.120  -26.283 4.583   1.00 89.33  ? 466 TYR A CZ  1 
ATOM   3625 O  OH  . TYR A 1 466 ? 9.650   -27.571 4.391   1.00 92.35  ? 466 TYR A OH  1 
ATOM   3626 N  N   . GLY A 1 467 ? 11.078  -19.503 6.724   1.00 111.17 ? 467 GLY A N   1 
ATOM   3627 C  CA  . GLY A 1 467 ? 11.445  -18.091 6.714   1.00 108.46 ? 467 GLY A CA  1 
ATOM   3628 C  C   . GLY A 1 467 ? 12.477  -17.598 7.713   1.00 106.72 ? 467 GLY A C   1 
ATOM   3629 O  O   . GLY A 1 467 ? 13.433  -16.892 7.344   1.00 109.73 ? 467 GLY A O   1 
ATOM   3630 N  N   . TYR A 1 468 ? 12.288  -17.942 8.984   1.00 112.81 ? 468 TYR A N   1 
ATOM   3631 C  CA  . TYR A 1 468 ? 13.296  -17.635 9.995   1.00 110.46 ? 468 TYR A CA  1 
ATOM   3632 C  C   . TYR A 1 468 ? 14.674  -18.164 9.595   1.00 117.01 ? 468 TYR A C   1 
ATOM   3633 O  O   . TYR A 1 468 ? 15.513  -17.351 9.253   1.00 119.17 ? 468 TYR A O   1 
ATOM   3634 C  CB  . TYR A 1 468 ? 12.879  -18.127 11.370  1.00 114.96 ? 468 TYR A CB  1 
ATOM   3635 C  CG  . TYR A 1 468 ? 11.767  -17.319 11.963  1.00 109.18 ? 468 TYR A CG  1 
ATOM   3636 C  CD1 . TYR A 1 468 ? 10.730  -17.935 12.644  1.00 103.56 ? 468 TYR A CD1 1 
ATOM   3637 C  CD2 . TYR A 1 468 ? 11.754  -15.943 11.852  1.00 106.20 ? 468 TYR A CD2 1 
ATOM   3638 C  CE1 . TYR A 1 468 ? 9.713   -17.200 13.202  1.00 96.10  ? 468 TYR A CE1 1 
ATOM   3639 C  CE2 . TYR A 1 468 ? 10.735  -15.202 12.397  1.00 98.66  ? 468 TYR A CE2 1 
ATOM   3640 C  CZ  . TYR A 1 468 ? 9.717   -15.836 13.075  1.00 93.69  ? 468 TYR A CZ  1 
ATOM   3641 O  OH  . TYR A 1 468 ? 8.688   -15.114 13.633  1.00 87.09  ? 468 TYR A OH  1 
ATOM   3642 N  N   . PRO A 1 469 ? 14.911  -19.509 9.623   1.00 71.08  ? 469 PRO A N   1 
ATOM   3643 C  CA  . PRO A 1 469 ? 16.181  -20.069 9.145   1.00 78.67  ? 469 PRO A CA  1 
ATOM   3644 C  C   . PRO A 1 469 ? 16.664  -19.438 7.854   1.00 85.18  ? 469 PRO A C   1 
ATOM   3645 O  O   . PRO A 1 469 ? 17.791  -18.959 7.844   1.00 87.58  ? 469 PRO A O   1 
ATOM   3646 C  CB  . PRO A 1 469 ? 15.833  -21.534 8.907   1.00 95.87  ? 469 PRO A CB  1 
ATOM   3647 C  CG  . PRO A 1 469 ? 14.912  -21.836 9.956   1.00 88.87  ? 469 PRO A CG  1 
ATOM   3648 C  CD  . PRO A 1 469 ? 14.052  -20.593 10.138  1.00 82.59  ? 469 PRO A CD  1 
ATOM   3649 N  N   . ILE A 1 470 ? 15.841  -19.435 6.803   1.00 112.11 ? 470 ILE A N   1 
ATOM   3650 C  CA  . ILE A 1 470 ? 16.239  -18.757 5.565   1.00 113.48 ? 470 ILE A CA  1 
ATOM   3651 C  C   . ILE A 1 470 ? 16.916  -17.430 5.905   1.00 109.28 ? 470 ILE A C   1 
ATOM   3652 O  O   . ILE A 1 470 ? 17.997  -17.097 5.386   1.00 110.04 ? 470 ILE A O   1 
ATOM   3653 C  CB  . ILE A 1 470 ? 15.027  -18.433 4.657   1.00 109.58 ? 470 ILE A CB  1 
ATOM   3654 C  CG1 . ILE A 1 470 ? 14.333  -19.703 4.166   1.00 111.95 ? 470 ILE A CG1 1 
ATOM   3655 C  CG2 . ILE A 1 470 ? 15.457  -17.561 3.477   1.00 111.25 ? 470 ILE A CG2 1 
ATOM   3656 C  CD1 . ILE A 1 470 ? 15.171  -20.555 3.264   1.00 133.99 ? 470 ILE A CD1 1 
ATOM   3657 N  N   . ARG A 1 471 ? 16.277  -16.679 6.797   1.00 110.83 ? 471 ARG A N   1 
ATOM   3658 C  CA  . ARG A 1 471 ? 16.750  -15.344 7.143   1.00 105.40 ? 471 ARG A CA  1 
ATOM   3659 C  C   . ARG A 1 471 ? 18.029  -15.283 8.011   1.00 103.74 ? 471 ARG A C   1 
ATOM   3660 O  O   . ARG A 1 471 ? 18.907  -14.464 7.782   1.00 100.91 ? 471 ARG A O   1 
ATOM   3661 C  CB  . ARG A 1 471 ? 15.612  -14.577 7.797   1.00 104.40 ? 471 ARG A CB  1 
ATOM   3662 C  CG  . ARG A 1 471 ? 15.398  -13.244 7.171   1.00 102.62 ? 471 ARG A CG  1 
ATOM   3663 C  CD  . ARG A 1 471 ? 14.027  -12.694 7.481   1.00 100.94 ? 471 ARG A CD  1 
ATOM   3664 N  NE  . ARG A 1 471 ? 13.731  -12.718 8.906   1.00 94.88  ? 471 ARG A NE  1 
ATOM   3665 C  CZ  . ARG A 1 471 ? 12.555  -12.379 9.413   1.00 90.55  ? 471 ARG A CZ  1 
ATOM   3666 N  NH1 . ARG A 1 471 ? 11.588  -11.987 8.599   1.00 91.30  ? 471 ARG A NH1 1 
ATOM   3667 N  NH2 . ARG A 1 471 ? 12.351  -12.438 10.722  1.00 85.64  ? 471 ARG A NH2 1 
ATOM   3668 N  N   . TYR A 1 472 ? 18.135  -16.141 9.010   1.00 108.86 ? 472 TYR A N   1 
ATOM   3669 C  CA  . TYR A 1 472 ? 19.274  -16.103 9.894   1.00 107.94 ? 472 TYR A CA  1 
ATOM   3670 C  C   . TYR A 1 472 ? 20.476  -16.550 9.126   1.00 112.78 ? 472 TYR A C   1 
ATOM   3671 O  O   . TYR A 1 472 ? 21.582  -16.077 9.351   1.00 111.17 ? 472 TYR A O   1 
ATOM   3672 C  CB  . TYR A 1 472 ? 19.088  -17.067 11.052  1.00 107.57 ? 472 TYR A CB  1 
ATOM   3673 C  CG  . TYR A 1 472 ? 20.372  -17.328 11.800  1.00 109.12 ? 472 TYR A CG  1 
ATOM   3674 C  CD1 . TYR A 1 472 ? 20.768  -16.506 12.842  1.00 103.06 ? 472 TYR A CD1 1 
ATOM   3675 C  CD2 . TYR A 1 472 ? 21.195  -18.381 11.451  1.00 117.27 ? 472 TYR A CD2 1 
ATOM   3676 C  CE1 . TYR A 1 472 ? 21.937  -16.736 13.515  1.00 104.86 ? 472 TYR A CE1 1 
ATOM   3677 C  CE2 . TYR A 1 472 ? 22.366  -18.611 12.123  1.00 119.62 ? 472 TYR A CE2 1 
ATOM   3678 C  CZ  . TYR A 1 472 ? 22.728  -17.786 13.151  1.00 113.31 ? 472 TYR A CZ  1 
ATOM   3679 O  OH  . TYR A 1 472 ? 23.893  -18.018 13.821  1.00 115.96 ? 472 TYR A OH  1 
ATOM   3680 N  N   . TYR A 1 473 ? 20.266  -17.503 8.235   1.00 98.40  ? 473 TYR A N   1 
ATOM   3681 C  CA  . TYR A 1 473 ? 21.371  -18.055 7.462   1.00 103.25 ? 473 TYR A CA  1 
ATOM   3682 C  C   . TYR A 1 473 ? 21.764  -17.217 6.233   1.00 103.11 ? 473 TYR A C   1 
ATOM   3683 O  O   . TYR A 1 473 ? 22.923  -17.253 5.809   1.00 105.53 ? 473 TYR A O   1 
ATOM   3684 C  CB  . TYR A 1 473 ? 21.066  -19.505 7.076   1.00 87.78  ? 473 TYR A CB  1 
ATOM   3685 C  CG  . TYR A 1 473 ? 21.215  -20.468 8.232   1.00 90.97  ? 473 TYR A CG  1 
ATOM   3686 C  CD1 . TYR A 1 473 ? 20.134  -21.168 8.737   1.00 91.62  ? 473 TYR A CD1 1 
ATOM   3687 C  CD2 . TYR A 1 473 ? 22.449  -20.662 8.818   1.00 93.71  ? 473 TYR A CD2 1 
ATOM   3688 C  CE1 . TYR A 1 473 ? 20.294  -22.042 9.787   1.00 92.97  ? 473 TYR A CE1 1 
ATOM   3689 C  CE2 . TYR A 1 473 ? 22.620  -21.527 9.860   1.00 97.49  ? 473 TYR A CE2 1 
ATOM   3690 C  CZ  . TYR A 1 473 ? 21.551  -22.215 10.351  1.00 96.31  ? 473 TYR A CZ  1 
ATOM   3691 O  OH  . TYR A 1 473 ? 21.771  -23.063 11.418  1.00 96.03  ? 473 TYR A OH  1 
ATOM   3692 N  N   . SER A 1 474 ? 20.812  -16.451 5.689   1.00 96.20  ? 474 SER A N   1 
ATOM   3693 C  CA  . SER A 1 474 ? 21.064  -15.675 4.473   1.00 96.30  ? 474 SER A CA  1 
ATOM   3694 C  C   . SER A 1 474 ? 21.044  -14.157 4.607   1.00 88.34  ? 474 SER A C   1 
ATOM   3695 O  O   . SER A 1 474 ? 21.488  -13.464 3.703   1.00 87.71  ? 474 SER A O   1 
ATOM   3696 C  CB  . SER A 1 474 ? 20.071  -16.076 3.401   1.00 90.21  ? 474 SER A CB  1 
ATOM   3697 O  OG  . SER A 1 474 ? 20.139  -17.468 3.200   1.00 93.26  ? 474 SER A OG  1 
ATOM   3698 N  N   . ASP A 1 475 ? 20.518  -13.642 5.710   1.00 123.17 ? 475 ASP A N   1 
ATOM   3699 C  CA  . ASP A 1 475 ? 20.432  -12.192 5.922   1.00 115.87 ? 475 ASP A CA  1 
ATOM   3700 C  C   . ASP A 1 475 ? 19.523  -11.533 4.874   1.00 115.62 ? 475 ASP A C   1 
ATOM   3701 O  O   . ASP A 1 475 ? 19.400  -10.304 4.808   1.00 112.95 ? 475 ASP A O   1 
ATOM   3702 C  CB  . ASP A 1 475 ? 21.828  -11.549 5.919   1.00 146.68 ? 475 ASP A CB  1 
ATOM   3703 C  CG  . ASP A 1 475 ? 21.967  -10.395 6.924   1.00 139.83 ? 475 ASP A CG  1 
ATOM   3704 O  OD1 . ASP A 1 475 ? 20.960  -10.000 7.572   1.00 137.43 ? 475 ASP A OD1 1 
ATOM   3705 O  OD2 . ASP A 1 475 ? 23.102  -9.878  7.056   1.00 137.99 ? 475 ASP A OD2 1 
ATOM   3706 N  N   . VAL A 1 476 ? 18.878  -12.365 4.065   1.00 111.48 ? 476 VAL A N   1 
ATOM   3707 C  CA  . VAL A 1 476 ? 17.902  -11.893 3.090   1.00 112.65 ? 476 VAL A CA  1 
ATOM   3708 C  C   . VAL A 1 476 ? 16.553  -11.476 3.722   1.00 110.68 ? 476 VAL A C   1 
ATOM   3709 O  O   . VAL A 1 476 ? 16.359  -11.615 4.919   1.00 108.88 ? 476 VAL A O   1 
ATOM   3710 C  CB  . VAL A 1 476 ? 17.663  -12.977 2.031   1.00 120.26 ? 476 VAL A CB  1 
ATOM   3711 C  CG1 . VAL A 1 476 ? 18.980  -13.339 1.377   1.00 123.31 ? 476 VAL A CG1 1 
ATOM   3712 C  CG2 . VAL A 1 476 ? 17.003  -14.223 2.655   1.00 124.33 ? 476 VAL A CG2 1 
ATOM   3713 N  N   . LYS A 1 477 ? 15.631  -10.950 2.918   1.00 111.54 ? 477 LYS A N   1 
ATOM   3714 C  CA  . LYS A 1 477 ? 14.266  -10.681 3.375   1.00 111.60 ? 477 LYS A CA  1 
ATOM   3715 C  C   . LYS A 1 477 ? 13.346  -11.792 2.874   1.00 117.40 ? 477 LYS A C   1 
ATOM   3716 O  O   . LYS A 1 477 ? 13.549  -12.319 1.776   1.00 121.40 ? 477 LYS A O   1 
ATOM   3717 C  CB  . LYS A 1 477 ? 13.745  -9.356  2.812   1.00 99.88  ? 477 LYS A CB  1 
ATOM   3718 C  CG  . LYS A 1 477 ? 14.424  -8.092  3.277   1.00 95.38  ? 477 LYS A CG  1 
ATOM   3719 C  CD  . LYS A 1 477 ? 13.706  -6.879  2.693   1.00 97.08  ? 477 LYS A CD  1 
ATOM   3720 C  CE  . LYS A 1 477 ? 14.019  -5.623  3.500   1.00 94.50  ? 477 LYS A CE  1 
ATOM   3721 N  NZ  . LYS A 1 477 ? 13.397  -4.349  2.980   1.00 99.61  ? 477 LYS A NZ  1 
ATOM   3722 N  N   . THR A 1 478 ? 12.320  -12.125 3.658   1.00 127.58 ? 478 THR A N   1 
ATOM   3723 C  CA  . THR A 1 478 ? 11.355  -13.157 3.272   1.00 129.12 ? 478 THR A CA  1 
ATOM   3724 C  C   . THR A 1 478 ? 9.930   -12.621 3.243   1.00 122.89 ? 478 THR A C   1 
ATOM   3725 O  O   . THR A 1 478 ? 9.629   -11.587 3.840   1.00 117.76 ? 478 THR A O   1 
ATOM   3726 C  CB  . THR A 1 478 ? 11.384  -14.325 4.242   1.00 112.24 ? 478 THR A CB  1 
ATOM   3727 O  OG1 . THR A 1 478 ? 10.942  -13.873 5.526   1.00 104.99 ? 478 THR A OG1 1 
ATOM   3728 C  CG2 . THR A 1 478 ? 12.792  -14.870 4.364   1.00 118.87 ? 478 THR A CG2 1 
ATOM   3729 N  N   . LEU A 1 479 ? 9.045   -13.330 2.556   1.00 110.93 ? 479 LEU A N   1 
ATOM   3730 C  CA  . LEU A 1 479 ? 7.678   -12.856 2.420   1.00 106.43 ? 479 LEU A CA  1 
ATOM   3731 C  C   . LEU A 1 479 ? 6.889   -13.170 3.678   1.00 100.06 ? 479 LEU A C   1 
ATOM   3732 O  O   . LEU A 1 479 ? 6.081   -12.356 4.138   1.00 95.39  ? 479 LEU A O   1 
ATOM   3733 C  CB  . LEU A 1 479 ? 6.995   -13.506 1.216   1.00 80.68  ? 479 LEU A CB  1 
ATOM   3734 C  CG  . LEU A 1 479 ? 6.939   -12.796 -0.138  1.00 85.88  ? 479 LEU A CG  1 
ATOM   3735 C  CD1 . LEU A 1 479 ? 6.277   -13.691 -1.163  1.00 89.02  ? 479 LEU A CD1 1 
ATOM   3736 C  CD2 . LEU A 1 479 ? 6.203   -11.476 -0.048  1.00 81.59  ? 479 LEU A CD2 1 
ATOM   3737 N  N   . ILE A 1 480 ? 7.113   -14.365 4.224   1.00 100.23 ? 480 ILE A N   1 
ATOM   3738 C  CA  . ILE A 1 480 ? 6.354   -14.823 5.385   1.00 96.47  ? 480 ILE A CA  1 
ATOM   3739 C  C   . ILE A 1 480 ? 7.218   -15.665 6.310   1.00 98.06  ? 480 ILE A C   1 
ATOM   3740 O  O   . ILE A 1 480 ? 8.003   -16.494 5.854   1.00 103.35 ? 480 ILE A O   1 
ATOM   3741 C  CB  . ILE A 1 480 ? 5.057   -15.620 4.986   1.00 79.36  ? 480 ILE A CB  1 
ATOM   3742 C  CG1 . ILE A 1 480 ? 5.416   -16.972 4.331   1.00 78.51  ? 480 ILE A CG1 1 
ATOM   3743 C  CG2 . ILE A 1 480 ? 4.137   -14.754 4.115   1.00 81.57  ? 480 ILE A CG2 1 
ATOM   3744 C  CD1 . ILE A 1 480 ? 4.248   -17.846 3.878   1.00 94.46  ? 480 ILE A CD1 1 
ATOM   3745 N  N   . ASP A 1 481 ? 7.070   -15.436 7.611   1.00 97.63  ? 481 ASP A N   1 
ATOM   3746 C  CA  . ASP A 1 481 ? 7.760   -16.230 8.624   1.00 98.10  ? 481 ASP A CA  1 
ATOM   3747 C  C   . ASP A 1 481 ? 6.793   -16.776 9.688   1.00 91.32  ? 481 ASP A C   1 
ATOM   3748 O  O   . ASP A 1 481 ? 5.600   -16.451 9.692   1.00 87.66  ? 481 ASP A O   1 
ATOM   3749 C  CB  . ASP A 1 481 ? 8.943   -15.455 9.261   1.00 124.59 ? 481 ASP A CB  1 
ATOM   3750 C  CG  . ASP A 1 481 ? 8.523   -14.140 9.962   1.00 118.15 ? 481 ASP A CG  1 
ATOM   3751 O  OD1 . ASP A 1 481 ? 8.304   -14.147 11.191  1.00 111.44 ? 481 ASP A OD1 1 
ATOM   3752 O  OD2 . ASP A 1 481 ? 8.455   -13.085 9.295   1.00 120.78 ? 481 ASP A OD2 1 
ATOM   3753 N  N   . GLY A 1 482 ? 7.319   -17.619 10.574  1.00 102.26 ? 482 GLY A N   1 
ATOM   3754 C  CA  . GLY A 1 482 ? 6.543   -18.209 11.654  1.00 97.22  ? 482 GLY A CA  1 
ATOM   3755 C  C   . GLY A 1 482 ? 5.822   -17.213 12.534  1.00 90.76  ? 482 GLY A C   1 
ATOM   3756 O  O   . GLY A 1 482 ? 5.132   -17.602 13.469  1.00 87.07  ? 482 GLY A O   1 
ATOM   3757 N  N   . GLY A 1 483 ? 5.997   -15.928 12.241  1.00 91.31  ? 483 GLY A N   1 
ATOM   3758 C  CA  . GLY A 1 483 ? 5.317   -14.869 12.955  1.00 86.06  ? 483 GLY A CA  1 
ATOM   3759 C  C   . GLY A 1 483 ? 4.328   -14.196 12.025  1.00 86.75  ? 483 GLY A C   1 
ATOM   3760 O  O   . GLY A 1 483 ? 3.170   -13.960 12.392  1.00 83.34  ? 483 GLY A O   1 
ATOM   3761 N  N   . LYS A 1 484 ? 4.781   -13.902 10.809  1.00 97.85  ? 484 LYS A N   1 
ATOM   3762 C  CA  . LYS A 1 484 ? 3.928   -13.350 9.754   1.00 99.54  ? 484 LYS A CA  1 
ATOM   3763 C  C   . LYS A 1 484 ? 3.425   -14.501 8.892   1.00 103.57 ? 484 LYS A C   1 
ATOM   3764 O  O   . LYS A 1 484 ? 4.025   -14.828 7.872   1.00 109.74 ? 484 LYS A O   1 
ATOM   3765 C  CB  . LYS A 1 484 ? 4.733   -12.362 8.897   1.00 100.39 ? 484 LYS A CB  1 
ATOM   3766 C  CG  . LYS A 1 484 ? 3.959   -11.664 7.783   1.00 102.86 ? 484 LYS A CG  1 
ATOM   3767 C  CD  . LYS A 1 484 ? 4.892   -10.895 6.858   1.00 108.16 ? 484 LYS A CD  1 
ATOM   3768 C  CE  . LYS A 1 484 ? 4.158   -9.800  6.099   1.00 110.08 ? 484 LYS A CE  1 
ATOM   3769 N  NZ  . LYS A 1 484 ? 5.084   -8.873  5.367   1.00 114.34 ? 484 LYS A NZ  1 
ATOM   3770 N  N   . HIS A 1 485 ? 2.340   -15.136 9.312   1.00 102.78 ? 485 HIS A N   1 
ATOM   3771 C  CA  . HIS A 1 485 ? 1.890   -16.330 8.611   1.00 106.30 ? 485 HIS A CA  1 
ATOM   3772 C  C   . HIS A 1 485 ? 0.381   -16.528 8.675   1.00 104.16 ? 485 HIS A C   1 
ATOM   3773 O  O   . HIS A 1 485 ? -0.089  -17.635 8.918   1.00 104.78 ? 485 HIS A O   1 
ATOM   3774 C  CB  . HIS A 1 485 ? 2.635   -17.593 9.088   1.00 99.81  ? 485 HIS A CB  1 
ATOM   3775 C  CG  . HIS A 1 485 ? 2.358   -17.975 10.497  1.00 95.13  ? 485 HIS A CG  1 
ATOM   3776 N  ND1 . HIS A 1 485 ? 1.269   -18.754 10.879  1.00 90.63  ? 485 HIS A ND1 1 
ATOM   3777 C  CD2 . HIS A 1 485 ? 3.007   -17.697 11.657  1.00 95.01  ? 485 HIS A CD2 1 
ATOM   3778 C  CE1 . HIS A 1 485 ? 1.266   -18.925 12.175  1.00 88.10  ? 485 HIS A CE1 1 
ATOM   3779 N  NE2 . HIS A 1 485 ? 2.323   -18.292 12.683  1.00 90.58  ? 485 HIS A NE2 1 
ATOM   3780 N  N   . LEU A 1 486 ? -0.374  -15.454 8.451   1.00 111.19 ? 486 LEU A N   1 
ATOM   3781 C  CA  . LEU A 1 486 ? -1.823  -15.566 8.295   1.00 110.58 ? 486 LEU A CA  1 
ATOM   3782 C  C   . LEU A 1 486 ? -2.164  -16.116 6.910   1.00 115.35 ? 486 LEU A C   1 
ATOM   3783 O  O   . LEU A 1 486 ? -1.327  -16.074 5.997   1.00 119.03 ? 486 LEU A O   1 
ATOM   3784 C  CB  . LEU A 1 486 ? -2.515  -14.211 8.507   1.00 101.73 ? 486 LEU A CB  1 
ATOM   3785 C  CG  . LEU A 1 486 ? -2.603  -13.649 9.932   1.00 97.50  ? 486 LEU A CG  1 
ATOM   3786 C  CD1 . LEU A 1 486 ? -3.600  -12.496 10.013  1.00 96.90  ? 486 LEU A CD1 1 
ATOM   3787 C  CD2 . LEU A 1 486 ? -2.984  -14.736 10.928  1.00 96.56  ? 486 LEU A CD2 1 
ATOM   3788 N  N   . GLY A 1 487 ? -3.383  -16.635 6.754   1.00 87.43  ? 487 GLY A N   1 
ATOM   3789 C  CA  . GLY A 1 487 ? -3.838  -17.111 5.457   1.00 91.88  ? 487 GLY A CA  1 
ATOM   3790 C  C   . GLY A 1 487 ? -3.541  -16.125 4.340   1.00 94.45  ? 487 GLY A C   1 
ATOM   3791 O  O   . GLY A 1 487 ? -3.045  -16.533 3.265   1.00 98.85  ? 487 GLY A O   1 
ATOM   3792 N  N   . LYS A 1 488 ? -3.846  -14.841 4.609   1.00 97.15  ? 488 LYS A N   1 
ATOM   3793 C  CA  . LYS A 1 488 ? -3.571  -13.735 3.701   1.00 99.35  ? 488 LYS A CA  1 
ATOM   3794 C  C   . LYS A 1 488 ? -2.079  -13.626 3.342   1.00 101.27 ? 488 LYS A C   1 
ATOM   3795 O  O   . LYS A 1 488 ? -1.738  -13.298 2.207   1.00 102.25 ? 488 LYS A O   1 
ATOM   3796 C  CB  . LYS A 1 488 ? -4.132  -12.421 4.254   1.00 150.95 ? 488 LYS A CB  1 
ATOM   3797 C  CG  . LYS A 1 488 ? -3.366  -11.119 3.877   1.00 148.04 ? 488 LYS A CG  1 
ATOM   3798 C  CD  . LYS A 1 488 ? -2.670  -11.068 2.472   1.00 145.84 ? 488 LYS A CD  1 
ATOM   3799 C  CE  . LYS A 1 488 ? -3.556  -10.626 1.302   1.00 150.26 ? 488 LYS A CE  1 
ATOM   3800 N  NZ  . LYS A 1 488 ? -3.558  -9.144  1.129   1.00 148.69 ? 488 LYS A NZ  1 
ATOM   3801 N  N   . ASP A 1 489 ? -1.180  -13.916 4.278   1.00 94.38  ? 489 ASP A N   1 
ATOM   3802 C  CA  . ASP A 1 489 ? 0.251   -13.790 3.990   1.00 95.73  ? 489 ASP A CA  1 
ATOM   3803 C  C   . ASP A 1 489 ? 0.784   -15.056 3.341   1.00 99.01  ? 489 ASP A C   1 
ATOM   3804 O  O   . ASP A 1 489 ? 1.556   -14.993 2.380   1.00 102.57 ? 489 ASP A O   1 
ATOM   3805 C  CB  . ASP A 1 489 ? 1.033   -13.482 5.261   1.00 115.25 ? 489 ASP A CB  1 
ATOM   3806 C  CG  . ASP A 1 489 ? 0.448   -12.320 6.042   1.00 110.36 ? 489 ASP A CG  1 
ATOM   3807 O  OD1 . ASP A 1 489 ? 0.229   -11.240 5.442   1.00 111.88 ? 489 ASP A OD1 1 
ATOM   3808 O  OD2 . ASP A 1 489 ? 0.206   -12.499 7.259   1.00 105.39 ? 489 ASP A OD2 1 
ATOM   3809 N  N   . ASN A 1 490 ? 0.368   -16.201 3.872   1.00 84.05  ? 490 ASN A N   1 
ATOM   3810 C  CA  . ASN A 1 490 ? 0.691   -17.473 3.250   1.00 87.14  ? 490 ASN A CA  1 
ATOM   3811 C  C   . ASN A 1 490 ? 0.200   -17.613 1.800   1.00 89.79  ? 490 ASN A C   1 
ATOM   3812 O  O   . ASN A 1 490 ? 0.738   -18.426 1.029   1.00 93.82  ? 490 ASN A O   1 
ATOM   3813 C  CB  . ASN A 1 490 ? 0.130   -18.622 4.068   1.00 112.58 ? 490 ASN A CB  1 
ATOM   3814 C  CG  . ASN A 1 490 ? 0.520   -18.537 5.496   1.00 108.30 ? 490 ASN A CG  1 
ATOM   3815 O  OD1 . ASN A 1 490 ? 1.687   -18.577 5.824   1.00 105.77 ? 490 ASN A OD1 1 
ATOM   3816 N  ND2 . ASN A 1 490 ? -0.452  -18.422 6.364   1.00 108.31 ? 490 ASN A ND2 1 
ATOM   3817 N  N   . PHE A 1 491 ? -0.823  -16.846 1.422   1.00 83.75  ? 491 PHE A N   1 
ATOM   3818 C  CA  . PHE A 1 491 ? -1.384  -17.000 0.074   1.00 85.79  ? 491 PHE A CA  1 
ATOM   3819 C  C   . PHE A 1 491 ? -0.363  -16.911 -1.049  1.00 89.64  ? 491 PHE A C   1 
ATOM   3820 O  O   . PHE A 1 491 ? -0.327  -17.773 -1.922  1.00 93.11  ? 491 PHE A O   1 
ATOM   3821 C  CB  . PHE A 1 491 ? -2.504  -16.014 -0.201  1.00 90.47  ? 491 PHE A CB  1 
ATOM   3822 C  CG  . PHE A 1 491 ? -3.127  -16.201 -1.540  1.00 93.05  ? 491 PHE A CG  1 
ATOM   3823 C  CD1 . PHE A 1 491 ? -4.077  -17.193 -1.743  1.00 93.41  ? 491 PHE A CD1 1 
ATOM   3824 C  CD2 . PHE A 1 491 ? -2.757  -15.404 -2.606  1.00 94.97  ? 491 PHE A CD2 1 
ATOM   3825 C  CE1 . PHE A 1 491 ? -4.649  -17.380 -2.983  1.00 95.57  ? 491 PHE A CE1 1 
ATOM   3826 C  CE2 . PHE A 1 491 ? -3.331  -15.583 -3.852  1.00 97.69  ? 491 PHE A CE2 1 
ATOM   3827 C  CZ  . PHE A 1 491 ? -4.273  -16.575 -4.040  1.00 97.54  ? 491 PHE A CZ  1 
ATOM   3828 N  N   . PHE A 1 492 ? 0.452   -15.862 -1.024  1.00 88.15  ? 492 PHE A N   1 
ATOM   3829 C  CA  . PHE A 1 492 ? 1.477   -15.662 -2.047  1.00 93.06  ? 492 PHE A CA  1 
ATOM   3830 C  C   . PHE A 1 492 ? 2.527   -16.781 -2.129  1.00 97.49  ? 492 PHE A C   1 
ATOM   3831 O  O   . PHE A 1 492 ? 2.645   -17.465 -3.157  1.00 102.64 ? 492 PHE A O   1 
ATOM   3832 C  CB  . PHE A 1 492 ? 2.143   -14.311 -1.854  1.00 123.56 ? 492 PHE A CB  1 
ATOM   3833 C  CG  . PHE A 1 492 ? 1.171   -13.198 -1.685  1.00 119.27 ? 492 PHE A CG  1 
ATOM   3834 C  CD1 . PHE A 1 492 ? 1.056   -12.537 -0.480  1.00 113.77 ? 492 PHE A CD1 1 
ATOM   3835 C  CD2 . PHE A 1 492 ? 0.352   -12.833 -2.719  1.00 120.95 ? 492 PHE A CD2 1 
ATOM   3836 C  CE1 . PHE A 1 492 ? 0.151   -11.509 -0.319  1.00 110.99 ? 492 PHE A CE1 1 
ATOM   3837 C  CE2 . PHE A 1 492 ? -0.555  -11.809 -2.568  1.00 117.85 ? 492 PHE A CE2 1 
ATOM   3838 C  CZ  . PHE A 1 492 ? -0.659  -11.145 -1.366  1.00 113.05 ? 492 PHE A CZ  1 
ATOM   3839 N  N   . SER A 1 493 ? 3.298   -16.970 -1.066  1.00 86.22  ? 493 SER A N   1 
ATOM   3840 C  CA  . SER A 1 493 ? 4.256   -18.080 -1.061  1.00 90.75  ? 493 SER A CA  1 
ATOM   3841 C  C   . SER A 1 493 ? 3.618   -19.447 -1.429  1.00 91.73  ? 493 SER A C   1 
ATOM   3842 O  O   . SER A 1 493 ? 4.261   -20.302 -2.040  1.00 97.28  ? 493 SER A O   1 
ATOM   3843 C  CB  . SER A 1 493 ? 5.014   -18.139 0.276   1.00 115.55 ? 493 SER A CB  1 
ATOM   3844 O  OG  . SER A 1 493 ? 5.912   -17.047 0.408   1.00 129.09 ? 493 SER A OG  1 
ATOM   3845 N  N   . SER A 1 494 ? 2.355   -19.640 -1.054  1.00 100.08 ? 494 SER A N   1 
ATOM   3846 C  CA  . SER A 1 494 ? 1.615   -20.824 -1.472  1.00 101.40 ? 494 SER A CA  1 
ATOM   3847 C  C   . SER A 1 494 ? 1.534   -20.849 -2.985  1.00 106.52 ? 494 SER A C   1 
ATOM   3848 O  O   . SER A 1 494 ? 1.908   -21.827 -3.630  1.00 111.63 ? 494 SER A O   1 
ATOM   3849 C  CB  . SER A 1 494 ? 0.191   -20.794 -0.906  1.00 94.44  ? 494 SER A CB  1 
ATOM   3850 O  OG  . SER A 1 494 ? -0.558  -21.930 -1.306  1.00 96.27  ? 494 SER A OG  1 
ATOM   3851 N  N   . PHE A 1 495 ? 1.039   -19.753 -3.542  1.00 96.81  ? 495 PHE A N   1 
ATOM   3852 C  CA  . PHE A 1 495 ? 0.793   -19.633 -4.971  1.00 101.33 ? 495 PHE A CA  1 
ATOM   3853 C  C   . PHE A 1 495 ? 2.049   -19.851 -5.814  1.00 108.04 ? 495 PHE A C   1 
ATOM   3854 O  O   . PHE A 1 495 ? 2.062   -20.699 -6.713  1.00 110.76 ? 495 PHE A O   1 
ATOM   3855 C  CB  . PHE A 1 495 ? 0.227   -18.252 -5.254  1.00 112.31 ? 495 PHE A CB  1 
ATOM   3856 C  CG  . PHE A 1 495 ? -0.262  -18.068 -6.652  1.00 115.99 ? 495 PHE A CG  1 
ATOM   3857 C  CD1 . PHE A 1 495 ? -1.621  -17.985 -6.912  1.00 112.98 ? 495 PHE A CD1 1 
ATOM   3858 C  CD2 . PHE A 1 495 ? 0.627   -17.963 -7.700  1.00 121.76 ? 495 PHE A CD2 1 
ATOM   3859 C  CE1 . PHE A 1 495 ? -2.078  -17.798 -8.186  1.00 116.60 ? 495 PHE A CE1 1 
ATOM   3860 C  CE2 . PHE A 1 495 ? 0.177   -17.781 -8.974  1.00 124.99 ? 495 PHE A CE2 1 
ATOM   3861 C  CZ  . PHE A 1 495 ? -1.176  -17.697 -9.221  1.00 123.17 ? 495 PHE A CZ  1 
ATOM   3862 N  N   . VAL A 1 496 ? 3.096   -19.078 -5.526  1.00 99.64  ? 496 VAL A N   1 
ATOM   3863 C  CA  . VAL A 1 496 ? 4.370   -19.186 -6.250  1.00 104.08 ? 496 VAL A CA  1 
ATOM   3864 C  C   . VAL A 1 496 ? 4.920   -20.602 -6.281  1.00 105.22 ? 496 VAL A C   1 
ATOM   3865 O  O   . VAL A 1 496 ? 5.645   -20.971 -7.180  1.00 107.79 ? 496 VAL A O   1 
ATOM   3866 C  CB  . VAL A 1 496 ? 5.439   -18.284 -5.628  1.00 88.70  ? 496 VAL A CB  1 
ATOM   3867 C  CG1 . VAL A 1 496 ? 6.822   -18.758 -6.023  1.00 107.13 ? 496 VAL A CG1 1 
ATOM   3868 C  CG2 . VAL A 1 496 ? 5.225   -16.852 -6.043  1.00 104.21 ? 496 VAL A CG2 1 
ATOM   3869 N  N   . LEU A 1 497 ? 4.556   -21.388 -5.285  1.00 84.24  ? 497 LEU A N   1 
ATOM   3870 C  CA  . LEU A 1 497 ? 5.066   -22.730 -5.130  1.00 85.91  ? 497 LEU A CA  1 
ATOM   3871 C  C   . LEU A 1 497 ? 4.142   -23.838 -5.577  1.00 86.49  ? 497 LEU A C   1 
ATOM   3872 O  O   . LEU A 1 497 ? 4.594   -24.969 -5.697  1.00 89.17  ? 497 LEU A O   1 
ATOM   3873 C  CB  . LEU A 1 497 ? 5.299   -22.994 -3.672  1.00 70.93  ? 497 LEU A CB  1 
ATOM   3874 C  CG  . LEU A 1 497 ? 6.626   -22.661 -3.087  1.00 71.77  ? 497 LEU A CG  1 
ATOM   3875 C  CD1 . LEU A 1 497 ? 6.348   -22.570 -1.624  1.00 70.15  ? 497 LEU A CD1 1 
ATOM   3876 C  CD2 . LEU A 1 497 ? 7.551   -23.787 -3.398  1.00 75.80  ? 497 LEU A CD2 1 
ATOM   3877 N  N   . SER A 1 498 ? 2.852   -23.567 -5.751  1.00 91.20  ? 498 SER A N   1 
ATOM   3878 C  CA  . SER A 1 498 ? 1.944   -24.670 -6.092  1.00 91.67  ? 498 SER A CA  1 
ATOM   3879 C  C   . SER A 1 498 ? 1.148   -24.473 -7.378  1.00 93.65  ? 498 SER A C   1 
ATOM   3880 O  O   . SER A 1 498 ? 0.596   -25.430 -7.933  1.00 95.86  ? 498 SER A O   1 
ATOM   3881 C  CB  . SER A 1 498 ? 1.012   -25.003 -4.931  1.00 94.40  ? 498 SER A CB  1 
ATOM   3882 O  OG  . SER A 1 498 ? 0.173   -23.911 -4.625  1.00 91.46  ? 498 SER A OG  1 
ATOM   3883 N  N   . LYS A 1 499 ? 1.091   -23.240 -7.857  1.00 121.61 ? 499 LYS A N   1 
ATOM   3884 C  CA  . LYS A 1 499 ? 0.423   -22.994 -9.114  1.00 124.21 ? 499 LYS A CA  1 
ATOM   3885 C  C   . LYS A 1 499 ? 1.397   -23.336 -10.229 1.00 129.05 ? 499 LYS A C   1 
ATOM   3886 O  O   . LYS A 1 499 ? 2.513   -23.797 -9.965  1.00 130.34 ? 499 LYS A O   1 
ATOM   3887 C  CB  . LYS A 1 499 ? -0.065  -21.549 -9.193  1.00 131.05 ? 499 LYS A CB  1 
ATOM   3888 C  CG  . LYS A 1 499 ? -1.046  -21.202 -8.080  1.00 125.85 ? 499 LYS A CG  1 
ATOM   3889 C  CD  . LYS A 1 499 ? -2.134  -22.283 -7.957  1.00 125.02 ? 499 LYS A CD  1 
ATOM   3890 C  CE  . LYS A 1 499 ? -3.251  -21.937 -6.963  1.00 119.25 ? 499 LYS A CE  1 
ATOM   3891 N  NZ  . LYS A 1 499 ? -4.501  -22.712 -7.257  1.00 119.76 ? 499 LYS A NZ  1 
ATOM   3892 N  N   . GLU A 1 500 ? 0.977   -23.128 -11.473 1.00 118.18 ? 500 GLU A N   1 
ATOM   3893 C  CA  . GLU A 1 500 ? 1.833   -23.427 -12.620 1.00 123.78 ? 500 GLU A CA  1 
ATOM   3894 C  C   . GLU A 1 500 ? 3.080   -22.521 -12.704 1.00 126.36 ? 500 GLU A C   1 
ATOM   3895 O  O   . GLU A 1 500 ? 3.085   -21.389 -12.233 1.00 124.81 ? 500 GLU A O   1 
ATOM   3896 C  CB  . GLU A 1 500 ? 1.020   -23.390 -13.928 1.00 147.06 ? 500 GLU A CB  1 
ATOM   3897 C  CG  . GLU A 1 500 ? -0.207  -24.316 -13.957 1.00 144.75 ? 500 GLU A CG  1 
ATOM   3898 C  CD  . GLU A 1 500 ? -0.697  -24.599 -15.371 1.00 159.28 ? 500 GLU A CD  1 
ATOM   3899 O  OE1 . GLU A 1 500 ? -0.323  -23.844 -16.292 1.00 164.81 ? 500 GLU A OE1 1 
ATOM   3900 O  OE2 . GLU A 1 500 ? -1.446  -25.582 -15.565 1.00 157.33 ? 500 GLU A OE2 1 
ATOM   3901 N  N   . GLN A 1 501 ? 4.138   -23.042 -13.309 1.00 138.05 ? 501 GLN A N   1 
ATOM   3902 C  CA  . GLN A 1 501 ? 5.411   -22.341 -13.384 1.00 135.83 ? 501 GLN A CA  1 
ATOM   3903 C  C   . GLN A 1 501 ? 5.310   -20.860 -13.713 1.00 129.23 ? 501 GLN A C   1 
ATOM   3904 O  O   . GLN A 1 501 ? 5.793   -20.025 -12.960 1.00 123.15 ? 501 GLN A O   1 
ATOM   3905 C  CB  . GLN A 1 501 ? 6.296   -22.995 -14.424 1.00 106.38 ? 501 GLN A CB  1 
ATOM   3906 C  CG  . GLN A 1 501 ? 7.253   -23.997 -13.881 1.00 113.55 ? 501 GLN A CG  1 
ATOM   3907 C  CD  . GLN A 1 501 ? 8.370   -24.264 -14.863 1.00 122.99 ? 501 GLN A CD  1 
ATOM   3908 O  OE1 . GLN A 1 501 ? 8.858   -23.348 -15.518 1.00 121.41 ? 501 GLN A OE1 1 
ATOM   3909 N  NE2 . GLN A 1 501 ? 8.765   -25.524 -14.995 1.00 143.62 ? 501 GLN A NE2 1 
ATOM   3910 N  N   . ILE A 1 502 ? 4.712   -20.536 -14.852 1.00 143.02 ? 502 ILE A N   1 
ATOM   3911 C  CA  . ILE A 1 502 ? 4.701   -19.155 -15.334 1.00 139.54 ? 502 ILE A CA  1 
ATOM   3912 C  C   . ILE A 1 502 ? 4.032   -18.206 -14.320 1.00 132.85 ? 502 ILE A C   1 
ATOM   3913 O  O   . ILE A 1 502 ? 4.677   -17.255 -13.807 1.00 128.79 ? 502 ILE A O   1 
ATOM   3914 C  CB  . ILE A 1 502 ? 4.042   -19.028 -16.760 1.00 118.22 ? 502 ILE A CB  1 
ATOM   3915 C  CG1 . ILE A 1 502 ? 4.686   -19.985 -17.785 1.00 136.34 ? 502 ILE A CG1 1 
ATOM   3916 C  CG2 . ILE A 1 502 ? 4.121   -17.592 -17.273 1.00 126.53 ? 502 ILE A CG2 1 
ATOM   3917 C  CD1 . ILE A 1 502 ? 4.095   -21.395 -17.836 1.00 142.12 ? 502 ILE A CD1 1 
ATOM   3918 N  N   . PRO A 1 503 ? 2.742   -18.464 -14.006 1.00 131.50 ? 503 PRO A N   1 
ATOM   3919 C  CA  . PRO A 1 503 ? 2.048   -17.585 -13.057 1.00 127.12 ? 503 PRO A CA  1 
ATOM   3920 C  C   . PRO A 1 503 ? 2.787   -17.512 -11.726 1.00 122.15 ? 503 PRO A C   1 
ATOM   3921 O  O   . PRO A 1 503 ? 2.846   -16.448 -11.137 1.00 118.68 ? 503 PRO A O   1 
ATOM   3922 C  CB  . PRO A 1 503 ? 0.660   -18.234 -12.910 1.00 92.54  ? 503 PRO A CB  1 
ATOM   3923 C  CG  . PRO A 1 503 ? 0.825   -19.620 -13.380 1.00 107.85 ? 503 PRO A CG  1 
ATOM   3924 C  CD  . PRO A 1 503 ? 1.876   -19.571 -14.449 1.00 109.87 ? 503 PRO A CD  1 
ATOM   3925 N  N   . ALA A 1 504 ? 3.358   -18.621 -11.278 1.00 116.43 ? 504 ALA A N   1 
ATOM   3926 C  CA  . ALA A 1 504 ? 4.193   -18.618 -10.087 1.00 112.91 ? 504 ALA A CA  1 
ATOM   3927 C  C   . ALA A 1 504 ? 5.239   -17.529 -10.225 1.00 110.35 ? 504 ALA A C   1 
ATOM   3928 O  O   . ALA A 1 504 ? 5.361   -16.613 -9.386  1.00 106.01 ? 504 ALA A O   1 
ATOM   3929 C  CB  . ALA A 1 504 ? 4.873   -19.983 -9.923  1.00 65.28  ? 504 ALA A CB  1 
ATOM   3930 N  N   . ALA A 1 505 ? 5.995   -17.652 -11.307 1.00 138.11 ? 505 ALA A N   1 
ATOM   3931 C  CA  . ALA A 1 505 ? 7.053   -16.722 -11.623 1.00 138.10 ? 505 ALA A CA  1 
ATOM   3932 C  C   . ALA A 1 505 ? 6.522   -15.301 -11.605 1.00 134.95 ? 505 ALA A C   1 
ATOM   3933 O  O   . ALA A 1 505 ? 7.267   -14.377 -11.300 1.00 133.32 ? 505 ALA A O   1 
ATOM   3934 C  CB  . ALA A 1 505 ? 7.638   -17.047 -12.952 1.00 65.96  ? 505 ALA A CB  1 
ATOM   3935 N  N   . ASN A 1 506 ? 5.240   -15.117 -11.919 1.00 138.16 ? 506 ASN A N   1 
ATOM   3936 C  CA  . ASN A 1 506 ? 4.647   -13.763 -11.801 1.00 137.34 ? 506 ASN A CA  1 
ATOM   3937 C  C   . ASN A 1 506 ? 4.293   -13.258 -10.377 1.00 133.14 ? 506 ASN A C   1 
ATOM   3938 O  O   . ASN A 1 506 ? 4.640   -12.113 -9.982  1.00 131.87 ? 506 ASN A O   1 
ATOM   3939 C  CB  . ASN A 1 506 ? 3.467   -13.600 -12.761 1.00 124.62 ? 506 ASN A CB  1 
ATOM   3940 C  CG  . ASN A 1 506 ? 3.911   -13.193 -14.155 1.00 129.73 ? 506 ASN A CG  1 
ATOM   3941 O  OD1 . ASN A 1 506 ? 5.060   -12.792 -14.354 1.00 130.76 ? 506 ASN A OD1 1 
ATOM   3942 N  ND2 . ASN A 1 506 ? 3.001   -13.278 -15.121 1.00 134.20 ? 506 ASN A ND2 1 
ATOM   3943 N  N   . MET A 1 507 ? 3.594   -14.098 -9.616  1.00 132.66 ? 507 MET A N   1 
ATOM   3944 C  CA  . MET A 1 507 ? 3.422   -13.847 -8.193  1.00 128.78 ? 507 MET A CA  1 
ATOM   3945 C  C   . MET A 1 507 ? 4.782   -13.452 -7.679  1.00 124.70 ? 507 MET A C   1 
ATOM   3946 O  O   . MET A 1 507 ? 5.000   -12.295 -7.445  1.00 122.74 ? 507 MET A O   1 
ATOM   3947 C  CB  . MET A 1 507 ? 2.901   -15.061 -7.410  1.00 107.35 ? 507 MET A CB  1 
ATOM   3948 C  CG  . MET A 1 507 ? 1.399   -15.111 -7.183  1.00 105.00 ? 507 MET A CG  1 
ATOM   3949 S  SD  . MET A 1 507 ? 0.638   -13.518 -6.839  1.00 108.13 ? 507 MET A SD  1 
ATOM   3950 C  CE  . MET A 1 507 ? 1.711   -12.910 -5.560  1.00 103.53 ? 507 MET A CE  1 
ATOM   3951 N  N   . ALA A 1 508 ? 5.723   -14.382 -7.562  1.00 141.27 ? 508 ALA A N   1 
ATOM   3952 C  CA  . ALA A 1 508 ? 7.005   -14.005 -6.961  1.00 139.02 ? 508 ALA A CA  1 
ATOM   3953 C  C   . ALA A 1 508 ? 7.277   -12.488 -7.086  1.00 138.51 ? 508 ALA A C   1 
ATOM   3954 O  O   . ALA A 1 508 ? 7.239   -11.750 -6.079  1.00 136.63 ? 508 ALA A O   1 
ATOM   3955 C  CB  . ALA A 1 508 ? 8.122   -14.818 -7.553  1.00 111.47 ? 508 ALA A CB  1 
ATOM   3956 N  N   . ARG A 1 509 ? 7.503   -12.021 -8.315  1.00 117.14 ? 509 ARG A N   1 
ATOM   3957 C  CA  . ARG A 1 509 ? 7.648   -10.585 -8.607  1.00 118.71 ? 509 ARG A CA  1 
ATOM   3958 C  C   . ARG A 1 509 ? 6.598   -9.682  -7.929  1.00 117.85 ? 509 ARG A C   1 
ATOM   3959 O  O   . ARG A 1 509 ? 6.928   -8.868  -7.040  1.00 116.75 ? 509 ARG A O   1 
ATOM   3960 C  CB  . ARG A 1 509 ? 7.630   -10.345 -10.122 1.00 120.33 ? 509 ARG A CB  1 
ATOM   3961 C  CG  . ARG A 1 509 ? 7.972   -8.923  -10.573 1.00 123.83 ? 509 ARG A CG  1 
ATOM   3962 C  CD  . ARG A 1 509 ? 9.247   -8.359  -9.884  1.00 121.75 ? 509 ARG A CD  1 
ATOM   3963 N  NE  . ARG A 1 509 ? 10.501  -9.086  -10.150 1.00 122.55 ? 509 ARG A NE  1 
ATOM   3964 C  CZ  . ARG A 1 509 ? 11.624  -8.946  -9.437  1.00 122.43 ? 509 ARG A CZ  1 
ATOM   3965 N  NH1 . ARG A 1 509 ? 11.662  -8.110  -8.406  1.00 120.06 ? 509 ARG A NH1 1 
ATOM   3966 N  NH2 . ARG A 1 509 ? 12.709  -9.645  -9.748  1.00 125.80 ? 509 ARG A NH2 1 
ATOM   3967 N  N   . LEU A 1 510 ? 5.335   -9.821  -8.332  1.00 109.65 ? 510 LEU A N   1 
ATOM   3968 C  CA  . LEU A 1 510 ? 4.304   -8.939  -7.761  1.00 111.25 ? 510 LEU A CA  1 
ATOM   3969 C  C   . LEU A 1 510 ? 4.074   -9.010  -6.229  1.00 107.50 ? 510 LEU A C   1 
ATOM   3970 O  O   . LEU A 1 510 ? 3.807   -8.002  -5.599  1.00 109.05 ? 510 LEU A O   1 
ATOM   3971 C  CB  . LEU A 1 510 ? 2.988   -9.119  -8.498  1.00 108.12 ? 510 LEU A CB  1 
ATOM   3972 C  CG  . LEU A 1 510 ? 2.933   -8.446  -9.860  1.00 114.74 ? 510 LEU A CG  1 
ATOM   3973 C  CD1 . LEU A 1 510 ? 1.574   -8.683  -10.492 1.00 119.90 ? 510 LEU A CD1 1 
ATOM   3974 C  CD2 . LEU A 1 510 ? 3.223   -6.951  -9.739  1.00 118.77 ? 510 LEU A CD2 1 
ATOM   3975 N  N   . SER A 1 511 ? 4.151   -10.196 -5.640  1.00 108.92 ? 511 SER A N   1 
ATOM   3976 C  CA  . SER A 1 511 ? 4.037   -10.372 -4.202  1.00 105.13 ? 511 SER A CA  1 
ATOM   3977 C  C   . SER A 1 511 ? 5.211   -9.742  -3.469  1.00 103.30 ? 511 SER A C   1 
ATOM   3978 O  O   . SER A 1 511 ? 5.042   -9.130  -2.415  1.00 102.27 ? 511 SER A O   1 
ATOM   3979 C  CB  . SER A 1 511 ? 3.995   -11.855 -3.848  1.00 108.42 ? 511 SER A CB  1 
ATOM   3980 O  OG  . SER A 1 511 ? 5.301   -12.348 -3.613  1.00 108.11 ? 511 SER A OG  1 
ATOM   3981 N  N   . VAL A 1 512 ? 6.418   -9.904  -3.991  1.00 102.41 ? 512 VAL A N   1 
ATOM   3982 C  CA  . VAL A 1 512 ? 7.511   -9.258  -3.291  1.00 101.55 ? 512 VAL A CA  1 
ATOM   3983 C  C   . VAL A 1 512 ? 7.410   -7.744  -3.419  1.00 105.46 ? 512 VAL A C   1 
ATOM   3984 O  O   . VAL A 1 512 ? 7.473   -7.010  -2.418  1.00 105.73 ? 512 VAL A O   1 
ATOM   3985 C  CB  . VAL A 1 512 ? 8.863   -9.757  -3.735  1.00 80.98  ? 512 VAL A CB  1 
ATOM   3986 C  CG1 . VAL A 1 512 ? 9.902   -8.717  -3.434  1.00 82.23  ? 512 VAL A CG1 1 
ATOM   3987 C  CG2 . VAL A 1 512 ? 9.176   -11.050 -3.009  1.00 78.91  ? 512 VAL A CG2 1 
ATOM   3988 N  N   . GLU A 1 513 ? 7.218   -7.265  -4.638  1.00 109.22 ? 513 GLU A N   1 
ATOM   3989 C  CA  . GLU A 1 513 ? 7.111   -5.827  -4.813  1.00 115.09 ? 513 GLU A CA  1 
ATOM   3990 C  C   . GLU A 1 513 ? 6.006   -5.200  -3.960  1.00 117.41 ? 513 GLU A C   1 
ATOM   3991 O  O   . GLU A 1 513 ? 6.239   -4.208  -3.245  1.00 119.63 ? 513 GLU A O   1 
ATOM   3992 C  CB  . GLU A 1 513 ? 6.906   -5.494  -6.277  1.00 147.58 ? 513 GLU A CB  1 
ATOM   3993 C  CG  . GLU A 1 513 ? 8.103   -5.846  -7.099  1.00 147.63 ? 513 GLU A CG  1 
ATOM   3994 C  CD  . GLU A 1 513 ? 9.347   -5.147  -6.607  1.00 147.67 ? 513 GLU A CD  1 
ATOM   3995 O  OE1 . GLU A 1 513 ? 9.216   -4.086  -5.957  1.00 149.87 ? 513 GLU A OE1 1 
ATOM   3996 O  OE2 . GLU A 1 513 ? 10.456  -5.657  -6.871  1.00 146.64 ? 513 GLU A OE2 1 
ATOM   3997 N  N   . TYR A 1 514 ? 4.808   -5.779  -4.032  1.00 115.16 ? 514 TYR A N   1 
ATOM   3998 C  CA  . TYR A 1 514 ? 3.653   -5.274  -3.291  1.00 119.05 ? 514 TYR A CA  1 
ATOM   3999 C  C   . TYR A 1 514 ? 3.760   -5.479  -1.781  1.00 114.73 ? 514 TYR A C   1 
ATOM   4000 O  O   . TYR A 1 514 ? 3.148   -4.738  -1.000  1.00 114.59 ? 514 TYR A O   1 
ATOM   4001 C  CB  . TYR A 1 514 ? 2.349   -5.858  -3.824  1.00 117.25 ? 514 TYR A CB  1 
ATOM   4002 C  CG  . TYR A 1 514 ? 1.740   -5.002  -4.893  1.00 125.00 ? 514 TYR A CG  1 
ATOM   4003 C  CD1 . TYR A 1 514 ? 2.431   -4.742  -6.061  1.00 133.21 ? 514 TYR A CD1 1 
ATOM   4004 C  CD2 . TYR A 1 514 ? 0.484   -4.442  -4.739  1.00 125.59 ? 514 TYR A CD2 1 
ATOM   4005 C  CE1 . TYR A 1 514 ? 1.891   -3.951  -7.062  1.00 142.62 ? 514 TYR A CE1 1 
ATOM   4006 C  CE2 . TYR A 1 514 ? -0.074  -3.648  -5.738  1.00 134.74 ? 514 TYR A CE2 1 
ATOM   4007 C  CZ  . TYR A 1 514 ? 0.640   -3.401  -6.901  1.00 143.35 ? 514 TYR A CZ  1 
ATOM   4008 O  OH  . TYR A 1 514 ? 0.122   -2.608  -7.909  1.00 153.80 ? 514 TYR A OH  1 
ATOM   4009 N  N   . THR A 1 515 ? 4.537   -6.475  -1.363  1.00 104.06 ? 515 THR A N   1 
ATOM   4010 C  CA  . THR A 1 515 ? 4.832   -6.630  0.062   1.00 101.22 ? 515 THR A CA  1 
ATOM   4011 C  C   . THR A 1 515 ? 5.772   -5.522  0.512   1.00 102.86 ? 515 THR A C   1 
ATOM   4012 O  O   . THR A 1 515 ? 5.665   -5.039  1.633   1.00 103.25 ? 515 THR A O   1 
ATOM   4013 C  CB  . THR A 1 515 ? 5.416   -8.023  0.436   1.00 103.45 ? 515 THR A CB  1 
ATOM   4014 O  OG1 . THR A 1 515 ? 4.733   -8.526  1.592   1.00 101.96 ? 515 THR A OG1 1 
ATOM   4015 C  CG2 . THR A 1 515 ? 6.896   -7.924  0.747   1.00 100.16 ? 515 THR A CG2 1 
ATOM   4016 N  N   . GLU A 1 516 ? 6.685   -5.112  -0.365  1.00 95.77  ? 516 GLU A N   1 
ATOM   4017 C  CA  . GLU A 1 516 ? 7.530   -3.979  -0.027  1.00 99.84  ? 516 GLU A CA  1 
ATOM   4018 C  C   . GLU A 1 516 ? 6.745   -2.662  -0.095  1.00 108.51 ? 516 GLU A C   1 
ATOM   4019 O  O   . GLU A 1 516 ? 7.120   -1.676  0.544   1.00 112.63 ? 516 GLU A O   1 
ATOM   4020 C  CB  . GLU A 1 516 ? 8.763   -3.922  -0.919  1.00 116.43 ? 516 GLU A CB  1 
ATOM   4021 C  CG  . GLU A 1 516 ? 9.910   -3.149  -0.301  1.00 118.56 ? 516 GLU A CG  1 
ATOM   4022 C  CD  . GLU A 1 516 ? 10.569  -3.930  0.808   1.00 113.08 ? 516 GLU A CD  1 
ATOM   4023 O  OE1 . GLU A 1 516 ? 11.461  -3.382  1.493   1.00 113.52 ? 516 GLU A OE1 1 
ATOM   4024 O  OE2 . GLU A 1 516 ? 10.193  -5.105  0.987   1.00 109.02 ? 516 GLU A OE2 1 
ATOM   4025 N  N   . LYS A 1 517 ? 5.668   -2.628  -0.876  1.00 114.43 ? 517 LYS A N   1 
ATOM   4026 C  CA  . LYS A 1 517 ? 4.823   -1.429  -0.905  1.00 125.84 ? 517 LYS A CA  1 
ATOM   4027 C  C   . LYS A 1 517 ? 3.882   -1.339  0.310   1.00 124.93 ? 517 LYS A C   1 
ATOM   4028 O  O   . LYS A 1 517 ? 3.535   -0.234  0.779   1.00 130.35 ? 517 LYS A O   1 
ATOM   4029 C  CB  . LYS A 1 517 ? 4.035   -1.366  -2.221  1.00 110.73 ? 517 LYS A CB  1 
ATOM   4030 C  CG  . LYS A 1 517 ? 4.886   -1.356  -3.483  1.00 112.81 ? 517 LYS A CG  1 
ATOM   4031 C  CD  . LYS A 1 517 ? 4.540   -0.178  -4.392  1.00 125.88 ? 517 LYS A CD  1 
ATOM   4032 C  CE  . LYS A 1 517 ? 3.144   -0.297  -5.000  1.00 129.25 ? 517 LYS A CE  1 
ATOM   4033 N  NZ  . LYS A 1 517 ? 2.703   0.950   -5.709  1.00 136.48 ? 517 LYS A NZ  1 
ATOM   4034 N  N   . SER A 1 518 ? 3.454   -2.494  0.815   1.00 154.41 ? 518 SER A N   1 
ATOM   4035 C  CA  . SER A 1 518 ? 2.615   -2.518  2.012   1.00 152.45 ? 518 SER A CA  1 
ATOM   4036 C  C   . SER A 1 518 ? 3.276   -1.747  3.133   1.00 157.32 ? 518 SER A C   1 
ATOM   4037 O  O   . SER A 1 518 ? 2.605   -1.293  4.057   1.00 158.78 ? 518 SER A O   1 
ATOM   4038 C  CB  . SER A 1 518 ? 2.354   -3.951  2.475   1.00 144.47 ? 518 SER A CB  1 
ATOM   4039 O  OG  . SER A 1 518 ? 1.798   -3.979  3.781   1.00 144.56 ? 518 SER A OG  1 
ATOM   4040 N  N   . PHE A 1 519 ? 4.592   -1.580  3.021   1.00 113.81 ? 519 PHE A N   1 
ATOM   4041 C  CA  . PHE A 1 519 ? 5.412   -1.042  4.097   1.00 114.12 ? 519 PHE A CA  1 
ATOM   4042 C  C   . PHE A 1 519 ? 5.348   0.469   4.148   1.00 125.83 ? 519 PHE A C   1 
ATOM   4043 O  O   . PHE A 1 519 ? 5.693   1.073   5.151   1.00 127.85 ? 519 PHE A O   1 
ATOM   4044 C  CB  . PHE A 1 519 ? 6.855   -1.513  3.937   1.00 161.76 ? 519 PHE A CB  1 
ATOM   4045 C  CG  . PHE A 1 519 ? 7.086   -2.918  4.403   1.00 152.77 ? 519 PHE A CG  1 
ATOM   4046 C  CD1 . PHE A 1 519 ? 8.110   -3.678  3.868   1.00 145.77 ? 519 PHE A CD1 1 
ATOM   4047 C  CD2 . PHE A 1 519 ? 6.285   -3.476  5.384   1.00 153.55 ? 519 PHE A CD2 1 
ATOM   4048 C  CE1 . PHE A 1 519 ? 8.332   -4.965  4.297   1.00 140.14 ? 519 PHE A CE1 1 
ATOM   4049 C  CE2 . PHE A 1 519 ? 6.500   -4.769  5.819   1.00 147.68 ? 519 PHE A CE2 1 
ATOM   4050 C  CZ  . PHE A 1 519 ? 7.525   -5.512  5.274   1.00 141.23 ? 519 PHE A CZ  1 
ATOM   4051 N  N   . LYS A 1 520 ? 4.903   1.077   3.056   1.00 147.12 ? 520 LYS A N   1 
ATOM   4052 C  CA  . LYS A 1 520 ? 4.660   2.511   3.034   1.00 161.34 ? 520 LYS A CA  1 
ATOM   4053 C  C   . LYS A 1 520 ? 3.177   2.808   2.924   1.00 151.31 ? 520 LYS A C   1 
ATOM   4054 O  O   . LYS A 1 520 ? 2.627   3.516   3.763   1.00 149.99 ? 520 LYS A O   1 
ATOM   4055 C  CB  . LYS A 1 520 ? 5.426   3.176   1.889   1.00 168.70 ? 520 LYS A CB  1 
ATOM   4056 C  CG  . LYS A 1 520 ? 6.922   2.969   1.973   1.00 171.69 ? 520 LYS A CG  1 
ATOM   4057 C  CD  . LYS A 1 520 ? 7.722   4.086   1.309   1.00 189.45 ? 520 LYS A CD  1 
ATOM   4058 C  CE  . LYS A 1 520 ? 9.208   3.956   1.665   1.00 186.14 ? 520 LYS A CE  1 
ATOM   4059 N  NZ  . LYS A 1 520 ? 10.065  5.005   1.047   1.00 203.61 ? 520 LYS A NZ  1 
ATOM   4060 N  N   . GLU A 1 521 ? 2.527   2.248   1.900   1.00 165.27 ? 521 GLU A N   1 
ATOM   4061 C  CA  . GLU A 1 521 ? 1.113   2.584   1.667   1.00 158.60 ? 521 GLU A CA  1 
ATOM   4062 C  C   . GLU A 1 521 ? 0.121   1.835   2.577   1.00 141.66 ? 521 GLU A C   1 
ATOM   4063 O  O   . GLU A 1 521 ? -1.076  2.101   2.554   1.00 135.75 ? 521 GLU A O   1 
ATOM   4064 C  CB  . GLU A 1 521 ? 0.776   2.488   0.175   1.00 182.32 ? 521 GLU A CB  1 
ATOM   4065 C  CG  . GLU A 1 521 ? 1.531   3.536   -0.647  1.00 201.21 ? 521 GLU A CG  1 
ATOM   4066 C  CD  . GLU A 1 521 ? 1.249   3.459   -2.135  1.00 208.50 ? 521 GLU A CD  1 
ATOM   4067 O  OE1 . GLU A 1 521 ? 0.303   2.750   -2.530  1.00 199.19 ? 521 GLU A OE1 1 
ATOM   4068 O  OE2 . GLU A 1 521 ? 1.978   4.110   -2.909  1.00 224.80 ? 521 GLU A OE2 1 
ATOM   4069 N  N   . ASN A 1 522 ? 0.646   0.930   3.400   1.00 171.10 ? 522 ASN A N   1 
ATOM   4070 C  CA  . ASN A 1 522 ? -0.133  0.263   4.441   1.00 156.33 ? 522 ASN A CA  1 
ATOM   4071 C  C   . ASN A 1 522 ? -1.376  -0.469  3.975   1.00 143.84 ? 522 ASN A C   1 
ATOM   4072 O  O   . ASN A 1 522 ? -2.465  -0.248  4.509   1.00 136.17 ? 522 ASN A O   1 
ATOM   4073 C  CB  . ASN A 1 522 ? -0.512  1.251   5.534   1.00 155.64 ? 522 ASN A CB  1 
ATOM   4074 C  CG  . ASN A 1 522 ? 0.525   1.326   6.613   1.00 161.45 ? 522 ASN A CG  1 
ATOM   4075 O  OD1 . ASN A 1 522 ? 0.953   0.303   7.149   1.00 156.75 ? 522 ASN A OD1 1 
ATOM   4076 N  ND2 . ASN A 1 522 ? 0.952   2.536   6.936   1.00 173.18 ? 522 ASN A ND2 1 
ATOM   4077 N  N   . TYR A 1 523 ? -1.205  -1.349  2.992   1.00 172.90 ? 523 TYR A N   1 
ATOM   4078 C  CA  . TYR A 1 523 ? -2.310  -2.143  2.470   1.00 160.45 ? 523 TYR A CA  1 
ATOM   4079 C  C   . TYR A 1 523 ? -2.838  -3.052  3.572   1.00 141.59 ? 523 TYR A C   1 
ATOM   4080 O  O   . TYR A 1 523 ? -2.072  -3.785  4.193   1.00 137.25 ? 523 TYR A O   1 
ATOM   4081 C  CB  . TYR A 1 523 ? -1.865  -2.980  1.262   1.00 81.14  ? 523 TYR A CB  1 
ATOM   4082 C  CG  . TYR A 1 523 ? -1.296  -2.188  0.093   1.00 99.45  ? 523 TYR A CG  1 
ATOM   4083 C  CD1 . TYR A 1 523 ? -0.026  -2.462  -0.407  1.00 109.35 ? 523 TYR A CD1 1 
ATOM   4084 C  CD2 . TYR A 1 523 ? -2.035  -1.177  -0.516  1.00 110.28 ? 523 TYR A CD2 1 
ATOM   4085 C  CE1 . TYR A 1 523 ? 0.487   -1.750  -1.472  1.00 129.61 ? 523 TYR A CE1 1 
ATOM   4086 C  CE2 . TYR A 1 523 ? -1.524  -0.461  -1.576  1.00 131.10 ? 523 TYR A CE2 1 
ATOM   4087 C  CZ  . TYR A 1 523 ? -0.267  -0.751  -2.047  1.00 140.53 ? 523 TYR A CZ  1 
ATOM   4088 O  OH  . TYR A 1 523 ? 0.233   -0.038  -3.107  1.00 162.59 ? 523 TYR A OH  1 
ATOM   4089 N  N   . PRO A 1 524 ? -4.150  -2.992  3.832   1.00 160.87 ? 524 PRO A N   1 
ATOM   4090 C  CA  . PRO A 1 524 ? -4.750  -3.895  4.814   1.00 143.73 ? 524 PRO A CA  1 
ATOM   4091 C  C   . PRO A 1 524 ? -4.887  -5.274  4.175   1.00 132.24 ? 524 PRO A C   1 
ATOM   4092 O  O   . PRO A 1 524 ? -4.915  -6.305  4.853   1.00 119.81 ? 524 PRO A O   1 
ATOM   4093 C  CB  . PRO A 1 524 ? -6.124  -3.271  5.048   1.00 109.06 ? 524 PRO A CB  1 
ATOM   4094 C  CG  . PRO A 1 524 ? -6.459  -2.645  3.737   1.00 119.25 ? 524 PRO A CG  1 
ATOM   4095 C  CD  . PRO A 1 524 ? -5.156  -2.157  3.155   1.00 134.50 ? 524 PRO A CD  1 
ATOM   4096 N  N   . ASP A 1 525 ? -4.952  -5.273  2.847   1.00 140.49 ? 525 ASP A N   1 
ATOM   4097 C  CA  . ASP A 1 525 ? -5.085  -6.491  2.068   1.00 132.51 ? 525 ASP A CA  1 
ATOM   4098 C  C   . ASP A 1 525 ? -4.256  -6.318  0.802   1.00 146.32 ? 525 ASP A C   1 
ATOM   4099 O  O   . ASP A 1 525 ? -4.666  -5.629  -0.127  1.00 155.66 ? 525 ASP A O   1 
ATOM   4100 C  CB  . ASP A 1 525 ? -6.559  -6.726  1.733   1.00 186.15 ? 525 ASP A CB  1 
ATOM   4101 C  CG  . ASP A 1 525 ? -6.879  -8.183  1.502   1.00 176.43 ? 525 ASP A CG  1 
ATOM   4102 O  OD1 . ASP A 1 525 ? -6.144  -8.818  0.724   1.00 182.24 ? 525 ASP A OD1 1 
ATOM   4103 O  OD2 . ASP A 1 525 ? -7.856  -8.693  2.098   1.00 164.25 ? 525 ASP A OD2 1 
ATOM   4104 N  N   . VAL A 1 526 ? -3.072  -6.924  0.796   1.00 125.00 ? 526 VAL A N   1 
ATOM   4105 C  CA  . VAL A 1 526 ? -2.108  -6.792  -0.296  1.00 139.87 ? 526 VAL A CA  1 
ATOM   4106 C  C   . VAL A 1 526 ? -2.655  -7.271  -1.639  1.00 143.30 ? 526 VAL A C   1 
ATOM   4107 O  O   . VAL A 1 526 ? -2.626  -6.544  -2.647  1.00 159.97 ? 526 VAL A O   1 
ATOM   4108 C  CB  . VAL A 1 526 ? -0.841  -7.597  0.015   1.00 86.72  ? 526 VAL A CB  1 
ATOM   4109 C  CG1 . VAL A 1 526 ? 0.076   -7.625  -1.177  1.00 96.37  ? 526 VAL A CG1 1 
ATOM   4110 C  CG2 . VAL A 1 526 ? -0.135  -7.032  1.218   1.00 85.23  ? 526 VAL A CG2 1 
ATOM   4111 N  N   . LEU A 1 527 ? -3.135  -8.510  -1.654  1.00 104.88 ? 527 LEU A N   1 
ATOM   4112 C  CA  . LEU A 1 527 ? -3.789  -9.062  -2.834  1.00 108.99 ? 527 LEU A CA  1 
ATOM   4113 C  C   . LEU A 1 527 ? -4.833  -8.099  -3.427  1.00 119.83 ? 527 LEU A C   1 
ATOM   4114 O  O   . LEU A 1 527 ? -4.766  -7.760  -4.615  1.00 137.11 ? 527 LEU A O   1 
ATOM   4115 C  CB  . LEU A 1 527 ? -4.440  -10.395 -2.491  1.00 95.87  ? 527 LEU A CB  1 
ATOM   4116 C  CG  . LEU A 1 527 ? -4.794  -11.218 -3.719  1.00 100.51 ? 527 LEU A CG  1 
ATOM   4117 C  CD1 . LEU A 1 527 ? -3.581  -11.985 -4.211  1.00 98.07  ? 527 LEU A CD1 1 
ATOM   4118 C  CD2 . LEU A 1 527 ? -5.884  -12.162 -3.351  1.00 86.05  ? 527 LEU A CD2 1 
ATOM   4119 N  N   . LYS A 1 528 ? -5.791  -7.670  -2.596  1.00 76.30  ? 528 LYS A N   1 
ATOM   4120 C  CA  . LYS A 1 528 ? -6.767  -6.644  -2.979  1.00 85.58  ? 528 LYS A CA  1 
ATOM   4121 C  C   . LYS A 1 528 ? -6.072  -5.405  -3.568  1.00 105.85 ? 528 LYS A C   1 
ATOM   4122 O  O   . LYS A 1 528 ? -6.562  -4.806  -4.513  1.00 120.59 ? 528 LYS A O   1 
ATOM   4123 C  CB  . LYS A 1 528 ? -7.687  -6.265  -1.803  1.00 203.92 ? 528 LYS A CB  1 
ATOM   4124 C  CG  . LYS A 1 528 ? -9.067  -5.754  -2.230  1.00 194.37 ? 528 LYS A CG  1 
ATOM   4125 C  CD  . LYS A 1 528 ? -9.775  -4.988  -1.118  1.00 185.36 ? 528 LYS A CD  1 
ATOM   4126 C  CE  . LYS A 1 528 ? -10.982 -4.193  -1.654  1.00 161.62 ? 528 LYS A CE  1 
ATOM   4127 N  NZ  . LYS A 1 528 ? -11.516 -3.128  -0.716  1.00 152.76 ? 528 LYS A NZ  1 
ATOM   4128 N  N   . ALA A 1 529 ? -4.919  -5.034  -3.021  1.00 98.65  ? 529 ALA A N   1 
ATOM   4129 C  CA  . ALA A 1 529 ? -4.128  -3.922  -3.557  1.00 118.12 ? 529 ALA A CA  1 
ATOM   4130 C  C   . ALA A 1 529 ? -3.758  -4.177  -5.003  1.00 136.06 ? 529 ALA A C   1 
ATOM   4131 O  O   . ALA A 1 529 ? -4.038  -3.364  -5.890  1.00 154.09 ? 529 ALA A O   1 
ATOM   4132 C  CB  . ALA A 1 529 ? -2.870  -3.728  -2.738  1.00 110.23 ? 529 ALA A CB  1 
ATOM   4133 N  N   . MET A 1 530 ? -3.112  -5.312  -5.232  1.00 95.34  ? 530 MET A N   1 
ATOM   4134 C  CA  . MET A 1 530 ? -2.732  -5.680  -6.586  1.00 113.66 ? 530 MET A CA  1 
ATOM   4135 C  C   . MET A 1 530 ? -3.941  -5.604  -7.492  1.00 119.20 ? 530 MET A C   1 
ATOM   4136 O  O   . MET A 1 530 ? -3.893  -4.964  -8.537  1.00 139.26 ? 530 MET A O   1 
ATOM   4137 C  CB  . MET A 1 530 ? -2.151  -7.080  -6.603  1.00 148.49 ? 530 MET A CB  1 
ATOM   4138 C  CG  . MET A 1 530 ? -1.064  -7.247  -5.589  1.00 128.14 ? 530 MET A CG  1 
ATOM   4139 S  SD  . MET A 1 530 ? -0.428  -8.916  -5.527  1.00 112.19 ? 530 MET A SD  1 
ATOM   4140 C  CE  . MET A 1 530 ? 0.046   -9.114  -7.226  1.00 117.57 ? 530 MET A CE  1 
ATOM   4141 N  N   . VAL A 1 531 ? -5.030  -6.242  -7.072  1.00 97.90  ? 531 VAL A N   1 
ATOM   4142 C  CA  . VAL A 1 531 ? -6.271  -6.258  -7.855  1.00 104.22 ? 531 VAL A CA  1 
ATOM   4143 C  C   . VAL A 1 531 ? -6.755  -4.858  -8.252  1.00 122.46 ? 531 VAL A C   1 
ATOM   4144 O  O   . VAL A 1 531 ? -6.889  -4.564  -9.439  1.00 143.52 ? 531 VAL A O   1 
ATOM   4145 C  CB  . VAL A 1 531 ? -7.411  -7.001  -7.117  1.00 115.24 ? 531 VAL A CB  1 
ATOM   4146 C  CG1 . VAL A 1 531 ? -8.754  -6.764  -7.813  1.00 111.76 ? 531 VAL A CG1 1 
ATOM   4147 C  CG2 . VAL A 1 531 ? -7.101  -8.488  -7.001  1.00 88.46  ? 531 VAL A CG2 1 
ATOM   4148 N  N   . LYS A 1 532 ? -7.021  -4.004  -7.261  1.00 141.42 ? 532 LYS A N   1 
ATOM   4149 C  CA  . LYS A 1 532 ? -7.457  -2.627  -7.513  1.00 158.53 ? 532 LYS A CA  1 
ATOM   4150 C  C   . LYS A 1 532 ? -6.422  -1.857  -8.327  1.00 183.06 ? 532 LYS A C   1 
ATOM   4151 O  O   . LYS A 1 532 ? -6.731  -0.817  -8.912  1.00 202.73 ? 532 LYS A O   1 
ATOM   4152 C  CB  . LYS A 1 532 ? -7.735  -1.880  -6.201  1.00 232.12 ? 532 LYS A CB  1 
ATOM   4153 C  CG  . LYS A 1 532 ? -9.149  -2.038  -5.655  1.00 216.91 ? 532 LYS A CG  1 
ATOM   4154 C  CD  . LYS A 1 532 ? -9.346  -1.228  -4.375  1.00 210.02 ? 532 LYS A CD  1 
ATOM   4155 C  CE  . LYS A 1 532 ? -10.719 -1.487  -3.754  1.00 193.96 ? 532 LYS A CE  1 
ATOM   4156 N  NZ  . LYS A 1 532 ? -10.892 -0.826  -2.424  1.00 186.10 ? 532 LYS A NZ  1 
ATOM   4157 N  N   . ASP A 1 533 ? -5.192  -2.367  -8.359  1.00 124.61 ? 533 ASP A N   1 
ATOM   4158 C  CA  . ASP A 1 533 ? -4.127  -1.723  -9.124  1.00 148.50 ? 533 ASP A CA  1 
ATOM   4159 C  C   . ASP A 1 533 ? -3.905  -2.357  -10.495 1.00 165.43 ? 533 ASP A C   1 
ATOM   4160 O  O   . ASP A 1 533 ? -3.003  -1.951  -11.225 1.00 188.84 ? 533 ASP A O   1 
ATOM   4161 C  CB  . ASP A 1 533 ? -2.824  -1.698  -8.324  1.00 188.75 ? 533 ASP A CB  1 
ATOM   4162 C  CG  . ASP A 1 533 ? -2.927  -0.845  -7.077  1.00 174.73 ? 533 ASP A CG  1 
ATOM   4163 O  OD1 . ASP A 1 533 ? -3.709  0.126   -7.078  1.00 175.94 ? 533 ASP A OD1 1 
ATOM   4164 O  OD2 . ASP A 1 533 ? -2.230  -1.145  -6.090  1.00 163.87 ? 533 ASP A OD2 1 
ATOM   4165 N  N   . TYR A 1 534 ? -4.723  -3.348  -10.842 1.00 130.26 ? 534 TYR A N   1 
ATOM   4166 C  CA  . TYR A 1 534 ? -4.744  -3.890  -12.204 1.00 141.51 ? 534 TYR A CA  1 
ATOM   4167 C  C   . TYR A 1 534 ? -6.141  -3.910  -12.836 1.00 146.74 ? 534 TYR A C   1 
ATOM   4168 O  O   . TYR A 1 534 ? -6.407  -4.676  -13.759 1.00 149.73 ? 534 TYR A O   1 
ATOM   4169 C  CB  . TYR A 1 534 ? -4.101  -5.275  -12.266 1.00 135.07 ? 534 TYR A CB  1 
ATOM   4170 C  CG  . TYR A 1 534 ? -2.596  -5.223  -12.230 1.00 136.35 ? 534 TYR A CG  1 
ATOM   4171 C  CD1 . TYR A 1 534 ? -1.929  -5.126  -11.031 1.00 127.85 ? 534 TYR A CD1 1 
ATOM   4172 C  CD2 . TYR A 1 534 ? -1.842  -5.252  -13.389 1.00 143.36 ? 534 TYR A CD2 1 
ATOM   4173 C  CE1 . TYR A 1 534 ? -0.549  -5.072  -10.978 1.00 126.72 ? 534 TYR A CE1 1 
ATOM   4174 C  CE2 . TYR A 1 534 ? -0.455  -5.196  -13.341 1.00 133.99 ? 534 TYR A CE2 1 
ATOM   4175 C  CZ  . TYR A 1 534 ? 0.183   -5.106  -12.125 1.00 126.35 ? 534 TYR A CZ  1 
ATOM   4176 O  OH  . TYR A 1 534 ? 1.554   -5.043  -12.029 1.00 118.62 ? 534 TYR A OH  1 
ATOM   4177 N  N   . ASN A 1 535 ? -7.023  -3.053  -12.339 1.00 170.72 ? 535 ASN A N   1 
ATOM   4178 C  CA  . ASN A 1 535 ? -8.345  -2.898  -12.919 1.00 178.60 ? 535 ASN A CA  1 
ATOM   4179 C  C   . ASN A 1 535 ? -8.958  -4.227  -13.326 1.00 166.49 ? 535 ASN A C   1 
ATOM   4180 O  O   . ASN A 1 535 ? -9.440  -4.371  -14.450 1.00 180.99 ? 535 ASN A O   1 
ATOM   4181 C  CB  . ASN A 1 535 ? -8.284  -1.938  -14.107 1.00 189.16 ? 535 ASN A CB  1 
ATOM   4182 C  CG  . ASN A 1 535 ? -7.889  -0.530  -13.691 1.00 200.80 ? 535 ASN A CG  1 
ATOM   4183 O  OD1 . ASN A 1 535 ? -8.493  0.051   -12.792 1.00 196.27 ? 535 ASN A OD1 1 
ATOM   4184 N  ND2 . ASN A 1 535 ? -6.858  0.015   -14.329 1.00 214.62 ? 535 ASN A ND2 1 
ATOM   4185 N  N   . GLN A 1 536 ? -8.907  -5.195  -12.407 1.00 185.02 ? 536 GLN A N   1 
ATOM   4186 C  CA  . GLN A 1 536 ? -9.624  -6.470  -12.528 1.00 168.96 ? 536 GLN A CA  1 
ATOM   4187 C  C   . GLN A 1 536 ? -10.828 -6.477  -11.563 1.00 151.34 ? 536 GLN A C   1 
ATOM   4188 O  O   . GLN A 1 536 ? -10.709 -6.046  -10.417 1.00 134.88 ? 536 GLN A O   1 
ATOM   4189 C  CB  . GLN A 1 536 ? -8.686  -7.653  -12.236 1.00 143.08 ? 536 GLN A CB  1 
ATOM   4190 C  CG  . GLN A 1 536 ? -7.572  -7.870  -13.251 1.00 153.25 ? 536 GLN A CG  1 
ATOM   4191 C  CD  . GLN A 1 536 ? -8.080  -8.447  -14.553 1.00 158.00 ? 536 GLN A CD  1 
ATOM   4192 O  OE1 . GLN A 1 536 ? -9.282  -8.623  -14.741 1.00 159.14 ? 536 GLN A OE1 1 
ATOM   4193 N  NE2 . GLN A 1 536 ? -7.165  -8.748  -15.460 1.00 162.59 ? 536 GLN A NE2 1 
ATOM   4194 N  N   . THR A 1 537 ? -11.979 -6.962  -12.029 1.00 181.32 ? 537 THR A N   1 
ATOM   4195 C  CA  . THR A 1 537 ? -13.229 -6.891  -11.256 1.00 167.59 ? 537 THR A CA  1 
ATOM   4196 C  C   . THR A 1 537 ? -13.308 -7.896  -10.096 1.00 138.99 ? 537 THR A C   1 
ATOM   4197 O  O   . THR A 1 537 ? -13.999 -7.664  -9.106  1.00 121.75 ? 537 THR A O   1 
ATOM   4198 C  CB  . THR A 1 537 ? -14.475 -7.091  -12.159 1.00 151.17 ? 537 THR A CB  1 
ATOM   4199 O  OG1 . THR A 1 537 ? -14.245 -6.515  -13.450 1.00 173.97 ? 537 THR A OG1 1 
ATOM   4200 C  CG2 . THR A 1 537 ? -15.715 -6.463  -11.529 1.00 136.62 ? 537 THR A CG2 1 
ATOM   4201 N  N   . SER A 1 538 ? -12.624 -9.026  -10.237 1.00 186.41 ? 538 SER A N   1 
ATOM   4202 C  CA  . SER A 1 538 ? -12.535 -10.010 -9.158  1.00 160.73 ? 538 SER A CA  1 
ATOM   4203 C  C   . SER A 1 538 ? -11.095 -10.487 -8.954  1.00 150.71 ? 538 SER A C   1 
ATOM   4204 O  O   . SER A 1 538 ? -10.143 -9.845  -9.389  1.00 160.76 ? 538 SER A O   1 
ATOM   4205 C  CB  . SER A 1 538 ? -13.500 -11.192 -9.379  1.00 209.89 ? 538 SER A CB  1 
ATOM   4206 O  OG  . SER A 1 538 ? -13.491 -11.661 -10.718 1.00 216.86 ? 538 SER A OG  1 
ATOM   4207 N  N   . ALA A 1 539 ? -10.933 -11.611 -8.282  1.00 134.00 ? 539 ALA A N   1 
ATOM   4208 C  CA  . ALA A 1 539 ? -9.599  -12.061 -7.958  1.00 124.54 ? 539 ALA A CA  1 
ATOM   4209 C  C   . ALA A 1 539 ? -9.205  -13.296 -8.767  1.00 120.00 ? 539 ALA A C   1 
ATOM   4210 O  O   . ALA A 1 539 ? -8.018  -13.580 -8.930  1.00 119.33 ? 539 ALA A O   1 
ATOM   4211 C  CB  . ALA A 1 539 ? -9.497  -12.315 -6.490  1.00 64.04  ? 539 ALA A CB  1 
ATOM   4212 N  N   . LYS A 1 540 ? -10.201 -14.022 -9.275  1.00 141.27 ? 540 LYS A N   1 
ATOM   4213 C  CA  . LYS A 1 540 ? -9.950  -15.141 -10.181 1.00 139.09 ? 540 LYS A CA  1 
ATOM   4214 C  C   . LYS A 1 540 ? -9.613  -14.621 -11.577 1.00 159.12 ? 540 LYS A C   1 
ATOM   4215 O  O   . LYS A 1 540 ? -8.954  -15.306 -12.363 1.00 160.16 ? 540 LYS A O   1 
ATOM   4216 C  CB  . LYS A 1 540 ? -11.149 -16.086 -10.241 1.00 271.41 ? 540 LYS A CB  1 
ATOM   4217 C  CG  . LYS A 1 540 ? -11.284 -16.974 -9.023  1.00 251.04 ? 540 LYS A CG  1 
ATOM   4218 C  CD  . LYS A 1 540 ? -12.245 -18.119 -9.284  1.00 242.77 ? 540 LYS A CD  1 
ATOM   4219 C  CE  . LYS A 1 540 ? -12.179 -19.161 -8.175  1.00 223.91 ? 540 LYS A CE  1 
ATOM   4220 N  NZ  . LYS A 1 540 ? -12.946 -20.397 -8.513  1.00 221.67 ? 540 LYS A NZ  1 
ATOM   4221 N  N   . ASP A 1 541 ? -10.065 -13.405 -11.879 1.00 123.48 ? 541 ASP A N   1 
ATOM   4222 C  CA  . ASP A 1 541 ? -9.761  -12.785 -13.163 1.00 145.38 ? 541 ASP A CA  1 
ATOM   4223 C  C   . ASP A 1 541 ? -8.343  -12.238 -13.107 1.00 147.70 ? 541 ASP A C   1 
ATOM   4224 O  O   . ASP A 1 541 ? -7.638  -12.231 -14.113 1.00 159.94 ? 541 ASP A O   1 
ATOM   4225 C  CB  . ASP A 1 541 ? -10.774 -11.683 -13.528 1.00 189.44 ? 541 ASP A CB  1 
ATOM   4226 C  CG  . ASP A 1 541 ? -11.755 -12.111 -14.632 1.00 199.89 ? 541 ASP A CG  1 
ATOM   4227 O  OD1 . ASP A 1 541 ? -11.484 -13.113 -15.335 1.00 191.26 ? 541 ASP A OD1 1 
ATOM   4228 O  OD2 . ASP A 1 541 ? -12.794 -11.432 -14.804 1.00 210.06 ? 541 ASP A OD2 1 
ATOM   4229 N  N   . PHE A 1 542 ? -7.923  -11.797 -11.925 1.00 126.97 ? 542 PHE A N   1 
ATOM   4230 C  CA  . PHE A 1 542 ? -6.539  -11.365 -11.717 1.00 129.43 ? 542 PHE A CA  1 
ATOM   4231 C  C   . PHE A 1 542 ? -5.569  -12.546 -11.784 1.00 113.70 ? 542 PHE A C   1 
ATOM   4232 O  O   . PHE A 1 542 ? -4.540  -12.501 -12.462 1.00 121.14 ? 542 PHE A O   1 
ATOM   4233 C  CB  . PHE A 1 542 ? -6.389  -10.646 -10.368 1.00 125.20 ? 542 PHE A CB  1 
ATOM   4234 C  CG  . PHE A 1 542 ? -4.961  -10.266 -10.030 1.00 125.20 ? 542 PHE A CG  1 
ATOM   4235 C  CD1 . PHE A 1 542 ? -4.637  -8.961  -9.692  1.00 133.28 ? 542 PHE A CD1 1 
ATOM   4236 C  CD2 . PHE A 1 542 ? -3.947  -11.214 -10.040 1.00 116.64 ? 542 PHE A CD2 1 
ATOM   4237 C  CE1 . PHE A 1 542 ? -3.335  -8.612  -9.386  1.00 132.79 ? 542 PHE A CE1 1 
ATOM   4238 C  CE2 . PHE A 1 542 ? -2.646  -10.865 -9.737  1.00 116.26 ? 542 PHE A CE2 1 
ATOM   4239 C  CZ  . PHE A 1 542 ? -2.343  -9.566  -9.410  1.00 124.26 ? 542 PHE A CZ  1 
ATOM   4240 N  N   . LEU A 1 543 ? -5.903  -13.599 -11.059 1.00 140.19 ? 543 LEU A N   1 
ATOM   4241 C  CA  . LEU A 1 543 ? -5.018  -14.733 -10.936 1.00 124.65 ? 543 LEU A CA  1 
ATOM   4242 C  C   . LEU A 1 543 ? -5.008  -15.630 -12.177 1.00 131.78 ? 543 LEU A C   1 
ATOM   4243 O  O   . LEU A 1 543 ? -3.979  -16.224 -12.497 1.00 130.28 ? 543 LEU A O   1 
ATOM   4244 C  CB  . LEU A 1 543 ? -5.385  -15.527 -9.693  1.00 104.87 ? 543 LEU A CB  1 
ATOM   4245 C  CG  . LEU A 1 543 ? -5.224  -14.725 -8.408  1.00 98.80  ? 543 LEU A CG  1 
ATOM   4246 C  CD1 . LEU A 1 543 ? -6.050  -15.323 -7.289  1.00 83.41  ? 543 LEU A CD1 1 
ATOM   4247 C  CD2 . LEU A 1 543 ? -3.755  -14.648 -8.029  1.00 95.04  ? 543 LEU A CD2 1 
ATOM   4248 N  N   . GLU A 1 544 ? -6.134  -15.747 -12.876 1.00 137.89 ? 544 GLU A N   1 
ATOM   4249 C  CA  . GLU A 1 544 ? -6.135  -16.524 -14.111 1.00 148.95 ? 544 GLU A CA  1 
ATOM   4250 C  C   . GLU A 1 544 ? -5.395  -15.716 -15.161 1.00 170.95 ? 544 GLU A C   1 
ATOM   4251 O  O   . GLU A 1 544 ? -5.381  -16.066 -16.337 1.00 185.31 ? 544 GLU A O   1 
ATOM   4252 C  CB  . GLU A 1 544 ? -7.556  -16.848 -14.568 1.00 194.79 ? 544 GLU A CB  1 
ATOM   4253 C  CG  . GLU A 1 544 ? -8.070  -18.188 -14.071 1.00 174.06 ? 544 GLU A CG  1 
ATOM   4254 C  CD  . GLU A 1 544 ? -9.537  -18.405 -14.394 1.00 179.80 ? 544 GLU A CD  1 
ATOM   4255 O  OE1 . GLU A 1 544 ? -10.262 -17.399 -14.572 1.00 194.93 ? 544 GLU A OE1 1 
ATOM   4256 O  OE2 . GLU A 1 544 ? -9.964  -19.578 -14.472 1.00 170.53 ? 544 GLU A OE2 1 
ATOM   4257 N  N   . SER A 1 545 ? -4.764  -14.639 -14.699 1.00 123.56 ? 545 SER A N   1 
ATOM   4258 C  CA  . SER A 1 545 ? -4.138  -13.641 -15.561 1.00 141.81 ? 545 SER A CA  1 
ATOM   4259 C  C   . SER A 1 545 ? -2.632  -13.488 -15.327 1.00 130.56 ? 545 SER A C   1 
ATOM   4260 O  O   . SER A 1 545 ? -1.981  -12.657 -15.953 1.00 141.98 ? 545 SER A O   1 
ATOM   4261 C  CB  . SER A 1 545 ? -4.819  -12.289 -15.357 1.00 109.97 ? 545 SER A CB  1 
ATOM   4262 O  OG  . SER A 1 545 ? -4.422  -11.373 -16.350 1.00 129.32 ? 545 SER A OG  1 
ATOM   4263 N  N   . LEU A 1 546 ? -2.088  -14.275 -14.405 1.00 154.49 ? 546 LEU A N   1 
ATOM   4264 C  CA  . LEU A 1 546 ? -0.647  -14.335 -14.195 1.00 145.19 ? 546 LEU A CA  1 
ATOM   4265 C  C   . LEU A 1 546 ? -0.120  -15.480 -15.032 1.00 139.58 ? 546 LEU A C   1 
ATOM   4266 O  O   . LEU A 1 546 ? 1.029   -15.879 -14.894 1.00 132.62 ? 546 LEU A O   1 
ATOM   4267 C  CB  . LEU A 1 546 ? -0.311  -14.585 -12.722 1.00 101.75 ? 546 LEU A CB  1 
ATOM   4268 C  CG  . LEU A 1 546 ? -0.952  -13.637 -11.709 1.00 108.21 ? 546 LEU A CG  1 
ATOM   4269 C  CD1 . LEU A 1 546 ? -0.434  -13.912 -10.320 1.00 88.36  ? 546 LEU A CD1 1 
ATOM   4270 C  CD2 . LEU A 1 546 ? -0.672  -12.214 -12.100 1.00 125.32 ? 546 LEU A CD2 1 
ATOM   4271 N  N   . ASN A 1 547 ? -0.982  -16.011 -15.895 1.00 191.80 ? 547 ASN A N   1 
ATOM   4272 C  CA  . ASN A 1 547 ? -0.622  -17.112 -16.773 1.00 190.57 ? 547 ASN A CA  1 
ATOM   4273 C  C   . ASN A 1 547 ? 0.174   -16.639 -17.978 1.00 202.30 ? 547 ASN A C   1 
ATOM   4274 O  O   . ASN A 1 547 ? 1.264   -17.140 -18.249 1.00 197.62 ? 547 ASN A O   1 
ATOM   4275 C  CB  . ASN A 1 547 ? -1.874  -17.850 -17.250 1.00 200.54 ? 547 ASN A CB  1 
ATOM   4276 C  CG  . ASN A 1 547 ? -2.038  -19.204 -16.594 1.00 180.93 ? 547 ASN A CG  1 
ATOM   4277 O  OD1 . ASN A 1 547 ? -1.462  -20.196 -17.039 1.00 172.34 ? 547 ASN A OD1 1 
ATOM   4278 N  ND2 . ASN A 1 547 ? -2.833  -19.253 -15.531 1.00 180.57 ? 547 ASN A ND2 1 
ATOM   4279 N  N   . ASP A 1 548 ? -0.372  -15.661 -18.692 1.00 148.42 ? 548 ASP A N   1 
ATOM   4280 C  CA  . ASP A 1 548 ? 0.179   -15.262 -19.988 1.00 163.30 ? 548 ASP A CA  1 
ATOM   4281 C  C   . ASP A 1 548 ? 1.573   -14.616 -19.889 1.00 161.71 ? 548 ASP A C   1 
ATOM   4282 O  O   . ASP A 1 548 ? 1.694   -13.413 -19.674 1.00 166.70 ? 548 ASP A O   1 
ATOM   4283 C  CB  . ASP A 1 548 ? -0.826  -14.389 -20.770 1.00 191.00 ? 548 ASP A CB  1 
ATOM   4284 C  CG  . ASP A 1 548 ? -2.097  -15.165 -21.190 1.00 196.26 ? 548 ASP A CG  1 
ATOM   4285 O  OD1 . ASP A 1 548 ? -1.987  -16.323 -21.650 1.00 184.07 ? 548 ASP A OD1 1 
ATOM   4286 O  OD2 . ASP A 1 548 ? -3.216  -14.622 -21.061 1.00 199.87 ? 548 ASP A OD2 1 
ATOM   4287 N  N   . LYS A 1 549 ? 2.606   -15.450 -20.059 1.00 156.10 ? 549 LYS A N   1 
ATOM   4288 C  CA  . LYS A 1 549 ? 4.032   -15.087 -19.993 1.00 154.23 ? 549 LYS A CA  1 
ATOM   4289 C  C   . LYS A 1 549 ? 4.406   -13.656 -20.414 1.00 171.01 ? 549 LYS A C   1 
ATOM   4290 O  O   . LYS A 1 549 ? 5.416   -13.113 -19.958 1.00 170.04 ? 549 LYS A O   1 
ATOM   4291 C  CB  . LYS A 1 549 ? 4.845   -16.087 -20.823 1.00 170.45 ? 549 LYS A CB  1 
ATOM   4292 C  CG  . LYS A 1 549 ? 6.120   -16.588 -20.169 1.00 155.39 ? 549 LYS A CG  1 
ATOM   4293 C  CD  . LYS A 1 549 ? 6.834   -17.577 -21.075 1.00 161.79 ? 549 LYS A CD  1 
ATOM   4294 C  CE  . LYS A 1 549 ? 5.842   -18.568 -21.684 1.00 150.42 ? 549 LYS A CE  1 
ATOM   4295 N  NZ  . LYS A 1 549 ? 6.412   -19.377 -22.816 1.00 159.90 ? 549 LYS A NZ  1 
ATOM   4296 N  N   . ASN A 1 550 ? 3.617   -13.069 -21.312 1.00 181.89 ? 550 ASN A N   1 
ATOM   4297 C  CA  . ASN A 1 550 ? 3.758   -11.656 -21.666 1.00 201.55 ? 550 ASN A CA  1 
ATOM   4298 C  C   . ASN A 1 550 ? 2.860   -10.810 -20.768 1.00 204.92 ? 550 ASN A C   1 
ATOM   4299 O  O   . ASN A 1 550 ? 1.678   -10.603 -21.061 1.00 218.07 ? 550 ASN A O   1 
ATOM   4300 C  CB  . ASN A 1 550 ? 3.435   -11.410 -23.148 1.00 169.05 ? 550 ASN A CB  1 
ATOM   4301 C  CG  . ASN A 1 550 ? 4.637   -11.642 -24.066 1.00 173.32 ? 550 ASN A CG  1 
ATOM   4302 O  OD1 . ASN A 1 550 ? 5.783   -11.671 -23.611 1.00 169.72 ? 550 ASN A OD1 1 
ATOM   4303 N  ND2 . ASN A 1 550 ? 4.375   -11.793 -25.367 1.00 173.29 ? 550 ASN A ND2 1 
ATOM   4304 N  N   . PHE A 1 551 ? 3.437   -10.327 -19.670 1.00 167.36 ? 551 PHE A N   1 
ATOM   4305 C  CA  . PHE A 1 551 ? 2.668   -9.689  -18.609 1.00 168.49 ? 551 PHE A CA  1 
ATOM   4306 C  C   . PHE A 1 551 ? 3.024   -8.212  -18.457 1.00 187.10 ? 551 PHE A C   1 
ATOM   4307 O  O   . PHE A 1 551 ? 4.200   -7.876  -18.286 1.00 185.23 ? 551 PHE A O   1 
ATOM   4308 C  CB  . PHE A 1 551 ? 2.918   -10.422 -17.287 1.00 157.55 ? 551 PHE A CB  1 
ATOM   4309 C  CG  . PHE A 1 551 ? 1.988   -10.013 -16.179 1.00 156.90 ? 551 PHE A CG  1 
ATOM   4310 C  CD1 . PHE A 1 551 ? 0.796   -10.681 -15.975 1.00 153.53 ? 551 PHE A CD1 1 
ATOM   4311 C  CD2 . PHE A 1 551 ? 2.309   -8.962  -15.338 1.00 161.51 ? 551 PHE A CD2 1 
ATOM   4312 C  CE1 . PHE A 1 551 ? -0.059  -10.304 -14.962 1.00 154.77 ? 551 PHE A CE1 1 
ATOM   4313 C  CE2 . PHE A 1 551 ? 1.455   -8.578  -14.323 1.00 162.97 ? 551 PHE A CE2 1 
ATOM   4314 C  CZ  . PHE A 1 551 ? 0.271   -9.250  -14.137 1.00 159.55 ? 551 PHE A CZ  1 
ATOM   4315 N  N   . LYS A 1 552 ? 2.014   -7.337  -18.518 1.00 165.53 ? 552 LYS A N   1 
ATOM   4316 C  CA  . LYS A 1 552 ? 2.243   -5.901  -18.335 1.00 187.03 ? 552 LYS A CA  1 
ATOM   4317 C  C   . LYS A 1 552 ? 2.899   -5.680  -16.984 1.00 174.76 ? 552 LYS A C   1 
ATOM   4318 O  O   . LYS A 1 552 ? 2.685   -6.446  -16.057 1.00 155.90 ? 552 LYS A O   1 
ATOM   4319 C  CB  . LYS A 1 552 ? 0.942   -5.086  -18.388 1.00 155.23 ? 552 LYS A CB  1 
ATOM   4320 C  CG  . LYS A 1 552 ? -0.302  -5.804  -18.903 1.00 158.34 ? 552 LYS A CG  1 
ATOM   4321 C  CD  . LYS A 1 552 ? -1.524  -4.885  -18.763 1.00 186.48 ? 552 LYS A CD  1 
ATOM   4322 C  CE  . LYS A 1 552 ? -2.773  -5.443  -19.436 1.00 202.77 ? 552 LYS A CE  1 
ATOM   4323 N  NZ  . LYS A 1 552 ? -3.906  -4.477  -19.366 1.00 234.33 ? 552 LYS A NZ  1 
ATOM   4324 N  N   . PHE A 1 553 ? 3.697   -4.634  -16.852 1.00 211.03 ? 553 PHE A N   1 
ATOM   4325 C  CA  . PHE A 1 553 ? 4.285   -4.369  -15.551 1.00 203.11 ? 553 PHE A CA  1 
ATOM   4326 C  C   . PHE A 1 553 ? 4.276   -2.881  -15.192 1.00 229.72 ? 553 PHE A C   1 
ATOM   4327 O  O   . PHE A 1 553 ? 5.244   -2.154  -15.437 1.00 244.00 ? 553 PHE A O   1 
ATOM   4328 C  CB  . PHE A 1 553 ? 5.673   -5.012  -15.428 1.00 201.10 ? 553 PHE A CB  1 
ATOM   4329 C  CG  . PHE A 1 553 ? 5.647   -6.416  -14.852 1.00 164.03 ? 553 PHE A CG  1 
ATOM   4330 C  CD1 . PHE A 1 553 ? 6.071   -7.504  -15.599 1.00 161.41 ? 553 PHE A CD1 1 
ATOM   4331 C  CD2 . PHE A 1 553 ? 5.191   -6.642  -13.555 1.00 150.65 ? 553 PHE A CD2 1 
ATOM   4332 C  CE1 . PHE A 1 553 ? 6.049   -8.790  -15.054 1.00 129.71 ? 553 PHE A CE1 1 
ATOM   4333 C  CE2 . PHE A 1 553 ? 5.167   -7.922  -13.010 1.00 126.86 ? 553 PHE A CE2 1 
ATOM   4334 C  CZ  . PHE A 1 553 ? 5.595   -8.994  -13.758 1.00 116.80 ? 553 PHE A CZ  1 
ATOM   4335 N  N   . ASP A 1 554 ? 3.154   -2.451  -14.613 1.00 176.91 ? 554 ASP A N   1 
ATOM   4336 C  CA  . ASP A 1 554 ? 2.950   -1.071  -14.182 1.00 204.05 ? 554 ASP A CA  1 
ATOM   4337 C  C   . ASP A 1 554 ? 3.697   -0.786  -12.878 1.00 197.85 ? 554 ASP A C   1 
ATOM   4338 O  O   . ASP A 1 554 ? 3.869   0.371   -12.497 1.00 221.27 ? 554 ASP A O   1 
ATOM   4339 C  CB  . ASP A 1 554 ? 1.455   -0.774  -13.997 1.00 193.04 ? 554 ASP A CB  1 
ATOM   4340 C  CG  . ASP A 1 554 ? 0.612   -1.181  -15.205 1.00 200.63 ? 554 ASP A CG  1 
ATOM   4341 O  OD1 . ASP A 1 554 ? -0.623  -1.319  -15.056 1.00 203.70 ? 554 ASP A OD1 1 
ATOM   4342 O  OD2 . ASP A 1 554 ? 1.179   -1.369  -16.303 1.00 204.85 ? 554 ASP A OD2 1 
ATOM   4343 N  N   . THR A 1 555 ? 4.135   -1.846  -12.202 1.00 192.97 ? 555 THR A N   1 
ATOM   4344 C  CA  . THR A 1 555 ? 4.867   -1.734  -10.934 1.00 184.54 ? 555 THR A CA  1 
ATOM   4345 C  C   . THR A 1 555 ? 6.351   -2.120  -11.079 1.00 173.78 ? 555 THR A C   1 
ATOM   4346 O  O   . THR A 1 555 ? 6.682   -3.160  -11.636 1.00 159.71 ? 555 THR A O   1 
ATOM   4347 C  CB  . THR A 1 555 ? 4.170   -2.555  -9.814  1.00 177.83 ? 555 THR A CB  1 
ATOM   4348 O  OG1 . THR A 1 555 ? 3.893   -3.886  -10.275 1.00 154.67 ? 555 THR A OG1 1 
ATOM   4349 C  CG2 . THR A 1 555 ? 2.854   -1.895  -9.418  1.00 189.88 ? 555 THR A CG2 1 
ATOM   4350 N  N   . ASN A 1 556 ? 7.244   -1.275  -10.579 1.00 177.05 ? 556 ASN A N   1 
ATOM   4351 C  CA  . ASN A 1 556 ? 8.664   -1.401  -10.911 1.00 175.22 ? 556 ASN A CA  1 
ATOM   4352 C  C   . ASN A 1 556 ? 9.431   -2.497  -10.164 1.00 147.73 ? 556 ASN A C   1 
ATOM   4353 O  O   . ASN A 1 556 ? 9.005   -2.946  -9.090  1.00 131.54 ? 556 ASN A O   1 
ATOM   4354 C  CB  . ASN A 1 556 ? 9.380   -0.052  -10.750 1.00 180.55 ? 556 ASN A CB  1 
ATOM   4355 C  CG  . ASN A 1 556 ? 9.027   0.937   -11.850 1.00 209.48 ? 556 ASN A CG  1 
ATOM   4356 O  OD1 . ASN A 1 556 ? 8.755   0.549   -12.986 1.00 206.28 ? 556 ASN A OD1 1 
ATOM   4357 N  ND2 . ASN A 1 556 ? 9.036   2.224   -11.516 1.00 227.96 ? 556 ASN A ND2 1 
ATOM   4358 N  N   . LYS A 1 557 ? 10.565  -2.898  -10.756 1.00 181.25 ? 557 LYS A N   1 
ATOM   4359 C  CA  . LYS A 1 557 ? 11.493  -3.900  -10.209 1.00 160.36 ? 557 LYS A CA  1 
ATOM   4360 C  C   . LYS A 1 557 ? 12.534  -3.244  -9.309  1.00 167.49 ? 557 LYS A C   1 
ATOM   4361 O  O   . LYS A 1 557 ? 13.347  -2.450  -9.783  1.00 188.10 ? 557 LYS A O   1 
ATOM   4362 C  CB  . LYS A 1 557 ? 12.205  -4.652  -11.345 1.00 216.56 ? 557 LYS A CB  1 
ATOM   4363 C  CG  . LYS A 1 557 ? 11.302  -5.574  -12.166 1.00 202.45 ? 557 LYS A CG  1 
ATOM   4364 C  CD  . LYS A 1 557 ? 11.608  -5.535  -13.676 1.00 212.25 ? 557 LYS A CD  1 
ATOM   4365 C  CE  . LYS A 1 557 ? 12.867  -6.314  -14.052 1.00 211.65 ? 557 LYS A CE  1 
ATOM   4366 N  NZ  . LYS A 1 557 ? 13.064  -6.389  -15.532 1.00 221.46 ? 557 LYS A NZ  1 
ATOM   4367 N  N   . THR A 1 558 ? 12.514  -3.591  -8.020  1.00 139.28 ? 558 THR A N   1 
ATOM   4368 C  CA  . THR A 1 558 ? 13.317  -2.898  -6.998  1.00 146.11 ? 558 THR A CA  1 
ATOM   4369 C  C   . THR A 1 558 ? 14.477  -3.729  -6.402  1.00 131.97 ? 558 THR A C   1 
ATOM   4370 O  O   . THR A 1 558 ? 15.450  -3.178  -5.869  1.00 142.88 ? 558 THR A O   1 
ATOM   4371 C  CB  . THR A 1 558 ? 12.416  -2.384  -5.845  1.00 137.67 ? 558 THR A CB  1 
ATOM   4372 O  OG1 . THR A 1 558 ? 11.872  -3.498  -5.129  1.00 112.70 ? 558 THR A OG1 1 
ATOM   4373 C  CG2 . THR A 1 558 ? 11.269  -1.549  -6.384  1.00 153.28 ? 558 THR A CG2 1 
ATOM   4374 N  N   . ARG A 1 559 ? 14.363  -5.049  -6.509  1.00 155.54 ? 559 ARG A N   1 
ATOM   4375 C  CA  . ARG A 1 559 ? 15.319  -5.981  -5.920  1.00 141.44 ? 559 ARG A CA  1 
ATOM   4376 C  C   . ARG A 1 559 ? 15.119  -7.358  -6.567  1.00 123.52 ? 559 ARG A C   1 
ATOM   4377 O  O   . ARG A 1 559 ? 14.045  -7.635  -7.103  1.00 116.22 ? 559 ARG A O   1 
ATOM   4378 C  CB  . ARG A 1 559 ? 15.080  -6.063  -4.411  1.00 140.27 ? 559 ARG A CB  1 
ATOM   4379 C  CG  . ARG A 1 559 ? 13.586  -6.106  -4.025  1.00 129.84 ? 559 ARG A CG  1 
ATOM   4380 C  CD  . ARG A 1 559 ? 13.355  -6.159  -2.520  1.00 123.80 ? 559 ARG A CD  1 
ATOM   4381 N  NE  . ARG A 1 559 ? 13.837  -4.966  -1.824  1.00 141.26 ? 559 ARG A NE  1 
ATOM   4382 C  CZ  . ARG A 1 559 ? 13.207  -3.793  -1.814  1.00 156.16 ? 559 ARG A CZ  1 
ATOM   4383 N  NH1 . ARG A 1 559 ? 12.070  -3.643  -2.476  1.00 158.87 ? 559 ARG A NH1 1 
ATOM   4384 N  NH2 . ARG A 1 559 ? 13.720  -2.764  -1.151  1.00 168.14 ? 559 ARG A NH2 1 
ATOM   4385 N  N   . ASP A 1 560 ? 16.134  -8.219  -6.529  1.00 147.05 ? 560 ASP A N   1 
ATOM   4386 C  CA  . ASP A 1 560 ? 16.006  -9.552  -7.128  1.00 132.38 ? 560 ASP A CA  1 
ATOM   4387 C  C   . ASP A 1 560 ? 15.265  -10.545 -6.217  1.00 112.06 ? 560 ASP A C   1 
ATOM   4388 O  O   . ASP A 1 560 ? 15.437  -10.533 -5.000  1.00 108.41 ? 560 ASP A O   1 
ATOM   4389 C  CB  . ASP A 1 560 ? 17.373  -10.093 -7.554  1.00 148.07 ? 560 ASP A CB  1 
ATOM   4390 C  CG  . ASP A 1 560 ? 17.740  -9.692  -8.977  1.00 165.36 ? 560 ASP A CG  1 
ATOM   4391 O  OD1 . ASP A 1 560 ? 16.820  -9.384  -9.770  1.00 168.86 ? 560 ASP A OD1 1 
ATOM   4392 O  OD2 . ASP A 1 560 ? 18.945  -9.691  -9.309  1.00 177.16 ? 560 ASP A OD2 1 
ATOM   4393 N  N   . VAL A 1 561 ? 14.432  -11.399 -6.807  1.00 144.91 ? 561 VAL A N   1 
ATOM   4394 C  CA  . VAL A 1 561 ? 13.600  -12.325 -6.042  1.00 126.15 ? 561 VAL A CA  1 
ATOM   4395 C  C   . VAL A 1 561 ? 14.075  -13.754 -6.228  1.00 116.94 ? 561 VAL A C   1 
ATOM   4396 O  O   . VAL A 1 561 ? 14.413  -14.141 -7.333  1.00 121.60 ? 561 VAL A O   1 
ATOM   4397 C  CB  . VAL A 1 561 ? 12.142  -12.266 -6.528  1.00 99.93  ? 561 VAL A CB  1 
ATOM   4398 C  CG1 . VAL A 1 561 ? 11.279  -13.223 -5.743  1.00 82.02  ? 561 VAL A CG1 1 
ATOM   4399 C  CG2 . VAL A 1 561 ? 11.604  -10.858 -6.431  1.00 107.04 ? 561 VAL A CG2 1 
ATOM   4400 N  N   . TYR A 1 562 ? 14.087  -14.550 -5.166  1.00 139.50 ? 562 TYR A N   1 
ATOM   4401 C  CA  . TYR A 1 562 ? 14.454  -15.959 -5.302  1.00 129.85 ? 562 TYR A CA  1 
ATOM   4402 C  C   . TYR A 1 562 ? 13.290  -16.900 -4.982  1.00 116.39 ? 562 TYR A C   1 
ATOM   4403 O  O   . TYR A 1 562 ? 12.181  -16.466 -4.692  1.00 112.36 ? 562 TYR A O   1 
ATOM   4404 C  CB  . TYR A 1 562 ? 15.647  -16.302 -4.410  1.00 98.70  ? 562 TYR A CB  1 
ATOM   4405 C  CG  . TYR A 1 562 ? 16.910  -15.512 -4.686  1.00 111.93 ? 562 TYR A CG  1 
ATOM   4406 C  CD1 . TYR A 1 562 ? 16.868  -14.135 -4.868  1.00 122.35 ? 562 TYR A CD1 1 
ATOM   4407 C  CD2 . TYR A 1 562 ? 18.155  -16.138 -4.737  1.00 114.75 ? 562 TYR A CD2 1 
ATOM   4408 C  CE1 . TYR A 1 562 ? 18.029  -13.404 -5.113  1.00 136.01 ? 562 TYR A CE1 1 
ATOM   4409 C  CE2 . TYR A 1 562 ? 19.317  -15.410 -4.981  1.00 127.99 ? 562 TYR A CE2 1 
ATOM   4410 C  CZ  . TYR A 1 562 ? 19.241  -14.044 -5.167  1.00 138.75 ? 562 TYR A CZ  1 
ATOM   4411 O  OH  . TYR A 1 562 ? 20.370  -13.303 -5.404  1.00 154.10 ? 562 TYR A OH  1 
ATOM   4412 N  N   . ILE A 1 563 ? 13.551  -18.198 -5.052  1.00 115.19 ? 563 ILE A N   1 
ATOM   4413 C  CA  . ILE A 1 563 ? 12.603  -19.209 -4.613  1.00 102.76 ? 563 ILE A CA  1 
ATOM   4414 C  C   . ILE A 1 563 ? 13.374  -20.426 -4.150  1.00 96.97  ? 563 ILE A C   1 
ATOM   4415 O  O   . ILE A 1 563 ? 14.123  -21.030 -4.934  1.00 100.90 ? 563 ILE A O   1 
ATOM   4416 C  CB  . ILE A 1 563 ? 11.679  -19.666 -5.728  1.00 72.84  ? 563 ILE A CB  1 
ATOM   4417 C  CG1 . ILE A 1 563 ? 10.848  -18.512 -6.256  1.00 88.48  ? 563 ILE A CG1 1 
ATOM   4418 C  CG2 . ILE A 1 563 ? 10.730  -20.716 -5.215  1.00 71.20  ? 563 ILE A CG2 1 
ATOM   4419 C  CD1 . ILE A 1 563 ? 9.900   -18.944 -7.336  1.00 76.54  ? 563 ILE A CD1 1 
ATOM   4420 N  N   . TYR A 1 564 ? 13.186  -20.767 -2.878  1.00 104.72 ? 564 TYR A N   1 
ATOM   4421 C  CA  . TYR A 1 564 ? 13.860  -21.882 -2.229  1.00 101.86 ? 564 TYR A CA  1 
ATOM   4422 C  C   . TYR A 1 564 ? 12.952  -23.098 -2.248  1.00 99.74  ? 564 TYR A C   1 
ATOM   4423 O  O   . TYR A 1 564 ? 11.818  -23.033 -1.767  1.00 94.74  ? 564 TYR A O   1 
ATOM   4424 C  CB  . TYR A 1 564 ? 14.181  -21.489 -0.792  1.00 110.25 ? 564 TYR A CB  1 
ATOM   4425 C  CG  . TYR A 1 564 ? 14.811  -22.561 0.078   1.00 110.92 ? 564 TYR A CG  1 
ATOM   4426 C  CD1 . TYR A 1 564 ? 16.146  -22.934 -0.071  1.00 117.08 ? 564 TYR A CD1 1 
ATOM   4427 C  CD2 . TYR A 1 564 ? 14.086  -23.156 1.094   1.00 106.27 ? 564 TYR A CD2 1 
ATOM   4428 C  CE1 . TYR A 1 564 ? 16.723  -23.899 0.755   1.00 118.70 ? 564 TYR A CE1 1 
ATOM   4429 C  CE2 . TYR A 1 564 ? 14.653  -24.113 1.920   1.00 108.00 ? 564 TYR A CE2 1 
ATOM   4430 C  CZ  . TYR A 1 564 ? 15.963  -24.481 1.748   1.00 114.30 ? 564 TYR A CZ  1 
ATOM   4431 O  OH  . TYR A 1 564 ? 16.484  -25.438 2.584   1.00 116.87 ? 564 TYR A OH  1 
ATOM   4432 N  N   . MET A 1 565 ? 13.439  -24.198 -2.818  1.00 107.85 ? 565 MET A N   1 
ATOM   4433 C  CA  . MET A 1 565 ? 12.628  -25.409 -2.949  1.00 107.22 ? 565 MET A CA  1 
ATOM   4434 C  C   . MET A 1 565 ? 13.403  -26.657 -2.566  1.00 111.50 ? 565 MET A C   1 
ATOM   4435 O  O   . MET A 1 565 ? 14.018  -27.289 -3.418  1.00 117.88 ? 565 MET A O   1 
ATOM   4436 C  CB  . MET A 1 565 ? 12.087  -25.534 -4.371  1.00 95.46  ? 565 MET A CB  1 
ATOM   4437 C  CG  . MET A 1 565 ? 11.151  -24.404 -4.738  1.00 93.44  ? 565 MET A CG  1 
ATOM   4438 S  SD  . MET A 1 565 ? 10.771  -24.333 -6.488  1.00 102.70 ? 565 MET A SD  1 
ATOM   4439 C  CE  . MET A 1 565 ? 12.192  -25.201 -7.108  1.00 111.47 ? 565 MET A CE  1 
ATOM   4440 N  N   . PRO A 1 566 ? 13.363  -27.010 -1.277  1.00 99.88  ? 566 PRO A N   1 
ATOM   4441 C  CA  . PRO A 1 566 ? 14.103  -28.041 -0.544  1.00 104.24 ? 566 PRO A CA  1 
ATOM   4442 C  C   . PRO A 1 566 ? 13.323  -29.324 -0.461  1.00 104.16 ? 566 PRO A C   1 
ATOM   4443 O  O   . PRO A 1 566 ? 12.102  -29.267 -0.516  1.00 98.96  ? 566 PRO A O   1 
ATOM   4444 C  CB  . PRO A 1 566 ? 14.149  -27.460 0.841   1.00 77.95  ? 566 PRO A CB  1 
ATOM   4445 C  CG  . PRO A 1 566 ? 12.804  -26.795 0.952   1.00 71.27  ? 566 PRO A CG  1 
ATOM   4446 C  CD  . PRO A 1 566 ? 12.496  -26.234 -0.385  1.00 71.95  ? 566 PRO A CD  1 
ATOM   4447 N  N   . TYR A 1 567 ? 13.990  -30.458 -0.304  1.00 98.25  ? 567 TYR A N   1 
ATOM   4448 C  CA  . TYR A 1 567 ? 13.267  -31.709 -0.375  1.00 100.41 ? 567 TYR A CA  1 
ATOM   4449 C  C   . TYR A 1 567 ? 12.312  -31.737 0.771   1.00 93.58  ? 567 TYR A C   1 
ATOM   4450 O  O   . TYR A 1 567 ? 11.182  -32.161 0.630   1.00 91.98  ? 567 TYR A O   1 
ATOM   4451 C  CB  . TYR A 1 567 ? 14.210  -32.893 -0.309  1.00 80.82  ? 567 TYR A CB  1 
ATOM   4452 C  CG  . TYR A 1 567 ? 13.563  -34.249 -0.076  1.00 95.35  ? 567 TYR A CG  1 
ATOM   4453 C  CD1 . TYR A 1 567 ? 13.330  -35.127 -1.118  1.00 101.35 ? 567 TYR A CD1 1 
ATOM   4454 C  CD2 . TYR A 1 567 ? 13.230  -34.670 1.194   1.00 93.61  ? 567 TYR A CD2 1 
ATOM   4455 C  CE1 . TYR A 1 567 ? 12.770  -36.369 -0.897  1.00 106.88 ? 567 TYR A CE1 1 
ATOM   4456 C  CE2 . TYR A 1 567 ? 12.669  -35.917 1.420   1.00 96.33  ? 567 TYR A CE2 1 
ATOM   4457 C  CZ  . TYR A 1 567 ? 12.446  -36.756 0.373   1.00 106.09 ? 567 TYR A CZ  1 
ATOM   4458 O  OH  . TYR A 1 567 ? 11.889  -37.986 0.612   1.00 110.03 ? 567 TYR A OH  1 
ATOM   4459 N  N   . ARG A 1 568 ? 12.756  -31.245 1.911   1.00 125.75 ? 568 ARG A N   1 
ATOM   4460 C  CA  . ARG A 1 568 ? 11.945  -31.318 3.115   1.00 119.46 ? 568 ARG A CA  1 
ATOM   4461 C  C   . ARG A 1 568 ? 10.492  -30.868 2.940   1.00 113.44 ? 568 ARG A C   1 
ATOM   4462 O  O   . ARG A 1 568 ? 9.599   -31.442 3.548   1.00 111.42 ? 568 ARG A O   1 
ATOM   4463 C  CB  . ARG A 1 568 ? 12.596  -30.527 4.236   1.00 126.34 ? 568 ARG A CB  1 
ATOM   4464 C  CG  . ARG A 1 568 ? 11.742  -30.388 5.462   1.00 118.64 ? 568 ARG A CG  1 
ATOM   4465 C  CD  . ARG A 1 568 ? 12.381  -29.360 6.314   1.00 114.15 ? 568 ARG A CD  1 
ATOM   4466 N  NE  . ARG A 1 568 ? 13.805  -29.589 6.252   1.00 119.14 ? 568 ARG A NE  1 
ATOM   4467 C  CZ  . ARG A 1 568 ? 14.479  -30.183 7.219   1.00 116.75 ? 568 ARG A CZ  1 
ATOM   4468 N  NH1 . ARG A 1 568 ? 13.835  -30.556 8.317   1.00 107.37 ? 568 ARG A NH1 1 
ATOM   4469 N  NH2 . ARG A 1 568 ? 15.786  -30.382 7.099   1.00 121.68 ? 568 ARG A NH2 1 
ATOM   4470 N  N   . MET A 1 569 ? 10.242  -29.853 2.121   1.00 107.77 ? 569 MET A N   1 
ATOM   4471 C  CA  . MET A 1 569 ? 8.884   -29.345 1.973   1.00 102.19 ? 569 MET A CA  1 
ATOM   4472 C  C   . MET A 1 569 ? 7.937   -30.314 1.287   1.00 104.57 ? 569 MET A C   1 
ATOM   4473 O  O   . MET A 1 569 ? 6.806   -29.945 0.999   1.00 102.14 ? 569 MET A O   1 
ATOM   4474 C  CB  . MET A 1 569 ? 8.870   -28.034 1.190   1.00 112.08 ? 569 MET A CB  1 
ATOM   4475 C  CG  . MET A 1 569 ? 7.510   -27.346 1.191   1.00 108.13 ? 569 MET A CG  1 
ATOM   4476 S  SD  . MET A 1 569 ? 7.365   -25.929 0.092   1.00 109.37 ? 569 MET A SD  1 
ATOM   4477 C  CE  . MET A 1 569 ? 6.425   -26.602 -1.267  1.00 112.14 ? 569 MET A CE  1 
ATOM   4478 N  N   . LEU A 1 570 ? 8.372   -31.540 0.996   1.00 94.55  ? 570 LEU A N   1 
ATOM   4479 C  CA  . LEU A 1 570 ? 7.483   -32.458 0.272   1.00 98.60  ? 570 LEU A CA  1 
ATOM   4480 C  C   . LEU A 1 570 ? 6.331   -32.931 1.133   1.00 96.29  ? 570 LEU A C   1 
ATOM   4481 O  O   . LEU A 1 570 ? 5.209   -32.897 0.678   1.00 96.25  ? 570 LEU A O   1 
ATOM   4482 C  CB  . LEU A 1 570 ? 8.225   -33.646 -0.371  1.00 96.95  ? 570 LEU A CB  1 
ATOM   4483 C  CG  . LEU A 1 570 ? 8.419   -33.713 -1.904  1.00 113.60 ? 570 LEU A CG  1 
ATOM   4484 C  CD1 . LEU A 1 570 ? 8.968   -35.076 -2.320  1.00 124.15 ? 570 LEU A CD1 1 
ATOM   4485 C  CD2 . LEU A 1 570 ? 7.149   -33.404 -2.686  1.00 112.34 ? 570 LEU A CD2 1 
ATOM   4486 N  N   . ARG A 1 571 ? 6.591   -33.346 2.372   1.00 123.35 ? 571 ARG A N   1 
ATOM   4487 C  CA  . ARG A 1 571 ? 5.525   -33.913 3.210   1.00 122.04 ? 571 ARG A CA  1 
ATOM   4488 C  C   . ARG A 1 571 ? 4.352   -32.949 3.406   1.00 115.43 ? 571 ARG A C   1 
ATOM   4489 O  O   . ARG A 1 571 ? 3.217   -33.366 3.652   1.00 115.91 ? 571 ARG A O   1 
ATOM   4490 C  CB  . ARG A 1 571 ? 6.078   -34.406 4.552   1.00 186.11 ? 571 ARG A CB  1 
ATOM   4491 C  CG  . ARG A 1 571 ? 6.630   -33.326 5.426   1.00 182.40 ? 571 ARG A CG  1 
ATOM   4492 C  CD  . ARG A 1 571 ? 7.162   -33.882 6.725   1.00 196.35 ? 571 ARG A CD  1 
ATOM   4493 N  NE  . ARG A 1 571 ? 7.598   -32.784 7.577   1.00 193.68 ? 571 ARG A NE  1 
ATOM   4494 C  CZ  . ARG A 1 571 ? 8.339   -32.918 8.670   1.00 186.31 ? 571 ARG A CZ  1 
ATOM   4495 N  NH1 . ARG A 1 571 ? 8.739   -34.120 9.056   1.00 181.79 ? 571 ARG A NH1 1 
ATOM   4496 N  NH2 . ARG A 1 571 ? 8.684   -31.846 9.377   1.00 183.82 ? 571 ARG A NH2 1 
ATOM   4497 N  N   . ILE A 1 572 ? 4.661   -31.667 3.224   1.00 87.95  ? 572 ILE A N   1 
ATOM   4498 C  CA  . ILE A 1 572 ? 3.777   -30.514 3.421   1.00 81.95  ? 572 ILE A CA  1 
ATOM   4499 C  C   . ILE A 1 572 ? 3.097   -29.977 2.132   1.00 82.68  ? 572 ILE A C   1 
ATOM   4500 O  O   . ILE A 1 572 ? 2.185   -29.162 2.197   1.00 79.49  ? 572 ILE A O   1 
ATOM   4501 C  CB  . ILE A 1 572 ? 4.617   -29.372 4.030   1.00 94.19  ? 572 ILE A CB  1 
ATOM   4502 C  CG1 . ILE A 1 572 ? 5.269   -29.830 5.306   1.00 94.14  ? 572 ILE A CG1 1 
ATOM   4503 C  CG2 . ILE A 1 572 ? 3.819   -28.141 4.309   1.00 90.22  ? 572 ILE A CG2 1 
ATOM   4504 C  CD1 . ILE A 1 572 ? 6.027   -28.704 5.955   1.00 90.92  ? 572 ILE A CD1 1 
ATOM   4505 N  N   . MET A 1 573 ? 3.535   -30.421 0.963   1.00 121.94 ? 573 MET A N   1 
ATOM   4506 C  CA  . MET A 1 573 ? 2.938   -29.946 -0.281  1.00 123.47 ? 573 MET A CA  1 
ATOM   4507 C  C   . MET A 1 573 ? 1.392   -29.860 -0.277  1.00 123.14 ? 573 MET A C   1 
ATOM   4508 O  O   . MET A 1 573 ? 0.843   -28.868 -0.756  1.00 121.13 ? 573 MET A O   1 
ATOM   4509 C  CB  . MET A 1 573 ? 3.489   -30.740 -1.478  1.00 140.07 ? 573 MET A CB  1 
ATOM   4510 C  CG  . MET A 1 573 ? 4.604   -30.044 -2.228  1.00 140.62 ? 573 MET A CG  1 
ATOM   4511 S  SD  . MET A 1 573 ? 3.990   -28.632 -3.142  1.00 149.79 ? 573 MET A SD  1 
ATOM   4512 C  CE  . MET A 1 573 ? 2.695   -29.442 -4.052  1.00 156.42 ? 573 MET A CE  1 
ATOM   4513 N  N   . PRO A 1 574 ? 0.688   -30.867 0.282   1.00 131.84 ? 574 PRO A N   1 
ATOM   4514 C  CA  . PRO A 1 574 ? -0.770  -30.754 0.358   1.00 132.52 ? 574 PRO A CA  1 
ATOM   4515 C  C   . PRO A 1 574 ? -1.190  -29.515 1.156   1.00 125.62 ? 574 PRO A C   1 
ATOM   4516 O  O   . PRO A 1 574 ? -1.890  -28.595 0.670   1.00 124.13 ? 574 PRO A O   1 
ATOM   4517 C  CB  . PRO A 1 574 ? -1.162  -32.002 1.150   1.00 112.90 ? 574 PRO A CB  1 
ATOM   4518 C  CG  . PRO A 1 574 ? -0.037  -32.929 0.990   1.00 126.03 ? 574 PRO A CG  1 
ATOM   4519 C  CD  . PRO A 1 574 ? 1.154   -32.061 0.996   1.00 122.94 ? 574 PRO A CD  1 
ATOM   4520 N  N   . VAL A 1 575 ? -0.744  -29.505 2.409   1.00 103.06 ? 575 VAL A N   1 
ATOM   4521 C  CA  . VAL A 1 575 ? -1.010  -28.429 3.359   1.00 97.34  ? 575 VAL A CA  1 
ATOM   4522 C  C   . VAL A 1 575 ? -0.626  -27.047 2.835   1.00 94.45  ? 575 VAL A C   1 
ATOM   4523 O  O   . VAL A 1 575 ? -1.344  -26.076 3.047   1.00 92.53  ? 575 VAL A O   1 
ATOM   4524 C  CB  . VAL A 1 575 ? -0.293  -28.693 4.666   1.00 66.38  ? 575 VAL A CB  1 
ATOM   4525 C  CG1 . VAL A 1 575 ? -0.817  -27.801 5.744   1.00 72.66  ? 575 VAL A CG1 1 
ATOM   4526 C  CG2 . VAL A 1 575 ? -0.479  -30.141 5.079   1.00 70.68  ? 575 VAL A CG2 1 
ATOM   4527 N  N   . VAL A 1 576 ? 0.506   -26.951 2.157   1.00 82.47  ? 576 VAL A N   1 
ATOM   4528 C  CA  . VAL A 1 576 ? 0.913   -25.698 1.552   1.00 81.20  ? 576 VAL A CA  1 
ATOM   4529 C  C   . VAL A 1 576 ? 0.003   -25.279 0.401   1.00 83.93  ? 576 VAL A C   1 
ATOM   4530 O  O   . VAL A 1 576 ? -0.357  -24.120 0.256   1.00 82.62  ? 576 VAL A O   1 
ATOM   4531 C  CB  . VAL A 1 576 ? 2.346   -25.821 1.051   1.00 74.58  ? 576 VAL A CB  1 
ATOM   4532 C  CG1 . VAL A 1 576 ? 2.651   -24.692 0.079   1.00 74.96  ? 576 VAL A CG1 1 
ATOM   4533 C  CG2 . VAL A 1 576 ? 3.289   -25.806 2.214   1.00 73.01  ? 576 VAL A CG2 1 
ATOM   4534 N  N   . ALA A 1 577 ? -0.354  -26.244 -0.430  1.00 112.44 ? 577 ALA A N   1 
ATOM   4535 C  CA  . ALA A 1 577 ? -1.185  -25.947 -1.586  1.00 116.71 ? 577 ALA A CA  1 
ATOM   4536 C  C   . ALA A 1 577 ? -2.578  -25.498 -1.194  1.00 116.67 ? 577 ALA A C   1 
ATOM   4537 O  O   . ALA A 1 577 ? -3.182  -24.681 -1.886  1.00 118.20 ? 577 ALA A O   1 
ATOM   4538 C  CB  . ALA A 1 577 ? -1.257  -27.135 -2.488  1.00 164.91 ? 577 ALA A CB  1 
ATOM   4539 N  N   . GLN A 1 578 ? -3.097  -26.067 -0.101  1.00 131.54 ? 578 GLN A N   1 
ATOM   4540 C  CA  . GLN A 1 578 ? -4.468  -25.735 0.318   1.00 133.09 ? 578 GLN A CA  1 
ATOM   4541 C  C   . GLN A 1 578 ? -4.726  -24.237 0.279   1.00 131.43 ? 578 GLN A C   1 
ATOM   4542 O  O   . GLN A 1 578 ? -5.778  -23.806 -0.165  1.00 135.12 ? 578 GLN A O   1 
ATOM   4543 C  CB  . GLN A 1 578 ? -4.758  -26.269 1.714   1.00 149.23 ? 578 GLN A CB  1 
ATOM   4544 C  CG  . GLN A 1 578 ? -5.115  -27.728 1.773   1.00 161.02 ? 578 GLN A CG  1 
ATOM   4545 C  CD  . GLN A 1 578 ? -5.237  -28.206 3.197   1.00 158.55 ? 578 GLN A CD  1 
ATOM   4546 O  OE1 . GLN A 1 578 ? -5.075  -27.426 4.129   1.00 153.24 ? 578 GLN A OE1 1 
ATOM   4547 N  NE2 . GLN A 1 578 ? -5.517  -29.491 3.378   1.00 163.07 ? 578 GLN A NE2 1 
ATOM   4548 N  N   . PHE A 1 579 ? -3.751  -23.449 0.723   1.00 109.73 ? 579 PHE A N   1 
ATOM   4549 C  CA  . PHE A 1 579 ? -3.928  -22.007 0.899   1.00 109.19 ? 579 PHE A CA  1 
ATOM   4550 C  C   . PHE A 1 579 ? -4.226  -21.244 -0.380  1.00 113.68 ? 579 PHE A C   1 
ATOM   4551 O  O   . PHE A 1 579 ? -5.057  -20.345 -0.366  1.00 116.10 ? 579 PHE A O   1 
ATOM   4552 C  CB  . PHE A 1 579 ? -2.707  -21.388 1.573   1.00 88.96  ? 579 PHE A CB  1 
ATOM   4553 C  CG  . PHE A 1 579 ? -2.612  -21.685 3.023   1.00 85.36  ? 579 PHE A CG  1 
ATOM   4554 C  CD1 . PHE A 1 579 ? -2.063  -22.860 3.455   1.00 83.63  ? 579 PHE A CD1 1 
ATOM   4555 C  CD2 . PHE A 1 579 ? -3.074  -20.788 3.957   1.00 84.39  ? 579 PHE A CD2 1 
ATOM   4556 C  CE1 . PHE A 1 579 ? -1.990  -23.144 4.793   1.00 81.15  ? 579 PHE A CE1 1 
ATOM   4557 C  CE2 . PHE A 1 579 ? -2.997  -21.071 5.304   1.00 79.37  ? 579 PHE A CE2 1 
ATOM   4558 C  CZ  . PHE A 1 579 ? -2.460  -22.249 5.719   1.00 80.03  ? 579 PHE A CZ  1 
ATOM   4559 N  N   . ALA A 1 580 ? -3.528  -21.571 -1.466  1.00 86.54  ? 580 ALA A N   1 
ATOM   4560 C  CA  . ALA A 1 580 ? -3.809  -20.961 -2.758  1.00 92.13  ? 580 ALA A CA  1 
ATOM   4561 C  C   . ALA A 1 580 ? -5.012  -21.667 -3.365  1.00 97.75  ? 580 ALA A C   1 
ATOM   4562 O  O   . ALA A 1 580 ? -5.767  -21.102 -4.161  1.00 105.63 ? 580 ALA A O   1 
ATOM   4563 C  CB  . ALA A 1 580 ? -2.617  -21.073 -3.670  1.00 87.56  ? 580 ALA A CB  1 
ATOM   4564 N  N   . ASN A 1 581 ? -5.203  -22.920 -2.990  1.00 151.21 ? 581 ASN A N   1 
ATOM   4565 C  CA  . ASN A 1 581 ? -6.414  -23.616 -3.398  1.00 158.29 ? 581 ASN A CA  1 
ATOM   4566 C  C   . ASN A 1 581 ? -7.668  -22.891 -2.925  1.00 160.11 ? 581 ASN A C   1 
ATOM   4567 O  O   . ASN A 1 581 ? -8.742  -23.052 -3.485  1.00 167.26 ? 581 ASN A O   1 
ATOM   4568 C  CB  . ASN A 1 581 ? -6.420  -25.046 -2.871  1.00 123.14 ? 581 ASN A CB  1 
ATOM   4569 C  CG  . ASN A 1 581 ? -6.997  -26.014 -3.856  1.00 131.65 ? 581 ASN A CG  1 
ATOM   4570 O  OD1 . ASN A 1 581 ? -6.996  -25.761 -5.052  1.00 134.62 ? 581 ASN A OD1 1 
ATOM   4571 N  ND2 . ASN A 1 581 ? -7.491  -27.139 -3.361  1.00 137.39 ? 581 ASN A ND2 1 
ATOM   4572 N  N   . THR A 1 582 ? -7.522  -22.097 -1.878  1.00 120.76 ? 582 THR A N   1 
ATOM   4573 C  CA  . THR A 1 582 ? -8.650  -21.400 -1.290  1.00 123.14 ? 582 THR A CA  1 
ATOM   4574 C  C   . THR A 1 582 ? -8.860  -20.049 -1.933  1.00 127.93 ? 582 THR A C   1 
ATOM   4575 O  O   . THR A 1 582 ? -8.157  -19.082 -1.607  1.00 124.93 ? 582 THR A O   1 
ATOM   4576 C  CB  . THR A 1 582 ? -8.420  -21.172 0.179   1.00 121.51 ? 582 THR A CB  1 
ATOM   4577 O  OG1 . THR A 1 582 ? -8.762  -22.364 0.887   1.00 120.32 ? 582 THR A OG1 1 
ATOM   4578 C  CG2 . THR A 1 582 ? -9.283  -20.047 0.668   1.00 121.57 ? 582 THR A CG2 1 
ATOM   4579 N  N   . ASN A 1 583 ? -9.841  -19.979 -2.831  1.00 113.37 ? 583 ASN A N   1 
ATOM   4580 C  CA  . ASN A 1 583 ? -10.043 -18.793 -3.670  1.00 121.60 ? 583 ASN A CA  1 
ATOM   4581 C  C   . ASN A 1 583 ? -10.352 -17.505 -2.901  1.00 124.43 ? 583 ASN A C   1 
ATOM   4582 O  O   . ASN A 1 583 ? -11.435 -17.356 -2.329  1.00 126.78 ? 583 ASN A O   1 
ATOM   4583 C  CB  . ASN A 1 583 ? -11.104 -19.066 -4.737  1.00 171.59 ? 583 ASN A CB  1 
ATOM   4584 C  CG  . ASN A 1 583 ? -11.952 -17.851 -5.041  1.00 179.36 ? 583 ASN A CG  1 
ATOM   4585 O  OD1 . ASN A 1 583 ? -13.124 -17.785 -4.656  1.00 183.14 ? 583 ASN A OD1 1 
ATOM   4586 N  ND2 . ASN A 1 583 ? -11.366 -16.878 -5.728  1.00 184.07 ? 583 ASN A ND2 1 
ATOM   4587 N  N   . PRO A 1 584 ? -9.391  -16.567 -2.893  1.00 151.78 ? 584 PRO A N   1 
ATOM   4588 C  CA  . PRO A 1 584 ? -9.477  -15.339 -2.103  1.00 149.55 ? 584 PRO A CA  1 
ATOM   4589 C  C   . PRO A 1 584 ? -10.812 -14.624 -2.241  1.00 153.83 ? 584 PRO A C   1 
ATOM   4590 O  O   . PRO A 1 584 ? -11.156 -13.816 -1.388  1.00 149.06 ? 584 PRO A O   1 
ATOM   4591 C  CB  . PRO A 1 584 ? -8.351  -14.474 -2.679  1.00 154.56 ? 584 PRO A CB  1 
ATOM   4592 C  CG  . PRO A 1 584 ? -7.919  -15.154 -3.933  1.00 158.23 ? 584 PRO A CG  1 
ATOM   4593 C  CD  . PRO A 1 584 ? -8.170  -16.592 -3.708  1.00 150.50 ? 584 PRO A CD  1 
ATOM   4594 N  N   . ASP A 1 585 ? -11.554 -14.924 -3.297  1.00 137.05 ? 585 ASP A N   1 
ATOM   4595 C  CA  . ASP A 1 585 ? -12.824 -14.252 -3.547  1.00 144.32 ? 585 ASP A CA  1 
ATOM   4596 C  C   . ASP A 1 585 ? -13.949 -14.790 -2.680  1.00 141.98 ? 585 ASP A C   1 
ATOM   4597 O  O   . ASP A 1 585 ? -14.882 -14.062 -2.353  1.00 143.39 ? 585 ASP A O   1 
ATOM   4598 C  CB  . ASP A 1 585 ? -13.225 -14.398 -5.018  1.00 144.04 ? 585 ASP A CB  1 
ATOM   4599 C  CG  . ASP A 1 585 ? -12.941 -13.156 -5.834  1.00 149.48 ? 585 ASP A CG  1 
ATOM   4600 O  OD1 . ASP A 1 585 ? -13.089 -12.038 -5.292  1.00 146.40 ? 585 ASP A OD1 1 
ATOM   4601 O  OD2 . ASP A 1 585 ? -12.579 -13.303 -7.022  1.00 153.81 ? 585 ASP A OD2 1 
ATOM   4602 N  N   . ASN A 1 586 ? -13.867 -16.067 -2.317  1.00 156.37 ? 586 ASN A N   1 
ATOM   4603 C  CA  . ASN A 1 586 ? -15.017 -16.723 -1.714  1.00 162.88 ? 586 ASN A CA  1 
ATOM   4604 C  C   . ASN A 1 586 ? -14.789 -17.882 -0.748  1.00 156.09 ? 586 ASN A C   1 
ATOM   4605 O  O   . ASN A 1 586 ? -15.677 -18.708 -0.581  1.00 158.58 ? 586 ASN A O   1 
ATOM   4606 C  CB  . ASN A 1 586 ? -15.963 -17.180 -2.808  1.00 180.06 ? 586 ASN A CB  1 
ATOM   4607 C  CG  . ASN A 1 586 ? -17.370 -16.755 -2.536  1.00 191.46 ? 586 ASN A CG  1 
ATOM   4608 O  OD1 . ASN A 1 586 ? -17.632 -16.045 -1.561  1.00 193.73 ? 586 ASN A OD1 1 
ATOM   4609 N  ND2 . ASN A 1 586 ? -18.293 -17.174 -3.394  1.00 198.65 ? 586 ASN A ND2 1 
ATOM   4610 N  N   . GLY A 1 587 ? -13.625 -17.938 -0.107  1.00 135.35 ? 587 GLY A N   1 
ATOM   4611 C  CA  . GLY A 1 587 ? -13.322 -18.990 0.856   1.00 129.15 ? 587 GLY A CA  1 
ATOM   4612 C  C   . GLY A 1 587 ? -13.200 -20.407 0.298   1.00 127.45 ? 587 GLY A C   1 
ATOM   4613 O  O   . GLY A 1 587 ? -12.442 -21.232 0.831   1.00 124.70 ? 587 GLY A O   1 
ATOM   4614 N  N   . GLU A 1 588 ? -13.942 -20.685 -0.777  1.00 170.62 ? 588 GLU A N   1 
ATOM   4615 C  CA  . GLU A 1 588 ? -14.080 -22.038 -1.318  1.00 171.44 ? 588 GLU A CA  1 
ATOM   4616 C  C   . GLU A 1 588 ? -12.756 -22.630 -1.776  1.00 163.98 ? 588 GLU A C   1 
ATOM   4617 O  O   . GLU A 1 588 ? -11.867 -21.909 -2.221  1.00 160.30 ? 588 GLU A O   1 
ATOM   4618 C  CB  . GLU A 1 588 ? -15.104 -22.061 -2.458  1.00 176.22 ? 588 GLU A CB  1 
ATOM   4619 C  CG  . GLU A 1 588 ? -16.511 -21.598 -2.059  1.00 184.25 ? 588 GLU A CG  1 
ATOM   4620 C  CD  . GLU A 1 588 ? -17.194 -22.511 -1.028  1.00 190.03 ? 588 GLU A CD  1 
ATOM   4621 O  OE1 . GLU A 1 588 ? -16.550 -23.468 -0.552  1.00 188.40 ? 588 GLU A OE1 1 
ATOM   4622 O  OE2 . GLU A 1 588 ? -18.381 -22.281 -0.699  1.00 196.94 ? 588 GLU A OE2 1 
ATOM   4623 N  N   . GLN A 1 589 ? -12.619 -23.944 -1.642  1.00 129.49 ? 589 GLN A N   1 
ATOM   4624 C  CA  . GLN A 1 589 ? -11.433 -24.612 -2.141  1.00 124.47 ? 589 GLN A CA  1 
ATOM   4625 C  C   . GLN A 1 589 ? -11.640 -24.880 -3.603  1.00 132.89 ? 589 GLN A C   1 
ATOM   4626 O  O   . GLN A 1 589 ? -12.628 -25.494 -3.982  1.00 143.72 ? 589 GLN A O   1 
ATOM   4627 C  CB  . GLN A 1 589 ? -11.168 -25.916 -1.406  1.00 184.99 ? 589 GLN A CB  1 
ATOM   4628 C  CG  . GLN A 1 589 ? -10.425 -25.714 -0.116  1.00 175.57 ? 589 GLN A CG  1 
ATOM   4629 C  CD  . GLN A 1 589 ? -9.617  -26.922 0.285   1.00 172.63 ? 589 GLN A CD  1 
ATOM   4630 O  OE1 . GLN A 1 589 ? -8.560  -27.198 -0.288  1.00 170.48 ? 589 GLN A OE1 1 
ATOM   4631 N  NE2 . GLN A 1 589 ? -10.103 -27.649 1.284   1.00 173.30 ? 589 GLN A NE2 1 
ATOM   4632 N  N   . GLU A 1 590 ? -10.725 -24.385 -4.425  1.00 141.38 ? 590 GLU A N   1 
ATOM   4633 C  CA  . GLU A 1 590 ? -10.779 -24.602 -5.863  1.00 147.37 ? 590 GLU A CA  1 
ATOM   4634 C  C   . GLU A 1 590 ? -10.835 -26.104 -6.169  1.00 151.32 ? 590 GLU A C   1 
ATOM   4635 O  O   . GLU A 1 590 ? -11.921 -26.674 -6.241  1.00 161.96 ? 590 GLU A O   1 
ATOM   4636 C  CB  . GLU A 1 590 ? -9.583  -23.925 -6.566  1.00 201.75 ? 590 GLU A CB  1 
ATOM   4637 C  CG  . GLU A 1 590 ? -9.645  -22.381 -6.628  1.00 201.16 ? 590 GLU A CG  1 
ATOM   4638 C  CD  . GLU A 1 590 ? -8.307  -21.720 -7.001  1.00 193.07 ? 590 GLU A CD  1 
ATOM   4639 O  OE1 . GLU A 1 590 ? -7.297  -22.434 -7.179  1.00 187.17 ? 590 GLU A OE1 1 
ATOM   4640 O  OE2 . GLU A 1 590 ? -8.267  -20.476 -7.111  1.00 193.26 ? 590 GLU A OE2 1 
ATOM   4641 N  N   . LYS A 1 591 ? -9.673  -26.745 -6.311  1.00 155.14 ? 591 LYS A N   1 
ATOM   4642 C  CA  . LYS A 1 591 ? -9.593  -28.125 -6.811  1.00 159.30 ? 591 LYS A CA  1 
ATOM   4643 C  C   . LYS A 1 591 ? -9.748  -29.225 -5.759  1.00 161.89 ? 591 LYS A C   1 
ATOM   4644 O  O   . LYS A 1 591 ? -10.159 -28.971 -4.637  1.00 158.59 ? 591 LYS A O   1 
ATOM   4645 C  CB  . LYS A 1 591 ? -8.297  -28.327 -7.600  1.00 169.00 ? 591 LYS A CB  1 
ATOM   4646 C  CG  . LYS A 1 591 ? -8.050  -27.248 -8.635  1.00 166.92 ? 591 LYS A CG  1 
ATOM   4647 C  CD  . LYS A 1 591 ? -6.966  -27.644 -9.608  1.00 159.38 ? 591 LYS A CD  1 
ATOM   4648 C  CE  . LYS A 1 591 ? -6.884  -26.653 -10.750 1.00 159.27 ? 591 LYS A CE  1 
ATOM   4649 N  NZ  . LYS A 1 591 ? -6.418  -27.302 -12.002 1.00 156.30 ? 591 LYS A NZ  1 
ATOM   4650 N  N   . SER A 1 592 ? -9.419  -30.452 -6.140  1.00 155.36 ? 592 SER A N   1 
ATOM   4651 C  CA  . SER A 1 592 ? -9.621  -31.607 -5.271  1.00 158.00 ? 592 SER A CA  1 
ATOM   4652 C  C   . SER A 1 592 ? -8.450  -31.837 -4.329  1.00 147.43 ? 592 SER A C   1 
ATOM   4653 O  O   . SER A 1 592 ? -8.642  -32.089 -3.141  1.00 147.44 ? 592 SER A O   1 
ATOM   4654 C  CB  . SER A 1 592 ? -9.860  -32.872 -6.101  1.00 162.97 ? 592 SER A CB  1 
ATOM   4655 O  OG  . SER A 1 592 ? -8.800  -33.122 -7.016  1.00 139.85 ? 592 SER A OG  1 
ATOM   4656 N  N   . LEU A 1 593 ? -7.240  -31.763 -4.879  1.00 164.73 ? 593 LEU A N   1 
ATOM   4657 C  CA  . LEU A 1 593 ? -6.001  -32.014 -4.138  1.00 151.58 ? 593 LEU A CA  1 
ATOM   4658 C  C   . LEU A 1 593 ? -5.880  -33.425 -3.552  1.00 151.38 ? 593 LEU A C   1 
ATOM   4659 O  O   . LEU A 1 593 ? -6.288  -33.689 -2.417  1.00 154.36 ? 593 LEU A O   1 
ATOM   4660 C  CB  . LEU A 1 593 ? -5.767  -30.941 -3.069  1.00 136.25 ? 593 LEU A CB  1 
ATOM   4661 C  CG  . LEU A 1 593 ? -5.117  -29.673 -3.620  1.00 129.32 ? 593 LEU A CG  1 
ATOM   4662 C  CD1 . LEU A 1 593 ? -3.925  -29.301 -2.775  1.00 118.27 ? 593 LEU A CD1 1 
ATOM   4663 C  CD2 . LEU A 1 593 ? -4.703  -29.884 -5.078  1.00 125.97 ? 593 LEU A CD2 1 
ATOM   4664 N  N   . PHE A 1 594 ? -5.315  -34.323 -4.353  1.00 144.79 ? 594 PHE A N   1 
ATOM   4665 C  CA  . PHE A 1 594 ? -4.996  -35.671 -3.924  1.00 143.95 ? 594 PHE A CA  1 
ATOM   4666 C  C   . PHE A 1 594 ? -3.496  -35.751 -3.983  1.00 128.84 ? 594 PHE A C   1 
ATOM   4667 O  O   . PHE A 1 594 ? -2.926  -35.576 -5.044  1.00 124.04 ? 594 PHE A O   1 
ATOM   4668 C  CB  . PHE A 1 594 ? -5.593  -36.691 -4.891  1.00 169.24 ? 594 PHE A CB  1 
ATOM   4669 C  CG  . PHE A 1 594 ? -5.437  -38.121 -4.446  1.00 157.89 ? 594 PHE A CG  1 
ATOM   4670 C  CD1 . PHE A 1 594 ? -6.317  -39.095 -4.886  1.00 172.89 ? 594 PHE A CD1 1 
ATOM   4671 C  CD2 . PHE A 1 594 ? -4.419  -38.493 -3.589  1.00 145.21 ? 594 PHE A CD2 1 
ATOM   4672 C  CE1 . PHE A 1 594 ? -6.183  -40.412 -4.475  1.00 175.18 ? 594 PHE A CE1 1 
ATOM   4673 C  CE2 . PHE A 1 594 ? -4.278  -39.808 -3.176  1.00 147.28 ? 594 PHE A CE2 1 
ATOM   4674 C  CZ  . PHE A 1 594 ? -5.160  -40.765 -3.618  1.00 162.28 ? 594 PHE A CZ  1 
ATOM   4675 N  N   . PHE A 1 595 ? -2.857  -36.006 -2.847  1.00 159.56 ? 595 PHE A N   1 
ATOM   4676 C  CA  . PHE A 1 595 ? -1.399  -36.059 -2.774  1.00 145.80 ? 595 PHE A CA  1 
ATOM   4677 C  C   . PHE A 1 595 ? -0.953  -36.962 -1.636  1.00 142.75 ? 595 PHE A C   1 
ATOM   4678 O  O   . PHE A 1 595 ? -1.658  -37.085 -0.649  1.00 148.22 ? 595 PHE A O   1 
ATOM   4679 C  CB  . PHE A 1 595 ? -0.837  -34.663 -2.538  1.00 149.56 ? 595 PHE A CB  1 
ATOM   4680 C  CG  . PHE A 1 595 ? 0.633   -34.645 -2.268  1.00 135.61 ? 595 PHE A CG  1 
ATOM   4681 C  CD1 . PHE A 1 595 ? 1.499   -34.025 -3.142  1.00 129.01 ? 595 PHE A CD1 1 
ATOM   4682 C  CD2 . PHE A 1 595 ? 1.147   -35.247 -1.142  1.00 129.18 ? 595 PHE A CD2 1 
ATOM   4683 C  CE1 . PHE A 1 595 ? 2.843   -34.013 -2.898  1.00 117.74 ? 595 PHE A CE1 1 
ATOM   4684 C  CE2 . PHE A 1 595 ? 2.483   -35.248 -0.900  1.00 117.84 ? 595 PHE A CE2 1 
ATOM   4685 C  CZ  . PHE A 1 595 ? 3.337   -34.627 -1.778  1.00 112.24 ? 595 PHE A CZ  1 
ATOM   4686 N  N   . SER A 1 596 ? 0.213   -37.594 -1.754  1.00 148.06 ? 596 SER A N   1 
ATOM   4687 C  CA  . SER A 1 596 ? 0.730   -38.361 -0.618  1.00 144.60 ? 596 SER A CA  1 
ATOM   4688 C  C   . SER A 1 596 ? 2.119   -38.930 -0.815  1.00 136.68 ? 596 SER A C   1 
ATOM   4689 O  O   . SER A 1 596 ? 2.371   -39.606 -1.800  1.00 138.80 ? 596 SER A O   1 
ATOM   4690 C  CB  . SER A 1 596 ? -0.205  -39.513 -0.292  1.00 148.72 ? 596 SER A CB  1 
ATOM   4691 O  OG  . SER A 1 596 ? 0.511   -40.727 -0.317  1.00 149.04 ? 596 SER A OG  1 
ATOM   4692 N  N   . GLN A 1 597 ? 3.010   -38.687 0.143   1.00 145.42 ? 597 GLN A N   1 
ATOM   4693 C  CA  . GLN A 1 597 ? 4.360   -39.251 0.103   1.00 138.69 ? 597 GLN A CA  1 
ATOM   4694 C  C   . GLN A 1 597 ? 4.560   -40.332 1.150   1.00 141.00 ? 597 GLN A C   1 
ATOM   4695 O  O   . GLN A 1 597 ? 4.321   -40.112 2.328   1.00 139.53 ? 597 GLN A O   1 
ATOM   4696 C  CB  . GLN A 1 597 ? 5.423   -38.170 0.302   1.00 195.95 ? 597 GLN A CB  1 
ATOM   4697 C  CG  . GLN A 1 597 ? 6.827   -38.735 0.440   1.00 176.37 ? 597 GLN A CG  1 
ATOM   4698 C  CD  . GLN A 1 597 ? 7.866   -37.676 0.725   1.00 166.77 ? 597 GLN A CD  1 
ATOM   4699 O  OE1 . GLN A 1 597 ? 7.643   -36.493 0.492   1.00 164.47 ? 597 GLN A OE1 1 
ATOM   4700 N  NE2 . GLN A 1 597 ? 9.010   -38.098 1.240   1.00 160.30 ? 597 GLN A NE2 1 
ATOM   4701 N  N   . ALA A 1 598 ? 5.024   -41.497 0.721   1.00 144.43 ? 598 ALA A N   1 
ATOM   4702 C  CA  . ALA A 1 598 ? 5.174   -42.602 1.658   1.00 140.60 ? 598 ALA A CA  1 
ATOM   4703 C  C   . ALA A 1 598 ? 6.256   -43.562 1.201   1.00 137.19 ? 598 ALA A C   1 
ATOM   4704 O  O   . ALA A 1 598 ? 6.820   -43.408 0.120   1.00 138.38 ? 598 ALA A O   1 
ATOM   4705 C  CB  . ALA A 1 598 ? 3.850   -43.329 1.850   1.00 382.09 ? 598 ALA A CB  1 
ATOM   4706 N  N   . ASN A 1 599 ? 6.552   -44.552 2.033   1.00 184.69 ? 599 ASN A N   1 
ATOM   4707 C  CA  . ASN A 1 599 ? 7.613   -45.502 1.728   1.00 181.92 ? 599 ASN A CA  1 
ATOM   4708 C  C   . ASN A 1 599 ? 7.110   -46.922 1.475   1.00 191.73 ? 599 ASN A C   1 
ATOM   4709 O  O   . ASN A 1 599 ? 5.943   -47.248 1.706   1.00 201.22 ? 599 ASN A O   1 
ATOM   4710 C  CB  . ASN A 1 599 ? 8.673   -45.510 2.840   1.00 181.33 ? 599 ASN A CB  1 
ATOM   4711 C  CG  . ASN A 1 599 ? 9.580   -44.282 2.803   1.00 173.31 ? 599 ASN A CG  1 
ATOM   4712 O  OD1 . ASN A 1 599 ? 9.401   -43.394 1.973   1.00 161.20 ? 599 ASN A OD1 1 
ATOM   4713 N  ND2 . ASN A 1 599 ? 10.554  -44.230 3.710   1.00 145.42 ? 599 ASN A ND2 1 
ATOM   4714 N  N   . ALA A 1 600 ? 8.016   -47.766 1.004   1.00 127.57 ? 600 ALA A N   1 
ATOM   4715 C  CA  . ALA A 1 600 ? 7.677   -49.133 0.665   1.00 136.50 ? 600 ALA A CA  1 
ATOM   4716 C  C   . ALA A 1 600 ? 7.899   -50.062 1.846   1.00 136.24 ? 600 ALA A C   1 
ATOM   4717 O  O   . ALA A 1 600 ? 8.850   -49.888 2.597   1.00 135.95 ? 600 ALA A O   1 
ATOM   4718 C  CB  . ALA A 1 600 ? 8.525   -49.574 -0.503  1.00 139.82 ? 600 ALA A CB  1 
ATOM   4719 N  N   . ILE A 1 601 ? 7.054   -51.075 2.002   1.00 194.09 ? 601 ILE A N   1 
ATOM   4720 C  CA  . ILE A 1 601 ? 7.250   -52.043 3.083   1.00 193.17 ? 601 ILE A CA  1 
ATOM   4721 C  C   . ILE A 1 601 ? 7.341   -53.507 2.629   1.00 194.41 ? 601 ILE A C   1 
ATOM   4722 O  O   . ILE A 1 601 ? 8.037   -54.318 3.247   1.00 195.01 ? 601 ILE A O   1 
ATOM   4723 C  CB  . ILE A 1 601 ? 6.140   -51.923 4.118   1.00 146.35 ? 601 ILE A CB  1 
ATOM   4724 C  CG1 . ILE A 1 601 ? 6.108   -50.511 4.668   1.00 124.13 ? 601 ILE A CG1 1 
ATOM   4725 C  CG2 . ILE A 1 601 ? 6.355   -52.910 5.237   1.00 132.67 ? 601 ILE A CG2 1 
ATOM   4726 C  CD1 . ILE A 1 601 ? 5.050   -50.308 5.710   1.00 140.90 ? 601 ILE A CD1 1 
ATOM   4727 N  N   . ALA A 1 602 ? 6.640   -53.836 1.547   1.00 283.43 ? 602 ALA A N   1 
ATOM   4728 C  CA  . ALA A 1 602 ? 6.540   -55.220 1.093   1.00 284.68 ? 602 ALA A CA  1 
ATOM   4729 C  C   . ALA A 1 602 ? 6.403   -55.336 -0.427  1.00 288.43 ? 602 ALA A C   1 
ATOM   4730 O  O   . ALA A 1 602 ? 5.882   -54.437 -1.082  1.00 288.63 ? 602 ALA A O   1 
ATOM   4731 C  CB  . ALA A 1 602 ? 5.372   -55.905 1.781   1.00 143.80 ? 602 ALA A CB  1 
ATOM   4732 N  N   . GLN A 1 603 ? 6.875   -56.450 -0.979  1.00 185.78 ? 603 GLN A N   1 
ATOM   4733 C  CA  . GLN A 1 603 ? 6.719   -56.730 -2.407  1.00 190.10 ? 603 GLN A CA  1 
ATOM   4734 C  C   . GLN A 1 603 ? 6.704   -58.237 -2.671  1.00 193.01 ? 603 GLN A C   1 
ATOM   4735 O  O   . GLN A 1 603 ? 7.397   -58.994 -1.994  1.00 193.75 ? 603 GLN A O   1 
ATOM   4736 C  CB  . GLN A 1 603 ? 7.826   -56.053 -3.236  1.00 184.09 ? 603 GLN A CB  1 
ATOM   4737 C  CG  . GLN A 1 603 ? 7.587   -56.061 -4.756  1.00 185.51 ? 603 GLN A CG  1 
ATOM   4738 C  CD  . GLN A 1 603 ? 8.658   -55.299 -5.542  1.00 174.88 ? 603 GLN A CD  1 
ATOM   4739 O  OE1 . GLN A 1 603 ? 9.276   -54.362 -5.030  1.00 168.15 ? 603 GLN A OE1 1 
ATOM   4740 N  NE2 . GLN A 1 603 ? 8.881   -55.706 -6.790  1.00 173.51 ? 603 GLN A NE2 1 
ATOM   4741 N  N   . ASP A 1 604 ? 5.906   -58.663 -3.650  1.00 384.25 ? 604 ASP A N   1 
ATOM   4742 C  CA  . ASP A 1 604 ? 5.820   -60.076 -4.029  1.00 386.59 ? 604 ASP A CA  1 
ATOM   4743 C  C   . ASP A 1 604 ? 6.552   -60.349 -5.339  1.00 394.96 ? 604 ASP A C   1 
ATOM   4744 O  O   . ASP A 1 604 ? 6.064   -60.000 -6.415  1.00 396.22 ? 604 ASP A O   1 
ATOM   4745 C  CB  . ASP A 1 604 ? 4.360   -60.521 -4.164  1.00 221.56 ? 604 ASP A CB  1 
ATOM   4746 C  CG  . ASP A 1 604 ? 3.669   -60.682 -2.826  1.00 216.72 ? 604 ASP A CG  1 
ATOM   4747 O  OD1 . ASP A 1 604 ? 4.242   -61.336 -1.930  1.00 214.72 ? 604 ASP A OD1 1 
ATOM   4748 O  OD2 . ASP A 1 604 ? 2.550   -60.148 -2.673  1.00 216.32 ? 604 ASP A OD2 1 
ATOM   4749 N  N   . GLY A 1 608 ? 3.241   -58.570 -7.745  1.00 165.09 ? 608 GLY A N   1 
ATOM   4750 C  CA  . GLY A 1 608 ? 4.087   -57.456 -7.351  1.00 162.87 ? 608 GLY A CA  1 
ATOM   4751 C  C   . GLY A 1 608 ? 3.376   -56.444 -6.473  1.00 152.22 ? 608 GLY A C   1 
ATOM   4752 O  O   . GLY A 1 608 ? 3.493   -55.240 -6.688  1.00 148.65 ? 608 GLY A O   1 
ATOM   4753 N  N   . SER A 1 609 ? 2.649   -56.945 -5.476  1.00 270.65 ? 609 SER A N   1 
ATOM   4754 C  CA  . SER A 1 609 ? 1.831   -56.116 -4.590  1.00 259.93 ? 609 SER A CA  1 
ATOM   4755 C  C   . SER A 1 609 ? 2.689   -55.366 -3.558  1.00 257.95 ? 609 SER A C   1 
ATOM   4756 O  O   . SER A 1 609 ? 3.264   -55.983 -2.662  1.00 257.44 ? 609 SER A O   1 
ATOM   4757 C  CB  . SER A 1 609 ? 0.787   -56.992 -3.881  1.00 173.55 ? 609 SER A CB  1 
ATOM   4758 O  OG  . SER A 1 609 ? -0.497  -56.384 -3.860  1.00 145.66 ? 609 SER A OG  1 
ATOM   4759 N  N   . VAL A 1 610 ? 2.771   -54.040 -3.684  1.00 214.83 ? 610 VAL A N   1 
ATOM   4760 C  CA  . VAL A 1 610 ? 3.585   -53.239 -2.763  1.00 212.97 ? 610 VAL A CA  1 
ATOM   4761 C  C   . VAL A 1 610 ? 2.766   -52.451 -1.755  1.00 203.48 ? 610 VAL A C   1 
ATOM   4762 O  O   . VAL A 1 610 ? 1.942   -51.631 -2.127  1.00 200.67 ? 610 VAL A O   1 
ATOM   4763 C  CB  . VAL A 1 610 ? 4.450   -52.219 -3.508  1.00 100.51 ? 610 VAL A CB  1 
ATOM   4764 C  CG1 . VAL A 1 610 ? 5.249   -51.401 -2.504  1.00 96.66  ? 610 VAL A CG1 1 
ATOM   4765 C  CG2 . VAL A 1 610 ? 5.367   -52.913 -4.492  1.00 105.56 ? 610 VAL A CG2 1 
ATOM   4766 N  N   . MET A 1 611 ? 3.018   -52.670 -0.473  1.00 163.92 ? 611 MET A N   1 
ATOM   4767 C  CA  . MET A 1 611 ? 2.251   -51.967 0.550   1.00 155.09 ? 611 MET A CA  1 
ATOM   4768 C  C   . MET A 1 611 ? 2.857   -50.600 0.906   1.00 154.07 ? 611 MET A C   1 
ATOM   4769 O  O   . MET A 1 611 ? 4.072   -50.461 1.038   1.00 156.55 ? 611 MET A O   1 
ATOM   4770 C  CB  . MET A 1 611 ? 2.119   -52.830 1.808   1.00 214.83 ? 611 MET A CB  1 
ATOM   4771 C  CG  . MET A 1 611 ? 1.189   -52.241 2.851   1.00 206.81 ? 611 MET A CG  1 
ATOM   4772 S  SD  . MET A 1 611 ? -0.538  -52.494 2.418   1.00 182.22 ? 611 MET A SD  1 
ATOM   4773 C  CE  . MET A 1 611 ? -0.698  -54.256 2.734   1.00 182.21 ? 611 MET A CE  1 
ATOM   4774 N  N   . LEU A 1 612 ? 2.007   -49.589 1.064   1.00 246.97 ? 612 LEU A N   1 
ATOM   4775 C  CA  . LEU A 1 612 ? 2.478   -48.271 1.469   1.00 242.99 ? 612 LEU A CA  1 
ATOM   4776 C  C   . LEU A 1 612 ? 1.845   -47.861 2.799   1.00 237.42 ? 612 LEU A C   1 
ATOM   4777 O  O   . LEU A 1 612 ? 0.662   -48.081 3.029   1.00 235.94 ? 612 LEU A O   1 
ATOM   4778 C  CB  . LEU A 1 612 ? 2.190   -47.224 0.385   1.00 114.42 ? 612 LEU A CB  1 
ATOM   4779 C  CG  . LEU A 1 612 ? 2.949   -47.366 -0.938  1.00 113.88 ? 612 LEU A CG  1 
ATOM   4780 C  CD1 . LEU A 1 612 ? 2.967   -46.076 -1.744  1.00 100.74 ? 612 LEU A CD1 1 
ATOM   4781 C  CD2 . LEU A 1 612 ? 4.360   -47.794 -0.640  1.00 117.00 ? 612 LEU A CD2 1 
ATOM   4782 N  N   . ASP A 1 613 ? 2.659   -47.285 3.679   1.00 175.52 ? 613 ASP A N   1 
ATOM   4783 C  CA  . ASP A 1 613 ? 2.227   -46.802 4.997   1.00 171.14 ? 613 ASP A CA  1 
ATOM   4784 C  C   . ASP A 1 613 ? 0.757   -46.475 5.079   1.00 169.03 ? 613 ASP A C   1 
ATOM   4785 O  O   . ASP A 1 613 ? -0.002  -47.053 5.853   1.00 168.10 ? 613 ASP A O   1 
ATOM   4786 C  CB  . ASP A 1 613 ? 2.992   -45.531 5.365   1.00 184.44 ? 613 ASP A CB  1 
ATOM   4787 C  CG  . ASP A 1 613 ? 4.477   -45.666 5.125   1.00 168.76 ? 613 ASP A CG  1 
ATOM   4788 O  OD1 . ASP A 1 613 ? 4.947   -46.823 5.136   1.00 173.64 ? 613 ASP A OD1 1 
ATOM   4789 O  OD2 . ASP A 1 613 ? 5.166   -44.633 4.954   1.00 168.36 ? 613 ASP A OD2 1 
ATOM   4790 N  N   . ASN A 1 614 ? 0.353   -45.511 4.275   1.00 228.55 ? 614 ASN A N   1 
ATOM   4791 C  CA  . ASN A 1 614 ? -1.024  -44.986 4.304   1.00 227.78 ? 614 ASN A CA  1 
ATOM   4792 C  C   . ASN A 1 614 ? -2.136  -45.930 3.901   1.00 228.64 ? 614 ASN A C   1 
ATOM   4793 O  O   . ASN A 1 614 ? -3.259  -45.466 3.689   1.00 228.41 ? 614 ASN A O   1 
ATOM   4794 C  CB  . ASN A 1 614 ? -1.077  -43.683 3.481   1.00 154.82 ? 614 ASN A CB  1 
ATOM   4795 C  CG  . ASN A 1 614 ? -0.179  -43.759 2.268   1.00 157.63 ? 614 ASN A CG  1 
ATOM   4796 O  OD1 . ASN A 1 614 ? 0.464   -44.809 2.016   1.00 160.44 ? 614 ASN A OD1 1 
ATOM   4797 N  ND2 . ASN A 1 614 ? -0.116  -42.680 1.512   1.00 152.71 ? 614 ASN A ND2 1 
ATOM   4798 N  N   . GLY A 1 615 ? -1.771  -47.190 3.647   1.00 183.87 ? 615 GLY A N   1 
ATOM   4799 C  CA  . GLY A 1 615 ? -2.727  -48.241 3.351   1.00 183.26 ? 615 GLY A CA  1 
ATOM   4800 C  C   . GLY A 1 615 ? -3.014  -48.370 1.872   1.00 187.85 ? 615 GLY A C   1 
ATOM   4801 O  O   . GLY A 1 615 ? -3.983  -49.006 1.453   1.00 189.71 ? 615 GLY A O   1 
ATOM   4802 N  N   . VAL A 1 616 ? -2.152  -47.741 1.085   1.00 127.19 ? 616 VAL A N   1 
ATOM   4803 C  CA  . VAL A 1 616 ? -2.284  -47.683 -0.360  1.00 131.58 ? 616 VAL A CA  1 
ATOM   4804 C  C   . VAL A 1 616 ? -1.388  -48.746 -0.907  1.00 136.14 ? 616 VAL A C   1 
ATOM   4805 O  O   . VAL A 1 616 ? -0.254  -48.855 -0.475  1.00 135.54 ? 616 VAL A O   1 
ATOM   4806 C  CB  . VAL A 1 616 ? -1.691  -46.379 -0.916  1.00 97.97  ? 616 VAL A CB  1 
ATOM   4807 C  CG1 . VAL A 1 616 ? -2.259  -46.066 -2.283  1.00 99.91  ? 616 VAL A CG1 1 
ATOM   4808 C  CG2 . VAL A 1 616 ? -1.966  -45.250 0.025   1.00 94.37  ? 616 VAL A CG2 1 
ATOM   4809 N  N   . GLU A 1 617 ? -1.869  -49.530 -1.860  1.00 158.77 ? 617 GLU A N   1 
ATOM   4810 C  CA  . GLU A 1 617 ? -0.958  -50.469 -2.488  1.00 164.61 ? 617 GLU A CA  1 
ATOM   4811 C  C   . GLU A 1 617 ? -0.657  -50.133 -3.939  1.00 167.44 ? 617 GLU A C   1 
ATOM   4812 O  O   . GLU A 1 617 ? -1.391  -49.408 -4.599  1.00 164.89 ? 617 GLU A O   1 
ATOM   4813 C  CB  . GLU A 1 617 ? -1.524  -51.873 -2.384  1.00 231.02 ? 617 GLU A CB  1 
ATOM   4814 C  CG  . GLU A 1 617 ? -1.926  -52.297 -1.016  1.00 201.15 ? 617 GLU A CG  1 
ATOM   4815 C  CD  . GLU A 1 617 ? -2.489  -53.700 -1.005  1.00 201.47 ? 617 GLU A CD  1 
ATOM   4816 O  OE1 . GLU A 1 617 ? -2.224  -54.476 -1.951  1.00 207.31 ? 617 GLU A OE1 1 
ATOM   4817 O  OE2 . GLU A 1 617 ? -3.212  -54.019 -0.041  1.00 196.65 ? 617 GLU A OE2 1 
ATOM   4818 N  N   . ILE A 1 618 ? 0.439   -50.697 -4.422  1.00 169.37 ? 618 ILE A N   1 
ATOM   4819 C  CA  . ILE A 1 618 ? 0.795   -50.640 -5.827  1.00 170.41 ? 618 ILE A CA  1 
ATOM   4820 C  C   . ILE A 1 618 ? 0.615   -52.046 -6.382  1.00 178.26 ? 618 ILE A C   1 
ATOM   4821 O  O   . ILE A 1 618 ? 1.313   -52.969 -5.951  1.00 182.81 ? 618 ILE A O   1 
ATOM   4822 C  CB  . ILE A 1 618 ? 2.264   -50.222 -5.990  1.00 161.06 ? 618 ILE A CB  1 
ATOM   4823 C  CG1 . ILE A 1 618 ? 2.587   -49.055 -5.053  1.00 128.62 ? 618 ILE A CG1 1 
ATOM   4824 C  CG2 . ILE A 1 618 ? 2.577   -49.813 -7.429  1.00 133.12 ? 618 ILE A CG2 1 
ATOM   4825 C  CD1 . ILE A 1 618 ? 3.734   -48.189 -5.537  1.00 145.45 ? 618 ILE A CD1 1 
ATOM   4826 N  N   . ILE A 1 619 ? -0.303  -52.218 -7.332  1.00 176.71 ? 619 ILE A N   1 
ATOM   4827 C  CA  . ILE A 1 619 ? -0.528  -53.535 -7.914  1.00 184.12 ? 619 ILE A CA  1 
ATOM   4828 C  C   . ILE A 1 619 ? -0.459  -53.564 -9.447  1.00 188.01 ? 619 ILE A C   1 
ATOM   4829 O  O   . ILE A 1 619 ? -0.205  -52.541 -10.094 1.00 187.20 ? 619 ILE A O   1 
ATOM   4830 C  CB  . ILE A 1 619 ? -1.838  -54.184 -7.392  1.00 183.52 ? 619 ILE A CB  1 
ATOM   4831 C  CG1 . ILE A 1 619 ? -3.056  -53.442 -7.920  1.00 146.66 ? 619 ILE A CG1 1 
ATOM   4832 C  CG2 . ILE A 1 619 ? -1.849  -54.221 -5.870  1.00 158.66 ? 619 ILE A CG2 1 
ATOM   4833 C  CD1 . ILE A 1 619 ? -4.299  -54.310 -7.963  1.00 146.13 ? 619 ILE A CD1 1 
ATOM   4834 N  N   . ASN A 1 620 ? -0.716  -54.749 -10.006 1.00 194.74 ? 620 ASN A N   1 
ATOM   4835 C  CA  . ASN A 1 620 ? -0.353  -55.099 -11.392 1.00 202.02 ? 620 ASN A CA  1 
ATOM   4836 C  C   . ASN A 1 620 ? 0.706   -54.215 -12.044 1.00 201.62 ? 620 ASN A C   1 
ATOM   4837 O  O   . ASN A 1 620 ? 0.374   -53.290 -12.769 1.00 199.78 ? 620 ASN A O   1 
ATOM   4838 C  CB  . ASN A 1 620 ? -1.586  -55.322 -12.309 1.00 221.47 ? 620 ASN A CB  1 
ATOM   4839 C  CG  . ASN A 1 620 ? -2.643  -54.228 -12.184 1.00 214.77 ? 620 ASN A CG  1 
ATOM   4840 O  OD1 . ASN A 1 620 ? -2.348  -53.103 -11.796 1.00 208.42 ? 620 ASN A OD1 1 
ATOM   4841 N  ND2 . ASN A 1 620 ? -3.885  -54.560 -12.528 1.00 188.66 ? 620 ASN A ND2 1 
ATOM   4842 N  N   . ASP A 1 621 ? 1.973   -54.537 -11.790 1.00 218.75 ? 621 ASP A N   1 
ATOM   4843 C  CA  . ASP A 1 621 ? 3.117   -53.859 -12.408 1.00 216.23 ? 621 ASP A CA  1 
ATOM   4844 C  C   . ASP A 1 621 ? 2.977   -52.348 -12.457 1.00 207.86 ? 621 ASP A C   1 
ATOM   4845 O  O   . ASP A 1 621 ? 2.881   -51.778 -13.543 1.00 209.08 ? 621 ASP A O   1 
ATOM   4846 C  CB  . ASP A 1 621 ? 3.337   -54.359 -13.837 1.00 211.45 ? 621 ASP A CB  1 
ATOM   4847 C  CG  . ASP A 1 621 ? 3.337   -55.865 -13.932 1.00 219.79 ? 621 ASP A CG  1 
ATOM   4848 O  OD1 . ASP A 1 621 ? 3.738   -56.526 -12.953 1.00 223.05 ? 621 ASP A OD1 1 
ATOM   4849 O  OD2 . ASP A 1 621 ? 2.922   -56.389 -14.983 1.00 224.30 ? 621 ASP A OD2 1 
ATOM   4850 N  N   . PHE A 1 622 ? 2.990   -51.704 -11.293 1.00 155.84 ? 622 PHE A N   1 
ATOM   4851 C  CA  . PHE A 1 622 ? 2.954   -50.243 -11.205 1.00 148.20 ? 622 PHE A CA  1 
ATOM   4852 C  C   . PHE A 1 622 ? 1.937   -49.586 -12.174 1.00 150.82 ? 622 PHE A C   1 
ATOM   4853 O  O   . PHE A 1 622 ? 2.274   -48.664 -12.921 1.00 150.78 ? 622 PHE A O   1 
ATOM   4854 C  CB  . PHE A 1 622 ? 4.364   -49.649 -11.382 1.00 221.75 ? 622 PHE A CB  1 
ATOM   4855 C  CG  . PHE A 1 622 ? 4.905   -49.757 -12.791 1.00 225.97 ? 622 PHE A CG  1 
ATOM   4856 C  CD1 . PHE A 1 622 ? 4.703   -48.732 -13.708 1.00 224.71 ? 622 PHE A CD1 1 
ATOM   4857 C  CD2 . PHE A 1 622 ? 5.621   -50.876 -13.198 1.00 233.16 ? 622 PHE A CD2 1 
ATOM   4858 C  CE1 . PHE A 1 622 ? 5.191   -48.824 -15.006 1.00 231.61 ? 622 PHE A CE1 1 
ATOM   4859 C  CE2 . PHE A 1 622 ? 6.116   -50.974 -14.496 1.00 238.44 ? 622 PHE A CE2 1 
ATOM   4860 C  CZ  . PHE A 1 622 ? 5.901   -49.945 -15.398 1.00 238.13 ? 622 PHE A CZ  1 
ATOM   4861 N  N   . ARG A 1 623 ? 0.689   -50.055 -12.150 1.00 118.77 ? 623 ARG A N   1 
ATOM   4862 C  CA  . ARG A 1 623 ? -0.359  -49.452 -12.972 1.00 122.75 ? 623 ARG A CA  1 
ATOM   4863 C  C   . ARG A 1 623 ? -1.532  -48.927 -12.145 1.00 119.03 ? 623 ARG A C   1 
ATOM   4864 O  O   . ARG A 1 623 ? -2.185  -47.956 -12.528 1.00 120.17 ? 623 ARG A O   1 
ATOM   4865 C  CB  . ARG A 1 623 ? -0.877  -50.441 -14.023 1.00 185.06 ? 623 ARG A CB  1 
ATOM   4866 C  CG  . ARG A 1 623 ? -0.198  -50.343 -15.383 1.00 191.48 ? 623 ARG A CG  1 
ATOM   4867 C  CD  . ARG A 1 623 ? -0.866  -51.250 -16.413 1.00 202.57 ? 623 ARG A CD  1 
ATOM   4868 N  NE  . ARG A 1 623 ? -0.154  -51.230 -17.686 1.00 211.12 ? 623 ARG A NE  1 
ATOM   4869 C  CZ  . ARG A 1 623 ? -0.383  -52.075 -18.683 1.00 221.67 ? 623 ARG A CZ  1 
ATOM   4870 N  NH1 . ARG A 1 623 ? -1.310  -53.014 -18.556 1.00 224.25 ? 623 ARG A NH1 1 
ATOM   4871 N  NH2 . ARG A 1 623 ? 0.317   -51.985 -19.805 1.00 230.63 ? 623 ARG A NH2 1 
ATOM   4872 N  N   . ALA A 1 624 ? -1.806  -49.566 -11.017 1.00 147.10 ? 624 ALA A N   1 
ATOM   4873 C  CA  . ALA A 1 624 ? -2.997  -49.220 -10.255 1.00 141.76 ? 624 ALA A CA  1 
ATOM   4874 C  C   . ALA A 1 624 ? -2.765  -49.300 -8.754  1.00 136.77 ? 624 ALA A C   1 
ATOM   4875 O  O   . ALA A 1 624 ? -2.040  -50.175 -8.268  1.00 139.27 ? 624 ALA A O   1 
ATOM   4876 C  CB  . ALA A 1 624 ? -4.158  -50.119 -10.657 1.00 447.66 ? 624 ALA A CB  1 
ATOM   4877 N  N   . LEU A 1 625 ? -3.416  -48.397 -8.026  1.00 159.43 ? 625 LEU A N   1 
ATOM   4878 C  CA  . LEU A 1 625 ? -3.256  -48.305 -6.580  1.00 156.54 ? 625 LEU A CA  1 
ATOM   4879 C  C   . LEU A 1 625 ? -4.483  -48.824 -5.830  1.00 157.52 ? 625 LEU A C   1 
ATOM   4880 O  O   . LEU A 1 625 ? -5.604  -48.521 -6.220  1.00 156.36 ? 625 LEU A O   1 
ATOM   4881 C  CB  . LEU A 1 625 ? -3.031  -46.847 -6.198  1.00 118.24 ? 625 LEU A CB  1 
ATOM   4882 C  CG  . LEU A 1 625 ? -2.270  -45.971 -7.192  1.00 116.58 ? 625 LEU A CG  1 
ATOM   4883 C  CD1 . LEU A 1 625 ? -1.918  -44.643 -6.544  1.00 109.09 ? 625 LEU A CD1 1 
ATOM   4884 C  CD2 . LEU A 1 625 ? -1.019  -46.672 -7.677  1.00 118.00 ? 625 LEU A CD2 1 
ATOM   4885 N  N   . LYS A 1 626 ? -4.279  -49.602 -4.764  1.00 171.72 ? 626 LYS A N   1 
ATOM   4886 C  CA  . LYS A 1 626 ? -5.374  -50.004 -3.872  1.00 169.48 ? 626 LYS A CA  1 
ATOM   4887 C  C   . LYS A 1 626 ? -5.448  -49.037 -2.694  1.00 164.48 ? 626 LYS A C   1 
ATOM   4888 O  O   . LYS A 1 626 ? -4.745  -49.212 -1.679  1.00 163.20 ? 626 LYS A O   1 
ATOM   4889 C  CB  . LYS A 1 626 ? -5.208  -51.445 -3.377  1.00 163.97 ? 626 LYS A CB  1 
ATOM   4890 C  CG  . LYS A 1 626 ? -6.512  -52.112 -2.909  1.00 164.09 ? 626 LYS A CG  1 
ATOM   4891 C  CD  . LYS A 1 626 ? -6.335  -53.624 -2.818  1.00 166.07 ? 626 LYS A CD  1 
ATOM   4892 C  CE  . LYS A 1 626 ? -7.654  -54.382 -2.801  1.00 167.03 ? 626 LYS A CE  1 
ATOM   4893 N  NZ  . LYS A 1 626 ? -7.428  -55.846 -3.026  1.00 169.04 ? 626 LYS A NZ  1 
ATOM   4894 N  N   . VAL A 1 627 ? -6.302  -48.024 -2.862  1.00 169.44 ? 627 VAL A N   1 
ATOM   4895 C  CA  . VAL A 1 627 ? -6.453  -46.889 -1.948  1.00 165.38 ? 627 VAL A CA  1 
ATOM   4896 C  C   . VAL A 1 627 ? -7.716  -47.036 -1.087  1.00 161.87 ? 627 VAL A C   1 
ATOM   4897 O  O   . VAL A 1 627 ? -8.716  -46.335 -1.295  1.00 156.49 ? 627 VAL A O   1 
ATOM   4898 C  CB  . VAL A 1 627 ? -6.547  -45.553 -2.744  1.00 108.23 ? 627 VAL A CB  1 
ATOM   4899 C  CG1 . VAL A 1 627 ? -6.528  -44.348 -1.828  1.00 105.28 ? 627 VAL A CG1 1 
ATOM   4900 C  CG2 . VAL A 1 627 ? -5.442  -45.434 -3.784  1.00 110.67 ? 627 VAL A CG2 1 
ATOM   4901 N  N   . GLU A 1 628 ? -7.665  -47.960 -0.129  1.00 222.33 ? 628 GLU A N   1 
ATOM   4902 C  CA  . GLU A 1 628 ? -8.804  -48.260 0.747   1.00 221.16 ? 628 GLU A CA  1 
ATOM   4903 C  C   . GLU A 1 628 ? -9.857  -49.182 0.108   1.00 223.09 ? 628 GLU A C   1 
ATOM   4904 O  O   . GLU A 1 628 ? -11.059 -49.034 0.348   1.00 220.06 ? 628 GLU A O   1 
ATOM   4905 C  CB  . GLU A 1 628 ? -9.454  -46.975 1.271   1.00 226.13 ? 628 GLU A CB  1 
ATOM   4906 C  CG  . GLU A 1 628 ? -10.381 -47.201 2.455   1.00 227.34 ? 628 GLU A CG  1 
ATOM   4907 C  CD  . GLU A 1 628 ? -10.936 -45.911 3.025   1.00 224.90 ? 628 GLU A CD  1 
ATOM   4908 O  OE1 . GLU A 1 628 ? -10.524 -44.825 2.561   1.00 221.08 ? 628 GLU A OE1 1 
ATOM   4909 O  OE2 . GLU A 1 628 ? -11.786 -45.986 3.936   1.00 228.55 ? 628 GLU A OE2 1 
ATOM   4910 N  N   . GLY A 1 629 ? -9.386  -50.148 -0.678  1.00 224.78 ? 629 GLY A N   1 
ATOM   4911 C  CA  . GLY A 1 629 ? -10.254 -51.091 -1.358  1.00 227.85 ? 629 GLY A CA  1 
ATOM   4912 C  C   . GLY A 1 629 ? -10.439 -50.714 -2.813  1.00 228.83 ? 629 GLY A C   1 
ATOM   4913 O  O   . GLY A 1 629 ? -10.730 -51.564 -3.655  1.00 234.14 ? 629 GLY A O   1 
ATOM   4914 N  N   . ALA A 1 630 ? -10.254 -49.429 -3.100  1.00 228.01 ? 630 ALA A N   1 
ATOM   4915 C  CA  . ALA A 1 630 ? -10.447 -48.874 -4.435  1.00 230.23 ? 630 ALA A CA  1 
ATOM   4916 C  C   . ALA A 1 630 ? -9.217  -49.054 -5.310  1.00 232.30 ? 630 ALA A C   1 
ATOM   4917 O  O   . ALA A 1 630 ? -8.152  -48.535 -4.991  1.00 229.89 ? 630 ALA A O   1 
ATOM   4918 C  CB  . ALA A 1 630 ? -10.775 -47.397 -4.331  1.00 94.97  ? 630 ALA A CB  1 
ATOM   4919 N  N   . SER A 1 631 ? -9.360  -49.776 -6.418  1.00 166.32 ? 631 SER A N   1 
ATOM   4920 C  CA  . SER A 1 631 ? -8.279  -49.863 -7.392  1.00 170.05 ? 631 SER A CA  1 
ATOM   4921 C  C   . SER A 1 631 ? -8.342  -48.623 -8.275  1.00 167.36 ? 631 SER A C   1 
ATOM   4922 O  O   . SER A 1 631 ? -9.429  -48.154 -8.618  1.00 167.59 ? 631 SER A O   1 
ATOM   4923 C  CB  . SER A 1 631 ? -8.370  -51.142 -8.229  1.00 191.13 ? 631 SER A CB  1 
ATOM   4924 O  OG  . SER A 1 631 ? -9.349  -51.034 -9.244  1.00 157.11 ? 631 SER A OG  1 
ATOM   4925 N  N   . ILE A 1 632 ? -7.178  -48.077 -8.614  1.00 150.60 ? 632 ILE A N   1 
ATOM   4926 C  CA  . ILE A 1 632 ? -7.116  -46.866 -9.425  1.00 151.01 ? 632 ILE A CA  1 
ATOM   4927 C  C   . ILE A 1 632 ? -6.050  -46.899 -10.501 1.00 156.40 ? 632 ILE A C   1 
ATOM   4928 O  O   . ILE A 1 632 ? -4.920  -47.332 -10.267 1.00 155.89 ? 632 ILE A O   1 
ATOM   4929 C  CB  . ILE A 1 632 ? -6.871  -45.630 -8.573  1.00 118.21 ? 632 ILE A CB  1 
ATOM   4930 C  CG1 . ILE A 1 632 ? -7.937  -45.518 -7.498  1.00 114.04 ? 632 ILE A CG1 1 
ATOM   4931 C  CG2 . ILE A 1 632 ? -6.870  -44.375 -9.432  1.00 122.14 ? 632 ILE A CG2 1 
ATOM   4932 C  CD1 . ILE A 1 632 ? -7.720  -44.338 -6.630  1.00 72.28  ? 632 ILE A CD1 1 
ATOM   4933 N  N   . PRO A 1 633 ? -6.423  -46.421 -11.688 1.00 139.21 ? 633 PRO A N   1 
ATOM   4934 C  CA  . PRO A 1 633 ? -5.575  -46.304 -12.871 1.00 147.80 ? 633 PRO A CA  1 
ATOM   4935 C  C   . PRO A 1 633 ? -4.567  -45.177 -12.718 1.00 145.31 ? 633 PRO A C   1 
ATOM   4936 O  O   . PRO A 1 633 ? -4.953  -44.067 -12.352 1.00 142.28 ? 633 PRO A O   1 
ATOM   4937 C  CB  . PRO A 1 633 ? -6.576  -45.938 -13.968 1.00 187.01 ? 633 PRO A CB  1 
ATOM   4938 C  CG  . PRO A 1 633 ? -7.691  -45.255 -13.239 1.00 145.85 ? 633 PRO A CG  1 
ATOM   4939 C  CD  . PRO A 1 633 ? -7.807  -45.994 -11.957 1.00 134.71 ? 633 PRO A CD  1 
ATOM   4940 N  N   . LEU A 1 634 ? -3.297  -45.459 -12.998 1.00 96.24  ? 634 LEU A N   1 
ATOM   4941 C  CA  . LEU A 1 634 ? -2.270  -44.433 -12.950 1.00 91.20  ? 634 LEU A CA  1 
ATOM   4942 C  C   . LEU A 1 634 ? -2.165  -43.750 -14.289 1.00 101.66 ? 634 LEU A C   1 
ATOM   4943 O  O   . LEU A 1 634 ? -1.825  -44.379 -15.271 1.00 109.10 ? 634 LEU A O   1 
ATOM   4944 C  CB  . LEU A 1 634 ? -0.920  -45.030 -12.578 1.00 152.45 ? 634 LEU A CB  1 
ATOM   4945 C  CG  . LEU A 1 634 ? -0.860  -45.524 -11.137 1.00 108.38 ? 634 LEU A CG  1 
ATOM   4946 C  CD1 . LEU A 1 634 ? 0.561   -45.795 -10.751 1.00 104.80 ? 634 LEU A CD1 1 
ATOM   4947 C  CD2 . LEU A 1 634 ? -1.445  -44.484 -10.214 1.00 101.33 ? 634 LEU A CD2 1 
ATOM   4948 N  N   . LYS A 1 635 ? -2.450  -42.458 -14.334 1.00 127.43 ? 635 LYS A N   1 
ATOM   4949 C  CA  . LYS A 1 635 ? -2.304  -41.714 -15.571 1.00 129.74 ? 635 LYS A CA  1 
ATOM   4950 C  C   . LYS A 1 635 ? -0.910  -41.915 -16.085 1.00 131.25 ? 635 LYS A C   1 
ATOM   4951 O  O   . LYS A 1 635 ? -0.645  -41.708 -17.258 1.00 134.57 ? 635 LYS A O   1 
ATOM   4952 C  CB  . LYS A 1 635 ? -2.528  -40.221 -15.361 1.00 149.32 ? 635 LYS A CB  1 
ATOM   4953 C  CG  . LYS A 1 635 ? -2.192  -39.407 -16.598 1.00 152.01 ? 635 LYS A CG  1 
ATOM   4954 C  CD  . LYS A 1 635 ? -2.442  -37.932 -16.408 1.00 120.85 ? 635 LYS A CD  1 
ATOM   4955 C  CE  . LYS A 1 635 ? -2.777  -37.259 -17.730 1.00 124.35 ? 635 LYS A CE  1 
ATOM   4956 N  NZ  . LYS A 1 635 ? -4.254  -37.203 -17.975 1.00 126.57 ? 635 LYS A NZ  1 
ATOM   4957 N  N   . ALA A 1 636 ? -0.012  -42.303 -15.193 1.00 136.60 ? 636 ALA A N   1 
ATOM   4958 C  CA  . ALA A 1 636 ? 1.364   -42.563 -15.566 1.00 137.84 ? 636 ALA A CA  1 
ATOM   4959 C  C   . ALA A 1 636 ? 2.117   -42.944 -14.332 1.00 134.72 ? 636 ALA A C   1 
ATOM   4960 O  O   . ALA A 1 636 ? 1.549   -42.987 -13.251 1.00 131.62 ? 636 ALA A O   1 
ATOM   4961 C  CB  . ALA A 1 636 ? 1.998   -41.344 -16.190 1.00 127.24 ? 636 ALA A CB  1 
ATOM   4962 N  N   . PHE A 1 637 ? 3.397   -43.232 -14.519 1.00 123.29 ? 637 PHE A N   1 
ATOM   4963 C  CA  . PHE A 1 637 ? 4.323   -43.504 -13.438 1.00 120.31 ? 637 PHE A CA  1 
ATOM   4964 C  C   . PHE A 1 637 ? 5.613   -42.850 -13.836 1.00 120.93 ? 637 PHE A C   1 
ATOM   4965 O  O   . PHE A 1 637 ? 6.184   -43.199 -14.860 1.00 124.46 ? 637 PHE A O   1 
ATOM   4966 C  CB  . PHE A 1 637 ? 4.566   -44.998 -13.279 1.00 168.48 ? 637 PHE A CB  1 
ATOM   4967 C  CG  . PHE A 1 637 ? 5.767   -45.332 -12.434 1.00 137.26 ? 637 PHE A CG  1 
ATOM   4968 C  CD1 . PHE A 1 637 ? 5.618   -45.916 -11.195 1.00 163.80 ? 637 PHE A CD1 1 
ATOM   4969 C  CD2 . PHE A 1 637 ? 7.049   -45.074 -12.887 1.00 139.00 ? 637 PHE A CD2 1 
ATOM   4970 C  CE1 . PHE A 1 637 ? 6.721   -46.231 -10.433 1.00 132.92 ? 637 PHE A CE1 1 
ATOM   4971 C  CE2 . PHE A 1 637 ? 8.151   -45.383 -12.123 1.00 137.71 ? 637 PHE A CE2 1 
ATOM   4972 C  CZ  . PHE A 1 637 ? 7.985   -45.960 -10.899 1.00 134.65 ? 637 PHE A CZ  1 
ATOM   4973 N  N   . VAL A 1 638 ? 6.072   -41.902 -13.034 1.00 129.92 ? 638 VAL A N   1 
ATOM   4974 C  CA  . VAL A 1 638 ? 7.342   -41.242 -13.286 1.00 130.49 ? 638 VAL A CA  1 
ATOM   4975 C  C   . VAL A 1 638 ? 8.421   -41.818 -12.378 1.00 128.63 ? 638 VAL A C   1 
ATOM   4976 O  O   . VAL A 1 638 ? 8.193   -42.060 -11.199 1.00 125.62 ? 638 VAL A O   1 
ATOM   4977 C  CB  . VAL A 1 638 ? 7.215   -39.728 -13.112 1.00 102.94 ? 638 VAL A CB  1 
ATOM   4978 C  CG1 . VAL A 1 638 ? 8.571   -39.055 -13.160 1.00 104.57 ? 638 VAL A CG1 1 
ATOM   4979 C  CG2 . VAL A 1 638 ? 6.293   -39.167 -14.174 1.00 104.69 ? 638 VAL A CG2 1 
ATOM   4980 N  N   . ASP A 1 639 ? 9.593   -42.050 -12.950 1.00 132.95 ? 639 ASP A N   1 
ATOM   4981 C  CA  . ASP A 1 639 ? 10.676  -42.743 -12.278 1.00 132.14 ? 639 ASP A CA  1 
ATOM   4982 C  C   . ASP A 1 639 ? 11.859  -41.795 -12.282 1.00 132.32 ? 639 ASP A C   1 
ATOM   4983 O  O   . ASP A 1 639 ? 12.568  -41.718 -13.275 1.00 135.30 ? 639 ASP A O   1 
ATOM   4984 C  CB  . ASP A 1 639 ? 10.999  -44.011 -13.076 1.00 166.50 ? 639 ASP A CB  1 
ATOM   4985 C  CG  . ASP A 1 639 ? 11.989  -44.916 -12.384 1.00 166.29 ? 639 ASP A CG  1 
ATOM   4986 O  OD1 . ASP A 1 639 ? 13.119  -44.479 -12.104 1.00 138.40 ? 639 ASP A OD1 1 
ATOM   4987 O  OD2 . ASP A 1 639 ? 11.643  -46.083 -12.133 1.00 139.45 ? 639 ASP A OD2 1 
ATOM   4988 N  N   . ILE A 1 640 ? 12.063  -41.051 -11.200 1.00 144.57 ? 640 ILE A N   1 
ATOM   4989 C  CA  . ILE A 1 640 ? 13.122  -40.039 -11.191 1.00 145.37 ? 640 ILE A CA  1 
ATOM   4990 C  C   . ILE A 1 640 ? 14.428  -40.544 -10.585 1.00 144.68 ? 640 ILE A C   1 
ATOM   4991 O  O   . ILE A 1 640 ? 14.465  -40.979 -9.435  1.00 141.93 ? 640 ILE A O   1 
ATOM   4992 C  CB  . ILE A 1 640 ? 12.682  -38.743 -10.500 1.00 123.47 ? 640 ILE A CB  1 
ATOM   4993 C  CG1 . ILE A 1 640 ? 11.372  -38.260 -11.110 1.00 124.12 ? 640 ILE A CG1 1 
ATOM   4994 C  CG2 . ILE A 1 640 ? 13.775  -37.666 -10.611 1.00 125.82 ? 640 ILE A CG2 1 
ATOM   4995 C  CD1 . ILE A 1 640 ? 10.918  -36.966 -10.563 1.00 124.34 ? 640 ILE A CD1 1 
ATOM   4996 N  N   . GLU A 1 641 ? 15.498  -40.471 -11.371 1.00 142.75 ? 641 GLU A N   1 
ATOM   4997 C  CA  . GLU A 1 641 ? 16.762  -41.068 -10.985 1.00 142.58 ? 641 GLU A CA  1 
ATOM   4998 C  C   . GLU A 1 641 ? 17.845  -40.026 -10.720 1.00 143.61 ? 641 GLU A C   1 
ATOM   4999 O  O   . GLU A 1 641 ? 18.848  -40.329 -10.082 1.00 143.28 ? 641 GLU A O   1 
ATOM   5000 C  CB  . GLU A 1 641 ? 17.210  -42.082 -12.039 1.00 235.36 ? 641 GLU A CB  1 
ATOM   5001 C  CG  . GLU A 1 641 ? 18.225  -43.085 -11.538 1.00 235.24 ? 641 GLU A CG  1 
ATOM   5002 C  CD  . GLU A 1 641 ? 18.307  -44.315 -12.414 1.00 213.45 ? 641 GLU A CD  1 
ATOM   5003 O  OE1 . GLU A 1 641 ? 17.246  -44.788 -12.881 1.00 215.33 ? 641 GLU A OE1 1 
ATOM   5004 O  OE2 . GLU A 1 641 ? 19.433  -44.809 -12.632 1.00 215.19 ? 641 GLU A OE2 1 
ATOM   5005 N  N   . SER A 1 642 ? 17.647  -38.800 -11.191 1.00 154.68 ? 642 SER A N   1 
ATOM   5006 C  CA  . SER A 1 642 ? 18.609  -37.734 -10.897 1.00 156.28 ? 642 SER A CA  1 
ATOM   5007 C  C   . SER A 1 642 ? 17.946  -36.361 -10.791 1.00 157.45 ? 642 SER A C   1 
ATOM   5008 O  O   . SER A 1 642 ? 17.750  -35.690 -11.801 1.00 160.21 ? 642 SER A O   1 
ATOM   5009 C  CB  . SER A 1 642 ? 19.725  -37.707 -11.943 1.00 371.97 ? 642 SER A CB  1 
ATOM   5010 O  OG  . SER A 1 642 ? 20.534  -38.865 -11.843 1.00 371.32 ? 642 SER A OG  1 
ATOM   5011 N  N   . ILE A 1 643 ? 17.606  -35.957 -9.563  1.00 125.44 ? 643 ILE A N   1 
ATOM   5012 C  CA  . ILE A 1 643 ? 16.943  -34.676 -9.297  1.00 127.37 ? 643 ILE A CA  1 
ATOM   5013 C  C   . ILE A 1 643 ? 17.833  -33.519 -9.722  1.00 131.93 ? 643 ILE A C   1 
ATOM   5014 O  O   . ILE A 1 643 ? 17.372  -32.479 -10.200 1.00 134.64 ? 643 ILE A O   1 
ATOM   5015 C  CB  . ILE A 1 643 ? 16.630  -34.498 -7.795  1.00 112.20 ? 643 ILE A CB  1 
ATOM   5016 C  CG1 . ILE A 1 643 ? 15.719  -35.612 -7.288  1.00 107.67 ? 643 ILE A CG1 1 
ATOM   5017 C  CG2 . ILE A 1 643 ? 16.001  -33.152 -7.552  1.00 115.58 ? 643 ILE A CG2 1 
ATOM   5018 C  CD1 . ILE A 1 643 ? 15.296  -35.433 -5.863  1.00 106.12 ? 643 ILE A CD1 1 
ATOM   5019 N  N   . THR A 1 644 ? 19.125  -33.724 -9.530  1.00 128.88 ? 644 THR A N   1 
ATOM   5020 C  CA  . THR A 1 644 ? 20.109  -32.710 -9.812  1.00 132.66 ? 644 THR A CA  1 
ATOM   5021 C  C   . THR A 1 644 ? 20.151  -32.454 -11.308 1.00 135.14 ? 644 THR A C   1 
ATOM   5022 O  O   . THR A 1 644 ? 20.192  -31.298 -11.728 1.00 137.03 ? 644 THR A O   1 
ATOM   5023 C  CB  . THR A 1 644 ? 21.483  -33.161 -9.311  1.00 165.24 ? 644 THR A CB  1 
ATOM   5024 O  OG1 . THR A 1 644 ? 21.359  -34.453 -8.696  1.00 134.53 ? 644 THR A OG1 1 
ATOM   5025 C  CG2 . THR A 1 644 ? 22.027  -32.168 -8.296  1.00 141.81 ? 644 THR A CG2 1 
ATOM   5026 N  N   . ASN A 1 645 ? 20.106  -33.536 -12.101 1.00 137.58 ? 645 ASN A N   1 
ATOM   5027 C  CA  . ASN A 1 645 ? 20.348  -33.486 -13.557 1.00 140.35 ? 645 ASN A CA  1 
ATOM   5028 C  C   . ASN A 1 645 ? 19.088  -33.463 -14.431 1.00 140.61 ? 645 ASN A C   1 
ATOM   5029 O  O   . ASN A 1 645 ? 19.095  -32.931 -15.542 1.00 143.80 ? 645 ASN A O   1 
ATOM   5030 C  CB  . ASN A 1 645 ? 21.267  -34.632 -13.993 1.00 183.84 ? 645 ASN A CB  1 
ATOM   5031 C  CG  . ASN A 1 645 ? 22.479  -34.792 -13.087 1.00 183.61 ? 645 ASN A CG  1 
ATOM   5032 O  OD1 . ASN A 1 645 ? 23.504  -34.125 -13.262 1.00 160.91 ? 645 ASN A OD1 1 
ATOM   5033 N  ND2 . ASN A 1 645 ? 22.365  -35.688 -12.114 1.00 154.95 ? 645 ASN A ND2 1 
ATOM   5034 N  N   . GLY A 1 646 ? 18.011  -34.044 -13.922 1.00 136.03 ? 646 GLY A N   1 
ATOM   5035 C  CA  . GLY A 1 646 ? 16.717  -33.971 -14.575 1.00 136.26 ? 646 GLY A CA  1 
ATOM   5036 C  C   . GLY A 1 646 ? 16.346  -35.276 -15.236 1.00 134.83 ? 646 GLY A C   1 
ATOM   5037 O  O   . GLY A 1 646 ? 15.454  -35.324 -16.081 1.00 135.69 ? 646 GLY A O   1 
ATOM   5038 N  N   . LYS A 1 647 ? 17.032  -36.341 -14.833 1.00 147.23 ? 647 LYS A N   1 
ATOM   5039 C  CA  . LYS A 1 647 ? 16.957  -37.631 -15.510 1.00 147.46 ? 647 LYS A CA  1 
ATOM   5040 C  C   . LYS A 1 647 ? 15.866  -38.508 -14.921 1.00 144.35 ? 647 LYS A C   1 
ATOM   5041 O  O   . LYS A 1 647 ? 16.016  -39.049 -13.819 1.00 141.49 ? 647 LYS A O   1 
ATOM   5042 C  CB  . LYS A 1 647 ? 18.308  -38.342 -15.425 1.00 199.83 ? 647 LYS A CB  1 
ATOM   5043 C  CG  . LYS A 1 647 ? 18.439  -39.605 -16.251 1.00 202.07 ? 647 LYS A CG  1 
ATOM   5044 C  CD  . LYS A 1 647 ? 19.799  -40.233 -15.989 1.00 203.68 ? 647 LYS A CD  1 
ATOM   5045 C  CE  . LYS A 1 647 ? 20.096  -41.393 -16.918 1.00 180.78 ? 647 LYS A CE  1 
ATOM   5046 N  NZ  . LYS A 1 647 ? 21.540  -41.791 -16.855 1.00 183.33 ? 647 LYS A NZ  1 
ATOM   5047 N  N   . PHE A 1 648 ? 14.770  -38.632 -15.676 1.00 118.40 ? 648 PHE A N   1 
ATOM   5048 C  CA  . PHE A 1 648 ? 13.633  -39.498 -15.343 1.00 116.32 ? 648 PHE A CA  1 
ATOM   5049 C  C   . PHE A 1 648 ? 13.023  -40.204 -16.574 1.00 119.25 ? 648 PHE A C   1 
ATOM   5050 O  O   . PHE A 1 648 ? 13.263  -39.830 -17.728 1.00 122.57 ? 648 PHE A O   1 
ATOM   5051 C  CB  . PHE A 1 648 ? 12.545  -38.718 -14.580 1.00 129.73 ? 648 PHE A CB  1 
ATOM   5052 C  CG  . PHE A 1 648 ? 12.067  -37.480 -15.291 1.00 131.69 ? 648 PHE A CG  1 
ATOM   5053 C  CD1 . PHE A 1 648 ? 11.170  -37.567 -16.347 1.00 132.92 ? 648 PHE A CD1 1 
ATOM   5054 C  CD2 . PHE A 1 648 ? 12.514  -36.231 -14.905 1.00 132.84 ? 648 PHE A CD2 1 
ATOM   5055 C  CE1 . PHE A 1 648 ? 10.734  -36.433 -17.003 1.00 135.03 ? 648 PHE A CE1 1 
ATOM   5056 C  CE2 . PHE A 1 648 ? 12.087  -35.098 -15.557 1.00 135.42 ? 648 PHE A CE2 1 
ATOM   5057 C  CZ  . PHE A 1 648 ? 11.194  -35.199 -16.607 1.00 136.32 ? 648 PHE A CZ  1 
ATOM   5058 N  N   . TYR A 1 649 ? 12.226  -41.231 -16.308 1.00 144.11 ? 649 TYR A N   1 
ATOM   5059 C  CA  . TYR A 1 649 ? 11.569  -41.962 -17.367 1.00 147.48 ? 649 TYR A CA  1 
ATOM   5060 C  C   . TYR A 1 649 ? 10.062  -41.897 -17.174 1.00 145.64 ? 649 TYR A C   1 
ATOM   5061 O  O   . TYR A 1 649 ? 9.509   -42.593 -16.331 1.00 143.07 ? 649 TYR A O   1 
ATOM   5062 C  CB  . TYR A 1 649 ? 12.041  -43.411 -17.371 1.00 196.41 ? 649 TYR A CB  1 
ATOM   5063 C  CG  . TYR A 1 649 ? 13.532  -43.573 -17.153 1.00 197.04 ? 649 TYR A CG  1 
ATOM   5064 C  CD1 . TYR A 1 649 ? 14.018  -44.272 -16.057 1.00 168.17 ? 649 TYR A CD1 1 
ATOM   5065 C  CD2 . TYR A 1 649 ? 14.456  -43.026 -18.038 1.00 173.45 ? 649 TYR A CD2 1 
ATOM   5066 C  CE1 . TYR A 1 649 ? 15.384  -44.430 -15.852 1.00 168.87 ? 649 TYR A CE1 1 
ATOM   5067 C  CE2 . TYR A 1 649 ? 15.826  -43.179 -17.837 1.00 174.17 ? 649 TYR A CE2 1 
ATOM   5068 C  CZ  . TYR A 1 649 ? 16.276  -43.882 -16.743 1.00 171.89 ? 649 TYR A CZ  1 
ATOM   5069 O  OH  . TYR A 1 649 ? 17.620  -44.039 -16.531 1.00 172.68 ? 649 TYR A OH  1 
ATOM   5070 N  N   . TYR A 1 650 ? 9.404   -41.057 -17.964 1.00 162.52 ? 650 TYR A N   1 
ATOM   5071 C  CA  . TYR A 1 650 ? 7.957   -40.892 -17.898 1.00 161.22 ? 650 TYR A CA  1 
ATOM   5072 C  C   . TYR A 1 650 ? 7.223   -42.073 -18.552 1.00 163.59 ? 650 TYR A C   1 
ATOM   5073 O  O   . TYR A 1 650 ? 7.062   -42.108 -19.769 1.00 167.29 ? 650 TYR A O   1 
ATOM   5074 C  CB  . TYR A 1 650 ? 7.568   -39.550 -18.546 1.00 152.65 ? 650 TYR A CB  1 
ATOM   5075 C  CG  . TYR A 1 650 ? 6.089   -39.227 -18.556 1.00 124.93 ? 650 TYR A CG  1 
ATOM   5076 C  CD1 . TYR A 1 650 ? 5.411   -38.893 -17.391 1.00 148.47 ? 650 TYR A CD1 1 
ATOM   5077 C  CD2 . TYR A 1 650 ? 5.375   -39.234 -19.741 1.00 127.62 ? 650 TYR A CD2 1 
ATOM   5078 C  CE1 . TYR A 1 650 ? 4.054   -38.597 -17.408 1.00 121.05 ? 650 TYR A CE1 1 
ATOM   5079 C  CE2 . TYR A 1 650 ? 4.015   -38.940 -19.770 1.00 126.85 ? 650 TYR A CE2 1 
ATOM   5080 C  CZ  . TYR A 1 650 ? 3.357   -38.621 -18.604 1.00 123.54 ? 650 TYR A CZ  1 
ATOM   5081 O  OH  . TYR A 1 650 ? 2.006   -38.332 -18.665 1.00 123.15 ? 650 TYR A OH  1 
ATOM   5082 N  N   . ASN A 1 651 ? 6.800   -43.046 -17.741 1.00 130.34 ? 651 ASN A N   1 
ATOM   5083 C  CA  . ASN A 1 651 ? 5.992   -44.182 -18.213 1.00 133.05 ? 651 ASN A CA  1 
ATOM   5084 C  C   . ASN A 1 651 ? 4.512   -43.844 -18.410 1.00 132.39 ? 651 ASN A C   1 
ATOM   5085 O  O   . ASN A 1 651 ? 3.841   -43.458 -17.464 1.00 128.46 ? 651 ASN A O   1 
ATOM   5086 C  CB  . ASN A 1 651 ? 6.074   -45.348 -17.227 1.00 193.47 ? 651 ASN A CB  1 
ATOM   5087 C  CG  . ASN A 1 651 ? 7.362   -46.116 -17.337 1.00 169.61 ? 651 ASN A CG  1 
ATOM   5088 O  OD1 . ASN A 1 651 ? 8.410   -45.547 -17.635 1.00 170.16 ? 651 ASN A OD1 1 
ATOM   5089 N  ND2 . ASN A 1 651 ? 7.295   -47.422 -17.101 1.00 171.89 ? 651 ASN A ND2 1 
ATOM   5090 N  N   . GLU A 1 652 ? 3.983   -44.014 -19.613 1.00 129.28 ? 652 GLU A N   1 
ATOM   5091 C  CA  . GLU A 1 652 ? 2.601   -43.625 -19.853 1.00 128.89 ? 652 GLU A CA  1 
ATOM   5092 C  C   . GLU A 1 652 ? 1.629   -44.778 -19.615 1.00 129.74 ? 652 GLU A C   1 
ATOM   5093 O  O   . GLU A 1 652 ? 1.799   -45.842 -20.189 1.00 134.33 ? 652 GLU A O   1 
ATOM   5094 C  CB  . GLU A 1 652 ? 2.457   -43.094 -21.276 1.00 246.75 ? 652 GLU A CB  1 
ATOM   5095 C  CG  . GLU A 1 652 ? 1.228   -42.242 -21.486 1.00 245.87 ? 652 GLU A CG  1 
ATOM   5096 C  CD  . GLU A 1 652 ? 1.181   -41.649 -22.872 1.00 250.05 ? 652 GLU A CD  1 
ATOM   5097 O  OE1 . GLU A 1 652 ? 2.146   -41.865 -23.638 1.00 227.16 ? 652 GLU A OE1 1 
ATOM   5098 O  OE2 . GLU A 1 652 ? 0.181   -40.971 -23.194 1.00 223.70 ? 652 GLU A OE2 1 
ATOM   5099 N  N   . ILE A 1 653 ? 0.625   -44.570 -18.762 1.00 211.16 ? 653 ILE A N   1 
ATOM   5100 C  CA  . ILE A 1 653 ? -0.465  -45.537 -18.574 1.00 211.63 ? 653 ILE A CA  1 
ATOM   5101 C  C   . ILE A 1 653 ? -1.799  -44.812 -18.621 1.00 209.25 ? 653 ILE A C   1 
ATOM   5102 O  O   . ILE A 1 653 ? -1.854  -43.613 -18.376 1.00 204.85 ? 653 ILE A O   1 
ATOM   5103 C  CB  . ILE A 1 653 ? -0.439  -46.223 -17.197 1.00 124.02 ? 653 ILE A CB  1 
ATOM   5104 C  CG1 . ILE A 1 653 ? 0.950   -46.731 -16.838 1.00 125.08 ? 653 ILE A CG1 1 
ATOM   5105 C  CG2 . ILE A 1 653 ? -1.443  -47.358 -17.157 1.00 125.59 ? 653 ILE A CG2 1 
ATOM   5106 C  CD1 . ILE A 1 653 ? 1.862   -45.689 -16.314 1.00 122.04 ? 653 ILE A CD1 1 
ATOM   5107 N  N   . ASP A 1 654 ? -2.878  -45.542 -18.891 1.00 138.15 ? 654 ASP A N   1 
ATOM   5108 C  CA  . ASP A 1 654 ? -4.227  -44.952 -18.940 1.00 136.19 ? 654 ASP A CA  1 
ATOM   5109 C  C   . ASP A 1 654 ? -4.214  -43.448 -19.216 1.00 133.68 ? 654 ASP A C   1 
ATOM   5110 O  O   . ASP A 1 654 ? -4.310  -42.633 -18.306 1.00 129.24 ? 654 ASP A O   1 
ATOM   5111 C  CB  . ASP A 1 654 ? -5.020  -45.257 -17.664 1.00 151.52 ? 654 ASP A CB  1 
ATOM   5112 C  CG  . ASP A 1 654 ? -6.345  -45.948 -17.952 1.00 153.64 ? 654 ASP A CG  1 
ATOM   5113 O  OD1 . ASP A 1 654 ? -6.997  -45.609 -18.961 1.00 156.10 ? 654 ASP A OD1 1 
ATOM   5114 O  OD2 . ASP A 1 654 ? -6.729  -46.842 -17.173 1.00 153.15 ? 654 ASP A OD2 1 
ATOM   5115 N  N   . SER A 1 655 ? -4.090  -43.100 -20.491 1.00 148.87 ? 655 SER A N   1 
ATOM   5116 C  CA  . SER A 1 655 ? -3.983  -41.716 -20.914 1.00 147.56 ? 655 SER A CA  1 
ATOM   5117 C  C   . SER A 1 655 ? -5.149  -40.932 -20.377 1.00 144.78 ? 655 SER A C   1 
ATOM   5118 O  O   . SER A 1 655 ? -5.094  -39.710 -20.293 1.00 143.57 ? 655 SER A O   1 
ATOM   5119 C  CB  . SER A 1 655 ? -3.972  -41.632 -22.443 1.00 172.89 ? 655 SER A CB  1 
ATOM   5120 O  OG  . SER A 1 655 ? -5.185  -42.116 -22.993 1.00 152.42 ? 655 SER A OG  1 
ATOM   5121 N  N   . LYS A 1 656 ? -6.203  -41.649 -20.008 1.00 145.94 ? 656 LYS A N   1 
ATOM   5122 C  CA  . LYS A 1 656 ? -7.432  -41.018 -19.555 1.00 143.58 ? 656 LYS A CA  1 
ATOM   5123 C  C   . LYS A 1 656 ? -7.674  -41.084 -18.038 1.00 138.66 ? 656 LYS A C   1 
ATOM   5124 O  O   . LYS A 1 656 ? -8.812  -41.205 -17.598 1.00 137.71 ? 656 LYS A O   1 
ATOM   5125 C  CB  . LYS A 1 656 ? -8.632  -41.563 -20.337 1.00 131.32 ? 656 LYS A CB  1 
ATOM   5126 C  CG  . LYS A 1 656 ? -8.774  -43.073 -20.381 1.00 133.74 ? 656 LYS A CG  1 
ATOM   5127 C  CD  . LYS A 1 656 ? -9.749  -43.463 -21.504 1.00 117.44 ? 656 LYS A CD  1 
ATOM   5128 C  CE  . LYS A 1 656 ? -10.435 -44.823 -21.276 1.00 120.86 ? 656 LYS A CE  1 
ATOM   5129 N  NZ  . LYS A 1 656 ? -9.902  -46.028 -22.000 1.00 127.56 ? 656 LYS A NZ  1 
ATOM   5130 N  N   . ALA A 1 657 ? -6.608  -40.975 -17.245 1.00 151.62 ? 657 ALA A N   1 
ATOM   5131 C  CA  . ALA A 1 657 ? -6.721  -40.975 -15.782 1.00 146.95 ? 657 ALA A CA  1 
ATOM   5132 C  C   . ALA A 1 657 ? -6.220  -39.676 -15.180 1.00 144.88 ? 657 ALA A C   1 
ATOM   5133 O  O   . ALA A 1 657 ? -5.880  -38.743 -15.902 1.00 146.88 ? 657 ALA A O   1 
ATOM   5134 C  CB  . ALA A 1 657 ? -5.953  -42.126 -15.192 1.00 77.86  ? 657 ALA A CB  1 
ATOM   5135 N  N   . GLN A 1 658 ? -6.143  -39.621 -13.856 1.00 142.81 ? 658 GLN A N   1 
ATOM   5136 C  CA  . GLN A 1 658 ? -5.709  -38.387 -13.215 1.00 141.25 ? 658 GLN A CA  1 
ATOM   5137 C  C   . GLN A 1 658 ? -4.591  -38.507 -12.163 1.00 138.26 ? 658 GLN A C   1 
ATOM   5138 O  O   . GLN A 1 658 ? -4.069  -37.491 -11.703 1.00 138.85 ? 658 GLN A O   1 
ATOM   5139 C  CB  . GLN A 1 658 ? -6.909  -37.635 -12.625 1.00 277.94 ? 658 GLN A CB  1 
ATOM   5140 C  CG  . GLN A 1 658 ? -6.617  -36.168 -12.323 1.00 278.80 ? 658 GLN A CG  1 
ATOM   5141 C  CD  . GLN A 1 658 ? -7.687  -35.502 -11.476 1.00 279.33 ? 658 GLN A CD  1 
ATOM   5142 O  OE1 . GLN A 1 658 ? -8.770  -36.050 -11.277 1.00 279.43 ? 658 GLN A OE1 1 
ATOM   5143 N  NE2 . GLN A 1 658 ? -7.382  -34.314 -10.970 1.00 279.91 ? 658 GLN A NE2 1 
ATOM   5144 N  N   . ILE A 1 659 ? -4.202  -39.720 -11.791 1.00 126.24 ? 659 ILE A N   1 
ATOM   5145 C  CA  . ILE A 1 659 ? -3.272  -39.882 -10.667 1.00 123.12 ? 659 ILE A CA  1 
ATOM   5146 C  C   . ILE A 1 659 ? -1.838  -40.294 -11.045 1.00 123.23 ? 659 ILE A C   1 
ATOM   5147 O  O   . ILE A 1 659 ? -1.625  -41.359 -11.600 1.00 124.18 ? 659 ILE A O   1 
ATOM   5148 C  CB  . ILE A 1 659 ? -3.858  -40.854 -9.633  1.00 142.77 ? 659 ILE A CB  1 
ATOM   5149 C  CG1 . ILE A 1 659 ? -5.079  -40.214 -8.977  1.00 125.59 ? 659 ILE A CG1 1 
ATOM   5150 C  CG2 . ILE A 1 659 ? -2.824  -41.215 -8.589  1.00 124.35 ? 659 ILE A CG2 1 
ATOM   5151 C  CD1 . ILE A 1 659 ? -6.040  -41.200 -8.367  1.00 140.84 ? 659 ILE A CD1 1 
ATOM   5152 N  N   . TYR A 1 660 ? -0.853  -39.458 -10.735 1.00 120.62 ? 660 TYR A N   1 
ATOM   5153 C  CA  . TYR A 1 660 ? 0.526   -39.788 -11.099 1.00 120.52 ? 660 TYR A CA  1 
ATOM   5154 C  C   . TYR A 1 660 ? 1.263   -40.480 -9.961  1.00 117.42 ? 660 TYR A C   1 
ATOM   5155 O  O   . TYR A 1 660 ? 1.204   -40.025 -8.829  1.00 115.29 ? 660 TYR A O   1 
ATOM   5156 C  CB  . TYR A 1 660 ? 1.313   -38.525 -11.433 1.00 122.54 ? 660 TYR A CB  1 
ATOM   5157 C  CG  . TYR A 1 660 ? 0.922   -37.805 -12.692 1.00 125.19 ? 660 TYR A CG  1 
ATOM   5158 C  CD1 . TYR A 1 660 ? -0.197  -37.005 -12.728 1.00 125.86 ? 660 TYR A CD1 1 
ATOM   5159 C  CD2 . TYR A 1 660 ? 1.702   -37.884 -13.827 1.00 127.14 ? 660 TYR A CD2 1 
ATOM   5160 C  CE1 . TYR A 1 660 ? -0.548  -36.326 -13.870 1.00 128.83 ? 660 TYR A CE1 1 
ATOM   5161 C  CE2 . TYR A 1 660 ? 1.358   -37.209 -14.973 1.00 129.98 ? 660 TYR A CE2 1 
ATOM   5162 C  CZ  . TYR A 1 660 ? 0.230   -36.434 -14.992 1.00 130.75 ? 660 TYR A CZ  1 
ATOM   5163 O  OH  . TYR A 1 660 ? -0.128  -35.754 -16.133 1.00 133.62 ? 660 TYR A OH  1 
ATOM   5164 N  N   . LEU A 1 661 ? 1.993   -41.549 -10.250 1.00 129.05 ? 661 LEU A N   1 
ATOM   5165 C  CA  . LEU A 1 661 ? 2.852   -42.150 -9.230  1.00 126.40 ? 661 LEU A CA  1 
ATOM   5166 C  C   . LEU A 1 661 ? 4.308   -41.790 -9.510  1.00 127.06 ? 661 LEU A C   1 
ATOM   5167 O  O   . LEU A 1 661 ? 4.766   -41.928 -10.631 1.00 129.70 ? 661 LEU A O   1 
ATOM   5168 C  CB  . LEU A 1 661 ? 2.641   -43.672 -9.148  1.00 111.94 ? 661 LEU A CB  1 
ATOM   5169 C  CG  . LEU A 1 661 ? 3.638   -44.622 -8.462  1.00 98.27  ? 661 LEU A CG  1 
ATOM   5170 C  CD1 . LEU A 1 661 ? 4.411   -43.963 -7.352  1.00 107.05 ? 661 LEU A CD1 1 
ATOM   5171 C  CD2 . LEU A 1 661 ? 2.948   -45.859 -7.919  1.00 98.35  ? 661 LEU A CD2 1 
ATOM   5172 N  N   . LEU A 1 662 ? 5.022   -41.302 -8.496  1.00 132.88 ? 662 LEU A N   1 
ATOM   5173 C  CA  . LEU A 1 662 ? 6.439   -40.988 -8.654  1.00 133.36 ? 662 LEU A CA  1 
ATOM   5174 C  C   . LEU A 1 662 ? 7.272   -41.832 -7.729  1.00 131.07 ? 662 LEU A C   1 
ATOM   5175 O  O   . LEU A 1 662 ? 6.815   -42.236 -6.661  1.00 128.40 ? 662 LEU A O   1 
ATOM   5176 C  CB  . LEU A 1 662 ? 6.742   -39.541 -8.302  1.00 102.03 ? 662 LEU A CB  1 
ATOM   5177 C  CG  . LEU A 1 662 ? 5.905   -38.406 -8.868  1.00 103.64 ? 662 LEU A CG  1 
ATOM   5178 C  CD1 . LEU A 1 662 ? 6.330   -37.062 -8.258  1.00 94.78  ? 662 LEU A CD1 1 
ATOM   5179 C  CD2 . LEU A 1 662 ? 5.999   -38.389 -10.369 1.00 96.04  ? 662 LEU A CD2 1 
ATOM   5180 N  N   . PHE A 1 663 ? 8.514   -42.065 -8.141  1.00 136.15 ? 663 PHE A N   1 
ATOM   5181 C  CA  . PHE A 1 663 ? 9.510   -42.697 -7.292  1.00 134.58 ? 663 PHE A CA  1 
ATOM   5182 C  C   . PHE A 1 663 ? 10.793  -41.908 -7.353  1.00 135.72 ? 663 PHE A C   1 
ATOM   5183 O  O   . PHE A 1 663 ? 11.332  -41.661 -8.424  1.00 138.39 ? 663 PHE A O   1 
ATOM   5184 C  CB  . PHE A 1 663 ? 9.777   -44.137 -7.713  1.00 155.61 ? 663 PHE A CB  1 
ATOM   5185 C  CG  . PHE A 1 663 ? 10.684  -44.880 -6.775  1.00 154.41 ? 663 PHE A CG  1 
ATOM   5186 C  CD1 . PHE A 1 663 ? 10.229  -45.292 -5.544  1.00 151.53 ? 663 PHE A CD1 1 
ATOM   5187 C  CD2 . PHE A 1 663 ? 11.984  -45.168 -7.122  1.00 156.42 ? 663 PHE A CD2 1 
ATOM   5188 C  CE1 . PHE A 1 663 ? 11.038  -45.978 -4.682  1.00 150.85 ? 663 PHE A CE1 1 
ATOM   5189 C  CE2 . PHE A 1 663 ? 12.806  -45.854 -6.256  1.00 155.80 ? 663 PHE A CE2 1 
ATOM   5190 C  CZ  . PHE A 1 663 ? 12.328  -46.256 -5.034  1.00 152.97 ? 663 PHE A CZ  1 
ATOM   5191 N  N   . LEU A 1 664 ? 11.250  -41.505 -6.181  1.00 126.12 ? 664 LEU A N   1 
ATOM   5192 C  CA  . LEU A 1 664 ? 12.521  -40.849 -5.983  1.00 127.35 ? 664 LEU A CA  1 
ATOM   5193 C  C   . LEU A 1 664 ? 13.489  -41.910 -5.525  1.00 126.74 ? 664 LEU A C   1 
ATOM   5194 O  O   . LEU A 1 664 ? 13.373  -42.364 -4.379  1.00 124.43 ? 664 LEU A O   1 
ATOM   5195 C  CB  . LEU A 1 664 ? 12.372  -39.849 -4.861  1.00 117.36 ? 664 LEU A CB  1 
ATOM   5196 C  CG  . LEU A 1 664 ? 11.352  -38.760 -5.121  1.00 118.13 ? 664 LEU A CG  1 
ATOM   5197 C  CD1 . LEU A 1 664 ? 10.684  -38.375 -3.831  1.00 118.04 ? 664 LEU A CD1 1 
ATOM   5198 C  CD2 . LEU A 1 664 ? 12.050  -37.581 -5.748  1.00 121.58 ? 664 LEU A CD2 1 
ATOM   5199 N  N   . ARG A 1 665 ? 14.423  -42.312 -6.398  1.00 130.75 ? 665 ARG A N   1 
ATOM   5200 C  CA  . ARG A 1 665 ? 15.289  -43.468 -6.124  1.00 130.85 ? 665 ARG A CA  1 
ATOM   5201 C  C   . ARG A 1 665 ? 16.420  -43.045 -5.213  1.00 129.99 ? 665 ARG A C   1 
ATOM   5202 O  O   . ARG A 1 665 ? 16.992  -43.859 -4.492  1.00 128.90 ? 665 ARG A O   1 
ATOM   5203 C  CB  . ARG A 1 665 ? 15.836  -44.115 -7.412  1.00 223.43 ? 665 ARG A CB  1 
ATOM   5204 C  CG  . ARG A 1 665 ? 16.411  -45.526 -7.194  1.00 224.53 ? 665 ARG A CG  1 
ATOM   5205 C  CD  . ARG A 1 665 ? 17.288  -46.019 -8.358  1.00 229.18 ? 665 ARG A CD  1 
ATOM   5206 N  NE  . ARG A 1 665 ? 18.145  -47.144 -7.957  1.00 221.52 ? 665 ARG A NE  1 
ATOM   5207 C  CZ  . ARG A 1 665 ? 19.144  -47.651 -8.685  1.00 225.90 ? 665 ARG A CZ  1 
ATOM   5208 N  NH1 . ARG A 1 665 ? 19.439  -47.145 -9.875  1.00 228.82 ? 665 ARG A NH1 1 
ATOM   5209 N  NH2 . ARG A 1 665 ? 19.858  -48.670 -8.220  1.00 227.75 ? 665 ARG A NH2 1 
ATOM   5210 N  N   . GLU A 1 666 ? 16.716  -41.753 -5.240  1.00 130.86 ? 666 GLU A N   1 
ATOM   5211 C  CA  . GLU A 1 666 ? 17.752  -41.197 -4.401  1.00 130.66 ? 666 GLU A CA  1 
ATOM   5212 C  C   . GLU A 1 666 ? 17.287  -41.112 -2.949  1.00 127.87 ? 666 GLU A C   1 
ATOM   5213 O  O   . GLU A 1 666 ? 18.102  -41.038 -2.043  1.00 127.65 ? 666 GLU A O   1 
ATOM   5214 C  CB  . GLU A 1 666 ? 18.143  -39.816 -4.908  1.00 151.70 ? 666 GLU A CB  1 
ATOM   5215 C  CG  . GLU A 1 666 ? 18.056  -39.667 -6.406  1.00 154.71 ? 666 GLU A CG  1 
ATOM   5216 C  CD  . GLU A 1 666 ? 18.625  -38.348 -6.894  1.00 148.21 ? 666 GLU A CD  1 
ATOM   5217 O  OE1 . GLU A 1 666 ? 19.691  -37.923 -6.395  1.00 148.32 ? 666 GLU A OE1 1 
ATOM   5218 O  OE2 . GLU A 1 666 ? 18.003  -37.731 -7.779  1.00 150.78 ? 666 GLU A OE2 1 
ATOM   5219 N  N   . TYR A 1 667 ? 15.977  -41.116 -2.727  1.00 108.50 ? 667 TYR A N   1 
ATOM   5220 C  CA  . TYR A 1 667 ? 15.424  -41.103 -1.372  1.00 105.93 ? 667 TYR A CA  1 
ATOM   5221 C  C   . TYR A 1 667 ? 14.588  -42.344 -1.082  1.00 103.20 ? 667 TYR A C   1 
ATOM   5222 O  O   . TYR A 1 667 ? 13.880  -42.391 -0.086  1.00 101.36 ? 667 TYR A O   1 
ATOM   5223 C  CB  . TYR A 1 667 ? 14.537  -39.879 -1.161  1.00 97.86  ? 667 TYR A CB  1 
ATOM   5224 C  CG  . TYR A 1 667 ? 15.257  -38.556 -1.126  1.00 101.19 ? 667 TYR A CG  1 
ATOM   5225 C  CD1 . TYR A 1 667 ? 15.366  -37.769 -2.260  1.00 104.34 ? 667 TYR A CD1 1 
ATOM   5226 C  CD2 . TYR A 1 667 ? 15.807  -38.085 0.052   1.00 102.20 ? 667 TYR A CD2 1 
ATOM   5227 C  CE1 . TYR A 1 667 ? 16.022  -36.551 -2.219  1.00 108.08 ? 667 TYR A CE1 1 
ATOM   5228 C  CE2 . TYR A 1 667 ? 16.468  -36.877 0.107   1.00 106.38 ? 667 TYR A CE2 1 
ATOM   5229 C  CZ  . TYR A 1 667 ? 16.575  -36.109 -1.026  1.00 109.30 ? 667 TYR A CZ  1 
ATOM   5230 O  OH  . TYR A 1 667 ? 17.230  -34.899 -0.954  1.00 114.06 ? 667 TYR A OH  1 
ATOM   5231 N  N   . LYS A 1 668 ? 14.672  -43.339 -1.962  1.00 127.00 ? 668 LYS A N   1 
ATOM   5232 C  CA  . LYS A 1 668 ? 13.816  -44.525 -1.904  1.00 125.38 ? 668 LYS A CA  1 
ATOM   5233 C  C   . LYS A 1 668 ? 12.423  -44.165 -1.441  1.00 123.33 ? 668 LYS A C   1 
ATOM   5234 O  O   . LYS A 1 668 ? 11.871  -44.836 -0.581  1.00 121.76 ? 668 LYS A O   1 
ATOM   5235 C  CB  . LYS A 1 668 ? 14.417  -45.605 -1.004  1.00 202.12 ? 668 LYS A CB  1 
ATOM   5236 C  CG  . LYS A 1 668 ? 15.455  -46.470 -1.702  1.00 196.80 ? 668 LYS A CG  1 
ATOM   5237 C  CD  . LYS A 1 668 ? 16.313  -47.219 -0.699  1.00 197.02 ? 668 LYS A CD  1 
ATOM   5238 C  CE  . LYS A 1 668 ? 17.405  -48.020 -1.386  1.00 200.16 ? 668 LYS A CE  1 
ATOM   5239 N  NZ  . LYS A 1 668 ? 18.410  -48.504 -0.403  1.00 200.66 ? 668 LYS A NZ  1 
ATOM   5240 N  N   . SER A 1 669 ? 11.852  -43.110 -2.020  1.00 134.85 ? 669 SER A N   1 
ATOM   5241 C  CA  . SER A 1 669 ? 10.554  -42.628 -1.549  1.00 133.43 ? 669 SER A CA  1 
ATOM   5242 C  C   . SER A 1 669 ? 9.504   -42.488 -2.647  1.00 134.44 ? 669 SER A C   1 
ATOM   5243 O  O   . SER A 1 669 ? 9.793   -42.012 -3.731  1.00 136.57 ? 669 SER A O   1 
ATOM   5244 C  CB  . SER A 1 669 ? 10.712  -41.303 -0.797  1.00 122.06 ? 669 SER A CB  1 
ATOM   5245 O  OG  . SER A 1 669 ? 9.554   -41.002 -0.026  1.00 111.33 ? 669 SER A OG  1 
ATOM   5246 N  N   . PHE A 1 670 ? 8.277   -42.897 -2.335  1.00 127.10 ? 670 PHE A N   1 
ATOM   5247 C  CA  . PHE A 1 670 ? 7.175   -42.853 -3.281  1.00 128.06 ? 670 PHE A CA  1 
ATOM   5248 C  C   . PHE A 1 670 ? 6.335   -41.616 -3.079  1.00 128.46 ? 670 PHE A C   1 
ATOM   5249 O  O   . PHE A 1 670 ? 6.132   -41.168 -1.945  1.00 127.73 ? 670 PHE A O   1 
ATOM   5250 C  CB  . PHE A 1 670 ? 6.276   -44.067 -3.093  1.00 138.56 ? 670 PHE A CB  1 
ATOM   5251 C  CG  . PHE A 1 670 ? 6.773   -45.299 -3.767  1.00 139.27 ? 670 PHE A CG  1 
ATOM   5252 C  CD1 . PHE A 1 670 ? 6.688   -46.527 -3.139  1.00 138.09 ? 670 PHE A CD1 1 
ATOM   5253 C  CD2 . PHE A 1 670 ? 7.308   -45.241 -5.039  1.00 141.59 ? 670 PHE A CD2 1 
ATOM   5254 C  CE1 . PHE A 1 670 ? 7.147   -47.667 -3.763  1.00 139.80 ? 670 PHE A CE1 1 
ATOM   5255 C  CE2 . PHE A 1 670 ? 7.763   -46.380 -5.666  1.00 143.29 ? 670 PHE A CE2 1 
ATOM   5256 C  CZ  . PHE A 1 670 ? 7.691   -47.589 -5.027  1.00 142.75 ? 670 PHE A CZ  1 
ATOM   5257 N  N   . VAL A 1 671 ? 5.821   -41.098 -4.186  1.00 118.80 ? 671 VAL A N   1 
ATOM   5258 C  CA  . VAL A 1 671 ? 4.921   -39.958 -4.182  1.00 119.87 ? 671 VAL A CA  1 
ATOM   5259 C  C   . VAL A 1 671 ? 3.670   -40.274 -5.006  1.00 120.16 ? 671 VAL A C   1 
ATOM   5260 O  O   . VAL A 1 671 ? 3.709   -41.100 -5.915  1.00 120.49 ? 671 VAL A O   1 
ATOM   5261 C  CB  . VAL A 1 671 ? 5.614   -38.730 -4.766  1.00 89.23  ? 671 VAL A CB  1 
ATOM   5262 C  CG1 . VAL A 1 671 ? 4.664   -37.562 -4.836  1.00 91.37  ? 671 VAL A CG1 1 
ATOM   5263 C  CG2 . VAL A 1 671 ? 6.807   -38.386 -3.944  1.00 89.15  ? 671 VAL A CG2 1 
ATOM   5264 N  N   . ILE A 1 672 ? 2.569   -39.604 -4.693  1.00 106.34 ? 672 ILE A N   1 
ATOM   5265 C  CA  . ILE A 1 672 ? 1.296   -39.825 -5.361  1.00 106.69 ? 672 ILE A CA  1 
ATOM   5266 C  C   . ILE A 1 672 ? 0.615   -38.475 -5.592  1.00 109.16 ? 672 ILE A C   1 
ATOM   5267 O  O   . ILE A 1 672 ? 0.157   -37.854 -4.647  1.00 109.15 ? 672 ILE A O   1 
ATOM   5268 C  CB  . ILE A 1 672 ? 0.402   -40.697 -4.483  1.00 98.90  ? 672 ILE A CB  1 
ATOM   5269 C  CG1 . ILE A 1 672 ? 0.891   -42.144 -4.498  1.00 91.16  ? 672 ILE A CG1 1 
ATOM   5270 C  CG2 . ILE A 1 672 ? -1.011  -40.622 -4.938  1.00 93.76  ? 672 ILE A CG2 1 
ATOM   5271 C  CD1 . ILE A 1 672 ? 0.118   -43.058 -3.572  1.00 95.28  ? 672 ILE A CD1 1 
ATOM   5272 N  N   . LEU A 1 673 ? 0.556   -38.017 -6.837  1.00 126.38 ? 673 LEU A N   1 
ATOM   5273 C  CA  . LEU A 1 673 ? 0.017   -36.692 -7.144  1.00 129.65 ? 673 LEU A CA  1 
ATOM   5274 C  C   . LEU A 1 673 ? -1.244  -36.703 -7.990  1.00 130.36 ? 673 LEU A C   1 
ATOM   5275 O  O   . LEU A 1 673 ? -1.648  -37.728 -8.542  1.00 128.55 ? 673 LEU A O   1 
ATOM   5276 C  CB  . LEU A 1 673 ? 1.040   -35.894 -7.937  1.00 239.73 ? 673 LEU A CB  1 
ATOM   5277 C  CG  . LEU A 1 673 ? 2.349   -35.606 -7.243  1.00 81.21  ? 673 LEU A CG  1 
ATOM   5278 C  CD1 . LEU A 1 673 ? 3.361   -35.066 -8.233  1.00 236.43 ? 673 LEU A CD1 1 
ATOM   5279 C  CD2 . LEU A 1 673 ? 2.099   -34.620 -6.142  1.00 235.87 ? 673 LEU A CD2 1 
ATOM   5280 N  N   . ASP A 1 674 ? -1.837  -35.526 -8.127  1.00 115.66 ? 674 ASP A N   1 
ATOM   5281 C  CA  . ASP A 1 674 ? -2.838  -35.292 -9.156  1.00 117.50 ? 674 ASP A CA  1 
ATOM   5282 C  C   . ASP A 1 674 ? -2.275  -34.288 -10.164 1.00 121.40 ? 674 ASP A C   1 
ATOM   5283 O  O   . ASP A 1 674 ? -1.367  -33.531 -9.840  1.00 123.56 ? 674 ASP A O   1 
ATOM   5284 C  CB  . ASP A 1 674 ? -4.156  -34.805 -8.546  1.00 151.48 ? 674 ASP A CB  1 
ATOM   5285 C  CG  . ASP A 1 674 ? -4.028  -33.455 -7.865  1.00 155.51 ? 674 ASP A CG  1 
ATOM   5286 O  OD1 . ASP A 1 674 ? -3.473  -32.524 -8.486  1.00 159.00 ? 674 ASP A OD1 1 
ATOM   5287 O  OD2 . ASP A 1 674 ? -4.490  -33.324 -6.709  1.00 156.23 ? 674 ASP A OD2 1 
ATOM   5288 N  N   . GLU A 1 675 ? -2.808  -34.285 -11.380 1.00 124.33 ? 675 GLU A N   1 
ATOM   5289 C  CA  . GLU A 1 675 ? -2.251  -33.476 -12.461 1.00 127.78 ? 675 GLU A CA  1 
ATOM   5290 C  C   . GLU A 1 675 ? -1.698  -32.124 -12.030 1.00 131.04 ? 675 GLU A C   1 
ATOM   5291 O  O   . GLU A 1 675 ? -0.594  -31.744 -12.424 1.00 133.03 ? 675 GLU A O   1 
ATOM   5292 C  CB  . GLU A 1 675 ? -3.291  -33.258 -13.553 1.00 142.59 ? 675 GLU A CB  1 
ATOM   5293 C  CG  . GLU A 1 675 ? -3.603  -34.491 -14.353 1.00 141.41 ? 675 GLU A CG  1 
ATOM   5294 C  CD  . GLU A 1 675 ? -3.649  -34.213 -15.838 1.00 145.11 ? 675 GLU A CD  1 
ATOM   5295 O  OE1 . GLU A 1 675 ? -2.668  -33.633 -16.367 1.00 140.19 ? 675 GLU A OE1 1 
ATOM   5296 O  OE2 . GLU A 1 675 ? -4.673  -34.575 -16.466 1.00 138.97 ? 675 GLU A OE2 1 
ATOM   5297 N  N   . SER A 1 676 ? -2.466  -31.396 -11.225 1.00 146.26 ? 676 SER A N   1 
ATOM   5298 C  CA  . SER A 1 676 ? -2.132  -30.007 -10.902 1.00 150.88 ? 676 SER A CA  1 
ATOM   5299 C  C   . SER A 1 676 ? -1.003  -29.871 -9.882  1.00 150.51 ? 676 SER A C   1 
ATOM   5300 O  O   . SER A 1 676 ? -0.329  -28.838 -9.821  1.00 152.79 ? 676 SER A O   1 
ATOM   5301 C  CB  . SER A 1 676 ? -3.373  -29.228 -10.442 1.00 118.98 ? 676 SER A CB  1 
ATOM   5302 O  OG  . SER A 1 676 ? -3.778  -29.584 -9.131  1.00 111.66 ? 676 SER A OG  1 
ATOM   5303 N  N   . LEU A 1 677 ? -0.806  -30.909 -9.078  1.00 111.41 ? 677 LEU A N   1 
ATOM   5304 C  CA  . LEU A 1 677 ? 0.349   -30.955 -8.188  1.00 110.36 ? 677 LEU A CA  1 
ATOM   5305 C  C   . LEU A 1 677 ? 1.573   -31.460 -8.969  1.00 108.46 ? 677 LEU A C   1 
ATOM   5306 O  O   . LEU A 1 677 ? 2.696   -30.968 -8.792  1.00 110.22 ? 677 LEU A O   1 
ATOM   5307 C  CB  . LEU A 1 677 ? 0.070   -31.816 -6.952  1.00 89.31  ? 677 LEU A CB  1 
ATOM   5308 C  CG  . LEU A 1 677 ? -0.916  -31.306 -5.894  1.00 91.70  ? 677 LEU A CG  1 
ATOM   5309 C  CD1 . LEU A 1 677 ? -0.842  -32.218 -4.702  1.00 79.75  ? 677 LEU A CD1 1 
ATOM   5310 C  CD2 . LEU A 1 677 ? -0.656  -29.845 -5.487  1.00 91.50  ? 677 LEU A CD2 1 
ATOM   5311 N  N   . TYR A 1 678 ? 1.347   -32.431 -9.851  1.00 105.28 ? 678 TYR A N   1 
ATOM   5312 C  CA  . TYR A 1 678 ? 2.361   -32.786 -10.827 1.00 104.57 ? 678 TYR A CA  1 
ATOM   5313 C  C   . TYR A 1 678 ? 2.856   -31.548 -11.582 1.00 109.03 ? 678 TYR A C   1 
ATOM   5314 O  O   . TYR A 1 678 ? 4.022   -31.483 -11.947 1.00 109.50 ? 678 TYR A O   1 
ATOM   5315 C  CB  . TYR A 1 678 ? 1.867   -33.850 -11.817 1.00 126.14 ? 678 TYR A CB  1 
ATOM   5316 C  CG  . TYR A 1 678 ? 2.996   -34.385 -12.670 1.00 125.97 ? 678 TYR A CG  1 
ATOM   5317 C  CD1 . TYR A 1 678 ? 3.659   -35.557 -12.329 1.00 122.87 ? 678 TYR A CD1 1 
ATOM   5318 C  CD2 . TYR A 1 678 ? 3.437   -33.688 -13.786 1.00 129.04 ? 678 TYR A CD2 1 
ATOM   5319 C  CE1 . TYR A 1 678 ? 4.712   -36.032 -13.093 1.00 123.24 ? 678 TYR A CE1 1 
ATOM   5320 C  CE2 . TYR A 1 678 ? 4.493   -34.155 -14.552 1.00 129.41 ? 678 TYR A CE2 1 
ATOM   5321 C  CZ  . TYR A 1 678 ? 5.126   -35.324 -14.203 1.00 126.63 ? 678 TYR A CZ  1 
ATOM   5322 O  OH  . TYR A 1 678 ? 6.173   -35.780 -14.968 1.00 126.26 ? 678 TYR A OH  1 
ATOM   5323 N  N   . ASN A 1 679 ? 1.987   -30.566 -11.811 1.00 100.36 ? 679 ASN A N   1 
ATOM   5324 C  CA  . ASN A 1 679 ? 2.388   -29.395 -12.598 1.00 103.18 ? 679 ASN A CA  1 
ATOM   5325 C  C   . ASN A 1 679 ? 2.755   -28.141 -11.789 1.00 104.30 ? 679 ASN A C   1 
ATOM   5326 O  O   . ASN A 1 679 ? 3.188   -27.124 -12.339 1.00 107.07 ? 679 ASN A O   1 
ATOM   5327 C  CB  . ASN A 1 679 ? 1.366   -29.095 -13.705 1.00 132.53 ? 679 ASN A CB  1 
ATOM   5328 C  CG  . ASN A 1 679 ? 1.445   -30.092 -14.864 1.00 132.40 ? 679 ASN A CG  1 
ATOM   5329 O  OD1 . ASN A 1 679 ? 2.492   -30.269 -15.497 1.00 132.99 ? 679 ASN A OD1 1 
ATOM   5330 N  ND2 . ASN A 1 679 ? 0.335   -30.754 -15.136 1.00 131.08 ? 679 ASN A ND2 1 
ATOM   5331 N  N   . SER A 1 680 ? 2.609   -28.239 -10.476 1.00 113.88 ? 680 SER A N   1 
ATOM   5332 C  CA  . SER A 1 680 ? 2.984   -27.168 -9.567  1.00 115.24 ? 680 SER A CA  1 
ATOM   5333 C  C   . SER A 1 680 ? 4.469   -26.856 -9.677  1.00 115.39 ? 680 SER A C   1 
ATOM   5334 O  O   . SER A 1 680 ? 5.300   -27.760 -9.679  1.00 112.56 ? 680 SER A O   1 
ATOM   5335 C  CB  . SER A 1 680 ? 2.681   -27.611 -8.143  1.00 161.77 ? 680 SER A CB  1 
ATOM   5336 O  OG  . SER A 1 680 ? 3.416   -28.785 -7.840  1.00 157.87 ? 680 SER A OG  1 
ATOM   5337 N  N   . ALA A 1 681 ? 4.805   -25.574 -9.729  1.00 126.38 ? 681 ALA A N   1 
ATOM   5338 C  CA  . ALA A 1 681 ? 6.189   -25.148 -9.916  1.00 127.27 ? 681 ALA A CA  1 
ATOM   5339 C  C   . ALA A 1 681 ? 7.206   -25.895 -9.058  1.00 123.95 ? 681 ALA A C   1 
ATOM   5340 O  O   . ALA A 1 681 ? 8.372   -25.992 -9.410  1.00 123.81 ? 681 ALA A O   1 
ATOM   5341 C  CB  . ALA A 1 681 ? 6.313   -23.654 -9.708  1.00 84.44  ? 681 ALA A CB  1 
ATOM   5342 N  N   . TYR A 1 682 ? 6.772   -26.424 -7.930  1.00 133.95 ? 682 TYR A N   1 
ATOM   5343 C  CA  . TYR A 1 682 ? 7.693   -27.122 -7.056  1.00 131.09 ? 682 TYR A CA  1 
ATOM   5344 C  C   . TYR A 1 682 ? 7.999   -28.500 -7.612  1.00 127.53 ? 682 TYR A C   1 
ATOM   5345 O  O   . TYR A 1 682 ? 9.148   -28.798 -7.896  1.00 127.43 ? 682 TYR A O   1 
ATOM   5346 C  CB  . TYR A 1 682 ? 7.133   -27.195 -5.641  1.00 122.18 ? 682 TYR A CB  1 
ATOM   5347 C  CG  . TYR A 1 682 ? 7.917   -28.054 -4.688  1.00 118.60 ? 682 TYR A CG  1 
ATOM   5348 C  CD1 . TYR A 1 682 ? 9.000   -27.549 -3.997  1.00 115.88 ? 682 TYR A CD1 1 
ATOM   5349 C  CD2 . TYR A 1 682 ? 7.552   -29.366 -4.457  1.00 114.40 ? 682 TYR A CD2 1 
ATOM   5350 C  CE1 . TYR A 1 682 ? 9.705   -28.333 -3.114  1.00 111.49 ? 682 TYR A CE1 1 
ATOM   5351 C  CE2 . TYR A 1 682 ? 8.247   -30.155 -3.575  1.00 111.64 ? 682 TYR A CE2 1 
ATOM   5352 C  CZ  . TYR A 1 682 ? 9.322   -29.634 -2.908  1.00 109.29 ? 682 TYR A CZ  1 
ATOM   5353 O  OH  . TYR A 1 682 ? 10.012  -30.425 -2.030  1.00 104.77 ? 682 TYR A OH  1 
ATOM   5354 N  N   . ILE A 1 683 ? 6.981   -29.334 -7.795  1.00 120.22 ? 683 ILE A N   1 
ATOM   5355 C  CA  . ILE A 1 683 ? 7.224   -30.680 -8.317  1.00 117.68 ? 683 ILE A CA  1 
ATOM   5356 C  C   . ILE A 1 683 ? 7.895   -30.595 -9.675  1.00 119.41 ? 683 ILE A C   1 
ATOM   5357 O  O   . ILE A 1 683 ? 8.718   -31.437 -10.025 1.00 118.63 ? 683 ILE A O   1 
ATOM   5358 C  CB  . ILE A 1 683 ? 5.941   -31.541 -8.440  1.00 83.84  ? 683 ILE A CB  1 
ATOM   5359 C  CG1 . ILE A 1 683 ? 5.277   -31.728 -7.089  1.00 82.12  ? 683 ILE A CG1 1 
ATOM   5360 C  CG2 . ILE A 1 683 ? 6.295   -32.942 -8.972  1.00 79.18  ? 683 ILE A CG2 1 
ATOM   5361 C  CD1 . ILE A 1 683 ? 5.761   -32.960 -6.377  1.00 80.92  ? 683 ILE A CD1 1 
ATOM   5362 N  N   . GLN A 1 684 ? 7.540   -29.566 -10.432 1.00 95.48  ? 684 GLN A N   1 
ATOM   5363 C  CA  . GLN A 1 684 ? 8.089   -29.385 -11.763 1.00 97.39  ? 684 GLN A CA  1 
ATOM   5364 C  C   . GLN A 1 684 ? 9.556   -28.998 -11.699 1.00 98.26  ? 684 GLN A C   1 
ATOM   5365 O  O   . GLN A 1 684 ? 10.389  -29.658 -12.302 1.00 97.69  ? 684 GLN A O   1 
ATOM   5366 C  CB  . GLN A 1 684 ? 7.297   -28.335 -12.543 1.00 131.41 ? 684 GLN A CB  1 
ATOM   5367 C  CG  . GLN A 1 684 ? 6.057   -28.874 -13.211 1.00 130.97 ? 684 GLN A CG  1 
ATOM   5368 C  CD  . GLN A 1 684 ? 6.369   -30.047 -14.111 1.00 129.88 ? 684 GLN A CD  1 
ATOM   5369 O  OE1 . GLN A 1 684 ? 6.974   -29.882 -15.166 1.00 131.77 ? 684 GLN A OE1 1 
ATOM   5370 N  NE2 . GLN A 1 684 ? 5.974   -31.241 -13.694 1.00 126.61 ? 684 GLN A NE2 1 
ATOM   5371 N  N   . MET A 1 685 ? 9.865   -27.944 -10.948 1.00 114.98 ? 685 MET A N   1 
ATOM   5372 C  CA  . MET A 1 685 ? 11.202  -27.367 -10.913 1.00 116.94 ? 685 MET A CA  1 
ATOM   5373 C  C   . MET A 1 685 ? 12.170  -28.032 -9.950  1.00 114.51 ? 685 MET A C   1 
ATOM   5374 O  O   . MET A 1 685 ? 13.368  -27.811 -10.026 1.00 115.25 ? 685 MET A O   1 
ATOM   5375 C  CB  . MET A 1 685 ? 11.115  -25.894 -10.574 1.00 106.98 ? 685 MET A CB  1 
ATOM   5376 C  CG  . MET A 1 685 ? 10.477  -25.081 -11.632 1.00 111.53 ? 685 MET A CG  1 
ATOM   5377 S  SD  . MET A 1 685 ? 10.270  -23.415 -11.040 1.00 114.40 ? 685 MET A SD  1 
ATOM   5378 C  CE  . MET A 1 685 ? 11.951  -22.900 -10.764 1.00 110.17 ? 685 MET A CE  1 
ATOM   5379 N  N   . PHE A 1 686 ? 11.668  -28.834 -9.030  1.00 129.08 ? 686 PHE A N   1 
ATOM   5380 C  CA  . PHE A 1 686 ? 12.558  -29.493 -8.088  1.00 126.79 ? 686 PHE A CA  1 
ATOM   5381 C  C   . PHE A 1 686 ? 12.749  -30.959 -8.461  1.00 124.23 ? 686 PHE A C   1 
ATOM   5382 O  O   . PHE A 1 686 ? 13.830  -31.372 -8.874  1.00 124.98 ? 686 PHE A O   1 
ATOM   5383 C  CB  . PHE A 1 686 ? 12.028  -29.350 -6.659  1.00 127.26 ? 686 PHE A CB  1 
ATOM   5384 C  CG  . PHE A 1 686 ? 12.858  -30.049 -5.635  1.00 124.69 ? 686 PHE A CG  1 
ATOM   5385 C  CD1 . PHE A 1 686 ? 14.122  -29.606 -5.335  1.00 123.29 ? 686 PHE A CD1 1 
ATOM   5386 C  CD2 . PHE A 1 686 ? 12.370  -31.149 -4.971  1.00 121.04 ? 686 PHE A CD2 1 
ATOM   5387 C  CE1 . PHE A 1 686 ? 14.875  -30.250 -4.404  1.00 121.00 ? 686 PHE A CE1 1 
ATOM   5388 C  CE2 . PHE A 1 686 ? 13.120  -31.792 -4.037  1.00 118.84 ? 686 PHE A CE2 1 
ATOM   5389 C  CZ  . PHE A 1 686 ? 14.370  -31.347 -3.752  1.00 119.42 ? 686 PHE A CZ  1 
ATOM   5390 N  N   . LEU A 1 687 ? 11.684  -31.736 -8.327  1.00 144.98 ? 687 LEU A N   1 
ATOM   5391 C  CA  . LEU A 1 687 ? 11.727  -33.163 -8.609  1.00 142.14 ? 687 LEU A CA  1 
ATOM   5392 C  C   . LEU A 1 687 ? 12.121  -33.522 -10.054 1.00 143.09 ? 687 LEU A C   1 
ATOM   5393 O  O   . LEU A 1 687 ? 12.782  -34.536 -10.294 1.00 141.15 ? 687 LEU A O   1 
ATOM   5394 C  CB  . LEU A 1 687 ? 10.372  -33.786 -8.273  1.00 117.59 ? 687 LEU A CB  1 
ATOM   5395 C  CG  . LEU A 1 687 ? 10.084  -34.057 -6.808  1.00 114.52 ? 687 LEU A CG  1 
ATOM   5396 C  CD1 . LEU A 1 687 ? 8.934   -35.030 -6.681  1.00 110.84 ? 687 LEU A CD1 1 
ATOM   5397 C  CD2 . LEU A 1 687 ? 11.322  -34.619 -6.179  1.00 112.59 ? 687 LEU A CD2 1 
ATOM   5398 N  N   . LEU A 1 688 ? 11.703  -32.700 -11.013 1.00 103.01 ? 688 LEU A N   1 
ATOM   5399 C  CA  . LEU A 1 688 ? 11.904  -32.994 -12.428 1.00 104.36 ? 688 LEU A CA  1 
ATOM   5400 C  C   . LEU A 1 688 ? 12.951  -32.067 -13.051 1.00 108.42 ? 688 LEU A C   1 
ATOM   5401 O  O   . LEU A 1 688 ? 13.342  -32.223 -14.199 1.00 110.26 ? 688 LEU A O   1 
ATOM   5402 C  CB  . LEU A 1 688 ? 10.574  -32.871 -13.175 1.00 95.69  ? 688 LEU A CB  1 
ATOM   5403 C  CG  . LEU A 1 688 ? 9.403   -33.771 -12.754 1.00 92.26  ? 688 LEU A CG  1 
ATOM   5404 C  CD1 . LEU A 1 688 ? 8.162   -33.504 -13.621 1.00 93.64  ? 688 LEU A CD1 1 
ATOM   5405 C  CD2 . LEU A 1 688 ? 9.752   -35.256 -12.783 1.00 89.40  ? 688 LEU A CD2 1 
ATOM   5406 N  N   . ASN A 1 689 ? 13.393  -31.093 -12.272 1.00 169.75 ? 689 ASN A N   1 
ATOM   5407 C  CA  . ASN A 1 689 ? 14.397  -30.132 -12.708 1.00 172.52 ? 689 ASN A CA  1 
ATOM   5408 C  C   . ASN A 1 689 ? 14.130  -29.455 -14.049 1.00 175.24 ? 689 ASN A C   1 
ATOM   5409 O  O   . ASN A 1 689 ? 15.062  -29.156 -14.780 1.00 177.25 ? 689 ASN A O   1 
ATOM   5410 C  CB  . ASN A 1 689 ? 15.779  -30.770 -12.731 1.00 137.96 ? 689 ASN A CB  1 
ATOM   5411 C  CG  . ASN A 1 689 ? 16.872  -29.755 -12.964 1.00 140.46 ? 689 ASN A CG  1 
ATOM   5412 O  OD1 . ASN A 1 689 ? 16.664  -28.553 -12.804 1.00 142.35 ? 689 ASN A OD1 1 
ATOM   5413 N  ND2 . ASN A 1 689 ? 18.044  -30.228 -13.353 1.00 141.05 ? 689 ASN A ND2 1 
ATOM   5414 N  N   . GLN A 1 690 ? 12.867  -29.192 -14.365 1.00 122.83 ? 690 GLN A N   1 
ATOM   5415 C  CA  . GLN A 1 690 ? 12.526  -28.467 -15.587 1.00 125.68 ? 690 GLN A CA  1 
ATOM   5416 C  C   . GLN A 1 690 ? 11.929  -27.086 -15.344 1.00 127.79 ? 690 GLN A C   1 
ATOM   5417 O  O   . GLN A 1 690 ? 10.906  -26.951 -14.694 1.00 126.84 ? 690 GLN A O   1 
ATOM   5418 C  CB  . GLN A 1 690 ? 11.564  -29.289 -16.417 1.00 189.36 ? 690 GLN A CB  1 
ATOM   5419 C  CG  . GLN A 1 690 ? 12.133  -30.603 -16.813 1.00 189.65 ? 690 GLN A CG  1 
ATOM   5420 C  CD  . GLN A 1 690 ? 11.058  -31.543 -17.216 1.00 190.85 ? 690 GLN A CD  1 
ATOM   5421 O  OE1 . GLN A 1 690 ? 9.920   -31.418 -16.763 1.00 189.60 ? 690 GLN A OE1 1 
ATOM   5422 N  NE2 . GLN A 1 690 ? 11.388  -32.486 -18.087 1.00 190.82 ? 690 GLN A NE2 1 
ATOM   5423 N  N   . TYR A 1 691 ? 12.552  -26.062 -15.907 1.00 146.61 ? 691 TYR A N   1 
ATOM   5424 C  CA  . TYR A 1 691 ? 12.131  -24.709 -15.620 1.00 149.64 ? 691 TYR A CA  1 
ATOM   5425 C  C   . TYR A 1 691 ? 12.343  -23.729 -16.774 1.00 153.86 ? 691 TYR A C   1 
ATOM   5426 O  O   . TYR A 1 691 ? 13.408  -23.682 -17.385 1.00 153.86 ? 691 TYR A O   1 
ATOM   5427 C  CB  . TYR A 1 691 ? 12.864  -24.232 -14.383 1.00 144.43 ? 691 TYR A CB  1 
ATOM   5428 C  CG  . TYR A 1 691 ? 14.332  -24.024 -14.608 1.00 142.09 ? 691 TYR A CG  1 
ATOM   5429 C  CD1 . TYR A 1 691 ? 15.209  -25.096 -14.665 1.00 141.37 ? 691 TYR A CD1 1 
ATOM   5430 C  CD2 . TYR A 1 691 ? 14.845  -22.745 -14.757 1.00 140.98 ? 691 TYR A CD2 1 
ATOM   5431 C  CE1 . TYR A 1 691 ? 16.571  -24.895 -14.874 1.00 139.69 ? 691 TYR A CE1 1 
ATOM   5432 C  CE2 . TYR A 1 691 ? 16.194  -22.528 -14.962 1.00 139.22 ? 691 TYR A CE2 1 
ATOM   5433 C  CZ  . TYR A 1 691 ? 17.057  -23.602 -15.024 1.00 138.43 ? 691 TYR A CZ  1 
ATOM   5434 O  OH  . TYR A 1 691 ? 18.401  -23.359 -15.232 1.00 137.18 ? 691 TYR A OH  1 
ATOM   5435 N  N   . ASP A 1 692 ? 11.311  -22.943 -17.059 1.00 145.09 ? 692 ASP A N   1 
ATOM   5436 C  CA  . ASP A 1 692 ? 11.336  -21.964 -18.144 1.00 148.97 ? 692 ASP A CA  1 
ATOM   5437 C  C   . ASP A 1 692 ? 12.502  -20.985 -17.990 1.00 146.90 ? 692 ASP A C   1 
ATOM   5438 O  O   . ASP A 1 692 ? 12.478  -20.102 -17.137 1.00 145.19 ? 692 ASP A O   1 
ATOM   5439 C  CB  . ASP A 1 692 ? 9.998   -21.217 -18.205 1.00 164.78 ? 692 ASP A CB  1 
ATOM   5440 C  CG  . ASP A 1 692 ? 9.812   -20.447 -19.496 1.00 169.19 ? 692 ASP A CG  1 
ATOM   5441 O  OD1 . ASP A 1 692 ? 8.734   -20.559 -20.113 1.00 169.04 ? 692 ASP A OD1 1 
ATOM   5442 O  OD2 . ASP A 1 692 ? 10.742  -19.720 -19.894 1.00 170.64 ? 692 ASP A OD2 1 
ATOM   5443 N  N   . GLN A 1 693 ? 13.508  -21.143 -18.847 1.00 135.45 ? 693 GLN A N   1 
ATOM   5444 C  CA  . GLN A 1 693 ? 14.794  -20.459 -18.699 1.00 133.36 ? 693 GLN A CA  1 
ATOM   5445 C  C   . GLN A 1 693 ? 14.794  -18.952 -18.982 1.00 135.63 ? 693 GLN A C   1 
ATOM   5446 O  O   . GLN A 1 693 ? 15.779  -18.262 -18.698 1.00 133.94 ? 693 GLN A O   1 
ATOM   5447 C  CB  . GLN A 1 693 ? 15.857  -21.163 -19.544 1.00 148.28 ? 693 GLN A CB  1 
ATOM   5448 C  CG  . GLN A 1 693 ? 15.715  -22.672 -19.531 1.00 148.65 ? 693 GLN A CG  1 
ATOM   5449 C  CD  . GLN A 1 693 ? 16.996  -23.371 -19.140 1.00 147.93 ? 693 GLN A CD  1 
ATOM   5450 O  OE1 . GLN A 1 693 ? 18.053  -22.744 -19.045 1.00 147.61 ? 693 GLN A OE1 1 
ATOM   5451 N  NE2 . GLN A 1 693 ? 16.909  -24.681 -18.907 1.00 149.43 ? 693 GLN A NE2 1 
ATOM   5452 N  N   . ASP A 1 694 ? 13.694  -18.445 -19.536 1.00 157.78 ? 694 ASP A N   1 
ATOM   5453 C  CA  . ASP A 1 694 ? 13.537  -17.011 -19.772 1.00 161.26 ? 694 ASP A CA  1 
ATOM   5454 C  C   . ASP A 1 694 ? 12.800  -16.353 -18.605 1.00 160.91 ? 694 ASP A C   1 
ATOM   5455 O  O   . ASP A 1 694 ? 12.463  -15.173 -18.665 1.00 165.02 ? 694 ASP A O   1 
ATOM   5456 C  CB  . ASP A 1 694 ? 12.784  -16.751 -21.085 1.00 204.27 ? 694 ASP A CB  1 
ATOM   5457 C  CG  . ASP A 1 694 ? 13.541  -17.245 -22.308 1.00 205.22 ? 694 ASP A CG  1 
ATOM   5458 O  OD1 . ASP A 1 694 ? 14.735  -16.904 -22.461 1.00 203.96 ? 694 ASP A OD1 1 
ATOM   5459 O  OD2 . ASP A 1 694 ? 12.934  -17.977 -23.120 1.00 210.48 ? 694 ASP A OD2 1 
ATOM   5460 N  N   . LEU A 1 695 ? 12.545  -17.131 -17.552 1.00 148.02 ? 695 LEU A N   1 
ATOM   5461 C  CA  . LEU A 1 695 ? 11.863  -16.652 -16.347 1.00 147.26 ? 695 LEU A CA  1 
ATOM   5462 C  C   . LEU A 1 695 ? 12.757  -16.794 -15.124 1.00 141.60 ? 695 LEU A C   1 
ATOM   5463 O  O   . LEU A 1 695 ? 12.872  -15.885 -14.303 1.00 141.43 ? 695 LEU A O   1 
ATOM   5464 C  CB  . LEU A 1 695 ? 10.574  -17.445 -16.108 1.00 100.16 ? 695 LEU A CB  1 
ATOM   5465 C  CG  . LEU A 1 695 ? 9.366   -17.070 -16.959 1.00 106.09 ? 695 LEU A CG  1 
ATOM   5466 C  CD1 . LEU A 1 695 ? 8.061   -17.528 -16.336 1.00 106.81 ? 695 LEU A CD1 1 
ATOM   5467 C  CD2 . LEU A 1 695 ? 9.372   -15.578 -17.121 1.00 109.81 ? 695 LEU A CD2 1 
ATOM   5468 N  N   . PHE A 1 696 ? 13.392  -17.955 -15.019 1.00 132.51 ? 696 PHE A N   1 
ATOM   5469 C  CA  . PHE A 1 696 ? 14.202  -18.294 -13.866 1.00 127.26 ? 696 PHE A CA  1 
ATOM   5470 C  C   . PHE A 1 696 ? 15.698  -18.422 -14.205 1.00 124.97 ? 696 PHE A C   1 
ATOM   5471 O  O   . PHE A 1 696 ? 16.136  -18.179 -15.324 1.00 127.43 ? 696 PHE A O   1 
ATOM   5472 C  CB  . PHE A 1 696 ? 13.701  -19.614 -13.267 1.00 102.80 ? 696 PHE A CB  1 
ATOM   5473 C  CG  . PHE A 1 696 ? 12.242  -19.604 -12.859 1.00 104.59 ? 696 PHE A CG  1 
ATOM   5474 C  CD1 . PHE A 1 696 ? 11.433  -20.691 -13.130 1.00 106.40 ? 696 PHE A CD1 1 
ATOM   5475 C  CD2 . PHE A 1 696 ? 11.693  -18.532 -12.182 1.00 105.47 ? 696 PHE A CD2 1 
ATOM   5476 C  CE1 . PHE A 1 696 ? 10.113  -20.703 -12.763 1.00 108.69 ? 696 PHE A CE1 1 
ATOM   5477 C  CE2 . PHE A 1 696 ? 10.356  -18.546 -11.803 1.00 107.79 ? 696 PHE A CE2 1 
ATOM   5478 C  CZ  . PHE A 1 696 ? 9.569   -19.635 -12.102 1.00 109.32 ? 696 PHE A CZ  1 
ATOM   5479 N  N   . GLU A 1 697 ? 16.473  -18.789 -13.198 1.00 137.89 ? 697 GLU A N   1 
ATOM   5480 C  CA  . GLU A 1 697 ? 17.856  -19.188 -13.347 1.00 135.20 ? 697 GLU A CA  1 
ATOM   5481 C  C   . GLU A 1 697 ? 18.038  -20.089 -12.136 1.00 130.83 ? 697 GLU A C   1 
ATOM   5482 O  O   . GLU A 1 697 ? 17.628  -19.739 -11.032 1.00 129.24 ? 697 GLU A O   1 
ATOM   5483 C  CB  . GLU A 1 697 ? 18.791  -17.966 -13.327 1.00 193.74 ? 697 GLU A CB  1 
ATOM   5484 C  CG  . GLU A 1 697 ? 19.785  -17.872 -12.158 1.00 190.87 ? 697 GLU A CG  1 
ATOM   5485 C  CD  . GLU A 1 697 ? 21.050  -18.694 -12.366 1.00 192.11 ? 697 GLU A CD  1 
ATOM   5486 O  OE1 . GLU A 1 697 ? 21.024  -19.620 -13.205 1.00 193.95 ? 697 GLU A OE1 1 
ATOM   5487 O  OE2 . GLU A 1 697 ? 22.068  -18.415 -11.689 1.00 189.46 ? 697 GLU A OE2 1 
ATOM   5488 N  N   . GLN A 1 698 ? 18.578  -21.281 -12.334 1.00 143.23 ? 698 GLN A N   1 
ATOM   5489 C  CA  . GLN A 1 698 ? 18.733  -22.188 -11.212 1.00 139.83 ? 698 GLN A CA  1 
ATOM   5490 C  C   . GLN A 1 698 ? 19.983  -21.822 -10.452 1.00 136.48 ? 698 GLN A C   1 
ATOM   5491 O  O   . GLN A 1 698 ? 21.054  -22.354 -10.718 1.00 136.45 ? 698 GLN A O   1 
ATOM   5492 C  CB  . GLN A 1 698 ? 18.819  -23.626 -11.682 1.00 116.99 ? 698 GLN A CB  1 
ATOM   5493 C  CG  . GLN A 1 698 ? 19.268  -24.578 -10.619 1.00 114.29 ? 698 GLN A CG  1 
ATOM   5494 C  CD  . GLN A 1 698 ? 19.377  -25.995 -11.133 1.00 121.80 ? 698 GLN A CD  1 
ATOM   5495 O  OE1 . GLN A 1 698 ? 18.370  -26.667 -11.346 1.00 124.53 ? 698 GLN A OE1 1 
ATOM   5496 N  NE2 . GLN A 1 698 ? 20.606  -26.457 -11.347 1.00 121.91 ? 698 GLN A NE2 1 
ATOM   5497 N  N   . VAL A 1 699 ? 19.842  -20.893 -9.514  1.00 140.67 ? 699 VAL A N   1 
ATOM   5498 C  CA  . VAL A 1 699 ? 20.963  -20.439 -8.708  1.00 137.65 ? 699 VAL A CA  1 
ATOM   5499 C  C   . VAL A 1 699 ? 21.600  -21.595 -7.964  1.00 134.91 ? 699 VAL A C   1 
ATOM   5500 O  O   . VAL A 1 699 ? 22.807  -21.764 -8.000  1.00 134.01 ? 699 VAL A O   1 
ATOM   5501 C  CB  . VAL A 1 699 ? 20.541  -19.398 -7.681  1.00 104.62 ? 699 VAL A CB  1 
ATOM   5502 C  CG1 . VAL A 1 699 ? 21.656  -19.175 -6.718  1.00 101.44 ? 699 VAL A CG1 1 
ATOM   5503 C  CG2 . VAL A 1 699 ? 20.166  -18.114 -8.353  1.00 108.25 ? 699 VAL A CG2 1 
ATOM   5504 N  N   . THR A 1 700 ? 20.810  -22.404 -7.276  1.00 130.38 ? 700 THR A N   1 
ATOM   5505 C  CA  . THR A 1 700 ? 21.457  -23.509 -6.561  1.00 128.68 ? 700 THR A CA  1 
ATOM   5506 C  C   . THR A 1 700 ? 20.776  -24.836 -6.889  1.00 131.17 ? 700 THR A C   1 
ATOM   5507 O  O   . THR A 1 700 ? 19.561  -24.876 -7.085  1.00 132.73 ? 700 THR A O   1 
ATOM   5508 C  CB  . THR A 1 700 ? 21.511  -23.270 -5.021  1.00 148.75 ? 700 THR A CB  1 
ATOM   5509 O  OG1 . THR A 1 700 ? 21.644  -21.873 -4.749  1.00 152.43 ? 700 THR A OG1 1 
ATOM   5510 C  CG2 . THR A 1 700 ? 22.692  -23.984 -4.400  1.00 146.47 ? 700 THR A CG2 1 
ATOM   5511 N  N   . ASN A 1 701 ? 21.558  -25.913 -6.947  1.00 131.16 ? 701 ASN A N   1 
ATOM   5512 C  CA  . ASN A 1 701 ? 21.035  -27.236 -7.283  1.00 134.57 ? 701 ASN A CA  1 
ATOM   5513 C  C   . ASN A 1 701 ? 21.634  -28.333 -6.407  1.00 134.17 ? 701 ASN A C   1 
ATOM   5514 O  O   . ASN A 1 701 ? 22.819  -28.627 -6.496  1.00 134.54 ? 701 ASN A O   1 
ATOM   5515 C  CB  . ASN A 1 701 ? 21.308  -27.538 -8.761  1.00 159.13 ? 701 ASN A CB  1 
ATOM   5516 C  CG  . ASN A 1 701 ? 20.648  -28.823 -9.240  1.00 163.79 ? 701 ASN A CG  1 
ATOM   5517 O  OD1 . ASN A 1 701 ? 20.196  -29.641 -8.442  1.00 163.74 ? 701 ASN A OD1 1 
ATOM   5518 N  ND2 . ASN A 1 701 ? 20.605  -29.008 -10.556 1.00 168.21 ? 701 ASN A ND2 1 
ATOM   5519 N  N   . ASP A 1 702 ? 20.816  -28.941 -5.561  1.00 113.11 ? 702 ASP A N   1 
ATOM   5520 C  CA  . ASP A 1 702 ? 21.276  -30.032 -4.710  1.00 113.78 ? 702 ASP A CA  1 
ATOM   5521 C  C   . ASP A 1 702 ? 20.121  -31.008 -4.552  1.00 116.92 ? 702 ASP A C   1 
ATOM   5522 O  O   . ASP A 1 702 ? 18.962  -30.603 -4.552  1.00 117.02 ? 702 ASP A O   1 
ATOM   5523 C  CB  . ASP A 1 702 ? 21.740  -29.487 -3.342  1.00 164.66 ? 702 ASP A CB  1 
ATOM   5524 C  CG  . ASP A 1 702 ? 22.486  -30.527 -2.483  1.00 169.07 ? 702 ASP A CG  1 
ATOM   5525 O  OD1 . ASP A 1 702 ? 22.147  -31.727 -2.537  1.00 173.89 ? 702 ASP A OD1 1 
ATOM   5526 O  OD2 . ASP A 1 702 ? 23.408  -30.133 -1.729  1.00 165.60 ? 702 ASP A OD2 1 
ATOM   5527 N  N   . THR A 1 703 ? 20.432  -32.290 -4.433  1.00 128.82 ? 703 THR A N   1 
ATOM   5528 C  CA  . THR A 1 703 ? 19.425  -33.294 -4.117  1.00 129.00 ? 703 THR A CA  1 
ATOM   5529 C  C   . THR A 1 703 ? 18.577  -32.896 -2.904  1.00 126.23 ? 703 THR A C   1 
ATOM   5530 O  O   . THR A 1 703 ? 17.472  -33.407 -2.701  1.00 125.70 ? 703 THR A O   1 
ATOM   5531 C  CB  . THR A 1 703 ? 20.110  -34.624 -3.826  1.00 121.07 ? 703 THR A CB  1 
ATOM   5532 O  OG1 . THR A 1 703 ? 20.595  -35.169 -5.054  1.00 123.71 ? 703 THR A OG1 1 
ATOM   5533 C  CG2 . THR A 1 703 ? 19.152  -35.606 -3.169  1.00 118.95 ? 703 THR A CG2 1 
ATOM   5534 N  N   . ARG A 1 704 ? 19.111  -31.969 -2.112  1.00 128.07 ? 704 ARG A N   1 
ATOM   5535 C  CA  . ARG A 1 704 ? 18.514  -31.562 -0.856  1.00 125.28 ? 704 ARG A CA  1 
ATOM   5536 C  C   . ARG A 1 704 ? 17.628  -30.342 -1.034  1.00 122.91 ? 704 ARG A C   1 
ATOM   5537 O  O   . ARG A 1 704 ? 16.695  -30.128 -0.256  1.00 121.39 ? 704 ARG A O   1 
ATOM   5538 C  CB  . ARG A 1 704 ? 19.615  -31.254 0.149   1.00 154.65 ? 704 ARG A CB  1 
ATOM   5539 C  CG  . ARG A 1 704 ? 20.574  -32.396 0.361   1.00 157.97 ? 704 ARG A CG  1 
ATOM   5540 C  CD  . ARG A 1 704 ? 20.836  -32.583 1.830   1.00 157.37 ? 704 ARG A CD  1 
ATOM   5541 N  NE  . ARG A 1 704 ? 21.125  -33.969 2.165   1.00 159.72 ? 704 ARG A NE  1 
ATOM   5542 C  CZ  . ARG A 1 704 ? 20.510  -34.643 3.132   1.00 155.83 ? 704 ARG A CZ  1 
ATOM   5543 N  NH1 . ARG A 1 704 ? 19.575  -34.052 3.867   1.00 147.73 ? 704 ARG A NH1 1 
ATOM   5544 N  NH2 . ARG A 1 704 ? 20.832  -35.909 3.365   1.00 156.66 ? 704 ARG A NH2 1 
ATOM   5545 N  N   . ALA A 1 705 ? 17.907  -29.548 -2.063  1.00 113.35 ? 705 ALA A N   1 
ATOM   5546 C  CA  . ALA A 1 705 ? 17.169  -28.308 -2.275  1.00 111.79 ? 705 ALA A CA  1 
ATOM   5547 C  C   . ALA A 1 705 ? 17.655  -27.557 -3.493  1.00 112.62 ? 705 ALA A C   1 
ATOM   5548 O  O   . ALA A 1 705 ? 18.796  -27.697 -3.891  1.00 112.54 ? 705 ALA A O   1 
ATOM   5549 C  CB  . ALA A 1 705 ? 17.295  -27.426 -1.064  1.00 110.53 ? 705 ALA A CB  1 
ATOM   5550 N  N   . LYS A 1 706 ? 16.789  -26.742 -4.074  1.00 89.83  ? 706 LYS A N   1 
ATOM   5551 C  CA  . LYS A 1 706 ? 17.180  -25.894 -5.193  1.00 90.66  ? 706 LYS A CA  1 
ATOM   5552 C  C   . LYS A 1 706 ? 16.858  -24.458 -4.889  1.00 88.91  ? 706 LYS A C   1 
ATOM   5553 O  O   . LYS A 1 706 ? 16.099  -24.165 -3.981  1.00 87.51  ? 706 LYS A O   1 
ATOM   5554 C  CB  . LYS A 1 706 ? 16.444  -26.302 -6.470  1.00 78.89  ? 706 LYS A CB  1 
ATOM   5555 C  CG  . LYS A 1 706 ? 16.612  -27.773 -6.827  1.00 81.76  ? 706 LYS A CG  1 
ATOM   5556 C  CD  . LYS A 1 706 ? 16.343  -28.073 -8.283  1.00 86.85  ? 706 LYS A CD  1 
ATOM   5557 C  CE  . LYS A 1 706 ? 16.696  -29.500 -8.543  1.00 89.61  ? 706 LYS A CE  1 
ATOM   5558 N  NZ  . LYS A 1 706 ? 16.373  -29.886 -9.917  1.00 92.42  ? 706 LYS A NZ  1 
ATOM   5559 N  N   . ILE A 1 707 ? 17.415  -23.546 -5.657  1.00 90.71  ? 707 ILE A N   1 
ATOM   5560 C  CA  . ILE A 1 707 ? 17.054  -22.150 -5.486  1.00 90.43  ? 707 ILE A CA  1 
ATOM   5561 C  C   . ILE A 1 707 ? 17.032  -21.536 -6.857  1.00 93.58  ? 707 ILE A C   1 
ATOM   5562 O  O   . ILE A 1 707 ? 18.013  -21.667 -7.595  1.00 93.81  ? 707 ILE A O   1 
ATOM   5563 C  CB  . ILE A 1 707 ? 18.086  -21.375 -4.625  1.00 99.37  ? 707 ILE A CB  1 
ATOM   5564 C  CG1 . ILE A 1 707 ? 18.254  -21.999 -3.244  1.00 95.76  ? 707 ILE A CG1 1 
ATOM   5565 C  CG2 . ILE A 1 707 ? 17.712  -19.898 -4.497  1.00 100.52 ? 707 ILE A CG2 1 
ATOM   5566 C  CD1 . ILE A 1 707 ? 19.167  -21.197 -2.352  1.00 99.86  ? 707 ILE A CD1 1 
ATOM   5567 N  N   . TYR A 1 708 ? 15.931  -20.882 -7.205  1.00 105.65 ? 708 TYR A N   1 
ATOM   5568 C  CA  . TYR A 1 708 ? 15.865  -20.214 -8.498  1.00 109.28 ? 708 TYR A CA  1 
ATOM   5569 C  C   . TYR A 1 708 ? 15.763  -18.727 -8.269  1.00 110.93 ? 708 TYR A C   1 
ATOM   5570 O  O   . TYR A 1 708 ? 15.553  -18.295 -7.148  1.00 109.47 ? 708 TYR A O   1 
ATOM   5571 C  CB  . TYR A 1 708 ? 14.674  -20.713 -9.319  1.00 95.75  ? 708 TYR A CB  1 
ATOM   5572 C  CG  . TYR A 1 708 ? 14.775  -22.172 -9.705  1.00 95.15  ? 708 TYR A CG  1 
ATOM   5573 C  CD1 . TYR A 1 708 ? 14.605  -23.166 -8.756  1.00 92.69  ? 708 TYR A CD1 1 
ATOM   5574 C  CD2 . TYR A 1 708 ? 15.055  -22.558 -11.000 1.00 97.22  ? 708 TYR A CD2 1 
ATOM   5575 C  CE1 . TYR A 1 708 ? 14.710  -24.495 -9.080  1.00 93.02  ? 708 TYR A CE1 1 
ATOM   5576 C  CE2 . TYR A 1 708 ? 15.159  -23.889 -11.328 1.00 97.58  ? 708 TYR A CE2 1 
ATOM   5577 C  CZ  . TYR A 1 708 ? 14.981  -24.851 -10.363 1.00 95.84  ? 708 TYR A CZ  1 
ATOM   5578 O  OH  . TYR A 1 708 ? 15.084  -26.183 -10.675 1.00 105.45 ? 708 TYR A OH  1 
ATOM   5579 N  N   . ARG A 1 709 ? 15.924  -17.941 -9.326  1.00 109.46 ? 709 ARG A N   1 
ATOM   5580 C  CA  . ARG A 1 709 ? 15.848  -16.482 -9.226  1.00 112.72 ? 709 ARG A CA  1 
ATOM   5581 C  C   . ARG A 1 709 ? 15.067  -15.898 -10.412 1.00 118.53 ? 709 ARG A C   1 
ATOM   5582 O  O   . ARG A 1 709 ? 15.100  -16.434 -11.513 1.00 119.72 ? 709 ARG A O   1 
ATOM   5583 C  CB  . ARG A 1 709 ? 17.254  -15.881 -9.119  1.00 121.23 ? 709 ARG A CB  1 
ATOM   5584 C  CG  . ARG A 1 709 ? 17.353  -14.434 -9.510  1.00 126.00 ? 709 ARG A CG  1 
ATOM   5585 C  CD  . ARG A 1 709 ? 18.767  -14.086 -9.955  1.00 126.21 ? 709 ARG A CD  1 
ATOM   5586 N  NE  . ARG A 1 709 ? 18.764  -12.981 -10.912 1.00 137.13 ? 709 ARG A NE  1 
ATOM   5587 C  CZ  . ARG A 1 709 ? 19.377  -12.998 -12.094 1.00 137.42 ? 709 ARG A CZ  1 
ATOM   5588 N  NH1 . ARG A 1 709 ? 20.068  -14.067 -12.472 1.00 133.08 ? 709 ARG A NH1 1 
ATOM   5589 N  NH2 . ARG A 1 709 ? 19.299  -11.941 -12.897 1.00 142.64 ? 709 ARG A NH2 1 
ATOM   5590 N  N   . LEU A 1 710 ? 14.324  -14.825 -10.190 1.00 147.24 ? 710 LEU A N   1 
ATOM   5591 C  CA  . LEU A 1 710 ? 13.546  -14.262 -11.282 1.00 153.54 ? 710 LEU A CA  1 
ATOM   5592 C  C   . LEU A 1 710 ? 14.485  -13.422 -12.130 1.00 156.48 ? 710 LEU A C   1 
ATOM   5593 O  O   . LEU A 1 710 ? 15.427  -12.845 -11.592 1.00 155.40 ? 710 LEU A O   1 
ATOM   5594 C  CB  . LEU A 1 710 ? 12.397  -13.398 -10.757 1.00 106.46 ? 710 LEU A CB  1 
ATOM   5595 C  CG  . LEU A 1 710 ? 11.263  -14.028 -9.950  1.00 105.58 ? 710 LEU A CG  1 
ATOM   5596 C  CD1 . LEU A 1 710 ? 10.240  -12.964 -9.559  1.00 111.57 ? 710 LEU A CD1 1 
ATOM   5597 C  CD2 . LEU A 1 710 ? 10.605  -15.153 -10.725 1.00 105.63 ? 710 LEU A CD2 1 
ATOM   5598 N  N   . LYS A 1 711 ? 14.241  -13.356 -13.441 1.00 117.67 ? 711 LYS A N   1 
ATOM   5599 C  CA  . LYS A 1 711 ? 15.037  -12.497 -14.331 1.00 121.40 ? 711 LYS A CA  1 
ATOM   5600 C  C   . LYS A 1 711 ? 14.321  -11.202 -14.759 1.00 129.26 ? 711 LYS A C   1 
ATOM   5601 O  O   . LYS A 1 711 ? 13.754  -11.103 -15.845 1.00 133.81 ? 711 LYS A O   1 
ATOM   5602 C  CB  . LYS A 1 711 ? 15.528  -13.289 -15.543 1.00 144.85 ? 711 LYS A CB  1 
ATOM   5603 C  CG  . LYS A 1 711 ? 16.386  -14.506 -15.184 1.00 140.44 ? 711 LYS A CG  1 
ATOM   5604 C  CD  . LYS A 1 711 ? 16.914  -15.231 -16.428 1.00 141.02 ? 711 LYS A CD  1 
ATOM   5605 C  CE  . LYS A 1 711 ? 17.942  -14.386 -17.186 1.00 144.33 ? 711 LYS A CE  1 
ATOM   5606 N  NZ  . LYS A 1 711 ? 18.459  -15.054 -18.416 1.00 145.28 ? 711 LYS A NZ  1 
ATOM   5607 N  N   . GLY B 2 1   ? 6.225   -32.247 17.123  0.00 137.40 ? 10  GLY B N   1 
ATOM   5608 C  CA  . GLY B 2 1   ? 4.949   -31.771 17.625  0.00 136.00 ? 10  GLY B CA  1 
ATOM   5609 C  C   . GLY B 2 1   ? 5.004   -30.350 18.175  1.00 139.91 ? 10  GLY B C   1 
ATOM   5610 O  O   . GLY B 2 1   ? 4.295   -29.457 17.713  1.00 139.47 ? 10  GLY B O   1 
ATOM   5611 N  N   . ASP B 2 2   ? 5.843   -30.143 19.180  1.00 95.22  ? 11  ASP B N   1 
ATOM   5612 C  CA  . ASP B 2 2   ? 5.984   -28.830 19.814  1.00 99.36  ? 11  ASP B CA  1 
ATOM   5613 C  C   . ASP B 2 2   ? 6.595   -27.678 19.029  1.00 101.34 ? 11  ASP B C   1 
ATOM   5614 O  O   . ASP B 2 2   ? 7.072   -26.739 19.652  1.00 102.01 ? 11  ASP B O   1 
ATOM   5615 C  CB  . ASP B 2 2   ? 6.863   -28.969 21.035  1.00 100.55 ? 11  ASP B CB  1 
ATOM   5616 C  CG  . ASP B 2 2   ? 6.089   -29.278 22.244  1.00 100.15 ? 11  ASP B CG  1 
ATOM   5617 O  OD1 . ASP B 2 2   ? 5.562   -28.326 22.849  1.00 103.83 ? 11  ASP B OD1 1 
ATOM   5618 O  OD2 . ASP B 2 2   ? 6.004   -30.474 22.581  1.00 96.33  ? 11  ASP B OD2 1 
ATOM   5619 N  N   . GLN B 2 3   ? 6.619   -27.720 17.703  1.00 89.48  ? 12  GLN B N   1 
ATOM   5620 C  CA  . GLN B 2 3   ? 7.335   -26.673 16.991  1.00 91.72  ? 12  GLN B CA  1 
ATOM   5621 C  C   . GLN B 2 3   ? 6.461   -25.860 16.041  1.00 101.19 ? 12  GLN B C   1 
ATOM   5622 O  O   . GLN B 2 3   ? 5.528   -26.387 15.456  1.00 98.32  ? 12  GLN B O   1 
ATOM   5623 C  CB  . GLN B 2 3   ? 8.570   -27.237 16.305  1.00 161.37 ? 12  GLN B CB  1 
ATOM   5624 C  CG  . GLN B 2 3   ? 9.614   -27.655 17.294  1.00 147.52 ? 12  GLN B CG  1 
ATOM   5625 C  CD  . GLN B 2 3   ? 10.747  -28.386 16.647  1.00 138.34 ? 12  GLN B CD  1 
ATOM   5626 O  OE1 . GLN B 2 3   ? 11.227  -29.399 17.165  1.00 130.01 ? 12  GLN B OE1 1 
ATOM   5627 N  NE2 . GLN B 2 3   ? 11.196  -27.879 15.504  1.00 140.24 ? 12  GLN B NE2 1 
ATOM   5628 N  N   . ASN B 2 4   ? 6.758   -24.564 15.915  1.00 84.63  ? 13  ASN B N   1 
ATOM   5629 C  CA  . ASN B 2 4   ? 5.990   -23.672 15.071  1.00 86.29  ? 13  ASN B CA  1 
ATOM   5630 C  C   . ASN B 2 4   ? 6.239   -24.000 13.612  1.00 86.87  ? 13  ASN B C   1 
ATOM   5631 O  O   . ASN B 2 4   ? 6.857   -23.231 12.878  1.00 87.48  ? 13  ASN B O   1 
ATOM   5632 C  CB  . ASN B 2 4   ? 6.357   -22.226 15.354  1.00 86.64  ? 13  ASN B CB  1 
ATOM   5633 C  CG  . ASN B 2 4   ? 5.266   -21.272 14.969  1.00 89.79  ? 13  ASN B CG  1 
ATOM   5634 O  OD1 . ASN B 2 4   ? 4.864   -21.203 13.813  1.00 90.59  ? 13  ASN B OD1 1 
ATOM   5635 N  ND2 . ASN B 2 4   ? 4.763   -20.521 15.936  1.00 93.82  ? 13  ASN B ND2 1 
ATOM   5636 N  N   . ALA B 2 5   ? 5.762   -25.166 13.206  1.00 101.34 ? 14  ALA B N   1 
ATOM   5637 C  CA  . ALA B 2 5   ? 5.931   -25.642 11.851  1.00 99.99  ? 14  ALA B CA  1 
ATOM   5638 C  C   . ALA B 2 5   ? 4.564   -26.041 11.319  1.00 97.38  ? 14  ALA B C   1 
ATOM   5639 O  O   . ALA B 2 5   ? 3.577   -26.074 12.066  1.00 97.56  ? 14  ALA B O   1 
ATOM   5640 C  CB  . ALA B 2 5   ? 6.893   -26.842 11.813  1.00 267.77 ? 14  ALA B CB  1 
ATOM   5641 N  N   . THR B 2 6   ? 4.520   -26.356 10.035  1.00 130.89 ? 15  THR B N   1 
ATOM   5642 C  CA  . THR B 2 6   ? 3.304   -26.829 9.408   1.00 129.51 ? 15  THR B CA  1 
ATOM   5643 C  C   . THR B 2 6   ? 3.222   -28.348 9.458   1.00 121.11 ? 15  THR B C   1 
ATOM   5644 O  O   . THR B 2 6   ? 4.237   -29.024 9.513   1.00 116.50 ? 15  THR B O   1 
ATOM   5645 C  CB  . THR B 2 6   ? 3.215   -26.349 7.962   1.00 95.48  ? 15  THR B CB  1 
ATOM   5646 O  OG1 . THR B 2 6   ? 2.998   -24.929 7.954   1.00 101.80 ? 15  THR B OG1 1 
ATOM   5647 C  CG2 . THR B 2 6   ? 2.079   -27.058 7.248   1.00 97.08  ? 15  THR B CG2 1 
HETATM 5648 N  N   . PPN B 2 7   ? 1.996   -28.853 9.534   1.00 118.43 ? 16  PPN B N   1 
HETATM 5649 C  CA  . PPN B 2 7   ? 1.646   -30.214 9.225   1.00 112.66 ? 16  PPN B CA  1 
HETATM 5650 C  C   . PPN B 2 7   ? 0.212   -30.058 8.834   1.00 117.55 ? 16  PPN B C   1 
HETATM 5651 O  O   . PPN B 2 7   ? -0.329  -28.966 9.142   1.00 118.14 ? 16  PPN B O   1 
HETATM 5652 C  CB  . PPN B 2 7   ? 1.690   -31.092 10.416  1.00 111.33 ? 16  PPN B CB  1 
HETATM 5653 C  CG  . PPN B 2 7   ? 0.440   -30.774 11.156  1.00 114.71 ? 16  PPN B CG  1 
HETATM 5654 C  CD1 . PPN B 2 7   ? -0.703  -31.540 11.007  1.00 114.68 ? 16  PPN B CD1 1 
HETATM 5655 C  CD2 . PPN B 2 7   ? 0.424   -29.671 11.983  1.00 119.20 ? 16  PPN B CD2 1 
HETATM 5656 C  CE1 . PPN B 2 7   ? -1.860  -31.200 11.690  1.00 119.79 ? 16  PPN B CE1 1 
HETATM 5657 C  CE2 . PPN B 2 7   ? -0.726  -29.330 12.671  1.00 123.57 ? 16  PPN B CE2 1 
HETATM 5658 C  CZ  . PPN B 2 7   ? -1.873  -30.092 12.528  1.00 124.26 ? 16  PPN B CZ  1 
HETATM 5659 N  N1  . PPN B 2 7   ? -3.040  -29.712 13.271  1.00 130.64 ? 16  PPN B N1  1 
HETATM 5660 O  O1  . PPN B 2 7   ? -3.089  -28.598 13.773  1.00 135.59 ? 16  PPN B O1  1 
HETATM 5661 O  O2  . PPN B 2 7   ? -4.036  -30.532 13.438  1.00 131.91 ? 16  PPN B O2  1 
ATOM   5662 N  N   . GLY B 2 8   ? -0.437  -31.032 8.185   1.00 114.32 ? 17  GLY B N   1 
ATOM   5663 C  CA  . GLY B 2 8   ? 0.188   -32.283 7.792   0.00 113.36 ? 17  GLY B CA  1 
ATOM   5664 C  C   . GLY B 2 8   ? -0.751  -33.174 6.997   0.00 120.47 ? 17  GLY B C   1 
ATOM   5665 O  O   . GLY B 2 8   ? -0.916  -32.995 5.792   0.00 122.60 ? 17  GLY B O   1 
HETATM 5666 MG MG  . MG  C 3 .   ? 7.238   -20.902 20.363  1.00 78.14  ? 725 MG  A MG  1 
HETATM 5667 MG MG  . MG  D 3 .   ? 18.551  -8.728  7.448   1.00 65.51  ? 726 MG  A MG  1 
HETATM 5668 O  O   . HOH E 4 .   ? 8.245   -15.698 17.364  1.00 38.74  ? 901 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . GLU A 2   ? 4.1257 3.1914 3.4144 0.1430  -0.1262 0.1359  2   GLU A N   
2    C  CA  . GLU A 2   ? 3.7230 2.8176 3.0701 0.1412  -0.1122 0.1138  2   GLU A CA  
3    C  C   . GLU A 2   ? 3.3902 2.4547 2.7383 0.1281  -0.0801 0.1172  2   GLU A C   
4    O  O   . GLU A 2   ? 3.0212 2.1052 2.3816 0.1139  -0.0602 0.1028  2   GLU A O   
5    C  CB  . GLU A 2   ? 3.0811 2.1921 2.4819 0.1623  -0.1305 0.1067  2   GLU A CB  
6    C  CG  . GLU A 2   ? 3.2268 2.3904 2.6525 0.1730  -0.1563 0.0920  2   GLU A CG  
7    C  CD  . GLU A 2   ? 3.2951 2.4774 2.7786 0.1941  -0.1700 0.0818  2   GLU A CD  
8    O  OE1 . GLU A 2   ? 3.0853 2.2473 2.5964 0.1967  -0.1559 0.0793  2   GLU A OE1 
9    O  OE2 . GLU A 2   ? 3.5765 2.7942 3.0785 0.2079  -0.1947 0.0759  2   GLU A OE2 
10   N  N   . LEU A 3   ? 3.0722 2.0895 2.4083 0.1326  -0.0752 0.1369  3   LEU A N   
11   C  CA  . LEU A 3   ? 2.7855 1.7770 2.1324 0.1211  -0.0462 0.1397  3   LEU A CA  
12   C  C   . LEU A 3   ? 2.8531 1.7968 2.1450 0.1088  -0.0276 0.1631  3   LEU A C   
13   O  O   . LEU A 3   ? 2.5729 1.4989 1.8716 0.0968  -0.0013 0.1656  3   LEU A O   
14   C  CB  . LEU A 3   ? 2.5868 1.5656 1.9800 0.1336  -0.0501 0.1388  3   LEU A CB  
15   C  CG  . LEU A 3   ? 2.3511 1.3656 1.8050 0.1318  -0.0414 0.1130  3   LEU A CG  
16   C  CD1 . LEU A 3   ? 2.5091 1.5090 2.0036 0.1469  -0.0503 0.1114  3   LEU A CD1 
17   C  CD2 . LEU A 3   ? 1.9297 0.9417 1.3855 0.1110  -0.0102 0.1092  3   LEU A CD2 
18   N  N   . GLN A 4   ? 2.9876 1.9120 2.2254 0.1113  -0.0411 0.1803  4   GLN A N   
19   C  CA  . GLN A 4   ? 3.1252 2.0036 2.3059 0.1000  -0.0240 0.2035  4   GLN A CA  
20   C  C   . GLN A 4   ? 2.9979 1.8858 2.1391 0.0829  -0.0062 0.1975  4   GLN A C   
21   O  O   . GLN A 4   ? 3.0999 1.9536 2.1905 0.0723  0.0106  0.2142  4   GLN A O   
22   C  CB  . GLN A 4   ? 2.2706 1.1165 1.4089 0.1114  -0.0475 0.2282  4   GLN A CB  
23   C  CG  . GLN A 4   ? 2.4820 1.2803 1.5561 0.0995  -0.0311 0.2536  4   GLN A CG  
24   C  CD  . GLN A 4   ? 3.0458 1.8180 2.0699 0.1092  -0.0574 0.2773  4   GLN A CD  
25   O  OE1 . GLN A 4   ? 3.2807 2.0556 2.3272 0.1277  -0.0856 0.2817  4   GLN A OE1 
26   N  NE2 . GLN A 4   ? 3.2124 1.9598 2.1681 0.0971  -0.0483 0.2926  4   GLN A NE2 
27   N  N   . GLN A 5   ? 3.1598 2.0931 2.3242 0.0801  -0.0090 0.1737  5   GLN A N   
28   C  CA  . GLN A 5   ? 3.0142 1.9583 2.1447 0.0652  0.0054  0.1652  5   GLN A CA  
29   C  C   . GLN A 5   ? 2.6468 1.5875 1.7912 0.0504  0.0414  0.1593  5   GLN A C   
30   O  O   . GLN A 5   ? 2.3682 1.3172 1.5633 0.0511  0.0514  0.1529  5   GLN A O   
31   C  CB  . GLN A 5   ? 2.5654 1.5589 1.7169 0.0674  -0.0129 0.1429  5   GLN A CB  
32   C  CG  . GLN A 5   ? 2.8850 1.8934 2.0385 0.0832  -0.0496 0.1452  5   GLN A CG  
33   C  CD  . GLN A 5   ? 2.7330 1.7964 1.9291 0.0865  -0.0653 0.1214  5   GLN A CD  
34   O  OE1 . GLN A 5   ? 2.3874 1.4759 1.6043 0.0757  -0.0497 0.1038  5   GLN A OE1 
35   N  NE2 . GLN A 5   ? 3.0117 2.0949 2.2222 0.1017  -0.0963 0.1214  5   GLN A NE2 
36   N  N   . ASN A 6   ? 2.8780 1.8078 1.9781 0.0373  0.0605  0.1605  6   ASN A N   
37   C  CA  . ASN A 6   ? 2.5580 1.4876 1.6710 0.0240  0.0948  0.1545  6   ASN A CA  
38   C  C   . ASN A 6   ? 2.2146 1.1890 1.3668 0.0195  0.0982  0.1291  6   ASN A C   
39   O  O   . ASN A 6   ? 2.2234 1.2131 1.3520 0.0153  0.0928  0.1185  6   ASN A O   
40   C  CB  . ASN A 6   ? 2.9136 1.8100 1.9625 0.0127  0.1167  0.1671  6   ASN A CB  
41   C  CG  . ASN A 6   ? 2.6495 1.5384 1.7126 0.0011  0.1539  0.1672  6   ASN A CG  
42   O  OD1 . ASN A 6   ? 2.4672 1.3337 1.5421 -0.0003 0.1674  0.1815  6   ASN A OD1 
43   N  ND2 . ASN A 6   ? 2.5957 1.5029 1.6586 -0.0074 0.1704  0.1518  6   ASN A ND2 
44   N  N   . PHE A 7   ? 2.7149 1.7096 1.9264 0.0195  0.1064  0.1194  7   PHE A N   
45   C  CA  . PHE A 7   ? 2.4136 1.4512 1.6634 0.0157  0.1072  0.0969  7   PHE A CA  
46   C  C   . PHE A 7   ? 2.1317 1.1689 1.3877 0.0026  0.1396  0.0932  7   PHE A C   
47   O  O   . PHE A 7   ? 1.9639 1.0279 1.2315 -0.0033 0.1444  0.0777  7   PHE A O   
48   C  CB  . PHE A 7   ? 1.8793 0.9459 1.1915 0.0239  0.0936  0.0859  7   PHE A CB  
49   C  CG  . PHE A 7   ? 2.1306 1.2047 1.4458 0.0387  0.0614  0.0864  7   PHE A CG  
50   C  CD1 . PHE A 7   ? 2.3856 1.4263 1.6866 0.0483  0.0520  0.1044  7   PHE A CD1 
51   C  CD2 . PHE A 7   ? 2.1227 1.2384 1.4582 0.0433  0.0405  0.0694  7   PHE A CD2 
52   C  CE1 . PHE A 7   ? 2.6372 1.6857 1.9444 0.0636  0.0221  0.1052  7   PHE A CE1 
53   C  CE2 . PHE A 7   ? 2.3737 1.4999 1.7162 0.0578  0.0114  0.0697  7   PHE A CE2 
54   C  CZ  . PHE A 7   ? 2.6331 1.7258 1.9622 0.0688  0.0020  0.0875  7   PHE A CZ  
55   N  N   . THR A 8   ? 2.4313 1.4389 1.6821 -0.0019 0.1618  0.1079  8   THR A N   
56   C  CA  . THR A 8   ? 2.1842 1.1933 1.4460 -0.0133 0.1934  0.1054  8   THR A CA  
57   C  C   . THR A 8   ? 2.2526 1.2595 1.4705 -0.0197 0.2035  0.1000  8   THR A C   
58   O  O   . THR A 8   ? 2.0356 1.0692 1.2750 -0.0243 0.2102  0.0845  8   THR A O   
59   C  CB  . THR A 8   ? 2.2378 1.2134 1.4945 -0.0181 0.2163  0.1244  8   THR A CB  
60   O  OG1 . THR A 8   ? 2.1924 1.1672 1.4892 -0.0126 0.2053  0.1284  8   THR A OG1 
61   C  CG2 . THR A 8   ? 1.9960 0.9787 1.2715 -0.0293 0.2493  0.1214  8   THR A CG2 
62   N  N   . ASP A 9   ? 2.6464 1.6209 1.8020 -0.0199 0.2033  0.1125  9   ASP A N   
63   C  CA  . ASP A 9   ? 2.7659 1.7297 1.8722 -0.0271 0.2173  0.1086  9   ASP A CA  
64   C  C   . ASP A 9   ? 2.7620 1.7486 1.8566 -0.0263 0.1962  0.0918  9   ASP A C   
65   O  O   . ASP A 9   ? 2.8105 1.7876 1.8634 -0.0323 0.2049  0.0863  9   ASP A O   
66   C  CB  . ASP A 9   ? 3.0976 2.0178 2.1370 -0.0290 0.2252  0.1278  9   ASP A CB  
67   C  CG  . ASP A 9   ? 3.1180 2.0151 2.1567 -0.0357 0.2598  0.1413  9   ASP A CG  
68   O  OD1 . ASP A 9   ? 2.8818 1.7889 1.9379 -0.0423 0.2863  0.1330  9   ASP A OD1 
69   O  OD2 . ASP A 9   ? 3.3522 2.2215 2.3738 -0.0345 0.2603  0.1610  9   ASP A OD2 
70   N  N   . ASN A 10  ? 2.5172 1.5337 1.6485 -0.0193 0.1688  0.0830  10  ASN A N   
71   C  CA  . ASN A 10  ? 2.5168 1.5599 1.6447 -0.0198 0.1486  0.0668  10  ASN A CA  
72   C  C   . ASN A 10  ? 2.2106 1.2838 1.3802 -0.0261 0.1614  0.0496  10  ASN A C   
73   O  O   . ASN A 10  ? 2.0412 1.1363 1.2665 -0.0246 0.1652  0.0457  10  ASN A O   
74   C  CB  . ASN A 10  ? 2.0021 1.0673 1.1522 -0.0093 0.1142  0.0650  10  ASN A CB  
75   C  CG  . ASN A 10  ? 2.1289 1.2193 1.2672 -0.0106 0.0909  0.0513  10  ASN A CG  
76   O  OD1 . ASN A 10  ? 2.0047 1.1096 1.1444 -0.0193 0.0992  0.0376  10  ASN A OD1 
77   N  ND2 . ASN A 10  ? 2.3692 1.4654 1.4974 -0.0020 0.0611  0.0554  10  ASN A ND2 
78   N  N   . ASN A 11  ? 2.3048 1.3775 1.4462 -0.0335 0.1677  0.0397  11  ASN A N   
79   C  CA  . ASN A 11  ? 2.0484 1.1474 1.2251 -0.0396 0.1781  0.0241  11  ASN A CA  
80   C  C   . ASN A 11  ? 2.1133 1.2280 1.2718 -0.0440 0.1597  0.0099  11  ASN A C   
81   O  O   . ASN A 11  ? 2.0787 1.1963 1.2348 -0.0513 0.1724  -0.0006 11  ASN A O   
82   C  CB  . ASN A 11  ? 2.5429 1.6211 1.7095 -0.0459 0.2137  0.0263  11  ASN A CB  
83   C  CG  . ASN A 11  ? 2.4647 1.5327 1.6575 -0.0439 0.2340  0.0395  11  ASN A CG  
84   O  OD1 . ASN A 11  ? 2.2496 1.3399 1.4964 -0.0449 0.2432  0.0359  11  ASN A OD1 
85   N  ND2 . ASN A 11  ? 2.6014 1.6355 1.7548 -0.0424 0.2407  0.0553  11  ASN A ND2 
86   N  N   . SER A 12  ? 2.7447 1.8698 1.8923 -0.0394 0.1295  0.0099  12  SER A N   
87   C  CA  . SER A 12  ? 2.8145 1.9525 1.9387 -0.0445 0.1094  -0.0017 12  SER A CA  
88   C  C   . SER A 12  ? 2.6339 1.8161 1.8086 -0.0475 0.0982  -0.0171 12  SER A C   
89   O  O   . SER A 12  ? 2.5019 1.7106 1.7305 -0.0427 0.0963  -0.0185 12  SER A O   
90   C  CB  . SER A 12  ? 2.2366 1.3707 1.3299 -0.0385 0.0803  0.0057  12  SER A CB  
91   O  OG  . SER A 12  ? 2.3305 1.4868 1.4675 -0.0275 0.0638  0.0101  12  SER A OG  
92   N  N   . ILE A 13  ? 2.5292 1.7181 1.6838 -0.0564 0.0907  -0.0287 13  ILE A N   
93   C  CA  . ILE A 13  ? 2.4095 1.6399 1.6042 -0.0611 0.0768  -0.0425 13  ILE A CA  
94   C  C   . ILE A 13  ? 2.4479 1.7142 1.6835 -0.0522 0.0524  -0.0421 13  ILE A C   
95   O  O   . ILE A 13  ? 2.2955 1.5905 1.5844 -0.0499 0.0549  -0.0463 13  ILE A O   
96   C  CB  . ILE A 13  ? 2.9840 2.2138 2.1409 -0.0713 0.0626  -0.0523 13  ILE A CB  
97   C  CG1 . ILE A 13  ? 3.0600 2.2418 2.1501 -0.0757 0.0772  -0.0483 13  ILE A CG1 
98   C  CG2 . ILE A 13  ? 2.8389 2.0959 2.0288 -0.0811 0.0646  -0.0662 13  ILE A CG2 
99   C  CD1 . ILE A 13  ? 3.1988 2.3726 2.2370 -0.0825 0.0549  -0.0526 13  ILE A CD1 
100  N  N   . LYS A 14  ? 2.9278 2.1923 2.1373 -0.0469 0.0288  -0.0371 14  LYS A N   
101  C  CA  . LYS A 14  ? 3.0135 2.3118 2.2582 -0.0369 0.0035  -0.0373 14  LYS A CA  
102  C  C   . LYS A 14  ? 2.9688 2.2698 2.2558 -0.0263 0.0132  -0.0313 14  LYS A C   
103  O  O   . LYS A 14  ? 2.8486 2.1861 2.1869 -0.0223 0.0055  -0.0388 14  LYS A O   
104  C  CB  . LYS A 14  ? 2.2537 1.5392 1.4572 -0.0311 -0.0199 -0.0284 14  LYS A CB  
105  C  CG  . LYS A 14  ? 2.4077 1.7308 1.6427 -0.0206 -0.0502 -0.0298 14  LYS A CG  
106  C  CD  . LYS A 14  ? 2.6883 1.9973 1.8771 -0.0162 -0.0742 -0.0199 14  LYS A CD  
107  C  CE  . LYS A 14  ? 2.7454 2.0497 1.8882 -0.0313 -0.0812 -0.0267 14  LYS A CE  
108  N  NZ  . LYS A 14  ? 3.0025 2.2855 2.0904 -0.0296 -0.1010 -0.0160 14  LYS A NZ  
109  N  N   . TYR A 15  ? 2.3426 1.6042 1.6066 -0.0228 0.0307  -0.0181 15  TYR A N   
110  C  CA  . TYR A 15  ? 2.2635 1.5213 1.5626 -0.0142 0.0402  -0.0111 15  TYR A CA  
111  C  C   . TYR A 15  ? 1.9510 1.2323 1.2999 -0.0194 0.0568  -0.0209 15  TYR A C   
112  O  O   . TYR A 15  ? 1.8687 1.1785 1.2659 -0.0140 0.0498  -0.0264 15  TYR A O   
113  C  CB  . TYR A 15  ? 2.1603 1.3702 1.4218 -0.0132 0.0593  0.0051  15  TYR A CB  
114  C  CG  . TYR A 15  ? 2.1355 1.3357 1.4274 -0.0050 0.0673  0.0146  15  TYR A CG  
115  C  CD1 . TYR A 15  ? 2.3332 1.5381 1.6403 0.0077  0.0464  0.0199  15  TYR A CD1 
116  C  CD2 . TYR A 15  ? 1.9411 1.1262 1.2465 -0.0100 0.0957  0.0185  15  TYR A CD2 
117  C  CE1 . TYR A 15  ? 2.3309 1.5228 1.6642 0.0145  0.0537  0.0281  15  TYR A CE1 
118  C  CE2 . TYR A 15  ? 1.8993 1.0740 1.2317 -0.0044 0.1027  0.0272  15  TYR A CE2 
119  C  CZ  . TYR A 15  ? 2.0840 1.2606 1.4291 0.0075  0.0818  0.0316  15  TYR A CZ  
120  O  OH  . TYR A 15  ? 2.0229 1.1857 1.3940 0.0122  0.0890  0.0397  15  TYR A OH  
121  N  N   . THR A 16  ? 2.3966 1.6654 1.7331 -0.0297 0.0789  -0.0232 16  THR A N   
122  C  CA  . THR A 16  ? 2.1232 1.4142 1.5044 -0.0355 0.0941  -0.0314 16  THR A CA  
123  C  C   . THR A 16  ? 2.0563 1.3958 1.4792 -0.0365 0.0752  -0.0451 16  THR A C   
124  O  O   . THR A 16  ? 1.8943 1.2578 1.3644 -0.0355 0.0787  -0.0495 16  THR A O   
125  C  CB  . THR A 16  ? 1.8192 1.0924 1.1783 -0.0458 0.1168  -0.0332 16  THR A CB  
126  O  OG1 . THR A 16  ? 1.7739 1.0163 1.1260 -0.0449 0.1426  -0.0221 16  THR A OG1 
127  C  CG2 . THR A 16  ? 1.6038 0.9099 1.0031 -0.0535 0.1206  -0.0452 16  THR A CG2 
128  N  N   . CYS A 17  ? 1.8555 1.2104 1.2609 -0.0392 0.0551  -0.0519 17  CYS A N   
129  C  CA  . CYS A 17  ? 1.8171 1.2201 1.2605 -0.0415 0.0379  -0.0647 17  CYS A CA  
130  C  C   . CYS A 17  ? 1.9305 1.3597 1.4070 -0.0294 0.0193  -0.0662 17  CYS A C   
131  O  O   . CYS A 17  ? 1.8617 1.3312 1.3816 -0.0300 0.0128  -0.0765 17  CYS A O   
132  C  CB  . CYS A 17  ? 2.1528 1.5659 1.5698 -0.0507 0.0237  -0.0718 17  CYS A CB  
133  S  SG  . CYS A 17  ? 1.9814 1.3811 1.3840 -0.0662 0.0447  -0.0770 17  CYS A SG  
134  N  N   . ILE A 18  ? 1.9359 1.3420 1.3917 -0.0182 0.0110  -0.0560 18  ILE A N   
135  C  CA  . ILE A 18  ? 2.0507 1.4749 1.5385 -0.0045 -0.0042 -0.0565 18  ILE A CA  
136  C  C   . ILE A 18  ? 1.8603 1.2816 1.3852 -0.0016 0.0127  -0.0561 18  ILE A C   
137  O  O   . ILE A 18  ? 1.8439 1.2947 1.4113 0.0044  0.0052  -0.0644 18  ILE A O   
138  C  CB  . ILE A 18  ? 1.7696 1.1672 1.2247 0.0074  -0.0189 -0.0439 18  ILE A CB  
139  C  CG1 . ILE A 18  ? 1.9850 1.4013 1.4183 0.0066  -0.0436 -0.0472 18  ILE A CG1 
140  C  CG2 . ILE A 18  ? 1.8753 1.2770 1.3640 0.0230  -0.0266 -0.0415 18  ILE A CG2 
141  C  CD1 . ILE A 18  ? 2.3002 1.7042 1.7149 0.0208  -0.0648 -0.0364 18  ILE A CD1 
142  N  N   . LEU A 19  ? 2.2427 1.6298 1.7520 -0.0066 0.0358  -0.0472 19  LEU A N   
143  C  CA  . LEU A 19  ? 1.9924 1.3767 1.5365 -0.0062 0.0523  -0.0463 19  LEU A CA  
144  C  C   . LEU A 19  ? 1.7355 1.1568 1.3195 -0.0157 0.0593  -0.0592 19  LEU A C   
145  O  O   . LEU A 19  ? 1.5955 1.0336 1.2201 -0.0140 0.0622  -0.0643 19  LEU A O   
146  C  CB  . LEU A 19  ? 1.7140 1.0533 1.2312 -0.0092 0.0754  -0.0319 19  LEU A CB  
147  C  CG  . LEU A 19  ? 1.9721 1.2703 1.4459 -0.0016 0.0716  -0.0164 19  LEU A CG  
148  C  CD1 . LEU A 19  ? 1.8732 1.1329 1.3360 -0.0042 0.0963  -0.0025 19  LEU A CD1 
149  C  CD2 . LEU A 19  ? 2.1517 1.4579 1.6404 0.0125  0.0484  -0.0160 19  LEU A CD2 
150  N  N   . ILE A 20  ? 1.6969 1.1293 1.2680 -0.0262 0.0614  -0.0644 20  ILE A N   
151  C  CA  . ILE A 20  ? 1.5061 0.9753 1.1111 -0.0357 0.0642  -0.0757 20  ILE A CA  
152  C  C   . ILE A 20  ? 1.5913 1.1050 1.2283 -0.0317 0.0434  -0.0877 20  ILE A C   
153  O  O   . ILE A 20  ? 1.4462 0.9900 1.1233 -0.0345 0.0454  -0.0960 20  ILE A O   
154  C  CB  . ILE A 20  ? 1.6279 1.0961 1.2083 -0.0473 0.0683  -0.0781 20  ILE A CB  
155  C  CG1 . ILE A 20  ? 1.4026 0.8519 0.9842 -0.0548 0.0939  -0.0733 20  ILE A CG1 
156  C  CG2 . ILE A 20  ? 1.6260 1.1399 1.2325 -0.0543 0.0552  -0.0907 20  ILE A CG2 
157  C  CD1 . ILE A 20  ? 1.4573 0.8685 0.9910 -0.0587 0.1063  -0.0669 20  ILE A CD1 
158  N  N   . LEU A 21  ? 1.6480 1.1672 1.2668 -0.0255 0.0235  -0.0887 21  LEU A N   
159  C  CA  . LEU A 21  ? 1.7654 1.3273 1.4141 -0.0196 0.0034  -0.0997 21  LEU A CA  
160  C  C   . LEU A 21  ? 1.7547 1.3223 1.4378 -0.0078 0.0028  -0.1022 21  LEU A C   
161  O  O   . LEU A 21  ? 1.6965 1.3005 1.4182 -0.0090 0.0009  -0.1138 21  LEU A O   
162  C  CB  . LEU A 21  ? 1.8611 1.4245 1.4832 -0.0137 -0.0179 -0.0979 21  LEU A CB  
163  C  CG  . LEU A 21  ? 1.8511 1.4506 1.4740 -0.0244 -0.0298 -0.1073 21  LEU A CG  
164  C  CD1 . LEU A 21  ? 2.0263 1.6778 1.6922 -0.0191 -0.0453 -0.1196 21  LEU A CD1 
165  C  CD2 . LEU A 21  ? 1.6266 1.2252 1.2481 -0.0410 -0.0128 -0.1096 21  LEU A CD2 
166  N  N   . ILE A 22  ? 1.7742 1.3047 1.4419 0.0030  0.0043  -0.0914 22  ILE A N   
167  C  CA  . ILE A 22  ? 1.7651 1.2935 1.4629 0.0140  0.0043  -0.0933 22  ILE A CA  
168  C  C   . ILE A 22  ? 1.4790 1.0150 1.2076 0.0053  0.0220  -0.0984 22  ILE A C   
169  O  O   . ILE A 22  ? 1.4409 1.0048 1.2071 0.0081  0.0185  -0.1101 22  ILE A O   
170  C  CB  . ILE A 22  ? 1.3723 0.8516 1.0449 0.0240  0.0068  -0.0778 22  ILE A CB  
171  C  CG1 . ILE A 22  ? 1.6802 1.1440 1.3116 0.0299  -0.0085 -0.0687 22  ILE A CG1 
172  C  CG2 . ILE A 22  ? 1.4069 0.8854 1.1119 0.0370  0.0020  -0.0814 22  ILE A CG2 
173  C  CD1 . ILE A 22  ? 1.8025 1.2132 1.3969 0.0352  -0.0028 -0.0501 22  ILE A CD1 
174  N  N   . ALA A 23  ? 1.9767 1.4883 1.6894 -0.0051 0.0411  -0.0897 23  ALA A N   
175  C  CA  . ALA A 23  ? 1.7316 1.2494 1.4732 -0.0138 0.0578  -0.0923 23  ALA A CA  
176  C  C   . ALA A 23  ? 1.6441 1.2111 1.4183 -0.0211 0.0526  -0.1072 23  ALA A C   
177  O  O   . ALA A 23  ? 1.5623 1.1494 1.3713 -0.0210 0.0533  -0.1159 23  ALA A O   
178  C  CB  . ALA A 23  ? 1.2527 0.7440 0.9731 -0.0236 0.0776  -0.0815 23  ALA A CB  
179  N  N   . PHE A 24  ? 1.3557 0.9414 1.1169 -0.0284 0.0476  -0.1102 24  PHE A N   
180  C  CA  . PHE A 24  ? 1.2987 0.9310 1.0869 -0.0370 0.0426  -0.1225 24  PHE A CA  
181  C  C   . PHE A 24  ? 1.4326 1.1017 1.2498 -0.0287 0.0267  -0.1361 24  PHE A C   
182  O  O   . PHE A 24  ? 1.3502 1.0508 1.2004 -0.0330 0.0281  -0.1464 24  PHE A O   
183  C  CB  . PHE A 24  ? 1.4035 1.0440 1.1682 -0.0458 0.0379  -0.1221 24  PHE A CB  
184  C  CG  . PHE A 24  ? 1.3992 1.0876 1.1879 -0.0548 0.0302  -0.1335 24  PHE A CG  
185  C  CD1 . PHE A 24  ? 1.2210 0.9213 1.0219 -0.0683 0.0412  -0.1336 24  PHE A CD1 
186  C  CD2 . PHE A 24  ? 1.5947 1.3179 1.3953 -0.0497 0.0121  -0.1435 24  PHE A CD2 
187  C  CE1 . PHE A 24  ? 1.2361 0.9805 1.0579 -0.0777 0.0340  -0.1428 24  PHE A CE1 
188  C  CE2 . PHE A 24  ? 1.6103 1.3798 1.4330 -0.0590 0.0059  -0.1536 24  PHE A CE2 
189  C  CZ  . PHE A 24  ? 1.4306 1.2102 1.2627 -0.0737 0.0167  -0.1530 24  PHE A CZ  
190  N  N   . ALA A 25  ? 1.6505 1.3165 1.4552 -0.0165 0.0115  -0.1361 25  ALA A N   
191  C  CA  . ALA A 25  ? 1.8150 1.5154 1.6467 -0.0061 -0.0037 -0.1489 25  ALA A CA  
192  C  C   . ALA A 25  ? 1.7519 1.4478 1.6119 0.0010  0.0020  -0.1545 25  ALA A C   
193  O  O   . ALA A 25  ? 1.7470 1.4791 1.6385 0.0019  -0.0018 -0.1689 25  ALA A O   
194  C  CB  . ALA A 25  ? 1.3976 1.0892 1.2101 0.0075  -0.0206 -0.1450 25  ALA A CB  
195  N  N   . PHE A 26  ? 1.5652 1.2158 1.4126 0.0050  0.0116  -0.1432 26  PHE A N   
196  C  CA  . PHE A 26  ? 1.4992 1.1369 1.3700 0.0091  0.0190  -0.1464 26  PHE A CA  
197  C  C   . PHE A 26  ? 1.2925 0.9537 1.1899 -0.0051 0.0307  -0.1543 26  PHE A C   
198  O  O   . PHE A 26  ? 1.3197 1.0069 1.2478 -0.0036 0.0279  -0.1688 26  PHE A O   
199  C  CB  . PHE A 26  ? 1.7708 1.3538 1.6173 0.0125  0.0284  -0.1294 26  PHE A CB  
200  C  CG  . PHE A 26  ? 1.6197 1.1839 1.4861 0.0102  0.0407  -0.1290 26  PHE A CG  
201  C  CD1 . PHE A 26  ? 1.7240 1.2741 1.6056 0.0229  0.0347  -0.1333 26  PHE A CD1 
202  C  CD2 . PHE A 26  ? 1.3954 0.9542 1.2655 -0.0045 0.0580  -0.1238 26  PHE A CD2 
203  C  CE1 . PHE A 26  ? 1.6025 1.1329 1.5020 0.0193  0.0456  -0.1333 26  PHE A CE1 
204  C  CE2 . PHE A 26  ? 1.2819 0.8242 1.1713 -0.0079 0.0687  -0.1229 26  PHE A CE2 
205  C  CZ  . PHE A 26  ? 1.3846 0.9121 1.2882 0.0033  0.0622  -0.1280 26  PHE A CZ  
206  N  N   . SER A 27  ? 1.6521 1.3042 1.5377 -0.0186 0.0437  -0.1451 27  SER A N   
207  C  CA  . SER A 27  ? 1.4876 1.1653 1.3968 -0.0328 0.0529  -0.1506 27  SER A CA  
208  C  C   . SER A 27  ? 1.5423 1.2728 1.4731 -0.0367 0.0426  -0.1665 27  SER A C   
209  O  O   . SER A 27  ? 1.4746 1.2301 1.4301 -0.0455 0.0467  -0.1744 27  SER A O   
210  C  CB  . SER A 27  ? 1.3383 1.0030 1.2303 -0.0451 0.0660  -0.1383 27  SER A CB  
211  O  OG  . SER A 27  ? 1.2183 0.9130 1.1330 -0.0585 0.0716  -0.1429 27  SER A OG  
212  N  N   . VAL A 28  ? 1.0667 0.8163 0.9882 -0.0313 0.0292  -0.1708 28  VAL A N   
213  C  CA  . VAL A 28  ? 1.1514 0.9531 1.0952 -0.0352 0.0204  -0.1860 28  VAL A CA  
214  C  C   . VAL A 28  ? 1.3097 1.1281 1.2782 -0.0223 0.0127  -0.2009 28  VAL A C   
215  O  O   . VAL A 28  ? 1.3245 1.1770 1.3183 -0.0273 0.0134  -0.2143 28  VAL A O   
216  C  CB  . VAL A 28  ? 1.3270 1.1507 1.2559 -0.0377 0.0095  -0.1858 28  VAL A CB  
217  C  CG1 . VAL A 28  ? 1.4556 1.3349 1.4101 -0.0407 0.0009  -0.2016 28  VAL A CG1 
218  C  CG2 . VAL A 28  ? 1.1765 0.9887 1.0849 -0.0525 0.0177  -0.1744 28  VAL A CG2 
219  N  N   . LEU A 29  ? 1.3306 1.1243 1.2907 -0.0055 0.0053  -0.1985 29  LEU A N   
220  C  CA  . LEU A 29  ? 1.5015 1.3024 1.4843 0.0094  -0.0012 -0.2118 29  LEU A CA  
221  C  C   . LEU A 29  ? 1.4007 1.1962 1.4043 0.0042  0.0094  -0.2189 29  LEU A C   
222  O  O   . LEU A 29  ? 1.5199 1.3435 1.5485 0.0074  0.0067  -0.2362 29  LEU A O   
223  C  CB  . LEU A 29  ? 1.4665 1.2281 1.4348 0.0277  -0.0083 -0.2033 29  LEU A CB  
224  C  CG  . LEU A 29  ? 1.6505 1.4230 1.6041 0.0372  -0.0237 -0.1999 29  LEU A CG  
225  C  CD1 . LEU A 29  ? 1.8964 1.6697 1.8658 0.0592  -0.0361 -0.2077 29  LEU A CD1 
226  C  CD2 . LEU A 29  ? 1.7312 1.5546 1.6898 0.0255  -0.0285 -0.2073 29  LEU A CD2 
227  N  N   . CYS A 30  ? 1.3957 1.1565 1.3894 -0.0042 0.0217  -0.2063 30  CYS A N   
228  C  CA  . CYS A 30  ? 1.3123 1.0689 1.3270 -0.0107 0.0308  -0.2128 30  CYS A CA  
229  C  C   . CYS A 30  ? 1.2522 1.0536 1.2872 -0.0261 0.0340  -0.2244 30  CYS A C   
230  O  O   . CYS A 30  ? 1.3086 1.1233 1.3657 -0.0270 0.0346  -0.2389 30  CYS A O   
231  C  CB  . CYS A 30  ? 1.3714 1.0823 1.3732 -0.0163 0.0434  -0.1957 30  CYS A CB  
232  S  SG  . CYS A 30  ? 1.4464 1.1058 1.4229 0.0006  0.0396  -0.1819 30  CYS A SG  
233  N  N   . ARG A 31  ? 1.3111 1.1342 1.3375 -0.0387 0.0357  -0.2181 31  ARG A N   
234  C  CA  . ARG A 31  ? 1.2681 1.1323 1.3112 -0.0544 0.0382  -0.2260 31  ARG A CA  
235  C  C   . ARG A 31  ? 1.4602 1.3654 1.5209 -0.0488 0.0291  -0.2462 31  ARG A C   
236  O  O   . ARG A 31  ? 1.4826 1.4221 1.5601 -0.0589 0.0303  -0.2575 31  ARG A O   
237  C  CB  . ARG A 31  ? 1.8223 1.7030 1.8520 -0.0668 0.0392  -0.2160 31  ARG A CB  
238  C  CG  . ARG A 31  ? 1.6806 1.5223 1.6868 -0.0691 0.0469  -0.1965 31  ARG A CG  
239  C  CD  . ARG A 31  ? 1.5156 1.3495 1.5286 -0.0827 0.0594  -0.1873 31  ARG A CD  
240  N  NE  . ARG A 31  ? 1.3983 1.1843 1.3946 -0.0790 0.0696  -0.1718 31  ARG A NE  
241  C  CZ  . ARG A 31  ? 1.2590 1.0295 1.2606 -0.0876 0.0823  -0.1613 31  ARG A CZ  
242  N  NH1 . ARG A 31  ? 1.2221 1.0202 1.2450 -0.1004 0.0850  -0.1637 31  ARG A NH1 
243  N  NH2 . ARG A 31  ? 1.1852 0.9138 1.1709 -0.0837 0.0924  -0.1478 31  ARG A NH2 
244  N  N   . LEU A 32  ? 1.0161 0.9167 1.0726 -0.0320 0.0200  -0.2503 32  LEU A N   
245  C  CA  . LEU A 32  ? 1.2391 1.1828 1.3088 -0.0247 0.0102  -0.2668 32  LEU A CA  
246  C  C   . LEU A 32  ? 1.4089 1.3550 1.4994 -0.0097 0.0073  -0.2852 32  LEU A C   
247  O  O   . LEU A 32  ? 1.6275 1.6087 1.7315 -0.0010 0.0002  -0.3000 32  LEU A O   
248  C  CB  . LEU A 32  ? 0.9071 0.8495 0.9599 -0.0160 0.0006  -0.2585 32  LEU A CB  
249  C  CG  . LEU A 32  ? 1.0931 1.0852 1.1570 -0.0123 -0.0097 -0.2706 32  LEU A CG  
250  C  CD1 . LEU A 32  ? 0.9793 0.9880 1.0266 -0.0254 -0.0128 -0.2600 32  LEU A CD1 
251  C  CD2 . LEU A 32  ? 1.3173 1.2986 1.3849 0.0109  -0.0201 -0.2748 32  LEU A CD2 
252  N  N   . TYR A 33  ? 1.1981 1.1068 1.2920 -0.0070 0.0133  -0.2847 33  TYR A N   
253  C  CA  . TYR A 33  ? 1.3580 1.2654 1.4718 0.0046  0.0121  -0.3035 33  TYR A CA  
254  C  C   . TYR A 33  ? 1.4104 1.3599 1.5421 -0.0085 0.0160  -0.3215 33  TYR A C   
255  O  O   . TYR A 33  ? 1.6223 1.6007 1.7706 -0.0002 0.0127  -0.3423 33  TYR A O   
256  C  CB  . TYR A 33  ? 1.2344 1.0860 1.3448 0.0087  0.0173  -0.2958 33  TYR A CB  
257  C  CG  . TYR A 33  ? 1.3552 1.2014 1.4859 0.0123  0.0194  -0.3149 33  TYR A CG  
258  C  CD1 . TYR A 33  ? 1.4756 1.2796 1.6092 0.0288  0.0171  -0.3167 33  TYR A CD1 
259  C  CD2 . TYR A 33  ? 1.3665 1.2467 1.5116 -0.0018 0.0236  -0.3305 33  TYR A CD2 
260  C  CE1 . TYR A 33  ? 1.5994 1.3949 1.7507 0.0315  0.0191  -0.3352 33  TYR A CE1 
261  C  CE2 . TYR A 33  ? 1.4978 1.3716 1.6589 0.0003  0.0254  -0.3493 33  TYR A CE2 
262  C  CZ  . TYR A 33  ? 1.6098 1.4405 1.7743 0.0169  0.0234  -0.3522 33  TYR A CZ  
263  O  OH  . TYR A 33  ? 1.7529 1.5748 1.9328 0.0183  0.0252  -0.3722 33  TYR A OH  
264  N  N   . TRP A 34  ? 1.1959 1.1492 1.3240 -0.0286 0.0233  -0.3135 34  TRP A N   
265  C  CA  . TRP A 34  ? 1.2548 1.2467 1.3967 -0.0432 0.0264  -0.3279 34  TRP A CA  
266  C  C   . TRP A 34  ? 1.3791 1.4260 1.5274 -0.0430 0.0213  -0.3412 34  TRP A C   
267  O  O   . TRP A 34  ? 1.3969 1.4778 1.5583 -0.0483 0.0226  -0.3598 34  TRP A O   
268  C  CB  . TRP A 34  ? 1.2871 1.2787 1.4232 -0.0646 0.0329  -0.3131 34  TRP A CB  
269  C  CG  . TRP A 34  ? 1.3390 1.3696 1.4872 -0.0806 0.0348  -0.3258 34  TRP A CG  
270  C  CD1 . TRP A 34  ? 1.3999 1.4249 1.5594 -0.0872 0.0381  -0.3363 34  TRP A CD1 
271  C  CD2 . TRP A 34  ? 1.2480 1.3293 1.3968 -0.0932 0.0329  -0.3290 34  TRP A CD2 
272  N  NE1 . TRP A 34  ? 1.3848 1.4544 1.5504 -0.1028 0.0380  -0.3461 34  TRP A NE1 
273  C  CE2 . TRP A 34  ? 1.2600 1.3645 1.4191 -0.1068 0.0352  -0.3410 34  TRP A CE2 
274  C  CE3 . TRP A 34  ? 1.1448 1.2537 1.2856 -0.0956 0.0291  -0.3223 34  TRP A CE3 
275  C  CZ2 . TRP A 34  ? 1.1777 1.3317 1.3382 -0.1221 0.0341  -0.3456 34  TRP A CZ2 
276  C  CZ3 . TRP A 34  ? 1.0610 1.2181 1.2048 -0.1111 0.0285  -0.3268 34  TRP A CZ3 
277  C  CH2 . TRP A 34  ? 1.0795 1.2588 1.2326 -0.1239 0.0310  -0.3378 34  TRP A CH2 
278  N  N   . VAL A 35  ? 1.2035 1.2601 1.3423 -0.0377 0.0157  -0.3321 35  VAL A N   
279  C  CA  . VAL A 35  ? 1.2028 1.3122 1.3498 -0.0362 0.0103  -0.3442 35  VAL A CA  
280  C  C   . VAL A 35  ? 1.4406 1.5554 1.6032 -0.0139 0.0056  -0.3629 35  VAL A C   
281  O  O   . VAL A 35  ? 1.4896 1.6480 1.6679 -0.0124 0.0055  -0.3825 35  VAL A O   
282  C  CB  . VAL A 35  ? 1.3489 1.4686 1.4815 -0.0395 0.0047  -0.3285 35  VAL A CB  
283  C  CG1 . VAL A 35  ? 1.3763 1.5521 1.5206 -0.0382 -0.0009 -0.3415 35  VAL A CG1 
284  C  CG2 . VAL A 35  ? 1.1414 1.2573 1.2603 -0.0609 0.0098  -0.3116 35  VAL A CG2 
285  N  N   . ALA A 36  ? 1.1299 1.1998 1.2883 0.0038  0.0021  -0.3565 36  ALA A N   
286  C  CA  . ALA A 36  ? 1.3931 1.4595 1.5675 0.0266  -0.0023 -0.3728 36  ALA A CA  
287  C  C   . ALA A 36  ? 1.4689 1.5421 1.6596 0.0251  0.0042  -0.3952 36  ALA A C   
288  O  O   . ALA A 36  ? 1.6606 1.7428 1.8684 0.0423  0.0023  -0.4147 36  ALA A O   
289  C  CB  . ALA A 36  ? 5.4638 5.4726 5.6283 0.0432  -0.0066 -0.3591 36  ALA A CB  
290  N  N   . TRP A 37  ? 1.2011 1.2700 1.3869 0.0050  0.0117  -0.3930 37  TRP A N   
291  C  CA  . TRP A 37  ? 1.2870 1.3560 1.4853 0.0020  0.0172  -0.4137 37  TRP A CA  
292  C  C   . TRP A 37  ? 1.2010 1.3236 1.4049 -0.0155 0.0213  -0.4283 37  TRP A C   
293  O  O   . TRP A 37  ? 1.3613 1.5014 1.5774 -0.0122 0.0240  -0.4526 37  TRP A O   
294  C  CB  . TRP A 37  ? 1.3326 1.3511 1.5239 -0.0063 0.0218  -0.4028 37  TRP A CB  
295  C  CG  . TRP A 37  ? 1.4001 1.4214 1.6010 -0.0162 0.0269  -0.4212 37  TRP A CG  
296  C  CD1 . TRP A 37  ? 1.5878 1.5869 1.7998 -0.0044 0.0275  -0.4404 37  TRP A CD1 
297  C  CD2 . TRP A 37  ? 1.2867 1.3325 1.4858 -0.0406 0.0313  -0.4218 37  TRP A CD2 
298  N  NE1 . TRP A 37  ? 1.6105 1.6192 1.8267 -0.0208 0.0320  -0.4542 37  TRP A NE1 
299  C  CE2 . TRP A 37  ? 1.4372 1.4758 1.6457 -0.0431 0.0339  -0.4425 37  TRP A CE2 
300  C  CE3 . TRP A 37  ? 1.0783 1.1505 1.2689 -0.0604 0.0326  -0.4064 37  TRP A CE3 
301  C  CZ2 . TRP A 37  ? 1.3919 1.4510 1.6007 -0.0653 0.0370  -0.4480 37  TRP A CZ2 
302  C  CZ3 . TRP A 37  ? 1.0319 1.1238 1.2242 -0.0812 0.0357  -0.4108 37  TRP A CZ3 
303  C  CH2 . TRP A 37  ? 1.1906 1.2770 1.3915 -0.0838 0.0375  -0.4313 37  TRP A CH2 
304  N  N   . ALA A 38  ? 1.6421 1.7892 1.8356 -0.0342 0.0219  -0.4135 38  ALA A N   
305  C  CA  . ALA A 38  ? 1.5404 1.7352 1.7359 -0.0540 0.0255  -0.4229 38  ALA A CA  
306  C  C   . ALA A 38  ? 1.5756 1.8281 1.7780 -0.0522 0.0238  -0.4349 38  ALA A C   
307  O  O   . ALA A 38  ? 1.5652 1.8609 1.7671 -0.0693 0.0266  -0.4410 38  ALA A O   
308  C  CB  . ALA A 38  ? 0.9054 1.0968 1.0879 -0.0757 0.0271  -0.4005 38  ALA A CB  
309  N  N   . SER A 39  ? 1.2735 1.5276 1.4825 -0.0320 0.0188  -0.4374 39  SER A N   
310  C  CA  . SER A 39  ? 1.3061 1.6161 1.5244 -0.0293 0.0168  -0.4472 39  SER A CA  
311  C  C   . SER A 39  ? 1.5348 1.8698 1.7718 -0.0159 0.0205  -0.4773 39  SER A C   
312  O  O   . SER A 39  ? 1.5695 1.9598 1.8153 -0.0200 0.0232  -0.4911 39  SER A O   
313  C  CB  . SER A 39  ? 1.1623 1.4651 1.3797 -0.0148 0.0084  -0.4339 39  SER A CB  
314  O  OG  . SER A 39  ? 1.1530 1.4116 1.3517 -0.0203 0.0057  -0.4084 39  SER A OG  
315  N  N   . GLU A 40  ? 1.3641 1.6573 1.6072 0.0001  0.0213  -0.4876 40  GLU A N   
316  C  CA  . GLU A 40  ? 1.6128 1.9208 1.8735 0.0148  0.0255  -0.5178 40  GLU A CA  
317  C  C   . GLU A 40  ? 1.6279 1.9527 1.8846 -0.0042 0.0335  -0.5338 40  GLU A C   
318  O  O   . GLU A 40  ? 1.8367 2.1617 2.1030 0.0044  0.0382  -0.5597 40  GLU A O   
319  C  CB  . GLU A 40  ? 1.9997 2.2524 2.2680 0.0394  0.0225  -0.5221 40  GLU A CB  
320  C  CG  . GLU A 40  ? 2.0492 2.2837 2.3199 0.0590  0.0132  -0.5056 40  GLU A CG  
321  C  CD  . GLU A 40  ? 2.4033 2.6079 2.6905 0.0888  0.0101  -0.5187 40  GLU A CD  
322  O  OE1 . GLU A 40  ? 2.6233 2.8242 2.9215 0.0950  0.0160  -0.5433 40  GLU A OE1 
323  O  OE2 . GLU A 40  ? 2.4816 2.6656 2.7700 0.1060  0.0012  -0.5044 40  GLU A OE2 
324  N  N   . PHE A 41  ? 1.2794 1.6175 1.5210 -0.0301 0.0345  -0.5183 41  PHE A N   
325  C  CA  . PHE A 41  ? 1.2953 1.6523 1.5305 -0.0513 0.0401  -0.5294 41  PHE A CA  
326  C  C   . PHE A 41  ? 1.1786 1.5934 1.4075 -0.0715 0.0416  -0.5242 41  PHE A C   
327  O  O   . PHE A 41  ? 1.1872 1.6042 1.4068 -0.0830 0.0379  -0.4996 41  PHE A O   
328  C  CB  . PHE A 41  ? 1.4221 1.7329 1.6461 -0.0648 0.0392  -0.5133 41  PHE A CB  
329  C  CG  . PHE A 41  ? 1.5959 1.8540 1.8256 -0.0504 0.0394  -0.5228 41  PHE A CG  
330  C  CD1 . PHE A 41  ? 1.5710 1.7750 1.7950 -0.0500 0.0369  -0.5020 41  PHE A CD1 
331  C  CD2 . PHE A 41  ? 1.8091 2.0712 2.0498 -0.0375 0.0429  -0.5531 41  PHE A CD2 
332  C  CE1 . PHE A 41  ? 1.7542 1.9091 1.9835 -0.0381 0.0371  -0.5097 41  PHE A CE1 
333  C  CE2 . PHE A 41  ? 1.9971 2.2079 2.2431 -0.0247 0.0428  -0.5619 41  PHE A CE2 
334  C  CZ  . PHE A 41  ? 1.9708 2.1276 2.2111 -0.0256 0.0396  -0.5396 41  PHE A CZ  
335  N  N   . TYR A 42  ? 1.5309 1.9920 1.7638 -0.0764 0.0475  -0.5478 42  TYR A N   
336  C  CA  . TYR A 42  ? 1.4345 1.9544 1.6633 -0.0927 0.0492  -0.5438 42  TYR A CA  
337  C  C   . TYR A 42  ? 1.2698 1.7967 1.4811 -0.1220 0.0483  -0.5261 42  TYR A C   
338  O  O   . TYR A 42  ? 1.2228 1.7816 1.4277 -0.1367 0.0468  -0.5105 42  TYR A O   
339  C  CB  . TYR A 42  ? 3.5600 4.1322 3.7984 -0.0886 0.0570  -0.5742 42  TYR A CB  
340  C  CG  . TYR A 42  ? 3.5132 4.1449 3.7502 -0.1022 0.0583  -0.5672 42  TYR A CG  
341  C  CD1 . TYR A 42  ? 3.4248 4.0781 3.6759 -0.0883 0.0558  -0.5635 42  TYR A CD1 
342  C  CD2 . TYR A 42  ? 3.5793 4.2442 3.8008 -0.1302 0.0608  -0.5617 42  TYR A CD2 
343  C  CE1 . TYR A 42  ? 3.4032 4.1102 3.6538 -0.1026 0.0567  -0.5559 42  TYR A CE1 
344  C  CE2 . TYR A 42  ? 3.5650 4.2818 3.7845 -0.1442 0.0618  -0.5531 42  TYR A CE2 
345  C  CZ  . TYR A 42  ? 3.4770 4.2147 3.7114 -0.1308 0.0601  -0.5506 42  TYR A CZ  
346  O  OH  . TYR A 42  ? 3.4808 4.2706 3.7143 -0.1462 0.0610  -0.5419 42  TYR A OH  
347  N  N   . GLU A 43  ? 1.7063 2.2028 1.9109 -0.1303 0.0487  -0.5283 43  GLU A N   
348  C  CA  . GLU A 43  ? 1.5507 2.0554 1.7410 -0.1574 0.0474  -0.5142 43  GLU A CA  
349  C  C   . GLU A 43  ? 1.4060 1.8882 1.5897 -0.1658 0.0418  -0.4800 43  GLU A C   
350  O  O   . GLU A 43  ? 1.2513 1.7421 1.4250 -0.1875 0.0400  -0.4642 43  GLU A O   
351  C  CB  . GLU A 43  ? 1.7081 2.1830 1.8962 -0.1620 0.0481  -0.5259 43  GLU A CB  
352  C  CG  . GLU A 43  ? 1.8825 2.3542 2.0796 -0.1446 0.0531  -0.5596 43  GLU A CG  
353  C  CD  . GLU A 43  ? 1.9468 2.3880 2.1406 -0.1512 0.0531  -0.5725 43  GLU A CD  
354  O  OE1 . GLU A 43  ? 1.9270 2.3314 2.1176 -0.1603 0.0486  -0.5530 43  GLU A OE1 
355  O  OE2 . GLU A 43  ? 2.0319 2.4869 2.2268 -0.1476 0.0580  -0.6029 43  GLU A OE2 
356  N  N   . PHE A 44  ? 1.3196 1.7733 1.5085 -0.1482 0.0391  -0.4692 44  PHE A N   
357  C  CA  . PHE A 44  ? 1.2262 1.6491 1.4080 -0.1517 0.0349  -0.4391 44  PHE A CA  
358  C  C   . PHE A 44  ? 1.1589 1.6104 1.3376 -0.1550 0.0322  -0.4259 44  PHE A C   
359  O  O   . PHE A 44  ? 1.1389 1.5637 1.3112 -0.1548 0.0288  -0.4037 44  PHE A O   
360  C  CB  . PHE A 44  ? 0.9403 1.3078 1.1263 -0.1305 0.0332  -0.4348 44  PHE A CB  
361  C  CG  . PHE A 44  ? 1.0096 1.3356 1.1969 -0.1301 0.0349  -0.4382 44  PHE A CG  
362  C  CD1 . PHE A 44  ? 1.1929 1.4739 1.3863 -0.1099 0.0347  -0.4430 44  PHE A CD1 
363  C  CD2 . PHE A 44  ? 0.9109 1.2428 1.0940 -0.1507 0.0359  -0.4353 44  PHE A CD2 
364  C  CE1 . PHE A 44  ? 1.2799 1.5219 1.4750 -0.1112 0.0362  -0.4454 44  PHE A CE1 
365  C  CE2 . PHE A 44  ? 0.9883 1.2837 1.1742 -0.1517 0.0369  -0.4382 44  PHE A CE2 
366  C  CZ  . PHE A 44  ? 1.1742 1.4241 1.3662 -0.1325 0.0374  -0.4433 44  PHE A CZ  
367  N  N   . PHE A 45  ? 1.1972 1.7016 1.3802 -0.1578 0.0341  -0.4399 45  PHE A N   
368  C  CA  . PHE A 45  ? 1.1418 1.6758 1.3240 -0.1610 0.0312  -0.4291 45  PHE A CA  
369  C  C   . PHE A 45  ? 1.0853 1.6679 1.2598 -0.1862 0.0325  -0.4235 45  PHE A C   
370  O  O   . PHE A 45  ? 1.0704 1.6831 1.2437 -0.1967 0.0370  -0.4380 45  PHE A O   
371  C  CB  . PHE A 45  ? 0.9527 1.5113 1.1502 -0.1410 0.0317  -0.4478 45  PHE A CB  
372  C  CG  . PHE A 45  ? 1.0344 1.5480 1.2387 -0.1158 0.0278  -0.4472 45  PHE A CG  
373  C  CD1 . PHE A 45  ? 1.2285 1.7178 1.4422 -0.0978 0.0304  -0.4662 45  PHE A CD1 
374  C  CD2 . PHE A 45  ? 0.9439 1.4385 1.1439 -0.1105 0.0211  -0.4279 45  PHE A CD2 
375  C  CE1 . PHE A 45  ? 1.3338 1.7802 1.5531 -0.0746 0.0262  -0.4641 45  PHE A CE1 
376  C  CE2 . PHE A 45  ? 1.0449 1.4978 1.2488 -0.0878 0.0168  -0.4262 45  PHE A CE2 
377  C  CZ  . PHE A 45  ? 1.2416 1.6705 1.4554 -0.0697 0.0192  -0.4436 45  PHE A CZ  
378  N  N   . PHE A 46  ? 1.7117 2.3009 1.8798 -0.1961 0.0284  -0.4026 46  PHE A N   
379  C  CA  . PHE A 46  ? 1.7054 2.3424 1.8673 -0.2188 0.0289  -0.3959 46  PHE A CA  
380  C  C   . PHE A 46  ? 1.7107 2.3566 1.8734 -0.2180 0.0242  -0.3833 46  PHE A C   
381  O  O   . PHE A 46  ? 1.6424 2.2480 1.8042 -0.2054 0.0198  -0.3730 46  PHE A O   
382  C  CB  . PHE A 46  ? 1.1900 1.8124 1.3383 -0.2397 0.0272  -0.3757 46  PHE A CB  
383  C  CG  . PHE A 46  ? 1.1691 1.8400 1.3098 -0.2642 0.0279  -0.3703 46  PHE A CG  
384  C  CD1 . PHE A 46  ? 1.1471 1.8512 1.2853 -0.2748 0.0322  -0.3852 46  PHE A CD1 
385  C  CD2 . PHE A 46  ? 1.1978 1.8797 1.3323 -0.2776 0.0242  -0.3501 46  PHE A CD2 
386  C  CE1 . PHE A 46  ? 1.1551 1.9040 1.2838 -0.2984 0.0327  -0.3788 46  PHE A CE1 
387  C  CE2 . PHE A 46  ? 1.2065 1.9315 1.3334 -0.3012 0.0246  -0.3434 46  PHE A CE2 
388  C  CZ  . PHE A 46  ? 1.1860 1.9452 1.3096 -0.3116 0.0290  -0.3572 46  PHE A CZ  
389  N  N   . ASN A 47  ? 1.0000 1.6982 1.1634 -0.2327 0.0252  -0.3837 47  ASN A N   
390  C  CA  . ASN A 47  ? 1.0566 1.7727 1.2242 -0.2325 0.0206  -0.3760 47  ASN A CA  
391  C  C   . ASN A 47  ? 1.0179 1.7082 1.1959 -0.2063 0.0163  -0.3815 47  ASN A C   
392  O  O   . ASN A 47  ? 1.0569 1.7201 1.2288 -0.2045 0.0095  -0.3650 47  ASN A O   
393  C  CB  . ASN A 47  ? 1.3191 2.0218 1.4716 -0.2526 0.0154  -0.3483 47  ASN A CB  
394  C  CG  . ASN A 47  ? 1.3313 2.0788 1.4772 -0.2794 0.0178  -0.3424 47  ASN A CG  
395  O  OD1 . ASN A 47  ? 1.3206 2.1182 1.4734 -0.2837 0.0234  -0.3590 47  ASN A OD1 
396  N  ND2 . ASN A 47  ? 1.3740 2.1032 1.5060 -0.2974 0.0140  -0.3183 47  ASN A ND2 
397  N  N   . ASP A 48  ? 1.9282 2.6259 2.1210 -0.1863 0.0201  -0.4048 48  ASP A N   
398  C  CA  . ASP A 48  ? 1.9170 2.5979 2.1231 -0.1598 0.0158  -0.4125 48  ASP A CA  
399  C  C   . ASP A 48  ? 1.8211 2.4357 2.0166 -0.1486 0.0095  -0.3963 48  ASP A C   
400  O  O   . ASP A 48  ? 1.8422 2.4441 2.0408 -0.1354 0.0024  -0.3911 48  ASP A O   
401  C  CB  . ASP A 48  ? 2.2432 2.9701 2.4616 -0.1598 0.0119  -0.4134 48  ASP A CB  
402  C  CG  . ASP A 48  ? 2.2994 3.0940 2.5256 -0.1756 0.0192  -0.4252 48  ASP A CG  
403  O  OD1 . ASP A 48  ? 2.4001 3.2098 2.6280 -0.1764 0.0278  -0.4421 48  ASP A OD1 
404  O  OD2 . ASP A 48  ? 2.2589 3.0914 2.4882 -0.1885 0.0164  -0.4175 48  ASP A OD2 
405  N  N   . GLN A 49  ? 1.5412 2.1158 1.7243 -0.1544 0.0123  -0.3887 49  GLN A N   
406  C  CA  . GLN A 49  ? 1.4460 1.9576 1.6180 -0.1459 0.0089  -0.3731 49  GLN A CA  
407  C  C   . GLN A 49  ? 1.4158 1.8946 1.5814 -0.1512 0.0140  -0.3710 49  GLN A C   
408  O  O   . GLN A 49  ? 1.4162 1.9174 1.5787 -0.1694 0.0178  -0.3714 49  GLN A O   
409  C  CB  . GLN A 49  ? 1.4240 1.9216 1.5809 -0.1578 0.0034  -0.3492 49  GLN A CB  
410  C  CG  . GLN A 49  ? 1.3535 1.7874 1.4961 -0.1515 0.0019  -0.3324 49  GLN A CG  
411  C  CD  . GLN A 49  ? 1.4594 1.8593 1.6070 -0.1257 -0.0003 -0.3397 49  GLN A CD  
412  O  OE1 . GLN A 49  ? 1.5415 1.9644 1.7040 -0.1108 -0.0025 -0.3560 49  GLN A OE1 
413  N  NE2 . GLN A 49  ? 1.4755 1.8204 1.6110 -0.1203 0.0006  -0.3272 49  GLN A NE2 
414  N  N   . LEU A 50  ? 1.4056 1.8323 1.5691 -0.1361 0.0136  -0.3681 50  LEU A N   
415  C  CA  . LEU A 50  ? 1.3713 1.7643 1.5306 -0.1409 0.0180  -0.3647 50  LEU A CA  
416  C  C   . LEU A 50  ? 1.2354 1.6298 1.3832 -0.1641 0.0189  -0.3453 50  LEU A C   
417  O  O   . LEU A 50  ? 1.1728 1.5730 1.3121 -0.1723 0.0157  -0.3302 50  LEU A O   
418  C  CB  . LEU A 50  ? 0.8912 1.2254 1.0468 -0.1242 0.0170  -0.3571 50  LEU A CB  
419  C  CG  . LEU A 50  ? 1.0643 1.3850 1.2322 -0.1020 0.0172  -0.3764 50  LEU A CG  
420  C  CD1 . LEU A 50  ? 1.0885 1.3497 1.2498 -0.0874 0.0157  -0.3648 50  LEU A CD1 
421  C  CD2 . LEU A 50  ? 1.1492 1.4795 1.3253 -0.1070 0.0226  -0.3942 50  LEU A CD2 
422  N  N   . MET A 51  ? 1.3713 1.7607 1.5193 -0.1749 0.0225  -0.3457 51  MET A N   
423  C  CA  . MET A 51  ? 1.2684 1.6580 1.4078 -0.1956 0.0226  -0.3259 51  MET A CA  
424  C  C   . MET A 51  ? 1.1826 1.5193 1.3181 -0.1935 0.0245  -0.3094 51  MET A C   
425  O  O   . MET A 51  ? 1.2173 1.5191 1.3564 -0.1783 0.0263  -0.3149 51  MET A O   
426  C  CB  . MET A 51  ? 0.7456 1.1773 0.8870 -0.2141 0.0239  -0.3336 51  MET A CB  
427  C  CG  . MET A 51  ? 0.9098 1.3657 1.0601 -0.2079 0.0267  -0.3616 51  MET A CG  
428  S  SD  . MET A 51  ? 1.0110 1.5072 1.1594 -0.2296 0.0284  -0.3722 51  MET A SD  
429  C  CE  . MET A 51  ? 0.9268 1.4719 1.0662 -0.2514 0.0262  -0.3582 51  MET A CE  
430  N  N   . ILE A 52  ? 1.0307 1.3628 1.1597 -0.2087 0.0245  -0.2889 52  ILE A N   
431  C  CA  . ILE A 52  ? 0.9495 1.2389 1.0762 -0.2103 0.0274  -0.2703 52  ILE A CA  
432  C  C   . ILE A 52  ? 0.9870 1.2553 1.1234 -0.2079 0.0307  -0.2761 52  ILE A C   
433  O  O   . ILE A 52  ? 1.0738 1.3654 1.2175 -0.2115 0.0301  -0.2929 52  ILE A O   
434  C  CB  . ILE A 52  ? 1.2539 1.5578 1.3764 -0.2298 0.0262  -0.2515 52  ILE A CB  
435  C  CG1 . ILE A 52  ? 1.2491 1.5367 1.3598 -0.2292 0.0253  -0.2355 52  ILE A CG1 
436  C  CG2 . ILE A 52  ? 1.1791 1.4615 1.3076 -0.2365 0.0290  -0.2388 52  ILE A CG2 
437  C  CD1 . ILE A 52  ? 1.2176 1.5113 1.3256 -0.2467 0.0246  -0.2159 52  ILE A CD1 
438  N  N   . THR A 53  ? 1.1269 1.3516 1.2633 -0.2031 0.0346  -0.2623 53  THR A N   
439  C  CA  . THR A 53  ? 1.1694 1.3728 1.3160 -0.2010 0.0377  -0.2675 53  THR A CA  
440  C  C   . THR A 53  ? 1.1069 1.2999 1.2602 -0.2139 0.0401  -0.2501 53  THR A C   
441  O  O   . THR A 53  ? 1.1332 1.3040 1.2959 -0.2128 0.0430  -0.2506 53  THR A O   
442  C  CB  . THR A 53  ? 0.9152 1.0750 1.0598 -0.1819 0.0408  -0.2699 53  THR A CB  
443  O  OG1 . THR A 53  ? 1.0024 1.1754 1.1460 -0.1695 0.0375  -0.2887 53  THR A OG1 
444  C  CG2 . THR A 53  ? 0.9756 1.1093 1.1309 -0.1810 0.0443  -0.2732 53  THR A CG2 
445  N  N   . THR A 54  ? 1.1454 1.3541 1.2957 -0.2263 0.0387  -0.2339 54  THR A N   
446  C  CA  . THR A 54  ? 1.1032 1.3076 1.2636 -0.2381 0.0400  -0.2180 54  THR A CA  
447  C  C   . THR A 54  ? 1.1043 1.3456 1.2635 -0.2549 0.0347  -0.2089 54  THR A C   
448  O  O   . THR A 54  ? 1.0909 1.3399 1.2394 -0.2561 0.0334  -0.2021 54  THR A O   
449  C  CB  . THR A 54  ? 1.4352 1.5980 1.5951 -0.2317 0.0470  -0.1978 54  THR A CB  
450  O  OG1 . THR A 54  ? 1.4567 1.5830 1.6186 -0.2182 0.0525  -0.2031 54  THR A OG1 
451  C  CG2 . THR A 54  ? 1.4017 1.5684 1.5756 -0.2442 0.0477  -0.1809 54  THR A CG2 
452  N  N   . ASN A 55  ? 1.1039 1.3668 1.2734 -0.2687 0.0310  -0.2080 55  ASN A N   
453  C  CA  . ASN A 55  ? 1.1404 1.4392 1.3085 -0.2860 0.0248  -0.1979 55  ASN A CA  
454  C  C   . ASN A 55  ? 1.0867 1.3725 1.2494 -0.2867 0.0262  -0.1754 55  ASN A C   
455  O  O   . ASN A 55  ? 1.1298 1.4367 1.2815 -0.2929 0.0228  -0.1727 55  ASN A O   
456  C  CB  . ASN A 55  ? 0.8676 1.1792 1.0498 -0.2989 0.0208  -0.1937 55  ASN A CB  
457  C  CG  . ASN A 55  ? 0.9505 1.2637 1.1381 -0.2968 0.0204  -0.2169 55  ASN A CG  
458  O  OD1 . ASN A 55  ? 0.9610 1.2438 1.1500 -0.2822 0.0259  -0.2271 55  ASN A OD1 
459  N  ND2 . ASN A 55  ? 1.0338 1.3814 1.2230 -0.3119 0.0136  -0.2251 55  ASN A ND2 
460  N  N   . ASP A 56  ? 1.3941 1.6438 1.5646 -0.2803 0.0320  -0.1601 56  ASP A N   
461  C  CA  . ASP A 56  ? 1.3622 1.5891 1.5277 -0.2776 0.0357  -0.1403 56  ASP A CA  
462  C  C   . ASP A 56  ? 1.3567 1.5879 1.5034 -0.2754 0.0342  -0.1437 56  ASP A C   
463  O  O   . ASP A 56  ? 1.3725 1.6130 1.5138 -0.2843 0.0313  -0.1308 56  ASP A O   
464  C  CB  . ASP A 56  ? 1.6170 1.7973 1.7875 -0.2638 0.0458  -0.1330 56  ASP A CB  
465  C  CG  . ASP A 56  ? 1.6331 1.8046 1.8221 -0.2686 0.0488  -0.1134 56  ASP A CG  
466  O  OD1 . ASP A 56  ? 1.6914 1.8934 1.8921 -0.2823 0.0414  -0.1079 56  ASP A OD1 
467  O  OD2 . ASP A 56  ? 1.6012 1.7366 1.7934 -0.2587 0.0585  -0.1032 56  ASP A OD2 
468  N  N   . GLY A 57  ? 0.7685 0.9926 0.9064 -0.2637 0.0358  -0.1605 57  GLY A N   
469  C  CA  . GLY A 57  ? 0.7791 1.0101 0.9013 -0.2608 0.0334  -0.1658 57  GLY A CA  
470  C  C   . GLY A 57  ? 0.8326 1.1047 0.9498 -0.2765 0.0265  -0.1643 57  GLY A C   
471  O  O   . GLY A 57  ? 0.8373 1.1055 0.9438 -0.2794 0.0253  -0.1554 57  GLY A O   
472  N  N   . TYR A 58  ? 0.9331 1.2441 1.0566 -0.2876 0.0221  -0.1726 58  TYR A N   
473  C  CA  . TYR A 58  ? 1.0107 1.3633 1.1276 -0.3033 0.0162  -0.1713 58  TYR A CA  
474  C  C   . TYR A 58  ? 1.0236 1.3707 1.1385 -0.3155 0.0139  -0.1469 58  TYR A C   
475  O  O   . TYR A 58  ? 1.0871 1.4576 1.1939 -0.3279 0.0096  -0.1411 58  TYR A O   
476  C  CB  . TYR A 58  ? 1.1085 1.5037 1.2299 -0.3138 0.0127  -0.1850 58  TYR A CB  
477  C  CG  . TYR A 58  ? 1.1196 1.5257 1.2420 -0.3025 0.0148  -0.2114 58  TYR A CG  
478  C  CD1 . TYR A 58  ? 1.0785 1.4555 1.2084 -0.2881 0.0186  -0.2213 58  TYR A CD1 
479  C  CD2 . TYR A 58  ? 1.1905 1.6360 1.3074 -0.3062 0.0133  -0.2263 58  TYR A CD2 
480  C  CE1 . TYR A 58  ? 1.1177 1.5014 1.2494 -0.2769 0.0203  -0.2448 58  TYR A CE1 
481  C  CE2 . TYR A 58  ? 1.2219 1.6768 1.3421 -0.2940 0.0157  -0.2509 58  TYR A CE2 
482  C  CZ  . TYR A 58  ? 1.1907 1.6131 1.3182 -0.2790 0.0189  -0.2600 58  TYR A CZ  
483  O  OH  . TYR A 58  ? 1.2531 1.6811 1.3847 -0.2658 0.0210  -0.2843 58  TYR A OH  
484  N  N   . ALA A 59  ? 1.0885 1.4040 1.2119 -0.3117 0.0171  -0.1323 59  ALA A N   
485  C  CA  . ALA A 59  ? 1.1206 1.4230 1.2446 -0.3193 0.0161  -0.1087 59  ALA A CA  
486  C  C   . ALA A 59  ? 1.1259 1.4107 1.2347 -0.3168 0.0172  -0.1042 59  ALA A C   
487  O  O   . ALA A 59  ? 1.2071 1.5053 1.3095 -0.3299 0.0125  -0.0929 59  ALA A O   
488  C  CB  . ALA A 59  ? 0.8086 1.0749 0.9462 -0.3102 0.0222  -0.0972 59  ALA A CB  
489  N  N   . PHE A 60  ? 1.1799 1.4344 1.2823 -0.3008 0.0229  -0.1131 60  PHE A N   
490  C  CA  . PHE A 60  ? 1.1869 1.4201 1.2732 -0.2969 0.0238  -0.1109 60  PHE A CA  
491  C  C   . PHE A 60  ? 1.2221 1.4904 1.2997 -0.3032 0.0177  -0.1236 60  PHE A C   
492  O  O   . PHE A 60  ? 1.2738 1.5512 1.3425 -0.3146 0.0136  -0.1159 60  PHE A O   
493  C  CB  . PHE A 60  ? 1.0828 1.2746 1.1639 -0.2780 0.0311  -0.1165 60  PHE A CB  
494  C  CG  . PHE A 60  ? 1.0470 1.2055 1.1381 -0.2709 0.0390  -0.1053 60  PHE A CG  
495  C  CD1 . PHE A 60  ? 0.9980 1.1438 1.0977 -0.2595 0.0441  -0.1136 60  PHE A CD1 
496  C  CD2 . PHE A 60  ? 1.0813 1.2211 1.1745 -0.2755 0.0417  -0.0862 60  PHE A CD2 
497  C  CE1 . PHE A 60  ? 0.9682 1.0862 1.0789 -0.2540 0.0521  -0.1028 60  PHE A CE1 
498  C  CE2 . PHE A 60  ? 1.0599 1.1723 1.1652 -0.2683 0.0500  -0.0760 60  PHE A CE2 
499  C  CZ  . PHE A 60  ? 0.9943 1.0973 1.1086 -0.2581 0.0553  -0.0841 60  PHE A CZ  
500  N  N   . ALA A 61  ? 1.0661 1.3536 1.1474 -0.2957 0.0175  -0.1432 61  ALA A N   
501  C  CA  . ALA A 61  ? 1.1099 1.4394 1.1882 -0.3012 0.0126  -0.1574 61  ALA A CA  
502  C  C   . ALA A 61  ? 1.1996 1.5614 1.2754 -0.3226 0.0075  -0.1462 61  ALA A C   
503  O  O   . ALA A 61  ? 1.2569 1.6187 1.3229 -0.3299 0.0046  -0.1392 61  ALA A O   
504  C  CB  . ALA A 61  ? 0.4311 0.7852 0.5195 -0.2955 0.0134  -0.1769 61  ALA A CB  
505  N  N   . GLU A 62  ? 1.0273 1.4141 1.1108 -0.3337 0.0059  -0.1431 62  GLU A N   
506  C  CA  . GLU A 62  ? 1.1295 1.5427 1.2098 -0.3546 0.0008  -0.1285 62  GLU A CA  
507  C  C   . GLU A 62  ? 1.1660 1.5523 1.2376 -0.3596 -0.0005 -0.1102 62  GLU A C   
508  O  O   . GLU A 62  ? 1.2380 1.6393 1.3006 -0.3680 -0.0036 -0.1106 62  GLU A O   
509  C  CB  . GLU A 62  ? 1.2426 1.6614 1.3318 -0.3626 -0.0009 -0.1177 62  GLU A CB  
510  C  CG  . GLU A 62  ? 1.3683 1.8073 1.4528 -0.3835 -0.0070 -0.0983 62  GLU A CG  
511  C  CD  . GLU A 62  ? 1.4292 1.8702 1.5229 -0.3912 -0.0104 -0.0832 62  GLU A CD  
512  O  OE1 . GLU A 62  ? 1.3658 1.7710 1.4698 -0.3800 -0.0073 -0.0753 62  GLU A OE1 
513  O  OE2 . GLU A 62  ? 1.5539 2.0330 1.6446 -0.4089 -0.0164 -0.0781 62  GLU A OE2 
514  N  N   . GLY A 63  ? 1.3930 1.7380 1.4676 -0.3537 0.0023  -0.0951 63  GLY A N   
515  C  CA  . GLY A 63  ? 1.4556 1.7676 1.5215 -0.3565 0.0023  -0.0785 63  GLY A CA  
516  C  C   . GLY A 63  ? 1.4594 1.7679 1.5113 -0.3557 0.0011  -0.0863 63  GLY A C   
517  O  O   . GLY A 63  ? 1.5592 1.8812 1.6035 -0.3710 -0.0039 -0.0785 63  GLY A O   
518  N  N   . ALA A 64  ? 0.9035 1.1955 0.9523 -0.3388 0.0047  -0.1014 64  ALA A N   
519  C  CA  . ALA A 64  ? 0.9088 1.1976 0.9450 -0.3363 0.0022  -0.1098 64  ALA A CA  
520  C  C   . ALA A 64  ? 0.9826 1.3224 1.0186 -0.3514 -0.0041 -0.1163 64  ALA A C   
521  O  O   . ALA A 64  ? 1.0564 1.3968 1.0827 -0.3621 -0.0084 -0.1107 64  ALA A O   
522  C  CB  . ALA A 64  ? 0.7358 1.0073 0.7711 -0.3155 0.0058  -0.1254 64  ALA A CB  
523  N  N   . ARG A 65  ? 1.0077 1.3896 1.0542 -0.3523 -0.0042 -0.1291 65  ARG A N   
524  C  CA  . ARG A 65  ? 1.0933 1.5281 1.1408 -0.3679 -0.0084 -0.1348 65  ARG A CA  
525  C  C   . ARG A 65  ? 1.2227 1.6619 1.2633 -0.3898 -0.0125 -0.1148 65  ARG A C   
526  O  O   . ARG A 65  ? 1.3215 1.7726 1.3555 -0.4005 -0.0164 -0.1129 65  ARG A O   
527  C  CB  . ARG A 65  ? 1.2155 1.6903 1.2737 -0.3684 -0.0065 -0.1477 65  ARG A CB  
528  C  CG  . ARG A 65  ? 1.3051 1.8375 1.3639 -0.3851 -0.0088 -0.1537 65  ARG A CG  
529  C  CD  . ARG A 65  ? 1.3234 1.8892 1.3874 -0.3925 -0.0073 -0.1584 65  ARG A CD  
530  N  NE  . ARG A 65  ? 1.3603 1.9065 1.4221 -0.4023 -0.0094 -0.1373 65  ARG A NE  
531  C  CZ  . ARG A 65  ? 1.4118 1.9700 1.4780 -0.4055 -0.0092 -0.1375 65  ARG A CZ  
532  N  NH1 . ARG A 65  ? 1.4339 2.0206 1.5049 -0.4000 -0.0063 -0.1590 65  ARG A NH1 
533  N  NH2 . ARG A 65  ? 1.4611 2.0023 1.5273 -0.4140 -0.0124 -0.1165 65  ARG A NH2 
534  N  N   . ASP A 66  ? 1.4725 1.8995 1.5154 -0.3964 -0.0123 -0.0987 66  ASP A N   
535  C  CA  . ASP A 66  ? 1.6156 2.0409 1.6524 -0.4162 -0.0168 -0.0772 66  ASP A CA  
536  C  C   . ASP A 66  ? 1.6657 2.0514 1.6911 -0.4167 -0.0181 -0.0684 66  ASP A C   
537  O  O   . ASP A 66  ? 1.7962 2.1953 1.8144 -0.4342 -0.0229 -0.0609 66  ASP A O   
538  C  CB  . ASP A 66  ? 1.8382 2.2502 1.8816 -0.4186 -0.0167 -0.0607 66  ASP A CB  
539  C  CG  . ASP A 66  ? 1.8679 2.3267 1.9182 -0.4270 -0.0183 -0.0657 66  ASP A CG  
540  O  OD1 . ASP A 66  ? 1.8996 2.4037 1.9470 -0.4366 -0.0194 -0.0773 66  ASP A OD1 
541  O  OD2 . ASP A 66  ? 1.8694 2.3215 1.9279 -0.4247 -0.0183 -0.0583 66  ASP A OD2 
542  N  N   . MET A 67  ? 1.2849 1.6231 1.3074 -0.3984 -0.0138 -0.0706 67  MET A N   
543  C  CA  . MET A 67  ? 1.3311 1.6300 1.3396 -0.3974 -0.0146 -0.0662 67  MET A CA  
544  C  C   . MET A 67  ? 1.3707 1.6952 1.3720 -0.4045 -0.0198 -0.0775 67  MET A C   
545  O  O   . MET A 67  ? 1.4909 1.8032 1.4812 -0.4167 -0.0242 -0.0701 67  MET A O   
546  C  CB  . MET A 67  ? 1.4590 1.7087 1.4639 -0.3749 -0.0079 -0.0709 67  MET A CB  
547  C  CG  . MET A 67  ? 1.4531 1.6680 1.4645 -0.3675 -0.0018 -0.0574 67  MET A CG  
548  S  SD  . MET A 67  ? 1.3935 1.5432 1.3917 -0.3485 0.0061  -0.0581 67  MET A SD  
549  C  CE  . MET A 67  ? 1.4599 1.6087 1.4374 -0.3579 -0.0011 -0.0645 67  MET A CE  
550  N  N   . ILE A 68  ? 1.1975 1.5577 1.2067 -0.3965 -0.0195 -0.0960 68  ILE A N   
551  C  CA  . ILE A 68  ? 1.2444 1.6377 1.2522 -0.4020 -0.0245 -0.1078 68  ILE A CA  
552  C  C   . ILE A 68  ? 1.3857 1.8222 1.3949 -0.4276 -0.0289 -0.0999 68  ILE A C   
553  O  O   . ILE A 68  ? 1.4843 1.9326 1.4883 -0.4394 -0.0341 -0.0999 68  ILE A O   
554  C  CB  . ILE A 68  ? 1.1562 1.5790 1.1756 -0.3858 -0.0222 -0.1290 68  ILE A CB  
555  C  CG1 . ILE A 68  ? 1.0446 1.4227 1.0597 -0.3616 -0.0192 -0.1363 68  ILE A CG1 
556  C  CG2 . ILE A 68  ? 1.2207 1.6912 1.2447 -0.3932 -0.0269 -0.1406 68  ILE A CG2 
557  C  CD1 . ILE A 68  ? 0.9438 1.3357 0.9714 -0.3433 -0.0150 -0.1528 68  ILE A CD1 
558  N  N   . ALA A 69  ? 1.2720 1.7319 1.2877 -0.4371 -0.0272 -0.0926 69  ALA A N   
559  C  CA  . ALA A 69  ? 1.4223 1.9225 1.4372 -0.4630 -0.0309 -0.0825 69  ALA A CA  
560  C  C   . ALA A 69  ? 1.5393 2.0046 1.5424 -0.4778 -0.0355 -0.0623 69  ALA A C   
561  O  O   . ALA A 69  ? 1.6750 2.1567 1.6732 -0.4945 -0.0402 -0.0597 69  ALA A O   
562  C  CB  . ALA A 69  ? 1.9410 2.4662 1.9616 -0.4698 -0.0290 -0.0765 69  ALA A CB  
563  N  N   . GLY A 70  ? 1.7413 2.1583 1.7409 -0.4720 -0.0340 -0.0480 70  GLY A N   
564  C  CA  . GLY A 70  ? 1.8819 2.2656 1.8718 -0.4864 -0.0378 -0.0275 70  GLY A CA  
565  C  C   . GLY A 70  ? 1.9879 2.3525 1.9822 -0.4870 -0.0367 -0.0091 70  GLY A C   
566  O  O   . GLY A 70  ? 2.1160 2.4304 2.1057 -0.4832 -0.0360 0.0039  70  GLY A O   
567  N  N   . PHE A 71  ? 1.8106 2.2139 1.8139 -0.4913 -0.0365 -0.0079 71  PHE A N   
568  C  CA  . PHE A 71  ? 1.9050 2.2886 1.9143 -0.4897 -0.0366 0.0097  71  PHE A CA  
569  C  C   . PHE A 71  ? 1.7717 2.1873 1.7924 -0.4831 -0.0346 0.0026  71  PHE A C   
570  O  O   . PHE A 71  ? 1.6118 2.0727 1.6339 -0.4854 -0.0337 -0.0140 71  PHE A O   
571  C  CB  . PHE A 71  ? 2.3073 2.6891 2.3109 -0.5128 -0.0433 0.0345  71  PHE A CB  
572  C  CG  . PHE A 71  ? 2.4888 2.8269 2.4975 -0.5077 -0.0439 0.0559  71  PHE A CG  
573  C  CD1 . PHE A 71  ? 2.5385 2.8181 2.5427 -0.4993 -0.0418 0.0631  71  PHE A CD1 
574  C  CD2 . PHE A 71  ? 2.6321 2.9888 2.6502 -0.5115 -0.0469 0.0690  71  PHE A CD2 
575  C  CE1 . PHE A 71  ? 2.7212 2.9631 2.7332 -0.4932 -0.0415 0.0825  71  PHE A CE1 
576  C  CE2 . PHE A 71  ? 2.8179 3.1381 2.8443 -0.5060 -0.0482 0.0895  71  PHE A CE2 
577  C  CZ  . PHE A 71  ? 2.8580 3.1217 2.8827 -0.4963 -0.0450 0.0962  71  PHE A CZ  
578  N  N   . HIS A 72  ? 2.0864 2.4758 2.1159 -0.4739 -0.0335 0.0141  72  HIS A N   
579  C  CA  . HIS A 72  ? 1.9978 2.4084 2.0391 -0.4687 -0.0330 0.0120  72  HIS A CA  
580  C  C   . HIS A 72  ? 2.1639 2.5922 2.2056 -0.4881 -0.0407 0.0354  72  HIS A C   
581  O  O   . HIS A 72  ? 2.3253 2.7311 2.3623 -0.4976 -0.0445 0.0547  72  HIS A O   
582  C  CB  . HIS A 72  ? 1.8941 2.2609 1.9465 -0.4464 -0.0273 0.0121  72  HIS A CB  
583  C  CG  . HIS A 72  ? 2.0660 2.3961 2.1247 -0.4464 -0.0290 0.0369  72  HIS A CG  
584  N  ND1 . HIS A 72  ? 2.2102 2.5540 2.2800 -0.4529 -0.0343 0.0535  72  HIS A ND1 
585  C  CD2 . HIS A 72  ? 2.1236 2.4038 2.1796 -0.4398 -0.0261 0.0476  72  HIS A CD2 
586  C  CE1 . HIS A 72  ? 2.3729 2.6782 2.4490 -0.4496 -0.0347 0.0741  72  HIS A CE1 
587  N  NE2 . HIS A 72  ? 2.3192 2.5845 2.3868 -0.4414 -0.0291 0.0702  72  HIS A NE2 
588  N  N   . GLN A 73  ? 2.6831 3.1489 2.7296 -0.4943 -0.0438 0.0352  73  GLN A N   
589  C  CA  . GLN A 73  ? 2.8513 3.3334 2.8953 -0.5143 -0.0526 0.0599  73  GLN A CA  
590  C  C   . GLN A 73  ? 2.9560 3.4037 3.0119 -0.5093 -0.0566 0.0839  73  GLN A C   
591  O  O   . GLN A 73  ? 2.8528 3.2655 2.9213 -0.4896 -0.0517 0.0816  73  GLN A O   
592  C  CB  . GLN A 73  ? 1.9561 2.4945 1.9966 -0.5277 -0.0562 0.0541  73  GLN A CB  
593  C  CG  . GLN A 73  ? 1.8722 2.4533 1.8993 -0.5420 -0.0544 0.0405  73  GLN A CG  
594  C  CD  . GLN A 73  ? 1.6787 2.2824 1.7087 -0.5285 -0.0469 0.0086  73  GLN A CD  
595  O  OE1 . GLN A 73  ? 1.6114 2.1862 1.6517 -0.5066 -0.0421 -0.0038 73  GLN A OE1 
596  N  NE2 . GLN A 73  ? 1.6032 2.2588 1.6246 -0.5414 -0.0453 -0.0047 73  GLN A NE2 
597  N  N   . PRO A 74  ? 1.4245 1.8831 1.4769 -0.5276 -0.0656 0.1084  74  PRO A N   
598  C  CA  . PRO A 74  ? 1.5709 2.0036 1.6382 -0.5220 -0.0706 0.1315  74  PRO A CA  
599  C  C   . PRO A 74  ? 1.5537 1.9969 1.6372 -0.5097 -0.0704 0.1250  74  PRO A C   
600  O  O   . PRO A 74  ? 1.6220 2.1092 1.7011 -0.5188 -0.0737 0.1158  74  PRO A O   
601  C  CB  . PRO A 74  ? 2.5866 3.0430 2.6452 -0.5468 -0.0823 0.1573  74  PRO A CB  
602  C  CG  . PRO A 74  ? 2.5722 3.0743 2.6110 -0.5657 -0.0817 0.1439  74  PRO A CG  
603  C  CD  . PRO A 74  ? 2.3311 2.8170 2.3675 -0.5528 -0.0714 0.1195  74  PRO A CD  
604  N  N   . ASN A 75  ? 1.6413 2.0454 1.7430 -0.4903 -0.0662 0.1294  75  ASN A N   
605  C  CA  . ASN A 75  ? 1.6429 2.0580 1.7631 -0.4835 -0.0693 0.1323  75  ASN A CA  
606  C  C   . ASN A 75  ? 1.4450 1.8924 1.5645 -0.4800 -0.0660 0.1054  75  ASN A C   
607  O  O   . ASN A 75  ? 1.4538 1.9166 1.5866 -0.4785 -0.0702 0.1068  75  ASN A O   
608  C  CB  . ASN A 75  ? 1.7634 2.2035 1.8855 -0.5012 -0.0833 0.1586  75  ASN A CB  
609  C  CG  . ASN A 75  ? 1.8652 2.2746 2.0109 -0.4913 -0.0873 0.1838  75  ASN A CG  
610  O  OD1 . ASN A 75  ? 1.6855 2.0703 1.8510 -0.4718 -0.0803 0.1788  75  ASN A OD1 
611  N  ND2 . ASN A 75  ? 2.1706 2.5825 2.3153 -0.5049 -0.0985 0.2119  75  ASN A ND2 
612  N  N   . ASP A 76  ? 2.4187 2.8774 2.5235 -0.4795 -0.0593 0.0815  76  ASP A N   
613  C  CA  . ASP A 76  ? 2.2175 2.6924 2.3242 -0.4699 -0.0535 0.0539  76  ASP A CA  
614  C  C   . ASP A 76  ? 2.0359 2.4636 2.1530 -0.4467 -0.0432 0.0460  76  ASP A C   
615  O  O   . ASP A 76  ? 2.0235 2.4168 2.1367 -0.4414 -0.0392 0.0531  76  ASP A O   
616  C  CB  . ASP A 76  ? 2.1556 2.6657 2.2439 -0.4790 -0.0513 0.0328  76  ASP A CB  
617  C  CG  . ASP A 76  ? 2.0208 2.5064 2.1036 -0.4666 -0.0423 0.0175  76  ASP A CG  
618  O  OD1 . ASP A 76  ? 2.0334 2.4785 2.1172 -0.4603 -0.0401 0.0296  76  ASP A OD1 
619  O  OD2 . ASP A 76  ? 1.9228 2.4296 1.9999 -0.4629 -0.0377 -0.0069 76  ASP A OD2 
620  N  N   . LEU A 77  ? 1.5926 2.0166 1.7218 -0.4336 -0.0387 0.0321  77  LEU A N   
621  C  CA  . LEU A 77  ? 1.4741 1.8517 1.6164 -0.4131 -0.0297 0.0326  77  LEU A CA  
622  C  C   . LEU A 77  ? 1.2977 1.6519 1.4298 -0.3990 -0.0195 0.0122  77  LEU A C   
623  O  O   . LEU A 77  ? 1.1495 1.4826 1.2901 -0.3829 -0.0119 0.0009  77  LEU A O   
624  C  CB  . LEU A 77  ? 1.2798 1.6601 1.4426 -0.4058 -0.0295 0.0307  77  LEU A CB  
625  C  CG  . LEU A 77  ? 1.4370 1.8334 1.6164 -0.4149 -0.0395 0.0519  77  LEU A CG  
626  C  CD1 . LEU A 77  ? 1.3421 1.7289 1.5439 -0.4028 -0.0357 0.0472  77  LEU A CD1 
627  C  CD2 . LEU A 77  ? 1.6517 2.0253 1.8374 -0.4163 -0.0425 0.0800  77  LEU A CD2 
628  N  N   . SER A 78  ? 1.3526 1.7095 1.4669 -0.4053 -0.0198 0.0084  78  SER A N   
629  C  CA  . SER A 78  ? 1.2005 1.5436 1.3045 -0.3935 -0.0124 -0.0123 78  SER A CA  
630  C  C   . SER A 78  ? 1.1379 1.4273 1.2424 -0.3765 -0.0040 -0.0090 78  SER A C   
631  O  O   . SER A 78  ? 1.2492 1.5106 1.3567 -0.3766 -0.0035 0.0098  78  SER A O   
632  C  CB  . SER A 78  ? 1.1107 1.4809 1.1975 -0.4062 -0.0159 -0.0199 78  SER A CB  
633  O  OG  . SER A 78  ? 1.2523 1.5961 1.3295 -0.4098 -0.0162 -0.0078 78  SER A OG  
634  N  N   . TYR A 79  ? 1.5434 1.8183 1.6444 -0.3615 0.0030  -0.0276 79  TYR A N   
635  C  CA  . TYR A 79  ? 1.4858 1.7108 1.5837 -0.3452 0.0119  -0.0267 79  TYR A CA  
636  C  C   . TYR A 79  ? 1.5257 1.7346 1.6034 -0.3468 0.0117  -0.0295 79  TYR A C   
637  O  O   . TYR A 79  ? 1.4480 1.6265 1.5164 -0.3334 0.0180  -0.0385 79  TYR A O   
638  C  CB  . TYR A 79  ? 1.2696 1.4824 1.3724 -0.3282 0.0192  -0.0430 79  TYR A CB  
639  C  CG  . TYR A 79  ? 1.2425 1.4487 1.3662 -0.3221 0.0228  -0.0367 79  TYR A CG  
640  C  CD1 . TYR A 79  ? 1.3207 1.5579 1.4589 -0.3343 0.0157  -0.0271 79  TYR A CD1 
641  C  CD2 . TYR A 79  ? 1.1536 1.3249 1.2824 -0.3053 0.0330  -0.0401 79  TYR A CD2 
642  C  CE1 . TYR A 79  ? 1.3088 1.5427 1.4678 -0.3298 0.0178  -0.0213 79  TYR A CE1 
643  C  CE2 . TYR A 79  ? 1.1372 1.3050 1.2872 -0.3011 0.0364  -0.0342 79  TYR A CE2 
644  C  CZ  . TYR A 79  ? 1.2142 1.4139 1.3802 -0.3133 0.0284  -0.0250 79  TYR A CZ  
645  O  OH  . TYR A 79  ? 1.1988 1.3976 1.3877 -0.3102 0.0306  -0.0189 79  TYR A OH  
646  N  N   . PHE A 80  ? 1.1795 1.4096 1.2499 -0.3642 0.0041  -0.0216 80  PHE A N   
647  C  CA  . PHE A 80  ? 1.2522 1.4658 1.3050 -0.3693 0.0027  -0.0207 80  PHE A CA  
648  C  C   . PHE A 80  ? 1.2824 1.4390 1.3304 -0.3575 0.0099  -0.0120 80  PHE A C   
649  O  O   . PHE A 80  ? 1.3908 1.5271 1.4482 -0.3573 0.0118  0.0051  80  PHE A O   
650  C  CB  . PHE A 80  ? 1.4304 1.6702 1.4802 -0.3916 -0.0061 -0.0068 80  PHE A CB  
651  C  CG  . PHE A 80  ? 1.5201 1.7475 1.5528 -0.4011 -0.0091 -0.0050 80  PHE A CG  
652  C  CD1 . PHE A 80  ? 1.4516 1.7030 1.4745 -0.4047 -0.0115 -0.0213 80  PHE A CD1 
653  C  CD2 . PHE A 80  ? 1.6874 1.8806 1.7155 -0.4070 -0.0101 0.0133  80  PHE A CD2 
654  C  CE1 . PHE A 80  ? 1.5310 1.7731 1.5394 -0.4150 -0.0153 -0.0195 80  PHE A CE1 
655  C  CE2 . PHE A 80  ? 1.7707 1.9513 1.7825 -0.4174 -0.0135 0.0144  80  PHE A CE2 
656  C  CZ  . PHE A 80  ? 1.6872 1.8930 1.6891 -0.4222 -0.0164 -0.0019 80  PHE A CZ  
657  N  N   . GLY A 81  ? 1.5368 1.6679 1.5701 -0.3472 0.0142  -0.0241 81  GLY A N   
658  C  CA  . GLY A 81  ? 1.5595 1.6365 1.5838 -0.3364 0.0221  -0.0184 81  GLY A CA  
659  C  C   . GLY A 81  ? 1.3861 1.4368 1.4165 -0.3162 0.0329  -0.0238 81  GLY A C   
660  O  O   . GLY A 81  ? 1.2598 1.2670 1.2787 -0.3052 0.0411  -0.0239 81  GLY A O   
661  N  N   . SER A 82  ? 1.2911 1.3676 1.3386 -0.3121 0.0335  -0.0286 82  SER A N   
662  C  CA  . SER A 82  ? 1.1563 1.2115 1.2094 -0.2943 0.0433  -0.0354 82  SER A CA  
663  C  C   . SER A 82  ? 1.0132 1.0368 1.0444 -0.2826 0.0483  -0.0471 82  SER A C   
664  O  O   . SER A 82  ? 1.0666 1.0991 1.0813 -0.2876 0.0418  -0.0560 82  SER A O   
665  C  CB  . SER A 82  ? 1.4579 1.5493 1.5257 -0.2934 0.0405  -0.0461 82  SER A CB  
666  O  OG  . SER A 82  ? 1.4937 1.5632 1.5707 -0.2785 0.0500  -0.0486 82  SER A OG  
667  N  N   . SER A 83  ? 1.2939 1.2818 1.3252 -0.2676 0.0598  -0.0462 83  SER A N   
668  C  CA  . SER A 83  ? 1.1721 1.1303 1.1831 -0.2550 0.0653  -0.0568 83  SER A CA  
669  C  C   . SER A 83  ? 1.2280 1.2136 1.2323 -0.2546 0.0570  -0.0734 83  SER A C   
670  O  O   . SER A 83  ? 1.2971 1.2814 1.2819 -0.2569 0.0510  -0.0805 83  SER A O   
671  C  CB  . SER A 83  ? 0.9667 0.8991 0.9873 -0.2403 0.0784  -0.0545 83  SER A CB  
672  O  OG  . SER A 83  ? 0.9933 0.9428 1.0422 -0.2433 0.0801  -0.0445 83  SER A OG  
673  N  N   . LEU A 84  ? 1.1992 1.2098 1.2212 -0.2514 0.0563  -0.0798 84  LEU A N   
674  C  CA  . LEU A 84  ? 1.2342 1.2694 1.2540 -0.2479 0.0501  -0.0963 84  LEU A CA  
675  C  C   . LEU A 84  ? 1.3105 1.3844 1.3271 -0.2617 0.0386  -0.1011 84  LEU A C   
676  O  O   . LEU A 84  ? 1.3216 1.4036 1.3267 -0.2592 0.0332  -0.1121 84  LEU A O   
677  C  CB  . LEU A 84  ? 1.2271 1.2807 1.2676 -0.2434 0.0518  -0.1024 84  LEU A CB  
678  C  CG  . LEU A 84  ? 1.2004 1.2754 1.2411 -0.2370 0.0467  -0.1206 84  LEU A CG  
679  C  CD1 . LEU A 84  ? 1.2258 1.2713 1.2467 -0.2238 0.0480  -0.1269 84  LEU A CD1 
680  C  CD2 . LEU A 84  ? 1.1414 1.2244 1.2012 -0.2324 0.0499  -0.1258 84  LEU A CD2 
681  N  N   . SER A 85  ? 1.0864 1.1851 1.1138 -0.2765 0.0348  -0.0919 85  SER A N   
682  C  CA  . SER A 85  ? 1.1488 1.2867 1.1737 -0.2917 0.0249  -0.0949 85  SER A CA  
683  C  C   . SER A 85  ? 1.2178 1.3379 1.2218 -0.2946 0.0216  -0.0947 85  SER A C   
684  O  O   . SER A 85  ? 1.2493 1.3915 1.2465 -0.2964 0.0150  -0.1062 85  SER A O   
685  C  CB  . SER A 85  ? 1.2666 1.4249 1.3026 -0.3078 0.0219  -0.0806 85  SER A CB  
686  O  OG  . SER A 85  ? 1.2488 1.4327 1.3029 -0.3081 0.0221  -0.0829 85  SER A OG  
687  N  N   . THR A 86  ? 1.1476 1.2275 1.1420 -0.2947 0.0263  -0.0821 86  THR A N   
688  C  CA  . THR A 86  ? 1.2079 1.2626 1.1798 -0.2976 0.0239  -0.0817 86  THR A CA  
689  C  C   . THR A 86  ? 1.1483 1.1963 1.1066 -0.2858 0.0222  -0.0964 86  THR A C   
690  O  O   . THR A 86  ? 1.1854 1.2535 1.1355 -0.2926 0.0134  -0.1035 86  THR A O   
691  C  CB  . THR A 86  ? 1.1732 1.1776 1.1364 -0.2940 0.0324  -0.0690 86  THR A CB  
692  O  OG1 . THR A 86  ? 1.2498 1.2616 1.2290 -0.3034 0.0330  -0.0541 86  THR A OG1 
693  C  CG2 . THR A 86  ? 1.1983 1.1780 1.1370 -0.3002 0.0288  -0.0692 86  THR A CG2 
694  N  N   . LEU A 87  ? 1.0379 1.0603 0.9952 -0.2685 0.0302  -0.1003 87  LEU A N   
695  C  CA  . LEU A 87  ? 1.0011 1.0146 0.9442 -0.2566 0.0277  -0.1124 87  LEU A CA  
696  C  C   . LEU A 87  ? 0.9989 1.0597 0.9519 -0.2571 0.0180  -0.1263 87  LEU A C   
697  O  O   . LEU A 87  ? 1.0276 1.0921 0.9686 -0.2538 0.0108  -0.1348 87  LEU A O   
698  C  CB  . LEU A 87  ? 0.9979 0.9754 0.9383 -0.2387 0.0384  -0.1126 87  LEU A CB  
699  C  CG  . LEU A 87  ? 0.9899 0.9512 0.9117 -0.2261 0.0356  -0.1224 87  LEU A CG  
700  C  CD1 . LEU A 87  ? 1.0288 0.9601 0.9216 -0.2299 0.0332  -0.1198 87  LEU A CD1 
701  C  CD2 . LEU A 87  ? 0.8618 0.7949 0.7840 -0.2094 0.0455  -0.1229 87  LEU A CD2 
702  N  N   . THR A 88  ? 1.4638 1.5615 1.4389 -0.2609 0.0176  -0.1291 88  THR A N   
703  C  CA  . THR A 88  ? 1.4757 1.6198 1.4619 -0.2609 0.0102  -0.1434 88  THR A CA  
704  C  C   . THR A 88  ? 1.5591 1.7322 1.5402 -0.2768 0.0011  -0.1435 88  THR A C   
705  O  O   . THR A 88  ? 1.5972 1.7952 1.5783 -0.2747 -0.0060 -0.1546 88  THR A O   
706  C  CB  . THR A 88  ? 1.2071 1.3855 1.2156 -0.2643 0.0122  -0.1469 88  THR A CB  
707  O  OG1 . THR A 88  ? 1.2254 1.3868 1.2390 -0.2702 0.0182  -0.1326 88  THR A OG1 
708  C  CG2 . THR A 88  ? 1.1216 1.2985 1.1392 -0.2474 0.0151  -0.1595 88  THR A CG2 
709  N  N   . TYR A 89  ? 1.0485 1.2181 1.0265 -0.2927 0.0011  -0.1304 89  TYR A N   
710  C  CA  . TYR A 89  ? 1.1378 1.3371 1.1128 -0.3112 -0.0073 -0.1287 89  TYR A CA  
711  C  C   . TYR A 89  ? 1.1837 1.3572 1.1375 -0.3128 -0.0124 -0.1283 89  TYR A C   
712  O  O   . TYR A 89  ? 1.2669 1.4677 1.2186 -0.3259 -0.0209 -0.1307 89  TYR A O   
713  C  CB  . TYR A 89  ? 1.3605 1.5660 1.3408 -0.3284 -0.0062 -0.1137 89  TYR A CB  
714  C  CG  . TYR A 89  ? 1.4842 1.6888 1.4530 -0.3470 -0.0123 -0.1047 89  TYR A CG  
715  C  CD1 . TYR A 89  ? 1.5622 1.8151 1.5378 -0.3653 -0.0190 -0.1053 89  TYR A CD1 
716  C  CD2 . TYR A 89  ? 1.5413 1.6958 1.4923 -0.3473 -0.0105 -0.0957 89  TYR A CD2 
717  C  CE1 . TYR A 89  ? 1.6941 1.9449 1.6596 -0.3842 -0.0248 -0.0960 89  TYR A CE1 
718  C  CE2 . TYR A 89  ? 1.6787 1.8288 1.6188 -0.3653 -0.0164 -0.0877 89  TYR A CE2 
719  C  CZ  . TYR A 89  ? 1.7551 1.9530 1.7029 -0.3842 -0.0240 -0.0873 89  TYR A CZ  
720  O  OH  . TYR A 89  ? 1.9114 2.1031 1.8485 -0.4037 -0.0300 -0.0785 89  TYR A OH  
721  N  N   . TRP A 90  ? 1.1795 1.3011 1.1172 -0.3006 -0.0070 -0.1252 90  TRP A N   
722  C  CA  . TRP A 90  ? 1.2196 1.3157 1.1346 -0.2977 -0.0121 -0.1288 90  TRP A CA  
723  C  C   . TRP A 90  ? 1.2121 1.3334 1.1321 -0.2854 -0.0183 -0.1432 90  TRP A C   
724  O  O   . TRP A 90  ? 1.2886 1.4441 1.2111 -0.2932 -0.0283 -0.1496 90  TRP A O   
725  C  CB  . TRP A 90  ? 1.3498 1.3840 1.2442 -0.2868 -0.0033 -0.1227 90  TRP A CB  
726  C  CG  . TRP A 90  ? 1.4062 1.4102 1.2944 -0.2972 0.0026  -0.1090 90  TRP A CG  
727  C  CD1 . TRP A 90  ? 1.4436 1.4621 1.3345 -0.3169 -0.0025 -0.1012 90  TRP A CD1 
728  C  CD2 . TRP A 90  ? 1.4452 1.3998 1.3252 -0.2878 0.0150  -0.1009 90  TRP A CD2 
729  N  NE1 . TRP A 90  ? 1.5271 1.5064 1.4122 -0.3194 0.0052  -0.0889 90  TRP A NE1 
730  C  CE2 . TRP A 90  ? 1.4815 1.4225 1.3608 -0.3013 0.0165  -0.0890 90  TRP A CE2 
731  C  CE3 . TRP A 90  ? 1.3959 1.3169 1.2697 -0.2695 0.0254  -0.1023 90  TRP A CE3 
732  C  CZ2 . TRP A 90  ? 1.4107 1.3071 1.2852 -0.2954 0.0282  -0.0794 90  TRP A CZ2 
733  C  CZ3 . TRP A 90  ? 1.3257 1.2044 1.1942 -0.2650 0.0378  -0.0927 90  TRP A CZ3 
734  C  CH2 . TRP A 90  ? 1.3340 1.2012 1.2038 -0.2771 0.0392  -0.0818 90  TRP A CH2 
735  N  N   . LEU A 91  ? 1.2513 1.3575 1.1749 -0.2663 -0.0123 -0.1481 91  LEU A N   
736  C  CA  . LEU A 91  ? 1.2722 1.3965 1.2000 -0.2524 -0.0185 -0.1610 91  LEU A CA  
737  C  C   . LEU A 91  ? 1.3429 1.5294 1.2923 -0.2586 -0.0264 -0.1713 91  LEU A C   
738  O  O   . LEU A 91  ? 1.3951 1.6009 1.3489 -0.2488 -0.0335 -0.1818 91  LEU A O   
739  C  CB  . LEU A 91  ? 1.3828 1.4872 1.3168 -0.2332 -0.0103 -0.1641 91  LEU A CB  
740  C  CG  . LEU A 91  ? 1.3395 1.3856 1.2524 -0.2213 -0.0025 -0.1574 91  LEU A CG  
741  C  CD1 . LEU A 91  ? 1.2551 1.2865 1.1811 -0.2154 0.0099  -0.1529 91  LEU A CD1 
742  C  CD2 . LEU A 91  ? 1.4005 1.4330 1.3009 -0.2052 -0.0082 -0.1644 91  LEU A CD2 
743  N  N   . TYR A 92  ? 1.0105 1.2287 0.9736 -0.2743 -0.0248 -0.1679 92  TYR A N   
744  C  CA  . TYR A 92  ? 1.0580 1.3367 1.0412 -0.2815 -0.0297 -0.1775 92  TYR A CA  
745  C  C   . TYR A 92  ? 1.1687 1.4714 1.1469 -0.2964 -0.0398 -0.1772 92  TYR A C   
746  O  O   . TYR A 92  ? 1.2331 1.5790 1.2240 -0.2954 -0.0464 -0.1881 92  TYR A O   
747  C  CB  . TYR A 92  ? 1.2364 1.5374 1.2321 -0.2948 -0.0240 -0.1719 92  TYR A CB  
748  C  CG  . TYR A 92  ? 1.2835 1.6484 1.2971 -0.3057 -0.0272 -0.1806 92  TYR A CG  
749  C  CD1 . TYR A 92  ? 1.2915 1.6903 1.3203 -0.2929 -0.0287 -0.1976 92  TYR A CD1 
750  C  CD2 . TYR A 92  ? 1.3343 1.7250 1.3497 -0.3285 -0.0280 -0.1715 92  TYR A CD2 
751  C  CE1 . TYR A 92  ? 1.3405 1.7989 1.3859 -0.3021 -0.0297 -0.2067 92  TYR A CE1 
752  C  CE2 . TYR A 92  ? 1.3884 1.8386 1.4186 -0.3392 -0.0295 -0.1791 92  TYR A CE2 
753  C  CZ  . TYR A 92  ? 1.3949 1.8797 1.4402 -0.3258 -0.0297 -0.1975 92  TYR A CZ  
754  O  OH  . TYR A 92  ? 1.4650 2.0107 1.5252 -0.3359 -0.0295 -0.2064 92  TYR A OH  
755  N  N   . SER A 93  ? 1.3507 1.6250 1.3116 -0.3106 -0.0408 -0.1647 93  SER A N   
756  C  CA  . SER A 93  ? 1.4691 1.7605 1.4235 -0.3282 -0.0504 -0.1627 93  SER A CA  
757  C  C   . SER A 93  ? 1.5094 1.7714 1.4449 -0.3189 -0.0577 -0.1662 93  SER A C   
758  O  O   . SER A 93  ? 1.6261 1.8906 1.5511 -0.3324 -0.0667 -0.1644 93  SER A O   
759  C  CB  . SER A 93  ? 1.3332 1.6049 1.2775 -0.3484 -0.0481 -0.1476 93  SER A CB  
760  O  OG  . SER A 93  ? 1.2740 1.5659 1.2334 -0.3543 -0.0412 -0.1425 93  SER A OG  
761  N  N   . ILE A 94  ? 1.3421 1.5760 1.2725 -0.2968 -0.0544 -0.1709 94  ILE A N   
762  C  CA  . ILE A 94  ? 1.3835 1.5898 1.2943 -0.2864 -0.0618 -0.1739 94  ILE A CA  
763  C  C   . ILE A 94  ? 1.4300 1.6661 1.3574 -0.2679 -0.0668 -0.1864 94  ILE A C   
764  O  O   . ILE A 94  ? 1.5079 1.7328 1.4241 -0.2579 -0.0754 -0.1899 94  ILE A O   
765  C  CB  . ILE A 94  ? 1.4334 1.5727 1.3190 -0.2754 -0.0531 -0.1669 94  ILE A CB  
766  C  CG1 . ILE A 94  ? 1.4580 1.5634 1.3253 -0.2920 -0.0491 -0.1556 94  ILE A CG1 
767  C  CG2 . ILE A 94  ? 1.4606 1.5734 1.3258 -0.2613 -0.0599 -0.1709 94  ILE A CG2 
768  C  CD1 . ILE A 94  ? 1.3888 1.4300 1.2324 -0.2812 -0.0385 -0.1492 94  ILE A CD1 
769  N  N   . LEU A 95  ? 1.6199 1.8936 1.5737 -0.2632 -0.0618 -0.1932 95  LEU A N   
770  C  CA  . LEU A 95  ? 1.6274 1.9217 1.5976 -0.2426 -0.0644 -0.2054 95  LEU A CA  
771  C  C   . LEU A 95  ? 1.6377 1.9985 1.6382 -0.2461 -0.0661 -0.2165 95  LEU A C   
772  O  O   . LEU A 95  ? 1.6092 1.9972 1.6195 -0.2623 -0.0610 -0.2146 95  LEU A O   
773  C  CB  . LEU A 95  ? 1.4154 1.6738 1.3847 -0.2246 -0.0538 -0.2055 95  LEU A CB  
774  C  CG  . LEU A 95  ? 1.3723 1.5660 1.3128 -0.2176 -0.0502 -0.1958 95  LEU A CG  
775  C  CD1 . LEU A 95  ? 1.2698 1.4351 1.2135 -0.2089 -0.0367 -0.1926 95  LEU A CD1 
776  C  CD2 . LEU A 95  ? 1.4456 1.6234 1.3739 -0.2017 -0.0595 -0.1993 95  LEU A CD2 
777  N  N   . PRO A 96  ? 1.4134 1.8003 1.4288 -0.2301 -0.0729 -0.2281 96  PRO A N   
778  C  CA  . PRO A 96  ? 1.4434 1.8962 1.4885 -0.2308 -0.0754 -0.2407 96  PRO A CA  
779  C  C   . PRO A 96  ? 1.3572 1.8233 1.4212 -0.2175 -0.0653 -0.2515 96  PRO A C   
780  O  O   . PRO A 96  ? 1.3565 1.8716 1.4454 -0.2111 -0.0660 -0.2651 96  PRO A O   
781  C  CB  . PRO A 96  ? 0.9989 1.4610 1.0484 -0.2157 -0.0882 -0.2466 96  PRO A CB  
782  C  CG  . PRO A 96  ? 0.9868 1.3890 1.0170 -0.1965 -0.0874 -0.2426 96  PRO A CG  
783  C  CD  . PRO A 96  ? 0.9260 1.2785 0.9302 -0.2088 -0.0788 -0.2293 96  PRO A CD  
784  N  N   . PHE A 97  ? 1.3115 1.7349 1.3646 -0.2134 -0.0560 -0.2462 97  PHE A N   
785  C  CA  . PHE A 97  ? 1.2402 1.6690 1.3087 -0.2010 -0.0471 -0.2564 97  PHE A CA  
786  C  C   . PHE A 97  ? 1.1891 1.6379 1.2622 -0.2195 -0.0384 -0.2539 97  PHE A C   
787  O  O   . PHE A 97  ? 1.1670 1.6025 1.2260 -0.2378 -0.0376 -0.2401 97  PHE A O   
788  C  CB  . PHE A 97  ? 1.3749 1.7440 1.4300 -0.1844 -0.0430 -0.2519 97  PHE A CB  
789  C  CG  . PHE A 97  ? 1.4520 1.7926 1.4959 -0.1679 -0.0518 -0.2504 97  PHE A CG  
790  C  CD1 . PHE A 97  ? 1.4664 1.7555 1.4823 -0.1694 -0.0529 -0.2367 97  PHE A CD1 
791  C  CD2 . PHE A 97  ? 1.5313 1.8960 1.5921 -0.1501 -0.0588 -0.2627 97  PHE A CD2 
792  C  CE1 . PHE A 97  ? 1.5594 1.8222 1.5619 -0.1551 -0.0614 -0.2348 97  PHE A CE1 
793  C  CE2 . PHE A 97  ? 1.6259 1.9645 1.6758 -0.1349 -0.0683 -0.2597 97  PHE A CE2 
794  C  CZ  . PHE A 97  ? 1.6403 1.9280 1.6596 -0.1380 -0.0699 -0.2455 97  PHE A CZ  
795  N  N   . SER A 98  ? 1.3705 1.8496 1.4621 -0.2146 -0.0323 -0.2673 98  SER A N   
796  C  CA  . SER A 98  ? 1.3560 1.8603 1.4516 -0.2326 -0.0251 -0.2660 98  SER A CA  
797  C  C   . SER A 98  ? 1.2743 1.7337 1.3578 -0.2354 -0.0186 -0.2546 98  SER A C   
798  O  O   . SER A 98  ? 1.2136 1.6309 1.2931 -0.2192 -0.0161 -0.2548 98  SER A O   
799  C  CB  . SER A 98  ? 1.6326 2.1844 1.7497 -0.2269 -0.0203 -0.2856 98  SER A CB  
800  O  OG  . SER A 98  ? 1.6451 2.1717 1.7648 -0.2142 -0.0139 -0.2925 98  SER A OG  
801  N  N   . PHE A 99  ? 1.4605 1.9303 1.5393 -0.2565 -0.0160 -0.2438 99  PHE A N   
802  C  CA  . PHE A 99  ? 1.4039 1.8388 1.4752 -0.2610 -0.0102 -0.2319 99  PHE A CA  
803  C  C   . PHE A 99  ? 1.3299 1.7453 1.4088 -0.2431 -0.0050 -0.2421 99  PHE A C   
804  O  O   . PHE A 99  ? 1.3279 1.6951 1.3990 -0.2330 -0.0025 -0.2351 99  PHE A O   
805  C  CB  . PHE A 99  ? 1.0749 1.5432 1.1487 -0.2832 -0.0082 -0.2258 99  PHE A CB  
806  C  CG  . PHE A 99  ? 1.0517 1.4883 1.1193 -0.2902 -0.0042 -0.2106 99  PHE A CG  
807  C  CD1 . PHE A 99  ? 1.0895 1.4966 1.1441 -0.3006 -0.0057 -0.1912 99  PHE A CD1 
808  C  CD2 . PHE A 99  ? 1.0142 1.4522 1.0901 -0.2869 0.0007  -0.2158 99  PHE A CD2 
809  C  CE1 . PHE A 99  ? 1.0737 1.4539 1.1259 -0.3058 -0.0019 -0.1768 99  PHE A CE1 
810  C  CE2 . PHE A 99  ? 1.0062 1.4195 1.0795 -0.2936 0.0035  -0.2011 99  PHE A CE2 
811  C  CZ  . PHE A 99  ? 1.0325 1.4175 1.0951 -0.3023 0.0024  -0.1812 99  PHE A CZ  
812  N  N   . GLU A 100 ? 1.1300 1.5830 1.2239 -0.2395 -0.0029 -0.2594 100 GLU A N   
813  C  CA  . GLU A 100 ? 1.0828 1.5204 1.1849 -0.2250 0.0020  -0.2709 100 GLU A CA  
814  C  C   . GLU A 100 ? 1.1002 1.4921 1.1995 -0.2024 0.0011  -0.2727 100 GLU A C   
815  O  O   . GLU A 100 ? 1.0893 1.4450 1.1881 -0.1942 0.0056  -0.2714 100 GLU A O   
816  C  CB  . GLU A 100 ? 1.4841 1.9715 1.6018 -0.2235 0.0041  -0.2926 100 GLU A CB  
817  C  CG  . GLU A 100 ? 1.5015 2.0316 1.6201 -0.2457 0.0067  -0.2920 100 GLU A CG  
818  C  CD  . GLU A 100 ? 1.4956 2.0729 1.6148 -0.2600 0.0037  -0.2907 100 GLU A CD  
819  O  OE1 . GLU A 100 ? 1.4947 2.0777 1.6173 -0.2515 -0.0005 -0.2938 100 GLU A OE1 
820  O  OE2 . GLU A 100 ? 1.5077 2.1171 1.6242 -0.2805 0.0052  -0.2858 100 GLU A OE2 
821  N  N   . SER A 101 ? 1.3173 1.7112 1.4145 -0.1933 -0.0051 -0.2747 101 SER A N   
822  C  CA  . SER A 101 ? 1.3493 1.7025 1.4420 -0.1721 -0.0074 -0.2754 101 SER A CA  
823  C  C   . SER A 101 ? 1.2866 1.5871 1.3585 -0.1738 -0.0067 -0.2562 101 SER A C   
824  O  O   . SER A 101 ? 1.2910 1.5476 1.3567 -0.1599 -0.0041 -0.2533 101 SER A O   
825  C  CB  . SER A 101 ? 1.3118 1.6888 1.4108 -0.1613 -0.0156 -0.2843 101 SER A CB  
826  O  OG  . SER A 101 ? 1.2856 1.7222 1.3987 -0.1717 -0.0166 -0.2944 101 SER A OG  
827  N  N   . ILE A 102 ? 1.1976 1.5017 1.2583 -0.1910 -0.0083 -0.2433 102 ILE A N   
828  C  CA  . ILE A 102 ? 1.1520 1.4080 1.1933 -0.1949 -0.0055 -0.2256 102 ILE A CA  
829  C  C   . ILE A 102 ? 1.0667 1.2971 1.1108 -0.1958 0.0038  -0.2195 102 ILE A C   
830  O  O   . ILE A 102 ? 1.0436 1.2331 1.0831 -0.1828 0.0083  -0.2169 102 ILE A O   
831  C  CB  . ILE A 102 ? 0.9342 1.2019 0.9655 -0.2145 -0.0089 -0.2144 102 ILE A CB  
832  C  CG1 . ILE A 102 ? 0.8989 1.1913 0.9282 -0.2140 -0.0189 -0.2202 102 ILE A CG1 
833  C  CG2 . ILE A 102 ? 0.9727 1.1901 0.9851 -0.2179 -0.0044 -0.1976 102 ILE A CG2 
834  C  CD1 . ILE A 102 ? 0.9520 1.2441 0.9667 -0.2316 -0.0240 -0.2088 102 ILE A CD1 
835  N  N   . ILE A 103 ? 0.9635 1.2193 1.0154 -0.2122 0.0062  -0.2162 103 ILE A N   
836  C  CA  . ILE A 103 ? 0.8994 1.1473 0.9605 -0.2146 0.0130  -0.2140 103 ILE A CA  
837  C  C   . ILE A 103 ? 0.8955 1.1231 0.9638 -0.1969 0.0164  -0.2247 103 ILE A C   
838  O  O   . ILE A 103 ? 0.8499 1.0451 0.9191 -0.1938 0.0226  -0.2177 103 ILE A O   
839  C  CB  . ILE A 103 ? 0.9509 1.2484 1.0247 -0.2292 0.0121  -0.2205 103 ILE A CB  
840  C  CG1 . ILE A 103 ? 0.9574 1.2568 1.0276 -0.2480 0.0130  -0.2032 103 ILE A CG1 
841  C  CG2 . ILE A 103 ? 0.9185 1.2221 1.0062 -0.2227 0.0158  -0.2335 103 ILE A CG2 
842  C  CD1 . ILE A 103 ? 0.9659 1.3035 1.0476 -0.2607 0.0132  -0.2075 103 ILE A CD1 
843  N  N   . LEU A 104 ? 1.0138 1.2605 1.0891 -0.1852 0.0124  -0.2412 104 LEU A N   
844  C  CA  . LEU A 104 ? 1.0466 1.2714 1.1290 -0.1681 0.0151  -0.2513 104 LEU A CA  
845  C  C   . LEU A 104 ? 1.0500 1.2212 1.1190 -0.1542 0.0167  -0.2419 104 LEU A C   
846  O  O   . LEU A 104 ? 1.0142 1.1523 1.0839 -0.1509 0.0233  -0.2365 104 LEU A O   
847  C  CB  . LEU A 104 ? 0.7331 0.9898 0.8281 -0.1571 0.0108  -0.2719 104 LEU A CB  
848  C  CG  . LEU A 104 ? 0.8211 1.0516 0.9244 -0.1427 0.0147  -0.2813 104 LEU A CG  
849  C  CD1 . LEU A 104 ? 0.8164 1.0761 0.9334 -0.1519 0.0181  -0.2936 104 LEU A CD1 
850  C  CD2 . LEU A 104 ? 0.8993 1.1248 1.0075 -0.1216 0.0102  -0.2938 104 LEU A CD2 
851  N  N   . TYR A 105 ? 1.1021 1.2659 1.1588 -0.1469 0.0107  -0.2395 105 TYR A N   
852  C  CA  . TYR A 105 ? 1.1548 1.2692 1.1959 -0.1322 0.0113  -0.2320 105 TYR A CA  
853  C  C   . TYR A 105 ? 1.1029 1.1773 1.1230 -0.1382 0.0166  -0.2132 105 TYR A C   
854  O  O   . TYR A 105 ? 1.1529 1.1844 1.1587 -0.1273 0.0194  -0.2064 105 TYR A O   
855  C  CB  . TYR A 105 ? 1.0836 1.2058 1.1204 -0.1193 0.0012  -0.2387 105 TYR A CB  
856  C  CG  . TYR A 105 ? 1.1796 1.3292 1.2368 -0.1064 -0.0029 -0.2572 105 TYR A CG  
857  C  CD1 . TYR A 105 ? 1.1714 1.3746 1.2461 -0.1137 -0.0051 -0.2702 105 TYR A CD1 
858  C  CD2 . TYR A 105 ? 1.3038 1.4247 1.3622 -0.0866 -0.0043 -0.2614 105 TYR A CD2 
859  C  CE1 . TYR A 105 ? 1.2781 1.5065 1.3718 -0.1009 -0.0075 -0.2886 105 TYR A CE1 
860  C  CE2 . TYR A 105 ? 1.4196 1.5631 1.4977 -0.0732 -0.0078 -0.2789 105 TYR A CE2 
861  C  CZ  . TYR A 105 ? 1.4041 1.6022 1.5004 -0.0800 -0.0090 -0.2934 105 TYR A CZ  
862  O  OH  . TYR A 105 ? 1.5347 1.7576 1.6517 -0.0662 -0.0111 -0.3128 105 TYR A OH  
863  N  N   . MET A 106 ? 1.1000 1.1877 1.1179 -0.1552 0.0182  -0.2050 106 MET A N   
864  C  CA  . MET A 106 ? 1.0687 1.1201 1.0689 -0.1609 0.0244  -0.1885 106 MET A CA  
865  C  C   . MET A 106 ? 1.0269 1.0344 1.0248 -0.1528 0.0351  -0.1808 106 MET A C   
866  O  O   . MET A 106 ? 0.9737 0.9416 0.9519 -0.1468 0.0392  -0.1719 106 MET A O   
867  C  CB  . MET A 106 ? 1.2655 1.3379 1.2712 -0.1796 0.0260  -0.1812 106 MET A CB  
868  C  CG  . MET A 106 ? 1.3033 1.4029 1.3021 -0.1908 0.0176  -0.1813 106 MET A CG  
869  S  SD  . MET A 106 ? 1.2803 1.3815 1.2786 -0.2108 0.0216  -0.1661 106 MET A SD  
870  C  CE  . MET A 106 ? 1.2563 1.2952 1.2322 -0.2045 0.0302  -0.1521 106 MET A CE  
871  N  N   . SER A 107 ? 1.1882 1.2045 1.2059 -0.1541 0.0398  -0.1844 107 SER A N   
872  C  CA  . SER A 107 ? 1.0959 1.0774 1.1172 -0.1472 0.0494  -0.1793 107 SER A CA  
873  C  C   . SER A 107 ? 1.0885 1.0346 1.0954 -0.1305 0.0494  -0.1802 107 SER A C   
874  O  O   . SER A 107 ? 0.9767 0.8823 0.9678 -0.1261 0.0571  -0.1687 107 SER A O   
875  C  CB  . SER A 107 ? 0.9252 0.9312 0.9709 -0.1500 0.0494  -0.1896 107 SER A CB  
876  O  OG  . SER A 107 ? 0.9395 0.9942 0.9947 -0.1599 0.0419  -0.1989 107 SER A OG  
877  N  N   . THR A 108 ? 1.1258 1.0887 1.1384 -0.1210 0.0409  -0.1938 108 THR A N   
878  C  CA  . THR A 108 ? 1.1683 1.1035 1.1684 -0.1043 0.0375  -0.1953 108 THR A CA  
879  C  C   . THR A 108 ? 1.1371 1.0444 1.1079 -0.1019 0.0364  -0.1839 108 THR A C   
880  O  O   . THR A 108 ? 1.0843 0.9508 1.0384 -0.0922 0.0403  -0.1764 108 THR A O   
881  C  CB  . THR A 108 ? 1.3387 1.3066 1.3496 -0.0956 0.0257  -0.2116 108 THR A CB  
882  O  OG1 . THR A 108 ? 1.3904 1.3949 1.4260 -0.1016 0.0260  -0.2244 108 THR A OG1 
883  C  CG2 . THR A 108 ? 1.3997 1.3383 1.4054 -0.0766 0.0225  -0.2139 108 THR A CG2 
884  N  N   . PHE A 109 ? 1.5433 1.4721 1.5061 -0.1114 0.0308  -0.1829 109 PHE A N   
885  C  CA  . PHE A 109 ? 1.5482 1.4500 1.4814 -0.1100 0.0289  -0.1740 109 PHE A CA  
886  C  C   . PHE A 109 ? 1.3662 1.2297 1.2855 -0.1147 0.0426  -0.1601 109 PHE A C   
887  O  O   . PHE A 109 ? 1.3085 1.1318 1.2116 -0.1059 0.0493  -0.1530 109 PHE A O   
888  C  CB  . PHE A 109 ? 1.6149 1.5468 1.5425 -0.1204 0.0191  -0.1763 109 PHE A CB  
889  C  CG  . PHE A 109 ? 1.6192 1.5217 1.5142 -0.1208 0.0166  -0.1681 109 PHE A CG  
890  C  CD1 . PHE A 109 ? 1.7474 1.6350 1.6253 -0.1084 0.0078  -0.1693 109 PHE A CD1 
891  C  CD2 . PHE A 109 ? 1.5192 1.4076 1.4000 -0.1334 0.0227  -0.1593 109 PHE A CD2 
892  C  CE1 . PHE A 109 ? 1.7746 1.6352 1.6199 -0.1098 0.0048  -0.1624 109 PHE A CE1 
893  C  CE2 . PHE A 109 ? 1.5433 1.4029 1.3921 -0.1342 0.0207  -0.1536 109 PHE A CE2 
894  C  CZ  . PHE A 109 ? 1.6707 1.5168 1.5007 -0.1230 0.0116  -0.1554 109 PHE A CZ  
895  N  N   . PHE A 110 ? 1.6904 1.5671 1.6164 -0.1287 0.0472  -0.1558 110 PHE A N   
896  C  CA  . PHE A 110 ? 1.5456 1.3892 1.4600 -0.1331 0.0603  -0.1428 110 PHE A CA  
897  C  C   . PHE A 110 ? 1.4256 1.2372 1.3436 -0.1254 0.0732  -0.1366 110 PHE A C   
898  O  O   . PHE A 110 ? 1.3673 1.1401 1.2638 -0.1215 0.0825  -0.1274 110 PHE A O   
899  C  CB  . PHE A 110 ? 0.9425 0.8080 0.8705 -0.1482 0.0627  -0.1389 110 PHE A CB  
900  C  CG  . PHE A 110 ? 1.0444 0.9267 0.9601 -0.1579 0.0533  -0.1401 110 PHE A CG  
901  C  CD1 . PHE A 110 ? 1.1745 1.1039 1.1057 -0.1659 0.0420  -0.1487 110 PHE A CD1 
902  C  CD2 . PHE A 110 ? 1.0316 0.8829 0.9196 -0.1596 0.0559  -0.1333 110 PHE A CD2 
903  C  CE1 . PHE A 110 ? 1.2670 1.2128 1.1880 -0.1764 0.0334  -0.1492 110 PHE A CE1 
904  C  CE2 . PHE A 110 ? 1.1410 1.0066 1.0180 -0.1700 0.0465  -0.1348 110 PHE A CE2 
905  C  CZ  . PHE A 110 ? 1.2532 1.1667 1.1478 -0.1788 0.0351  -0.1422 110 PHE A CZ  
906  N  N   . ALA A 111 ? 1.3637 1.1901 1.3075 -0.1238 0.0743  -0.1416 111 ALA A N   
907  C  CA  . ALA A 111 ? 1.2610 1.0561 1.2092 -0.1188 0.0873  -0.1342 111 ALA A CA  
908  C  C   . ALA A 111 ? 1.2891 1.0497 1.2179 -0.1052 0.0880  -0.1329 111 ALA A C   
909  O  O   . ALA A 111 ? 1.2110 0.9414 1.1386 -0.1015 0.0996  -0.1251 111 ALA A O   
910  C  CB  . ALA A 111 ? 0.9564 0.7724 0.9358 -0.1227 0.0889  -0.1389 111 ALA A CB  
911  N  N   . SER A 112 ? 1.3803 1.1459 1.2945 -0.0982 0.0754  -0.1396 112 SER A N   
912  C  CA  . SER A 112 ? 1.4423 1.1740 1.3347 -0.0852 0.0742  -0.1364 112 SER A CA  
913  C  C   . SER A 112 ? 1.4272 1.1237 1.2840 -0.0853 0.0808  -0.1251 112 SER A C   
914  O  O   . SER A 112 ? 1.4924 1.1569 1.3250 -0.0759 0.0810  -0.1199 112 SER A O   
915  C  CB  . SER A 112 ? 1.1487 0.9008 1.0418 -0.0761 0.0570  -0.1475 112 SER A CB  
916  O  OG  . SER A 112 ? 1.1776 0.9328 1.0918 -0.0676 0.0550  -0.1547 112 SER A OG  
917  N  N   . LEU A 113 ? 1.5629 1.2638 1.4158 -0.0960 0.0866  -0.1212 113 LEU A N   
918  C  CA  . LEU A 113 ? 1.5655 1.2340 1.3837 -0.0969 0.0929  -0.1130 113 LEU A CA  
919  C  C   . LEU A 113 ? 1.4542 1.0826 1.2623 -0.0937 0.1121  -0.1016 113 LEU A C   
920  O  O   . LEU A 113 ? 1.4681 1.0635 1.2430 -0.0919 0.1191  -0.0952 113 LEU A O   
921  C  CB  . LEU A 113 ? 1.0439 0.7282 0.8614 -0.1092 0.0925  -0.1133 113 LEU A CB  
922  C  CG  . LEU A 113 ? 1.1862 0.8735 0.9770 -0.1113 0.0789  -0.1176 113 LEU A CG  
923  C  CD1 . LEU A 113 ? 1.3492 1.0487 1.1380 -0.1016 0.0632  -0.1246 113 LEU A CD1 
924  C  CD2 . LEU A 113 ? 1.2027 0.9221 1.0054 -0.1248 0.0726  -0.1215 113 LEU A CD2 
925  N  N   . ILE A 114 ? 1.6082 1.2406 1.4447 -0.0939 0.1208  -0.0995 114 ILE A N   
926  C  CA  . ILE A 114 ? 1.5197 1.1211 1.3542 -0.0930 0.1405  -0.0883 114 ILE A CA  
927  C  C   . ILE A 114 ? 1.5892 1.1512 1.3932 -0.0830 0.1441  -0.0822 114 ILE A C   
928  O  O   . ILE A 114 ? 1.5753 1.1024 1.3561 -0.0816 0.1601  -0.0722 114 ILE A O   
929  C  CB  . ILE A 114 ? 1.3763 0.9961 1.2511 -0.0969 0.1458  -0.0883 114 ILE A CB  
930  C  CG1 . ILE A 114 ? 1.2880 0.8954 1.1726 -0.1020 0.1654  -0.0775 114 ILE A CG1 
931  C  CG2 . ILE A 114 ? 1.4137 1.0243 1.2955 -0.0894 0.1425  -0.0904 114 ILE A CG2 
932  C  CD1 . ILE A 114 ? 1.2423 0.8481 1.1555 -0.1029 0.1751  -0.0729 114 ILE A CD1 
933  N  N   . VAL A 115 ? 1.5027 1.0713 1.3062 -0.0757 0.1290  -0.0885 115 VAL A N   
934  C  CA  . VAL A 115 ? 1.6218 1.1582 1.3951 -0.0655 0.1260  -0.0835 115 VAL A CA  
935  C  C   . VAL A 115 ? 1.6867 1.1951 1.4152 -0.0656 0.1300  -0.0773 115 VAL A C   
936  O  O   . VAL A 115 ? 1.7660 1.2398 1.4639 -0.0592 0.1336  -0.0692 115 VAL A O   
937  C  CB  . VAL A 115 ? 1.4132 0.9700 1.1942 -0.0574 0.1045  -0.0935 115 VAL A CB  
938  C  CG1 . VAL A 115 ? 1.5890 1.1443 1.3374 -0.0536 0.0899  -0.0953 115 VAL A CG1 
939  C  CG2 . VAL A 115 ? 1.4428 0.9812 1.2332 -0.0480 0.1046  -0.0909 115 VAL A CG2 
940  N  N   . VAL A 116 ? 1.5969 1.1186 1.3205 -0.0737 0.1298  -0.0809 116 VAL A N   
941  C  CA  . VAL A 116 ? 1.6788 1.1739 1.3598 -0.0754 0.1340  -0.0773 116 VAL A CA  
942  C  C   . VAL A 116 ? 1.5967 1.0586 1.2643 -0.0772 0.1590  -0.0674 116 VAL A C   
943  O  O   . VAL A 116 ? 1.6891 1.1149 1.3222 -0.0724 0.1674  -0.0600 116 VAL A O   
944  C  CB  . VAL A 116 ? 1.0770 0.5967 0.7553 -0.0837 0.1220  -0.0858 116 VAL A CB  
945  C  CG1 . VAL A 116 ? 1.0816 0.5737 0.7275 -0.0888 0.1338  -0.0825 116 VAL A CG1 
946  C  CG2 . VAL A 116 ? 1.2703 0.8050 0.9364 -0.0799 0.0990  -0.0926 116 VAL A CG2 
947  N  N   . PRO A 117 ? 1.5349 1.0096 1.2297 -0.0839 0.1713  -0.0668 117 PRO A N   
948  C  CA  . PRO A 117 ? 1.4936 0.9381 1.1788 -0.0835 0.1957  -0.0573 117 PRO A CA  
949  C  C   . PRO A 117 ? 1.4919 0.9183 1.1811 -0.0778 0.2053  -0.0489 117 PRO A C   
950  O  O   . PRO A 117 ? 1.5378 0.9308 1.2002 -0.0755 0.2224  -0.0407 117 PRO A O   
951  C  CB  . PRO A 117 ? 1.2491 0.7162 0.9724 -0.0903 0.2048  -0.0572 117 PRO A CB  
952  C  CG  . PRO A 117 ? 1.2013 0.7087 0.9570 -0.0940 0.1867  -0.0649 117 PRO A CG  
953  C  CD  . PRO A 117 ? 1.3160 0.8291 1.0484 -0.0915 0.1657  -0.0727 117 PRO A CD  
954  N  N   . ILE A 118 ? 1.7811 1.2261 1.5001 -0.0759 0.1960  -0.0507 118 ILE A N   
955  C  CA  . ILE A 118 ? 1.8061 1.2262 1.5242 -0.0715 0.2072  -0.0410 118 ILE A CA  
956  C  C   . ILE A 118 ? 1.9465 1.3262 1.6135 -0.0655 0.2105  -0.0337 118 ILE A C   
957  O  O   . ILE A 118 ? 1.9898 1.3401 1.6373 -0.0657 0.2313  -0.0238 118 ILE A O   
958  C  CB  . ILE A 118 ? 1.4388 0.8742 1.1857 -0.0686 0.1946  -0.0445 118 ILE A CB  
959  C  CG1 . ILE A 118 ? 1.3251 0.7992 1.1201 -0.0754 0.1917  -0.0515 118 ILE A CG1 
960  C  CG2 . ILE A 118 ? 1.4835 0.8890 1.2279 -0.0658 0.2077  -0.0331 118 ILE A CG2 
961  C  CD1 . ILE A 118 ? 1.2749 0.7466 1.0973 -0.0808 0.2111  -0.0434 118 ILE A CD1 
962  N  N   . ILE A 119 ? 1.4572 0.8373 1.1024 -0.0603 0.1898  -0.0385 119 ILE A N   
963  C  CA  . ILE A 119 ? 1.6470 0.9915 1.2435 -0.0545 0.1886  -0.0311 119 ILE A CA  
964  C  C   . ILE A 119 ? 1.7065 1.0299 1.2620 -0.0580 0.1993  -0.0299 119 ILE A C   
965  O  O   . ILE A 119 ? 1.8325 1.1208 1.3483 -0.0556 0.2092  -0.0210 119 ILE A O   
966  C  CB  . ILE A 119 ? 1.5723 0.9236 1.1585 -0.0468 0.1620  -0.0353 119 ILE A CB  
967  C  CG1 . ILE A 119 ? 1.6396 1.0173 1.2204 -0.0490 0.1434  -0.0470 119 ILE A CG1 
968  C  CG2 . ILE A 119 ? 1.5182 0.8884 1.1458 -0.0423 0.1527  -0.0384 119 ILE A CG2 
969  C  CD1 . ILE A 119 ? 1.7726 1.1714 1.3656 -0.0412 0.1183  -0.0531 119 ILE A CD1 
970  N  N   . LEU A 120 ? 1.5838 0.9264 1.1478 -0.0641 0.1986  -0.0385 120 LEU A N   
971  C  CA  . LEU A 120 ? 1.6370 0.9560 1.1640 -0.0677 0.2117  -0.0383 120 LEU A CA  
972  C  C   . LEU A 120 ? 1.5751 0.8689 1.0992 -0.0681 0.2423  -0.0291 120 LEU A C   
973  O  O   . LEU A 120 ? 1.7007 0.9599 1.1804 -0.0669 0.2554  -0.0241 120 LEU A O   
974  C  CB  . LEU A 120 ? 1.4093 0.7514 0.9463 -0.0745 0.2043  -0.0491 120 LEU A CB  
975  C  CG  . LEU A 120 ? 1.5544 0.9131 1.0766 -0.0762 0.1776  -0.0584 120 LEU A CG  
976  C  CD1 . LEU A 120 ? 1.5151 0.8844 1.0387 -0.0847 0.1775  -0.0662 120 LEU A CD1 
977  C  CD2 . LEU A 120 ? 1.7931 1.1222 1.2622 -0.0721 0.1701  -0.0554 120 LEU A CD2 
978  N  N   . ILE A 121 ? 1.5344 0.8467 1.1053 -0.0703 0.2539  -0.0268 121 ILE A N   
979  C  CA  . ILE A 121 ? 1.5315 0.8251 1.1067 -0.0705 0.2826  -0.0174 121 ILE A CA  
980  C  C   . ILE A 121 ? 1.6327 0.8989 1.1863 -0.0666 0.2899  -0.0063 121 ILE A C   
981  O  O   . ILE A 121 ? 1.7407 0.9763 1.2624 -0.0658 0.3102  0.0010  121 ILE A O   
982  C  CB  . ILE A 121 ? 1.5176 0.8395 1.1506 -0.0738 0.2903  -0.0158 121 ILE A CB  
983  C  CG1 . ILE A 121 ? 1.4298 0.7798 1.0856 -0.0781 0.2823  -0.0250 121 ILE A CG1 
984  C  CG2 . ILE A 121 ? 1.5469 0.8515 1.1861 -0.0738 0.3204  -0.0053 121 ILE A CG2 
985  C  CD1 . ILE A 121 ? 1.3144 0.6967 1.0274 -0.0821 0.2856  -0.0237 121 ILE A CD1 
986  N  N   . ALA A 122 ? 1.5962 0.8726 1.1676 -0.0643 0.2739  -0.0048 122 ALA A N   
987  C  CA  . ALA A 122 ? 1.7216 0.9692 1.2695 -0.0605 0.2773  0.0065  122 ALA A CA  
988  C  C   . ALA A 122 ? 1.9118 1.1250 1.3964 -0.0583 0.2807  0.0098  122 ALA A C   
989  O  O   . ALA A 122 ? 2.0232 1.2061 1.4807 -0.0583 0.3006  0.0209  122 ALA A O   
990  C  CB  . ALA A 122 ? 1.8445 1.1037 1.4070 -0.0561 0.2528  0.0044  122 ALA A CB  
991  N  N   . ARG A 123 ? 1.9060 1.1253 1.3670 -0.0575 0.2616  0.0001  123 ARG A N   
992  C  CA  . ARG A 123 ? 2.1454 1.3345 1.5441 -0.0563 0.2591  0.0016  123 ARG A CA  
993  C  C   . ARG A 123 ? 2.1914 1.3570 1.5607 -0.0598 0.2853  0.0021  123 ARG A C   
994  O  O   . ARG A 123 ? 2.4065 1.5390 1.7238 -0.0591 0.2933  0.0079  123 ARG A O   
995  C  CB  . ARG A 123 ? 1.6379 0.8435 1.0236 -0.0562 0.2314  -0.0099 123 ARG A CB  
996  C  CG  . ARG A 123 ? 1.8933 1.0739 1.2203 -0.0583 0.2305  -0.0126 123 ARG A CG  
997  C  CD  . ARG A 123 ? 1.9347 1.1391 1.2612 -0.0608 0.2045  -0.0251 123 ARG A CD  
998  N  NE  . ARG A 123 ? 2.1988 1.3817 1.4684 -0.0605 0.1907  -0.0246 123 ARG A NE  
999  C  CZ  . ARG A 123 ? 2.2981 1.4622 1.5249 -0.0664 0.1951  -0.0308 123 ARG A CZ  
1000 N  NH1 . ARG A 123 ? 2.1832 1.3465 1.4197 -0.0717 0.2136  -0.0379 123 ARG A NH1 
1001 N  NH2 . ARG A 123 ? 2.5260 1.6716 1.7003 -0.0668 0.1803  -0.0299 123 ARG A NH2 
1002 N  N   . GLU A 124 ? 1.7885 0.9711 1.1900 -0.0632 0.2984  -0.0041 124 GLU A N   
1003 C  CA  . GLU A 124 ? 1.8499 1.0103 1.2309 -0.0649 0.3270  -0.0033 124 GLU A CA  
1004 C  C   . GLU A 124 ? 1.9290 1.0647 1.2979 -0.0633 0.3510  0.0109  124 GLU A C   
1005 O  O   . GLU A 124 ? 2.0974 1.2028 1.4228 -0.0634 0.3706  0.0137  124 GLU A O   
1006 C  CB  . GLU A 124 ? 2.3695 1.5540 1.7980 -0.0672 0.3384  -0.0090 124 GLU A CB  
1007 C  CG  . GLU A 124 ? 2.3104 1.5169 1.7486 -0.0703 0.3182  -0.0221 124 GLU A CG  
1008 C  CD  . GLU A 124 ? 2.4926 1.6748 1.8743 -0.0720 0.3126  -0.0301 124 GLU A CD  
1009 O  OE1 . GLU A 124 ? 2.6756 1.8265 2.0069 -0.0703 0.3174  -0.0258 124 GLU A OE1 
1010 O  OE2 . GLU A 124 ? 2.4687 1.6628 1.8556 -0.0759 0.3030  -0.0405 124 GLU A OE2 
1011 N  N   . TYR A 125 ? 1.9353 1.0839 1.3426 -0.0627 0.3496  0.0195  125 TYR A N   
1012 C  CA  . TYR A 125 ? 2.0159 1.1450 1.4208 -0.0630 0.3716  0.0343  125 TYR A CA  
1013 C  C   . TYR A 125 ? 2.2002 1.3003 1.5583 -0.0608 0.3620  0.0442  125 TYR A C   
1014 O  O   . TYR A 125 ? 2.2741 1.3572 1.6294 -0.0616 0.3753  0.0583  125 TYR A O   
1015 C  CB  . TYR A 125 ? 2.2606 1.4161 1.7297 -0.0650 0.3743  0.0387  125 TYR A CB  
1016 C  CG  . TYR A 125 ? 2.1299 1.3105 1.6418 -0.0674 0.3881  0.0326  125 TYR A CG  
1017 C  CD1 . TYR A 125 ? 1.9577 1.1742 1.5283 -0.0697 0.3779  0.0289  125 TYR A CD1 
1018 C  CD2 . TYR A 125 ? 2.2088 1.3765 1.7015 -0.0669 0.4111  0.0305  125 TYR A CD2 
1019 C  CE1 . TYR A 125 ? 1.8677 1.1074 1.4772 -0.0717 0.3891  0.0250  125 TYR A CE1 
1020 C  CE2 . TYR A 125 ? 2.1159 1.3053 1.6491 -0.0677 0.4232  0.0259  125 TYR A CE2 
1021 C  CZ  . TYR A 125 ? 1.9451 1.1711 1.5370 -0.0702 0.4115  0.0241  125 TYR A CZ  
1022 O  OH  . TYR A 125 ? 1.8689 1.1171 1.5013 -0.0708 0.4221  0.0212  125 TYR A OH  
1023 N  N   . LYS A 126 ? 1.8591 0.9540 1.1808 -0.0584 0.3384  0.0375  126 LYS A N   
1024 C  CA  . LYS A 126 ? 2.1138 1.1817 1.3868 -0.0556 0.3257  0.0467  126 LYS A CA  
1025 C  C   . LYS A 126 ? 2.0760 1.1509 1.3799 -0.0523 0.3111  0.0555  126 LYS A C   
1026 O  O   . LYS A 126 ? 2.2771 1.3258 1.5521 -0.0503 0.3092  0.0691  126 LYS A O   
1027 C  CB  . LYS A 126 ? 2.2689 1.2988 1.4895 -0.0578 0.3520  0.0573  126 LYS A CB  
1028 C  CG  . LYS A 126 ? 2.3493 1.3681 1.5315 -0.0602 0.3641  0.0460  126 LYS A CG  
1029 C  CD  . LYS A 126 ? 2.6227 1.6028 1.7457 -0.0623 0.3898  0.0546  126 LYS A CD  
1030 C  CE  . LYS A 126 ? 2.7410 1.7076 1.8207 -0.0643 0.3977  0.0407  126 LYS A CE  
1031 N  NZ  . LYS A 126 ? 3.0178 1.9469 2.0367 -0.0665 0.4238  0.0472  126 LYS A NZ  
1032 N  N   . LEU A 127 ? 2.0541 1.1636 1.4161 -0.0520 0.3004  0.0473  127 LEU A N   
1033 C  CA  . LEU A 127 ? 2.0037 1.1228 1.4005 -0.0488 0.2857  0.0517  127 LEU A CA  
1034 C  C   . LEU A 127 ? 1.9197 1.0728 1.3458 -0.0452 0.2570  0.0375  127 LEU A C   
1035 O  O   . LEU A 127 ? 1.7177 0.9000 1.1961 -0.0469 0.2550  0.0308  127 LEU A O   
1036 C  CB  . LEU A 127 ? 1.7686 0.8993 1.2160 -0.0537 0.3050  0.0559  127 LEU A CB  
1037 C  CG  . LEU A 127 ? 1.8095 0.9208 1.2496 -0.0591 0.3386  0.0673  127 LEU A CG  
1038 C  CD1 . LEU A 127 ? 1.6737 0.8020 1.1716 -0.0640 0.3497  0.0714  127 LEU A CD1 
1039 C  CD2 . LEU A 127 ? 2.0455 1.1159 1.4320 -0.0581 0.3450  0.0827  127 LEU A CD2 
1040 N  N   . THR A 128 ? 2.2847 1.4361 1.6783 -0.0408 0.2348  0.0330  128 THR A N   
1041 C  CA  . THR A 128 ? 2.2259 1.4127 1.6476 -0.0379 0.2091  0.0192  128 THR A CA  
1042 C  C   . THR A 128 ? 2.2135 1.4114 1.6708 -0.0316 0.1939  0.0203  128 THR A C   
1043 O  O   . THR A 128 ? 2.0192 1.2464 1.5258 -0.0333 0.1922  0.0120  128 THR A O   
1044 C  CB  . THR A 128 ? 1.7089 0.8942 1.0900 -0.0353 0.1883  0.0140  128 THR A CB  
1045 O  OG1 . THR A 128 ? 1.6565 0.8439 1.0195 -0.0424 0.1981  0.0059  128 THR A OG1 
1046 C  CG2 . THR A 128 ? 1.7184 0.9389 1.1305 -0.0303 0.1599  0.0033  128 THR A CG2 
1047 N  N   . THR A 129 ? 2.0840 1.2576 1.5154 -0.0244 0.1825  0.0306  129 THR A N   
1048 C  CA  . THR A 129 ? 2.0983 1.2763 1.5605 -0.0169 0.1682  0.0322  129 THR A CA  
1049 C  C   . THR A 129 ? 1.8588 1.0467 1.3710 -0.0216 0.1827  0.0313  129 THR A C   
1050 O  O   . THR A 129 ? 1.7903 0.9994 1.3418 -0.0178 0.1697  0.0230  129 THR A O   
1051 C  CB  . THR A 129 ? 1.8086 0.9478 1.2332 -0.0098 0.1619  0.0488  129 THR A CB  
1052 O  OG1 . THR A 129 ? 2.0581 1.1899 1.4350 -0.0065 0.1474  0.0498  129 THR A OG1 
1053 C  CG2 . THR A 129 ? 1.8552 0.9975 1.3110 0.0000  0.1439  0.0491  129 THR A CG2 
1054 N  N   . TYR A 130 ? 2.0381 1.2124 1.5502 -0.0301 0.2095  0.0391  130 TYR A N   
1055 C  CA  . TYR A 130 ? 1.8278 1.0168 1.3902 -0.0361 0.2220  0.0373  130 TYR A CA  
1056 C  C   . TYR A 130 ? 1.6167 0.8491 1.2173 -0.0403 0.2184  0.0208  130 TYR A C   
1057 O  O   . TYR A 130 ? 1.4887 0.7443 1.1351 -0.0424 0.2146  0.0137  130 TYR A O   
1058 C  CB  . TYR A 130 ? 1.5401 0.7062 1.0960 -0.0441 0.2517  0.0510  130 TYR A CB  
1059 C  CG  . TYR A 130 ? 1.7451 0.8692 1.2686 -0.0418 0.2560  0.0688  130 TYR A CG  
1060 C  CD1 . TYR A 130 ? 1.9207 1.0143 1.3899 -0.0422 0.2677  0.0803  130 TYR A CD1 
1061 C  CD2 . TYR A 130 ? 1.7844 0.8977 1.3298 -0.0393 0.2478  0.0742  130 TYR A CD2 
1062 C  CE1 . TYR A 130 ? 2.1330 1.1878 1.5699 -0.0409 0.2713  0.0983  130 TYR A CE1 
1063 C  CE2 . TYR A 130 ? 1.9894 1.0620 1.5046 -0.0375 0.2510  0.0923  130 TYR A CE2 
1064 C  CZ  . TYR A 130 ? 2.1650 1.2091 1.6255 -0.0385 0.2626  0.1050  130 TYR A CZ  
1065 O  OH  . TYR A 130 ? 2.3921 1.3957 1.8201 -0.0377 0.2657  0.1244  130 TYR A OH  
1066 N  N   . GLY A 131 ? 1.7930 1.0349 1.3731 -0.0421 0.2190  0.0147  131 GLY A N   
1067 C  CA  . GLY A 131 ? 1.6382 0.9200 1.2483 -0.0456 0.2116  -0.0002 131 GLY A CA  
1068 C  C   . GLY A 131 ? 1.6581 0.9681 1.2927 -0.0403 0.1857  -0.0121 131 GLY A C   
1069 O  O   . GLY A 131 ? 1.5164 0.8592 1.1929 -0.0440 0.1822  -0.0221 131 GLY A O   
1070 N  N   . PHE A 132 ? 1.8331 1.1313 1.4413 -0.0313 0.1675  -0.0110 132 PHE A N   
1071 C  CA  . PHE A 132 ? 1.8943 1.2188 1.5243 -0.0241 0.1430  -0.0222 132 PHE A CA  
1072 C  C   . PHE A 132 ? 1.7913 1.1271 1.4672 -0.0241 0.1441  -0.0261 132 PHE A C   
1073 O  O   . PHE A 132 ? 1.7199 1.0923 1.4312 -0.0254 0.1350  -0.0399 132 PHE A O   
1074 C  CB  . PHE A 132 ? 1.4681 0.7707 1.0640 -0.0129 0.1260  -0.0160 132 PHE A CB  
1075 C  CG  . PHE A 132 ? 1.5663 0.8933 1.1863 -0.0029 0.1018  -0.0263 132 PHE A CG  
1076 C  CD1 . PHE A 132 ? 1.5835 0.9493 1.2141 -0.0029 0.0860  -0.0404 132 PHE A CD1 
1077 C  CD2 . PHE A 132 ? 1.6607 0.9713 1.2929 0.0065  0.0952  -0.0219 132 PHE A CD2 
1078 C  CE1 . PHE A 132 ? 1.6959 1.0866 1.3502 0.0070  0.0654  -0.0505 132 PHE A CE1 
1079 C  CE2 . PHE A 132 ? 1.7709 1.1034 1.4263 0.0173  0.0742  -0.0324 132 PHE A CE2 
1080 C  CZ  . PHE A 132 ? 1.7901 1.1643 1.4572 0.0179  0.0597  -0.0469 132 PHE A CZ  
1081 N  N   . ILE A 133 ? 1.6824 0.9861 1.3558 -0.0237 0.1558  -0.0137 133 ILE A N   
1082 C  CA  . ILE A 133 ? 1.5929 0.9009 1.3072 -0.0262 0.1600  -0.0158 133 ILE A CA  
1083 C  C   . ILE A 133 ? 1.3744 0.7125 1.1258 -0.0382 0.1727  -0.0229 133 ILE A C   
1084 O  O   . ILE A 133 ? 1.3123 0.6805 1.1015 -0.0400 0.1644  -0.0357 133 ILE A O   
1085 C  CB  . ILE A 133 ? 1.6015 0.8655 1.3020 -0.0256 0.1716  0.0012  133 ILE A CB  
1086 C  CG1 . ILE A 133 ? 1.8336 1.0729 1.5088 -0.0125 0.1540  0.0066  133 ILE A CG1 
1087 C  CG2 . ILE A 133 ? 1.5261 0.7925 1.2687 -0.0316 0.1787  -0.0004 133 ILE A CG2 
1088 C  CD1 . ILE A 133 ? 1.9283 1.1303 1.6049 -0.0113 0.1597  0.0196  133 ILE A CD1 
1089 N  N   . ALA A 134 ? 1.8524 1.1833 1.5926 -0.0461 0.1925  -0.0148 134 ALA A N   
1090 C  CA  . ALA A 134 ? 1.7056 1.0646 1.4809 -0.0565 0.2040  -0.0194 134 ALA A CA  
1091 C  C   . ALA A 134 ? 1.6323 1.0340 1.4293 -0.0574 0.1880  -0.0358 134 ALA A C   
1092 O  O   . ALA A 134 ? 1.5424 0.9723 1.3768 -0.0646 0.1897  -0.0422 134 ALA A O   
1093 C  CB  . ALA A 134 ? 1.1452 0.4928 0.9024 -0.0619 0.2255  -0.0102 134 ALA A CB  
1094 N  N   . ALA A 135 ? 1.3216 0.7290 1.0949 -0.0508 0.1720  -0.0419 135 ALA A N   
1095 C  CA  . ALA A 135 ? 1.2921 0.7402 1.0826 -0.0524 0.1571  -0.0566 135 ALA A CA  
1096 C  C   . ALA A 135 ? 1.3592 0.8285 1.1735 -0.0462 0.1382  -0.0689 135 ALA A C   
1097 O  O   . ALA A 135 ? 1.3081 0.8150 1.1524 -0.0508 0.1314  -0.0811 135 ALA A O   
1098 C  CB  . ALA A 135 ? 1.2226 0.6701 0.9782 -0.0507 0.1507  -0.0575 135 ALA A CB  
1099 N  N   . LEU A 136 ? 1.5099 0.9559 1.3111 -0.0356 0.1298  -0.0660 136 LEU A N   
1100 C  CA  . LEU A 136 ? 1.5800 1.0421 1.4083 -0.0291 0.1154  -0.0778 136 LEU A CA  
1101 C  C   . LEU A 136 ? 1.4575 0.9313 1.3234 -0.0384 0.1251  -0.0819 136 LEU A C   
1102 O  O   . LEU A 136 ? 1.4473 0.9562 1.3422 -0.0410 0.1172  -0.0963 136 LEU A O   
1103 C  CB  . LEU A 136 ? 1.3351 0.7634 1.1479 -0.0161 0.1075  -0.0717 136 LEU A CB  
1104 C  CG  . LEU A 136 ? 1.5328 0.9546 1.3149 -0.0042 0.0913  -0.0699 136 LEU A CG  
1105 C  CD1 . LEU A 136 ? 1.7316 1.1351 1.5171 0.0103  0.0782  -0.0698 136 LEU A CD1 
1106 C  CD2 . LEU A 136 ? 1.5457 1.0116 1.3352 -0.0053 0.0787  -0.0838 136 LEU A CD2 
1107 N  N   . LEU A 137 ? 1.4642 0.9108 1.3295 -0.0444 0.1425  -0.0691 137 LEU A N   
1108 C  CA  . LEU A 137 ? 1.3829 0.8405 1.2849 -0.0544 0.1510  -0.0718 137 LEU A CA  
1109 C  C   . LEU A 137 ? 1.2630 0.7603 1.1865 -0.0653 0.1542  -0.0784 137 LEU A C   
1110 O  O   . LEU A 137 ? 1.2401 0.7663 1.1955 -0.0710 0.1490  -0.0898 137 LEU A O   
1111 C  CB  . LEU A 137 ? 1.3528 0.7760 1.2508 -0.0599 0.1701  -0.0553 137 LEU A CB  
1112 C  CG  . LEU A 137 ? 1.2819 0.7232 1.2199 -0.0727 0.1789  -0.0579 137 LEU A CG  
1113 C  CD1 . LEU A 137 ? 1.3514 0.7955 1.3139 -0.0713 0.1676  -0.0694 137 LEU A CD1 
1114 C  CD2 . LEU A 137 ? 1.2598 0.6778 1.1983 -0.0809 0.2008  -0.0409 137 LEU A CD2 
1115 N  N   . GLY A 138 ? 1.4469 0.9438 1.3518 -0.0684 0.1629  -0.0708 138 GLY A N   
1116 C  CA  . GLY A 138 ? 1.3434 0.8722 1.2676 -0.0787 0.1676  -0.0735 138 GLY A CA  
1117 C  C   . GLY A 138 ? 1.3446 0.9137 1.2806 -0.0794 0.1508  -0.0888 138 GLY A C   
1118 O  O   . GLY A 138 ? 1.2814 0.8813 1.2403 -0.0886 0.1514  -0.0928 138 GLY A O   
1119 N  N   . SER A 139 ? 1.4665 1.0372 1.3878 -0.0697 0.1354  -0.0968 139 SER A N   
1120 C  CA  . SER A 139 ? 1.5011 1.1126 1.4325 -0.0708 0.1205  -0.1110 139 SER A CA  
1121 C  C   . SER A 139 ? 1.5710 1.2055 1.5322 -0.0700 0.1110  -0.1254 139 SER A C   
1122 O  O   . SER A 139 ? 1.6487 1.3166 1.6189 -0.0689 0.0982  -0.1388 139 SER A O   
1123 C  CB  . SER A 139 ? 1.1186 0.7242 1.0201 -0.0612 0.1088  -0.1124 139 SER A CB  
1124 O  OG  . SER A 139 ? 1.2163 0.7910 1.1041 -0.0493 0.1051  -0.1091 139 SER A OG  
1125 N  N   . ILE A 140 ? 1.4103 1.0264 1.3866 -0.0710 0.1179  -0.1230 140 ILE A N   
1126 C  CA  . ILE A 140 ? 1.4992 1.1284 1.4997 -0.0691 0.1094  -0.1374 140 ILE A CA  
1127 C  C   . ILE A 140 ? 1.4528 1.0848 1.4810 -0.0810 0.1184  -0.1369 140 ILE A C   
1128 O  O   . ILE A 140 ? 1.5273 1.1860 1.5795 -0.0858 0.1120  -0.1510 140 ILE A O   
1129 C  CB  . ILE A 140 ? 1.4525 1.0498 1.4409 -0.0547 0.1034  -0.1378 140 ILE A CB  
1130 C  CG1 . ILE A 140 ? 1.5539 1.1652 1.5276 -0.0430 0.0885  -0.1454 140 ILE A CG1 
1131 C  CG2 . ILE A 140 ? 1.5413 1.1400 1.5552 -0.0539 0.0994  -0.1501 140 ILE A CG2 
1132 C  CD1 . ILE A 140 ? 1.7219 1.3143 1.6957 -0.0276 0.0785  -0.1514 140 ILE A CD1 
1133 N  N   . ALA A 141 ? 1.5429 1.1488 1.5676 -0.0862 0.1333  -0.1208 141 ALA A N   
1134 C  CA  . ALA A 141 ? 1.5172 1.1258 1.5693 -0.0985 0.1425  -0.1178 141 ALA A CA  
1135 C  C   . ALA A 141 ? 1.5420 1.1957 1.6220 -0.1091 0.1355  -0.1308 141 ALA A C   
1136 O  O   . ALA A 141 ? 1.5950 1.2793 1.6730 -0.1115 0.1304  -0.1344 141 ALA A O   
1137 C  CB  . ALA A 141 ? 1.0768 0.6697 1.1237 -0.1044 0.1597  -0.0994 141 ALA A CB  
1138 N  N   . ASN A 142 ? 1.1888 0.8452 1.2935 -0.1164 0.1351  -0.1371 142 ASN A N   
1139 C  CA  . ASN A 142 ? 1.2459 0.9424 1.3746 -0.1259 0.1262  -0.1523 142 ASN A CA  
1140 C  C   . ASN A 142 ? 1.2148 0.9493 1.3488 -0.1348 0.1257  -0.1494 142 ASN A C   
1141 O  O   . ASN A 142 ? 1.2522 1.0114 1.3779 -0.1317 0.1164  -0.1584 142 ASN A O   
1142 C  CB  . ASN A 142 ? 1.5449 1.2357 1.6991 -0.1367 0.1293  -0.1546 142 ASN A CB  
1143 C  CG  . ASN A 142 ? 1.4989 1.1515 1.6490 -0.1285 0.1280  -0.1594 142 ASN A CG  
1144 O  OD1 . ASN A 142 ? 1.4881 1.1172 1.6497 -0.1351 0.1354  -0.1525 142 ASN A OD1 
1145 N  ND2 . ASN A 142 ? 1.4982 1.1447 1.6330 -0.1141 0.1185  -0.1705 142 ASN A ND2 
1146 N  N   . SER A 143 ? 1.1394 0.8786 1.2883 -0.1456 0.1354  -0.1363 143 SER A N   
1147 C  CA  . SER A 143 ? 1.1195 0.8902 1.2740 -0.1533 0.1356  -0.1305 143 SER A CA  
1148 C  C   . SER A 143 ? 1.1372 0.9155 1.2673 -0.1457 0.1302  -0.1323 143 SER A C   
1149 O  O   . SER A 143 ? 1.1738 0.9874 1.3079 -0.1511 0.1215  -0.1391 143 SER A O   
1150 C  CB  . SER A 143 ? 1.0711 0.8295 1.2338 -0.1581 0.1507  -0.1110 143 SER A CB  
1151 O  OG  . SER A 143 ? 1.1281 0.8773 1.3132 -0.1653 0.1564  -0.1077 143 SER A OG  
1152 N  N   . TYR A 144 ? 1.0015 0.7471 1.1055 -0.1343 0.1352  -0.1258 144 TYR A N   
1153 C  CA  . TYR A 144 ? 1.0414 0.7928 1.1218 -0.1285 0.1301  -0.1265 144 TYR A CA  
1154 C  C   . TYR A 144 ? 1.0997 0.8765 1.1785 -0.1248 0.1145  -0.1443 144 TYR A C   
1155 O  O   . TYR A 144 ? 1.1226 0.9327 1.2031 -0.1302 0.1074  -0.1493 144 TYR A O   
1156 C  CB  . TYR A 144 ? 1.0398 0.7511 1.0898 -0.1180 0.1380  -0.1157 144 TYR A CB  
1157 C  CG  . TYR A 144 ? 1.0952 0.8130 1.1230 -0.1165 0.1354  -0.1131 144 TYR A CG  
1158 C  CD1 . TYR A 144 ? 1.0799 0.8024 1.1097 -0.1236 0.1442  -0.1027 144 TYR A CD1 
1159 C  CD2 . TYR A 144 ? 1.1811 0.9007 1.1876 -0.1083 0.1237  -0.1213 144 TYR A CD2 
1160 C  CE1 . TYR A 144 ? 1.1473 0.8729 1.1567 -0.1232 0.1416  -0.1011 144 TYR A CE1 
1161 C  CE2 . TYR A 144 ? 1.2528 0.9785 1.2397 -0.1090 0.1206  -0.1192 144 TYR A CE2 
1162 C  CZ  . TYR A 144 ? 1.2334 0.9606 1.2210 -0.1169 0.1296  -0.1095 144 TYR A CZ  
1163 O  OH  . TYR A 144 ? 1.3226 1.0527 1.2903 -0.1184 0.1264  -0.1081 144 TYR A OH  
1164 N  N   . TYR A 145 ? 1.1211 0.8832 1.1981 -0.1157 0.1095  -0.1539 145 TYR A N   
1165 C  CA  . TYR A 145 ? 1.1907 0.9778 1.2689 -0.1103 0.0959  -0.1719 145 TYR A CA  
1166 C  C   . TYR A 145 ? 1.2046 1.0372 1.3036 -0.1231 0.0906  -0.1819 145 TYR A C   
1167 O  O   . TYR A 145 ? 1.2757 1.1404 1.3713 -0.1250 0.0829  -0.1888 145 TYR A O   
1168 C  CB  . TYR A 145 ? 0.9790 0.7450 1.0611 -0.1002 0.0923  -0.1818 145 TYR A CB  
1169 C  CG  . TYR A 145 ? 1.1257 0.9207 1.2149 -0.0945 0.0798  -0.2025 145 TYR A CG  
1170 C  CD1 . TYR A 145 ? 1.2060 1.0115 1.2806 -0.0843 0.0714  -0.2069 145 TYR A CD1 
1171 C  CD2 . TYR A 145 ? 1.2103 1.0235 1.3211 -0.0997 0.0766  -0.2181 145 TYR A CD2 
1172 C  CE1 . TYR A 145 ? 1.3642 1.1990 1.4476 -0.0784 0.0613  -0.2258 145 TYR A CE1 
1173 C  CE2 . TYR A 145 ? 1.3663 1.2067 1.4832 -0.0938 0.0669  -0.2381 145 TYR A CE2 
1174 C  CZ  . TYR A 145 ? 1.4419 1.2938 1.5462 -0.0826 0.0598  -0.2416 145 TYR A CZ  
1175 O  OH  . TYR A 145 ? 1.6200 1.5018 1.7325 -0.0757 0.0512  -0.2616 145 TYR A OH  
1176 N  N   . ASN A 146 ? 0.9177 0.7528 1.0375 -0.1329 0.0949  -0.1815 146 ASN A N   
1177 C  CA  . ASN A 146 ? 0.9651 0.8402 1.1045 -0.1455 0.0892  -0.1919 146 ASN A CA  
1178 C  C   . ASN A 146 ? 0.9729 0.8808 1.1112 -0.1549 0.0868  -0.1863 146 ASN A C   
1179 O  O   . ASN A 146 ? 1.0759 1.0220 1.2204 -0.1615 0.0786  -0.1982 146 ASN A O   
1180 C  CB  . ASN A 146 ? 1.0988 0.9671 1.2591 -0.1558 0.0948  -0.1876 146 ASN A CB  
1181 C  CG  . ASN A 146 ? 1.1358 0.9795 1.3014 -0.1502 0.0943  -0.1980 146 ASN A CG  
1182 O  OD1 . ASN A 146 ? 1.1755 1.0231 1.3600 -0.1600 0.0943  -0.2028 146 ASN A OD1 
1183 N  ND2 . ASN A 146 ? 1.1491 0.9666 1.2983 -0.1346 0.0929  -0.2015 146 ASN A ND2 
1184 N  N   . ARG A 147 ? 0.9397 0.8323 1.0696 -0.1558 0.0946  -0.1683 147 ARG A N   
1185 C  CA  . ARG A 147 ? 0.9427 0.8614 1.0720 -0.1651 0.0931  -0.1604 147 ARG A CA  
1186 C  C   . ARG A 147 ? 0.9785 0.8996 1.0848 -0.1589 0.0885  -0.1613 147 ARG A C   
1187 O  O   . ARG A 147 ? 0.9922 0.9247 1.0930 -0.1651 0.0884  -0.1527 147 ARG A O   
1188 C  CB  . ARG A 147 ? 1.0091 0.9127 1.1461 -0.1703 0.1042  -0.1412 147 ARG A CB  
1189 C  CG  . ARG A 147 ? 1.0635 0.9657 1.2249 -0.1771 0.1084  -0.1391 147 ARG A CG  
1190 C  CD  . ARG A 147 ? 1.0254 0.9339 1.2021 -0.1858 0.1152  -0.1222 147 ARG A CD  
1191 N  NE  . ARG A 147 ? 1.0954 1.0415 1.2949 -0.1996 0.1073  -0.1251 147 ARG A NE  
1192 C  CZ  . ARG A 147 ? 1.1683 1.1437 1.3717 -0.2082 0.1018  -0.1196 147 ARG A CZ  
1193 N  NH1 . ARG A 147 ? 1.1673 1.1368 1.3546 -0.2043 0.1038  -0.1116 147 ARG A NH1 
1194 N  NH2 . ARG A 147 ? 1.1645 1.1740 1.3868 -0.2213 0.0937  -0.1217 147 ARG A NH2 
1195 N  N   . THR A 148 ? 1.4100 1.3215 1.5046 -0.1470 0.0837  -0.1723 148 THR A N   
1196 C  CA  . THR A 148 ? 1.4585 1.3637 1.5304 -0.1389 0.0796  -0.1721 148 THR A CA  
1197 C  C   . THR A 148 ? 1.5803 1.4965 1.6501 -0.1286 0.0698  -0.1890 148 THR A C   
1198 O  O   . THR A 148 ? 1.5881 1.4922 1.6399 -0.1185 0.0659  -0.1891 148 THR A O   
1199 C  CB  . THR A 148 ? 1.2909 1.1492 1.3441 -0.1298 0.0886  -0.1592 148 THR A CB  
1200 O  OG1 . THR A 148 ? 1.1919 1.0369 1.2511 -0.1372 0.1002  -0.1443 148 THR A OG1 
1201 C  CG2 . THR A 148 ? 1.3584 1.2106 1.3867 -0.1246 0.0845  -0.1568 148 THR A CG2 
1202 N  N   . MET A 149 ? 1.5302 1.4690 1.6184 -0.1306 0.0658  -0.2037 149 MET A N   
1203 C  CA  . MET A 149 ? 1.6843 1.6351 1.7736 -0.1194 0.0574  -0.2214 149 MET A CA  
1204 C  C   . MET A 149 ? 1.7579 1.7395 1.8384 -0.1195 0.0495  -0.2253 149 MET A C   
1205 O  O   . MET A 149 ? 1.6997 1.6934 1.7735 -0.1301 0.0501  -0.2154 149 MET A O   
1206 C  CB  . MET A 149 ? 1.2897 1.2679 1.3995 -0.1242 0.0546  -0.2387 149 MET A CB  
1207 C  CG  . MET A 149 ? 1.2500 1.2082 1.3729 -0.1286 0.0604  -0.2379 149 MET A CG  
1208 S  SD  . MET A 149 ? 1.4066 1.4126 1.5484 -0.1424 0.0558  -0.2559 149 MET A SD  
1209 C  CE  . MET A 149 ? 1.5139 1.5569 1.6509 -0.1339 0.0471  -0.2739 149 MET A CE  
1210 N  N   . SER A 150 ? 1.4020 1.3979 1.4844 -0.1083 0.0419  -0.2402 150 SER A N   
1211 C  CA  . SER A 150 ? 1.4595 1.4900 1.5372 -0.1091 0.0340  -0.2451 150 SER A CA  
1212 C  C   . SER A 150 ? 1.3602 1.4361 1.4489 -0.1262 0.0334  -0.2498 150 SER A C   
1213 O  O   . SER A 150 ? 1.3406 1.4489 1.4263 -0.1320 0.0282  -0.2515 150 SER A O   
1214 C  CB  . SER A 150 ? 1.5855 1.6273 1.6688 -0.0928 0.0263  -0.2612 150 SER A CB  
1215 O  OG  . SER A 150 ? 1.6888 1.6927 1.7579 -0.0774 0.0239  -0.2540 150 SER A OG  
1216 N  N   . GLY A 151 ? 1.2217 1.3005 1.3226 -0.1354 0.0382  -0.2512 151 GLY A N   
1217 C  CA  . GLY A 151 ? 1.1628 1.2855 1.2730 -0.1517 0.0367  -0.2560 151 GLY A CA  
1218 C  C   . GLY A 151 ? 1.0495 1.1728 1.1572 -0.1679 0.0401  -0.2380 151 GLY A C   
1219 O  O   . GLY A 151 ? 1.0198 1.1803 1.1300 -0.1819 0.0370  -0.2379 151 GLY A O   
1220 N  N   . TYR A 152 ? 1.2448 1.3273 1.3476 -0.1658 0.0466  -0.2223 152 TYR A N   
1221 C  CA  . TYR A 152 ? 1.1653 1.2427 1.2727 -0.1787 0.0518  -0.2059 152 TYR A CA  
1222 C  C   . TYR A 152 ? 1.1083 1.1920 1.2049 -0.1872 0.0511  -0.1918 152 TYR A C   
1223 O  O   . TYR A 152 ? 1.0991 1.1505 1.1860 -0.1843 0.0569  -0.1775 152 TYR A O   
1224 C  CB  . TYR A 152 ? 1.3278 1.3591 1.4356 -0.1717 0.0607  -0.1952 152 TYR A CB  
1225 C  CG  . TYR A 152 ? 1.2928 1.3248 1.4178 -0.1826 0.0655  -0.1869 152 TYR A CG  
1226 C  CD1 . TYR A 152 ? 1.3463 1.3664 1.4848 -0.1809 0.0682  -0.1931 152 TYR A CD1 
1227 C  CD2 . TYR A 152 ? 1.2264 1.2710 1.3553 -0.1948 0.0667  -0.1727 152 TYR A CD2 
1228 C  CE1 . TYR A 152 ? 1.3257 1.3493 1.4816 -0.1918 0.0714  -0.1854 152 TYR A CE1 
1229 C  CE2 . TYR A 152 ? 1.2097 1.2576 1.3567 -0.2041 0.0698  -0.1643 152 TYR A CE2 
1230 C  CZ  . TYR A 152 ? 1.2544 1.2933 1.4152 -0.2029 0.0719  -0.1707 152 TYR A CZ  
1231 O  OH  . TYR A 152 ? 1.2468 1.2919 1.4272 -0.2133 0.0739  -0.1621 152 TYR A OH  
1232 N  N   . TYR A 153 ? 1.1714 1.2957 1.2692 -0.1984 0.0447  -0.1957 153 TYR A N   
1233 C  CA  . TYR A 153 ? 1.1478 1.2776 1.2350 -0.2073 0.0429  -0.1830 153 TYR A CA  
1234 C  C   . TYR A 153 ? 1.0983 1.2233 1.1929 -0.2191 0.0470  -0.1656 153 TYR A C   
1235 O  O   . TYR A 153 ? 1.0717 1.2279 1.1717 -0.2334 0.0427  -0.1615 153 TYR A O   
1236 C  CB  . TYR A 153 ? 0.9426 1.1177 1.0281 -0.2149 0.0346  -0.1933 153 TYR A CB  
1237 C  CG  . TYR A 153 ? 0.9515 1.1382 1.0275 -0.2275 0.0314  -0.1813 153 TYR A CG  
1238 C  CD1 . TYR A 153 ? 0.9842 1.1520 1.0436 -0.2230 0.0300  -0.1768 153 TYR A CD1 
1239 C  CD2 . TYR A 153 ? 0.9531 1.1695 1.0356 -0.2447 0.0290  -0.1745 153 TYR A CD2 
1240 C  CE1 . TYR A 153 ? 1.0169 1.1928 1.0674 -0.2357 0.0267  -0.1665 153 TYR A CE1 
1241 C  CE2 . TYR A 153 ? 0.9899 1.2143 1.0639 -0.2567 0.0259  -0.1629 153 TYR A CE2 
1242 C  CZ  . TYR A 153 ? 1.0213 1.2248 1.0798 -0.2523 0.0250  -0.1594 153 TYR A CZ  
1243 O  OH  . TYR A 153 ? 1.0700 1.2795 1.1200 -0.2655 0.0215  -0.1483 153 TYR A OH  
1244 N  N   . ASP A 154 ? 1.0697 1.1560 1.1653 -0.2124 0.0555  -0.1549 154 ASP A N   
1245 C  CA  . ASP A 154 ? 1.0374 1.1151 1.1430 -0.2201 0.0606  -0.1377 154 ASP A CA  
1246 C  C   . ASP A 154 ? 1.0342 1.0678 1.1265 -0.2116 0.0695  -0.1251 154 ASP A C   
1247 O  O   . ASP A 154 ? 1.0086 1.0167 1.0846 -0.2000 0.0719  -0.1298 154 ASP A O   
1248 C  CB  . ASP A 154 ? 0.8156 0.9003 0.9433 -0.2231 0.0625  -0.1393 154 ASP A CB  
1249 C  CG  . ASP A 154 ? 0.8232 0.8886 0.9649 -0.2257 0.0705  -0.1206 154 ASP A CG  
1250 O  OD1 . ASP A 154 ? 0.8179 0.9001 0.9689 -0.2366 0.0680  -0.1082 154 ASP A OD1 
1251 O  OD2 . ASP A 154 ? 0.8499 0.8847 0.9958 -0.2167 0.0793  -0.1183 154 ASP A OD2 
1252 N  N   . THR A 155 ? 1.4886 1.5149 1.5871 -0.2177 0.0740  -0.1090 155 THR A N   
1253 C  CA  . THR A 155 ? 1.3723 1.3600 1.4593 -0.2116 0.0835  -0.0964 155 THR A CA  
1254 C  C   . THR A 155 ? 1.2497 1.1989 1.3293 -0.1976 0.0939  -0.0975 155 THR A C   
1255 O  O   . THR A 155 ? 1.1696 1.0851 1.2366 -0.1916 0.1033  -0.0888 155 THR A O   
1256 C  CB  . THR A 155 ? 1.1931 1.1815 1.2989 -0.2183 0.0883  -0.0798 155 THR A CB  
1257 O  OG1 . THR A 155 ? 1.2725 1.2544 1.3672 -0.2231 0.0874  -0.0702 155 THR A OG1 
1258 C  CG2 . THR A 155 ? 1.0777 1.0339 1.1932 -0.2090 0.1022  -0.0716 155 THR A CG2 
1259 N  N   . ASP A 156 ? 1.1539 1.1070 1.2405 -0.1927 0.0927  -0.1083 156 ASP A N   
1260 C  CA  . ASP A 156 ? 1.0494 0.9668 1.1335 -0.1814 0.1032  -0.1067 156 ASP A CA  
1261 C  C   . ASP A 156 ? 1.0028 0.8914 1.0588 -0.1696 0.1041  -0.1115 156 ASP A C   
1262 O  O   . ASP A 156 ? 0.9348 0.7906 0.9838 -0.1605 0.1132  -0.1083 156 ASP A O   
1263 C  CB  . ASP A 156 ? 1.3175 1.2465 1.4216 -0.1817 0.1016  -0.1151 156 ASP A CB  
1264 C  CG  . ASP A 156 ? 1.3549 1.2898 1.4853 -0.1890 0.1074  -0.1048 156 ASP A CG  
1265 O  OD1 . ASP A 156 ? 1.3878 1.3404 1.5277 -0.1979 0.1058  -0.0952 156 ASP A OD1 
1266 O  OD2 . ASP A 156 ? 1.3693 1.2909 1.5117 -0.1862 0.1130  -0.1054 156 ASP A OD2 
1267 N  N   . MET A 157 ? 1.4164 1.3179 1.4561 -0.1705 0.0945  -0.1183 157 MET A N   
1268 C  CA  . MET A 157 ? 1.4161 1.2958 1.4313 -0.1595 0.0922  -0.1241 157 MET A CA  
1269 C  C   . MET A 157 ? 1.3353 1.1723 1.3254 -0.1534 0.1019  -0.1140 157 MET A C   
1270 O  O   . MET A 157 ? 1.3387 1.1511 1.3083 -0.1433 0.1021  -0.1165 157 MET A O   
1271 C  CB  . MET A 157 ? 1.0288 0.9385 1.0365 -0.1621 0.0782  -0.1353 157 MET A CB  
1272 C  CG  . MET A 157 ? 1.0878 1.0280 1.0997 -0.1761 0.0723  -0.1328 157 MET A CG  
1273 S  SD  . MET A 157 ? 1.2566 1.2308 1.2608 -0.1769 0.0573  -0.1474 157 MET A SD  
1274 C  CE  . MET A 157 ? 1.3245 1.3510 1.3554 -0.1900 0.0519  -0.1537 157 MET A CE  
1275 N  N   . LEU A 158 ? 1.3796 1.2077 1.3704 -0.1593 0.1098  -0.1026 158 LEU A N   
1276 C  CA  . LEU A 158 ? 1.3222 1.1091 1.2891 -0.1539 0.1212  -0.0938 158 LEU A CA  
1277 C  C   . LEU A 158 ? 1.2526 1.0224 1.2351 -0.1534 0.1374  -0.0816 158 LEU A C   
1278 O  O   . LEU A 158 ? 1.2209 0.9599 1.1877 -0.1501 0.1491  -0.0739 158 LEU A O   
1279 C  CB  . LEU A 158 ? 0.8283 0.6151 0.7772 -0.1604 0.1165  -0.0923 158 LEU A CB  
1280 C  CG  . LEU A 158 ? 0.9301 0.7346 0.8626 -0.1636 0.1009  -0.1020 158 LEU A CG  
1281 C  CD1 . LEU A 158 ? 0.9716 0.7765 0.8936 -0.1737 0.0982  -0.0977 158 LEU A CD1 
1282 C  CD2 . LEU A 158 ? 0.9583 0.7373 0.8632 -0.1528 0.0993  -0.1069 158 LEU A CD2 
1283 N  N   . VAL A 159 ? 1.2668 1.0577 1.2805 -0.1571 0.1381  -0.0805 159 VAL A N   
1284 C  CA  . VAL A 159 ? 1.2327 1.0168 1.2686 -0.1583 0.1514  -0.0685 159 VAL A CA  
1285 C  C   . VAL A 159 ? 1.1720 0.9176 1.1973 -0.1484 0.1674  -0.0631 159 VAL A C   
1286 O  O   . VAL A 159 ? 1.1480 0.8778 1.1817 -0.1469 0.1823  -0.0521 159 VAL A O   
1287 C  CB  . VAL A 159 ? 1.0257 0.8427 1.0962 -0.1653 0.1462  -0.0698 159 VAL A CB  
1288 C  CG1 . VAL A 159 ? 1.0101 0.8192 1.1055 -0.1654 0.1600  -0.0576 159 VAL A CG1 
1289 C  CG2 . VAL A 159 ? 1.1079 0.9629 1.1891 -0.1765 0.1329  -0.0719 159 VAL A CG2 
1290 N  N   . LEU A 160 ? 1.3575 1.0884 1.3646 -0.1415 0.1646  -0.0704 160 LEU A N   
1291 C  CA  . LEU A 160 ? 1.3210 1.0134 1.3121 -0.1326 0.1790  -0.0650 160 LEU A CA  
1292 C  C   . LEU A 160 ? 1.3322 0.9929 1.2804 -0.1253 0.1800  -0.0665 160 LEU A C   
1293 O  O   . LEU A 160 ? 1.3197 0.9459 1.2494 -0.1189 0.1941  -0.0601 160 LEU A O   
1294 C  CB  . LEU A 160 ? 1.1996 0.8923 1.2033 -0.1301 0.1773  -0.0689 160 LEU A CB  
1295 C  CG  . LEU A 160 ? 1.1945 0.8989 1.2346 -0.1358 0.1860  -0.0618 160 LEU A CG  
1296 C  CD1 . LEU A 160 ? 1.1900 0.8744 1.2335 -0.1319 0.1927  -0.0607 160 LEU A CD1 
1297 C  CD2 . LEU A 160 ? 1.1786 0.8706 1.2220 -0.1359 0.2018  -0.0493 160 LEU A CD2 
1298 N  N   . VAL A 161 ? 1.3920 1.0658 1.3243 -0.1273 0.1651  -0.0746 161 VAL A N   
1299 C  CA  . VAL A 161 ? 1.4346 1.0830 1.3267 -0.1226 0.1630  -0.0767 161 VAL A CA  
1300 C  C   . VAL A 161 ? 1.4225 1.0485 1.3000 -0.1243 0.1758  -0.0694 161 VAL A C   
1301 O  O   . VAL A 161 ? 1.4397 1.0298 1.2866 -0.1185 0.1862  -0.0662 161 VAL A O   
1302 C  CB  . VAL A 161 ? 1.4397 1.1145 1.3244 -0.1261 0.1425  -0.0875 161 VAL A CB  
1303 C  CG1 . VAL A 161 ? 1.4812 1.1503 1.3447 -0.1316 0.1402  -0.0870 161 VAL A CG1 
1304 C  CG2 . VAL A 161 ? 1.5033 1.1702 1.3696 -0.1174 0.1328  -0.0941 161 VAL A CG2 
1305 N  N   . LEU A 162 ? 1.6640 1.3105 1.5632 -0.1321 0.1753  -0.0667 162 LEU A N   
1306 C  CA  . LEU A 162 ? 1.6716 1.2983 1.5594 -0.1336 0.1856  -0.0609 162 LEU A CA  
1307 C  C   . LEU A 162 ? 1.6383 1.2338 1.5264 -0.1268 0.2093  -0.0513 162 LEU A C   
1308 O  O   . LEU A 162 ? 1.6825 1.2435 1.5389 -0.1224 0.2199  -0.0505 162 LEU A O   
1309 C  CB  . LEU A 162 ? 1.0152 0.6722 0.9272 -0.1437 0.1774  -0.0593 162 LEU A CB  
1310 C  CG  . LEU A 162 ? 1.0795 0.7551 0.9777 -0.1516 0.1586  -0.0674 162 LEU A CG  
1311 C  CD1 . LEU A 162 ? 1.1053 0.8232 1.0360 -0.1616 0.1480  -0.0665 162 LEU A CD1 
1312 C  CD2 . LEU A 162 ? 1.1239 0.7731 0.9936 -0.1540 0.1612  -0.0666 162 LEU A CD2 
1313 N  N   . PRO A 163 ? 1.7156 1.3236 1.6388 -0.1263 0.2180  -0.0445 163 PRO A N   
1314 C  CA  . PRO A 163 ? 1.7290 1.3105 1.6547 -0.1201 0.2414  -0.0352 163 PRO A CA  
1315 C  C   . PRO A 163 ? 1.7585 1.3077 1.6527 -0.1126 0.2504  -0.0359 163 PRO A C   
1316 O  O   . PRO A 163 ? 1.8044 1.3219 1.6786 -0.1069 0.2689  -0.0314 163 PRO A O   
1317 C  CB  . PRO A 163 ? 1.6361 1.2448 1.6093 -0.1232 0.2448  -0.0283 163 PRO A CB  
1318 C  CG  . PRO A 163 ? 1.6231 1.2681 1.6127 -0.1304 0.2232  -0.0357 163 PRO A CG  
1319 C  CD  . PRO A 163 ? 1.6362 1.2770 1.5918 -0.1302 0.2084  -0.0463 163 PRO A CD  
1320 N  N   . MET A 164 ? 1.5452 1.1023 1.4347 -0.1123 0.2374  -0.0415 164 MET A N   
1321 C  CA  . MET A 164 ? 1.5909 1.1175 1.4471 -0.1054 0.2417  -0.0417 164 MET A CA  
1322 C  C   . MET A 164 ? 1.6614 1.1606 1.4693 -0.1026 0.2398  -0.0459 164 MET A C   
1323 O  O   . MET A 164 ? 1.7274 1.1943 1.5024 -0.0969 0.2487  -0.0434 164 MET A O   
1324 C  CB  . MET A 164 ? 1.4655 1.0076 1.3292 -0.1050 0.2256  -0.0473 164 MET A CB  
1325 C  CG  . MET A 164 ? 1.4375 0.9902 1.3369 -0.1063 0.2321  -0.0424 164 MET A CG  
1326 S  SD  . MET A 164 ? 1.4769 0.9884 1.3592 -0.1002 0.2554  -0.0312 164 MET A SD  
1327 C  CE  . MET A 164 ? 1.5217 1.0055 1.3529 -0.0929 0.2440  -0.0361 164 MET A CE  
1328 N  N   . LEU A 165 ? 1.5716 1.0836 1.3738 -0.1077 0.2274  -0.0521 165 LEU A N   
1329 C  CA  . LEU A 165 ? 1.6558 1.1411 1.4134 -0.1070 0.2264  -0.0562 165 LEU A CA  
1330 C  C   . LEU A 165 ? 1.6854 1.1436 1.4349 -0.1049 0.2488  -0.0508 165 LEU A C   
1331 O  O   . LEU A 165 ? 1.7731 1.1952 1.4838 -0.1003 0.2604  -0.0506 165 LEU A O   
1332 C  CB  . LEU A 165 ? 1.1429 0.6507 0.8981 -0.1146 0.2058  -0.0645 165 LEU A CB  
1333 C  CG  . LEU A 165 ? 1.1993 0.7205 0.9396 -0.1145 0.1843  -0.0724 165 LEU A CG  
1334 C  CD1 . LEU A 165 ? 1.2579 0.8015 0.9947 -0.1232 0.1657  -0.0801 165 LEU A CD1 
1335 C  CD2 . LEU A 165 ? 1.2918 0.7765 0.9881 -0.1074 0.1879  -0.0719 165 LEU A CD2 
1336 N  N   . ILE A 166 ? 1.5577 1.0338 1.3443 -0.1079 0.2549  -0.0464 166 ILE A N   
1337 C  CA  . ILE A 166 ? 1.5911 1.0455 1.3792 -0.1045 0.2769  -0.0409 166 ILE A CA  
1338 C  C   . ILE A 166 ? 1.6382 1.0636 1.4132 -0.0964 0.3005  -0.0349 166 ILE A C   
1339 O  O   . ILE A 166 ? 1.7263 1.1198 1.4756 -0.0919 0.3183  -0.0348 166 ILE A O   
1340 C  CB  . ILE A 166 ? 1.0492 0.5329 0.8882 -0.1077 0.2789  -0.0343 166 ILE A CB  
1341 C  CG1 . ILE A 166 ? 1.0520 0.5550 0.8961 -0.1161 0.2605  -0.0387 166 ILE A CG1 
1342 C  CG2 . ILE A 166 ? 1.0898 0.5540 0.9392 -0.1012 0.3044  -0.0267 166 ILE A CG2 
1343 C  CD1 . ILE A 166 ? 1.0228 0.5542 0.9136 -0.1199 0.2600  -0.0309 166 ILE A CD1 
1344 N  N   . LEU A 167 ? 1.3207 0.7564 1.1121 -0.0950 0.3010  -0.0305 167 LEU A N   
1345 C  CA  . LEU A 167 ? 1.3752 0.7875 1.1586 -0.0892 0.3229  -0.0232 167 LEU A CA  
1346 C  C   . LEU A 167 ? 1.4729 0.8484 1.1992 -0.0853 0.3254  -0.0262 167 LEU A C   
1347 O  O   . LEU A 167 ? 1.5650 0.9106 1.2684 -0.0806 0.3477  -0.0219 167 LEU A O   
1348 C  CB  . LEU A 167 ? 1.3371 0.7715 1.1571 -0.0908 0.3208  -0.0174 167 LEU A CB  
1349 C  CG  . LEU A 167 ? 1.3981 0.8110 1.2104 -0.0870 0.3390  -0.0091 167 LEU A CG  
1350 C  CD1 . LEU A 167 ? 1.4122 0.8334 1.2645 -0.0867 0.3615  0.0011  167 LEU A CD1 
1351 C  CD2 . LEU A 167 ? 1.3673 0.7882 1.1826 -0.0886 0.3232  -0.0100 167 LEU A CD2 
1352 N  N   . LEU A 168 ? 1.8584 1.2371 1.5617 -0.0872 0.3027  -0.0331 168 LEU A N   
1353 C  CA  . LEU A 168 ? 1.9736 1.3191 1.6214 -0.0842 0.3018  -0.0356 168 LEU A CA  
1354 C  C   . LEU A 168 ? 2.0642 1.3862 1.6803 -0.0845 0.3103  -0.0408 168 LEU A C   
1355 O  O   . LEU A 168 ? 2.1907 1.4780 1.7626 -0.0814 0.3224  -0.0408 168 LEU A O   
1356 C  CB  . LEU A 168 ? 1.3071 0.6648 0.9403 -0.0859 0.2739  -0.0423 168 LEU A CB  
1357 C  CG  . LEU A 168 ? 1.4475 0.7767 1.0239 -0.0855 0.2683  -0.0478 168 LEU A CG  
1358 C  CD1 . LEU A 168 ? 1.5313 0.8515 1.0795 -0.0819 0.2539  -0.0467 168 LEU A CD1 
1359 C  CD2 . LEU A 168 ? 1.4382 0.7824 1.0140 -0.0921 0.2527  -0.0575 168 LEU A CD2 
1360 N  N   . THR A 169 ? 1.4795 0.8196 1.1166 -0.0890 0.3030  -0.0456 169 THR A N   
1361 C  CA  . THR A 169 ? 1.5653 0.8816 1.1784 -0.0895 0.3128  -0.0506 169 THR A CA  
1362 C  C   . THR A 169 ? 1.6317 0.9218 1.2422 -0.0826 0.3451  -0.0447 169 THR A C   
1363 O  O   . THR A 169 ? 1.7739 1.0271 1.3379 -0.0796 0.3585  -0.0482 169 THR A O   
1364 C  CB  . THR A 169 ? 1.3579 0.6996 1.0030 -0.0956 0.3014  -0.0537 169 THR A CB  
1365 O  OG1 . THR A 169 ? 1.4156 0.7597 1.0346 -0.1026 0.2785  -0.0630 169 THR A OG1 
1366 C  CG2 . THR A 169 ? 1.3928 0.7168 1.0451 -0.0926 0.3225  -0.0522 169 THR A CG2 
1367 N  N   . PHE A 170 ? 1.5121 0.8229 1.1724 -0.0803 0.3572  -0.0362 170 PHE A N   
1368 C  CA  . PHE A 170 ? 1.5801 0.8740 1.2483 -0.0735 0.3883  -0.0294 170 PHE A CA  
1369 C  C   . PHE A 170 ? 1.7013 0.9630 1.3241 -0.0698 0.4024  -0.0277 170 PHE A C   
1370 O  O   . PHE A 170 ? 1.8380 1.0671 1.4262 -0.0656 0.4223  -0.0306 170 PHE A O   
1371 C  CB  . PHE A 170 ? 1.6782 1.0037 1.4063 -0.0729 0.3954  -0.0188 170 PHE A CB  
1372 C  CG  . PHE A 170 ? 1.6179 0.9706 1.3933 -0.0745 0.3913  -0.0172 170 PHE A CG  
1373 C  CD1 . PHE A 170 ? 1.6074 0.9580 1.3724 -0.0775 0.3784  -0.0247 170 PHE A CD1 
1374 C  CD2 . PHE A 170 ? 1.5881 0.9686 1.4185 -0.0739 0.3996  -0.0072 170 PHE A CD2 
1375 C  CE1 . PHE A 170 ? 1.5678 0.9421 1.3755 -0.0793 0.3742  -0.0213 170 PHE A CE1 
1376 C  CE2 . PHE A 170 ? 1.5532 0.9593 1.4269 -0.0753 0.3947  -0.0040 170 PHE A CE2 
1377 C  CZ  . PHE A 170 ? 1.5428 0.9451 1.4047 -0.0777 0.3821  -0.0106 170 PHE A CZ  
1378 N  N   . ILE A 171 ? 1.5021 0.7720 1.1241 -0.0714 0.3920  -0.0231 171 ILE A N   
1379 C  CA  . ILE A 171 ? 1.6237 0.8643 1.2052 -0.0685 0.4044  -0.0185 171 ILE A CA  
1380 C  C   . ILE A 171 ? 1.7733 0.9787 1.2879 -0.0683 0.4013  -0.0268 171 ILE A C   
1381 O  O   . ILE A 171 ? 1.9263 1.0999 1.4041 -0.0650 0.4235  -0.0255 171 ILE A O   
1382 C  CB  . ILE A 171 ? 1.5649 0.8200 1.1604 -0.0703 0.3909  -0.0115 171 ILE A CB  
1383 C  CG1 . ILE A 171 ? 1.4390 0.7302 1.1006 -0.0723 0.3918  -0.0056 171 ILE A CG1 
1384 C  CG2 . ILE A 171 ? 1.6995 0.9244 1.2590 -0.0678 0.4066  -0.0032 171 ILE A CG2 
1385 C  CD1 . ILE A 171 ? 1.3924 0.6930 1.0723 -0.0740 0.3868  0.0021  171 ILE A CD1 
1386 N  N   . ARG A 172 ? 1.6932 0.9052 1.1921 -0.0726 0.3745  -0.0357 172 ARG A N   
1387 C  CA  . ARG A 172 ? 1.8533 1.0349 1.2903 -0.0740 0.3681  -0.0440 172 ARG A CA  
1388 C  C   . ARG A 172 ? 1.9714 1.1263 1.3889 -0.0720 0.3912  -0.0499 172 ARG A C   
1389 O  O   . ARG A 172 ? 2.1527 1.2719 1.5156 -0.0709 0.4026  -0.0535 172 ARG A O   
1390 C  CB  . ARG A 172 ? 2.2175 1.4160 1.6480 -0.0800 0.3350  -0.0526 172 ARG A CB  
1391 C  CG  . ARG A 172 ? 2.3551 1.5272 1.7221 -0.0818 0.3226  -0.0578 172 ARG A CG  
1392 C  CD  . ARG A 172 ? 2.3495 1.5455 1.7179 -0.0867 0.2886  -0.0632 172 ARG A CD  
1393 N  NE  . ARG A 172 ? 2.3811 1.5642 1.7139 -0.0931 0.2776  -0.0746 172 ARG A NE  
1394 C  CZ  . ARG A 172 ? 2.3091 1.4862 1.6482 -0.0967 0.2866  -0.0815 172 ARG A CZ  
1395 N  NH1 . ARG A 172 ? 2.2015 1.3864 1.5821 -0.0932 0.3062  -0.0773 172 ARG A NH1 
1396 N  NH2 . ARG A 172 ? 2.3777 1.5408 1.6828 -0.1039 0.2753  -0.0924 172 ARG A NH2 
1397 N  N   . LEU A 173 ? 1.6646 0.8358 1.1262 -0.0712 0.3989  -0.0507 173 LEU A N   
1398 C  CA  . LEU A 173 ? 1.7847 0.9296 1.2341 -0.0668 0.4247  -0.0554 173 LEU A CA  
1399 C  C   . LEU A 173 ? 1.8946 1.0191 1.3321 -0.0600 0.4567  -0.0485 173 LEU A C   
1400 O  O   . LEU A 173 ? 2.0778 1.1667 1.4671 -0.0577 0.4734  -0.0546 173 LEU A O   
1401 C  CB  . LEU A 173 ? 1.8074 0.9734 1.3105 -0.0655 0.4283  -0.0551 173 LEU A CB  
1402 C  CG  . LEU A 173 ? 1.9524 1.0874 1.4402 -0.0597 0.4538  -0.0615 173 LEU A CG  
1403 C  CD1 . LEU A 173 ? 2.0748 1.1802 1.5076 -0.0650 0.4416  -0.0755 173 LEU A CD1 
1404 C  CD2 . LEU A 173 ? 1.8659 1.0216 1.4120 -0.0561 0.4605  -0.0578 173 LEU A CD2 
1405 N  N   . THR A 174 ? 1.8544 1.0017 1.3351 -0.0577 0.4655  -0.0362 174 THR A N   
1406 C  CA  . THR A 174 ? 1.9670 1.0981 1.4398 -0.0526 0.4968  -0.0281 174 THR A CA  
1407 C  C   . THR A 174 ? 2.1522 1.2466 1.5542 -0.0534 0.5011  -0.0300 174 THR A C   
1408 O  O   . THR A 174 ? 2.3365 1.4021 1.7057 -0.0494 0.5287  -0.0316 174 THR A O   
1409 C  CB  . THR A 174 ? 1.8324 0.9906 1.3505 -0.0533 0.4990  -0.0138 174 THR A CB  
1410 O  OG1 . THR A 174 ? 1.6490 0.8464 1.2249 -0.0562 0.4798  -0.0122 174 THR A OG1 
1411 C  CG2 . THR A 174 ? 1.9326 1.0859 1.4687 -0.0479 0.5356  -0.0054 174 THR A CG2 
1412 N  N   . ILE A 175 ? 2.0902 1.1865 1.4687 -0.0584 0.4741  -0.0294 175 ILE A N   
1413 C  CA  . ILE A 175 ? 2.2745 1.3396 1.5896 -0.0594 0.4755  -0.0276 175 ILE A CA  
1414 C  C   . ILE A 175 ? 2.4540 1.4880 1.7064 -0.0616 0.4697  -0.0412 175 ILE A C   
1415 O  O   . ILE A 175 ? 2.6651 1.6661 1.8720 -0.0597 0.4930  -0.0442 175 ILE A O   
1416 C  CB  . ILE A 175 ? 2.3398 1.4184 1.6571 -0.0624 0.4505  -0.0192 175 ILE A CB  
1417 C  CG1 . ILE A 175 ? 2.2098 1.3084 1.5773 -0.0610 0.4628  -0.0052 175 ILE A CG1 
1418 C  CG2 . ILE A 175 ? 2.5672 1.6132 1.8144 -0.0637 0.4454  -0.0179 175 ILE A CG2 
1419 C  CD1 . ILE A 175 ? 2.2133 1.3087 1.5682 -0.0624 0.4504  0.0057  175 ILE A CD1 
1420 N  N   . ASN A 176 ? 2.2521 1.2974 1.5025 -0.0664 0.4393  -0.0499 176 ASN A N   
1421 C  CA  . ASN A 176 ? 2.4368 1.4546 1.6280 -0.0707 0.4291  -0.0630 176 ASN A CA  
1422 C  C   . ASN A 176 ? 2.4779 1.4812 1.6681 -0.0701 0.4433  -0.0757 176 ASN A C   
1423 O  O   . ASN A 176 ? 2.6786 1.6508 1.8146 -0.0734 0.4433  -0.0874 176 ASN A O   
1424 C  CB  . ASN A 176 ? 3.0004 2.0365 2.1877 -0.0770 0.3902  -0.0667 176 ASN A CB  
1425 C  CG  . ASN A 176 ? 2.9464 1.9919 2.1286 -0.0763 0.3747  -0.0554 176 ASN A CG  
1426 O  OD1 . ASN A 176 ? 2.8146 1.8855 2.0149 -0.0788 0.3457  -0.0554 176 ASN A OD1 
1427 N  ND2 . ASN A 176 ? 3.0619 2.0865 2.2202 -0.0728 0.3945  -0.0453 176 ASN A ND2 
1428 N  N   . LYS A 177 ? 2.1012 1.3014 1.4115 -0.1639 0.2986  -0.2164 177 LYS A N   
1429 C  CA  . LYS A 177 ? 2.1368 1.3355 1.4850 -0.1648 0.3079  -0.2209 177 LYS A CA  
1430 C  C   . LYS A 177 ? 2.1667 1.3636 1.4994 -0.1683 0.2928  -0.2307 177 LYS A C   
1431 O  O   . LYS A 177 ? 2.2599 1.4459 1.6102 -0.1693 0.3036  -0.2387 177 LYS A O   
1432 C  CB  . LYS A 177 ? 1.9087 1.0802 1.2558 -0.1632 0.3410  -0.2293 177 LYS A CB  
1433 C  CG  . LYS A 177 ? 1.9079 1.0781 1.2708 -0.1611 0.3605  -0.2220 177 LYS A CG  
1434 C  CD  . LYS A 177 ? 2.0776 1.2265 1.4530 -0.1596 0.3932  -0.2295 177 LYS A CD  
1435 C  CE  . LYS A 177 ? 2.0838 1.2315 1.4784 -0.1587 0.4148  -0.2234 177 LYS A CE  
1436 N  NZ  . LYS A 177 ? 2.2546 1.3848 1.6663 -0.1574 0.4467  -0.2313 177 LYS A NZ  
1437 N  N   . ASP A 178 ? 3.1770 2.3849 2.4788 -0.1701 0.2680  -0.2312 178 ASP A N   
1438 C  CA  . ASP A 178 ? 3.2074 2.4161 2.4966 -0.1743 0.2529  -0.2425 178 ASP A CA  
1439 C  C   . ASP A 178 ? 3.1231 2.3534 2.4672 -0.1765 0.2437  -0.2318 178 ASP A C   
1440 O  O   . ASP A 178 ? 2.9834 2.2373 2.3615 -0.1732 0.2357  -0.2148 178 ASP A O   
1441 C  CB  . ASP A 178 ? 2.6660 1.8823 1.9069 -0.1749 0.2288  -0.2474 178 ASP A CB  
1442 C  CG  . ASP A 178 ? 2.6715 1.9218 1.9343 -0.1757 0.2040  -0.2305 178 ASP A CG  
1443 O  OD1 . ASP A 178 ? 2.7062 1.9722 2.0109 -0.1727 0.2071  -0.2141 178 ASP A OD1 
1444 O  OD2 . ASP A 178 ? 2.6501 1.9130 1.8889 -0.1781 0.1806  -0.2353 178 ASP A OD2 
1445 N  N   . ILE A 179 ? 2.9209 2.1425 2.2736 -0.1808 0.2451  -0.2424 179 ILE A N   
1446 C  CA  . ILE A 179 ? 2.8750 2.1092 2.2792 -0.1816 0.2429  -0.2320 179 ILE A CA  
1447 C  C   . ILE A 179 ? 2.7428 2.0073 2.1608 -0.1819 0.2179  -0.2176 179 ILE A C   
1448 O  O   . ILE A 179 ? 2.6683 1.9470 2.1294 -0.1778 0.2167  -0.2026 179 ILE A O   
1449 C  CB  . ILE A 179 ? 2.7248 1.9397 2.1371 -0.1867 0.2521  -0.2473 179 ILE A CB  
1450 C  CG1 . ILE A 179 ? 2.8747 2.0607 2.2689 -0.1849 0.2749  -0.2637 179 ILE A CG1 
1451 C  CG2 . ILE A 179 ? 2.6936 1.9151 2.1599 -0.1855 0.2561  -0.2343 179 ILE A CG2 
1452 C  CD1 . ILE A 179 ? 3.0448 2.2119 2.4462 -0.1890 0.2826  -0.2820 179 ILE A CD1 
1453 N  N   . PHE A 180 ? 2.4781 1.7531 1.8591 -0.1850 0.1978  -0.2220 180 PHE A N   
1454 C  CA  . PHE A 180 ? 2.3678 1.6730 1.7630 -0.1849 0.1742  -0.2085 180 PHE A CA  
1455 C  C   . PHE A 180 ? 2.2171 1.5466 1.6496 -0.1751 0.1700  -0.1858 180 PHE A C   
1456 O  O   . PHE A 180 ? 2.1387 1.4897 1.6020 -0.1713 0.1590  -0.1715 180 PHE A O   
1457 C  CB  . PHE A 180 ? 2.4877 1.8025 1.8354 -0.1885 0.1518  -0.2176 180 PHE A CB  
1458 C  CG  . PHE A 180 ? 2.6350 1.9392 1.9623 -0.1969 0.1478  -0.2390 180 PHE A CG  
1459 C  CD1 . PHE A 180 ? 2.7777 2.0522 2.0936 -0.1993 0.1663  -0.2591 180 PHE A CD1 
1460 C  CD2 . PHE A 180 ? 2.6303 1.9557 1.9530 -0.2017 0.1255  -0.2406 180 PHE A CD2 
1461 C  CE1 . PHE A 180 ? 2.9303 2.1972 2.2328 -0.2059 0.1618  -0.2818 180 PHE A CE1 
1462 C  CE2 . PHE A 180 ? 2.7799 2.0973 2.0898 -0.2096 0.1223  -0.2632 180 PHE A CE2 
1463 C  CZ  . PHE A 180 ? 2.9345 2.2228 2.2355 -0.2115 0.1402  -0.2846 180 PHE A CZ  
1464 N  N   . THR A 181 ? 2.2549 1.5808 1.6866 -0.1699 0.1799  -0.1832 181 THR A N   
1465 C  CA  . THR A 181 ? 2.1403 1.4886 1.6136 -0.1591 0.1784  -0.1663 181 THR A CA  
1466 C  C   . THR A 181 ? 2.1328 1.4865 1.6561 -0.1521 0.1857  -0.1567 181 THR A C   
1467 O  O   . THR A 181 ? 2.0409 1.4222 1.5932 -0.1420 0.1717  -0.1416 181 THR A O   
1468 C  CB  . THR A 181 ? 2.1817 1.5194 1.6552 -0.1561 0.1957  -0.1691 181 THR A CB  
1469 O  OG1 . THR A 181 ? 2.1393 1.4843 1.5796 -0.1569 0.1829  -0.1687 181 THR A OG1 
1470 C  CG2 . THR A 181 ? 2.1165 1.4725 1.6453 -0.1447 0.2008  -0.1578 181 THR A CG2 
1471 N  N   . LEU A 182 ? 1.9775 1.3046 1.5091 -0.1557 0.2073  -0.1658 182 LEU A N   
1472 C  CA  . LEU A 182 ? 1.9990 1.3249 1.5731 -0.1490 0.2161  -0.1580 182 LEU A CA  
1473 C  C   . LEU A 182 ? 1.9617 1.3054 1.5482 -0.1465 0.1992  -0.1452 182 LEU A C   
1474 O  O   . LEU A 182 ? 1.9506 1.3029 1.5733 -0.1349 0.2013  -0.1320 182 LEU A O   
1475 C  CB  . LEU A 182 ? 1.9801 1.2720 1.5523 -0.1562 0.2385  -0.1726 182 LEU A CB  
1476 C  CG  . LEU A 182 ? 2.0465 1.3169 1.6257 -0.1547 0.2631  -0.1828 182 LEU A CG  
1477 C  CD1 . LEU A 182 ? 2.1941 1.4350 1.7642 -0.1629 0.2770  -0.1980 182 LEU A CD1 
1478 C  CD2 . LEU A 182 ? 1.9616 1.2430 1.5878 -0.1408 0.2709  -0.1723 182 LEU A CD2 
1479 N  N   . LEU A 183 ? 1.8100 1.1581 1.3659 -0.1566 0.1840  -0.1498 183 LEU A N   
1480 C  CA  . LEU A 183 ? 1.7761 1.1409 1.3446 -0.1552 0.1701  -0.1376 183 LEU A CA  
1481 C  C   . LEU A 183 ? 1.6424 1.0442 1.2173 -0.1434 0.1477  -0.1209 183 LEU A C   
1482 O  O   . LEU A 183 ? 1.6068 1.0272 1.2087 -0.1318 0.1407  -0.1036 183 LEU A O   
1483 C  CB  . LEU A 183 ? 1.7575 1.1144 1.2960 -0.1707 0.1629  -0.1518 183 LEU A CB  
1484 C  CG  . LEU A 183 ? 1.8828 1.2177 1.4410 -0.1776 0.1781  -0.1567 183 LEU A CG  
1485 C  CD1 . LEU A 183 ? 1.9292 1.2717 1.4766 -0.1886 0.1653  -0.1622 183 LEU A CD1 
1486 C  CD2 . LEU A 183 ? 1.8808 1.2176 1.4827 -0.1644 0.1881  -0.1365 183 LEU A CD2 
1487 N  N   . LEU A 184 ? 1.8448 1.2559 1.3947 -0.1445 0.1375  -0.1261 184 LEU A N   
1488 C  CA  . LEU A 184 ? 1.7364 1.1830 1.2862 -0.1353 0.1129  -0.1141 184 LEU A CA  
1489 C  C   . LEU A 184 ? 1.6661 1.1344 1.2574 -0.1160 0.1117  -0.1002 184 LEU A C   
1490 O  O   . LEU A 184 ? 1.6233 1.1198 1.2349 -0.1027 0.0961  -0.0849 184 LEU A O   
1491 C  CB  . LEU A 184 ? 1.5288 0.9754 1.0353 -0.1433 0.1019  -0.1252 184 LEU A CB  
1492 C  CG  . LEU A 184 ? 1.6177 1.0490 1.0826 -0.1585 0.0978  -0.1405 184 LEU A CG  
1493 C  CD1 . LEU A 184 ? 1.5998 1.0455 1.0227 -0.1616 0.0745  -0.1455 184 LEU A CD1 
1494 C  CD2 . LEU A 184 ? 1.6241 1.0613 1.1072 -0.1610 0.0946  -0.1350 184 LEU A CD2 
1495 N  N   . SER A 185 ? 1.6533 1.1102 1.2588 -0.1128 0.1283  -0.1063 185 SER A N   
1496 C  CA  . SER A 185 ? 1.6056 1.0869 1.2536 -0.0932 0.1252  -0.0971 185 SER A CA  
1497 C  C   . SER A 185 ? 1.6138 1.1050 1.2977 -0.0764 0.1261  -0.0837 185 SER A C   
1498 O  O   . SER A 185 ? 1.5503 1.0741 1.2587 -0.0571 0.1096  -0.0718 185 SER A O   
1499 C  CB  . SER A 185 ? 1.3121 0.7799 0.9744 -0.0930 0.1451  -0.1078 185 SER A CB  
1500 O  OG  . SER A 185 ? 1.4186 0.8503 1.0717 -0.1038 0.1699  -0.1183 185 SER A OG  
1501 N  N   . PRO A 186 ? 1.6231 1.0858 1.3097 -0.0819 0.1452  -0.0857 186 PRO A N   
1502 C  CA  . PRO A 186 ? 1.6458 1.1154 1.3622 -0.0644 0.1463  -0.0710 186 PRO A CA  
1503 C  C   . PRO A 186 ? 1.6235 1.1111 1.3296 -0.0625 0.1279  -0.0565 186 PRO A C   
1504 O  O   . PRO A 186 ? 1.6280 1.1324 1.3574 -0.0420 0.1226  -0.0405 186 PRO A O   
1505 C  CB  . PRO A 186 ? 1.4160 0.8470 1.1355 -0.0732 0.1724  -0.0784 186 PRO A CB  
1506 C  CG  . PRO A 186 ? 1.4509 0.8591 1.1348 -0.0974 0.1783  -0.0950 186 PRO A CG  
1507 C  CD  . PRO A 186 ? 1.3737 0.7977 1.0419 -0.0997 0.1675  -0.1012 186 PRO A CD  
1508 N  N   . ILE A 187 ? 1.5492 1.0344 1.2208 -0.0815 0.1184  -0.0625 187 ILE A N   
1509 C  CA  . ILE A 187 ? 1.5262 1.0359 1.1877 -0.0797 0.0974  -0.0504 187 ILE A CA  
1510 C  C   . ILE A 187 ? 1.4260 0.9778 1.0929 -0.0631 0.0711  -0.0411 187 ILE A C   
1511 O  O   . ILE A 187 ? 1.4141 0.9917 1.0995 -0.0434 0.0593  -0.0239 187 ILE A O   
1512 C  CB  . ILE A 187 ? 1.4919 0.9898 1.1157 -0.1038 0.0928  -0.0630 187 ILE A CB  
1513 C  CG1 . ILE A 187 ? 1.6035 1.0722 1.2314 -0.1153 0.1116  -0.0660 187 ILE A CG1 
1514 C  CG2 . ILE A 187 ? 1.4401 0.9725 1.0473 -0.1020 0.0643  -0.0552 187 ILE A CG2 
1515 C  CD1 . ILE A 187 ? 1.6576 1.1217 1.2555 -0.1357 0.1042  -0.0789 187 ILE A CD1 
1516 N  N   . PHE A 188 ? 1.5311 1.0895 1.1819 -0.0693 0.0624  -0.0521 188 PHE A N   
1517 C  CA  . PHE A 188 ? 1.4475 1.0449 1.1086 -0.0533 0.0383  -0.0454 188 PHE A CA  
1518 C  C   . PHE A 188 ? 1.4365 1.0536 1.1429 -0.0253 0.0389  -0.0346 188 PHE A C   
1519 O  O   . PHE A 188 ? 1.4207 1.0692 1.1402 -0.0056 0.0208  -0.0199 188 PHE A O   
1520 C  CB  . PHE A 188 ? 1.5997 1.1945 1.2430 -0.0633 0.0352  -0.0592 188 PHE A CB  
1521 C  CG  . PHE A 188 ? 1.6073 1.1949 1.2026 -0.0828 0.0245  -0.0676 188 PHE A CG  
1522 C  CD1 . PHE A 188 ? 1.6235 1.1967 1.1912 -0.0946 0.0273  -0.0811 188 PHE A CD1 
1523 C  CD2 . PHE A 188 ? 1.6158 1.2104 1.1928 -0.0884 0.0126  -0.0626 188 PHE A CD2 
1524 C  CE1 . PHE A 188 ? 1.6286 1.1947 1.1485 -0.1094 0.0165  -0.0899 188 PHE A CE1 
1525 C  CE2 . PHE A 188 ? 1.6261 1.2161 1.1594 -0.1048 0.0013  -0.0732 188 PHE A CE2 
1526 C  CZ  . PHE A 188 ? 1.6204 1.1961 1.1235 -0.1143 0.0024  -0.0872 188 PHE A CZ  
1527 N  N   . ILE A 189 ? 1.5321 1.1315 1.2615 -0.0218 0.0595  -0.0430 189 ILE A N   
1528 C  CA  . ILE A 189 ? 1.5424 1.1564 1.3153 0.0058  0.0630  -0.0371 189 ILE A CA  
1529 C  C   . ILE A 189 ? 1.5905 1.2144 1.3741 0.0256  0.0589  -0.0182 189 ILE A C   
1530 O  O   . ILE A 189 ? 1.6051 1.2549 1.4186 0.0554  0.0502  -0.0103 189 ILE A O   
1531 C  CB  . ILE A 189 ? 1.4747 1.0570 1.2636 0.0019  0.0917  -0.0488 189 ILE A CB  
1532 C  CG1 . ILE A 189 ? 1.4376 1.0344 1.2554 0.0109  0.0926  -0.0609 189 ILE A CG1 
1533 C  CG2 . ILE A 189 ? 1.5333 1.1088 1.3456 0.0214  0.1025  -0.0388 189 ILE A CG2 
1534 C  CD1 . ILE A 189 ? 1.4248 1.0426 1.2881 0.0426  0.0916  -0.0581 189 ILE A CD1 
1535 N  N   . MET A 190 ? 1.4453 1.0475 1.2051 0.0102  0.0663  -0.0120 190 MET A N   
1536 C  CA  . MET A 190 ? 1.5225 1.1291 1.2889 0.0260  0.0659  0.0076  190 MET A CA  
1537 C  C   . MET A 190 ? 1.4995 1.1454 1.2569 0.0365  0.0376  0.0209  190 MET A C   
1538 O  O   . MET A 190 ? 1.5423 1.2156 1.3185 0.0666  0.0263  0.0360  190 MET A O   
1539 C  CB  . MET A 190 ? 1.4884 1.0562 1.2377 0.0036  0.0864  0.0074  190 MET A CB  
1540 C  CG  . MET A 190 ? 1.5592 1.0877 1.3209 -0.0014 0.1153  -0.0015 190 MET A CG  
1541 S  SD  . MET A 190 ? 1.6888 1.1783 1.4422 -0.0181 0.1370  0.0039  190 MET A SD  
1542 C  CE  . MET A 190 ? 1.7715 1.2747 1.5467 0.0162  0.1364  0.0323  190 MET A CE  
1543 N  N   . ILE A 191 ? 1.3881 1.0369 1.1150 0.0132  0.0257  0.0143  191 ILE A N   
1544 C  CA  . ILE A 191 ? 1.3729 1.0594 1.0878 0.0199  -0.0026 0.0239  191 ILE A CA  
1545 C  C   . ILE A 191 ? 1.3241 1.0514 1.0623 0.0480  -0.0244 0.0273  191 ILE A C   
1546 O  O   . ILE A 191 ? 1.3618 1.1201 1.1113 0.0736  -0.0399 0.0435  191 ILE A O   
1547 C  CB  . ILE A 191 ? 1.1515 0.8355 0.8298 -0.0081 -0.0138 0.0104  191 ILE A CB  
1548 C  CG1 . ILE A 191 ? 1.2301 0.8777 0.8878 -0.0341 0.0053  0.0042  191 ILE A CG1 
1549 C  CG2 . ILE A 191 ? 1.1251 0.8527 0.7921 0.0010  -0.0467 0.0187  191 ILE A CG2 
1550 C  CD1 . ILE A 191 ? 1.2162 0.8504 0.8362 -0.0620 0.0009  -0.0162 191 ILE A CD1 
1551 N  N   . TYR A 192 ? 1.2487 0.9763 0.9957 0.0445  -0.0248 0.0115  192 TYR A N   
1552 C  CA  . TYR A 192 ? 1.2133 0.9787 0.9912 0.0711  -0.0432 0.0105  192 TYR A CA  
1553 C  C   . TYR A 192 ? 1.2944 1.0742 1.1051 0.1064  -0.0410 0.0232  192 TYR A C   
1554 O  O   . TYR A 192 ? 1.3172 1.1373 1.1423 0.1346  -0.0641 0.0328  192 TYR A O   
1555 C  CB  . TYR A 192 ? 1.4543 1.2082 1.2461 0.0621  -0.0330 -0.0089 192 TYR A CB  
1556 C  CG  . TYR A 192 ? 1.4093 1.2036 1.2312 0.0826  -0.0550 -0.0146 192 TYR A CG  
1557 C  CD1 . TYR A 192 ? 1.4041 1.2416 1.2286 0.1017  -0.0861 -0.0048 192 TYR A CD1 
1558 C  CD2 . TYR A 192 ? 1.3846 1.1749 1.2350 0.0830  -0.0442 -0.0308 192 TYR A CD2 
1559 C  CE1 . TYR A 192 ? 1.3748 1.2509 1.2307 0.1213  -0.1074 -0.0120 192 TYR A CE1 
1560 C  CE2 . TYR A 192 ? 1.3549 1.1828 1.2389 0.1013  -0.0636 -0.0382 192 TYR A CE2 
1561 C  CZ  . TYR A 192 ? 1.3497 1.2207 1.2368 0.1207  -0.0959 -0.0292 192 TYR A CZ  
1562 O  OH  . TYR A 192 ? 1.3307 1.2410 1.2540 0.1398  -0.1170 -0.0382 192 TYR A OH  
1563 N  N   . LEU A 193 ? 1.0984 0.8447 0.9186 0.1064  -0.0136 0.0230  193 LEU A N   
1564 C  CA  . LEU A 193 ? 1.1996 0.9525 1.0476 0.1411  -0.0078 0.0337  193 LEU A CA  
1565 C  C   . LEU A 193 ? 1.2872 1.0521 1.1232 0.1579  -0.0156 0.0578  193 LEU A C   
1566 O  O   . LEU A 193 ? 1.3779 1.1663 1.2326 0.1951  -0.0237 0.0697  193 LEU A O   
1567 C  CB  . LEU A 193 ? 1.2175 0.9269 1.0742 0.1336  0.0245  0.0265  193 LEU A CB  
1568 C  CG  . LEU A 193 ? 1.2762 0.9903 1.1709 0.1613  0.0323  0.0177  193 LEU A CG  
1569 C  CD1 . LEU A 193 ? 1.2126 0.9644 1.1336 0.1728  0.0126  0.0029  193 LEU A CD1 
1570 C  CD2 . LEU A 193 ? 1.3360 1.0059 1.2324 0.1424  0.0625  0.0052  193 LEU A CD2 
1571 N  N   . TRP A 194 ? 1.6389 1.3879 1.4439 0.1313  -0.0125 0.0642  194 TRP A N   
1572 C  CA  . TRP A 194 ? 1.7261 1.4879 1.5196 0.1435  -0.0193 0.0865  194 TRP A CA  
1573 C  C   . TRP A 194 ? 1.7124 1.5268 1.5091 0.1660  -0.0532 0.0922  194 TRP A C   
1574 O  O   . TRP A 194 ? 1.7933 1.6336 1.6029 0.2023  -0.0629 0.1080  194 TRP A O   
1575 C  CB  . TRP A 194 ? 1.2744 1.0145 1.0368 0.1075  -0.0127 0.0867  194 TRP A CB  
1576 C  CG  . TRP A 194 ? 1.3569 1.1192 1.1075 0.1171  -0.0247 0.1074  194 TRP A CG  
1577 C  CD1 . TRP A 194 ? 1.4851 1.2521 1.2453 0.1462  -0.0182 0.1307  194 TRP A CD1 
1578 C  CD2 . TRP A 194 ? 1.2966 1.0781 1.0224 0.0985  -0.0437 0.1065  194 TRP A CD2 
1579 N  NE1 . TRP A 194 ? 1.5063 1.2946 1.2506 0.1457  -0.0309 0.1449  194 TRP A NE1 
1580 C  CE2 . TRP A 194 ? 1.3907 1.1895 1.1149 0.1162  -0.0475 0.1294  194 TRP A CE2 
1581 C  CE3 . TRP A 194 ? 1.1754 0.9609 0.8787 0.0701  -0.0577 0.0882  194 TRP A CE3 
1582 C  CZ2 . TRP A 194 ? 1.3396 1.1615 1.0432 0.1048  -0.0652 0.1334  194 TRP A CZ2 
1583 C  CZ3 . TRP A 194 ? 1.1253 0.9327 0.8064 0.0600  -0.0763 0.0914  194 TRP A CZ3 
1584 C  CH2 . TRP A 194 ? 1.2056 1.0322 0.8883 0.0766  -0.0804 0.1132  194 TRP A CH2 
1585 N  N   . TRP A 195 ? 1.3787 1.2073 1.1619 0.1449  -0.0712 0.0785  195 TRP A N   
1586 C  CA  . TRP A 195 ? 1.2958 1.1699 1.0711 0.1547  -0.1046 0.0831  195 TRP A CA  
1587 C  C   . TRP A 195 ? 1.2447 1.1579 1.0502 0.1832  -0.1267 0.0752  195 TRP A C   
1588 O  O   . TRP A 195 ? 1.1352 1.0862 0.9379 0.1888  -0.1562 0.0732  195 TRP A O   
1589 C  CB  . TRP A 195 ? 1.8700 1.7364 1.6115 0.1171  -0.1124 0.0718  195 TRP A CB  
1590 C  CG  . TRP A 195 ? 1.7485 1.6591 1.4785 0.1227  -0.1479 0.0725  195 TRP A CG  
1591 C  CD1 . TRP A 195 ? 1.7327 1.6646 1.4408 0.1215  -0.1646 0.0842  195 TRP A CD1 
1592 C  CD2 . TRP A 195 ? 1.6446 1.5826 1.3856 0.1293  -0.1704 0.0599  195 TRP A CD2 
1593 N  NE1 . TRP A 195 ? 1.6234 1.5954 1.3265 0.1281  -0.1979 0.0795  195 TRP A NE1 
1594 C  CE2 . TRP A 195 ? 1.5661 1.5416 1.2898 0.1329  -0.2018 0.0648  195 TRP A CE2 
1595 C  CE3 . TRP A 195 ? 1.6283 1.5631 1.3945 0.1324  -0.1663 0.0443  195 TRP A CE3 
1596 C  CZ2 . TRP A 195 ? 1.4709 1.4786 1.2012 0.1397  -0.2293 0.0549  195 TRP A CZ2 
1597 C  CZ3 . TRP A 195 ? 1.5387 1.5048 1.3138 0.1385  -0.1917 0.0348  195 TRP A CZ3 
1598 C  CH2 . TRP A 195 ? 1.4567 1.4583 1.2137 0.1421  -0.2233 0.0401  195 TRP A CH2 
1599 N  N   . TYR A 196 ? 1.2057 1.1101 1.0422 0.2019  -0.1124 0.0694  196 TYR A N   
1600 C  CA  . TYR A 196 ? 1.2073 1.1491 1.0819 0.2352  -0.1302 0.0604  196 TYR A CA  
1601 C  C   . TYR A 196 ? 1.3049 1.2251 1.2074 0.2516  -0.1063 0.0547  196 TYR A C   
1602 O  O   . TYR A 196 ? 1.2453 1.1416 1.1591 0.2330  -0.0897 0.0368  196 TYR A O   
1603 C  CB  . TYR A 196 ? 1.3057 1.2605 1.1872 0.2172  -0.1444 0.0398  196 TYR A CB  
1604 C  CG  . TYR A 196 ? 1.3091 1.3115 1.2314 0.2502  -0.1695 0.0298  196 TYR A CG  
1605 C  CD1 . TYR A 196 ? 1.2286 1.2502 1.1585 0.2385  -0.1875 0.0147  196 TYR A CD1 
1606 C  CD2 . TYR A 196 ? 1.4112 1.4390 1.3649 0.2944  -0.1753 0.0344  196 TYR A CD2 
1607 C  CE1 . TYR A 196 ? 1.2480 1.3138 1.2202 0.2679  -0.2105 0.0033  196 TYR A CE1 
1608 C  CE2 . TYR A 196 ? 1.4330 1.5067 1.4274 0.3260  -0.1997 0.0217  196 TYR A CE2 
1609 C  CZ  . TYR A 196 ? 1.3321 1.4252 1.3379 0.3114  -0.2172 0.0057  196 TYR A CZ  
1610 O  OH  . TYR A 196 ? 1.3140 1.4533 1.3653 0.3415  -0.2415 -0.0093 196 TYR A OH  
1611 N  N   . PRO A 197 ? 1.1555 1.0845 1.0682 0.2886  -0.1046 0.0698  197 PRO A N   
1612 C  CA  . PRO A 197 ? 1.2520 1.1571 1.1853 0.3065  -0.0811 0.0665  197 PRO A CA  
1613 C  C   . PRO A 197 ? 1.2366 1.1552 1.2102 0.3162  -0.0837 0.0405  197 PRO A C   
1614 O  O   . PRO A 197 ? 1.3199 1.2148 1.3110 0.3217  -0.0624 0.0310  197 PRO A O   
1615 C  CB  . PRO A 197 ? 1.8661 1.7945 1.8034 0.3544  -0.0903 0.0865  197 PRO A CB  
1616 C  CG  . PRO A 197 ? 1.8207 1.8026 1.7615 0.3713  -0.1263 0.0886  197 PRO A CG  
1617 C  CD  . PRO A 197 ? 1.6480 1.6202 1.5600 0.3245  -0.1303 0.0870  197 PRO A CD  
1618 N  N   . SER A 198 ? 1.2628 1.2203 1.2532 0.3187  -0.1097 0.0281  198 SER A N   
1619 C  CA  . SER A 198 ? 1.2816 1.2633 1.3192 0.3383  -0.1166 0.0046  198 SER A CA  
1620 C  C   . SER A 198 ? 1.1442 1.1025 1.1871 0.2989  -0.1022 -0.0157 198 SER A C   
1621 O  O   . SER A 198 ? 1.1493 1.1157 1.2320 0.3060  -0.0981 -0.0374 198 SER A O   
1622 C  CB  . SER A 198 ? 1.2027 1.2439 1.2634 0.3706  -0.1538 0.0018  198 SER A CB  
1623 O  OG  . SER A 198 ? 1.2882 1.3493 1.3356 0.4062  -0.1664 0.0238  198 SER A OG  
1624 N  N   . SER A 199 ? 1.2006 1.1290 1.2033 0.2581  -0.0931 -0.0095 199 SER A N   
1625 C  CA  . SER A 199 ? 1.0965 0.9989 1.0973 0.2218  -0.0775 -0.0269 199 SER A CA  
1626 C  C   . SER A 199 ? 1.1481 1.0155 1.1642 0.2188  -0.0459 -0.0367 199 SER A C   
1627 O  O   . SER A 199 ? 1.0981 0.9394 1.1154 0.1920  -0.0269 -0.0515 199 SER A O   
1628 C  CB  . SER A 199 ? 1.0824 0.9581 1.0322 0.1826  -0.0739 -0.0187 199 SER A CB  
1629 O  OG  . SER A 199 ? 1.1385 0.9832 1.0584 0.1746  -0.0576 -0.0030 199 SER A OG  
1630 N  N   . TYR A 200 ? 1.2831 1.1501 1.3103 0.2485  -0.0403 -0.0285 200 TYR A N   
1631 C  CA  . TYR A 200 ? 1.3586 1.1917 1.3976 0.2478  -0.0113 -0.0369 200 TYR A CA  
1632 C  C   . TYR A 200 ? 1.3300 1.1636 1.4048 0.2393  -0.0012 -0.0638 200 TYR A C   
1633 O  O   . TYR A 200 ? 1.2794 1.0791 1.3397 0.2045  0.0196  -0.0718 200 TYR A O   
1634 C  CB  . TYR A 200 ? 1.4112 1.2529 1.4657 0.2905  -0.0113 -0.0285 200 TYR A CB  
1635 C  CG  . TYR A 200 ? 1.5001 1.3019 1.5596 0.2867  0.0190  -0.0356 200 TYR A CG  
1636 C  CD1 . TYR A 200 ? 1.5128 1.2681 1.5370 0.2633  0.0416  -0.0220 200 TYR A CD1 
1637 C  CD2 . TYR A 200 ? 1.5864 1.3976 1.6877 0.3049  0.0248  -0.0581 200 TYR A CD2 
1638 C  CE1 . TYR A 200 ? 1.6027 1.3216 1.6316 0.2596  0.0682  -0.0292 200 TYR A CE1 
1639 C  CE2 . TYR A 200 ? 1.6813 1.4569 1.7863 0.3013  0.0515  -0.0656 200 TYR A CE2 
1640 C  CZ  . TYR A 200 ? 1.6840 1.4132 1.7518 0.2788  0.0728  -0.0506 200 TYR A CZ  
1641 O  OH  . TYR A 200 ? 1.7886 1.4827 1.8608 0.2759  0.0984  -0.0588 200 TYR A OH  
1642 N  N   . SER A 201 ? 1.5954 1.4680 1.7176 0.2720  -0.0156 -0.0784 201 SER A N   
1643 C  CA  . SER A 201 ? 1.5763 1.4545 1.7398 0.2653  -0.0068 -0.1055 201 SER A CA  
1644 C  C   . SER A 201 ? 1.4370 1.2960 1.5825 0.2218  0.0018  -0.1112 201 SER A C   
1645 O  O   . SER A 201 ? 1.4286 1.2564 1.5763 0.1992  0.0282  -0.1232 201 SER A O   
1646 C  CB  . SER A 201 ? 1.4623 1.3949 1.6787 0.3031  -0.0320 -0.1208 201 SER A CB  
1647 O  OG  . SER A 201 ? 1.4442 1.4092 1.6466 0.3162  -0.0623 -0.1060 201 SER A OG  
1648 N  N   . LEU A 202 ? 1.2477 1.1244 1.3738 0.2118  -0.0196 -0.1030 202 LEU A N   
1649 C  CA  . LEU A 202 ? 1.1376 0.9935 1.2386 0.1727  -0.0122 -0.1067 202 LEU A CA  
1650 C  C   . LEU A 202 ? 1.1227 0.9229 1.1806 0.1380  0.0185  -0.1027 202 LEU A C   
1651 O  O   . LEU A 202 ? 1.0915 0.8663 1.1461 0.1123  0.0390  -0.1149 202 LEU A O   
1652 C  CB  . LEU A 202 ? 1.2049 1.0837 1.2785 0.1695  -0.0413 -0.0936 202 LEU A CB  
1653 C  CG  . LEU A 202 ? 1.1101 0.9737 1.1491 0.1353  -0.0425 -0.0942 202 LEU A CG  
1654 C  CD1 . LEU A 202 ? 1.0670 0.8798 1.0487 0.1009  -0.0203 -0.0861 202 LEU A CD1 
1655 C  CD2 . LEU A 202 ? 1.0928 0.9619 1.1677 0.1274  -0.0359 -0.1146 202 LEU A CD2 
1656 N  N   . ASN A 203 ? 1.3971 1.1781 1.4233 0.1385  0.0228  -0.0861 203 ASN A N   
1657 C  CA  . ASN A 203 ? 1.4087 1.1400 1.3991 0.1102  0.0499  -0.0838 203 ASN A CA  
1658 C  C   . ASN A 203 ? 1.4837 1.1920 1.4993 0.1107  0.0776  -0.0982 203 ASN A C   
1659 O  O   . ASN A 203 ? 1.5001 1.1746 1.5010 0.0840  0.1010  -0.1075 203 ASN A O   
1660 C  CB  . ASN A 203 ? 1.2287 0.9484 1.1886 0.1140  0.0475  -0.0636 203 ASN A CB  
1661 C  CG  . ASN A 203 ? 1.1623 0.8985 1.0900 0.1070  0.0238  -0.0499 203 ASN A CG  
1662 O  OD1 . ASN A 203 ? 1.0878 0.8135 0.9872 0.0802  0.0224  -0.0541 203 ASN A OD1 
1663 N  ND2 . ASN A 203 ? 1.2042 0.9669 1.1347 0.1326  0.0050  -0.0339 203 ASN A ND2 
1664 N  N   . PHE A 204 ? 1.2341 0.9613 1.2862 0.1434  0.0746  -0.1005 204 PHE A N   
1665 C  CA  . PHE A 204 ? 1.3181 1.0307 1.4004 0.1491  0.0973  -0.1169 204 PHE A CA  
1666 C  C   . PHE A 204 ? 1.2671 0.9773 1.3683 0.1290  0.1094  -0.1368 204 PHE A C   
1667 O  O   . PHE A 204 ? 1.2741 0.9483 1.3584 0.1036  0.1344  -0.1430 204 PHE A O   
1668 C  CB  . PHE A 204 ? 1.1162 0.8616 1.2432 0.1921  0.0860  -0.1227 204 PHE A CB  
1669 C  CG  . PHE A 204 ? 1.2423 0.9707 1.3958 0.2004  0.1090  -0.1387 204 PHE A CG  
1670 C  CD1 . PHE A 204 ? 1.3391 1.0338 1.4711 0.2027  0.1253  -0.1292 204 PHE A CD1 
1671 C  CD2 . PHE A 204 ? 1.2797 1.0252 1.4809 0.2051  0.1149  -0.1643 204 PHE A CD2 
1672 C  CE1 . PHE A 204 ? 1.4720 1.1512 1.6271 0.2111  0.1453  -0.1448 204 PHE A CE1 
1673 C  CE2 . PHE A 204 ? 1.4201 1.1518 1.6463 0.2131  0.1355  -0.1809 204 PHE A CE2 
1674 C  CZ  . PHE A 204 ? 1.5154 1.2140 1.7169 0.2166  0.1499  -0.1710 204 PHE A CZ  
1675 N  N   . ALA A 205 ? 1.5294 1.2783 1.6661 0.1416  0.0917  -0.1467 205 ALA A N   
1676 C  CA  . ALA A 205 ? 1.4965 1.2474 1.6555 0.1242  0.1011  -0.1643 205 ALA A CA  
1677 C  C   . ALA A 205 ? 1.4545 1.1663 1.5661 0.0846  0.1186  -0.1603 205 ALA A C   
1678 O  O   . ALA A 205 ? 1.5014 1.1883 1.6190 0.0671  0.1456  -0.1732 205 ALA A O   
1679 C  CB  . ALA A 205 ? 0.8139 0.6118 1.0061 0.1412  0.0732  -0.1692 205 ALA A CB  
1680 N  N   . MET A 206 ? 1.5885 1.2959 1.6530 0.0721  0.1034  -0.1438 206 MET A N   
1681 C  CA  . MET A 206 ? 1.5824 1.2520 1.5982 0.0379  0.1193  -0.1418 206 MET A CA  
1682 C  C   . MET A 206 ? 1.6648 1.2902 1.6578 0.0222  0.1492  -0.1442 206 MET A C   
1683 O  O   . MET A 206 ? 1.7002 1.2960 1.6748 -0.0002 0.1717  -0.1520 206 MET A O   
1684 C  CB  . MET A 206 ? 1.5428 1.2146 1.5103 0.0292  0.0974  -0.1254 206 MET A CB  
1685 C  CG  . MET A 206 ? 1.4728 1.1760 1.4496 0.0328  0.0739  -0.1261 206 MET A CG  
1686 S  SD  . MET A 206 ? 1.4002 1.1044 1.3166 0.0219  0.0490  -0.1086 206 MET A SD  
1687 C  CE  . MET A 206 ? 1.4394 1.0872 1.2962 -0.0131 0.0767  -0.1111 206 MET A CE  
1688 N  N   . ILE A 207 ? 1.2182 0.8386 1.2120 0.0354  0.1501  -0.1372 207 ILE A N   
1689 C  CA  . ILE A 207 ? 1.3178 0.8988 1.2977 0.0239  0.1776  -0.1413 207 ILE A CA  
1690 C  C   . ILE A 207 ? 1.3968 0.9734 1.4175 0.0271  0.2007  -0.1606 207 ILE A C   
1691 O  O   . ILE A 207 ? 1.4694 1.0139 1.4736 0.0070  0.2254  -0.1686 207 ILE A O   
1692 C  CB  . ILE A 207 ? 1.0192 0.5942 0.9915 0.0378  0.1735  -0.1285 207 ILE A CB  
1693 C  CG1 . ILE A 207 ? 0.9619 0.5427 0.8967 0.0331  0.1524  -0.1103 207 ILE A CG1 
1694 C  CG2 . ILE A 207 ? 1.1256 0.6596 1.0832 0.0251  0.2002  -0.1331 207 ILE A CG2 
1695 C  CD1 . ILE A 207 ? 1.0000 0.5642 0.9187 0.0382  0.1547  -0.0968 207 ILE A CD1 
1696 N  N   . GLY A 208 ? 1.3343 0.9443 1.4082 0.0532  0.1925  -0.1697 208 GLY A N   
1697 C  CA  . GLY A 208 ? 1.4014 1.0130 1.5198 0.0569  0.2125  -0.1909 208 GLY A CA  
1698 C  C   . GLY A 208 ? 1.4067 1.0023 1.5162 0.0301  0.2300  -0.1994 208 GLY A C   
1699 O  O   . GLY A 208 ? 1.4949 1.0594 1.5958 0.0135  0.2586  -0.2082 208 GLY A O   
1700 N  N   . LEU A 209 ? 1.5118 1.1279 1.6219 0.0268  0.2136  -0.1964 209 LEU A N   
1701 C  CA  . LEU A 209 ? 1.5245 1.1237 1.6227 0.0030  0.2301  -0.2021 209 LEU A CA  
1702 C  C   . LEU A 209 ? 1.5798 1.1315 1.6189 -0.0214 0.2513  -0.1959 209 LEU A C   
1703 O  O   . LEU A 209 ? 1.6778 1.2059 1.7205 -0.0331 0.2801  -0.2068 209 LEU A O   
1704 C  CB  . LEU A 209 ? 1.0552 0.6747 1.1428 0.0004  0.2066  -0.1943 209 LEU A CB  
1705 C  CG  . LEU A 209 ? 1.0618 0.6814 1.1753 -0.0109 0.2222  -0.2072 209 LEU A CG  
1706 C  CD1 . LEU A 209 ? 1.0383 0.6902 1.2304 0.0089  0.2253  -0.2271 209 LEU A CD1 
1707 C  CD2 . LEU A 209 ? 1.0917 0.7235 1.1867 -0.0171 0.2017  -0.1991 209 LEU A CD2 
1708 N  N   . PHE A 210 ? 1.4601 1.0001 1.4479 -0.0276 0.2368  -0.1800 210 PHE A N   
1709 C  CA  . PHE A 210 ? 1.5142 1.0115 1.4450 -0.0494 0.2537  -0.1764 210 PHE A CA  
1710 C  C   . PHE A 210 ? 1.6424 1.1119 1.5797 -0.0533 0.2831  -0.1868 210 PHE A C   
1711 O  O   . PHE A 210 ? 1.7199 1.1549 1.6218 -0.0712 0.3048  -0.1906 210 PHE A O   
1712 C  CB  . PHE A 210 ? 1.5426 1.0365 1.4323 -0.0505 0.2337  -0.1614 210 PHE A CB  
1713 C  CG  . PHE A 210 ? 1.5933 1.0478 1.4261 -0.0715 0.2470  -0.1605 210 PHE A CG  
1714 C  CD1 . PHE A 210 ? 1.5737 1.0147 1.3653 -0.0872 0.2479  -0.1607 210 PHE A CD1 
1715 C  CD2 . PHE A 210 ? 1.6751 1.1056 1.4956 -0.0741 0.2585  -0.1611 210 PHE A CD2 
1716 C  CE1 . PHE A 210 ? 1.6358 1.0419 1.3741 -0.1032 0.2590  -0.1625 210 PHE A CE1 
1717 C  CE2 . PHE A 210 ? 1.7343 1.1309 1.5054 -0.0917 0.2695  -0.1633 210 PHE A CE2 
1718 C  CZ  . PHE A 210 ? 1.7161 1.1012 1.4455 -0.1054 0.2694  -0.1648 210 PHE A CZ  
1719 N  N   . GLY A 211 ? 1.3031 0.7881 1.2839 -0.0344 0.2827  -0.1918 211 GLY A N   
1720 C  CA  . GLY A 211 ? 1.4336 0.8974 1.4275 -0.0346 0.3079  -0.2031 211 GLY A CA  
1721 C  C   . GLY A 211 ? 1.5017 0.9649 1.5289 -0.0392 0.3323  -0.2205 211 GLY A C   
1722 O  O   . GLY A 211 ? 1.5875 1.0200 1.5948 -0.0539 0.3579  -0.2268 211 GLY A O   
1723 N  N   . LEU A 212 ? 1.6744 1.1723 1.7542 -0.0258 0.3247  -0.2292 212 LEU A N   
1724 C  CA  . LEU A 212 ? 1.7502 1.2489 1.8690 -0.0310 0.3500  -0.2475 212 LEU A CA  
1725 C  C   . LEU A 212 ? 1.7642 1.2331 1.8412 -0.0562 0.3690  -0.2438 212 LEU A C   
1726 O  O   . LEU A 212 ? 1.8787 1.3273 1.9603 -0.0674 0.3996  -0.2544 212 LEU A O   
1727 C  CB  . LEU A 212 ? 1.4192 0.9616 1.6025 -0.0140 0.3370  -0.2589 212 LEU A CB  
1728 C  CG  . LEU A 212 ? 1.3950 0.9758 1.6236 0.0173  0.3128  -0.2638 212 LEU A CG  
1729 C  CD1 . LEU A 212 ? 1.4284 1.0450 1.7308 0.0304  0.3145  -0.2863 212 LEU A CD1 
1730 C  CD2 . LEU A 212 ? 1.4877 1.0571 1.7132 0.0312  0.3163  -0.2647 212 LEU A CD2 
1731 N  N   . TYR A 213 ? 1.7937 1.2595 1.8268 -0.0635 0.3506  -0.2286 213 TYR A N   
1732 C  CA  . TYR A 213 ? 1.8024 1.2401 1.7861 -0.0839 0.3631  -0.2229 213 TYR A CA  
1733 C  C   . TYR A 213 ? 1.9048 1.3007 1.8350 -0.0968 0.3825  -0.2213 213 TYR A C   
1734 O  O   . TYR A 213 ? 2.0009 1.3692 1.9108 -0.1095 0.4102  -0.2261 213 TYR A O   
1735 C  CB  . TYR A 213 ? 1.8397 1.2893 1.7914 -0.0848 0.3333  -0.2085 213 TYR A CB  
1736 C  CG  . TYR A 213 ? 1.8470 1.2659 1.7364 -0.1029 0.3413  -0.2015 213 TYR A CG  
1737 C  CD1 . TYR A 213 ? 1.8260 1.2472 1.7188 -0.1088 0.3452  -0.2016 213 TYR A CD1 
1738 C  CD2 . TYR A 213 ? 1.8845 1.2724 1.7118 -0.1124 0.3436  -0.1957 213 TYR A CD2 
1739 C  CE1 . TYR A 213 ? 1.8456 1.2370 1.6773 -0.1223 0.3521  -0.1949 213 TYR A CE1 
1740 C  CE2 . TYR A 213 ? 1.9045 1.2654 1.6725 -0.1252 0.3492  -0.1913 213 TYR A CE2 
1741 C  CZ  . TYR A 213 ? 1.8860 1.2476 1.6537 -0.1295 0.3536  -0.1902 213 TYR A CZ  
1742 O  OH  . TYR A 213 ? 1.9220 1.2537 1.6249 -0.1397 0.3596  -0.1855 213 TYR A OH  
1743 N  N   . THR A 214 ? 1.5965 0.9874 1.5053 -0.0925 0.3690  -0.2150 214 THR A N   
1744 C  CA  . THR A 214 ? 1.7167 1.0712 1.5861 -0.1020 0.3871  -0.2174 214 THR A CA  
1745 C  C   . THR A 214 ? 1.8650 1.2070 1.7627 -0.1027 0.4189  -0.2323 214 THR A C   
1746 O  O   . THR A 214 ? 1.9967 1.3073 1.8608 -0.1139 0.4420  -0.2366 214 THR A O   
1747 C  CB  . THR A 214 ? 1.8638 1.2177 1.7236 -0.0951 0.3704  -0.2111 214 THR A CB  
1748 O  OG1 . THR A 214 ? 1.7808 1.1263 1.5895 -0.1032 0.3526  -0.2000 214 THR A OG1 
1749 C  CG2 . THR A 214 ? 2.0123 1.3383 1.8654 -0.0981 0.3922  -0.2199 214 THR A CG2 
1750 N  N   . LEU A 215 ? 1.7118 1.0802 1.6712 -0.0890 0.4191  -0.2414 215 LEU A N   
1751 C  CA  . LEU A 215 ? 1.8559 1.2192 1.8511 -0.0876 0.4470  -0.2579 215 LEU A CA  
1752 C  C   . LEU A 215 ? 1.9197 1.2727 1.9175 -0.1001 0.4734  -0.2642 215 LEU A C   
1753 O  O   . LEU A 215 ? 2.0672 1.3968 2.0573 -0.1077 0.5026  -0.2727 215 LEU A O   
1754 C  CB  . LEU A 215 ? 1.5796 0.9784 1.6428 -0.0672 0.4374  -0.2684 215 LEU A CB  
1755 C  CG  . LEU A 215 ? 1.5895 0.9919 1.6544 -0.0517 0.4209  -0.2648 215 LEU A CG  
1756 C  CD1 . LEU A 215 ? 1.6904 1.1084 1.8117 -0.0352 0.4304  -0.2829 215 LEU A CD1 
1757 C  CD2 . LEU A 215 ? 1.6674 1.0321 1.6755 -0.0637 0.4272  -0.2570 215 LEU A CD2 
1758 N  N   . VAL A 216 ? 1.7312 1.1013 1.7406 -0.1016 0.4643  -0.2600 216 VAL A N   
1759 C  CA  . VAL A 216 ? 1.8050 1.1603 1.8125 -0.1143 0.4916  -0.2636 216 VAL A CA  
1760 C  C   . VAL A 216 ? 1.8544 1.1690 1.7840 -0.1287 0.5032  -0.2529 216 VAL A C   
1761 O  O   . VAL A 216 ? 1.9836 1.2692 1.8885 -0.1347 0.5293  -0.2577 216 VAL A O   
1762 C  CB  . VAL A 216 ? 1.5034 0.8849 1.5452 -0.1129 0.4809  -0.2627 216 VAL A CB  
1763 C  CG1 . VAL A 216 ? 1.5625 0.9185 1.5874 -0.1281 0.5116  -0.2623 216 VAL A CG1 
1764 C  CG2 . VAL A 216 ? 1.5286 0.9506 1.6540 -0.0976 0.4752  -0.2790 216 VAL A CG2 
1765 N  N   . PHE A 217 ? 1.6871 1.0008 1.5772 -0.1320 0.4823  -0.2397 217 PHE A N   
1766 C  CA  . PHE A 217 ? 1.7411 1.0188 1.5575 -0.1431 0.4916  -0.2313 217 PHE A CA  
1767 C  C   . PHE A 217 ? 1.8365 1.0884 1.5994 -0.1449 0.4908  -0.2303 217 PHE A C   
1768 O  O   . PHE A 217 ? 1.9391 1.1601 1.6399 -0.1515 0.5003  -0.2269 217 PHE A O   
1769 C  CB  . PHE A 217 ? 1.9184 1.2065 1.7120 -0.1442 0.4664  -0.2196 217 PHE A CB  
1770 C  CG  . PHE A 217 ? 1.8896 1.2000 1.7344 -0.1431 0.4689  -0.2219 217 PHE A CG  
1771 C  CD1 . PHE A 217 ? 1.8126 1.1642 1.7283 -0.1317 0.4523  -0.2286 217 PHE A CD1 
1772 C  CD2 . PHE A 217 ? 1.9578 1.2473 1.7827 -0.1519 0.4897  -0.2188 217 PHE A CD2 
1773 C  CE1 . PHE A 217 ? 1.7992 1.1743 1.7694 -0.1297 0.4541  -0.2342 217 PHE A CE1 
1774 C  CE2 . PHE A 217 ? 1.9428 1.2526 1.8210 -0.1517 0.4934  -0.2224 217 PHE A CE2 
1775 C  CZ  . PHE A 217 ? 1.8624 1.2166 1.8161 -0.1408 0.4748  -0.2313 217 PHE A CZ  
1776 N  N   . HIS A 218 ? 2.1947 1.4583 1.9823 -0.1378 0.4805  -0.2345 218 HIS A N   
1777 C  CA  . HIS A 218 ? 2.2963 1.5388 2.0395 -0.1394 0.4754  -0.2339 218 HIS A CA  
1778 C  C   . HIS A 218 ? 2.3553 1.5983 2.1288 -0.1332 0.4818  -0.2429 218 HIS A C   
1779 O  O   . HIS A 218 ? 2.3846 1.6224 2.1402 -0.1315 0.4671  -0.2407 218 HIS A O   
1780 C  CB  . HIS A 218 ? 2.4102 1.6643 2.1276 -0.1381 0.4405  -0.2229 218 HIS A CB  
1781 C  CG  . HIS A 218 ? 2.3870 1.6343 2.0588 -0.1444 0.4322  -0.2151 218 HIS A CG  
1782 N  ND1 . HIS A 218 ? 2.4853 1.7010 2.0906 -0.1510 0.4395  -0.2158 218 HIS A ND1 
1783 C  CD2 . HIS A 218 ? 2.2901 1.5581 1.9718 -0.1435 0.4163  -0.2075 218 HIS A CD2 
1784 C  CE1 . HIS A 218 ? 2.4491 1.6649 2.0234 -0.1537 0.4290  -0.2085 218 HIS A CE1 
1785 N  NE2 . HIS A 218 ? 2.3310 1.5783 1.9513 -0.1501 0.4147  -0.2030 218 HIS A NE2 
1786 N  N   . ARG A 219 ? 2.1195 1.3679 1.9387 -0.1298 0.5038  -0.2538 219 ARG A N   
1787 C  CA  . ARG A 219 ? 2.0994 1.3511 1.9484 -0.1216 0.5051  -0.2623 219 ARG A CA  
1788 C  C   . ARG A 219 ? 2.1086 1.3288 1.9149 -0.1259 0.5143  -0.2660 219 ARG A C   
1789 O  O   . ARG A 219 ? 2.0525 1.2716 1.8787 -0.1196 0.5151  -0.2726 219 ARG A O   
1790 C  CB  . ARG A 219 ? 2.5178 1.7874 2.4308 -0.1143 0.5222  -0.2759 219 ARG A CB  
1791 C  CG  . ARG A 219 ? 2.5391 1.7957 2.4575 -0.1224 0.5567  -0.2849 219 ARG A CG  
1792 C  CD  . ARG A 219 ? 2.5815 1.8647 2.5736 -0.1137 0.5670  -0.3001 219 ARG A CD  
1793 N  NE  . ARG A 219 ? 2.6555 1.9351 2.6677 -0.1217 0.5981  -0.3080 219 ARG A NE  
1794 C  CZ  . ARG A 219 ? 2.7194 2.0271 2.7977 -0.1172 0.6046  -0.3198 219 ARG A CZ  
1795 N  NH1 . ARG A 219 ? 2.7111 2.0539 2.8395 -0.1022 0.5801  -0.3257 219 ARG A NH1 
1796 N  NH2 . ARG A 219 ? 2.8027 2.1033 2.8979 -0.1265 0.6362  -0.3264 219 ARG A NH2 
1797 N  N   . LYS A 220 ? 2.0368 1.2319 1.7842 -0.1350 0.5193  -0.2626 220 LYS A N   
1798 C  CA  . LYS A 220 ? 2.0662 1.2320 1.7717 -0.1379 0.5279  -0.2689 220 LYS A CA  
1799 C  C   . LYS A 220 ? 2.0325 1.1913 1.6968 -0.1404 0.5031  -0.2630 220 LYS A C   
1800 O  O   . LYS A 220 ? 2.0161 1.1604 1.6677 -0.1400 0.5017  -0.2693 220 LYS A O   
1801 C  CB  . LYS A 220 ? 2.6476 1.7871 2.3142 -0.1430 0.5564  -0.2740 220 LYS A CB  
1802 C  CG  . LYS A 220 ? 2.7116 1.8443 2.4054 -0.1409 0.5870  -0.2860 220 LYS A CG  
1803 C  CD  . LYS A 220 ? 2.8221 1.9336 2.4839 -0.1450 0.6169  -0.2866 220 LYS A CD  
1804 C  CE  . LYS A 220 ? 2.8898 1.9958 2.5803 -0.1434 0.6499  -0.2985 220 LYS A CE  
1805 N  NZ  . LYS A 220 ? 3.0026 2.0882 2.6650 -0.1469 0.6820  -0.2966 220 LYS A NZ  
1806 N  N   . GLU A 221 ? 2.1887 1.3581 1.8341 -0.1431 0.4838  -0.2522 221 GLU A N   
1807 C  CA  . GLU A 221 ? 2.1800 1.3423 1.7809 -0.1468 0.4619  -0.2485 221 GLU A CA  
1808 C  C   . GLU A 221 ? 2.1027 1.2758 1.7276 -0.1435 0.4423  -0.2459 221 GLU A C   
1809 O  O   . GLU A 221 ? 2.0489 1.2438 1.7216 -0.1365 0.4354  -0.2407 221 GLU A O   
1810 C  CB  . GLU A 221 ? 2.8476 2.0214 2.4253 -0.1496 0.4449  -0.2379 221 GLU A CB  
1811 C  CG  . GLU A 221 ? 2.9467 2.1011 2.4818 -0.1531 0.4625  -0.2391 221 GLU A CG  
1812 C  CD  . GLU A 221 ? 2.9467 2.1112 2.5187 -0.1524 0.4803  -0.2363 221 GLU A CD  
1813 O  OE1 . GLU A 221 ? 2.8675 2.0538 2.4990 -0.1482 0.4806  -0.2371 221 GLU A OE1 
1814 O  OE2 . GLU A 221 ? 3.0318 2.1822 2.5744 -0.1551 0.4945  -0.2340 221 GLU A OE2 
1815 N  N   . LYS A 222 ? 2.2603 1.4176 1.8525 -0.1474 0.4340  -0.2504 222 LYS A N   
1816 C  CA  . LYS A 222 ? 2.2063 1.3683 1.8215 -0.1452 0.4203  -0.2483 222 LYS A CA  
1817 C  C   . LYS A 222 ? 2.1872 1.3727 1.8099 -0.1443 0.3933  -0.2341 222 LYS A C   
1818 O  O   . LYS A 222 ? 2.1359 1.3417 1.8003 -0.1359 0.3855  -0.2248 222 LYS A O   
1819 C  CB  . LYS A 222 ? 2.1565 1.2932 1.7423 -0.1500 0.4230  -0.2609 222 LYS A CB  
1820 C  CG  . LYS A 222 ? 2.1510 1.2738 1.7631 -0.1461 0.4396  -0.2707 222 LYS A CG  
1821 C  CD  . LYS A 222 ? 2.1912 1.2870 1.7682 -0.1493 0.4510  -0.2880 222 LYS A CD  
1822 C  CE  . LYS A 222 ? 2.1830 1.2671 1.7851 -0.1443 0.4711  -0.2981 222 LYS A CE  
1823 N  NZ  . LYS A 222 ? 2.2237 1.2835 1.7916 -0.1448 0.4842  -0.3160 222 LYS A NZ  
1824 N  N   . ILE A 223 ? 2.4101 1.5933 1.9911 -0.1510 0.3791  -0.2333 223 ILE A N   
1825 C  CA  . ILE A 223 ? 2.4050 1.6103 1.9875 -0.1510 0.3527  -0.2208 223 ILE A CA  
1826 C  C   . ILE A 223 ? 2.3598 1.5945 1.9871 -0.1412 0.3445  -0.2073 223 ILE A C   
1827 O  O   . ILE A 223 ? 2.3373 1.5895 1.9855 -0.1357 0.3276  -0.1965 223 ILE A O   
1828 C  CB  . ILE A 223 ? 1.8416 1.0473 1.3752 -0.1573 0.3402  -0.2213 223 ILE A CB  
1829 C  CG1 . ILE A 223 ? 1.8913 1.0748 1.3823 -0.1642 0.3389  -0.2354 223 ILE A CG1 
1830 C  CG2 . ILE A 223 ? 1.8328 1.0669 1.3752 -0.1554 0.3137  -0.2072 223 ILE A CG2 
1831 C  CD1 . ILE A 223 ? 1.9349 1.1306 1.4035 -0.1687 0.3130  -0.2327 223 ILE A CD1 
1832 N  N   . PHE A 224 ? 2.0041 1.2442 1.6474 -0.1377 0.3577  -0.2089 224 PHE A N   
1833 C  CA  . PHE A 224 ? 1.9707 1.2415 1.6577 -0.1271 0.3493  -0.2000 224 PHE A CA  
1834 C  C   . PHE A 224 ? 1.9103 1.1954 1.6458 -0.1135 0.3459  -0.1959 224 PHE A C   
1835 O  O   . PHE A 224 ? 1.8930 1.2052 1.6516 -0.1030 0.3266  -0.1850 224 PHE A O   
1836 C  CB  . PHE A 224 ? 1.9550 1.2264 1.6524 -0.1276 0.3673  -0.2058 224 PHE A CB  
1837 C  CG  . PHE A 224 ? 2.0181 1.2844 1.6740 -0.1359 0.3643  -0.2039 224 PHE A CG  
1838 C  CD1 . PHE A 224 ? 2.0694 1.3099 1.6682 -0.1450 0.3662  -0.2084 224 PHE A CD1 
1839 C  CD2 . PHE A 224 ? 2.0325 1.3198 1.7061 -0.1331 0.3586  -0.1988 224 PHE A CD2 
1840 C  CE1 . PHE A 224 ? 2.1366 1.3705 1.6927 -0.1502 0.3632  -0.2071 224 PHE A CE1 
1841 C  CE2 . PHE A 224 ? 2.0978 1.3775 1.7308 -0.1401 0.3563  -0.1965 224 PHE A CE2 
1842 C  CZ  . PHE A 224 ? 2.1510 1.4032 1.7230 -0.1481 0.3588  -0.2001 224 PHE A CZ  
1843 N  N   . TYR A 225 ? 2.2097 1.4769 1.9595 -0.1116 0.3640  -0.2047 225 TYR A N   
1844 C  CA  . TYR A 225 ? 2.1616 1.4397 1.9533 -0.0965 0.3611  -0.2010 225 TYR A CA  
1845 C  C   . TYR A 225 ? 2.1631 1.4401 1.9457 -0.0949 0.3442  -0.1893 225 TYR A C   
1846 O  O   . TYR A 225 ? 2.1426 1.4388 1.9525 -0.0797 0.3316  -0.1785 225 TYR A O   
1847 C  CB  . TYR A 225 ? 1.9163 1.1747 1.7241 -0.0946 0.3845  -0.2142 225 TYR A CB  
1848 C  CG  . TYR A 225 ? 1.9246 1.1860 1.7456 -0.0960 0.4028  -0.2252 225 TYR A CG  
1849 C  CD1 . TYR A 225 ? 1.9701 1.2087 1.7571 -0.1096 0.4205  -0.2341 225 TYR A CD1 
1850 C  CD2 . TYR A 225 ? 1.8965 1.1845 1.7646 -0.0825 0.4027  -0.2274 225 TYR A CD2 
1851 C  CE1 . TYR A 225 ? 1.9906 1.2301 1.7900 -0.1112 0.4406  -0.2428 225 TYR A CE1 
1852 C  CE2 . TYR A 225 ? 1.9123 1.2034 1.7976 -0.0851 0.4217  -0.2387 225 TYR A CE2 
1853 C  CZ  . TYR A 225 ? 1.9606 1.2263 1.8110 -0.1003 0.4417  -0.2452 225 TYR A CZ  
1854 O  OH  . TYR A 225 ? 1.9884 1.2546 1.8548 -0.1034 0.4636  -0.2550 225 TYR A OH  
1855 N  N   . LEU A 226 ? 1.7166 0.9717 1.4609 -0.1094 0.3444  -0.1924 226 LEU A N   
1856 C  CA  . LEU A 226 ? 1.7313 0.9861 1.4656 -0.1114 0.3291  -0.1826 226 LEU A CA  
1857 C  C   . LEU A 226 ? 1.7430 1.0298 1.4816 -0.1045 0.3058  -0.1676 226 LEU A C   
1858 O  O   . LEU A 226 ? 1.7359 1.0357 1.4929 -0.0935 0.2941  -0.1544 226 LEU A O   
1859 C  CB  . LEU A 226 ? 1.8285 1.0612 1.5201 -0.1286 0.3298  -0.1918 226 LEU A CB  
1860 C  CG  . LEU A 226 ? 1.8287 1.0461 1.5207 -0.1327 0.3276  -0.1907 226 LEU A CG  
1861 C  CD1 . LEU A 226 ? 1.8650 1.0823 1.5218 -0.1455 0.3133  -0.1930 226 LEU A CD1 
1862 C  CD2 . LEU A 226 ? 1.8190 1.0484 1.5463 -0.1187 0.3211  -0.1739 226 LEU A CD2 
1863 N  N   . ALA A 227 ? 1.8299 1.1289 1.5508 -0.1096 0.2993  -0.1691 227 ALA A N   
1864 C  CA  . ALA A 227 ? 1.8459 1.1764 1.5700 -0.1031 0.2757  -0.1563 227 ALA A CA  
1865 C  C   . ALA A 227 ? 1.8058 1.1636 1.5775 -0.0817 0.2699  -0.1484 227 ALA A C   
1866 O  O   . ALA A 227 ? 1.8113 1.1873 1.5941 -0.0703 0.2533  -0.1350 227 ALA A O   
1867 C  CB  . ALA A 227 ? 1.1653 0.5011 0.8629 -0.1118 0.2714  -0.1604 227 ALA A CB  
1868 N  N   . ILE A 228 ? 1.7539 1.1152 1.5541 -0.0747 0.2837  -0.1575 228 ILE A N   
1869 C  CA  . ILE A 228 ? 1.7277 1.1161 1.5752 -0.0516 0.2775  -0.1538 228 ILE A CA  
1870 C  C   . ILE A 228 ? 1.7190 1.1041 1.5764 -0.0383 0.2729  -0.1432 228 ILE A C   
1871 O  O   . ILE A 228 ? 1.7243 1.1354 1.6007 -0.0192 0.2557  -0.1315 228 ILE A O   
1872 C  CB  . ILE A 228 ? 1.8807 1.2664 1.7621 -0.0452 0.2979  -0.1687 228 ILE A CB  
1873 C  CG1 . ILE A 228 ? 1.8923 1.2820 1.7725 -0.0558 0.3063  -0.1786 228 ILE A CG1 
1874 C  CG2 . ILE A 228 ? 1.8729 1.2881 1.8026 -0.0179 0.2888  -0.1673 228 ILE A CG2 
1875 C  CD1 . ILE A 228 ? 1.8680 1.2598 1.7887 -0.0487 0.3264  -0.1940 228 ILE A CD1 
1876 N  N   . ALA A 229 ? 1.7633 1.1157 1.6079 -0.0472 0.2889  -0.1472 229 ALA A N   
1877 C  CA  . ALA A 229 ? 1.7611 1.1049 1.6163 -0.0349 0.2885  -0.1369 229 ALA A CA  
1878 C  C   . ALA A 229 ? 1.8093 1.1617 1.6476 -0.0351 0.2702  -0.1193 229 ALA A C   
1879 O  O   . ALA A 229 ? 1.8282 1.1921 1.6835 -0.0154 0.2623  -0.1054 229 ALA A O   
1880 C  CB  . ALA A 229 ? 1.4934 0.7995 1.3410 -0.0453 0.3099  -0.1466 229 ALA A CB  
1881 N  N   . LEU A 230 ? 1.7461 1.0932 1.5502 -0.0558 0.2638  -0.1203 230 LEU A N   
1882 C  CA  . LEU A 230 ? 1.7963 1.1530 1.5847 -0.0579 0.2468  -0.1058 230 LEU A CA  
1883 C  C   . LEU A 230 ? 1.7855 1.1826 1.5852 -0.0412 0.2236  -0.0932 230 LEU A C   
1884 O  O   . LEU A 230 ? 1.7813 1.1921 1.5862 -0.0288 0.2116  -0.0769 230 LEU A O   
1885 C  CB  . LEU A 230 ? 1.7352 1.0780 1.4841 -0.0831 0.2446  -0.1141 230 LEU A CB  
1886 C  CG  . LEU A 230 ? 1.7592 1.0648 1.4924 -0.1001 0.2639  -0.1293 230 LEU A CG  
1887 C  CD1 . LEU A 230 ? 1.7734 1.0735 1.4660 -0.1200 0.2568  -0.1392 230 LEU A CD1 
1888 C  CD2 . LEU A 230 ? 1.7599 1.0459 1.5073 -0.0977 0.2728  -0.1231 230 LEU A CD2 
1889 N  N   . MET A 231 ? 1.9755 1.3915 1.7788 -0.0408 0.2175  -0.1008 231 MET A N   
1890 C  CA  . MET A 231 ? 1.9711 1.4271 1.7918 -0.0229 0.1957  -0.0922 231 MET A CA  
1891 C  C   . MET A 231 ? 1.9765 1.4467 1.8350 0.0068  0.1949  -0.0844 231 MET A C   
1892 O  O   . MET A 231 ? 1.9766 1.4703 1.8418 0.0252  0.1776  -0.0691 231 MET A O   
1893 C  CB  . MET A 231 ? 1.6434 1.1118 1.4700 -0.0274 0.1954  -0.1048 231 MET A CB  
1894 C  CG  . MET A 231 ? 1.6420 1.1013 1.4269 -0.0512 0.1915  -0.1097 231 MET A CG  
1895 S  SD  . MET A 231 ? 1.6777 1.1369 1.4660 -0.0592 0.2019  -0.1250 231 MET A SD  
1896 C  CE  . MET A 231 ? 1.6721 1.1687 1.5219 -0.0314 0.1949  -0.1251 231 MET A CE  
1897 N  N   . ILE A 232 ? 1.6560 1.1112 1.5370 0.0131  0.2139  -0.0954 232 ILE A N   
1898 C  CA  . ILE A 232 ? 1.6473 1.1136 1.5627 0.0436  0.2145  -0.0916 232 ILE A CA  
1899 C  C   . ILE A 232 ? 1.6885 1.1439 1.5955 0.0547  0.2131  -0.0729 232 ILE A C   
1900 O  O   . ILE A 232 ? 1.7185 1.1950 1.6434 0.0841  0.2022  -0.0616 232 ILE A O   
1901 C  CB  . ILE A 232 ? 1.5721 1.0197 1.5092 0.0460  0.2369  -0.1085 232 ILE A CB  
1902 C  CG1 . ILE A 232 ? 1.5444 1.0163 1.5096 0.0502  0.2358  -0.1250 232 ILE A CG1 
1903 C  CG2 . ILE A 232 ? 1.5708 1.0160 1.5296 0.0744  0.2404  -0.1025 232 ILE A CG2 
1904 C  CD1 . ILE A 232 ? 1.5033 0.9605 1.4926 0.0521  0.2581  -0.1437 232 ILE A CD1 
1905 N  N   . ILE A 233 ? 1.5905 1.0126 1.4710 0.0323  0.2249  -0.0702 233 ILE A N   
1906 C  CA  . ILE A 233 ? 1.5994 1.0073 1.4712 0.0375  0.2264  -0.0522 233 ILE A CA  
1907 C  C   . ILE A 233 ? 1.5921 1.0284 1.4523 0.0429  0.2038  -0.0349 233 ILE A C   
1908 O  O   . ILE A 233 ? 1.6112 1.0511 1.4751 0.0616  0.2005  -0.0162 233 ILE A O   
1909 C  CB  . ILE A 233 ? 1.5971 0.9637 1.4473 0.0092  0.2442  -0.0576 233 ILE A CB  
1910 C  CG1 . ILE A 233 ? 1.5967 0.9318 1.4619 0.0146  0.2668  -0.0649 233 ILE A CG1 
1911 C  CG2 . ILE A 233 ? 1.5954 0.9559 1.4300 0.0030  0.2397  -0.0408 233 ILE A CG2 
1912 C  CD1 . ILE A 233 ? 1.6009 0.8973 1.4503 -0.0092 0.2830  -0.0701 233 ILE A CD1 
1913 N  N   . ALA A 234 ? 1.5804 1.0357 1.4252 0.0272  0.1891  -0.0409 234 ALA A N   
1914 C  CA  . ALA A 234 ? 1.5775 1.0621 1.4094 0.0300  0.1657  -0.0274 234 ALA A CA  
1915 C  C   . ALA A 234 ? 1.5880 1.1121 1.4456 0.0645  0.1479  -0.0184 234 ALA A C   
1916 O  O   . ALA A 234 ? 1.6020 1.1492 1.4560 0.0789  0.1312  -0.0016 234 ALA A O   
1917 C  CB  . ALA A 234 ? 1.0815 0.5729 0.8881 0.0048  0.1553  -0.0387 234 ALA A CB  
1918 N  N   . LEU A 235 ? 1.6266 1.1589 1.5117 0.0786  0.1518  -0.0313 235 LEU A N   
1919 C  CA  . LEU A 235 ? 1.6463 1.2169 1.5620 0.1140  0.1356  -0.0288 235 LEU A CA  
1920 C  C   . LEU A 235 ? 1.6724 1.2414 1.5983 0.1461  0.1383  -0.0125 235 LEU A C   
1921 O  O   . LEU A 235 ? 1.6754 1.2755 1.6066 0.1726  0.1194  0.0011  235 LEU A O   
1922 C  CB  . LEU A 235 ? 1.5734 1.1501 1.5193 0.1185  0.1427  -0.0507 235 LEU A CB  
1923 C  CG  . LEU A 235 ? 1.5864 1.2102 1.5658 0.1453  0.1214  -0.0570 235 LEU A CG  
1924 C  CD1 . LEU A 235 ? 1.5728 1.2225 1.5378 0.1329  0.0991  -0.0540 235 LEU A CD1 
1925 C  CD2 . LEU A 235 ? 1.6043 1.2303 1.6186 0.1483  0.1331  -0.0808 235 LEU A CD2 
1926 N  N   . SER A 236 ? 1.6413 1.1734 1.5683 0.1451  0.1619  -0.0136 236 SER A N   
1927 C  CA  . SER A 236 ? 1.6838 1.2085 1.6191 0.1777  0.1679  0.0013  236 SER A CA  
1928 C  C   . SER A 236 ? 1.7229 1.2467 1.6370 0.1830  0.1625  0.0277  236 SER A C   
1929 O  O   . SER A 236 ? 1.7166 1.2455 1.6100 0.1591  0.1540  0.0330  236 SER A O   
1930 C  CB  . SER A 236 ? 2.1048 1.5857 2.0430 0.1722  0.1953  -0.0059 236 SER A CB  
1931 O  OG  . SER A 236 ? 2.0757 1.5196 1.9890 0.1424  0.2103  0.0014  236 SER A OG  
1932 N  N   . MET A 237 ? 2.2612 1.7777 2.1802 0.2157  0.1688  0.0436  237 MET A N   
1933 C  CA  . MET A 237 ? 2.2852 1.8028 2.1881 0.2296  0.1658  0.0713  237 MET A CA  
1934 C  C   . MET A 237 ? 2.3316 1.7991 2.2204 0.2150  0.1930  0.0838  237 MET A C   
1935 O  O   . MET A 237 ? 2.3989 1.8445 2.2922 0.2406  0.2078  0.0938  237 MET A O   
1936 C  CB  . MET A 237 ? 2.7765 2.3219 2.6926 0.2821  0.1538  0.0828  237 MET A CB  
1937 C  CG  . MET A 237 ? 2.7622 2.3444 2.7067 0.3036  0.1369  0.0610  237 MET A CG  
1938 S  SD  . MET A 237 ? 2.7812 2.4266 2.7360 0.3430  0.1014  0.0685  237 MET A SD  
1939 C  CE  . MET A 237 ? 2.7176 2.3973 2.7089 0.3414  0.0863  0.0340  237 MET A CE  
1940 N  N   . LEU A 238 ? 1.7485 1.1984 1.6207 0.1750  0.1988  0.0823  238 LEU A N   
1941 C  CA  . LEU A 238 ? 1.7958 1.1981 1.6596 0.1541  0.2246  0.0882  238 LEU A CA  
1942 C  C   . LEU A 238 ? 1.7401 1.1449 1.5871 0.1328  0.2210  0.1013  238 LEU A C   
1943 O  O   . LEU A 238 ? 1.6520 1.0747 1.4887 0.1070  0.2067  0.0895  238 LEU A O   
1944 C  CB  . LEU A 238 ? 1.8860 1.2602 1.7506 0.1201  0.2381  0.0630  238 LEU A CB  
1945 C  CG  . LEU A 238 ? 1.9558 1.3133 1.8359 0.1271  0.2502  0.0448  238 LEU A CG  
1946 C  CD1 . LEU A 238 ? 1.9613 1.2934 1.8354 0.0889  0.2619  0.0227  238 LEU A CD1 
1947 C  CD2 . LEU A 238 ? 2.0588 1.3864 1.9467 0.1527  0.2690  0.0575  238 LEU A CD2 
1948 N  N   . ALA A 239 ? 2.0400 1.4256 1.8838 0.1430  0.2349  0.1246  239 ALA A N   
1949 C  CA  . ALA A 239 ? 2.0030 1.3897 1.8345 0.1217  0.2344  0.1361  239 ALA A CA  
1950 C  C   . ALA A 239 ? 1.9510 1.3410 1.7730 0.0789  0.2263  0.1126  239 ALA A C   
1951 O  O   . ALA A 239 ? 1.9251 1.2871 1.7494 0.0556  0.2392  0.0928  239 ALA A O   
1952 C  CB  . ALA A 239 ? 4.5475 3.8904 4.3820 0.1191  0.2635  0.1527  239 ALA A CB  
1953 N  N   . TRP A 240 ? 2.2812 1.7062 2.0907 0.0710  0.2041  0.1144  240 TRP A N   
1954 C  CA  . TRP A 240 ? 2.2381 1.6711 2.0336 0.0357  0.1924  0.0921  240 TRP A CA  
1955 C  C   . TRP A 240 ? 2.2308 1.6216 2.0256 0.0016  0.2138  0.0739  240 TRP A C   
1956 O  O   . TRP A 240 ? 2.1914 1.5787 1.9768 -0.0206 0.2098  0.0499  240 TRP A O   
1957 C  CB  . TRP A 240 ? 2.3227 1.7877 2.1041 0.0300  0.1728  0.1015  240 TRP A CB  
1958 C  CG  . TRP A 240 ? 2.3688 1.8116 2.1497 0.0117  0.1892  0.1097  240 TRP A CG  
1959 C  CD1 . TRP A 240 ? 2.4348 1.8512 2.2285 0.0237  0.2128  0.1303  240 TRP A CD1 
1960 C  CD2 . TRP A 240 ? 2.3608 1.8050 2.1296 -0.0217 0.1844  0.0958  240 TRP A CD2 
1961 N  NE1 . TRP A 240 ? 2.4682 1.8696 2.2623 -0.0021 0.2243  0.1300  240 TRP A NE1 
1962 C  CE2 . TRP A 240 ? 2.4227 1.8424 2.2023 -0.0299 0.2062  0.1077  240 TRP A CE2 
1963 C  CE3 . TRP A 240 ? 2.3152 1.7784 2.0648 -0.0443 0.1642  0.0737  240 TRP A CE3 
1964 C  CZ2 . TRP A 240 ? 2.4375 1.8541 2.2134 -0.0605 0.2074  0.0957  240 TRP A CZ2 
1965 C  CZ3 . TRP A 240 ? 2.3307 1.7902 2.0718 -0.0724 0.1643  0.0622  240 TRP A CZ3 
1966 C  CH2 . TRP A 240 ? 2.3903 1.8282 2.1465 -0.0807 0.1853  0.0720  240 TRP A CH2 
1967 N  N   . GLN A 241 ? 2.2805 1.6389 2.0855 -0.0003 0.2371  0.0856  241 GLN A N   
1968 C  CA  . GLN A 241 ? 2.2852 1.6040 2.0948 -0.0304 0.2580  0.0696  241 GLN A CA  
1969 C  C   . GLN A 241 ? 2.2537 1.5472 2.0687 -0.0353 0.2692  0.0493  241 GLN A C   
1970 O  O   . GLN A 241 ? 2.2293 1.5097 2.0378 -0.0625 0.2714  0.0249  241 GLN A O   
1971 C  CB  . GLN A 241 ? 2.8212 2.1109 2.6454 -0.0273 0.2819  0.0895  241 GLN A CB  
1972 C  CG  . GLN A 241 ? 2.8682 2.1566 2.7000 0.0122  0.2893  0.1185  241 GLN A CG  
1973 C  CD  . GLN A 241 ? 2.9447 2.2113 2.7853 0.0166  0.3104  0.1432  241 GLN A CD  
1974 O  OE1 . GLN A 241 ? 2.9688 2.2372 2.8100 -0.0067 0.3122  0.1424  241 GLN A OE1 
1975 N  NE2 . GLN A 241 ? 2.9914 2.2367 2.8390 0.0474  0.3273  0.1648  241 GLN A NE2 
1976 N  N   . TYR A 242 ? 2.3255 1.6132 2.1515 -0.0073 0.2757  0.0585  242 TYR A N   
1977 C  CA  . TYR A 242 ? 2.3036 1.5717 2.1362 -0.0077 0.2854  0.0404  242 TYR A CA  
1978 C  C   . TYR A 242 ? 2.2480 1.5389 2.0682 -0.0203 0.2685  0.0182  242 TYR A C   
1979 O  O   . TYR A 242 ? 2.2316 1.5033 2.0498 -0.0375 0.2770  -0.0036 242 TYR A O   
1980 C  CB  . TYR A 242 ? 1.9825 1.2492 1.8285 0.0293  0.2908  0.0539  242 TYR A CB  
1981 C  CG  . TYR A 242 ? 2.0506 1.2837 1.9066 0.0434  0.3131  0.0741  242 TYR A CG  
1982 C  CD1 . TYR A 242 ? 2.1153 1.3400 1.9804 0.0788  0.3208  0.0860  242 TYR A CD1 
1983 C  CD2 . TYR A 242 ? 2.0598 1.2687 1.9169 0.0223  0.3273  0.0805  242 TYR A CD2 
1984 C  CE1 . TYR A 242 ? 2.1883 1.3790 2.0591 0.0934  0.3424  0.1056  242 TYR A CE1 
1985 C  CE2 . TYR A 242 ? 2.1312 1.3066 1.9983 0.0346  0.3501  0.1000  242 TYR A CE2 
1986 C  CZ  . TYR A 242 ? 2.1963 1.3615 2.0681 0.0706  0.3578  0.1135  242 TYR A CZ  
1987 O  OH  . TYR A 242 ? 2.2785 1.4070 2.1569 0.0845  0.3817  0.1342  242 TYR A OH  
1988 N  N   . LYS A 243 ? 1.7551 1.0865 1.5668 -0.0105 0.2450  0.0244  243 LYS A N   
1989 C  CA  . LYS A 243 ? 1.7097 1.0637 1.5085 -0.0216 0.2285  0.0063  243 LYS A CA  
1990 C  C   . LYS A 243 ? 1.6968 1.0412 1.4742 -0.0558 0.2269  -0.0114 243 LYS A C   
1991 O  O   . LYS A 243 ? 1.6874 1.0118 1.4588 -0.0722 0.2361  -0.0323 243 LYS A O   
1992 C  CB  . LYS A 243 ? 1.9362 1.3356 1.7335 -0.0013 0.2032  0.0183  243 LYS A CB  
1993 C  CG  . LYS A 243 ? 1.9544 1.3681 1.7732 0.0365  0.2017  0.0316  243 LYS A CG  
1994 C  CD  . LYS A 243 ? 1.9471 1.3847 1.7749 0.0459  0.1901  0.0171  243 LYS A CD  
1995 C  CE  . LYS A 243 ? 1.9511 1.4291 1.7943 0.0820  0.1708  0.0298  243 LYS A CE  
1996 N  NZ  . LYS A 243 ? 1.9456 1.4581 1.7753 0.0825  0.1466  0.0408  243 LYS A NZ  
1997 N  N   . LEU A 244 ? 2.1022 1.4616 1.8680 -0.0649 0.2151  -0.0043 244 LEU A N   
1998 C  CA  . LEU A 244 ? 2.0998 1.4512 1.8460 -0.0949 0.2128  -0.0231 244 LEU A CA  
1999 C  C   . LEU A 244 ? 2.1086 1.4187 1.8603 -0.1120 0.2357  -0.0415 244 LEU A C   
2000 O  O   . LEU A 244 ? 2.0968 1.3984 1.8324 -0.1281 0.2355  -0.0646 244 LEU A O   
2001 C  CB  . LEU A 244 ? 1.8972 1.2595 1.6411 -0.1013 0.2065  -0.0115 244 LEU A CB  
2002 C  CG  . LEU A 244 ? 1.8967 1.2883 1.6149 -0.1145 0.1822  -0.0200 244 LEU A CG  
2003 C  CD1 . LEU A 244 ? 1.9380 1.3326 1.6591 -0.1250 0.1824  -0.0131 244 LEU A CD1 
2004 C  CD2 . LEU A 244 ? 1.8896 1.2715 1.5843 -0.1357 0.1791  -0.0494 244 LEU A CD2 
2005 N  N   . ALA A 245 ? 2.1226 1.4068 1.8967 -0.1066 0.2555  -0.0307 245 ALA A N   
2006 C  CA  . ALA A 245 ? 2.1398 1.3841 1.9244 -0.1205 0.2777  -0.0465 245 ALA A CA  
2007 C  C   . ALA A 245 ? 2.1223 1.3552 1.9039 -0.1190 0.2835  -0.0635 245 ALA A C   
2008 O  O   . ALA A 245 ? 2.1123 1.3398 1.8769 -0.1366 0.2817  -0.0871 245 ALA A O   
2009 C  CB  . ALA A 245 ? 1.5682 0.7881 1.3781 -0.1087 0.2976  -0.0274 245 ALA A CB  
2010 N  N   . LEU A 246 ? 2.0704 1.2990 1.8681 -0.0965 0.2915  -0.0521 246 LEU A N   
2011 C  CA  . LEU A 246 ? 2.0610 1.2824 1.8607 -0.0912 0.2978  -0.0660 246 LEU A CA  
2012 C  C   . LEU A 246 ? 2.0351 1.2725 1.8108 -0.1046 0.2856  -0.0851 246 LEU A C   
2013 O  O   . LEU A 246 ? 2.0420 1.2608 1.8104 -0.1163 0.2954  -0.1059 246 LEU A O   
2014 C  CB  . LEU A 246 ? 1.5629 0.7971 1.3800 -0.0602 0.2971  -0.0492 246 LEU A CB  
2015 C  CG  . LEU A 246 ? 1.5627 0.7918 1.3927 -0.0456 0.3056  -0.0582 246 LEU A CG  
2016 C  CD1 . LEU A 246 ? 1.5645 0.7624 1.3927 -0.0631 0.3223  -0.0806 246 LEU A CD1 
2017 C  CD2 . LEU A 246 ? 1.5949 0.8204 1.4463 -0.0146 0.3122  -0.0404 246 LEU A CD2 
2018 N  N   . ILE A 247 ? 2.1880 1.4585 1.9500 -0.1022 0.2648  -0.0780 247 ILE A N   
2019 C  CA  . ILE A 247 ? 2.1726 1.4562 1.9073 -0.1157 0.2529  -0.0942 247 ILE A CA  
2020 C  C   . ILE A 247 ? 2.1855 1.4480 1.8996 -0.1401 0.2576  -0.1152 247 ILE A C   
2021 O  O   . ILE A 247 ? 2.1884 1.4357 1.8895 -0.1483 0.2656  -0.1344 247 ILE A O   
2022 C  CB  . ILE A 247 ? 2.2609 1.5815 1.9823 -0.1115 0.2283  -0.0832 247 ILE A CB  
2023 C  CG1 . ILE A 247 ? 2.2525 1.5993 1.9917 -0.0869 0.2200  -0.0696 247 ILE A CG1 
2024 C  CG2 . ILE A 247 ? 2.2574 1.5838 1.9449 -0.1287 0.2174  -0.1011 247 ILE A CG2 
2025 C  CD1 . ILE A 247 ? 2.2535 1.5972 1.9965 -0.0841 0.2275  -0.0830 247 ILE A CD1 
2026 N  N   . VAL A 248 ? 2.1916 1.4543 1.9032 -0.1504 0.2526  -0.1128 248 VAL A N   
2027 C  CA  . VAL A 248 ? 2.2125 1.4591 1.9070 -0.1721 0.2546  -0.1361 248 VAL A CA  
2028 C  C   . VAL A 248 ? 2.2339 1.4449 1.9381 -0.1790 0.2759  -0.1544 248 VAL A C   
2029 O  O   . VAL A 248 ? 2.2495 1.4507 1.9316 -0.1901 0.2765  -0.1783 248 VAL A O   
2030 C  CB  . VAL A 248 ? 1.7884 1.0424 1.4851 -0.1827 0.2469  -0.1328 248 VAL A CB  
2031 C  CG1 . VAL A 248 ? 1.8248 1.0481 1.5363 -0.1982 0.2633  -0.1500 248 VAL A CG1 
2032 C  CG2 . VAL A 248 ? 1.7916 1.0711 1.4543 -0.1911 0.2240  -0.1427 248 VAL A CG2 
2033 N  N   . LEU A 249 ? 2.2616 1.4532 1.9963 -0.1705 0.2927  -0.1438 249 LEU A N   
2034 C  CA  . LEU A 249 ? 2.2878 1.4468 2.0325 -0.1752 0.3119  -0.1611 249 LEU A CA  
2035 C  C   . LEU A 249 ? 2.2866 1.4462 2.0160 -0.1701 0.3142  -0.1726 249 LEU A C   
2036 O  O   . LEU A 249 ? 2.3101 1.4580 2.0200 -0.1807 0.3173  -0.1961 249 LEU A O   
2037 C  CB  . LEU A 249 ? 2.1936 1.3302 1.9724 -0.1652 0.3295  -0.1468 249 LEU A CB  
2038 C  CG  . LEU A 249 ? 2.2037 1.3376 2.0022 -0.1646 0.3321  -0.1275 249 LEU A CG  
2039 C  CD1 . LEU A 249 ? 2.2355 1.3396 2.0632 -0.1535 0.3530  -0.1162 249 LEU A CD1 
2040 C  CD2 . LEU A 249 ? 2.2154 1.3469 2.0112 -0.1866 0.3286  -0.1418 249 LEU A CD2 
2041 N  N   . LEU A 250 ? 2.0433 1.2176 1.7818 -0.1529 0.3128  -0.1566 250 LEU A N   
2042 C  CA  . LEU A 250 ? 2.0394 1.2178 1.7674 -0.1480 0.3157  -0.1659 250 LEU A CA  
2043 C  C   . LEU A 250 ? 2.0493 1.2386 1.7406 -0.1591 0.3049  -0.1800 250 LEU A C   
2044 O  O   . LEU A 250 ? 2.0361 1.2257 1.7154 -0.1571 0.3097  -0.1886 250 LEU A O   
2045 C  CB  . LEU A 250 ? 1.9923 1.1918 1.7390 -0.1273 0.3121  -0.1478 250 LEU A CB  
2046 C  CG  . LEU A 250 ? 1.9544 1.1366 1.7294 -0.1135 0.3291  -0.1460 250 LEU A CG  
2047 C  CD1 . LEU A 250 ? 1.9323 1.1362 1.7298 -0.0894 0.3234  -0.1271 250 LEU A CD1 
2048 C  CD2 . LEU A 250 ? 1.9147 1.0840 1.6829 -0.1181 0.3418  -0.1663 250 LEU A CD2 
2049 N  N   . PHE A 251 ? 2.3864 1.5839 2.0596 -0.1701 0.2913  -0.1824 251 PHE A N   
2050 C  CA  . PHE A 251 ? 2.4005 1.6065 2.0346 -0.1791 0.2797  -0.1964 251 PHE A CA  
2051 C  C   . PHE A 251 ? 2.4388 1.6212 2.0555 -0.1920 0.2866  -0.2225 251 PHE A C   
2052 O  O   . PHE A 251 ? 2.4745 1.6442 2.0698 -0.1929 0.2946  -0.2391 251 PHE A O   
2053 C  CB  . PHE A 251 ? 2.3131 1.5457 1.9357 -0.1814 0.2577  -0.1857 251 PHE A CB  
2054 C  CG  . PHE A 251 ? 2.3382 1.5781 1.9177 -0.1902 0.2442  -0.2011 251 PHE A CG  
2055 C  CD1 . PHE A 251 ? 2.3395 1.5934 1.8968 -0.1847 0.2368  -0.1980 251 PHE A CD1 
2056 C  CD2 . PHE A 251 ? 2.3684 1.6010 1.9303 -0.2029 0.2388  -0.2196 251 PHE A CD2 
2057 C  CE1 . PHE A 251 ? 2.3735 1.6313 1.8873 -0.1908 0.2248  -0.2112 251 PHE A CE1 
2058 C  CE2 . PHE A 251 ? 2.4016 1.6406 1.9202 -0.2080 0.2253  -0.2352 251 PHE A CE2 
2059 C  CZ  . PHE A 251 ? 2.4056 1.6560 1.8978 -0.2015 0.2185  -0.2299 251 PHE A CZ  
2060 N  N   . ALA A 252 ? 2.7517 1.9288 2.3791 -0.2011 0.2840  -0.2270 252 ALA A N   
2061 C  CA  . ALA A 252 ? 2.7912 1.9475 2.4097 -0.2120 0.2897  -0.2546 252 ALA A CA  
2062 C  C   . ALA A 252 ? 2.8233 1.9548 2.4483 -0.2079 0.3091  -0.2664 252 ALA A C   
2063 O  O   . ALA A 252 ? 2.8669 1.9883 2.4638 -0.2099 0.3116  -0.2888 252 ALA A O   
2064 C  CB  . ALA A 252 ? 2.0279 1.1786 1.6736 -0.2216 0.2901  -0.2561 252 ALA A CB  
2065 N  N   . ILE A 253 ? 2.5914 1.7132 2.2502 -0.2001 0.3226  -0.2521 253 ILE A N   
2066 C  CA  . ILE A 253 ? 2.5610 1.6600 2.2253 -0.1965 0.3402  -0.2655 253 ILE A CA  
2067 C  C   . ILE A 253 ? 2.5515 1.6550 2.1815 -0.1925 0.3410  -0.2746 253 ILE A C   
2068 O  O   . ILE A 253 ? 2.5586 1.6455 2.1737 -0.1938 0.3502  -0.2956 253 ILE A O   
2069 C  CB  . ILE A 253 ? 2.0972 1.1860 1.7982 -0.1855 0.3546  -0.2502 253 ILE A CB  
2070 C  CG1 . ILE A 253 ? 2.0498 1.1589 1.7515 -0.1724 0.3520  -0.2316 253 ILE A CG1 
2071 C  CG2 . ILE A 253 ? 2.0402 1.1182 1.7746 -0.1874 0.3581  -0.2391 253 ILE A CG2 
2072 C  CD1 . ILE A 253 ? 2.0353 1.1372 1.7690 -0.1586 0.3646  -0.2203 253 ILE A CD1 
2073 N  N   . PHE A 254 ? 2.0878 1.2133 1.7058 -0.1871 0.3323  -0.2592 254 PHE A N   
2074 C  CA  . PHE A 254 ? 2.0893 1.2171 1.6774 -0.1834 0.3361  -0.2654 254 PHE A CA  
2075 C  C   . PHE A 254 ? 2.1595 1.2851 1.7004 -0.1897 0.3277  -0.2837 254 PHE A C   
2076 O  O   . PHE A 254 ? 2.1777 1.2917 1.6914 -0.1869 0.3375  -0.2969 254 PHE A O   
2077 C  CB  . PHE A 254 ? 2.4380 1.5891 2.0330 -0.1752 0.3305  -0.2447 254 PHE A CB  
2078 C  CG  . PHE A 254 ? 2.4403 1.5907 2.0127 -0.1718 0.3393  -0.2499 254 PHE A CG  
2079 C  CD1 . PHE A 254 ? 2.3973 1.5419 1.9916 -0.1643 0.3571  -0.2492 254 PHE A CD1 
2080 C  CD2 . PHE A 254 ? 2.4958 1.6500 2.0246 -0.1755 0.3311  -0.2561 254 PHE A CD2 
2081 C  CE1 . PHE A 254 ? 2.4103 1.5534 1.9868 -0.1619 0.3683  -0.2537 254 PHE A CE1 
2082 C  CE2 . PHE A 254 ? 2.5099 1.6600 2.0174 -0.1720 0.3424  -0.2593 254 PHE A CE2 
2083 C  CZ  . PHE A 254 ? 2.4679 1.6125 2.0009 -0.1659 0.3619  -0.2577 254 PHE A CZ  
2084 N  N   . ALA A 255 ? 2.5524 1.6891 2.0823 -0.1965 0.3101  -0.2851 255 ALA A N   
2085 C  CA  . ALA A 255 ? 2.6161 1.7514 2.0996 -0.2003 0.3003  -0.3051 255 ALA A CA  
2086 C  C   . ALA A 255 ? 2.6682 1.7811 2.1443 -0.2028 0.3084  -0.3337 255 ALA A C   
2087 O  O   . ALA A 255 ? 2.7206 1.8241 2.1561 -0.1989 0.3100  -0.3527 255 ALA A O   
2088 C  CB  . ALA A 255 ? 2.9024 2.0584 2.3768 -0.2061 0.2782  -0.3006 255 ALA A CB  
2089 N  N   . PHE A 256 ? 3.2025 2.3066 2.7173 -0.2080 0.3131  -0.3373 256 PHE A N   
2090 C  CA  . PHE A 256 ? 3.2486 2.3338 2.7623 -0.2107 0.3183  -0.3669 256 PHE A CA  
2091 C  C   . PHE A 256 ? 3.2153 2.2790 2.7481 -0.2054 0.3386  -0.3733 256 PHE A C   
2092 O  O   . PHE A 256 ? 3.2633 2.3116 2.7942 -0.2053 0.3430  -0.3993 256 PHE A O   
2093 C  CB  . PHE A 256 ? 2.8187 1.9064 2.3615 -0.2215 0.3101  -0.3738 256 PHE A CB  
2094 C  CG  . PHE A 256 ? 2.7953 1.9051 2.3196 -0.2271 0.2897  -0.3715 256 PHE A CG  
2095 C  CD1 . PHE A 256 ? 2.7357 1.8634 2.2804 -0.2300 0.2824  -0.3438 256 PHE A CD1 
2096 C  CD2 . PHE A 256 ? 2.8412 1.9547 2.3266 -0.2274 0.2770  -0.3983 256 PHE A CD2 
2097 C  CE1 . PHE A 256 ? 2.7213 1.8710 2.2491 -0.2349 0.2629  -0.3422 256 PHE A CE1 
2098 C  CE2 . PHE A 256 ? 2.8270 1.9617 2.2948 -0.2321 0.2572  -0.3979 256 PHE A CE2 
2099 C  CZ  . PHE A 256 ? 2.7663 1.9195 2.2560 -0.2367 0.2501  -0.3697 256 PHE A CZ  
2100 N  N   . LYS A 257 ? 2.5908 1.6547 2.1436 -0.1999 0.3497  -0.3515 257 LYS A N   
2101 C  CA  . LYS A 257 ? 2.5635 1.6092 2.1292 -0.1934 0.3688  -0.3579 257 LYS A CA  
2102 C  C   . LYS A 257 ? 2.5741 1.6188 2.1034 -0.1852 0.3769  -0.3613 257 LYS A C   
2103 O  O   . LYS A 257 ? 2.5464 1.5845 2.0879 -0.1789 0.3926  -0.3563 257 LYS A O   
2104 C  CB  . LYS A 257 ? 2.4921 1.5363 2.1022 -0.1902 0.3782  -0.3367 257 LYS A CB  
2105 C  CG  . LYS A 257 ? 2.4854 1.5233 2.1326 -0.1966 0.3757  -0.3328 257 LYS A CG  
2106 C  CD  . LYS A 257 ? 2.4962 1.5139 2.1514 -0.2020 0.3801  -0.3599 257 LYS A CD  
2107 C  CE  . LYS A 257 ? 2.4925 1.5074 2.1813 -0.2112 0.3757  -0.3547 257 LYS A CE  
2108 N  NZ  . LYS A 257 ? 2.5013 1.4928 2.2180 -0.2157 0.3847  -0.3754 257 LYS A NZ  
2109 N  N   . GLU A 258 ? 4.1440 3.1948 3.6283 -0.1850 0.3669  -0.3699 258 GLU A N   
2110 C  CA  . GLU A 258 ? 4.1892 3.2317 3.6301 -0.1763 0.3766  -0.3800 258 GLU A CA  
2111 C  C   . GLU A 258 ? 4.1250 3.1715 3.5731 -0.1713 0.3908  -0.3599 258 GLU A C   
2112 O  O   . GLU A 258 ? 4.1003 3.1583 3.5272 -0.1703 0.3867  -0.3471 258 GLU A O   
2113 C  CB  . GLU A 258 ? 3.1140 2.1360 2.5472 -0.1711 0.3865  -0.4080 258 GLU A CB  
2114 C  CG  . GLU A 258 ? 3.1605 2.1804 2.5923 -0.1756 0.3717  -0.4326 258 GLU A CG  
2115 C  CD  . GLU A 258 ? 3.2587 2.2606 2.6967 -0.1702 0.3800  -0.4610 258 GLU A CD  
2116 O  OE1 . GLU A 258 ? 3.3109 2.3012 2.7431 -0.1613 0.3968  -0.4633 258 GLU A OE1 
2117 O  OE2 . GLU A 258 ? 3.2884 2.2888 2.7391 -0.1747 0.3696  -0.4822 258 GLU A OE2 
2118 N  N   . GLU A 259 ? 5.1186 4.1563 4.5990 -0.1681 0.4072  -0.3585 259 GLU A N   
2119 C  CA  . GLU A 259 ? 5.0691 4.1107 4.5606 -0.1628 0.4227  -0.3447 259 GLU A CA  
2120 C  C   . GLU A 259 ? 5.0111 4.0502 4.5523 -0.1603 0.4336  -0.3390 259 GLU A C   
2121 O  O   . GLU A 259 ? 5.0010 4.0459 4.5586 -0.1555 0.4457  -0.3296 259 GLU A O   
2122 C  CB  . GLU A 259 ? 3.6885 2.7164 3.1405 -0.1556 0.4397  -0.3571 259 GLU A CB  
2123 C  CG  . GLU A 259 ? 3.7433 2.7754 3.1478 -0.1541 0.4361  -0.3527 259 GLU A CG  
2124 C  CD  . GLU A 259 ? 3.8186 2.8392 3.1979 -0.1463 0.4596  -0.3541 259 GLU A CD  
2125 O  OE1 . GLU A 259 ? 3.8294 2.8436 3.2337 -0.1430 0.4782  -0.3563 259 GLU A OE1 
2126 O  OE2 . GLU A 259 ? 3.8749 2.8919 3.2086 -0.1430 0.4602  -0.3530 259 GLU A OE2 
2127 N  N   . LYS A 260 ? 3.5300 2.5606 3.0964 -0.1632 0.4296  -0.3453 260 LYS A N   
2128 C  CA  . LYS A 260 ? 3.4968 2.5174 3.1009 -0.1586 0.4426  -0.3463 260 LYS A CA  
2129 C  C   . LYS A 260 ? 3.4148 2.4465 3.0621 -0.1558 0.4398  -0.3252 260 LYS A C   
2130 O  O   . LYS A 260 ? 3.3682 2.3959 3.0396 -0.1581 0.4329  -0.3201 260 LYS A O   
2131 C  CB  . LYS A 260 ? 2.7788 1.7792 2.3855 -0.1604 0.4445  -0.3680 260 LYS A CB  
2132 C  CG  . LYS A 260 ? 2.8199 1.8111 2.3818 -0.1577 0.4484  -0.3904 260 LYS A CG  
2133 C  CD  . LYS A 260 ? 2.8435 1.8162 2.4095 -0.1562 0.4511  -0.4163 260 LYS A CD  
2134 C  CE  . LYS A 260 ? 2.8894 1.8555 2.4064 -0.1493 0.4535  -0.4386 260 LYS A CE  
2135 N  NZ  . LYS A 260 ? 2.9202 1.8715 2.4388 -0.1451 0.4540  -0.4673 260 LYS A NZ  
2136 N  N   . ILE A 261 ? 2.7596 1.8047 2.4158 -0.1494 0.4465  -0.3141 261 ILE A N   
2137 C  CA  . ILE A 261 ? 2.6923 1.7527 2.3855 -0.1421 0.4437  -0.2958 261 ILE A CA  
2138 C  C   . ILE A 261 ? 2.6742 1.7440 2.3766 -0.1347 0.4577  -0.2960 261 ILE A C   
2139 O  O   . ILE A 261 ? 2.7001 1.7781 2.3795 -0.1372 0.4601  -0.2959 261 ILE A O   
2140 C  CB  . ILE A 261 ? 2.4062 1.4878 2.0962 -0.1444 0.4245  -0.2778 261 ILE A CB  
2141 C  CG1 . ILE A 261 ? 2.4326 1.5070 2.1166 -0.1527 0.4115  -0.2778 261 ILE A CG1 
2142 C  CG2 . ILE A 261 ? 2.3467 1.4461 2.0730 -0.1330 0.4211  -0.2604 261 ILE A CG2 
2143 C  CD1 . ILE A 261 ? 2.4332 1.5273 2.1288 -0.1517 0.3944  -0.2570 261 ILE A CD1 
2144 N  N   . ASN A 262 ? 3.0415 2.1093 2.7776 -0.1254 0.4679  -0.2972 262 ASN A N   
2145 C  CA  . ASN A 262 ? 3.0300 2.1074 2.7797 -0.1187 0.4828  -0.3010 262 ASN A CA  
2146 C  C   . ASN A 262 ? 2.9944 2.0977 2.7772 -0.1089 0.4757  -0.2870 262 ASN A C   
2147 O  O   . ASN A 262 ? 2.9680 2.0785 2.7671 -0.1034 0.4615  -0.2744 262 ASN A O   
2148 C  CB  . ASN A 262 ? 2.9108 1.9712 2.6726 -0.1140 0.5006  -0.3173 262 ASN A CB  
2149 C  CG  . ASN A 262 ? 2.9100 1.9722 2.7134 -0.1018 0.5005  -0.3141 262 ASN A CG  
2150 O  OD1 . ASN A 262 ? 2.9120 1.9856 2.7341 -0.0955 0.4874  -0.2994 262 ASN A OD1 
2151 N  ND2 . ASN A 262 ? 2.9166 1.9673 2.7324 -0.0964 0.5153  -0.3285 262 ASN A ND2 
2152 N  N   . PHE A 263 ? 2.7891 1.9069 2.5822 -0.1059 0.4861  -0.2899 263 PHE A N   
2153 C  CA  . PHE A 263 ? 2.7618 1.9080 2.5869 -0.0961 0.4781  -0.2799 263 PHE A CA  
2154 C  C   . PHE A 263 ? 2.7249 1.8769 2.5865 -0.0805 0.4711  -0.2753 263 PHE A C   
2155 O  O   . PHE A 263 ? 2.7060 1.8746 2.5791 -0.0729 0.4544  -0.2615 263 PHE A O   
2156 C  CB  . PHE A 263 ? 3.4678 2.6262 3.3072 -0.0951 0.4947  -0.2884 263 PHE A CB  
2157 C  CG  . PHE A 263 ? 3.5255 2.6756 3.3261 -0.1081 0.5038  -0.2906 263 PHE A CG  
2158 C  CD1 . PHE A 263 ? 3.5813 2.7084 3.3567 -0.1138 0.5237  -0.3036 263 PHE A CD1 
2159 C  CD2 . PHE A 263 ? 3.5344 2.6989 3.3212 -0.1127 0.4923  -0.2796 263 PHE A CD2 
2160 C  CE1 . PHE A 263 ? 3.6465 2.7635 3.3815 -0.1225 0.5332  -0.3050 263 PHE A CE1 
2161 C  CE2 . PHE A 263 ? 3.5968 2.7505 3.3440 -0.1227 0.5013  -0.2811 263 PHE A CE2 
2162 C  CZ  . PHE A 263 ? 3.6540 2.7832 3.3740 -0.1268 0.5223  -0.2933 263 PHE A CZ  
2163 N  N   . TYR A 264 ? 6.9639 6.8463 6.9456 0.0154  0.0063  -0.0492 264 TYR A N   
2164 C  CA  . TYR A 264 ? 6.9633 6.8353 6.9449 0.0183  0.0073  -0.0523 264 TYR A CA  
2165 C  C   . TYR A 264 ? 6.9638 6.8372 6.9477 0.0161  0.0061  -0.0483 264 TYR A C   
2166 O  O   . TYR A 264 ? 6.9633 6.8359 6.9483 0.0180  0.0066  -0.0478 264 TYR A O   
2167 C  CB  . TYR A 264 ? 2.8865 2.0106 2.8093 -0.0497 0.4915  -0.2967 264 TYR A CB  
2168 C  CG  . TYR A 264 ? 2.9101 2.0385 2.8413 -0.0517 0.5106  -0.3149 264 TYR A CG  
2169 C  CD1 . TYR A 264 ? 2.9497 2.0625 2.8511 -0.0672 0.5238  -0.3244 264 TYR A CD1 
2170 C  CD2 . TYR A 264 ? 2.9032 2.0517 2.8726 -0.0366 0.5161  -0.3237 264 TYR A CD2 
2171 C  CE1 . TYR A 264 ? 2.9848 2.1003 2.8928 -0.0684 0.5436  -0.3395 264 TYR A CE1 
2172 C  CE2 . TYR A 264 ? 2.9342 2.0870 2.9142 -0.0395 0.5355  -0.3409 264 TYR A CE2 
2173 C  CZ  . TYR A 264 ? 2.9765 2.1119 2.9249 -0.0558 0.5500  -0.3474 264 TYR A CZ  
2174 O  OH  . TYR A 264 ? 3.0198 2.1585 2.9774 -0.0582 0.5716  -0.3630 264 TYR A OH  
2175 N  N   . MET A 265 ? 2.7082 1.8286 2.5818 -0.0683 0.4560  -0.2611 265 MET A N   
2176 C  CA  . MET A 265 ? 2.7121 1.8270 2.5823 -0.0672 0.4421  -0.2448 265 MET A CA  
2177 C  C   . MET A 265 ? 2.7022 1.8434 2.5662 -0.0673 0.4246  -0.2290 265 MET A C   
2178 O  O   . MET A 265 ? 2.7003 1.8482 2.5716 -0.0587 0.4122  -0.2126 265 MET A O   
2179 C  CB  . MET A 265 ? 2.8892 1.9761 2.7359 -0.0832 0.4447  -0.2504 265 MET A CB  
2180 C  CG  . MET A 265 ? 2.9126 2.0005 2.7253 -0.1006 0.4429  -0.2576 265 MET A CG  
2181 S  SD  . MET A 265 ? 2.9988 2.0552 2.7891 -0.1157 0.4474  -0.2725 265 MET A SD  
2182 C  CE  . MET A 265 ? 3.0647 2.1053 2.8618 -0.1112 0.4681  -0.2932 265 MET A CE  
2183 N  N   . ILE A 266 ? 2.7489 1.9043 2.5991 -0.0759 0.4246  -0.2340 266 ILE A N   
2184 C  CA  . ILE A 266 ? 2.7426 1.9255 2.5904 -0.0744 0.4085  -0.2216 266 ILE A CA  
2185 C  C   . ILE A 266 ? 2.7129 1.9232 2.5982 -0.0531 0.4033  -0.2167 266 ILE A C   
2186 O  O   . ILE A 266 ? 2.7100 1.9407 2.6020 -0.0438 0.3865  -0.2024 266 ILE A O   
2187 C  CB  . ILE A 266 ? 1.6504 0.8373 1.4727 -0.0886 0.4122  -0.2291 266 ILE A CB  
2188 C  CG1 . ILE A 266 ? 1.7106 0.8746 1.4925 -0.1060 0.4125  -0.2342 266 ILE A CG1 
2189 C  CG2 . ILE A 266 ? 1.6229 0.8391 1.4459 -0.0861 0.3957  -0.2177 266 ILE A CG2 
2190 C  CD1 . ILE A 266 ? 1.7390 0.8998 1.4895 -0.1173 0.4209  -0.2442 266 ILE A CD1 
2191 N  N   . TRP A 267 ? 2.7493 1.9617 2.6596 -0.0443 0.4171  -0.2301 267 TRP A N   
2192 C  CA  . TRP A 267 ? 2.7259 1.9658 2.6752 -0.0220 0.4121  -0.2304 267 TRP A CA  
2193 C  C   . TRP A 267 ? 2.7330 1.9685 2.6966 -0.0018 0.4049  -0.2204 267 TRP A C   
2194 O  O   . TRP A 267 ? 2.7340 1.9936 2.7233 0.0208  0.3941  -0.2154 267 TRP A O   
2195 C  CB  . TRP A 267 ? 3.3756 2.6170 3.3488 -0.0186 0.4305  -0.2505 267 TRP A CB  
2196 C  CG  . TRP A 267 ? 3.3884 2.6296 3.3490 -0.0368 0.4437  -0.2609 267 TRP A CG  
2197 C  CD1 . TRP A 267 ? 3.4143 2.6297 3.3502 -0.0527 0.4617  -0.2713 267 TRP A CD1 
2198 C  CD2 . TRP A 267 ? 3.3871 2.6541 3.3599 -0.0387 0.4415  -0.2621 267 TRP A CD2 
2199 N  NE1 . TRP A 267 ? 3.4339 2.6557 3.3624 -0.0638 0.4722  -0.2772 267 TRP A NE1 
2200 C  CE2 . TRP A 267 ? 3.4163 2.6687 3.3683 -0.0566 0.4606  -0.2716 267 TRP A CE2 
2201 C  CE3 . TRP A 267 ? 3.3713 2.6721 3.3709 -0.0259 0.4252  -0.2564 267 TRP A CE3 
2202 C  CZ2 . TRP A 267 ? 3.4310 2.6985 3.3880 -0.0632 0.4657  -0.2741 267 TRP A CZ2 
2203 C  CZ3 . TRP A 267 ? 3.3805 2.6986 3.3884 -0.0333 0.4285  -0.2607 267 TRP A CZ3 
2204 C  CH2 . TRP A 267 ? 3.4106 2.7107 3.3972 -0.0524 0.4496  -0.2688 267 TRP A CH2 
2205 N  N   . ALA A 268 ? 2.1895 1.3932 2.1371 -0.0084 0.4119  -0.2188 268 ALA A N   
2206 C  CA  . ALA A 268 ? 2.2072 1.4012 2.1615 0.0083  0.4061  -0.2051 268 ALA A CA  
2207 C  C   . ALA A 268 ? 2.2263 1.4301 2.1653 0.0061  0.3889  -0.1839 268 ALA A C   
2208 O  O   . ALA A 268 ? 2.2409 1.4575 2.1923 0.0274  0.3785  -0.1699 268 ALA A O   
2209 C  CB  . ALA A 268 ? 4.6041 3.7593 4.5501 0.0017  0.4202  -0.2104 268 ALA A CB  
2210 N  N   . LEU A 269 ? 2.3433 1.5438 2.2548 -0.0174 0.3850  -0.1822 269 LEU A N   
2211 C  CA  . LEU A 269 ? 2.3647 1.5807 2.2638 -0.0186 0.3671  -0.1639 269 LEU A CA  
2212 C  C   . LEU A 269 ? 2.3591 1.6143 2.2761 -0.0001 0.3514  -0.1569 269 LEU A C   
2213 O  O   . LEU A 269 ? 2.3860 1.6565 2.3060 0.0139  0.3369  -0.1395 269 LEU A O   
2214 C  CB  . LEU A 269 ? 1.9598 1.1700 1.8260 -0.0454 0.3638  -0.1671 269 LEU A CB  
2215 C  CG  . LEU A 269 ? 1.9911 1.1686 1.8408 -0.0605 0.3710  -0.1684 269 LEU A CG  
2216 C  CD1 . LEU A 269 ? 2.0156 1.1838 1.8348 -0.0842 0.3734  -0.1825 269 LEU A CD1 
2217 C  CD2 . LEU A 269 ? 2.0214 1.2010 1.8703 -0.0565 0.3600  -0.1487 269 LEU A CD2 
2218 N  N   . ILE A 270 ? 2.0964 1.3681 2.0258 -0.0004 0.3548  -0.1710 270 ILE A N   
2219 C  CA  . ILE A 270 ? 2.0925 1.4016 2.0458 0.0165  0.3419  -0.1700 270 ILE A CA  
2220 C  C   . ILE A 270 ? 2.0965 1.4168 2.0810 0.0492  0.3383  -0.1669 270 ILE A C   
2221 O  O   . ILE A 270 ? 2.1253 1.4692 2.1183 0.0690  0.3211  -0.1535 270 ILE A O   
2222 C  CB  . ILE A 270 ? 1.8448 1.1632 1.8081 0.0065  0.3520  -0.1886 270 ILE A CB  
2223 C  CG1 . ILE A 270 ? 1.8499 1.1658 1.7795 -0.0191 0.3494  -0.1874 270 ILE A CG1 
2224 C  CG2 . ILE A 270 ? 1.8502 1.2058 1.8534 0.0287  0.3433  -0.1941 270 ILE A CG2 
2225 C  CD1 . ILE A 270 ? 1.8546 1.1859 1.7959 -0.0251 0.3561  -0.2002 270 ILE A CD1 
2226 N  N   . PHE A 271 ? 2.6833 1.9865 2.6827 0.0572  0.3539  -0.1791 271 PHE A N   
2227 C  CA  . PHE A 271 ? 2.6926 2.0055 2.7196 0.0913  0.3508  -0.1790 271 PHE A CA  
2228 C  C   . PHE A 271 ? 2.7286 2.0318 2.7438 0.1079  0.3423  -0.1560 271 PHE A C   
2229 O  O   . PHE A 271 ? 2.7516 2.0795 2.7807 0.1367  0.3278  -0.1469 271 PHE A O   
2230 C  CB  . PHE A 271 ? 2.6712 1.9640 2.7126 0.0951  0.3698  -0.1979 271 PHE A CB  
2231 C  CG  . PHE A 271 ? 2.6842 1.9892 2.7546 0.1318  0.3667  -0.2031 271 PHE A CG  
2232 C  CD1 . PHE A 271 ? 2.6749 2.0039 2.7800 0.1446  0.3695  -0.2259 271 PHE A CD1 
2233 C  CD2 . PHE A 271 ? 2.7153 2.0074 2.7786 0.1548  0.3618  -0.1862 271 PHE A CD2 
2234 C  CE1 . PHE A 271 ? 2.6940 2.0356 2.8257 0.1809  0.3653  -0.2340 271 PHE A CE1 
2235 C  CE2 . PHE A 271 ? 2.7380 2.0399 2.8238 0.1923  0.3586  -0.1917 271 PHE A CE2 
2236 C  CZ  . PHE A 271 ? 2.7263 2.0542 2.8463 0.2060  0.3593  -0.2169 271 PHE A CZ  
2237 N  N   . ILE A 272 ? 2.5874 1.8542 2.5784 0.0907  0.3524  -0.1480 272 ILE A N   
2238 C  CA  . ILE A 272 ? 2.6296 1.8808 2.6046 0.0959  0.3486  -0.1250 272 ILE A CA  
2239 C  C   . ILE A 272 ? 2.6604 1.9420 2.6296 0.1021  0.3283  -0.1076 272 ILE A C   
2240 O  O   . ILE A 272 ? 2.6959 1.9893 2.6712 0.1308  0.3190  -0.0918 272 ILE A O   
2241 C  CB  . ILE A 272 ? 1.7217 0.9367 1.6719 0.0639  0.3603  -0.1240 272 ILE A CB  
2242 C  CG1 . ILE A 272 ? 1.7209 0.8979 1.6756 0.0674  0.3788  -0.1299 272 ILE A CG1 
2243 C  CG2 . ILE A 272 ? 1.7635 0.9772 1.6957 0.0572  0.3511  -0.1020 272 ILE A CG2 
2244 C  CD1 . ILE A 272 ? 1.7347 0.8760 1.6708 0.0394  0.3900  -0.1309 272 ILE A CD1 
2245 N  N   . SER A 273 ? 2.3347 1.6288 2.2898 0.0769  0.3211  -0.1106 273 SER A N   
2246 C  CA  . SER A 273 ? 2.3698 1.6926 2.3169 0.0799  0.3008  -0.0954 273 SER A CA  
2247 C  C   . SER A 273 ? 2.3699 1.7323 2.3437 0.1137  0.2852  -0.0943 273 SER A C   
2248 O  O   . SER A 273 ? 2.4198 1.7991 2.3939 0.1359  0.2715  -0.0766 273 SER A O   
2249 C  CB  . SER A 273 ? 1.7567 1.0854 1.6832 0.0486  0.2958  -0.1019 273 SER A CB  
2250 O  OG  . SER A 273 ? 1.6981 1.0661 1.6339 0.0574  0.2775  -0.1015 273 SER A OG  
2251 N  N   . ILE A 274 ? 2.3597 1.7376 2.3580 0.1198  0.2877  -0.1145 274 ILE A N   
2252 C  CA  . ILE A 274 ? 2.3637 1.7802 2.3940 0.1536  0.2735  -0.1192 274 ILE A CA  
2253 C  C   . ILE A 274 ? 2.3995 1.8115 2.4394 0.1915  0.2734  -0.1101 274 ILE A C   
2254 O  O   . ILE A 274 ? 2.4149 1.8592 2.4733 0.2261  0.2571  -0.1071 274 ILE A O   
2255 C  CB  . ILE A 274 ? 2.0085 1.4393 2.0676 0.1505  0.2802  -0.1457 274 ILE A CB  
2256 C  CG1 . ILE A 274 ? 1.9923 1.4186 2.0354 0.1134  0.2851  -0.1526 274 ILE A CG1 
2257 C  CG2 . ILE A 274 ? 2.0140 1.4898 2.1113 0.1843  0.2631  -0.1542 274 ILE A CG2 
2258 C  CD1 . ILE A 274 ? 1.9519 1.4010 2.0256 0.1117  0.2882  -0.1745 274 ILE A CD1 
2259 N  N   . SER A 275 ? 2.3448 1.7156 2.3710 0.1864  0.2915  -0.1061 275 SER A N   
2260 C  CA  . SER A 275 ? 2.4040 1.7616 2.4306 0.2199  0.2940  -0.0933 275 SER A CA  
2261 C  C   . SER A 275 ? 2.4684 1.8283 2.4742 0.2271  0.2836  -0.0646 275 SER A C   
2262 O  O   . SER A 275 ? 2.5351 1.9089 2.5456 0.2647  0.2746  -0.0523 275 SER A O   
2263 C  CB  . SER A 275 ? 2.6593 1.9701 2.6776 0.2109  0.3169  -0.0973 275 SER A CB  
2264 O  OG  . SER A 275 ? 2.6246 1.9366 2.6635 0.2087  0.3259  -0.1240 275 SER A OG  
2265 N  N   . ILE A 276 ? 2.0292 1.3762 2.0118 0.1927  0.2851  -0.0549 276 ILE A N   
2266 C  CA  . ILE A 276 ? 2.0924 1.4492 2.0573 0.1954  0.2731  -0.0298 276 ILE A CA  
2267 C  C   . ILE A 276 ? 2.1190 1.5267 2.0979 0.2228  0.2480  -0.0273 276 ILE A C   
2268 O  O   . ILE A 276 ? 2.2015 1.6226 2.1810 0.2581  0.2391  -0.0104 276 ILE A O   
2269 C  CB  . ILE A 276 ? 1.6319 0.9757 1.5734 0.1524  0.2750  -0.0270 276 ILE A CB  
2270 C  CG1 . ILE A 276 ? 1.5912 0.8916 1.5255 0.1249  0.2974  -0.0386 276 ILE A CG1 
2271 C  CG2 . ILE A 276 ? 1.7128 1.0575 1.6366 0.1536  0.2683  -0.0013 276 ILE A CG2 
2272 C  CD1 . ILE A 276 ? 1.5861 0.8684 1.4972 0.0886  0.3008  -0.0351 276 ILE A CD1 
2273 N  N   . LEU A 277 ? 2.0402 1.4757 2.0303 0.2080  0.2373  -0.0446 277 LEU A N   
2274 C  CA  . LEU A 277 ? 2.0668 1.5513 2.0800 0.2361  0.2146  -0.0494 277 LEU A CA  
2275 C  C   . LEU A 277 ? 2.1162 1.6115 2.1488 0.2850  0.2115  -0.0483 277 LEU A C   
2276 O  O   . LEU A 277 ? 2.1898 1.7086 2.2203 0.3148  0.1954  -0.0322 277 LEU A O   
2277 C  CB  . LEU A 277 ? 1.5791 1.0840 1.6140 0.2200  0.2118  -0.0751 277 LEU A CB  
2278 C  CG  . LEU A 277 ? 1.5788 1.1148 1.6113 0.2029  0.1934  -0.0763 277 LEU A CG  
2279 C  CD1 . LEU A 277 ? 1.5705 1.1393 1.6402 0.2096  0.1864  -0.1004 277 LEU A CD1 
2280 C  CD2 . LEU A 277 ? 1.6440 1.2063 1.6664 0.2229  0.1711  -0.0544 277 LEU A CD2 
2281 N  N   . HIS A 278 ? 2.4635 1.9415 2.5122 0.2952  0.2264  -0.0651 278 HIS A N   
2282 C  CA  . HIS A 278 ? 2.5082 1.9986 2.5756 0.3450  0.2221  -0.0685 278 HIS A CA  
2283 C  C   . HIS A 278 ? 2.5899 2.0647 2.6344 0.3751  0.2226  -0.0401 278 HIS A C   
2284 O  O   . HIS A 278 ? 2.6315 2.1353 2.6838 0.4183  0.2066  -0.0344 278 HIS A O   
2285 C  CB  . HIS A 278 ? 2.5741 2.0443 2.6591 0.3485  0.2395  -0.0919 278 HIS A CB  
2286 C  CG  . HIS A 278 ? 2.6013 2.1013 2.7175 0.3957  0.2291  -0.1091 278 HIS A CG  
2287 N  ND1 . HIS A 278 ? 2.5741 2.1154 2.7290 0.4011  0.2173  -0.1365 278 HIS A ND1 
2288 C  CD2 . HIS A 278 ? 2.6606 2.1562 2.7756 0.4418  0.2282  -0.1041 278 HIS A CD2 
2289 C  CE1 . HIS A 278 ? 2.6132 2.1763 2.7921 0.4479  0.2088  -0.1501 278 HIS A CE1 
2290 N  NE2 . HIS A 278 ? 2.6674 2.2030 2.8203 0.4746  0.2147  -0.1306 278 HIS A NE2 
2291 N  N   . LEU A 279 ? 2.3231 1.7514 2.3405 0.3533  0.2422  -0.0233 279 LEU A N   
2292 C  CA  . LEU A 279 ? 2.4108 1.8171 2.4041 0.3739  0.2478  0.0070  279 LEU A CA  
2293 C  C   . LEU A 279 ? 2.4777 1.9183 2.4618 0.3841  0.2271  0.0269  279 LEU A C   
2294 O  O   . LEU A 279 ? 2.5300 1.9729 2.5028 0.4204  0.2238  0.0487  279 LEU A O   
2295 C  CB  . LEU A 279 ? 2.5305 1.8838 2.5020 0.3371  0.2721  0.0179  279 LEU A CB  
2296 C  CG  . LEU A 279 ? 2.4704 1.7856 2.4481 0.3287  0.2934  0.0008  279 LEU A CG  
2297 C  CD1 . LEU A 279 ? 2.4772 1.7407 2.4352 0.2973  0.3160  0.0131  279 LEU A CD1 
2298 C  CD2 . LEU A 279 ? 2.4947 1.8066 2.4816 0.3776  0.2958  -0.0031 279 LEU A CD2 
2299 N  N   . SER A 280 ? 4.0093 3.4762 3.9965 0.3537  0.2133  0.0198  280 SER A N   
2300 C  CA  . SER A 280 ? 4.0033 3.5047 3.9814 0.3622  0.1919  0.0376  280 SER A CA  
2301 C  C   . SER A 280 ? 4.0249 3.5819 4.0274 0.4006  0.1647  0.0274  280 SER A C   
2302 O  O   . SER A 280 ? 4.0727 3.6523 4.0698 0.4371  0.1508  0.0447  280 SER A O   
2303 C  CB  . SER A 280 ? 2.2611 1.7621 2.2248 0.3132  0.1890  0.0383  280 SER A CB  
2304 O  OG  . SER A 280 ? 2.2532 1.7084 2.1939 0.2853  0.2104  0.0517  280 SER A OG  
2305 N  N   . GLY A 281 ? 2.1972 1.7763 2.2283 0.3929  0.1579  -0.0014 281 GLY A N   
2306 C  CA  . GLY A 281 ? 2.2115 1.8444 2.2734 0.4240  0.1325  -0.0168 281 GLY A CA  
2307 C  C   . GLY A 281 ? 2.1484 1.7999 2.2264 0.3868  0.1255  -0.0367 281 GLY A C   
2308 O  O   . GLY A 281 ? 2.1198 1.7661 2.1759 0.3519  0.1233  -0.0263 281 GLY A O   
2309 N  N   . GLY A 282 ? 1.7232 1.3945 1.8387 0.3942  0.1234  -0.0659 282 GLY A N   
2310 C  CA  . GLY A 282 ? 1.6644 1.3467 1.7959 0.3583  0.1226  -0.0853 282 GLY A CA  
2311 C  C   . GLY A 282 ? 1.6243 1.3386 1.8060 0.3770  0.1169  -0.1172 282 GLY A C   
2312 O  O   . GLY A 282 ? 1.5761 1.2717 1.7740 0.3688  0.1358  -0.1367 282 GLY A O   
2313 N  N   . ALA A 307 ? 2.2651 3.0705 1.3416 0.2710  -0.5386 -0.2067 307 ALA A N   
2314 C  CA  . ALA A 307 ? 2.2056 3.0138 1.4238 0.2035  -0.4931 -0.1828 307 ALA A CA  
2315 C  C   . ALA A 307 ? 2.0502 2.8877 1.2824 0.1826  -0.4392 -0.1513 307 ALA A C   
2316 O  O   . ALA A 307 ? 1.8715 2.7033 1.1446 0.1258  -0.3873 -0.0903 307 ALA A O   
2317 C  CB  . ALA A 307 ? 1.3675 2.1754 0.7603 0.2001  -0.5287 -0.2627 307 ALA A CB  
2318 N  N   . PHE A 308 ? 2.3499 3.2184 1.5431 0.2332  -0.4549 -0.1951 308 PHE A N   
2319 C  CA  . PHE A 308 ? 2.2227 3.1236 1.4089 0.2265  -0.4107 -0.1725 308 PHE A CA  
2320 C  C   . PHE A 308 ? 2.1759 3.0819 1.5022 0.1688  -0.3670 -0.1550 308 PHE A C   
2321 O  O   . PHE A 308 ? 1.9512 2.8423 1.2739 0.1155  -0.3188 -0.0796 308 PHE A O   
2322 C  CB  . PHE A 308 ? 1.7669 2.6727 0.7890 0.2299  -0.3707 -0.0916 308 PHE A CB  
2323 C  CG  . PHE A 308 ? 1.8827 2.8072 0.7631 0.3063  -0.3995 -0.1190 308 PHE A CG  
2324 C  CD1 . PHE A 308 ? 2.0614 2.9677 0.8873 0.3581  -0.4599 -0.1670 308 PHE A CD1 
2325 C  CD2 . PHE A 308 ? 1.8248 2.7851 0.6216 0.3295  -0.3649 -0.0950 308 PHE A CD2 
2326 C  CE1 . PHE A 308 ? 2.1778 3.0987 0.8623 0.4354  -0.4855 -0.1900 308 PHE A CE1 
2327 C  CE2 . PHE A 308 ? 1.9431 2.9216 0.6060 0.4041  -0.3847 -0.1161 308 PHE A CE2 
2328 C  CZ  . PHE A 308 ? 2.1173 3.0742 0.7222 0.4593  -0.4443 -0.1629 308 PHE A CZ  
2329 N  N   . MET A 309 ? 1.3919 2.3186 0.8365 0.1853  -0.3866 -0.2262 309 MET A N   
2330 C  CA  . MET A 309 ? 1.3454 2.2740 0.9383 0.1398  -0.3530 -0.2218 309 MET A CA  
2331 C  C   . MET A 309 ? 1.3330 2.2965 0.9311 0.1582  -0.3388 -0.2387 309 MET A C   
2332 O  O   . MET A 309 ? 1.5871 2.5776 1.1582 0.2167  -0.3788 -0.3047 309 MET A O   
2333 C  CB  . MET A 309 ? 1.4357 2.3551 1.2013 0.1395  -0.3890 -0.2945 309 MET A CB  
2334 C  CG  . MET A 309 ? 1.5315 2.4322 1.2940 0.1609  -0.4392 -0.3335 309 MET A CG  
2335 S  SD  . MET A 309 ? 1.8639 2.7772 1.7741 0.2126  -0.5164 -0.4641 309 MET A SD  
2336 C  CE  . MET A 309 ? 1.6256 2.5388 1.7686 0.1628  -0.4826 -0.4752 309 MET A CE  
2337 N  N   . TYR A 310 ? 1.4361 2.3994 1.0712 0.1125  -0.2856 -0.1842 310 TYR A N   
2338 C  CA  . TYR A 310 ? 1.3996 2.3954 1.0408 0.1254  -0.2683 -0.1941 310 TYR A CA  
2339 C  C   . TYR A 310 ? 1.4346 2.4221 1.2438 0.0916  -0.2518 -0.2071 310 TYR A C   
2340 O  O   . TYR A 310 ? 1.3168 2.2725 1.2072 0.0476  -0.2325 -0.1774 310 TYR A O   
2341 C  CB  . TYR A 310 ? 1.9085 2.9145 1.4250 0.1072  -0.2178 -0.1121 310 TYR A CB  
2342 C  CG  . TYR A 310 ? 1.8334 2.8384 1.1905 0.1285  -0.2209 -0.0763 310 TYR A CG  
2343 C  CD1 . TYR A 310 ? 1.6556 2.6246 0.9796 0.0972  -0.2147 -0.0262 310 TYR A CD1 
2344 C  CD2 . TYR A 310 ? 1.9183 2.9577 1.1571 0.1823  -0.2283 -0.0904 310 TYR A CD2 
2345 C  CE1 . TYR A 310 ? 1.6275 2.5906 0.8117 0.1166  -0.2184 0.0095  310 TYR A CE1 
2346 C  CE2 . TYR A 310 ? 1.9105 2.9449 1.0029 0.2029  -0.2263 -0.0500 310 TYR A CE2 
2347 C  CZ  . TYR A 310 ? 1.7987 2.7929 0.8684 0.1684  -0.2222 0.0004  310 TYR A CZ  
2348 O  OH  . TYR A 310 ? 1.8165 2.8012 0.7500 0.1883  -0.2205 0.0431  310 TYR A OH  
2349 N  N   . PHE A 311 ? 1.5228 2.5382 1.3821 0.1146  -0.2585 -0.2499 311 PHE A N   
2350 C  CA  . PHE A 311 ? 1.4508 2.4569 1.4700 0.0873  -0.2441 -0.2623 311 PHE A CA  
2351 C  C   . PHE A 311 ? 1.0744 2.0519 1.1016 0.0261  -0.1835 -0.1724 311 PHE A C   
2352 O  O   . PHE A 311 ? 0.9074 1.8825 0.8148 0.0096  -0.1544 -0.1075 311 PHE A O   
2353 C  CB  . PHE A 311 ? 1.1751 2.2196 1.2046 0.1244  -0.2568 -0.3095 311 PHE A CB  
2354 C  CG  . PHE A 311 ? 1.0275 2.0632 1.2274 0.1067  -0.2527 -0.3349 311 PHE A CG  
2355 C  CD1 . PHE A 311 ? 1.1724 2.2072 1.5200 0.1296  -0.2997 -0.4179 311 PHE A CD1 
2356 C  CD2 . PHE A 311 ? 0.7777 1.8058 0.9931 0.0706  -0.2046 -0.2781 311 PHE A CD2 
2357 C  CE1 . PHE A 311 ? 1.0612 2.0848 1.5729 0.1129  -0.2945 -0.4371 311 PHE A CE1 
2358 C  CE2 . PHE A 311 ? 0.6815 1.6970 1.0495 0.0569  -0.2010 -0.2978 311 PHE A CE2 
2359 C  CZ  . PHE A 311 ? 0.8158 1.8282 1.3325 0.0766  -0.2440 -0.3744 311 PHE A CZ  
2360 N  N   . ASN A 312 ? 1.3438 2.2980 1.5103 -0.0052 -0.1644 -0.1664 312 ASN A N   
2361 C  CA  . ASN A 312 ? 1.0275 1.9502 1.1907 -0.0564 -0.1107 -0.0822 312 ASN A CA  
2362 C  C   . ASN A 312 ? 0.9143 1.8418 1.0752 -0.0702 -0.0760 -0.0462 312 ASN A C   
2363 O  O   . ASN A 312 ? 0.9317 1.8614 1.1984 -0.0641 -0.0807 -0.0795 312 ASN A O   
2364 C  CB  . ASN A 312 ? 1.4339 2.3207 1.7347 -0.0848 -0.1007 -0.0793 312 ASN A CB  
2365 C  CG  . ASN A 312 ? 1.1620 2.0158 1.4373 -0.1285 -0.0496 0.0057  312 ASN A CG  
2366 O  OD1 . ASN A 312 ? 1.0751 1.9306 1.2509 -0.1397 -0.0238 0.0590  312 ASN A OD1 
2367 N  ND2 . ASN A 312 ? 1.0499 1.8751 1.4193 -0.1504 -0.0352 0.0165  312 ASN A ND2 
2368 N  N   . VAL A 313 ? 1.1103 2.0374 1.1618 -0.0887 -0.0434 0.0200  313 VAL A N   
2369 C  CA  . VAL A 313 ? 1.0127 1.9461 1.0645 -0.0988 -0.0145 0.0491  313 VAL A CA  
2370 C  C   . VAL A 313 ? 0.7963 1.6903 0.9480 -0.1301 0.0147  0.0824  313 VAL A C   
2371 O  O   . VAL A 313 ? 0.7033 1.5941 0.8443 -0.1411 0.0399  0.1169  313 VAL A O   
2372 C  CB  . VAL A 313 ? 1.1678 2.1111 1.0904 -0.1115 0.0130  0.1117  313 VAL A CB  
2373 C  CG1 . VAL A 313 ? 1.1260 2.1127 1.0080 -0.0884 0.0156  0.0961  313 VAL A CG1 
2374 C  CG2 . VAL A 313 ? 1.0964 2.0402 0.9199 -0.1093 0.0033  0.1290  313 VAL A CG2 
2375 N  N   . ASN A 314 ? 1.1978 2.0616 1.4445 -0.1428 0.0138  0.0753  314 ASN A N   
2376 C  CA  . ASN A 314 ? 1.0149 1.8378 1.3388 -0.1712 0.0505  0.1210  314 ASN A CA  
2377 C  C   . ASN A 314 ? 1.0508 1.8641 1.5218 -0.1659 0.0477  0.0862  314 ASN A C   
2378 O  O   . ASN A 314 ? 0.9564 1.7447 1.4633 -0.1795 0.0772  0.1243  314 ASN A O   
2379 C  CB  . ASN A 314 ? 1.3920 2.1837 1.7256 -0.1931 0.0672  0.1552  314 ASN A CB  
2380 C  CG  . ASN A 314 ? 1.3159 2.1037 1.5127 -0.2059 0.0816  0.2115  314 ASN A CG  
2381 O  OD1 . ASN A 314 ? 1.2509 2.0382 1.3796 -0.2123 0.1000  0.2523  314 ASN A OD1 
2382 N  ND2 . ASN A 314 ? 1.3379 2.1225 1.5022 -0.2087 0.0697  0.2104  314 ASN A ND2 
2383 N  N   . GLU A 315 ? 0.9982 1.8298 1.5567 -0.1432 0.0090  0.0124  315 GLU A N   
2384 C  CA  . GLU A 315 ? 1.0751 1.9022 1.7795 -0.1340 -0.0020 -0.0298 315 GLU A CA  
2385 C  C   . GLU A 315 ? 1.1747 2.0360 1.8310 -0.1091 -0.0184 -0.0567 315 GLU A C   
2386 O  O   . GLU A 315 ? 1.3110 2.1874 2.0639 -0.0857 -0.0485 -0.1189 315 GLU A O   
2387 C  CB  . GLU A 315 ? 1.4803 2.3150 2.3145 -0.1162 -0.0431 -0.1065 315 GLU A CB  
2388 C  CG  . GLU A 315 ? 1.6781 2.5549 2.4353 -0.0789 -0.0944 -0.1710 315 GLU A CG  
2389 C  CD  . GLU A 315 ? 1.6732 2.5416 2.3945 -0.0870 -0.0989 -0.1629 315 GLU A CD  
2390 O  OE1 . GLU A 315 ? 1.8790 2.7725 2.5771 -0.0541 -0.1466 -0.2250 315 GLU A OE1 
2391 O  OE2 . GLU A 315 ? 1.4863 2.3228 2.2001 -0.1225 -0.0568 -0.0963 315 GLU A OE2 
2392 N  N   . THR A 316 ? 0.4715 1.3464 0.9850 -0.1137 0.0014  -0.0107 316 THR A N   
2393 C  CA  . THR A 316 ? 0.5753 1.4908 1.0263 -0.0893 -0.0097 -0.0328 316 THR A CA  
2394 C  C   . THR A 316 ? 0.4701 1.3734 0.8693 -0.1095 0.0280  0.0308  316 THR A C   
2395 O  O   . THR A 316 ? 0.5033 1.4337 0.8924 -0.0929 0.0229  0.0120  316 THR A O   
2396 C  CB  . THR A 316 ? 0.5212 1.4859 0.8466 -0.0584 -0.0354 -0.0644 316 THR A CB  
2397 O  OG1 . THR A 316 ? 0.6568 1.6503 1.0423 -0.0173 -0.0833 -0.1522 316 THR A OG1 
2398 C  CG2 . THR A 316 ? 0.5303 1.5302 0.7381 -0.0508 -0.0175 -0.0379 316 THR A CG2 
2399 N  N   . ILE A 317 ? 0.8993 1.7627 1.2710 -0.1410 0.0627  0.1009  317 ILE A N   
2400 C  CA  . ILE A 317 ? 0.7775 1.6319 1.0874 -0.1541 0.0914  0.1564  317 ILE A CA  
2401 C  C   . ILE A 317 ? 0.7104 1.5266 1.1121 -0.1616 0.1080  0.1748  317 ILE A C   
2402 O  O   . ILE A 317 ? 0.6407 1.4131 1.1169 -0.1757 0.1235  0.1966  317 ILE A O   
2403 C  CB  . ILE A 317 ? 0.9257 1.7577 1.1457 -0.1775 0.1156  0.2212  317 ILE A CB  
2404 C  CG1 . ILE A 317 ? 0.9766 1.8403 1.1077 -0.1707 0.0990  0.2077  317 ILE A CG1 
2405 C  CG2 . ILE A 317 ? 0.7850 1.6087 0.9476 -0.1865 0.1381  0.2711  317 ILE A CG2 
2406 C  CD1 . ILE A 317 ? 0.7420 1.6155 0.7556 -0.1814 0.1142  0.2569  317 ILE A CD1 
2407 N  N   . MET A 318 ? 0.7311 1.5622 1.1288 -0.1512 0.1072  0.1692  318 MET A N   
2408 C  CA  . MET A 318 ? 0.7134 1.5061 1.2089 -0.1529 0.1163  0.1784  318 MET A CA  
2409 C  C   . MET A 318 ? 0.5782 1.3105 1.0690 -0.1747 0.1521  0.2515  318 MET A C   
2410 O  O   . MET A 318 ? 0.5879 1.2748 1.1758 -0.1811 0.1663  0.2665  318 MET A O   
2411 C  CB  . MET A 318 ? 0.8724 1.6883 1.3449 -0.1394 0.1119  0.1701  318 MET A CB  
2412 C  CG  . MET A 318 ? 1.0335 1.9107 1.5109 -0.1112 0.0809  0.0996  318 MET A CG  
2413 S  SD  . MET A 318 ? 1.0235 1.9040 1.5345 -0.0991 0.0799  0.0941  318 MET A SD  
2414 C  CE  . MET A 318 ? 1.0681 1.8776 1.7293 -0.1068 0.0817  0.1024  318 MET A CE  
2415 N  N   . GLU A 319 ? 0.9801 1.7148 1.3563 -0.1824 0.1663  0.2961  319 GLU A N   
2416 C  CA  . GLU A 319 ? 0.9340 1.6218 1.2635 -0.1948 0.1953  0.3647  319 GLU A CA  
2417 C  C   . GLU A 319 ? 0.9307 1.5794 1.2965 -0.2076 0.2156  0.3921  319 GLU A C   
2418 O  O   . GLU A 319 ? 0.9352 1.5383 1.2829 -0.2124 0.2436  0.4476  319 GLU A O   
2419 C  CB  . GLU A 319 ? 1.5180 2.2341 1.7248 -0.1986 0.1932  0.3845  319 GLU A CB  
2420 C  CG  . GLU A 319 ? 1.4811 2.1605 1.6201 -0.2061 0.2127  0.4454  319 GLU A CG  
2421 C  CD  . GLU A 319 ? 1.2999 2.0109 1.3398 -0.2119 0.2051  0.4560  319 GLU A CD  
2422 O  OE1 . GLU A 319 ? 1.2642 2.0022 1.2807 -0.2178 0.1959  0.4377  319 GLU A OE1 
2423 O  OE2 . GLU A 319 ? 1.2081 1.9111 1.2063 -0.2023 0.1943  0.4730  319 GLU A OE2 
2424 N  N   . VAL A 320 ? 1.0497 1.7178 1.4691 -0.2094 0.2011  0.3505  320 VAL A N   
2425 C  CA  . VAL A 320 ? 1.0448 1.6866 1.4968 -0.2220 0.2188  0.3706  320 VAL A CA  
2426 C  C   . VAL A 320 ? 1.0855 1.7205 1.6904 -0.2212 0.2119  0.3281  320 VAL A C   
2427 O  O   . VAL A 320 ? 1.0950 1.7226 1.7512 -0.2299 0.2179  0.3236  320 VAL A O   
2428 C  CB  . VAL A 320 ? 0.8950 1.5650 1.2491 -0.2271 0.2068  0.3683  320 VAL A CB  
2429 C  CG1 . VAL A 320 ? 0.9039 1.6060 1.3078 -0.2213 0.1769  0.3057  320 VAL A CG1 
2430 C  CG2 . VAL A 320 ? 0.8632 1.4983 1.1719 -0.2390 0.2358  0.4261  320 VAL A CG2 
2431 N  N   . ASN A 321 ? 1.1102 1.7482 1.7960 -0.2099 0.1975  0.2951  321 ASN A N   
2432 C  CA  . ASN A 321 ? 1.2140 1.8394 2.0649 -0.2079 0.1894  0.2564  321 ASN A CA  
2433 C  C   . ASN A 321 ? 1.2085 1.7737 2.1286 -0.2237 0.2376  0.3206  321 ASN A C   
2434 O  O   . ASN A 321 ? 1.1708 1.7092 1.9959 -0.2296 0.2707  0.3869  321 ASN A O   
2435 C  CB  . ASN A 321 ? 1.0186 1.6563 1.9255 -0.1904 0.1642  0.2154  321 ASN A CB  
2436 C  CG  . ASN A 321 ? 1.1688 1.8095 2.2476 -0.1820 0.1374  0.1511  321 ASN A CG  
2437 O  OD1 . ASN A 321 ? 1.2050 1.8524 2.3517 -0.1856 0.1273  0.1213  321 ASN A OD1 
2438 N  ND2 . ASN A 321 ? 1.2719 1.9076 2.4289 -0.1690 0.1218  0.1254  321 ASN A ND2 
2439 N  N   . THR A 322 ? 0.5881 1.1319 1.6739 -0.2278 0.2426  0.3023  322 THR A N   
2440 C  CA  . THR A 322 ? 0.6233 1.1116 1.7849 -0.2424 0.2964  0.3675  322 THR A CA  
2441 C  C   . THR A 322 ? 0.7166 1.1542 1.9463 -0.2392 0.3228  0.4094  322 THR A C   
2442 O  O   . THR A 322 ? 0.7184 1.1613 1.9190 -0.2260 0.2997  0.3935  322 THR A O   
2443 C  CB  . THR A 322 ? 0.8598 1.3510 2.1772 -0.2525 0.2955  0.3329  322 THR A CB  
2444 O  OG1 . THR A 322 ? 0.8422 1.3886 2.1370 -0.2437 0.2426  0.2555  322 THR A OG1 
2445 C  CG2 . THR A 322 ? 0.8635 1.3254 2.1733 -0.2684 0.3505  0.3988  322 THR A CG2 
2446 N  N   . ILE A 323 ? 0.6115 0.9989 1.9312 -0.2497 0.3737  0.4660  323 ILE A N   
2447 C  CA  . ILE A 323 ? 0.7339 1.0688 2.1302 -0.2447 0.3976  0.5055  323 ILE A CA  
2448 C  C   . ILE A 323 ? 0.8935 1.1843 2.4851 -0.2574 0.4382  0.5321  323 ILE A C   
2449 O  O   . ILE A 323 ? 0.9073 1.1985 2.5573 -0.2718 0.4679  0.5455  323 ILE A O   
2450 C  CB  . ILE A 323 ? 1.1312 1.4281 2.3748 -0.2331 0.4306  0.5846  323 ILE A CB  
2451 C  CG1 . ILE A 323 ? 0.9867 1.3265 2.0494 -0.2245 0.3979  0.5659  323 ILE A CG1 
2452 C  CG2 . ILE A 323 ? 1.2421 1.4992 2.5342 -0.2204 0.4294  0.6002  323 ILE A CG2 
2453 C  CD1 . ILE A 323 ? 0.9685 1.2930 1.9483 -0.2065 0.3861  0.5828  323 ILE A CD1 
2454 N  N   . ASP A 324 ? 1.2521 1.5064 2.9525 -0.2520 0.4378  0.5370  324 ASP A N   
2455 C  CA  . ASP A 324 ? 1.4506 1.6478 3.3240 -0.2622 0.4872  0.5858  324 ASP A CA  
2456 C  C   . ASP A 324 ? 1.5462 1.6861 3.3016 -0.2537 0.5511  0.6938  324 ASP A C   
2457 O  O   . ASP A 324 ? 1.5481 1.6706 3.1850 -0.2352 0.5404  0.7155  324 ASP A O   
2458 C  CB  . ASP A 324 ? 3.0690 3.2459 5.0941 -0.2562 0.4567  0.5499  324 ASP A CB  
2459 C  CG  . ASP A 324 ? 3.0430 3.2820 5.1315 -0.2500 0.3775  0.4332  324 ASP A CG  
2460 O  OD1 . ASP A 324 ? 2.9666 3.2545 5.0624 -0.2558 0.3539  0.3792  324 ASP A OD1 
2461 O  OD2 . ASP A 324 ? 3.1291 3.3676 5.2572 -0.2354 0.3377  0.3944  324 ASP A OD2 
2462 N  N   . PRO A 325 ? 1.3886 1.5756 1.5924 -0.1368 0.1885  -0.2068 325 PRO A N   
2463 C  CA  . PRO A 325 ? 1.3802 1.5050 1.5516 -0.1385 0.2010  -0.1895 325 PRO A CA  
2464 C  C   . PRO A 325 ? 1.4619 1.5297 1.6044 -0.1398 0.1932  -0.1936 325 PRO A C   
2465 O  O   . PRO A 325 ? 1.4424 1.4634 1.5520 -0.1353 0.1974  -0.1797 325 PRO A O   
2466 C  CB  . PRO A 325 ? 0.8509 0.9657 1.0377 -0.1536 0.2205  -0.1876 325 PRO A CB  
2467 C  CG  . PRO A 325 ? 0.9334 1.0987 1.1633 -0.1621 0.2157  -0.2086 325 PRO A CG  
2468 C  CD  . PRO A 325 ? 0.8331 1.0546 1.0728 -0.1476 0.1974  -0.2149 325 PRO A CD  
2469 N  N   . GLU A 326 ? 1.1636 1.2359 1.3189 -0.1451 0.1814  -0.2133 326 GLU A N   
2470 C  CA  . GLU A 326 ? 1.2432 1.2667 1.3745 -0.1440 0.1711  -0.2188 326 GLU A CA  
2471 C  C   . GLU A 326 ? 1.1065 1.1244 1.2128 -0.1274 0.1604  -0.2100 326 GLU A C   
2472 O  O   . GLU A 326 ? 1.1140 1.0808 1.1879 -0.1231 0.1614  -0.1993 326 GLU A O   
2473 C  CB  . GLU A 326 ? 1.9166 1.9618 2.0725 -0.1490 0.1574  -0.2437 326 GLU A CB  
2474 C  CG  . GLU A 326 ? 2.1201 2.1393 2.2923 -0.1668 0.1657  -0.2548 326 GLU A CG  
2475 C  CD  . GLU A 326 ? 2.2724 2.2406 2.4293 -0.1688 0.1565  -0.2638 326 GLU A CD  
2476 O  OE1 . GLU A 326 ? 2.2180 2.1766 2.3545 -0.1561 0.1416  -0.2641 326 GLU A OE1 
2477 O  OE2 . GLU A 326 ? 2.4223 2.3596 2.5895 -0.1829 0.1645  -0.2705 326 GLU A OE2 
2478 N  N   . VAL A 327 ? 1.3010 1.3731 1.4231 -0.1176 0.1504  -0.2152 327 VAL A N   
2479 C  CA  . VAL A 327 ? 1.1744 1.2484 1.2798 -0.1022 0.1417  -0.2081 327 VAL A CA  
2480 C  C   . VAL A 327 ? 1.0502 1.1157 1.1421 -0.0961 0.1539  -0.1862 327 VAL A C   
2481 O  O   . VAL A 327 ? 0.9674 1.0162 1.0414 -0.0855 0.1502  -0.1783 327 VAL A O   
2482 C  CB  . VAL A 327 ? 1.0911 1.2279 1.2169 -0.0930 0.1308  -0.2172 327 VAL A CB  
2483 C  CG1 . VAL A 327 ? 1.0564 1.1816 1.1681 -0.0823 0.1172  -0.2222 327 VAL A CG1 
2484 C  CG2 . VAL A 327 ? 1.2113 1.3865 1.3656 -0.1015 0.1256  -0.2376 327 VAL A CG2 
2485 N  N   . PHE A 328 ? 1.3641 1.4436 1.4680 -0.1024 0.1687  -0.1777 328 PHE A N   
2486 C  CA  . PHE A 328 ? 1.2696 1.3357 1.3602 -0.0968 0.1808  -0.1582 328 PHE A CA  
2487 C  C   . PHE A 328 ? 1.3367 1.3346 1.3916 -0.0973 0.1815  -0.1536 328 PHE A C   
2488 O  O   . PHE A 328 ? 1.2652 1.2442 1.3009 -0.0862 0.1749  -0.1484 328 PHE A O   
2489 C  CB  . PHE A 328 ? 1.2149 1.2999 1.3237 -0.1051 0.1976  -0.1515 328 PHE A CB  
2490 C  CG  . PHE A 328 ? 1.1284 1.2022 1.2267 -0.0994 0.2108  -0.1328 328 PHE A CG  
2491 C  CD1 . PHE A 328 ? 0.9792 1.0818 1.0825 -0.0856 0.2085  -0.1230 328 PHE A CD1 
2492 C  CD2 . PHE A 328 ? 1.2134 1.2465 1.2968 -0.1077 0.2266  -0.1251 328 PHE A CD2 
2493 C  CE1 . PHE A 328 ? 0.9091 1.0004 1.0056 -0.0804 0.2209  -0.1072 328 PHE A CE1 
2494 C  CE2 . PHE A 328 ? 1.1499 1.1733 1.2241 -0.1022 0.2387  -0.1099 328 PHE A CE2 
2495 C  CZ  . PHE A 328 ? 0.9937 1.0463 1.0758 -0.0886 0.2353  -0.1017 328 PHE A CZ  
2496 N  N   . MET A 329 ? 1.4902 1.4513 1.5366 -0.1099 0.1889  -0.1563 329 MET A N   
2497 C  CA  . MET A 329 ? 1.5182 1.4132 1.5273 -0.1098 0.1896  -0.1512 329 MET A CA  
2498 C  C   . MET A 329 ? 1.4435 1.3259 1.4385 -0.0982 0.1703  -0.1580 329 MET A C   
2499 O  O   . MET A 329 ? 1.3427 1.2023 1.3154 -0.0879 0.1678  -0.1500 329 MET A O   
2500 C  CB  . MET A 329 ? 1.2923 1.1510 1.2967 -0.1241 0.1959  -0.1567 329 MET A CB  
2501 C  CG  . MET A 329 ? 1.4181 1.3138 1.4593 -0.1378 0.2060  -0.1641 329 MET A CG  
2502 S  SD  . MET A 329 ? 1.5078 1.3745 1.5441 -0.1517 0.2334  -0.1518 329 MET A SD  
2503 C  CE  . MET A 329 ? 1.5103 1.2933 1.4987 -0.1526 0.2339  -0.1458 329 MET A CE  
2504 N  N   . GLN A 330 ? 1.3597 1.2596 1.3704 -0.0994 0.1565  -0.1742 330 GLN A N   
2505 C  CA  . GLN A 330 ? 1.3134 1.2002 1.3129 -0.0889 0.1379  -0.1830 330 GLN A CA  
2506 C  C   . GLN A 330 ? 1.1886 1.0896 1.1834 -0.0747 0.1340  -0.1754 330 GLN A C   
2507 O  O   . GLN A 330 ? 1.1122 0.9738 1.0813 -0.0675 0.1312  -0.1697 330 GLN A O   
2508 C  CB  . GLN A 330 ? 1.3200 1.2417 1.3451 -0.0909 0.1251  -0.2022 330 GLN A CB  
2509 C  CG  . GLN A 330 ? 1.3934 1.2850 1.4193 -0.1021 0.1227  -0.2142 330 GLN A CG  
2510 C  CD  . GLN A 330 ? 1.5467 1.4844 1.6056 -0.1065 0.1143  -0.2342 330 GLN A CD  
2511 O  OE1 . GLN A 330 ? 1.5274 1.5057 1.5981 -0.0975 0.1037  -0.2418 330 GLN A OE1 
2512 N  NE2 . GLN A 330 ? 1.6561 1.5893 1.7311 -0.1206 0.1198  -0.2434 330 GLN A NE2 
2513 N  N   . ARG A 331 ? 1.2354 1.1930 1.2559 -0.0703 0.1336  -0.1761 331 ARG A N   
2514 C  CA  . ARG A 331 ? 1.0878 1.0650 1.1105 -0.0584 0.1357  -0.1655 331 ARG A CA  
2515 C  C   . ARG A 331 ? 1.0428 0.9801 1.0422 -0.0547 0.1442  -0.1515 331 ARG A C   
2516 O  O   . ARG A 331 ? 0.9748 0.8978 0.9647 -0.0442 0.1381  -0.1501 331 ARG A O   
2517 C  CB  . ARG A 331 ? 0.9818 1.0195 1.0321 -0.0578 0.1439  -0.1596 331 ARG A CB  
2518 C  CG  . ARG A 331 ? 0.9699 1.0561 1.0412 -0.0547 0.1335  -0.1721 331 ARG A CG  
2519 C  CD  . ARG A 331 ? 0.8677 1.0092 0.9592 -0.0483 0.1408  -0.1617 331 ARG A CD  
2520 N  NE  . ARG A 331 ? 0.8023 0.9732 0.9003 -0.0359 0.1349  -0.1611 331 ARG A NE  
2521 C  CZ  . ARG A 331 ? 0.6972 0.8703 0.7951 -0.0259 0.1413  -0.1464 331 ARG A CZ  
2522 N  NH1 . ARG A 331 ? 0.6437 0.7907 0.7343 -0.0265 0.1523  -0.1326 331 ARG A NH1 
2523 N  NH2 . ARG A 331 ? 0.6610 0.8620 0.7673 -0.0155 0.1381  -0.1457 331 ARG A NH2 
2524 N  N   . ILE A 332 ? 1.2810 1.2016 1.2726 -0.0629 0.1587  -0.1424 332 ILE A N   
2525 C  CA  . ILE A 332 ? 1.2195 1.1031 1.1871 -0.0585 0.1666  -0.1308 332 ILE A CA  
2526 C  C   . ILE A 332 ? 1.2148 1.0377 1.1463 -0.0554 0.1574  -0.1347 332 ILE A C   
2527 O  O   . ILE A 332 ? 1.1252 0.9257 1.0399 -0.0457 0.1544  -0.1313 332 ILE A O   
2528 C  CB  . ILE A 332 ? 1.0152 0.9008 0.9848 -0.0665 0.1864  -0.1192 332 ILE A CB  
2529 C  CG1 . ILE A 332 ? 0.9546 0.8956 0.9556 -0.0628 0.1940  -0.1119 332 ILE A CG1 
2530 C  CG2 . ILE A 332 ? 1.0293 0.8675 0.9674 -0.0634 0.1940  -0.1104 332 ILE A CG2 
2531 C  CD1 . ILE A 332 ? 0.9846 0.9430 0.9997 -0.0721 0.2114  -0.1047 332 ILE A CD1 
2532 N  N   . SER A 333 ? 1.4934 1.2901 1.4143 -0.0628 0.1521  -0.1424 333 SER A N   
2533 C  CA  . SER A 333 ? 1.4628 1.1996 1.3472 -0.0590 0.1430  -0.1447 333 SER A CA  
2534 C  C   . SER A 333 ? 1.4832 1.2048 1.3666 -0.0588 0.1254  -0.1593 333 SER A C   
2535 O  O   . SER A 333 ? 1.4525 1.1261 1.3065 -0.0528 0.1152  -0.1613 333 SER A O   
2536 C  CB  . SER A 333 ? 1.4658 1.1597 1.3213 -0.0662 0.1589  -0.1332 333 SER A CB  
2537 O  OG  . SER A 333 ? 1.5441 1.2618 1.4204 -0.0800 0.1762  -0.1291 333 SER A OG  
2538 N  N   . SER A 334 ? 1.8151 1.5776 1.7301 -0.0641 0.1211  -0.1702 334 SER A N   
2539 C  CA  . SER A 334 ? 1.8495 1.6032 1.7689 -0.0637 0.1046  -0.1862 334 SER A CA  
2540 C  C   . SER A 334 ? 1.9202 1.6275 1.8228 -0.0731 0.1074  -0.1868 334 SER A C   
2541 O  O   . SER A 334 ? 1.8990 1.5656 1.7825 -0.0677 0.0943  -0.1925 334 SER A O   
2542 C  CB  . SER A 334 ? 1.5598 1.2917 1.4641 -0.0490 0.0867  -0.1922 334 SER A CB  
2543 O  OG  . SER A 334 ? 1.5276 1.3005 1.4506 -0.0404 0.0841  -0.1930 334 SER A OG  
2544 N  N   . SER A 335 ? 1.6015 1.3141 1.5126 -0.0866 0.1248  -0.1807 335 SER A N   
2545 C  CA  . SER A 335 ? 1.6862 1.3513 1.5818 -0.0968 0.1321  -0.1785 335 SER A CA  
2546 C  C   . SER A 335 ? 1.7525 1.4146 1.6480 -0.1092 0.1564  -0.1655 335 SER A C   
2547 O  O   . SER A 335 ? 1.7054 1.3401 1.5719 -0.1057 0.1667  -0.1506 335 SER A O   
2548 C  CB  . SER A 335 ? 2.7382 2.3389 2.5901 -0.0867 0.1232  -0.1729 335 SER A CB  
2549 O  OG  . SER A 335 ? 2.8219 2.3740 2.6574 -0.0956 0.1306  -0.1691 335 SER A OG  
2550 N  N   . VAL A 336 ? 1.3568 1.0468 1.2853 -0.1236 0.1655  -0.1727 336 VAL A N   
2551 C  CA  . VAL A 336 ? 1.4453 1.1375 1.3808 -0.1364 0.1893  -0.1627 336 VAL A CA  
2552 C  C   . VAL A 336 ? 1.4669 1.0941 1.3613 -0.1390 0.2045  -0.1462 336 VAL A C   
2553 O  O   . VAL A 336 ? 1.4857 1.1114 1.3699 -0.1407 0.2214  -0.1331 336 VAL A O   
2554 C  CB  . VAL A 336 ? 1.0200 0.7427 0.9978 -0.1524 0.1953  -0.1763 336 VAL A CB  
2555 C  CG1 . VAL A 336 ? 1.1277 0.8403 1.1110 -0.1668 0.2210  -0.1666 336 VAL A CG1 
2556 C  CG2 . VAL A 336 ? 1.0365 0.8321 1.0527 -0.1494 0.1858  -0.1886 336 VAL A CG2 
2557 N  N   . LEU A 337 ? 1.3955 0.9691 1.2655 -0.1386 0.1986  -0.1467 337 LEU A N   
2558 C  CA  . LEU A 337 ? 1.4386 0.9466 1.2637 -0.1390 0.2118  -0.1301 337 LEU A CA  
2559 C  C   . LEU A 337 ? 1.3318 0.8268 1.1196 -0.1240 0.2097  -0.1180 337 LEU A C   
2560 O  O   . LEU A 337 ? 1.3796 0.8533 1.1435 -0.1261 0.2286  -0.1034 337 LEU A O   
2561 C  CB  . LEU A 337 ? 1.5786 1.0334 1.3842 -0.1372 0.2007  -0.1335 337 LEU A CB  
2562 C  CG  . LEU A 337 ? 1.6658 1.0431 1.4185 -0.1328 0.2060  -0.1180 337 LEU A CG  
2563 C  CD1 . LEU A 337 ? 1.6044 0.9544 1.3233 -0.1121 0.1797  -0.1200 337 LEU A CD1 
2564 C  CD2 . LEU A 337 ? 1.7453 1.0980 1.4668 -0.1362 0.2313  -0.0980 337 LEU A CD2 
2565 N  N   . VAL A 338 ? 1.7792 1.2899 1.5656 -0.1092 0.1875  -0.1257 338 VAL A N   
2566 C  CA  . VAL A 338 ? 1.6756 1.1791 1.4338 -0.0942 0.1824  -0.1184 338 VAL A CA  
2567 C  C   . VAL A 338 ? 1.6579 1.2045 1.4353 -0.0971 0.1977  -0.1123 338 VAL A C   
2568 O  O   . VAL A 338 ? 1.6326 1.1643 1.3844 -0.0898 0.2040  -0.1026 338 VAL A O   
2569 C  CB  . VAL A 338 ? 1.5475 1.0635 1.3094 -0.0792 0.1558  -0.1306 338 VAL A CB  
2570 C  CG1 . VAL A 338 ? 1.4514 0.9546 1.1853 -0.0640 0.1502  -0.1249 338 VAL A CG1 
2571 C  CG2 . VAL A 338 ? 1.5847 1.0606 1.3316 -0.0758 0.1401  -0.1376 338 VAL A CG2 
2572 N  N   . PHE A 339 ? 1.4641 1.0648 1.2871 -0.1068 0.2029  -0.1189 339 PHE A N   
2573 C  CA  . PHE A 339 ? 1.4691 1.1126 1.3142 -0.1096 0.2175  -0.1129 339 PHE A CA  
2574 C  C   . PHE A 339 ? 1.5772 1.1948 1.4077 -0.1201 0.2428  -0.1006 339 PHE A C   
2575 O  O   . PHE A 339 ? 1.5626 1.1821 1.3829 -0.1166 0.2548  -0.0908 339 PHE A O   
2576 C  CB  . PHE A 339 ? 1.4333 1.1395 1.3289 -0.1166 0.2151  -0.1238 339 PHE A CB  
2577 C  CG  . PHE A 339 ? 1.4462 1.2008 1.3678 -0.1172 0.2271  -0.1181 339 PHE A CG  
2578 C  CD1 . PHE A 339 ? 1.3396 1.1255 1.2691 -0.1047 0.2190  -0.1164 339 PHE A CD1 
2579 C  CD2 . PHE A 339 ? 1.5645 1.3335 1.5054 -0.1304 0.2470  -0.1147 339 PHE A CD2 
2580 C  CE1 . PHE A 339 ? 1.3125 1.1408 1.2662 -0.1043 0.2300  -0.1100 339 PHE A CE1 
2581 C  CE2 . PHE A 339 ? 1.5368 1.3505 1.5030 -0.1298 0.2570  -0.1097 339 PHE A CE2 
2582 C  CZ  . PHE A 339 ? 1.4114 1.2540 1.3831 -0.1164 0.2483  -0.1068 339 PHE A CZ  
2583 N  N   . ILE A 340 ? 1.5225 1.1152 1.3534 -0.1331 0.2520  -0.1015 340 ILE A N   
2584 C  CA  . ILE A 340 ? 1.6558 1.2222 1.4747 -0.1447 0.2786  -0.0899 340 ILE A CA  
2585 C  C   . ILE A 340 ? 1.6527 1.1599 1.4135 -0.1351 0.2826  -0.0764 340 ILE A C   
2586 O  O   . ILE A 340 ? 1.7483 1.2381 1.4921 -0.1397 0.3049  -0.0648 340 ILE A O   
2587 C  CB  . ILE A 340 ? 1.2116 0.7583 1.0444 -0.1616 0.2892  -0.0937 340 ILE A CB  
2588 C  CG1 . ILE A 340 ? 1.1949 0.7693 1.0626 -0.1642 0.2697  -0.1118 340 ILE A CG1 
2589 C  CG2 . ILE A 340 ? 1.3657 0.9311 1.2245 -0.1777 0.3169  -0.0896 340 ILE A CG2 
2590 C  CD1 . ILE A 340 ? 1.3394 0.9705 1.2644 -0.1784 0.2766  -0.1243 340 ILE A CD1 
2591 N  N   . LEU A 341 ? 1.8439 1.3203 1.5739 -0.1212 0.2611  -0.0787 341 LEU A N   
2592 C  CA  . LEU A 341 ? 1.8538 1.2751 1.5258 -0.1094 0.2618  -0.0674 341 LEU A CA  
2593 C  C   . LEU A 341 ? 1.7536 1.1957 1.4190 -0.0976 0.2604  -0.0653 341 LEU A C   
2594 O  O   . LEU A 341 ? 1.8051 1.2201 1.4355 -0.0935 0.2733  -0.0550 341 LEU A O   
2595 C  CB  . LEU A 341 ? 1.5105 0.8911 1.1528 -0.0974 0.2379  -0.0717 341 LEU A CB  
2596 C  CG  . LEU A 341 ? 1.6407 0.9772 1.2714 -0.1061 0.2421  -0.0688 341 LEU A CG  
2597 C  CD1 . LEU A 341 ? 1.6249 0.9122 1.2141 -0.0902 0.2201  -0.0690 341 LEU A CD1 
2598 C  CD2 . LEU A 341 ? 1.8119 1.1165 1.4220 -0.1180 0.2729  -0.0529 341 LEU A CD2 
2599 N  N   . SER A 342 ? 1.7562 1.2477 1.4575 -0.0924 0.2453  -0.0756 342 SER A N   
2600 C  CA  . SER A 342 ? 1.6514 1.1688 1.3573 -0.0810 0.2413  -0.0759 342 SER A CA  
2601 C  C   . SER A 342 ? 1.7169 1.2612 1.4406 -0.0887 0.2653  -0.0682 342 SER A C   
2602 O  O   . SER A 342 ? 1.7062 1.2418 1.4110 -0.0810 0.2716  -0.0630 342 SER A O   
2603 C  CB  . SER A 342 ? 1.5953 1.1594 1.3389 -0.0751 0.2214  -0.0879 342 SER A CB  
2604 O  OG  . SER A 342 ? 1.5287 1.0686 1.2552 -0.0648 0.1980  -0.0963 342 SER A OG  
2605 N  N   . PHE A 343 ? 1.6060 1.1840 1.3678 -0.1033 0.2781  -0.0689 343 PHE A N   
2606 C  CA  . PHE A 343 ? 1.6801 1.2859 1.4629 -0.1105 0.3007  -0.0624 343 PHE A CA  
2607 C  C   . PHE A 343 ? 1.7962 1.3555 1.5376 -0.1125 0.3214  -0.0512 343 PHE A C   
2608 O  O   . PHE A 343 ? 1.8122 1.3771 1.5479 -0.1079 0.3330  -0.0459 343 PHE A O   
2609 C  CB  . PHE A 343 ? 1.5114 1.1556 1.3397 -0.1262 0.3100  -0.0669 343 PHE A CB  
2610 C  CG  . PHE A 343 ? 1.5715 1.2592 1.4334 -0.1310 0.3273  -0.0634 343 PHE A CG  
2611 C  CD1 . PHE A 343 ? 1.4555 1.1818 1.3364 -0.1201 0.3211  -0.0629 343 PHE A CD1 
2612 C  CD2 . PHE A 343 ? 1.7327 1.4231 1.6101 -0.1462 0.3504  -0.0607 343 PHE A CD2 
2613 C  CE1 . PHE A 343 ? 1.4693 1.2355 1.3825 -0.1232 0.3365  -0.0592 343 PHE A CE1 
2614 C  CE2 . PHE A 343 ? 1.7465 1.4789 1.6578 -0.1498 0.3655  -0.0586 343 PHE A CE2 
2615 C  CZ  . PHE A 343 ? 1.6144 1.3843 1.5427 -0.1377 0.3579  -0.0575 343 PHE A CZ  
2616 N  N   . ILE A 344 ? 1.6041 1.1163 1.3160 -0.1188 0.3264  -0.0475 344 ILE A N   
2617 C  CA  . ILE A 344 ? 1.7380 1.1985 1.4026 -0.1200 0.3457  -0.0356 344 ILE A CA  
2618 C  C   . ILE A 344 ? 1.6699 1.1022 1.2887 -0.1017 0.3356  -0.0332 344 ILE A C   
2619 O  O   . ILE A 344 ? 1.7341 1.1582 1.3339 -0.0993 0.3520  -0.0268 344 ILE A O   
2620 C  CB  . ILE A 344 ? 1.5293 0.9397 1.1678 -0.1275 0.3488  -0.0313 344 ILE A CB  
2621 C  CG1 . ILE A 344 ? 1.6395 1.0731 1.3233 -0.1480 0.3649  -0.0341 344 ILE A CG1 
2622 C  CG2 . ILE A 344 ? 1.6676 1.0172 1.2442 -0.1233 0.3644  -0.0174 344 ILE A CG2 
2623 C  CD1 . ILE A 344 ? 1.6968 1.0945 1.3729 -0.1550 0.3610  -0.0349 344 ILE A CD1 
2624 N  N   . GLY A 345 ? 2.1770 1.5959 1.7802 -0.0886 0.3085  -0.0399 345 GLY A N   
2625 C  CA  . GLY A 345 ? 2.1105 1.5060 1.6750 -0.0703 0.2951  -0.0411 345 GLY A CA  
2626 C  C   . GLY A 345 ? 2.0481 1.4806 1.6338 -0.0649 0.3001  -0.0436 345 GLY A C   
2627 O  O   . GLY A 345 ? 2.0827 1.4944 1.6354 -0.0544 0.3026  -0.0421 345 GLY A O   
2628 N  N   . PHE A 346 ? 1.7490 1.2370 1.3903 -0.0717 0.3016  -0.0477 346 PHE A N   
2629 C  CA  . PHE A 346 ? 1.6986 1.2260 1.3684 -0.0675 0.3073  -0.0489 346 PHE A CA  
2630 C  C   . PHE A 346 ? 1.8494 1.3751 1.5151 -0.0752 0.3361  -0.0403 346 PHE A C   
2631 O  O   . PHE A 346 ? 1.8634 1.3901 1.5213 -0.0674 0.3424  -0.0399 346 PHE A O   
2632 C  CB  . PHE A 346 ? 1.4778 1.0642 1.2058 -0.0715 0.3006  -0.0538 346 PHE A CB  
2633 C  CG  . PHE A 346 ? 1.4468 1.0738 1.2074 -0.0684 0.3101  -0.0520 346 PHE A CG  
2634 C  CD1 . PHE A 346 ? 1.3365 0.9710 1.0997 -0.0544 0.2985  -0.0562 346 PHE A CD1 
2635 C  CD2 . PHE A 346 ? 1.5414 1.1980 1.3316 -0.0794 0.3312  -0.0466 346 PHE A CD2 
2636 C  CE1 . PHE A 346 ? 1.3176 0.9866 1.1120 -0.0513 0.3084  -0.0537 346 PHE A CE1 
2637 C  CE2 . PHE A 346 ? 1.5233 1.2161 1.3441 -0.0753 0.3398  -0.0443 346 PHE A CE2 
2638 C  CZ  . PHE A 346 ? 1.4107 1.1085 1.2331 -0.0613 0.3287  -0.0472 346 PHE A CZ  
2639 N  N   . ILE A 347 ? 1.2001 0.7247 0.8748 -0.0910 0.3540  -0.0349 347 ILE A N   
2640 C  CA  . ILE A 347 ? 1.3741 0.8927 1.0436 -0.1001 0.3839  -0.0269 347 ILE A CA  
2641 C  C   . ILE A 347 ? 1.4861 0.9512 1.0941 -0.0924 0.3931  -0.0210 347 ILE A C   
2642 O  O   . ILE A 347 ? 1.5787 1.0472 1.1806 -0.0893 0.4081  -0.0191 347 ILE A O   
2643 C  CB  . ILE A 347 ? 1.7676 1.2852 1.4532 -0.1187 0.4007  -0.0233 347 ILE A CB  
2644 C  CG1 . ILE A 347 ? 1.7383 1.3180 1.4896 -0.1275 0.3993  -0.0295 347 ILE A CG1 
2645 C  CG2 . ILE A 347 ? 1.9680 1.4609 1.6317 -0.1267 0.4318  -0.0141 347 ILE A CG2 
2646 C  CD1 . ILE A 347 ? 1.7697 1.3938 1.5535 -0.1230 0.4066  -0.0297 347 ILE A CD1 
2647 N  N   . LEU A 348 ? 1.6248 1.0406 1.1865 -0.0889 0.3842  -0.0181 348 LEU A N   
2648 C  CA  . LEU A 348 ? 1.7546 1.1185 1.2521 -0.0790 0.3899  -0.0123 348 LEU A CA  
2649 C  C   . LEU A 348 ? 1.6564 1.0277 1.1440 -0.0609 0.3733  -0.0210 348 LEU A C   
2650 O  O   . LEU A 348 ? 1.7590 1.1259 1.2295 -0.0563 0.3873  -0.0201 348 LEU A O   
2651 C  CB  . LEU A 348 ? 1.5483 0.8584 0.9987 -0.0759 0.3795  -0.0073 348 LEU A CB  
2652 C  CG  . LEU A 348 ? 1.6288 0.9323 1.0975 -0.0934 0.3897  -0.0017 348 LEU A CG  
2653 C  CD1 . LEU A 348 ? 1.6748 0.9262 1.1017 -0.0877 0.3741  0.0021  348 LEU A CD1 
2654 C  CD2 . LEU A 348 ? 1.8294 1.1288 1.3020 -0.1099 0.4265  0.0085  348 LEU A CD2 
2655 N  N   . LEU A 349 ? 1.8783 1.2627 1.3802 -0.0510 0.3445  -0.0307 349 LEU A N   
2656 C  CA  . LEU A 349 ? 1.7775 1.1726 1.2791 -0.0347 0.3286  -0.0409 349 LEU A CA  
2657 C  C   . LEU A 349 ? 1.8005 1.2290 1.3307 -0.0360 0.3464  -0.0417 349 LEU A C   
2658 O  O   . LEU A 349 ? 1.8577 1.2740 1.3645 -0.0246 0.3468  -0.0465 349 LEU A O   
2659 C  CB  . LEU A 349 ? 1.8867 1.3099 1.4239 -0.0291 0.3014  -0.0511 349 LEU A CB  
2660 C  CG  . LEU A 349 ? 1.7840 1.2186 1.3269 -0.0132 0.2855  -0.0626 349 LEU A CG  
2661 C  CD1 . LEU A 349 ? 1.8721 1.2570 1.3537 0.0016  0.2752  -0.0666 349 LEU A CD1 
2662 C  CD2 . LEU A 349 ? 1.6039 1.0683 1.1857 -0.0092 0.2622  -0.0717 349 LEU A CD2 
2663 N  N   . CYS A 350 ? 1.4639 0.9358 1.0463 -0.0490 0.3599  -0.0384 350 CYS A N   
2664 C  CA  . CYS A 350 ? 1.5052 1.0111 1.1203 -0.0513 0.3784  -0.0378 350 CYS A CA  
2665 C  C   . CYS A 350 ? 1.7147 1.1909 1.2925 -0.0544 0.4037  -0.0319 350 CYS A C   
2666 O  O   . CYS A 350 ? 1.7561 1.2155 1.3061 -0.0431 0.4046  -0.0363 350 CYS A O   
2667 C  CB  . CYS A 350 ? 1.9333 1.4894 1.6082 -0.0644 0.3872  -0.0347 350 CYS A CB  
2668 S  SG  . CYS A 350 ? 1.7175 1.3237 1.4454 -0.0569 0.3647  -0.0414 350 CYS A SG  
2669 N  N   . LYS A 351 ? 1.7503 1.2199 1.3277 -0.0697 0.4245  -0.0229 351 LYS A N   
2670 C  CA  . LYS A 351 ? 1.9817 1.4209 1.5218 -0.0740 0.4522  -0.0160 351 LYS A CA  
2671 C  C   . LYS A 351 ? 2.0801 1.4592 1.5456 -0.0629 0.4451  -0.0137 351 LYS A C   
2672 O  O   . LYS A 351 ? 2.2705 1.6114 1.6969 -0.0695 0.4617  -0.0037 351 LYS A O   
2673 C  CB  . LYS A 351 ? 2.7729 2.2190 2.3340 -0.0939 0.4774  -0.0075 351 LYS A CB  
2674 C  CG  . LYS A 351 ? 2.6602 2.1566 2.2874 -0.1046 0.4709  -0.0104 351 LYS A CG  
2675 C  CD  . LYS A 351 ? 2.5732 2.1253 2.2548 -0.1008 0.4686  -0.0161 351 LYS A CD  
2676 C  CE  . LYS A 351 ? 2.4323 2.0304 2.1691 -0.1072 0.4554  -0.0192 351 LYS A CE  
2677 N  NZ  . LYS A 351 ? 2.4078 2.0597 2.1965 -0.1026 0.4530  -0.0223 351 LYS A NZ  
2678 N  N   . ASP A 352 ? 1.8978 1.2708 1.3473 -0.0457 0.4196  -0.0233 352 ASP A N   
2679 C  CA  . ASP A 352 ? 1.9745 1.2990 1.3569 -0.0298 0.4084  -0.0255 352 ASP A CA  
2680 C  C   . ASP A 352 ? 1.8534 1.1944 1.2443 -0.0133 0.3902  -0.0406 352 ASP A C   
2681 O  O   . ASP A 352 ? 1.9049 1.2137 1.2464 0.0021  0.3788  -0.0467 352 ASP A O   
2682 C  CB  . ASP A 352 ? 2.3407 1.6332 1.6950 -0.0257 0.3857  -0.0234 352 ASP A CB  
2683 C  CG  . ASP A 352 ? 2.5299 1.7719 1.8306 -0.0311 0.4017  -0.0089 352 ASP A CG  
2684 O  OD1 . ASP A 352 ? 2.6830 1.9262 1.9896 -0.0456 0.4324  0.0009  352 ASP A OD1 
2685 O  OD2 . ASP A 352 ? 2.5386 1.7394 1.7927 -0.0204 0.3837  -0.0071 352 ASP A OD2 
2686 N  N   . HIS A 353 ? 3.0365 2.4274 2.4905 -0.0159 0.3873  -0.0468 353 HIS A N   
2687 C  CA  . HIS A 353 ? 2.9264 2.3331 2.3955 -0.0011 0.3699  -0.0613 353 HIS A CA  
2688 C  C   . HIS A 353 ? 2.8551 2.3101 2.3844 -0.0038 0.3808  -0.0650 353 HIS A C   
2689 O  O   . HIS A 353 ? 2.8420 2.3020 2.3755 0.0074  0.3768  -0.0761 353 HIS A O   
2690 C  CB  . HIS A 353 ? 1.9796 1.3855 1.4547 0.0073  0.3376  -0.0689 353 HIS A CB  
2691 C  CG  . HIS A 353 ? 2.0546 1.4102 1.4652 0.0193  0.3207  -0.0717 353 HIS A CG  
2692 N  ND1 . HIS A 353 ? 2.0723 1.4130 1.4591 0.0374  0.3006  -0.0864 353 HIS A ND1 
2693 C  CD2 . HIS A 353 ? 2.1247 1.4410 1.4901 0.0165  0.3209  -0.0617 353 HIS A CD2 
2694 C  CE1 . HIS A 353 ? 2.1497 1.4451 1.4774 0.0464  0.2876  -0.0851 353 HIS A CE1 
2695 N  NE2 . HIS A 353 ? 2.1820 1.4604 1.4949 0.0341  0.3001  -0.0692 353 HIS A NE2 
2696 N  N   . LYS A 354 ? 1.7553 1.2458 1.3323 -0.0179 0.3936  -0.0565 354 LYS A N   
2697 C  CA  . LYS A 354 ? 1.7340 1.2684 1.3654 -0.0209 0.4081  -0.0568 354 LYS A CA  
2698 C  C   . LYS A 354 ? 1.5359 1.1038 1.2139 -0.0130 0.3894  -0.0637 354 LYS A C   
2699 O  O   . LYS A 354 ? 1.4641 1.0740 1.1951 -0.0183 0.3950  -0.0591 354 LYS A O   
2700 C  CB  . LYS A 354 ? 2.0067 1.5294 1.6188 -0.0160 0.4271  -0.0611 354 LYS A CB  
2701 C  CG  . LYS A 354 ? 2.2302 1.7179 1.7923 -0.0228 0.4494  -0.0540 354 LYS A CG  
2702 C  CD  . LYS A 354 ? 2.3877 1.8551 1.9154 -0.0125 0.4605  -0.0624 354 LYS A CD  
2703 C  CE  . LYS A 354 ? 2.6153 2.0409 2.0813 -0.0168 0.4811  -0.0547 354 LYS A CE  
2704 N  NZ  . LYS A 354 ? 2.7859 2.1979 2.2221 -0.0084 0.4969  -0.0626 354 LYS A NZ  
2705 N  N   . SER A 355 ? 2.0993 1.6486 1.7576 0.0004  0.3677  -0.0748 355 SER A N   
2706 C  CA  . SER A 355 ? 1.9192 1.4963 1.6205 0.0083  0.3505  -0.0822 355 SER A CA  
2707 C  C   . SER A 355 ? 1.7811 1.3802 1.5096 0.0023  0.3375  -0.0765 355 SER A C   
2708 O  O   . SER A 355 ? 1.6637 1.3007 1.4421 0.0029  0.3335  -0.0754 355 SER A O   
2709 C  CB  . SER A 355 ? 1.4486 0.9974 1.1198 0.0234  0.3299  -0.0975 355 SER A CB  
2710 O  OG  . SER A 355 ? 1.6240 1.1339 1.2385 0.0277  0.3372  -0.1009 355 SER A OG  
2711 N  N   . MET A 356 ? 1.8442 1.4181 1.5381 -0.0029 0.3312  -0.0729 356 MET A N   
2712 C  CA  . MET A 356 ? 1.7421 1.3328 1.4561 -0.0093 0.3192  -0.0692 356 MET A CA  
2713 C  C   . MET A 356 ? 1.7532 1.3872 1.5138 -0.0211 0.3356  -0.0594 356 MET A C   
2714 O  O   . MET A 356 ? 1.6625 1.3269 1.4560 -0.0247 0.3271  -0.0574 356 MET A O   
2715 C  CB  . MET A 356 ? 1.9952 1.5457 1.6615 -0.0132 0.3136  -0.0668 356 MET A CB  
2716 C  CG  . MET A 356 ? 1.8855 1.4429 1.5632 -0.0150 0.2939  -0.0686 356 MET A CG  
2717 S  SD  . MET A 356 ? 1.6974 1.2822 1.4114 -0.0030 0.2697  -0.0799 356 MET A SD  
2718 C  CE  . MET A 356 ? 1.7248 1.2747 1.4031 0.0134  0.2605  -0.0921 356 MET A CE  
2719 N  N   . LEU A 357 ? 1.5523 1.1902 1.3155 -0.0262 0.3589  -0.0543 357 LEU A N   
2720 C  CA  . LEU A 357 ? 1.5899 1.2708 1.4000 -0.0352 0.3753  -0.0465 357 LEU A CA  
2721 C  C   . LEU A 357 ? 1.4618 1.1841 1.3214 -0.0276 0.3667  -0.0471 357 LEU A C   
2722 O  O   . LEU A 357 ? 1.4186 1.1819 1.3195 -0.0322 0.3684  -0.0410 357 LEU A O   
2723 C  CB  . LEU A 357 ? 1.1118 0.7860 0.9147 -0.0383 0.4007  -0.0440 357 LEU A CB  
2724 C  CG  . LEU A 357 ? 1.2321 0.9298 1.0598 -0.0517 0.4232  -0.0361 357 LEU A CG  
2725 C  CD1 . LEU A 357 ? 1.3058 0.9926 1.1197 -0.0639 0.4216  -0.0326 357 LEU A CD1 
2726 C  CD2 . LEU A 357 ? 1.3822 1.0602 1.1886 -0.0526 0.4463  -0.0363 357 LEU A CD2 
2727 N  N   . LEU A 358 ? 1.9565 1.6675 1.8116 -0.0153 0.3572  -0.0549 358 LEU A N   
2728 C  CA  . LEU A 358 ? 1.8512 1.5958 1.7519 -0.0076 0.3511  -0.0550 358 LEU A CA  
2729 C  C   . LEU A 358 ? 1.7315 1.4970 1.6508 -0.0078 0.3333  -0.0536 358 LEU A C   
2730 O  O   . LEU A 358 ? 1.6145 1.4100 1.5721 -0.0020 0.3290  -0.0515 358 LEU A O   
2731 C  CB  . LEU A 358 ? 1.1366 0.8608 1.0285 0.0049  0.3447  -0.0663 358 LEU A CB  
2732 C  CG  . LEU A 358 ? 1.2336 0.9586 1.1356 0.0085  0.3629  -0.0681 358 LEU A CG  
2733 C  CD1 . LEU A 358 ? 1.2008 0.9084 1.0994 0.0213  0.3535  -0.0824 358 LEU A CD1 
2734 C  CD2 . LEU A 358 ? 1.2311 1.0011 1.1881 0.0061  0.3767  -0.0569 358 LEU A CD2 
2735 N  N   . ALA A 359 ? 1.6067 1.3564 1.4998 -0.0142 0.3239  -0.0547 359 ALA A N   
2736 C  CA  . ALA A 359 ? 1.5065 1.2777 1.4171 -0.0153 0.3080  -0.0546 359 ALA A CA  
2737 C  C   . ALA A 359 ? 1.5004 1.3130 1.4437 -0.0244 0.3168  -0.0455 359 ALA A C   
2738 O  O   . ALA A 359 ? 1.4207 1.2640 1.3892 -0.0234 0.3068  -0.0442 359 ALA A O   
2739 C  CB  . ALA A 359 ? 0.8395 0.5755 0.7105 -0.0171 0.2928  -0.0614 359 ALA A CB  
2740 N  N   . LEU A 360 ? 1.3515 1.1664 1.2951 -0.0327 0.3354  -0.0401 360 LEU A N   
2741 C  CA  . LEU A 360 ? 1.3530 1.2056 1.3258 -0.0421 0.3423  -0.0341 360 LEU A CA  
2742 C  C   . LEU A 360 ? 1.1893 1.0923 1.2051 -0.0372 0.3340  -0.0299 360 LEU A C   
2743 O  O   . LEU A 360 ? 1.1699 1.0924 1.1941 -0.0425 0.3255  -0.0312 360 LEU A O   
2744 C  CB  . LEU A 360 ? 1.1442 1.0020 1.1246 -0.0497 0.3655  -0.0291 360 LEU A CB  
2745 C  CG  . LEU A 360 ? 1.3103 1.1311 1.2544 -0.0613 0.3752  -0.0312 360 LEU A CG  
2746 C  CD1 . LEU A 360 ? 1.4526 1.2702 1.3986 -0.0658 0.4000  -0.0276 360 LEU A CD1 
2747 C  CD2 . LEU A 360 ? 1.3239 1.1580 1.2768 -0.0729 0.3707  -0.0324 360 LEU A CD2 
2748 N  N   . PRO A 361 ? 1.3966 1.3199 1.4389 -0.0268 0.3367  -0.0248 361 PRO A N   
2749 C  CA  . PRO A 361 ? 1.2499 1.2192 1.3290 -0.0210 0.3298  -0.0185 361 PRO A CA  
2750 C  C   . PRO A 361 ? 1.1943 1.1669 1.2655 -0.0210 0.3104  -0.0243 361 PRO A C   
2751 O  O   . PRO A 361 ? 1.1410 1.1469 1.2281 -0.0247 0.3057  -0.0229 361 PRO A O   
2752 C  CB  . PRO A 361 ? 1.2546 1.2254 1.3513 -0.0088 0.3328  -0.0145 361 PRO A CB  
2753 C  CG  . PRO A 361 ? 1.3755 1.3197 1.4597 -0.0099 0.3474  -0.0164 361 PRO A CG  
2754 C  CD  . PRO A 361 ? 1.5023 1.4074 1.5426 -0.0192 0.3457  -0.0249 361 PRO A CD  
2755 N  N   . MET A 362 ? 1.1626 1.1011 1.2095 -0.0167 0.2989  -0.0325 362 MET A N   
2756 C  CA  . MET A 362 ? 1.1261 1.0637 1.1648 -0.0161 0.2806  -0.0399 362 MET A CA  
2757 C  C   . MET A 362 ? 1.2090 1.1414 1.2316 -0.0274 0.2760  -0.0450 362 MET A C   
2758 O  O   . MET A 362 ? 1.1792 1.1317 1.2100 -0.0284 0.2644  -0.0488 362 MET A O   
2759 C  CB  . MET A 362 ? 1.5636 1.4617 1.5778 -0.0098 0.2693  -0.0495 362 MET A CB  
2760 C  CG  . MET A 362 ? 1.4839 1.3875 1.5184 0.0011  0.2712  -0.0478 362 MET A CG  
2761 S  SD  . MET A 362 ? 1.5054 1.3686 1.5135 0.0076  0.2521  -0.0637 362 MET A SD  
2762 C  CE  . MET A 362 ? 1.4664 1.3486 1.4783 0.0049  0.2357  -0.0679 362 MET A CE  
2763 N  N   . LEU A 363 ? 1.0136 0.9179 1.0135 -0.0359 0.2857  -0.0458 363 LEU A N   
2764 C  CA  . LEU A 363 ? 1.1012 1.0059 1.0953 -0.0480 0.2855  -0.0492 363 LEU A CA  
2765 C  C   . LEU A 363 ? 1.0586 1.0189 1.0924 -0.0511 0.2895  -0.0450 363 LEU A C   
2766 O  O   . LEU A 363 ? 1.0310 1.0152 1.0760 -0.0529 0.2779  -0.0501 363 LEU A O   
2767 C  CB  . LEU A 363 ? 1.1689 1.0373 1.1366 -0.0570 0.3002  -0.0482 363 LEU A CB  
2768 C  CG  . LEU A 363 ? 1.2448 1.0665 1.1735 -0.0634 0.2942  -0.0545 363 LEU A CG  
2769 C  CD1 . LEU A 363 ? 1.3826 1.1963 1.3081 -0.0779 0.3113  -0.0521 363 LEU A CD1 
2770 C  CD2 . LEU A 363 ? 1.1835 1.0109 1.1143 -0.0626 0.2739  -0.0627 363 LEU A CD2 
2771 N  N   . ALA A 364 ? 1.2222 1.2045 1.2776 -0.0504 0.3050  -0.0364 364 ALA A N   
2772 C  CA  . ALA A 364 ? 1.1532 1.1877 1.2453 -0.0524 0.3092  -0.0324 364 ALA A CA  
2773 C  C   . ALA A 364 ? 1.0208 1.0956 1.1330 -0.0445 0.2942  -0.0322 364 ALA A C   
2774 O  O   . ALA A 364 ? 1.0262 1.1317 1.1524 -0.0493 0.2880  -0.0374 364 ALA A O   
2775 C  CB  . ALA A 364 ? 0.6808 0.7324 0.7946 -0.0485 0.3258  -0.0224 364 ALA A CB  
2776 N  N   . LEU A 365 ? 1.0432 1.1180 1.1573 -0.0324 0.2892  -0.0273 365 LEU A N   
2777 C  CA  . LEU A 365 ? 0.9455 1.0523 1.0734 -0.0243 0.2763  -0.0267 365 LEU A CA  
2778 C  C   . LEU A 365 ? 0.9909 1.0985 1.1074 -0.0306 0.2611  -0.0398 365 LEU A C   
2779 O  O   . LEU A 365 ? 0.9692 1.1191 1.1036 -0.0300 0.2550  -0.0414 365 LEU A O   
2780 C  CB  . LEU A 365 ? 0.8176 0.9083 0.9425 -0.0133 0.2735  -0.0233 365 LEU A CB  
2781 C  CG  . LEU A 365 ? 0.7191 0.8480 0.8749 -0.0016 0.2795  -0.0091 365 LEU A CG  
2782 C  CD1 . LEU A 365 ? 0.6631 0.7742 0.8204 0.0080  0.2785  -0.0068 365 LEU A CD1 
2783 C  CD2 . LEU A 365 ? 0.7085 0.8838 0.8789 0.0008  0.2712  -0.0077 365 LEU A CD2 
2784 N  N   . GLY A 366 ? 0.7997 0.8611 0.8865 -0.0358 0.2548  -0.0496 366 GLY A N   
2785 C  CA  . GLY A 366 ? 0.8646 0.9208 0.9409 -0.0425 0.2415  -0.0626 366 GLY A CA  
2786 C  C   . GLY A 366 ? 0.9277 1.0117 1.0199 -0.0529 0.2450  -0.0666 366 GLY A C   
2787 O  O   . GLY A 366 ? 0.9232 1.0405 1.0294 -0.0534 0.2350  -0.0740 366 GLY A O   
2788 N  N   . PHE A 367 ? 0.8496 0.9222 0.9419 -0.0608 0.2599  -0.0627 367 PHE A N   
2789 C  CA  . PHE A 367 ? 0.9208 1.0193 1.0330 -0.0717 0.2655  -0.0675 367 PHE A CA  
2790 C  C   . PHE A 367 ? 0.8342 0.9958 0.9816 -0.0649 0.2642  -0.0634 367 PHE A C   
2791 O  O   . PHE A 367 ? 0.8772 1.0725 1.0438 -0.0704 0.2593  -0.0725 367 PHE A O   
2792 C  CB  . PHE A 367 ? 1.2315 1.3028 1.3370 -0.0813 0.2842  -0.0636 367 PHE A CB  
2793 C  CG  . PHE A 367 ? 1.3742 1.3887 1.4457 -0.0903 0.2854  -0.0692 367 PHE A CG  
2794 C  CD1 . PHE A 367 ? 1.3898 1.3582 1.4270 -0.0839 0.2827  -0.0660 367 PHE A CD1 
2795 C  CD2 . PHE A 367 ? 1.5100 1.5171 1.5843 -0.1046 0.2885  -0.0780 367 PHE A CD2 
2796 C  CE1 . PHE A 367 ? 1.5026 1.4178 1.5050 -0.0902 0.2826  -0.0699 367 PHE A CE1 
2797 C  CE2 . PHE A 367 ? 1.6597 1.6117 1.7011 -0.1120 0.2905  -0.0809 367 PHE A CE2 
2798 C  CZ  . PHE A 367 ? 1.6316 1.5372 1.6349 -0.1041 0.2871  -0.0760 367 PHE A CZ  
2799 N  N   . MET A 368 ? 1.1547 1.3322 1.3109 -0.0522 0.2680  -0.0502 368 MET A N   
2800 C  CA  . MET A 368 ? 1.0893 1.3248 1.2760 -0.0433 0.2668  -0.0434 368 MET A CA  
2801 C  C   . MET A 368 ? 1.0944 1.3584 1.2836 -0.0411 0.2497  -0.0536 368 MET A C   
2802 O  O   . MET A 368 ? 1.1147 1.4282 1.3258 -0.0386 0.2451  -0.0560 368 MET A O   
2803 C  CB  . MET A 368 ? 1.8412 2.0829 2.0344 -0.0289 0.2726  -0.0269 368 MET A CB  
2804 C  CG  . MET A 368 ? 1.8064 2.1020 2.0308 -0.0196 0.2765  -0.0159 368 MET A CG  
2805 S  SD  . MET A 368 ? 1.7031 2.0145 1.9378 -0.0003 0.2791  0.0039  368 MET A SD  
2806 C  CE  . MET A 368 ? 1.6660 1.9603 1.8789 0.0025  0.2647  -0.0033 368 MET A CE  
2807 N  N   . ALA A 369 ? 1.1555 1.3878 1.3217 -0.0418 0.2399  -0.0611 369 ALA A N   
2808 C  CA  . ALA A 369 ? 1.1821 1.4356 1.3484 -0.0404 0.2240  -0.0730 369 ALA A CA  
2809 C  C   . ALA A 369 ? 1.2685 1.5608 1.4546 -0.0477 0.2200  -0.0847 369 ALA A C   
2810 O  O   . ALA A 369 ? 1.2727 1.6144 1.4740 -0.0404 0.2115  -0.0872 369 ALA A O   
2811 C  CB  . ALA A 369 ? 0.6071 0.8123 0.7473 -0.0462 0.2158  -0.0842 369 ALA A CB  
2812 N  N   . LEU A 370 ? 1.0738 1.3436 1.2600 -0.0620 0.2268  -0.0922 370 LEU A N   
2813 C  CA  . LEU A 370 ? 1.1770 1.4756 1.3837 -0.0719 0.2231  -0.1076 370 LEU A CA  
2814 C  C   . LEU A 370 ? 1.1782 1.5434 1.4160 -0.0645 0.2209  -0.1063 370 LEU A C   
2815 O  O   . LEU A 370 ? 1.2689 1.6680 1.5250 -0.0693 0.2124  -0.1225 370 LEU A O   
2816 C  CB  . LEU A 370 ? 0.8141 1.0768 1.0197 -0.0883 0.2361  -0.1120 370 LEU A CB  
2817 C  CG  . LEU A 370 ? 0.8986 1.0977 1.0737 -0.0976 0.2361  -0.1172 370 LEU A CG  
2818 C  CD1 . LEU A 370 ? 1.0042 1.1648 1.1710 -0.1077 0.2550  -0.1105 370 LEU A CD1 
2819 C  CD2 . LEU A 370 ? 0.9945 1.1926 1.1738 -0.1070 0.2246  -0.1371 370 LEU A CD2 
2820 N  N   . ARG A 371 ? 1.4547 1.8389 1.6994 -0.0522 0.2280  -0.0881 371 ARG A N   
2821 C  CA  . ARG A 371 ? 1.4672 1.9143 1.7393 -0.0422 0.2253  -0.0843 371 ARG A CA  
2822 C  C   . ARG A 371 ? 1.3791 1.8480 1.6465 -0.0230 0.2224  -0.0668 371 ARG A C   
2823 O  O   . ARG A 371 ? 1.4003 1.9208 1.6844 -0.0108 0.2185  -0.0607 371 ARG A O   
2824 C  CB  . ARG A 371 ? 2.2667 2.7227 2.5614 -0.0466 0.2395  -0.0790 371 ARG A CB  
2825 C  CG  . ARG A 371 ? 2.3167 2.8371 2.6405 -0.0343 0.2361  -0.0741 371 ARG A CG  
2826 C  CD  . ARG A 371 ? 2.3682 2.9024 2.7208 -0.0423 0.2473  -0.0773 371 ARG A CD  
2827 N  NE  . ARG A 371 ? 2.4889 3.0533 2.8641 -0.0529 0.2393  -0.1004 371 ARG A NE  
2828 C  CZ  . ARG A 371 ? 2.5645 3.1696 2.9750 -0.0545 0.2416  -0.1072 371 ARG A CZ  
2829 N  NH1 . ARG A 371 ? 2.5332 3.1537 2.9596 -0.0455 0.2515  -0.0917 371 ARG A NH1 
2830 N  NH2 . ARG A 371 ? 2.6816 3.3129 3.1147 -0.0650 0.2337  -0.1309 371 ARG A NH2 
2831 N  N   . ALA A 372 ? 1.2248 1.6533 1.4695 -0.0201 0.2243  -0.0592 372 ALA A N   
2832 C  CA  . ALA A 372 ? 1.1412 1.5799 1.3835 -0.0038 0.2265  -0.0406 372 ALA A CA  
2833 C  C   . ALA A 372 ? 1.1520 1.5949 1.3799 0.0019  0.2144  -0.0461 372 ALA A C   
2834 O  O   . ALA A 372 ? 1.1594 1.6360 1.3910 0.0162  0.2119  -0.0356 372 ALA A O   
2835 C  CB  . ALA A 372 ? 0.8654 1.2569 1.0982 -0.0040 0.2396  -0.0282 372 ALA A CB  
2836 N  N   . GLY A 373 ? 1.2038 1.6113 1.4152 -0.0089 0.2077  -0.0622 373 GLY A N   
2837 C  CA  . GLY A 373 ? 1.2295 1.6357 1.4280 -0.0044 0.1968  -0.0693 373 GLY A CA  
2838 C  C   . GLY A 373 ? 1.2233 1.5777 1.4022 -0.0151 0.1915  -0.0835 373 GLY A C   
2839 O  O   . GLY A 373 ? 1.1944 1.5041 1.3635 -0.0237 0.1980  -0.0832 373 GLY A O   
2840 N  N   . LEU A 374 ? 1.1184 1.4810 1.2911 -0.0131 0.1792  -0.0959 374 LEU A N   
2841 C  CA  . LEU A 374 ? 1.1339 1.4534 1.2895 -0.0202 0.1711  -0.1103 374 LEU A CA  
2842 C  C   . LEU A 374 ? 1.0439 1.3217 1.1858 -0.0152 0.1754  -0.1006 374 LEU A C   
2843 O  O   . LEU A 374 ? 1.0598 1.2889 1.1851 -0.0217 0.1730  -0.1074 374 LEU A O   
2844 C  CB  . LEU A 374 ? 0.9313 1.2811 1.0887 -0.0161 0.1577  -0.1246 374 LEU A CB  
2845 C  CG  . LEU A 374 ? 1.0184 1.3365 1.1618 -0.0169 0.1478  -0.1375 374 LEU A CG  
2846 C  CD1 . LEU A 374 ? 1.1145 1.4380 1.2607 -0.0267 0.1369  -0.1599 374 LEU A CD1 
2847 C  CD2 . LEU A 374 ? 0.9647 1.3116 1.1104 -0.0037 0.1455  -0.1334 374 LEU A CD2 
2848 N  N   . ARG A 375 ? 1.3204 1.6177 1.4699 -0.0031 0.1820  -0.0847 375 ARG A N   
2849 C  CA  . ARG A 375 ? 1.2473 1.5129 1.3899 0.0030  0.1848  -0.0784 375 ARG A CA  
2850 C  C   . ARG A 375 ? 1.1937 1.4198 1.3305 0.0002  0.1953  -0.0693 375 ARG A C   
2851 O  O   . ARG A 375 ? 1.1410 1.3411 1.2745 0.0054  0.1981  -0.0648 375 ARG A O   
2852 C  CB  . ARG A 375 ? 1.4798 1.7806 1.6359 0.0167  0.1900  -0.0646 375 ARG A CB  
2853 C  CG  . ARG A 375 ? 1.3875 1.6860 1.5545 0.0232  0.2052  -0.0436 375 ARG A CG  
2854 C  CD  . ARG A 375 ? 1.3872 1.7362 1.5705 0.0353  0.2118  -0.0270 375 ARG A CD  
2855 N  NE  . ARG A 375 ? 1.3335 1.6845 1.5298 0.0401  0.2259  -0.0076 375 ARG A NE  
2856 C  CZ  . ARG A 375 ? 1.2782 1.6109 1.4830 0.0465  0.2366  0.0053  375 ARG A CZ  
2857 N  NH1 . ARG A 375 ? 1.2681 1.5808 1.4704 0.0487  0.2344  0.0002  375 ARG A NH1 
2858 N  NH2 . ARG A 375 ? 1.2417 1.5766 1.4604 0.0507  0.2495  0.0218  375 ARG A NH2 
2859 N  N   . PHE A 376 ? 0.9216 1.1443 1.0586 -0.0080 0.2013  -0.0679 376 PHE A N   
2860 C  CA  . PHE A 376 ? 0.8965 1.0843 1.0271 -0.0110 0.2129  -0.0598 376 PHE A CA  
2861 C  C   . PHE A 376 ? 0.9709 1.1046 1.0760 -0.0210 0.2097  -0.0708 376 PHE A C   
2862 O  O   . PHE A 376 ? 0.9646 1.0620 1.0576 -0.0205 0.2163  -0.0663 376 PHE A O   
2863 C  CB  . PHE A 376 ? 1.0427 1.2589 1.1907 -0.0123 0.2248  -0.0491 376 PHE A CB  
2864 C  CG  . PHE A 376 ? 0.9834 1.2430 1.1532 0.0004  0.2303  -0.0335 376 PHE A CG  
2865 C  CD1 . PHE A 376 ? 1.0164 1.3278 1.2019 0.0038  0.2270  -0.0320 376 PHE A CD1 
2866 C  CD2 . PHE A 376 ? 0.9123 1.1608 1.0873 0.0096  0.2386  -0.0203 376 PHE A CD2 
2867 C  CE1 . PHE A 376 ? 0.9875 1.3373 1.1899 0.0173  0.2323  -0.0154 376 PHE A CE1 
2868 C  CE2 . PHE A 376 ? 0.8770 1.1625 1.0722 0.0218  0.2450  -0.0039 376 PHE A CE2 
2869 C  CZ  . PHE A 376 ? 0.9183 1.2536 1.1254 0.0261  0.2420  -0.0004 376 PHE A CZ  
2870 N  N   . THR A 377 ? 1.1511 1.2790 1.2478 -0.0292 0.1997  -0.0852 377 THR A N   
2871 C  CA  . THR A 377 ? 1.2491 1.3249 1.3201 -0.0377 0.1961  -0.0944 377 THR A CA  
2872 C  C   . THR A 377 ? 1.2299 1.2636 1.2812 -0.0309 0.1926  -0.0939 377 THR A C   
2873 O  O   . THR A 377 ? 1.3081 1.2966 1.3359 -0.0346 0.1956  -0.0941 377 THR A O   
2874 C  CB  . THR A 377 ? 1.1572 1.2335 1.2249 -0.0433 0.1823  -0.1109 377 THR A CB  
2875 O  OG1 . THR A 377 ? 1.1211 1.2419 1.2063 -0.0357 0.1742  -0.1142 377 THR A OG1 
2876 C  CG2 . THR A 377 ? 1.2406 1.3259 1.3159 -0.0560 0.1869  -0.1162 377 THR A CG2 
2877 N  N   . ILE A 378 ? 1.1017 1.1510 1.1627 -0.0207 0.1862  -0.0939 378 ILE A N   
2878 C  CA  . ILE A 378 ? 1.0712 1.0889 1.1221 -0.0127 0.1826  -0.0948 378 ILE A CA  
2879 C  C   . ILE A 378 ? 1.0826 1.0682 1.1213 -0.0124 0.1938  -0.0867 378 ILE A C   
2880 O  O   . ILE A 378 ? 1.1432 1.0831 1.1563 -0.0120 0.1886  -0.0930 378 ILE A O   
2881 C  CB  . ILE A 378 ? 0.9980 1.0493 1.0724 -0.0020 0.1820  -0.0907 378 ILE A CB  
2882 C  CG1 . ILE A 378 ? 1.0390 1.0852 1.1102 0.0009  0.1663  -0.1054 378 ILE A CG1 
2883 C  CG2 . ILE A 378 ? 0.9356 0.9738 1.0168 0.0056  0.1908  -0.0817 378 ILE A CG2 
2884 C  CD1 . ILE A 378 ? 1.0809 1.0813 1.1365 0.0049  0.1584  -0.1137 378 ILE A CD1 
2885 N  N   . TYR A 379 ? 1.2649 1.2756 1.3214 -0.0116 0.2087  -0.0733 379 TYR A N   
2886 C  CA  . TYR A 379 ? 1.2809 1.2684 1.3308 -0.0110 0.2213  -0.0657 379 TYR A CA  
2887 C  C   . TYR A 379 ? 1.4126 1.3553 1.4301 -0.0191 0.2227  -0.0707 379 TYR A C   
2888 O  O   . TYR A 379 ? 1.4337 1.3441 1.4348 -0.0167 0.2281  -0.0696 379 TYR A O   
2889 C  CB  . TYR A 379 ? 1.3493 1.3748 1.4248 -0.0108 0.2365  -0.0518 379 TYR A CB  
2890 C  CG  . TYR A 379 ? 1.2341 1.2932 1.3375 -0.0001 0.2391  -0.0426 379 TYR A CG  
2891 C  CD1 . TYR A 379 ? 1.1847 1.2927 1.3120 0.0023  0.2430  -0.0333 379 TYR A CD1 
2892 C  CD2 . TYR A 379 ? 1.1934 1.2350 1.2995 0.0081  0.2377  -0.0433 379 TYR A CD2 
2893 C  CE1 . TYR A 379 ? 1.1057 1.2424 1.2562 0.0131  0.2468  -0.0224 379 TYR A CE1 
2894 C  CE2 . TYR A 379 ? 1.1048 1.1749 1.2385 0.0175  0.2426  -0.0337 379 TYR A CE2 
2895 C  CZ  . TYR A 379 ? 1.0647 1.1814 1.2191 0.0201  0.2477  -0.0219 379 TYR A CZ  
2896 O  OH  . TYR A 379 ? 1.0009 1.1451 1.1806 0.0303  0.2540  -0.0096 379 TYR A OH  
2897 N  N   . ALA A 380 ? 1.3297 1.2697 1.3379 -0.0286 0.2186  -0.0765 380 ALA A N   
2898 C  CA  . ALA A 380 ? 1.4436 1.3420 1.4225 -0.0369 0.2237  -0.0782 380 ALA A CA  
2899 C  C   . ALA A 380 ? 1.4796 1.3337 1.4270 -0.0360 0.2086  -0.0890 380 ALA A C   
2900 O  O   . ALA A 380 ? 1.5431 1.3583 1.4619 -0.0419 0.2119  -0.0896 380 ALA A O   
2901 C  CB  . ALA A 380 ? 0.9715 0.8896 0.9617 -0.0491 0.2328  -0.0767 380 ALA A CB  
2902 N  N   . VAL A 381 ? 1.3132 1.1721 1.2656 -0.0280 0.1927  -0.0970 381 VAL A N   
2903 C  CA  . VAL A 381 ? 1.3181 1.1349 1.2422 -0.0249 0.1766  -0.1080 381 VAL A CA  
2904 C  C   . VAL A 381 ? 1.2755 1.0451 1.1671 -0.0190 0.1771  -0.1073 381 VAL A C   
2905 O  O   . VAL A 381 ? 1.3167 1.0470 1.1758 -0.0236 0.1797  -0.1062 381 VAL A O   
2906 C  CB  . VAL A 381 ? 1.2460 1.0786 1.1850 -0.0167 0.1594  -0.1185 381 VAL A CB  
2907 C  CG1 . VAL A 381 ? 1.1913 0.9779 1.1024 -0.0094 0.1436  -0.1289 381 VAL A CG1 
2908 C  CG2 . VAL A 381 ? 1.2994 1.1617 1.2551 -0.0227 0.1532  -0.1249 381 VAL A CG2 
2909 N  N   . PRO A 382 ? 1.4572 1.2308 1.3577 -0.0086 0.1757  -0.1078 382 PRO A N   
2910 C  CA  . PRO A 382 ? 1.4173 1.1482 1.2881 -0.0004 0.1712  -0.1120 382 PRO A CA  
2911 C  C   . PRO A 382 ? 1.4846 1.1856 1.3248 -0.0056 0.1855  -0.1042 382 PRO A C   
2912 O  O   . PRO A 382 ? 1.5044 1.1606 1.3047 -0.0034 0.1790  -0.1077 382 PRO A O   
2913 C  CB  . PRO A 382 ? 1.3844 1.1378 1.2835 0.0085  0.1737  -0.1122 382 PRO A CB  
2914 C  CG  . PRO A 382 ? 1.4078 1.2111 1.3451 0.0038  0.1860  -0.1021 382 PRO A CG  
2915 C  CD  . PRO A 382 ? 1.4579 1.2770 1.3979 -0.0043 0.1811  -0.1033 382 PRO A CD  
2916 N  N   . VAL A 383 ? 1.3750 1.1005 1.2330 -0.0119 0.2051  -0.0935 383 VAL A N   
2917 C  CA  . VAL A 383 ? 1.4609 1.1618 1.2932 -0.0185 0.2213  -0.0861 383 VAL A CA  
2918 C  C   . VAL A 383 ? 1.5376 1.2086 1.3411 -0.0273 0.2197  -0.0862 383 VAL A C   
2919 O  O   . VAL A 383 ? 1.5864 1.2102 1.3469 -0.0254 0.2193  -0.0862 383 VAL A O   
2920 C  CB  . VAL A 383 ? 1.4401 1.1782 1.3031 -0.0253 0.2417  -0.0758 383 VAL A CB  
2921 C  CG1 . VAL A 383 ? 1.5600 1.2769 1.4010 -0.0355 0.2591  -0.0692 383 VAL A CG1 
2922 C  CG2 . VAL A 383 ? 1.3928 1.1439 1.2732 -0.0162 0.2474  -0.0740 383 VAL A CG2 
2923 N  N   . MET A 384 ? 1.4302 1.1277 1.2568 -0.0361 0.2183  -0.0867 384 MET A N   
2924 C  CA  . MET A 384 ? 1.5119 1.1835 1.3185 -0.0458 0.2188  -0.0871 384 MET A CA  
2925 C  C   . MET A 384 ? 1.4786 1.1064 1.2511 -0.0383 0.1996  -0.0948 384 MET A C   
2926 O  O   . MET A 384 ? 1.5516 1.1489 1.3026 -0.0442 0.1986  -0.0947 384 MET A O   
2927 C  CB  . MET A 384 ? 1.2994 1.0121 1.1422 -0.0554 0.2182  -0.0899 384 MET A CB  
2928 C  CG  . MET A 384 ? 1.3798 1.1274 1.2501 -0.0654 0.2378  -0.0825 384 MET A CG  
2929 S  SD  . MET A 384 ? 1.5191 1.2409 1.3768 -0.0819 0.2507  -0.0811 384 MET A SD  
2930 C  CE  . MET A 384 ? 1.6109 1.3072 1.4459 -0.0841 0.2750  -0.0691 384 MET A CE  
2931 N  N   . ALA A 385 ? 1.4476 1.0721 1.2174 -0.0248 0.1843  -0.1019 385 ALA A N   
2932 C  CA  . ALA A 385 ? 1.4272 1.0090 1.1635 -0.0156 0.1650  -0.1100 385 ALA A CA  
2933 C  C   . ALA A 385 ? 1.4809 1.0150 1.1697 -0.0090 0.1693  -0.1057 385 ALA A C   
2934 O  O   . ALA A 385 ? 1.5540 1.0431 1.2031 -0.0081 0.1653  -0.1040 385 ALA A O   
2935 C  CB  . ALA A 385 ? 1.0736 0.6740 0.8309 -0.0043 0.1451  -0.1222 385 ALA A CB  
2936 N  N   . LEU A 386 ? 1.3854 0.9292 1.0777 -0.0041 0.1785  -0.1036 386 LEU A N   
2937 C  CA  . LEU A 386 ? 1.4656 0.9677 1.1124 0.0025  0.1837  -0.1007 386 LEU A CA  
2938 C  C   . LEU A 386 ? 1.6021 1.0774 1.2208 -0.0090 0.2013  -0.0887 386 LEU A C   
2939 O  O   . LEU A 386 ? 1.6930 1.1197 1.2628 -0.0045 0.1984  -0.0861 386 LEU A O   
2940 C  CB  . LEU A 386 ? 1.5837 1.1057 1.2452 0.0062  0.1962  -0.0997 386 LEU A CB  
2941 C  CG  . LEU A 386 ? 1.4783 1.0217 1.1668 0.0180  0.1828  -0.1112 386 LEU A CG  
2942 C  CD1 . LEU A 386 ? 1.4816 1.0480 1.1922 0.0184  0.1999  -0.1080 386 LEU A CD1 
2943 C  CD2 . LEU A 386 ? 1.4920 0.9973 1.1451 0.0330  0.1613  -0.1236 386 LEU A CD2 
2944 N  N   . GLY A 387 ? 1.7147 1.2225 1.3657 -0.0234 0.2197  -0.0814 387 GLY A N   
2945 C  CA  . GLY A 387 ? 1.8518 1.3412 1.4880 -0.0370 0.2379  -0.0714 387 GLY A CA  
2946 C  C   . GLY A 387 ? 1.8999 1.3458 1.5031 -0.0359 0.2253  -0.0724 387 GLY A C   
2947 O  O   . GLY A 387 ? 2.0226 1.4197 1.5774 -0.0335 0.2311  -0.0655 387 GLY A O   
2948 N  N   . PHE A 388 ? 1.5395 1.0027 1.1679 -0.0366 0.2081  -0.0808 388 PHE A N   
2949 C  CA  . PHE A 388 ? 1.5817 1.0053 1.1842 -0.0352 0.1950  -0.0828 388 PHE A CA  
2950 C  C   . PHE A 388 ? 1.6165 0.9873 1.1633 -0.0197 0.1841  -0.0818 388 PHE A C   
2951 O  O   . PHE A 388 ? 1.7407 1.0641 1.2461 -0.0209 0.1906  -0.0728 388 PHE A O   
2952 C  CB  . PHE A 388 ? 1.5292 0.9784 1.1645 -0.0336 0.1739  -0.0955 388 PHE A CB  
2953 C  CG  . PHE A 388 ? 1.5765 0.9841 1.1877 -0.0314 0.1598  -0.0985 388 PHE A CG  
2954 C  CD1 . PHE A 388 ? 1.6849 1.0737 1.2932 -0.0450 0.1723  -0.0921 388 PHE A CD1 
2955 C  CD2 . PHE A 388 ? 1.5303 0.9169 1.1240 -0.0157 0.1345  -0.1080 388 PHE A CD2 
2956 C  CE1 . PHE A 388 ? 1.7366 1.0852 1.3247 -0.0428 0.1602  -0.0941 388 PHE A CE1 
2957 C  CE2 . PHE A 388 ? 1.5857 0.9336 1.1586 -0.0127 0.1212  -0.1103 388 PHE A CE2 
2958 C  CZ  . PHE A 388 ? 1.6872 1.0153 1.2569 -0.0261 0.1343  -0.1027 388 PHE A CZ  
2959 N  N   . GLY A 389 ? 1.6465 1.0253 1.1923 -0.0049 0.1684  -0.0910 389 GLY A N   
2960 C  CA  . GLY A 389 ? 1.6965 1.0295 1.1910 0.0117  0.1554  -0.0929 389 GLY A CA  
2961 C  C   . GLY A 389 ? 1.8521 1.1465 1.2983 0.0102  0.1757  -0.0791 389 GLY A C   
2962 O  O   . GLY A 389 ? 1.9592 1.2026 1.3555 0.0161  0.1721  -0.0728 389 GLY A O   
2963 N  N   . TYR A 390 ? 1.6425 0.9607 1.1032 0.0026  0.1981  -0.0736 390 TYR A N   
2964 C  CA  . TYR A 390 ? 1.8090 1.0945 1.2261 0.0009  0.2197  -0.0615 390 TYR A CA  
2965 C  C   . TYR A 390 ? 1.9525 1.1997 1.3427 -0.0089 0.2313  -0.0485 390 TYR A C   
2966 O  O   . TYR A 390 ? 2.1118 1.3084 1.4443 -0.0018 0.2349  -0.0399 390 TYR A O   
2967 C  CB  . TYR A 390 ? 1.4728 0.7958 0.9206 -0.0088 0.2442  -0.0579 390 TYR A CB  
2968 C  CG  . TYR A 390 ? 1.6528 0.9447 1.0543 -0.0064 0.2643  -0.0493 390 TYR A CG  
2969 C  CD1 . TYR A 390 ? 1.7101 0.9746 1.0675 0.0118  0.2527  -0.0551 390 TYR A CD1 
2970 C  CD2 . TYR A 390 ? 1.7857 1.0758 1.1871 -0.0218 0.2948  -0.0365 390 TYR A CD2 
2971 C  CE1 . TYR A 390 ? 1.8996 1.1358 1.2111 0.0150  0.2709  -0.0481 390 TYR A CE1 
2972 C  CE2 . TYR A 390 ? 1.9722 1.2337 1.3298 -0.0194 0.3147  -0.0289 390 TYR A CE2 
2973 C  CZ  . TYR A 390 ? 2.0311 1.2656 1.3421 -0.0006 0.3026  -0.0345 390 TYR A CZ  
2974 O  OH  . TYR A 390 ? 2.2257 1.4327 1.4902 0.0028  0.3223  -0.0279 390 TYR A OH  
2975 N  N   . PHE A 391 ? 1.6414 0.9120 1.0729 -0.0245 0.2365  -0.0476 391 PHE A N   
2976 C  CA  . PHE A 391 ? 1.7823 1.0205 1.1989 -0.0367 0.2505  -0.0364 391 PHE A CA  
2977 C  C   . PHE A 391 ? 1.8651 1.0447 1.2296 -0.0246 0.2344  -0.0329 391 PHE A C   
2978 O  O   . PHE A 391 ? 2.0378 1.1742 1.3694 -0.0300 0.2492  -0.0194 391 PHE A O   
2979 C  CB  . PHE A 391 ? 1.6696 0.9464 1.1440 -0.0531 0.2523  -0.0413 391 PHE A CB  
2980 C  CG  . PHE A 391 ? 1.8043 1.0473 1.2692 -0.0655 0.2643  -0.0327 391 PHE A CG  
2981 C  CD1 . PHE A 391 ? 1.9455 1.1839 1.4134 -0.0817 0.2956  -0.0215 391 PHE A CD1 
2982 C  CD2 . PHE A 391 ? 1.8023 1.0159 1.2559 -0.0608 0.2454  -0.0360 391 PHE A CD2 
2983 C  CE1 . PHE A 391 ? 2.0813 1.2867 1.5430 -0.0937 0.3085  -0.0136 391 PHE A CE1 
2984 C  CE2 . PHE A 391 ? 1.9349 1.1148 1.3815 -0.0721 0.2576  -0.0277 391 PHE A CE2 
2985 C  CZ  . PHE A 391 ? 2.0744 1.2497 1.5254 -0.0890 0.2896  -0.0164 391 PHE A CZ  
2986 N  N   . LEU A 392 ? 1.7026 0.8821 1.0634 -0.0081 0.2040  -0.0453 392 LEU A N   
2987 C  CA  . LEU A 392 ? 1.7804 0.9058 1.0928 0.0061  0.1854  -0.0431 392 LEU A CA  
2988 C  C   . LEU A 392 ? 1.9426 1.0248 1.1892 0.0187  0.1929  -0.0330 392 LEU A C   
2989 O  O   . LEU A 392 ? 2.1238 1.1554 1.3236 0.0187  0.2041  -0.0176 392 LEU A O   
2990 C  CB  . LEU A 392 ? 2.0437 1.1839 1.3729 0.0209  0.1510  -0.0610 392 LEU A CB  
2991 C  CG  . LEU A 392 ? 1.8858 1.0778 1.2820 0.0096  0.1446  -0.0728 392 LEU A CG  
2992 C  CD1 . LEU A 392 ? 1.7765 0.9749 1.1854 0.0240  0.1116  -0.0897 392 LEU A CD1 
2993 C  CD2 . LEU A 392 ? 1.9552 1.1436 1.3709 -0.0090 0.1598  -0.0655 392 LEU A CD2 
2994 N  N   . TYR A 393 ? 2.0587 1.1619 1.3030 0.0286  0.1888  -0.0413 393 TYR A N   
2995 C  CA  . TYR A 393 ? 2.2295 1.3003 1.4153 0.0398  0.1983  -0.0342 393 TYR A CA  
2996 C  C   . TYR A 393 ? 2.4218 1.4699 1.5869 0.0244  0.2336  -0.0143 393 TYR A C   
2997 O  O   . TYR A 393 ? 2.6220 1.6162 1.7317 0.0289  0.2397  0.0000  393 TYR A O   
2998 C  CB  . TYR A 393 ? 1.9845 1.0944 1.1907 0.0451  0.1981  -0.0465 393 TYR A CB  
2999 C  CG  . TYR A 393 ? 2.1796 1.2655 1.3346 0.0523  0.2147  -0.0400 393 TYR A CG  
3000 C  CD1 . TYR A 393 ? 2.3235 1.3593 1.4081 0.0719  0.2025  -0.0378 393 TYR A CD1 
3001 C  CD2 . TYR A 393 ? 2.2211 1.3354 1.3979 0.0405  0.2420  -0.0369 393 TYR A CD2 
3002 C  CE1 . TYR A 393 ? 2.4859 1.5007 1.5205 0.0794  0.2182  -0.0328 393 TYR A CE1 
3003 C  CE2 . TYR A 393 ? 2.3792 1.4727 1.5097 0.0470  0.2583  -0.0324 393 TYR A CE2 
3004 C  CZ  . TYR A 393 ? 2.5125 1.5566 1.5710 0.0663  0.2466  -0.0306 393 TYR A CZ  
3005 O  OH  . TYR A 393 ? 2.6874 1.7123 1.6978 0.0736  0.2628  -0.0271 393 TYR A OH  
3006 N  N   . ALA A 394 ? 1.8661 0.9562 1.0778 0.0063  0.2570  -0.0133 394 ALA A N   
3007 C  CA  . ALA A 394 ? 2.0280 1.1082 1.2404 -0.0128 0.2912  0.0025  394 ALA A CA  
3008 C  C   . ALA A 394 ? 2.1837 1.2079 1.3573 -0.0140 0.2939  0.0166  394 ALA A C   
3009 O  O   . ALA A 394 ? 2.4227 1.3988 1.5376 -0.0099 0.3101  0.0318  394 ALA A O   
3010 C  CB  . ALA A 394 ? 1.8879 1.0250 1.1763 -0.0331 0.3016  -0.0029 394 ALA A CB  
3011 N  N   . PHE A 395 ? 2.1029 1.1327 1.3085 -0.0187 0.2779  0.0112  395 PHE A N   
3012 C  CA  . PHE A 395 ? 2.2297 1.2108 1.4121 -0.0225 0.2812  0.0235  395 PHE A CA  
3013 C  C   . PHE A 395 ? 2.3907 1.3078 1.4959 -0.0010 0.2683  0.0332  395 PHE A C   
3014 O  O   . PHE A 395 ? 2.6151 1.4807 1.6751 -0.0030 0.2877  0.0525  395 PHE A O   
3015 C  CB  . PHE A 395 ? 1.7989 0.8027 1.0328 -0.0286 0.2615  0.0114  395 PHE A CB  
3016 C  CG  . PHE A 395 ? 1.9209 0.8750 1.1372 -0.0324 0.2633  0.0220  395 PHE A CG  
3017 C  CD1 . PHE A 395 ? 2.0039 0.9558 1.2477 -0.0551 0.2910  0.0305  395 PHE A CD1 
3018 C  CD2 . PHE A 395 ? 1.9646 0.8745 1.1399 -0.0132 0.2374  0.0228  395 PHE A CD2 
3019 C  CE1 . PHE A 395 ? 2.1232 1.0292 1.3547 -0.0590 0.2939  0.0398  395 PHE A CE1 
3020 C  CE2 . PHE A 395 ? 2.0845 0.9480 1.2454 -0.0160 0.2396  0.0332  395 PHE A CE2 
3021 C  CZ  . PHE A 395 ? 2.1619 1.0224 1.3512 -0.0393 0.2683  0.0419  395 PHE A CZ  
3022 N  N   . PHE A 396 ? 2.1077 1.0282 1.1988 0.0202  0.2356  0.0198  396 PHE A N   
3023 C  CA  . PHE A 396 ? 2.2657 1.1302 1.2849 0.0438  0.2182  0.0261  396 PHE A CA  
3024 C  C   . PHE A 396 ? 2.5010 1.3350 1.4579 0.0500  0.2404  0.0404  396 PHE A C   
3025 O  O   . PHE A 396 ? 2.7005 1.4831 1.5880 0.0689  0.2324  0.0499  396 PHE A O   
3026 C  CB  . PHE A 396 ? 2.6354 1.5181 1.6603 0.0645  0.1790  0.0051  396 PHE A CB  
3027 C  CG  . PHE A 396 ? 2.5085 1.3892 1.5598 0.0677  0.1528  -0.0036 396 PHE A CG  
3028 C  CD1 . PHE A 396 ? 2.3687 1.2727 1.4760 0.0472  0.1618  -0.0046 396 PHE A CD1 
3029 C  CD2 . PHE A 396 ? 2.5469 1.4033 1.5679 0.0917  0.1189  -0.0122 396 PHE A CD2 
3030 C  CE1 . PHE A 396 ? 2.2692 1.1715 1.4010 0.0502  0.1383  -0.0139 396 PHE A CE1 
3031 C  CE2 . PHE A 396 ? 2.4427 1.2974 1.4895 0.0949  0.0953  -0.0211 396 PHE A CE2 
3032 C  CZ  . PHE A 396 ? 2.3037 1.1809 1.4056 0.0740  0.1055  -0.0219 396 PHE A CZ  
3033 N  N   . ASN A 397 ? 2.5376 1.4052 1.5200 0.0347  0.2680  0.0412  397 ASN A N   
3034 C  CA  . ASN A 397 ? 2.7887 1.6299 1.7194 0.0354  0.2965  0.0559  397 ASN A CA  
3035 C  C   . ASN A 397 ? 3.0026 1.7984 1.9081 0.0220  0.3268  0.0799  397 ASN A C   
3036 O  O   . ASN A 397 ? 3.2572 1.9961 2.0903 0.0346  0.3328  0.0965  397 ASN A O   
3037 C  CB  . ASN A 397 ? 2.4989 1.3921 1.4706 0.0229  0.3167  0.0481  397 ASN A CB  
3038 C  CG  . ASN A 397 ? 2.4765 1.3715 1.4103 0.0412  0.3100  0.0398  397 ASN A CG  
3039 O  OD1 . ASN A 397 ? 2.4284 1.3210 1.3455 0.0618  0.2773  0.0263  397 ASN A OD1 
3040 N  ND2 . ASN A 397 ? 2.5227 1.4212 1.4428 0.0343  0.3408  0.0465  397 ASN A ND2 
3041 N  N   . PHE A 398 ? 2.3706 1.1913 1.3361 -0.0030 0.3459  0.0816  398 PHE A N   
3042 C  CA  . PHE A 398 ? 2.5636 1.3449 1.5172 -0.0189 0.3772  0.1026  398 PHE A CA  
3043 C  C   . PHE A 398 ? 2.7438 1.4547 1.6266 -0.0011 0.3664  0.1183  398 PHE A C   
3044 O  O   . PHE A 398 ? 3.0133 1.6746 1.8439 -0.0019 0.3927  0.1404  398 PHE A O   
3045 C  CB  . PHE A 398 ? 2.2492 1.0597 1.2776 -0.0412 0.3804  0.0964  398 PHE A CB  
3046 C  CG  . PHE A 398 ? 2.4061 1.2207 1.4628 -0.0673 0.4222  0.1074  398 PHE A CG  
3047 C  CD1 . PHE A 398 ? 2.5462 1.3651 1.5856 -0.0728 0.4530  0.1151  398 PHE A CD1 
3048 C  CD2 . PHE A 398 ? 2.4190 1.2349 1.5235 -0.0864 0.4304  0.1079  398 PHE A CD2 
3049 C  CE1 . PHE A 398 ? 2.6986 1.5236 1.7690 -0.0971 0.4916  0.1236  398 PHE A CE1 
3050 C  CE2 . PHE A 398 ? 2.5703 1.3924 1.7066 -0.1108 0.4681  0.1154  398 PHE A CE2 
3051 C  CZ  . PHE A 398 ? 2.7101 1.5369 1.8300 -0.1163 0.4989  0.1235  398 PHE A CZ  
3052 N  N   . LEU A 399 ? 2.7826 1.4896 1.6640 0.0156  0.3277  0.1072  399 LEU A N   
3053 C  CA  . LEU A 399 ? 2.9451 1.5873 1.7629 0.0350  0.3123  0.1205  399 LEU A CA  
3054 C  C   . LEU A 399 ? 3.1820 1.7865 1.9135 0.0589  0.3109  0.1302  399 LEU A C   
3055 O  O   . LEU A 399 ? 3.4771 2.0289 2.1497 0.0606  0.3357  0.1543  399 LEU A O   
3056 C  CB  . LEU A 399 ? 2.4181 1.0717 1.2621 0.0474  0.2699  0.1030  399 LEU A CB  
3057 C  CG  . LEU A 399 ? 2.2041 0.9003 1.1332 0.0260  0.2677  0.0899  399 LEU A CG  
3058 C  CD1 . LEU A 399 ? 2.1255 0.7986 1.0559 0.0384  0.2357  0.0844  399 LEU A CD1 
3059 C  CD2 . LEU A 399 ? 2.3499 1.0388 1.3044 -0.0010 0.3073  0.1046  399 LEU A CD2 
3060 N  N   . GLU A 400 ? 3.1727 1.8044 1.8970 0.0774  0.2827  0.1109  400 GLU A N   
3061 C  CA  . GLU A 400 ? 3.3539 1.9550 1.9983 0.1020  0.2772  0.1154  400 GLU A CA  
3062 C  C   . GLU A 400 ? 3.5698 2.1577 2.1788 0.0926  0.3196  0.1322  400 GLU A C   
3063 O  O   . GLU A 400 ? 3.8251 2.3658 2.3532 0.1097  0.3260  0.1471  400 GLU A O   
3064 C  CB  . GLU A 400 ? 4.2095 2.8534 2.8682 0.1188  0.2443  0.0877  400 GLU A CB  
3065 C  CG  . GLU A 400 ? 4.0916 2.7297 2.7514 0.1393  0.1987  0.0732  400 GLU A CG  
3066 C  CD  . GLU A 400 ? 3.8915 2.5750 2.5742 0.1534  0.1691  0.0443  400 GLU A CD  
3067 O  OE1 . GLU A 400 ? 3.8507 2.5709 2.5514 0.1465  0.1838  0.0358  400 GLU A OE1 
3068 O  OE2 . GLU A 400 ? 3.7877 2.4702 2.4731 0.1711  0.1315  0.0297  400 GLU A OE2 
3069 N  N   . LYS A 401 ? 2.5730 1.2029 1.2418 0.0661  0.3484  0.1297  401 LYS A N   
3070 C  CA  . LYS A 401 ? 2.7629 1.3904 1.4090 0.0560  0.3888  0.1414  401 LYS A CA  
3071 C  C   . LYS A 401 ? 3.0150 1.6078 1.6567 0.0350  0.4301  0.1669  401 LYS A C   
3072 O  O   . LYS A 401 ? 3.2594 1.8334 1.8639 0.0304  0.4649  0.1815  401 LYS A O   
3073 C  CB  . LYS A 401 ? 3.1821 1.8788 1.8922 0.0428  0.3964  0.1217  401 LYS A CB  
3074 C  CG  . LYS A 401 ? 3.3538 2.0507 2.0243 0.0462  0.4219  0.1246  401 LYS A CG  
3075 C  CD  . LYS A 401 ? 3.1939 1.9558 1.9343 0.0291  0.4366  0.1092  401 LYS A CD  
3076 C  CE  . LYS A 401 ? 3.4020 2.1611 2.1024 0.0324  0.4639  0.1122  401 LYS A CE  
3077 N  NZ  . LYS A 401 ? 3.3044 2.1196 2.0730 0.0119  0.4874  0.1029  401 LYS A NZ  
3078 N  N   . LYS A 402 ? 3.1440 1.7293 1.8261 0.0220  0.4274  0.1710  402 LYS A N   
3079 C  CA  . LYS A 402 ? 3.3594 1.9020 2.0330 0.0047  0.4634  0.1957  402 LYS A CA  
3080 C  C   . LYS A 402 ? 3.5628 2.0325 2.1628 0.0254  0.4504  0.2152  402 LYS A C   
3081 O  O   . LYS A 402 ? 3.6353 2.0689 2.2425 0.0157  0.4609  0.2303  402 LYS A O   
3082 C  CB  . LYS A 402 ? 2.5731 1.1493 1.3364 -0.0223 0.4697  0.1879  402 LYS A CB  
3083 C  CG  . LYS A 402 ? 2.7653 1.3307 1.5512 -0.0496 0.5175  0.2039  402 LYS A CG  
3084 C  CD  . LYS A 402 ? 2.7831 1.4136 1.6315 -0.0696 0.5379  0.1897  402 LYS A CD  
3085 C  CE  . LYS A 402 ? 2.9748 1.5998 1.8585 -0.0982 0.5826  0.2019  402 LYS A CE  
3086 N  NZ  . LYS A 402 ? 3.3540 1.9108 2.1628 -0.0950 0.6160  0.2308  402 LYS A NZ  
3087 N  N   . GLN A 403 ? 3.0493 1.4987 1.5801 0.0548  0.4267  0.2139  403 GLN A N   
3088 C  CA  . GLN A 403 ? 3.2585 1.6418 1.7125 0.0806  0.4079  0.2303  403 GLN A CA  
3089 C  C   . GLN A 403 ? 3.1290 1.5000 1.6190 0.0796  0.3833  0.2281  403 GLN A C   
3090 O  O   . GLN A 403 ? 3.2650 1.6075 1.7733 0.0627  0.4054  0.2445  403 GLN A O   
3091 C  CB  . GLN A 403 ? 2.9534 1.2717 1.3314 0.0818  0.4467  0.2640  403 GLN A CB  
3092 C  CG  . GLN A 403 ? 3.1082 1.4093 1.4004 0.1055  0.4485  0.2684  403 GLN A CG  
3093 C  CD  . GLN A 403 ? 3.5359 1.7694 1.7471 0.1085  0.4871  0.3037  403 GLN A CD  
3094 O  OE1 . GLN A 403 ? 3.7516 1.9260 1.9284 0.1139  0.4900  0.3274  403 GLN A OE1 
3095 N  NE2 . GLN A 403 ? 3.6762 1.9175 1.8573 0.1051  0.5183  0.3076  403 GLN A NE2 
3096 N  N   . ILE A 404 ? 3.6720 2.0654 2.1749 0.0978  0.3377  0.2062  404 ILE A N   
3097 C  CA  . ILE A 404 ? 3.5208 1.9061 2.0577 0.0999  0.3100  0.2003  404 ILE A CA  
3098 C  C   . ILE A 404 ? 3.4542 1.8368 1.9598 0.1321  0.2610  0.1848  404 ILE A C   
3099 O  O   . ILE A 404 ? 3.1828 1.6200 1.7380 0.1343  0.2333  0.1567  404 ILE A O   
3100 C  CB  . ILE A 404 ? 2.7468 1.1943 1.3877 0.0727  0.3107  0.1799  404 ILE A CB  
3101 C  CG1 . ILE A 404 ? 2.8585 1.2974 1.5325 0.0422  0.3550  0.1962  404 ILE A CG1 
3102 C  CG2 . ILE A 404 ? 2.5352 0.9871 1.2120 0.0801  0.2732  0.1655  404 ILE A CG2 
3103 C  CD1 . ILE A 404 ? 2.5879 1.0819 1.3603 0.0170  0.3543  0.1771  404 ILE A CD1 
3104 N  N   . LYS A 405 ? 3.6534 1.9721 2.0757 0.1576  0.2516  0.2035  405 LYS A N   
3105 C  CA  . LYS A 405 ? 3.6522 1.9609 2.0402 0.1903  0.2041  0.1904  405 LYS A CA  
3106 C  C   . LYS A 405 ? 3.3272 1.6738 1.7929 0.1858  0.1721  0.1659  405 LYS A C   
3107 O  O   . LYS A 405 ? 3.3081 1.6329 1.8008 0.1767  0.1732  0.1739  405 LYS A O   
3108 C  CB  . LYS A 405 ? 3.1458 1.3739 1.4461 0.2148  0.1993  0.2181  405 LYS A CB  
3109 C  CG  . LYS A 405 ? 3.4537 1.6376 1.6641 0.2242  0.2291  0.2443  405 LYS A CG  
3110 C  CD  . LYS A 405 ? 3.7926 1.8962 1.9161 0.2510  0.2209  0.2725  405 LYS A CD  
3111 C  CE  . LYS A 405 ? 4.0922 2.1541 2.1168 0.2665  0.2443  0.2960  405 LYS A CE  
3112 N  NZ  . LYS A 405 ? 4.3784 2.3700 2.3116 0.3014  0.2239  0.3176  405 LYS A NZ  
3113 N  N   . LEU A 406 ? 3.2583 1.6622 1.7617 0.1914  0.1453  0.1356  406 LEU A N   
3114 C  CA  . LEU A 406 ? 2.9723 1.4150 1.5453 0.1900  0.1133  0.1105  406 LEU A CA  
3115 C  C   . LEU A 406 ? 2.9817 1.4391 1.5359 0.2193  0.0702  0.0875  406 LEU A C   
3116 O  O   . LEU A 406 ? 3.0016 1.4973 1.5599 0.2222  0.0677  0.0718  406 LEU A O   
3117 C  CB  . LEU A 406 ? 2.6332 1.1446 1.2948 0.1601  0.1292  0.0940  406 LEU A CB  
3118 C  CG  . LEU A 406 ? 2.4192 0.9571 1.1589 0.1426  0.1219  0.0828  406 LEU A CG  
3119 C  CD1 . LEU A 406 ? 2.1082 0.7219 0.9198 0.1336  0.1092  0.0540  406 LEU A CD1 
3120 C  CD2 . LEU A 406 ? 2.4437 0.9435 1.1686 0.1617  0.0898  0.0820  406 LEU A CD2 
3121 N  N   . SER A 407 ? 3.3352 1.7622 1.8710 0.2411  0.0366  0.0848  407 SER A N   
3122 C  CA  . SER A 407 ? 3.3547 1.7927 1.8734 0.2705  -0.0066 0.0619  407 SER A CA  
3123 C  C   . SER A 407 ? 3.0174 1.5287 1.6197 0.2607  -0.0235 0.0285  407 SER A C   
3124 O  O   . SER A 407 ? 2.7881 1.3393 1.4562 0.2326  -0.0025 0.0248  407 SER A O   
3125 C  CB  . SER A 407 ? 3.3219 1.7122 1.8106 0.2945  -0.0380 0.0665  407 SER A CB  
3126 O  OG  . SER A 407 ? 3.1779 1.5660 1.7207 0.2765  -0.0327 0.0701  407 SER A OG  
3127 N  N   . LEU A 408 ? 3.6237 2.1530 2.2241 0.2842  -0.0611 0.0040  408 LEU A N   
3128 C  CA  . LEU A 408 ? 3.3315 1.9294 2.0079 0.2764  -0.0757 -0.0275 408 LEU A CA  
3129 C  C   . LEU A 408 ? 3.1149 1.7347 1.8591 0.2699  -0.0951 -0.0421 408 LEU A C   
3130 O  O   . LEU A 408 ? 2.8466 1.5214 1.6643 0.2498  -0.0888 -0.0572 408 LEU A O   
3131 C  CB  . LEU A 408 ? 2.5822 1.1957 1.2359 0.3016  -0.1042 -0.0502 408 LEU A CB  
3132 C  CG  . LEU A 408 ? 2.7173 1.3367 1.3334 0.3008  -0.0820 -0.0459 408 LEU A CG  
3133 C  CD1 . LEU A 408 ? 2.6693 1.3460 1.3288 0.3041  -0.0973 -0.0779 408 LEU A CD1 
3134 C  CD2 . LEU A 408 ? 2.6162 1.2380 1.2426 0.2709  -0.0348 -0.0232 408 LEU A CD2 
3135 N  N   . ARG A 409 ? 2.9587 1.5355 1.6770 0.2876  -0.1183 -0.0374 409 ARG A N   
3136 C  CA  . ARG A 409 ? 2.7952 1.3846 1.5720 0.2813  -0.1336 -0.0483 409 ARG A CA  
3137 C  C   . ARG A 409 ? 2.6403 1.2488 1.4671 0.2473  -0.0988 -0.0377 409 ARG A C   
3138 O  O   . ARG A 409 ? 2.4013 1.0629 1.3011 0.2307  -0.0993 -0.0558 409 ARG A O   
3139 C  CB  . ARG A 409 ? 3.3318 1.8593 2.0629 0.3038  -0.1554 -0.0367 409 ARG A CB  
3140 C  CG  . ARG A 409 ? 3.2030 1.7288 1.9857 0.2934  -0.1610 -0.0395 409 ARG A CG  
3141 C  CD  . ARG A 409 ? 3.4137 1.8890 2.1603 0.3221  -0.1937 -0.0373 409 ARG A CD  
3142 N  NE  . ARG A 409 ? 3.2910 1.8023 2.0955 0.3305  -0.2284 -0.0686 409 ARG A NE  
3143 C  CZ  . ARG A 409 ? 3.4522 1.9334 2.2446 0.3550  -0.2619 -0.0748 409 ARG A CZ  
3144 N  NH1 . ARG A 409 ? 3.7503 2.1626 2.4717 0.3748  -0.2663 -0.0503 409 ARG A NH1 
3145 N  NH2 . ARG A 409 ? 3.3282 1.8480 2.1797 0.3603  -0.2906 -0.1052 409 ARG A NH2 
3146 N  N   . ASN A 410 ? 3.5667 2.1331 2.3535 0.2372  -0.0678 -0.0085 410 ASN A N   
3147 C  CA  . ASN A 410 ? 3.4622 2.0409 2.2930 0.2056  -0.0342 0.0023  410 ASN A CA  
3148 C  C   . ASN A 410 ? 3.2415 1.8845 2.1243 0.1827  -0.0131 -0.0085 410 ASN A C   
3149 O  O   . ASN A 410 ? 3.0513 1.7346 2.0015 0.1613  -0.0050 -0.0179 410 ASN A O   
3150 C  CB  . ASN A 410 ? 2.9533 1.4702 1.7272 0.2009  -0.0040 0.0362  410 ASN A CB  
3151 C  CG  . ASN A 410 ? 3.2034 1.6517 1.9183 0.2262  -0.0239 0.0505  410 ASN A CG  
3152 O  OD1 . ASN A 410 ? 3.1592 1.6070 1.8930 0.2409  -0.0575 0.0352  410 ASN A OD1 
3153 N  ND2 . ASN A 410 ? 3.4831 1.8729 2.1261 0.2320  -0.0025 0.0805  410 ASN A ND2 
3154 N  N   . LYS A 411 ? 2.9211 1.5739 1.7727 0.1879  -0.0048 -0.0077 411 LYS A N   
3155 C  CA  . LYS A 411 ? 2.7251 1.4373 1.6249 0.1681  0.0147  -0.0175 411 LYS A CA  
3156 C  C   . LYS A 411 ? 2.4640 1.2359 1.4342 0.1666  -0.0085 -0.0463 411 LYS A C   
3157 O  O   . LYS A 411 ? 2.2922 1.1127 1.3238 0.1448  0.0061  -0.0530 411 LYS A O   
3158 C  CB  . LYS A 411 ? 2.2913 1.0036 1.1463 0.1768  0.0245  -0.0146 411 LYS A CB  
3159 C  CG  . LYS A 411 ? 2.1219 0.8945 1.0289 0.1562  0.0463  -0.0234 411 LYS A CG  
3160 C  CD  . LYS A 411 ? 2.1982 0.9856 1.0788 0.1694  0.0432  -0.0330 411 LYS A CD  
3161 C  CE  . LYS A 411 ? 2.2378 1.0316 1.1068 0.1535  0.0820  -0.0188 411 LYS A CE  
3162 N  NZ  . LYS A 411 ? 2.3260 1.1242 1.1591 0.1689  0.0789  -0.0271 411 LYS A NZ  
3163 N  N   . ASN A 412 ? 2.6220 1.3905 1.5831 0.1904  -0.0446 -0.0634 412 ASN A N   
3164 C  CA  . ASN A 412 ? 2.3990 1.2222 1.4257 0.1901  -0.0662 -0.0910 412 ASN A CA  
3165 C  C   . ASN A 412 ? 2.2737 1.1116 1.3554 0.1770  -0.0703 -0.0966 412 ASN A C   
3166 O  O   . ASN A 412 ? 2.0690 0.9617 1.2152 0.1617  -0.0662 -0.1105 412 ASN A O   
3167 C  CB  . ASN A 412 ? 2.6590 1.4777 1.6645 0.2189  -0.1028 -0.1102 412 ASN A CB  
3168 C  CG  . ASN A 412 ? 2.7110 1.5415 1.6896 0.2271  -0.0987 -0.1148 412 ASN A CG  
3169 O  OD1 . ASN A 412 ? 2.7332 1.5588 1.6890 0.2157  -0.0690 -0.0986 412 ASN A OD1 
3170 N  ND2 . ASN A 412 ? 2.7405 1.5877 1.7250 0.2468  -0.1283 -0.1386 412 ASN A ND2 
3171 N  N   . ILE A 413 ? 2.5660 1.3554 1.6221 0.1833  -0.0774 -0.0858 413 ILE A N   
3172 C  CA  . ILE A 413 ? 2.4726 1.2729 1.5794 0.1699  -0.0787 -0.0909 413 ILE A CA  
3173 C  C   . ILE A 413 ? 2.3594 1.1915 1.5065 0.1394  -0.0440 -0.0831 413 ILE A C   
3174 O  O   . ILE A 413 ? 2.1866 1.0674 1.3972 0.1251  -0.0437 -0.0978 413 ILE A O   
3175 C  CB  . ILE A 413 ? 2.2087 0.9449 1.2785 0.1790  -0.0852 -0.0758 413 ILE A CB  
3176 C  CG1 . ILE A 413 ? 2.3780 1.0732 1.3926 0.2117  -0.1170 -0.0780 413 ILE A CG1 
3177 C  CG2 . ILE A 413 ? 2.1130 0.8641 1.2400 0.1687  -0.0929 -0.0876 413 ILE A CG2 
3178 C  CD1 . ILE A 413 ? 2.6192 1.2412 1.5786 0.2225  -0.1167 -0.0546 413 ILE A CD1 
3179 N  N   . LEU A 414 ? 2.5280 1.3331 1.6376 0.1302  -0.0146 -0.0602 414 LEU A N   
3180 C  CA  . LEU A 414 ? 2.4733 1.3064 1.6189 0.1020  0.0192  -0.0524 414 LEU A CA  
3181 C  C   . LEU A 414 ? 2.2774 1.1810 1.4747 0.0918  0.0232  -0.0685 414 LEU A C   
3182 O  O   . LEU A 414 ? 2.1667 1.1128 1.4207 0.0724  0.0341  -0.0752 414 LEU A O   
3183 C  CB  . LEU A 414 ? 2.0386 0.8293 1.1321 0.0957  0.0506  -0.0255 414 LEU A CB  
3184 C  CG  . LEU A 414 ? 2.2340 0.9669 1.3034 0.0912  0.0625  -0.0059 414 LEU A CG  
3185 C  CD1 . LEU A 414 ? 2.3373 1.0715 1.4197 0.0648  0.1035  0.0103  414 LEU A CD1 
3186 C  CD2 . LEU A 414 ? 2.1398 0.8804 1.2545 0.0902  0.0416  -0.0206 414 LEU A CD2 
3187 N  N   . LEU A 415 ? 2.1875 1.1038 1.3662 0.1054  0.0141  -0.0753 415 LEU A N   
3188 C  CA  . LEU A 415 ? 2.0090 0.9893 1.2378 0.0973  0.0170  -0.0901 415 LEU A CA  
3189 C  C   . LEU A 415 ? 1.8514 0.8733 1.1403 0.0960  -0.0034 -0.1114 415 LEU A C   
3190 O  O   . LEU A 415 ? 1.7355 0.8061 1.0780 0.0786  0.0085  -0.1169 415 LEU A O   
3191 C  CB  . LEU A 415 ? 1.9041 0.8880 1.1046 0.1139  0.0083  -0.0961 415 LEU A CB  
3192 C  CG  . LEU A 415 ? 1.9782 0.9655 1.1591 0.1041  0.0387  -0.0822 415 LEU A CG  
3193 C  CD1 . LEU A 415 ? 2.0593 1.0308 1.1928 0.1239  0.0299  -0.0854 415 LEU A CD1 
3194 C  CD2 . LEU A 415 ? 1.8318 0.8811 1.0768 0.0835  0.0570  -0.0876 415 LEU A CD2 
3195 N  N   . ILE A 416 ? 2.3339 1.3370 1.6129 0.1151  -0.0342 -0.1235 416 ILE A N   
3196 C  CA  . ILE A 416 ? 2.2038 1.2456 1.5375 0.1163  -0.0549 -0.1455 416 ILE A CA  
3197 C  C   . ILE A 416 ? 2.1786 1.2364 1.5538 0.0970  -0.0439 -0.1450 416 ILE A C   
3198 O  O   . ILE A 416 ? 2.0699 1.1802 1.5007 0.0873  -0.0443 -0.1590 416 ILE A O   
3199 C  CB  . ILE A 416 ? 2.0649 1.0770 1.3783 0.1407  -0.0896 -0.1579 416 ILE A CB  
3200 C  CG1 . ILE A 416 ? 2.0908 1.1056 1.3814 0.1597  -0.1049 -0.1673 416 ILE A CG1 
3201 C  CG2 . ILE A 416 ? 1.9487 0.9942 1.3187 0.1394  -0.1074 -0.1787 416 ILE A CG2 
3202 C  CD1 . ILE A 416 ? 2.1791 1.1613 1.4424 0.1860  -0.1392 -0.1786 416 ILE A CD1 
3203 N  N   . LEU A 417 ? 2.0398 1.0525 1.3881 0.0915  -0.0330 -0.1290 417 LEU A N   
3204 C  CA  . LEU A 417 ? 2.0320 1.0579 1.4203 0.0726  -0.0218 -0.1298 417 LEU A CA  
3205 C  C   . LEU A 417 ? 1.9791 1.0482 1.4001 0.0493  0.0078  -0.1245 417 LEU A C   
3206 O  O   . LEU A 417 ? 1.8865 1.0058 1.3611 0.0380  0.0085  -0.1376 417 LEU A O   
3207 C  CB  . LEU A 417 ? 1.8662 0.8300 1.2222 0.0739  -0.0199 -0.1159 417 LEU A CB  
3208 C  CG  . LEU A 417 ? 1.9061 0.8406 1.2510 0.0952  -0.0529 -0.1269 417 LEU A CG  
3209 C  CD1 . LEU A 417 ? 2.1002 0.9646 1.3733 0.1140  -0.0590 -0.1090 417 LEU A CD1 
3210 C  CD2 . LEU A 417 ? 1.8903 0.8273 1.2765 0.0861  -0.0576 -0.1367 417 LEU A CD2 
3211 N  N   . ILE A 418 ? 2.1067 1.1590 1.4965 0.0429  0.0319  -0.1061 418 ILE A N   
3212 C  CA  . ILE A 418 ? 2.0519 1.1499 1.4754 0.0230  0.0580  -0.1030 418 ILE A CA  
3213 C  C   . ILE A 418 ? 1.8794 1.0440 1.3535 0.0228  0.0477  -0.1215 418 ILE A C   
3214 O  O   . ILE A 418 ? 1.8133 1.0246 1.3366 0.0076  0.0566  -0.1281 418 ILE A O   
3215 C  CB  . ILE A 418 ? 1.6549 0.7334 1.0367 0.0219  0.0806  -0.0848 418 ILE A CB  
3216 C  CG1 . ILE A 418 ? 1.8399 0.8782 1.1997 0.0080  0.1073  -0.0651 418 ILE A CG1 
3217 C  CG2 . ILE A 418 ? 1.5570 0.6934 0.9737 0.0127  0.0939  -0.0891 418 ILE A CG2 
3218 C  CD1 . ILE A 418 ? 1.8697 0.9477 1.2808 -0.0179 0.1326  -0.0648 418 ILE A CD1 
3219 N  N   . ALA A 419 ? 1.8341 1.0020 1.2963 0.0408  0.0280  -0.1305 419 ALA A N   
3220 C  CA  . ALA A 419 ? 1.6874 0.9125 1.1933 0.0427  0.0191  -0.1464 419 ALA A CA  
3221 C  C   . ALA A 419 ? 1.6218 0.8816 1.1769 0.0400  0.0043  -0.1642 419 ALA A C   
3222 O  O   . ALA A 419 ? 1.5482 0.8613 1.1495 0.0278  0.0136  -0.1697 419 ALA A O   
3223 C  CB  . ALA A 419 ? 1.2596 0.4741 0.7406 0.0629  0.0016  -0.1530 419 ALA A CB  
3224 N  N   . PHE A 420 ? 2.0441 1.2752 1.5890 0.0526  -0.0191 -0.1735 420 PHE A N   
3225 C  CA  . PHE A 420 ? 2.0030 1.2642 1.5925 0.0509  -0.0332 -0.1915 420 PHE A CA  
3226 C  C   . PHE A 420 ? 2.0343 1.3169 1.6540 0.0301  -0.0151 -0.1888 420 PHE A C   
3227 O  O   . PHE A 420 ? 1.9954 1.3309 1.6620 0.0219  -0.0139 -0.2006 420 PHE A O   
3228 C  CB  . PHE A 420 ? 2.3146 1.5344 1.8867 0.0662  -0.0588 -0.2002 420 PHE A CB  
3229 C  CG  . PHE A 420 ? 2.2971 1.5427 1.9139 0.0621  -0.0699 -0.2179 420 PHE A CG  
3230 C  CD1 . PHE A 420 ? 2.2200 1.5081 1.8739 0.0690  -0.0854 -0.2379 420 PHE A CD1 
3231 C  CD2 . PHE A 420 ? 2.3719 1.6007 1.9961 0.0508  -0.0634 -0.2155 420 PHE A CD2 
3232 C  CE1 . PHE A 420 ? 2.2248 1.5385 1.9189 0.0655  -0.0944 -0.2550 420 PHE A CE1 
3233 C  CE2 . PHE A 420 ? 2.3722 1.6265 2.0382 0.0473  -0.0736 -0.2339 420 PHE A CE2 
3234 C  CZ  . PHE A 420 ? 2.3017 1.5990 2.0013 0.0549  -0.0891 -0.2536 420 PHE A CZ  
3235 N  N   . PHE A 421 ? 1.6985 0.9401 1.2911 0.0221  -0.0007 -0.1734 421 PHE A N   
3236 C  CA  . PHE A 421 ? 1.7432 1.0004 1.3629 0.0017  0.0183  -0.1706 421 PHE A CA  
3237 C  C   . PHE A 421 ? 1.6683 0.9875 1.3240 -0.0107 0.0347  -0.1716 421 PHE A C   
3238 O  O   . PHE A 421 ? 1.6424 1.0086 1.3428 -0.0182 0.0326  -0.1850 421 PHE A O   
3239 C  CB  . PHE A 421 ? 3.2288 2.4323 2.8124 -0.0056 0.0363  -0.1512 421 PHE A CB  
3240 C  CG  . PHE A 421 ? 3.2864 2.5063 2.9031 -0.0273 0.0561  -0.1505 421 PHE A CG  
3241 C  CD1 . PHE A 421 ? 3.3515 2.5501 2.9824 -0.0324 0.0510  -0.1572 421 PHE A CD1 
3242 C  CD2 . PHE A 421 ? 3.2810 2.5398 2.9185 -0.0424 0.0789  -0.1451 421 PHE A CD2 
3243 C  CE1 . PHE A 421 ? 3.4152 2.6310 3.0808 -0.0527 0.0687  -0.1594 421 PHE A CE1 
3244 C  CE2 . PHE A 421 ? 3.3460 2.6233 3.0175 -0.0620 0.0958  -0.1470 421 PHE A CE2 
3245 C  CZ  . PHE A 421 ? 3.4142 2.6704 3.1003 -0.0675 0.0907  -0.1548 421 PHE A CZ  
3246 N  N   . SER A 422 ? 1.9431 1.2642 1.5799 -0.0117 0.0502  -0.1582 422 SER A N   
3247 C  CA  . SER A 422 ? 1.8819 1.2608 1.5537 -0.0230 0.0665  -0.1576 422 SER A CA  
3248 C  C   . SER A 422 ? 1.7766 1.2122 1.4861 -0.0171 0.0547  -0.1718 422 SER A C   
3249 O  O   . SER A 422 ? 1.7646 1.2516 1.5106 -0.0270 0.0652  -0.1739 422 SER A O   
3250 C  CB  . SER A 422 ? 1.6825 1.0497 1.3277 -0.0256 0.0871  -0.1404 422 SER A CB  
3251 O  OG  . SER A 422 ? 1.6541 0.9995 1.2664 -0.0088 0.0764  -0.1388 422 SER A OG  
3252 N  N   . ILE A 423 ? 1.4709 0.8972 1.1721 -0.0008 0.0334  -0.1814 423 ILE A N   
3253 C  CA  . ILE A 423 ? 1.3865 0.8613 1.1230 0.0056  0.0224  -0.1951 423 ILE A CA  
3254 C  C   . ILE A 423 ? 1.4093 0.9138 1.1829 0.0033  0.0102  -0.2126 423 ILE A C   
3255 O  O   . ILE A 423 ? 1.3760 0.9353 1.1881 0.0012  0.0107  -0.2212 423 ILE A O   
3256 C  CB  . ILE A 423 ? 1.5669 1.0170 1.2802 0.0241  0.0053  -0.1996 423 ILE A CB  
3257 C  CG1 . ILE A 423 ? 1.5430 0.9871 1.2345 0.0261  0.0187  -0.1867 423 ILE A CG1 
3258 C  CG2 . ILE A 423 ? 1.4941 0.9812 1.2423 0.0325  -0.0105 -0.2171 423 ILE A CG2 
3259 C  CD1 . ILE A 423 ? 1.4618 0.9225 1.1631 0.0393  0.0076  -0.1958 423 ILE A CD1 
3260 N  N   . SER A 424 ? 1.5255 0.9923 1.2863 0.0045  -0.0006 -0.2176 424 SER A N   
3261 C  CA  . SER A 424 ? 1.5676 1.0545 1.3596 0.0033  -0.0132 -0.2356 424 SER A CA  
3262 C  C   . SER A 424 ? 1.5835 1.1281 1.4171 -0.0111 -0.0013 -0.2412 424 SER A C   
3263 O  O   . SER A 424 ? 1.5763 1.1556 1.4401 -0.0092 -0.0112 -0.2574 424 SER A O   
3264 C  CB  . SER A 424 ? 1.4035 0.8381 1.1759 0.0037  -0.0215 -0.2369 424 SER A CB  
3265 O  OG  . SER A 424 ? 1.4643 0.8772 1.2223 -0.0097 -0.0018 -0.2218 424 SER A OG  
3266 N  N   . PRO A 425 ? 1.5577 1.1134 1.3929 -0.0247 0.0196  -0.2288 425 PRO A N   
3267 C  CA  . PRO A 425 ? 1.5935 1.2070 1.4677 -0.0366 0.0293  -0.2348 425 PRO A CA  
3268 C  C   . PRO A 425 ? 1.5244 1.1922 1.4218 -0.0306 0.0285  -0.2381 425 PRO A C   
3269 O  O   . PRO A 425 ? 1.5636 1.2782 1.4926 -0.0325 0.0252  -0.2506 425 PRO A O   
3270 C  CB  . PRO A 425 ? 1.4053 1.0152 1.2716 -0.0491 0.0517  -0.2184 425 PRO A CB  
3271 C  CG  . PRO A 425 ? 1.4421 0.9867 1.2694 -0.0478 0.0532  -0.2080 425 PRO A CG  
3272 C  CD  . PRO A 425 ? 1.3816 0.8961 1.1836 -0.0301 0.0349  -0.2102 425 PRO A CD  
3273 N  N   . ALA A 426 ? 1.6510 1.3121 1.5322 -0.0234 0.0327  -0.2265 426 ALA A N   
3274 C  CA  . ALA A 426 ? 1.5857 1.2909 1.4879 -0.0165 0.0326  -0.2281 426 ALA A CA  
3275 C  C   . ALA A 426 ? 1.5737 1.2834 1.4877 -0.0053 0.0130  -0.2453 426 ALA A C   
3276 O  O   . ALA A 426 ? 1.5842 1.3423 1.5284 -0.0040 0.0120  -0.2538 426 ALA A O   
3277 C  CB  . ALA A 426 ? 0.8336 0.5253 0.7175 -0.0112 0.0406  -0.2140 426 ALA A CB  
3278 N  N   . LEU A 427 ? 1.2606 0.9212 1.1512 0.0033  -0.0023 -0.2507 427 LEU A N   
3279 C  CA  . LEU A 427 ? 1.2726 0.9396 1.1795 0.0131  -0.0217 -0.2701 427 LEU A CA  
3280 C  C   . LEU A 427 ? 1.3736 1.0796 1.3126 0.0063  -0.0238 -0.2851 427 LEU A C   
3281 O  O   . LEU A 427 ? 1.3922 1.1409 1.3591 0.0104  -0.0272 -0.2963 427 LEU A O   
3282 C  CB  . LEU A 427 ? 1.5905 1.1993 1.4696 0.0228  -0.0395 -0.2754 427 LEU A CB  
3283 C  CG  . LEU A 427 ? 1.5151 1.0847 1.3617 0.0342  -0.0446 -0.2672 427 LEU A CG  
3284 C  CD1 . LEU A 427 ? 1.5616 1.0722 1.3770 0.0425  -0.0612 -0.2702 427 LEU A CD1 
3285 C  CD2 . LEU A 427 ? 1.4349 1.0304 1.3010 0.0454  -0.0520 -0.2761 427 LEU A CD2 
3286 N  N   . MET A 428 ? 1.3442 1.0341 1.2790 -0.0038 -0.0211 -0.2858 428 MET A N   
3287 C  CA  . MET A 428 ? 1.4640 1.1848 1.4262 -0.0118 -0.0225 -0.3008 428 MET A CA  
3288 C  C   . MET A 428 ? 1.4954 1.2825 1.4852 -0.0156 -0.0117 -0.3010 428 MET A C   
3289 O  O   . MET A 428 ? 1.5715 1.3968 1.5858 -0.0126 -0.0180 -0.3164 428 MET A O   
3290 C  CB  . MET A 428 ? 2.2588 1.9552 2.2134 -0.0251 -0.0140 -0.2961 428 MET A CB  
3291 C  CG  . MET A 428 ? 2.3360 1.9932 2.2883 -0.0251 -0.0271 -0.3091 428 MET A CG  
3292 S  SD  . MET A 428 ? 2.4570 2.0908 2.4094 -0.0430 -0.0135 -0.3046 428 MET A SD  
3293 C  CE  . MET A 428 ? 2.4184 1.9914 2.3241 -0.0426 -0.0017 -0.2772 428 MET A CE  
3294 N  N   . HIS A 429 ? 1.2743 1.0748 1.2590 -0.0214 0.0050  -0.2834 429 HIS A N   
3295 C  CA  . HIS A 429 ? 1.3096 1.1715 1.3177 -0.0235 0.0157  -0.2804 429 HIS A CA  
3296 C  C   . HIS A 429 ? 1.2849 1.1743 1.3063 -0.0119 0.0105  -0.2853 429 HIS A C   
3297 O  O   . HIS A 429 ? 1.3661 1.3059 1.4108 -0.0112 0.0121  -0.2927 429 HIS A O   
3298 C  CB  . HIS A 429 ? 1.3864 1.2538 1.3864 -0.0286 0.0334  -0.2596 429 HIS A CB  
3299 C  CG  . HIS A 429 ? 1.4211 1.3487 1.4432 -0.0277 0.0434  -0.2542 429 HIS A CG  
3300 N  ND1 . HIS A 429 ? 1.5441 1.5171 1.5864 -0.0350 0.0485  -0.2591 429 HIS A ND1 
3301 C  CD2 . HIS A 429 ? 1.3440 1.2938 1.3718 -0.0195 0.0489  -0.2447 429 HIS A CD2 
3302 C  CE1 . HIS A 429 ? 1.4589 1.4790 1.5151 -0.0303 0.0565  -0.2510 429 HIS A CE1 
3303 N  NE2 . HIS A 429 ? 1.3613 1.3673 1.4099 -0.0213 0.0577  -0.2416 429 HIS A NE2 
3304 N  N   . ILE A 430 ? 1.2299 1.0870 1.2368 -0.0024 0.0048  -0.2813 430 ILE A N   
3305 C  CA  . ILE A 430 ? 1.2092 1.0900 1.2328 0.0082  0.0005  -0.2873 430 ILE A CA  
3306 C  C   . ILE A 430 ? 1.3073 1.2027 1.3493 0.0120  -0.0132 -0.3097 430 ILE A C   
3307 O  O   . ILE A 430 ? 1.3622 1.2996 1.4268 0.0164  -0.0110 -0.3157 430 ILE A O   
3308 C  CB  . ILE A 430 ? 1.2560 1.0983 1.2645 0.0182  -0.0063 -0.2843 430 ILE A CB  
3309 C  CG1 . ILE A 430 ? 1.1663 0.9937 1.1570 0.0162  0.0069  -0.2641 430 ILE A CG1 
3310 C  CG2 . ILE A 430 ? 1.2487 1.1193 1.2812 0.0275  -0.0084 -0.2915 430 ILE A CG2 
3311 C  CD1 . ILE A 430 ? 1.0645 0.8600 1.0435 0.0272  -0.0010 -0.2646 430 ILE A CD1 
3312 N  N   . TYR A 431 ? 1.1659 1.0248 1.1980 0.0110  -0.0266 -0.3216 431 TYR A N   
3313 C  CA  . TYR A 431 ? 1.2726 1.1435 1.3237 0.0146  -0.0402 -0.3448 431 TYR A CA  
3314 C  C   . TYR A 431 ? 1.4190 1.3445 1.4922 0.0073  -0.0327 -0.3520 431 TYR A C   
3315 O  O   . TYR A 431 ? 1.5244 1.4865 1.6190 0.0119  -0.0359 -0.3663 431 TYR A O   
3316 C  CB  . TYR A 431 ? 1.1911 1.0107 1.2280 0.0143  -0.0548 -0.3545 431 TYR A CB  
3317 C  CG  . TYR A 431 ? 1.3265 1.1592 1.3850 0.0154  -0.0672 -0.3791 431 TYR A CG  
3318 C  CD1 . TYR A 431 ? 1.3230 1.1410 1.3890 0.0270  -0.0839 -0.3954 431 TYR A CD1 
3319 C  CD2 . TYR A 431 ? 1.4716 1.3319 1.5448 0.0051  -0.0627 -0.3879 431 TYR A CD2 
3320 C  CE1 . TYR A 431 ? 1.4588 1.2890 1.5463 0.0282  -0.0948 -0.4191 431 TYR A CE1 
3321 C  CE2 . TYR A 431 ? 1.6108 1.4841 1.7050 0.0061  -0.0737 -0.4123 431 TYR A CE2 
3322 C  CZ  . TYR A 431 ? 1.6026 1.4603 1.7035 0.0176  -0.0893 -0.4275 431 TYR A CZ  
3323 O  OH  . TYR A 431 ? 1.7513 1.6224 1.8745 0.0186  -0.0996 -0.4526 431 TYR A OH  
3324 N  N   . TYR A 432 ? 1.1597 1.0910 1.2275 -0.0036 -0.0225 -0.3427 432 TYR A N   
3325 C  CA  . TYR A 432 ? 1.2840 1.2642 1.3710 -0.0107 -0.0173 -0.3514 432 TYR A CA  
3326 C  C   . TYR A 432 ? 1.2449 1.2799 1.3426 -0.0082 -0.0042 -0.3406 432 TYR A C   
3327 O  O   . TYR A 432 ? 1.2687 1.3524 1.3820 -0.0104 -0.0011 -0.3484 432 TYR A O   
3328 C  CB  . TYR A 432 ? 2.1573 2.1217 2.2380 -0.0236 -0.0120 -0.3475 432 TYR A CB  
3329 C  CG  . TYR A 432 ? 2.2411 2.1714 2.3237 -0.0278 -0.0241 -0.3652 432 TYR A CG  
3330 C  CD1 . TYR A 432 ? 2.2213 2.1110 2.2919 -0.0377 -0.0204 -0.3591 432 TYR A CD1 
3331 C  CD2 . TYR A 432 ? 2.3384 2.2762 2.4360 -0.0217 -0.0381 -0.3879 432 TYR A CD2 
3332 C  CE1 . TYR A 432 ? 2.2906 2.1467 2.3646 -0.0414 -0.0303 -0.3740 432 TYR A CE1 
3333 C  CE2 . TYR A 432 ? 2.4223 2.3277 2.5239 -0.0249 -0.0492 -0.4041 432 TYR A CE2 
3334 C  CZ  . TYR A 432 ? 2.3879 2.2517 2.4777 -0.0347 -0.0452 -0.3966 432 TYR A CZ  
3335 O  OH  . TYR A 432 ? 2.4635 2.2929 2.5589 -0.0377 -0.0551 -0.4116 432 TYR A OH  
3336 N  N   . TYR A 433 ? 1.4684 1.4955 1.5576 -0.0027 0.0032  -0.3229 433 TYR A N   
3337 C  CA  . TYR A 433 ? 1.3655 1.4397 1.4642 0.0001  0.0176  -0.3086 433 TYR A CA  
3338 C  C   . TYR A 433 ? 1.3619 1.4632 1.4761 0.0105  0.0174  -0.3138 433 TYR A C   
3339 O  O   . TYR A 433 ? 1.2980 1.3847 1.4114 0.0170  0.0207  -0.3045 433 TYR A O   
3340 C  CB  . TYR A 433 ? 1.4318 1.4855 1.5161 -0.0014 0.0293  -0.2850 433 TYR A CB  
3341 C  CG  . TYR A 433 ? 1.3338 1.4328 1.4276 0.0003  0.0452  -0.2678 433 TYR A CG  
3342 C  CD1 . TYR A 433 ? 1.3437 1.4663 1.4382 -0.0068 0.0546  -0.2586 433 TYR A CD1 
3343 C  CD2 . TYR A 433 ? 1.2324 1.3495 1.3363 0.0095  0.0513  -0.2606 433 TYR A CD2 
3344 C  CE1 . TYR A 433 ? 1.2586 1.4216 1.3614 -0.0035 0.0681  -0.2421 433 TYR A CE1 
3345 C  CE2 . TYR A 433 ? 1.1425 1.2981 1.2549 0.0121  0.0665  -0.2430 433 TYR A CE2 
3346 C  CZ  . TYR A 433 ? 1.1573 1.3356 1.2679 0.0062  0.0742  -0.2334 433 TYR A CZ  
3347 O  OH  . TYR A 433 ? 1.0830 1.2990 1.2018 0.0105  0.0884  -0.2151 433 TYR A OH  
3348 N  N   . LYS A 434 ? 1.2978 1.4396 1.4272 0.0119  0.0146  -0.3294 434 LYS A N   
3349 C  CA  . LYS A 434 ? 1.3354 1.5031 1.4808 0.0210  0.0145  -0.3381 434 LYS A CA  
3350 C  C   . LYS A 434 ? 1.3034 1.5304 1.4586 0.0244  0.0292  -0.3283 434 LYS A C   
3351 O  O   . LYS A 434 ? 1.3802 1.6464 1.5438 0.0254  0.0277  -0.3420 434 LYS A O   
3352 C  CB  . LYS A 434 ? 1.2679 1.4365 1.4231 0.0218  -0.0001 -0.3660 434 LYS A CB  
3353 C  CG  . LYS A 434 ? 1.3362 1.4496 1.4818 0.0185  -0.0158 -0.3773 434 LYS A CG  
3354 C  CD  . LYS A 434 ? 1.4406 1.5594 1.6000 0.0203  -0.0292 -0.4052 434 LYS A CD  
3355 C  CE  . LYS A 434 ? 1.5003 1.5605 1.6510 0.0194  -0.0456 -0.4158 434 LYS A CE  
3356 N  NZ  . LYS A 434 ? 1.4948 1.5236 1.6451 0.0294  -0.0536 -0.4169 434 LYS A NZ  
3357 N  N   . SER A 435 ? 1.3682 1.6024 1.5220 0.0273  0.0435  -0.3049 435 SER A N   
3358 C  CA  . SER A 435 ? 1.3458 1.6344 1.5072 0.0321  0.0583  -0.2924 435 SER A CA  
3359 C  C   . SER A 435 ? 1.4514 1.7671 1.6277 0.0399  0.0599  -0.3039 435 SER A C   
3360 O  O   . SER A 435 ? 1.5197 1.8094 1.7043 0.0424  0.0524  -0.3170 435 SER A O   
3361 C  CB  . SER A 435 ? 1.1268 1.4133 1.2872 0.0348  0.0739  -0.2647 435 SER A CB  
3362 O  OG  . SER A 435 ? 1.0427 1.2803 1.1920 0.0299  0.0704  -0.2583 435 SER A OG  
3363 N  N   . SER A 436 ? 1.2578 1.6265 1.4372 0.0444  0.0700  -0.2993 436 SER A N   
3364 C  CA  . SER A 436 ? 1.3599 1.7565 1.5525 0.0526  0.0783  -0.3026 436 SER A CA  
3365 C  C   . SER A 436 ? 1.2648 1.6628 1.4628 0.0576  0.0966  -0.2753 436 SER A C   
3366 O  O   . SER A 436 ? 1.1119 1.4782 1.3062 0.0547  0.0984  -0.2610 436 SER A O   
3367 C  CB  . SER A 436 ? 1.9117 2.3648 2.1023 0.0564  0.0809  -0.3108 436 SER A CB  
3368 O  OG  . SER A 436 ? 1.8361 2.3261 2.0186 0.0606  0.0950  -0.2872 436 SER A OG  
3369 N  N   . THR A 437 ? 1.1330 1.5673 1.3403 0.0654  0.1113  -0.2680 437 THR A N   
3370 C  CA  . THR A 437 ? 1.0446 1.4808 1.2607 0.0703  0.1304  -0.2421 437 THR A CA  
3371 C  C   . THR A 437 ? 1.0810 1.5576 1.2848 0.0743  0.1424  -0.2197 437 THR A C   
3372 O  O   . THR A 437 ? 1.2328 1.7425 1.4244 0.0749  0.1365  -0.2281 437 THR A O   
3373 C  CB  . THR A 437 ? 1.1178 1.5701 1.3532 0.0767  0.1417  -0.2465 437 THR A CB  
3374 O  OG1 . THR A 437 ? 1.0981 1.5170 1.3469 0.0739  0.1280  -0.2712 437 THR A OG1 
3375 C  CG2 . THR A 437 ? 1.0516 1.5059 1.3002 0.0816  0.1639  -0.2193 437 THR A CG2 
3376 N  N   . VAL A 438 ? 0.9852 1.4601 1.1932 0.0778  0.1585  -0.1923 438 VAL A N   
3377 C  CA  . VAL A 438 ? 1.0437 1.5613 1.2425 0.0850  0.1721  -0.1690 438 VAL A CA  
3378 C  C   . VAL A 438 ? 1.2764 1.8410 1.4701 0.0920  0.1750  -0.1783 438 VAL A C   
3379 O  O   . VAL A 438 ? 1.3619 1.9616 1.5396 0.0942  0.1689  -0.1819 438 VAL A O   
3380 C  CB  . VAL A 438 ? 0.6762 1.1893 0.8875 0.0908  0.1938  -0.1390 438 VAL A CB  
3381 C  CG1 . VAL A 438 ? 0.7669 1.3247 0.9677 0.1006  0.2081  -0.1128 438 VAL A CG1 
3382 C  CG2 . VAL A 438 ? 0.4938 0.9610 0.7100 0.0842  0.1905  -0.1329 438 VAL A CG2 
3383 N  N   . PHE A 439 ? 0.8030 1.3682 1.0117 0.0953  0.1838  -0.1844 439 PHE A N   
3384 C  CA  . PHE A 439 ? 1.0444 1.6525 1.2498 0.1024  0.1897  -0.1933 439 PHE A CA  
3385 C  C   . PHE A 439 ? 1.1067 1.6979 1.3262 0.0981  0.1792  -0.2245 439 PHE A C   
3386 O  O   . PHE A 439 ? 0.9621 1.5090 1.1959 0.0917  0.1704  -0.2347 439 PHE A O   
3387 C  CB  . PHE A 439 ? 0.8561 1.4857 1.0691 0.1122  0.2165  -0.1672 439 PHE A CB  
3388 C  CG  . PHE A 439 ? 0.9071 1.5700 1.1024 0.1210  0.2282  -0.1379 439 PHE A CG  
3389 C  CD1 . PHE A 439 ? 0.7857 1.4580 0.9629 0.1195  0.2146  -0.1368 439 PHE A CD1 
3390 C  CD2 . PHE A 439 ? 1.0752 1.7601 1.2732 0.1314  0.2534  -0.1110 439 PHE A CD2 
3391 C  CE1 . PHE A 439 ? 0.8305 1.5352 0.9926 0.1291  0.2240  -0.1104 439 PHE A CE1 
3392 C  CE2 . PHE A 439 ? 1.1316 1.8467 1.3120 0.1415  0.2635  -0.0826 439 PHE A CE2 
3393 C  CZ  . PHE A 439 ? 1.0031 1.7289 1.1656 0.1408  0.2477  -0.0828 439 PHE A CZ  
3394 N  N   . THR A 440 ? 1.0753 1.0056 1.1833 0.1651  -0.0078 -0.2564 440 THR A N   
3395 C  CA  . THR A 440 ? 1.2216 1.1666 1.3461 0.1800  -0.0261 -0.2833 440 THR A CA  
3396 C  C   . THR A 440 ? 1.3494 1.3507 1.4799 0.1738  -0.0248 -0.2955 440 THR A C   
3397 O  O   . THR A 440 ? 1.3533 1.3900 1.4810 0.1567  -0.0117 -0.2884 440 THR A O   
3398 C  CB  . THR A 440 ? 1.2432 1.2101 1.3989 0.1873  -0.0348 -0.3087 440 THR A CB  
3399 O  OG1 . THR A 440 ? 1.3105 1.3164 1.4764 0.1721  -0.0201 -0.3076 440 THR A OG1 
3400 C  CG2 . THR A 440 ? 1.1147 1.0205 1.2650 0.1974  -0.0452 -0.3025 440 THR A CG2 
3401 N  N   . SER A 441 ? 1.4324 1.4411 1.5706 0.1866  -0.0400 -0.3141 441 SER A N   
3402 C  CA  . SER A 441 ? 1.3904 1.4612 1.5405 0.1807  -0.0400 -0.3323 441 SER A CA  
3403 C  C   . SER A 441 ? 1.3328 1.4639 1.4968 0.1627  -0.0272 -0.3413 441 SER A C   
3404 O  O   . SER A 441 ? 1.2614 1.4151 1.4096 0.1433  -0.0156 -0.3269 441 SER A O   
3405 C  CB  . SER A 441 ? 1.0174 1.1069 1.1954 0.1999  -0.0603 -0.3669 441 SER A CB  
3406 O  OG  . SER A 441 ? 1.1038 1.1537 1.2934 0.2167  -0.0742 -0.3751 441 SER A OG  
3407 N  N   . TYR A 442 ? 1.3577 1.5109 1.5492 0.1686  -0.0312 -0.3646 442 TYR A N   
3408 C  CA  . TYR A 442 ? 1.3180 1.5305 1.5236 0.1516  -0.0209 -0.3775 442 TYR A CA  
3409 C  C   . TYR A 442 ? 1.2268 1.4386 1.4062 0.1274  -0.0050 -0.3470 442 TYR A C   
3410 O  O   . TYR A 442 ? 1.1812 1.4422 1.3557 0.1073  0.0013  -0.3501 442 TYR A O   
3411 C  CB  . TYR A 442 ? 1.3834 1.5924 1.6123 0.1610  -0.0255 -0.3934 442 TYR A CB  
3412 C  CG  . TYR A 442 ? 1.5003 1.6998 1.7548 0.1869  -0.0458 -0.4227 442 TYR A CG  
3413 C  CD1 . TYR A 442 ? 1.2704 1.4169 1.5144 0.2038  -0.0599 -0.4149 442 TYR A CD1 
3414 C  CD2 . TYR A 442 ? 1.2489 1.4899 1.5376 0.1943  -0.0531 -0.4588 442 TYR A CD2 
3415 C  CE1 . TYR A 442 ? 1.3862 1.5185 1.6530 0.2276  -0.0833 -0.4414 442 TYR A CE1 
3416 C  CE2 . TYR A 442 ? 1.3613 1.5905 1.6756 0.2199  -0.0756 -0.4873 442 TYR A CE2 
3417 C  CZ  . TYR A 442 ? 1.4322 1.6053 1.7355 0.2366  -0.0920 -0.4780 442 TYR A CZ  
3418 O  OH  . TYR A 442 ? 1.5586 1.7143 1.8866 0.2622  -0.1190 -0.5058 442 TYR A OH  
3419 N  N   . GLU A 443 ? 1.4632 1.6190 1.6257 0.1284  0.0001  -0.3184 443 GLU A N   
3420 C  CA  . GLU A 443 ? 1.3871 1.5360 1.5292 0.1089  0.0124  -0.2907 443 GLU A CA  
3421 C  C   . GLU A 443 ? 1.3285 1.4785 1.4453 0.0981  0.0145  -0.2741 443 GLU A C   
3422 O  O   . GLU A 443 ? 1.2685 1.4500 1.3751 0.0766  0.0189  -0.2673 443 GLU A O   
3423 C  CB  . GLU A 443 ? 1.3421 1.4323 1.4766 0.1151  0.0171  -0.2682 443 GLU A CB  
3424 C  CG  . GLU A 443 ? 1.4209 1.4958 1.5762 0.1288  0.0116  -0.2824 443 GLU A CG  
3425 C  CD  . GLU A 443 ? 1.4396 1.4820 1.5928 0.1243  0.0200  -0.2633 443 GLU A CD  
3426 O  OE1 . GLU A 443 ? 1.4291 1.4271 1.5636 0.1249  0.0258  -0.2401 443 GLU A OE1 
3427 O  OE2 . GLU A 443 ? 1.4564 1.5193 1.6272 0.1195  0.0213  -0.2724 443 GLU A OE2 
3428 N  N   . ALA A 444 ? 1.4794 1.5924 1.5839 0.1119  0.0094  -0.2671 444 ALA A N   
3429 C  CA  . ALA A 444 ? 1.4370 1.5511 1.5193 0.1045  0.0089  -0.2550 444 ALA A CA  
3430 C  C   . ALA A 444 ? 1.4168 1.5987 1.5062 0.0876  0.0079  -0.2728 444 ALA A C   
3431 O  O   . ALA A 444 ? 1.3691 1.5706 1.4442 0.0656  0.0126  -0.2604 444 ALA A O   
3432 C  CB  . ALA A 444 ? 0.7736 0.8540 0.8496 0.1230  -0.0003 -0.2570 444 ALA A CB  
3433 N  N   . SER A 445 ? 1.5069 1.7246 1.6190 0.0971  0.0004  -0.3032 445 SER A N   
3434 C  CA  . SER A 445 ? 1.4951 1.7831 1.6161 0.0814  0.0001  -0.3253 445 SER A CA  
3435 C  C   . SER A 445 ? 1.4657 1.7983 1.5865 0.0553  0.0085  -0.3273 445 SER A C   
3436 O  O   . SER A 445 ? 1.4499 1.8278 1.5597 0.0313  0.0107  -0.3296 445 SER A O   
3437 C  CB  . SER A 445 ? 1.7755 2.0966 1.9299 0.0994  -0.0095 -0.3635 445 SER A CB  
3438 O  OG  . SER A 445 ? 1.8333 2.1464 2.0121 0.1144  -0.0123 -0.3794 445 SER A OG  
3439 N  N   . ILE A 446 ? 1.4184 1.7374 1.5492 0.0580  0.0121  -0.3259 446 ILE A N   
3440 C  CA  . ILE A 446 ? 1.3962 1.7470 1.5216 0.0322  0.0186  -0.3224 446 ILE A CA  
3441 C  C   . ILE A 446 ? 1.3410 1.6705 1.4322 0.0120  0.0199  -0.2892 446 ILE A C   
3442 O  O   . ILE A 446 ? 1.3345 1.7029 1.4105 -0.0164 0.0201  -0.2877 446 ILE A O   
3443 C  CB  . ILE A 446 ? 0.7992 1.1307 0.9402 0.0397  0.0212  -0.3230 446 ILE A CB  
3444 C  CG1 . ILE A 446 ? 0.9817 1.3512 1.1563 0.0520  0.0182  -0.3609 446 ILE A CG1 
3445 C  CG2 . ILE A 446 ? 0.8976 1.2407 1.0249 0.0130  0.0259  -0.3077 446 ILE A CG2 
3446 C  CD1 . ILE A 446 ? 0.8903 1.2254 1.0816 0.0690  0.0168  -0.3622 446 ILE A CD1 
3447 N  N   . LEU A 447 ? 1.4757 1.7430 1.5534 0.0255  0.0195  -0.2635 447 LEU A N   
3448 C  CA  . LEU A 447 ? 1.4260 1.6677 1.4739 0.0103  0.0186  -0.2333 447 LEU A CA  
3449 C  C   . LEU A 447 ? 1.4167 1.6778 1.4437 -0.0028 0.0136  -0.2302 447 LEU A C   
3450 O  O   . LEU A 447 ? 1.3979 1.6717 1.4029 -0.0283 0.0102  -0.2165 447 LEU A O   
3451 C  CB  . LEU A 447 ? 1.2213 1.3961 1.2626 0.0283  0.0210  -0.2106 447 LEU A CB  
3452 C  CG  . LEU A 447 ? 1.2256 1.3849 1.2831 0.0323  0.0260  -0.2087 447 LEU A CG  
3453 C  CD1 . LEU A 447 ? 1.2252 1.3284 1.2850 0.0543  0.0301  -0.1981 447 LEU A CD1 
3454 C  CD2 . LEU A 447 ? 1.2038 1.3666 1.2514 0.0106  0.0249  -0.1925 447 LEU A CD2 
3455 N  N   . ASN A 448 ? 1.2978 1.5593 1.3312 0.0138  0.0112  -0.2425 448 ASN A N   
3456 C  CA  . ASN A 448 ? 1.2980 1.5852 1.3171 0.0027  0.0063  -0.2448 448 ASN A CA  
3457 C  C   . ASN A 448 ? 1.3161 1.6737 1.3352 -0.0274 0.0069  -0.2609 448 ASN A C   
3458 O  O   . ASN A 448 ? 1.2863 1.6563 1.2788 -0.0531 0.0033  -0.2468 448 ASN A O   
3459 C  CB  . ASN A 448 ? 1.5054 1.7917 1.5413 0.0269  0.0023  -0.2639 448 ASN A CB  
3460 C  CG  . ASN A 448 ? 1.4924 1.7864 1.5107 0.0204  -0.0035 -0.2594 448 ASN A CG  
3461 O  OD1 . ASN A 448 ? 1.4266 1.6902 1.4147 0.0102  -0.0054 -0.2321 448 ASN A OD1 
3462 N  ND2 . ASN A 448 ? 1.5251 1.8607 1.5637 0.0266  -0.0075 -0.2874 448 ASN A ND2 
3463 N  N   . ASP A 449 ? 1.5224 1.9256 1.5700 -0.0254 0.0108  -0.2911 449 ASP A N   
3464 C  CA  . ASP A 449 ? 1.5483 2.0194 1.5959 -0.0560 0.0140  -0.3082 449 ASP A CA  
3465 C  C   . ASP A 449 ? 1.5321 1.9887 1.5489 -0.0849 0.0124  -0.2799 449 ASP A C   
3466 O  O   . ASP A 449 ? 1.5384 2.0305 1.5324 -0.1180 0.0099  -0.2767 449 ASP A O   
3467 C  CB  . ASP A 449 ? 2.2536 2.7621 2.3366 -0.0463 0.0189  -0.3415 449 ASP A CB  
3468 C  CG  . ASP A 449 ? 2.3114 2.9031 2.4003 -0.0745 0.0234  -0.3703 449 ASP A CG  
3469 O  OD1 . ASP A 449 ? 2.4606 3.0756 2.5197 -0.1087 0.0232  -0.3577 449 ASP A OD1 
3470 O  OD2 . ASP A 449 ? 2.4803 3.1141 2.6028 -0.0636 0.0265  -0.4063 449 ASP A OD2 
3471 N  N   . LEU A 450 ? 1.5572 1.9609 1.5729 -0.0734 0.0124  -0.2597 450 LEU A N   
3472 C  CA  . LEU A 450 ? 1.5283 1.9114 1.5180 -0.0973 0.0073  -0.2328 450 LEU A CA  
3473 C  C   . LEU A 450 ? 1.4802 1.8412 1.4350 -0.1130 -0.0022 -0.2072 450 LEU A C   
3474 O  O   . LEU A 450 ? 1.4570 1.8200 1.3858 -0.1426 -0.0108 -0.1909 450 LEU A O   
3475 C  CB  . LEU A 450 ? 1.1606 1.4907 1.1606 -0.0788 0.0089  -0.2177 450 LEU A CB  
3476 C  CG  . LEU A 450 ? 1.1768 1.4989 1.1661 -0.1002 0.0039  -0.2022 450 LEU A CG  
3477 C  CD1 . LEU A 450 ? 1.1336 1.3918 1.1202 -0.0857 0.0007  -0.1761 450 LEU A CD1 
3478 C  CD2 . LEU A 450 ? 1.2294 1.5809 1.1871 -0.1396 -0.0059 -0.1942 450 LEU A CD2 
3479 N  N   . LYS A 451 ? 1.6355 1.9722 1.5885 -0.0934 -0.0028 -0.2031 451 LYS A N   
3480 C  CA  . LYS A 451 ? 1.5594 1.8744 1.4801 -0.1059 -0.0125 -0.1806 451 LYS A CA  
3481 C  C   . LYS A 451 ? 1.5562 1.9252 1.4554 -0.1439 -0.0182 -0.1856 451 LYS A C   
3482 O  O   . LYS A 451 ? 1.5052 1.8617 1.3726 -0.1704 -0.0297 -0.1637 451 LYS A O   
3483 C  CB  . LYS A 451 ? 1.3537 1.6402 1.2778 -0.0787 -0.0115 -0.1802 451 LYS A CB  
3484 C  CG  . LYS A 451 ? 1.2812 1.5193 1.1752 -0.0799 -0.0206 -0.1517 451 LYS A CG  
3485 C  CD  . LYS A 451 ? 1.2755 1.4805 1.1725 -0.0514 -0.0187 -0.1515 451 LYS A CD  
3486 C  CE  . LYS A 451 ? 1.2711 1.5151 1.1655 -0.0578 -0.0219 -0.1659 451 LYS A CE  
3487 N  NZ  . LYS A 451 ? 1.2598 1.4685 1.1543 -0.0315 -0.0231 -0.1646 451 LYS A NZ  
3488 N  N   . ASN A 452 ? 1.7259 2.1550 1.6426 -0.1473 -0.0111 -0.2155 452 ASN A N   
3489 C  CA  . ASN A 452 ? 1.7365 2.2264 1.6357 -0.1844 -0.0134 -0.2254 452 ASN A CA  
3490 C  C   . ASN A 452 ? 1.7640 2.2909 1.6501 -0.2211 -0.0139 -0.2282 452 ASN A C   
3491 O  O   . ASN A 452 ? 1.7950 2.3781 1.6656 -0.2561 -0.0140 -0.2389 452 ASN A O   
3492 C  CB  . ASN A 452 ? 1.4113 1.9588 1.3401 -0.1741 -0.0048 -0.2617 452 ASN A CB  
3493 C  CG  . ASN A 452 ? 1.3938 1.9031 1.3429 -0.1328 -0.0047 -0.2644 452 ASN A CG  
3494 O  OD1 . ASN A 452 ? 1.3397 1.7955 1.2685 -0.1236 -0.0117 -0.2385 452 ASN A OD1 
3495 N  ND2 . ASN A 452 ? 1.4418 1.9758 1.4301 -0.1078 0.0016  -0.2959 452 ASN A ND2 
3496 N  N   . LYS A 453 ? 1.5207 2.0179 1.4129 -0.2146 -0.0139 -0.2195 453 LYS A N   
3497 C  CA  . LYS A 453 ? 1.5415 2.0654 1.4190 -0.2490 -0.0166 -0.2194 453 LYS A CA  
3498 C  C   . LYS A 453 ? 1.4677 1.9349 1.3129 -0.2638 -0.0334 -0.1827 453 LYS A C   
3499 O  O   . LYS A 453 ? 1.4769 1.9569 1.2945 -0.3015 -0.0432 -0.1737 453 LYS A O   
3500 C  CB  . LYS A 453 ? 1.2566 1.7929 1.1680 -0.2317 -0.0059 -0.2399 453 LYS A CB  
3501 C  CG  . LYS A 453 ? 1.5259 2.1174 1.4737 -0.2153 0.0079  -0.2799 453 LYS A CG  
3502 C  CD  . LYS A 453 ? 1.5705 2.1780 1.5425 -0.2096 0.0149  -0.2980 453 LYS A CD  
3503 C  CE  . LYS A 453 ? 1.6224 2.2816 1.6340 -0.1902 0.0258  -0.3400 453 LYS A CE  
3504 N  NZ  . LYS A 453 ? 1.6559 2.3502 1.6822 -0.1994 0.0319  -0.3613 453 LYS A NZ  
3505 N  N   . ALA A 454 ? 1.8758 2.2794 1.7248 -0.2341 -0.0378 -0.1627 454 ALA A N   
3506 C  CA  . ALA A 454 ? 1.8223 2.1683 1.6533 -0.2380 -0.0531 -0.1330 454 ALA A CA  
3507 C  C   . ALA A 454 ? 1.7445 2.0512 1.5448 -0.2437 -0.0689 -0.1077 454 ALA A C   
3508 O  O   . ALA A 454 ? 1.7154 2.0248 1.5148 -0.2320 -0.0648 -0.1110 454 ALA A O   
3509 C  CB  . ALA A 454 ? 0.5326 0.8371 0.3951 -0.2002 -0.0454 -0.1319 454 ALA A CB  
3510 N  N   . GLN A 455 ? 1.8394 2.1078 1.6149 -0.2613 -0.0890 -0.0829 455 GLN A N   
3511 C  CA  . GLN A 455 ? 1.7740 1.9992 1.5199 -0.2663 -0.1078 -0.0584 455 GLN A CA  
3512 C  C   . GLN A 455 ? 1.7301 1.8937 1.4939 -0.2264 -0.1073 -0.0470 455 GLN A C   
3513 O  O   . GLN A 455 ? 1.7508 1.8943 1.5406 -0.2062 -0.1014 -0.0490 455 GLN A O   
3514 C  CB  . GLN A 455 ? 1.8409 2.0544 1.5472 -0.3083 -0.1349 -0.0379 455 GLN A CB  
3515 C  CG  . GLN A 455 ? 1.8819 2.1561 1.5618 -0.3548 -0.1362 -0.0472 455 GLN A CG  
3516 C  CD  . GLN A 455 ? 2.0951 2.4162 1.7728 -0.3588 -0.1227 -0.0628 455 GLN A CD  
3517 O  OE1 . GLN A 455 ? 2.0413 2.3378 1.7170 -0.3401 -0.1241 -0.0555 455 GLN A OE1 
3518 N  NE2 . GLN A 455 ? 2.1507 2.5415 1.8302 -0.3831 -0.1096 -0.0861 455 GLN A NE2 
3519 N  N   . ARG A 456 ? 1.5812 1.7173 1.3301 -0.2171 -0.1133 -0.0359 456 ARG A N   
3520 C  CA  . ARG A 456 ? 1.5415 1.6254 1.3052 -0.1799 -0.1095 -0.0286 456 ARG A CA  
3521 C  C   . ARG A 456 ? 1.5505 1.5876 1.3211 -0.1715 -0.1217 -0.0149 456 ARG A C   
3522 O  O   . ARG A 456 ? 1.5379 1.5400 1.3292 -0.1398 -0.1131 -0.0144 456 ARG A O   
3523 C  CB  . ARG A 456 ? 1.4359 1.4990 1.1749 -0.1785 -0.1180 -0.0175 456 ARG A CB  
3524 C  CG  . ARG A 456 ? 1.4266 1.5287 1.1687 -0.1752 -0.1034 -0.0334 456 ARG A CG  
3525 C  CD  . ARG A 456 ? 1.4527 1.5571 1.2313 -0.1401 -0.0804 -0.0512 456 ARG A CD  
3526 N  NE  . ARG A 456 ? 1.5145 1.6782 1.3106 -0.1459 -0.0669 -0.0758 456 ARG A NE  
3527 C  CZ  . ARG A 456 ? 1.5780 1.7729 1.3922 -0.1532 -0.0600 -0.0893 456 ARG A CZ  
3528 N  NH1 . ARG A 456 ? 1.5859 1.7576 1.4027 -0.1564 -0.0656 -0.0789 456 ARG A NH1 
3529 N  NH2 . ARG A 456 ? 1.6404 1.8906 1.4720 -0.1565 -0.0483 -0.1146 456 ARG A NH2 
3530 N  N   . GLU A 457 ? 1.1262 1.1635 0.8791 -0.2015 -0.1425 -0.0048 457 GLU A N   
3531 C  CA  . GLU A 457 ? 1.1502 1.1443 0.9096 -0.1969 -0.1599 0.0077  457 GLU A CA  
3532 C  C   . GLU A 457 ? 1.2099 1.2227 0.9955 -0.1976 -0.1517 -0.0026 457 GLU A C   
3533 O  O   . GLU A 457 ? 1.2452 1.2278 1.0428 -0.1933 -0.1647 0.0045  457 GLU A O   
3534 C  CB  . GLU A 457 ? 1.5505 1.5203 1.2701 -0.2288 -0.1954 0.0285  457 GLU A CB  
3535 C  CG  . GLU A 457 ? 1.6326 1.5451 1.3571 -0.2183 -0.2204 0.0426  457 GLU A CG  
3536 C  CD  . GLU A 457 ? 1.6266 1.4955 1.3527 -0.1904 -0.2239 0.0488  457 GLU A CD  
3537 O  OE1 . GLU A 457 ? 1.5509 1.4293 1.2717 -0.1789 -0.2073 0.0446  457 GLU A OE1 
3538 O  OE2 . GLU A 457 ? 1.6979 1.5230 1.4318 -0.1796 -0.2442 0.0565  457 GLU A OE2 
3539 N  N   . ASP A 458 ? 1.2764 1.3388 1.0729 -0.2015 -0.1308 -0.0209 458 ASP A N   
3540 C  CA  . ASP A 458 ? 1.3353 1.4212 1.1541 -0.2045 -0.1222 -0.0328 458 ASP A CA  
3541 C  C   . ASP A 458 ? 1.3461 1.4100 1.2053 -0.1672 -0.1057 -0.0397 458 ASP A C   
3542 O  O   . ASP A 458 ? 1.3208 1.3792 1.1951 -0.1398 -0.0879 -0.0471 458 ASP A O   
3543 C  CB  . ASP A 458 ? 1.6523 1.7994 1.4726 -0.2173 -0.1047 -0.0537 458 ASP A CB  
3544 C  CG  . ASP A 458 ? 1.6820 1.8628 1.4671 -0.2636 -0.1194 -0.0509 458 ASP A CG  
3545 O  OD1 . ASP A 458 ? 1.7123 1.8663 1.4739 -0.2867 -0.1444 -0.0322 458 ASP A OD1 
3546 O  OD2 . ASP A 458 ? 1.6992 1.9338 1.4802 -0.2781 -0.1068 -0.0684 458 ASP A OD2 
3547 N  N   . TYR A 459 ? 1.4643 1.5159 1.3400 -0.1679 -0.1122 -0.0375 459 TYR A N   
3548 C  CA  . TYR A 459 ? 1.4646 1.5003 1.3793 -0.1362 -0.0956 -0.0452 459 TYR A CA  
3549 C  C   . TYR A 459 ? 1.4989 1.5715 1.4359 -0.1303 -0.0744 -0.0648 459 TYR A C   
3550 O  O   . TYR A 459 ? 1.5301 1.6372 1.4603 -0.1536 -0.0772 -0.0719 459 TYR A O   
3551 C  CB  . TYR A 459 ? 1.8566 1.8601 1.7840 -0.1360 -0.1127 -0.0350 459 TYR A CB  
3552 C  CG  . TYR A 459 ? 1.8264 1.7857 1.7541 -0.1195 -0.1229 -0.0236 459 TYR A CG  
3553 C  CD1 . TYR A 459 ? 1.8125 1.7530 1.7079 -0.1363 -0.1474 -0.0090 459 TYR A CD1 
3554 C  CD2 . TYR A 459 ? 1.7956 1.7327 1.7545 -0.0880 -0.1078 -0.0284 459 TYR A CD2 
3555 C  CE1 . TYR A 459 ? 1.7907 1.6903 1.6872 -0.1195 -0.1579 -0.0006 459 TYR A CE1 
3556 C  CE2 . TYR A 459 ? 1.7448 1.6447 1.7051 -0.0724 -0.1157 -0.0211 459 TYR A CE2 
3557 C  CZ  . TYR A 459 ? 1.7437 1.6246 1.6739 -0.0869 -0.1411 -0.0078 459 TYR A CZ  
3558 O  OH  . TYR A 459 ? 1.6979 1.5416 1.6307 -0.0700 -0.1499 -0.0027 459 TYR A OH  
3559 N  N   . VAL A 460 ? 1.1461 1.2096 1.1086 -0.0998 -0.0543 -0.0738 460 VAL A N   
3560 C  CA  . VAL A 460 ? 1.1886 1.2771 1.1761 -0.0899 -0.0369 -0.0918 460 VAL A CA  
3561 C  C   . VAL A 460 ? 1.1818 1.2441 1.2003 -0.0708 -0.0305 -0.0909 460 VAL A C   
3562 O  O   . VAL A 460 ? 1.1476 1.1774 1.1764 -0.0493 -0.0238 -0.0858 460 VAL A O   
3563 C  CB  . VAL A 460 ? 0.6981 0.8040 0.6883 -0.0742 -0.0204 -0.1064 460 VAL A CB  
3564 C  CG1 . VAL A 460 ? 0.7020 0.7811 0.7159 -0.0431 -0.0048 -0.1106 460 VAL A CG1 
3565 C  CG2 . VAL A 460 ? 0.7343 0.8896 0.7285 -0.0866 -0.0154 -0.1260 460 VAL A CG2 
3566 N  N   . VAL A 461 ? 1.2366 1.3136 1.2690 -0.0803 -0.0327 -0.0961 461 VAL A N   
3567 C  CA  . VAL A 461 ? 1.1976 1.2547 1.2615 -0.0628 -0.0251 -0.0973 461 VAL A CA  
3568 C  C   . VAL A 461 ? 1.1918 1.2609 1.2740 -0.0444 -0.0047 -0.1135 461 VAL A C   
3569 O  O   . VAL A 461 ? 1.2197 1.3230 1.3012 -0.0518 -0.0010 -0.1279 461 VAL A O   
3570 C  CB  . VAL A 461 ? 0.8408 0.9026 0.9137 -0.0795 -0.0383 -0.0947 461 VAL A CB  
3571 C  CG1 . VAL A 461 ? 0.7986 0.8469 0.9066 -0.0612 -0.0276 -0.0992 461 VAL A CG1 
3572 C  CG2 . VAL A 461 ? 0.8677 0.9065 0.9250 -0.0948 -0.0630 -0.0774 461 VAL A CG2 
3573 N  N   . ALA A 462 ? 1.1429 1.1833 1.2401 -0.0213 0.0074  -0.1118 462 ALA A N   
3574 C  CA  . ALA A 462 ? 1.1495 1.1899 1.2633 -0.0037 0.0236  -0.1241 462 ALA A CA  
3575 C  C   . ALA A 462 ? 1.0993 1.1058 1.2317 0.0115  0.0319  -0.1172 462 ALA A C   
3576 O  O   . ALA A 462 ? 1.0421 1.0324 1.1779 0.0087  0.0248  -0.1065 462 ALA A O   
3577 C  CB  . ALA A 462 ? 1.2421 1.2849 1.3412 0.0060  0.0298  -0.1303 462 ALA A CB  
3578 N  N   . TRP A 463 ? 1.5808 1.5772 1.7258 0.0264  0.0456  -0.1244 463 TRP A N   
3579 C  CA  . TRP A 463 ? 1.4987 1.4655 1.6586 0.0382  0.0561  -0.1189 463 TRP A CA  
3580 C  C   . TRP A 463 ? 1.4563 1.3983 1.5977 0.0473  0.0610  -0.1114 463 TRP A C   
3581 O  O   . TRP A 463 ? 1.4913 1.4385 1.6106 0.0465  0.0570  -0.1117 463 TRP A O   
3582 C  CB  . TRP A 463 ? 1.1884 1.1512 1.3633 0.0468  0.0670  -0.1280 463 TRP A CB  
3583 C  CG  . TRP A 463 ? 1.1231 1.0619 1.3152 0.0536  0.0783  -0.1236 463 TRP A CG  
3584 C  CD1 . TRP A 463 ? 1.1176 1.0329 1.3077 0.0631  0.0913  -0.1243 463 TRP A CD1 
3585 C  CD2 . TRP A 463 ? 1.0682 1.0056 1.2821 0.0495  0.0770  -0.1188 463 TRP A CD2 
3586 N  NE1 . TRP A 463 ? 1.0452 0.9481 1.2537 0.0636  0.1006  -0.1206 463 TRP A NE1 
3587 C  CE2 . TRP A 463 ? 1.0332 0.9507 1.2594 0.0568  0.0921  -0.1183 463 TRP A CE2 
3588 C  CE3 . TRP A 463 ? 1.0541 1.0044 1.2778 0.0393  0.0630  -0.1153 463 TRP A CE3 
3589 C  CZ2 . TRP A 463 ? 0.9670 0.8822 1.2197 0.0558  0.0952  -0.1168 463 TRP A CZ2 
3590 C  CZ3 . TRP A 463 ? 0.9999 0.9433 1.2498 0.0398  0.0632  -0.1129 463 TRP A CZ3 
3591 C  CH2 . TRP A 463 ? 0.9658 0.8943 1.2322 0.0487  0.0800  -0.1148 463 TRP A CH2 
3592 N  N   . TRP A 464 ? 1.1042 1.0217 1.2548 0.0548  0.0697  -0.1058 464 TRP A N   
3593 C  CA  . TRP A 464 ? 1.0619 0.9547 1.1947 0.0632  0.0757  -0.0998 464 TRP A CA  
3594 C  C   . TRP A 464 ? 1.0775 0.9530 1.1917 0.0727  0.0868  -0.1022 464 TRP A C   
3595 O  O   . TRP A 464 ? 1.0611 0.9222 1.1525 0.0767  0.0866  -0.0975 464 TRP A O   
3596 C  CB  . TRP A 464 ? 1.3624 1.2389 1.5125 0.0676  0.0821  -0.0966 464 TRP A CB  
3597 C  CG  . TRP A 464 ? 1.3121 1.1791 1.4798 0.0726  0.0995  -0.1012 464 TRP A CG  
3598 C  CD1 . TRP A 464 ? 1.3032 1.1805 1.5002 0.0693  0.1019  -0.1054 464 TRP A CD1 
3599 C  CD2 . TRP A 464 ? 1.2699 1.1142 1.4246 0.0792  0.1160  -0.1014 464 TRP A CD2 
3600 N  NE1 . TRP A 464 ? 1.2618 1.1258 1.4651 0.0729  0.1195  -0.1082 464 TRP A NE1 
3601 C  CE2 . TRP A 464 ? 1.2437 1.0864 1.4195 0.0780  0.1282  -0.1055 464 TRP A CE2 
3602 C  CE3 . TRP A 464 ? 1.2585 1.0822 1.3835 0.0843  0.1207  -0.0980 464 TRP A CE3 
3603 C  CZ2 . TRP A 464 ? 1.2137 1.0347 1.3792 0.0796  0.1448  -0.1057 464 TRP A CZ2 
3604 C  CZ3 . TRP A 464 ? 1.2243 1.0250 1.3392 0.0868  0.1366  -0.0982 464 TRP A CZ3 
3605 C  CH2 . TRP A 464 ? 1.2060 1.0054 1.3397 0.0835  0.1484  -0.1018 464 TRP A CH2 
3606 N  N   . ASP A 465 ? 1.0402 0.9142 1.1633 0.0758  0.0939  -0.1089 465 ASP A N   
3607 C  CA  . ASP A 465 ? 1.0691 0.9252 1.1750 0.0834  0.0986  -0.1121 465 ASP A CA  
3608 C  C   . ASP A 465 ? 1.1445 1.0118 1.2310 0.0844  0.0880  -0.1148 465 ASP A C   
3609 O  O   . ASP A 465 ? 1.1346 0.9821 1.2009 0.0913  0.0890  -0.1140 465 ASP A O   
3610 C  CB  . ASP A 465 ? 1.5005 1.3610 1.6202 0.0844  0.0989  -0.1212 465 ASP A CB  
3611 C  CG  . ASP A 465 ? 1.4513 1.2934 1.5840 0.0839  0.1110  -0.1188 465 ASP A CG  
3612 O  OD1 . ASP A 465 ? 1.4734 1.2968 1.6012 0.0869  0.1136  -0.1218 465 ASP A OD1 
3613 O  OD2 . ASP A 465 ? 1.4171 1.2639 1.5657 0.0797  0.1163  -0.1146 465 ASP A OD2 
3614 N  N   . TYR A 466 ? 1.1773 1.0775 1.2697 0.0758  0.0774  -0.1187 466 TYR A N   
3615 C  CA  . TYR A 466 ? 1.2383 1.1598 1.3176 0.0740  0.0680  -0.1255 466 TYR A CA  
3616 C  C   . TYR A 466 ? 1.2014 1.1238 1.2602 0.0684  0.0615  -0.1162 466 TYR A C   
3617 O  O   . TYR A 466 ? 1.2202 1.1474 1.2623 0.0703  0.0569  -0.1191 466 TYR A O   
3618 C  CB  . TYR A 466 ? 1.0123 0.9728 1.1073 0.0645  0.0611  -0.1372 466 TYR A CB  
3619 C  CG  . TYR A 466 ? 1.0422 1.0008 1.1570 0.0706  0.0655  -0.1471 466 TYR A CG  
3620 C  CD1 . TYR A 466 ? 1.0596 0.9928 1.1711 0.0838  0.0691  -0.1515 466 TYR A CD1 
3621 C  CD2 . TYR A 466 ? 1.0558 1.0345 1.1904 0.0623  0.0639  -0.1513 466 TYR A CD2 
3622 C  CE1 . TYR A 466 ? 1.0888 1.0165 1.2161 0.0884  0.0703  -0.1598 466 TYR A CE1 
3623 C  CE2 . TYR A 466 ? 1.0791 1.0546 1.2310 0.0677  0.0667  -0.1602 466 TYR A CE2 
3624 C  CZ  . TYR A 466 ? 1.0989 1.0483 1.2471 0.0808  0.0696  -0.1643 466 TYR A CZ  
3625 O  OH  . TYR A 466 ? 1.1345 1.0762 1.2980 0.0854  0.0699  -0.1723 466 TYR A OH  
3626 N  N   . GLY A 467 ? 1.4153 1.3320 1.4766 0.0619  0.0593  -0.1057 467 GLY A N   
3627 C  CA  . GLY A 467 ? 1.3869 1.3037 1.4304 0.0539  0.0488  -0.0961 467 GLY A CA  
3628 C  C   . GLY A 467 ? 1.3783 1.2809 1.3957 0.0593  0.0477  -0.0921 467 GLY A C   
3629 O  O   . GLY A 467 ? 1.4161 1.3358 1.4173 0.0493  0.0367  -0.0905 467 GLY A O   
3630 N  N   . TYR A 468 ? 1.4681 1.3389 1.4793 0.0729  0.0587  -0.0900 468 TYR A N   
3631 C  CA  . TYR A 468 ? 1.4524 1.3066 1.4381 0.0788  0.0576  -0.0869 468 TYR A CA  
3632 C  C   . TYR A 468 ? 1.5283 1.4083 1.5092 0.0770  0.0505  -0.0972 468 TYR A C   
3633 O  O   . TYR A 468 ? 1.5539 1.4520 1.5220 0.0680  0.0405  -0.0953 468 TYR A O   
3634 C  CB  . TYR A 468 ? 1.5247 1.3405 1.5026 0.0913  0.0705  -0.0843 468 TYR A CB  
3635 C  CG  . TYR A 468 ? 1.4588 1.2524 1.4371 0.0928  0.0774  -0.0763 468 TYR A CG  
3636 C  CD1 . TYR A 468 ? 1.3917 1.1647 1.3784 0.0980  0.0927  -0.0773 468 TYR A CD1 
3637 C  CD2 . TYR A 468 ? 1.4236 1.2173 1.3944 0.0885  0.0678  -0.0690 468 TYR A CD2 
3638 C  CE1 . TYR A 468 ? 1.3008 1.0590 1.2916 0.0997  0.1003  -0.0739 468 TYR A CE1 
3639 C  CE2 . TYR A 468 ? 1.3328 1.1077 1.3081 0.0921  0.0726  -0.0652 468 TYR A CE2 
3640 C  CZ  . TYR A 468 ? 1.2711 1.0307 1.2580 0.0982  0.0899  -0.0690 468 TYR A CZ  
3641 O  OH  . TYR A 468 ? 1.1892 0.9355 1.1845 0.1021  0.0962  -0.0691 468 TYR A OH  
3642 N  N   . PRO A 469 ? 0.9419 0.8247 0.9341 0.0851  0.0545  -0.1092 469 PRO A N   
3643 C  CA  . PRO A 469 ? 1.0270 0.9401 1.0220 0.0850  0.0467  -0.1240 469 PRO A CA  
3644 C  C   . PRO A 469 ? 1.0928 1.0521 1.0915 0.0681  0.0385  -0.1287 469 PRO A C   
3645 O  O   . PRO A 469 ? 1.1212 1.0990 1.1075 0.0632  0.0315  -0.1319 469 PRO A O   
3646 C  CB  . PRO A 469 ? 1.2378 1.1512 1.2536 0.0929  0.0503  -0.1367 469 PRO A CB  
3647 C  CG  . PRO A 469 ? 1.1660 1.0347 1.1759 0.1010  0.0595  -0.1265 469 PRO A CG  
3648 C  CD  . PRO A 469 ? 1.0927 0.9502 1.0953 0.0943  0.0647  -0.1110 469 PRO A CD  
3649 N  N   . ILE A 470 ? 1.4229 1.4001 1.4365 0.0577  0.0390  -0.1289 470 ILE A N   
3650 C  CA  . ILE A 470 ? 1.4277 1.4454 1.4387 0.0371  0.0301  -0.1312 470 ILE A CA  
3651 C  C   . ILE A 470 ? 1.3844 1.3989 1.3690 0.0278  0.0218  -0.1195 470 ILE A C   
3652 O  O   . ILE A 470 ? 1.3857 1.4344 1.3608 0.0146  0.0149  -0.1260 470 ILE A O   
3653 C  CB  . ILE A 470 ? 1.3741 1.3940 1.3953 0.0254  0.0284  -0.1239 470 ILE A CB  
3654 C  CG1 . ILE A 470 ? 1.3933 1.4196 1.4406 0.0318  0.0354  -0.1352 470 ILE A CG1 
3655 C  CG2 . ILE A 470 ? 1.3877 1.4419 1.3973 0.0002  0.0163  -0.1224 470 ILE A CG2 
3656 C  CD1 . ILE A 470 ? 1.6547 1.7238 1.7124 0.0269  0.0339  -0.1558 470 ILE A CD1 
3657 N  N   . ARG A 471 ? 1.4211 1.3955 1.3943 0.0342  0.0224  -0.1032 471 ARG A N   
3658 C  CA  . ARG A 471 ? 1.3641 1.3288 1.3118 0.0260  0.0125  -0.0903 471 ARG A CA  
3659 C  C   . ARG A 471 ? 1.3497 1.3118 1.2801 0.0325  0.0115  -0.0928 471 ARG A C   
3660 O  O   . ARG A 471 ? 1.3141 1.2933 1.2267 0.0189  0.0015  -0.0897 471 ARG A O   
3661 C  CB  . ARG A 471 ? 1.3660 1.2901 1.3105 0.0323  0.0128  -0.0755 471 ARG A CB  
3662 C  CG  . ARG A 471 ? 1.3473 1.2724 1.2793 0.0150  -0.0036 -0.0636 471 ARG A CG  
3663 C  CD  . ARG A 471 ? 1.3334 1.2267 1.2751 0.0220  -0.0047 -0.0549 471 ARG A CD  
3664 N  NE  . ARG A 471 ? 1.2694 1.1276 1.2081 0.0415  0.0069  -0.0528 471 ARG A NE  
3665 C  CZ  . ARG A 471 ? 1.2192 1.0516 1.1695 0.0510  0.0108  -0.0497 471 ARG A CZ  
3666 N  NH1 . ARG A 471 ? 1.2216 1.0580 1.1895 0.0444  0.0017  -0.0482 471 ARG A NH1 
3667 N  NH2 . ARG A 471 ? 1.1685 0.9723 1.1130 0.0661  0.0232  -0.0494 471 ARG A NH2 
3668 N  N   . TYR A 472 ? 1.4208 1.3602 1.3550 0.0517  0.0203  -0.0980 472 TYR A N   
3669 C  CA  . TYR A 472 ? 1.4171 1.3487 1.3355 0.0591  0.0175  -0.0998 472 TYR A CA  
3670 C  C   . TYR A 472 ? 1.4594 1.4391 1.3865 0.0519  0.0121  -0.1174 472 TYR A C   
3671 O  O   . TYR A 472 ? 1.4392 1.4317 1.3531 0.0476  0.0052  -0.1190 472 TYR A O   
3672 C  CB  . TYR A 472 ? 1.4241 1.3189 1.3441 0.0794  0.0257  -0.1023 472 TYR A CB  
3673 C  CG  . TYR A 472 ? 1.4487 1.3397 1.3576 0.0878  0.0199  -0.1088 472 TYR A CG  
3674 C  CD1 . TYR A 472 ? 1.3907 1.2519 1.2733 0.0907  0.0167  -0.0965 472 TYR A CD1 
3675 C  CD2 . TYR A 472 ? 1.5373 1.4548 1.4637 0.0933  0.0161  -0.1285 472 TYR A CD2 
3676 C  CE1 . TYR A 472 ? 1.4181 1.2749 1.2913 0.0982  0.0097  -0.1023 472 TYR A CE1 
3677 C  CE2 . TYR A 472 ? 1.5703 1.4846 1.4901 0.1020  0.0083  -0.1360 472 TYR A CE2 
3678 C  CZ  . TYR A 472 ? 1.5097 1.3931 1.4024 0.1039  0.0051  -0.1221 472 TYR A CZ  
3679 O  OH  . TYR A 472 ? 1.5467 1.4258 1.4336 0.1125  -0.0042 -0.1295 472 TYR A OH  
3680 N  N   . TYR A 473 ? 1.2598 1.2680 1.2109 0.0508  0.0156  -0.1325 473 TYR A N   
3681 C  CA  . TYR A 473 ? 1.2997 1.3591 1.2642 0.0452  0.0119  -0.1546 473 TYR A CA  
3682 C  C   . TYR A 473 ? 1.2843 1.3913 1.2422 0.0176  0.0064  -0.1558 473 TYR A C   
3683 O  O   . TYR A 473 ? 1.2994 1.4505 1.2596 0.0087  0.0029  -0.1716 473 TYR A O   
3684 C  CB  . TYR A 473 ? 1.0910 1.1604 1.0840 0.0569  0.0167  -0.1731 473 TYR A CB  
3685 C  CG  . TYR A 473 ? 1.1423 1.1745 1.1395 0.0809  0.0170  -0.1778 473 TYR A CG  
3686 C  CD1 . TYR A 473 ? 1.1626 1.1540 1.1644 0.0927  0.0232  -0.1710 473 TYR A CD1 
3687 C  CD2 . TYR A 473 ? 1.1760 1.2134 1.1712 0.0899  0.0095  -0.1890 473 TYR A CD2 
3688 C  CE1 . TYR A 473 ? 1.1926 1.1469 1.1929 0.1107  0.0211  -0.1739 473 TYR A CE1 
3689 C  CE2 . TYR A 473 ? 1.2362 1.2356 1.2322 0.1101  0.0058  -0.1926 473 TYR A CE2 
3690 C  CZ  . TYR A 473 ? 1.2356 1.1919 1.2319 0.1196  0.0112  -0.1843 473 TYR A CZ  
3691 O  OH  . TYR A 473 ? 1.2475 1.1621 1.2391 0.1364  0.0051  -0.1864 473 TYR A OH  
3692 N  N   . SER A 474 ? 1.2029 1.3005 1.1518 0.0031  0.0045  -0.1397 474 SER A N   
3693 C  CA  . SER A 474 ? 1.1948 1.3314 1.1327 -0.0266 -0.0032 -0.1385 474 SER A CA  
3694 C  C   . SER A 474 ? 1.1105 1.2284 1.0176 -0.0435 -0.0151 -0.1161 474 SER A C   
3695 O  O   . SER A 474 ? 1.0973 1.2464 0.9888 -0.0712 -0.0241 -0.1144 474 SER A O   
3696 C  CB  . SER A 474 ? 1.1090 1.2570 1.0617 -0.0353 -0.0012 -0.1410 474 SER A CB  
3697 O  OG  . SER A 474 ? 1.1320 1.2989 1.1124 -0.0212 0.0078  -0.1627 474 SER A OG  
3698 N  N   . ASP A 475 ? 1.5721 1.6388 1.4690 -0.0283 -0.0161 -0.0995 475 ASP A N   
3699 C  CA  . ASP A 475 ? 1.4970 1.5397 1.3658 -0.0411 -0.0297 -0.0788 475 ASP A CA  
3700 C  C   . ASP A 475 ? 1.4952 1.5378 1.3599 -0.0614 -0.0408 -0.0682 475 ASP A C   
3701 O  O   . ASP A 475 ? 1.4753 1.4995 1.3167 -0.0758 -0.0570 -0.0516 475 ASP A O   
3702 C  CB  . ASP A 475 ? 1.8861 1.9545 1.7327 -0.0573 -0.0380 -0.0795 475 ASP A CB  
3703 C  CG  . ASP A 475 ? 1.8220 1.8492 1.6418 -0.0541 -0.0480 -0.0607 475 ASP A CG  
3704 O  OD1 . ASP A 475 ? 1.8078 1.7882 1.6258 -0.0405 -0.0491 -0.0477 475 ASP A OD1 
3705 O  OD2 . ASP A 475 ? 1.7992 1.8432 1.6006 -0.0658 -0.0548 -0.0603 475 ASP A OD2 
3706 N  N   . VAL A 476 ? 1.4295 1.4898 1.3165 -0.0622 -0.0343 -0.0779 476 VAL A N   
3707 C  CA  . VAL A 476 ? 1.4456 1.5021 1.3323 -0.0789 -0.0453 -0.0689 476 VAL A CA  
3708 C  C   . VAL A 476 ? 1.4347 1.4408 1.3298 -0.0622 -0.0480 -0.0556 476 VAL A C   
3709 O  O   . VAL A 476 ? 1.4201 1.3964 1.3203 -0.0387 -0.0386 -0.0542 476 VAL A O   
3710 C  CB  . VAL A 476 ? 1.5227 1.6151 1.4314 -0.0845 -0.0371 -0.0850 476 VAL A CB  
3711 C  CG1 . VAL A 476 ? 1.5451 1.6923 1.4480 -0.1016 -0.0342 -0.1018 476 VAL A CG1 
3712 C  CG2 . VAL A 476 ? 1.5690 1.6461 1.5087 -0.0547 -0.0197 -0.0951 476 VAL A CG2 
3713 N  N   . LYS A 477 ? 1.4479 1.4455 1.3445 -0.0754 -0.0618 -0.0471 477 LYS A N   
3714 C  CA  . LYS A 477 ? 1.4563 1.4142 1.3697 -0.0590 -0.0639 -0.0398 477 LYS A CA  
3715 C  C   . LYS A 477 ? 1.5156 1.4839 1.4611 -0.0511 -0.0517 -0.0501 477 LYS A C   
3716 O  O   . LYS A 477 ? 1.5543 1.5556 1.5028 -0.0672 -0.0523 -0.0575 477 LYS A O   
3717 C  CB  . LYS A 477 ? 1.3199 1.2572 1.2180 -0.0769 -0.0914 -0.0245 477 LYS A CB  
3718 C  CG  . LYS A 477 ? 1.2801 1.1981 1.1458 -0.0856 -0.1088 -0.0115 477 LYS A CG  
3719 C  CD  . LYS A 477 ? 1.3143 1.2053 1.1690 -0.1011 -0.1396 0.0028  477 LYS A CD  
3720 C  CE  . LYS A 477 ? 1.3012 1.1579 1.1314 -0.0991 -0.1569 0.0152  477 LYS A CE  
3721 N  NZ  . LYS A 477 ? 1.3810 1.2056 1.1981 -0.1140 -0.1928 0.0292  477 LYS A NZ  
3722 N  N   . THR A 478 ? 1.6459 1.5870 1.6145 -0.0281 -0.0409 -0.0511 478 THR A N   
3723 C  CA  . THR A 478 ? 1.6530 1.6005 1.6526 -0.0204 -0.0296 -0.0598 478 THR A CA  
3724 C  C   . THR A 478 ? 1.5762 1.4981 1.5951 -0.0153 -0.0380 -0.0538 478 THR A C   
3725 O  O   . THR A 478 ? 1.5224 1.4170 1.5349 -0.0104 -0.0483 -0.0456 478 THR A O   
3726 C  CB  . THR A 478 ? 1.4361 1.3787 1.4499 0.0019  -0.0060 -0.0696 478 THR A CB  
3727 O  OG1 . THR A 478 ? 1.3562 1.2639 1.3690 0.0188  -0.0002 -0.0640 478 THR A OG1 
3728 C  CG2 . THR A 478 ? 1.5174 1.4828 1.5164 0.0005  -0.0001 -0.0778 478 THR A CG2 
3729 N  N   . LEU A 479 ? 1.4129 1.3441 1.4577 -0.0156 -0.0345 -0.0596 479 LEU A N   
3730 C  CA  . LEU A 479 ? 1.3549 1.2663 1.4228 -0.0114 -0.0442 -0.0562 479 LEU A CA  
3731 C  C   . LEU A 479 ? 1.2738 1.1644 1.3636 0.0131  -0.0253 -0.0611 479 LEU A C   
3732 O  O   . LEU A 479 ? 1.2183 1.0867 1.3195 0.0213  -0.0328 -0.0587 479 LEU A O   
3733 C  CB  . LEU A 479 ? 1.0160 0.9452 1.1042 -0.0216 -0.0478 -0.0607 479 LEU A CB  
3734 C  CG  . LEU A 479 ? 1.0838 1.0195 1.1598 -0.0472 -0.0753 -0.0533 479 LEU A CG  
3735 C  CD1 . LEU A 479 ? 1.1104 1.0639 1.2079 -0.0538 -0.0733 -0.0599 479 LEU A CD1 
3736 C  CD2 . LEU A 479 ? 1.0393 0.9438 1.1170 -0.0477 -0.1002 -0.0433 479 LEU A CD2 
3737 N  N   . ILE A 480 ? 1.2715 1.1695 1.3671 0.0238  -0.0018 -0.0691 480 ILE A N   
3738 C  CA  . ILE A 480 ? 1.2242 1.1042 1.3371 0.0426  0.0180  -0.0739 480 ILE A CA  
3739 C  C   . ILE A 480 ? 1.2506 1.1278 1.3473 0.0513  0.0364  -0.0773 480 ILE A C   
3740 O  O   . ILE A 480 ? 1.3138 1.2094 1.4038 0.0467  0.0389  -0.0819 480 ILE A O   
3741 C  CB  . ILE A 480 ? 0.9935 0.8793 1.1427 0.0458  0.0262  -0.0808 480 ILE A CB  
3742 C  CG1 . ILE A 480 ? 0.9745 0.8816 1.1271 0.0410  0.0347  -0.0871 480 ILE A CG1 
3743 C  CG2 . ILE A 480 ? 1.0154 0.9006 1.1834 0.0385  0.0052  -0.0781 480 ILE A CG2 
3744 C  CD1 . ILE A 480 ? 1.1634 1.0767 1.3490 0.0425  0.0419  -0.0933 480 ILE A CD1 
3745 N  N   . ASP A 481 ? 1.2552 1.1086 1.3456 0.0637  0.0476  -0.0764 481 ASP A N   
3746 C  CA  . ASP A 481 ? 1.2702 1.1132 1.3439 0.0721  0.0635  -0.0786 481 ASP A CA  
3747 C  C   . ASP A 481 ? 1.1868 1.0104 1.2724 0.0824  0.0835  -0.0824 481 ASP A C   
3748 O  O   . ASP A 481 ? 1.1333 0.9549 1.2425 0.0844  0.0865  -0.0848 481 ASP A O   
3749 C  CB  . ASP A 481 ? 1.6201 1.4525 1.6612 0.0728  0.0568  -0.0725 481 ASP A CB  
3750 C  CG  . ASP A 481 ? 1.5480 1.3583 1.5828 0.0773  0.0515  -0.0667 481 ASP A CG  
3751 O  OD1 . ASP A 481 ? 1.4728 1.2607 1.5006 0.0876  0.0650  -0.0676 481 ASP A OD1 
3752 O  OD2 . ASP A 481 ? 1.5802 1.3942 1.6147 0.0696  0.0323  -0.0617 481 ASP A OD2 
3753 N  N   . GLY A 482 ? 1.3355 1.1454 1.4045 0.0877  0.0962  -0.0836 482 GLY A N   
3754 C  CA  . GLY A 482 ? 1.2775 1.0673 1.3491 0.0932  0.1155  -0.0861 482 GLY A CA  
3755 C  C   . GLY A 482 ? 1.2003 0.9753 1.2727 0.0976  0.1221  -0.0857 482 GLY A C   
3756 O  O   . GLY A 482 ? 1.1579 0.9192 1.2313 0.0996  0.1399  -0.0891 482 GLY A O   
3757 N  N   . GLY A 483 ? 1.2070 0.9846 1.2776 0.0980  0.1069  -0.0824 483 GLY A N   
3758 C  CA  . GLY A 483 ? 1.1431 0.9084 1.2184 0.1039  0.1089  -0.0846 483 GLY A CA  
3759 C  C   . GLY A 483 ? 1.1354 0.9157 1.2449 0.1029  0.0961  -0.0887 483 GLY A C   
3760 O  O   . GLY A 483 ? 1.0836 0.8641 1.2188 0.1080  0.1045  -0.0976 483 GLY A O   
3761 N  N   . LYS A 484 ? 1.2712 1.0651 1.3814 0.0951  0.0750  -0.0832 484 LYS A N   
3762 C  CA  . LYS A 484 ? 1.2790 1.0846 1.4185 0.0913  0.0579  -0.0852 484 LYS A CA  
3763 C  C   . LYS A 484 ? 1.3159 1.1411 1.4783 0.0855  0.0641  -0.0890 484 LYS A C   
3764 O  O   . LYS A 484 ? 1.3916 1.2311 1.5469 0.0755  0.0532  -0.0848 484 LYS A O   
3765 C  CB  . LYS A 484 ? 1.2957 1.1023 1.4165 0.0816  0.0297  -0.0755 484 LYS A CB  
3766 C  CG  . LYS A 484 ? 1.3174 1.1294 1.4614 0.0751  0.0056  -0.0752 484 LYS A CG  
3767 C  CD  . LYS A 484 ? 1.3930 1.2064 1.5101 0.0593  -0.0217 -0.0637 484 LYS A CD  
3768 C  CE  . LYS A 484 ? 1.4155 1.2198 1.5472 0.0541  -0.0518 -0.0612 484 LYS A CE  
3769 N  NZ  . LYS A 484 ? 1.4824 1.2816 1.5803 0.0359  -0.0806 -0.0481 484 LYS A NZ  
3770 N  N   . HIS A 485 ? 1.2963 1.1236 1.4851 0.0907  0.0822  -0.0977 485 HIS A N   
3771 C  CA  . HIS A 485 ? 1.3292 1.1723 1.5374 0.0854  0.0893  -0.1009 485 HIS A CA  
3772 C  C   . HIS A 485 ? 1.2862 1.1364 1.5349 0.0886  0.0991  -0.1109 485 HIS A C   
3773 O  O   . HIS A 485 ? 1.2894 1.1437 1.5479 0.0872  0.1173  -0.1151 485 HIS A O   
3774 C  CB  . HIS A 485 ? 1.2558 1.0948 1.4419 0.0846  0.1056  -0.0997 485 HIS A CB  
3775 C  CG  . HIS A 485 ? 1.2050 1.0268 1.3828 0.0901  0.1280  -0.1028 485 HIS A CG  
3776 N  ND1 . HIS A 485 ? 1.1468 0.9614 1.3354 0.0957  0.1367  -0.1083 485 HIS A ND1 
3777 C  CD2 . HIS A 485 ? 1.2143 1.0233 1.3723 0.0895  0.1430  -0.1020 485 HIS A CD2 
3778 C  CE1 . HIS A 485 ? 1.1245 0.9249 1.2981 0.0962  0.1576  -0.1102 485 HIS A CE1 
3779 N  NE2 . HIS A 485 ? 1.1648 0.9588 1.3182 0.0920  0.1607  -0.1052 485 HIS A NE2 
3780 N  N   . LEU A 486 ? 1.3669 1.2183 1.6396 0.0925  0.0851  -0.1153 486 LEU A N   
3781 C  CA  . LEU A 486 ? 1.3400 1.2035 1.6581 0.0954  0.0898  -0.1270 486 LEU A CA  
3782 C  C   . LEU A 486 ? 1.3888 1.2674 1.7266 0.0866  0.0770  -0.1249 486 LEU A C   
3783 O  O   . LEU A 486 ? 1.4419 1.3216 1.7590 0.0782  0.0599  -0.1153 486 LEU A O   
3784 C  CB  . LEU A 486 ? 1.2216 1.0809 1.5629 0.1046  0.0756  -0.1353 486 LEU A CB  
3785 C  CG  . LEU A 486 ? 1.1735 1.0225 1.5084 0.1150  0.0910  -0.1436 486 LEU A CG  
3786 C  CD1 . LEU A 486 ? 1.1525 1.0039 1.5253 0.1258  0.0772  -0.1581 486 LEU A CD1 
3787 C  CD2 . LEU A 486 ? 1.1598 1.0144 1.4947 0.1136  0.1260  -0.1505 486 LEU A CD2 
3788 N  N   . GLY A 487 ? 1.0178 0.9095 1.3947 0.0873  0.0858  -0.1346 487 GLY A N   
3789 C  CA  . GLY A 487 ? 1.0626 0.9674 1.4611 0.0794  0.0728  -0.1334 487 GLY A CA  
3790 C  C   . GLY A 487 ? 1.0976 0.9989 1.4920 0.0741  0.0390  -0.1264 487 GLY A C   
3791 O  O   . GLY A 487 ? 1.1558 1.0629 1.5370 0.0626  0.0272  -0.1189 487 GLY A O   
3792 N  N   . LYS A 488 ? 1.1320 1.0231 1.5363 0.0814  0.0229  -0.1297 488 LYS A N   
3793 C  CA  . LYS A 488 ? 1.1662 1.0467 1.5620 0.0753  -0.0129 -0.1220 488 LYS A CA  
3794 C  C   . LYS A 488 ? 1.2095 1.0841 1.5543 0.0634  -0.0214 -0.1071 488 LYS A C   
3795 O  O   . LYS A 488 ? 1.2264 1.1006 1.5581 0.0492  -0.0463 -0.0984 488 LYS A O   
3796 C  CB  . LYS A 488 ? 1.8179 1.6850 2.2327 0.0877  -0.0283 -0.1300 488 LYS A CB  
3797 C  CG  . LYS A 488 ? 1.7982 1.6434 2.1831 0.0824  -0.0621 -0.1187 488 LYS A CG  
3798 C  CD  . LYS A 488 ? 1.7805 1.6237 2.1372 0.0611  -0.0882 -0.1028 488 LYS A CD  
3799 C  CE  . LYS A 488 ? 1.8290 1.6675 2.2126 0.0541  -0.1213 -0.1031 488 LYS A CE  
3800 N  NZ  . LYS A 488 ? 1.8204 1.6320 2.1973 0.0535  -0.1602 -0.0988 488 LYS A NZ  
3801 N  N   . ASP A 489 ? 1.1332 1.0042 1.4485 0.0672  -0.0013 -0.1047 489 ASP A N   
3802 C  CA  . ASP A 489 ? 1.1659 1.0350 1.4365 0.0566  -0.0089 -0.0931 489 ASP A CA  
3803 C  C   . ASP A 489 ? 1.2046 1.0920 1.4654 0.0471  0.0020  -0.0919 489 ASP A C   
3804 O  O   . ASP A 489 ? 1.2539 1.1501 1.4931 0.0324  -0.0128 -0.0854 489 ASP A O   
3805 C  CB  . ASP A 489 ? 1.4264 1.2823 1.6701 0.0655  0.0044  -0.0916 489 ASP A CB  
3806 C  CG  . ASP A 489 ? 1.3662 1.2048 1.6221 0.0774  -0.0030 -0.0962 489 ASP A CG  
3807 O  OD1 . ASP A 489 ? 1.3871 1.2163 1.6475 0.0739  -0.0324 -0.0931 489 ASP A OD1 
3808 O  OD2 . ASP A 489 ? 1.3037 1.1371 1.5636 0.0895  0.0197  -0.1037 489 ASP A OD2 
3809 N  N   . ASN A 490 ? 1.0082 0.9013 1.2841 0.0544  0.0272  -0.0991 490 ASN A N   
3810 C  CA  . ASN A 490 ? 1.0430 0.9516 1.3162 0.0476  0.0357  -0.1005 490 ASN A CA  
3811 C  C   . ASN A 490 ? 1.0664 0.9889 1.3563 0.0355  0.0184  -0.1003 490 ASN A C   
3812 O  O   . ASN A 490 ? 1.1157 1.0531 1.3958 0.0265  0.0187  -0.1009 490 ASN A O   
3813 C  CB  . ASN A 490 ? 1.3607 1.2679 1.6490 0.0562  0.0619  -0.1075 490 ASN A CB  
3814 C  CG  . ASN A 490 ? 1.3178 1.2091 1.5879 0.0657  0.0787  -0.1075 490 ASN A CG  
3815 O  OD1 . ASN A 490 ? 1.2981 1.1842 1.5364 0.0656  0.0795  -0.1033 490 ASN A OD1 
3816 N  ND2 . ASN A 490 ? 1.3135 1.1982 1.6036 0.0731  0.0924  -0.1134 490 ASN A ND2 
3817 N  N   . PHE A 491 ? 0.9828 0.9005 1.2988 0.0354  0.0024  -0.1008 491 PHE A N   
3818 C  CA  . PHE A 491 ? 0.9999 0.9274 1.3323 0.0234  -0.0153 -0.1002 491 PHE A CA  
3819 C  C   . PHE A 491 ? 1.0563 0.9934 1.3561 0.0045  -0.0320 -0.0931 491 PHE A C   
3820 O  O   . PHE A 491 ? 1.0945 1.0473 1.3961 -0.0048 -0.0308 -0.0955 491 PHE A O   
3821 C  CB  . PHE A 491 ? 1.0527 0.9698 1.4150 0.0256  -0.0368 -0.1014 491 PHE A CB  
3822 C  CG  . PHE A 491 ? 1.0775 1.0013 1.4565 0.0132  -0.0561 -0.1004 491 PHE A CG  
3823 C  CD1 . PHE A 491 ? 1.0670 1.0021 1.4801 0.0166  -0.0437 -0.1082 491 PHE A CD1 
3824 C  CD2 . PHE A 491 ? 1.1110 1.0286 1.4688 -0.0041 -0.0873 -0.0911 491 PHE A CD2 
3825 C  CE1 . PHE A 491 ? 1.0879 1.0279 1.5155 0.0050  -0.0621 -0.1072 491 PHE A CE1 
3826 C  CE2 . PHE A 491 ? 1.1402 1.0616 1.5099 -0.0175 -0.1062 -0.0896 491 PHE A CE2 
3827 C  CZ  . PHE A 491 ? 1.1227 1.0553 1.5282 -0.0120 -0.0935 -0.0979 491 PHE A CZ  
3828 N  N   . PHE A 492 ? 1.0502 0.9790 1.3200 -0.0023 -0.0475 -0.0851 492 PHE A N   
3829 C  CA  . PHE A 492 ? 1.1199 1.0606 1.3553 -0.0240 -0.0630 -0.0787 492 PHE A CA  
3830 C  C   . PHE A 492 ? 1.1741 1.1384 1.3915 -0.0270 -0.0435 -0.0846 492 PHE A C   
3831 O  O   . PHE A 492 ? 1.2332 1.2170 1.4495 -0.0397 -0.0456 -0.0885 492 PHE A O   
3832 C  CB  . PHE A 492 ? 1.5211 1.4469 1.7269 -0.0311 -0.0824 -0.0688 492 PHE A CB  
3833 C  CG  . PHE A 492 ? 1.4690 1.3691 1.6935 -0.0252 -0.1039 -0.0653 492 PHE A CG  
3834 C  CD1 . PHE A 492 ? 1.4039 1.2857 1.6331 -0.0077 -0.0993 -0.0665 492 PHE A CD1 
3835 C  CD2 . PHE A 492 ? 1.4876 1.3813 1.7265 -0.0364 -0.1299 -0.0625 492 PHE A CD2 
3836 C  CE1 . PHE A 492 ? 1.3690 1.2287 1.6194 -0.0002 -0.1205 -0.0669 492 PHE A CE1 
3837 C  CE2 . PHE A 492 ? 1.4496 1.3186 1.7096 -0.0291 -0.1532 -0.0617 492 PHE A CE2 
3838 C  CZ  . PHE A 492 ? 1.3916 1.2448 1.6591 -0.0102 -0.1485 -0.0649 492 PHE A CZ  
3839 N  N   . SER A 493 ? 1.0367 0.9988 1.2405 -0.0153 -0.0263 -0.0866 493 SER A N   
3840 C  CA  . SER A 493 ? 1.0912 1.0736 1.2832 -0.0147 -0.0099 -0.0948 493 SER A CA  
3841 C  C   . SER A 493 ? 1.0916 1.0843 1.3095 -0.0100 0.0024  -0.1044 493 SER A C   
3842 O  O   . SER A 493 ? 1.1569 1.1713 1.3681 -0.0160 0.0061  -0.1126 493 SER A O   
3843 C  CB  . SER A 493 ? 1.4135 1.3856 1.5912 0.0000  0.0056  -0.0955 493 SER A CB  
3844 O  OG  . SER A 493 ? 1.5956 1.5652 1.7440 -0.0078 -0.0063 -0.0880 493 SER A OG  
3845 N  N   . SER A 494 ? 1.1921 1.1704 1.4401 0.0003  0.0082  -0.1046 494 SER A N   
3846 C  CA  . SER A 494 ? 1.1979 1.1837 1.4711 0.0023  0.0167  -0.1119 494 SER A CA  
3847 C  C   . SER A 494 ? 1.2569 1.2601 1.5301 -0.0157 -0.0005 -0.1124 494 SER A C   
3848 O  O   . SER A 494 ? 1.3164 1.3375 1.5875 -0.0206 0.0036  -0.1204 494 SER A O   
3849 C  CB  . SER A 494 ? 1.1036 1.0742 1.4106 0.0128  0.0230  -0.1118 494 SER A CB  
3850 O  OG  . SER A 494 ? 1.1165 1.0938 1.4477 0.0132  0.0306  -0.1179 494 SER A OG  
3851 N  N   . PHE A 495 ? 1.1360 1.1319 1.4106 -0.0259 -0.0215 -0.1044 495 PHE A N   
3852 C  CA  . PHE A 495 ? 1.1902 1.1966 1.4633 -0.0456 -0.0414 -0.1026 495 PHE A CA  
3853 C  C   . PHE A 495 ? 1.2779 1.3093 1.5178 -0.0638 -0.0448 -0.1059 495 PHE A C   
3854 O  O   . PHE A 495 ? 1.3051 1.3552 1.5479 -0.0726 -0.0437 -0.1136 495 PHE A O   
3855 C  CB  . PHE A 495 ? 1.3354 1.3230 1.6088 -0.0536 -0.0675 -0.0920 495 PHE A CB  
3856 C  CG  . PHE A 495 ? 1.3810 1.3712 1.6550 -0.0739 -0.0913 -0.0885 495 PHE A CG  
3857 C  CD1 . PHE A 495 ? 1.3354 1.3125 1.6448 -0.0694 -0.1025 -0.0882 495 PHE A CD1 
3858 C  CD2 . PHE A 495 ? 1.4603 1.4669 1.6993 -0.0988 -0.1031 -0.0862 495 PHE A CD2 
3859 C  CE1 . PHE A 495 ? 1.3819 1.3577 1.6905 -0.0885 -0.1270 -0.0842 495 PHE A CE1 
3860 C  CE2 . PHE A 495 ? 1.5025 1.5090 1.7376 -0.1201 -0.1259 -0.0821 495 PHE A CE2 
3861 C  CZ  . PHE A 495 ? 1.4739 1.4628 1.7431 -0.1147 -0.1389 -0.0803 495 PHE A CZ  
3862 N  N   . VAL A 496 ? 1.1810 1.2145 1.3903 -0.0700 -0.0488 -0.1015 496 VAL A N   
3863 C  CA  . VAL A 496 ? 1.2382 1.3006 1.4159 -0.0887 -0.0507 -0.1066 496 VAL A CA  
3864 C  C   . VAL A 496 ? 1.2419 1.3292 1.4268 -0.0806 -0.0309 -0.1234 496 VAL A C   
3865 O  O   . VAL A 496 ? 1.2694 1.3865 1.4397 -0.0964 -0.0324 -0.1329 496 VAL A O   
3866 C  CB  . VAL A 496 ? 1.0537 1.1148 1.2018 -0.0917 -0.0529 -0.1009 496 VAL A CB  
3867 C  CG1 . VAL A 496 ? 1.2827 1.3799 1.4079 -0.1030 -0.0451 -0.1125 496 VAL A CG1 
3868 C  CG2 . VAL A 496 ? 1.2623 1.3057 1.3915 -0.1099 -0.0797 -0.0854 496 VAL A CG2 
3869 N  N   . LEU A 497 ? 0.9732 1.0473 1.1803 -0.0565 -0.0134 -0.1279 497 LEU A N   
3870 C  CA  . LEU A 497 ? 0.9869 1.0763 1.2011 -0.0457 0.0024  -0.1434 497 LEU A CA  
3871 C  C   . LEU A 497 ? 0.9854 1.0743 1.2266 -0.0409 0.0067  -0.1501 497 LEU A C   
3872 O  O   . LEU A 497 ? 1.0131 1.1162 1.2587 -0.0349 0.0150  -0.1644 497 LEU A O   
3873 C  CB  . LEU A 497 ? 0.8027 0.8727 1.0195 -0.0237 0.0173  -0.1432 497 LEU A CB  
3874 C  CG  . LEU A 497 ? 0.8189 0.8966 1.0115 -0.0216 0.0202  -0.1457 497 LEU A CG  
3875 C  CD1 . LEU A 497 ? 0.8077 0.8539 1.0039 -0.0025 0.0309  -0.1387 497 LEU A CD1 
3876 C  CD2 . LEU A 497 ? 0.8614 0.9651 1.0537 -0.0188 0.0263  -0.1644 497 LEU A CD2 
3877 N  N   . SER A 498 ? 1.0441 1.1156 1.3055 -0.0417 0.0005  -0.1412 498 SER A N   
3878 C  CA  . SER A 498 ? 1.0415 1.1116 1.3299 -0.0367 0.0054  -0.1473 498 SER A CA  
3879 C  C   . SER A 498 ? 1.0618 1.1376 1.3590 -0.0536 -0.0108 -0.1444 498 SER A C   
3880 O  O   . SER A 498 ? 1.0823 1.1630 1.3970 -0.0536 -0.0091 -0.1512 498 SER A O   
3881 C  CB  . SER A 498 ? 1.0766 1.1212 1.3891 -0.0183 0.0185  -0.1434 498 SER A CB  
3882 O  OG  . SER A 498 ? 1.0413 1.0696 1.3642 -0.0183 0.0116  -0.1323 498 SER A OG  
3883 N  N   . LYS A 499 ? 1.4216 1.4941 1.7051 -0.0688 -0.0287 -0.1339 499 LYS A N   
3884 C  CA  . LYS A 499 ? 1.4527 1.5276 1.7393 -0.0874 -0.0479 -0.1303 499 LYS A CA  
3885 C  C   . LYS A 499 ? 1.5129 1.6182 1.7724 -0.1079 -0.0518 -0.1395 499 LYS A C   
3886 O  O   . LYS A 499 ? 1.5274 1.6528 1.7723 -0.1044 -0.0390 -0.1505 499 LYS A O   
3887 C  CB  . LYS A 499 ? 1.5476 1.6021 1.8295 -0.0965 -0.0698 -0.1154 499 LYS A CB  
3888 C  CG  . LYS A 499 ? 1.4798 1.5092 1.7926 -0.0752 -0.0650 -0.1106 499 LYS A CG  
3889 C  CD  . LYS A 499 ? 1.4570 1.4846 1.8085 -0.0623 -0.0526 -0.1174 499 LYS A CD  
3890 C  CE  . LYS A 499 ? 1.3788 1.3872 1.7648 -0.0448 -0.0476 -0.1152 499 LYS A CE  
3891 N  NZ  . LYS A 499 ? 1.3726 1.3810 1.7969 -0.0409 -0.0451 -0.1197 499 LYS A NZ  
3892 N  N   . GLU A 500 ? 1.3757 1.4853 1.6292 -0.1297 -0.0699 -0.1366 500 GLU A N   
3893 C  CA  . GLU A 500 ? 1.4452 1.5866 1.6714 -0.1530 -0.0733 -0.1468 500 GLU A CA  
3894 C  C   . GLU A 500 ? 1.4856 1.6434 1.6720 -0.1714 -0.0781 -0.1447 500 GLU A C   
3895 O  O   . GLU A 500 ? 1.4765 1.6145 1.6512 -0.1739 -0.0888 -0.1301 500 GLU A O   
3896 C  CB  . GLU A 500 ? 1.7411 1.8796 1.9670 -0.1745 -0.0928 -0.1428 500 GLU A CB  
3897 C  CG  . GLU A 500 ? 1.7031 1.8284 1.9685 -0.1590 -0.0892 -0.1455 500 GLU A CG  
3898 C  CD  . GLU A 500 ? 1.8864 2.0182 2.1472 -0.1813 -0.1047 -0.1473 500 GLU A CD  
3899 O  OE1 . GLU A 500 ? 1.9656 2.1035 2.1928 -0.2104 -0.1228 -0.1418 500 GLU A OE1 
3900 O  OE2 . GLU A 500 ? 1.8533 1.9829 2.1415 -0.1714 -0.0996 -0.1537 500 GLU A OE2 
3901 N  N   . GLN A 501 ? 1.6507 2.0762 1.5185 0.2688  -0.2148 -0.0659 501 GLN A N   
3902 C  CA  . GLN A 501 ? 1.6068 2.0987 1.4553 0.2564  -0.1828 -0.0467 501 GLN A CA  
3903 C  C   . GLN A 501 ? 1.5316 2.0245 1.3539 0.2235  -0.1725 -0.0175 501 GLN A C   
3904 O  O   . GLN A 501 ? 1.4403 1.9571 1.2819 0.1931  -0.1534 0.0066  501 GLN A O   
3905 C  CB  . GLN A 501 ? 1.2327 1.7687 1.0404 0.2897  -0.1730 -0.0658 501 GLN A CB  
3906 C  CG  . GLN A 501 ? 1.2984 1.8768 1.1391 0.3125  -0.1633 -0.0809 501 GLN A CG  
3907 C  CD  . GLN A 501 ? 1.4087 2.0503 1.2140 0.3378  -0.1406 -0.0941 501 GLN A CD  
3908 O  OE1 . GLN A 501 ? 1.3890 2.0676 1.1564 0.3215  -0.1174 -0.0771 501 GLN A OE1 
3909 N  NE2 . GLN A 501 ? 1.6624 2.3152 1.4794 0.3777  -0.1462 -0.1253 501 GLN A NE2 
3910 N  N   . ILE A 502 ? 1.7318 2.1957 1.5066 0.2290  -0.1878 -0.0193 502 ILE A N   
3911 C  CA  . ILE A 502 ? 1.6997 2.1623 1.4398 0.1999  -0.1811 0.0097  502 ILE A CA  
3912 C  C   . ILE A 502 ? 1.6107 2.0397 1.3972 0.1658  -0.1846 0.0304  502 ILE A C   
3913 O  O   . ILE A 502 ? 1.5480 2.0051 1.3403 0.1356  -0.1623 0.0559  502 ILE A O   
3914 C  CB  . ILE A 502 ? 1.4640 1.8883 1.1394 0.2123  -0.2053 0.0043  502 ILE A CB  
3915 C  CG1 . ILE A 502 ? 1.7018 2.1552 1.3232 0.2467  -0.1993 -0.0207 502 ILE A CG1 
3916 C  CG2 . ILE A 502 ? 1.5843 2.0050 1.2182 0.1806  -0.1998 0.0378  502 ILE A CG2 
3917 C  CD1 . ILE A 502 ? 1.7802 2.2013 1.4185 0.2837  -0.2253 -0.0583 502 ILE A CD1 
3918 N  N   . PRO A 503 ? 1.6013 1.9710 1.4240 0.1699  -0.2118 0.0181  503 PRO A N   
3919 C  CA  . PRO A 503 ? 1.5411 1.8785 1.4105 0.1399  -0.2121 0.0330  503 PRO A CA  
3920 C  C   . PRO A 503 ? 1.4559 1.8249 1.3604 0.1200  -0.1847 0.0417  503 PRO A C   
3921 O  O   . PRO A 503 ? 1.4090 1.7746 1.3256 0.0891  -0.1724 0.0622  503 PRO A O   
3922 C  CB  . PRO A 503 ? 1.1078 1.3891 1.0191 0.1539  -0.2416 0.0110  503 PRO A CB  
3923 C  CG  . PRO A 503 ? 1.3042 1.5931 1.2006 0.1884  -0.2527 -0.0152 503 PRO A CG  
3924 C  CD  . PRO A 503 ? 1.3385 1.6698 1.1661 0.2007  -0.2418 -0.0112 503 PRO A CD  
3925 N  N   . ALA A 504 ? 1.3699 1.7659 1.2880 0.1376  -0.1780 0.0263  504 ALA A N   
3926 C  CA  . ALA A 504 ? 1.3061 1.7342 1.2499 0.1201  -0.1563 0.0358  504 ALA A CA  
3927 C  C   . ALA A 504 ? 1.2664 1.7408 1.1855 0.0959  -0.1338 0.0624  504 ALA A C   
3928 O  O   . ALA A 504 ? 1.2075 1.6783 1.1422 0.0626  -0.1220 0.0814  504 ALA A O   
3929 C  CB  . ALA A 504 ? 0.6905 1.1481 0.6418 0.1487  -0.1567 0.0170  504 ALA A CB  
3930 N  N   . ALA A 505 ? 1.6171 2.1343 1.4960 0.1122  -0.1271 0.0625  505 ALA A N   
3931 C  CA  . ALA A 505 ? 1.6086 2.1770 1.4617 0.0905  -0.1041 0.0872  505 ALA A CA  
3932 C  C   . ALA A 505 ? 1.5841 2.1161 1.4273 0.0557  -0.1065 0.1122  505 ALA A C   
3933 O  O   . ALA A 505 ? 1.5549 2.1155 1.3953 0.0253  -0.0888 0.1366  505 ALA A O   
3934 C  CB  . ALA A 505 ? 0.6981 1.3051 0.5028 0.1135  -0.0970 0.0806  505 ALA A CB  
3935 N  N   . ASN A 506 ? 1.6463 2.1145 1.4885 0.0600  -0.1304 0.1059  506 ASN A N   
3936 C  CA  . ASN A 506 ? 1.6496 2.0762 1.4925 0.0291  -0.1361 0.1275  506 ASN A CA  
3937 C  C   . ASN A 506 ? 1.5884 1.9887 1.4816 0.0029  -0.1298 0.1315  506 ASN A C   
3938 O  O   . ASN A 506 ? 1.5730 1.9731 1.4643 -0.0300 -0.1186 0.1543  506 ASN A O   
3939 C  CB  . ASN A 506 ? 1.5132 1.8839 1.3379 0.0422  -0.1663 0.1222  506 ASN A CB  
3940 C  CG  . ASN A 506 ? 1.5967 1.9816 1.3509 0.0439  -0.1690 0.1370  506 ASN A CG  
3941 O  OD1 . ASN A 506 ? 1.6030 2.0388 1.3266 0.0285  -0.1441 0.1554  506 ASN A OD1 
3942 N  ND2 . ASN A 506 ? 1.6774 2.0169 1.4048 0.0604  -0.1995 0.1300  506 ASN A ND2 
3943 N  N   . MET A 507 ? 1.5771 1.9519 1.5115 0.0156  -0.1365 0.1091  507 MET A N   
3944 C  CA  . MET A 507 ? 1.5208 1.8778 1.4946 -0.0080 -0.1247 0.1093  507 MET A CA  
3945 C  C   . MET A 507 ? 1.4568 1.8640 1.4172 -0.0305 -0.1031 0.1283  507 MET A C   
3946 O  O   . MET A 507 ? 1.4360 1.8376 1.3900 -0.0603 -0.0951 0.1480  507 MET A O   
3947 C  CB  . MET A 507 ? 1.2431 1.5835 1.2521 0.0077  -0.1285 0.0851  507 MET A CB  
3948 C  CG  . MET A 507 ? 1.2203 1.5015 1.2678 0.0105  -0.1417 0.0689  507 MET A CG  
3949 S  SD  . MET A 507 ? 1.2676 1.5054 1.3354 -0.0202 -0.1378 0.0810  507 MET A SD  
3950 C  CE  . MET A 507 ? 1.2051 1.4651 1.2635 -0.0562 -0.1089 0.0971  507 MET A CE  
3951 N  N   . ALA A 508 ? 1.6509 2.1078 1.6091 -0.0158 -0.0959 0.1228  508 ALA A N   
3952 C  CA  . ALA A 508 ? 1.6062 2.1128 1.5630 -0.0388 -0.0782 0.1409  508 ALA A CA  
3953 C  C   . ALA A 508 ? 1.6062 2.1112 1.5455 -0.0747 -0.0696 0.1679  508 ALA A C   
3954 O  O   . ALA A 508 ? 1.5858 2.0675 1.5381 -0.1059 -0.0640 0.1770  508 ALA A O   
3955 C  CB  . ALA A 508 ? 1.2376 1.8127 1.1849 -0.0153 -0.0720 0.1376  508 ALA A CB  
3956 N  N   . ARG A 509 ? 1.3406 1.8638 1.2462 -0.0715 -0.0694 0.1801  509 ARG A N   
3957 C  CA  . ARG A 509 ? 1.3715 1.8836 1.2552 -0.1048 -0.0656 0.2075  509 ARG A CA  
3958 C  C   . ARG A 509 ? 1.3787 1.8183 1.2806 -0.1260 -0.0751 0.2090  509 ARG A C   
3959 O  O   . ARG A 509 ? 1.3641 1.7960 1.2759 -0.1589 -0.0663 0.2217  509 ARG A O   
3960 C  CB  . ARG A 509 ? 1.4051 1.9243 1.2427 -0.0940 -0.0707 0.2169  509 ARG A CB  
3961 C  CG  . ARG A 509 ? 1.4616 1.9754 1.2680 -0.1295 -0.0668 0.2498  509 ARG A CG  
3962 C  CD  . ARG A 509 ? 1.4144 1.9800 1.2314 -0.1639 -0.0451 0.2709  509 ARG A CD  
3963 N  NE  . ARG A 509 ? 1.3960 2.0480 1.2125 -0.1537 -0.0248 0.2702  509 ARG A NE  
3964 C  CZ  . ARG A 509 ? 1.3677 2.0747 1.2092 -0.1755 -0.0089 0.2815  509 ARG A CZ  
3965 N  NH1 . ARG A 509 ? 1.3404 2.0209 1.2006 -0.2104 -0.0115 0.2944  509 ARG A NH1 
3966 N  NH2 . ARG A 509 ? 1.3806 2.1687 1.2306 -0.1618 0.0084  0.2782  509 ARG A NH2 
3967 N  N   . LEU A 510 ? 1.2901 1.6767 1.1994 -0.1069 -0.0935 0.1943  510 LEU A N   
3968 C  CA  . LEU A 510 ? 1.3237 1.6448 1.2585 -0.1238 -0.1013 0.1931  510 LEU A CA  
3969 C  C   . LEU A 510 ? 1.2707 1.5710 1.2428 -0.1393 -0.0887 0.1800  510 LEU A C   
3970 O  O   . LEU A 510 ? 1.2989 1.5630 1.2815 -0.1655 -0.0845 0.1859  510 LEU A O   
3971 C  CB  . LEU A 510 ? 1.2963 1.5696 1.2420 -0.0990 -0.1256 0.1789  510 LEU A CB  
3972 C  CG  . LEU A 510 ? 1.3978 1.6604 1.3014 -0.0974 -0.1435 0.1981  510 LEU A CG  
3973 C  CD1 . LEU A 510 ? 1.4742 1.6865 1.3950 -0.0723 -0.1734 0.1823  510 LEU A CD1 
3974 C  CD2 . LEU A 510 ? 1.4600 1.7022 1.3506 -0.1336 -0.1409 0.2259  510 LEU A CD2 
3975 N  N   . SER A 511 ? 1.2773 1.5954 1.2656 -0.1237 -0.0834 0.1616  511 SER A N   
3976 C  CA  . SER A 511 ? 1.2278 1.5275 1.2391 -0.1402 -0.0708 0.1510  511 SER A CA  
3977 C  C   . SER A 511 ? 1.2013 1.5281 1.1956 -0.1732 -0.0572 0.1702  511 SER A C   
3978 O  O   . SER A 511 ? 1.1971 1.4908 1.1978 -0.2004 -0.0481 0.1692  511 SER A O   
3979 C  CB  . SER A 511 ? 1.2603 1.5744 1.2846 -0.1164 -0.0721 0.1317  511 SER A CB  
3980 O  OG  . SER A 511 ? 1.2433 1.6123 1.2521 -0.1181 -0.0662 0.1411  511 SER A OG  
3981 N  N   . VAL A 512 ? 1.1762 1.5644 1.1504 -0.1718 -0.0552 0.1861  512 VAL A N   
3982 C  CA  . VAL A 512 ? 1.1594 1.5742 1.1247 -0.2056 -0.0453 0.2051  512 VAL A CA  
3983 C  C   . VAL A 512 ? 1.2233 1.6074 1.1762 -0.2369 -0.0444 0.2235  512 VAL A C   
3984 O  O   . VAL A 512 ? 1.2362 1.5910 1.1902 -0.2683 -0.0391 0.2269  512 VAL A O   
3985 C  CB  . VAL A 512 ? 0.8749 1.3687 0.8331 -0.1988 -0.0415 0.2173  512 VAL A CB  
3986 C  CG1 . VAL A 512 ? 0.8845 1.4057 0.8341 -0.2376 -0.0343 0.2431  512 VAL A CG1 
3987 C  CG2 . VAL A 512 ? 0.8359 1.3510 0.8114 -0.1811 -0.0436 0.2016  512 VAL A CG2 
3988 N  N   . GLU A 513 ? 1.2763 1.6601 1.2135 -0.2293 -0.0514 0.2350  513 GLU A N   
3989 C  CA  . GLU A 513 ? 1.3667 1.7153 1.2909 -0.2587 -0.0545 0.2546  513 GLU A CA  
3990 C  C   . GLU A 513 ? 1.4141 1.6870 1.3600 -0.2697 -0.0570 0.2398  513 GLU A C   
3991 O  O   . GLU A 513 ? 1.4519 1.6990 1.3946 -0.3030 -0.0523 0.2487  513 GLU A O   
3992 C  CB  . GLU A 513 ? 1.7865 2.1351 1.6857 -0.2467 -0.0659 0.2686  513 GLU A CB  
3993 C  CG  . GLU A 513 ? 1.7710 2.1947 1.6435 -0.2443 -0.0569 0.2855  513 GLU A CG  
3994 C  CD  . GLU A 513 ? 1.7597 2.2229 1.6280 -0.2828 -0.0436 0.3093  513 GLU A CD  
3995 O  OE1 . GLU A 513 ? 1.8011 2.2210 1.6723 -0.3149 -0.0464 0.3193  513 GLU A OE1 
3996 O  OE2 . GLU A 513 ? 1.7227 2.2607 1.5881 -0.2807 -0.0310 0.3168  513 GLU A OE2 
3997 N  N   . TYR A 514 ? 1.3891 1.6271 1.3595 -0.2420 -0.0635 0.2156  514 TYR A N   
3998 C  CA  . TYR A 514 ? 1.4505 1.6217 1.4512 -0.2476 -0.0624 0.1970  514 TYR A CA  
3999 C  C   . TYR A 514 ? 1.3969 1.5564 1.4061 -0.2664 -0.0437 0.1820  514 TYR A C   
4000 O  O   . TYR A 514 ? 1.4078 1.5153 1.4309 -0.2837 -0.0359 0.1709  514 TYR A O   
4001 C  CB  . TYR A 514 ? 1.4263 1.5699 1.4586 -0.2138 -0.0748 0.1756  514 TYR A CB  
4002 C  CG  . TYR A 514 ? 1.5353 1.6460 1.5680 -0.2076 -0.0967 0.1866  514 TYR A CG  
4003 C  CD1 . TYR A 514 ? 1.6441 1.7822 1.6351 -0.2074 -0.1091 0.2129  514 TYR A CD1 
4004 C  CD2 . TYR A 514 ? 1.5485 1.6003 1.6231 -0.2027 -0.1052 0.1712  514 TYR A CD2 
4005 C  CE1 . TYR A 514 ? 1.7783 1.8801 1.7607 -0.2040 -0.1330 0.2264  514 TYR A CE1 
4006 C  CE2 . TYR A 514 ? 1.6752 1.6927 1.7515 -0.1960 -0.1316 0.1831  514 TYR A CE2 
4007 C  CZ  . TYR A 514 ? 1.7938 1.8335 1.8193 -0.1977 -0.1471 0.2123  514 TYR A CZ  
4008 O  OH  . TYR A 514 ? 1.9421 1.9423 1.9594 -0.1938 -0.1767 0.2278  514 TYR A OH  
4009 N  N   . THR A 515 ? 1.2501 1.4550 1.2488 -0.2631 -0.0371 0.1811  515 THR A N   
4010 C  CA  . THR A 515 ? 1.2195 1.4134 1.2130 -0.2860 -0.0232 0.1727  515 THR A CA  
4011 C  C   . THR A 515 ? 1.2478 1.4435 1.2169 -0.3247 -0.0205 0.1931  515 THR A C   
4012 O  O   . THR A 515 ? 1.2682 1.4249 1.2299 -0.3509 -0.0108 0.1849  515 THR A O   
4013 C  CB  . THR A 515 ? 1.2349 1.4712 1.2245 -0.2720 -0.0226 0.1678  515 THR A CB  
4014 O  OG1 . THR A 515 ? 1.2272 1.4232 1.2238 -0.2771 -0.0118 0.1461  515 THR A OG1 
4015 C  CG2 . THR A 515 ? 1.1842 1.4698 1.1516 -0.2932 -0.0239 0.1890  515 THR A CG2 
4016 N  N   . GLU A 516 ? 1.1481 1.3878 1.1029 -0.3301 -0.0285 0.2191  516 GLU A N   
4017 C  CA  . GLU A 516 ? 1.2062 1.4455 1.1419 -0.3694 -0.0282 0.2403  516 GLU A CA  
4018 C  C   . GLU A 516 ? 1.3380 1.5095 1.2753 -0.3849 -0.0310 0.2402  516 GLU A C   
4019 O  O   . GLU A 516 ? 1.4038 1.5484 1.3274 -0.4197 -0.0297 0.2482  516 GLU A O   
4020 C  CB  . GLU A 516 ? 1.3967 1.7067 1.3204 -0.3742 -0.0326 0.2691  516 GLU A CB  
4021 C  CG  . GLU A 516 ? 1.4218 1.7504 1.3325 -0.4164 -0.0321 0.2899  516 GLU A CG  
4022 C  CD  . GLU A 516 ? 1.3428 1.6978 1.2560 -0.4231 -0.0303 0.2822  516 GLU A CD  
4023 O  OE1 . GLU A 516 ? 1.3477 1.7133 1.2521 -0.4584 -0.0334 0.2960  516 GLU A OE1 
4024 O  OE2 . GLU A 516 ? 1.2854 1.6480 1.2088 -0.3936 -0.0288 0.2633  516 GLU A OE2 
4025 N  N   . LYS A 517 ? 1.4170 1.5586 1.3723 -0.3589 -0.0379 0.2310  517 LYS A N   
4026 C  CA  . LYS A 517 ? 1.5807 1.6538 1.5467 -0.3689 -0.0436 0.2277  517 LYS A CA  
4027 C  C   . LYS A 517 ? 1.5809 1.5965 1.5693 -0.3726 -0.0290 0.1953  517 LYS A C   
4028 O  O   . LYS A 517 ? 1.6671 1.6268 1.6587 -0.3927 -0.0273 0.1902  517 LYS A O   
4029 C  CB  . LYS A 517 ? 1.3891 1.4500 1.3682 -0.3406 -0.0614 0.2317  517 LYS A CB  
4030 C  CG  . LYS A 517 ? 1.4096 1.5195 1.3571 -0.3393 -0.0730 0.2631  517 LYS A CG  
4031 C  CD  . LYS A 517 ? 1.5931 1.6598 1.5301 -0.3473 -0.0931 0.2837  517 LYS A CD  
4032 C  CE  . LYS A 517 ? 1.6412 1.6627 1.6072 -0.3145 -0.1112 0.2670  517 LYS A CE  
4033 N  NZ  . LYS A 517 ? 1.7535 1.7184 1.7139 -0.3236 -0.1357 0.2857  517 LYS A NZ  
4034 N  N   . SER A 518 ? 1.9456 1.9725 1.9487 -0.3537 -0.0175 0.1726  518 SER A N   
4035 C  CA  . SER A 518 ? 1.9317 1.9098 1.9510 -0.3600 0.0021  0.1418  518 SER A CA  
4036 C  C   . SER A 518 ? 2.0125 1.9662 1.9988 -0.4000 0.0127  0.1437  518 SER A C   
4037 O  O   . SER A 518 ? 2.0471 1.9468 2.0390 -0.4123 0.0294  0.1197  518 SER A O   
4038 C  CB  . SER A 518 ? 1.8206 1.8209 1.8476 -0.3422 0.0131  0.1240  518 SER A CB  
4039 O  OG  . SER A 518 ? 1.8358 1.7936 1.8634 -0.3577 0.0365  0.0984  518 SER A OG  
4040 N  N   . PHE A 519 ? 1.4590 1.4530 1.4121 -0.4207 0.0030  0.1714  519 PHE A N   
4041 C  CA  . PHE A 519 ? 1.4791 1.4597 1.3971 -0.4602 0.0078  0.1759  519 PHE A CA  
4042 C  C   . PHE A 519 ? 1.6471 1.5753 1.5587 -0.4860 0.0034  0.1809  519 PHE A C   
4043 O  O   . PHE A 519 ? 1.6930 1.5872 1.5775 -0.5186 0.0089  0.1756  519 PHE A O   
4044 C  CB  . PHE A 519 ? 2.0663 2.1173 1.9627 -0.4711 -0.0032 0.2035  519 PHE A CB  
4045 C  CG  . PHE A 519 ? 1.9411 2.0289 1.8347 -0.4561 0.0008  0.1951  519 PHE A CG  
4046 C  CD1 . PHE A 519 ? 1.8273 1.9894 1.7220 -0.4458 -0.0100 0.2149  519 PHE A CD1 
4047 C  CD2 . PHE A 519 ? 1.9656 2.0125 1.8562 -0.4529 0.0160  0.1673  519 PHE A CD2 
4048 C  CE1 . PHE A 519 ? 1.7463 1.9374 1.6409 -0.4305 -0.0102 0.2074  519 PHE A CE1 
4049 C  CE2 . PHE A 519 ? 1.8842 1.9583 1.7688 -0.4412 0.0165  0.1623  519 PHE A CE2 
4050 C  CZ  . PHE A 519 ? 1.7782 1.9225 1.6655 -0.4289 0.0011  0.1825  519 PHE A CZ  
4051 N  N   . LYS A 520 ? 1.9132 1.8301 1.8467 -0.4718 -0.0093 0.1912  520 LYS A N   
4052 C  CA  . LYS A 520 ? 2.1134 1.9699 2.0468 -0.4917 -0.0168 0.1942  520 LYS A CA  
4053 C  C   . LYS A 520 ? 1.9914 1.7902 1.9676 -0.4665 -0.0126 0.1661  520 LYS A C   
4054 O  O   . LYS A 520 ? 1.9931 1.7306 1.9753 -0.4788 -0.0009 0.1419  520 LYS A O   
4055 C  CB  . LYS A 520 ? 2.2025 2.0838 2.1234 -0.5025 -0.0391 0.2336  520 LYS A CB  
4056 C  CG  . LYS A 520 ? 2.2298 2.1743 2.1195 -0.5291 -0.0417 0.2614  520 LYS A CG  
4057 C  CD  . LYS A 520 ? 2.4601 2.4059 2.3321 -0.5593 -0.0583 0.2975  520 LYS A CD  
4058 C  CE  . LYS A 520 ? 2.4051 2.4119 2.2554 -0.5915 -0.0585 0.3203  520 LYS A CE  
4059 N  NZ  . LYS A 520 ? 2.6285 2.6436 2.4640 -0.6259 -0.0723 0.3575  520 LYS A NZ  
4060 N  N   . GLU A 521 ? 2.1509 1.9699 2.1586 -0.4309 -0.0225 0.1673  521 GLU A N   
4061 C  CA  . GLU A 521 ? 2.0663 1.8343 2.1254 -0.4057 -0.0246 0.1432  521 GLU A CA  
4062 C  C   . GLU A 521 ? 1.8451 1.5994 1.9381 -0.3899 0.0027  0.1023  521 GLU A C   
4063 O  O   . GLU A 521 ? 1.7658 1.4810 1.9109 -0.3707 0.0058  0.0775  521 GLU A O   
4064 C  CB  . GLU A 521 ? 2.3553 2.1391 2.4328 -0.3778 -0.0524 0.1626  521 GLU A CB  
4065 C  CG  . GLU A 521 ? 2.6081 2.3838 2.6530 -0.3986 -0.0770 0.2008  521 GLU A CG  
4066 C  CD  . GLU A 521 ? 2.6956 2.4821 2.7442 -0.3749 -0.1053 0.2225  521 GLU A CD  
4067 O  OE1 . GLU A 521 ? 2.5647 2.3538 2.6500 -0.3403 -0.1103 0.2045  521 GLU A OE1 
4068 O  OE2 . GLU A 521 ? 2.9127 2.7038 2.9248 -0.3929 -0.1232 0.2581  521 GLU A OE2 
4069 N  N   . ASN A 522 ? 2.2169 2.0028 2.2812 -0.4002 0.0219  0.0963  522 ASN A N   
4070 C  CA  . ASN A 522 ? 2.0297 1.7990 2.1111 -0.3957 0.0516  0.0606  522 ASN A CA  
4071 C  C   . ASN A 522 ? 1.8498 1.6236 1.9920 -0.3591 0.0545  0.0401  522 ASN A C   
4072 O  O   . ASN A 522 ? 1.7514 1.4861 1.9364 -0.3530 0.0745  0.0079  522 ASN A O   
4073 C  CB  . ASN A 522 ? 2.0438 1.7485 2.1212 -0.4193 0.0731  0.0350  522 ASN A CB  
4074 C  CG  . ASN A 522 ? 2.1405 1.8421 2.1518 -0.4574 0.0839  0.0398  522 ASN A CG  
4075 O  OD1 . ASN A 522 ? 2.0801 1.8133 2.0625 -0.4626 0.0933  0.0407  522 ASN A OD1 
4076 N  ND2 . ASN A 522 ? 2.3112 1.9715 2.2973 -0.4849 0.0789  0.0439  522 ASN A ND2 
4077 N  N   . TYR A 523 ? 2.1998 2.0223 2.3474 -0.3352 0.0352  0.0572  523 TYR A N   
4078 C  CA  . TYR A 523 ? 2.0210 1.8512 2.2242 -0.3010 0.0322  0.0401  523 TYR A CA  
4079 C  C   . TYR A 523 ? 1.7792 1.6067 1.9937 -0.3036 0.0642  0.0114  523 TYR A C   
4080 O  O   . TYR A 523 ? 1.7316 1.5827 1.9005 -0.3180 0.0742  0.0176  523 TYR A O   
4081 C  CB  . TYR A 523 ? 1.0029 0.8848 1.1951 -0.2779 0.0055  0.0635  523 TYR A CB  
4082 C  CG  . TYR A 523 ? 1.2397 1.1280 1.4108 -0.2773 -0.0242 0.0949  523 TYR A CG  
4083 C  CD1 . TYR A 523 ? 1.3661 1.3030 1.4858 -0.2850 -0.0339 0.1244  523 TYR A CD1 
4084 C  CD2 . TYR A 523 ? 1.3801 1.2259 1.5840 -0.2696 -0.0426 0.0952  523 TYR A CD2 
4085 C  CE1 . TYR A 523 ? 1.6283 1.5717 1.7247 -0.2880 -0.0569 0.1539  523 TYR A CE1 
4086 C  CE2 . TYR A 523 ? 1.6527 1.4988 1.8297 -0.2724 -0.0705 0.1266  523 TYR A CE2 
4087 C  CZ  . TYR A 523 ? 1.7745 1.6697 1.8952 -0.2831 -0.0755 0.1561  523 TYR A CZ  
4088 O  OH  . TYR A 523 ? 2.0638 1.9596 2.1543 -0.2893 -0.0996 0.1883  523 TYR A OH  
4089 N  N   . PRO A 524 ? 2.0125 1.8104 2.2895 -0.2910 0.0800  -0.0195 524 PRO A N   
4090 C  CA  . PRO A 524 ? 1.7914 1.5875 2.0821 -0.2948 0.1130  -0.0462 524 PRO A CA  
4091 C  C   . PRO A 524 ? 1.6270 1.4651 1.9326 -0.2703 0.0982  -0.0400 524 PRO A C   
4092 O  O   . PRO A 524 ? 1.4704 1.3191 1.7627 -0.2762 0.1164  -0.0485 524 PRO A O   
4093 C  CB  . PRO A 524 ? 1.3399 1.0976 1.7061 -0.2857 0.1314  -0.0797 524 PRO A CB  
4094 C  CG  . PRO A 524 ? 1.4547 1.2109 1.8653 -0.2598 0.0932  -0.0672 524 PRO A CG  
4095 C  CD  . PRO A 524 ? 1.6662 1.4346 2.0094 -0.2712 0.0657  -0.0299 524 PRO A CD  
4096 N  N   . ASP A 525 ? 1.7175 1.5750 2.0455 -0.2438 0.0630  -0.0244 525 ASP A N   
4097 C  CA  . ASP A 525 ? 1.6003 1.4935 1.9410 -0.2177 0.0434  -0.0193 525 ASP A CA  
4098 C  C   . ASP A 525 ? 1.7773 1.6976 2.0845 -0.2049 0.0073  0.0114  525 ASP A C   
4099 O  O   . ASP A 525 ? 1.8916 1.7987 2.2240 -0.1907 -0.0167 0.0175  525 ASP A O   
4100 C  CB  . ASP A 525 ? 2.2558 2.1357 2.6814 -0.1941 0.0407  -0.0439 525 ASP A CB  
4101 C  CG  . ASP A 525 ? 2.1186 2.0250 2.5600 -0.1765 0.0347  -0.0496 525 ASP A CG  
4102 O  OD1 . ASP A 525 ? 2.1948 2.1317 2.5977 -0.1633 0.0094  -0.0297 525 ASP A OD1 
4103 O  OD2 . ASP A 525 ? 1.9505 1.8471 2.4433 -0.1766 0.0564  -0.0747 525 ASP A OD2 
4104 N  N   . VAL A 526 ? 1.5144 1.4716 1.7636 -0.2112 0.0043  0.0307  526 VAL A N   
4105 C  CA  . VAL A 526 ? 1.7047 1.6951 1.9146 -0.2037 -0.0217 0.0598  526 VAL A CA  
4106 C  C   . VAL A 526 ? 1.7366 1.7386 1.9696 -0.1697 -0.0511 0.0613  526 VAL A C   
4107 O  O   . VAL A 526 ? 1.9519 1.9482 2.1782 -0.1631 -0.0742 0.0773  526 VAL A O   
4108 C  CB  . VAL A 526 ? 1.0339 1.0686 1.1926 -0.2117 -0.0168 0.0739  526 VAL A CB  
4109 C  CG1 . VAL A 526 ? 1.1529 1.2298 1.2791 -0.2002 -0.0388 0.0994  526 VAL A CG1 
4110 C  CG2 . VAL A 526 ? 1.0295 1.0532 1.1556 -0.2476 0.0041  0.0777  526 VAL A CG2 
4111 N  N   . LEU A 527 ? 1.2384 1.2532 1.4933 -0.1500 -0.0522 0.0455  527 LEU A N   
4112 C  CA  . LEU A 527 ? 1.2807 1.3003 1.5602 -0.1180 -0.0814 0.0418  527 LEU A CA  
4113 C  C   . LEU A 527 ? 1.4148 1.3968 1.7414 -0.1097 -0.1002 0.0375  527 LEU A C   
4114 O  O   . LEU A 527 ? 1.6392 1.6213 1.9492 -0.0960 -0.1307 0.0534  527 LEU A O   
4115 C  CB  . LEU A 527 ? 1.1022 1.1260 1.4144 -0.1035 -0.0768 0.0197  527 LEU A CB  
4116 C  CG  . LEU A 527 ? 1.1543 1.1904 1.4744 -0.0709 -0.1096 0.0177  527 LEU A CG  
4117 C  CD1 . LEU A 527 ? 1.1301 1.2076 1.3885 -0.0615 -0.1169 0.0322  527 LEU A CD1 
4118 C  CD2 . LEU A 527 ? 0.9563 0.9794 1.3338 -0.0605 -0.1073 -0.0077 527 LEU A CD2 
4119 N  N   . LYS A 528 ? 0.8552 0.8044 1.2396 -0.1179 -0.0820 0.0157  528 LYS A N   
4120 C  CA  . LYS A 528 ? 0.9670 0.8784 1.4064 -0.1110 -0.0978 0.0093  528 LYS A CA  
4121 C  C   . LYS A 528 ? 1.2428 1.1404 1.6385 -0.1218 -0.1151 0.0369  528 LYS A C   
4122 O  O   . LYS A 528 ? 1.4308 1.3060 1.8450 -0.1081 -0.1479 0.0452  528 LYS A O   
4123 C  CB  . LYS A 528 ? 2.4541 2.3367 2.9574 -0.1226 -0.0655 -0.0199 528 LYS A CB  
4124 C  CG  . LYS A 528 ? 2.3129 2.1663 2.9060 -0.1033 -0.0838 -0.0377 528 LYS A CG  
4125 C  CD  . LYS A 528 ? 2.1902 2.0131 2.8397 -0.1173 -0.0489 -0.0646 528 LYS A CD  
4126 C  CE  . LYS A 528 ? 1.8693 1.6619 2.6095 -0.0969 -0.0731 -0.0782 528 LYS A CE  
4127 N  NZ  . LYS A 528 ? 1.7523 1.5098 2.5420 -0.1088 -0.0426 -0.1023 528 LYS A NZ  
4128 N  N   . ALA A 529 ? 1.1672 1.0768 1.5042 -0.1479 -0.0956 0.0528  529 ALA A N   
4129 C  CA  . ALA A 529 ? 1.4323 1.3330 1.7229 -0.1631 -0.1102 0.0822  529 ALA A CA  
4130 C  C   . ALA A 529 ? 1.6649 1.5871 1.9178 -0.1459 -0.1437 0.1062  529 ALA A C   
4131 O  O   . ALA A 529 ? 1.9030 1.7970 2.1547 -0.1414 -0.1730 0.1214  529 ALA A O   
4132 C  CB  . ALA A 529 ? 1.3441 1.2649 1.5794 -0.1941 -0.0849 0.0952  529 ALA A CB  
4133 N  N   . MET A 530 ? 1.1448 1.1143 1.3632 -0.1367 -0.1397 0.1093  530 MET A N   
4134 C  CA  . MET A 530 ? 1.3831 1.3758 1.5595 -0.1194 -0.1666 0.1277  530 MET A CA  
4135 C  C   . MET A 530 ? 1.4524 1.4100 1.6667 -0.0945 -0.2020 0.1202  530 MET A C   
4136 O  O   . MET A 530 ? 1.7221 1.6627 1.9066 -0.0923 -0.2306 0.1416  530 MET A O   
4137 C  CB  . MET A 530 ? 1.8156 1.8582 1.9683 -0.1055 -0.1569 0.1210  530 MET A CB  
4138 C  CG  . MET A 530 ? 1.5554 1.6306 1.6828 -0.1281 -0.1257 0.1255  530 MET A CG  
4139 S  SD  . MET A 530 ? 1.3417 1.4700 1.4509 -0.1091 -0.1179 0.1158  530 MET A SD  
4140 C  CE  . MET A 530 ? 1.4165 1.5730 1.4776 -0.0873 -0.1428 0.1327  530 MET A CE  
4141 N  N   . VAL A 531 ? 1.1646 1.1100 1.4453 -0.0779 -0.2011 0.0909  531 VAL A N   
4142 C  CA  . VAL A 531 ? 1.2381 1.1526 1.5693 -0.0534 -0.2374 0.0804  531 VAL A CA  
4143 C  C   . VAL A 531 ? 1.4786 1.3450 1.8293 -0.0585 -0.2619 0.0930  531 VAL A C   
4144 O  O   . VAL A 531 ? 1.7598 1.6085 2.0849 -0.0474 -0.3016 0.1108  531 VAL A O   
4145 C  CB  . VAL A 531 ? 1.3512 1.2606 1.7667 -0.0413 -0.2262 0.0456  531 VAL A CB  
4146 C  CG1 . VAL A 531 ? 1.2953 1.1707 1.7804 -0.0194 -0.2648 0.0347  531 VAL A CG1 
4147 C  CG2 . VAL A 531 ? 1.0056 0.9529 1.4027 -0.0309 -0.2156 0.0349  531 VAL A CG2 
4148 N  N   . LYS A 532 ? 1.7133 1.5544 2.1058 -0.0754 -0.2397 0.0832  532 LYS A N   
4149 C  CA  . LYS A 532 ? 1.9390 1.7295 2.3550 -0.0805 -0.2619 0.0931  532 LYS A CA  
4150 C  C   . LYS A 532 ? 2.2801 2.0648 2.6107 -0.0969 -0.2799 0.1331  532 LYS A C   
4151 O  O   . LYS A 532 ? 2.5432 2.2825 2.8771 -0.0983 -0.3116 0.1494  532 LYS A O   
4152 C  CB  . LYS A 532 ? 2.8626 2.6293 3.3275 -0.0979 -0.2278 0.0732  532 LYS A CB  
4153 C  CG  . LYS A 532 ? 2.6403 2.3894 3.2118 -0.0805 -0.2215 0.0356  532 LYS A CG  
4154 C  CD  . LYS A 532 ? 2.5492 2.2726 3.1581 -0.0991 -0.1835 0.0145  532 LYS A CD  
4155 C  CE  . LYS A 532 ? 2.3121 2.0278 3.0298 -0.0833 -0.1674 -0.0263 532 LYS A CE  
4156 N  NZ  . LYS A 532 ? 2.2100 1.9040 2.9571 -0.1019 -0.1219 -0.0521 532 LYS A NZ  
4157 N  N   . ASP A 533 ? 1.5490 1.3798 1.8060 -0.1101 -0.2600 0.1492  533 ASP A N   
4158 C  CA  . ASP A 533 ? 1.8771 1.7125 2.0529 -0.1288 -0.2707 0.1874  533 ASP A CA  
4159 C  C   . ASP A 533 ? 2.1034 1.9587 2.2236 -0.1117 -0.2982 0.2038  533 ASP A C   
4160 O  O   . ASP A 533 ? 2.4209 2.2862 2.4679 -0.1270 -0.3039 0.2354  533 ASP A O   
4161 C  CB  . ASP A 533 ? 2.3882 2.2632 2.5202 -0.1578 -0.2316 0.1973  533 ASP A CB  
4162 C  CG  . ASP A 533 ? 2.2088 2.0538 2.3763 -0.1803 -0.2088 0.1861  533 ASP A CG  
4163 O  OD1 . ASP A 533 ? 2.2297 2.0189 2.4364 -0.1802 -0.2263 0.1830  533 ASP A OD1 
4164 O  OD2 . ASP A 533 ? 2.0655 1.9400 2.2210 -0.1977 -0.1749 0.1794  533 ASP A OD2 
4165 N  N   . TYR A 534 ? 1.6454 1.5053 1.7984 -0.0816 -0.3142 0.1816  534 TYR A N   
4166 C  CA  . TYR A 534 ? 1.8031 1.6675 1.9060 -0.0624 -0.3476 0.1926  534 TYR A CA  
4167 C  C   . TYR A 534 ? 1.8672 1.6855 2.0228 -0.0367 -0.3943 0.1802  534 TYR A C   
4168 O  O   . TYR A 534 ? 1.9120 1.7340 2.0432 -0.0155 -0.4216 0.1771  534 TYR A O   
4169 C  CB  . TYR A 534 ? 1.7135 1.6360 1.7825 -0.0500 -0.3269 0.1810  534 TYR A CB  
4170 C  CG  . TYR A 534 ? 1.7375 1.7078 1.7352 -0.0714 -0.2960 0.2027  534 TYR A CG  
4171 C  CD1 . TYR A 534 ? 1.6158 1.6130 1.6290 -0.0921 -0.2571 0.1993  534 TYR A CD1 
4172 C  CD2 . TYR A 534 ? 1.8476 1.8364 1.7629 -0.0725 -0.3057 0.2262  534 TYR A CD2 
4173 C  CE1 . TYR A 534 ? 1.6039 1.6487 1.5621 -0.1121 -0.2315 0.2191  534 TYR A CE1 
4174 C  CE2 . TYR A 534 ? 1.7302 1.7700 1.5909 -0.0928 -0.2745 0.2450  534 TYR A CE2 
4175 C  CZ  . TYR A 534 ? 1.6148 1.6838 1.5022 -0.1121 -0.2389 0.2414  534 TYR A CZ  
4176 O  OH  . TYR A 534 ? 1.5132 1.6361 1.3576 -0.1328 -0.2105 0.2596  534 TYR A OH  
4177 N  N   . ASN A 535 ? 2.1607 1.9352 2.3905 -0.0384 -0.4046 0.1720  535 ASN A N   
4178 C  CA  . ASN A 535 ? 2.2549 1.9847 2.5462 -0.0153 -0.4527 0.1623  535 ASN A CA  
4179 C  C   . ASN A 535 ? 2.0872 1.8375 2.4010 0.0125  -0.4686 0.1394  535 ASN A C   
4180 O  O   . ASN A 535 ? 2.2853 2.0112 2.5804 0.0292  -0.5174 0.1468  535 ASN A O   
4181 C  CB  . ASN A 535 ? 2.4236 2.1059 2.6576 -0.0201 -0.5006 0.1978  535 ASN A CB  
4182 C  CG  . ASN A 535 ? 2.5842 2.2335 2.8117 -0.0469 -0.4925 0.2191  535 ASN A CG  
4183 O  OD1 . ASN A 535 ? 2.5070 2.1336 2.8167 -0.0480 -0.4819 0.2007  535 ASN A OD1 
4184 N  ND2 . ASN A 535 ? 2.7929 2.4396 2.9221 -0.0699 -0.4953 0.2569  535 ASN A ND2 
4185 N  N   . GLN A 536 ? 2.2968 2.0881 2.6449 0.0152  -0.4290 0.1127  536 GLN A N   
4186 C  CA  . GLN A 536 ? 2.0741 1.8816 2.4642 0.0392  -0.4397 0.0858  536 GLN A CA  
4187 C  C   . GLN A 536 ? 1.8131 1.6102 2.3268 0.0449  -0.4289 0.0542  536 GLN A C   
4188 O  O   . GLN A 536 ? 1.5918 1.3942 2.1390 0.0279  -0.3872 0.0453  536 GLN A O   
4189 C  CB  . GLN A 536 ? 1.7467 1.6059 2.0838 0.0382  -0.4049 0.0795  536 GLN A CB  
4190 C  CG  . GLN A 536 ? 1.9066 1.7850 2.1313 0.0378  -0.4129 0.1036  536 GLN A CG  
4191 C  CD  . GLN A 536 ? 1.9819 1.8424 2.1789 0.0621  -0.4619 0.1021  536 GLN A CD  
4192 O  OE1 . GLN A 536 ? 1.9831 1.8151 2.2485 0.0787  -0.4958 0.0855  536 GLN A OE1 
4193 N  NE2 . GLN A 536 ? 2.0675 1.9454 2.1646 0.0637  -0.4657 0.1181  536 GLN A NE2 
4194 N  N   . THR A 537 ? 2.1751 1.9582 2.7559 0.0675  -0.4658 0.0367  537 THR A N   
4195 C  CA  . THR A 537 ? 1.9613 1.7360 2.6705 0.0738  -0.4592 0.0070  537 THR A CA  
4196 C  C   . THR A 537 ? 1.5728 1.3849 2.3233 0.0677  -0.4087 -0.0206 537 THR A C   
4197 O  O   . THR A 537 ? 1.3251 1.1369 2.1639 0.0617  -0.3794 -0.0432 537 THR A O   
4198 C  CB  . THR A 537 ? 1.7386 1.4888 2.5165 0.0992  -0.5194 -0.0024 537 THR A CB  
4199 O  OG1 . THR A 537 ? 2.0623 1.7782 2.7695 0.1054  -0.5732 0.0270  537 THR A OG1 
4200 C  CG2 . THR A 537 ? 1.5141 1.2478 2.4289 0.1044  -0.5193 -0.0255 537 THR A CG2 
4201 N  N   . SER A 538 ? 2.1848 2.0267 2.8711 0.0694  -0.3990 -0.0194 538 SER A N   
4202 C  CA  . SER A 538 ? 1.8422 1.7150 2.5499 0.0609  -0.3536 -0.0400 538 SER A CA  
4203 C  C   . SER A 538 ? 1.7398 1.6420 2.3446 0.0494  -0.3251 -0.0249 538 SER A C   
4204 O  O   . SER A 538 ? 1.8925 1.7954 2.4204 0.0420  -0.3278 0.0001  538 SER A O   
4205 C  CB  . SER A 538 ? 2.4419 2.3204 3.2127 0.0786  -0.3743 -0.0631 538 SER A CB  
4206 O  OG  . SER A 538 ? 2.5480 2.4177 3.2740 0.0993  -0.4266 -0.0542 538 SER A OG  
4207 N  N   . ALA A 539 ? 1.5194 1.4459 2.1262 0.0469  -0.2986 -0.0394 539 ALA A N   
4208 C  CA  . ALA A 539 ? 1.4178 1.3733 1.9408 0.0366  -0.2716 -0.0272 539 ALA A CA  
4209 C  C   . ALA A 539 ? 1.3707 1.3437 1.8451 0.0571  -0.2940 -0.0282 539 ALA A C   
4210 O  O   . ALA A 539 ? 1.3794 1.3777 1.7768 0.0560  -0.2837 -0.0148 539 ALA A O   
4211 C  CB  . ALA A 539 ? 0.6403 0.6060 1.1870 0.0154  -0.2232 -0.0395 539 ALA A CB  
4212 N  N   . LYS A 540 ? 1.6284 1.5881 2.1511 0.0761  -0.3251 -0.0454 540 LYS A N   
4213 C  CA  . LYS A 540 ? 1.6136 1.5808 2.0905 0.0982  -0.3534 -0.0493 540 LYS A CA  
4214 C  C   . LYS A 540 ? 1.8929 1.8496 2.3032 0.1115  -0.3912 -0.0316 540 LYS A C   
4215 O  O   . LYS A 540 ? 1.9259 1.8943 2.2652 0.1263  -0.4047 -0.0293 540 LYS A O   
4216 C  CB  . LYS A 540 ? 3.2695 3.2222 3.8207 0.1113  -0.3766 -0.0739 540 LYS A CB  
4217 C  CG  . LYS A 540 ? 2.9939 2.9586 3.5858 0.0991  -0.3409 -0.0899 540 LYS A CG  
4218 C  CD  . LYS A 540 ? 2.8750 2.8279 3.5213 0.1127  -0.3682 -0.1113 540 LYS A CD  
4219 C  CE  . LYS A 540 ? 2.6270 2.5890 3.2915 0.0998  -0.3351 -0.1228 540 LYS A CE  
4220 N  NZ  . LYS A 540 ? 2.5896 2.5388 3.2940 0.1125  -0.3646 -0.1414 540 LYS A NZ  
4221 N  N   . ASP A 541 ? 1.4428 1.3750 1.8738 0.1058  -0.4078 -0.0194 541 ASP A N   
4222 C  CA  . ASP A 541 ? 1.7489 1.6642 2.1108 0.1133  -0.4439 0.0018  541 ASP A CA  
4223 C  C   . ASP A 541 ? 1.7986 1.7390 2.0743 0.0970  -0.4131 0.0264  541 ASP A C   
4224 O  O   . ASP A 541 ? 1.9804 1.9260 2.1707 0.1028  -0.4277 0.0420  541 ASP A O   
4225 C  CB  . ASP A 541 ? 2.3023 2.1765 2.7192 0.1133  -0.4788 0.0080  541 ASP A CB  
4226 C  CG  . ASP A 541 ? 2.4383 2.2825 2.8741 0.1365  -0.5393 -0.0008 541 ASP A CG  
4227 O  OD1 . ASP A 541 ? 2.3453 2.1962 2.7254 0.1515  -0.5565 -0.0071 541 ASP A OD1 
4228 O  OD2 . ASP A 541 ? 2.5538 2.3662 3.0612 0.1401  -0.5718 -0.0023 541 ASP A OD2 
4229 N  N   . PHE A 542 ? 1.5233 1.4800 1.8208 0.0752  -0.3696 0.0290  542 PHE A N   
4230 C  CA  . PHE A 542 ? 1.5684 1.5547 1.7945 0.0572  -0.3382 0.0507  542 PHE A CA  
4231 C  C   . PHE A 542 ? 1.3728 1.4015 1.5457 0.0669  -0.3217 0.0455  542 PHE A C   
4232 O  O   . PHE A 542 ? 1.4844 1.5376 1.5809 0.0674  -0.3188 0.0619  542 PHE A O   
4233 C  CB  . PHE A 542 ? 1.5013 1.4898 1.7659 0.0308  -0.2991 0.0519  542 PHE A CB  
4234 C  CG  . PHE A 542 ? 1.5119 1.5333 1.7118 0.0099  -0.2678 0.0729  542 PHE A CG  
4235 C  CD1 . PHE A 542 ? 1.6211 1.6292 1.8139 -0.0151 -0.2563 0.0918  542 PHE A CD1 
4236 C  CD2 . PHE A 542 ? 1.4048 1.4702 1.5566 0.0153  -0.2517 0.0729  542 PHE A CD2 
4237 C  CE1 . PHE A 542 ? 1.6223 1.6621 1.7612 -0.0365 -0.2301 0.1115  542 PHE A CE1 
4238 C  CE2 . PHE A 542 ? 1.4046 1.5050 1.5077 -0.0038 -0.2251 0.0919  542 PHE A CE2 
4239 C  CZ  . PHE A 542 ? 1.5119 1.6005 1.6088 -0.0309 -0.2145 0.1117  542 PHE A CZ  
4240 N  N   . LEU A 543 ? 1.6910 1.7280 1.9074 0.0743  -0.3101 0.0224  543 LEU A N   
4241 C  CA  . LEU A 543 ? 1.4951 1.5681 1.6729 0.0838  -0.2944 0.0156  543 LEU A CA  
4242 C  C   . LEU A 543 ? 1.5997 1.6732 1.7342 0.1130  -0.3259 0.0066  543 LEU A C   
4243 O  O   . LEU A 543 ? 1.5886 1.6954 1.6660 0.1226  -0.3155 0.0078  543 LEU A O   
4244 C  CB  . LEU A 543 ? 1.2253 1.2994 1.4600 0.0786  -0.2729 -0.0035 543 LEU A CB  
4245 C  CG  . LEU A 543 ? 1.1394 1.2143 1.4004 0.0485  -0.2370 0.0037  543 LEU A CG  
4246 C  CD1 . LEU A 543 ? 0.9275 0.9873 1.2545 0.0411  -0.2210 -0.0169 543 LEU A CD1 
4247 C  CD2 . LEU A 543 ? 1.0982 1.2118 1.3012 0.0357  -0.2104 0.0204  543 LEU A CD2 
4248 N  N   . GLU A 544 ? 1.6799 1.7169 1.8423 0.1277  -0.3650 -0.0043 544 GLU A N   
4249 C  CA  . GLU A 544 ? 1.8392 1.8697 1.9506 0.1539  -0.3983 -0.0134 544 GLU A CA  
4250 C  C   . GLU A 544 ? 2.1446 2.1802 2.1704 0.1513  -0.4051 0.0103  544 GLU A C   
4251 O  O   . GLU A 544 ? 2.3497 2.3740 2.3171 0.1692  -0.4335 0.0072  544 GLU A O   
4252 C  CB  . GLU A 544 ? 2.4159 2.4038 2.5815 0.1681  -0.4429 -0.0306 544 GLU A CB  
4253 C  CG  . GLU A 544 ? 2.1371 2.1233 2.3530 0.1802  -0.4454 -0.0581 544 GLU A CG  
4254 C  CD  . GLU A 544 ? 2.1990 2.1468 2.4857 0.1891  -0.4879 -0.0741 544 GLU A CD  
4255 O  OE1 . GLU A 544 ? 2.3852 2.3109 2.7103 0.1816  -0.5061 -0.0649 544 GLU A OE1 
4256 O  OE2 . GLU A 544 ? 2.0776 2.0165 2.3851 0.2035  -0.5051 -0.0960 544 GLU A OE2 
4257 N  N   . SER A 545 ? 1.5428 1.5938 1.5583 0.1265  -0.3776 0.0340  545 SER A N   
4258 C  CA  . SER A 545 ? 1.7980 1.8494 1.7409 0.1154  -0.3816 0.0620  545 SER A CA  
4259 C  C   . SER A 545 ? 1.6553 1.7603 1.5450 0.1014  -0.3395 0.0779  545 SER A C   
4260 O  O   . SER A 545 ? 1.8176 1.9299 1.6470 0.0872  -0.3357 0.1033  545 SER A O   
4261 C  CB  . SER A 545 ? 1.3946 1.4080 1.3759 0.0955  -0.3944 0.0797  545 SER A CB  
4262 O  OG  . SER A 545 ? 1.6683 1.6680 1.5774 0.0858  -0.4096 0.1076  545 SER A OG  
4263 N  N   . LEU A 546 ? 1.9376 2.0796 1.8528 0.1036  -0.3094 0.0644  546 LEU A N   
4264 C  CA  . LEU A 546 ? 1.8144 2.0133 1.6888 0.0951  -0.2733 0.0754  546 LEU A CA  
4265 C  C   . LEU A 546 ? 1.7509 1.9762 1.5763 0.1243  -0.2766 0.0587  546 LEU A C   
4266 O  O   . LEU A 546 ? 1.6530 1.9307 1.4553 0.1267  -0.2487 0.0591  546 LEU A O   
4267 C  CB  . LEU A 546 ? 1.2392 1.4607 1.1662 0.0822  -0.2432 0.0701  546 LEU A CB  
4268 C  CG  . LEU A 546 ? 1.3128 1.5036 1.2950 0.0558  -0.2368 0.0777  546 LEU A CG  
4269 C  CD1 . LEU A 546 ? 1.0432 1.2576 1.0565 0.0409  -0.2056 0.0741  546 LEU A CD1 
4270 C  CD2 . LEU A 546 ? 1.5424 1.7248 1.4944 0.0323  -0.2366 0.1064  546 LEU A CD2 
4271 N  N   . ASN A 547 ? 2.4288 2.6167 2.2419 0.1472  -0.3124 0.0423  547 ASN A N   
4272 C  CA  . ASN A 547 ? 2.4255 2.6275 2.1878 0.1772  -0.3201 0.0219  547 ASN A CA  
4273 C  C   . ASN A 547 ? 2.5986 2.8197 2.2683 0.1757  -0.3145 0.0377  547 ASN A C   
4274 O  O   . ASN A 547 ? 2.5361 2.8072 2.1653 0.1859  -0.2879 0.0322  547 ASN A O   
4275 C  CB  . ASN A 547 ? 2.5628 2.7127 2.3441 0.2001  -0.3639 -0.0024 547 ASN A CB  
4276 C  CG  . ASN A 547 ? 2.2974 2.4517 2.1256 0.2200  -0.3628 -0.0317 547 ASN A CG  
4277 O  OD1 . ASN A 547 ? 2.1946 2.3682 1.9855 0.2443  -0.3603 -0.0506 547 ASN A OD1 
4278 N  ND2 . ASN A 547 ? 2.2722 2.4068 2.1819 0.2093  -0.3642 -0.0363 547 ASN A ND2 
4279 N  N   . ASP A 548 ? 1.9401 2.1213 1.5777 0.1622  -0.3392 0.0577  548 ASP A N   
4280 C  CA  . ASP A 548 ? 2.1606 2.3455 1.6984 0.1599  -0.3410 0.0727  548 ASP A CA  
4281 C  C   . ASP A 548 ? 2.1323 2.3777 1.6342 0.1367  -0.2945 0.0975  548 ASP A C   
4282 O  O   . ASP A 548 ? 2.1972 2.4365 1.7003 0.1054  -0.2884 0.1287  548 ASP A O   
4283 C  CB  . ASP A 548 ? 2.5426 2.6605 2.0542 0.1504  -0.3864 0.0902  548 ASP A CB  
4284 C  CG  . ASP A 548 ? 2.6203 2.6839 2.1526 0.1769  -0.4367 0.0634  548 ASP A CG  
4285 O  OD1 . ASP A 548 ? 2.4733 2.5441 1.9764 0.2042  -0.4415 0.0353  548 ASP A OD1 
4286 O  OD2 . ASP A 548 ? 2.6662 2.6797 2.2482 0.1709  -0.4729 0.0694  548 ASP A OD2 
4287 N  N   . LYS A 549 ? 2.0512 2.3544 1.5256 0.1531  -0.2636 0.0819  549 LYS A N   
4288 C  CA  . LYS A 549 ? 2.0121 2.3866 1.4615 0.1362  -0.2165 0.0991  549 LYS A CA  
4289 C  C   . LYS A 549 ? 2.2409 2.6141 1.6427 0.0978  -0.2074 0.1404  549 LYS A C   
4290 O  O   . LYS A 549 ? 2.2074 2.6339 1.6193 0.0736  -0.1713 0.1604  549 LYS A O   
4291 C  CB  . LYS A 549 ? 2.2213 2.6405 1.6147 0.1645  -0.1967 0.0751  549 LYS A CB  
4292 C  CG  . LYS A 549 ? 1.9910 2.4928 1.4203 0.1696  -0.1523 0.0673  549 LYS A CG  
4293 C  CD  . LYS A 549 ? 2.0763 2.6183 1.4527 0.2017  -0.1340 0.0392  549 LYS A CD  
4294 C  CE  . LYS A 549 ? 1.9604 2.4426 1.3123 0.2371  -0.1731 0.0053  549 LYS A CE  
4295 N  NZ  . LYS A 549 ? 2.0975 2.6033 1.3747 0.2668  -0.1591 -0.0224 549 LYS A NZ  
4296 N  N   . ASN A 550 ? 2.4171 2.7284 1.7655 0.0915  -0.2425 0.1540  550 ASN A N   
4297 C  CA  . ASN A 550 ? 2.6865 2.9781 1.9935 0.0536  -0.2439 0.1957  550 ASN A CA  
4298 C  C   . ASN A 550 ? 2.7213 2.9630 2.1019 0.0360  -0.2685 0.2095  550 ASN A C   
4299 O  O   . ASN A 550 ? 2.9081 3.0814 2.2963 0.0429  -0.3136 0.2079  550 ASN A O   
4300 C  CB  . ASN A 550 ? 2.3252 2.5714 1.5267 0.0539  -0.2714 0.2065  550 ASN A CB  
4301 C  CG  . ASN A 550 ? 2.3908 2.6934 1.5011 0.0515  -0.2321 0.2095  550 ASN A CG  
4302 O  OD1 . ASN A 550 ? 2.3135 2.6916 1.4435 0.0414  -0.1837 0.2130  550 ASN A OD1 
4303 N  ND2 . ASN A 550 ? 2.4362 2.7021 1.4461 0.0598  -0.2531 0.2077  550 ASN A ND2 
4304 N  N   . PHE A 551 ? 2.2152 2.4919 1.6517 0.0136  -0.2387 0.2213  551 PHE A N   
4305 C  CA  . PHE A 551 ? 2.2164 2.4538 1.7316 0.0002  -0.2530 0.2257  551 PHE A CA  
4306 C  C   . PHE A 551 ? 2.4602 2.6852 1.9634 -0.0411 -0.2466 0.2648  551 PHE A C   
4307 O  O   . PHE A 551 ? 2.4248 2.7038 1.9092 -0.0640 -0.2106 0.2826  551 PHE A O   
4308 C  CB  . PHE A 551 ? 2.0388 2.3157 1.6318 0.0087  -0.2277 0.2027  551 PHE A CB  
4309 C  CG  . PHE A 551 ? 2.0179 2.2522 1.6912 0.0006  -0.2404 0.1978  551 PHE A CG  
4310 C  CD1 . PHE A 551 ? 1.9721 2.1669 1.6945 0.0250  -0.2671 0.1708  551 PHE A CD1 
4311 C  CD2 . PHE A 551 ? 2.0673 2.3016 1.7676 -0.0325 -0.2242 0.2188  551 PHE A CD2 
4312 C  CE1 . PHE A 551 ? 1.9742 2.1342 1.7722 0.0169  -0.2732 0.1643  551 PHE A CE1 
4313 C  CE2 . PHE A 551 ? 2.0757 2.2701 1.8463 -0.0394 -0.2319 0.2109  551 PHE A CE2 
4314 C  CZ  . PHE A 551 ? 2.0276 2.1870 1.8477 -0.0145 -0.2544 0.1833  551 PHE A CZ  
4315 N  N   . LYS A 552 ? 2.2055 2.3594 1.7243 -0.0503 -0.2829 0.2776  552 LYS A N   
4316 C  CA  . LYS A 552 ? 2.4880 2.6179 2.0002 -0.0886 -0.2825 0.3135  552 LYS A CA  
4317 C  C   . LYS A 552 ? 2.2994 2.4695 1.8713 -0.1080 -0.2461 0.3127  552 LYS A C   
4318 O  O   . LYS A 552 ? 2.0336 2.2218 1.6681 -0.0911 -0.2350 0.2841  552 LYS A O   
4319 C  CB  . LYS A 552 ? 2.1033 2.1482 1.6466 -0.0894 -0.3292 0.3200  552 LYS A CB  
4320 C  CG  . LYS A 552 ? 2.1515 2.1531 1.7117 -0.0541 -0.3716 0.2948  552 LYS A CG  
4321 C  CD  . LYS A 552 ? 2.5159 2.4412 2.1282 -0.0569 -0.4147 0.3013  552 LYS A CD  
4322 C  CE  . LYS A 552 ? 2.7327 2.6115 2.3601 -0.0254 -0.4648 0.2820  552 LYS A CE  
4323 N  NZ  . LYS A 552 ? 3.1376 2.9454 2.8204 -0.0278 -0.5085 0.2901  552 LYS A NZ  
4324 N  N   . PHE A 553 ? 2.7623 2.9432 2.3126 -0.1456 -0.2292 0.3448  553 PHE A N   
4325 C  CA  . PHE A 553 ? 2.6335 2.8457 2.2381 -0.1661 -0.1999 0.3442  553 PHE A CA  
4326 C  C   . PHE A 553 ? 2.9833 3.1513 2.5937 -0.2044 -0.2074 0.3738  553 PHE A C   
4327 O  O   . PHE A 553 ? 3.1698 3.3614 2.7396 -0.2378 -0.1915 0.4051  553 PHE A O   
4328 C  CB  . PHE A 553 ? 2.5831 2.8855 2.1723 -0.1702 -0.1586 0.3437  553 PHE A CB  
4329 C  CG  . PHE A 553 ? 2.0864 2.4276 1.7184 -0.1363 -0.1465 0.3061  553 PHE A CG  
4330 C  CD1 . PHE A 553 ? 2.0490 2.4363 1.6477 -0.1087 -0.1368 0.2906  553 PHE A CD1 
4331 C  CD2 . PHE A 553 ? 1.8982 2.2252 1.6006 -0.1328 -0.1451 0.2859  553 PHE A CD2 
4332 C  CE1 . PHE A 553 ? 1.6242 2.0409 1.2633 -0.0776 -0.1292 0.2569  553 PHE A CE1 
4333 C  CE2 . PHE A 553 ? 1.5753 1.9318 1.3130 -0.1047 -0.1363 0.2547  553 PHE A CE2 
4334 C  CZ  . PHE A 553 ? 1.4432 1.8432 1.1513 -0.0768 -0.1302 0.2409  553 PHE A CZ  
4335 N  N   . ASP A 554 ? 2.3178 2.4213 1.9826 -0.1989 -0.2317 0.3620  554 ASP A N   
4336 C  CA  . ASP A 554 ? 2.6740 2.7236 2.3552 -0.2293 -0.2431 0.3827  554 ASP A CA  
4337 C  C   . ASP A 554 ? 2.5732 2.6534 2.2907 -0.2550 -0.2102 0.3807  554 ASP A C   
4338 O  O   . ASP A 554 ? 2.8799 2.9269 2.6003 -0.2867 -0.2127 0.4007  554 ASP A O   
4339 C  CB  . ASP A 554 ? 2.5417 2.5152 2.2778 -0.2101 -0.2787 0.3652  554 ASP A CB  
4340 C  CG  . ASP A 554 ? 2.6573 2.5990 2.3667 -0.1815 -0.3172 0.3628  554 ASP A CG  
4341 O  OD1 . ASP A 554 ? 2.6920 2.5890 2.4587 -0.1574 -0.3445 0.3404  554 ASP A OD1 
4342 O  OD2 . ASP A 554 ? 2.7302 2.6918 2.3615 -0.1838 -0.3202 0.3824  554 ASP A OD2 
4343 N  N   . THR A 555 ? 2.4834 2.6224 2.2263 -0.2414 -0.1829 0.3568  555 THR A N   
4344 C  CA  . THR A 555 ? 2.3560 2.5261 2.1297 -0.2639 -0.1546 0.3530  555 THR A CA  
4345 C  C   . THR A 555 ? 2.2019 2.4567 1.9443 -0.2782 -0.1259 0.3680  555 THR A C   
4346 O  O   . THR A 555 ? 2.0123 2.3178 1.7380 -0.2537 -0.1170 0.3580  555 THR A O   
4347 C  CB  . THR A 555 ? 2.2529 2.4162 2.0878 -0.2418 -0.1477 0.3144  555 THR A CB  
4348 O  OG1 . THR A 555 ? 1.9495 2.1417 1.7854 -0.2043 -0.1496 0.2926  555 THR A OG1 
4349 C  CG2 . THR A 555 ? 2.4171 2.5018 2.2955 -0.2379 -0.1680 0.3011  555 THR A CG2 
4350 N  N   . ASN A 556 ? 2.2395 2.5097 1.9780 -0.3175 -0.1121 0.3906  556 ASN A N   
4351 C  CA  . ASN A 556 ? 2.1988 2.5492 1.9095 -0.3364 -0.0876 0.4114  556 ASN A CA  
4352 C  C   . ASN A 556 ? 1.8153 2.2397 1.5582 -0.3239 -0.0636 0.3912  556 ASN A C   
4353 O  O   . ASN A 556 ? 1.6017 2.0097 1.3865 -0.3130 -0.0642 0.3660  556 ASN A O   
4354 C  CB  . ASN A 556 ? 2.2743 2.6156 1.9700 -0.3868 -0.0847 0.4468  556 ASN A CB  
4355 C  CG  . ASN A 556 ? 2.6750 2.9634 2.3207 -0.4024 -0.1055 0.4771  556 ASN A CG  
4356 O  OD1 . ASN A 556 ? 2.6477 2.9375 2.2525 -0.3821 -0.1133 0.4804  556 ASN A OD1 
4357 N  ND2 . ASN A 556 ? 2.9267 3.1635 2.5714 -0.4396 -0.1170 0.4998  556 ASN A ND2 
4358 N  N   . LYS A 557 ? 2.2199 2.7243 1.9423 -0.3266 -0.0427 0.4032  557 LYS A N   
4359 C  CA  . LYS A 557 ? 1.9182 2.5027 1.6719 -0.3151 -0.0213 0.3885  557 LYS A CA  
4360 C  C   . LYS A 557 ? 1.9892 2.6076 1.7671 -0.3565 -0.0094 0.4070  557 LYS A C   
4361 O  O   . LYS A 557 ? 2.2470 2.8953 2.0045 -0.3900 0.0007  0.4377  557 LYS A O   
4362 C  CB  . LYS A 557 ? 2.6151 3.2726 2.3407 -0.2950 -0.0033 0.3892  557 LYS A CB  
4363 C  CG  . LYS A 557 ? 2.4522 3.0853 2.1548 -0.2494 -0.0153 0.3646  557 LYS A CG  
4364 C  CD  . LYS A 557 ? 2.5894 3.2470 2.2283 -0.2458 -0.0067 0.3787  557 LYS A CD  
4365 C  CE  . LYS A 557 ? 2.5475 3.3067 2.1876 -0.2355 0.0264  0.3737  557 LYS A CE  
4366 N  NZ  . LYS A 557 ? 2.6883 3.4670 2.2591 -0.2285 0.0381  0.3815  557 LYS A NZ  
4367 N  N   . THR A 558 ? 1.6202 2.2329 1.4390 -0.3560 -0.0115 0.3890  558 THR A N   
4368 C  CA  . THR A 558 ? 1.6953 2.3210 1.5352 -0.3971 -0.0079 0.4038  558 THR A CA  
4369 C  C   . THR A 558 ? 1.4761 2.1866 1.3514 -0.3944 0.0047  0.3983  558 THR A C   
4370 O  O   . THR A 558 ? 1.5974 2.3427 1.4888 -0.4305 0.0088  0.4168  558 THR A O   
4371 C  CB  . THR A 558 ? 1.6129 2.1531 1.4650 -0.4086 -0.0229 0.3906  558 THR A CB  
4372 O  OG1 . THR A 558 ? 1.2915 1.8231 1.1674 -0.3765 -0.0246 0.3580  558 THR A OG1 
4373 C  CG2 . THR A 558 ? 1.8457 2.3032 1.6752 -0.4088 -0.0379 0.3942  558 THR A CG2 
4374 N  N   . ARG A 559 ? 1.7596 2.5010 1.6494 -0.3516 0.0077  0.3730  559 ARG A N   
4375 C  CA  . ARG A 559 ? 1.5443 2.3574 1.4725 -0.3409 0.0140  0.3635  559 ARG A CA  
4376 C  C   . ARG A 559 ? 1.3057 2.1498 1.2377 -0.2888 0.0181  0.3382  559 ARG A C   
4377 O  O   . ARG A 559 ? 1.2382 2.0311 1.1464 -0.2630 0.0109  0.3235  559 ARG A O   
4378 C  CB  . ARG A 559 ? 1.5369 2.3071 1.4858 -0.3523 -0.0002 0.3518  559 ARG A CB  
4379 C  CG  . ARG A 559 ? 1.4412 2.1166 1.3755 -0.3381 -0.0119 0.3307  559 ARG A CG  
4380 C  CD  . ARG A 559 ? 1.3754 2.0068 1.3215 -0.3531 -0.0208 0.3187  559 ARG A CD  
4381 N  NE  . ARG A 559 ? 1.6044 2.2180 1.5449 -0.4013 -0.0234 0.3380  559 ARG A NE  
4382 C  CZ  . ARG A 559 ? 1.8216 2.3695 1.7423 -0.4255 -0.0261 0.3453  559 ARG A CZ  
4383 N  NH1 . ARG A 559 ? 1.8769 2.3739 1.7854 -0.4056 -0.0277 0.3362  559 ARG A NH1 
4384 N  NH2 . ARG A 559 ? 1.9806 2.5121 1.8959 -0.4694 -0.0300 0.3613  559 ARG A NH2 
4385 N  N   . ASP A 560 ? 1.5656 2.4913 1.5302 -0.2725 0.0274  0.3321  560 ASP A N   
4386 C  CA  . ASP A 560 ? 1.3689 2.3226 1.3383 -0.2217 0.0305  0.3057  560 ASP A CA  
4387 C  C   . ASP A 560 ? 1.1217 2.0275 1.1084 -0.1947 0.0113  0.2786  560 ASP A C   
4388 O  O   . ASP A 560 ? 1.0727 1.9641 1.0821 -0.2120 0.0005  0.2797  560 ASP A O   
4389 C  CB  . ASP A 560 ? 1.5211 2.5825 1.5225 -0.2108 0.0497  0.3071  560 ASP A CB  
4390 C  CG  . ASP A 560 ? 1.7362 2.8418 1.7050 -0.2129 0.0745  0.3195  560 ASP A CG  
4391 O  OD1 . ASP A 560 ? 1.8167 2.8659 1.7333 -0.2077 0.0717  0.3197  560 ASP A OD1 
4392 O  OD2 . ASP A 560 ? 1.8464 3.0431 1.8416 -0.2206 0.0966  0.3293  560 ASP A OD2 
4393 N  N   . VAL A 561 ? 1.6337 2.2973 1.5749 -0.0422 -0.2524 0.0955  561 VAL A N   
4394 C  CA  . VAL A 561 ? 1.4027 2.0374 1.3530 -0.0284 -0.2411 0.0631  561 VAL A CA  
4395 C  C   . VAL A 561 ? 1.2787 1.9298 1.2347 -0.0358 -0.2120 0.0202  561 VAL A C   
4396 O  O   . VAL A 561 ? 1.3219 2.0303 1.2680 -0.0543 -0.2006 0.0100  561 VAL A O   
4397 C  CB  . VAL A 561 ? 1.0633 1.7314 1.0022 -0.0304 -0.2487 0.0622  561 VAL A CB  
4398 C  CG1 . VAL A 561 ? 0.8421 1.4838 0.7903 -0.0188 -0.2375 0.0303  561 VAL A CG1 
4399 C  CG2 . VAL A 561 ? 1.1610 1.8158 1.0904 -0.0209 -0.2773 0.1046  561 VAL A CG2 
4400 N  N   . TYR A 562 ? 1.5768 2.1771 1.5466 -0.0208 -0.1998 -0.0053 562 TYR A N   
4401 C  CA  . TYR A 562 ? 1.4508 2.0601 1.4227 -0.0259 -0.1720 -0.0477 562 TYR A CA  
4402 C  C   . TYR A 562 ? 1.2844 1.8830 1.2550 -0.0229 -0.1629 -0.0794 562 TYR A C   
4403 O  O   . TYR A 562 ? 1.2358 1.8275 1.2057 -0.0171 -0.1775 -0.0681 562 TYR A O   
4404 C  CB  . TYR A 562 ? 1.0667 1.6290 1.0544 -0.0132 -0.1610 -0.0553 562 TYR A CB  
4405 C  CG  . TYR A 562 ? 1.2292 1.8043 1.2195 -0.0183 -0.1677 -0.0266 562 TYR A CG  
4406 C  CD1 . TYR A 562 ? 1.3612 1.9410 1.3466 -0.0219 -0.1931 0.0161  562 TYR A CD1 
4407 C  CD2 . TYR A 562 ? 1.2605 1.8424 1.2572 -0.0192 -0.1488 -0.0412 562 TYR A CD2 
4408 C  CE1 . TYR A 562 ? 1.5298 2.1212 1.5166 -0.0295 -0.2002 0.0438  562 TYR A CE1 
4409 C  CE2 . TYR A 562 ? 1.4213 2.0202 1.4215 -0.0254 -0.1552 -0.0133 562 TYR A CE2 
4410 C  CZ  . TYR A 562 ? 1.5577 2.1610 1.5530 -0.0320 -0.1813 0.0293  562 TYR A CZ  
4411 O  OH  . TYR A 562 ? 1.7460 2.3656 1.7435 -0.0411 -0.1891 0.0586  562 TYR A OH  
4412 N  N   . ILE A 563 ? 1.2699 1.8681 1.2386 -0.0272 -0.1386 -0.1188 563 ILE A N   
4413 C  CA  . ILE A 563 ? 1.1195 1.6978 1.0870 -0.0254 -0.1282 -0.1511 563 ILE A CA  
4414 C  C   . ILE A 563 ? 1.0565 1.6005 1.0276 -0.0197 -0.1036 -0.1866 563 ILE A C   
4415 O  O   . ILE A 563 ? 1.1001 1.6733 1.0602 -0.0300 -0.0870 -0.2046 563 ILE A O   
4416 C  CB  . ILE A 563 ? 0.7276 1.3642 0.6756 -0.0470 -0.1246 -0.1670 563 ILE A CB  
4417 C  CG1 . ILE A 563 ? 0.9143 1.5902 0.8572 -0.0521 -0.1483 -0.1326 563 ILE A CG1 
4418 C  CG2 . ILE A 563 ? 0.7151 1.3286 0.6616 -0.0473 -0.1147 -0.1993 563 ILE A CG2 
4419 C  CD1 . ILE A 563 ? 0.7492 1.4856 0.6734 -0.0739 -0.1459 -0.1472 563 ILE A CD1 
4420 N  N   . TYR A 564 ? 1.1705 1.6527 1.1558 -0.0020 -0.1015 -0.1958 564 TYR A N   
4421 C  CA  . TYR A 564 ? 1.1472 1.5860 1.1371 0.0074  -0.0798 -0.2275 564 TYR A CA  
4422 C  C   . TYR A 564 ? 1.1265 1.5591 1.1042 -0.0011 -0.0659 -0.2651 564 TYR A C   
4423 O  O   . TYR A 564 ? 1.0661 1.4863 1.0472 0.0001  -0.0754 -0.2632 564 TYR A O   
4424 C  CB  . TYR A 564 ? 1.2679 1.6414 1.2797 0.0314  -0.0871 -0.2133 564 TYR A CB  
4425 C  CG  . TYR A 564 ? 1.2913 1.6127 1.3105 0.0449  -0.0668 -0.2426 564 TYR A CG  
4426 C  CD1 . TYR A 564 ? 1.3688 1.6903 1.3894 0.0488  -0.0517 -0.2510 564 TYR A CD1 
4427 C  CD2 . TYR A 564 ? 1.2466 1.5190 1.2720 0.0553  -0.0635 -0.2594 564 TYR A CD2 
4428 C  CE1 . TYR A 564 ? 1.4036 1.6762 1.4304 0.0636  -0.0335 -0.2766 564 TYR A CE1 
4429 C  CE2 . TYR A 564 ? 1.2834 1.5053 1.3147 0.0685  -0.0457 -0.2847 564 TYR A CE2 
4430 C  CZ  . TYR A 564 ? 1.3633 1.5845 1.3949 0.0732  -0.0309 -0.2934 564 TYR A CZ  
4431 O  OH  . TYR A 564 ? 1.4112 1.5817 1.4477 0.0881  -0.0134 -0.3181 564 TYR A OH  
4432 N  N   . MET A 565 ? 1.2313 1.6732 1.1932 -0.0100 -0.0438 -0.2986 565 MET A N   
4433 C  CA  . MET A 565 ? 1.2314 1.6664 1.1761 -0.0219 -0.0303 -0.3360 565 MET A CA  
4434 C  C   . MET A 565 ? 1.3024 1.6937 1.2404 -0.0136 -0.0057 -0.3718 565 MET A C   
4435 O  O   . MET A 565 ? 1.3821 1.7963 1.3006 -0.0217 0.0103  -0.3927 565 MET A O   
4436 C  CB  . MET A 565 ? 1.0685 1.5700 0.9886 -0.0480 -0.0302 -0.3437 565 MET A CB  
4437 C  CG  . MET A 565 ? 1.0271 1.5716 0.9516 -0.0560 -0.0542 -0.3106 565 MET A CG  
4438 S  SD  . MET A 565 ? 1.1249 1.7547 1.0224 -0.0851 -0.0558 -0.3123 565 MET A SD  
4439 C  CE  . MET A 565 ? 1.2407 1.8726 1.1222 -0.0864 -0.0303 -0.3401 565 MET A CE  
4440 N  N   . PRO A 566 ? 1.1715 1.4991 1.1244 0.0038  -0.0027 -0.3787 566 PRO A N   
4441 C  CA  . PRO A 566 ? 1.2455 1.5168 1.1982 0.0188  0.0176  -0.4063 566 PRO A CA  
4442 C  C   . PRO A 566 ? 1.2601 1.5048 1.1927 0.0080  0.0309  -0.4444 566 PRO A C   
4443 O  O   . PRO A 566 ? 1.1911 1.4487 1.1201 -0.0063 0.0206  -0.4433 566 PRO A O   
4444 C  CB  . PRO A 566 ? 0.9195 1.1414 0.9007 0.0408  0.0065  -0.3850 566 PRO A CB  
4445 C  CG  . PRO A 566 ? 0.8281 1.0655 0.8143 0.0326  -0.0137 -0.3664 566 PRO A CG  
4446 C  CD  . PRO A 566 ? 0.8178 1.1258 0.7902 0.0122  -0.0225 -0.3539 566 PRO A CD  
4447 N  N   . TYR A 567 ? 1.2022 1.4096 1.1211 0.0149  0.0529  -0.4768 567 TYR A N   
4448 C  CA  . TYR A 567 ? 1.2466 1.4287 1.1398 0.0009  0.0655  -0.5141 567 TYR A CA  
4449 C  C   . TYR A 567 ? 1.1686 1.3094 1.0775 0.0044  0.0564  -0.5101 567 TYR A C   
4450 O  O   . TYR A 567 ? 1.1510 1.2970 1.0469 -0.0150 0.0533  -0.5224 567 TYR A O   
4451 C  CB  . TYR A 567 ? 1.0186 1.1593 0.8928 0.0118  0.0905  -0.5483 567 TYR A CB  
4452 C  CG  . TYR A 567 ? 1.2274 1.3204 1.0750 0.0015  0.1038  -0.5872 567 TYR A CG  
4453 C  CD1 . TYR A 567 ? 1.3116 1.4196 1.1198 -0.0195 0.1154  -0.6183 567 TYR A CD1 
4454 C  CD2 . TYR A 567 ? 1.2223 1.2524 1.0821 0.0126  0.1049  -0.5930 567 TYR A CD2 
4455 C  CE1 . TYR A 567 ? 1.4070 1.4663 1.1877 -0.0305 0.1267  -0.6536 567 TYR A CE1 
4456 C  CE2 . TYR A 567 ? 1.2808 1.2645 1.1147 0.0018  0.1168  -0.6276 567 TYR A CE2 
4457 C  CZ  . TYR A 567 ? 1.4133 1.4105 1.2072 -0.0203 0.1273  -0.6576 567 TYR A CZ  
4458 O  OH  . TYR A 567 ? 1.4896 1.4361 1.2550 -0.0329 0.1378  -0.6914 567 TYR A OH  
4459 N  N   . ARG A 568 ? 1.5794 1.6820 1.5165 0.0288  0.0513  -0.4912 568 ARG A N   
4460 C  CA  . ARG A 568 ? 1.5094 1.5677 1.4619 0.0360  0.0443  -0.4881 568 ARG A CA  
4461 C  C   . ARG A 568 ? 1.4213 1.5141 1.3749 0.0181  0.0269  -0.4751 568 ARG A C   
4462 O  O   . ARG A 568 ? 1.4052 1.4713 1.3571 0.0125  0.0275  -0.4876 568 ARG A O   
4463 C  CB  . ARG A 568 ? 1.5971 1.6223 1.5809 0.0641  0.0362  -0.4615 568 ARG A CB  
4464 C  CG  . ARG A 568 ? 1.5067 1.4932 1.5080 0.0735  0.0263  -0.4526 568 ARG A CG  
4465 C  CD  . ARG A 568 ? 1.4471 1.4139 1.4760 0.0983  0.0143  -0.4214 568 ARG A CD  
4466 N  NE  . ARG A 568 ? 1.5148 1.4678 1.5442 0.1107  0.0276  -0.4276 568 ARG A NE  
4467 C  CZ  . ARG A 568 ? 1.5007 1.3975 1.5379 0.1300  0.0397  -0.4400 568 ARG A CZ  
4468 N  NH1 . ARG A 568 ? 1.3936 1.2455 1.4405 0.1370  0.0383  -0.4432 568 ARG A NH1 
4469 N  NH2 . ARG A 568 ? 1.5648 1.4563 1.6023 0.1417  0.0520  -0.4447 568 ARG A NH2 
4470 N  N   . MET A 569 ? 1.3284 1.4817 1.2846 0.0092  0.0115  -0.4495 569 MET A N   
4471 C  CA  . MET A 569 ? 1.2447 1.4346 1.2034 -0.0045 -0.0058 -0.4341 569 MET A CA  
4472 C  C   . MET A 569 ? 1.2764 1.4880 1.2086 -0.0338 0.0010  -0.4625 569 MET A C   
4473 O  O   . MET A 569 ? 1.2320 1.4847 1.1640 -0.0483 -0.0127 -0.4508 569 MET A O   
4474 C  CB  . MET A 569 ? 1.3480 1.5978 1.3127 -0.0068 -0.0239 -0.3997 569 MET A CB  
4475 C  CG  . MET A 569 ? 1.2842 1.5694 1.2550 -0.0138 -0.0436 -0.3781 569 MET A CG  
4476 S  SD  . MET A 569 ? 1.2754 1.6341 1.2460 -0.0200 -0.0642 -0.3408 569 MET A SD  
4477 C  CE  . MET A 569 ? 1.2983 1.7218 1.2406 -0.0562 -0.0604 -0.3623 569 MET A CE  
4478 N  N   . LEU A 570 ? 1.1664 1.3520 1.0742 -0.0431 0.0213  -0.4994 570 LEU A N   
4479 C  CA  . LEU A 570 ? 1.2211 1.4261 1.0991 -0.0742 0.0267  -0.5269 570 LEU A CA  
4480 C  C   . LEU A 570 ? 1.1991 1.3780 1.0813 -0.0817 0.0228  -0.5333 570 LEU A C   
4481 O  O   . LEU A 570 ? 1.1870 1.4087 1.0615 -0.1048 0.0130  -0.5311 570 LEU A O   
4482 C  CB  . LEU A 570 ? 1.2188 1.4019 1.0629 -0.0831 0.0490  -0.5657 570 LEU A CB  
4483 C  CG  . LEU A 570 ? 1.4202 1.6600 1.2359 -0.1037 0.0526  -0.5757 570 LEU A CG  
4484 C  CD1 . LEU A 570 ? 1.5787 1.7820 1.3566 -0.1110 0.0755  -0.6189 570 LEU A CD1 
4485 C  CD2 . LEU A 570 ? 1.3865 1.6888 1.1932 -0.1329 0.0376  -0.5677 570 LEU A CD2 
4486 N  N   . ARG A 571 ? 1.5596 1.6725 1.4547 -0.0627 0.0297  -0.5396 571 ARG A N   
4487 C  CA  . ARG A 571 ? 1.5512 1.6373 1.4485 -0.0711 0.0278  -0.5478 571 ARG A CA  
4488 C  C   . ARG A 571 ? 1.4446 1.5783 1.3629 -0.0737 0.0062  -0.5162 571 ARG A C   
4489 O  O   . ARG A 571 ? 1.4493 1.5908 1.3639 -0.0910 0.0022  -0.5217 571 ARG A O   
4490 C  CB  . ARG A 571 ? 2.3845 2.3924 2.2944 -0.0469 0.0382  -0.5561 571 ARG A CB  
4491 C  CG  . ARG A 571 ? 2.3305 2.3248 2.2751 -0.0138 0.0285  -0.5241 571 ARG A CG  
4492 C  CD  . ARG A 571 ? 2.5289 2.4473 2.4841 0.0087  0.0393  -0.5341 571 ARG A CD  
4493 N  NE  . ARG A 571 ? 2.4880 2.3953 2.4755 0.0387  0.0277  -0.5019 571 ARG A NE  
4494 C  CZ  . ARG A 571 ? 2.4081 2.2590 2.4120 0.0639  0.0338  -0.4998 571 ARG A CZ  
4495 N  NH1 . ARG A 571 ? 2.3597 2.1812 2.3662 0.0606  0.0491  -0.5096 571 ARG A NH1 
4496 N  NH2 . ARG A 571 ? 2.3690 2.2147 2.4007 0.0883  0.0208  -0.4680 571 ARG A NH2 
4497 N  N   . ILE A 572 ? 1.0789 1.2464 1.0165 -0.0571 -0.0075 -0.4831 572 ILE A N   
4498 C  CA  . ILE A 572 ? 0.9818 1.1915 0.9403 -0.0504 -0.0291 -0.4475 572 ILE A CA  
4499 C  C   . ILE A 572 ? 0.9678 1.2588 0.9147 -0.0727 -0.0411 -0.4355 572 ILE A C   
4500 O  O   . ILE A 572 ? 0.9098 1.2411 0.8692 -0.0705 -0.0583 -0.4090 572 ILE A O   
4501 C  CB  . ILE A 572 ? 1.1351 1.3250 1.1188 -0.0169 -0.0379 -0.4169 572 ILE A CB  
4502 C  CG1 . ILE A 572 ? 1.1555 1.2697 1.1517 0.0057  -0.0275 -0.4264 572 ILE A CG1 
4503 C  CG2 . ILE A 572 ? 1.0677 1.2903 1.0700 -0.0047 -0.0600 -0.3798 572 ILE A CG2 
4504 C  CD1 . ILE A 572 ? 1.1137 1.2074 1.1334 0.0366  -0.0379 -0.3959 572 ILE A CD1 
4505 N  N   . MET A 573 ? 1.4651 1.7810 1.3872 -0.0928 -0.0320 -0.4543 573 MET A N   
4506 C  CA  . MET A 573 ? 1.4629 1.8558 1.3727 -0.1144 -0.0428 -0.4438 573 MET A CA  
4507 C  C   . MET A 573 ? 1.4431 1.8809 1.3547 -0.1315 -0.0561 -0.4348 573 MET A C   
4508 O  O   . MET A 573 ? 1.3957 1.8919 1.3148 -0.1311 -0.0729 -0.4062 573 MET A O   
4509 C  CB  . MET A 573 ? 1.6790 2.0867 1.5563 -0.1376 -0.0283 -0.4735 573 MET A CB  
4510 C  CG  . MET A 573 ? 1.6790 2.1083 1.5558 -0.1274 -0.0278 -0.4605 573 MET A CG  
4511 S  SD  . MET A 573 ? 1.7641 2.2792 1.6481 -0.1331 -0.0510 -0.4210 573 MET A SD  
4512 C  CE  . MET A 573 ? 1.8403 2.4068 1.6963 -0.1732 -0.0513 -0.4435 573 MET A CE  
4513 N  N   . PRO A 574 ? 1.5640 1.9761 1.4691 -0.1457 -0.0493 -0.4572 574 PRO A N   
4514 C  CA  . PRO A 574 ? 1.5555 2.0144 1.4652 -0.1608 -0.0623 -0.4459 574 PRO A CA  
4515 C  C   . PRO A 574 ? 1.4534 1.9246 1.3949 -0.1308 -0.0798 -0.4061 574 PRO A C   
4516 O  O   . PRO A 574 ? 1.4113 1.9462 1.3589 -0.1307 -0.0965 -0.3787 574 PRO A O   
4517 C  CB  . PRO A 574 ? 1.3262 1.7352 1.2284 -0.1735 -0.0505 -0.4744 574 PRO A CB  
4518 C  CG  . PRO A 574 ? 1.5186 1.8702 1.3998 -0.1760 -0.0307 -0.5071 574 PRO A CG  
4519 C  CD  . PRO A 574 ? 1.4789 1.8175 1.3749 -0.1456 -0.0309 -0.4894 574 PRO A CD  
4520 N  N   . VAL A 575 ? 1.1830 1.5899 1.1431 -0.1036 -0.0758 -0.4032 575 VAL A N   
4521 C  CA  . VAL A 575 ? 1.1033 1.5040 1.0911 -0.0709 -0.0902 -0.3690 575 VAL A CA  
4522 C  C   . VAL A 575 ? 1.0533 1.4867 1.0485 -0.0532 -0.1051 -0.3358 575 VAL A C   
4523 O  O   . VAL A 575 ? 1.0143 1.4793 1.0222 -0.0383 -0.1221 -0.3052 575 VAL A O   
4524 C  CB  . VAL A 575 ? 0.7333 1.0532 0.7356 -0.0453 -0.0812 -0.3750 575 VAL A CB  
4525 C  CG1 . VAL A 575 ? 0.8073 1.1192 0.8342 -0.0155 -0.0954 -0.3447 575 VAL A CG1 
4526 C  CG2 . VAL A 575 ? 0.8049 1.0854 0.7952 -0.0644 -0.0646 -0.4105 575 VAL A CG2 
4527 N  N   . VAL A 576 ? 0.9075 1.3328 0.8933 -0.0541 -0.0987 -0.3411 576 VAL A N   
4528 C  CA  . VAL A 576 ? 0.8796 1.3369 0.8689 -0.0420 -0.1124 -0.3106 576 VAL A CA  
4529 C  C   . VAL A 576 ? 0.8904 1.4303 0.8682 -0.0625 -0.1245 -0.2982 576 VAL A C   
4530 O  O   . VAL A 576 ? 0.8602 1.4334 0.8457 -0.0487 -0.1422 -0.2647 576 VAL A O   
4531 C  CB  . VAL A 576 ? 0.8060 1.2405 0.7871 -0.0418 -0.1011 -0.3213 576 VAL A CB  
4532 C  CG1 . VAL A 576 ? 0.7957 1.2791 0.7735 -0.0409 -0.1143 -0.2935 576 VAL A CG1 
4533 C  CG2 . VAL A 576 ? 0.8053 1.1661 0.8026 -0.0145 -0.0950 -0.3210 576 VAL A CG2 
4534 N  N   . ALA A 577 ? 1.2481 1.8190 1.2052 -0.0956 -0.1149 -0.3258 577 ALA A N   
4535 C  CA  . ALA A 577 ? 1.2795 1.9311 1.2237 -0.1182 -0.1252 -0.3168 577 ALA A CA  
4536 C  C   . ALA A 577 ? 1.2617 1.9535 1.2179 -0.1144 -0.1407 -0.2954 577 ALA A C   
4537 O  O   . ALA A 577 ? 1.2604 2.0157 1.2151 -0.1163 -0.1557 -0.2710 577 ALA A O   
4538 C  CB  . ALA A 577 ? 1.8929 2.5631 1.8100 -0.1550 -0.1115 -0.3530 577 ALA A CB  
4539 N  N   . GLN A 578 ? 1.4579 2.1151 1.4250 -0.1092 -0.1365 -0.3047 578 GLN A N   
4540 C  CA  . GLN A 578 ? 1.4596 2.1589 1.4384 -0.1057 -0.1498 -0.2856 578 GLN A CA  
4541 C  C   . GLN A 578 ? 1.4234 2.1558 1.4144 -0.0776 -0.1698 -0.2432 578 GLN A C   
4542 O  O   . GLN A 578 ? 1.4478 2.2481 1.4381 -0.0834 -0.1826 -0.2254 578 GLN A O   
4543 C  CB  . GLN A 578 ? 1.6765 2.3232 1.6703 -0.0928 -0.1439 -0.2936 578 GLN A CB  
4544 C  CG  . GLN A 578 ? 1.8345 2.4686 1.8150 -0.1253 -0.1293 -0.3300 578 GLN A CG  
4545 C  CD  . GLN A 578 ? 1.8178 2.3928 1.8137 -0.1100 -0.1229 -0.3365 578 GLN A CD  
4546 O  OE1 . GLN A 578 ? 1.7533 2.2994 1.7698 -0.0743 -0.1297 -0.3137 578 GLN A OE1 
4547 N  NE2 . GLN A 578 ? 1.8861 2.4403 1.8697 -0.1371 -0.1102 -0.3675 578 GLN A NE2 
4548 N  N   . PHE A 579 ? 1.1618 1.8457 1.1619 -0.0476 -0.1728 -0.2267 579 PHE A N   
4549 C  CA  . PHE A 579 ? 1.1473 1.8445 1.1571 -0.0166 -0.1923 -0.1860 579 PHE A CA  
4550 C  C   . PHE A 579 ? 1.1842 1.9533 1.1817 -0.0268 -0.2051 -0.1659 579 PHE A C   
4551 O  O   . PHE A 579 ? 1.2005 2.0085 1.2021 -0.0108 -0.2218 -0.1360 579 PHE A O   
4552 C  CB  . PHE A 579 ? 0.9120 1.5380 0.9302 0.0126  -0.1926 -0.1750 579 PHE A CB  
4553 C  CG  . PHE A 579 ? 0.8833 1.4426 0.9174 0.0346  -0.1872 -0.1808 579 PHE A CG  
4554 C  CD1 . PHE A 579 ? 0.8771 1.3891 0.9115 0.0229  -0.1681 -0.2143 579 PHE A CD1 
4555 C  CD2 . PHE A 579 ? 0.8724 1.4150 0.9191 0.0683  -0.2012 -0.1528 579 PHE A CD2 
4556 C  CE1 . PHE A 579 ? 0.8609 1.3126 0.9097 0.0431  -0.1632 -0.2191 579 PHE A CE1 
4557 C  CE2 . PHE A 579 ? 0.8243 1.3064 0.8849 0.0888  -0.1961 -0.1584 579 PHE A CE2 
4558 C  CZ  . PHE A 579 ? 0.8468 1.2848 0.9093 0.0755  -0.1771 -0.1912 579 PHE A CZ  
4559 N  N   . ALA A 580 ? 0.8403 1.6260 0.8217 -0.0511 -0.1973 -0.1810 580 ALA A N   
4560 C  CA  . ALA A 580 ? 0.8918 1.7491 0.8597 -0.0648 -0.2081 -0.1646 580 ALA A CA  
4561 C  C   . ALA A 580 ? 0.9433 1.8689 0.9020 -0.0953 -0.2075 -0.1784 580 ALA A C   
4562 O  O   . ALA A 580 ? 1.0215 2.0180 0.9739 -0.1021 -0.2205 -0.1591 580 ALA A O   
4563 C  CB  . ALA A 580 ? 0.8406 1.6921 0.7943 -0.0792 -0.1995 -0.1759 580 ALA A CB  
4564 N  N   . ASN A 581 ? 1.6280 2.5326 1.5847 -0.1150 -0.1927 -0.2117 581 ASN A N   
4565 C  CA  . ASN A 581 ? 1.7002 2.6650 1.6490 -0.1449 -0.1932 -0.2241 581 ASN A CA  
4566 C  C   . ASN A 581 ? 1.7031 2.7132 1.6671 -0.1271 -0.2100 -0.1934 581 ASN A C   
4567 O  O   . ASN A 581 ? 1.7715 2.8538 1.7299 -0.1481 -0.2164 -0.1908 581 ASN A O   
4568 C  CB  . ASN A 581 ? 1.2706 2.1935 1.2147 -0.1662 -0.1757 -0.2627 581 ASN A CB  
4569 C  CG  . ASN A 581 ? 1.3694 2.3423 1.2904 -0.2110 -0.1703 -0.2887 581 ASN A CG  
4570 O  OD1 . ASN A 581 ? 1.3944 2.4211 1.2996 -0.2279 -0.1748 -0.2854 581 ASN A OD1 
4571 N  ND2 . ASN A 581 ? 1.4497 2.4038 1.3666 -0.2317 -0.1608 -0.3148 581 ASN A ND2 
4572 N  N   . THR A 582 ? 1.2129 2.1805 1.1951 -0.0877 -0.2170 -0.1701 582 THR A N   
4573 C  CA  . THR A 582 ? 1.2269 2.2290 1.2230 -0.0644 -0.2318 -0.1411 582 THR A CA  
4574 C  C   . THR A 582 ? 1.2732 2.3216 1.2660 -0.0452 -0.2505 -0.1036 582 THR A C   
4575 O  O   . THR A 582 ? 1.2486 2.2536 1.2446 -0.0139 -0.2578 -0.0819 582 THR A O   
4576 C  CB  . THR A 582 ? 1.2238 2.1550 1.2381 -0.0288 -0.2309 -0.1338 582 THR A CB  
4577 O  OG1 . THR A 582 ? 1.2141 2.1235 1.2340 -0.0449 -0.2176 -0.1615 582 THR A OG1 
4578 C  CG2 . THR A 582 ? 1.2116 2.1710 1.2366 0.0063  -0.2489 -0.0959 582 THR A CG2 
4579 N  N   . ASN A 583 ? 1.0624 2.1980 1.0473 -0.0643 -0.2588 -0.0953 583 ASN A N   
4580 C  CA  . ASN A 583 ? 1.1518 2.3394 1.1291 -0.0519 -0.2758 -0.0620 583 ASN A CA  
4581 C  C   . ASN A 583 ? 1.1891 2.3620 1.1767 -0.0037 -0.2922 -0.0229 583 ASN A C   
4582 O  O   . ASN A 583 ? 1.2048 2.4097 1.2025 0.0117  -0.2992 -0.0092 583 ASN A O   
4583 C  CB  . ASN A 583 ? 1.7550 3.0423 1.7223 -0.0829 -0.2811 -0.0622 583 ASN A CB  
4584 C  CG  . ASN A 583 ? 1.8323 3.1823 1.8004 -0.0584 -0.3014 -0.0212 583 ASN A CG  
4585 O  OD1 . ASN A 583 ? 1.8610 3.2589 1.8385 -0.0500 -0.3086 -0.0084 583 ASN A OD1 
4586 N  ND2 . ASN A 583 ? 1.8952 3.2460 1.8525 -0.0462 -0.3109 0.0005  583 ASN A ND2 
4587 N  N   . PRO A 584 ? 1.5531 2.6774 1.5363 0.0202  -0.2987 -0.0046 584 PRO A N   
4588 C  CA  . PRO A 584 ? 1.5344 2.6252 1.5225 0.0670  -0.3139 0.0303  584 PRO A CA  
4589 C  C   . PRO A 584 ? 1.5651 2.7272 1.5527 0.0851  -0.3302 0.0603  584 PRO A C   
4590 O  O   . PRO A 584 ? 1.5113 2.6488 1.5036 0.1254  -0.3410 0.0850  584 PRO A O   
4591 C  CB  . PRO A 584 ? 1.6130 2.6712 1.5882 0.0738  -0.3204 0.0459  584 PRO A CB  
4592 C  CG  . PRO A 584 ? 1.6503 2.7478 1.6141 0.0314  -0.3105 0.0237  584 PRO A CG  
4593 C  CD  . PRO A 584 ? 1.5486 2.6503 1.5193 0.0026  -0.2926 -0.0148 584 PRO A CD  
4594 N  N   . ASP A 585 ? 1.3256 2.5754 1.3063 0.0566  -0.3320 0.0579  585 ASP A N   
4595 C  CA  . ASP A 585 ? 1.3921 2.7196 1.3717 0.0724  -0.3475 0.0873  585 ASP A CA  
4596 C  C   . ASP A 585 ? 1.3476 2.7034 1.3435 0.0783  -0.3449 0.0830  585 ASP A C   
4597 O  O   . ASP A 585 ? 1.3520 2.7448 1.3512 0.1094  -0.3578 0.1116  585 ASP A O   
4598 C  CB  . ASP A 585 ? 1.3633 2.7799 1.3296 0.0378  -0.3507 0.0866  585 ASP A CB  
4599 C  CG  . ASP A 585 ? 1.4327 2.8640 1.3829 0.0544  -0.3664 0.1189  585 ASP A CG  
4600 O  OD1 . ASP A 585 ? 1.4023 2.8089 1.3513 0.0978  -0.3805 0.1514  585 ASP A OD1 
4601 O  OD2 . ASP A 585 ? 1.4802 2.9469 1.4169 0.0240  -0.3649 0.1119  585 ASP A OD2 
4602 N  N   . ASN A 586 ? 1.5325 2.8717 1.5370 0.0489  -0.3282 0.0478  586 ASN A N   
4603 C  CA  . ASN A 586 ? 1.5960 2.9784 1.6142 0.0433  -0.3252 0.0419  586 ASN A CA  
4604 C  C   . ASN A 586 ? 1.5241 2.8521 1.5544 0.0292  -0.3083 0.0097  586 ASN A C   
4605 O  O   . ASN A 586 ? 1.5380 2.9120 1.5754 0.0069  -0.3035 -0.0027 586 ASN A O   
4606 C  CB  . ASN A 586 ? 1.7807 3.2680 1.7926 0.0057  -0.3279 0.0383  586 ASN A CB  
4607 C  CG  . ASN A 586 ? 1.8961 3.4610 1.9174 0.0252  -0.3398 0.0651  586 ASN A CG  
4608 O  OD1 . ASN A 586 ? 1.9301 3.4698 1.9611 0.0703  -0.3465 0.0877  586 ASN A OD1 
4609 N  ND2 . ASN A 586 ? 1.9561 3.6179 1.9739 -0.0075 -0.3429 0.0633  586 ASN A ND2 
4610 N  N   . GLY A 587 ? 1.2928 2.5249 1.3248 0.0418  -0.2999 -0.0025 587 GLY A N   
4611 C  CA  . GLY A 587 ? 1.2306 2.4034 1.2731 0.0321  -0.2838 -0.0318 587 GLY A CA  
4612 C  C   . GLY A 587 ? 1.2080 2.3914 1.2431 -0.0203 -0.2681 -0.0712 587 GLY A C   
4613 O  O   . GLY A 587 ? 1.1959 2.3097 1.2325 -0.0303 -0.2531 -0.0991 587 GLY A O   
4614 N  N   . GLU A 588 ? 1.7296 2.9985 1.7547 -0.0532 -0.2719 -0.0733 588 GLU A N   
4615 C  CA  . GLU A 588 ? 1.7368 3.0257 1.7515 -0.1049 -0.2593 -0.1091 588 GLU A CA  
4616 C  C   . GLU A 588 ? 1.6684 2.8940 1.6680 -0.1250 -0.2453 -0.1393 588 GLU A C   
4617 O  O   . GLU A 588 ? 1.6318 2.8336 1.6254 -0.1099 -0.2483 -0.1293 588 GLU A O   
4618 C  CB  . GLU A 588 ? 1.7649 3.1609 1.7696 -0.1343 -0.2686 -0.1017 588 GLU A CB  
4619 C  CG  . GLU A 588 ? 1.8367 3.3078 1.8561 -0.1178 -0.2815 -0.0730 588 GLU A CG  
4620 C  CD  . GLU A 588 ? 1.9075 3.3727 1.9402 -0.1279 -0.2738 -0.0869 588 GLU A CD  
4621 O  OE1 . GLU A 588 ? 1.9110 3.3059 1.9415 -0.1450 -0.2587 -0.1182 588 GLU A OE1 
4622 O  OE2 . GLU A 588 ? 1.9683 3.5011 2.0134 -0.1188 -0.2828 -0.0659 588 GLU A OE2 
4623 N  N   . GLN A 589 ? 1.2433 2.4406 1.2360 -0.1582 -0.2299 -0.1758 589 GLN A N   
4624 C  CA  . GLN A 589 ? 1.2035 2.3469 1.1790 -0.1786 -0.2155 -0.2068 589 GLN A CA  
4625 C  C   . GLN A 589 ? 1.2957 2.5052 1.2485 -0.2166 -0.2173 -0.2166 589 GLN A C   
4626 O  O   . GLN A 589 ? 1.4155 2.6843 1.3610 -0.2490 -0.2191 -0.2253 589 GLN A O   
4627 C  CB  . GLN A 589 ? 1.9918 3.0717 1.9651 -0.1966 -0.1983 -0.2423 589 GLN A CB  
4628 C  CG  . GLN A 589 ? 1.8957 2.8888 1.8864 -0.1597 -0.1925 -0.2394 589 GLN A CG  
4629 C  CD  . GLN A 589 ? 1.8872 2.8031 1.8689 -0.1760 -0.1730 -0.2777 589 GLN A CD  
4630 O  OE1 . GLN A 589 ? 1.8767 2.7576 1.8432 -0.1844 -0.1633 -0.2964 589 GLN A OE1 
4631 N  NE2 . GLN A 589 ? 1.9018 2.7907 1.8921 -0.1793 -0.1669 -0.2888 589 GLN A NE2 
4632 N  N   . GLU A 590 ? 1.4094 2.6117 1.3507 -0.2131 -0.2174 -0.2138 590 GLU A N   
4633 C  CA  . GLU A 590 ? 1.4735 2.7345 1.3912 -0.2475 -0.2183 -0.2237 590 GLU A CA  
4634 C  C   . GLU A 590 ? 1.5341 2.7846 1.4309 -0.2927 -0.2035 -0.2669 590 GLU A C   
4635 O  O   . GLU A 590 ? 1.6537 2.9532 1.5469 -0.3196 -0.2067 -0.2731 590 GLU A O   
4636 C  CB  . GLU A 590 ? 2.1719 3.4126 2.0809 -0.2351 -0.2179 -0.2168 590 GLU A CB  
4637 C  CG  . GLU A 590 ? 2.1517 3.4187 2.0726 -0.1989 -0.2358 -0.1721 590 GLU A CG  
4638 C  CD  . GLU A 590 ? 2.0644 3.2910 1.9802 -0.1827 -0.2343 -0.1644 590 GLU A CD  
4639 O  OE1 . GLU A 590 ? 2.0088 3.1889 1.9140 -0.1966 -0.2187 -0.1930 590 GLU A OE1 
4640 O  OE2 . GLU A 590 ? 2.0601 3.3016 1.9814 -0.1558 -0.2491 -0.1289 590 GLU A OE2 
4641 N  N   . LYS A 591 ? 1.6092 2.7944 1.4911 -0.3003 -0.1877 -0.2960 591 LYS A N   
4642 C  CA  . LYS A 591 ? 1.6756 2.8474 1.5295 -0.3429 -0.1736 -0.3382 591 LYS A CA  
4643 C  C   . LYS A 591 ? 1.7281 2.8392 1.5836 -0.3518 -0.1618 -0.3640 591 LYS A C   
4644 O  O   . LYS A 591 ? 1.6839 2.7775 1.5643 -0.3290 -0.1656 -0.3483 591 LYS A O   
4645 C  CB  . LYS A 591 ? 1.8172 2.9545 1.6496 -0.3474 -0.1618 -0.3583 591 LYS A CB  
4646 C  CG  . LYS A 591 ? 1.7730 2.9663 1.6030 -0.3391 -0.1727 -0.3326 591 LYS A CG  
4647 C  CD  . LYS A 591 ? 1.6919 2.8685 1.4953 -0.3537 -0.1605 -0.3564 591 LYS A CD  
4648 C  CE  . LYS A 591 ? 1.6700 2.9136 1.4680 -0.3523 -0.1722 -0.3314 591 LYS A CE  
4649 N  NZ  . LYS A 591 ? 1.6374 2.9000 1.4013 -0.3836 -0.1626 -0.3590 591 LYS A NZ  
4650 N  N   . SER A 592 ? 1.6660 2.7441 1.4927 -0.3849 -0.1476 -0.4037 592 SER A N   
4651 C  CA  . SER A 592 ? 1.7198 2.7417 1.5417 -0.3998 -0.1365 -0.4305 592 SER A CA  
4652 C  C   . SER A 592 ? 1.6164 2.5388 1.4464 -0.3708 -0.1219 -0.4429 592 SER A C   
4653 O  O   . SER A 592 ? 1.6253 2.5042 1.4724 -0.3575 -0.1189 -0.4423 592 SER A O   
4654 C  CB  . SER A 592 ? 1.7944 2.8215 1.5764 -0.4503 -0.1286 -0.4686 592 SER A CB  
4655 O  OG  . SER A 592 ? 1.5187 2.5213 1.2735 -0.4562 -0.1180 -0.4904 592 SER A OG  
4656 N  N   . LEU A 593 ? 1.8506 2.7406 1.6678 -0.3616 -0.1127 -0.4539 593 LEU A N   
4657 C  CA  . LEU A 593 ? 1.7126 2.5122 1.5344 -0.3355 -0.0978 -0.4673 593 LEU A CA  
4658 C  C   . LEU A 593 ? 1.7398 2.4686 1.5434 -0.3532 -0.0816 -0.5052 593 LEU A C   
4659 O  O   . LEU A 593 ? 1.7833 2.4784 1.6034 -0.3450 -0.0809 -0.5032 593 LEU A O   
4660 C  CB  . LEU A 593 ? 1.5129 2.2911 1.3727 -0.2900 -0.1053 -0.4336 593 LEU A CB  
4661 C  CG  . LEU A 593 ? 1.4127 2.2181 1.2826 -0.2652 -0.1142 -0.4051 593 LEU A CG  
4662 C  CD1 . LEU A 593 ? 1.2913 2.0242 1.1783 -0.2281 -0.1074 -0.3994 593 LEU A CD1 
4663 C  CD2 . LEU A 593 ? 1.3681 2.2097 1.2085 -0.2906 -0.1101 -0.4204 593 LEU A CD2 
4664 N  N   . PHE A 594 ? 1.6759 2.3820 1.4433 -0.3770 -0.0686 -0.5395 594 PHE A N   
4665 C  CA  . PHE A 594 ? 1.6989 2.3285 1.4420 -0.3916 -0.0517 -0.5779 594 PHE A CA  
4666 C  C   . PHE A 594 ? 1.5298 2.0997 1.2658 -0.3669 -0.0364 -0.5917 594 PHE A C   
4667 O  O   . PHE A 594 ? 1.4665 2.0618 1.1846 -0.3714 -0.0338 -0.5969 594 PHE A O   
4668 C  CB  . PHE A 594 ? 2.0261 2.6782 1.7262 -0.4406 -0.0494 -0.6082 594 PHE A CB  
4669 C  CG  . PHE A 594 ? 1.9188 2.4911 1.5891 -0.4596 -0.0340 -0.6475 594 PHE A CG  
4670 C  CD1 . PHE A 594 ? 2.1161 2.7004 1.7524 -0.5064 -0.0353 -0.6709 594 PHE A CD1 
4671 C  CD2 . PHE A 594 ? 1.7861 2.2705 1.4606 -0.4314 -0.0188 -0.6604 594 PHE A CD2 
4672 C  CE1 . PHE A 594 ? 2.1819 2.6872 1.7870 -0.5246 -0.0219 -0.7067 594 PHE A CE1 
4673 C  CE2 . PHE A 594 ? 1.8478 2.2556 1.4927 -0.4474 -0.0047 -0.6960 594 PHE A CE2 
4674 C  CZ  . PHE A 594 ? 2.0469 2.4629 1.6561 -0.4940 -0.0064 -0.7191 594 PHE A CZ  
4675 N  N   . PHE A 595 ? 1.9394 2.4335 1.6897 -0.3406 -0.0263 -0.5966 595 PHE A N   
4676 C  CA  . PHE A 595 ? 1.7850 2.2225 1.5324 -0.3138 -0.0116 -0.6074 595 PHE A CA  
4677 C  C   . PHE A 595 ? 1.7771 2.1235 1.5232 -0.3018 0.0031  -0.6289 595 PHE A C   
4678 O  O   . PHE A 595 ? 1.8463 2.1759 1.6096 -0.3007 -0.0015 -0.6216 595 PHE A O   
4679 C  CB  . PHE A 595 ? 1.8133 2.2720 1.5972 -0.2765 -0.0209 -0.5697 595 PHE A CB  
4680 C  CG  . PHE A 595 ? 1.6543 2.0566 1.4417 -0.2470 -0.0072 -0.5760 595 PHE A CG  
4681 C  CD1 . PHE A 595 ? 1.5621 1.9934 1.3463 -0.2378 -0.0066 -0.5674 595 PHE A CD1 
4682 C  CD2 . PHE A 595 ? 1.5970 1.9203 1.3910 -0.2288 0.0048  -0.5896 595 PHE A CD2 
4683 C  CE1 . PHE A 595 ? 1.4333 1.8188 1.2215 -0.2118 0.0057  -0.5719 595 PHE A CE1 
4684 C  CE2 . PHE A 595 ? 1.4680 1.7441 1.2654 -0.2020 0.0172  -0.5949 595 PHE A CE2 
4685 C  CZ  . PHE A 595 ? 1.3870 1.6956 1.1820 -0.1936 0.0176  -0.5858 595 PHE A CZ  
4686 N  N   . SER A 596 ? 1.8704 2.1591 1.5961 -0.2916 0.0209  -0.6546 596 SER A N   
4687 C  CA  . SER A 596 ? 1.8556 2.0562 1.5825 -0.2748 0.0347  -0.6719 596 SER A CA  
4688 C  C   . SER A 596 ? 1.7811 1.9253 1.4869 -0.2580 0.0543  -0.6969 596 SER A C   
4689 O  O   . SER A 596 ? 1.8207 1.9658 1.4873 -0.2775 0.0635  -0.7241 596 SER A O   
4690 C  CB  . SER A 596 ? 1.9256 2.0966 1.6286 -0.3068 0.0375  -0.6963 596 SER A CB  
4691 O  OG  . SER A 596 ? 1.9667 2.0634 1.6328 -0.3109 0.0568  -0.7348 596 SER A OG  
4692 N  N   . GLN A 597 ? 1.8999 1.9947 1.6306 -0.2215 0.0608  -0.6881 597 GLN A N   
4693 C  CA  . GLN A 597 ? 1.8387 1.8782 1.5525 -0.2016 0.0802  -0.7105 597 GLN A CA  
4694 C  C   . GLN A 597 ? 1.9009 1.8519 1.6046 -0.1941 0.0942  -0.7346 597 GLN A C   
4695 O  O   . GLN A 597 ? 1.8815 1.8052 1.6147 -0.1785 0.0896  -0.7192 597 GLN A O   
4696 C  CB  . GLN A 597 ? 2.5488 2.6004 2.2959 -0.1649 0.0784  -0.6829 597 GLN A CB  
4697 C  CG  . GLN A 597 ? 2.3236 2.3189 2.0586 -0.1406 0.0985  -0.7030 597 GLN A CG  
4698 C  CD  . GLN A 597 ? 2.1866 2.1939 1.9560 -0.1065 0.0957  -0.6742 597 GLN A CD  
4699 O  OE1 . GLN A 597 ? 2.1302 2.1941 1.9247 -0.1038 0.0793  -0.6413 597 GLN A OE1 
4700 N  NE2 . GLN A 597 ? 2.1227 2.0759 1.8921 -0.0803 0.1114  -0.6859 597 GLN A NE2 
4701 N  N   . ALA A 598 ? 1.9744 1.8786 1.6345 -0.2038 0.1114  -0.7724 598 ALA A N   
4702 C  CA  . ALA A 598 ? 1.9569 1.7780 1.6073 -0.1984 0.1251  -0.7918 598 ALA A CA  
4703 C  C   . ALA A 598 ? 1.9370 1.7159 1.5597 -0.1892 0.1466  -0.8147 598 ALA A C   
4704 O  O   . ALA A 598 ? 1.9514 1.7579 1.5484 -0.1898 0.1508  -0.8285 598 ALA A O   
4705 C  CB  . ALA A 598 ? 5.0252 4.8361 4.6564 -0.2357 0.1190  -0.8046 598 ALA A CB  
4706 N  N   . ASN A 599 ? 2.5594 2.2726 2.1855 -0.1798 0.1600  -0.8181 599 ASN A N   
4707 C  CA  . ASN A 599 ? 2.5483 2.2157 2.1480 -0.1668 0.1802  -0.8381 599 ASN A CA  
4708 C  C   . ASN A 599 ? 2.7062 2.3226 2.2559 -0.1962 0.1900  -0.8703 599 ASN A C   
4709 O  O   . ASN A 599 ? 2.8315 2.4428 2.3711 -0.2271 0.1818  -0.8750 599 ASN A O   
4710 C  CB  . ASN A 599 ? 2.5399 2.1701 2.1796 -0.1262 0.1888  -0.8151 599 ASN A CB  
4711 C  CG  . ASN A 599 ? 2.4122 2.0850 2.0878 -0.0955 0.1838  -0.7908 599 ASN A CG  
4712 O  OD1 . ASN A 599 ? 2.2417 1.9706 1.9126 -0.1032 0.1742  -0.7902 599 ASN A OD1 
4713 N  ND2 . ASN A 599 ? 2.0563 1.7034 1.7655 -0.0622 0.1893  -0.7698 599 ASN A ND2 
4714 N  N   . ALA A 600 ? 1.4782 1.4702 1.8986 -0.0212 -0.1234 -0.0085 600 ALA A N   
4715 C  CA  . ALA A 600 ? 1.6059 1.5774 2.0031 -0.0120 -0.1406 -0.0227 600 ALA A CA  
4716 C  C   . ALA A 600 ? 1.6456 1.5321 1.9988 -0.0178 -0.1848 -0.0287 600 ALA A C   
4717 O  O   . ALA A 600 ? 1.6460 1.5078 2.0117 -0.0139 -0.2117 -0.0323 600 ALA A O   
4718 C  CB  . ALA A 600 ? 1.6093 1.6410 2.0623 0.0163  -0.1399 -0.0416 600 ALA A CB  
4719 N  N   . ILE A 601 ? 2.4121 2.2496 2.7129 -0.0264 -0.1946 -0.0310 601 ILE A N   
4720 C  CA  . ILE A 601 ? 2.4498 2.1938 2.6958 -0.0325 -0.2375 -0.0353 601 ILE A CA  
4721 C  C   . ILE A 601 ? 2.4760 2.1972 2.7136 -0.0168 -0.2660 -0.0540 601 ILE A C   
4722 O  O   . ILE A 601 ? 2.5118 2.1704 2.7274 -0.0076 -0.3119 -0.0646 601 ILE A O   
4723 C  CB  . ILE A 601 ? 1.9058 1.5798 2.0751 -0.0669 -0.2266 -0.0179 601 ILE A CB  
4724 C  CG1 . ILE A 601 ? 1.6172 1.3068 1.7922 -0.0801 -0.2047 -0.0021 601 ILE A CG1 
4725 C  CG2 . ILE A 601 ? 1.7924 1.3578 1.8908 -0.0747 -0.2694 -0.0197 601 ILE A CG2 
4726 C  CD1 . ILE A 601 ? 1.8751 1.5012 1.9774 -0.1134 -0.1905 0.0122  601 ILE A CD1 
4727 N  N   . ALA A 602 ? 3.5823 3.3509 3.8360 -0.0116 -0.2426 -0.0594 602 ALA A N   
4728 C  CA  . ALA A 602 ? 3.6095 3.3550 3.8522 0.0012  -0.2676 -0.0769 602 ALA A CA  
4729 C  C   . ALA A 602 ? 3.6112 3.4422 3.9055 0.0243  -0.2460 -0.0906 602 ALA A C   
4730 O  O   . ALA A 602 ? 3.5867 3.4780 3.9020 0.0216  -0.2061 -0.0819 602 ALA A O   
4731 C  CB  . ALA A 602 ? 1.8766 1.5418 2.0453 -0.0292 -0.2690 -0.0682 602 ALA A CB  
4732 N  N   . GLN A 603 ? 2.3063 2.1369 2.6157 0.0489  -0.2751 -0.1130 603 GLN A N   
4733 C  CA  . GLN A 603 ? 2.3247 2.2260 2.6724 0.0730  -0.2590 -0.1288 603 GLN A CA  
4734 C  C   . GLN A 603 ? 2.3783 2.2426 2.7127 0.0882  -0.2966 -0.1508 603 GLN A C   
4735 O  O   . GLN A 603 ? 2.4118 2.2177 2.7321 0.0942  -0.3404 -0.1605 603 GLN A O   
4736 C  CB  . GLN A 603 ? 2.1979 2.1838 2.6128 0.0998  -0.2435 -0.1387 603 GLN A CB  
4737 C  CG  . GLN A 603 ? 2.1815 2.2424 2.6248 0.1225  -0.2158 -0.1503 603 GLN A CG  
4738 C  CD  . GLN A 603 ? 2.0009 2.1409 2.5029 0.1429  -0.1913 -0.1573 603 GLN A CD  
4739 O  OE1 . GLN A 603 ? 1.9044 2.0557 2.4287 0.1327  -0.1802 -0.1460 603 GLN A OE1 
4740 N  NE2 . GLN A 603 ? 1.9575 2.1510 2.4839 0.1708  -0.1816 -0.1772 603 GLN A NE2 
4741 N  N   . ASP A 604 ? 4.7893 4.6835 5.1269 0.0960  -0.2830 -0.1597 604 ASP A N   
4742 C  CA  . ASP A 604 ? 4.8318 4.6961 5.1609 0.1118  -0.3174 -0.1821 604 ASP A CA  
4743 C  C   . ASP A 604 ? 4.8947 4.8346 5.2774 0.1538  -0.3191 -0.2083 604 ASP A C   
4744 O  O   . ASP A 604 ? 4.8844 4.8860 5.2840 0.1652  -0.2883 -0.2115 604 ASP A O   
4745 C  CB  . ASP A 604 ? 2.7618 2.5991 3.0572 0.0907  -0.3061 -0.1786 604 ASP A CB  
4746 C  CG  . ASP A 604 ? 2.7509 2.4969 2.9865 0.0486  -0.3111 -0.1598 604 ASP A CG  
4747 O  OD1 . ASP A 604 ? 2.7626 2.4317 2.9639 0.0436  -0.3485 -0.1594 604 ASP A OD1 
4748 O  OD2 . ASP A 604 ? 2.7498 2.4989 2.9705 0.0210  -0.2778 -0.1470 604 ASP A OD2 
4749 N  N   . GLY A 608 ? 1.9436 2.0112 2.3180 0.1428  -0.2078 -0.1896 608 GLY A N   
4750 C  CA  . GLY A 608 ? 1.9030 1.9938 2.2916 0.1378  -0.1883 -0.1719 608 GLY A CA  
4751 C  C   . GLY A 608 ? 1.7823 1.8520 2.1495 0.1029  -0.1654 -0.1461 608 GLY A C   
4752 O  O   . GLY A 608 ? 1.7202 1.8296 2.0983 0.1020  -0.1353 -0.1317 608 GLY A O   
4753 N  N   . SER A 609 ? 3.3151 3.3190 3.6495 0.0735  -0.1790 -0.1410 609 SER A N   
4754 C  CA  . SER A 609 ? 3.1952 3.1750 3.5061 0.0385  -0.1570 -0.1208 609 SER A CA  
4755 C  C   . SER A 609 ? 3.1788 3.1380 3.4842 0.0253  -0.1571 -0.1021 609 SER A C   
4756 O  O   . SER A 609 ? 3.1987 3.0995 3.4833 0.0177  -0.1861 -0.1017 609 SER A O   
4757 C  CB  . SER A 609 ? 2.1347 2.0488 2.4106 0.0091  -0.1677 -0.1243 609 SER A CB  
4758 O  OG  . SER A 609 ? 1.7781 1.7053 2.0512 -0.0122 -0.1384 -0.1209 609 SER A OG  
4759 N  N   . VAL A 610 ? 2.6129 2.6152 2.9345 0.0238  -0.1279 -0.0877 610 VAL A N   
4760 C  CA  . VAL A 610 ? 2.5938 2.5816 2.9165 0.0128  -0.1280 -0.0716 610 VAL A CA  
4761 C  C   . VAL A 610 ? 2.4947 2.4501 2.7864 -0.0205 -0.1109 -0.0535 610 VAL A C   
4762 O  O   . VAL A 610 ? 2.4466 2.4351 2.7429 -0.0262 -0.0824 -0.0480 610 VAL A O   
4763 C  CB  . VAL A 610 ? 1.1325 1.1880 1.4984 0.0324  -0.1075 -0.0673 610 VAL A CB  
4764 C  CG1 . VAL A 610 ? 1.0870 1.1257 1.4598 0.0195  -0.1102 -0.0530 610 VAL A CG1 
4765 C  CG2 . VAL A 610 ? 1.1723 1.2660 1.5725 0.0651  -0.1191 -0.0875 610 VAL A CG2 
4766 N  N   . MET A 611 ? 2.0275 1.9157 2.2849 -0.0406 -0.1297 -0.0458 611 MET A N   
4767 C  CA  . MET A 611 ? 1.9390 1.7924 2.1614 -0.0728 -0.1124 -0.0306 611 MET A CA  
4768 C  C   . MET A 611 ? 1.9118 1.7894 2.1526 -0.0731 -0.1002 -0.0156 611 MET A C   
4769 O  O   . MET A 611 ? 1.9347 1.8161 2.1975 -0.0587 -0.1182 -0.0151 611 MET A O   
4770 C  CB  . MET A 611 ? 2.7474 2.5060 2.9092 -0.0971 -0.1354 -0.0281 611 MET A CB  
4771 C  CG  . MET A 611 ? 2.6732 2.3927 2.7919 -0.1329 -0.1128 -0.0156 611 MET A CG  
4772 S  SD  . MET A 611 ? 2.3561 2.0935 2.4740 -0.1542 -0.0800 -0.0263 611 MET A SD  
4773 C  CE  . MET A 611 ? 2.3981 2.0548 2.4702 -0.1666 -0.1069 -0.0360 611 MET A CE  
4774 N  N   . LEU A 612 ? 3.0843 2.9787 3.3207 -0.0894 -0.0711 -0.0059 612 LEU A N   
4775 C  CA  . LEU A 612 ? 3.0239 2.9345 3.2741 -0.0922 -0.0605 0.0086  612 LEU A CA  
4776 C  C   . LEU A 612 ? 2.9868 2.8430 3.1911 -0.1229 -0.0551 0.0181  612 LEU A C   
4777 O  O   . LEU A 612 ? 2.9826 2.8218 3.1602 -0.1427 -0.0395 0.0139  612 LEU A O   
4778 C  CB  . LEU A 612 ? 1.3593 1.3413 1.6468 -0.0792 -0.0318 0.0119  612 LEU A CB  
4779 C  CG  . LEU A 612 ? 1.3205 1.3578 1.6486 -0.0491 -0.0304 0.0054  612 LEU A CG  
4780 C  CD1 . LEU A 612 ? 1.1283 1.2185 1.4810 -0.0398 -0.0032 0.0154  612 LEU A CD1 
4781 C  CD2 . LEU A 612 ? 1.3568 1.3836 1.7051 -0.0385 -0.0549 0.0019  612 LEU A CD2 
4782 N  N   . ASP A 613 ? 2.2144 2.0434 2.4113 -0.1264 -0.0682 0.0281  613 ASP A N   
4783 C  CA  . ASP A 613 ? 2.1931 1.9674 2.3420 -0.1525 -0.0649 0.0372  613 ASP A CA  
4784 C  C   . ASP A 613 ? 2.1700 1.9515 2.3008 -0.1743 -0.0325 0.0353  613 ASP A C   
4785 O  O   . ASP A 613 ? 2.1932 1.9206 2.2733 -0.1992 -0.0277 0.0323  613 ASP A O   
4786 C  CB  . ASP A 613 ? 2.3480 2.1386 2.5211 -0.1474 -0.0664 0.0479  613 ASP A CB  
4787 C  CG  . ASP A 613 ? 2.1319 1.9350 2.3451 -0.1242 -0.0938 0.0452  613 ASP A CG  
4788 O  OD1 . ASP A 613 ? 2.2078 1.9802 2.4095 -0.1154 -0.1206 0.0354  613 ASP A OD1 
4789 O  OD2 . ASP A 613 ? 2.0993 1.9408 2.3569 -0.1157 -0.0894 0.0509  613 ASP A OD2 
4790 N  N   . ASN A 614 ? 2.8878 2.7352 3.0607 -0.1652 -0.0097 0.0355  614 ASN A N   
4791 C  CA  . ASN A 614 ? 2.8737 2.7383 3.0427 -0.1814 0.0189  0.0292  614 ASN A CA  
4792 C  C   . ASN A 614 ? 2.8857 2.7522 3.0494 -0.1907 0.0299  0.0122  614 ASN A C   
4793 O  O   . ASN A 614 ? 2.8682 2.7643 3.0461 -0.1984 0.0524  0.0013  614 ASN A O   
4794 C  CB  . ASN A 614 ? 1.9134 1.8423 2.1267 -0.1645 0.0335  0.0332  614 ASN A CB  
4795 C  CG  . ASN A 614 ? 1.9219 1.8941 2.1733 -0.1354 0.0257  0.0361  614 ASN A CG  
4796 O  OD1 . ASN A 614 ? 1.9609 1.9222 2.2127 -0.1259 0.0085  0.0320  614 ASN A OD1 
4797 N  ND2 . ASN A 614 ? 1.8348 1.8526 2.1150 -0.1213 0.0382  0.0424  614 ASN A ND2 
4798 N  N   . GLY A 615 ? 2.3298 2.1729 2.4837 -0.1853 0.0116  0.0074  615 GLY A N   
4799 C  CA  . GLY A 615 ? 2.3269 2.1616 2.4744 -0.1962 0.0177  -0.0091 615 GLY A CA  
4800 C  C   . GLY A 615 ? 2.3471 2.2472 2.5430 -0.1696 0.0199  -0.0224 615 GLY A C   
4801 O  O   . GLY A 615 ? 2.3647 2.2738 2.5696 -0.1754 0.0273  -0.0402 615 GLY A O   
4802 N  N   . VAL A 616 ? 1.5544 1.4982 1.7802 -0.1407 0.0139  -0.0144 616 VAL A N   
4803 C  CA  . VAL A 616 ? 1.5784 1.5809 1.8403 -0.1117 0.0167  -0.0239 616 VAL A CA  
4804 C  C   . VAL A 616 ? 1.6359 1.6345 1.9022 -0.0922 -0.0054 -0.0277 616 VAL A C   
4805 O  O   . VAL A 616 ? 1.6368 1.6147 1.8983 -0.0886 -0.0209 -0.0178 616 VAL A O   
4806 C  CB  . VAL A 616 ? 1.1309 1.1764 1.4152 -0.0926 0.0255  -0.0105 616 VAL A CB  
4807 C  CG1 . VAL A 616 ? 1.1315 1.2275 1.4370 -0.0683 0.0344  -0.0206 616 VAL A CG1 
4808 C  CG2 . VAL A 616 ? 1.0925 1.1257 1.3673 -0.1122 0.0379  0.0003  616 VAL A CG2 
4809 N  N   . GLU A 617 ? 1.9115 1.9306 2.1904 -0.0774 -0.0095 -0.0450 617 GLU A N   
4810 C  CA  . GLU A 617 ? 1.9817 2.0039 2.2687 -0.0540 -0.0309 -0.0510 617 GLU A CA  
4811 C  C   . GLU A 617 ? 1.9883 2.0710 2.3027 -0.0192 -0.0248 -0.0560 617 GLU A C   
4812 O  O   . GLU A 617 ? 1.9425 2.0585 2.2641 -0.0115 -0.0084 -0.0586 617 GLU A O   
4813 C  CB  . GLU A 617 ? 2.8399 2.8254 3.1124 -0.0631 -0.0466 -0.0675 617 GLU A CB  
4814 C  CG  . GLU A 617 ? 2.4974 2.4141 2.7314 -0.1002 -0.0488 -0.0627 617 GLU A CG  
4815 C  CD  . GLU A 617 ? 2.5196 2.3967 2.7387 -0.1109 -0.0627 -0.0786 617 GLU A CD  
4816 O  OE1 . GLU A 617 ? 2.5807 2.4773 2.8188 -0.0850 -0.0804 -0.0923 617 GLU A OE1 
4817 O  OE2 . GLU A 617 ? 2.4868 2.3113 2.6736 -0.1465 -0.0543 -0.0779 617 GLU A OE2 
4818 N  N   . ILE A 618 ? 2.0054 2.0982 2.3316 0.0025  -0.0393 -0.0593 618 ILE A N   
4819 C  CA  . ILE A 618 ? 1.9955 2.1392 2.3401 0.0359  -0.0334 -0.0671 618 ILE A CA  
4820 C  C   . ILE A 618 ? 2.0971 2.2340 2.4418 0.0511  -0.0550 -0.0897 618 ILE A C   
4821 O  O   . ILE A 618 ? 2.1639 2.2729 2.5091 0.0513  -0.0782 -0.0954 618 ILE A O   
4822 C  CB  . ILE A 618 ? 1.8624 2.0293 2.2280 0.0493  -0.0302 -0.0582 618 ILE A CB  
4823 C  CG1 . ILE A 618 ? 1.4544 1.6109 1.8215 0.0280  -0.0183 -0.0367 618 ILE A CG1 
4824 C  CG2 . ILE A 618 ? 1.4872 1.7071 1.8635 0.0786  -0.0115 -0.0614 618 ILE A CG2 
4825 C  CD1 . ILE A 618 ? 1.6454 1.8409 2.0400 0.0404  -0.0019 -0.0270 618 ILE A CD1 
4826 N  N   . ILE A 619 ? 2.0703 2.2294 2.4144 0.0658  -0.0514 -0.1043 619 ILE A N   
4827 C  CA  . ILE A 619 ? 2.1653 2.3187 2.5118 0.0818  -0.0734 -0.1278 619 ILE A CA  
4828 C  C   . ILE A 619 ? 2.1976 2.3969 2.5489 0.1209  -0.0704 -0.1417 619 ILE A C   
4829 O  O   . ILE A 619 ? 2.1776 2.4101 2.5251 0.1350  -0.0490 -0.1313 619 ILE A O   
4830 C  CB  . ILE A 619 ? 2.1714 2.2901 2.5113 0.0575  -0.0814 -0.1400 619 ILE A CB  
4831 C  CG1 . ILE A 619 ? 1.6933 1.8399 2.0392 0.0593  -0.0648 -0.1473 619 ILE A CG1 
4832 C  CG2 . ILE A 619 ? 1.8803 1.9453 2.2029 0.0182  -0.0818 -0.1257 619 ILE A CG2 
4833 C  CD1 . ILE A 619 ? 1.6883 1.8202 2.0439 0.0491  -0.0754 -0.1721 619 ILE A CD1 
4834 N  N   . ASN A 620 ? 2.2833 2.4781 2.6377 0.1374  -0.0925 -0.1653 620 ASN A N   
4835 C  CA  . ASN A 620 ? 2.3635 2.5940 2.7184 0.1782  -0.0965 -0.1821 620 ASN A CA  
4836 C  C   . ASN A 620 ? 2.3462 2.6156 2.6990 0.1976  -0.0725 -0.1695 620 ASN A C   
4837 O  O   . ASN A 620 ? 2.3213 2.6127 2.6568 0.2092  -0.0519 -0.1627 620 ASN A O   
4838 C  CB  . ASN A 620 ? 2.6087 2.8491 2.9571 0.1955  -0.1032 -0.2032 620 ASN A CB  
4839 C  CG  . ASN A 620 ? 2.5245 2.7689 2.8667 0.1819  -0.0860 -0.1950 620 ASN A CG  
4840 O  OD1 . ASN A 620 ? 2.4445 2.6946 2.7800 0.1695  -0.0641 -0.1719 620 ASN A OD1 
4841 N  ND2 . ASN A 620 ? 2.1925 2.4346 2.5412 0.1855  -0.0982 -0.2173 620 ASN A ND2 
4842 N  N   . ASP A 621 ? 2.5554 2.8301 2.9259 0.2011  -0.0765 -0.1686 621 ASP A N   
4843 C  CA  . ASP A 621 ? 2.5072 2.8225 2.8860 0.2175  -0.0516 -0.1616 621 ASP A CA  
4844 C  C   . ASP A 621 ? 2.4018 2.7296 2.7663 0.2060  -0.0180 -0.1361 621 ASP A C   
4845 O  O   . ASP A 621 ? 2.4170 2.7686 2.7585 0.2260  0.0030  -0.1345 621 ASP A O   
4846 C  CB  . ASP A 621 ? 2.4388 2.7867 2.8085 0.2564  -0.0495 -0.1831 621 ASP A CB  
4847 C  CG  . ASP A 621 ? 2.5449 2.8798 2.9265 0.2720  -0.0858 -0.2114 621 ASP A CG  
4848 O  OD1 . ASP A 621 ? 2.5884 2.8956 2.9910 0.2566  -0.1098 -0.2141 621 ASP A OD1 
4849 O  OD2 . ASP A 621 ? 2.6032 2.9502 2.9690 0.3006  -0.0931 -0.2314 621 ASP A OD2 
4850 N  N   . PHE A 622 ? 1.7471 2.0540 2.1202 0.1749  -0.0144 -0.1163 622 PHE A N   
4851 C  CA  . PHE A 622 ? 1.6508 1.9658 2.0144 0.1621  0.0145  -0.0917 622 PHE A CA  
4852 C  C   . PHE A 622 ? 1.6935 2.0156 2.0213 0.1764  0.0278  -0.0900 622 PHE A C   
4853 O  O   . PHE A 622 ? 1.6933 2.0330 2.0028 0.1867  0.0537  -0.0776 622 PHE A O   
4854 C  CB  . PHE A 622 ? 2.5648 2.9094 2.9512 0.1648  0.0372  -0.0819 622 PHE A CB  
4855 C  CG  . PHE A 622 ? 2.6088 2.9904 2.9868 0.1951  0.0564  -0.0926 622 PHE A CG  
4856 C  CD1 . PHE A 622 ? 2.6006 2.9936 2.9436 0.2034  0.0872  -0.0787 622 PHE A CD1 
4857 C  CD2 . PHE A 622 ? 2.6863 3.0867 3.0862 0.2158  0.0433  -0.1173 622 PHE A CD2 
4858 C  CE1 . PHE A 622 ? 2.6856 3.1055 3.0090 0.2302  0.1082  -0.0877 622 PHE A CE1 
4859 C  CE2 . PHE A 622 ? 2.7452 3.1803 3.1341 0.2437  0.0643  -0.1292 622 PHE A CE2 
4860 C  CZ  . PHE A 622 ? 2.7522 3.1959 3.0998 0.2500  0.0987  -0.1135 622 PHE A CZ  
4861 N  N   . ARG A 623 ? 1.2972 1.6015 1.6142 0.1765  0.0092  -0.1037 623 ARG A N   
4862 C  CA  . ARG A 623 ? 1.3566 1.6634 1.6439 0.1918  0.0138  -0.1070 623 ARG A CA  
4863 C  C   . ARG A 623 ? 1.3149 1.6017 1.6060 0.1677  0.0093  -0.1042 623 ARG A C   
4864 O  O   . ARG A 623 ? 1.3359 1.6232 1.6070 0.1738  0.0172  -0.0993 623 ARG A O   
4865 C  CB  . ARG A 623 ? 2.1477 2.4606 2.4230 0.2231  -0.0052 -0.1350 623 ARG A CB  
4866 C  CG  . ARG A 623 ? 2.2319 2.5663 2.4771 0.2578  0.0086  -0.1374 623 ARG A CG  
4867 C  CD  . ARG A 623 ? 2.3777 2.7133 2.6056 0.2911  -0.0140 -0.1670 623 ARG A CD  
4868 N  NE  . ARG A 623 ? 2.4921 2.8451 2.6844 0.3246  0.0008  -0.1704 623 ARG A NE  
4869 C  CZ  . ARG A 623 ? 2.6305 2.9878 2.8040 0.3586  -0.0163 -0.1965 623 ARG A CZ  
4870 N  NH1 . ARG A 623 ? 2.6603 3.0067 2.8534 0.3629  -0.0508 -0.2217 623 ARG A NH1 
4871 N  NH2 . ARG A 623 ? 2.7523 3.1236 2.8871 0.3873  0.0023  -0.1985 623 ARG A NH2 
4872 N  N   . ALA A 624 ? 1.6698 1.9360 1.9834 0.1408  -0.0036 -0.1089 624 ALA A N   
4873 C  CA  . ALA A 624 ? 1.6054 1.8556 1.9254 0.1171  -0.0052 -0.1124 624 ALA A CA  
4874 C  C   . ALA A 624 ? 1.5475 1.7701 1.8789 0.0795  -0.0038 -0.1001 624 ALA A C   
4875 O  O   . ALA A 624 ? 1.5834 1.7885 1.9198 0.0722  -0.0148 -0.0997 624 ALA A O   
4876 C  CB  . ALA A 624 ? 5.4772 5.7256 5.8061 0.1252  -0.0241 -0.1428 624 ALA A CB  
4877 N  N   . LEU A 625 ? 1.8370 2.0517 2.1688 0.0577  0.0074  -0.0922 625 LEU A N   
4878 C  CA  . LEU A 625 ? 1.8102 1.9944 2.1431 0.0224  0.0111  -0.0796 625 LEU A CA  
4879 C  C   . LEU A 625 ? 1.8283 1.9904 2.1665 -0.0041 0.0089  -0.0967 625 LEU A C   
4880 O  O   . LEU A 625 ? 1.8038 1.9835 2.1537 -0.0003 0.0123  -0.1139 625 LEU A O   
4881 C  CB  . LEU A 625 ? 1.3247 1.5145 1.6535 0.0146  0.0280  -0.0583 625 LEU A CB  
4882 C  CG  . LEU A 625 ? 1.2966 1.5133 1.6195 0.0401  0.0383  -0.0441 625 LEU A CG  
4883 C  CD1 . LEU A 625 ? 1.2038 1.4158 1.5253 0.0251  0.0525  -0.0213 625 LEU A CD1 
4884 C  CD2 . LEU A 625 ? 1.3100 1.5361 1.6374 0.0557  0.0343  -0.0416 625 LEU A CD2 
4885 N  N   . LYS A 626 ? 2.0248 2.1461 2.3537 -0.0311 0.0032  -0.0938 626 LYS A N   
4886 C  CA  . LYS A 626 ? 2.0062 2.0993 2.3339 -0.0647 0.0092  -0.1064 626 LYS A CA  
4887 C  C   . LYS A 626 ? 1.9534 2.0282 2.2678 -0.0924 0.0264  -0.0906 626 LYS A C   
4888 O  O   . LYS A 626 ? 1.9602 1.9923 2.2482 -0.1114 0.0233  -0.0742 626 LYS A O   
4889 C  CB  . LYS A 626 ? 1.9570 2.0035 2.2696 -0.0808 -0.0060 -0.1121 626 LYS A CB  
4890 C  CG  . LYS A 626 ? 1.9640 1.9889 2.2819 -0.1111 0.0019  -0.1331 626 LYS A CG  
4891 C  CD  . LYS A 626 ? 2.0083 1.9895 2.3122 -0.1183 -0.0178 -0.1408 626 LYS A CD  
4892 C  CE  . LYS A 626 ? 2.0169 1.9899 2.3396 -0.1410 -0.0111 -0.1676 626 LYS A CE  
4893 N  NZ  . LYS A 626 ? 2.0575 1.9939 2.3714 -0.1391 -0.0356 -0.1768 626 LYS A NZ  
4894 N  N   . VAL A 627 ? 2.0005 2.1056 2.3317 -0.0916 0.0409  -0.0981 627 VAL A N   
4895 C  CA  . VAL A 627 ? 1.9535 2.0523 2.2777 -0.1107 0.0571  -0.0865 627 VAL A CA  
4896 C  C   . VAL A 627 ? 1.9117 1.9971 2.2414 -0.1445 0.0736  -0.1062 627 VAL A C   
4897 O  O   . VAL A 627 ? 1.8240 1.9413 2.1805 -0.1429 0.0838  -0.1246 627 VAL A O   
4898 C  CB  . VAL A 627 ? 1.2109 1.3514 1.5500 -0.0850 0.0608  -0.0833 627 VAL A CB  
4899 C  CG1 . VAL A 627 ? 1.1785 1.3111 1.5105 -0.1014 0.0735  -0.0696 627 VAL A CG1 
4900 C  CG2 . VAL A 627 ? 1.2376 1.3954 1.5720 -0.0525 0.0511  -0.0678 627 VAL A CG2 
4901 N  N   . GLU A 628 ? 2.7030 2.7385 3.0060 -0.1751 0.0762  -0.1039 628 GLU A N   
4902 C  CA  . GLU A 628 ? 2.6952 2.7104 2.9973 -0.2134 0.0977  -0.1221 628 GLU A CA  
4903 C  C   . GLU A 628 ? 2.7016 2.7355 3.0392 -0.2162 0.0987  -0.1544 628 GLU A C   
4904 O  O   . GLU A 628 ? 2.6473 2.6994 3.0144 -0.2363 0.1188  -0.1805 628 GLU A O   
4905 C  CB  . GLU A 628 ? 2.7465 2.7841 3.0612 -0.2237 0.1187  -0.1274 628 GLU A CB  
4906 C  CG  . GLU A 628 ? 2.7756 2.7840 3.0784 -0.2688 0.1469  -0.1417 628 GLU A CG  
4907 C  CD  . GLU A 628 ? 2.7332 2.7642 3.0478 -0.2770 0.1665  -0.1485 628 GLU A CD  
4908 O  OE1 . GLU A 628 ? 2.6704 2.7321 2.9975 -0.2483 0.1551  -0.1382 628 GLU A OE1 
4909 O  OE2 . GLU A 628 ? 2.7858 2.8020 3.0962 -0.3129 0.1943  -0.1649 628 GLU A OE2 
4910 N  N   . GLY A 629 ? 2.7241 2.7541 3.0624 -0.1964 0.0763  -0.1551 629 GLY A N   
4911 C  CA  . GLY A 629 ? 2.7465 2.7916 3.1191 -0.1951 0.0712  -0.1854 629 GLY A CA  
4912 C  C   . GLY A 629 ? 2.7263 2.8306 3.1375 -0.1500 0.0546  -0.2012 629 GLY A C   
4913 O  O   . GLY A 629 ? 2.7826 2.8985 3.2153 -0.1340 0.0385  -0.2213 629 GLY A O   
4914 N  N   . ALA A 630 ? 2.7045 2.8402 3.1187 -0.1290 0.0572  -0.1916 630 ALA A N   
4915 C  CA  . ALA A 630 ? 2.7095 2.8919 3.1464 -0.0861 0.0426  -0.2038 630 ALA A CA  
4916 C  C   . ALA A 630 ? 2.7439 2.9269 3.1555 -0.0518 0.0247  -0.1830 630 ALA A C   
4917 O  O   . ALA A 630 ? 2.7263 2.8973 3.1110 -0.0506 0.0283  -0.1531 630 ALA A O   
4918 C  CB  . ALA A 630 ? 0.9861 1.1924 1.4300 -0.0801 0.0526  -0.2013 630 ALA A CB  
4919 N  N   . SER A 631 ? 1.8992 2.0980 2.3223 -0.0237 0.0060  -0.2012 631 SER A N   
4920 C  CA  . SER A 631 ? 1.9511 2.1580 2.3519 0.0122  -0.0075 -0.1864 631 SER A CA  
4921 C  C   . SER A 631 ? 1.9098 2.1456 2.3034 0.0435  -0.0066 -0.1827 631 SER A C   
4922 O  O   . SER A 631 ? 1.9001 2.1541 2.3134 0.0519  -0.0100 -0.2056 631 SER A O   
4923 C  CB  . SER A 631 ? 2.2147 2.4231 2.6242 0.0317  -0.0287 -0.2081 631 SER A CB  
4924 O  OG  . SER A 631 ? 1.7673 2.0043 2.1980 0.0582  -0.0406 -0.2376 631 SER A OG  
4925 N  N   . ILE A 632 ? 1.7065 1.9436 2.0722 0.0597  -0.0021 -0.1552 632 ILE A N   
4926 C  CA  . ILE A 632 ? 1.7124 1.9656 2.0596 0.0863  0.0013  -0.1461 632 ILE A CA  
4927 C  C   . ILE A 632 ? 1.7882 2.0484 2.1059 0.1176  0.0004  -0.1322 632 ILE A C   
4928 O  O   . ILE A 632 ? 1.7846 2.0402 2.0983 0.1120  0.0057  -0.1160 632 ILE A O   
4929 C  CB  . ILE A 632 ? 1.3013 1.5473 1.6428 0.0660  0.0183  -0.1224 632 ILE A CB  
4930 C  CG1 . ILE A 632 ? 1.2413 1.4823 1.6094 0.0350  0.0233  -0.1381 632 ILE A CG1 
4931 C  CG2 . ILE A 632 ? 1.3563 1.6105 1.6740 0.0925  0.0200  -0.1130 632 ILE A CG2 
4932 C  CD1 . ILE A 632 ? 0.7172 0.9501 1.0791 0.0165  0.0379  -0.1175 632 ILE A CD1 
4933 N  N   . PRO A 633 ? 1.5748 1.8443 1.8704 0.1515  -0.0065 -0.1406 633 PRO A N   
4934 C  CA  . PRO A 633 ? 1.6950 1.9687 1.9520 0.1837  -0.0031 -0.1295 633 PRO A CA  
4935 C  C   . PRO A 633 ? 1.6723 1.9417 1.9071 0.1762  0.0207  -0.0946 633 PRO A C   
4936 O  O   . PRO A 633 ? 1.6383 1.8993 1.8683 0.1667  0.0264  -0.0843 633 PRO A O   
4937 C  CB  . PRO A 633 ? 2.1997 2.4724 2.4334 0.2176  -0.0202 -0.1504 633 PRO A CB  
4938 C  CG  . PRO A 633 ? 1.6703 1.9410 1.9304 0.2004  -0.0252 -0.1615 633 PRO A CG  
4939 C  CD  . PRO A 633 ? 1.5129 1.7866 1.8190 0.1615  -0.0201 -0.1663 633 PRO A CD  
4940 N  N   . LEU A 634 ? 1.0514 1.3278 1.2774 0.1804  0.0341  -0.0794 634 LEU A N   
4941 C  CA  . LEU A 634 ? 0.9928 1.2682 1.2040 0.1728  0.0591  -0.0489 634 LEU A CA  
4942 C  C   . LEU A 634 ? 1.1448 1.4150 1.3029 0.2025  0.0692  -0.0418 634 LEU A C   
4943 O  O   . LEU A 634 ? 1.2438 1.5217 1.3799 0.2275  0.0698  -0.0512 634 LEU A O   
4944 C  CB  . LEU A 634 ? 1.7562 2.0446 1.9917 0.1618  0.0698  -0.0400 634 LEU A CB  
4945 C  CG  . LEU A 634 ? 1.1876 1.4677 1.4628 0.1305  0.0598  -0.0407 634 LEU A CG  
4946 C  CD1 . LEU A 634 ? 1.1317 1.4206 1.4295 0.1219  0.0681  -0.0302 634 LEU A CD1 
4947 C  CD2 . LEU A 634 ? 1.1023 1.3670 1.3809 0.1066  0.0638  -0.0284 634 LEU A CD2 
4948 N  N   . LYS A 635 ? 1.1826 1.8801 1.7792 -0.0320 0.0201  -0.7157 635 LYS A N   
4949 C  CA  . LYS A 635 ? 1.1886 1.9711 1.7698 -0.0181 0.0270  -0.7148 635 LYS A CA  
4950 C  C   . LYS A 635 ? 1.2002 2.0136 1.7730 -0.0098 0.0159  -0.7425 635 LYS A C   
4951 O  O   . LYS A 635 ? 1.2158 2.1109 1.7865 0.0030  0.0121  -0.7574 635 LYS A O   
4952 C  CB  . LYS A 635 ? 1.4522 2.2265 1.9946 -0.0183 0.0588  -0.6635 635 LYS A CB  
4953 C  CG  . LYS A 635 ? 1.4632 2.3238 1.9885 -0.0042 0.0663  -0.6591 635 LYS A CG  
4954 C  CD  . LYS A 635 ? 1.0838 1.9338 1.5741 -0.0040 0.0982  -0.6074 635 LYS A CD  
4955 C  CE  . LYS A 635 ? 1.0966 2.0431 1.5851 0.0104  0.1047  -0.5984 635 LYS A CE  
4956 N  NZ  . LYS A 635 ? 1.1098 2.0812 1.6181 0.0127  0.1099  -0.5834 635 LYS A NZ  
4957 N  N   . ALA A 636 ? 1.2905 2.0414 1.8584 -0.0170 0.0112  -0.7478 636 ALA A N   
4958 C  CA  . ALA A 636 ? 1.3004 2.0755 1.8615 -0.0093 0.0002  -0.7735 636 ALA A CA  
4959 C  C   . ALA A 636 ? 1.2893 1.9833 1.8461 -0.0204 -0.0018 -0.7696 636 ALA A C   
4960 O  O   . ALA A 636 ? 1.2727 1.8968 1.8314 -0.0339 0.0052  -0.7476 636 ALA A O   
4961 C  CB  . ALA A 636 ? 1.1623 1.9866 1.6855 -0.0020 0.0178  -0.7513 636 ALA A CB  
4962 N  N   . PHE A 637 ? 1.1415 1.8499 1.6931 -0.0143 -0.0116 -0.7906 637 PHE A N   
4963 C  CA  . PHE A 637 ? 1.1282 1.7712 1.6720 -0.0235 -0.0130 -0.7853 637 PHE A CA  
4964 C  C   . PHE A 637 ? 1.1347 1.8136 1.6464 -0.0173 -0.0068 -0.7818 637 PHE A C   
4965 O  O   . PHE A 637 ? 1.1539 1.9000 1.6752 -0.0022 -0.0202 -0.8135 637 PHE A O   
4966 C  CB  . PHE A 637 ? 1.7300 2.3548 2.3167 -0.0206 -0.0397 -0.8262 637 PHE A CB  
4967 C  CG  . PHE A 637 ? 1.3519 1.9310 1.9324 -0.0252 -0.0438 -0.8260 637 PHE A CG  
4968 C  CD1 . PHE A 637 ? 1.7087 2.2106 2.3045 -0.0388 -0.0472 -0.8158 637 PHE A CD1 
4969 C  CD2 . PHE A 637 ? 1.3676 1.9856 1.9282 -0.0160 -0.0446 -0.8346 637 PHE A CD2 
4970 C  CE1 . PHE A 637 ? 1.3312 1.7965 1.9226 -0.0429 -0.0512 -0.8141 637 PHE A CE1 
4971 C  CE2 . PHE A 637 ? 1.3654 1.9461 1.9209 -0.0202 -0.0485 -0.8331 637 PHE A CE2 
4972 C  CZ  . PHE A 637 ? 1.3467 1.8515 1.9177 -0.0335 -0.0516 -0.8227 637 PHE A CZ  
4973 N  N   . VAL A 638 ? 1.2756 1.9119 1.7490 -0.0294 0.0135  -0.7439 638 VAL A N   
4974 C  CA  . VAL A 638 ? 1.2842 1.9485 1.7254 -0.0269 0.0200  -0.7366 638 VAL A CA  
4975 C  C   . VAL A 638 ? 1.2764 1.8935 1.7173 -0.0341 0.0114  -0.7428 638 VAL A C   
4976 O  O   . VAL A 638 ? 1.2617 1.8058 1.7053 -0.0486 0.0143  -0.7282 638 VAL A O   
4977 C  CB  . VAL A 638 ? 0.9529 1.6081 1.3502 -0.0358 0.0486  -0.6909 638 VAL A CB  
4978 C  CG1 . VAL A 638 ? 0.9795 1.6510 1.3425 -0.0379 0.0556  -0.6798 638 VAL A CG1 
4979 C  CG2 . VAL A 638 ? 0.9540 1.6701 1.3536 -0.0251 0.0560  -0.6853 638 VAL A CG2 
4980 N  N   . ASP A 639 ? 1.3164 1.9801 1.7550 -0.0234 0.0007  -0.7639 639 ASP A N   
4981 C  CA  . ASP A 639 ? 1.3141 1.9478 1.7587 -0.0260 -0.0107 -0.7752 639 ASP A CA  
4982 C  C   . ASP A 639 ? 1.3239 1.9774 1.7264 -0.0302 0.0018  -0.7537 639 ASP A C   
4983 O  O   . ASP A 639 ? 1.3393 2.0635 1.7380 -0.0159 -0.0044 -0.7706 639 ASP A O   
4984 C  CB  . ASP A 639 ? 1.7205 2.3996 2.2063 -0.0062 -0.0370 -0.8255 639 ASP A CB  
4985 C  CG  . ASP A 639 ? 1.7235 2.3694 2.2253 -0.0061 -0.0509 -0.8397 639 ASP A CG  
4986 O  OD1 . ASP A 639 ? 1.3782 2.0277 1.8528 -0.0096 -0.0451 -0.8253 639 ASP A OD1 
4987 O  OD2 . ASP A 639 ? 1.3792 1.9969 1.9224 -0.0025 -0.0679 -0.8648 639 ASP A OD2 
4988 N  N   . ILE A 640 ? 1.5095 2.1038 1.8797 -0.0504 0.0194  -0.7166 640 ILE A N   
4989 C  CA  . ILE A 640 ? 1.5282 2.1394 1.8558 -0.0577 0.0330  -0.6933 640 ILE A CA  
4990 C  C   . ILE A 640 ? 1.5247 2.1224 1.8499 -0.0618 0.0232  -0.6993 640 ILE A C   
4991 O  O   . ILE A 640 ? 1.5095 2.0431 1.8402 -0.0750 0.0218  -0.6912 640 ILE A O   
4992 C  CB  . ILE A 640 ? 1.2800 1.8435 1.5678 -0.0777 0.0604  -0.6488 640 ILE A CB  
4993 C  CG1 . ILE A 640 ? 1.2813 1.8606 1.5740 -0.0715 0.0705  -0.6411 640 ILE A CG1 
4994 C  CG2 . ILE A 640 ? 1.3169 1.9022 1.5615 -0.0858 0.0739  -0.6261 640 ILE A CG2 
4995 C  CD1 . ILE A 640 ? 1.3104 1.8477 1.5663 -0.0875 0.0984  -0.5993 640 ILE A CD1 
4996 N  N   . GLU A 641 ? 1.4815 2.1439 1.7986 -0.0504 0.0166  -0.7118 641 GLU A N   
4997 C  CA  . GLU A 641 ? 1.4777 2.1417 1.7981 -0.0495 0.0047  -0.7220 641 GLU A CA  
4998 C  C   . GLU A 641 ? 1.5032 2.1756 1.7777 -0.0639 0.0188  -0.6921 641 GLU A C   
4999 O  O   . GLU A 641 ? 1.5053 2.1640 1.7748 -0.0704 0.0137  -0.6893 641 GLU A O   
5000 C  CB  . GLU A 641 ? 2.6186 3.3502 2.9737 -0.0227 -0.0180 -0.7666 641 GLU A CB  
5001 C  CG  . GLU A 641 ? 2.6142 3.3347 2.9893 -0.0177 -0.0339 -0.7837 641 GLU A CG  
5002 C  CD  . GLU A 641 ? 2.3079 3.0741 2.7280 0.0093  -0.0569 -0.8327 641 GLU A CD  
5003 O  OE1 . GLU A 641 ? 2.3218 3.0897 2.7701 0.0178  -0.0637 -0.8545 641 GLU A OE1 
5004 O  OE2 . GLU A 641 ? 2.3160 3.1171 2.7433 0.0218  -0.0680 -0.8497 641 GLU A OE2 
5005 N  N   . SER A 642 ? 1.6468 2.3417 1.8887 -0.0697 0.0366  -0.6684 642 SER A N   
5006 C  CA  . SER A 642 ? 1.6813 2.3783 1.8785 -0.0868 0.0513  -0.6375 642 SER A CA  
5007 C  C   . SER A 642 ? 1.7160 2.3878 1.8786 -0.1025 0.0768  -0.6016 642 SER A C   
5008 O  O   . SER A 642 ? 1.7359 2.4611 1.8904 -0.0935 0.0832  -0.5968 642 SER A O   
5009 C  CB  . SER A 642 ? 4.3851 5.1696 4.5785 -0.0717 0.0418  -0.6513 642 SER A CB  
5010 O  OG  . SER A 642 ? 4.3632 5.1627 4.5826 -0.0598 0.0213  -0.6793 642 SER A OG  
5011 N  N   . ILE A 643 ? 1.3438 1.9353 1.4872 -0.1256 0.0916  -0.5763 643 ILE A N   
5012 C  CA  . ILE A 643 ? 1.3912 1.9460 1.5021 -0.1413 0.1175  -0.5422 643 ILE A CA  
5013 C  C   . ILE A 643 ? 1.4502 2.0399 1.5228 -0.1500 0.1302  -0.5198 643 ILE A C   
5014 O  O   . ILE A 643 ? 1.4873 2.0867 1.5417 -0.1515 0.1475  -0.4987 643 ILE A O   
5015 C  CB  . ILE A 643 ? 1.2352 1.6982 1.3296 -0.1660 0.1305  -0.5215 643 ILE A CB  
5016 C  CG1 . ILE A 643 ? 1.1778 1.6030 1.3103 -0.1597 0.1187  -0.5394 643 ILE A CG1 
5017 C  CG2 . ILE A 643 ? 1.3019 1.7274 1.3622 -0.1808 0.1583  -0.4883 643 ILE A CG2 
5018 C  CD1 . ILE A 643 ? 1.1910 1.5322 1.3089 -0.1827 0.1317  -0.5185 643 ILE A CD1 
5019 N  N   . THR A 644 ? 1.4084 2.0177 1.4706 -0.1559 0.1212  -0.5232 644 THR A N   
5020 C  CA  . THR A 644 ? 1.4579 2.0986 1.4839 -0.1674 0.1312  -0.5017 644 THR A CA  
5021 C  C   . THR A 644 ? 1.4571 2.1862 1.4915 -0.1458 0.1269  -0.5092 644 THR A C   
5022 O  O   . THR A 644 ? 1.4843 2.2299 1.4924 -0.1531 0.1433  -0.4833 644 THR A O   
5023 C  CB  . THR A 644 ? 1.8700 2.5201 1.8882 -0.1761 0.1194  -0.5066 644 THR A CB  
5024 O  OG1 . THR A 644 ? 1.4795 2.1019 1.5301 -0.1692 0.1027  -0.5301 644 THR A OG1 
5025 C  CG2 . THR A 644 ? 1.6056 2.2035 1.5790 -0.2092 0.1379  -0.4736 644 THR A CG2 
5026 N  N   . ASN A 645 ? 1.4567 2.2419 1.5289 -0.1196 0.1053  -0.5447 645 ASN A N   
5027 C  CA  . ASN A 645 ? 1.4557 2.3386 1.5384 -0.0974 0.0970  -0.5581 645 ASN A CA  
5028 C  C   . ASN A 645 ? 1.4426 2.3531 1.5470 -0.0800 0.0987  -0.5661 645 ASN A C   
5029 O  O   . ASN A 645 ? 1.4599 2.4423 1.5617 -0.0687 0.1012  -0.5616 645 ASN A O   
5030 C  CB  . ASN A 645 ? 1.9791 2.9190 2.0868 -0.0788 0.0722  -0.5939 645 ASN A CB  
5031 C  CG  . ASN A 645 ? 1.9905 2.9047 2.0813 -0.0944 0.0689  -0.5867 645 ASN A CG  
5032 O  OD1 . ASN A 645 ? 1.7002 2.6500 1.7636 -0.1032 0.0733  -0.5693 645 ASN A OD1 
5033 N  ND2 . ASN A 645 ? 1.6413 2.4964 1.7498 -0.0983 0.0608  -0.5989 645 ASN A ND2 
5034 N  N   . GLY A 646 ? 1.3952 2.2518 1.5217 -0.0786 0.0973  -0.5765 646 GLY A N   
5035 C  CA  . GLY A 646 ? 1.3865 2.2592 1.5317 -0.0660 0.1010  -0.5796 646 GLY A CA  
5036 C  C   . GLY A 646 ? 1.3394 2.2547 1.5288 -0.0427 0.0775  -0.6239 646 GLY A C   
5037 O  O   . GLY A 646 ? 1.3304 2.2867 1.5384 -0.0285 0.0759  -0.6333 646 GLY A O   
5038 N  N   . LYS A 647 ? 1.4941 2.3990 1.7009 -0.0392 0.0593  -0.6509 647 LYS A N   
5039 C  CA  . LYS A 647 ? 1.4682 2.4180 1.7166 -0.0162 0.0353  -0.6972 647 LYS A CA  
5040 C  C   . LYS A 647 ? 1.4381 2.3281 1.7183 -0.0164 0.0284  -0.7130 647 LYS A C   
5041 O  O   . LYS A 647 ? 1.4227 2.2446 1.7088 -0.0274 0.0250  -0.7124 647 LYS A O   
5042 C  CB  . LYS A 647 ? 2.1224 3.0944 2.3759 -0.0101 0.0194  -0.7180 647 LYS A CB  
5043 C  CG  . LYS A 647 ? 2.1186 3.1465 2.4127 0.0159  -0.0048 -0.7678 647 LYS A CG  
5044 C  CD  . LYS A 647 ? 2.1342 3.1734 2.4312 0.0207  -0.0175 -0.7825 647 LYS A CD  
5045 C  CE  . LYS A 647 ? 1.8104 2.9136 2.1448 0.0488  -0.0401 -0.8329 647 LYS A CE  
5046 N  NZ  . LYS A 647 ? 1.8338 2.9659 2.1660 0.0562  -0.0497 -0.8428 647 LYS A NZ  
5047 N  N   . PHE A 648 ? 1.0925 2.0126 1.3934 -0.0048 0.0264  -0.7254 648 PHE A N   
5048 C  CA  . PHE A 648 ? 1.0688 1.9468 1.4039 -0.0031 0.0180  -0.7434 648 PHE A CA  
5049 C  C   . PHE A 648 ? 1.0707 2.0197 1.4406 0.0185  0.0017  -0.7819 648 PHE A C   
5050 O  O   . PHE A 648 ? 1.0866 2.1197 1.4509 0.0316  0.0009  -0.7889 648 PHE A O   
5051 C  CB  . PHE A 648 ? 1.2658 2.0780 1.5852 -0.0202 0.0390  -0.7063 648 PHE A CB  
5052 C  CG  . PHE A 648 ? 1.2852 2.1373 1.5812 -0.0194 0.0579  -0.6784 648 PHE A CG  
5053 C  CD1 . PHE A 648 ? 1.2740 2.1857 1.5906 -0.0044 0.0540  -0.6915 648 PHE A CD1 
5054 C  CD2 . PHE A 648 ? 1.3206 2.1516 1.5752 -0.0340 0.0798  -0.6384 648 PHE A CD2 
5055 C  CE1 . PHE A 648 ? 1.2940 2.2452 1.5914 -0.0027 0.0716  -0.6630 648 PHE A CE1 
5056 C  CE2 . PHE A 648 ? 1.3479 2.2136 1.5837 -0.0325 0.0975  -0.6110 648 PHE A CE2 
5057 C  CZ  . PHE A 648 ? 1.3316 2.2584 1.5896 -0.0162 0.0936  -0.6222 648 PHE A CZ  
5058 N  N   . TYR A 649 ? 1.3846 2.3002 1.7907 0.0210  -0.0113 -0.8065 649 TYR A N   
5059 C  CA  . TYR A 649 ? 1.3962 2.3708 1.8364 0.0382  -0.0271 -0.8448 649 TYR A CA  
5060 C  C   . TYR A 649 ? 1.3791 2.3222 1.8325 0.0312  -0.0208 -0.8336 649 TYR A C   
5061 O  O   . TYR A 649 ? 1.3616 2.2378 1.8366 0.0229  -0.0265 -0.8382 649 TYR A O   
5062 C  CB  . TYR A 649 ? 2.0043 2.9762 2.4821 0.0496  -0.0520 -0.8920 649 TYR A CB  
5063 C  CG  . TYR A 649 ? 2.0141 2.9919 2.4805 0.0534  -0.0570 -0.8973 649 TYR A CG  
5064 C  CD1 . TYR A 649 ? 1.6679 2.5760 2.1458 0.0461  -0.0637 -0.8988 649 TYR A CD1 
5065 C  CD2 . TYR A 649 ? 1.6962 2.7530 2.1412 0.0642  -0.0552 -0.8987 649 TYR A CD2 
5066 C  CE1 . TYR A 649 ? 1.6770 2.5940 2.1454 0.0500  -0.0682 -0.9020 649 TYR A CE1 
5067 C  CE2 . TYR A 649 ? 1.7057 2.7715 2.1406 0.0678  -0.0599 -0.9024 649 TYR A CE2 
5068 C  CZ  . TYR A 649 ? 1.6962 2.6919 2.1428 0.0608  -0.0663 -0.9041 649 TYR A CZ  
5069 O  OH  . TYR A 649 ? 1.7055 2.7125 2.1430 0.0645  -0.0708 -0.9059 649 TYR A OH  
5070 N  N   . TYR A 650 ? 1.5796 2.5745 2.0211 0.0348  -0.0090 -0.8172 650 TYR A N   
5071 C  CA  . TYR A 650 ? 1.5653 2.5423 2.0179 0.0298  -0.0015 -0.8036 650 TYR A CA  
5072 C  C   . TYR A 650 ? 1.5693 2.5800 2.0663 0.0405  -0.0236 -0.8488 650 TYR A C   
5073 O  O   . TYR A 650 ? 1.5845 2.6813 2.0905 0.0543  -0.0305 -0.8697 650 TYR A O   
5074 C  CB  . TYR A 650 ? 1.4499 2.4750 1.8750 0.0310  0.0196  -0.7678 650 TYR A CB  
5075 C  CG  . TYR A 650 ? 1.0990 2.1149 1.5329 0.0276  0.0302  -0.7485 650 TYR A CG  
5076 C  CD1 . TYR A 650 ? 1.4290 2.3580 1.8543 0.0121  0.0453  -0.7168 650 TYR A CD1 
5077 C  CD2 . TYR A 650 ? 1.1001 2.1987 1.5502 0.0402  0.0255  -0.7609 650 TYR A CD2 
5078 C  CE1 . TYR A 650 ? 1.0805 2.0043 1.5144 0.0103  0.0555  -0.6982 650 TYR A CE1 
5079 C  CE2 . TYR A 650 ? 1.0884 2.1837 1.5475 0.0375  0.0351  -0.7417 650 TYR A CE2 
5080 C  CZ  . TYR A 650 ? 1.0785 2.0859 1.5297 0.0232  0.0503  -0.7100 650 TYR A CZ  
5081 O  OH  . TYR A 650 ? 1.0698 2.0788 1.5307 0.0221  0.0601  -0.6905 650 TYR A OH  
5082 N  N   . ASN A 651 ? 1.1611 2.1052 1.6860 0.0333  -0.0350 -0.8639 651 ASN A N   
5083 C  CA  . ASN A 651 ? 1.1748 2.1370 1.7434 0.0396  -0.0554 -0.9046 651 ASN A CA  
5084 C  C   . ASN A 651 ? 1.1613 2.1318 1.7373 0.0346  -0.0472 -0.8877 651 ASN A C   
5085 O  O   . ASN A 651 ? 1.1360 2.0407 1.7041 0.0207  -0.0335 -0.8534 651 ASN A O   
5086 C  CB  . ASN A 651 ? 1.9561 2.8406 2.5542 0.0326  -0.0705 -0.9235 651 ASN A CB  
5087 C  CG  . ASN A 651 ? 1.6473 2.5413 2.2557 0.0432  -0.0866 -0.9571 651 ASN A CG  
5088 O  OD1 . ASN A 651 ? 1.6517 2.5808 2.2328 0.0496  -0.0805 -0.9503 651 ASN A OD1 
5089 N  ND2 . ASN A 651 ? 1.6729 2.5359 2.3221 0.0455  -0.1072 -0.9931 651 ASN A ND2 
5090 N  N   . GLU A 652 ? 1.0891 2.1418 1.6812 0.0457  -0.0558 -0.9120 652 GLU A N   
5091 C  CA  . GLU A 652 ? 1.0767 2.1460 1.6746 0.0415  -0.0471 -0.8929 652 GLU A CA  
5092 C  C   . GLU A 652 ? 1.0834 2.1228 1.7233 0.0355  -0.0647 -0.9203 652 GLU A C   
5093 O  O   . GLU A 652 ? 1.1213 2.1912 1.7916 0.0428  -0.0874 -0.9695 652 GLU A O   
5094 C  CB  . GLU A 652 ? 2.5346 3.7143 3.1263 0.0549  -0.0453 -0.8985 652 GLU A CB  
5095 C  CG  . GLU A 652 ? 2.5186 3.7199 3.1034 0.0515  -0.0280 -0.8615 652 GLU A CG  
5096 C  CD  . GLU A 652 ? 2.5364 3.8507 3.1138 0.0648  -0.0251 -0.8621 652 GLU A CD  
5097 O  OE1 . GLU A 652 ? 2.2272 3.6016 2.8023 0.0763  -0.0359 -0.8910 652 GLU A OE1 
5098 O  OE2 . GLU A 652 ? 2.1931 3.5386 2.7677 0.0643  -0.0117 -0.8329 652 GLU A OE2 
5099 N  N   . ILE A 653 ? 2.1339 3.1135 2.7759 0.0220  -0.0540 -0.8888 653 ILE A N   
5100 C  CA  . ILE A 653 ? 2.1341 3.0914 2.8154 0.0145  -0.0687 -0.9080 653 ILE A CA  
5101 C  C   . ILE A 653 ? 2.1013 3.0718 2.7776 0.0090  -0.0527 -0.8723 653 ILE A C   
5102 O  O   . ILE A 653 ? 2.0590 3.0228 2.7016 0.0081  -0.0282 -0.8273 653 ILE A O   
5103 C  CB  . ILE A 653 ? 1.0538 1.9086 1.7498 0.0008  -0.0738 -0.9034 653 ILE A CB  
5104 C  CG1 . ILE A 653 ? 1.0776 1.9026 1.7722 0.0046  -0.0835 -0.9239 653 ILE A CG1 
5105 C  CG2 . ILE A 653 ? 1.0632 1.9041 1.8046 -0.0062 -0.0931 -0.9300 653 ILE A CG2 
5106 C  CD1 . ILE A 653 ? 1.0614 1.8635 1.7122 0.0032  -0.0632 -0.8876 653 ILE A CD1 
5107 N  N   . ASP A 654 ? 1.1842 2.1703 1.8947 0.0048  -0.0662 -0.8915 654 ASP A N   
5108 C  CA  . ASP A 654 ? 1.1541 2.1563 1.8642 -0.0002 -0.0525 -0.8584 654 ASP A CA  
5109 C  C   . ASP A 654 ? 1.1243 2.1601 1.7947 0.0066  -0.0246 -0.8122 654 ASP A C   
5110 O  O   . ASP A 654 ? 1.0962 2.0727 1.7417 0.0004  -0.0026 -0.7681 654 ASP A O   
5111 C  CB  . ASP A 654 ? 1.3734 2.2870 2.0965 -0.0163 -0.0493 -0.8359 654 ASP A CB  
5112 C  CG  . ASP A 654 ? 1.3805 2.3169 2.1402 -0.0230 -0.0623 -0.8494 654 ASP A CG  
5113 O  OD1 . ASP A 654 ? 1.3840 2.4012 2.1458 -0.0166 -0.0604 -0.8498 654 ASP A OD1 
5114 O  OD2 . ASP A 654 ? 1.3853 2.2611 2.1727 -0.0353 -0.0748 -0.8589 654 ASP A OD2 
5115 N  N   . SER A 655 ? 1.2860 2.4187 1.9517 0.0194  -0.0257 -0.8234 655 SER A N   
5116 C  CA  . SER A 655 ? 1.2667 2.4416 1.8982 0.0275  -0.0013 -0.7823 655 SER A CA  
5117 C  C   . SER A 655 ? 1.2437 2.3897 1.8677 0.0215  0.0210  -0.7330 655 SER A C   
5118 O  O   . SER A 655 ? 1.2387 2.3841 1.8323 0.0252  0.0462  -0.6893 655 SER A O   
5119 C  CB  . SER A 655 ? 1.5457 2.8406 2.1829 0.0411  -0.0091 -0.8035 655 SER A CB  
5120 O  OG  . SER A 655 ? 1.2606 2.6035 1.9272 0.0393  -0.0191 -0.8166 655 SER A OG  
5121 N  N   . LYS A 656 ? 1.2569 2.3785 1.9097 0.0124  0.0116  -0.7403 656 LYS A N   
5122 C  CA  . LYS A 656 ? 1.2343 2.3364 1.8848 0.0077  0.0309  -0.6963 656 LYS A CA  
5123 C  C   . LYS A 656 ? 1.2100 2.2019 1.8565 -0.0059 0.0400  -0.6728 656 LYS A C   
5124 O  O   . LYS A 656 ? 1.1998 2.1709 1.8615 -0.0130 0.0436  -0.6557 656 LYS A O   
5125 C  CB  . LYS A 656 ? 1.0451 2.2157 1.7287 0.0076  0.0178  -0.7120 656 LYS A CB  
5126 C  CG  . LYS A 656 ? 1.0648 2.2291 1.7876 -0.0010 -0.0136 -0.7646 656 LYS A CG  
5127 C  CD  . LYS A 656 ? 0.8178 2.0766 1.5679 0.0008  -0.0267 -0.7846 656 LYS A CD  
5128 C  CE  . LYS A 656 ? 0.8545 2.0909 1.6466 -0.0130 -0.0523 -0.8211 656 LYS A CE  
5129 N  NZ  . LYS A 656 ? 0.9188 2.1900 1.7378 -0.0127 -0.0826 -0.8864 656 LYS A NZ  
5130 N  N   . ALA A 657 ? 1.4032 2.3290 2.0286 -0.0098 0.0442  -0.6704 657 ALA A N   
5131 C  CA  . ALA A 657 ? 1.3804 2.2048 1.9983 -0.0231 0.0539  -0.6472 657 ALA A CA  
5132 C  C   . ALA A 657 ? 1.3826 2.1656 1.9565 -0.0228 0.0835  -0.6042 657 ALA A C   
5133 O  O   . ALA A 657 ? 1.3994 2.2310 1.9503 -0.0124 0.0972  -0.5889 657 ALA A O   
5134 C  CB  . ALA A 657 ? 0.5164 1.2900 1.1519 -0.0313 0.0315  -0.6826 657 ALA A CB  
5135 N  N   . GLN A 658 ? 1.3901 2.0837 1.9524 -0.0351 0.0929  -0.5852 658 GLN A N   
5136 C  CA  . GLN A 658 ? 1.3994 2.0484 1.9192 -0.0369 0.1217  -0.5457 658 GLN A CA  
5137 C  C   . GLN A 658 ? 1.3927 1.9675 1.8931 -0.0482 0.1217  -0.5481 658 GLN A C   
5138 O  O   . GLN A 658 ? 1.4236 1.9653 1.8868 -0.0509 0.1440  -0.5200 658 GLN A O   
5139 C  CB  . GLN A 658 ? 3.1434 3.7619 3.6552 -0.0393 0.1464  -0.5029 658 GLN A CB  
5140 C  CG  . GLN A 658 ? 3.1772 3.7701 3.6458 -0.0369 0.1792  -0.4615 658 GLN A CG  
5141 C  CD  . GLN A 658 ? 3.2032 3.7475 3.6625 -0.0403 0.2044  -0.4214 658 GLN A CD  
5142 O  OE1 . GLN A 658 ? 3.1957 3.7397 3.6815 -0.0424 0.1984  -0.4207 658 GLN A OE1 
5143 N  NE2 . GLN A 658 ? 3.2370 3.7398 3.6585 -0.0412 0.2330  -0.3881 658 GLN A NE2 
5144 N  N   . ILE A 659 ? 1.2405 1.7903 1.7659 -0.0551 0.0972  -0.5808 659 ILE A N   
5145 C  CA  . ILE A 659 ? 1.2301 1.7076 1.7402 -0.0670 0.0976  -0.5789 659 ILE A CA  
5146 C  C   . ILE A 659 ? 1.2264 1.7227 1.7331 -0.0632 0.0817  -0.6092 659 ILE A C   
5147 O  O   . ILE A 659 ? 1.2172 1.7452 1.7558 -0.0579 0.0562  -0.6482 659 ILE A O   
5148 C  CB  . ILE A 659 ? 1.4894 1.9077 2.0276 -0.0800 0.0860  -0.5830 659 ILE A CB  
5149 C  CG1 . ILE A 659 ? 1.2851 1.6715 1.8154 -0.0855 0.1079  -0.5445 659 ILE A CG1 
5150 C  CG2 . ILE A 659 ? 1.2802 1.6356 1.8091 -0.0915 0.0815  -0.5863 659 ILE A CG2 
5151 C  CD1 . ILE A 659 ? 1.4755 1.8329 2.0427 -0.0948 0.0942  -0.5494 659 ILE A CD1 
5152 N  N   . TYR A 660 ? 1.2126 1.6894 1.6810 -0.0661 0.0970  -0.5916 660 TYR A N   
5153 C  CA  . TYR A 660 ? 1.2056 1.7046 1.6692 -0.0620 0.0832  -0.6174 660 TYR A CA  
5154 C  C   . TYR A 660 ? 1.1874 1.6201 1.6541 -0.0746 0.0738  -0.6245 660 TYR A C   
5155 O  O   . TYR A 660 ? 1.1889 1.5569 1.6346 -0.0885 0.0897  -0.5958 660 TYR A O   
5156 C  CB  . TYR A 660 ? 1.2384 1.7582 1.6592 -0.0592 0.1031  -0.5948 660 TYR A CB  
5157 C  CG  . TYR A 660 ? 1.2479 1.8448 1.6638 -0.0450 0.1112  -0.5882 660 TYR A CG  
5158 C  CD1 . TYR A 660 ? 1.2586 1.8556 1.6678 -0.0437 0.1315  -0.5566 660 TYR A CD1 
5159 C  CD2 . TYR A 660 ? 1.2472 1.9190 1.6645 -0.0323 0.0995  -0.6113 660 TYR A CD2 
5160 C  CE1 . TYR A 660 ? 1.2729 1.9432 1.6789 -0.0304 0.1395  -0.5471 660 TYR A CE1 
5161 C  CE2 . TYR A 660 ? 1.2594 2.0065 1.6726 -0.0197 0.1070  -0.6028 660 TYR A CE2 
5162 C  CZ  . TYR A 660 ? 1.2712 2.0174 1.6793 -0.0189 0.1269  -0.5700 660 TYR A CZ  
5163 O  OH  . TYR A 660 ? 1.2822 2.1065 1.6882 -0.0060 0.1348  -0.5585 660 TYR A OH  
5164 N  N   . LEU A 661 ? 1.3204 1.7704 1.8126 -0.0694 0.0488  -0.6618 661 LEU A N   
5165 C  CA  . LEU A 661 ? 1.3049 1.6988 1.7990 -0.0797 0.0405  -0.6663 661 LEU A CA  
5166 C  C   . LEU A 661 ? 1.3141 1.7315 1.7820 -0.0758 0.0410  -0.6717 661 LEU A C   
5167 O  O   . LEU A 661 ? 1.3234 1.8071 1.7975 -0.0609 0.0306  -0.6967 661 LEU A O   
5168 C  CB  . LEU A 661 ? 1.1082 1.4923 1.6528 -0.0781 0.0127  -0.7009 661 LEU A CB  
5169 C  CG  . LEU A 661 ? 0.9418 1.2893 1.5027 -0.0821 -0.0041 -0.7178 661 LEU A CG  
5170 C  CD1 . LEU A 661 ? 1.0822 1.3788 1.6063 -0.0963 0.0122  -0.6863 661 LEU A CD1 
5171 C  CD2 . LEU A 661 ? 0.9400 1.2492 1.5477 -0.0877 -0.0223 -0.7319 661 LEU A CD2 
5172 N  N   . LEU A 662 ? 1.4149 1.7813 1.8525 -0.0896 0.0536  -0.6477 662 LEU A N   
5173 C  CA  . LEU A 662 ? 1.4228 1.8088 1.8356 -0.0883 0.0536  -0.6507 662 LEU A CA  
5174 C  C   . LEU A 662 ? 1.4042 1.7474 1.8283 -0.0965 0.0405  -0.6595 662 LEU A C   
5175 O  O   . LEU A 662 ? 1.3866 1.6700 1.8220 -0.1092 0.0406  -0.6483 662 LEU A O   
5176 C  CB  . LEU A 662 ? 1.0487 1.4173 1.4105 -0.0993 0.0813  -0.6127 662 LEU A CB  
5177 C  CG  . LEU A 662 ? 1.0684 1.4593 1.4102 -0.0956 0.1026  -0.5890 662 LEU A CG  
5178 C  CD1 . LEU A 662 ? 0.9845 1.3400 1.2767 -0.1098 0.1300  -0.5516 662 LEU A CD1 
5179 C  CD2 . LEU A 662 ? 0.9396 1.4176 1.2918 -0.0762 0.0938  -0.6095 662 LEU A CD2 
5180 N  N   . PHE A 663 ? 1.4583 1.8356 1.8791 -0.0890 0.0300  -0.6775 663 PHE A N   
5181 C  CA  . PHE A 663 ? 1.4481 1.7917 1.8736 -0.0962 0.0201  -0.6811 663 PHE A CA  
5182 C  C   . PHE A 663 ? 1.4689 1.8333 1.8547 -0.0996 0.0295  -0.6689 663 PHE A C   
5183 O  O   . PHE A 663 ? 1.4836 1.9118 1.8626 -0.0858 0.0263  -0.6831 663 PHE A O   
5184 C  CB  . PHE A 663 ? 1.6914 2.0557 2.1655 -0.0811 -0.0080 -0.7223 663 PHE A CB  
5185 C  CG  . PHE A 663 ? 1.6850 2.0112 2.1705 -0.0876 -0.0184 -0.7236 663 PHE A CG  
5186 C  CD1 . PHE A 663 ? 1.6666 1.9260 2.1650 -0.1032 -0.0180 -0.7064 663 PHE A CD1 
5187 C  CD2 . PHE A 663 ? 1.6994 2.0602 2.1838 -0.0777 -0.0285 -0.7402 663 PHE A CD2 
5188 C  CE1 . PHE A 663 ? 1.6642 1.8923 2.1751 -0.1090 -0.0274 -0.7049 663 PHE A CE1 
5189 C  CE2 . PHE A 663 ? 1.6982 2.0266 2.1948 -0.0829 -0.0376 -0.7391 663 PHE A CE2 
5190 C  CZ  . PHE A 663 ? 1.6800 1.9421 2.1901 -0.0987 -0.0371 -0.7207 663 PHE A CZ  
5191 N  N   . LEU A 664 ? 1.3736 1.6854 1.7330 -0.1192 0.0412  -0.6416 664 LEU A N   
5192 C  CA  . LEU A 664 ? 1.3985 1.7195 1.7208 -0.1274 0.0491  -0.6278 664 LEU A CA  
5193 C  C   . LEU A 664 ? 1.3851 1.7003 1.7301 -0.1257 0.0299  -0.6441 664 LEU A C   
5194 O  O   . LEU A 664 ? 1.3714 1.6309 1.7256 -0.1393 0.0286  -0.6329 664 LEU A O   
5195 C  CB  . LEU A 664 ? 1.3049 1.5672 1.5869 -0.1521 0.0731  -0.5892 664 LEU A CB  
5196 C  CG  . LEU A 664 ? 1.3244 1.5802 1.5839 -0.1549 0.0951  -0.5684 664 LEU A CG  
5197 C  CD1 . LEU A 664 ? 1.3530 1.5357 1.5964 -0.1755 0.1121  -0.5407 664 LEU A CD1 
5198 C  CD2 . LEU A 664 ? 1.3691 1.6615 1.5887 -0.1558 0.1097  -0.5548 664 LEU A CD2 
5199 N  N   . ARG A 665 ? 1.4130 1.7868 1.7681 -0.1087 0.0156  -0.6692 665 ARG A N   
5200 C  CA  . ARG A 665 ? 1.4039 1.7787 1.7890 -0.1014 -0.0048 -0.6896 665 ARG A CA  
5201 C  C   . ARG A 665 ? 1.4103 1.7654 1.7635 -0.1188 0.0030  -0.6645 665 ARG A C   
5202 O  O   . ARG A 665 ? 1.3974 1.7304 1.7700 -0.1213 -0.0083 -0.6669 665 ARG A O   
5203 C  CB  . ARG A 665 ? 2.5443 2.9907 2.9545 -0.0746 -0.0232 -0.7286 665 ARG A CB  
5204 C  CG  . ARG A 665 ? 2.5453 2.9864 2.9996 -0.0626 -0.0459 -0.7555 665 ARG A CG  
5205 C  CD  . ARG A 665 ? 2.5746 3.0888 3.0443 -0.0371 -0.0612 -0.7911 665 ARG A CD  
5206 N  NE  . ARG A 665 ? 2.4700 2.9752 2.9716 -0.0282 -0.0782 -0.8075 665 ARG A NE  
5207 C  CZ  . ARG A 665 ? 2.5028 3.0629 3.0174 -0.0071 -0.0910 -0.8348 665 ARG A CZ  
5208 N  NH1 . ARG A 665 ? 2.5215 3.1533 3.0193 0.0067  -0.0895 -0.8497 665 ARG A NH1 
5209 N  NH2 . ARG A 665 ? 2.5210 3.0661 3.0664 0.0009  -0.1050 -0.8462 665 ARG A NH2 
5210 N  N   . GLU A 666 ? 1.4347 1.7979 1.7393 -0.1318 0.0228  -0.6393 666 GLU A N   
5211 C  CA  . GLU A 666 ? 1.4498 1.7962 1.7185 -0.1517 0.0323  -0.6140 666 GLU A CA  
5212 C  C   . GLU A 666 ? 1.4426 1.7139 1.7020 -0.1761 0.0427  -0.5879 666 GLU A C   
5213 O  O   . GLU A 666 ? 1.4524 1.7034 1.6942 -0.1930 0.0454  -0.5710 666 GLU A O   
5214 C  CB  . GLU A 666 ? 1.7224 2.0984 1.9431 -0.1594 0.0506  -0.5954 666 GLU A CB  
5215 C  CG  . GLU A 666 ? 1.7346 2.1808 1.9629 -0.1364 0.0457  -0.6158 666 GLU A CG  
5216 C  CD  . GLU A 666 ? 1.6561 2.1361 1.8391 -0.1443 0.0622  -0.5951 666 GLU A CD  
5217 O  OE1 . GLU A 666 ? 1.6676 2.1460 1.8217 -0.1596 0.0671  -0.5785 666 GLU A OE1 
5218 O  OE2 . GLU A 666 ? 1.6805 2.1904 1.8579 -0.1357 0.0702  -0.5942 666 GLU A OE2 
5219 N  N   . TYR A 667 ? 1.2058 1.4397 1.4771 -0.1784 0.0487  -0.5840 667 TYR A N   
5220 C  CA  . TYR A 667 ? 1.1976 1.3634 1.4637 -0.1998 0.0580  -0.5608 667 TYR A CA  
5221 C  C   . TYR A 667 ? 1.1543 1.2947 1.4722 -0.1915 0.0416  -0.5756 667 TYR A C   
5222 O  O   . TYR A 667 ? 1.1477 1.2360 1.4674 -0.2065 0.0484  -0.5579 667 TYR A O   
5223 C  CB  . TYR A 667 ? 1.1176 1.2531 1.3474 -0.2136 0.0836  -0.5364 667 TYR A CB  
5224 C  CG  . TYR A 667 ? 1.1759 1.3172 1.3515 -0.2288 0.1036  -0.5149 667 TYR A CG  
5225 C  CD1 . TYR A 667 ? 1.2065 1.3936 1.3643 -0.2184 0.1106  -0.5176 667 TYR A CD1 
5226 C  CD2 . TYR A 667 ? 1.2131 1.3145 1.3557 -0.2550 0.1155  -0.4911 667 TYR A CD2 
5227 C  CE1 . TYR A 667 ? 1.2689 1.4590 1.3787 -0.2336 0.1288  -0.4965 667 TYR A CE1 
5228 C  CE2 . TYR A 667 ? 1.2817 1.3855 1.3747 -0.2712 0.1336  -0.4723 667 TYR A CE2 
5229 C  CZ  . TYR A 667 ? 1.3098 1.4560 1.3870 -0.2606 0.1403  -0.4746 667 TYR A CZ  
5230 O  OH  . TYR A 667 ? 1.3861 1.5320 1.4155 -0.2781 0.1583  -0.4545 667 TYR A OH  
5231 N  N   . LYS A 668 ? 1.4290 1.6072 1.7891 -0.1680 0.0201  -0.6084 668 LYS A N   
5232 C  CA  . LYS A 668 ? 1.3973 1.5562 1.8102 -0.1583 0.0032  -0.6267 668 LYS A CA  
5233 C  C   . LYS A 668 ? 1.3862 1.5030 1.7967 -0.1694 0.0160  -0.6095 668 LYS A C   
5234 O  O   . LYS A 668 ? 1.3722 1.4456 1.8084 -0.1775 0.0105  -0.6027 668 LYS A O   
5235 C  CB  . LYS A 668 ? 2.3679 2.5004 2.8112 -0.1619 -0.0121 -0.6272 668 LYS A CB  
5236 C  CG  . LYS A 668 ? 2.2764 2.4534 2.7476 -0.1409 -0.0324 -0.6568 668 LYS A CG  
5237 C  CD  . LYS A 668 ? 2.2814 2.4351 2.7694 -0.1475 -0.0419 -0.6470 668 LYS A CD  
5238 C  CE  . LYS A 668 ? 2.2974 2.4965 2.8113 -0.1251 -0.0602 -0.6751 668 LYS A CE  
5239 N  NZ  . LYS A 668 ? 2.3065 2.4904 2.8271 -0.1329 -0.0655 -0.6587 668 LYS A NZ  
5240 N  N   . SER A 669 ? 1.5370 1.6686 1.9179 -0.1692 0.0331  -0.6012 669 SER A N   
5241 C  CA  . SER A 669 ? 1.5346 1.6271 1.9082 -0.1796 0.0485  -0.5812 669 SER A CA  
5242 C  C   . SER A 669 ? 1.5320 1.6565 1.9195 -0.1638 0.0488  -0.5949 669 SER A C   
5243 O  O   . SER A 669 ? 1.5460 1.7219 1.9212 -0.1512 0.0505  -0.6058 669 SER A O   
5244 C  CB  . SER A 669 ? 1.4191 1.4808 1.7377 -0.2006 0.0757  -0.5466 669 SER A CB  
5245 O  OG  . SER A 669 ? 1.3007 1.3145 1.6150 -0.2126 0.0899  -0.5257 669 SER A OG  
5246 N  N   . PHE A 670 ? 1.4400 1.5363 1.8531 -0.1657 0.0473  -0.5923 670 PHE A N   
5247 C  CA  . PHE A 670 ? 1.4366 1.5624 1.8666 -0.1525 0.0467  -0.6037 670 PHE A CA  
5248 C  C   . PHE A 670 ? 1.4593 1.5674 1.8542 -0.1609 0.0737  -0.5731 670 PHE A C   
5249 O  O   . PHE A 670 ? 1.4748 1.5304 1.8481 -0.1786 0.0893  -0.5454 670 PHE A O   
5250 C  CB  . PHE A 670 ? 1.5583 1.6663 2.0401 -0.1497 0.0282  -0.6191 670 PHE A CB  
5251 C  CG  . PHE A 670 ? 1.5425 1.6817 2.0676 -0.1342 0.0005  -0.6579 670 PHE A CG  
5252 C  CD1 . PHE A 670 ? 1.5241 1.6305 2.0922 -0.1372 -0.0181 -0.6681 670 PHE A CD1 
5253 C  CD2 . PHE A 670 ? 1.5511 1.7533 2.0753 -0.1163 -0.0066 -0.6844 670 PHE A CD2 
5254 C  CE1 . PHE A 670 ? 1.5236 1.6551 2.1330 -0.1220 -0.0428 -0.7052 670 PHE A CE1 
5255 C  CE2 . PHE A 670 ? 1.5499 1.7807 2.1139 -0.1010 -0.0313 -0.7228 670 PHE A CE2 
5256 C  CZ  . PHE A 670 ? 1.5413 1.7347 2.1478 -0.1036 -0.0491 -0.7338 670 PHE A CZ  
5257 N  N   . VAL A 671 ? 1.3229 1.4767 1.7142 -0.1475 0.0791  -0.5785 671 VAL A N   
5258 C  CA  . VAL A 671 ? 1.3488 1.4930 1.7128 -0.1510 0.1044  -0.5508 671 VAL A CA  
5259 C  C   . VAL A 671 ? 1.3311 1.5079 1.7264 -0.1375 0.0983  -0.5620 671 VAL A C   
5260 O  O   . VAL A 671 ? 1.3088 1.5321 1.7371 -0.1234 0.0769  -0.5938 671 VAL A O   
5261 C  CB  . VAL A 671 ? 0.9652 1.1387 1.2864 -0.1489 0.1218  -0.5385 671 VAL A CB  
5262 C  CG1 . VAL A 671 ? 1.0035 1.1679 1.3001 -0.1500 0.1482  -0.5100 671 VAL A CG1 
5263 C  CG2 . VAL A 671 ? 0.9852 1.1277 1.2745 -0.1645 0.1281  -0.5266 671 VAL A CG2 
5264 N  N   . ILE A 672 ? 1.1673 1.3215 1.5517 -0.1419 0.1177  -0.5363 672 ILE A N   
5265 C  CA  . ILE A 672 ? 1.1527 1.3362 1.5647 -0.1312 0.1143  -0.5414 672 ILE A CA  
5266 C  C   . ILE A 672 ? 1.1925 1.3819 1.5730 -0.1288 0.1429  -0.5106 672 ILE A C   
5267 O  O   . ILE A 672 ? 1.2167 1.3545 1.5759 -0.1401 0.1635  -0.4816 672 ILE A O   
5268 C  CB  . ILE A 672 ? 1.0580 1.1980 1.5018 -0.1402 0.1055  -0.5397 672 ILE A CB  
5269 C  CG1 . ILE A 672 ? 0.9451 1.0882 1.4305 -0.1388 0.0746  -0.5732 672 ILE A CG1 
5270 C  CG2 . ILE A 672 ? 0.9798 1.1407 1.4418 -0.1335 0.1096  -0.5335 672 ILE A CG2 
5271 C  CD1 . ILE A 672 ? 1.0010 1.0990 1.5202 -0.1494 0.0644  -0.5700 672 ILE A CD1 
5272 N  N   . LEU A 673 ? 1.3903 1.6432 1.7684 -0.1138 0.1448  -0.5162 673 LEU A N   
5273 C  CA  . LEU A 673 ? 1.4380 1.7007 1.7873 -0.1097 0.1724  -0.4853 673 LEU A CA  
5274 C  C   . LEU A 673 ? 1.4234 1.7331 1.7967 -0.0963 0.1725  -0.4842 673 LEU A C   
5275 O  O   . LEU A 673 ? 1.3756 1.7213 1.7876 -0.0895 0.1493  -0.5117 673 LEU A O   
5276 C  CB  . LEU A 673 ? 2.8278 3.1318 3.1491 -0.1034 0.1790  -0.4841 673 LEU A CB  
5277 C  CG  . LEU A 673 ? 0.8428 1.1100 1.1329 -0.1166 0.1831  -0.4801 673 LEU A CG  
5278 C  CD1 . LEU A 673 ? 2.7959 3.1195 3.0679 -0.1084 0.1828  -0.4853 673 LEU A CD1 
5279 C  CD2 . LEU A 673 ? 2.8360 3.0350 3.0909 -0.1317 0.2114  -0.4449 673 LEU A CD2 
5280 N  N   . ASP A 674 ? 1.2442 1.5558 1.5944 -0.0925 0.1990  -0.4521 674 ASP A N   
5281 C  CA  . ASP A 674 ? 1.2418 1.6141 1.6086 -0.0773 0.2020  -0.4471 674 ASP A CA  
5282 C  C   . ASP A 674 ? 1.2812 1.7067 1.6247 -0.0665 0.2140  -0.4369 674 ASP A C   
5283 O  O   . ASP A 674 ? 1.3290 1.7276 1.6382 -0.0729 0.2277  -0.4234 674 ASP A O   
5284 C  CB  . ASP A 674 ? 1.6840 2.0216 2.0499 -0.0791 0.2229  -0.4155 674 ASP A CB  
5285 C  CG  . ASP A 674 ? 1.7665 2.0531 2.0892 -0.0845 0.2564  -0.3782 674 ASP A CG  
5286 O  OD1 . ASP A 674 ? 1.8101 2.1227 2.1085 -0.0783 0.2696  -0.3665 674 ASP A OD1 
5287 O  OD2 . ASP A 674 ? 1.8005 2.0216 2.1138 -0.0953 0.2696  -0.3607 674 ASP A OD2 
5288 N  N   . GLU A 675 ? 1.2862 1.7891 1.6486 -0.0511 0.2086  -0.4426 675 GLU A N   
5289 C  CA  . GLU A 675 ? 1.3142 1.8805 1.6604 -0.0399 0.2158  -0.4355 675 GLU A CA  
5290 C  C   . GLU A 675 ? 1.3832 1.9097 1.6861 -0.0454 0.2446  -0.4002 675 GLU A C   
5291 O  O   . GLU A 675 ? 1.4076 1.9557 1.6911 -0.0454 0.2440  -0.4032 675 GLU A O   
5292 C  CB  . GLU A 675 ? 1.4702 2.1113 1.8363 -0.0242 0.2182  -0.4275 675 GLU A CB  
5293 C  CG  . GLU A 675 ? 1.4209 2.1248 1.8272 -0.0174 0.1880  -0.4674 675 GLU A CG  
5294 C  CD  . GLU A 675 ? 1.4307 2.2377 1.8450 -0.0014 0.1841  -0.4720 675 GLU A CD  
5295 O  OE1 . GLU A 675 ? 1.3649 2.2035 1.7582 0.0030  0.1882  -0.4690 675 GLU A OE1 
5296 O  OE2 . GLU A 675 ? 1.3264 2.1855 1.7683 0.0059  0.1769  -0.4776 675 GLU A OE2 
5297 N  N   . SER A 676 ? 1.6001 2.0691 1.8881 -0.0503 0.2699  -0.3672 676 SER A N   
5298 C  CA  . SER A 676 ? 1.6838 2.1165 1.9324 -0.0541 0.3003  -0.3316 676 SER A CA  
5299 C  C   . SER A 676 ? 1.7121 2.0766 1.9299 -0.0727 0.3037  -0.3339 676 SER A C   
5300 O  O   . SER A 676 ? 1.7578 2.1051 1.9425 -0.0777 0.3223  -0.3137 676 SER A O   
5301 C  CB  . SER A 676 ? 1.2934 1.6904 1.5370 -0.0509 0.3281  -0.2959 676 SER A CB  
5302 O  OG  . SER A 676 ? 1.2271 1.5471 1.4683 -0.0640 0.3320  -0.2946 676 SER A OG  
5303 N  N   . LEU A 677 ? 1.2256 1.5523 1.4553 -0.0838 0.2857  -0.3573 677 LEU A N   
5304 C  CA  . LEU A 677 ? 1.2380 1.5122 1.4428 -0.1013 0.2841  -0.3633 677 LEU A CA  
5305 C  C   . LEU A 677 ? 1.1941 1.5230 1.4037 -0.0979 0.2612  -0.3911 677 LEU A C   
5306 O  O   . LEU A 677 ? 1.2303 1.5467 1.4110 -0.1071 0.2662  -0.3869 677 LEU A O   
5307 C  CB  . LEU A 677 ? 0.9886 1.2005 1.2043 -0.1147 0.2757  -0.3726 677 LEU A CB  
5308 C  CG  . LEU A 677 ? 1.0447 1.1907 1.2486 -0.1224 0.2995  -0.3452 677 LEU A CG  
5309 C  CD1 . LEU A 677 ? 0.9084 1.0008 1.1211 -0.1377 0.2873  -0.3570 677 LEU A CD1 
5310 C  CD2 . LEU A 677 ? 1.0711 1.1754 1.2300 -0.1294 0.3325  -0.3136 677 LEU A CD2 
5311 N  N   . TYR A 678 ? 1.1209 1.5124 1.3670 -0.0846 0.2364  -0.4198 678 TYR A N   
5312 C  CA  . TYR A 678 ? 1.0877 1.5457 1.3396 -0.0764 0.2173  -0.4449 678 TYR A CA  
5313 C  C   . TYR A 678 ? 1.1407 1.6375 1.3645 -0.0713 0.2350  -0.4218 678 TYR A C   
5314 O  O   . TYR A 678 ? 1.1415 1.6665 1.3526 -0.0723 0.2275  -0.4315 678 TYR A O   
5315 C  CB  . TYR A 678 ? 1.3237 1.8507 1.6183 -0.0609 0.1918  -0.4778 678 TYR A CB  
5316 C  CG  . TYR A 678 ? 1.2986 1.8874 1.6002 -0.0531 0.1702  -0.5094 678 TYR A CG  
5317 C  CD1 . TYR A 678 ? 1.2578 1.8332 1.5776 -0.0565 0.1461  -0.5432 678 TYR A CD1 
5318 C  CD2 . TYR A 678 ? 1.3176 1.9781 1.6074 -0.0421 0.1748  -0.5035 678 TYR A CD2 
5319 C  CE1 . TYR A 678 ? 1.2416 1.8733 1.5675 -0.0478 0.1275  -0.5721 678 TYR A CE1 
5320 C  CE2 . TYR A 678 ? 1.3007 2.0205 1.5957 -0.0345 0.1557  -0.5319 678 TYR A CE2 
5321 C  CZ  . TYR A 678 ? 1.2647 1.9695 1.5773 -0.0369 0.1325  -0.5669 678 TYR A CZ  
5322 O  OH  . TYR A 678 ? 1.2382 2.0030 1.5561 -0.0275 0.1145  -0.5955 678 TYR A OH  
5323 N  N   . ASN A 679 ? 1.0328 1.5321 1.2482 -0.0657 0.2585  -0.3899 679 ASN A N   
5324 C  CA  . ASN A 679 ? 1.0624 1.6022 1.2557 -0.0598 0.2751  -0.3655 679 ASN A CA  
5325 C  C   . ASN A 679 ? 1.1133 1.5847 1.2650 -0.0743 0.3044  -0.3306 679 ASN A C   
5326 O  O   . ASN A 679 ? 1.1468 1.6427 1.2785 -0.0722 0.3191  -0.3083 679 ASN A O   
5327 C  CB  . ASN A 679 ? 1.4040 2.0137 1.6180 -0.0409 0.2798  -0.3537 679 ASN A CB  
5328 C  CG  . ASN A 679 ? 1.3606 2.0623 1.6076 -0.0266 0.2508  -0.3896 679 ASN A CG  
5329 O  OD1 . ASN A 679 ? 1.3529 2.1037 1.5965 -0.0238 0.2371  -0.4076 679 ASN A OD1 
5330 N  ND2 . ASN A 679 ? 1.3252 2.0513 1.6040 -0.0181 0.2414  -0.4010 679 ASN A ND2 
5331 N  N   . SER A 680 ? 1.2670 1.6535 1.4063 -0.0899 0.3122  -0.3268 680 SER A N   
5332 C  CA  . SER A 680 ? 1.3217 1.6361 1.4209 -0.1066 0.3386  -0.2994 680 SER A CA  
5333 C  C   . SER A 680 ? 1.3290 1.6529 1.4025 -0.1175 0.3345  -0.3033 680 SER A C   
5334 O  O   . SER A 680 ? 1.2839 1.6270 1.3660 -0.1209 0.3104  -0.3316 680 SER A O   
5335 C  CB  . SER A 680 ? 1.9400 2.1721 2.0343 -0.1221 0.3410  -0.3032 680 SER A CB  
5336 O  OG  . SER A 680 ? 1.8854 2.1202 1.9928 -0.1291 0.3136  -0.3352 680 SER A OG  
5337 N  N   . ALA A 681 ? 1.4838 1.7919 1.5263 -0.1235 0.3586  -0.2739 681 ALA A N   
5338 C  CA  . ALA A 681 ? 1.4986 1.8210 1.5159 -0.1345 0.3564  -0.2731 681 ALA A CA  
5339 C  C   . ALA A 681 ? 1.4708 1.7607 1.4780 -0.1523 0.3399  -0.2964 681 ALA A C   
5340 O  O   . ALA A 681 ? 1.4602 1.7852 1.4587 -0.1567 0.3275  -0.3062 681 ALA A O   
5341 C  CB  . ALA A 681 ? 0.9812 1.2634 0.9637 -0.1445 0.3879  -0.2365 681 ALA A CB  
5342 N  N   . TYR A 682 ? 1.6180 1.8441 1.6272 -0.1623 0.3397  -0.3035 682 TYR A N   
5343 C  CA  . TYR A 682 ? 1.5950 1.7899 1.5959 -0.1795 0.3251  -0.3221 682 TYR A CA  
5344 C  C   . TYR A 682 ? 1.5188 1.7709 1.5557 -0.1667 0.2918  -0.3571 682 TYR A C   
5345 O  O   . TYR A 682 ? 1.5077 1.7935 1.5406 -0.1693 0.2767  -0.3712 682 TYR A O   
5346 C  CB  . TYR A 682 ? 1.5138 1.6239 1.5046 -0.1951 0.3367  -0.3158 682 TYR A CB  
5347 C  CG  . TYR A 682 ? 1.4790 1.5595 1.4677 -0.2115 0.3203  -0.3341 682 TYR A CG  
5348 C  CD1 . TYR A 682 ? 1.4677 1.5152 1.4202 -0.2341 0.3277  -0.3267 682 TYR A CD1 
5349 C  CD2 . TYR A 682 ? 1.4124 1.4977 1.4364 -0.2052 0.2977  -0.3573 682 TYR A CD2 
5350 C  CE1 . TYR A 682 ? 1.4200 1.4445 1.3717 -0.2490 0.3130  -0.3411 682 TYR A CE1 
5351 C  CE2 . TYR A 682 ? 1.3860 1.4451 1.4109 -0.2193 0.2832  -0.3712 682 TYR A CE2 
5352 C  CZ  . TYR A 682 ? 1.3778 1.4083 1.3664 -0.2408 0.2910  -0.3624 682 TYR A CZ  
5353 O  OH  . TYR A 682 ? 1.3270 1.3359 1.3177 -0.2546 0.2766  -0.3740 682 TYR A OH  
5354 N  N   . ILE A 683 ? 1.4101 1.6749 1.4828 -0.1528 0.2803  -0.3714 683 ILE A N   
5355 C  CA  . ILE A 683 ? 1.3491 1.6640 1.4583 -0.1408 0.2487  -0.4072 683 ILE A CA  
5356 C  C   . ILE A 683 ? 1.3404 1.7420 1.4547 -0.1260 0.2378  -0.4178 683 ILE A C   
5357 O  O   . ILE A 683 ? 1.3127 1.7534 1.4414 -0.1211 0.2147  -0.4454 683 ILE A O   
5358 C  CB  . ILE A 683 ? 0.9054 1.2263 1.0540 -0.1281 0.2383  -0.4208 683 ILE A CB  
5359 C  CG1 . ILE A 683 ? 0.9111 1.1513 1.0577 -0.1423 0.2470  -0.4110 683 ILE A CG1 
5360 C  CG2 . ILE A 683 ? 0.8178 1.1867 1.0039 -0.1170 0.2053  -0.4607 683 ILE A CG2 
5361 C  CD1 . ILE A 683 ? 0.8973 1.1148 1.0626 -0.1500 0.2242  -0.4357 683 ILE A CD1 
5362 N  N   . GLN A 684 ? 1.0305 1.4635 1.1337 -0.1183 0.2552  -0.3947 684 GLN A N   
5363 C  CA  . GLN A 684 ? 1.0238 1.5449 1.1317 -0.1040 0.2469  -0.4004 684 GLN A CA  
5364 C  C   . GLN A 684 ? 1.0419 1.5700 1.1214 -0.1158 0.2460  -0.3975 684 GLN A C   
5365 O  O   . GLN A 684 ? 1.0117 1.5970 1.1030 -0.1082 0.2246  -0.4224 684 GLN A O   
5366 C  CB  . GLN A 684 ? 1.4454 1.9978 1.5498 -0.0933 0.2672  -0.3713 684 GLN A CB  
5367 C  CG  . GLN A 684 ? 1.4139 2.0080 1.5543 -0.0746 0.2597  -0.3815 684 GLN A CG  
5368 C  CD  . GLN A 684 ? 1.3639 2.0348 1.5362 -0.0602 0.2288  -0.4217 684 GLN A CD  
5369 O  OE1 . GLN A 684 ? 1.3620 2.1098 1.5348 -0.0500 0.2218  -0.4270 684 GLN A OE1 
5370 N  NE2 . GLN A 684 ? 1.3202 1.9709 1.5195 -0.0594 0.2104  -0.4507 684 GLN A NE2 
5371 N  N   . MET A 685 ? 1.2856 1.7551 1.3280 -0.1349 0.2692  -0.3680 685 MET A N   
5372 C  CA  . MET A 685 ? 1.3183 1.7946 1.3302 -0.1486 0.2719  -0.3591 685 MET A CA  
5373 C  C   . MET A 685 ? 1.3032 1.7422 1.3055 -0.1653 0.2592  -0.3756 685 MET A C   
5374 O  O   . MET A 685 ? 1.3122 1.7714 1.2953 -0.1745 0.2551  -0.3746 685 MET A O   
5375 C  CB  . MET A 685 ? 1.2194 1.6498 1.1956 -0.1631 0.3029  -0.3202 685 MET A CB  
5376 C  CG  . MET A 685 ? 1.2593 1.7369 1.2415 -0.1474 0.3162  -0.2985 685 MET A CG  
5377 S  SD  . MET A 685 ? 1.3326 1.7381 1.2758 -0.1648 0.3544  -0.2536 685 MET A SD  
5378 C  CE  . MET A 685 ? 1.2932 1.6931 1.1995 -0.1889 0.3539  -0.2481 685 MET A CE  
5379 N  N   . PHE A 686 ? 1.5006 1.8872 1.5166 -0.1698 0.2530  -0.3887 686 PHE A N   
5380 C  CA  . PHE A 686 ? 1.4850 1.8381 1.4945 -0.1853 0.2410  -0.4020 686 PHE A CA  
5381 C  C   . PHE A 686 ? 1.4250 1.8211 1.4741 -0.1692 0.2103  -0.4389 686 PHE A C   
5382 O  O   . PHE A 686 ? 1.4181 1.8607 1.4698 -0.1655 0.1941  -0.4547 686 PHE A O   
5383 C  CB  . PHE A 686 ? 1.5263 1.7879 1.5210 -0.2048 0.2558  -0.3887 686 PHE A CB  
5384 C  CG  . PHE A 686 ? 1.5064 1.7349 1.4964 -0.2212 0.2438  -0.3999 686 PHE A CG  
5385 C  CD1 . PHE A 686 ? 1.4992 1.7271 1.4582 -0.2388 0.2460  -0.3923 686 PHE A CD1 
5386 C  CD2 . PHE A 686 ? 1.4603 1.6606 1.4781 -0.2195 0.2302  -0.4163 686 PHE A CD2 
5387 C  CE1 . PHE A 686 ? 1.4797 1.6822 1.4356 -0.2534 0.2350  -0.4006 686 PHE A CE1 
5388 C  CE2 . PHE A 686 ? 1.4421 1.6152 1.4580 -0.2339 0.2194  -0.4238 686 PHE A CE2 
5389 C  CZ  . PHE A 686 ? 1.4591 1.6343 1.4439 -0.2505 0.2219  -0.4159 686 PHE A CZ  
5390 N  N   . LEU A 687 ? 1.6824 2.0631 1.7632 -0.1594 0.2029  -0.4524 687 LEU A N   
5391 C  CA  . LEU A 687 ? 1.6225 2.0340 1.7442 -0.1450 0.1746  -0.4882 687 LEU A CA  
5392 C  C   . LEU A 687 ? 1.5967 2.1016 1.7384 -0.1226 0.1575  -0.5117 687 LEU A C   
5393 O  O   . LEU A 687 ? 1.5542 2.0907 1.7181 -0.1136 0.1346  -0.5414 687 LEU A O   
5394 C  CB  . LEU A 687 ? 1.3125 1.6914 1.4639 -0.1398 0.1722  -0.4946 687 LEU A CB  
5395 C  CG  . LEU A 687 ? 1.3026 1.5987 1.4498 -0.1584 0.1774  -0.4852 687 LEU A CG  
5396 C  CD1 . LEU A 687 ? 1.2469 1.5300 1.4344 -0.1496 0.1657  -0.5004 687 LEU A CD1 
5397 C  CD2 . LEU A 687 ? 1.2838 1.5680 1.4261 -0.1691 0.1643  -0.4955 687 LEU A CD2 
5398 N  N   . LEU A 688 ? 1.0761 1.6267 1.2112 -0.1128 0.1689  -0.4983 688 LEU A N   
5399 C  CA  . LEU A 688 ? 1.0552 1.6999 1.2100 -0.0910 0.1541  -0.5194 688 LEU A CA  
5400 C  C   . LEU A 688 ? 1.1001 1.7935 1.2257 -0.0929 0.1616  -0.5032 688 LEU A C   
5401 O  O   . LEU A 688 ? 1.0918 1.8688 1.2286 -0.0765 0.1499  -0.5184 688 LEU A O   
5402 C  CB  . LEU A 688 ? 0.9287 1.6030 1.1040 -0.0765 0.1586  -0.5174 688 LEU A CB  
5403 C  CG  . LEU A 688 ? 0.8863 1.5251 1.0940 -0.0731 0.1505  -0.5330 688 LEU A CG  
5404 C  CD1 . LEU A 688 ? 0.8841 1.5651 1.1087 -0.0589 0.1562  -0.5274 688 LEU A CD1 
5405 C  CD2 . LEU A 688 ? 0.8340 1.4867 1.0761 -0.0651 0.1214  -0.5756 688 LEU A CD2 
5406 N  N   . ASN A 689 ? 1.9068 2.5480 1.9948 -0.1140 0.1813  -0.4721 689 ASN A N   
5407 C  CA  . ASN A 689 ? 1.9402 2.6169 1.9979 -0.1205 0.1902  -0.4523 689 ASN A CA  
5408 C  C   . ASN A 689 ? 1.9476 2.7023 2.0084 -0.1047 0.1957  -0.4413 689 ASN A C   
5409 O  O   . ASN A 689 ? 1.9552 2.7729 2.0065 -0.1013 0.1911  -0.4397 689 ASN A O   
5410 C  CB  . ASN A 689 ? 1.4918 2.2014 1.5487 -0.1214 0.1710  -0.4729 689 ASN A CB  
5411 C  CG  . ASN A 689 ? 1.5264 2.2620 1.5486 -0.1333 0.1810  -0.4491 689 ASN A CG  
5412 O  OD1 . ASN A 689 ? 1.5691 2.2760 1.5637 -0.1466 0.2041  -0.4154 689 ASN A OD1 
5413 N  ND2 . ASN A 689 ? 1.5148 2.3053 1.5390 -0.1284 0.1638  -0.4662 689 ASN A ND2 
5414 N  N   . GLN A 690 ? 1.2799 2.0332 1.3540 -0.0953 0.2058  -0.4315 690 GLN A N   
5415 C  CA  . GLN A 690 ? 1.2907 2.1168 1.3679 -0.0812 0.2135  -0.4155 690 GLN A CA  
5416 C  C   . GLN A 690 ? 1.3395 2.1231 1.3928 -0.0909 0.2442  -0.3711 690 GLN A C   
5417 O  O   . GLN A 690 ? 1.3473 2.0691 1.4028 -0.0944 0.2573  -0.3602 690 GLN A O   
5418 C  CB  . GLN A 690 ? 2.0659 2.9469 2.1821 -0.0587 0.1989  -0.4408 690 GLN A CB  
5419 C  CG  . GLN A 690 ? 2.0450 2.9743 2.1867 -0.0467 0.1694  -0.4860 690 GLN A CG  
5420 C  CD  . GLN A 690 ? 2.0401 2.9914 2.2198 -0.0309 0.1557  -0.5136 690 GLN A CD  
5421 O  OE1 . GLN A 690 ? 2.0379 2.9418 2.2242 -0.0338 0.1667  -0.5010 690 GLN A OE1 
5422 N  NE2 . GLN A 690 ? 2.0065 3.0318 2.2120 -0.0141 0.1319  -0.5521 690 GLN A NE2 
5423 N  N   . TYR A 691 ? 1.5729 2.3924 1.6051 -0.0943 0.2556  -0.3449 691 TYR A N   
5424 C  CA  . TYR A 691 ? 1.6350 2.4075 1.6432 -0.1050 0.2856  -0.3020 691 TYR A CA  
5425 C  C   . TYR A 691 ? 1.6655 2.5114 1.6692 -0.0969 0.2951  -0.2744 691 TYR A C   
5426 O  O   . TYR A 691 ? 1.6470 2.5545 1.6444 -0.0970 0.2845  -0.2778 691 TYR A O   
5427 C  CB  . TYR A 691 ? 1.6097 2.2958 1.5822 -0.1326 0.2977  -0.2895 691 TYR A CB  
5428 C  CG  . TYR A 691 ? 1.5746 2.2968 1.5272 -0.1432 0.2898  -0.2891 691 TYR A CG  
5429 C  CD1 . TYR A 691 ? 1.5500 2.3088 1.5128 -0.1402 0.2637  -0.3227 691 TYR A CD1 
5430 C  CD2 . TYR A 691 ? 1.5710 2.2902 1.4954 -0.1564 0.3089  -0.2540 691 TYR A CD2 
5431 C  CE1 . TYR A 691 ? 1.5223 2.3183 1.4668 -0.1495 0.2567  -0.3208 691 TYR A CE1 
5432 C  CE2 . TYR A 691 ? 1.5431 2.2977 1.4490 -0.1676 0.3016  -0.2516 691 TYR A CE2 
5433 C  CZ  . TYR A 691 ? 1.5163 2.3115 1.4318 -0.1639 0.2755  -0.2847 691 TYR A CZ  
5434 O  OH  . TYR A 691 ? 1.4939 2.3278 1.3907 -0.1747 0.2689  -0.2803 691 TYR A OH  
5435 N  N   . ASP A 692 ? 1.5546 2.3952 1.5628 -0.0896 0.3154  -0.2453 692 ASP A N   
5436 C  CA  . ASP A 692 ? 1.5813 2.4897 1.5891 -0.0807 0.3267  -0.2137 692 ASP A CA  
5437 C  C   . ASP A 692 ? 1.5709 2.4650 1.5455 -0.1002 0.3379  -0.1882 692 ASP A C   
5438 O  O   . ASP A 692 ? 1.5862 2.3957 1.5348 -0.1187 0.3609  -0.1621 692 ASP A O   
5439 C  CB  . ASP A 692 ? 1.7872 2.6708 1.8030 -0.0722 0.3507  -0.1822 692 ASP A CB  
5440 C  CG  . ASP A 692 ? 1.8100 2.7817 1.8369 -0.0569 0.3583  -0.1529 692 ASP A CG  
5441 O  OD1 . ASP A 692 ? 1.7853 2.7992 1.8382 -0.0380 0.3599  -0.1483 692 ASP A OD1 
5442 O  OD2 . ASP A 692 ? 1.8241 2.8253 1.8343 -0.0645 0.3627  -0.1327 692 ASP A OD2 
5443 N  N   . GLN A 693 ? 1.3967 2.3769 1.3730 -0.0959 0.3215  -0.1962 693 GLN A N   
5444 C  CA  . GLN A 693 ? 1.3815 2.3576 1.3280 -0.1157 0.3256  -0.1792 693 GLN A CA  
5445 C  C   . GLN A 693 ? 1.4184 2.3872 1.3478 -0.1241 0.3519  -0.1293 693 GLN A C   
5446 O  O   . GLN A 693 ? 1.4129 2.3612 1.3150 -0.1449 0.3589  -0.1115 693 GLN A O   
5447 C  CB  . GLN A 693 ? 1.5342 2.6101 1.4898 -0.1067 0.2990  -0.2044 693 GLN A CB  
5448 C  CG  . GLN A 693 ? 1.5232 2.6212 1.5037 -0.0922 0.2728  -0.2540 693 GLN A CG  
5449 C  CD  . GLN A 693 ? 1.5163 2.6180 1.4864 -0.1018 0.2538  -0.2805 693 GLN A CD  
5450 O  OE1 . GLN A 693 ? 1.5195 2.6248 1.4642 -0.1179 0.2581  -0.2624 693 GLN A OE1 
5451 N  NE2 . GLN A 693 ? 1.5286 2.6297 1.5192 -0.0920 0.2328  -0.3227 693 GLN A NE2 
5452 N  N   . ASP A 694 ? 1.6875 2.6734 1.6342 -0.1083 0.3665  -0.1060 694 ASP A N   
5453 C  CA  . ASP A 694 ? 1.7402 2.7118 1.6752 -0.1141 0.3937  -0.0562 694 ASP A CA  
5454 C  C   . ASP A 694 ? 1.7826 2.6310 1.7004 -0.1276 0.4211  -0.0378 694 ASP A C   
5455 O  O   . ASP A 694 ? 1.8468 2.6662 1.7571 -0.1310 0.4469  0.0027  694 ASP A O   
5456 C  CB  . ASP A 694 ? 2.2434 3.3097 2.2081 -0.0883 0.3957  -0.0364 694 ASP A CB  
5457 C  CG  . ASP A 694 ? 2.2078 3.4025 2.1873 -0.0754 0.3713  -0.0508 694 ASP A CG  
5458 O  OD1 . ASP A 694 ? 2.1895 3.4089 2.1511 -0.0887 0.3669  -0.0431 694 ASP A OD1 
5459 O  OD2 . ASP A 694 ? 2.2383 3.5113 2.2475 -0.0524 0.3565  -0.0704 694 ASP A OD2 
5460 N  N   . LEU A 695 ? 1.6443 2.4223 1.5575 -0.1346 0.4154  -0.0675 695 LEU A N   
5461 C  CA  . LEU A 695 ? 1.6793 2.3406 1.5754 -0.1476 0.4394  -0.0561 695 LEU A CA  
5462 C  C   . LEU A 695 ? 1.6443 2.2276 1.5083 -0.1762 0.4375  -0.0718 695 LEU A C   
5463 O  O   . LEU A 695 ? 1.6796 2.1791 1.5151 -0.1972 0.4605  -0.0510 695 LEU A O   
5464 C  CB  . LEU A 695 ? 1.0798 1.7250 1.0008 -0.1303 0.4362  -0.0747 695 LEU A CB  
5465 C  CG  . LEU A 695 ? 1.1311 1.8205 1.0792 -0.1057 0.4479  -0.0513 695 LEU A CG  
5466 C  CD1 . LEU A 695 ? 1.1526 1.7908 1.1150 -0.0966 0.4541  -0.0605 695 LEU A CD1 
5467 C  CD2 . LEU A 695 ? 1.1914 1.8568 1.1242 -0.1114 0.4773  -0.0036 695 LEU A CD2 
5468 N  N   . PHE A 696 ? 1.5171 2.1307 1.3869 -0.1767 0.4100  -0.1090 696 PHE A N   
5469 C  CA  . PHE A 696 ? 1.4806 2.0300 1.3248 -0.2016 0.4046  -0.1270 696 PHE A CA  
5470 C  C   . PHE A 696 ? 1.4378 2.0414 1.2691 -0.2129 0.3872  -0.1343 696 PHE A C   
5471 O  O   . PHE A 696 ? 1.4374 2.1266 1.2777 -0.2025 0.3805  -0.1240 696 PHE A O   
5472 C  CB  . PHE A 696 ? 1.1717 1.7003 1.0341 -0.1942 0.3872  -0.1641 696 PHE A CB  
5473 C  CG  . PHE A 696 ? 1.2071 1.6839 1.0828 -0.1840 0.4021  -0.1590 696 PHE A CG  
5474 C  CD1 . PHE A 696 ? 1.2082 1.7169 1.1177 -0.1632 0.3852  -0.1844 696 PHE A CD1 
5475 C  CD2 . PHE A 696 ? 1.2523 1.6480 1.1069 -0.1955 0.4327  -0.1301 696 PHE A CD2 
5476 C  CE1 . PHE A 696 ? 1.2472 1.7132 1.1694 -0.1544 0.3979  -0.1789 696 PHE A CE1 
5477 C  CE2 . PHE A 696 ? 1.2922 1.6439 1.1596 -0.1848 0.4464  -0.1253 696 PHE A CE2 
5478 C  CZ  . PHE A 696 ? 1.2877 1.6769 1.1890 -0.1644 0.4286  -0.1489 696 PHE A CZ  
5479 N  N   . GLU A 697 ? 1.6250 2.1793 1.4349 -0.2349 0.3807  -0.1505 697 GLU A N   
5480 C  CA  . GLU A 697 ? 1.5780 2.1805 1.3785 -0.2446 0.3607  -0.1640 697 GLU A CA  
5481 C  C   . GLU A 697 ? 1.5449 2.0872 1.3389 -0.2572 0.3506  -0.1918 697 GLU A C   
5482 O  O   . GLU A 697 ? 1.5616 2.0122 1.3367 -0.2747 0.3677  -0.1848 697 GLU A O   
5483 C  CB  . GLU A 697 ? 2.3339 2.9261 2.1013 -0.2693 0.3756  -0.1324 697 GLU A CB  
5484 C  CG  . GLU A 697 ? 2.3298 2.8600 2.0624 -0.3028 0.3767  -0.1360 697 GLU A CG  
5485 C  CD  . GLU A 697 ? 2.3233 2.9191 2.0570 -0.3048 0.3496  -0.1577 697 GLU A CD  
5486 O  OE1 . GLU A 697 ? 2.3098 2.9853 2.0740 -0.2783 0.3279  -0.1799 697 GLU A OE1 
5487 O  OE2 . GLU A 697 ? 2.3086 2.8773 2.0127 -0.3328 0.3504  -0.1530 697 GLU A OE2 
5488 N  N   . GLN A 698 ? 1.6787 2.2725 1.4908 -0.2467 0.3233  -0.2236 698 GLN A N   
5489 C  CA  . GLN A 698 ? 1.6539 2.1948 1.4643 -0.2571 0.3129  -0.2481 698 GLN A CA  
5490 C  C   . GLN A 698 ? 1.6325 2.1453 1.4079 -0.2874 0.3146  -0.2404 698 GLN A C   
5491 O  O   . GLN A 698 ? 1.6133 2.1809 1.3902 -0.2875 0.2953  -0.2537 698 GLN A O   
5492 C  CB  . GLN A 698 ? 1.3325 1.9346 1.1781 -0.2338 0.2835  -0.2851 698 GLN A CB  
5493 C  CG  . GLN A 698 ? 1.3123 1.8731 1.1571 -0.2449 0.2700  -0.3080 698 GLN A CG  
5494 C  CD  . GLN A 698 ? 1.3751 1.9955 1.2572 -0.2207 0.2413  -0.3448 698 GLN A CD  
5495 O  OE1 . GLN A 698 ? 1.3991 2.0209 1.3115 -0.2016 0.2350  -0.3617 698 GLN A OE1 
5496 N  NE2 . GLN A 698 ? 1.3602 2.0311 1.2409 -0.2213 0.2238  -0.3575 698 GLN A NE2 
5497 N  N   . VAL A 699 ? 1.7242 2.1527 1.4678 -0.3134 0.3384  -0.2188 699 VAL A N   
5498 C  CA  . VAL A 699 ? 1.7093 2.1044 1.4163 -0.3464 0.3426  -0.2099 699 VAL A CA  
5499 C  C   . VAL A 699 ? 1.6739 2.0669 1.3850 -0.3522 0.3216  -0.2367 699 VAL A C   
5500 O  O   . VAL A 699 ? 1.6533 2.0850 1.3536 -0.3629 0.3088  -0.2396 699 VAL A O   
5501 C  CB  . VAL A 699 ? 1.3351 1.6306 1.0094 -0.3728 0.3716  -0.1888 699 VAL A CB  
5502 C  CG1 . VAL A 699 ? 1.3183 1.5789 0.9571 -0.4077 0.3724  -0.1866 699 VAL A CG1 
5503 C  CG2 . VAL A 699 ? 1.3843 1.6785 1.0502 -0.3718 0.3941  -0.1577 699 VAL A CG2 
5504 N  N   . THR A 700 ? 1.6255 1.9752 1.3532 -0.3452 0.3177  -0.2548 700 THR A N   
5505 C  CA  . THR A 700 ? 1.6021 1.9511 1.3359 -0.3507 0.2976  -0.2777 700 THR A CA  
5506 C  C   . THR A 700 ? 1.6095 1.9865 1.3879 -0.3207 0.2774  -0.3065 700 THR A C   
5507 O  O   . THR A 700 ? 1.6291 1.9879 1.4261 -0.3050 0.2843  -0.3078 700 THR A O   
5508 C  CB  . THR A 700 ? 1.8961 2.1556 1.6000 -0.3826 0.3108  -0.2713 700 THR A CB  
5509 O  OG1 . THR A 700 ? 1.9702 2.1861 1.6352 -0.4079 0.3363  -0.2441 700 THR A OG1 
5510 C  CG2 . THR A 700 ? 1.8646 2.1387 1.5619 -0.3973 0.2930  -0.2831 700 THR A CG2 
5511 N  N   . ASN A 701 ? 1.5888 2.0097 1.3849 -0.3130 0.2527  -0.3291 701 ASN A N   
5512 C  CA  . ASN A 701 ? 1.6080 2.0571 1.4480 -0.2853 0.2317  -0.3591 701 ASN A CA  
5513 C  C   . ASN A 701 ? 1.6047 2.0385 1.4547 -0.2912 0.2141  -0.3775 701 ASN A C   
5514 O  O   . ASN A 701 ? 1.5970 2.0724 1.4424 -0.2947 0.2010  -0.3826 701 ASN A O   
5515 C  CB  . ASN A 701 ? 1.8786 2.4250 1.7427 -0.2576 0.2161  -0.3724 701 ASN A CB  
5516 C  CG  . ASN A 701 ? 1.9122 2.4888 1.8224 -0.2281 0.1958  -0.4051 701 ASN A CG  
5517 O  OD1 . ASN A 701 ? 1.9216 2.4513 1.8483 -0.2286 0.1894  -0.4191 701 ASN A OD1 
5518 N  ND2 . ASN A 701 ? 1.9341 2.5915 1.8657 -0.2031 0.1854  -0.4174 701 ASN A ND2 
5519 N  N   . ASP A 702 ? 1.3522 1.7284 1.2170 -0.2920 0.2140  -0.3857 702 ASP A N   
5520 C  CA  . ASP A 702 ? 1.3613 1.7215 1.2404 -0.2963 0.1974  -0.4011 702 ASP A CA  
5521 C  C   . ASP A 702 ? 1.3962 1.7320 1.3143 -0.2786 0.1888  -0.4196 702 ASP A C   
5522 O  O   . ASP A 702 ? 1.4081 1.7102 1.3278 -0.2757 0.2028  -0.4122 702 ASP A O   
5523 C  CB  . ASP A 702 ? 2.0396 2.3360 1.8806 -0.3318 0.2114  -0.3811 702 ASP A CB  
5524 C  CG  . ASP A 702 ? 2.0932 2.3850 1.9455 -0.3389 0.1940  -0.3921 702 ASP A CG  
5525 O  OD1 . ASP A 702 ? 2.1374 2.4391 2.0304 -0.3187 0.1758  -0.4137 702 ASP A OD1 
5526 O  OD2 . ASP A 702 ? 2.0645 2.3422 1.8852 -0.3656 0.1989  -0.3780 702 ASP A OD2 
5527 N  N   . THR A 703 ? 1.5300 1.8838 1.4809 -0.2664 0.1661  -0.4428 703 THR A N   
5528 C  CA  . THR A 703 ? 1.5294 1.8540 1.5182 -0.2537 0.1565  -0.4595 703 THR A CA  
5529 C  C   . THR A 703 ? 1.5272 1.7691 1.4997 -0.2748 0.1748  -0.4408 703 THR A C   
5530 O  O   . THR A 703 ? 1.5216 1.7347 1.5199 -0.2661 0.1733  -0.4477 703 THR A O   
5531 C  CB  . THR A 703 ? 1.4132 1.7541 1.4327 -0.2458 0.1322  -0.4808 703 THR A CB  
5532 O  OG1 . THR A 703 ? 1.4130 1.8303 1.4571 -0.2196 0.1143  -0.5047 703 THR A OG1 
5533 C  CG2 . THR A 703 ? 1.3899 1.6852 1.4444 -0.2408 0.1243  -0.4918 703 THR A CG2 
5534 N  N   . ARG A 704 ? 1.5769 1.7833 1.5059 -0.3030 0.1921  -0.4174 704 ARG A N   
5535 C  CA  . ARG A 704 ? 1.5739 1.7040 1.4821 -0.3260 0.2099  -0.4002 704 ARG A CA  
5536 C  C   . ARG A 704 ? 1.5624 1.6616 1.4461 -0.3304 0.2360  -0.3820 704 ARG A C   
5537 O  O   . ARG A 704 ? 1.5645 1.6051 1.4428 -0.3390 0.2504  -0.3728 704 ARG A O   
5538 C  CB  . ARG A 704 ? 1.9643 2.0735 1.8381 -0.3559 0.2142  -0.3868 704 ARG A CB  
5539 C  CG  . ARG A 704 ? 1.9880 2.1296 1.8846 -0.3520 0.1898  -0.4009 704 ARG A CG  
5540 C  CD  . ARG A 704 ? 2.0015 2.0941 1.8838 -0.3785 0.1931  -0.3896 704 ARG A CD  
5541 N  NE  . ARG A 704 ? 2.0135 2.1201 1.9352 -0.3680 0.1697  -0.4039 704 ARG A NE  
5542 C  CZ  . ARG A 704 ? 1.9723 2.0356 1.9128 -0.3730 0.1670  -0.4028 704 ARG A CZ  
5543 N  NH1 . ARG A 704 ? 1.8953 1.9008 1.8170 -0.3883 0.1864  -0.3892 704 ARG A NH1 
5544 N  NH2 . ARG A 704 ? 1.9648 2.0436 1.9441 -0.3623 0.1451  -0.4147 704 ARG A NH2 
5545 N  N   . ALA A 705 ? 1.4321 1.5723 1.3025 -0.3236 0.2424  -0.3758 705 ALA A N   
5546 C  CA  . ALA A 705 ? 1.4293 1.5422 1.2762 -0.3275 0.2685  -0.3554 705 ALA A CA  
5547 C  C   . ALA A 705 ? 1.4238 1.5943 1.2610 -0.3189 0.2715  -0.3482 705 ALA A C   
5548 O  O   . ALA A 705 ? 1.4080 1.6273 1.2407 -0.3204 0.2588  -0.3532 705 ALA A O   
5549 C  CB  . ALA A 705 ? 1.4510 1.4935 1.2552 -0.3597 0.2910  -0.3350 705 ALA A CB  
5550 N  N   . LYS A 706 ? 1.1375 1.3040 0.9718 -0.3099 0.2888  -0.3346 706 LYS A N   
5551 C  CA  . LYS A 706 ? 1.1341 1.3525 0.9579 -0.3034 0.2947  -0.3223 706 LYS A CA  
5552 C  C   . LYS A 706 ? 1.1412 1.3075 0.9294 -0.3207 0.3255  -0.2927 706 LYS A C   
5553 O  O   . LYS A 706 ? 1.1507 1.2463 0.9278 -0.3314 0.3425  -0.2846 706 LYS A O   
5554 C  CB  . LYS A 706 ? 0.9518 1.2327 0.8128 -0.2706 0.2845  -0.3336 706 LYS A CB  
5555 C  CG  . LYS A 706 ? 0.9589 1.2884 0.8593 -0.2509 0.2544  -0.3667 706 LYS A CG  
5556 C  CD  . LYS A 706 ? 0.9858 1.3980 0.9160 -0.2218 0.2419  -0.3798 706 LYS A CD  
5557 C  CE  . LYS A 706 ? 0.9949 1.4496 0.9601 -0.2055 0.2127  -0.4145 706 LYS A CE  
5558 N  NZ  . LYS A 706 ? 0.9938 1.5284 0.9892 -0.1774 0.1997  -0.4319 706 LYS A NZ  
5559 N  N   . ILE A 707 ? 1.1579 1.3593 0.9292 -0.3231 0.3334  -0.2761 707 ILE A N   
5560 C  CA  . ILE A 707 ? 1.1806 1.3332 0.9220 -0.3371 0.3635  -0.2473 707 ILE A CA  
5561 C  C   . ILE A 707 ? 1.1961 1.4131 0.9465 -0.3197 0.3663  -0.2334 707 ILE A C   
5562 O  O   . ILE A 707 ? 1.1755 1.4609 0.9278 -0.3169 0.3512  -0.2370 707 ILE A O   
5563 C  CB  . ILE A 707 ? 1.3233 1.4322 1.0202 -0.3731 0.3753  -0.2339 707 ILE A CB  
5564 C  CG1 . ILE A 707 ? 1.2994 1.3531 0.9858 -0.3927 0.3711  -0.2469 707 ILE A CG1 
5565 C  CG2 . ILE A 707 ? 1.3654 1.4211 1.0328 -0.3872 0.4072  -0.2052 707 ILE A CG2 
5566 C  CD1 . ILE A 707 ? 1.3814 1.3903 1.0225 -0.4299 0.3843  -0.2341 707 ILE A CD1 
5567 N  N   . TYR A 708 ? 1.3526 1.5524 1.1094 -0.3074 0.3854  -0.2166 708 TYR A N   
5568 C  CA  . TYR A 708 ? 1.3750 1.6367 1.1406 -0.2914 0.3902  -0.1988 708 TYR A CA  
5569 C  C   . TYR A 708 ? 1.4240 1.6321 1.1588 -0.3084 0.4213  -0.1651 708 TYR A C   
5570 O  O   . TYR A 708 ? 1.4420 1.5650 1.1522 -0.3288 0.4392  -0.1593 708 TYR A O   
5571 C  CB  . TYR A 708 ? 1.1767 1.4800 0.9815 -0.2590 0.3848  -0.2056 708 TYR A CB  
5572 C  CG  . TYR A 708 ? 1.1383 1.5006 0.9765 -0.2407 0.3534  -0.2405 708 TYR A CG  
5573 C  CD1 . TYR A 708 ? 1.1184 1.4386 0.9647 -0.2453 0.3420  -0.2638 708 TYR A CD1 
5574 C  CD2 . TYR A 708 ? 1.1241 1.5836 0.9862 -0.2192 0.3354  -0.2503 708 TYR A CD2 
5575 C  CE1 . TYR A 708 ? 1.0959 1.4643 0.9741 -0.2291 0.3140  -0.2956 708 TYR A CE1 
5576 C  CE2 . TYR A 708 ? 1.1021 1.6110 0.9945 -0.2028 0.3076  -0.2847 708 TYR A CE2 
5577 C  CZ  . TYR A 708 ? 1.0933 1.5538 0.9942 -0.2078 0.2971  -0.3071 708 TYR A CZ  
5578 O  OH  . TYR A 708 ? 1.1896 1.6945 1.1226 -0.1916 0.2698  -0.3414 708 TYR A OH  
5579 N  N   . ARG A 709 ? 1.3879 1.6462 1.1247 -0.3003 0.4279  -0.1429 709 ARG A N   
5580 C  CA  . ARG A 709 ? 1.4538 1.6641 1.1648 -0.3152 0.4578  -0.1085 709 ARG A CA  
5581 C  C   . ARG A 709 ? 1.5037 1.7620 1.2378 -0.2897 0.4681  -0.0848 709 ARG A C   
5582 O  O   . ARG A 709 ? 1.4790 1.8287 1.2410 -0.2671 0.4495  -0.0919 709 ARG A O   
5583 C  CB  . ARG A 709 ? 1.5707 1.7852 1.2501 -0.3432 0.4574  -0.0984 709 ARG A CB  
5584 C  CG  . ARG A 709 ? 1.6420 1.8414 1.3042 -0.3532 0.4819  -0.0616 709 ARG A CG  
5585 C  CD  . ARG A 709 ? 1.6334 1.8830 1.2789 -0.3709 0.4721  -0.0526 709 ARG A CD  
5586 N  NE  . ARG A 709 ? 1.7606 2.0414 1.4084 -0.3665 0.4867  -0.0175 709 ARG A NE  
5587 C  CZ  . ARG A 709 ? 1.7267 2.1056 1.3892 -0.3552 0.4721  -0.0086 709 ARG A CZ  
5588 N  NH1 . ARG A 709 ? 1.6422 2.0969 1.3173 -0.3464 0.4426  -0.0346 709 ARG A NH1 
5589 N  NH2 . ARG A 709 ? 1.7840 2.1861 1.4495 -0.3521 0.4874  0.0268  709 ARG A NH2 
5590 N  N   . LEU A 710 ? 1.8906 2.0893 1.6147 -0.2922 0.4980  -0.0573 710 LEU A N   
5591 C  CA  . LEU A 710 ? 1.9472 2.1916 1.6949 -0.2675 0.5089  -0.0317 710 LEU A CA  
5592 C  C   . LEU A 710 ? 1.9705 2.2659 1.7093 -0.2749 0.5108  -0.0064 710 LEU A C   
5593 O  O   . LEU A 710 ? 1.9805 2.2363 1.6876 -0.3036 0.5172  0.0006  710 LEU A O   
5594 C  CB  . LEU A 710 ? 1.3798 1.5428 1.1224 -0.2652 0.5415  -0.0089 710 LEU A CB  
5595 C  CG  . LEU A 710 ? 1.3829 1.4931 1.1354 -0.2559 0.5453  -0.0262 710 LEU A CG  
5596 C  CD1 . LEU A 710 ? 1.4859 1.5220 1.2314 -0.2531 0.5807  0.0020  710 LEU A CD1 
5597 C  CD2 . LEU A 710 ? 1.3440 1.5326 1.1370 -0.2263 0.5222  -0.0449 710 LEU A CD2 
5598 N  N   . LYS A 711 ? 1.4396 1.8250 1.2063 -0.2505 0.5049  0.0078  711 LYS A N   
5599 C  CA  . LYS A 711 ? 1.4702 1.9104 1.2320 -0.2556 0.5080  0.0369  711 LYS A CA  
5600 C  C   . LYS A 711 ? 1.5748 1.9952 1.3413 -0.2486 0.5380  0.0812  711 LYS A C   
5601 O  O   . LYS A 711 ? 1.5984 2.0918 1.3940 -0.2231 0.5376  0.0983  711 LYS A O   
5602 C  CB  . LYS A 711 ? 1.7167 2.2829 1.5040 -0.2362 0.4788  0.0231  711 LYS A CB  
5603 C  CG  . LYS A 711 ? 1.6546 2.2437 1.4378 -0.2429 0.4496  -0.0183 711 LYS A CG  
5604 C  CD  . LYS A 711 ? 1.6117 2.3272 1.4193 -0.2229 0.4221  -0.0325 711 LYS A CD  
5605 C  CE  . LYS A 711 ? 1.6379 2.4116 1.4344 -0.2328 0.4235  -0.0040 711 LYS A CE  
5606 N  NZ  . LYS A 711 ? 1.5996 2.5012 1.4191 -0.2126 0.3978  -0.0174 711 LYS A NZ  
5607 N  N   . GLY B 1   ? 1.9430 1.6915 1.5861 -0.3902 0.3444  -0.0625 10  GLY B N   
5608 C  CA  . GLY B 1   ? 1.9473 1.6124 1.6075 -0.3906 0.3328  -0.0291 10  GLY B CA  
5609 C  C   . GLY B 1   ? 2.0306 1.6099 1.6756 -0.3832 0.3128  -0.0054 10  GLY B C   
5610 O  O   . GLY B 1   ? 2.0476 1.5556 1.6959 -0.4120 0.3008  0.0088  10  GLY B O   
5611 N  N   . ASP B 2   ? 1.4693 1.0526 1.0961 -0.3419 0.3063  -0.0035 11  ASP B N   
5612 C  CA  . ASP B 2   ? 1.5507 1.0616 1.1628 -0.3278 0.2868  0.0151  11  ASP B CA  
5613 C  C   . ASP B 2   ? 1.5840 1.0527 1.2139 -0.2913 0.2833  0.0326  11  ASP B C   
5614 O  O   . ASP B 2   ? 1.6133 1.0186 1.2440 -0.2801 0.2676  0.0468  11  ASP B O   
5615 C  CB  . ASP B 2   ? 1.5920 1.0207 1.2076 -0.3623 0.2696  0.0287  11  ASP B CB  
5616 C  CG  . ASP B 2   ? 1.6099 1.0206 1.1746 -0.3763 0.2620  0.0224  11  ASP B CG  
5617 O  OD1 . ASP B 2   ? 1.6593 1.0892 1.1967 -0.3505 0.2607  0.0178  11  ASP B OD1 
5618 O  OD2 . ASP B 2   ? 1.5815 0.9513 1.1273 -0.4127 0.2585  0.0218  11  ASP B OD2 
5619 N  N   . GLN B 3   ? 1.4213 0.9146 1.0639 -0.2740 0.2993  0.0308  12  GLN B N   
5620 C  CA  . GLN B 3   ? 1.4652 0.9043 1.1155 -0.2419 0.3046  0.0464  12  GLN B CA  
5621 C  C   . GLN B 3   ? 1.5842 1.0673 1.1934 -0.1972 0.3154  0.0358  12  GLN B C   
5622 O  O   . GLN B 3   ? 1.5288 1.0813 1.1257 -0.1952 0.3209  0.0162  12  GLN B O   
5623 C  CB  . GLN B 3   ? 2.3484 1.7350 2.0478 -0.2626 0.3152  0.0581  12  GLN B CB  
5624 C  CG  . GLN B 3   ? 2.1817 1.5009 1.9225 -0.2901 0.2961  0.0681  12  GLN B CG  
5625 C  CD  . GLN B 3   ? 2.0604 1.3355 1.8604 -0.3138 0.3045  0.0734  12  GLN B CD  
5626 O  OE1 . GLN B 3   ? 1.9526 1.2040 1.7831 -0.3475 0.2878  0.0726  12  GLN B OE1 
5627 N  NE2 . GLN B 3   ? 2.0866 1.3431 1.8986 -0.2955 0.3316  0.0773  12  GLN B NE2 
5628 N  N   . ASN B 4   ? 1.3964 0.8369 0.9821 -0.1593 0.3156  0.0457  13  ASN B N   
5629 C  CA  . ASN B 4   ? 1.4270 0.8917 0.9598 -0.1098 0.3214  0.0361  13  ASN B CA  
5630 C  C   . ASN B 4   ? 1.4437 0.8900 0.9669 -0.0988 0.3421  0.0369  13  ASN B C   
5631 O  O   . ASN B 4   ? 1.4834 0.8585 0.9820 -0.0715 0.3595  0.0501  13  ASN B O   
5632 C  CB  . ASN B 4   ? 1.4596 0.8664 0.9658 -0.0746 0.3199  0.0493  13  ASN B CB  
5633 C  CG  . ASN B 4   ? 1.5087 0.9523 0.9508 -0.0229 0.3145  0.0344  13  ASN B CG  
5634 O  OD1 . ASN B 4   ? 1.5433 0.9573 0.9414 0.0135  0.3271  0.0346  13  ASN B OD1 
5635 N  ND2 . ASN B 4   ? 1.5437 1.0463 0.9748 -0.0174 0.2953  0.0192  13  ASN B ND2 
5636 N  N   . ALA B 5   ? 1.6021 1.1066 1.1417 -0.1216 0.3432  0.0221  14  ALA B N   
5637 C  CA  . ALA B 5   ? 1.5928 1.0842 1.1220 -0.1144 0.3609  0.0209  14  ALA B CA  
5638 C  C   . ALA B 5   ? 1.5377 1.1219 1.0405 -0.0959 0.3498  -0.0109 14  ALA B C   
5639 O  O   . ALA B 5   ? 1.5130 1.1734 1.0205 -0.0978 0.3328  -0.0332 14  ALA B O   
5640 C  CB  . ALA B 5   ? 3.7058 3.1717 3.2965 -0.1656 0.3726  0.0326  14  ALA B CB  
5641 N  N   . THR B 6   ? 1.9736 1.5485 1.4512 -0.0785 0.3603  -0.0163 15  THR B N   
5642 C  CA  . THR B 6   ? 1.9334 1.5936 1.3938 -0.0594 0.3468  -0.0511 15  THR B CA  
5643 C  C   . THR B 6   ? 1.7879 1.5056 1.3080 -0.1111 0.3513  -0.0618 15  THR B C   
5644 O  O   . THR B 6   ? 1.7325 1.4040 1.2901 -0.1514 0.3674  -0.0386 15  THR B O   
5645 C  CB  . THR B 6   ? 1.5425 1.1555 0.9298 -0.0065 0.3510  -0.0546 15  THR B CB  
5646 O  OG1 . THR B 6   ? 1.6588 1.2297 0.9794 0.0472  0.3426  -0.0525 15  THR B OG1 
5647 C  CG2 . THR B 6   ? 1.5355 1.2355 0.9175 0.0095  0.3333  -0.0941 15  THR B CG2 
5648 N  N   . PPN B 7   ? 1.7152 1.5352 1.2494 -0.1108 0.3371  -0.1002 16  PPN B N   
5649 C  CA  . PPN B 7   ? 1.6071 1.4896 1.1840 -0.1457 0.3418  -0.1202 16  PPN B CA  
5650 C  C   . PPN B 7   ? 1.6419 1.6175 1.2070 -0.1077 0.3218  -0.1693 16  PPN B C   
5651 O  O   . PPN B 7   ? 1.6568 1.6416 1.1903 -0.0675 0.3059  -0.1807 16  PPN B O   
5652 C  CB  . PPN B 7   ? 1.5610 1.4757 1.1933 -0.2063 0.3487  -0.1200 16  PPN B CB  
5653 C  CG  . PPN B 7   ? 1.5745 1.5724 1.2115 -0.1972 0.3373  -0.1566 16  PPN B CG  
5654 C  CD1 . PPN B 7   ? 1.5295 1.6287 1.1990 -0.2072 0.3368  -0.2031 16  PPN B CD1 
5655 C  CD2 . PPN B 7   ? 1.6476 1.6210 1.2606 -0.1780 0.3289  -0.1473 16  PPN B CD2 
5656 C  CE1 . PPN B 7   ? 1.5643 1.7405 1.2468 -0.1994 0.3305  -0.2427 16  PPN B CE1 
5657 C  CE2 . PPN B 7   ? 1.6760 1.7241 1.2950 -0.1694 0.3209  -0.1829 16  PPN B CE2 
5658 C  CZ  . PPN B 7   ? 1.6385 1.7884 1.2944 -0.1807 0.3230  -0.2320 16  PPN B CZ  
5659 N  N1  . PPN B 7   ? 1.6888 1.9148 1.3601 -0.1742 0.3194  -0.2735 16  PPN B N1  
5660 O  O1  . PPN B 7   ? 1.7691 1.9724 1.4104 -0.1456 0.3086  -0.2656 16  PPN B O1  
5661 O  O2  . PPN B 7   ? 1.6581 1.9753 1.3785 -0.2003 0.3307  -0.3215 16  PPN B O2  
5662 N  N   . GLY B 8   ? 1.5690 1.6140 1.1606 -0.1153 0.3194  -0.2020 17  GLY B N   
5663 C  CA  . GLY B 8   ? 1.5495 1.5825 1.1751 -0.1603 0.3377  -0.1884 17  GLY B CA  
5664 C  C   . GLY B 8   ? 1.6025 1.7226 1.2523 -0.1562 0.3300  -0.2334 17  GLY B C   
5665 O  O   . GLY B 8   ? 1.6477 1.7544 1.2562 -0.1110 0.3179  -0.2442 17  GLY B O   
5666 MG MG  . MG  C .   ? 0.7527 0.9444 1.2718 -0.5920 -0.6029 0.2879  725 MG  A MG  
5667 MG MG  . MG  D .   ? 0.5336 0.6925 1.2629 -0.1716 -0.0863 0.0320  726 MG  A MG  
5668 O  O   . HOH E .   ? 0.4906 0.4906 0.4906 0.0000  0.0000  0.0000  901 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLU 2   2   2   GLU GLU A . n 
A 1 3   LEU 3   3   3   LEU LEU A . n 
A 1 4   GLN 4   4   4   GLN GLN A . n 
A 1 5   GLN 5   5   5   GLN GLN A . n 
A 1 6   ASN 6   6   6   ASN ASN A . n 
A 1 7   PHE 7   7   7   PHE PHE A . n 
A 1 8   THR 8   8   8   THR THR A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  ASN 10  10  10  ASN ASN A . n 
A 1 11  ASN 11  11  11  ASN ASN A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  ILE 13  13  13  ILE ILE A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  TYR 15  15  15  TYR TYR A . n 
A 1 16  THR 16  16  16  THR THR A . n 
A 1 17  CYS 17  17  17  CYS CYS A . n 
A 1 18  ILE 18  18  18  ILE ILE A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  LEU 21  21  21  LEU LEU A . n 
A 1 22  ILE 22  22  22  ILE ILE A . n 
A 1 23  ALA 23  23  23  ALA ALA A . n 
A 1 24  PHE 24  24  24  PHE PHE A . n 
A 1 25  ALA 25  25  25  ALA ALA A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  SER 27  27  27  SER SER A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  CYS 30  30  30  CYS CYS A . n 
A 1 31  ARG 31  31  31  ARG ARG A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  TYR 33  33  33  TYR TYR A . n 
A 1 34  TRP 34  34  34  TRP TRP A . n 
A 1 35  VAL 35  35  35  VAL VAL A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  TRP 37  37  37  TRP TRP A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  SER 39  39  39  SER SER A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  PHE 41  41  41  PHE PHE A . n 
A 1 42  TYR 42  42  42  TYR TYR A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  PHE 44  44  44  PHE PHE A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  ASN 47  47  47  ASN ASN A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  GLN 49  49  49  GLN GLN A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  MET 51  51  51  MET MET A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  THR 53  53  53  THR THR A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  ASN 55  55  55  ASN ASN A . n 
A 1 56  ASP 56  56  56  ASP ASP A . n 
A 1 57  GLY 57  57  57  GLY GLY A . n 
A 1 58  TYR 58  58  58  TYR TYR A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  ALA 6