data_3RCW
# 
_entry.id   3RCW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3RCW         
RCSB  RCSB064775   
WWPDB D_1000064775 
# 
_pdbx_database_status.entry_id                        3RCW 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-03-31 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Filippakopoulos, P.'                  1  
'Keates, T.'                           2  
'Picaud, S.'                           3  
'Felletar, I.'                         4  
'Pike, A.C.W.'                         5  
'Krojer, T.'                           6  
'von Delft, F.'                        7  
'Arrowsmith, C.H.'                     8  
'Edwards, A.M.'                        9  
'Weigelt, J.'                          10 
'Bountra, C.'                          11 
'Knapp, S.'                            12 
'Structural Genomics Consortium (SGC)' 13 
# 
_citation.id                        primary 
_citation.title                     'Histone recognition and large-scale structural analysis of the human bromodomain family.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            149 
_citation.page_first                214 
_citation.page_last                 231 
_citation.year                      2012 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22464331 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2012.02.013 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Filippakopoulos, P.' 1  
primary 'Picaud, S.'          2  
primary 'Mangos, M.'          3  
primary 'Keates, T.'          4  
primary 'Lambert, J.P.'       5  
primary 'Barsyte-Lovejoy, D.' 6  
primary 'Felletar, I.'        7  
primary 'Volkmer, R.'         8  
primary 'Muller, S.'          9  
primary 'Pawson, T.'          10 
primary 'Gingras, A.C.'       11 
primary 'Arrowsmith, C.H.'    12 
primary 'Knapp, S.'           13 
# 
_cell.length_a           43.137 
_cell.length_b           51.245 
_cell.length_c           130.626 
_cell.angle_alpha        100.610 
_cell.angle_beta         90.750 
_cell.angle_gamma        93.890 
_cell.entry_id           3RCW 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.entry_id                         3RCW 
_symmetry.Int_Tables_number                1 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Bromodomain-containing protein 1' 15662.945 8   ? ? ? ? 
2 non-polymer syn 1-methylpyrrolidin-2-one           99.131    1   ? ? ? ? 
3 non-polymer syn 'ACETATE ION'                      59.044    2   ? ? ? ? 
4 non-polymer syn 1,2-ETHANEDIOL                     62.068    2   ? ? ? ? 
5 water       nat water                              18.015    166 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'BR140-like protein, Bromodomain and PHD finger-containing protein 2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMEQVAMELRLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDL
IIDNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVDSIGLEEASGMHLPERPA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMEQVAMELRLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDL
IIDNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVDSIGLEEASGMHLPERPA
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   GLU n 
1 4   GLN n 
1 5   VAL n 
1 6   ALA n 
1 7   MET n 
1 8   GLU n 
1 9   LEU n 
1 10  ARG n 
1 11  LEU n 
1 12  THR n 
1 13  PRO n 
1 14  LEU n 
1 15  THR n 
1 16  VAL n 
1 17  LEU n 
1 18  LEU n 
1 19  ARG n 
1 20  SER n 
1 21  VAL n 
1 22  LEU n 
1 23  ASP n 
1 24  GLN n 
1 25  LEU n 
1 26  GLN n 
1 27  ASP n 
1 28  LYS n 
1 29  ASP n 
1 30  PRO n 
1 31  ALA n 
1 32  ARG n 
1 33  ILE n 
1 34  PHE n 
1 35  ALA n 
1 36  GLN n 
1 37  PRO n 
1 38  VAL n 
1 39  SER n 
1 40  LEU n 
1 41  LYS n 
1 42  GLU n 
1 43  VAL n 
1 44  PRO n 
1 45  ASP n 
1 46  TYR n 
1 47  LEU n 
1 48  ASP n 
1 49  HIS n 
1 50  ILE n 
1 51  LYS n 
1 52  HIS n 
1 53  PRO n 
1 54  MET n 
1 55  ASP n 
1 56  PHE n 
1 57  ALA n 
1 58  THR n 
1 59  MET n 
1 60  ARG n 
1 61  LYS n 
1 62  ARG n 
1 63  LEU n 
1 64  GLU n 
1 65  ALA n 
1 66  GLN n 
1 67  GLY n 
1 68  TYR n 
1 69  LYS n 
1 70  ASN n 
1 71  LEU n 
1 72  HIS n 
1 73  GLU n 
1 74  PHE n 
1 75  GLU n 
1 76  GLU n 
1 77  ASP n 
1 78  PHE n 
1 79  ASP n 
1 80  LEU n 
1 81  ILE n 
1 82  ILE n 
1 83  ASP n 
1 84  ASN n 
1 85  CYS n 
1 86  MET n 
1 87  LYS n 
1 88  TYR n 
1 89  ASN n 
1 90  ALA n 
1 91  ARG n 
1 92  ASP n 
1 93  THR n 
1 94  VAL n 
1 95  PHE n 
1 96  TYR n 
1 97  ARG n 
1 98  ALA n 
1 99  ALA n 
1 100 VAL n 
1 101 ARG n 
1 102 LEU n 
1 103 ARG n 
1 104 ASP n 
1 105 GLN n 
1 106 GLY n 
1 107 GLY n 
1 108 VAL n 
1 109 VAL n 
1 110 LEU n 
1 111 ARG n 
1 112 GLN n 
1 113 ALA n 
1 114 ARG n 
1 115 ARG n 
1 116 GLU n 
1 117 VAL n 
1 118 ASP n 
1 119 SER n 
1 120 ILE n 
1 121 GLY n 
1 122 LEU n 
1 123 GLU n 
1 124 GLU n 
1 125 ALA n 
1 126 SER n 
1 127 GLY n 
1 128 MET n 
1 129 HIS n 
1 130 LEU n 
1 131 PRO n 
1 132 GLU n 
1 133 ARG n 
1 134 PRO n 
1 135 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'BRD1, BRL, BRPF2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)-R3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pNIC28-Bsa4 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BRD1_HUMAN 
_struct_ref.pdbx_db_accession          O95696 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EQVAMELRLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDLII
DNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVDSIGLEEASGMHLPERPA
;
_struct_ref.pdbx_align_begin           556 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3RCW A 3 ? 135 ? O95696 556 ? 688 ? 556 688 
2 1 3RCW B 3 ? 135 ? O95696 556 ? 688 ? 556 688 
3 1 3RCW C 3 ? 135 ? O95696 556 ? 688 ? 556 688 
4 1 3RCW D 3 ? 135 ? O95696 556 ? 688 ? 556 688 
5 1 3RCW E 3 ? 135 ? O95696 556 ? 688 ? 556 688 
6 1 3RCW F 3 ? 135 ? O95696 556 ? 688 ? 556 688 
7 1 3RCW G 3 ? 135 ? O95696 556 ? 688 ? 556 688 
8 1 3RCW H 3 ? 135 ? O95696 556 ? 688 ? 556 688 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3RCW SER A 1 ? UNP O95696 ? ? 'EXPRESSION TAG' 554 1  
1 3RCW MET A 2 ? UNP O95696 ? ? 'EXPRESSION TAG' 555 2  
2 3RCW SER B 1 ? UNP O95696 ? ? 'EXPRESSION TAG' 554 3  
2 3RCW MET B 2 ? UNP O95696 ? ? 'EXPRESSION TAG' 555 4  
3 3RCW SER C 1 ? UNP O95696 ? ? 'EXPRESSION TAG' 554 5  
3 3RCW MET C 2 ? UNP O95696 ? ? 'EXPRESSION TAG' 555 6  
4 3RCW SER D 1 ? UNP O95696 ? ? 'EXPRESSION TAG' 554 7  
4 3RCW MET D 2 ? UNP O95696 ? ? 'EXPRESSION TAG' 555 8  
5 3RCW SER E 1 ? UNP O95696 ? ? 'EXPRESSION TAG' 554 9  
5 3RCW MET E 2 ? UNP O95696 ? ? 'EXPRESSION TAG' 555 10 
6 3RCW SER F 1 ? UNP O95696 ? ? 'EXPRESSION TAG' 554 11 
6 3RCW MET F 2 ? UNP O95696 ? ? 'EXPRESSION TAG' 555 12 
7 3RCW SER G 1 ? UNP O95696 ? ? 'EXPRESSION TAG' 554 13 
7 3RCW MET G 2 ? UNP O95696 ? ? 'EXPRESSION TAG' 555 14 
8 3RCW SER H 1 ? UNP O95696 ? ? 'EXPRESSION TAG' 554 15 
8 3RCW MET H 2 ? UNP O95696 ? ? 'EXPRESSION TAG' 555 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'            ?                 'C2 H3 O2 -1'    59.044  
ALA 'L-peptide linking' y ALANINE                  ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                 ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE               ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ?                 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                 ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL           'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE                ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                  ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                    ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                  ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                   ?                 'C6 H15 N2 O2 1' 147.195 
MB3 non-polymer         . 1-methylpyrrolidin-2-one ?                 'C5 H9 N O'      99.131  
MET 'L-peptide linking' y METHIONINE               ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE            ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                  ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                   ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                ?                 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE                 ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                   ?                 'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3RCW 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.26 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   45.55 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              4.8 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'32.5% PEG3350, 5% EtGly, 0.1M Acetate, pH 4.8, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'PSI PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2011-02-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I03 
# 
_reflns.entry_id                     3RCW 
_reflns.d_resolution_high            2.210 
_reflns.d_resolution_low             19.892 
_reflns.number_all                   54956 
_reflns.number_obs                   53142 
_reflns.pdbx_netI_over_sigmaI        9.600 
_reflns.pdbx_Rsym_value              0.057 
_reflns.pdbx_redundancy              2.000 
_reflns.percent_possible_obs         96.700 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.pdbx_Rmerge_I_obs            0.057 
_reflns.B_iso_Wilson_estimate        39.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.210 2.330  ? 15955 ? 0.418 1.900  0.418 ? 2.100 ? 7768 96.800 1  1 
2.330 2.470  ? 14648 ? 0.269 2.900  0.269 ? 2.000 ? 7363 96.700 2  1 
2.470 2.640  ? 13769 ? 0.190 4.100  0.190 ? 2.000 ? 6904 97.100 3  1 
2.640 2.850  ? 13308 ? 0.132 5.800  0.132 ? 2.100 ? 6489 96.900 4  1 
2.850 3.130  ? 11380 ? 0.085 8.900  0.085 ? 1.900 ? 5873 96.700 5  1 
3.130 3.490  ? 10980 ? 0.055 13.400 0.055 ? 2.100 ? 5328 96.900 6  1 
3.490 4.030  ? 9270  ? 0.036 19.400 0.036 ? 2.000 ? 4736 96.900 7  1 
4.030 4.940  ? 8160  ? 0.029 22.900 0.029 ? 2.000 ? 4018 97.500 8  1 
4.940 6.990  ? 5933  ? 0.031 21.100 0.031 ? 1.900 ? 3057 96.500 9  1 
6.990 19.892 ? 3182  ? 0.024 22.800 0.024 ? 2.000 ? 1606 92.300 10 1 
# 
_refine.entry_id                                 3RCW 
_refine.ls_d_res_high                            2.2100 
_refine.ls_d_res_low                             19.8500 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    96.8600 
_refine.ls_number_reflns_obs                     53137 
_refine.ls_number_reflns_all                     54860 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES: WITH TLS ADDED' 
_refine.ls_R_factor_all                          0.2087 
_refine.ls_R_factor_obs                          0.2087 
_refine.ls_R_factor_R_work                       0.2061 
_refine.ls_wR_factor_R_work                      0.2061 
_refine.ls_R_factor_R_free                       0.2751 
_refine.ls_wR_factor_R_free                      0.2751 
_refine.ls_percent_reflns_R_free                 3.8000 
_refine.ls_number_reflns_R_free                  1999 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               41.3436 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            3.2300 
_refine.aniso_B[2][2]                            -1.7500 
_refine.aniso_B[3][3]                            -2.0300 
_refine.aniso_B[1][2]                            -0.7000 
_refine.aniso_B[1][3]                            0.9500 
_refine.aniso_B[2][3]                            -1.3000 
_refine.correlation_coeff_Fo_to_Fc               0.9500 
_refine.correlation_coeff_Fo_to_Fc_free          0.9170 
_refine.overall_SU_R_Cruickshank_DPI             0.2746 
_refine.overall_SU_R_free                        0.2372 
_refine.pdbx_overall_ESU_R_Free                  0.2370 
_refine.overall_SU_ML                            0.1960 
_refine.overall_SU_B                             16.2150 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'Ensemble of 3HME, 2MB3, 2OSS, 2OIO, 2GRC, 2OO1, 3DAI, 3D7C, 3DWY' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.7911 
_refine.B_iso_max                                108.400 
_refine.B_iso_min                                11.440 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.500 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7216 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         23 
_refine_hist.number_atoms_solvent             166 
_refine_hist.number_atoms_total               7405 
_refine_hist.d_res_high                       2.2100 
_refine_hist.d_res_low                        19.8500 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       7388  0.015  0.022  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d         5050  0.001  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    9994  1.430  1.974  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      12247 0.902  3.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 905   5.424  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 379   34.915 23.826 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 1281  16.296 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 69    18.004 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         1123  0.074  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   8248  0.006  0.021  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     1515  0.001  0.020  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            4550  4.442  3.000  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_other         1804  1.463  3.000  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           7314  6.238  5.000  ? ? 'X-RAY DIFFRACTION' 
r_scbond_it            2838  10.258 8.000  ? ? 'X-RAY DIFFRACTION' 
r_scangle_it           2677  12.608 11.000 ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.2100 
_refine_ls_shell.d_res_low                        2.2670 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               96.9500 
_refine_ls_shell.number_reflns_R_work             3765 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2980 
_refine_ls_shell.R_factor_R_free                  0.4120 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             140 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                3905 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3RCW 
_struct.title                     'Crystal Structure of the bromodomain of human BRD1' 
_struct.pdbx_descriptor           'Bromodomain-containing protein 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3RCW 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'Transcription, Bromodomain, Structural Genomics, Structural Genomics Consortium, SGC' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 1 ? 
H N N 1 ? 
I N N 2 ? 
J N N 3 ? 
K N N 4 ? 
L N N 4 ? 
M N N 3 ? 
N N N 5 ? 
O N N 5 ? 
P N N 5 ? 
Q N N 5 ? 
R N N 5 ? 
S N N 5 ? 
T N N 5 ? 
U N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 12  ? LYS A 28  ? THR A 565 LYS A 581 1 ? 17 
HELX_P HELX_P2  2  ASP A 45  ? ILE A 50  ? ASP A 598 ILE A 603 1 ? 6  
HELX_P HELX_P3  3  ASP A 55  ? ALA A 65  ? ASP A 608 ALA A 618 1 ? 11 
HELX_P HELX_P4  4  ASN A 70  ? ASN A 89  ? ASN A 623 ASN A 642 1 ? 20 
HELX_P HELX_P5  5  THR A 93  ? GLU A 124 ? THR A 646 GLU A 677 1 ? 32 
HELX_P HELX_P6  6  THR B 12  ? LYS B 28  ? THR B 565 LYS B 581 1 ? 17 
HELX_P HELX_P7  7  ASP B 45  ? HIS B 49  ? ASP B 598 HIS B 602 5 ? 5  
HELX_P HELX_P8  8  ASP B 55  ? ALA B 65  ? ASP B 608 ALA B 618 1 ? 11 
HELX_P HELX_P9  9  ASN B 70  ? ASN B 89  ? ASN B 623 ASN B 642 1 ? 20 
HELX_P HELX_P10 10 THR B 93  ? LEU B 122 ? THR B 646 LEU B 675 1 ? 30 
HELX_P HELX_P11 11 GLU B 123 ? GLY B 127 ? GLU B 676 GLY B 680 5 ? 5  
HELX_P HELX_P12 12 THR C 12  ? LYS C 28  ? THR C 565 LYS C 581 1 ? 17 
HELX_P HELX_P13 13 ASP C 45  ? ILE C 50  ? ASP C 598 ILE C 603 1 ? 6  
HELX_P HELX_P14 14 ASP C 55  ? ALA C 65  ? ASP C 608 ALA C 618 1 ? 11 
HELX_P HELX_P15 15 ASN C 70  ? ASN C 89  ? ASN C 623 ASN C 642 1 ? 20 
HELX_P HELX_P16 16 THR C 93  ? GLY C 121 ? THR C 646 GLY C 674 1 ? 29 
HELX_P HELX_P17 17 LEU D 11  ? ASP D 27  ? LEU D 564 ASP D 580 1 ? 17 
HELX_P HELX_P18 18 ASP D 45  ? ILE D 50  ? ASP D 598 ILE D 603 1 ? 6  
HELX_P HELX_P19 19 ASP D 55  ? ALA D 65  ? ASP D 608 ALA D 618 1 ? 11 
HELX_P HELX_P20 20 ASN D 70  ? ASN D 89  ? ASN D 623 ASN D 642 1 ? 20 
HELX_P HELX_P21 21 THR D 93  ? LEU D 122 ? THR D 646 LEU D 675 1 ? 30 
HELX_P HELX_P22 22 THR E 12  ? LYS E 28  ? THR E 565 LYS E 581 1 ? 17 
HELX_P HELX_P23 23 ASP E 45  ? ILE E 50  ? ASP E 598 ILE E 603 1 ? 6  
HELX_P HELX_P24 24 ASP E 55  ? ALA E 65  ? ASP E 608 ALA E 618 1 ? 11 
HELX_P HELX_P25 25 ASN E 70  ? ASN E 89  ? ASN E 623 ASN E 642 1 ? 20 
HELX_P HELX_P26 26 THR E 93  ? GLU E 124 ? THR E 646 GLU E 677 1 ? 32 
HELX_P HELX_P27 27 THR F 12  ? ASP F 27  ? THR F 565 ASP F 580 1 ? 16 
HELX_P HELX_P28 28 ASP F 45  ? ILE F 50  ? ASP F 598 ILE F 603 1 ? 6  
HELX_P HELX_P29 29 ASP F 55  ? ALA F 65  ? ASP F 608 ALA F 618 1 ? 11 
HELX_P HELX_P30 30 ASN F 70  ? ASN F 89  ? ASN F 623 ASN F 642 1 ? 20 
HELX_P HELX_P31 31 THR F 93  ? GLU F 123 ? THR F 646 GLU F 676 1 ? 31 
HELX_P HELX_P32 32 THR G 12  ? LYS G 28  ? THR G 565 LYS G 581 1 ? 17 
HELX_P HELX_P33 33 ASP G 45  ? ILE G 50  ? ASP G 598 ILE G 603 1 ? 6  
HELX_P HELX_P34 34 ASP G 55  ? ALA G 65  ? ASP G 608 ALA G 618 1 ? 11 
HELX_P HELX_P35 35 ASN G 70  ? ASN G 89  ? ASN G 623 ASN G 642 1 ? 20 
HELX_P HELX_P36 36 THR G 93  ? GLY G 121 ? THR G 646 GLY G 674 1 ? 29 
HELX_P HELX_P37 37 PRO H 13  ? ASP H 27  ? PRO H 566 ASP H 580 1 ? 15 
HELX_P HELX_P38 38 ASP H 45  ? ILE H 50  ? ASP H 598 ILE H 603 1 ? 6  
HELX_P HELX_P39 39 ASP H 55  ? GLU H 64  ? ASP H 608 GLU H 617 1 ? 10 
HELX_P HELX_P40 40 ASN H 70  ? ASN H 89  ? ASN H 623 ASN H 642 1 ? 20 
HELX_P HELX_P41 41 THR H 93  ? ILE H 120 ? THR H 646 ILE H 673 1 ? 28 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           124 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            677 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   ALA 
_struct_mon_prot_cis.pdbx_label_seq_id_2    125 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    ALA 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     678 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       2.04 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MB3 C 1' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ACT D 1' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE EDO F 2' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE EDO G 1' 
AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE ACT H 2' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7 HOH P .   ? HOH C 132 . ? 1_555 ? 
2  AC1 7 ILE C 33  ? ILE C 586 . ? 1_555 ? 
3  AC1 7 PHE C 34  ? PHE C 587 . ? 1_555 ? 
4  AC1 7 VAL C 38  ? VAL C 591 . ? 1_555 ? 
5  AC1 7 CYS C 85  ? CYS C 638 . ? 1_555 ? 
6  AC1 7 ASN C 89  ? ASN C 642 . ? 1_555 ? 
7  AC1 7 PHE C 95  ? PHE C 648 . ? 1_555 ? 
8  AC2 4 ARG D 62  ? ARG D 615 . ? 1_555 ? 
9  AC2 4 GLU D 73  ? GLU D 626 . ? 1_555 ? 
10 AC2 4 GLU D 76  ? GLU D 629 . ? 1_555 ? 
11 AC2 4 TYR H 96  ? TYR H 649 . ? 1_665 ? 
12 AC3 5 SER E 20  ? SER E 573 . ? 1_645 ? 
13 AC3 5 GLN E 24  ? GLN E 577 . ? 1_645 ? 
14 AC3 5 LEU F 17  ? LEU F 570 . ? 1_555 ? 
15 AC3 5 SER F 20  ? SER F 573 . ? 1_555 ? 
16 AC3 5 GLN F 24  ? GLN F 577 . ? 1_555 ? 
17 AC4 5 ASN G 70  ? ASN G 623 . ? 1_555 ? 
18 AC4 5 LEU G 71  ? LEU G 624 . ? 1_555 ? 
19 AC4 5 HIS G 72  ? HIS G 625 . ? 1_555 ? 
20 AC4 5 ARG G 114 ? ARG G 667 . ? 1_555 ? 
21 AC4 5 VAL G 117 ? VAL G 670 . ? 1_555 ? 
22 AC5 3 PRO H 37  ? PRO H 590 . ? 1_555 ? 
23 AC5 3 VAL H 38  ? VAL H 591 . ? 1_555 ? 
24 AC5 3 PRO H 53  ? PRO H 606 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3RCW 
_atom_sites.fract_transf_matrix[1][1]   0.023182 
_atom_sites.fract_transf_matrix[1][2]   0.001576 
_atom_sites.fract_transf_matrix[1][3]   0.000606 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019559 
_atom_sites.fract_transf_matrix[2][3]   0.003690 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007791 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LEU A 1 9   ? 12.394  24.686  101.027 1.00 86.74  ? 562 LEU A N   1 
ATOM   2    C CA  . LEU A 1 9   ? 12.686  23.508  100.149 1.00 86.39  ? 562 LEU A CA  1 
ATOM   3    C C   . LEU A 1 9   ? 13.664  23.925  99.036  1.00 84.62  ? 562 LEU A C   1 
ATOM   4    O O   . LEU A 1 9   ? 13.609  25.068  98.550  1.00 87.31  ? 562 LEU A O   1 
ATOM   5    C CB  . LEU A 1 9   ? 11.391  22.940  99.541  1.00 83.84  ? 562 LEU A CB  1 
ATOM   6    C CG  . LEU A 1 9   ? 10.135  22.822  100.423 1.00 83.05  ? 562 LEU A CG  1 
ATOM   7    C CD1 . LEU A 1 9   ? 8.875   23.170  99.625  1.00 71.56  ? 562 LEU A CD1 1 
ATOM   8    C CD2 . LEU A 1 9   ? 10.014  21.440  101.073 1.00 76.84  ? 562 LEU A CD2 1 
ATOM   9    N N   . ARG A 1 10  ? 14.533  22.989  98.636  1.00 76.45  ? 563 ARG A N   1 
ATOM   10   C CA  . ARG A 1 10  ? 15.626  23.242  97.675  1.00 70.92  ? 563 ARG A CA  1 
ATOM   11   C C   . ARG A 1 10  ? 15.288  22.671  96.275  1.00 60.56  ? 563 ARG A C   1 
ATOM   12   O O   . ARG A 1 10  ? 15.902  21.710  95.832  1.00 55.15  ? 563 ARG A O   1 
ATOM   13   C CB  . ARG A 1 10  ? 16.937  22.613  98.206  1.00 72.81  ? 563 ARG A CB  1 
ATOM   14   C CG  . ARG A 1 10  ? 17.223  22.844  99.709  1.00 76.73  ? 563 ARG A CG  1 
ATOM   15   C CD  . ARG A 1 10  ? 18.694  22.591  100.065 1.00 71.17  ? 563 ARG A CD  1 
ATOM   16   N N   . LEU A 1 11  ? 14.330  23.279  95.576  1.00 49.74  ? 564 LEU A N   1 
ATOM   17   C CA  . LEU A 1 11  ? 13.672  22.615  94.443  1.00 52.05  ? 564 LEU A CA  1 
ATOM   18   C C   . LEU A 1 11  ? 14.413  22.806  93.131  1.00 45.10  ? 564 LEU A C   1 
ATOM   19   O O   . LEU A 1 11  ? 14.694  23.940  92.765  1.00 53.20  ? 564 LEU A O   1 
ATOM   20   C CB  . LEU A 1 11  ? 12.227  23.123  94.288  1.00 47.44  ? 564 LEU A CB  1 
ATOM   21   C CG  . LEU A 1 11  ? 11.241  22.853  95.433  1.00 48.63  ? 564 LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 11  ? 9.872   23.467  95.109  1.00 32.23  ? 564 LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 11  ? 11.105  21.349  95.763  1.00 36.39  ? 564 LEU A CD2 1 
ATOM   24   N N   . THR A 1 12  ? 14.694  21.712  92.412  1.00 42.45  ? 565 THR A N   1 
ATOM   25   C CA  . THR A 1 12  ? 15.341  21.794  91.086  1.00 40.71  ? 565 THR A CA  1 
ATOM   26   C C   . THR A 1 12  ? 14.346  22.271  90.041  1.00 43.25  ? 565 THR A C   1 
ATOM   27   O O   . THR A 1 12  ? 13.132  22.215  90.251  1.00 45.72  ? 565 THR A O   1 
ATOM   28   C CB  . THR A 1 12  ? 15.930  20.453  90.556  1.00 40.84  ? 565 THR A CB  1 
ATOM   29   O OG1 . THR A 1 12  ? 14.874  19.609  90.055  1.00 45.17  ? 565 THR A OG1 1 
ATOM   30   C CG2 . THR A 1 12  ? 16.726  19.741  91.620  1.00 39.65  ? 565 THR A CG2 1 
ATOM   31   N N   . PRO A 1 13  ? 14.857  22.758  88.909  1.00 37.82  ? 566 PRO A N   1 
ATOM   32   C CA  . PRO A 1 13  ? 13.916  23.197  87.909  1.00 31.84  ? 566 PRO A CA  1 
ATOM   33   C C   . PRO A 1 13  ? 13.061  22.033  87.343  1.00 38.41  ? 566 PRO A C   1 
ATOM   34   O O   . PRO A 1 13  ? 11.880  22.223  87.023  1.00 31.62  ? 566 PRO A O   1 
ATOM   35   C CB  . PRO A 1 13  ? 14.794  23.830  86.831  1.00 33.90  ? 566 PRO A CB  1 
ATOM   36   C CG  . PRO A 1 13  ? 16.197  23.817  87.329  1.00 34.16  ? 566 PRO A CG  1 
ATOM   37   C CD  . PRO A 1 13  ? 16.220  23.284  88.709  1.00 40.17  ? 566 PRO A CD  1 
ATOM   38   N N   . LEU A 1 14  ? 13.620  20.834  87.231  1.00 39.49  ? 567 LEU A N   1 
ATOM   39   C CA  . LEU A 1 14  ? 12.801  19.731  86.725  1.00 37.03  ? 567 LEU A CA  1 
ATOM   40   C C   . LEU A 1 14  ? 11.575  19.517  87.633  1.00 29.19  ? 567 LEU A C   1 
ATOM   41   O O   . LEU A 1 14  ? 10.451  19.426  87.146  1.00 30.82  ? 567 LEU A O   1 
ATOM   42   C CB  . LEU A 1 14  ? 13.615  18.447  86.607  1.00 36.35  ? 567 LEU A CB  1 
ATOM   43   C CG  . LEU A 1 14  ? 12.841  17.253  86.070  1.00 34.02  ? 567 LEU A CG  1 
ATOM   44   C CD1 . LEU A 1 14  ? 12.287  17.608  84.690  1.00 23.45  ? 567 LEU A CD1 1 
ATOM   45   C CD2 . LEU A 1 14  ? 13.744  16.047  86.048  1.00 34.50  ? 567 LEU A CD2 1 
ATOM   46   N N   . THR A 1 15  ? 11.813  19.446  88.946  1.00 28.40  ? 568 THR A N   1 
ATOM   47   C CA  . THR A 1 15  ? 10.757  19.252  89.928  1.00 33.08  ? 568 THR A CA  1 
ATOM   48   C C   . THR A 1 15  ? 9.648   20.333  89.784  1.00 33.82  ? 568 THR A C   1 
ATOM   49   O O   . THR A 1 15  ? 8.467   19.998  89.707  1.00 34.76  ? 568 THR A O   1 
ATOM   50   C CB  . THR A 1 15  ? 11.313  19.230  91.366  1.00 36.34  ? 568 THR A CB  1 
ATOM   51   O OG1 . THR A 1 15  ? 12.273  18.171  91.514  1.00 32.01  ? 568 THR A OG1 1 
ATOM   52   C CG2 . THR A 1 15  ? 10.186  19.052  92.382  1.00 30.14  ? 568 THR A CG2 1 
ATOM   53   N N   . VAL A 1 16  ? 10.044  21.599  89.698  1.00 31.80  ? 569 VAL A N   1 
ATOM   54   C CA  . VAL A 1 16  ? 9.108   22.711  89.528  1.00 29.27  ? 569 VAL A CA  1 
ATOM   55   C C   . VAL A 1 16  ? 8.268   22.497  88.291  1.00 29.30  ? 569 VAL A C   1 
ATOM   56   O O   . VAL A 1 16  ? 7.042   22.583  88.326  1.00 26.84  ? 569 VAL A O   1 
ATOM   57   C CB  . VAL A 1 16  ? 9.818   24.073  89.450  1.00 29.09  ? 569 VAL A CB  1 
ATOM   58   C CG1 . VAL A 1 16  ? 8.796   25.231  89.226  1.00 29.51  ? 569 VAL A CG1 1 
ATOM   59   C CG2 . VAL A 1 16  ? 10.609  24.323  90.719  1.00 32.81  ? 569 VAL A CG2 1 
ATOM   60   N N   . LEU A 1 17  ? 8.910   22.117  87.206  1.00 27.09  ? 570 LEU A N   1 
ATOM   61   C CA  . LEU A 1 17  ? 8.160   21.838  86.009  1.00 29.16  ? 570 LEU A CA  1 
ATOM   62   C C   . LEU A 1 17  ? 7.208   20.621  86.170  1.00 27.39  ? 570 LEU A C   1 
ATOM   63   O O   . LEU A 1 17  ? 6.031   20.613  85.708  1.00 21.27  ? 570 LEU A O   1 
ATOM   64   C CB  . LEU A 1 17  ? 9.165   21.604  84.887  1.00 33.28  ? 570 LEU A CB  1 
ATOM   65   C CG  . LEU A 1 17  ? 8.529   21.677  83.508  1.00 52.74  ? 570 LEU A CG  1 
ATOM   66   C CD1 . LEU A 1 17  ? 7.895   23.072  83.297  1.00 62.94  ? 570 LEU A CD1 1 
ATOM   67   C CD2 . LEU A 1 17  ? 9.556   21.348  82.432  1.00 57.65  ? 570 LEU A CD2 1 
ATOM   68   N N   . LEU A 1 18  ? 7.716   19.565  86.794  1.00 20.75  ? 571 LEU A N   1 
ATOM   69   C CA  . LEU A 1 18  ? 6.936   18.357  86.903  1.00 24.33  ? 571 LEU A CA  1 
ATOM   70   C C   . LEU A 1 18  ? 5.764   18.614  87.836  1.00 28.69  ? 571 LEU A C   1 
ATOM   71   O O   . LEU A 1 18  ? 4.692   18.149  87.576  1.00 21.32  ? 571 LEU A O   1 
ATOM   72   C CB  . LEU A 1 18  ? 7.777   17.166  87.339  1.00 26.55  ? 571 LEU A CB  1 
ATOM   73   C CG  . LEU A 1 18  ? 8.876   16.687  86.354  1.00 26.64  ? 571 LEU A CG  1 
ATOM   74   C CD1 . LEU A 1 18  ? 9.574   15.446  86.888  1.00 31.20  ? 571 LEU A CD1 1 
ATOM   75   C CD2 . LEU A 1 18  ? 8.307   16.391  85.018  1.00 28.16  ? 571 LEU A CD2 1 
ATOM   76   N N   . ARG A 1 19  ? 5.946   19.408  88.881  1.00 27.36  ? 572 ARG A N   1 
ATOM   77   C CA  . ARG A 1 19  ? 4.823   19.757  89.733  1.00 24.99  ? 572 ARG A CA  1 
ATOM   78   C C   . ARG A 1 19  ? 3.733   20.491  88.981  1.00 33.63  ? 572 ARG A C   1 
ATOM   79   O O   . ARG A 1 19  ? 2.534   20.298  89.234  1.00 32.32  ? 572 ARG A O   1 
ATOM   80   C CB  . ARG A 1 19  ? 5.275   20.627  90.899  1.00 24.92  ? 572 ARG A CB  1 
ATOM   81   C CG  . ARG A 1 19  ? 4.176   20.874  91.882  1.00 32.27  ? 572 ARG A CG  1 
ATOM   82   C CD  . ARG A 1 19  ? 4.617   21.691  93.067  1.00 41.70  ? 572 ARG A CD  1 
ATOM   83   N NE  . ARG A 1 19  ? 3.486   21.928  93.969  1.00 27.38  ? 572 ARG A NE  1 
ATOM   84   C CZ  . ARG A 1 19  ? 3.140   21.129  94.965  1.00 31.20  ? 572 ARG A CZ  1 
ATOM   85   N NH1 . ARG A 1 19  ? 3.848   20.028  95.234  1.00 47.67  ? 572 ARG A NH1 1 
ATOM   86   N NH2 . ARG A 1 19  ? 2.092   21.435  95.711  1.00 61.06  ? 572 ARG A NH2 1 
ATOM   87   N N   . SER A 1 20  ? 4.133   21.352  88.061  1.00 32.74  ? 573 SER A N   1 
ATOM   88   C CA  . SER A 1 20  ? 3.146   22.073  87.271  1.00 31.45  ? 573 SER A CA  1 
ATOM   89   C C   . SER A 1 20  ? 2.443   21.129  86.327  1.00 31.64  ? 573 SER A C   1 
ATOM   90   O O   . SER A 1 20  ? 1.235   21.269  86.063  1.00 29.94  ? 573 SER A O   1 
ATOM   91   C CB  . SER A 1 20  ? 3.818   23.165  86.469  1.00 35.73  ? 573 SER A CB  1 
ATOM   92   O OG  . SER A 1 20  ? 2.860   23.800  85.662  1.00 32.97  ? 573 SER A OG  1 
ATOM   93   N N   . VAL A 1 21  ? 3.206   20.182  85.788  1.00 23.67  ? 574 VAL A N   1 
ATOM   94   C CA  . VAL A 1 21  ? 2.621   19.149  84.967  1.00 20.94  ? 574 VAL A CA  1 
ATOM   95   C C   . VAL A 1 21  ? 1.628   18.371  85.790  1.00 25.30  ? 574 VAL A C   1 
ATOM   96   O O   . VAL A 1 21  ? 0.442   18.299  85.424  1.00 18.98  ? 574 VAL A O   1 
ATOM   97   C CB  . VAL A 1 21  ? 3.682   18.228  84.332  1.00 20.51  ? 574 VAL A CB  1 
ATOM   98   C CG1 . VAL A 1 21  ? 3.050   17.022  83.663  1.00 23.29  ? 574 VAL A CG1 1 
ATOM   99   C CG2 . VAL A 1 21  ? 4.477   19.037  83.312  1.00 19.73  ? 574 VAL A CG2 1 
ATOM   100  N N   . LEU A 1 22  ? 2.093   17.848  86.924  1.00 22.04  ? 575 LEU A N   1 
ATOM   101  C CA  . LEU A 1 22  ? 1.281   16.989  87.772  1.00 28.84  ? 575 LEU A CA  1 
ATOM   102  C C   . LEU A 1 22  ? -0.003  17.652  88.240  1.00 27.08  ? 575 LEU A C   1 
ATOM   103  O O   . LEU A 1 22  ? -1.041  17.003  88.302  1.00 25.82  ? 575 LEU A O   1 
ATOM   104  C CB  . LEU A 1 22  ? 2.063   16.536  89.005  1.00 25.33  ? 575 LEU A CB  1 
ATOM   105  C CG  . LEU A 1 22  ? 1.291   15.554  89.904  1.00 30.61  ? 575 LEU A CG  1 
ATOM   106  C CD1 . LEU A 1 22  ? 0.855   14.300  89.116  1.00 17.02  ? 575 LEU A CD1 1 
ATOM   107  C CD2 . LEU A 1 22  ? 2.150   15.166  91.086  1.00 34.92  ? 575 LEU A CD2 1 
ATOM   108  N N   . ASP A 1 23  ? 0.071   18.926  88.593  1.00 25.38  ? 576 ASP A N   1 
ATOM   109  C CA  . ASP A 1 23  ? -1.136  19.666  88.996  1.00 23.22  ? 576 ASP A CA  1 
ATOM   110  C C   . ASP A 1 23  ? -2.118  19.816  87.858  1.00 27.54  ? 576 ASP A C   1 
ATOM   111  O O   . ASP A 1 23  ? -3.340  19.783  88.066  1.00 27.96  ? 576 ASP A O   1 
ATOM   112  C CB  . ASP A 1 23  ? -0.786  21.055  89.522  1.00 22.64  ? 576 ASP A CB  1 
ATOM   113  C CG  . ASP A 1 23  ? -0.103  21.025  90.853  1.00 23.02  ? 576 ASP A CG  1 
ATOM   114  O OD1 . ASP A 1 23  ? -0.195  20.005  91.551  1.00 29.66  ? 576 ASP A OD1 1 
ATOM   115  O OD2 . ASP A 1 23  ? 0.532   22.038  91.206  1.00 32.90  ? 576 ASP A OD2 1 
ATOM   116  N N   . GLN A 1 24  ? -1.592  19.989  86.651  1.00 26.73  ? 577 GLN A N   1 
ATOM   117  C CA  . GLN A 1 24  ? -2.437  20.127  85.469  1.00 29.52  ? 577 GLN A CA  1 
ATOM   118  C C   . GLN A 1 24  ? -3.091  18.790  85.115  1.00 34.96  ? 577 GLN A C   1 
ATOM   119  O O   . GLN A 1 24  ? -4.230  18.760  84.646  1.00 17.18  ? 577 GLN A O   1 
ATOM   120  C CB  . GLN A 1 24  ? -1.648  20.650  84.261  1.00 37.20  ? 577 GLN A CB  1 
ATOM   121  C CG  . GLN A 1 24  ? -1.414  22.147  84.285  1.00 28.51  ? 577 GLN A CG  1 
ATOM   122  C CD  . GLN A 1 24  ? -0.625  22.618  83.063  1.00 49.15  ? 577 GLN A CD  1 
ATOM   123  O OE1 . GLN A 1 24  ? -1.188  22.895  82.001  1.00 49.43  ? 577 GLN A OE1 1 
ATOM   124  N NE2 . GLN A 1 24  ? 0.676   22.723  83.221  1.00 29.50  ? 577 GLN A NE2 1 
ATOM   125  N N   . LEU A 1 25  ? -2.376  17.695  85.350  1.00 27.56  ? 578 LEU A N   1 
ATOM   126  C CA  . LEU A 1 25  ? -2.920  16.365  85.061  1.00 33.33  ? 578 LEU A CA  1 
ATOM   127  C C   . LEU A 1 25  ? -4.067  16.091  86.002  1.00 34.17  ? 578 LEU A C   1 
ATOM   128  O O   . LEU A 1 25  ? -5.154  15.614  85.581  1.00 29.10  ? 578 LEU A O   1 
ATOM   129  C CB  . LEU A 1 25  ? -1.843  15.284  85.198  1.00 28.57  ? 578 LEU A CB  1 
ATOM   130  C CG  . LEU A 1 25  ? -0.759  15.289  84.121  1.00 38.26  ? 578 LEU A CG  1 
ATOM   131  C CD1 . LEU A 1 25  ? 0.172   14.090  84.269  1.00 32.61  ? 578 LEU A CD1 1 
ATOM   132  C CD2 . LEU A 1 25  ? -1.383  15.313  82.733  1.00 38.14  ? 578 LEU A CD2 1 
ATOM   133  N N   . GLN A 1 26  ? -3.842  16.432  87.274  1.00 29.18  ? 579 GLN A N   1 
ATOM   134  C CA  . GLN A 1 26  ? -4.891  16.290  88.270  1.00 25.34  ? 579 GLN A CA  1 
ATOM   135  C C   . GLN A 1 26  ? -6.073  17.181  87.959  1.00 27.24  ? 579 GLN A C   1 
ATOM   136  O O   . GLN A 1 26  ? -7.196  16.784  88.229  1.00 27.23  ? 579 GLN A O   1 
ATOM   137  C CB  . GLN A 1 26  ? -4.375  16.490  89.703  1.00 28.64  ? 579 GLN A CB  1 
ATOM   138  C CG  . GLN A 1 26  ? -3.555  15.302  90.185  1.00 35.79  ? 579 GLN A CG  1 
ATOM   139  C CD  . GLN A 1 26  ? -3.458  15.130  91.690  1.00 28.83  ? 579 GLN A CD  1 
ATOM   140  O OE1 . GLN A 1 26  ? -2.399  15.401  92.297  1.00 30.14  ? 579 GLN A OE1 1 
ATOM   141  N NE2 . GLN A 1 26  ? -4.518  14.591  92.303  1.00 20.00  ? 579 GLN A NE2 1 
ATOM   142  N N   . ASP A 1 27  ? -5.840  18.354  87.357  1.00 29.30  ? 580 ASP A N   1 
ATOM   143  C CA  . ASP A 1 27  ? -6.938  19.270  87.068  1.00 28.24  ? 580 ASP A CA  1 
ATOM   144  C C   . ASP A 1 27  ? -7.915  18.647  86.120  1.00 39.66  ? 580 ASP A C   1 
ATOM   145  O O   . ASP A 1 27  ? -9.102  18.938  86.196  1.00 38.08  ? 580 ASP A O   1 
ATOM   146  C CB  . ASP A 1 27  ? -6.470  20.628  86.512  1.00 32.59  ? 580 ASP A CB  1 
ATOM   147  C CG  . ASP A 1 27  ? -5.831  21.514  87.573  1.00 26.62  ? 580 ASP A CG  1 
ATOM   148  O OD1 . ASP A 1 27  ? -6.122  21.308  88.779  1.00 49.38  ? 580 ASP A OD1 1 
ATOM   149  O OD2 . ASP A 1 27  ? -5.017  22.408  87.217  1.00 30.68  ? 580 ASP A OD2 1 
ATOM   150  N N   . LYS A 1 28  ? -7.405  17.773  85.250  1.00 42.92  ? 581 LYS A N   1 
ATOM   151  C CA  . LYS A 1 28  ? -8.223  17.035  84.298  1.00 38.22  ? 581 LYS A CA  1 
ATOM   152  C C   . LYS A 1 28  ? -8.931  15.811  84.887  1.00 39.68  ? 581 LYS A C   1 
ATOM   153  O O   . LYS A 1 28  ? -9.673  15.152  84.177  1.00 38.24  ? 581 LYS A O   1 
ATOM   154  C CB  . LYS A 1 28  ? -7.364  16.576  83.124  1.00 38.29  ? 581 LYS A CB  1 
ATOM   155  C CG  . LYS A 1 28  ? -6.427  17.637  82.508  1.00 43.14  ? 581 LYS A CG  1 
ATOM   156  C CD  . LYS A 1 28  ? -7.146  18.795  81.820  1.00 61.33  ? 581 LYS A CD  1 
ATOM   157  C CE  . LYS A 1 28  ? -6.185  19.958  81.541  1.00 58.62  ? 581 LYS A CE  1 
ATOM   158  N NZ  . LYS A 1 28  ? -5.787  20.689  82.799  1.00 65.19  ? 581 LYS A NZ  1 
ATOM   159  N N   . ASP A 1 29  ? -8.737  15.513  86.171  1.00 39.99  ? 582 ASP A N   1 
ATOM   160  C CA  . ASP A 1 29  ? -9.396  14.370  86.840  1.00 33.18  ? 582 ASP A CA  1 
ATOM   161  C C   . ASP A 1 29  ? -10.376 14.858  87.933  1.00 26.00  ? 582 ASP A C   1 
ATOM   162  O O   . ASP A 1 29  ? -10.314 14.430  89.068  1.00 25.98  ? 582 ASP A O   1 
ATOM   163  C CB  . ASP A 1 29  ? -8.291  13.465  87.428  1.00 34.59  ? 582 ASP A CB  1 
ATOM   164  C CG  . ASP A 1 29  ? -8.833  12.296  88.260  1.00 29.83  ? 582 ASP A CG  1 
ATOM   165  O OD1 . ASP A 1 29  ? -9.958  11.824  87.989  1.00 36.77  ? 582 ASP A OD1 1 
ATOM   166  O OD2 . ASP A 1 29  ? -8.136  11.882  89.210  1.00 38.37  ? 582 ASP A OD2 1 
ATOM   167  N N   . PRO A 1 30  ? -11.315 15.745  87.585  1.00 36.74  ? 583 PRO A N   1 
ATOM   168  C CA  . PRO A 1 30  ? -12.143 16.349  88.627  1.00 34.15  ? 583 PRO A CA  1 
ATOM   169  C C   . PRO A 1 30  ? -12.862 15.379  89.545  1.00 31.40  ? 583 PRO A C   1 
ATOM   170  O O   . PRO A 1 30  ? -13.185 15.745  90.667  1.00 36.19  ? 583 PRO A O   1 
ATOM   171  C CB  . PRO A 1 30  ? -13.182 17.170  87.836  1.00 42.45  ? 583 PRO A CB  1 
ATOM   172  C CG  . PRO A 1 30  ? -13.201 16.593  86.464  1.00 37.64  ? 583 PRO A CG  1 
ATOM   173  C CD  . PRO A 1 30  ? -11.789 16.102  86.231  1.00 44.85  ? 583 PRO A CD  1 
ATOM   174  N N   . ALA A 1 31  ? -13.129 14.164  89.091  1.00 23.19  ? 584 ALA A N   1 
ATOM   175  C CA  . ALA A 1 31  ? -13.794 13.173  89.932  1.00 25.27  ? 584 ALA A CA  1 
ATOM   176  C C   . ALA A 1 31  ? -12.832 12.459  90.835  1.00 24.20  ? 584 ALA A C   1 
ATOM   177  O O   . ALA A 1 31  ? -13.256 11.640  91.619  1.00 29.34  ? 584 ALA A O   1 
ATOM   178  C CB  . ALA A 1 31  ? -14.523 12.152  89.086  1.00 33.16  ? 584 ALA A CB  1 
ATOM   179  N N   . ARG A 1 32  ? -11.538 12.746  90.720  1.00 21.48  ? 585 ARG A N   1 
ATOM   180  C CA  . ARG A 1 32  ? -10.555 12.165  91.632  1.00 31.09  ? 585 ARG A CA  1 
ATOM   181  C C   . ARG A 1 32  ? -10.587 10.630  91.540  1.00 32.73  ? 585 ARG A C   1 
ATOM   182  O O   . ARG A 1 32  ? -10.423 9.924   92.518  1.00 39.84  ? 585 ARG A O   1 
ATOM   183  C CB  . ARG A 1 32  ? -10.739 12.660  93.077  1.00 30.51  ? 585 ARG A CB  1 
ATOM   184  C CG  . ARG A 1 32  ? -10.189 14.056  93.323  1.00 35.93  ? 585 ARG A CG  1 
ATOM   185  C CD  . ARG A 1 32  ? -10.574 14.603  94.692  1.00 38.89  ? 585 ARG A CD  1 
ATOM   186  N NE  . ARG A 1 32  ? -10.074 13.748  95.765  1.00 33.52  ? 585 ARG A NE  1 
ATOM   187  C CZ  . ARG A 1 32  ? -8.814  13.724  96.196  1.00 35.70  ? 585 ARG A CZ  1 
ATOM   188  N NH1 . ARG A 1 32  ? -8.473  12.889  97.165  1.00 23.10  ? 585 ARG A NH1 1 
ATOM   189  N NH2 . ARG A 1 32  ? -7.895  14.528  95.676  1.00 22.40  ? 585 ARG A NH2 1 
ATOM   190  N N   . ILE A 1 33  ? -10.753 10.138  90.320  1.00 34.14  ? 586 ILE A N   1 
ATOM   191  C CA  . ILE A 1 33  ? -10.684 8.729   90.055  1.00 28.98  ? 586 ILE A CA  1 
ATOM   192  C C   . ILE A 1 33  ? -9.271  8.202   90.290  1.00 27.70  ? 586 ILE A C   1 
ATOM   193  O O   . ILE A 1 33  ? -9.086  7.121   90.830  1.00 25.28  ? 586 ILE A O   1 
ATOM   194  C CB  . ILE A 1 33  ? -11.190 8.456   88.632  1.00 31.65  ? 586 ILE A CB  1 
ATOM   195  C CG1 . ILE A 1 33  ? -12.706 8.716   88.605  1.00 35.61  ? 586 ILE A CG1 1 
ATOM   196  C CG2 . ILE A 1 33  ? -10.921 7.014   88.216  1.00 33.08  ? 586 ILE A CG2 1 
ATOM   197  C CD1 . ILE A 1 33  ? -13.239 9.022   87.275  1.00 38.52  ? 586 ILE A CD1 1 
ATOM   198  N N   . PHE A 1 34  ? -8.262  8.964   89.906  1.00 23.96  ? 587 PHE A N   1 
ATOM   199  C CA  . PHE A 1 34  ? -6.889  8.483   90.030  1.00 26.06  ? 587 PHE A CA  1 
ATOM   200  C C   . PHE A 1 34  ? -6.061  9.243   91.069  1.00 28.85  ? 587 PHE A C   1 
ATOM   201  O O   . PHE A 1 34  ? -4.835  9.205   91.042  1.00 31.17  ? 587 PHE A O   1 
ATOM   202  C CB  . PHE A 1 34  ? -6.193  8.584   88.671  1.00 31.22  ? 587 PHE A CB  1 
ATOM   203  C CG  . PHE A 1 34  ? -7.035  8.136   87.529  1.00 25.92  ? 587 PHE A CG  1 
ATOM   204  C CD1 . PHE A 1 34  ? -7.013  6.816   87.115  1.00 37.74  ? 587 PHE A CD1 1 
ATOM   205  C CD2 . PHE A 1 34  ? -7.853  9.043   86.849  1.00 21.72  ? 587 PHE A CD2 1 
ATOM   206  C CE1 . PHE A 1 34  ? -7.781  6.398   86.049  1.00 36.66  ? 587 PHE A CE1 1 
ATOM   207  C CE2 . PHE A 1 34  ? -8.597  8.632   85.767  1.00 30.39  ? 587 PHE A CE2 1 
ATOM   208  C CZ  . PHE A 1 34  ? -8.573  7.301   85.376  1.00 26.52  ? 587 PHE A CZ  1 
ATOM   209  N N   . ALA A 1 35  ? -6.741  9.900   92.002  1.00 29.31  ? 588 ALA A N   1 
ATOM   210  C CA  . ALA A 1 35  ? -6.116  10.751  93.001  1.00 20.29  ? 588 ALA A CA  1 
ATOM   211  C C   . ALA A 1 35  ? -5.292  9.952   94.012  1.00 22.84  ? 588 ALA A C   1 
ATOM   212  O O   . ALA A 1 35  ? -4.235  10.418  94.496  1.00 23.42  ? 588 ALA A O   1 
ATOM   213  C CB  . ALA A 1 35  ? -7.220  11.551  93.716  1.00 25.22  ? 588 ALA A CB  1 
ATOM   214  N N   . GLN A 1 36  ? -5.779  8.748   94.317  1.00 26.54  ? 589 GLN A N   1 
ATOM   215  C CA  . GLN A 1 36  ? -5.233  7.879   95.376  1.00 25.59  ? 589 GLN A CA  1 
ATOM   216  C C   . GLN A 1 36  ? -5.055  6.416   94.911  1.00 27.10  ? 589 GLN A C   1 
ATOM   217  O O   . GLN A 1 36  ? -5.687  5.997   93.932  1.00 21.46  ? 589 GLN A O   1 
ATOM   218  C CB  . GLN A 1 36  ? -6.138  7.961   96.623  1.00 23.78  ? 589 GLN A CB  1 
ATOM   219  C CG  . GLN A 1 36  ? -6.122  9.374   97.320  1.00 28.72  ? 589 GLN A CG  1 
ATOM   220  C CD  . GLN A 1 36  ? -6.947  9.446   98.602  1.00 41.50  ? 589 GLN A CD  1 
ATOM   221  O OE1 . GLN A 1 36  ? -8.172  9.478   98.580  1.00 35.55  ? 589 GLN A OE1 1 
ATOM   222  N NE2 . GLN A 1 36  ? -6.266  9.467   99.722  1.00 35.04  ? 589 GLN A NE2 1 
ATOM   223  N N   . PRO A 1 37  ? -4.145  5.657   95.580  1.00 23.81  ? 590 PRO A N   1 
ATOM   224  C CA  . PRO A 1 37  ? -4.046  4.218   95.372  1.00 28.31  ? 590 PRO A CA  1 
ATOM   225  C C   . PRO A 1 37  ? -5.439  3.575   95.424  1.00 26.03  ? 590 PRO A C   1 
ATOM   226  O O   . PRO A 1 37  ? -6.285  3.949   96.247  1.00 27.69  ? 590 PRO A O   1 
ATOM   227  C CB  . PRO A 1 37  ? -3.209  3.727   96.575  1.00 19.48  ? 590 PRO A CB  1 
ATOM   228  C CG  . PRO A 1 37  ? -2.431  4.938   97.029  1.00 32.14  ? 590 PRO A CG  1 
ATOM   229  C CD  . PRO A 1 37  ? -3.358  6.098   96.754  1.00 19.41  ? 590 PRO A CD  1 
ATOM   230  N N   . VAL A 1 38  ? -5.665  2.661   94.499  1.00 32.19  ? 591 VAL A N   1 
ATOM   231  C CA  . VAL A 1 38  ? -6.857  1.809   94.491  1.00 35.16  ? 591 VAL A CA  1 
ATOM   232  C C   . VAL A 1 38  ? -6.954  1.075   95.820  1.00 36.35  ? 591 VAL A C   1 
ATOM   233  O O   . VAL A 1 38  ? -5.940  0.569   96.317  1.00 25.03  ? 591 VAL A O   1 
ATOM   234  C CB  . VAL A 1 38  ? -6.703  0.763   93.369  1.00 35.06  ? 591 VAL A CB  1 
ATOM   235  C CG1 . VAL A 1 38  ? -5.384  0.017   93.559  1.00 44.81  ? 591 VAL A CG1 1 
ATOM   236  C CG2 . VAL A 1 38  ? -7.855  -0.196  93.370  1.00 30.96  ? 591 VAL A CG2 1 
ATOM   237  N N   . SER A 1 39  ? -8.140  1.033   96.422  1.00 30.17  ? 592 SER A N   1 
ATOM   238  C CA  . SER A 1 39  ? -8.304  0.244   97.644  1.00 35.40  ? 592 SER A CA  1 
ATOM   239  C C   . SER A 1 39  ? -8.541  -1.233  97.314  1.00 35.84  ? 592 SER A C   1 
ATOM   240  O O   . SER A 1 39  ? -9.422  -1.575  96.500  1.00 32.47  ? 592 SER A O   1 
ATOM   241  C CB  . SER A 1 39  ? -9.475  0.734   98.490  1.00 42.86  ? 592 SER A CB  1 
ATOM   242  O OG  . SER A 1 39  ? -9.689  -0.147  99.583  1.00 37.72  ? 592 SER A OG  1 
ATOM   243  N N   . LEU A 1 40  ? -7.753  -2.085  97.956  1.00 29.97  ? 593 LEU A N   1 
ATOM   244  C CA  . LEU A 1 40  ? -7.892  -3.531  97.832  1.00 26.59  ? 593 LEU A CA  1 
ATOM   245  C C   . LEU A 1 40  ? -9.130  -4.055  98.521  1.00 28.43  ? 593 LEU A C   1 
ATOM   246  O O   . LEU A 1 40  ? -9.684  -5.039  98.096  1.00 39.02  ? 593 LEU A O   1 
ATOM   247  C CB  . LEU A 1 40  ? -6.666  -4.208  98.415  1.00 27.08  ? 593 LEU A CB  1 
ATOM   248  C CG  . LEU A 1 40  ? -5.422  -4.118  97.576  1.00 25.36  ? 593 LEU A CG  1 
ATOM   249  C CD1 . LEU A 1 40  ? -4.324  -5.047  98.172  1.00 34.71  ? 593 LEU A CD1 1 
ATOM   250  C CD2 . LEU A 1 40  ? -5.707  -4.479  96.143  1.00 35.12  ? 593 LEU A CD2 1 
ATOM   251  N N   . LYS A 1 41  ? -9.596  -3.373  99.561  1.00 33.88  ? 594 LYS A N   1 
ATOM   252  C CA  . LYS A 1 41  ? -10.868 -3.714  100.210 1.00 27.15  ? 594 LYS A CA  1 
ATOM   253  C C   . LYS A 1 41  ? -11.993 -3.566  99.213  1.00 33.53  ? 594 LYS A C   1 
ATOM   254  O O   . LYS A 1 41  ? -12.979 -4.317  99.249  1.00 37.60  ? 594 LYS A O   1 
ATOM   255  C CB  . LYS A 1 41  ? -11.185 -2.753  101.369 1.00 37.80  ? 594 LYS A CB  1 
ATOM   256  C CG  . LYS A 1 41  ? -10.180 -2.712  102.507 1.00 45.95  ? 594 LYS A CG  1 
ATOM   257  C CD  . LYS A 1 41  ? -10.068 -4.054  103.141 1.00 41.16  ? 594 LYS A CD  1 
ATOM   258  C CE  . LYS A 1 41  ? -9.404  -3.993  104.470 1.00 47.22  ? 594 LYS A CE  1 
ATOM   259  N NZ  . LYS A 1 41  ? -9.584  -5.328  105.079 1.00 27.29  ? 594 LYS A NZ  1 
ATOM   260  N N   . GLU A 1 42  ? -11.854 -2.547  98.361  1.00 32.95  ? 595 GLU A N   1 
ATOM   261  C CA  A GLU A 1 42  ? -12.840 -2.202  97.333  0.50 33.91  ? 595 GLU A CA  1 
ATOM   262  C CA  B GLU A 1 42  ? -12.884 -2.262  97.379  0.50 34.54  ? 595 GLU A CA  1 
ATOM   263  C C   . GLU A 1 42  ? -12.586 -3.020  96.085  1.00 38.01  ? 595 GLU A C   1 
ATOM   264  O O   . GLU A 1 42  ? -13.480 -3.242  95.297  1.00 36.63  ? 595 GLU A O   1 
ATOM   265  C CB  A GLU A 1 42  ? -12.746 -0.717  96.938  0.50 33.07  ? 595 GLU A CB  1 
ATOM   266  C CB  B GLU A 1 42  ? -13.031 -0.751  97.160  0.50 35.09  ? 595 GLU A CB  1 
ATOM   267  C CG  A GLU A 1 42  ? -13.308 0.285   97.937  0.50 37.68  ? 595 GLU A CG  1 
ATOM   268  C CG  B GLU A 1 42  ? -13.537 0.015   98.410  0.50 38.92  ? 595 GLU A CG  1 
ATOM   269  C CD  A GLU A 1 42  ? -13.206 1.717   97.429  0.50 44.29  ? 595 GLU A CD  1 
ATOM   270  C CD  B GLU A 1 42  ? -14.931 -0.416  98.893  0.50 48.10  ? 595 GLU A CD  1 
ATOM   271  O OE1 A GLU A 1 42  ? -13.030 2.631   98.261  0.50 58.52  ? 595 GLU A OE1 1 
ATOM   272  O OE1 B GLU A 1 42  ? -15.621 -1.181  98.182  0.50 62.07  ? 595 GLU A OE1 1 
ATOM   273  O OE2 A GLU A 1 42  ? -13.286 1.931   96.198  0.50 34.42  ? 595 GLU A OE2 1 
ATOM   274  O OE2 B GLU A 1 42  ? -15.355 0.028   99.983  0.50 47.08  ? 595 GLU A OE2 1 
ATOM   275  N N   . VAL A 1 43  ? -11.332 -3.454  95.887  1.00 39.84  ? 596 VAL A N   1 
ATOM   276  C CA  . VAL A 1 43  ? -11.020 -4.233  94.690  1.00 37.60  ? 596 VAL A CA  1 
ATOM   277  C C   . VAL A 1 43  ? -10.030 -5.363  94.968  1.00 35.45  ? 596 VAL A C   1 
ATOM   278  O O   . VAL A 1 43  ? -8.840  -5.235  94.704  1.00 30.37  ? 596 VAL A O   1 
ATOM   279  C CB  . VAL A 1 43  ? -10.521 -3.341  93.543  1.00 41.86  ? 596 VAL A CB  1 
ATOM   280  C CG1 . VAL A 1 43  ? -10.594 -4.145  92.254  1.00 36.89  ? 596 VAL A CG1 1 
ATOM   281  C CG2 . VAL A 1 43  ? -11.361 -2.036  93.445  1.00 38.09  ? 596 VAL A CG2 1 
ATOM   282  N N   . PRO A 1 44  ? -10.529 -6.491  95.480  1.00 34.20  ? 597 PRO A N   1 
ATOM   283  C CA  . PRO A 1 44  ? -9.613  -7.474  96.078  1.00 33.43  ? 597 PRO A CA  1 
ATOM   284  C C   . PRO A 1 44  ? -8.787  -8.248  95.082  1.00 32.57  ? 597 PRO A C   1 
ATOM   285  O O   . PRO A 1 44  ? -7.795  -8.856  95.469  1.00 31.86  ? 597 PRO A O   1 
ATOM   286  C CB  . PRO A 1 44  ? -10.544 -8.417  96.856  1.00 26.94  ? 597 PRO A CB  1 
ATOM   287  C CG  . PRO A 1 44  ? -11.852 -7.725  96.938  1.00 40.86  ? 597 PRO A CG  1 
ATOM   288  C CD  . PRO A 1 44  ? -11.938 -6.801  95.756  1.00 37.31  ? 597 PRO A CD  1 
ATOM   289  N N   . ASP A 1 45  ? -9.194  -8.245  93.813  1.00 35.78  ? 598 ASP A N   1 
ATOM   290  C CA  . ASP A 1 45  ? -8.469  -8.999  92.777  1.00 33.29  ? 598 ASP A CA  1 
ATOM   291  C C   . ASP A 1 45  ? -7.511  -8.103  92.016  1.00 34.06  ? 598 ASP A C   1 
ATOM   292  O O   . ASP A 1 45  ? -6.855  -8.544  91.074  1.00 33.56  ? 598 ASP A O   1 
ATOM   293  C CB  . ASP A 1 45  ? -9.442  -9.620  91.787  1.00 30.00  ? 598 ASP A CB  1 
ATOM   294  C CG  . ASP A 1 45  ? -10.319 -8.576  91.106  1.00 46.93  ? 598 ASP A CG  1 
ATOM   295  O OD1 . ASP A 1 45  ? -10.252 -7.410  91.535  1.00 45.36  ? 598 ASP A OD1 1 
ATOM   296  O OD2 . ASP A 1 45  ? -11.057 -8.913  90.155  1.00 39.58  ? 598 ASP A OD2 1 
ATOM   297  N N   . TYR A 1 46  ? -7.418  -6.844  92.421  1.00 33.12  ? 599 TYR A N   1 
ATOM   298  C CA  . TYR A 1 46  ? -6.712  -5.872  91.609  1.00 32.53  ? 599 TYR A CA  1 
ATOM   299  C C   . TYR A 1 46  ? -5.355  -6.383  91.240  1.00 30.76  ? 599 TYR A C   1 
ATOM   300  O O   . TYR A 1 46  ? -4.980  -6.305  90.089  1.00 34.20  ? 599 TYR A O   1 
ATOM   301  C CB  . TYR A 1 46  ? -6.624  -4.526  92.303  1.00 28.36  ? 599 TYR A CB  1 
ATOM   302  C CG  . TYR A 1 46  ? -6.239  -3.386  91.401  1.00 27.78  ? 599 TYR A CG  1 
ATOM   303  C CD1 . TYR A 1 46  ? -4.985  -2.803  91.501  1.00 22.14  ? 599 TYR A CD1 1 
ATOM   304  C CD2 . TYR A 1 46  ? -7.115  -2.895  90.437  1.00 32.47  ? 599 TYR A CD2 1 
ATOM   305  C CE1 . TYR A 1 46  ? -4.608  -1.752  90.688  1.00 34.46  ? 599 TYR A CE1 1 
ATOM   306  C CE2 . TYR A 1 46  ? -6.744  -1.834  89.604  1.00 23.73  ? 599 TYR A CE2 1 
ATOM   307  C CZ  . TYR A 1 46  ? -5.475  -1.263  89.753  1.00 49.60  ? 599 TYR A CZ  1 
ATOM   308  O OH  . TYR A 1 46  ? -5.028  -0.220  88.980  1.00 28.37  ? 599 TYR A OH  1 
ATOM   309  N N   . LEU A 1 47  ? -4.640  -6.975  92.184  1.00 33.67  ? 600 LEU A N   1 
ATOM   310  C CA  . LEU A 1 47  ? -3.266  -7.404  91.885  1.00 32.39  ? 600 LEU A CA  1 
ATOM   311  C C   . LEU A 1 47  ? -3.168  -8.749  91.149  1.00 39.42  ? 600 LEU A C   1 
ATOM   312  O O   . LEU A 1 47  ? -2.044  -9.204  90.842  1.00 40.50  ? 600 LEU A O   1 
ATOM   313  C CB  . LEU A 1 47  ? -2.407  -7.410  93.145  1.00 16.95  ? 600 LEU A CB  1 
ATOM   314  C CG  . LEU A 1 47  ? -2.308  -6.108  93.957  1.00 30.07  ? 600 LEU A CG  1 
ATOM   315  C CD1 . LEU A 1 47  ? -1.585  -6.360  95.312  1.00 39.45  ? 600 LEU A CD1 1 
ATOM   316  C CD2 . LEU A 1 47  ? -1.609  -4.985  93.207  1.00 38.67  ? 600 LEU A CD2 1 
ATOM   317  N N   . ASP A 1 48  ? -4.308  -9.394  90.865  1.00 27.68  ? 601 ASP A N   1 
ATOM   318  C CA  . ASP A 1 48  ? -4.308  -10.481 89.882  1.00 38.36  ? 601 ASP A CA  1 
ATOM   319  C C   . ASP A 1 48  ? -3.994  -9.912  88.485  1.00 42.87  ? 601 ASP A C   1 
ATOM   320  O O   . ASP A 1 48  ? -3.251  -10.517 87.716  1.00 42.20  ? 601 ASP A O   1 
ATOM   321  C CB  . ASP A 1 48  ? -5.639  -11.265 89.898  1.00 41.35  ? 601 ASP A CB  1 
ATOM   322  C CG  . ASP A 1 48  ? -5.821  -12.090 91.199  1.00 52.41  ? 601 ASP A CG  1 
ATOM   323  O OD1 . ASP A 1 48  ? -4.797  -12.307 91.892  1.00 52.48  ? 601 ASP A OD1 1 
ATOM   324  O OD2 . ASP A 1 48  ? -6.964  -12.521 91.535  1.00 47.70  ? 601 ASP A OD2 1 
ATOM   325  N N   . HIS A 1 49  ? -4.502  -8.714  88.192  1.00 45.92  ? 602 HIS A N   1 
ATOM   326  C CA  . HIS A 1 49  ? -4.413  -8.143  86.844  1.00 42.43  ? 602 HIS A CA  1 
ATOM   327  C C   . HIS A 1 49  ? -3.287  -7.131  86.688  1.00 36.50  ? 602 HIS A C   1 
ATOM   328  O O   . HIS A 1 49  ? -2.693  -7.075  85.627  1.00 39.65  ? 602 HIS A O   1 
ATOM   329  C CB  . HIS A 1 49  ? -5.755  -7.508  86.456  1.00 48.22  ? 602 HIS A CB  1 
ATOM   330  C CG  . HIS A 1 49  ? -6.920  -8.440  86.593  1.00 61.90  ? 602 HIS A CG  1 
ATOM   331  N ND1 . HIS A 1 49  ? -7.514  -8.717  87.808  1.00 69.59  ? 602 HIS A ND1 1 
ATOM   332  C CD2 . HIS A 1 49  ? -7.594  -9.171  85.672  1.00 74.04  ? 602 HIS A CD2 1 
ATOM   333  C CE1 . HIS A 1 49  ? -8.513  -9.564  87.628  1.00 56.44  ? 602 HIS A CE1 1 
ATOM   334  N NE2 . HIS A 1 49  ? -8.583  -9.856  86.342  1.00 66.61  ? 602 HIS A NE2 1 
ATOM   335  N N   . ILE A 1 50  ? -2.982  -6.367  87.747  1.00 36.28  ? 603 ILE A N   1 
ATOM   336  C CA  . ILE A 1 50  ? -2.071  -5.213  87.697  1.00 32.35  ? 603 ILE A CA  1 
ATOM   337  C C   . ILE A 1 50  ? -0.775  -5.438  88.461  1.00 31.96  ? 603 ILE A C   1 
ATOM   338  O O   . ILE A 1 50  ? -0.796  -5.687  89.662  1.00 41.72  ? 603 ILE A O   1 
ATOM   339  C CB  . ILE A 1 50  ? -2.739  -3.952  88.330  1.00 33.32  ? 603 ILE A CB  1 
ATOM   340  C CG1 . ILE A 1 50  ? -3.880  -3.432  87.453  1.00 40.98  ? 603 ILE A CG1 1 
ATOM   341  C CG2 . ILE A 1 50  ? -1.699  -2.865  88.618  1.00 35.96  ? 603 ILE A CG2 1 
ATOM   342  C CD1 . ILE A 1 50  ? -3.611  -3.419  85.968  1.00 44.86  ? 603 ILE A CD1 1 
ATOM   343  N N   . LYS A 1 51  ? 0.359   -5.293  87.779  1.00 39.48  ? 604 LYS A N   1 
ATOM   344  C CA  . LYS A 1 51  ? 1.655   -5.591  88.389  1.00 34.85  ? 604 LYS A CA  1 
ATOM   345  C C   . LYS A 1 51  ? 2.260   -4.425  89.160  1.00 38.02  ? 604 LYS A C   1 
ATOM   346  O O   . LYS A 1 51  ? 3.018   -4.638  90.124  1.00 41.00  ? 604 LYS A O   1 
ATOM   347  C CB  . LYS A 1 51  ? 2.638   -6.069  87.331  1.00 42.60  ? 604 LYS A CB  1 
ATOM   348  C CG  . LYS A 1 51  ? 2.213   -7.311  86.517  1.00 41.42  ? 604 LYS A CG  1 
ATOM   349  C CD  . LYS A 1 51  ? 1.668   -8.450  87.353  1.00 35.45  ? 604 LYS A CD  1 
ATOM   350  C CE  . LYS A 1 51  ? 1.221   -9.652  86.485  1.00 75.66  ? 604 LYS A CE  1 
ATOM   351  N NZ  . LYS A 1 51  ? 0.853   -9.340  85.053  1.00 64.75  ? 604 LYS A NZ  1 
ATOM   352  N N   . HIS A 1 52  ? 1.911   -3.208  88.738  1.00 35.36  ? 605 HIS A N   1 
ATOM   353  C CA  . HIS A 1 52  ? 2.491   -1.967  89.252  1.00 30.44  ? 605 HIS A CA  1 
ATOM   354  C C   . HIS A 1 52  ? 1.364   -0.952  89.373  1.00 33.79  ? 605 HIS A C   1 
ATOM   355  O O   . HIS A 1 52  ? 1.089   -0.213  88.429  1.00 30.51  ? 605 HIS A O   1 
ATOM   356  C CB  . HIS A 1 52  ? 3.527   -1.455  88.254  1.00 32.32  ? 605 HIS A CB  1 
ATOM   357  C CG  . HIS A 1 52  ? 4.530   -0.521  88.848  1.00 53.75  ? 605 HIS A CG  1 
ATOM   358  N ND1 . HIS A 1 52  ? 5.864   -0.559  88.510  1.00 41.14  ? 605 HIS A ND1 1 
ATOM   359  C CD2 . HIS A 1 52  ? 4.401   0.460   89.772  1.00 51.30  ? 605 HIS A CD2 1 
ATOM   360  C CE1 . HIS A 1 52  ? 6.511   0.373   89.186  1.00 45.37  ? 605 HIS A CE1 1 
ATOM   361  N NE2 . HIS A 1 52  ? 5.650   0.993   89.970  1.00 39.64  ? 605 HIS A NE2 1 
ATOM   362  N N   . PRO A 1 53  ? 0.668   -0.950  90.514  1.00 37.17  ? 606 PRO A N   1 
ATOM   363  C CA  . PRO A 1 53  ? -0.313  0.098   90.747  1.00 34.83  ? 606 PRO A CA  1 
ATOM   364  C C   . PRO A 1 53  ? 0.346   1.484   90.776  1.00 35.02  ? 606 PRO A C   1 
ATOM   365  O O   . PRO A 1 53  ? 1.517   1.618   91.161  1.00 27.71  ? 606 PRO A O   1 
ATOM   366  C CB  . PRO A 1 53  ? -0.906  -0.259  92.116  1.00 32.08  ? 606 PRO A CB  1 
ATOM   367  C CG  . PRO A 1 53  ? -0.635  -1.724  92.296  1.00 35.12  ? 606 PRO A CG  1 
ATOM   368  C CD  . PRO A 1 53  ? 0.693   -1.953  91.598  1.00 36.92  ? 606 PRO A CD  1 
ATOM   369  N N   . MET A 1 54  ? -0.387  2.500   90.337  1.00 31.99  ? 607 MET A N   1 
ATOM   370  C CA  . MET A 1 54  ? 0.118   3.877   90.380  1.00 29.78  ? 607 MET A CA  1 
ATOM   371  C C   . MET A 1 54  ? -1.060  4.829   90.478  1.00 27.82  ? 607 MET A C   1 
ATOM   372  O O   . MET A 1 54  ? -2.161  4.522   90.018  1.00 24.55  ? 607 MET A O   1 
ATOM   373  C CB  . MET A 1 54  ? 0.977   4.161   89.129  1.00 25.26  ? 607 MET A CB  1 
ATOM   374  C CG  . MET A 1 54  ? 1.664   5.532   89.112  1.00 21.31  ? 607 MET A CG  1 
ATOM   375  S SD  . MET A 1 54  ? 2.552   5.866   90.613  1.00 33.31  ? 607 MET A SD  1 
ATOM   376  C CE  . MET A 1 54  ? 3.614   4.390   90.713  1.00 21.14  ? 607 MET A CE  1 
ATOM   377  N N   . ASP A 1 55  ? -0.841  5.976   91.111  1.00 33.36  ? 608 ASP A N   1 
ATOM   378  C CA  . ASP A 1 55  ? -1.908  6.994   91.312  1.00 30.75  ? 608 ASP A CA  1 
ATOM   379  C C   . ASP A 1 55  ? -1.215  8.349   91.464  1.00 25.24  ? 608 ASP A C   1 
ATOM   380  O O   . ASP A 1 55  ? -0.003  8.405   91.645  1.00 19.96  ? 608 ASP A O   1 
ATOM   381  C CB  . ASP A 1 55  ? -2.698  6.687   92.586  1.00 22.78  ? 608 ASP A CB  1 
ATOM   382  C CG  . ASP A 1 55  ? -1.814  6.698   93.780  1.00 32.13  ? 608 ASP A CG  1 
ATOM   383  O OD1 . ASP A 1 55  ? -1.082  5.701   93.986  1.00 35.42  ? 608 ASP A OD1 1 
ATOM   384  O OD2 . ASP A 1 55  ? -1.783  7.730   94.479  1.00 38.83  ? 608 ASP A OD2 1 
ATOM   385  N N   . PHE A 1 56  ? -1.956  9.449   91.407  1.00 21.24  ? 609 PHE A N   1 
ATOM   386  C CA  . PHE A 1 56  ? -1.291  10.761  91.426  1.00 25.58  ? 609 PHE A CA  1 
ATOM   387  C C   . PHE A 1 56  ? -0.692  11.024  92.790  1.00 24.23  ? 609 PHE A C   1 
ATOM   388  O O   . PHE A 1 56  ? 0.348   11.700  92.913  1.00 24.50  ? 609 PHE A O   1 
ATOM   389  C CB  . PHE A 1 56  ? -2.244  11.905  91.107  1.00 32.62  ? 609 PHE A CB  1 
ATOM   390  C CG  . PHE A 1 56  ? -2.702  11.961  89.681  1.00 27.72  ? 609 PHE A CG  1 
ATOM   391  C CD1 . PHE A 1 56  ? -1.789  12.039  88.638  1.00 33.55  ? 609 PHE A CD1 1 
ATOM   392  C CD2 . PHE A 1 56  ? -4.049  11.980  89.389  1.00 19.88  ? 609 PHE A CD2 1 
ATOM   393  C CE1 . PHE A 1 56  ? -2.220  12.121  87.325  1.00 25.35  ? 609 PHE A CE1 1 
ATOM   394  C CE2 . PHE A 1 56  ? -4.498  12.059  88.085  1.00 35.65  ? 609 PHE A CE2 1 
ATOM   395  C CZ  . PHE A 1 56  ? -3.570  12.117  87.039  1.00 37.28  ? 609 PHE A CZ  1 
ATOM   396  N N   . ALA A 1 57  ? -1.367  10.545  93.825  1.00 24.41  ? 610 ALA A N   1 
ATOM   397  C CA  . ALA A 1 57  ? -0.843  10.696  95.196  1.00 26.61  ? 610 ALA A CA  1 
ATOM   398  C C   . ALA A 1 57  ? 0.572   10.116  95.299  1.00 25.34  ? 610 ALA A C   1 
ATOM   399  O O   . ALA A 1 57  ? 1.451   10.750  95.858  1.00 27.19  ? 610 ALA A O   1 
ATOM   400  C CB  . ALA A 1 57  ? -1.756  10.050  96.241  1.00 20.75  ? 610 ALA A CB  1 
ATOM   401  N N   . THR A 1 58  ? 0.800   8.947   94.725  1.00 22.60  ? 611 THR A N   1 
ATOM   402  C CA  . THR A 1 58  ? 2.129   8.296   94.836  1.00 28.78  ? 611 THR A CA  1 
ATOM   403  C C   . THR A 1 58  ? 3.160   9.044   93.992  1.00 26.55  ? 611 THR A C   1 
ATOM   404  O O   . THR A 1 58  ? 4.342   9.107   94.339  1.00 31.82  ? 611 THR A O   1 
ATOM   405  C CB  . THR A 1 58  ? 2.066   6.790   94.433  1.00 37.48  ? 611 THR A CB  1 
ATOM   406  O OG1 . THR A 1 58  ? 1.021   6.149   95.161  1.00 30.43  ? 611 THR A OG1 1 
ATOM   407  C CG2 . THR A 1 58  ? 3.426   6.029   94.687  1.00 16.78  ? 611 THR A CG2 1 
ATOM   408  N N   . MET A 1 59  ? 2.715   9.628   92.885  1.00 33.10  ? 612 MET A N   1 
ATOM   409  C CA  . MET A 1 59  ? 3.617   10.395  92.016  1.00 30.02  ? 612 MET A CA  1 
ATOM   410  C C   . MET A 1 59  ? 4.015   11.685  92.702  1.00 21.20  ? 612 MET A C   1 
ATOM   411  O O   . MET A 1 59  ? 5.167   12.051  92.695  1.00 27.21  ? 612 MET A O   1 
ATOM   412  C CB  . MET A 1 59  ? 2.965   10.704  90.669  1.00 26.89  ? 612 MET A CB  1 
ATOM   413  C CG  . MET A 1 59  ? 2.757   9.489   89.785  1.00 22.80  ? 612 MET A CG  1 
ATOM   414  S SD  . MET A 1 59  ? 2.070   9.947   88.149  1.00 30.41  ? 612 MET A SD  1 
ATOM   415  C CE  . MET A 1 59  ? 3.520   10.740  87.417  1.00 25.15  ? 612 MET A CE  1 
ATOM   416  N N   . ARG A 1 60  ? 3.052   12.383  93.297  1.00 23.71  ? 613 ARG A N   1 
ATOM   417  C CA  . ARG A 1 60  ? 3.363   13.628  94.027  1.00 21.43  ? 613 ARG A CA  1 
ATOM   418  C C   . ARG A 1 60  ? 4.376   13.366  95.155  1.00 27.88  ? 613 ARG A C   1 
ATOM   419  O O   . ARG A 1 60  ? 5.314   14.134  95.369  1.00 26.70  ? 613 ARG A O   1 
ATOM   420  C CB  . ARG A 1 60  ? 2.088   14.252  94.610  1.00 18.85  ? 613 ARG A CB  1 
ATOM   421  C CG  . ARG A 1 60  ? 2.301   15.580  95.315  1.00 15.52  ? 613 ARG A CG  1 
ATOM   422  C CD  . ARG A 1 60  ? 0.988   16.294  95.632  1.00 34.62  ? 613 ARG A CD  1 
ATOM   423  N NE  . ARG A 1 60  ? 0.143   16.461  94.450  1.00 19.57  ? 613 ARG A NE  1 
ATOM   424  C CZ  . ARG A 1 60  ? 0.175   17.462  93.566  1.00 24.28  ? 613 ARG A CZ  1 
ATOM   425  N NH1 . ARG A 1 60  ? 1.030   18.475  93.660  1.00 21.19  ? 613 ARG A NH1 1 
ATOM   426  N NH2 . ARG A 1 60  ? -0.678  17.433  92.542  1.00 23.03  ? 613 ARG A NH2 1 
ATOM   427  N N   . LYS A 1 61  ? 4.164   12.281  95.878  1.00 31.70  ? 614 LYS A N   1 
ATOM   428  C CA  . LYS A 1 61  ? 5.106   11.849  96.926  1.00 31.43  ? 614 LYS A CA  1 
ATOM   429  C C   . LYS A 1 61  ? 6.516   11.611  96.405  1.00 33.54  ? 614 LYS A C   1 
ATOM   430  O O   . LYS A 1 61  ? 7.459   12.063  97.028  1.00 31.10  ? 614 LYS A O   1 
ATOM   431  C CB  . LYS A 1 61  ? 4.616   10.568  97.599  1.00 35.74  ? 614 LYS A CB  1 
ATOM   432  C CG  . LYS A 1 61  ? 5.165   10.386  99.004  1.00 46.93  ? 614 LYS A CG  1 
ATOM   433  C CD  . LYS A 1 61  ? 5.550   8.957   99.305  1.00 61.33  ? 614 LYS A CD  1 
ATOM   434  C CE  . LYS A 1 61  ? 5.390   8.663   100.793 1.00 74.90  ? 614 LYS A CE  1 
ATOM   435  N NZ  . LYS A 1 61  ? 6.048   7.390   101.186 1.00 73.62  ? 614 LYS A NZ  1 
ATOM   436  N N   . ARG A 1 62  ? 6.666   10.892  95.279  1.00 34.11  ? 615 ARG A N   1 
ATOM   437  C CA  . ARG A 1 62  ? 7.970   10.732  94.669  1.00 27.19  ? 615 ARG A CA  1 
ATOM   438  C C   . ARG A 1 62  ? 8.478   12.116  94.247  1.00 33.17  ? 615 ARG A C   1 
ATOM   439  O O   . ARG A 1 62  ? 9.645   12.417  94.468  1.00 27.61  ? 615 ARG A O   1 
ATOM   440  C CB  . ARG A 1 62  ? 7.940   9.746   93.478  1.00 34.42  ? 615 ARG A CB  1 
ATOM   441  C CG  . ARG A 1 62  ? 9.159   9.854   92.498  1.00 39.31  ? 615 ARG A CG  1 
ATOM   442  C CD  . ARG A 1 62  ? 10.062  8.599   92.366  1.00 51.94  ? 615 ARG A CD  1 
ATOM   443  N NE  . ARG A 1 62  ? 9.565   7.703   91.326  1.00 53.35  ? 615 ARG A NE  1 
ATOM   444  C CZ  . ARG A 1 62  ? 10.181  7.303   90.202  1.00 33.50  ? 615 ARG A CZ  1 
ATOM   445  N NH1 . ARG A 1 62  ? 11.415  7.671   89.831  1.00 37.76  ? 615 ARG A NH1 1 
ATOM   446  N NH2 . ARG A 1 62  ? 9.509   6.485   89.413  1.00 28.57  ? 615 ARG A NH2 1 
ATOM   447  N N   . LEU A 1 63  ? 7.607   12.965  93.677  1.00 28.95  ? 616 LEU A N   1 
ATOM   448  C CA  . LEU A 1 63  ? 8.039   14.283  93.187  1.00 24.51  ? 616 LEU A CA  1 
ATOM   449  C C   . LEU A 1 63  ? 8.544   15.146  94.298  1.00 32.31  ? 616 LEU A C   1 
ATOM   450  O O   . LEU A 1 63  ? 9.632   15.705  94.219  1.00 35.24  ? 616 LEU A O   1 
ATOM   451  C CB  . LEU A 1 63  ? 6.917   15.051  92.459  1.00 33.25  ? 616 LEU A CB  1 
ATOM   452  C CG  . LEU A 1 63  ? 7.289   16.452  91.904  1.00 33.22  ? 616 LEU A CG  1 
ATOM   453  C CD1 . LEU A 1 63  ? 8.524   16.354  90.992  1.00 32.45  ? 616 LEU A CD1 1 
ATOM   454  C CD2 . LEU A 1 63  ? 6.136   17.110  91.163  1.00 31.13  ? 616 LEU A CD2 1 
ATOM   455  N N   . GLU A 1 64  ? 7.740   15.268  95.340  1.00 32.85  ? 617 GLU A N   1 
ATOM   456  C CA  . GLU A 1 64  ? 8.101   16.104  96.469  1.00 30.68  ? 617 GLU A CA  1 
ATOM   457  C C   . GLU A 1 64  ? 9.387   15.649  97.186  1.00 39.62  ? 617 GLU A C   1 
ATOM   458  O O   . GLU A 1 64  ? 10.022  16.476  97.847  1.00 39.20  ? 617 GLU A O   1 
ATOM   459  C CB  . GLU A 1 64  ? 6.911   16.211  97.423  1.00 37.04  ? 617 GLU A CB  1 
ATOM   460  C CG  . GLU A 1 64  ? 5.796   17.101  96.809  1.00 41.12  ? 617 GLU A CG  1 
ATOM   461  C CD  . GLU A 1 64  ? 4.508   17.127  97.615  1.00 43.15  ? 617 GLU A CD  1 
ATOM   462  O OE1 . GLU A 1 64  ? 4.310   16.233  98.468  1.00 53.34  ? 617 GLU A OE1 1 
ATOM   463  O OE2 . GLU A 1 64  ? 3.678   18.033  97.368  1.00 49.64  ? 617 GLU A OE2 1 
ATOM   464  N N   . ALA A 1 65  ? 9.788   14.367  97.024  1.00 35.85  ? 618 ALA A N   1 
ATOM   465  C CA  . ALA A 1 65  ? 11.122  13.894  97.466  1.00 36.81  ? 618 ALA A CA  1 
ATOM   466  C C   . ALA A 1 65  ? 12.160  14.057  96.350  1.00 38.89  ? 618 ALA A C   1 
ATOM   467  O O   . ALA A 1 65  ? 13.259  13.528  96.434  1.00 48.57  ? 618 ALA A O   1 
ATOM   468  C CB  . ALA A 1 65  ? 11.056  12.442  97.909  1.00 32.37  ? 618 ALA A CB  1 
ATOM   469  N N   . GLN A 1 66  ? 11.793  14.773  95.292  1.00 45.47  ? 619 GLN A N   1 
ATOM   470  C CA  . GLN A 1 66  ? 12.666  15.019  94.144  1.00 44.47  ? 619 GLN A CA  1 
ATOM   471  C C   . GLN A 1 66  ? 13.212  13.719  93.557  1.00 43.79  ? 619 GLN A C   1 
ATOM   472  O O   . GLN A 1 66  ? 14.355  13.663  93.078  1.00 38.11  ? 619 GLN A O   1 
ATOM   473  C CB  . GLN A 1 66  ? 13.779  16.003  94.502  1.00 39.94  ? 619 GLN A CB  1 
ATOM   474  C CG  . GLN A 1 66  ? 13.275  17.371  94.988  1.00 51.37  ? 619 GLN A CG  1 
ATOM   475  C CD  . GLN A 1 66  ? 14.044  18.546  94.371  1.00 38.73  ? 619 GLN A CD  1 
ATOM   476  O OE1 . GLN A 1 66  ? 14.097  18.693  93.152  1.00 67.26  ? 619 GLN A OE1 1 
ATOM   477  N NE2 . GLN A 1 66  ? 14.619  19.382  95.210  1.00 53.79  ? 619 GLN A NE2 1 
ATOM   478  N N   . GLY A 1 67  ? 12.332  12.709  93.546  1.00 40.96  ? 620 GLY A N   1 
ATOM   479  C CA  . GLY A 1 67  ? 12.637  11.339  93.104  1.00 35.62  ? 620 GLY A CA  1 
ATOM   480  C C   . GLY A 1 67  ? 12.499  11.030  91.622  1.00 38.41  ? 620 GLY A C   1 
ATOM   481  O O   . GLY A 1 67  ? 12.685  9.880   91.220  1.00 39.83  ? 620 GLY A O   1 
ATOM   482  N N   . TYR A 1 68  ? 12.156  12.041  90.817  1.00 37.00  ? 621 TYR A N   1 
ATOM   483  C CA  . TYR A 1 68  ? 12.261  11.977  89.361  1.00 30.02  ? 621 TYR A CA  1 
ATOM   484  C C   . TYR A 1 68  ? 13.546  12.653  88.884  1.00 38.30  ? 621 TYR A C   1 
ATOM   485  O O   . TYR A 1 68  ? 13.818  13.816  89.194  1.00 39.24  ? 621 TYR A O   1 
ATOM   486  C CB  . TYR A 1 68  ? 11.058  12.652  88.687  1.00 33.97  ? 621 TYR A CB  1 
ATOM   487  C CG  . TYR A 1 68  ? 9.797   11.923  88.943  1.00 22.19  ? 621 TYR A CG  1 
ATOM   488  C CD1 . TYR A 1 68  ? 9.591   10.646  88.405  1.00 16.87  ? 621 TYR A CD1 1 
ATOM   489  C CD2 . TYR A 1 68  ? 8.804   12.477  89.749  1.00 42.67  ? 621 TYR A CD2 1 
ATOM   490  C CE1 . TYR A 1 68  ? 8.403   9.938   88.653  1.00 31.77  ? 621 TYR A CE1 1 
ATOM   491  C CE2 . TYR A 1 68  ? 7.617   11.794  90.008  1.00 19.73  ? 621 TYR A CE2 1 
ATOM   492  C CZ  . TYR A 1 68  ? 7.417   10.522  89.462  1.00 29.38  ? 621 TYR A CZ  1 
ATOM   493  O OH  . TYR A 1 68  ? 6.259   9.828   89.727  1.00 21.61  ? 621 TYR A OH  1 
ATOM   494  N N   . LYS A 1 69  ? 14.325  11.904  88.114  1.00 39.61  ? 622 LYS A N   1 
ATOM   495  C CA  . LYS A 1 69  ? 15.621  12.349  87.631  1.00 39.22  ? 622 LYS A CA  1 
ATOM   496  C C   . LYS A 1 69  ? 15.458  12.928  86.243  1.00 38.11  ? 622 LYS A C   1 
ATOM   497  O O   . LYS A 1 69  ? 16.332  13.653  85.781  1.00 40.37  ? 622 LYS A O   1 
ATOM   498  C CB  . LYS A 1 69  ? 16.595  11.162  87.580  1.00 44.08  ? 622 LYS A CB  1 
ATOM   499  C CG  . LYS A 1 69  ? 17.353  10.859  88.899  1.00 58.03  ? 622 LYS A CG  1 
ATOM   500  C CD  . LYS A 1 69  ? 17.804  9.368   89.068  1.00 71.90  ? 622 LYS A CD  1 
ATOM   501  C CE  . LYS A 1 69  ? 18.036  8.568   87.753  1.00 77.86  ? 622 LYS A CE  1 
ATOM   502  N NZ  . LYS A 1 69  ? 18.907  9.217   86.723  1.00 83.44  ? 622 LYS A NZ  1 
ATOM   503  N N   . ASN A 1 70  ? 14.363  12.570  85.564  1.00 29.17  ? 623 ASN A N   1 
ATOM   504  C CA  . ASN A 1 70  ? 14.084  13.070  84.219  1.00 32.65  ? 623 ASN A CA  1 
ATOM   505  C C   . ASN A 1 70  ? 12.584  13.010  83.848  1.00 24.15  ? 623 ASN A C   1 
ATOM   506  O O   . ASN A 1 70  ? 11.831  12.354  84.516  1.00 26.13  ? 623 ASN A O   1 
ATOM   507  C CB  . ASN A 1 70  ? 14.905  12.301  83.206  1.00 38.40  ? 623 ASN A CB  1 
ATOM   508  C CG  . ASN A 1 70  ? 14.682  10.821  83.292  1.00 42.03  ? 623 ASN A CG  1 
ATOM   509  O OD1 . ASN A 1 70  ? 13.565  10.342  83.133  1.00 36.09  ? 623 ASN A OD1 1 
ATOM   510  N ND2 . ASN A 1 70  ? 15.746  10.083  83.548  1.00 36.81  ? 623 ASN A ND2 1 
ATOM   511  N N   . LEU A 1 71  ? 12.156  13.737  82.819  1.00 27.67  ? 624 LEU A N   1 
ATOM   512  C CA  . LEU A 1 71  ? 10.709  13.728  82.444  1.00 31.83  ? 624 LEU A CA  1 
ATOM   513  C C   . LEU A 1 71  ? 10.284  12.302  82.048  1.00 33.32  ? 624 LEU A C   1 
ATOM   514  O O   . LEU A 1 71  ? 9.143   11.891  82.235  1.00 34.80  ? 624 LEU A O   1 
ATOM   515  C CB  . LEU A 1 71  ? 10.422  14.699  81.284  1.00 25.60  ? 624 LEU A CB  1 
ATOM   516  C CG  . LEU A 1 71  ? 9.061   14.706  80.565  1.00 29.05  ? 624 LEU A CG  1 
ATOM   517  C CD1 . LEU A 1 71  ? 7.862   14.928  81.532  1.00 18.69  ? 624 LEU A CD1 1 
ATOM   518  C CD2 . LEU A 1 71  ? 9.071   15.731  79.456  1.00 41.69  ? 624 LEU A CD2 1 
ATOM   519  N N   . HIS A 1 72  ? 11.213  11.553  81.488  1.00 32.47  ? 625 HIS A N   1 
ATOM   520  C CA  . HIS A 1 72  ? 10.911  10.215  81.028  1.00 34.12  ? 625 HIS A CA  1 
ATOM   521  C C   . HIS A 1 72  ? 10.426  9.311   82.181  1.00 23.32  ? 625 HIS A C   1 
ATOM   522  O O   . HIS A 1 72  ? 9.539   8.455   82.001  1.00 22.69  ? 625 HIS A O   1 
ATOM   523  C CB  . HIS A 1 72  ? 12.135  9.634   80.303  1.00 35.28  ? 625 HIS A CB  1 
ATOM   524  C CG  . HIS A 1 72  ? 12.057  8.161   80.071  1.00 54.01  ? 625 HIS A CG  1 
ATOM   525  N ND1 . HIS A 1 72  ? 12.540  7.240   80.978  1.00 69.54  ? 625 HIS A ND1 1 
ATOM   526  C CD2 . HIS A 1 72  ? 11.539  7.447   79.045  1.00 57.40  ? 625 HIS A CD2 1 
ATOM   527  C CE1 . HIS A 1 72  ? 12.316  6.021   80.524  1.00 75.55  ? 625 HIS A CE1 1 
ATOM   528  N NE2 . HIS A 1 72  ? 11.716  6.120   79.350  1.00 69.01  ? 625 HIS A NE2 1 
ATOM   529  N N   . GLU A 1 73  ? 10.991  9.497   83.363  1.00 30.55  ? 626 GLU A N   1 
ATOM   530  C CA  . GLU A 1 73  ? 10.548  8.718   84.538  1.00 33.17  ? 626 GLU A CA  1 
ATOM   531  C C   . GLU A 1 73  ? 9.136   9.082   84.955  1.00 30.27  ? 626 GLU A C   1 
ATOM   532  O O   . GLU A 1 73  ? 8.366   8.209   85.385  1.00 27.09  ? 626 GLU A O   1 
ATOM   533  C CB  . GLU A 1 73  ? 11.513  8.888   85.721  1.00 39.34  ? 626 GLU A CB  1 
ATOM   534  C CG  . GLU A 1 73  ? 12.840  8.108   85.559  1.00 39.31  ? 626 GLU A CG  1 
ATOM   535  C CD  . GLU A 1 73  ? 13.766  8.258   86.763  1.00 52.04  ? 626 GLU A CD  1 
ATOM   536  O OE1 . GLU A 1 73  ? 13.359  8.930   87.728  1.00 47.82  ? 626 GLU A OE1 1 
ATOM   537  O OE2 . GLU A 1 73  ? 14.897  7.715   86.745  1.00 53.69  ? 626 GLU A OE2 1 
ATOM   538  N N   . PHE A 1 74  ? 8.790   10.362  84.798  1.00 27.34  ? 627 PHE A N   1 
ATOM   539  C CA  . PHE A 1 74  ? 7.485   10.870  85.211  1.00 29.16  ? 627 PHE A CA  1 
ATOM   540  C C   . PHE A 1 74  ? 6.440   10.322  84.267  1.00 28.09  ? 627 PHE A C   1 
ATOM   541  O O   . PHE A 1 74  ? 5.434   9.790   84.707  1.00 28.61  ? 627 PHE A O   1 
ATOM   542  C CB  . PHE A 1 74  ? 7.490   12.406  85.203  1.00 31.38  ? 627 PHE A CB  1 
ATOM   543  C CG  . PHE A 1 74  ? 6.220   13.035  85.670  1.00 20.29  ? 627 PHE A CG  1 
ATOM   544  C CD1 . PHE A 1 74  ? 6.074   13.440  86.970  1.00 21.76  ? 627 PHE A CD1 1 
ATOM   545  C CD2 . PHE A 1 74  ? 5.201   13.303  84.782  1.00 23.69  ? 627 PHE A CD2 1 
ATOM   546  C CE1 . PHE A 1 74  ? 4.923   14.031  87.399  1.00 31.11  ? 627 PHE A CE1 1 
ATOM   547  C CE2 . PHE A 1 74  ? 4.063   13.904  85.209  1.00 35.70  ? 627 PHE A CE2 1 
ATOM   548  C CZ  . PHE A 1 74  ? 3.916   14.262  86.525  1.00 31.75  ? 627 PHE A CZ  1 
ATOM   549  N N   . GLU A 1 75  ? 6.693   10.424  82.968  1.00 32.92  ? 628 GLU A N   1 
ATOM   550  C CA  . GLU A 1 75  ? 5.744   9.920   81.936  1.00 34.74  ? 628 GLU A CA  1 
ATOM   551  C C   . GLU A 1 75  ? 5.484   8.431   82.068  1.00 31.77  ? 628 GLU A C   1 
ATOM   552  O O   . GLU A 1 75  ? 4.350   7.984   81.905  1.00 28.76  ? 628 GLU A O   1 
ATOM   553  C CB  . GLU A 1 75  ? 6.227   10.198  80.494  1.00 40.66  ? 628 GLU A CB  1 
ATOM   554  C CG  . GLU A 1 75  ? 6.349   11.681  80.098  1.00 43.23  ? 628 GLU A CG  1 
ATOM   555  C CD  . GLU A 1 75  ? 7.031   11.903  78.739  1.00 59.32  ? 628 GLU A CD  1 
ATOM   556  O OE1 . GLU A 1 75  ? 6.485   12.673  77.921  1.00 80.28  ? 628 GLU A OE1 1 
ATOM   557  O OE2 . GLU A 1 75  ? 8.111   11.325  78.486  1.00 65.05  ? 628 GLU A OE2 1 
ATOM   558  N N   . GLU A 1 76  ? 6.521   7.657   82.402  1.00 29.51  ? 629 GLU A N   1 
ATOM   559  C CA  . GLU A 1 76  ? 6.342   6.223   82.624  1.00 25.00  ? 629 GLU A CA  1 
ATOM   560  C C   . GLU A 1 76  ? 5.294   5.969   83.745  1.00 28.31  ? 629 GLU A C   1 
ATOM   561  O O   . GLU A 1 76  ? 4.349   5.191   83.554  1.00 27.76  ? 629 GLU A O   1 
ATOM   562  C CB  . GLU A 1 76  ? 7.677   5.552   82.912  1.00 33.61  ? 629 GLU A CB  1 
ATOM   563  C CG  . GLU A 1 76  ? 7.718   4.087   82.619  1.00 35.64  ? 629 GLU A CG  1 
ATOM   564  C CD  . GLU A 1 76  ? 9.096   3.493   82.862  1.00 45.02  ? 629 GLU A CD  1 
ATOM   565  O OE1 . GLU A 1 76  ? 10.131  4.203   82.747  1.00 46.56  ? 629 GLU A OE1 1 
ATOM   566  O OE2 . GLU A 1 76  ? 9.137   2.290   83.178  1.00 56.53  ? 629 GLU A OE2 1 
ATOM   567  N N   . ASP A 1 77  ? 5.413   6.670   84.873  1.00 27.21  ? 630 ASP A N   1 
ATOM   568  C CA  . ASP A 1 77  ? 4.431   6.504   85.952  1.00 28.53  ? 630 ASP A CA  1 
ATOM   569  C C   . ASP A 1 77  ? 3.070   7.013   85.505  1.00 30.07  ? 630 ASP A C   1 
ATOM   570  O O   . ASP A 1 77  ? 2.077   6.376   85.826  1.00 26.02  ? 630 ASP A O   1 
ATOM   571  C CB  . ASP A 1 77  ? 4.839   7.166   87.289  1.00 29.81  ? 630 ASP A CB  1 
ATOM   572  C CG  . ASP A 1 77  ? 5.911   6.380   88.044  1.00 40.78  ? 630 ASP A CG  1 
ATOM   573  O OD1 . ASP A 1 77  ? 6.146   5.194   87.725  1.00 43.20  ? 630 ASP A OD1 1 
ATOM   574  O OD2 . ASP A 1 77  ? 6.526   6.965   88.960  1.00 35.41  ? 630 ASP A OD2 1 
ATOM   575  N N   . PHE A 1 78  ? 3.004   8.127   84.772  1.00 25.00  ? 631 PHE A N   1 
ATOM   576  C CA  . PHE A 1 78  ? 1.685   8.594   84.312  1.00 25.75  ? 631 PHE A CA  1 
ATOM   577  C C   . PHE A 1 78  ? 1.035   7.548   83.422  1.00 28.86  ? 631 PHE A C   1 
ATOM   578  O O   . PHE A 1 78  ? -0.154  7.245   83.598  1.00 37.86  ? 631 PHE A O   1 
ATOM   579  C CB  . PHE A 1 78  ? 1.742   9.953   83.610  1.00 28.18  ? 631 PHE A CB  1 
ATOM   580  C CG  . PHE A 1 78  ? 0.414   10.407  83.045  1.00 21.25  ? 631 PHE A CG  1 
ATOM   581  C CD1 . PHE A 1 78  ? 0.251   10.550  81.685  1.00 43.52  ? 631 PHE A CD1 1 
ATOM   582  C CD2 . PHE A 1 78  ? -0.669  10.642  83.857  1.00 30.04  ? 631 PHE A CD2 1 
ATOM   583  C CE1 . PHE A 1 78  ? -0.941  10.942  81.160  1.00 26.46  ? 631 PHE A CE1 1 
ATOM   584  C CE2 . PHE A 1 78  ? -1.894  11.050  83.315  1.00 22.87  ? 631 PHE A CE2 1 
ATOM   585  C CZ  . PHE A 1 78  ? -2.018  11.207  81.990  1.00 34.67  ? 631 PHE A CZ  1 
ATOM   586  N N   . ASP A 1 79  ? 1.803   6.982   82.491  1.00 26.98  ? 632 ASP A N   1 
ATOM   587  C CA  . ASP A 1 79  ? 1.306   5.902   81.634  1.00 31.59  ? 632 ASP A CA  1 
ATOM   588  C C   . ASP A 1 79  ? 0.713   4.692   82.386  1.00 35.10  ? 632 ASP A C   1 
ATOM   589  O O   . ASP A 1 79  ? -0.349  4.165   81.979  1.00 31.83  ? 632 ASP A O   1 
ATOM   590  C CB  . ASP A 1 79  ? 2.385   5.451   80.653  1.00 39.95  ? 632 ASP A CB  1 
ATOM   591  C CG  . ASP A 1 79  ? 2.512   6.388   79.457  1.00 43.23  ? 632 ASP A CG  1 
ATOM   592  O OD1 . ASP A 1 79  ? 1.908   7.482   79.491  1.00 45.26  ? 632 ASP A OD1 1 
ATOM   593  O OD2 . ASP A 1 79  ? 3.230   6.042   78.492  1.00 69.33  ? 632 ASP A OD2 1 
ATOM   594  N N   . LEU A 1 80  ? 1.383   4.281   83.469  1.00 33.15  ? 633 LEU A N   1 
ATOM   595  C CA  . LEU A 1 80  ? 0.895   3.245   84.389  1.00 33.93  ? 633 LEU A CA  1 
ATOM   596  C C   . LEU A 1 80  ? -0.525  3.545   84.887  1.00 37.62  ? 633 LEU A C   1 
ATOM   597  O O   . LEU A 1 80  ? -1.377  2.662   84.885  1.00 39.54  ? 633 LEU A O   1 
ATOM   598  C CB  . LEU A 1 80  ? 1.823   3.109   85.603  1.00 34.78  ? 633 LEU A CB  1 
ATOM   599  C CG  . LEU A 1 80  ? 3.176   2.422   85.468  1.00 35.39  ? 633 LEU A CG  1 
ATOM   600  C CD1 . LEU A 1 80  ? 3.921   2.448   86.786  1.00 32.62  ? 633 LEU A CD1 1 
ATOM   601  C CD2 . LEU A 1 80  ? 2.960   0.959   85.022  1.00 37.47  ? 633 LEU A CD2 1 
ATOM   602  N N   . ILE A 1 81  ? -0.778  4.789   85.303  1.00 34.32  ? 634 ILE A N   1 
ATOM   603  C CA  . ILE A 1 81  ? -2.100  5.185   85.824  1.00 27.34  ? 634 ILE A CA  1 
ATOM   604  C C   . ILE A 1 81  ? -3.184  4.885   84.815  1.00 35.56  ? 634 ILE A C   1 
ATOM   605  O O   . ILE A 1 81  ? -4.254  4.266   85.145  1.00 27.73  ? 634 ILE A O   1 
ATOM   606  C CB  . ILE A 1 81  ? -2.158  6.698   86.156  1.00 31.96  ? 634 ILE A CB  1 
ATOM   607  C CG1 . ILE A 1 81  ? -1.296  7.019   87.391  1.00 22.91  ? 634 ILE A CG1 1 
ATOM   608  C CG2 . ILE A 1 81  ? -3.595  7.157   86.312  1.00 17.53  ? 634 ILE A CG2 1 
ATOM   609  C CD1 . ILE A 1 81  ? -1.416  8.459   87.903  1.00 28.21  ? 634 ILE A CD1 1 
ATOM   610  N N   . ILE A 1 82  ? -2.900  5.351   83.599  1.00 29.80  ? 635 ILE A N   1 
ATOM   611  C CA  . ILE A 1 82  ? -3.772  5.177   82.444  1.00 32.26  ? 635 ILE A CA  1 
ATOM   612  C C   . ILE A 1 82  ? -3.930  3.679   82.052  1.00 38.37  ? 635 ILE A C   1 
ATOM   613  O O   . ILE A 1 82  ? -5.055  3.102   81.997  1.00 32.64  ? 635 ILE A O   1 
ATOM   614  C CB  . ILE A 1 82  ? -3.199  5.978   81.248  1.00 30.13  ? 635 ILE A CB  1 
ATOM   615  C CG1 . ILE A 1 82  ? -3.146  7.488   81.560  1.00 25.91  ? 635 ILE A CG1 1 
ATOM   616  C CG2 . ILE A 1 82  ? -4.035  5.762   79.999  1.00 31.11  ? 635 ILE A CG2 1 
ATOM   617  C CD1 . ILE A 1 82  ? -4.515  8.084   82.041  1.00 27.14  ? 635 ILE A CD1 1 
ATOM   618  N N   . ASP A 1 83  ? -2.791  3.048   81.808  1.00 33.37  ? 636 ASP A N   1 
ATOM   619  C CA  . ASP A 1 83  ? -2.775  1.688   81.285  1.00 40.08  ? 636 ASP A CA  1 
ATOM   620  C C   . ASP A 1 83  ? -3.393  0.728   82.308  1.00 41.72  ? 636 ASP A C   1 
ATOM   621  O O   . ASP A 1 83  ? -4.102  -0.200  81.933  1.00 46.03  ? 636 ASP A O   1 
ATOM   622  C CB  . ASP A 1 83  ? -1.332  1.249   80.932  1.00 46.50  ? 636 ASP A CB  1 
ATOM   623  C CG  . ASP A 1 83  ? -0.655  2.152   79.865  1.00 40.36  ? 636 ASP A CG  1 
ATOM   624  O OD1 . ASP A 1 83  ? -1.336  2.872   79.097  1.00 50.29  ? 636 ASP A OD1 1 
ATOM   625  O OD2 . ASP A 1 83  ? 0.585   2.137   79.802  1.00 48.97  ? 636 ASP A OD2 1 
ATOM   626  N N   . ASN A 1 84  ? -3.145  0.951   83.603  1.00 36.50  ? 637 ASN A N   1 
ATOM   627  C CA  . ASN A 1 84  ? -3.677  0.052   84.597  1.00 37.19  ? 637 ASN A CA  1 
ATOM   628  C C   . ASN A 1 84  ? -5.203  0.073   84.585  1.00 43.25  ? 637 ASN A C   1 
ATOM   629  O O   . ASN A 1 84  ? -5.822  -0.973  84.702  1.00 39.32  ? 637 ASN A O   1 
ATOM   630  C CB  . ASN A 1 84  ? -3.170  0.389   85.989  1.00 35.27  ? 637 ASN A CB  1 
ATOM   631  C CG  . ASN A 1 84  ? -1.728  -0.030  86.201  1.00 47.75  ? 637 ASN A CG  1 
ATOM   632  O OD1 . ASN A 1 84  ? -1.169  -0.795  85.417  1.00 28.66  ? 637 ASN A OD1 1 
ATOM   633  N ND2 . ASN A 1 84  ? -1.115  0.488   87.264  1.00 25.22  ? 637 ASN A ND2 1 
ATOM   634  N N   . CYS A 1 85  ? -5.777  1.275   84.448  1.00 40.23  ? 638 CYS A N   1 
ATOM   635  C CA  . CYS A 1 85  ? -7.226  1.481   84.463  1.00 45.45  ? 638 CYS A CA  1 
ATOM   636  C C   . CYS A 1 85  ? -7.861  0.833   83.248  1.00 40.82  ? 638 CYS A C   1 
ATOM   637  O O   . CYS A 1 85  ? -8.935  0.247   83.351  1.00 47.20  ? 638 CYS A O   1 
ATOM   638  C CB  . CYS A 1 85  ? -7.548  2.987   84.512  1.00 37.19  ? 638 CYS A CB  1 
ATOM   639  S SG  . CYS A 1 85  ? -9.274  3.422   84.491  1.00 36.98  ? 638 CYS A SG  1 
ATOM   640  N N   . MET A 1 86  ? -7.183  0.923   82.111  1.00 39.10  ? 639 MET A N   1 
ATOM   641  C CA  . MET A 1 86  ? -7.708  0.356   80.872  1.00 43.75  ? 639 MET A CA  1 
ATOM   642  C C   . MET A 1 86  ? -7.582  -1.179  80.886  1.00 41.55  ? 639 MET A C   1 
ATOM   643  O O   . MET A 1 86  ? -8.495  -1.858  80.436  1.00 38.53  ? 639 MET A O   1 
ATOM   644  C CB  . MET A 1 86  ? -7.073  1.028   79.636  1.00 40.92  ? 639 MET A CB  1 
ATOM   645  C CG  . MET A 1 86  ? -7.397  2.548   79.551  1.00 46.65  ? 639 MET A CG  1 
ATOM   646  S SD  . MET A 1 86  ? -6.850  3.554   78.135  1.00 49.62  ? 639 MET A SD  1 
ATOM   647  C CE  . MET A 1 86  ? -5.185  2.904   77.911  1.00 70.06  ? 639 MET A CE  1 
ATOM   648  N N   . LYS A 1 87  ? -6.502  -1.720  81.460  1.00 38.52  ? 640 LYS A N   1 
ATOM   649  C CA  . LYS A 1 87  ? -6.371  -3.174  81.632  1.00 39.04  ? 640 LYS A CA  1 
ATOM   650  C C   . LYS A 1 87  ? -7.391  -3.736  82.613  1.00 40.97  ? 640 LYS A C   1 
ATOM   651  O O   . LYS A 1 87  ? -7.930  -4.795  82.378  1.00 39.51  ? 640 LYS A O   1 
ATOM   652  C CB  . LYS A 1 87  ? -4.959  -3.610  82.087  1.00 41.54  ? 640 LYS A CB  1 
ATOM   653  C CG  . LYS A 1 87  ? -3.863  -3.591  80.990  1.00 43.55  ? 640 LYS A CG  1 
ATOM   654  C CD  . LYS A 1 87  ? -2.839  -4.734  81.149  1.00 61.81  ? 640 LYS A CD  1 
ATOM   655  C CE  . LYS A 1 87  ? -1.892  -4.570  82.343  1.00 64.84  ? 640 LYS A CE  1 
ATOM   656  N NZ  . LYS A 1 87  ? -0.664  -3.758  82.065  1.00 47.39  ? 640 LYS A NZ  1 
ATOM   657  N N   . TYR A 1 88  ? -7.661  -3.046  83.715  1.00 42.36  ? 641 TYR A N   1 
ATOM   658  C CA  . TYR A 1 88  ? -8.608  -3.593  84.707  1.00 40.07  ? 641 TYR A CA  1 
ATOM   659  C C   . TYR A 1 88  ? -10.059 -3.391  84.309  1.00 42.61  ? 641 TYR A C   1 
ATOM   660  O O   . TYR A 1 88  ? -10.848 -4.319  84.417  1.00 46.87  ? 641 TYR A O   1 
ATOM   661  C CB  . TYR A 1 88  ? -8.360  -3.042  86.124  1.00 40.47  ? 641 TYR A CB  1 
ATOM   662  C CG  . TYR A 1 88  ? -9.232  -3.703  87.162  1.00 40.82  ? 641 TYR A CG  1 
ATOM   663  C CD1 . TYR A 1 88  ? -8.946  -4.992  87.611  1.00 47.50  ? 641 TYR A CD1 1 
ATOM   664  C CD2 . TYR A 1 88  ? -10.364 -3.057  87.672  1.00 40.18  ? 641 TYR A CD2 1 
ATOM   665  C CE1 . TYR A 1 88  ? -9.751  -5.625  88.539  1.00 36.92  ? 641 TYR A CE1 1 
ATOM   666  C CE2 . TYR A 1 88  ? -11.180 -3.676  88.596  1.00 32.59  ? 641 TYR A CE2 1 
ATOM   667  C CZ  . TYR A 1 88  ? -10.870 -4.974  89.023  1.00 44.47  ? 641 TYR A CZ  1 
ATOM   668  O OH  . TYR A 1 88  ? -11.660 -5.613  89.948  1.00 39.64  ? 641 TYR A OH  1 
ATOM   669  N N   . ASN A 1 89  ? -10.428 -2.197  83.851  1.00 40.70  ? 642 ASN A N   1 
ATOM   670  C CA  . ASN A 1 89  ? -11.830 -1.933  83.586  1.00 39.45  ? 642 ASN A CA  1 
ATOM   671  C C   . ASN A 1 89  ? -12.205 -2.151  82.132  1.00 41.10  ? 642 ASN A C   1 
ATOM   672  O O   . ASN A 1 89  ? -11.446 -1.828  81.233  1.00 44.46  ? 642 ASN A O   1 
ATOM   673  C CB  . ASN A 1 89  ? -12.205 -0.530  84.035  1.00 35.30  ? 642 ASN A CB  1 
ATOM   674  C CG  . ASN A 1 89  ? -11.832 -0.256  85.510  1.00 45.06  ? 642 ASN A CG  1 
ATOM   675  O OD1 . ASN A 1 89  ? -12.597 -0.556  86.440  1.00 41.73  ? 642 ASN A OD1 1 
ATOM   676  N ND2 . ASN A 1 89  ? -10.660 0.328   85.720  1.00 42.40  ? 642 ASN A ND2 1 
ATOM   677  N N   . ALA A 1 90  ? -13.403 -2.695  81.924  1.00 50.61  ? 643 ALA A N   1 
ATOM   678  C CA  . ALA A 1 90  ? -13.981 -2.905  80.591  1.00 52.60  ? 643 ALA A CA  1 
ATOM   679  C C   . ALA A 1 90  ? -14.162 -1.593  79.855  1.00 48.53  ? 643 ALA A C   1 
ATOM   680  O O   . ALA A 1 90  ? -14.414 -0.578  80.493  1.00 40.00  ? 643 ALA A O   1 
ATOM   681  C CB  . ALA A 1 90  ? -15.347 -3.601  80.720  1.00 58.07  ? 643 ALA A CB  1 
ATOM   682  N N   . ARG A 1 91  ? -14.060 -1.626  78.519  1.00 52.88  ? 644 ARG A N   1 
ATOM   683  C CA  . ARG A 1 91  ? -14.312 -0.443  77.674  1.00 58.23  ? 644 ARG A CA  1 
ATOM   684  C C   . ARG A 1 91  ? -15.652 0.261   77.978  1.00 63.48  ? 644 ARG A C   1 
ATOM   685  O O   . ARG A 1 91  ? -15.802 1.459   77.723  1.00 64.65  ? 644 ARG A O   1 
ATOM   686  C CB  . ARG A 1 91  ? -14.236 -0.813  76.184  1.00 57.74  ? 644 ARG A CB  1 
ATOM   687  N N   . ASP A 1 92  ? -16.591 -0.484  78.566  1.00 69.71  ? 645 ASP A N   1 
ATOM   688  C CA  . ASP A 1 92  ? -17.987 -0.050  78.791  1.00 72.91  ? 645 ASP A CA  1 
ATOM   689  C C   . ASP A 1 92  ? -18.167 0.926   79.965  1.00 70.76  ? 645 ASP A C   1 
ATOM   690  O O   . ASP A 1 92  ? -19.259 1.479   80.164  1.00 72.14  ? 645 ASP A O   1 
ATOM   691  C CB  . ASP A 1 92  ? -18.854 -1.312  79.043  1.00 75.50  ? 645 ASP A CB  1 
ATOM   692  C CG  . ASP A 1 92  ? -20.349 -1.080  78.809  1.00 85.58  ? 645 ASP A CG  1 
ATOM   693  O OD1 . ASP A 1 92  ? -20.696 -0.240  77.952  1.00 97.73  ? 645 ASP A OD1 1 
ATOM   694  O OD2 . ASP A 1 92  ? -21.178 -1.761  79.469  1.00 68.87  ? 645 ASP A OD2 1 
ATOM   695  N N   . THR A 1 93  ? -17.098 1.137   80.734  1.00 65.23  ? 646 THR A N   1 
ATOM   696  C CA  . THR A 1 93  ? -17.199 1.736   82.060  1.00 57.27  ? 646 THR A CA  1 
ATOM   697  C C   . THR A 1 93  ? -16.785 3.190   82.098  1.00 55.12  ? 646 THR A C   1 
ATOM   698  O O   . THR A 1 93  ? -16.238 3.716   81.138  1.00 50.38  ? 646 THR A O   1 
ATOM   699  C CB  . THR A 1 93  ? -16.349 0.954   83.051  1.00 61.54  ? 646 THR A CB  1 
ATOM   700  O OG1 . THR A 1 93  ? -14.963 1.016   82.662  1.00 59.74  ? 646 THR A OG1 1 
ATOM   701  C CG2 . THR A 1 93  ? -16.823 -0.516  83.089  1.00 54.23  ? 646 THR A CG2 1 
ATOM   702  N N   . VAL A 1 94  ? -17.077 3.836   83.222  1.00 57.36  ? 647 VAL A N   1 
ATOM   703  C CA  . VAL A 1 94  ? -16.693 5.227   83.472  1.00 53.82  ? 647 VAL A CA  1 
ATOM   704  C C   . VAL A 1 94  ? -15.157 5.314   83.707  1.00 49.95  ? 647 VAL A C   1 
ATOM   705  O O   . VAL A 1 94  ? -14.456 6.200   83.198  1.00 47.52  ? 647 VAL A O   1 
ATOM   706  C CB  . VAL A 1 94  ? -17.492 5.782   84.685  1.00 54.87  ? 647 VAL A CB  1 
ATOM   707  C CG1 . VAL A 1 94  ? -17.304 7.271   84.829  1.00 67.23  ? 647 VAL A CG1 1 
ATOM   708  C CG2 . VAL A 1 94  ? -18.976 5.467   84.528  1.00 51.42  ? 647 VAL A CG2 1 
ATOM   709  N N   . PHE A 1 95  ? -14.625 4.357   84.439  1.00 39.27  ? 648 PHE A N   1 
ATOM   710  C CA  . PHE A 1 95  ? -13.221 4.357   84.707  1.00 39.46  ? 648 PHE A CA  1 
ATOM   711  C C   . PHE A 1 95  ? -12.456 4.303   83.391  1.00 35.76  ? 648 PHE A C   1 
ATOM   712  O O   . PHE A 1 95  ? -11.610 5.128   83.146  1.00 27.97  ? 648 PHE A O   1 
ATOM   713  C CB  . PHE A 1 95  ? -12.847 3.211   85.655  1.00 44.79  ? 648 PHE A CB  1 
ATOM   714  C CG  . PHE A 1 95  ? -13.452 3.330   87.057  1.00 48.14  ? 648 PHE A CG  1 
ATOM   715  C CD1 . PHE A 1 95  ? -13.386 4.521   87.775  1.00 60.26  ? 648 PHE A CD1 1 
ATOM   716  C CD2 . PHE A 1 95  ? -14.055 2.228   87.667  1.00 62.15  ? 648 PHE A CD2 1 
ATOM   717  C CE1 . PHE A 1 95  ? -13.922 4.620   89.056  1.00 34.72  ? 648 PHE A CE1 1 
ATOM   718  C CE2 . PHE A 1 95  ? -14.587 2.319   88.958  1.00 59.39  ? 648 PHE A CE2 1 
ATOM   719  C CZ  . PHE A 1 95  ? -14.517 3.518   89.651  1.00 51.39  ? 648 PHE A CZ  1 
ATOM   720  N N   . TYR A 1 96  ? -12.812 3.388   82.505  1.00 40.61  ? 649 TYR A N   1 
ATOM   721  C CA  . TYR A 1 96  ? -12.156 3.313   81.208  1.00 42.42  ? 649 TYR A CA  1 
ATOM   722  C C   . TYR A 1 96  ? -12.263 4.603   80.378  1.00 43.62  ? 649 TYR A C   1 
ATOM   723  O O   . TYR A 1 96  ? -11.268 5.061   79.817  1.00 45.65  ? 649 TYR A O   1 
ATOM   724  C CB  . TYR A 1 96  ? -12.707 2.140   80.426  1.00 39.79  ? 649 TYR A CB  1 
ATOM   725  C CG  . TYR A 1 96  ? -11.952 1.846   79.166  1.00 41.03  ? 649 TYR A CG  1 
ATOM   726  C CD1 . TYR A 1 96  ? -10.979 0.856   79.127  1.00 56.76  ? 649 TYR A CD1 1 
ATOM   727  C CD2 . TYR A 1 96  ? -12.219 2.555   77.992  1.00 55.35  ? 649 TYR A CD2 1 
ATOM   728  C CE1 . TYR A 1 96  ? -10.289 0.557   77.931  1.00 50.44  ? 649 TYR A CE1 1 
ATOM   729  C CE2 . TYR A 1 96  ? -11.533 2.279   76.805  1.00 52.87  ? 649 TYR A CE2 1 
ATOM   730  C CZ  . TYR A 1 96  ? -10.578 1.278   76.779  1.00 44.51  ? 649 TYR A CZ  1 
ATOM   731  O OH  . TYR A 1 96  ? -9.907  1.017   75.608  1.00 53.56  ? 649 TYR A OH  1 
ATOM   732  N N   . ARG A 1 97  ? -13.462 5.179   80.309  1.00 51.67  ? 650 ARG A N   1 
ATOM   733  C CA  . ARG A 1 97  ? -13.701 6.384   79.522  1.00 53.92  ? 650 ARG A CA  1 
ATOM   734  C C   . ARG A 1 97  ? -12.881 7.539   80.076  1.00 59.10  ? 650 ARG A C   1 
ATOM   735  O O   . ARG A 1 97  ? -12.198 8.226   79.326  1.00 60.96  ? 650 ARG A O   1 
ATOM   736  C CB  . ARG A 1 97  ? -15.194 6.738   79.483  1.00 60.37  ? 650 ARG A CB  1 
ATOM   737  C CG  . ARG A 1 97  ? -16.038 5.789   78.600  1.00 71.67  ? 650 ARG A CG  1 
ATOM   738  C CD  . ARG A 1 97  ? -17.549 5.825   78.915  1.00 79.59  ? 650 ARG A CD  1 
ATOM   739  N NE  . ARG A 1 97  ? -18.074 7.192   78.897  1.00 83.84  ? 650 ARG A NE  1 
ATOM   740  C CZ  . ARG A 1 97  ? -18.567 7.854   79.948  1.00 84.41  ? 650 ARG A CZ  1 
ATOM   741  N NH1 . ARG A 1 97  ? -18.663 7.294   81.152  1.00 86.28  ? 650 ARG A NH1 1 
ATOM   742  N NH2 . ARG A 1 97  ? -18.986 9.100   79.784  1.00 86.18  ? 650 ARG A NH2 1 
ATOM   743  N N   . ALA A 1 98  ? -12.932 7.748   81.390  1.00 59.36  ? 651 ALA A N   1 
ATOM   744  C CA  . ALA A 1 98  ? -12.188 8.854   82.012  1.00 51.50  ? 651 ALA A CA  1 
ATOM   745  C C   . ALA A 1 98  ? -10.697 8.732   81.712  1.00 45.35  ? 651 ALA A C   1 
ATOM   746  O O   . ALA A 1 98  ? -10.037 9.716   81.414  1.00 44.21  ? 651 ALA A O   1 
ATOM   747  C CB  . ALA A 1 98  ? -12.425 8.883   83.495  1.00 44.49  ? 651 ALA A CB  1 
ATOM   748  N N   . ALA A 1 99  ? -10.195 7.506   81.752  1.00 41.83  ? 652 ALA A N   1 
ATOM   749  C CA  . ALA A 1 99  ? -8.803  7.225   81.478  1.00 38.70  ? 652 ALA A CA  1 
ATOM   750  C C   . ALA A 1 99  ? -8.437  7.654   80.052  1.00 36.18  ? 652 ALA A C   1 
ATOM   751  O O   . ALA A 1 99  ? -7.428  8.285   79.828  1.00 39.55  ? 652 ALA A O   1 
ATOM   752  C CB  . ALA A 1 99  ? -8.532  5.752   81.697  1.00 38.02  ? 652 ALA A CB  1 
ATOM   753  N N   . VAL A 1 100 ? -9.289  7.349   79.094  1.00 46.69  ? 653 VAL A N   1 
ATOM   754  C CA  . VAL A 1 100 ? -9.026  7.746   77.713  1.00 49.65  ? 653 VAL A CA  1 
ATOM   755  C C   . VAL A 1 100 ? -9.003  9.283   77.607  1.00 43.56  ? 653 VAL A C   1 
ATOM   756  O O   . VAL A 1 100 ? -8.075  9.859   77.037  1.00 44.19  ? 653 VAL A O   1 
ATOM   757  C CB  . VAL A 1 100 ? -10.032 7.076   76.719  1.00 52.84  ? 653 VAL A CB  1 
ATOM   758  C CG1 . VAL A 1 100 ? -9.680  7.395   75.258  1.00 44.75  ? 653 VAL A CG1 1 
ATOM   759  C CG2 . VAL A 1 100 ? -10.028 5.583   76.903  1.00 52.38  ? 653 VAL A CG2 1 
ATOM   760  N N   . ARG A 1 101 ? -10.010 9.928   78.183  1.00 39.07  ? 654 ARG A N   1 
ATOM   761  C CA  . ARG A 1 101 ? -10.114 11.409  78.238  1.00 44.50  ? 654 ARG A CA  1 
ATOM   762  C C   . ARG A 1 101 ? -8.846  12.026  78.858  1.00 46.62  ? 654 ARG A C   1 
ATOM   763  O O   . ARG A 1 101 ? -8.288  13.003  78.334  1.00 39.52  ? 654 ARG A O   1 
ATOM   764  C CB  . ARG A 1 101 ? -11.344 11.810  79.066  1.00 41.75  ? 654 ARG A CB  1 
ATOM   765  C CG  . ARG A 1 101 ? -11.943 13.168  78.775  1.00 62.37  ? 654 ARG A CG  1 
ATOM   766  C CD  . ARG A 1 101 ? -13.487 13.155  78.932  1.00 60.72  ? 654 ARG A CD  1 
ATOM   767  N N   . LEU A 1 102 ? -8.397  11.430  79.969  1.00 43.45  ? 655 LEU A N   1 
ATOM   768  C CA  . LEU A 1 102 ? -7.218  11.907  80.684  1.00 39.22  ? 655 LEU A CA  1 
ATOM   769  C C   . LEU A 1 102 ? -5.942  11.639  79.894  1.00 38.94  ? 655 LEU A C   1 
ATOM   770  O O   . LEU A 1 102 ? -5.029  12.461  79.918  1.00 37.05  ? 655 LEU A O   1 
ATOM   771  C CB  . LEU A 1 102 ? -7.107  11.263  82.066  1.00 39.84  ? 655 LEU A CB  1 
ATOM   772  C CG  . LEU A 1 102 ? -5.973  11.792  82.972  1.00 46.85  ? 655 LEU A CG  1 
ATOM   773  C CD1 . LEU A 1 102 ? -6.257  13.220  83.350  1.00 39.27  ? 655 LEU A CD1 1 
ATOM   774  C CD2 . LEU A 1 102 ? -5.779  10.933  84.219  1.00 32.59  ? 655 LEU A CD2 1 
ATOM   775  N N   . ARG A 1 103 ? -5.876  10.507  79.196  1.00 41.42  ? 656 ARG A N   1 
ATOM   776  C CA  . ARG A 1 103 ? -4.699  10.189  78.371  1.00 45.06  ? 656 ARG A CA  1 
ATOM   777  C C   . ARG A 1 103 ? -4.542  11.219  77.247  1.00 44.93  ? 656 ARG A C   1 
ATOM   778  O O   . ARG A 1 103 ? -3.489  11.837  77.081  1.00 45.11  ? 656 ARG A O   1 
ATOM   779  C CB  . ARG A 1 103 ? -4.829  8.791   77.789  1.00 43.51  ? 656 ARG A CB  1 
ATOM   780  C CG  . ARG A 1 103 ? -3.639  8.328   76.955  1.00 49.37  ? 656 ARG A CG  1 
ATOM   781  C CD  . ARG A 1 103 ? -4.036  7.127   76.130  1.00 57.59  ? 656 ARG A CD  1 
ATOM   782  N NE  . ARG A 1 103 ? -5.085  7.478   75.168  1.00 57.59  ? 656 ARG A NE  1 
ATOM   783  C CZ  . ARG A 1 103 ? -5.699  6.615   74.364  1.00 55.45  ? 656 ARG A CZ  1 
ATOM   784  N NH1 . ARG A 1 103 ? -6.631  7.061   73.529  1.00 58.67  ? 656 ARG A NH1 1 
ATOM   785  N NH2 . ARG A 1 103 ? -5.391  5.313   74.395  1.00 50.50  ? 656 ARG A NH2 1 
ATOM   786  N N   . ASP A 1 104 ? -5.613  11.398  76.492  1.00 44.05  ? 657 ASP A N   1 
ATOM   787  C CA  . ASP A 1 104 ? -5.662  12.417  75.450  1.00 46.57  ? 657 ASP A CA  1 
ATOM   788  C C   . ASP A 1 104 ? -5.320  13.817  75.975  1.00 44.41  ? 657 ASP A C   1 
ATOM   789  O O   . ASP A 1 104 ? -4.368  14.434  75.504  1.00 48.91  ? 657 ASP A O   1 
ATOM   790  C CB  . ASP A 1 104 ? -7.049  12.424  74.799  1.00 50.64  ? 657 ASP A CB  1 
ATOM   791  C CG  . ASP A 1 104 ? -7.337  11.149  73.995  1.00 58.04  ? 657 ASP A CG  1 
ATOM   792  O OD1 . ASP A 1 104 ? -6.402  10.327  73.815  1.00 55.51  ? 657 ASP A OD1 1 
ATOM   793  O OD2 . ASP A 1 104 ? -8.501  10.981  73.540  1.00 49.65  ? 657 ASP A OD2 1 
ATOM   794  N N   . GLN A 1 105 ? -6.063  14.304  76.971  1.00 38.90  ? 658 GLN A N   1 
ATOM   795  C CA  . GLN A 1 105 ? -5.825  15.638  77.501  1.00 31.60  ? 658 GLN A CA  1 
ATOM   796  C C   . GLN A 1 105 ? -4.393  15.820  78.066  1.00 34.44  ? 658 GLN A C   1 
ATOM   797  O O   . GLN A 1 105 ? -3.771  16.887  77.894  1.00 36.83  ? 658 GLN A O   1 
ATOM   798  C CB  . GLN A 1 105 ? -6.906  15.987  78.517  1.00 36.16  ? 658 GLN A CB  1 
ATOM   799  C CG  . GLN A 1 105 ? -8.285  16.196  77.853  1.00 42.18  ? 658 GLN A CG  1 
ATOM   800  C CD  . GLN A 1 105 ? -9.395  16.513  78.837  1.00 42.44  ? 658 GLN A CD  1 
ATOM   801  O OE1 . GLN A 1 105 ? -9.216  16.415  80.038  1.00 53.28  ? 658 GLN A OE1 1 
ATOM   802  N NE2 . GLN A 1 105 ? -10.560 16.875  78.321  1.00 52.23  ? 658 GLN A NE2 1 
ATOM   803  N N   . GLY A 1 106 ? -3.843  14.771  78.672  1.00 38.59  ? 659 GLY A N   1 
ATOM   804  C CA  . GLY A 1 106 ? -2.522  14.849  79.318  1.00 34.51  ? 659 GLY A CA  1 
ATOM   805  C C   . GLY A 1 106 ? -1.373  14.713  78.351  1.00 44.14  ? 659 GLY A C   1 
ATOM   806  O O   . GLY A 1 106 ? -0.228  15.142  78.630  1.00 44.38  ? 659 GLY A O   1 
ATOM   807  N N   . GLY A 1 107 ? -1.660  14.078  77.219  1.00 45.58  ? 660 GLY A N   1 
ATOM   808  C CA  . GLY A 1 107 ? -0.715  14.052  76.123  1.00 43.17  ? 660 GLY A CA  1 
ATOM   809  C C   . GLY A 1 107 ? -0.337  15.473  75.753  1.00 42.71  ? 660 GLY A C   1 
ATOM   810  O O   . GLY A 1 107 ? 0.843   15.770  75.536  1.00 40.89  ? 660 GLY A O   1 
ATOM   811  N N   . VAL A 1 108 ? -1.341  16.351  75.682  1.00 40.39  ? 661 VAL A N   1 
ATOM   812  C CA  . VAL A 1 108 ? -1.112  17.744  75.304  1.00 44.35  ? 661 VAL A CA  1 
ATOM   813  C C   . VAL A 1 108 ? -0.145  18.345  76.290  1.00 35.17  ? 661 VAL A C   1 
ATOM   814  O O   . VAL A 1 108 ? 0.820   19.009  75.922  1.00 36.10  ? 661 VAL A O   1 
ATOM   815  C CB  . VAL A 1 108 ? -2.415  18.620  75.326  1.00 48.03  ? 661 VAL A CB  1 
ATOM   816  C CG1 . VAL A 1 108 ? -2.074  20.106  75.110  1.00 44.04  ? 661 VAL A CG1 1 
ATOM   817  C CG2 . VAL A 1 108 ? -3.426  18.153  74.282  1.00 48.52  ? 661 VAL A CG2 1 
ATOM   818  N N   . VAL A 1 109 ? -0.416  18.100  77.558  1.00 33.38  ? 662 VAL A N   1 
ATOM   819  C CA  . VAL A 1 109 ? 0.354   18.727  78.615  1.00 33.50  ? 662 VAL A CA  1 
ATOM   820  C C   . VAL A 1 109 ? 1.793   18.166  78.645  1.00 28.80  ? 662 VAL A C   1 
ATOM   821  O O   . VAL A 1 109 ? 2.736   18.906  78.861  1.00 30.08  ? 662 VAL A O   1 
ATOM   822  C CB  . VAL A 1 109 ? -0.364  18.614  79.987  1.00 30.12  ? 662 VAL A CB  1 
ATOM   823  C CG1 . VAL A 1 109 ? 0.321   19.469  81.014  1.00 29.60  ? 662 VAL A CG1 1 
ATOM   824  C CG2 . VAL A 1 109 ? -1.862  19.041  79.853  1.00 34.02  ? 662 VAL A CG2 1 
ATOM   825  N N   . LEU A 1 110 ? 1.969   16.884  78.386  1.00 29.12  ? 663 LEU A N   1 
ATOM   826  C CA  . LEU A 1 110 ? 3.317   16.306  78.496  1.00 33.88  ? 663 LEU A CA  1 
ATOM   827  C C   . LEU A 1 110 ? 4.138   16.726  77.291  1.00 33.51  ? 663 LEU A C   1 
ATOM   828  O O   . LEU A 1 110 ? 5.323   17.023  77.408  1.00 36.03  ? 663 LEU A O   1 
ATOM   829  C CB  . LEU A 1 110 ? 3.271   14.782  78.649  1.00 26.92  ? 663 LEU A CB  1 
ATOM   830  C CG  . LEU A 1 110 ? 2.756   14.423  80.051  1.00 28.79  ? 663 LEU A CG  1 
ATOM   831  C CD1 . LEU A 1 110 ? 2.212   13.009  80.075  1.00 33.54  ? 663 LEU A CD1 1 
ATOM   832  C CD2 . LEU A 1 110 ? 3.905   14.594  81.049  1.00 45.39  ? 663 LEU A CD2 1 
ATOM   833  N N   . ARG A 1 111 ? 3.479   16.815  76.144  1.00 35.80  ? 664 ARG A N   1 
ATOM   834  C CA  . ARG A 1 111 ? 4.129   17.319  74.952  1.00 40.66  ? 664 ARG A CA  1 
ATOM   835  C C   . ARG A 1 111 ? 4.573   18.745  75.194  1.00 38.98  ? 664 ARG A C   1 
ATOM   836  O O   . ARG A 1 111 ? 5.697   19.096  74.854  1.00 32.66  ? 664 ARG A O   1 
ATOM   837  C CB  . ARG A 1 111 ? 3.224   17.189  73.729  1.00 44.19  ? 664 ARG A CB  1 
ATOM   838  C CG  . ARG A 1 111 ? 3.417   15.854  72.985  1.00 60.51  ? 664 ARG A CG  1 
ATOM   839  C CD  . ARG A 1 111 ? 2.122   15.252  72.446  1.00 60.59  ? 664 ARG A CD  1 
ATOM   840  N NE  . ARG A 1 111 ? 1.201   16.274  71.961  1.00 60.77  ? 664 ARG A NE  1 
ATOM   841  C CZ  . ARG A 1 111 ? -0.117  16.105  71.838  1.00 64.97  ? 664 ARG A CZ  1 
ATOM   842  N NH1 . ARG A 1 111 ? -0.877  17.113  71.404  1.00 62.72  ? 664 ARG A NH1 1 
ATOM   843  N NH2 . ARG A 1 111 ? -0.682  14.940  72.151  1.00 44.21  ? 664 ARG A NH2 1 
ATOM   844  N N   . GLN A 1 112 ? 3.723   19.554  75.824  1.00 36.56  ? 665 GLN A N   1 
ATOM   845  C CA  . GLN A 1 112 ? 4.157   20.893  76.228  1.00 36.61  ? 665 GLN A CA  1 
ATOM   846  C C   . GLN A 1 112 ? 5.345   20.841  77.180  1.00 37.21  ? 665 GLN A C   1 
ATOM   847  O O   . GLN A 1 112 ? 6.276   21.628  77.044  1.00 27.15  ? 665 GLN A O   1 
ATOM   848  C CB  . GLN A 1 112 ? 3.033   21.699  76.874  1.00 40.86  ? 665 GLN A CB  1 
ATOM   849  C CG  . GLN A 1 112 ? 3.439   23.122  77.173  1.00 42.48  ? 665 GLN A CG  1 
ATOM   850  C CD  . GLN A 1 112 ? 3.829   23.896  75.904  1.00 64.21  ? 665 GLN A CD  1 
ATOM   851  O OE1 . GLN A 1 112 ? 3.243   23.703  74.830  1.00 61.32  ? 665 GLN A OE1 1 
ATOM   852  N NE2 . GLN A 1 112 ? 4.823   24.768  76.029  1.00 45.04  ? 665 GLN A NE2 1 
ATOM   853  N N   . ALA A 1 113 ? 5.319   19.900  78.128  1.00 37.95  ? 666 ALA A N   1 
ATOM   854  C CA  . ALA A 1 113 ? 6.425   19.748  79.080  1.00 37.24  ? 666 ALA A CA  1 
ATOM   855  C C   . ALA A 1 113 ? 7.744   19.413  78.396  1.00 33.73  ? 666 ALA A C   1 
ATOM   856  O O   . ALA A 1 113 ? 8.805   19.923  78.803  1.00 35.28  ? 666 ALA A O   1 
ATOM   857  C CB  . ALA A 1 113 ? 6.094   18.695  80.108  1.00 42.98  ? 666 ALA A CB  1 
ATOM   858  N N   . ARG A 1 114 ? 7.702   18.573  77.359  1.00 29.90  ? 667 ARG A N   1 
ATOM   859  C CA  . ARG A 1 114 ? 8.946   18.235  76.623  1.00 31.30  ? 667 ARG A CA  1 
ATOM   860  C C   . ARG A 1 114 ? 9.556   19.492  75.984  1.00 29.83  ? 667 ARG A C   1 
ATOM   861  O O   . ARG A 1 114 ? 10.741  19.768  76.167  1.00 34.42  ? 667 ARG A O   1 
ATOM   862  C CB  . ARG A 1 114 ? 8.718   17.120  75.593  1.00 36.71  ? 667 ARG A CB  1 
ATOM   863  C CG  . ARG A 1 114 ? 9.997   16.644  74.860  1.00 44.27  ? 667 ARG A CG  1 
ATOM   864  C CD  . ARG A 1 114 ? 10.977  15.870  75.763  1.00 53.19  ? 667 ARG A CD  1 
ATOM   865  N N   . ARG A 1 115 ? 8.735   20.294  75.317  1.00 27.96  ? 668 ARG A N   1 
ATOM   866  C CA  . ARG A 1 115 ? 9.205   21.563  74.742  1.00 35.49  ? 668 ARG A CA  1 
ATOM   867  C C   . ARG A 1 115 ? 9.864   22.424  75.792  1.00 30.57  ? 668 ARG A C   1 
ATOM   868  O O   . ARG A 1 115 ? 10.892  23.074  75.552  1.00 28.36  ? 668 ARG A O   1 
ATOM   869  C CB  . ARG A 1 115 ? 8.046   22.364  74.124  1.00 39.88  ? 668 ARG A CB  1 
ATOM   870  C CG  . ARG A 1 115 ? 7.345   21.647  73.002  1.00 48.73  ? 668 ARG A CG  1 
ATOM   871  C CD  . ARG A 1 115 ? 6.290   22.488  72.365  1.00 43.68  ? 668 ARG A CD  1 
ATOM   872  N NE  . ARG A 1 115 ? 5.439   21.618  71.551  1.00 68.76  ? 668 ARG A NE  1 
ATOM   873  C CZ  . ARG A 1 115 ? 4.127   21.448  71.721  1.00 89.13  ? 668 ARG A CZ  1 
ATOM   874  N NH1 . ARG A 1 115 ? 3.452   22.126  72.651  1.00 91.24  ? 668 ARG A NH1 1 
ATOM   875  N NH2 . ARG A 1 115 ? 3.471   20.603  70.935  1.00 90.93  ? 668 ARG A NH2 1 
ATOM   876  N N   . GLU A 1 116 ? 9.281   22.426  76.973  1.00 29.49  ? 669 GLU A N   1 
ATOM   877  C CA  . GLU A 1 116 ? 9.812   23.258  78.033  1.00 33.17  ? 669 GLU A CA  1 
ATOM   878  C C   . GLU A 1 116 ? 11.113  22.718  78.639  1.00 32.54  ? 669 GLU A C   1 
ATOM   879  O O   . GLU A 1 116 ? 11.993  23.506  78.984  1.00 37.79  ? 669 GLU A O   1 
ATOM   880  C CB  . GLU A 1 116 ? 8.766   23.494  79.101  1.00 36.26  ? 669 GLU A CB  1 
ATOM   881  C CG  . GLU A 1 116 ? 9.080   24.670  80.004  1.00 45.04  ? 669 GLU A CG  1 
ATOM   882  C CD  . GLU A 1 116 ? 9.433   25.970  79.257  1.00 44.54  ? 669 GLU A CD  1 
ATOM   883  O OE1 . GLU A 1 116 ? 8.727   26.371  78.294  1.00 34.43  ? 669 GLU A OE1 1 
ATOM   884  O OE2 . GLU A 1 116 ? 10.431  26.592  79.671  1.00 39.50  ? 669 GLU A OE2 1 
ATOM   885  N N   . VAL A 1 117 ? 11.283  21.403  78.737  1.00 31.59  ? 670 VAL A N   1 
ATOM   886  C CA  . VAL A 1 117 ? 12.602  20.889  79.174  1.00 33.13  ? 670 VAL A CA  1 
ATOM   887  C C   . VAL A 1 117 ? 13.681  21.273  78.139  1.00 38.76  ? 670 VAL A C   1 
ATOM   888  O O   . VAL A 1 117 ? 14.802  21.621  78.511  1.00 46.50  ? 670 VAL A O   1 
ATOM   889  C CB  . VAL A 1 117 ? 12.633  19.354  79.397  1.00 39.07  ? 670 VAL A CB  1 
ATOM   890  C CG1 . VAL A 1 117 ? 14.078  18.869  79.785  1.00 35.04  ? 670 VAL A CG1 1 
ATOM   891  C CG2 . VAL A 1 117 ? 11.613  18.943  80.459  1.00 26.71  ? 670 VAL A CG2 1 
ATOM   892  N N   . ASP A 1 118 ? 13.344  21.217  76.852  1.00 40.69  ? 671 ASP A N   1 
ATOM   893  C CA  . ASP A 1 118 ? 14.243  21.715  75.780  1.00 38.90  ? 671 ASP A CA  1 
ATOM   894  C C   . ASP A 1 118 ? 14.508  23.229  75.906  1.00 37.81  ? 671 ASP A C   1 
ATOM   895  O O   . ASP A 1 118 ? 15.648  23.667  75.824  1.00 34.10  ? 671 ASP A O   1 
ATOM   896  C CB  . ASP A 1 118 ? 13.669  21.441  74.374  1.00 37.02  ? 671 ASP A CB  1 
ATOM   897  C CG  . ASP A 1 118 ? 13.756  19.977  73.944  1.00 55.80  ? 671 ASP A CG  1 
ATOM   898  O OD1 . ASP A 1 118 ? 14.597  19.208  74.471  1.00 54.69  ? 671 ASP A OD1 1 
ATOM   899  O OD2 . ASP A 1 118 ? 12.967  19.608  73.038  1.00 50.10  ? 671 ASP A OD2 1 
ATOM   900  N N   . SER A 1 119 ? 13.449  24.023  76.041  1.00 33.19  ? 672 SER A N   1 
ATOM   901  C CA  . SER A 1 119 ? 13.575  25.492  76.268  1.00 38.92  ? 672 SER A CA  1 
ATOM   902  C C   . SER A 1 119 ? 14.585  25.840  77.382  1.00 41.32  ? 672 SER A C   1 
ATOM   903  O O   . SER A 1 119 ? 15.491  26.651  77.191  1.00 39.13  ? 672 SER A O   1 
ATOM   904  C CB  . SER A 1 119 ? 12.195  26.083  76.604  1.00 35.66  ? 672 SER A CB  1 
ATOM   905  O OG  . SER A 1 119 ? 12.241  27.474  76.820  1.00 42.96  ? 672 SER A OG  1 
ATOM   906  N N   . ILE A 1 120 ? 14.443  25.199  78.537  1.00 42.04  ? 673 ILE A N   1 
ATOM   907  C CA  . ILE A 1 120 ? 15.348  25.446  79.653  1.00 45.94  ? 673 ILE A CA  1 
ATOM   908  C C   . ILE A 1 120 ? 16.749  24.992  79.242  1.00 47.25  ? 673 ILE A C   1 
ATOM   909  O O   . ILE A 1 120 ? 17.750  25.652  79.553  1.00 49.75  ? 673 ILE A O   1 
ATOM   910  C CB  . ILE A 1 120 ? 14.887  24.732  80.944  1.00 46.32  ? 673 ILE A CB  1 
ATOM   911  C CG1 . ILE A 1 120 ? 13.519  25.262  81.400  1.00 58.99  ? 673 ILE A CG1 1 
ATOM   912  C CG2 . ILE A 1 120 ? 15.900  24.932  82.024  1.00 52.09  ? 673 ILE A CG2 1 
ATOM   913  C CD1 . ILE A 1 120 ? 12.754  24.311  82.338  1.00 51.67  ? 673 ILE A CD1 1 
ATOM   914  N N   . GLY A 1 121 ? 16.823  23.891  78.504  1.00 44.98  ? 674 GLY A N   1 
ATOM   915  C CA  . GLY A 1 121 ? 18.104  23.468  77.916  1.00 53.35  ? 674 GLY A CA  1 
ATOM   916  C C   . GLY A 1 121 ? 18.826  24.563  77.113  1.00 53.99  ? 674 GLY A C   1 
ATOM   917  O O   . GLY A 1 121 ? 20.053  24.691  77.185  1.00 56.02  ? 674 GLY A O   1 
ATOM   918  N N   . LEU A 1 122 ? 18.068  25.355  76.353  1.00 48.96  ? 675 LEU A N   1 
ATOM   919  C CA  . LEU A 1 122 ? 18.652  26.436  75.543  1.00 49.08  ? 675 LEU A CA  1 
ATOM   920  C C   . LEU A 1 122 ? 19.120  27.622  76.380  1.00 46.00  ? 675 LEU A C   1 
ATOM   921  O O   . LEU A 1 122 ? 20.153  28.195  76.071  1.00 51.47  ? 675 LEU A O   1 
ATOM   922  C CB  . LEU A 1 122 ? 17.681  26.905  74.438  1.00 47.21  ? 675 LEU A CB  1 
ATOM   923  C CG  . LEU A 1 122 ? 17.486  25.892  73.304  1.00 43.81  ? 675 LEU A CG  1 
ATOM   924  C CD1 . LEU A 1 122 ? 16.550  26.389  72.215  1.00 39.05  ? 675 LEU A CD1 1 
ATOM   925  C CD2 . LEU A 1 122 ? 18.828  25.538  72.713  1.00 39.18  ? 675 LEU A CD2 1 
ATOM   926  N N   . GLU A 1 123 ? 18.392  27.975  77.443  1.00 56.19  ? 676 GLU A N   1 
ATOM   927  C CA  . GLU A 1 123 ? 18.769  29.118  78.297  1.00 61.32  ? 676 GLU A CA  1 
ATOM   928  C C   . GLU A 1 123 ? 20.244  29.095  78.707  1.00 66.33  ? 676 GLU A C   1 
ATOM   929  O O   . GLU A 1 123 ? 20.851  30.158  78.837  1.00 69.69  ? 676 GLU A O   1 
ATOM   930  C CB  . GLU A 1 123 ? 17.895  29.234  79.553  1.00 58.77  ? 676 GLU A CB  1 
ATOM   931  C CG  . GLU A 1 123 ? 18.274  30.456  80.427  1.00 57.91  ? 676 GLU A CG  1 
ATOM   932  C CD  . GLU A 1 123 ? 17.295  30.756  81.551  1.00 76.05  ? 676 GLU A CD  1 
ATOM   933  O OE1 . GLU A 1 123 ? 16.225  30.113  81.618  1.00 74.64  ? 676 GLU A OE1 1 
ATOM   934  O OE2 . GLU A 1 123 ? 17.600  31.653  82.367  1.00 80.47  ? 676 GLU A OE2 1 
ATOM   935  N N   . GLU A 1 124 ? 20.807  27.898  78.894  1.00 74.05  ? 677 GLU A N   1 
ATOM   936  C CA  . GLU A 1 124 ? 22.256  27.704  79.170  1.00 78.49  ? 677 GLU A CA  1 
ATOM   937  C C   . GLU A 1 124 ? 23.089  27.421  77.887  1.00 77.97  ? 677 GLU A C   1 
ATOM   938  O O   . GLU A 1 124 ? 23.285  26.247  77.547  1.00 74.68  ? 677 GLU A O   1 
ATOM   939  C CB  . GLU A 1 124 ? 22.431  26.526  80.151  1.00 78.88  ? 677 GLU A CB  1 
ATOM   940  C CG  . GLU A 1 124 ? 21.497  26.578  81.382  1.00 89.92  ? 677 GLU A CG  1 
ATOM   941  C CD  . GLU A 1 124 ? 20.799  25.248  81.706  1.00 95.99  ? 677 GLU A CD  1 
ATOM   942  O OE1 . GLU A 1 124 ? 21.007  24.243  80.985  1.00 82.75  ? 677 GLU A OE1 1 
ATOM   943  O OE2 . GLU A 1 124 ? 20.026  25.219  82.695  1.00 92.67  ? 677 GLU A OE2 1 
ATOM   944  N N   . ALA A 1 125 ? 23.603  28.440  77.175  1.00 78.04  ? 678 ALA A N   1 
ATOM   945  C CA  . ALA A 1 125 ? 23.497  29.867  77.508  1.00 76.79  ? 678 ALA A CA  1 
ATOM   946  C C   . ALA A 1 125 ? 23.089  30.684  76.280  1.00 73.84  ? 678 ALA A C   1 
ATOM   947  O O   . ALA A 1 125 ? 22.475  31.743  76.416  1.00 66.50  ? 678 ALA A O   1 
ATOM   948  C CB  . ALA A 1 125 ? 24.815  30.392  78.087  1.00 78.84  ? 678 ALA A CB  1 
ATOM   949  N N   . ARG B 1 10  ? 25.335  -22.482 88.896  1.00 56.02  ? 563 ARG B N   1 
ATOM   950  C CA  . ARG B 1 10  ? 24.206  -23.266 89.444  1.00 62.58  ? 563 ARG B CA  1 
ATOM   951  C C   . ARG B 1 10  ? 22.915  -22.463 89.271  1.00 65.18  ? 563 ARG B C   1 
ATOM   952  O O   . ARG B 1 10  ? 22.801  -21.338 89.778  1.00 61.28  ? 563 ARG B O   1 
ATOM   953  C CB  . ARG B 1 10  ? 24.443  -23.608 90.919  1.00 65.97  ? 563 ARG B CB  1 
ATOM   954  N N   . LEU B 1 11  ? 21.960  -23.030 88.529  1.00 61.16  ? 564 LEU B N   1 
ATOM   955  C CA  . LEU B 1 11  ? 20.701  -22.351 88.255  1.00 59.49  ? 564 LEU B CA  1 
ATOM   956  C C   . LEU B 1 11  ? 19.778  -22.479 89.450  1.00 54.48  ? 564 LEU B C   1 
ATOM   957  O O   . LEU B 1 11  ? 19.580  -23.570 89.976  1.00 60.96  ? 564 LEU B O   1 
ATOM   958  C CB  . LEU B 1 11  ? 19.990  -22.958 87.033  1.00 63.26  ? 564 LEU B CB  1 
ATOM   959  C CG  . LEU B 1 11  ? 20.461  -22.679 85.603  1.00 68.35  ? 564 LEU B CG  1 
ATOM   960  C CD1 . LEU B 1 11  ? 20.941  -21.225 85.471  1.00 70.49  ? 564 LEU B CD1 1 
ATOM   961  C CD2 . LEU B 1 11  ? 21.533  -23.681 85.175  1.00 68.10  ? 564 LEU B CD2 1 
ATOM   962  N N   . THR B 1 12  ? 19.166  -21.379 89.850  1.00 52.62  ? 565 THR B N   1 
ATOM   963  C CA  . THR B 1 12  ? 18.231  -21.422 90.950  1.00 49.95  ? 565 THR B CA  1 
ATOM   964  C C   . THR B 1 12  ? 16.856  -21.953 90.537  1.00 50.37  ? 565 THR B C   1 
ATOM   965  O O   . THR B 1 12  ? 16.380  -21.720 89.439  1.00 53.06  ? 565 THR B O   1 
ATOM   966  C CB  . THR B 1 12  ? 18.006  -20.045 91.581  1.00 53.17  ? 565 THR B CB  1 
ATOM   967  O OG1 . THR B 1 12  ? 17.084  -19.298 90.773  1.00 40.03  ? 565 THR B OG1 1 
ATOM   968  C CG2 . THR B 1 12  ? 19.334  -19.306 91.767  1.00 40.43  ? 565 THR B CG2 1 
ATOM   969  N N   . PRO B 1 13  ? 16.183  -22.636 91.454  1.00 49.67  ? 566 PRO B N   1 
ATOM   970  C CA  . PRO B 1 13  ? 14.838  -23.039 91.167  1.00 46.66  ? 566 PRO B CA  1 
ATOM   971  C C   . PRO B 1 13  ? 14.047  -22.057 90.320  1.00 41.05  ? 566 PRO B C   1 
ATOM   972  O O   . PRO B 1 13  ? 13.360  -22.472 89.379  1.00 46.57  ? 566 PRO B O   1 
ATOM   973  C CB  . PRO B 1 13  ? 14.239  -23.164 92.561  1.00 47.26  ? 566 PRO B CB  1 
ATOM   974  C CG  . PRO B 1 13  ? 15.403  -23.704 93.378  1.00 52.07  ? 566 PRO B CG  1 
ATOM   975  C CD  . PRO B 1 13  ? 16.659  -23.201 92.732  1.00 46.48  ? 566 PRO B CD  1 
ATOM   976  N N   . LEU B 1 14  ? 14.119  -20.780 90.645  1.00 38.97  ? 567 LEU B N   1 
ATOM   977  C CA  . LEU B 1 14  ? 13.268  -19.773 89.981  1.00 41.39  ? 567 LEU B CA  1 
ATOM   978  C C   . LEU B 1 14  ? 13.729  -19.541 88.546  1.00 32.80  ? 567 LEU B C   1 
ATOM   979  O O   . LEU B 1 14  ? 12.912  -19.393 87.671  1.00 28.73  ? 567 LEU B O   1 
ATOM   980  C CB  . LEU B 1 14  ? 13.291  -18.442 90.744  1.00 46.17  ? 567 LEU B CB  1 
ATOM   981  C CG  . LEU B 1 14  ? 12.572  -17.229 90.144  1.00 51.20  ? 567 LEU B CG  1 
ATOM   982  C CD1 . LEU B 1 14  ? 11.045  -17.325 90.331  1.00 52.30  ? 567 LEU B CD1 1 
ATOM   983  C CD2 . LEU B 1 14  ? 13.135  -15.921 90.758  1.00 47.42  ? 567 LEU B CD2 1 
ATOM   984  N N   . THR B 1 15  ? 15.040  -19.507 88.317  1.00 27.12  ? 568 THR B N   1 
ATOM   985  C CA  . THR B 1 15  ? 15.570  -19.376 86.976  1.00 34.31  ? 568 THR B CA  1 
ATOM   986  C C   . THR B 1 15  ? 15.091  -20.529 86.060  1.00 31.58  ? 568 THR B C   1 
ATOM   987  O O   . THR B 1 15  ? 14.530  -20.301 84.994  1.00 33.66  ? 568 THR B O   1 
ATOM   988  C CB  . THR B 1 15  ? 17.087  -19.259 87.038  1.00 40.31  ? 568 THR B CB  1 
ATOM   989  O OG1 . THR B 1 15  ? 17.392  -17.957 87.558  1.00 43.22  ? 568 THR B OG1 1 
ATOM   990  C CG2 . THR B 1 15  ? 17.744  -19.443 85.648  1.00 29.27  ? 568 THR B CG2 1 
ATOM   991  N N   . VAL B 1 16  ? 15.259  -21.750 86.528  1.00 28.90  ? 569 VAL B N   1 
ATOM   992  C CA  . VAL B 1 16  ? 14.882  -22.919 85.797  1.00 23.78  ? 569 VAL B CA  1 
ATOM   993  C C   . VAL B 1 16  ? 13.385  -22.877 85.419  1.00 25.45  ? 569 VAL B C   1 
ATOM   994  O O   . VAL B 1 16  ? 13.045  -23.199 84.312  1.00 24.58  ? 569 VAL B O   1 
ATOM   995  C CB  . VAL B 1 16  ? 15.172  -24.146 86.613  1.00 17.97  ? 569 VAL B CB  1 
ATOM   996  C CG1 . VAL B 1 16  ? 14.599  -25.422 85.915  1.00 24.24  ? 569 VAL B CG1 1 
ATOM   997  C CG2 . VAL B 1 16  ? 16.691  -24.243 86.913  1.00 39.29  ? 569 VAL B CG2 1 
ATOM   998  N N   . LEU B 1 17  ? 12.518  -22.419 86.310  1.00 26.75  ? 570 LEU B N   1 
ATOM   999  C CA  . LEU B 1 17  ? 11.070  -22.296 86.018  1.00 31.21  ? 570 LEU B CA  1 
ATOM   1000 C C   . LEU B 1 17  ? 10.707  -21.113 85.059  1.00 36.14  ? 570 LEU B C   1 
ATOM   1001 O O   . LEU B 1 17  ? 9.754   -21.170 84.243  1.00 30.68  ? 570 LEU B O   1 
ATOM   1002 C CB  . LEU B 1 17  ? 10.367  -22.111 87.370  1.00 27.03  ? 570 LEU B CB  1 
ATOM   1003 C CG  . LEU B 1 17  ? 8.884   -22.286 87.653  1.00 51.16  ? 570 LEU B CG  1 
ATOM   1004 C CD1 . LEU B 1 17  ? 8.368   -23.567 87.061  1.00 54.59  ? 570 LEU B CD1 1 
ATOM   1005 C CD2 . LEU B 1 17  ? 8.676   -22.265 89.201  1.00 49.78  ? 570 LEU B CD2 1 
ATOM   1006 N N   . LEU B 1 18  ? 11.436  -20.010 85.175  1.00 36.58  ? 571 LEU B N   1 
ATOM   1007 C CA  . LEU B 1 18  ? 11.147  -18.845 84.312  1.00 37.67  ? 571 LEU B CA  1 
ATOM   1008 C C   . LEU B 1 18  ? 11.615  -19.169 82.888  1.00 33.43  ? 571 LEU B C   1 
ATOM   1009 O O   . LEU B 1 18  ? 10.929  -18.874 81.883  1.00 27.30  ? 571 LEU B O   1 
ATOM   1010 C CB  . LEU B 1 18  ? 11.794  -17.572 84.867  1.00 37.90  ? 571 LEU B CB  1 
ATOM   1011 C CG  . LEU B 1 18  ? 11.155  -17.050 86.162  1.00 29.52  ? 571 LEU B CG  1 
ATOM   1012 C CD1 . LEU B 1 18  ? 11.856  -15.771 86.667  1.00 27.19  ? 571 LEU B CD1 1 
ATOM   1013 C CD2 . LEU B 1 18  ? 9.690   -16.812 85.898  1.00 19.83  ? 571 LEU B CD2 1 
ATOM   1014 N N   . ARG B 1 19  ? 12.737  -19.873 82.818  1.00 25.30  ? 572 ARG B N   1 
ATOM   1015 C CA  . ARG B 1 19  ? 13.299  -20.272 81.536  1.00 31.66  ? 572 ARG B CA  1 
ATOM   1016 C C   . ARG B 1 19  ? 12.313  -21.134 80.767  1.00 27.83  ? 572 ARG B C   1 
ATOM   1017 O O   . ARG B 1 19  ? 11.962  -20.841 79.620  1.00 34.97  ? 572 ARG B O   1 
ATOM   1018 C CB  . ARG B 1 19  ? 14.626  -20.978 81.706  1.00 26.99  ? 572 ARG B CB  1 
ATOM   1019 C CG  . ARG B 1 19  ? 15.110  -21.518 80.399  1.00 48.15  ? 572 ARG B CG  1 
ATOM   1020 C CD  . ARG B 1 19  ? 16.589  -21.458 80.248  1.00 54.69  ? 572 ARG B CD  1 
ATOM   1021 N NE  . ARG B 1 19  ? 16.871  -21.878 78.895  1.00 63.92  ? 572 ARG B NE  1 
ATOM   1022 C CZ  . ARG B 1 19  ? 17.800  -21.354 78.116  1.00 67.29  ? 572 ARG B CZ  1 
ATOM   1023 N NH1 . ARG B 1 19  ? 17.940  -21.815 76.877  1.00 68.64  ? 572 ARG B NH1 1 
ATOM   1024 N NH2 . ARG B 1 19  ? 18.580  -20.377 78.558  1.00 81.13  ? 572 ARG B NH2 1 
ATOM   1025 N N   . SER B 1 20  ? 11.807  -22.155 81.426  1.00 29.09  ? 573 SER B N   1 
ATOM   1026 C CA  . SER B 1 20  ? 10.743  -22.935 80.839  1.00 31.53  ? 573 SER B CA  1 
ATOM   1027 C C   . SER B 1 20  ? 9.559   -22.053 80.456  1.00 22.10  ? 573 SER B C   1 
ATOM   1028 O O   . SER B 1 20  ? 8.951   -22.270 79.401  1.00 23.56  ? 573 SER B O   1 
ATOM   1029 C CB  . SER B 1 20  ? 10.312  -24.054 81.778  1.00 33.24  ? 573 SER B CB  1 
ATOM   1030 O OG  . SER B 1 20  ? 9.098   -24.600 81.332  1.00 29.17  ? 573 SER B OG  1 
ATOM   1031 N N   . VAL B 1 21  ? 9.219   -21.063 81.284  1.00 27.75  ? 574 VAL B N   1 
ATOM   1032 C CA  . VAL B 1 21  ? 8.041   -20.216 80.986  1.00 23.08  ? 574 VAL B CA  1 
ATOM   1033 C C   . VAL B 1 21  ? 8.285   -19.372 79.746  1.00 24.79  ? 574 VAL B C   1 
ATOM   1034 O O   . VAL B 1 21  ? 7.360   -19.097 78.966  1.00 32.33  ? 574 VAL B O   1 
ATOM   1035 C CB  . VAL B 1 21  ? 7.639   -19.245 82.160  1.00 22.48  ? 574 VAL B CB  1 
ATOM   1036 C CG1 . VAL B 1 21  ? 6.653   -18.215 81.651  1.00 20.20  ? 574 VAL B CG1 1 
ATOM   1037 C CG2 . VAL B 1 21  ? 6.990   -20.024 83.274  1.00 23.32  ? 574 VAL B CG2 1 
ATOM   1038 N N   . LEU B 1 22  ? 9.532   -18.933 79.587  1.00 28.55  ? 575 LEU B N   1 
ATOM   1039 C CA  . LEU B 1 22  ? 9.888   -18.006 78.517  1.00 28.09  ? 575 LEU B CA  1 
ATOM   1040 C C   . LEU B 1 22  ? 9.956   -18.756 77.196  1.00 25.70  ? 575 LEU B C   1 
ATOM   1041 O O   . LEU B 1 22  ? 9.424   -18.254 76.196  1.00 24.85  ? 575 LEU B O   1 
ATOM   1042 C CB  . LEU B 1 22  ? 11.207  -17.294 78.798  1.00 26.20  ? 575 LEU B CB  1 
ATOM   1043 C CG  . LEU B 1 22  ? 11.743  -16.321 77.756  1.00 30.09  ? 575 LEU B CG  1 
ATOM   1044 C CD1 . LEU B 1 22  ? 10.804  -15.134 77.673  1.00 21.80  ? 575 LEU B CD1 1 
ATOM   1045 C CD2 . LEU B 1 22  ? 13.146  -15.865 78.117  1.00 26.76  ? 575 LEU B CD2 1 
ATOM   1046 N N   . ASP B 1 23  ? 10.543  -19.957 77.203  1.00 21.76  ? 576 ASP B N   1 
ATOM   1047 C CA  . ASP B 1 23  ? 10.496  -20.859 76.013  1.00 24.44  ? 576 ASP B CA  1 
ATOM   1048 C C   . ASP B 1 23  ? 9.087   -21.121 75.481  1.00 24.46  ? 576 ASP B C   1 
ATOM   1049 O O   . ASP B 1 23  ? 8.851   -20.979 74.284  1.00 29.88  ? 576 ASP B O   1 
ATOM   1050 C CB  . ASP B 1 23  ? 11.190  -22.195 76.318  1.00 15.69  ? 576 ASP B CB  1 
ATOM   1051 C CG  . ASP B 1 23  ? 12.696  -22.012 76.498  1.00 32.50  ? 576 ASP B CG  1 
ATOM   1052 O OD1 . ASP B 1 23  ? 13.190  -20.959 76.067  1.00 28.29  ? 576 ASP B OD1 1 
ATOM   1053 O OD2 . ASP B 1 23  ? 13.375  -22.867 77.080  1.00 24.91  ? 576 ASP B OD2 1 
ATOM   1054 N N   . GLN B 1 24  ? 8.174   -21.532 76.354  1.00 23.02  ? 577 GLN B N   1 
ATOM   1055 C CA  . GLN B 1 24  ? 6.771   -21.721 75.962  1.00 22.12  ? 577 GLN B CA  1 
ATOM   1056 C C   . GLN B 1 24  ? 6.180   -20.438 75.399  1.00 25.68  ? 577 GLN B C   1 
ATOM   1057 O O   . GLN B 1 24  ? 5.542   -20.461 74.366  1.00 35.10  ? 577 GLN B O   1 
ATOM   1058 C CB  . GLN B 1 24  ? 5.932   -22.190 77.155  1.00 22.14  ? 577 GLN B CB  1 
ATOM   1059 C CG  . GLN B 1 24  ? 6.296   -23.622 77.580  1.00 29.96  ? 577 GLN B CG  1 
ATOM   1060 C CD  . GLN B 1 24  ? 5.485   -24.114 78.741  1.00 31.25  ? 577 GLN B CD  1 
ATOM   1061 O OE1 . GLN B 1 24  ? 4.344   -24.552 78.572  1.00 50.66  ? 577 GLN B OE1 1 
ATOM   1062 N NE2 . GLN B 1 24  ? 6.062   -24.035 79.939  1.00 41.89  ? 577 GLN B NE2 1 
ATOM   1063 N N   . LEU B 1 25  ? 6.439   -19.312 76.060  1.00 34.80  ? 578 LEU B N   1 
ATOM   1064 C CA  . LEU B 1 25  ? 6.003   -18.005 75.563  1.00 29.35  ? 578 LEU B CA  1 
ATOM   1065 C C   . LEU B 1 25  ? 6.477   -17.777 74.150  1.00 29.18  ? 578 LEU B C   1 
ATOM   1066 O O   . LEU B 1 25  ? 5.697   -17.415 73.278  1.00 19.24  ? 578 LEU B O   1 
ATOM   1067 C CB  . LEU B 1 25  ? 6.504   -16.879 76.480  1.00 34.10  ? 578 LEU B CB  1 
ATOM   1068 C CG  . LEU B 1 25  ? 5.552   -16.284 77.532  1.00 34.08  ? 578 LEU B CG  1 
ATOM   1069 C CD1 . LEU B 1 25  ? 4.446   -17.222 77.867  1.00 28.43  ? 578 LEU B CD1 1 
ATOM   1070 C CD2 . LEU B 1 25  ? 6.316   -15.879 78.765  1.00 40.91  ? 578 LEU B CD2 1 
ATOM   1071 N N   . GLN B 1 26  ? 7.760   -17.999 73.915  1.00 24.05  ? 579 GLN B N   1 
ATOM   1072 C CA  . GLN B 1 26  ? 8.305   -17.806 72.591  1.00 26.46  ? 579 GLN B CA  1 
ATOM   1073 C C   . GLN B 1 26  ? 7.769   -18.855 71.611  1.00 21.55  ? 579 GLN B C   1 
ATOM   1074 O O   . GLN B 1 26  ? 7.660   -18.566 70.432  1.00 30.02  ? 579 GLN B O   1 
ATOM   1075 C CB  . GLN B 1 26  ? 9.840   -17.786 72.588  1.00 24.27  ? 579 GLN B CB  1 
ATOM   1076 C CG  . GLN B 1 26  ? 10.473  -16.580 73.297  1.00 27.19  ? 579 GLN B CG  1 
ATOM   1077 C CD  . GLN B 1 26  ? 11.835  -16.185 72.742  1.00 19.33  ? 579 GLN B CD  1 
ATOM   1078 O OE1 . GLN B 1 26  ? 12.859  -16.358 73.404  1.00 28.12  ? 579 GLN B OE1 1 
ATOM   1079 N NE2 . GLN B 1 26  ? 11.853  -15.662 71.513  1.00 17.83  ? 579 GLN B NE2 1 
ATOM   1080 N N   . ASP B 1 27  ? 7.387   -20.036 72.097  1.00 26.14  ? 580 ASP B N   1 
ATOM   1081 C CA  . ASP B 1 27  ? 6.810   -21.067 71.219  1.00 26.97  ? 580 ASP B CA  1 
ATOM   1082 C C   . ASP B 1 27  ? 5.475   -20.580 70.688  1.00 28.32  ? 580 ASP B C   1 
ATOM   1083 O O   . ASP B 1 27  ? 5.038   -21.032 69.650  1.00 29.14  ? 580 ASP B O   1 
ATOM   1084 C CB  . ASP B 1 27  ? 6.618   -22.420 71.926  1.00 26.64  ? 580 ASP B CB  1 
ATOM   1085 C CG  . ASP B 1 27  ? 7.941   -23.145 72.212  1.00 39.61  ? 580 ASP B CG  1 
ATOM   1086 O OD1 . ASP B 1 27  ? 8.982   -22.781 71.618  1.00 30.47  ? 580 ASP B OD1 1 
ATOM   1087 O OD2 . ASP B 1 27  ? 7.935   -24.095 73.019  1.00 35.12  ? 580 ASP B OD2 1 
ATOM   1088 N N   . LYS B 1 28  ? 4.864   -19.610 71.356  1.00 20.06  ? 581 LYS B N   1 
ATOM   1089 C CA  . LYS B 1 28  ? 3.594   -19.051 70.843  1.00 30.09  ? 581 LYS B CA  1 
ATOM   1090 C C   . LYS B 1 28  ? 3.797   -17.913 69.854  1.00 29.11  ? 581 LYS B C   1 
ATOM   1091 O O   . LYS B 1 28  ? 2.832   -17.390 69.357  1.00 26.87  ? 581 LYS B O   1 
ATOM   1092 C CB  . LYS B 1 28  ? 2.705   -18.569 71.975  1.00 26.06  ? 581 LYS B CB  1 
ATOM   1093 C CG  . LYS B 1 28  ? 2.473   -19.580 73.137  1.00 39.49  ? 581 LYS B CG  1 
ATOM   1094 C CD  . LYS B 1 28  ? 1.824   -20.896 72.700  1.00 48.58  ? 581 LYS B CD  1 
ATOM   1095 C CE  . LYS B 1 28  ? 1.757   -21.895 73.888  1.00 43.54  ? 581 LYS B CE  1 
ATOM   1096 N NZ  . LYS B 1 28  ? 3.117   -22.509 74.236  1.00 46.49  ? 581 LYS B NZ  1 
ATOM   1097 N N   . ASP B 1 29  ? 5.050   -17.551 69.559  1.00 24.98  ? 582 ASP B N   1 
ATOM   1098 C CA  . ASP B 1 29  ? 5.344   -16.467 68.639  1.00 28.22  ? 582 ASP B CA  1 
ATOM   1099 C C   . ASP B 1 29  ? 6.315   -16.981 67.573  1.00 30.75  ? 582 ASP B C   1 
ATOM   1100 O O   . ASP B 1 29  ? 7.453   -16.495 67.480  1.00 24.65  ? 582 ASP B O   1 
ATOM   1101 C CB  . ASP B 1 29  ? 5.941   -15.279 69.456  1.00 34.37  ? 582 ASP B CB  1 
ATOM   1102 C CG  . ASP B 1 29  ? 6.435   -14.109 68.576  1.00 51.96  ? 582 ASP B CG  1 
ATOM   1103 O OD1 . ASP B 1 29  ? 5.775   -13.770 67.570  1.00 36.14  ? 582 ASP B OD1 1 
ATOM   1104 O OD2 . ASP B 1 29  ? 7.489   -13.510 68.912  1.00 24.03  ? 582 ASP B OD2 1 
ATOM   1105 N N   . PRO B 1 30  ? 5.887   -17.975 66.755  1.00 30.09  ? 583 PRO B N   1 
ATOM   1106 C CA  . PRO B 1 30  ? 6.852   -18.512 65.792  1.00 29.81  ? 583 PRO B CA  1 
ATOM   1107 C C   . PRO B 1 30  ? 7.238   -17.511 64.733  1.00 34.37  ? 583 PRO B C   1 
ATOM   1108 O O   . PRO B 1 30  ? 8.317   -17.670 64.120  1.00 30.38  ? 583 PRO B O   1 
ATOM   1109 C CB  . PRO B 1 30  ? 6.145   -19.717 65.151  1.00 31.05  ? 583 PRO B CB  1 
ATOM   1110 C CG  . PRO B 1 30  ? 4.821   -19.812 65.765  1.00 33.70  ? 583 PRO B CG  1 
ATOM   1111 C CD  . PRO B 1 30  ? 4.589   -18.650 66.680  1.00 26.54  ? 583 PRO B CD  1 
ATOM   1112 N N   . ALA B 1 31  ? 6.362   -16.514 64.515  1.00 26.79  ? 584 ALA B N   1 
ATOM   1113 C CA  . ALA B 1 31  ? 6.665   -15.361 63.651  1.00 30.39  ? 584 ALA B CA  1 
ATOM   1114 C C   . ALA B 1 31  ? 7.774   -14.451 64.215  1.00 27.86  ? 584 ALA B C   1 
ATOM   1115 O O   . ALA B 1 31  ? 8.304   -13.596 63.504  1.00 34.18  ? 584 ALA B O   1 
ATOM   1116 C CB  . ALA B 1 31  ? 5.367   -14.517 63.353  1.00 23.86  ? 584 ALA B CB  1 
ATOM   1117 N N   . ARG B 1 32  ? 8.125   -14.619 65.488  1.00 28.80  ? 585 ARG B N   1 
ATOM   1118 C CA  . ARG B 1 32  ? 9.273   -13.903 66.069  1.00 24.22  ? 585 ARG B CA  1 
ATOM   1119 C C   . ARG B 1 32  ? 9.099   -12.396 66.035  1.00 31.11  ? 585 ARG B C   1 
ATOM   1120 O O   . ARG B 1 32  ? 10.070  -11.656 65.952  1.00 24.60  ? 585 ARG B O   1 
ATOM   1121 C CB  . ARG B 1 32  ? 10.578  -14.335 65.379  1.00 28.10  ? 585 ARG B CB  1 
ATOM   1122 C CG  . ARG B 1 32  ? 10.942  -15.780 65.721  1.00 39.98  ? 585 ARG B CG  1 
ATOM   1123 C CD  . ARG B 1 32  ? 12.214  -16.252 65.031  1.00 38.89  ? 585 ARG B CD  1 
ATOM   1124 N NE  . ARG B 1 32  ? 13.285  -15.256 65.033  1.00 37.70  ? 585 ARG B NE  1 
ATOM   1125 C CZ  . ARG B 1 32  ? 14.120  -15.017 66.045  1.00 26.13  ? 585 ARG B CZ  1 
ATOM   1126 N NH1 . ARG B 1 32  ? 13.990  -15.655 67.201  1.00 24.81  ? 585 ARG B NH1 1 
ATOM   1127 N NH2 . ARG B 1 32  ? 15.075  -14.087 65.907  1.00 21.01  ? 585 ARG B NH2 1 
ATOM   1128 N N   . ILE B 1 33  ? 7.842   -11.953 66.086  1.00 28.78  ? 586 ILE B N   1 
ATOM   1129 C CA  . ILE B 1 33  ? 7.515   -10.532 66.144  1.00 35.50  ? 586 ILE B CA  1 
ATOM   1130 C C   . ILE B 1 33  ? 8.077   -9.892  67.423  1.00 28.62  ? 586 ILE B C   1 
ATOM   1131 O O   . ILE B 1 33  ? 8.516   -8.755  67.416  1.00 29.54  ? 586 ILE B O   1 
ATOM   1132 C CB  . ILE B 1 33  ? 5.931   -10.318 66.079  1.00 32.46  ? 586 ILE B CB  1 
ATOM   1133 C CG1 . ILE B 1 33  ? 5.431   -10.493 64.636  1.00 27.45  ? 586 ILE B CG1 1 
ATOM   1134 C CG2 . ILE B 1 33  ? 5.523   -8.957  66.619  1.00 35.28  ? 586 ILE B CG2 1 
ATOM   1135 C CD1 . ILE B 1 33  ? 3.867   -10.784 64.481  1.00 22.59  ? 586 ILE B CD1 1 
ATOM   1136 N N   . PHE B 1 34  ? 8.041   -10.636 68.518  1.00 25.81  ? 587 PHE B N   1 
ATOM   1137 C CA  . PHE B 1 34  ? 8.429   -10.142 69.814  1.00 17.24  ? 587 PHE B CA  1 
ATOM   1138 C C   . PHE B 1 34  ? 9.832   -10.680 70.221  1.00 21.98  ? 587 PHE B C   1 
ATOM   1139 O O   . PHE B 1 34  ? 10.254  -10.479 71.344  1.00 21.63  ? 587 PHE B O   1 
ATOM   1140 C CB  . PHE B 1 34  ? 7.316   -10.502 70.814  1.00 23.92  ? 587 PHE B CB  1 
ATOM   1141 C CG  . PHE B 1 34  ? 5.894   -10.052 70.345  1.00 14.75  ? 587 PHE B CG  1 
ATOM   1142 C CD1 . PHE B 1 34  ? 5.493   -8.737  70.475  1.00 11.96  ? 587 PHE B CD1 1 
ATOM   1143 C CD2 . PHE B 1 34  ? 5.033   -10.935 69.774  1.00 22.56  ? 587 PHE B CD2 1 
ATOM   1144 C CE1 . PHE B 1 34  ? 4.237   -8.320  70.057  1.00 30.08  ? 587 PHE B CE1 1 
ATOM   1145 C CE2 . PHE B 1 34  ? 3.765   -10.517 69.352  1.00 36.03  ? 587 PHE B CE2 1 
ATOM   1146 C CZ  . PHE B 1 34  ? 3.390   -9.216  69.491  1.00 20.13  ? 587 PHE B CZ  1 
ATOM   1147 N N   . ALA B 1 35  ? 10.545  -11.297 69.281  1.00 20.25  ? 588 ALA B N   1 
ATOM   1148 C CA  . ALA B 1 35  ? 11.829  -11.977 69.575  1.00 27.02  ? 588 ALA B CA  1 
ATOM   1149 C C   . ALA B 1 35  ? 12.964  -11.053 69.946  1.00 19.42  ? 588 ALA B C   1 
ATOM   1150 O O   . ALA B 1 35  ? 13.873  -11.454 70.692  1.00 28.83  ? 588 ALA B O   1 
ATOM   1151 C CB  . ALA B 1 35  ? 12.247  -12.788 68.409  1.00 18.40  ? 588 ALA B CB  1 
ATOM   1152 N N   . GLN B 1 36  ? 12.960  -9.842  69.388  1.00 18.53  ? 589 GLN B N   1 
ATOM   1153 C CA  . GLN B 1 36  ? 14.116  -8.947  69.475  1.00 24.50  ? 589 GLN B CA  1 
ATOM   1154 C C   . GLN B 1 36  ? 13.605  -7.560  69.657  1.00 27.32  ? 589 GLN B C   1 
ATOM   1155 O O   . GLN B 1 36  ? 12.457  -7.328  69.360  1.00 24.27  ? 589 GLN B O   1 
ATOM   1156 C CB  . GLN B 1 36  ? 14.945  -9.022  68.201  1.00 33.07  ? 589 GLN B CB  1 
ATOM   1157 C CG  . GLN B 1 36  ? 15.713  -10.321 68.049  1.00 34.85  ? 589 GLN B CG  1 
ATOM   1158 C CD  . GLN B 1 36  ? 16.532  -10.390 66.762  1.00 42.75  ? 589 GLN B CD  1 
ATOM   1159 O OE1 . GLN B 1 36  ? 15.990  -10.588 65.688  1.00 42.30  ? 589 GLN B OE1 1 
ATOM   1160 N NE2 . GLN B 1 36  ? 17.842  -10.265 66.886  1.00 33.68  ? 589 GLN B NE2 1 
ATOM   1161 N N   . PRO B 1 37  ? 14.455  -6.625  70.129  1.00 23.21  ? 590 PRO B N   1 
ATOM   1162 C CA  . PRO B 1 37  ? 13.930  -5.289  70.355  1.00 25.68  ? 590 PRO B CA  1 
ATOM   1163 C C   . PRO B 1 37  ? 13.413  -4.701  69.064  1.00 32.14  ? 590 PRO B C   1 
ATOM   1164 O O   . PRO B 1 37  ? 13.970  -4.983  67.983  1.00 31.37  ? 590 PRO B O   1 
ATOM   1165 C CB  . PRO B 1 37  ? 15.136  -4.490  70.851  1.00 23.85  ? 590 PRO B CB  1 
ATOM   1166 C CG  . PRO B 1 37  ? 16.157  -5.506  71.302  1.00 33.83  ? 590 PRO B CG  1 
ATOM   1167 C CD  . PRO B 1 37  ? 15.856  -6.786  70.562  1.00 30.18  ? 590 PRO B CD  1 
ATOM   1168 N N   . VAL B 1 38  ? 12.370  -3.885  69.163  1.00 26.17  ? 591 VAL B N   1 
ATOM   1169 C CA  . VAL B 1 38  ? 11.907  -3.143  67.998  1.00 24.99  ? 591 VAL B CA  1 
ATOM   1170 C C   . VAL B 1 38  ? 13.076  -2.313  67.414  1.00 30.75  ? 591 VAL B C   1 
ATOM   1171 O O   . VAL B 1 38  ? 13.906  -1.798  68.162  1.00 38.73  ? 591 VAL B O   1 
ATOM   1172 C CB  . VAL B 1 38  ? 10.751  -2.252  68.391  1.00 33.96  ? 591 VAL B CB  1 
ATOM   1173 C CG1 . VAL B 1 38  ? 10.333  -1.354  67.235  1.00 38.74  ? 591 VAL B CG1 1 
ATOM   1174 C CG2 . VAL B 1 38  ? 9.542   -3.126  68.828  1.00 36.18  ? 591 VAL B CG2 1 
ATOM   1175 N N   . SER B 1 39  ? 13.197  -2.265  66.090  1.00 33.22  ? 592 SER B N   1 
ATOM   1176 C CA  . SER B 1 39  ? 14.232  -1.446  65.440  1.00 37.48  ? 592 SER B CA  1 
ATOM   1177 C C   . SER B 1 39  ? 13.680  -0.062  65.184  1.00 31.27  ? 592 SER B C   1 
ATOM   1178 O O   . SER B 1 39  ? 12.701  0.095   64.452  1.00 34.51  ? 592 SER B O   1 
ATOM   1179 C CB  . SER B 1 39  ? 14.699  -2.024  64.086  1.00 41.22  ? 592 SER B CB  1 
ATOM   1180 O OG  . SER B 1 39  ? 15.636  -1.139  63.443  1.00 40.01  ? 592 SER B OG  1 
ATOM   1181 N N   . LEU B 1 40  ? 14.318  0.930   65.778  1.00 33.89  ? 593 LEU B N   1 
ATOM   1182 C CA  . LEU B 1 40  ? 13.989  2.334   65.506  1.00 38.24  ? 593 LEU B CA  1 
ATOM   1183 C C   . LEU B 1 40  ? 14.076  2.670   64.026  1.00 37.27  ? 593 LEU B C   1 
ATOM   1184 O O   . LEU B 1 40  ? 13.231  3.400   63.531  1.00 39.87  ? 593 LEU B O   1 
ATOM   1185 C CB  . LEU B 1 40  ? 14.905  3.265   66.314  1.00 40.16  ? 593 LEU B CB  1 
ATOM   1186 C CG  . LEU B 1 40  ? 14.761  3.117   67.823  1.00 33.56  ? 593 LEU B CG  1 
ATOM   1187 C CD1 . LEU B 1 40  ? 15.655  4.115   68.576  1.00 34.12  ? 593 LEU B CD1 1 
ATOM   1188 C CD2 . LEU B 1 40  ? 13.295  3.297   68.200  1.00 39.36  ? 593 LEU B CD2 1 
ATOM   1189 N N   . LYS B 1 41  ? 15.047  2.096   63.307  1.00 40.40  ? 594 LYS B N   1 
ATOM   1190 C CA  . LYS B 1 41  ? 15.146  2.295   61.848  1.00 37.71  ? 594 LYS B CA  1 
ATOM   1191 C C   . LYS B 1 41  ? 13.848  1.914   61.161  1.00 32.97  ? 594 LYS B C   1 
ATOM   1192 O O   . LYS B 1 41  ? 13.376  2.612   60.265  1.00 33.42  ? 594 LYS B O   1 
ATOM   1193 C CB  . LYS B 1 41  ? 16.319  1.531   61.220  1.00 42.16  ? 594 LYS B CB  1 
ATOM   1194 C CG  . LYS B 1 41  ? 17.707  1.897   61.811  1.00 32.89  ? 594 LYS B CG  1 
ATOM   1195 C CD  . LYS B 1 41  ? 18.400  3.032   61.133  1.00 40.63  ? 594 LYS B CD  1 
ATOM   1196 C CE  . LYS B 1 41  ? 19.865  3.069   61.533  1.00 42.40  ? 594 LYS B CE  1 
ATOM   1197 N NZ  . LYS B 1 41  ? 20.432  4.424   61.350  1.00 47.98  ? 594 LYS B NZ  1 
ATOM   1198 N N   . GLU B 1 42  ? 13.229  0.843   61.609  1.00 36.86  ? 595 GLU B N   1 
ATOM   1199 C CA  . GLU B 1 42  ? 11.953  0.422   61.016  1.00 38.72  ? 595 GLU B CA  1 
ATOM   1200 C C   . GLU B 1 42  ? 10.770  1.203   61.572  1.00 29.35  ? 595 GLU B C   1 
ATOM   1201 O O   . GLU B 1 42  ? 9.781   1.341   60.877  1.00 34.13  ? 595 GLU B O   1 
ATOM   1202 C CB  . GLU B 1 42  ? 11.732  -1.101  61.185  1.00 43.37  ? 595 GLU B CB  1 
ATOM   1203 C CG  . GLU B 1 42  ? 12.538  -1.951  60.201  1.00 52.98  ? 595 GLU B CG  1 
ATOM   1204 C CD  . GLU B 1 42  ? 12.456  -3.445  60.447  1.00 66.98  ? 595 GLU B CD  1 
ATOM   1205 O OE1 . GLU B 1 42  ? 11.731  -3.889  61.363  1.00 72.20  ? 595 GLU B OE1 1 
ATOM   1206 O OE2 . GLU B 1 42  ? 13.124  -4.186  59.698  1.00 89.72  ? 595 GLU B OE2 1 
ATOM   1207 N N   . VAL B 1 43  ? 10.877  1.724   62.801  1.00 26.13  ? 596 VAL B N   1 
ATOM   1208 C CA  . VAL B 1 43  ? 9.768   2.437   63.467  1.00 32.84  ? 596 VAL B CA  1 
ATOM   1209 C C   . VAL B 1 43  ? 10.331  3.639   64.243  1.00 32.00  ? 596 VAL B C   1 
ATOM   1210 O O   . VAL B 1 43  ? 10.509  3.564   65.444  1.00 37.63  ? 596 VAL B O   1 
ATOM   1211 C CB  . VAL B 1 43  ? 8.949   1.461   64.427  1.00 34.66  ? 596 VAL B CB  1 
ATOM   1212 C CG1 . VAL B 1 43  ? 7.745   2.121   64.991  1.00 40.82  ? 596 VAL B CG1 1 
ATOM   1213 C CG2 . VAL B 1 43  ? 8.510   0.220   63.685  1.00 39.07  ? 596 VAL B CG2 1 
ATOM   1214 N N   . PRO B 1 44  ? 10.636  4.751   63.548  1.00 28.58  ? 597 PRO B N   1 
ATOM   1215 C CA  . PRO B 1 44  ? 11.483  5.780   64.162  1.00 31.91  ? 597 PRO B CA  1 
ATOM   1216 C C   . PRO B 1 44  ? 10.864  6.636   65.229  1.00 32.65  ? 597 PRO B C   1 
ATOM   1217 O O   . PRO B 1 44  ? 11.609  7.333   65.948  1.00 26.52  ? 597 PRO B O   1 
ATOM   1218 C CB  . PRO B 1 44  ? 11.882  6.660   62.993  1.00 30.73  ? 597 PRO B CB  1 
ATOM   1219 C CG  . PRO B 1 44  ? 11.748  5.786   61.798  1.00 35.31  ? 597 PRO B CG  1 
ATOM   1220 C CD  . PRO B 1 44  ? 10.666  4.824   62.084  1.00 26.98  ? 597 PRO B CD  1 
ATOM   1221 N N   . ASP B 1 45  ? 9.537   6.627   65.286  1.00 29.94  ? 598 ASP B N   1 
ATOM   1222 C CA  . ASP B 1 45  ? 8.778   7.342   66.322  1.00 30.71  ? 598 ASP B CA  1 
ATOM   1223 C C   . ASP B 1 45  ? 8.323   6.443   67.456  1.00 30.33  ? 598 ASP B C   1 
ATOM   1224 O O   . ASP B 1 45  ? 7.423   6.829   68.219  1.00 33.59  ? 598 ASP B O   1 
ATOM   1225 C CB  . ASP B 1 45  ? 7.508   7.991   65.724  1.00 31.70  ? 598 ASP B CB  1 
ATOM   1226 C CG  . ASP B 1 45  ? 6.502   6.976   65.238  1.00 36.66  ? 598 ASP B CG  1 
ATOM   1227 O OD1 . ASP B 1 45  ? 6.923   5.838   64.912  1.00 38.60  ? 598 ASP B OD1 1 
ATOM   1228 O OD2 . ASP B 1 45  ? 5.297   7.309   65.178  1.00 41.68  ? 598 ASP B OD2 1 
ATOM   1229 N N   . TYR B 1 46  ? 8.916   5.257   67.583  1.00 33.35  ? 599 TYR B N   1 
ATOM   1230 C CA  . TYR B 1 46  ? 8.534   4.314   68.654  1.00 31.56  ? 599 TYR B CA  1 
ATOM   1231 C C   . TYR B 1 46  ? 8.687   4.992   70.032  1.00 33.18  ? 599 TYR B C   1 
ATOM   1232 O O   . TYR B 1 46  ? 7.868   4.856   70.901  1.00 28.23  ? 599 TYR B O   1 
ATOM   1233 C CB  . TYR B 1 46  ? 9.380   3.035   68.578  1.00 29.24  ? 599 TYR B CB  1 
ATOM   1234 C CG  . TYR B 1 46  ? 8.846   1.867   69.377  1.00 24.95  ? 599 TYR B CG  1 
ATOM   1235 C CD1 . TYR B 1 46  ? 7.552   1.377   69.149  1.00 32.31  ? 599 TYR B CD1 1 
ATOM   1236 C CD2 . TYR B 1 46  ? 9.616   1.257   70.368  1.00 22.16  ? 599 TYR B CD2 1 
ATOM   1237 C CE1 . TYR B 1 46  ? 7.048   0.296   69.873  1.00 28.03  ? 599 TYR B CE1 1 
ATOM   1238 C CE2 . TYR B 1 46  ? 9.124   0.140   71.099  1.00 30.46  ? 599 TYR B CE2 1 
ATOM   1239 C CZ  . TYR B 1 46  ? 7.833   -0.331  70.838  1.00 34.24  ? 599 TYR B CZ  1 
ATOM   1240 O OH  . TYR B 1 46  ? 7.295   -1.399  71.544  1.00 31.48  ? 599 TYR B OH  1 
ATOM   1241 N N   . LEU B 1 47  ? 9.758   5.730   70.220  1.00 39.02  ? 600 LEU B N   1 
ATOM   1242 C CA  . LEU B 1 47  ? 10.032  6.266   71.524  1.00 36.18  ? 600 LEU B CA  1 
ATOM   1243 C C   . LEU B 1 47  ? 9.175   7.499   71.844  1.00 38.70  ? 600 LEU B C   1 
ATOM   1244 O O   . LEU B 1 47  ? 9.123   7.879   72.986  1.00 37.62  ? 600 LEU B O   1 
ATOM   1245 C CB  . LEU B 1 47  ? 11.531  6.536   71.697  1.00 36.08  ? 600 LEU B CB  1 
ATOM   1246 C CG  . LEU B 1 47  ? 12.479  5.327   71.545  1.00 34.11  ? 600 LEU B CG  1 
ATOM   1247 C CD1 . LEU B 1 47  ? 13.901  5.767   71.840  1.00 33.59  ? 600 LEU B CD1 1 
ATOM   1248 C CD2 . LEU B 1 47  ? 12.089  4.108   72.445  1.00 28.79  ? 600 LEU B CD2 1 
ATOM   1249 N N   . ASP B 1 48  ? 8.462   8.075   70.865  1.00 37.92  ? 601 ASP B N   1 
ATOM   1250 C CA  . ASP B 1 48  ? 7.447   9.100   71.164  1.00 37.17  ? 601 ASP B CA  1 
ATOM   1251 C C   . ASP B 1 48  ? 6.250   8.551   71.954  1.00 46.10  ? 601 ASP B C   1 
ATOM   1252 O O   . ASP B 1 48  ? 5.458   9.320   72.531  1.00 45.01  ? 601 ASP B O   1 
ATOM   1253 C CB  . ASP B 1 48  ? 6.924   9.741   69.882  1.00 35.34  ? 601 ASP B CB  1 
ATOM   1254 C CG  . ASP B 1 48  ? 7.980   10.552  69.165  1.00 43.37  ? 601 ASP B CG  1 
ATOM   1255 O OD1 . ASP B 1 48  ? 9.147   10.503  69.608  1.00 47.15  ? 601 ASP B OD1 1 
ATOM   1256 O OD2 . ASP B 1 48  ? 7.645   11.217  68.155  1.00 58.94  ? 601 ASP B OD2 1 
ATOM   1257 N N   . HIS B 1 49  ? 6.104   7.227   71.964  1.00 36.07  ? 602 HIS B N   1 
ATOM   1258 C CA  . HIS B 1 49  ? 4.924   6.599   72.557  1.00 37.12  ? 602 HIS B CA  1 
ATOM   1259 C C   . HIS B 1 49  ? 5.267   5.622   73.645  1.00 33.85  ? 602 HIS B C   1 
ATOM   1260 O O   . HIS B 1 49  ? 4.520   5.517   74.597  1.00 36.08  ? 602 HIS B O   1 
ATOM   1261 C CB  . HIS B 1 49  ? 4.115   5.870   71.480  1.00 45.82  ? 602 HIS B CB  1 
ATOM   1262 C CG  . HIS B 1 49  ? 3.552   6.770   70.429  1.00 44.92  ? 602 HIS B CG  1 
ATOM   1263 N ND1 . HIS B 1 49  ? 4.107   6.878   69.173  1.00 37.24  ? 602 HIS B ND1 1 
ATOM   1264 C CD2 . HIS B 1 49  ? 2.490   7.612   70.448  1.00 63.54  ? 602 HIS B CD2 1 
ATOM   1265 C CE1 . HIS B 1 49  ? 3.410   7.746   68.459  1.00 45.91  ? 602 HIS B CE1 1 
ATOM   1266 N NE2 . HIS B 1 49  ? 2.418   8.200   69.206  1.00 53.20  ? 602 HIS B NE2 1 
ATOM   1267 N N   . ILE B 1 50  ? 6.386   4.909   73.489  1.00 31.87  ? 603 ILE B N   1 
ATOM   1268 C CA  . ILE B 1 50  ? 6.704   3.756   74.301  1.00 33.15  ? 603 ILE B CA  1 
ATOM   1269 C C   . ILE B 1 50  ? 7.871   4.133   75.161  1.00 37.76  ? 603 ILE B C   1 
ATOM   1270 O O   . ILE B 1 50  ? 8.948   4.498   74.662  1.00 39.73  ? 603 ILE B O   1 
ATOM   1271 C CB  . ILE B 1 50  ? 7.086   2.501   73.444  1.00 29.80  ? 603 ILE B CB  1 
ATOM   1272 C CG1 . ILE B 1 50  ? 5.953   2.086   72.514  1.00 35.40  ? 603 ILE B CG1 1 
ATOM   1273 C CG2 . ILE B 1 50  ? 7.401   1.339   74.318  1.00 29.25  ? 603 ILE B CG2 1 
ATOM   1274 C CD1 . ILE B 1 50  ? 4.594   2.029   73.154  1.00 27.44  ? 603 ILE B CD1 1 
ATOM   1275 N N   . LYS B 1 51  ? 7.654   4.062   76.464  1.00 36.17  ? 604 LYS B N   1 
ATOM   1276 C CA  . LYS B 1 51  ? 8.616   4.576   77.399  1.00 33.89  ? 604 LYS B CA  1 
ATOM   1277 C C   . LYS B 1 51  ? 9.509   3.469   77.898  1.00 41.54  ? 604 LYS B C   1 
ATOM   1278 O O   . LYS B 1 51  ? 10.656  3.738   78.271  1.00 40.06  ? 604 LYS B O   1 
ATOM   1279 C CB  . LYS B 1 51  ? 7.893   5.268   78.554  1.00 33.67  ? 604 LYS B CB  1 
ATOM   1280 C CG  . LYS B 1 51  ? 6.928   6.381   78.094  1.00 39.74  ? 604 LYS B CG  1 
ATOM   1281 C CD  . LYS B 1 51  ? 7.559   7.304   77.031  1.00 51.88  ? 604 LYS B CD  1 
ATOM   1282 C CE  . LYS B 1 51  ? 6.595   8.375   76.544  1.00 55.23  ? 604 LYS B CE  1 
ATOM   1283 N NZ  . LYS B 1 51  ? 7.339   9.481   75.893  1.00 59.74  ? 604 LYS B NZ  1 
ATOM   1284 N N   . HIS B 1 52  ? 9.007   2.227   77.917  1.00 38.49  ? 605 HIS B N   1 
ATOM   1285 C CA  . HIS B 1 52  ? 9.835   1.110   78.383  1.00 34.71  ? 605 HIS B CA  1 
ATOM   1286 C C   . HIS B 1 52  ? 9.775   -0.044  77.374  1.00 30.72  ? 605 HIS B C   1 
ATOM   1287 O O   . HIS B 1 52  ? 8.954   -0.942  77.532  1.00 32.64  ? 605 HIS B O   1 
ATOM   1288 C CB  . HIS B 1 52  ? 9.379   0.659   79.789  1.00 38.12  ? 605 HIS B CB  1 
ATOM   1289 C CG  . HIS B 1 52  ? 10.412  -0.124  80.547  1.00 45.74  ? 605 HIS B CG  1 
ATOM   1290 N ND1 . HIS B 1 52  ? 11.472  -0.763  79.932  1.00 61.46  ? 605 HIS B ND1 1 
ATOM   1291 C CD2 . HIS B 1 52  ? 10.528  -0.399  81.868  1.00 45.96  ? 605 HIS B CD2 1 
ATOM   1292 C CE1 . HIS B 1 52  ? 12.206  -1.376  80.842  1.00 37.39  ? 605 HIS B CE1 1 
ATOM   1293 N NE2 . HIS B 1 52  ? 11.656  -1.168  82.025  1.00 52.44  ? 605 HIS B NE2 1 
ATOM   1294 N N   . PRO B 1 53  ? 10.644  -0.024  76.330  1.00 34.63  ? 606 PRO B N   1 
ATOM   1295 C CA  . PRO B 1 53  ? 10.599  -1.090  75.303  1.00 36.00  ? 606 PRO B CA  1 
ATOM   1296 C C   . PRO B 1 53  ? 10.960  -2.437  75.894  1.00 33.75  ? 606 PRO B C   1 
ATOM   1297 O O   . PRO B 1 53  ? 11.819  -2.497  76.776  1.00 36.35  ? 606 PRO B O   1 
ATOM   1298 C CB  . PRO B 1 53  ? 11.673  -0.658  74.288  1.00 30.90  ? 606 PRO B CB  1 
ATOM   1299 C CG  . PRO B 1 53  ? 11.802  0.816   74.495  1.00 32.43  ? 606 PRO B CG  1 
ATOM   1300 C CD  . PRO B 1 53  ? 11.652  0.999   75.978  1.00 30.75  ? 606 PRO B CD  1 
ATOM   1301 N N   . MET B 1 54  ? 10.302  -3.498  75.441  1.00 29.25  ? 607 MET B N   1 
ATOM   1302 C CA  . MET B 1 54  ? 10.655  -4.838  75.924  1.00 24.44  ? 607 MET B CA  1 
ATOM   1303 C C   . MET B 1 54  ? 10.438  -5.843  74.808  1.00 24.75  ? 607 MET B C   1 
ATOM   1304 O O   . MET B 1 54  ? 9.665   -5.594  73.880  1.00 24.23  ? 607 MET B O   1 
ATOM   1305 C CB  . MET B 1 54  ? 9.854   -5.189  77.177  1.00 21.87  ? 607 MET B CB  1 
ATOM   1306 C CG  . MET B 1 54  ? 10.333  -6.438  77.939  1.00 24.11  ? 607 MET B CG  1 
ATOM   1307 S SD  . MET B 1 54  ? 12.082  -6.429  78.346  1.00 32.75  ? 607 MET B SD  1 
ATOM   1308 C CE  . MET B 1 54  ? 12.298  -4.892  79.297  1.00 31.86  ? 607 MET B CE  1 
ATOM   1309 N N   . ASP B 1 55  ? 11.148  -6.957  74.915  1.00 14.28  ? 608 ASP B N   1 
ATOM   1310 C CA  . ASP B 1 55  ? 11.186  -8.018  73.929  1.00 21.11  ? 608 ASP B CA  1 
ATOM   1311 C C   . ASP B 1 55  ? 11.758  -9.280  74.609  1.00 26.79  ? 608 ASP B C   1 
ATOM   1312 O O   . ASP B 1 55  ? 12.328  -9.191  75.708  1.00 26.44  ? 608 ASP B O   1 
ATOM   1313 C CB  . ASP B 1 55  ? 12.152  -7.648  72.805  1.00 23.96  ? 608 ASP B CB  1 
ATOM   1314 C CG  . ASP B 1 55  ? 13.545  -7.565  73.290  1.00 30.32  ? 608 ASP B CG  1 
ATOM   1315 O OD1 . ASP B 1 55  ? 14.214  -8.626  73.255  1.00 29.29  ? 608 ASP B OD1 1 
ATOM   1316 O OD2 . ASP B 1 55  ? 13.927  -6.469  73.778  1.00 36.26  ? 608 ASP B OD2 1 
ATOM   1317 N N   . PHE B 1 56  ? 11.736  -10.409 73.892  1.00 21.16  ? 609 PHE B N   1 
ATOM   1318 C CA  . PHE B 1 56  ? 12.047  -11.692 74.497  1.00 25.59  ? 609 PHE B CA  1 
ATOM   1319 C C   . PHE B 1 56  ? 13.531  -11.846 74.723  1.00 24.30  ? 609 PHE B C   1 
ATOM   1320 O O   . PHE B 1 56  ? 13.950  -12.425 75.742  1.00 33.60  ? 609 PHE B O   1 
ATOM   1321 C CB  . PHE B 1 56  ? 11.473  -12.865 73.668  1.00 29.50  ? 609 PHE B CB  1 
ATOM   1322 C CG  . PHE B 1 56  ? 9.984   -13.120 73.877  1.00 20.63  ? 609 PHE B CG  1 
ATOM   1323 C CD1 . PHE B 1 56  ? 9.416   -13.146 75.153  1.00 33.63  ? 609 PHE B CD1 1 
ATOM   1324 C CD2 . PHE B 1 56  ? 9.138   -13.340 72.768  1.00 19.98  ? 609 PHE B CD2 1 
ATOM   1325 C CE1 . PHE B 1 56  ? 8.017   -13.407 75.334  1.00 21.79  ? 609 PHE B CE1 1 
ATOM   1326 C CE2 . PHE B 1 56  ? 7.776   -13.609 72.944  1.00 26.09  ? 609 PHE B CE2 1 
ATOM   1327 C CZ  . PHE B 1 56  ? 7.214   -13.629 74.239  1.00 30.42  ? 609 PHE B CZ  1 
ATOM   1328 N N   . ALA B 1 57  ? 14.341  -11.292 73.822  1.00 21.76  ? 610 ALA B N   1 
ATOM   1329 C CA  . ALA B 1 57  ? 15.795  -11.425 73.946  1.00 30.52  ? 610 ALA B CA  1 
ATOM   1330 C C   . ALA B 1 57  ? 16.280  -10.664 75.173  1.00 24.88  ? 610 ALA B C   1 
ATOM   1331 O O   . ALA B 1 57  ? 17.116  -11.161 75.924  1.00 27.87  ? 610 ALA B O   1 
ATOM   1332 C CB  . ALA B 1 57  ? 16.550  -10.964 72.658  1.00 24.18  ? 610 ALA B CB  1 
ATOM   1333 N N   . THR B 1 58  ? 15.746  -9.470  75.368  1.00 26.31  ? 611 THR B N   1 
ATOM   1334 C CA  . THR B 1 58  ? 16.012  -8.667  76.581  1.00 31.28  ? 611 THR B CA  1 
ATOM   1335 C C   . THR B 1 58  ? 15.631  -9.443  77.858  1.00 27.61  ? 611 THR B C   1 
ATOM   1336 O O   . THR B 1 58  ? 16.417  -9.503  78.804  1.00 28.13  ? 611 THR B O   1 
ATOM   1337 C CB  . THR B 1 58  ? 15.280  -7.312  76.460  1.00 32.93  ? 611 THR B CB  1 
ATOM   1338 O OG1 . THR B 1 58  ? 15.790  -6.659  75.309  1.00 28.47  ? 611 THR B OG1 1 
ATOM   1339 C CG2 . THR B 1 58  ? 15.485  -6.381  77.660  1.00 24.48  ? 611 THR B CG2 1 
ATOM   1340 N N   . MET B 1 59  ? 14.460  -10.075 77.854  1.00 27.56  ? 612 MET B N   1 
ATOM   1341 C CA  . MET B 1 59  ? 14.005  -10.866 78.995  1.00 23.83  ? 612 MET B CA  1 
ATOM   1342 C C   . MET B 1 59  ? 14.908  -12.059 79.236  1.00 26.50  ? 612 MET B C   1 
ATOM   1343 O O   . MET B 1 59  ? 15.217  -12.378 80.377  1.00 27.54  ? 612 MET B O   1 
ATOM   1344 C CB  . MET B 1 59  ? 12.576  -11.357 78.771  1.00 29.58  ? 612 MET B CB  1 
ATOM   1345 C CG  . MET B 1 59  ? 11.528  -10.277 78.890  1.00 25.47  ? 612 MET B CG  1 
ATOM   1346 S SD  . MET B 1 59  ? 9.849   -10.962 78.952  1.00 31.61  ? 612 MET B SD  1 
ATOM   1347 C CE  . MET B 1 59  ? 9.794   -11.853 80.491  1.00 24.70  ? 612 MET B CE  1 
ATOM   1348 N N   . ARG B 1 60  ? 15.351  -12.703 78.156  1.00 29.01  ? 613 ARG B N   1 
ATOM   1349 C CA  . ARG B 1 60  ? 16.174  -13.900 78.269  1.00 25.84  ? 613 ARG B CA  1 
ATOM   1350 C C   . ARG B 1 60  ? 17.516  -13.521 78.834  1.00 28.56  ? 613 ARG B C   1 
ATOM   1351 O O   . ARG B 1 60  ? 18.086  -14.261 79.625  1.00 28.61  ? 613 ARG B O   1 
ATOM   1352 C CB  . ARG B 1 60  ? 16.316  -14.642 76.895  1.00 23.79  ? 613 ARG B CB  1 
ATOM   1353 C CG  . ARG B 1 60  ? 17.232  -15.840 76.912  1.00 29.31  ? 613 ARG B CG  1 
ATOM   1354 C CD  . ARG B 1 60  ? 17.165  -16.718 75.639  1.00 42.35  ? 613 ARG B CD  1 
ATOM   1355 N NE  . ARG B 1 60  ? 15.793  -17.048 75.299  1.00 17.63  ? 613 ARG B NE  1 
ATOM   1356 C CZ  . ARG B 1 60  ? 15.084  -18.103 75.706  1.00 25.94  ? 613 ARG B CZ  1 
ATOM   1357 N NH1 . ARG B 1 60  ? 15.607  -19.078 76.424  1.00 23.94  ? 613 ARG B NH1 1 
ATOM   1358 N NH2 . ARG B 1 60  ? 13.810  -18.200 75.334  1.00 16.10  ? 613 ARG B NH2 1 
ATOM   1359 N N   . LYS B 1 61  ? 18.038  -12.373 78.423  1.00 38.11  ? 614 LYS B N   1 
ATOM   1360 C CA  . LYS B 1 61  ? 19.326  -11.871 78.932  1.00 35.81  ? 614 LYS B CA  1 
ATOM   1361 C C   . LYS B 1 61  ? 19.285  -11.623 80.429  1.00 36.40  ? 614 LYS B C   1 
ATOM   1362 O O   . LYS B 1 61  ? 20.158  -12.082 81.171  1.00 28.97  ? 614 LYS B O   1 
ATOM   1363 C CB  . LYS B 1 61  ? 19.691  -10.560 78.236  1.00 44.69  ? 614 LYS B CB  1 
ATOM   1364 C CG  . LYS B 1 61  ? 21.071  -9.991  78.622  1.00 50.87  ? 614 LYS B CG  1 
ATOM   1365 C CD  . LYS B 1 61  ? 21.413  -8.819  77.706  1.00 68.25  ? 614 LYS B CD  1 
ATOM   1366 C CE  . LYS B 1 61  ? 22.529  -7.936  78.233  1.00 59.48  ? 614 LYS B CE  1 
ATOM   1367 N NZ  . LYS B 1 61  ? 22.411  -6.546  77.683  1.00 66.56  ? 614 LYS B NZ  1 
ATOM   1368 N N   . ARG B 1 62  ? 18.269  -10.878 80.866  1.00 33.69  ? 615 ARG B N   1 
ATOM   1369 C CA  . ARG B 1 62  ? 18.047  -10.637 82.306  1.00 30.86  ? 615 ARG B CA  1 
ATOM   1370 C C   . ARG B 1 62  ? 17.846  -11.990 82.995  1.00 30.83  ? 615 ARG B C   1 
ATOM   1371 O O   . ARG B 1 62  ? 18.422  -12.239 84.036  1.00 43.65  ? 615 ARG B O   1 
ATOM   1372 C CB  . ARG B 1 62  ? 16.843  -9.707  82.543  1.00 32.32  ? 615 ARG B CB  1 
ATOM   1373 C CG  . ARG B 1 62  ? 16.726  -9.197  83.953  1.00 38.95  ? 615 ARG B CG  1 
ATOM   1374 C CD  . ARG B 1 62  ? 15.554  -8.243  84.120  1.00 34.48  ? 615 ARG B CD  1 
ATOM   1375 N NE  . ARG B 1 62  ? 15.113  -8.160  85.517  1.00 42.01  ? 615 ARG B NE  1 
ATOM   1376 C CZ  . ARG B 1 62  ? 14.092  -7.420  85.960  1.00 45.95  ? 615 ARG B CZ  1 
ATOM   1377 N NH1 . ARG B 1 62  ? 13.776  -7.444  87.249  1.00 45.95  ? 615 ARG B NH1 1 
ATOM   1378 N NH2 . ARG B 1 62  ? 13.375  -6.649  85.136  1.00 34.00  ? 615 ARG B NH2 1 
ATOM   1379 N N   . LEU B 1 63  ? 17.079  -12.897 82.390  1.00 35.59  ? 616 LEU B N   1 
ATOM   1380 C CA  . LEU B 1 63  ? 16.902  -14.208 83.014  1.00 27.50  ? 616 LEU B CA  1 
ATOM   1381 C C   . LEU B 1 63  ? 18.247  -14.963 83.110  1.00 23.53  ? 616 LEU B C   1 
ATOM   1382 O O   . LEU B 1 63  ? 18.557  -15.510 84.145  1.00 33.51  ? 616 LEU B O   1 
ATOM   1383 C CB  . LEU B 1 63  ? 15.895  -15.036 82.277  1.00 22.02  ? 616 LEU B CB  1 
ATOM   1384 C CG  . LEU B 1 63  ? 15.637  -16.436 82.794  1.00 31.57  ? 616 LEU B CG  1 
ATOM   1385 C CD1 . LEU B 1 63  ? 15.173  -16.279 84.202  1.00 40.05  ? 616 LEU B CD1 1 
ATOM   1386 C CD2 . LEU B 1 63  ? 14.571  -17.112 81.937  1.00 29.44  ? 616 LEU B CD2 1 
ATOM   1387 N N   . GLU B 1 64  ? 19.050  -14.956 82.060  1.00 30.31  ? 617 GLU B N   1 
ATOM   1388 C CA  . GLU B 1 64  ? 20.339  -15.672 82.104  1.00 44.05  ? 617 GLU B CA  1 
ATOM   1389 C C   . GLU B 1 64  ? 21.427  -15.071 83.011  1.00 44.77  ? 617 GLU B C   1 
ATOM   1390 O O   . GLU B 1 64  ? 22.437  -15.731 83.283  1.00 53.69  ? 617 GLU B O   1 
ATOM   1391 C CB  . GLU B 1 64  ? 20.856  -15.921 80.693  1.00 41.81  ? 617 GLU B CB  1 
ATOM   1392 C CG  . GLU B 1 64  ? 19.925  -16.901 79.975  1.00 44.40  ? 617 GLU B CG  1 
ATOM   1393 C CD  . GLU B 1 64  ? 20.318  -17.225 78.561  1.00 42.24  ? 617 GLU B CD  1 
ATOM   1394 O OE1 . GLU B 1 64  ? 21.189  -16.523 77.996  1.00 43.49  ? 617 GLU B OE1 1 
ATOM   1395 O OE2 . GLU B 1 64  ? 19.734  -18.194 78.015  1.00 50.34  ? 617 GLU B OE2 1 
ATOM   1396 N N   . ALA B 1 65  ? 21.223  -13.849 83.493  1.00 46.17  ? 618 ALA B N   1 
ATOM   1397 C CA  . ALA B 1 65  ? 22.011  -13.349 84.639  1.00 50.18  ? 618 ALA B CA  1 
ATOM   1398 C C   . ALA B 1 65  ? 21.226  -13.498 85.969  1.00 46.47  ? 618 ALA B C   1 
ATOM   1399 O O   . ALA B 1 65  ? 21.521  -12.838 86.946  1.00 50.53  ? 618 ALA B O   1 
ATOM   1400 C CB  . ALA B 1 65  ? 22.455  -11.887 84.397  1.00 47.31  ? 618 ALA B CB  1 
ATOM   1401 N N   . GLN B 1 66  ? 20.221  -14.376 85.988  1.00 47.54  ? 619 GLN B N   1 
ATOM   1402 C CA  . GLN B 1 66  ? 19.320  -14.536 87.134  1.00 48.65  ? 619 GLN B CA  1 
ATOM   1403 C C   . GLN B 1 66  ? 19.042  -13.191 87.808  1.00 48.75  ? 619 GLN B C   1 
ATOM   1404 O O   . GLN B 1 66  ? 19.180  -13.046 89.030  1.00 47.14  ? 619 GLN B O   1 
ATOM   1405 C CB  . GLN B 1 66  ? 19.883  -15.549 88.153  1.00 50.29  ? 619 GLN B CB  1 
ATOM   1406 C CG  . GLN B 1 66  ? 20.546  -16.773 87.536  1.00 43.73  ? 619 GLN B CG  1 
ATOM   1407 C CD  . GLN B 1 66  ? 20.538  -17.977 88.447  1.00 53.78  ? 619 GLN B CD  1 
ATOM   1408 O OE1 . GLN B 1 66  ? 19.485  -18.359 88.950  1.00 46.90  ? 619 GLN B OE1 1 
ATOM   1409 N NE2 . GLN B 1 66  ? 21.716  -18.597 88.658  1.00 41.02  ? 619 GLN B NE2 1 
ATOM   1410 N N   . GLY B 1 67  ? 18.658  -12.217 86.988  1.00 43.13  ? 620 GLY B N   1 
ATOM   1411 C CA  . GLY B 1 67  ? 18.304  -10.880 87.458  1.00 46.38  ? 620 GLY B CA  1 
ATOM   1412 C C   . GLY B 1 67  ? 16.808  -10.719 87.661  1.00 39.77  ? 620 GLY B C   1 
ATOM   1413 O O   . GLY B 1 67  ? 16.308  -9.607  87.759  1.00 32.26  ? 620 GLY B O   1 
ATOM   1414 N N   . TYR B 1 68  ? 16.088  -11.827 87.664  1.00 38.10  ? 621 TYR B N   1 
ATOM   1415 C CA  . TYR B 1 68  ? 14.731  -11.833 88.161  1.00 44.16  ? 621 TYR B CA  1 
ATOM   1416 C C   . TYR B 1 68  ? 14.724  -12.325 89.613  1.00 48.13  ? 621 TYR B C   1 
ATOM   1417 O O   . TYR B 1 68  ? 15.035  -13.486 89.894  1.00 46.32  ? 621 TYR B O   1 
ATOM   1418 C CB  . TYR B 1 68  ? 13.803  -12.663 87.285  1.00 39.21  ? 621 TYR B CB  1 
ATOM   1419 C CG  . TYR B 1 68  ? 13.530  -12.014 85.947  1.00 43.22  ? 621 TYR B CG  1 
ATOM   1420 C CD1 . TYR B 1 68  ? 12.776  -10.856 85.852  1.00 31.83  ? 621 TYR B CD1 1 
ATOM   1421 C CD2 . TYR B 1 68  ? 14.038  -12.565 84.774  1.00 36.79  ? 621 TYR B CD2 1 
ATOM   1422 C CE1 . TYR B 1 68  ? 12.537  -10.255 84.606  1.00 43.02  ? 621 TYR B CE1 1 
ATOM   1423 C CE2 . TYR B 1 68  ? 13.814  -11.991 83.555  1.00 23.50  ? 621 TYR B CE2 1 
ATOM   1424 C CZ  . TYR B 1 68  ? 13.062  -10.845 83.466  1.00 41.71  ? 621 TYR B CZ  1 
ATOM   1425 O OH  . TYR B 1 68  ? 12.856  -10.317 82.217  1.00 28.38  ? 621 TYR B OH  1 
ATOM   1426 N N   . LYS B 1 69  ? 14.400  -11.388 90.506  1.00 47.47  ? 622 LYS B N   1 
ATOM   1427 C CA  . LYS B 1 69  ? 14.209  -11.613 91.935  1.00 46.78  ? 622 LYS B CA  1 
ATOM   1428 C C   . LYS B 1 69  ? 13.054  -12.591 92.166  1.00 37.60  ? 622 LYS B C   1 
ATOM   1429 O O   . LYS B 1 69  ? 13.118  -13.430 93.062  1.00 29.56  ? 622 LYS B O   1 
ATOM   1430 C CB  . LYS B 1 69  ? 13.916  -10.249 92.615  1.00 52.03  ? 622 LYS B CB  1 
ATOM   1431 C CG  . LYS B 1 69  ? 13.943  -10.191 94.141  1.00 54.74  ? 622 LYS B CG  1 
ATOM   1432 C CD  . LYS B 1 69  ? 13.396  -8.837  94.665  1.00 50.13  ? 622 LYS B CD  1 
ATOM   1433 N N   . ASN B 1 70  ? 11.998  -12.476 91.365  1.00 30.59  ? 623 ASN B N   1 
ATOM   1434 C CA  . ASN B 1 70  ? 10.833  -13.313 91.537  1.00 38.50  ? 623 ASN B CA  1 
ATOM   1435 C C   . ASN B 1 70  ? 9.885   -13.305 90.313  1.00 38.32  ? 623 ASN B C   1 
ATOM   1436 O O   . ASN B 1 70  ? 10.109  -12.568 89.362  1.00 40.09  ? 623 ASN B O   1 
ATOM   1437 C CB  . ASN B 1 70  ? 10.091  -12.888 92.790  1.00 35.79  ? 623 ASN B CB  1 
ATOM   1438 C CG  . ASN B 1 70  ? 9.138   -11.769 92.527  1.00 53.90  ? 623 ASN B CG  1 
ATOM   1439 O OD1 . ASN B 1 70  ? 7.949   -11.887 92.799  1.00 74.42  ? 623 ASN B OD1 1 
ATOM   1440 N ND2 . ASN B 1 70  ? 9.634   -10.698 91.935  1.00 46.81  ? 623 ASN B ND2 1 
ATOM   1441 N N   . LEU B 1 71  ? 8.817   -14.102 90.359  1.00 30.94  ? 624 LEU B N   1 
ATOM   1442 C CA  . LEU B 1 71  ? 7.907   -14.251 89.213  1.00 34.23  ? 624 LEU B CA  1 
ATOM   1443 C C   . LEU B 1 71  ? 7.270   -12.944 88.813  1.00 38.53  ? 624 LEU B C   1 
ATOM   1444 O O   . LEU B 1 71  ? 6.959   -12.710 87.629  1.00 35.59  ? 624 LEU B O   1 
ATOM   1445 C CB  . LEU B 1 71  ? 6.784   -15.257 89.507  1.00 36.53  ? 624 LEU B CB  1 
ATOM   1446 C CG  . LEU B 1 71  ? 5.704   -15.433 88.427  1.00 34.42  ? 624 LEU B CG  1 
ATOM   1447 C CD1 . LEU B 1 71  ? 6.347   -15.803 87.116  1.00 33.30  ? 624 LEU B CD1 1 
ATOM   1448 C CD2 . LEU B 1 71  ? 4.679   -16.481 88.811  1.00 39.56  ? 624 LEU B CD2 1 
ATOM   1449 N N   . HIS B 1 72  ? 7.036   -12.109 89.815  1.00 35.93  ? 625 HIS B N   1 
ATOM   1450 C CA  . HIS B 1 72  ? 6.330   -10.876 89.619  1.00 34.22  ? 625 HIS B CA  1 
ATOM   1451 C C   . HIS B 1 72  ? 7.107   -9.962  88.672  1.00 29.48  ? 625 HIS B C   1 
ATOM   1452 O O   . HIS B 1 72  ? 6.505   -9.336  87.815  1.00 24.20  ? 625 HIS B O   1 
ATOM   1453 C CB  . HIS B 1 72  ? 6.091   -10.203 90.977  1.00 40.37  ? 625 HIS B CB  1 
ATOM   1454 C CG  . HIS B 1 72  ? 5.355   -8.903  90.886  1.00 47.26  ? 625 HIS B CG  1 
ATOM   1455 N ND1 . HIS B 1 72  ? 6.002   -7.699  90.710  1.00 50.96  ? 625 HIS B ND1 1 
ATOM   1456 C CD2 . HIS B 1 72  ? 4.033   -8.617  90.933  1.00 59.78  ? 625 HIS B CD2 1 
ATOM   1457 C CE1 . HIS B 1 72  ? 5.111   -6.724  90.664  1.00 59.03  ? 625 HIS B CE1 1 
ATOM   1458 N NE2 . HIS B 1 72  ? 3.907   -7.254  90.795  1.00 66.25  ? 625 HIS B NE2 1 
ATOM   1459 N N   . GLU B 1 73  ? 8.442   -9.913  88.808  1.00 29.53  ? 626 GLU B N   1 
ATOM   1460 C CA  . GLU B 1 73  ? 9.303   -9.087  87.939  1.00 25.87  ? 626 GLU B CA  1 
ATOM   1461 C C   . GLU B 1 73  ? 9.197   -9.537  86.487  1.00 33.58  ? 626 GLU B C   1 
ATOM   1462 O O   . GLU B 1 73  ? 8.902   -8.733  85.580  1.00 33.30  ? 626 GLU B O   1 
ATOM   1463 C CB  . GLU B 1 73  ? 10.774  -9.115  88.425  1.00 36.37  ? 626 GLU B CB  1 
ATOM   1464 C CG  . GLU B 1 73  ? 11.047  -8.279  89.750  1.00 33.91  ? 626 GLU B CG  1 
ATOM   1465 C CD  . GLU B 1 73  ? 12.554  -8.182  90.141  1.00 56.51  ? 626 GLU B CD  1 
ATOM   1466 O OE1 . GLU B 1 73  ? 13.364  -9.044  89.736  1.00 50.66  ? 626 GLU B OE1 1 
ATOM   1467 O OE2 . GLU B 1 73  ? 12.932  -7.234  90.860  1.00 59.42  ? 626 GLU B OE2 1 
ATOM   1468 N N   . PHE B 1 74  ? 9.419   -10.833 86.279  1.00 33.53  ? 627 PHE B N   1 
ATOM   1469 C CA  . PHE B 1 74  ? 9.244   -11.483 84.981  1.00 31.26  ? 627 PHE B CA  1 
ATOM   1470 C C   . PHE B 1 74  ? 7.902   -11.159 84.315  1.00 29.13  ? 627 PHE B C   1 
ATOM   1471 O O   . PHE B 1 74  ? 7.868   -10.811 83.147  1.00 38.38  ? 627 PHE B O   1 
ATOM   1472 C CB  . PHE B 1 74  ? 9.377   -12.981 85.157  1.00 33.44  ? 627 PHE B CB  1 
ATOM   1473 C CG  . PHE B 1 74  ? 9.221   -13.759 83.888  1.00 29.44  ? 627 PHE B CG  1 
ATOM   1474 C CD1 . PHE B 1 74  ? 7.968   -14.030 83.376  1.00 21.41  ? 627 PHE B CD1 1 
ATOM   1475 C CD2 . PHE B 1 74  ? 10.331  -14.222 83.218  1.00 22.35  ? 627 PHE B CD2 1 
ATOM   1476 C CE1 . PHE B 1 74  ? 7.830   -14.763 82.239  1.00 34.49  ? 627 PHE B CE1 1 
ATOM   1477 C CE2 . PHE B 1 74  ? 10.209  -14.950 82.068  1.00 27.98  ? 627 PHE B CE2 1 
ATOM   1478 C CZ  . PHE B 1 74  ? 8.965   -15.235 81.576  1.00 21.68  ? 627 PHE B CZ  1 
ATOM   1479 N N   . GLU B 1 75  ? 6.808   -11.230 85.057  1.00 28.01  ? 628 GLU B N   1 
ATOM   1480 C CA  . GLU B 1 75  ? 5.485   -10.944 84.476  1.00 30.07  ? 628 GLU B CA  1 
ATOM   1481 C C   . GLU B 1 75  ? 5.252   -9.472  84.091  1.00 35.93  ? 628 GLU B C   1 
ATOM   1482 O O   . GLU B 1 75  ? 4.490   -9.172  83.171  1.00 43.56  ? 628 GLU B O   1 
ATOM   1483 C CB  . GLU B 1 75  ? 4.342   -11.290 85.429  1.00 33.82  ? 628 GLU B CB  1 
ATOM   1484 C CG  . GLU B 1 75  ? 4.360   -12.662 86.105  1.00 50.56  ? 628 GLU B CG  1 
ATOM   1485 C CD  . GLU B 1 75  ? 2.977   -13.017 86.683  1.00 58.76  ? 628 GLU B CD  1 
ATOM   1486 O OE1 . GLU B 1 75  ? 2.696   -12.718 87.866  1.00 54.26  ? 628 GLU B OE1 1 
ATOM   1487 O OE2 . GLU B 1 75  ? 2.155   -13.547 85.922  1.00 53.38  ? 628 GLU B OE2 1 
ATOM   1488 N N   . GLU B 1 76  ? 5.851   -8.560  84.840  1.00 34.01  ? 629 GLU B N   1 
ATOM   1489 C CA  . GLU B 1 76  ? 5.745   -7.155  84.537  1.00 36.42  ? 629 GLU B CA  1 
ATOM   1490 C C   . GLU B 1 76  ? 6.367   -6.872  83.161  1.00 35.90  ? 629 GLU B C   1 
ATOM   1491 O O   . GLU B 1 76  ? 5.742   -6.222  82.328  1.00 34.60  ? 629 GLU B O   1 
ATOM   1492 C CB  . GLU B 1 76  ? 6.407   -6.353  85.646  1.00 34.79  ? 629 GLU B CB  1 
ATOM   1493 C CG  . GLU B 1 76  ? 6.326   -4.844  85.497  1.00 47.71  ? 629 GLU B CG  1 
ATOM   1494 C CD  . GLU B 1 76  ? 6.796   -4.098  86.763  1.00 41.16  ? 629 GLU B CD  1 
ATOM   1495 O OE1 . GLU B 1 76  ? 6.836   -2.854  86.713  1.00 51.68  ? 629 GLU B OE1 1 
ATOM   1496 O OE2 . GLU B 1 76  ? 7.114   -4.750  87.795  1.00 42.86  ? 629 GLU B OE2 1 
ATOM   1497 N N   . ASP B 1 77  ? 7.568   -7.391  82.915  1.00 36.35  ? 630 ASP B N   1 
ATOM   1498 C CA  . ASP B 1 77  ? 8.184   -7.357  81.571  1.00 41.23  ? 630 ASP B CA  1 
ATOM   1499 C C   . ASP B 1 77  ? 7.325   -7.933  80.448  1.00 39.97  ? 630 ASP B C   1 
ATOM   1500 O O   . ASP B 1 77  ? 7.326   -7.384  79.342  1.00 34.97  ? 630 ASP B O   1 
ATOM   1501 C CB  . ASP B 1 77  ? 9.538   -8.081  81.551  1.00 36.50  ? 630 ASP B CB  1 
ATOM   1502 C CG  . ASP B 1 77  ? 10.636  -7.227  82.062  1.00 28.56  ? 630 ASP B CG  1 
ATOM   1503 O OD1 . ASP B 1 77  ? 10.396  -6.027  82.096  1.00 36.90  ? 630 ASP B OD1 1 
ATOM   1504 O OD2 . ASP B 1 77  ? 11.738  -7.711  82.367  1.00 32.05  ? 630 ASP B OD2 1 
ATOM   1505 N N   . PHE B 1 78  ? 6.620   -9.034  80.709  1.00 34.08  ? 631 PHE B N   1 
ATOM   1506 C CA  . PHE B 1 78  ? 5.823   -9.648  79.657  1.00 26.12  ? 631 PHE B CA  1 
ATOM   1507 C C   . PHE B 1 78  ? 4.641   -8.744  79.381  1.00 32.94  ? 631 PHE B C   1 
ATOM   1508 O O   . PHE B 1 78  ? 4.216   -8.607  78.239  1.00 36.44  ? 631 PHE B O   1 
ATOM   1509 C CB  . PHE B 1 78  ? 5.380   -11.081 80.026  1.00 25.51  ? 631 PHE B CB  1 
ATOM   1510 C CG  . PHE B 1 78  ? 4.503   -11.758 78.974  1.00 20.12  ? 631 PHE B CG  1 
ATOM   1511 C CD1 . PHE B 1 78  ? 5.033   -12.213 77.761  1.00 21.15  ? 631 PHE B CD1 1 
ATOM   1512 C CD2 . PHE B 1 78  ? 3.135   -11.914 79.199  1.00 31.22  ? 631 PHE B CD2 1 
ATOM   1513 C CE1 . PHE B 1 78  ? 4.227   -12.800 76.795  1.00 31.57  ? 631 PHE B CE1 1 
ATOM   1514 C CE2 . PHE B 1 78  ? 2.327   -12.531 78.269  1.00 29.20  ? 631 PHE B CE2 1 
ATOM   1515 C CZ  . PHE B 1 78  ? 2.857   -12.963 77.047  1.00 30.12  ? 631 PHE B CZ  1 
ATOM   1516 N N   . ASP B 1 79  ? 4.106   -8.119  80.419  1.00 33.18  ? 632 ASP B N   1 
ATOM   1517 C CA  . ASP B 1 79  ? 3.044   -7.145  80.217  1.00 34.11  ? 632 ASP B CA  1 
ATOM   1518 C C   . ASP B 1 79  ? 3.575   -5.993  79.365  1.00 33.09  ? 632 ASP B C   1 
ATOM   1519 O O   . ASP B 1 79  ? 2.839   -5.433  78.570  1.00 30.99  ? 632 ASP B O   1 
ATOM   1520 C CB  . ASP B 1 79  ? 2.483   -6.641  81.557  1.00 37.07  ? 632 ASP B CB  1 
ATOM   1521 C CG  . ASP B 1 79  ? 1.483   -7.615  82.186  1.00 54.81  ? 632 ASP B CG  1 
ATOM   1522 O OD1 . ASP B 1 79  ? 1.452   -8.793  81.768  1.00 63.73  ? 632 ASP B OD1 1 
ATOM   1523 O OD2 . ASP B 1 79  ? 0.734   -7.208  83.107  1.00 59.27  ? 632 ASP B OD2 1 
ATOM   1524 N N   . LEU B 1 80  ? 4.859   -5.653  79.489  1.00 32.96  ? 633 LEU B N   1 
ATOM   1525 C CA  . LEU B 1 80  ? 5.400   -4.563  78.659  1.00 32.75  ? 633 LEU B CA  1 
ATOM   1526 C C   . LEU B 1 80  ? 5.317   -4.912  77.190  1.00 33.17  ? 633 LEU B C   1 
ATOM   1527 O O   . LEU B 1 80  ? 4.844   -4.112  76.372  1.00 37.30  ? 633 LEU B O   1 
ATOM   1528 C CB  . LEU B 1 80  ? 6.821   -4.185  79.049  1.00 29.16  ? 633 LEU B CB  1 
ATOM   1529 C CG  . LEU B 1 80  ? 6.932   -3.341  80.331  1.00 40.40  ? 633 LEU B CG  1 
ATOM   1530 C CD1 . LEU B 1 80  ? 8.411   -3.165  80.730  1.00 33.11  ? 633 LEU B CD1 1 
ATOM   1531 C CD2 . LEU B 1 80  ? 6.212   -1.982  80.176  1.00 23.58  ? 633 LEU B CD2 1 
ATOM   1532 N N   . ILE B 1 81  ? 5.702   -6.127  76.852  1.00 32.54  ? 634 ILE B N   1 
ATOM   1533 C CA  . ILE B 1 81  ? 5.682   -6.557  75.434  1.00 27.92  ? 634 ILE B CA  1 
ATOM   1534 C C   . ILE B 1 81  ? 4.258   -6.425  74.848  1.00 29.49  ? 634 ILE B C   1 
ATOM   1535 O O   . ILE B 1 81  ? 4.055   -5.820  73.795  1.00 33.55  ? 634 ILE B O   1 
ATOM   1536 C CB  . ILE B 1 81  ? 6.255   -7.982  75.310  1.00 30.27  ? 634 ILE B CB  1 
ATOM   1537 C CG1 . ILE B 1 81  ? 7.739   -7.975  75.727  1.00 38.36  ? 634 ILE B CG1 1 
ATOM   1538 C CG2 . ILE B 1 81  ? 6.132   -8.517  73.883  1.00 34.20  ? 634 ILE B CG2 1 
ATOM   1539 C CD1 . ILE B 1 81  ? 8.286   -9.324  76.132  1.00 27.78  ? 634 ILE B CD1 1 
ATOM   1540 N N   . ILE B 1 82  ? 3.267   -6.932  75.564  1.00 29.88  ? 635 ILE B N   1 
ATOM   1541 C CA  . ILE B 1 82  ? 1.903   -6.955  75.058  1.00 27.99  ? 635 ILE B CA  1 
ATOM   1542 C C   . ILE B 1 82  ? 1.424   -5.519  74.995  1.00 31.07  ? 635 ILE B C   1 
ATOM   1543 O O   . ILE B 1 82  ? 0.979   -5.026  73.958  1.00 28.51  ? 635 ILE B O   1 
ATOM   1544 C CB  . ILE B 1 82  ? 0.979   -7.730  76.021  1.00 30.79  ? 635 ILE B CB  1 
ATOM   1545 C CG1 . ILE B 1 82  ? 1.453   -9.174  76.201  1.00 34.96  ? 635 ILE B CG1 1 
ATOM   1546 C CG2 . ILE B 1 82  ? -0.486  -7.641  75.579  1.00 34.81  ? 635 ILE B CG2 1 
ATOM   1547 C CD1 . ILE B 1 82  ? 1.768   -9.946  74.952  1.00 25.45  ? 635 ILE B CD1 1 
ATOM   1548 N N   . ASP B 1 83  ? 1.550   -4.849  76.133  1.00 37.22  ? 636 ASP B N   1 
ATOM   1549 C CA  . ASP B 1 83  ? 0.990   -3.527  76.320  1.00 39.17  ? 636 ASP B CA  1 
ATOM   1550 C C   . ASP B 1 83  ? 1.650   -2.485  75.382  1.00 39.07  ? 636 ASP B C   1 
ATOM   1551 O O   . ASP B 1 83  ? 0.951   -1.702  74.708  1.00 37.18  ? 636 ASP B O   1 
ATOM   1552 C CB  . ASP B 1 83  ? 1.076   -3.132  77.808  1.00 38.64  ? 636 ASP B CB  1 
ATOM   1553 C CG  . ASP B 1 83  ? 0.228   -4.044  78.717  1.00 50.31  ? 636 ASP B CG  1 
ATOM   1554 O OD1 . ASP B 1 83  ? -0.876  -4.427  78.292  1.00 40.64  ? 636 ASP B OD1 1 
ATOM   1555 O OD2 . ASP B 1 83  ? 0.652   -4.367  79.856  1.00 49.97  ? 636 ASP B OD2 1 
ATOM   1556 N N   . ASN B 1 84  ? 2.979   -2.481  75.312  1.00 29.97  ? 637 ASN B N   1 
ATOM   1557 C CA  . ASN B 1 84  ? 3.645   -1.622  74.344  1.00 33.84  ? 637 ASN B CA  1 
ATOM   1558 C C   . ASN B 1 84  ? 3.049   -1.814  72.950  1.00 35.41  ? 637 ASN B C   1 
ATOM   1559 O O   . ASN B 1 84  ? 2.663   -0.839  72.288  1.00 28.65  ? 637 ASN B O   1 
ATOM   1560 C CB  . ASN B 1 84  ? 5.159   -1.887  74.285  1.00 29.53  ? 637 ASN B CB  1 
ATOM   1561 C CG  . ASN B 1 84  ? 5.882   -1.406  75.534  1.00 21.06  ? 637 ASN B CG  1 
ATOM   1562 O OD1 . ASN B 1 84  ? 5.281   -0.759  76.370  1.00 32.36  ? 637 ASN B OD1 1 
ATOM   1563 N ND2 . ASN B 1 84  ? 7.180   -1.750  75.671  1.00 28.14  ? 637 ASN B ND2 1 
ATOM   1564 N N   . CYS B 1 85  ? 2.965   -3.077  72.524  1.00 36.94  ? 638 CYS B N   1 
ATOM   1565 C CA  . CYS B 1 85  ? 2.505   -3.406  71.185  1.00 33.73  ? 638 CYS B CA  1 
ATOM   1566 C C   . CYS B 1 85  ? 1.038   -3.028  70.976  1.00 33.84  ? 638 CYS B C   1 
ATOM   1567 O O   . CYS B 1 85  ? 0.650   -2.672  69.879  1.00 36.19  ? 638 CYS B O   1 
ATOM   1568 C CB  . CYS B 1 85  ? 2.709   -4.885  70.888  1.00 36.52  ? 638 CYS B CB  1 
ATOM   1569 S SG  . CYS B 1 85  ? 2.331   -5.327  69.194  1.00 35.89  ? 638 CYS B SG  1 
ATOM   1570 N N   . MET B 1 86  ? 0.237   -3.080  72.032  1.00 43.54  ? 639 MET B N   1 
ATOM   1571 C CA  . MET B 1 86  ? -1.173  -2.667  71.949  1.00 40.86  ? 639 MET B CA  1 
ATOM   1572 C C   . MET B 1 86  ? -1.327  -1.127  72.043  1.00 43.84  ? 639 MET B C   1 
ATOM   1573 O O   . MET B 1 86  ? -2.344  -0.571  71.611  1.00 41.93  ? 639 MET B O   1 
ATOM   1574 C CB  . MET B 1 86  ? -1.994  -3.372  73.044  1.00 36.07  ? 639 MET B CB  1 
ATOM   1575 C CG  . MET B 1 86  ? -1.928  -4.899  72.979  1.00 40.73  ? 639 MET B CG  1 
ATOM   1576 S SD  . MET B 1 86  ? -3.121  -5.778  74.032  1.00 43.11  ? 639 MET B SD  1 
ATOM   1577 C CE  . MET B 1 86  ? -4.642  -4.952  73.568  1.00 37.63  ? 639 MET B CE  1 
ATOM   1578 N N   . LYS B 1 87  ? -0.327  -0.459  72.611  1.00 38.00  ? 640 LYS B N   1 
ATOM   1579 C CA  . LYS B 1 87  ? -0.288  1.004   72.659  1.00 46.02  ? 640 LYS B CA  1 
ATOM   1580 C C   . LYS B 1 87  ? 0.178   1.634   71.331  1.00 37.12  ? 640 LYS B C   1 
ATOM   1581 O O   . LYS B 1 87  ? -0.413  2.577   70.851  1.00 41.54  ? 640 LYS B O   1 
ATOM   1582 C CB  . LYS B 1 87  ? 0.644   1.483   73.792  1.00 49.17  ? 640 LYS B CB  1 
ATOM   1583 C CG  . LYS B 1 87  ? 0.008   1.540   75.174  1.00 53.37  ? 640 LYS B CG  1 
ATOM   1584 C CD  . LYS B 1 87  ? 1.058   1.412   76.319  1.00 61.78  ? 640 LYS B CD  1 
ATOM   1585 C CE  . LYS B 1 87  ? 1.765   2.738   76.665  1.00 69.37  ? 640 LYS B CE  1 
ATOM   1586 N NZ  . LYS B 1 87  ? 2.612   2.596   77.913  1.00 57.51  ? 640 LYS B NZ  1 
ATOM   1587 N N   . TYR B 1 88  ? 1.253   1.127   70.751  1.00 34.42  ? 641 TYR B N   1 
ATOM   1588 C CA  . TYR B 1 88  ? 1.767   1.710   69.529  1.00 31.08  ? 641 TYR B CA  1 
ATOM   1589 C C   . TYR B 1 88  ? 0.928   1.471   68.272  1.00 35.61  ? 641 TYR B C   1 
ATOM   1590 O O   . TYR B 1 88  ? 0.782   2.365   67.463  1.00 36.29  ? 641 TYR B O   1 
ATOM   1591 C CB  . TYR B 1 88  ? 3.163   1.222   69.277  1.00 32.16  ? 641 TYR B CB  1 
ATOM   1592 C CG  . TYR B 1 88  ? 3.759   1.865   68.059  1.00 39.79  ? 641 TYR B CG  1 
ATOM   1593 C CD1 . TYR B 1 88  ? 3.777   1.213   66.844  1.00 34.96  ? 641 TYR B CD1 1 
ATOM   1594 C CD2 . TYR B 1 88  ? 4.276   3.139   68.121  1.00 31.78  ? 641 TYR B CD2 1 
ATOM   1595 C CE1 . TYR B 1 88  ? 4.322   1.805   65.733  1.00 36.31  ? 641 TYR B CE1 1 
ATOM   1596 C CE2 . TYR B 1 88  ? 4.821   3.740   67.012  1.00 39.86  ? 641 TYR B CE2 1 
ATOM   1597 C CZ  . TYR B 1 88  ? 4.845   3.074   65.823  1.00 31.52  ? 641 TYR B CZ  1 
ATOM   1598 O OH  . TYR B 1 88  ? 5.392   3.703   64.714  1.00 36.68  ? 641 TYR B OH  1 
ATOM   1599 N N   . ASN B 1 89  ? 0.406   0.265   68.089  1.00 36.93  ? 642 ASN B N   1 
ATOM   1600 C CA  . ASN B 1 89  ? -0.272  -0.103  66.829  1.00 40.49  ? 642 ASN B CA  1 
ATOM   1601 C C   . ASN B 1 89  ? -1.771  -0.013  67.070  1.00 35.39  ? 642 ASN B C   1 
ATOM   1602 O O   . ASN B 1 89  ? -2.187  -0.107  68.194  1.00 37.17  ? 642 ASN B O   1 
ATOM   1603 C CB  . ASN B 1 89  ? 0.114   -1.532  66.407  1.00 33.80  ? 642 ASN B CB  1 
ATOM   1604 C CG  . ASN B 1 89  ? 1.635   -1.750  66.321  1.00 34.33  ? 642 ASN B CG  1 
ATOM   1605 O OD1 . ASN B 1 89  ? 2.253   -1.459  65.303  1.00 50.66  ? 642 ASN B OD1 1 
ATOM   1606 N ND2 . ASN B 1 89  ? 2.223   -2.331  67.371  1.00 31.86  ? 642 ASN B ND2 1 
ATOM   1607 N N   . ALA B 1 90  ? -2.580  0.164   66.033  1.00 45.82  ? 643 ALA B N   1 
ATOM   1608 C CA  . ALA B 1 90  ? -4.040  0.331   66.201  1.00 46.57  ? 643 ALA B CA  1 
ATOM   1609 C C   . ALA B 1 90  ? -4.800  -1.006  66.286  1.00 51.39  ? 643 ALA B C   1 
ATOM   1610 O O   . ALA B 1 90  ? -4.244  -2.055  65.971  1.00 56.28  ? 643 ALA B O   1 
ATOM   1611 C CB  . ALA B 1 90  ? -4.594  1.185   65.064  1.00 51.76  ? 643 ALA B CB  1 
ATOM   1612 N N   . ARG B 1 91  ? -6.072  -0.964  66.696  1.00 53.97  ? 644 ARG B N   1 
ATOM   1613 C CA  . ARG B 1 91  ? -6.912  -2.179  66.801  1.00 56.82  ? 644 ARG B CA  1 
ATOM   1614 C C   . ARG B 1 91  ? -6.992  -2.986  65.498  1.00 55.43  ? 644 ARG B C   1 
ATOM   1615 O O   . ARG B 1 91  ? -7.143  -4.217  65.522  1.00 44.43  ? 644 ARG B O   1 
ATOM   1616 C CB  . ARG B 1 91  ? -8.354  -1.828  67.236  1.00 62.50  ? 644 ARG B CB  1 
ATOM   1617 C CG  . ARG B 1 91  ? -8.613  -1.790  68.760  1.00 70.38  ? 644 ARG B CG  1 
ATOM   1618 C CD  . ARG B 1 91  ? -10.123 -1.809  69.093  1.00 60.02  ? 644 ARG B CD  1 
ATOM   1619 N N   . ASP B 1 92  ? -6.903  -2.277  64.372  1.00 55.18  ? 645 ASP B N   1 
ATOM   1620 C CA  . ASP B 1 92  ? -7.156  -2.841  63.046  1.00 53.75  ? 645 ASP B CA  1 
ATOM   1621 C C   . ASP B 1 92  ? -5.978  -3.644  62.502  1.00 56.90  ? 645 ASP B C   1 
ATOM   1622 O O   . ASP B 1 92  ? -6.144  -4.366  61.523  1.00 62.05  ? 645 ASP B O   1 
ATOM   1623 C CB  . ASP B 1 92  ? -7.521  -1.724  62.043  1.00 47.41  ? 645 ASP B CB  1 
ATOM   1624 N N   . THR B 1 93  ? -4.808  -3.545  63.138  1.00 51.49  ? 646 THR B N   1 
ATOM   1625 C CA  . THR B 1 93  ? -3.576  -4.100  62.573  1.00 45.54  ? 646 THR B CA  1 
ATOM   1626 C C   . THR B 1 93  ? -3.185  -5.515  63.037  1.00 42.99  ? 646 THR B C   1 
ATOM   1627 O O   . THR B 1 93  ? -3.750  -6.085  63.962  1.00 42.83  ? 646 THR B O   1 
ATOM   1628 C CB  . THR B 1 93  ? -2.371  -3.176  62.850  1.00 44.52  ? 646 THR B CB  1 
ATOM   1629 O OG1 . THR B 1 93  ? -1.994  -3.299  64.216  1.00 31.96  ? 646 THR B OG1 1 
ATOM   1630 C CG2 . THR B 1 93  ? -2.728  -1.730  62.531  1.00 44.92  ? 646 THR B CG2 1 
ATOM   1631 N N   . VAL B 1 94  ? -2.185  -6.031  62.340  1.00 41.70  ? 647 VAL B N   1 
ATOM   1632 C CA  . VAL B 1 94  ? -1.652  -7.365  62.499  1.00 46.24  ? 647 VAL B CA  1 
ATOM   1633 C C   . VAL B 1 94  ? -0.782  -7.449  63.741  1.00 43.06  ? 647 VAL B C   1 
ATOM   1634 O O   . VAL B 1 94  ? -0.781  -8.449  64.427  1.00 46.92  ? 647 VAL B O   1 
ATOM   1635 C CB  . VAL B 1 94  ? -0.795  -7.737  61.243  1.00 45.53  ? 647 VAL B CB  1 
ATOM   1636 C CG1 . VAL B 1 94  ? 0.136   -8.882  61.524  1.00 33.97  ? 647 VAL B CG1 1 
ATOM   1637 C CG2 . VAL B 1 94  ? -1.705  -8.042  60.065  1.00 53.61  ? 647 VAL B CG2 1 
ATOM   1638 N N   . PHE B 1 95  ? -0.019  -6.401  64.010  1.00 38.89  ? 648 PHE B N   1 
ATOM   1639 C CA  . PHE B 1 95  ? 0.750   -6.333  65.224  1.00 33.12  ? 648 PHE B CA  1 
ATOM   1640 C C   . PHE B 1 95  ? -0.141  -6.295  66.473  1.00 35.27  ? 648 PHE B C   1 
ATOM   1641 O O   . PHE B 1 95  ? 0.152   -6.954  67.469  1.00 29.60  ? 648 PHE B O   1 
ATOM   1642 C CB  . PHE B 1 95  ? 1.641   -5.116  65.201  1.00 41.26  ? 648 PHE B CB  1 
ATOM   1643 C CG  . PHE B 1 95  ? 2.858   -5.262  64.348  1.00 40.72  ? 648 PHE B CG  1 
ATOM   1644 C CD1 . PHE B 1 95  ? 3.752   -6.314  64.569  1.00 37.35  ? 648 PHE B CD1 1 
ATOM   1645 C CD2 . PHE B 1 95  ? 3.152   -4.296  63.372  1.00 38.67  ? 648 PHE B CD2 1 
ATOM   1646 C CE1 . PHE B 1 95  ? 4.900   -6.438  63.816  1.00 36.20  ? 648 PHE B CE1 1 
ATOM   1647 C CE2 . PHE B 1 95  ? 4.296   -4.399  62.598  1.00 42.36  ? 648 PHE B CE2 1 
ATOM   1648 C CZ  . PHE B 1 95  ? 5.181   -5.474  62.809  1.00 53.52  ? 648 PHE B CZ  1 
ATOM   1649 N N   . TYR B 1 96  ? -1.255  -5.569  66.419  1.00 38.80  ? 649 TYR B N   1 
ATOM   1650 C CA  . TYR B 1 96  ? -2.128  -5.508  67.587  1.00 35.70  ? 649 TYR B CA  1 
ATOM   1651 C C   . TYR B 1 96  ? -2.713  -6.897  67.863  1.00 40.59  ? 649 TYR B C   1 
ATOM   1652 O O   . TYR B 1 96  ? -2.684  -7.389  69.002  1.00 39.77  ? 649 TYR B O   1 
ATOM   1653 C CB  . TYR B 1 96  ? -3.200  -4.478  67.377  1.00 40.19  ? 649 TYR B CB  1 
ATOM   1654 C CG  . TYR B 1 96  ? -4.130  -4.252  68.529  1.00 32.26  ? 649 TYR B CG  1 
ATOM   1655 C CD1 . TYR B 1 96  ? -5.282  -5.005  68.666  1.00 47.42  ? 649 TYR B CD1 1 
ATOM   1656 C CD2 . TYR B 1 96  ? -3.901  -3.228  69.441  1.00 38.29  ? 649 TYR B CD2 1 
ATOM   1657 C CE1 . TYR B 1 96  ? -6.170  -4.764  69.711  1.00 34.27  ? 649 TYR B CE1 1 
ATOM   1658 C CE2 . TYR B 1 96  ? -4.767  -2.985  70.486  1.00 48.13  ? 649 TYR B CE2 1 
ATOM   1659 C CZ  . TYR B 1 96  ? -5.914  -3.757  70.613  1.00 44.10  ? 649 TYR B CZ  1 
ATOM   1660 O OH  . TYR B 1 96  ? -6.799  -3.530  71.649  1.00 35.29  ? 649 TYR B OH  1 
ATOM   1661 N N   . ARG B 1 97  ? -3.148  -7.569  66.802  1.00 42.20  ? 650 ARG B N   1 
ATOM   1662 C CA  . ARG B 1 97  ? -3.720  -8.912  66.950  1.00 43.32  ? 650 ARG B CA  1 
ATOM   1663 C C   . ARG B 1 97  ? -2.742  -9.959  67.513  1.00 37.18  ? 650 ARG B C   1 
ATOM   1664 O O   . ARG B 1 97  ? -3.160  -10.826 68.303  1.00 34.17  ? 650 ARG B O   1 
ATOM   1665 C CB  . ARG B 1 97  ? -4.367  -9.362  65.631  1.00 47.24  ? 650 ARG B CB  1 
ATOM   1666 C CG  . ARG B 1 97  ? -5.595  -8.510  65.293  1.00 53.04  ? 650 ARG B CG  1 
ATOM   1667 C CD  . ARG B 1 97  ? -6.437  -9.019  64.118  1.00 65.37  ? 650 ARG B CD  1 
ATOM   1668 N NE  . ARG B 1 97  ? -6.128  -8.311  62.874  1.00 65.71  ? 650 ARG B NE  1 
ATOM   1669 C CZ  . ARG B 1 97  ? -5.408  -8.808  61.868  1.00 82.57  ? 650 ARG B CZ  1 
ATOM   1670 N NH1 . ARG B 1 97  ? -5.192  -8.061  60.786  1.00 84.73  ? 650 ARG B NH1 1 
ATOM   1671 N NH2 . ARG B 1 97  ? -4.907  -10.045 61.921  1.00 74.43  ? 650 ARG B NH2 1 
ATOM   1672 N N   . ALA B 1 98  ? -1.461  -9.849  67.136  1.00 28.07  ? 651 ALA B N   1 
ATOM   1673 C CA  . ALA B 1 98  ? -0.428  -10.788 67.544  1.00 29.99  ? 651 ALA B CA  1 
ATOM   1674 C C   . ALA B 1 98  ? -0.199  -10.664 69.033  1.00 26.82  ? 651 ALA B C   1 
ATOM   1675 O O   . ALA B 1 98  ? -0.049  -11.656 69.722  1.00 36.40  ? 651 ALA B O   1 
ATOM   1676 C CB  . ALA B 1 98  ? 0.905   -10.519 66.778  1.00 25.46  ? 651 ALA B CB  1 
ATOM   1677 N N   . ALA B 1 99  ? -0.188  -9.424  69.511  1.00 33.54  ? 652 ALA B N   1 
ATOM   1678 C CA  . ALA B 1 99  ? -0.031  -9.121  70.908  1.00 29.34  ? 652 ALA B CA  1 
ATOM   1679 C C   . ALA B 1 99  ? -1.199  -9.707  71.704  1.00 34.30  ? 652 ALA B C   1 
ATOM   1680 O O   . ALA B 1 99  ? -0.998  -10.373 72.732  1.00 33.84  ? 652 ALA B O   1 
ATOM   1681 C CB  . ALA B 1 99  ? 0.068   -7.624  71.117  1.00 33.30  ? 652 ALA B CB  1 
ATOM   1682 N N   . VAL B 1 100 ? -2.409  -9.501  71.208  1.00 26.94  ? 653 VAL B N   1 
ATOM   1683 C CA  . VAL B 1 100 ? -3.591  -10.082 71.832  1.00 31.44  ? 653 VAL B CA  1 
ATOM   1684 C C   . VAL B 1 100 ? -3.612  -11.616 71.920  1.00 29.31  ? 653 VAL B C   1 
ATOM   1685 O O   . VAL B 1 100 ? -3.918  -12.146 72.970  1.00 27.30  ? 653 VAL B O   1 
ATOM   1686 C CB  . VAL B 1 100 ? -4.873  -9.609  71.108  1.00 33.68  ? 653 VAL B CB  1 
ATOM   1687 C CG1 . VAL B 1 100 ? -6.027  -10.532 71.412  1.00 24.86  ? 653 VAL B CG1 1 
ATOM   1688 C CG2 . VAL B 1 100 ? -5.176  -8.221  71.539  1.00 31.30  ? 653 VAL B CG2 1 
ATOM   1689 N N   . ARG B 1 101 ? -3.314  -12.329 70.832  1.00 33.40  ? 654 ARG B N   1 
ATOM   1690 C CA  . ARG B 1 101 ? -3.211  -13.787 70.890  1.00 35.61  ? 654 ARG B CA  1 
ATOM   1691 C C   . ARG B 1 101 ? -2.113  -14.204 71.864  1.00 35.67  ? 654 ARG B C   1 
ATOM   1692 O O   . ARG B 1 101 ? -2.225  -15.220 72.538  1.00 40.05  ? 654 ARG B O   1 
ATOM   1693 C CB  . ARG B 1 101 ? -2.905  -14.386 69.502  1.00 42.04  ? 654 ARG B CB  1 
ATOM   1694 C CG  . ARG B 1 101 ? -4.059  -14.281 68.508  1.00 52.45  ? 654 ARG B CG  1 
ATOM   1695 C CD  . ARG B 1 101 ? -3.751  -14.924 67.152  1.00 60.86  ? 654 ARG B CD  1 
ATOM   1696 N NE  . ARG B 1 101 ? -3.265  -13.951 66.157  1.00 74.93  ? 654 ARG B NE  1 
ATOM   1697 C CZ  . ARG B 1 101 ? -2.009  -13.854 65.700  1.00 39.34  ? 654 ARG B CZ  1 
ATOM   1698 N NH1 . ARG B 1 101 ? -1.046  -14.682 66.127  1.00 57.88  ? 654 ARG B NH1 1 
ATOM   1699 N NH2 . ARG B 1 101 ? -1.715  -12.924 64.800  1.00 58.97  ? 654 ARG B NH2 1 
ATOM   1700 N N   . LEU B 1 102 ? -1.052  -13.414 71.941  1.00 31.34  ? 655 LEU B N   1 
ATOM   1701 C CA  . LEU B 1 102 ? 0.105   -13.818 72.742  1.00 29.86  ? 655 LEU B CA  1 
ATOM   1702 C C   . LEU B 1 102 ? -0.241  -13.584 74.199  1.00 33.04  ? 655 LEU B C   1 
ATOM   1703 O O   . LEU B 1 102 ? 0.172   -14.345 75.063  1.00 30.70  ? 655 LEU B O   1 
ATOM   1704 C CB  . LEU B 1 102 ? 1.354   -13.049 72.330  1.00 16.30  ? 655 LEU B CB  1 
ATOM   1705 C CG  . LEU B 1 102 ? 2.623   -13.263 73.192  1.00 46.81  ? 655 LEU B CG  1 
ATOM   1706 C CD1 . LEU B 1 102 ? 2.981   -14.724 73.228  1.00 26.54  ? 655 LEU B CD1 1 
ATOM   1707 C CD2 . LEU B 1 102 ? 3.869   -12.441 72.761  1.00 25.37  ? 655 LEU B CD2 1 
ATOM   1708 N N   . ARG B 1 103 ? -1.030  -12.541 74.466  1.00 39.52  ? 656 ARG B N   1 
ATOM   1709 C CA  . ARG B 1 103 ? -1.590  -12.337 75.810  1.00 42.54  ? 656 ARG B CA  1 
ATOM   1710 C C   . ARG B 1 103 ? -2.523  -13.489 76.218  1.00 40.36  ? 656 ARG B C   1 
ATOM   1711 O O   . ARG B 1 103 ? -2.343  -14.081 77.262  1.00 37.39  ? 656 ARG B O   1 
ATOM   1712 C CB  . ARG B 1 103 ? -2.345  -11.020 75.883  1.00 42.28  ? 656 ARG B CB  1 
ATOM   1713 C CG  . ARG B 1 103 ? -3.059  -10.756 77.212  1.00 50.87  ? 656 ARG B CG  1 
ATOM   1714 C CD  . ARG B 1 103 ? -4.386  -10.016 77.006  1.00 47.98  ? 656 ARG B CD  1 
ATOM   1715 N NE  . ARG B 1 103 ? -4.289  -8.617  77.418  1.00 71.00  ? 656 ARG B NE  1 
ATOM   1716 C CZ  . ARG B 1 103 ? -5.229  -7.696  77.218  1.00 71.69  ? 656 ARG B CZ  1 
ATOM   1717 N NH1 . ARG B 1 103 ? -6.366  -8.008  76.593  1.00 72.50  ? 656 ARG B NH1 1 
ATOM   1718 N NH2 . ARG B 1 103 ? -5.024  -6.452  77.648  1.00 64.32  ? 656 ARG B NH2 1 
ATOM   1719 N N   . ASP B 1 104 ? -3.505  -13.792 75.376  1.00 46.84  ? 657 ASP B N   1 
ATOM   1720 C CA  . ASP B 1 104 ? -4.491  -14.829 75.667  1.00 49.94  ? 657 ASP B CA  1 
ATOM   1721 C C   . ASP B 1 104 ? -3.811  -16.166 75.921  1.00 51.75  ? 657 ASP B C   1 
ATOM   1722 O O   . ASP B 1 104 ? -4.047  -16.808 76.941  1.00 54.00  ? 657 ASP B O   1 
ATOM   1723 C CB  . ASP B 1 104 ? -5.477  -14.962 74.502  1.00 47.82  ? 657 ASP B CB  1 
ATOM   1724 C CG  . ASP B 1 104 ? -6.389  -13.741 74.351  1.00 55.47  ? 657 ASP B CG  1 
ATOM   1725 O OD1 . ASP B 1 104 ? -6.489  -12.945 75.318  1.00 47.22  ? 657 ASP B OD1 1 
ATOM   1726 O OD2 . ASP B 1 104 ? -7.007  -13.584 73.260  1.00 55.71  ? 657 ASP B OD2 1 
ATOM   1727 N N   . GLN B 1 105 ? -2.944  -16.570 74.999  1.00 49.67  ? 658 GLN B N   1 
ATOM   1728 C CA  . GLN B 1 105 ? -2.255  -17.850 75.117  1.00 43.28  ? 658 GLN B CA  1 
ATOM   1729 C C   . GLN B 1 105 ? -1.183  -17.877 76.223  1.00 37.29  ? 658 GLN B C   1 
ATOM   1730 O O   . GLN B 1 105 ? -0.821  -18.935 76.712  1.00 42.27  ? 658 GLN B O   1 
ATOM   1731 C CB  . GLN B 1 105 ? -1.634  -18.238 73.778  1.00 47.29  ? 658 GLN B CB  1 
ATOM   1732 C CG  . GLN B 1 105 ? -2.625  -18.493 72.660  1.00 41.70  ? 658 GLN B CG  1 
ATOM   1733 C CD  . GLN B 1 105 ? -1.935  -18.720 71.321  1.00 35.21  ? 658 GLN B CD  1 
ATOM   1734 O OE1 . GLN B 1 105 ? -1.422  -17.789 70.715  1.00 52.94  ? 658 GLN B OE1 1 
ATOM   1735 N NE2 . GLN B 1 105 ? -1.929  -19.963 70.859  1.00 41.52  ? 658 GLN B NE2 1 
ATOM   1736 N N   . GLY B 1 106 ? -0.683  -16.727 76.632  1.00 39.54  ? 659 GLY B N   1 
ATOM   1737 C CA  . GLY B 1 106 ? 0.407   -16.698 77.596  1.00 37.83  ? 659 GLY B CA  1 
ATOM   1738 C C   . GLY B 1 106 ? -0.075  -16.682 79.026  1.00 40.34  ? 659 GLY B C   1 
ATOM   1739 O O   . GLY B 1 106 ? 0.684   -16.972 79.948  1.00 39.60  ? 659 GLY B O   1 
ATOM   1740 N N   . GLY B 1 107 ? -1.337  -16.340 79.226  1.00 40.18  ? 660 GLY B N   1 
ATOM   1741 C CA  . GLY B 1 107 ? -1.878  -16.316 80.578  1.00 39.84  ? 660 GLY B CA  1 
ATOM   1742 C C   . GLY B 1 107 ? -1.910  -17.710 81.154  1.00 38.40  ? 660 GLY B C   1 
ATOM   1743 O O   . GLY B 1 107 ? -1.646  -17.912 82.334  1.00 40.83  ? 660 GLY B O   1 
ATOM   1744 N N   . VAL B 1 108 ? -2.241  -18.671 80.298  1.00 39.65  ? 661 VAL B N   1 
ATOM   1745 C CA  . VAL B 1 108 ? -2.240  -20.090 80.637  1.00 37.93  ? 661 VAL B CA  1 
ATOM   1746 C C   . VAL B 1 108 ? -0.882  -20.554 81.186  1.00 41.30  ? 661 VAL B C   1 
ATOM   1747 O O   . VAL B 1 108 ? -0.821  -21.259 82.185  1.00 38.60  ? 661 VAL B O   1 
ATOM   1748 C CB  . VAL B 1 108 ? -2.594  -20.916 79.388  1.00 45.72  ? 661 VAL B CB  1 
ATOM   1749 C CG1 . VAL B 1 108 ? -2.574  -22.409 79.690  1.00 40.53  ? 661 VAL B CG1 1 
ATOM   1750 C CG2 . VAL B 1 108 ? -3.964  -20.455 78.818  1.00 40.22  ? 661 VAL B CG2 1 
ATOM   1751 N N   . VAL B 1 109 ? 0.201   -20.150 80.533  1.00 34.67  ? 662 VAL B N   1 
ATOM   1752 C CA  . VAL B 1 109 ? 1.558   -20.577 80.938  1.00 33.14  ? 662 VAL B CA  1 
ATOM   1753 C C   . VAL B 1 109 ? 1.909   -19.889 82.224  1.00 34.21  ? 662 VAL B C   1 
ATOM   1754 O O   . VAL B 1 109 ? 2.516   -20.498 83.103  1.00 38.57  ? 662 VAL B O   1 
ATOM   1755 C CB  . VAL B 1 109 ? 2.618   -20.227 79.845  1.00 22.82  ? 662 VAL B CB  1 
ATOM   1756 C CG1 . VAL B 1 109 ? 4.070   -20.640 80.266  1.00 27.27  ? 662 VAL B CG1 1 
ATOM   1757 C CG2 . VAL B 1 109 ? 2.177   -20.860 78.553  1.00 30.75  ? 662 VAL B CG2 1 
ATOM   1758 N N   . LEU B 1 110 ? 1.508   -18.625 82.348  1.00 35.59  ? 663 LEU B N   1 
ATOM   1759 C CA  . LEU B 1 110 ? 1.895   -17.832 83.527  1.00 39.43  ? 663 LEU B CA  1 
ATOM   1760 C C   . LEU B 1 110 ? 1.113   -18.244 84.780  1.00 37.64  ? 663 LEU B C   1 
ATOM   1761 O O   . LEU B 1 110 ? 1.681   -18.287 85.861  1.00 36.17  ? 663 LEU B O   1 
ATOM   1762 C CB  . LEU B 1 110 ? 1.759   -16.323 83.270  1.00 39.05  ? 663 LEU B CB  1 
ATOM   1763 C CG  . LEU B 1 110 ? 2.893   -15.746 82.429  1.00 35.96  ? 663 LEU B CG  1 
ATOM   1764 C CD1 . LEU B 1 110 ? 2.588   -14.284 82.086  1.00 39.97  ? 663 LEU B CD1 1 
ATOM   1765 C CD2 . LEU B 1 110 ? 4.201   -15.877 83.182  1.00 26.68  ? 663 LEU B CD2 1 
ATOM   1766 N N   . ARG B 1 111 ? -0.166  -18.565 84.608  1.00 29.25  ? 664 ARG B N   1 
ATOM   1767 C CA  . ARG B 1 111 ? -0.984  -19.134 85.676  1.00 36.13  ? 664 ARG B CA  1 
ATOM   1768 C C   . ARG B 1 111 ? -0.438  -20.480 86.112  1.00 36.37  ? 664 ARG B C   1 
ATOM   1769 O O   . ARG B 1 111 ? -0.311  -20.743 87.292  1.00 41.73  ? 664 ARG B O   1 
ATOM   1770 C CB  . ARG B 1 111 ? -2.455  -19.253 85.249  1.00 36.37  ? 664 ARG B CB  1 
ATOM   1771 C CG  . ARG B 1 111 ? -3.194  -17.904 85.293  1.00 47.80  ? 664 ARG B CG  1 
ATOM   1772 C CD  . ARG B 1 111 ? -4.724  -18.046 85.161  1.00 53.89  ? 664 ARG B CD  1 
ATOM   1773 N NE  . ARG B 1 111 ? -5.138  -18.456 83.823  1.00 64.24  ? 664 ARG B NE  1 
ATOM   1774 C CZ  . ARG B 1 111 ? -5.208  -17.654 82.757  1.00 64.43  ? 664 ARG B CZ  1 
ATOM   1775 N NH1 . ARG B 1 111 ? -5.599  -18.161 81.593  1.00 59.07  ? 664 ARG B NH1 1 
ATOM   1776 N NH2 . ARG B 1 111 ? -4.873  -16.366 82.828  1.00 50.59  ? 664 ARG B NH2 1 
ATOM   1777 N N   . GLN B 1 112 ? -0.080  -21.324 85.161  1.00 37.77  ? 665 GLN B N   1 
ATOM   1778 C CA  . GLN B 1 112 ? 0.636   -22.543 85.500  1.00 36.10  ? 665 GLN B CA  1 
ATOM   1779 C C   . GLN B 1 112 ? 1.923   -22.271 86.281  1.00 30.12  ? 665 GLN B C   1 
ATOM   1780 O O   . GLN B 1 112 ? 2.255   -23.014 87.200  1.00 35.46  ? 665 GLN B O   1 
ATOM   1781 C CB  . GLN B 1 112 ? 0.983   -23.363 84.254  1.00 37.12  ? 665 GLN B CB  1 
ATOM   1782 C CG  . GLN B 1 112 ? 1.646   -24.723 84.607  1.00 42.78  ? 665 GLN B CG  1 
ATOM   1783 C CD  . GLN B 1 112 ? 0.787   -25.530 85.597  1.00 75.10  ? 665 GLN B CD  1 
ATOM   1784 O OE1 . GLN B 1 112 ? -0.470  -25.470 85.560  1.00 51.08  ? 665 GLN B OE1 1 
ATOM   1785 N NE2 . GLN B 1 112 ? 1.455   -26.268 86.499  1.00 51.22  ? 665 GLN B NE2 1 
ATOM   1786 N N   . ALA B 1 113 ? 2.636   -21.216 85.905  1.00 32.55  ? 666 ALA B N   1 
ATOM   1787 C CA  . ALA B 1 113 ? 3.884   -20.852 86.550  1.00 30.70  ? 666 ALA B CA  1 
ATOM   1788 C C   . ALA B 1 113 ? 3.615   -20.401 87.986  1.00 29.83  ? 666 ALA B C   1 
ATOM   1789 O O   . ALA B 1 113 ? 4.363   -20.734 88.898  1.00 27.54  ? 666 ALA B O   1 
ATOM   1790 C CB  . ALA B 1 113 ? 4.553   -19.757 85.771  1.00 34.77  ? 666 ALA B CB  1 
ATOM   1791 N N   . ARG B 1 114 ? 2.530   -19.666 88.177  1.00 28.64  ? 667 ARG B N   1 
ATOM   1792 C CA  . ARG B 1 114 ? 2.111   -19.225 89.523  1.00 36.74  ? 667 ARG B CA  1 
ATOM   1793 C C   . ARG B 1 114 ? 1.806   -20.461 90.415  1.00 35.00  ? 667 ARG B C   1 
ATOM   1794 O O   . ARG B 1 114 ? 2.321   -20.514 91.533  1.00 33.56  ? 667 ARG B O   1 
ATOM   1795 C CB  . ARG B 1 114 ? 0.936   -18.212 89.432  1.00 36.80  ? 667 ARG B CB  1 
ATOM   1796 C CG  . ARG B 1 114 ? 0.498   -17.480 90.771  1.00 52.71  ? 667 ARG B CG  1 
ATOM   1797 C CD  . ARG B 1 114 ? 1.520   -16.439 91.315  1.00 54.61  ? 667 ARG B CD  1 
ATOM   1798 N N   . ARG B 1 115 ? 1.041   -21.456 89.912  1.00 31.31  ? 668 ARG B N   1 
ATOM   1799 C CA  . ARG B 1 115 ? 0.855   -22.768 90.633  1.00 34.86  ? 668 ARG B CA  1 
ATOM   1800 C C   . ARG B 1 115 ? 2.196   -23.403 91.047  1.00 31.04  ? 668 ARG B C   1 
ATOM   1801 O O   . ARG B 1 115 ? 2.334   -23.948 92.125  1.00 28.57  ? 668 ARG B O   1 
ATOM   1802 C CB  . ARG B 1 115 ? 0.180   -23.874 89.812  1.00 35.56  ? 668 ARG B CB  1 
ATOM   1803 C CG  . ARG B 1 115 ? -0.944  -23.554 88.849  1.00 55.00  ? 668 ARG B CG  1 
ATOM   1804 C CD  . ARG B 1 115 ? -2.269  -23.429 89.498  1.00 57.29  ? 668 ARG B CD  1 
ATOM   1805 N NE  . ARG B 1 115 ? -2.603  -22.022 89.724  1.00 83.89  ? 668 ARG B NE  1 
ATOM   1806 C CZ  . ARG B 1 115 ? -3.685  -21.397 89.255  1.00 84.36  ? 668 ARG B CZ  1 
ATOM   1807 N NH1 . ARG B 1 115 ? -4.595  -22.046 88.527  1.00 57.52  ? 668 ARG B NH1 1 
ATOM   1808 N NH2 . ARG B 1 115 ? -3.870  -20.109 89.540  1.00 88.61  ? 668 ARG B NH2 1 
ATOM   1809 N N   . GLU B 1 116 ? 3.194   -23.340 90.185  1.00 25.49  ? 669 GLU B N   1 
ATOM   1810 C CA  . GLU B 1 116 ? 4.381   -24.146 90.402  1.00 23.84  ? 669 GLU B CA  1 
ATOM   1811 C C   . GLU B 1 116 ? 5.333   -23.485 91.374  1.00 24.56  ? 669 GLU B C   1 
ATOM   1812 O O   . GLU B 1 116 ? 6.025   -24.189 92.125  1.00 36.35  ? 669 GLU B O   1 
ATOM   1813 C CB  . GLU B 1 116 ? 5.044   -24.499 89.057  1.00 31.55  ? 669 GLU B CB  1 
ATOM   1814 C CG  . GLU B 1 116 ? 6.294   -25.411 89.177  1.00 43.18  ? 669 GLU B CG  1 
ATOM   1815 C CD  . GLU B 1 116 ? 6.006   -26.735 89.885  1.00 47.67  ? 669 GLU B CD  1 
ATOM   1816 O OE1 . GLU B 1 116 ? 4.885   -27.285 89.708  1.00 23.92  ? 669 GLU B OE1 1 
ATOM   1817 O OE2 . GLU B 1 116 ? 6.912   -27.221 90.608  1.00 51.20  ? 669 GLU B OE2 1 
ATOM   1818 N N   . VAL B 1 117 ? 5.367   -22.144 91.386  1.00 28.26  ? 670 VAL B N   1 
ATOM   1819 C CA  . VAL B 1 117 ? 6.002   -21.390 92.486  1.00 31.25  ? 670 VAL B CA  1 
ATOM   1820 C C   . VAL B 1 117 ? 5.350   -21.788 93.822  1.00 27.63  ? 670 VAL B C   1 
ATOM   1821 O O   . VAL B 1 117 ? 6.020   -22.166 94.780  1.00 32.61  ? 670 VAL B O   1 
ATOM   1822 C CB  . VAL B 1 117 ? 5.907   -19.840 92.301  1.00 35.12  ? 670 VAL B CB  1 
ATOM   1823 C CG1 . VAL B 1 117 ? 6.171   -19.145 93.581  1.00 42.24  ? 670 VAL B CG1 1 
ATOM   1824 C CG2 . VAL B 1 117 ? 6.911   -19.353 91.305  1.00 38.14  ? 670 VAL B CG2 1 
ATOM   1825 N N   . ASP B 1 118 ? 4.029   -21.716 93.895  1.00 35.02  ? 671 ASP B N   1 
ATOM   1826 C CA  . ASP B 1 118 ? 3.320   -22.219 95.099  1.00 26.62  ? 671 ASP B CA  1 
ATOM   1827 C C   . ASP B 1 118 ? 3.724   -23.634 95.468  1.00 30.29  ? 671 ASP B C   1 
ATOM   1828 O O   . ASP B 1 118 ? 4.048   -23.923 96.611  1.00 33.61  ? 671 ASP B O   1 
ATOM   1829 C CB  . ASP B 1 118 ? 1.823   -22.162 94.887  1.00 29.58  ? 671 ASP B CB  1 
ATOM   1830 C CG  . ASP B 1 118 ? 1.291   -20.750 94.893  1.00 44.06  ? 671 ASP B CG  1 
ATOM   1831 O OD1 . ASP B 1 118 ? 1.949   -19.884 95.497  1.00 58.02  ? 671 ASP B OD1 1 
ATOM   1832 O OD2 . ASP B 1 118 ? 0.236   -20.503 94.275  1.00 41.73  ? 671 ASP B OD2 1 
ATOM   1833 N N   . SER B 1 119 ? 3.754   -24.521 94.480  1.00 32.22  ? 672 SER B N   1 
ATOM   1834 C CA  . SER B 1 119 ? 4.045   -25.917 94.746  1.00 31.71  ? 672 SER B CA  1 
ATOM   1835 C C   . SER B 1 119 ? 5.447   -26.123 95.337  1.00 32.10  ? 672 SER B C   1 
ATOM   1836 O O   . SER B 1 119 ? 5.610   -26.953 96.221  1.00 36.16  ? 672 SER B O   1 
ATOM   1837 C CB  . SER B 1 119 ? 3.836   -26.793 93.482  1.00 31.90  ? 672 SER B CB  1 
ATOM   1838 O OG  . SER B 1 119 ? 4.480   -28.056 93.643  1.00 22.78  ? 672 SER B OG  1 
ATOM   1839 N N   . ILE B 1 120 ? 6.455   -25.390 94.873  1.00 33.34  ? 673 ILE B N   1 
ATOM   1840 C CA  . ILE B 1 120 ? 7.798   -25.574 95.425  1.00 34.48  ? 673 ILE B CA  1 
ATOM   1841 C C   . ILE B 1 120 ? 7.852   -25.019 96.835  1.00 36.83  ? 673 ILE B C   1 
ATOM   1842 O O   . ILE B 1 120 ? 8.549   -25.550 97.710  1.00 39.84  ? 673 ILE B O   1 
ATOM   1843 C CB  . ILE B 1 120 ? 8.883   -24.899 94.582  1.00 41.11  ? 673 ILE B CB  1 
ATOM   1844 C CG1 . ILE B 1 120 ? 9.055   -25.630 93.255  1.00 31.80  ? 673 ILE B CG1 1 
ATOM   1845 C CG2 . ILE B 1 120 ? 10.206  -24.914 95.339  1.00 47.07  ? 673 ILE B CG2 1 
ATOM   1846 C CD1 . ILE B 1 120 ? 9.818   -24.850 92.251  1.00 40.25  ? 673 ILE B CD1 1 
ATOM   1847 N N   . GLY B 1 121 ? 7.086   -23.966 97.057  1.00 28.79  ? 674 GLY B N   1 
ATOM   1848 C CA  . GLY B 1 121 ? 6.851   -23.463 98.424  1.00 35.99  ? 674 GLY B CA  1 
ATOM   1849 C C   . GLY B 1 121 ? 6.272   -24.488 99.391  1.00 43.09  ? 674 GLY B C   1 
ATOM   1850 O O   . GLY B 1 121 ? 6.525   -24.397 100.607 1.00 48.20  ? 674 GLY B O   1 
ATOM   1851 N N   . LEU B 1 122 ? 5.493   -25.463 98.901  1.00 34.72  ? 675 LEU B N   1 
ATOM   1852 C CA  . LEU B 1 122 ? 4.967   -26.472 99.834  1.00 37.83  ? 675 LEU B CA  1 
ATOM   1853 C C   . LEU B 1 122 ? 5.866   -27.695 100.004 1.00 38.42  ? 675 LEU B C   1 
ATOM   1854 O O   . LEU B 1 122 ? 5.484   -28.598 100.736 1.00 37.73  ? 675 LEU B O   1 
ATOM   1855 C CB  . LEU B 1 122 ? 3.559   -26.944 99.470  1.00 32.39  ? 675 LEU B CB  1 
ATOM   1856 C CG  . LEU B 1 122 ? 2.438   -25.936 99.240  1.00 33.43  ? 675 LEU B CG  1 
ATOM   1857 C CD1 . LEU B 1 122 ? 1.149   -26.736 99.003  1.00 31.23  ? 675 LEU B CD1 1 
ATOM   1858 C CD2 . LEU B 1 122 ? 2.277   -24.975 100.411 1.00 40.96  ? 675 LEU B CD2 1 
ATOM   1859 N N   . GLU B 1 123 ? 7.037   -27.729 99.365  1.00 40.14  ? 676 GLU B N   1 
ATOM   1860 C CA  . GLU B 1 123 ? 7.935   -28.901 99.446  1.00 41.91  ? 676 GLU B CA  1 
ATOM   1861 C C   . GLU B 1 123 ? 8.610   -29.056 100.795 1.00 53.59  ? 676 GLU B C   1 
ATOM   1862 O O   . GLU B 1 123 ? 9.056   -30.153 101.161 1.00 58.82  ? 676 GLU B O   1 
ATOM   1863 C CB  . GLU B 1 123 ? 9.076   -28.805 98.446  1.00 41.92  ? 676 GLU B CB  1 
ATOM   1864 C CG  . GLU B 1 123 ? 8.884   -29.525 97.181  1.00 32.83  ? 676 GLU B CG  1 
ATOM   1865 C CD  . GLU B 1 123 ? 10.173  -30.146 96.635  1.00 59.80  ? 676 GLU B CD  1 
ATOM   1866 O OE1 . GLU B 1 123 ? 11.120  -30.305 97.421  1.00 41.90  ? 676 GLU B OE1 1 
ATOM   1867 O OE2 . GLU B 1 123 ? 10.236  -30.500 95.428  1.00 82.76  ? 676 GLU B OE2 1 
ATOM   1868 N N   . GLU B 1 124 ? 8.747   -27.956 101.517 1.00 59.68  ? 677 GLU B N   1 
ATOM   1869 C CA  . GLU B 1 124 ? 9.540   -27.960 102.737 1.00 65.23  ? 677 GLU B CA  1 
ATOM   1870 C C   . GLU B 1 124 ? 9.278   -29.222 103.572 1.00 63.67  ? 677 GLU B C   1 
ATOM   1871 O O   . GLU B 1 124 ? 10.231  -29.881 104.010 1.00 64.11  ? 677 GLU B O   1 
ATOM   1872 C CB  . GLU B 1 124 ? 9.299   -26.665 103.530 1.00 65.34  ? 677 GLU B CB  1 
ATOM   1873 C CG  . GLU B 1 124 ? 9.787   -26.661 104.982 1.00 83.32  ? 677 GLU B CG  1 
ATOM   1874 C CD  . GLU B 1 124 ? 11.297  -26.711 105.142 1.00 92.80  ? 677 GLU B CD  1 
ATOM   1875 O OE1 . GLU B 1 124 ? 11.964  -27.439 104.368 1.00 97.16  ? 677 GLU B OE1 1 
ATOM   1876 O OE2 . GLU B 1 124 ? 11.806  -26.037 106.073 1.00 76.82  ? 677 GLU B OE2 1 
ATOM   1877 N N   . ALA B 1 125 ? 8.004   -29.585 103.743 1.00 56.99  ? 678 ALA B N   1 
ATOM   1878 C CA  . ALA B 1 125 ? 7.647   -30.678 104.641 1.00 57.70  ? 678 ALA B CA  1 
ATOM   1879 C C   . ALA B 1 125 ? 8.293   -32.005 104.222 1.00 57.09  ? 678 ALA B C   1 
ATOM   1880 O O   . ALA B 1 125 ? 8.805   -32.736 105.059 1.00 57.31  ? 678 ALA B O   1 
ATOM   1881 C CB  . ALA B 1 125 ? 6.127   -30.819 104.757 1.00 58.41  ? 678 ALA B CB  1 
ATOM   1882 N N   . SER B 1 126 ? 8.284   -32.305 102.932 1.00 56.45  ? 679 SER B N   1 
ATOM   1883 C CA  . SER B 1 126 ? 8.989   -33.486 102.420 1.00 63.39  ? 679 SER B CA  1 
ATOM   1884 C C   . SER B 1 126 ? 10.497  -33.562 102.802 1.00 67.74  ? 679 SER B C   1 
ATOM   1885 O O   . SER B 1 126 ? 11.054  -34.661 102.898 1.00 70.20  ? 679 SER B O   1 
ATOM   1886 C CB  . SER B 1 126 ? 8.818   -33.591 100.899 1.00 57.49  ? 679 SER B CB  1 
ATOM   1887 O OG  . SER B 1 126 ? 9.353   -32.454 100.237 1.00 55.00  ? 679 SER B OG  1 
ATOM   1888 N N   . GLY B 1 127 ? 11.144  -32.414 103.020 1.00 69.19  ? 680 GLY B N   1 
ATOM   1889 C CA  . GLY B 1 127 ? 12.541  -32.383 103.479 1.00 69.73  ? 680 GLY B CA  1 
ATOM   1890 C C   . GLY B 1 127 ? 12.714  -32.773 104.942 1.00 66.09  ? 680 GLY B C   1 
ATOM   1891 O O   . GLY B 1 127 ? 12.920  -33.946 105.259 1.00 65.70  ? 680 GLY B O   1 
ATOM   1892 N N   . THR C 1 12  ? 16.768  0.305   118.632 1.00 53.99  ? 565 THR C N   1 
ATOM   1893 C CA  . THR C 1 12  ? 16.075  1.234   119.591 1.00 60.01  ? 565 THR C CA  1 
ATOM   1894 C C   . THR C 1 12  ? 16.289  0.765   121.023 1.00 61.05  ? 565 THR C C   1 
ATOM   1895 O O   . THR C 1 12  ? 16.546  -0.419  121.251 1.00 65.31  ? 565 THR C O   1 
ATOM   1896 C CB  . THR C 1 12  ? 14.535  1.322   119.354 1.00 62.19  ? 565 THR C CB  1 
ATOM   1897 O OG1 . THR C 1 12  ? 13.875  0.360   120.183 1.00 44.42  ? 565 THR C OG1 1 
ATOM   1898 C CG2 . THR C 1 12  ? 14.161  1.079   117.873 1.00 55.92  ? 565 THR C CG2 1 
ATOM   1899 N N   . PRO C 1 13  ? 16.164  1.680   122.001 1.00 64.88  ? 566 PRO C N   1 
ATOM   1900 C CA  . PRO C 1 13  ? 16.378  1.241   123.387 1.00 63.43  ? 566 PRO C CA  1 
ATOM   1901 C C   . PRO C 1 13  ? 15.206  0.450   124.010 1.00 58.07  ? 566 PRO C C   1 
ATOM   1902 O O   . PRO C 1 13  ? 15.449  -0.385  124.891 1.00 47.35  ? 566 PRO C O   1 
ATOM   1903 C CB  . PRO C 1 13  ? 16.643  2.560   124.147 1.00 62.25  ? 566 PRO C CB  1 
ATOM   1904 C CG  . PRO C 1 13  ? 16.886  3.594   123.083 1.00 70.39  ? 566 PRO C CG  1 
ATOM   1905 C CD  . PRO C 1 13  ? 16.067  3.147   121.912 1.00 69.03  ? 566 PRO C CD  1 
ATOM   1906 N N   . LEU C 1 14  ? 13.966  0.706   123.577 1.00 52.73  ? 567 LEU C N   1 
ATOM   1907 C CA  . LEU C 1 14  ? 12.831  -0.145  123.973 1.00 47.42  ? 567 LEU C CA  1 
ATOM   1908 C C   . LEU C 1 14  ? 13.113  -1.634  123.743 1.00 37.62  ? 567 LEU C C   1 
ATOM   1909 O O   . LEU C 1 14  ? 12.911  -2.469  124.605 1.00 41.80  ? 567 LEU C O   1 
ATOM   1910 C CB  . LEU C 1 14  ? 11.546  0.227   123.209 1.00 44.35  ? 567 LEU C CB  1 
ATOM   1911 C CG  . LEU C 1 14  ? 10.311  -0.426  123.859 1.00 47.67  ? 567 LEU C CG  1 
ATOM   1912 C CD1 . LEU C 1 14  ? 10.131  0.156   125.240 1.00 35.35  ? 567 LEU C CD1 1 
ATOM   1913 C CD2 . LEU C 1 14  ? 9.017   -0.281  123.069 1.00 40.35  ? 567 LEU C CD2 1 
ATOM   1914 N N   . THR C 1 15  ? 13.577  -1.947  122.555 1.00 38.81  ? 568 THR C N   1 
ATOM   1915 C CA  . THR C 1 15  ? 13.719  -3.313  122.115 1.00 40.64  ? 568 THR C CA  1 
ATOM   1916 C C   . THR C 1 15  ? 14.835  -4.047  122.880 1.00 42.06  ? 568 THR C C   1 
ATOM   1917 O O   . THR C 1 15  ? 14.716  -5.238  123.180 1.00 40.21  ? 568 THR C O   1 
ATOM   1918 C CB  . THR C 1 15  ? 13.985  -3.302  120.592 1.00 46.44  ? 568 THR C CB  1 
ATOM   1919 O OG1 . THR C 1 15  ? 13.193  -2.273  119.992 1.00 57.52  ? 568 THR C OG1 1 
ATOM   1920 C CG2 . THR C 1 15  ? 13.635  -4.601  119.944 1.00 36.89  ? 568 THR C CG2 1 
ATOM   1921 N N   . VAL C 1 16  ? 15.921  -3.356  123.202 1.00 40.65  ? 569 VAL C N   1 
ATOM   1922 C CA  . VAL C 1 16  ? 16.983  -3.998  123.980 1.00 44.78  ? 569 VAL C CA  1 
ATOM   1923 C C   . VAL C 1 16  ? 16.450  -4.198  125.382 1.00 42.14  ? 569 VAL C C   1 
ATOM   1924 O O   . VAL C 1 16  ? 16.719  -5.202  126.021 1.00 46.40  ? 569 VAL C O   1 
ATOM   1925 C CB  . VAL C 1 16  ? 18.306  -3.187  124.011 1.00 45.99  ? 569 VAL C CB  1 
ATOM   1926 C CG1 . VAL C 1 16  ? 19.355  -3.902  124.850 1.00 57.01  ? 569 VAL C CG1 1 
ATOM   1927 C CG2 . VAL C 1 16  ? 18.836  -2.984  122.603 1.00 50.03  ? 569 VAL C CG2 1 
ATOM   1928 N N   . LEU C 1 17  ? 15.649  -3.255  125.840 1.00 38.92  ? 570 LEU C N   1 
ATOM   1929 C CA  . LEU C 1 17  ? 15.037  -3.388  127.153 1.00 38.04  ? 570 LEU C CA  1 
ATOM   1930 C C   . LEU C 1 17  ? 14.088  -4.552  127.211 1.00 30.27  ? 570 LEU C C   1 
ATOM   1931 O O   . LEU C 1 17  ? 14.259  -5.426  128.028 1.00 30.84  ? 570 LEU C O   1 
ATOM   1932 C CB  . LEU C 1 17  ? 14.295  -2.108  127.544 1.00 33.84  ? 570 LEU C CB  1 
ATOM   1933 C CG  . LEU C 1 17  ? 13.802  -2.071  128.981 1.00 44.53  ? 570 LEU C CG  1 
ATOM   1934 C CD1 . LEU C 1 17  ? 14.847  -2.635  129.937 1.00 39.69  ? 570 LEU C CD1 1 
ATOM   1935 C CD2 . LEU C 1 17  ? 13.437  -0.666  129.348 1.00 46.96  ? 570 LEU C CD2 1 
ATOM   1936 N N   . LEU C 1 18  ? 13.075  -4.562  126.349 1.00 34.09  ? 571 LEU C N   1 
ATOM   1937 C CA  . LEU C 1 18  ? 12.068  -5.642  126.374 1.00 32.21  ? 571 LEU C CA  1 
ATOM   1938 C C   . LEU C 1 18  ? 12.665  -7.037  126.146 1.00 32.46  ? 571 LEU C C   1 
ATOM   1939 O O   . LEU C 1 18  ? 12.133  -8.021  126.649 1.00 31.26  ? 571 LEU C O   1 
ATOM   1940 C CB  . LEU C 1 18  ? 10.947  -5.380  125.363 1.00 31.63  ? 571 LEU C CB  1 
ATOM   1941 C CG  . LEU C 1 18  ? 10.039  -4.175  125.658 1.00 37.37  ? 571 LEU C CG  1 
ATOM   1942 C CD1 . LEU C 1 18  ? 8.943   -4.103  124.624 1.00 33.49  ? 571 LEU C CD1 1 
ATOM   1943 C CD2 . LEU C 1 18  ? 9.417   -4.260  127.024 1.00 24.99  ? 571 LEU C CD2 1 
ATOM   1944 N N   . ARG C 1 19  ? 13.765  -7.126  125.402 1.00 34.81  ? 572 ARG C N   1 
ATOM   1945 C CA  . ARG C 1 19  ? 14.417  -8.419  125.190 1.00 32.27  ? 572 ARG C CA  1 
ATOM   1946 C C   . ARG C 1 19  ? 14.911  -8.993  126.476 1.00 33.27  ? 572 ARG C C   1 
ATOM   1947 O O   . ARG C 1 19  ? 14.780  -10.185 126.708 1.00 38.10  ? 572 ARG C O   1 
ATOM   1948 C CB  . ARG C 1 19  ? 15.573  -8.335  124.203 1.00 39.90  ? 572 ARG C CB  1 
ATOM   1949 C CG  . ARG C 1 19  ? 15.173  -8.676  122.772 1.00 48.65  ? 572 ARG C CG  1 
ATOM   1950 C CD  . ARG C 1 19  ? 16.269  -8.259  121.798 1.00 54.55  ? 572 ARG C CD  1 
ATOM   1951 N NE  . ARG C 1 19  ? 15.949  -8.592  120.413 1.00 59.32  ? 572 ARG C NE  1 
ATOM   1952 C CZ  . ARG C 1 19  ? 16.745  -8.330  119.381 1.00 66.58  ? 572 ARG C CZ  1 
ATOM   1953 N NH1 . ARG C 1 19  ? 17.905  -7.725  119.585 1.00 49.57  ? 572 ARG C NH1 1 
ATOM   1954 N NH2 . ARG C 1 19  ? 16.389  -8.675  118.142 1.00 59.59  ? 572 ARG C NH2 1 
ATOM   1955 N N   . SER C 1 20  ? 15.511  -8.166  127.316 1.00 34.19  ? 573 SER C N   1 
ATOM   1956 C CA  . SER C 1 20  ? 16.041  -8.694  128.557 1.00 36.28  ? 573 SER C CA  1 
ATOM   1957 C C   . SER C 1 20  ? 14.877  -8.970  129.515 1.00 29.21  ? 573 SER C C   1 
ATOM   1958 O O   . SER C 1 20  ? 14.844  -10.008 130.169 1.00 32.99  ? 573 SER C O   1 
ATOM   1959 C CB  . SER C 1 20  ? 17.084  -7.757  129.147 1.00 38.54  ? 573 SER C CB  1 
ATOM   1960 O OG  . SER C 1 20  ? 18.311  -7.890  128.441 1.00 49.90  ? 573 SER C OG  1 
ATOM   1961 N N   . VAL C 1 21  ? 13.911  -8.059  129.572 1.00 30.20  ? 574 VAL C N   1 
ATOM   1962 C CA  . VAL C 1 21  ? 12.702  -8.283  130.374 1.00 26.57  ? 574 VAL C CA  1 
ATOM   1963 C C   . VAL C 1 21  ? 12.098  -9.639  130.025 1.00 24.88  ? 574 VAL C C   1 
ATOM   1964 O O   . VAL C 1 21  ? 11.769  -10.410 130.907 1.00 32.06  ? 574 VAL C O   1 
ATOM   1965 C CB  . VAL C 1 21  ? 11.640  -7.174  130.159 1.00 26.43  ? 574 VAL C CB  1 
ATOM   1966 C CG1 . VAL C 1 21  ? 10.322  -7.549  130.857 1.00 32.76  ? 574 VAL C CG1 1 
ATOM   1967 C CG2 . VAL C 1 21  ? 12.153  -5.829  130.683 1.00 22.23  ? 574 VAL C CG2 1 
ATOM   1968 N N   . LEU C 1 22  ? 11.957  -9.935  128.737 1.00 31.95  ? 575 LEU C N   1 
ATOM   1969 C CA  . LEU C 1 22  ? 11.323  -11.191 128.336 1.00 29.06  ? 575 LEU C CA  1 
ATOM   1970 C C   . LEU C 1 22  ? 12.204  -12.383 128.723 1.00 27.70  ? 575 LEU C C   1 
ATOM   1971 O O   . LEU C 1 22  ? 11.704  -13.369 129.245 1.00 28.09  ? 575 LEU C O   1 
ATOM   1972 C CB  . LEU C 1 22  ? 10.994  -11.201 126.849 1.00 33.02  ? 575 LEU C CB  1 
ATOM   1973 C CG  . LEU C 1 22  ? 10.297  -12.446 126.301 1.00 31.23  ? 575 LEU C CG  1 
ATOM   1974 C CD1 . LEU C 1 22  ? 8.923   -12.582 126.878 1.00 25.36  ? 575 LEU C CD1 1 
ATOM   1975 C CD2 . LEU C 1 22  ? 10.235  -12.368 124.794 1.00 28.52  ? 575 LEU C CD2 1 
ATOM   1976 N N   . ASP C 1 23  ? 13.508  -12.295 128.501 1.00 32.25  ? 576 ASP C N   1 
ATOM   1977 C CA  . ASP C 1 23  ? 14.405  -13.345 128.975 1.00 35.51  ? 576 ASP C CA  1 
ATOM   1978 C C   . ASP C 1 23  ? 14.105  -13.603 130.465 1.00 35.38  ? 576 ASP C C   1 
ATOM   1979 O O   . ASP C 1 23  ? 13.926  -14.756 130.891 1.00 32.80  ? 576 ASP C O   1 
ATOM   1980 C CB  . ASP C 1 23  ? 15.894  -12.955 128.788 1.00 39.96  ? 576 ASP C CB  1 
ATOM   1981 C CG  . ASP C 1 23  ? 16.362  -13.030 127.334 1.00 52.35  ? 576 ASP C CG  1 
ATOM   1982 O OD1 . ASP C 1 23  ? 15.708  -13.739 126.560 1.00 45.97  ? 576 ASP C OD1 1 
ATOM   1983 O OD2 . ASP C 1 23  ? 17.383  -12.386 126.960 1.00 42.44  ? 576 ASP C OD2 1 
ATOM   1984 N N   . GLN C 1 24  ? 14.050  -12.529 131.256 1.00 36.58  ? 577 GLN C N   1 
ATOM   1985 C CA  . GLN C 1 24  ? 13.832  -12.664 132.708 1.00 31.28  ? 577 GLN C CA  1 
ATOM   1986 C C   . GLN C 1 24  ? 12.419  -13.178 133.083 1.00 35.02  ? 577 GLN C C   1 
ATOM   1987 O O   . GLN C 1 24  ? 12.263  -13.808 134.122 1.00 35.32  ? 577 GLN C O   1 
ATOM   1988 C CB  . GLN C 1 24  ? 14.097  -11.337 133.438 1.00 31.02  ? 577 GLN C CB  1 
ATOM   1989 C CG  . GLN C 1 24  ? 15.601  -10.995 133.669 1.00 34.71  ? 577 GLN C CG  1 
ATOM   1990 C CD  . GLN C 1 24  ? 15.820  -9.557  134.177 1.00 35.48  ? 577 GLN C CD  1 
ATOM   1991 O OE1 . GLN C 1 24  ? 14.880  -8.881  134.619 1.00 49.97  ? 577 GLN C OE1 1 
ATOM   1992 N NE2 . GLN C 1 24  ? 17.053  -9.086  134.092 1.00 32.76  ? 577 GLN C NE2 1 
ATOM   1993 N N   . LEU C 1 25  ? 11.382  -12.885 132.304 1.00 29.06  ? 578 LEU C N   1 
ATOM   1994 C CA  . LEU C 1 25  ? 10.078  -13.477 132.641 1.00 30.77  ? 578 LEU C CA  1 
ATOM   1995 C C   . LEU C 1 25  ? 10.165  -14.984 132.424 1.00 30.92  ? 578 LEU C C   1 
ATOM   1996 O O   . LEU C 1 25  ? 9.605   -15.771 133.214 1.00 33.83  ? 578 LEU C O   1 
ATOM   1997 C CB  . LEU C 1 25  ? 8.937   -12.888 131.823 1.00 23.30  ? 578 LEU C CB  1 
ATOM   1998 C CG  . LEU C 1 25  ? 8.725   -11.378 131.894 1.00 35.60  ? 578 LEU C CG  1 
ATOM   1999 C CD1 . LEU C 1 25  ? 7.544   -10.957 130.998 1.00 18.25  ? 578 LEU C CD1 1 
ATOM   2000 C CD2 . LEU C 1 25  ? 8.476   -10.991 133.317 1.00 26.25  ? 578 LEU C CD2 1 
ATOM   2001 N N   . GLN C 1 26  ? 10.870  -15.404 131.368 1.00 32.32  ? 579 GLN C N   1 
ATOM   2002 C CA  . GLN C 1 26  ? 10.968  -16.837 131.067 1.00 34.71  ? 579 GLN C CA  1 
ATOM   2003 C C   . GLN C 1 26  ? 11.789  -17.575 132.122 1.00 38.99  ? 579 GLN C C   1 
ATOM   2004 O O   . GLN C 1 26  ? 11.485  -18.725 132.459 1.00 36.82  ? 579 GLN C O   1 
ATOM   2005 C CB  . GLN C 1 26  ? 11.572  -17.086 129.692 1.00 35.45  ? 579 GLN C CB  1 
ATOM   2006 C CG  . GLN C 1 26  ? 10.684  -16.643 128.570 1.00 52.19  ? 579 GLN C CG  1 
ATOM   2007 C CD  . GLN C 1 26  ? 10.681  -17.610 127.388 1.00 62.62  ? 579 GLN C CD  1 
ATOM   2008 O OE1 . GLN C 1 26  ? 10.171  -18.747 127.471 1.00 35.28  ? 579 GLN C OE1 1 
ATOM   2009 N NE2 . GLN C 1 26  ? 11.216  -17.144 126.267 1.00 38.54  ? 579 GLN C NE2 1 
ATOM   2010 N N   . ASP C 1 27  ? 12.832  -16.919 132.636 1.00 37.72  ? 580 ASP C N   1 
ATOM   2011 C CA  . ASP C 1 27  ? 13.628  -17.478 133.731 1.00 33.83  ? 580 ASP C CA  1 
ATOM   2012 C C   . ASP C 1 27  ? 12.757  -17.742 134.964 1.00 34.22  ? 580 ASP C C   1 
ATOM   2013 O O   . ASP C 1 27  ? 13.128  -18.544 135.775 1.00 34.08  ? 580 ASP C O   1 
ATOM   2014 C CB  . ASP C 1 27  ? 14.752  -16.522 134.128 1.00 38.49  ? 580 ASP C CB  1 
ATOM   2015 C CG  . ASP C 1 27  ? 15.911  -16.511 133.126 1.00 58.71  ? 580 ASP C CG  1 
ATOM   2016 O OD1 . ASP C 1 27  ? 16.090  -17.503 132.380 1.00 59.47  ? 580 ASP C OD1 1 
ATOM   2017 O OD2 . ASP C 1 27  ? 16.656  -15.501 133.090 1.00 64.02  ? 580 ASP C OD2 1 
ATOM   2018 N N   . LYS C 1 28  ? 11.613  -17.061 135.121 1.00 30.98  ? 581 LYS C N   1 
ATOM   2019 C CA  . LYS C 1 28  ? 10.691  -17.378 136.228 1.00 30.12  ? 581 LYS C CA  1 
ATOM   2020 C C   . LYS C 1 28  ? 9.744   -18.525 135.888 1.00 27.52  ? 581 LYS C C   1 
ATOM   2021 O O   . LYS C 1 28  ? 8.923   -18.908 136.718 1.00 32.64  ? 581 LYS C O   1 
ATOM   2022 C CB  . LYS C 1 28  ? 9.907   -16.138 136.725 1.00 31.71  ? 581 LYS C CB  1 
ATOM   2023 C CG  . LYS C 1 28  ? 10.738  -14.884 136.986 1.00 37.96  ? 581 LYS C CG  1 
ATOM   2024 C CD  . LYS C 1 28  ? 11.964  -15.132 137.917 1.00 40.74  ? 581 LYS C CD  1 
ATOM   2025 C CE  . LYS C 1 28  ? 12.864  -13.900 137.993 1.00 48.77  ? 581 LYS C CE  1 
ATOM   2026 N NZ  . LYS C 1 28  ? 13.705  -13.705 136.751 1.00 39.55  ? 581 LYS C NZ  1 
ATOM   2027 N N   . ASP C 1 29  ? 9.884   -19.113 134.699 1.00 31.12  ? 582 ASP C N   1 
ATOM   2028 C CA  . ASP C 1 29  ? 9.070   -20.262 134.292 1.00 24.92  ? 582 ASP C CA  1 
ATOM   2029 C C   . ASP C 1 29  ? 9.941   -21.375 133.735 1.00 29.23  ? 582 ASP C C   1 
ATOM   2030 O O   . ASP C 1 29  ? 9.787   -21.752 132.562 1.00 21.15  ? 582 ASP C O   1 
ATOM   2031 C CB  . ASP C 1 29  ? 8.035   -19.795 133.252 1.00 36.47  ? 582 ASP C CB  1 
ATOM   2032 C CG  . ASP C 1 29  ? 7.373   -20.959 132.489 1.00 23.20  ? 582 ASP C CG  1 
ATOM   2033 O OD1 . ASP C 1 29  ? 7.032   -21.979 133.148 1.00 26.13  ? 582 ASP C OD1 1 
ATOM   2034 O OD2 . ASP C 1 29  ? 7.240   -20.857 131.241 1.00 28.53  ? 582 ASP C OD2 1 
ATOM   2035 N N   . PRO C 1 30  ? 10.873  -21.929 134.572 1.00 31.05  ? 583 PRO C N   1 
ATOM   2036 C CA  . PRO C 1 30  ? 11.741  -23.012 134.093 1.00 30.65  ? 583 PRO C CA  1 
ATOM   2037 C C   . PRO C 1 30  ? 10.977  -24.295 133.815 1.00 30.46  ? 583 PRO C C   1 
ATOM   2038 O O   . PRO C 1 30  ? 11.461  -25.143 133.085 1.00 31.12  ? 583 PRO C O   1 
ATOM   2039 C CB  . PRO C 1 30  ? 12.766  -23.196 135.226 1.00 33.51  ? 583 PRO C CB  1 
ATOM   2040 C CG  . PRO C 1 30  ? 12.075  -22.697 136.437 1.00 33.60  ? 583 PRO C CG  1 
ATOM   2041 C CD  . PRO C 1 30  ? 11.101  -21.636 135.991 1.00 29.98  ? 583 PRO C CD  1 
ATOM   2042 N N   . ALA C 1 31  ? 9.766   -24.429 134.356 1.00 36.23  ? 584 ALA C N   1 
ATOM   2043 C CA  . ALA C 1 31  ? 8.893   -25.504 133.920 1.00 31.88  ? 584 ALA C CA  1 
ATOM   2044 C C   . ALA C 1 31  ? 8.548   -25.421 132.410 1.00 33.09  ? 584 ALA C C   1 
ATOM   2045 O O   . ALA C 1 31  ? 8.086   -26.400 131.833 1.00 36.70  ? 584 ALA C O   1 
ATOM   2046 C CB  . ALA C 1 31  ? 7.633   -25.537 134.762 1.00 34.22  ? 584 ALA C CB  1 
ATOM   2047 N N   . ARG C 1 32  ? 8.800   -24.267 131.781 1.00 30.36  ? 585 ARG C N   1 
ATOM   2048 C CA  . ARG C 1 32  ? 8.388   -23.990 130.405 1.00 29.92  ? 585 ARG C CA  1 
ATOM   2049 C C   . ARG C 1 32  ? 6.890   -24.215 130.206 1.00 28.70  ? 585 ARG C C   1 
ATOM   2050 O O   . ARG C 1 32  ? 6.458   -24.625 129.137 1.00 30.00  ? 585 ARG C O   1 
ATOM   2051 C CB  . ARG C 1 32  ? 9.168   -24.814 129.363 1.00 28.67  ? 585 ARG C CB  1 
ATOM   2052 C CG  . ARG C 1 32  ? 10.625  -25.108 129.690 1.00 41.37  ? 585 ARG C CG  1 
ATOM   2053 C CD  . ARG C 1 32  ? 11.515  -23.898 129.481 1.00 43.56  ? 585 ARG C CD  1 
ATOM   2054 N NE  . ARG C 1 32  ? 11.494  -23.411 128.102 1.00 61.53  ? 585 ARG C NE  1 
ATOM   2055 C CZ  . ARG C 1 32  ? 12.070  -22.278 127.708 1.00 57.17  ? 585 ARG C CZ  1 
ATOM   2056 N NH1 . ARG C 1 32  ? 12.720  -21.519 128.583 1.00 69.01  ? 585 ARG C NH1 1 
ATOM   2057 N NH2 . ARG C 1 32  ? 11.998  -21.900 126.438 1.00 42.62  ? 585 ARG C NH2 1 
ATOM   2058 N N   . ILE C 1 33  ? 6.090   -23.927 131.214 1.00 30.54  ? 586 ILE C N   1 
ATOM   2059 C CA  . ILE C 1 33  ? 4.627   -24.050 131.070 1.00 25.50  ? 586 ILE C CA  1 
ATOM   2060 C C   . ILE C 1 33  ? 4.082   -22.973 130.157 1.00 30.34  ? 586 ILE C C   1 
ATOM   2061 O O   . ILE C 1 33  ? 3.059   -23.192 129.517 1.00 25.27  ? 586 ILE C O   1 
ATOM   2062 C CB  . ILE C 1 33  ? 3.926   -23.964 132.465 1.00 24.82  ? 586 ILE C CB  1 
ATOM   2063 C CG1 . ILE C 1 33  ? 4.142   -25.265 133.227 1.00 35.52  ? 586 ILE C CG1 1 
ATOM   2064 C CG2 . ILE C 1 33  ? 2.374   -23.603 132.392 1.00 21.70  ? 586 ILE C CG2 1 
ATOM   2065 C CD1 . ILE C 1 33  ? 4.011   -25.113 134.729 1.00 29.20  ? 586 ILE C CD1 1 
ATOM   2066 N N   . PHE C 1 34  ? 4.722   -21.803 130.105 1.00 26.63  ? 587 PHE C N   1 
ATOM   2067 C CA  . PHE C 1 34  ? 4.139   -20.704 129.318 1.00 34.24  ? 587 PHE C CA  1 
ATOM   2068 C C   . PHE C 1 34  ? 5.000   -20.344 128.124 1.00 36.67  ? 587 PHE C C   1 
ATOM   2069 O O   . PHE C 1 34  ? 4.729   -19.341 127.457 1.00 24.57  ? 587 PHE C O   1 
ATOM   2070 C CB  . PHE C 1 34  ? 3.900   -19.468 130.195 1.00 40.45  ? 587 PHE C CB  1 
ATOM   2071 C CG  . PHE C 1 34  ? 3.104   -19.750 131.437 1.00 26.71  ? 587 PHE C CG  1 
ATOM   2072 C CD1 . PHE C 1 34  ? 1.722   -19.821 131.398 1.00 39.19  ? 587 PHE C CD1 1 
ATOM   2073 C CD2 . PHE C 1 34  ? 3.752   -20.021 132.626 1.00 41.43  ? 587 PHE C CD2 1 
ATOM   2074 C CE1 . PHE C 1 34  ? 0.987   -20.080 132.542 1.00 38.86  ? 587 PHE C CE1 1 
ATOM   2075 C CE2 . PHE C 1 34  ? 3.034   -20.307 133.758 1.00 37.56  ? 587 PHE C CE2 1 
ATOM   2076 C CZ  . PHE C 1 34  ? 1.648   -20.314 133.726 1.00 38.07  ? 587 PHE C CZ  1 
ATOM   2077 N N   . ALA C 1 35  ? 6.019   -21.181 127.868 1.00 26.78  ? 588 ALA C N   1 
ATOM   2078 C CA  . ALA C 1 35  ? 7.004   -20.970 126.806 1.00 27.66  ? 588 ALA C CA  1 
ATOM   2079 C C   . ALA C 1 35  ? 6.460   -20.996 125.398 1.00 26.29  ? 588 ALA C C   1 
ATOM   2080 O O   . ALA C 1 35  ? 6.958   -20.274 124.547 1.00 35.09  ? 588 ALA C O   1 
ATOM   2081 C CB  . ALA C 1 35  ? 8.124   -22.049 126.913 1.00 24.81  ? 588 ALA C CB  1 
ATOM   2082 N N   . GLN C 1 36  ? 5.494   -21.877 125.141 1.00 31.41  ? 589 GLN C N   1 
ATOM   2083 C CA  . GLN C 1 36  ? 4.947   -22.102 123.805 1.00 28.58  ? 589 GLN C CA  1 
ATOM   2084 C C   . GLN C 1 36  ? 3.423   -22.147 123.888 1.00 32.17  ? 589 GLN C C   1 
ATOM   2085 O O   . GLN C 1 36  ? 2.870   -22.350 124.965 1.00 34.81  ? 589 GLN C O   1 
ATOM   2086 C CB  . GLN C 1 36  ? 5.452   -23.450 123.243 1.00 23.70  ? 589 GLN C CB  1 
ATOM   2087 C CG  . GLN C 1 36  ? 6.951   -23.535 123.026 1.00 35.03  ? 589 GLN C CG  1 
ATOM   2088 C CD  . GLN C 1 36  ? 7.468   -22.653 121.878 1.00 58.60  ? 589 GLN C CD  1 
ATOM   2089 O OE1 . GLN C 1 36  ? 6.782   -22.430 120.872 1.00 55.08  ? 589 GLN C OE1 1 
ATOM   2090 N NE2 . GLN C 1 36  ? 8.692   -22.147 122.036 1.00 52.01  ? 589 GLN C NE2 1 
ATOM   2091 N N   . PRO C 1 37  ? 2.731   -21.962 122.753 1.00 34.64  ? 590 PRO C N   1 
ATOM   2092 C CA  . PRO C 1 37  ? 1.273   -22.025 122.866 1.00 29.55  ? 590 PRO C CA  1 
ATOM   2093 C C   . PRO C 1 37  ? 0.803   -23.335 123.489 1.00 32.63  ? 590 PRO C C   1 
ATOM   2094 O O   . PRO C 1 37  ? 1.530   -24.354 123.473 1.00 30.86  ? 590 PRO C O   1 
ATOM   2095 C CB  . PRO C 1 37  ? 0.779   -21.887 121.424 1.00 29.77  ? 590 PRO C CB  1 
ATOM   2096 C CG  . PRO C 1 37  ? 1.922   -21.270 120.650 1.00 30.69  ? 590 PRO C CG  1 
ATOM   2097 C CD  . PRO C 1 37  ? 3.192   -21.564 121.404 1.00 30.25  ? 590 PRO C CD  1 
ATOM   2098 N N   . VAL C 1 38  ? -0.362  -23.256 124.121 1.00 26.94  ? 591 VAL C N   1 
ATOM   2099 C CA  . VAL C 1 38  ? -0.964  -24.382 124.785 1.00 30.43  ? 591 VAL C CA  1 
ATOM   2100 C C   . VAL C 1 38  ? -1.360  -25.328 123.655 1.00 34.16  ? 591 VAL C C   1 
ATOM   2101 O O   . VAL C 1 38  ? -1.974  -24.903 122.675 1.00 42.36  ? 591 VAL C O   1 
ATOM   2102 C CB  . VAL C 1 38  ? -2.218  -23.933 125.654 1.00 37.94  ? 591 VAL C CB  1 
ATOM   2103 C CG1 . VAL C 1 38  ? -3.121  -25.121 126.042 1.00 30.49  ? 591 VAL C CG1 1 
ATOM   2104 C CG2 . VAL C 1 38  ? -1.786  -23.136 126.903 1.00 29.43  ? 591 VAL C CG2 1 
ATOM   2105 N N   . SER C 1 39  ? -1.016  -26.602 123.796 1.00 29.42  ? 592 SER C N   1 
ATOM   2106 C CA  . SER C 1 39  ? -1.258  -27.595 122.778 1.00 36.86  ? 592 SER C CA  1 
ATOM   2107 C C   . SER C 1 39  ? -2.612  -28.308 122.977 1.00 41.92  ? 592 SER C C   1 
ATOM   2108 O O   . SER C 1 39  ? -2.964  -28.688 124.098 1.00 38.34  ? 592 SER C O   1 
ATOM   2109 C CB  . SER C 1 39  ? -0.145  -28.622 122.785 1.00 35.37  ? 592 SER C CB  1 
ATOM   2110 O OG  . SER C 1 39  ? -0.526  -29.729 121.975 1.00 47.29  ? 592 SER C OG  1 
ATOM   2111 N N   . LEU C 1 40  ? -3.362  -28.484 121.887 1.00 37.99  ? 593 LEU C N   1 
ATOM   2112 C CA  . LEU C 1 40  ? -4.644  -29.181 121.952 1.00 39.78  ? 593 LEU C CA  1 
ATOM   2113 C C   . LEU C 1 40  ? -4.435  -30.700 121.914 1.00 39.62  ? 593 LEU C C   1 
ATOM   2114 O O   . LEU C 1 40  ? -5.365  -31.462 122.151 1.00 43.01  ? 593 LEU C O   1 
ATOM   2115 C CB  . LEU C 1 40  ? -5.585  -28.763 120.829 1.00 41.53  ? 593 LEU C CB  1 
ATOM   2116 C CG  . LEU C 1 40  ? -5.887  -27.306 120.517 1.00 33.18  ? 593 LEU C CG  1 
ATOM   2117 C CD1 . LEU C 1 40  ? -7.123  -27.266 119.575 1.00 37.87  ? 593 LEU C CD1 1 
ATOM   2118 C CD2 . LEU C 1 40  ? -6.134  -26.477 121.751 1.00 22.48  ? 593 LEU C CD2 1 
ATOM   2119 N N   . LYS C 1 41  ? -3.221  -31.146 121.636 1.00 43.00  ? 594 LYS C N   1 
ATOM   2120 C CA  . LYS C 1 41  ? -2.871  -32.535 121.934 1.00 51.89  ? 594 LYS C CA  1 
ATOM   2121 C C   . LYS C 1 41  ? -3.035  -32.779 123.448 1.00 49.91  ? 594 LYS C C   1 
ATOM   2122 O O   . LYS C 1 41  ? -3.575  -33.802 123.852 1.00 52.18  ? 594 LYS C O   1 
ATOM   2123 C CB  . LYS C 1 41  ? -1.441  -32.899 121.463 1.00 53.49  ? 594 LYS C CB  1 
ATOM   2124 C CG  . LYS C 1 41  ? -1.184  -32.763 119.950 1.00 55.96  ? 594 LYS C CG  1 
ATOM   2125 C CD  . LYS C 1 41  ? -1.641  -33.977 119.158 1.00 75.45  ? 594 LYS C CD  1 
ATOM   2126 N N   . GLU C 1 42  ? -2.594  -31.826 124.272 1.00 52.98  ? 595 GLU C N   1 
ATOM   2127 C CA  . GLU C 1 42  ? -2.658  -31.953 125.737 1.00 50.87  ? 595 GLU C CA  1 
ATOM   2128 C C   . GLU C 1 42  ? -3.993  -31.454 126.309 1.00 47.09  ? 595 GLU C C   1 
ATOM   2129 O O   . GLU C 1 42  ? -4.434  -31.945 127.329 1.00 45.85  ? 595 GLU C O   1 
ATOM   2130 C CB  . GLU C 1 42  ? -1.471  -31.214 126.408 1.00 48.41  ? 595 GLU C CB  1 
ATOM   2131 C CG  . GLU C 1 42  ? -0.087  -31.881 126.156 1.00 68.94  ? 595 GLU C CG  1 
ATOM   2132 C CD  . GLU C 1 42  ? 1.136   -31.015 126.532 1.00 65.25  ? 595 GLU C CD  1 
ATOM   2133 O OE1 . GLU C 1 42  ? 2.209   -31.239 125.945 1.00 73.37  ? 595 GLU C OE1 1 
ATOM   2134 O OE2 . GLU C 1 42  ? 1.042   -30.121 127.397 1.00 67.56  ? 595 GLU C OE2 1 
ATOM   2135 N N   . VAL C 1 43  ? -4.631  -30.491 125.651 1.00 44.64  ? 596 VAL C N   1 
ATOM   2136 C CA  . VAL C 1 43  ? -5.789  -29.803 126.225 1.00 44.25  ? 596 VAL C CA  1 
ATOM   2137 C C   . VAL C 1 43  ? -6.821  -29.499 125.136 1.00 46.46  ? 596 VAL C C   1 
ATOM   2138 O O   . VAL C 1 43  ? -6.972  -28.349 124.727 1.00 51.40  ? 596 VAL C O   1 
ATOM   2139 C CB  . VAL C 1 43  ? -5.374  -28.467 126.935 1.00 49.57  ? 596 VAL C CB  1 
ATOM   2140 C CG1 . VAL C 1 43  ? -6.523  -27.898 127.662 1.00 43.42  ? 596 VAL C CG1 1 
ATOM   2141 C CG2 . VAL C 1 43  ? -4.200  -28.655 127.920 1.00 39.42  ? 596 VAL C CG2 1 
ATOM   2142 N N   . PRO C 1 44  ? -7.551  -30.535 124.674 1.00 50.93  ? 597 PRO C N   1 
ATOM   2143 C CA  . PRO C 1 44  ? -8.368  -30.460 123.443 1.00 48.57  ? 597 PRO C CA  1 
ATOM   2144 C C   . PRO C 1 44  ? -9.414  -29.342 123.350 1.00 42.91  ? 597 PRO C C   1 
ATOM   2145 O O   . PRO C 1 44  ? -9.576  -28.783 122.273 1.00 48.72  ? 597 PRO C O   1 
ATOM   2146 C CB  . PRO C 1 44  ? -9.042  -31.832 123.381 1.00 47.19  ? 597 PRO C CB  1 
ATOM   2147 C CG  . PRO C 1 44  ? -8.143  -32.721 124.143 1.00 54.85  ? 597 PRO C CG  1 
ATOM   2148 C CD  . PRO C 1 44  ? -7.607  -31.884 125.267 1.00 52.58  ? 597 PRO C CD  1 
ATOM   2149 N N   . ASP C 1 45  ? -10.096 -28.997 124.440 1.00 47.36  ? 598 ASP C N   1 
ATOM   2150 C CA  . ASP C 1 45  ? -11.090 -27.908 124.387 1.00 51.85  ? 598 ASP C CA  1 
ATOM   2151 C C   . ASP C 1 45  ? -10.533 -26.483 124.660 1.00 52.65  ? 598 ASP C C   1 
ATOM   2152 O O   . ASP C 1 45  ? -11.310 -25.530 124.778 1.00 53.15  ? 598 ASP C O   1 
ATOM   2153 C CB  . ASP C 1 45  ? -12.254 -28.209 125.337 1.00 59.45  ? 598 ASP C CB  1 
ATOM   2154 C CG  . ASP C 1 45  ? -11.846 -28.148 126.805 1.00 64.36  ? 598 ASP C CG  1 
ATOM   2155 O OD1 . ASP C 1 45  ? -10.633 -28.027 127.070 1.00 50.21  ? 598 ASP C OD1 1 
ATOM   2156 O OD2 . ASP C 1 45  ? -12.739 -28.225 127.683 1.00 68.77  ? 598 ASP C OD2 1 
ATOM   2157 N N   . TYR C 1 46  ? -9.207  -26.324 124.702 1.00 47.57  ? 599 TYR C N   1 
ATOM   2158 C CA  . TYR C 1 46  ? -8.611  -25.052 125.121 1.00 43.02  ? 599 TYR C CA  1 
ATOM   2159 C C   . TYR C 1 46  ? -9.129  -23.800 124.401 1.00 44.94  ? 599 TYR C C   1 
ATOM   2160 O O   . TYR C 1 46  ? -9.450  -22.823 125.057 1.00 53.02  ? 599 TYR C O   1 
ATOM   2161 C CB  . TYR C 1 46  ? -7.093  -25.094 125.027 1.00 39.33  ? 599 TYR C CB  1 
ATOM   2162 C CG  . TYR C 1 46  ? -6.462  -23.880 125.651 1.00 42.17  ? 599 TYR C CG  1 
ATOM   2163 C CD1 . TYR C 1 46  ? -6.394  -23.754 127.032 1.00 41.76  ? 599 TYR C CD1 1 
ATOM   2164 C CD2 . TYR C 1 46  ? -5.946  -22.850 124.878 1.00 40.34  ? 599 TYR C CD2 1 
ATOM   2165 C CE1 . TYR C 1 46  ? -5.832  -22.629 127.636 1.00 43.63  ? 599 TYR C CE1 1 
ATOM   2166 C CE2 . TYR C 1 46  ? -5.389  -21.703 125.483 1.00 40.92  ? 599 TYR C CE2 1 
ATOM   2167 C CZ  . TYR C 1 46  ? -5.336  -21.614 126.867 1.00 39.88  ? 599 TYR C CZ  1 
ATOM   2168 O OH  . TYR C 1 46  ? -4.796  -20.521 127.499 1.00 36.74  ? 599 TYR C OH  1 
ATOM   2169 N N   . LEU C 1 47  ? -9.202  -23.812 123.074 1.00 43.98  ? 600 LEU C N   1 
ATOM   2170 C CA  . LEU C 1 47  ? -9.606  -22.621 122.295 1.00 39.48  ? 600 LEU C CA  1 
ATOM   2171 C C   . LEU C 1 47  ? -11.117 -22.460 122.163 1.00 41.54  ? 600 LEU C C   1 
ATOM   2172 O O   . LEU C 1 47  ? -11.614 -21.484 121.581 1.00 35.70  ? 600 LEU C O   1 
ATOM   2173 C CB  . LEU C 1 47  ? -8.987  -22.676 120.894 1.00 47.18  ? 600 LEU C CB  1 
ATOM   2174 C CG  . LEU C 1 47  ? -7.454  -22.557 120.810 1.00 41.81  ? 600 LEU C CG  1 
ATOM   2175 C CD1 . LEU C 1 47  ? -6.942  -22.964 119.459 1.00 39.81  ? 600 LEU C CD1 1 
ATOM   2176 C CD2 . LEU C 1 47  ? -7.020  -21.143 121.125 1.00 32.80  ? 600 LEU C CD2 1 
ATOM   2177 N N   . ASP C 1 48  ? -11.856 -23.430 122.670 1.00 43.87  ? 601 ASP C N   1 
ATOM   2178 C CA  . ASP C 1 48  ? -13.303 -23.285 122.759 1.00 52.75  ? 601 ASP C CA  1 
ATOM   2179 C C   . ASP C 1 48  ? -13.634 -22.275 123.870 1.00 51.30  ? 601 ASP C C   1 
ATOM   2180 O O   . ASP C 1 48  ? -14.629 -21.571 123.776 1.00 49.62  ? 601 ASP C O   1 
ATOM   2181 C CB  . ASP C 1 48  ? -13.981 -24.652 122.995 1.00 56.01  ? 601 ASP C CB  1 
ATOM   2182 C CG  . ASP C 1 48  ? -13.783 -25.633 121.814 1.00 64.05  ? 601 ASP C CG  1 
ATOM   2183 O OD1 . ASP C 1 48  ? -13.167 -25.254 120.785 1.00 66.97  ? 601 ASP C OD1 1 
ATOM   2184 O OD2 . ASP C 1 48  ? -14.246 -26.793 121.913 1.00 59.28  ? 601 ASP C OD2 1 
ATOM   2185 N N   . HIS C 1 49  ? -12.737 -22.191 124.865 1.00 52.92  ? 602 HIS C N   1 
ATOM   2186 C CA  . HIS C 1 49  ? -12.849 -21.335 126.058 1.00 50.73  ? 602 HIS C CA  1 
ATOM   2187 C C   . HIS C 1 49  ? -11.965 -20.066 126.048 1.00 47.14  ? 602 HIS C C   1 
ATOM   2188 O O   . HIS C 1 49  ? -12.407 -19.018 126.492 1.00 55.83  ? 602 HIS C O   1 
ATOM   2189 C CB  . HIS C 1 49  ? -12.481 -22.155 127.308 1.00 53.02  ? 602 HIS C CB  1 
ATOM   2190 C CG  . HIS C 1 49  ? -13.420 -23.293 127.600 1.00 70.62  ? 602 HIS C CG  1 
ATOM   2191 N ND1 . HIS C 1 49  ? -13.415 -24.470 126.879 1.00 83.94  ? 602 HIS C ND1 1 
ATOM   2192 C CD2 . HIS C 1 49  ? -14.376 -23.441 128.551 1.00 62.52  ? 602 HIS C CD2 1 
ATOM   2193 C CE1 . HIS C 1 49  ? -14.332 -25.288 127.367 1.00 78.73  ? 602 HIS C CE1 1 
ATOM   2194 N NE2 . HIS C 1 49  ? -14.927 -24.688 128.382 1.00 75.67  ? 602 HIS C NE2 1 
ATOM   2195 N N   . ILE C 1 50  ? -10.713 -20.166 125.603 1.00 35.28  ? 603 ILE C N   1 
ATOM   2196 C CA  . ILE C 1 50  ? -9.804  -19.003 125.530 1.00 35.95  ? 603 ILE C CA  1 
ATOM   2197 C C   . ILE C 1 50  ? -9.738  -18.359 124.145 1.00 34.48  ? 603 ILE C C   1 
ATOM   2198 O O   . ILE C 1 50  ? -9.299  -18.963 123.182 1.00 40.05  ? 603 ILE C O   1 
ATOM   2199 C CB  . ILE C 1 50  ? -8.364  -19.371 125.914 1.00 32.06  ? 603 ILE C CB  1 
ATOM   2200 C CG1 . ILE C 1 50  ? -8.341  -19.974 127.314 1.00 33.89  ? 603 ILE C CG1 1 
ATOM   2201 C CG2 . ILE C 1 50  ? -7.526  -18.151 125.848 1.00 25.77  ? 603 ILE C CG2 1 
ATOM   2202 C CD1 . ILE C 1 50  ? -9.148  -19.156 128.352 1.00 46.50  ? 603 ILE C CD1 1 
ATOM   2203 N N   . LYS C 1 51  ? -10.116 -17.101 124.089 1.00 35.70  ? 604 LYS C N   1 
ATOM   2204 C CA  . LYS C 1 51  ? -10.371 -16.405 122.854 1.00 43.67  ? 604 LYS C CA  1 
ATOM   2205 C C   . LYS C 1 51  ? -9.076  -15.808 122.274 1.00 42.73  ? 604 LYS C C   1 
ATOM   2206 O O   . LYS C 1 51  ? -8.897  -15.738 121.068 1.00 46.33  ? 604 LYS C O   1 
ATOM   2207 C CB  . LYS C 1 51  ? -11.379 -15.280 123.163 1.00 49.50  ? 604 LYS C CB  1 
ATOM   2208 C CG  . LYS C 1 51  ? -12.299 -14.882 122.037 1.00 55.56  ? 604 LYS C CG  1 
ATOM   2209 C CD  . LYS C 1 51  ? -13.376 -13.894 122.542 1.00 68.43  ? 604 LYS C CD  1 
ATOM   2210 N N   . HIS C 1 52  ? -8.194  -15.346 123.146 1.00 43.04  ? 605 HIS C N   1 
ATOM   2211 C CA  . HIS C 1 52  ? -6.946  -14.703 122.727 1.00 45.70  ? 605 HIS C CA  1 
ATOM   2212 C C   . HIS C 1 52  ? -5.776  -15.348 123.440 1.00 34.36  ? 605 HIS C C   1 
ATOM   2213 O O   . HIS C 1 52  ? -5.228  -14.763 124.359 1.00 31.29  ? 605 HIS C O   1 
ATOM   2214 C CB  . HIS C 1 52  ? -6.981  -13.201 123.026 1.00 42.44  ? 605 HIS C CB  1 
ATOM   2215 C CG  . HIS C 1 52  ? -8.073  -12.482 122.303 1.00 53.80  ? 605 HIS C CG  1 
ATOM   2216 N ND1 . HIS C 1 52  ? -7.936  -12.033 121.006 1.00 61.50  ? 605 HIS C ND1 1 
ATOM   2217 C CD2 . HIS C 1 52  ? -9.335  -12.170 122.681 1.00 45.91  ? 605 HIS C CD2 1 
ATOM   2218 C CE1 . HIS C 1 52  ? -9.062  -11.458 120.622 1.00 34.01  ? 605 HIS C CE1 1 
ATOM   2219 N NE2 . HIS C 1 52  ? -9.925  -11.527 121.620 1.00 64.03  ? 605 HIS C NE2 1 
ATOM   2220 N N   . PRO C 1 53  ? -5.371  -16.544 122.982 1.00 34.49  ? 606 PRO C N   1 
ATOM   2221 C CA  . PRO C 1 53  ? -4.257  -17.247 123.598 1.00 34.74  ? 606 PRO C CA  1 
ATOM   2222 C C   . PRO C 1 53  ? -2.958  -16.474 123.446 1.00 28.72  ? 606 PRO C C   1 
ATOM   2223 O O   . PRO C 1 53  ? -2.835  -15.647 122.529 1.00 29.01  ? 606 PRO C O   1 
ATOM   2224 C CB  . PRO C 1 53  ? -4.187  -18.562 122.803 1.00 34.17  ? 606 PRO C CB  1 
ATOM   2225 C CG  . PRO C 1 53  ? -4.750  -18.222 121.498 1.00 39.29  ? 606 PRO C CG  1 
ATOM   2226 C CD  . PRO C 1 53  ? -5.827  -17.223 121.757 1.00 35.72  ? 606 PRO C CD  1 
ATOM   2227 N N   . MET C 1 54  ? -1.995  -16.778 124.318 1.00 16.74  ? 607 MET C N   1 
ATOM   2228 C CA  . MET C 1 54  ? -0.777  -16.049 124.362 1.00 16.42  ? 607 MET C CA  1 
ATOM   2229 C C   . MET C 1 54  ? 0.260   -16.877 125.110 1.00 16.81  ? 607 MET C C   1 
ATOM   2230 O O   . MET C 1 54  ? -0.091  -17.674 125.969 1.00 15.75  ? 607 MET C O   1 
ATOM   2231 C CB  . MET C 1 54  ? -0.982  -14.706 125.072 1.00 19.93  ? 607 MET C CB  1 
ATOM   2232 C CG  . MET C 1 54  ? 0.235   -13.742 125.051 1.00 37.16  ? 607 MET C CG  1 
ATOM   2233 S SD  . MET C 1 54  ? 1.056   -13.464 123.456 1.00 36.03  ? 607 MET C SD  1 
ATOM   2234 C CE  . MET C 1 54  ? -0.357  -13.026 122.416 1.00 25.42  ? 607 MET C CE  1 
ATOM   2235 N N   . ASP C 1 55  ? 1.519   -16.700 124.750 1.00 17.83  ? 608 ASP C N   1 
ATOM   2236 C CA  . ASP C 1 55  ? 2.638   -17.448 125.413 1.00 22.12  ? 608 ASP C CA  1 
ATOM   2237 C C   . ASP C 1 55  ? 3.902   -16.665 125.213 1.00 23.49  ? 608 ASP C C   1 
ATOM   2238 O O   . ASP C 1 55  ? 3.887   -15.666 124.495 1.00 18.60  ? 608 ASP C O   1 
ATOM   2239 C CB  . ASP C 1 55  ? 2.840   -18.793 124.777 1.00 27.78  ? 608 ASP C CB  1 
ATOM   2240 C CG  . ASP C 1 55  ? 3.041   -18.687 123.293 1.00 43.99  ? 608 ASP C CG  1 
ATOM   2241 O OD1 . ASP C 1 55  ? 1.989   -18.619 122.626 1.00 30.88  ? 608 ASP C OD1 1 
ATOM   2242 O OD2 . ASP C 1 55  ? 4.220   -18.649 122.808 1.00 24.64  ? 608 ASP C OD2 1 
ATOM   2243 N N   . PHE C 1 56  ? 5.024   -17.136 125.777 1.00 24.42  ? 609 PHE C N   1 
ATOM   2244 C CA  . PHE C 1 56  ? 6.247   -16.383 125.623 1.00 16.40  ? 609 PHE C CA  1 
ATOM   2245 C C   . PHE C 1 56  ? 6.812   -16.340 124.200 1.00 21.42  ? 609 PHE C C   1 
ATOM   2246 O O   . PHE C 1 56  ? 7.412   -15.342 123.808 1.00 26.01  ? 609 PHE C O   1 
ATOM   2247 C CB  . PHE C 1 56  ? 7.309   -16.862 126.625 1.00 28.35  ? 609 PHE C CB  1 
ATOM   2248 C CG  . PHE C 1 56  ? 7.004   -16.492 128.036 1.00 29.39  ? 609 PHE C CG  1 
ATOM   2249 C CD1 . PHE C 1 56  ? 6.662   -15.184 128.368 1.00 29.34  ? 609 PHE C CD1 1 
ATOM   2250 C CD2 . PHE C 1 56  ? 7.069   -17.433 129.043 1.00 29.93  ? 609 PHE C CD2 1 
ATOM   2251 C CE1 . PHE C 1 56  ? 6.389   -14.851 129.655 1.00 32.71  ? 609 PHE C CE1 1 
ATOM   2252 C CE2 . PHE C 1 56  ? 6.805   -17.082 130.343 1.00 31.85  ? 609 PHE C CE2 1 
ATOM   2253 C CZ  . PHE C 1 56  ? 6.472   -15.791 130.648 1.00 36.79  ? 609 PHE C CZ  1 
ATOM   2254 N N   . ALA C 1 57  ? 6.695   -17.438 123.468 1.00 20.43  ? 610 ALA C N   1 
ATOM   2255 C CA  . ALA C 1 57  ? 7.231   -17.514 122.119 1.00 22.54  ? 610 ALA C CA  1 
ATOM   2256 C C   . ALA C 1 57  ? 6.502   -16.524 121.214 1.00 28.18  ? 610 ALA C C   1 
ATOM   2257 O O   . ALA C 1 57  ? 7.129   -15.835 120.413 1.00 32.01  ? 610 ALA C O   1 
ATOM   2258 C CB  . ALA C 1 57  ? 7.125   -18.971 121.573 1.00 18.98  ? 610 ALA C CB  1 
ATOM   2259 N N   . THR C 1 58  ? 5.180   -16.439 121.342 1.00 30.20  ? 611 THR C N   1 
ATOM   2260 C CA  . THR C 1 58  ? 4.416   -15.410 120.619 1.00 32.95  ? 611 THR C CA  1 
ATOM   2261 C C   . THR C 1 58  ? 4.791   -13.969 120.988 1.00 34.75  ? 611 THR C C   1 
ATOM   2262 O O   . THR C 1 58  ? 4.781   -13.095 120.143 1.00 40.35  ? 611 THR C O   1 
ATOM   2263 C CB  . THR C 1 58  ? 2.967   -15.574 120.906 1.00 35.15  ? 611 THR C CB  1 
ATOM   2264 O OG1 . THR C 1 58  ? 2.659   -16.950 120.696 1.00 29.59  ? 611 THR C OG1 1 
ATOM   2265 C CG2 . THR C 1 58  ? 2.087   -14.617 119.991 1.00 36.15  ? 611 THR C CG2 1 
ATOM   2266 N N   . MET C 1 59  ? 5.090   -13.720 122.255 1.00 33.04  ? 612 MET C N   1 
ATOM   2267 C CA  . MET C 1 59  ? 5.539   -12.405 122.668 1.00 32.42  ? 612 MET C CA  1 
ATOM   2268 C C   . MET C 1 59  ? 6.881   -12.136 122.008 1.00 28.29  ? 612 MET C C   1 
ATOM   2269 O O   . MET C 1 59  ? 7.129   -11.059 121.463 1.00 28.39  ? 612 MET C O   1 
ATOM   2270 C CB  . MET C 1 59  ? 5.633   -12.302 124.209 1.00 25.38  ? 612 MET C CB  1 
ATOM   2271 C CG  . MET C 1 59  ? 4.263   -12.275 124.920 1.00 34.67  ? 612 MET C CG  1 
ATOM   2272 S SD  . MET C 1 59  ? 4.308   -11.906 126.698 1.00 34.18  ? 612 MET C SD  1 
ATOM   2273 C CE  . MET C 1 59  ? 5.256   -10.391 126.770 1.00 33.61  ? 612 MET C CE  1 
ATOM   2274 N N   . ARG C 1 60  ? 7.760   -13.117 122.053 1.00 29.76  ? 613 ARG C N   1 
ATOM   2275 C CA  . ARG C 1 60  ? 9.064   -12.983 121.402 1.00 32.58  ? 613 ARG C CA  1 
ATOM   2276 C C   . ARG C 1 60  ? 8.960   -12.647 119.913 1.00 29.96  ? 613 ARG C C   1 
ATOM   2277 O O   . ARG C 1 60  ? 9.796   -11.959 119.387 1.00 32.49  ? 613 ARG C O   1 
ATOM   2278 C CB  . ARG C 1 60  ? 9.867   -14.269 121.558 1.00 26.99  ? 613 ARG C CB  1 
ATOM   2279 C CG  . ARG C 1 60  ? 11.250  -14.241 120.855 1.00 31.78  ? 613 ARG C CG  1 
ATOM   2280 C CD  . ARG C 1 60  ? 12.322  -13.786 121.760 1.00 56.05  ? 613 ARG C CD  1 
ATOM   2281 N NE  . ARG C 1 60  ? 12.444  -14.667 122.931 1.00 51.39  ? 613 ARG C NE  1 
ATOM   2282 C CZ  . ARG C 1 60  ? 13.170  -14.359 123.999 1.00 57.54  ? 613 ARG C CZ  1 
ATOM   2283 N NH1 . ARG C 1 60  ? 13.844  -13.212 124.029 1.00 50.90  ? 613 ARG C NH1 1 
ATOM   2284 N NH2 . ARG C 1 60  ? 13.222  -15.183 125.038 1.00 57.06  ? 613 ARG C NH2 1 
ATOM   2285 N N   . LYS C 1 61  ? 7.932   -13.142 119.249 1.00 29.60  ? 614 LYS C N   1 
ATOM   2286 C CA  . LYS C 1 61  ? 7.803   -12.971 117.820 1.00 37.94  ? 614 LYS C CA  1 
ATOM   2287 C C   . LYS C 1 61  ? 7.428   -11.518 117.531 1.00 39.73  ? 614 LYS C C   1 
ATOM   2288 O O   . LYS C 1 61  ? 8.089   -10.832 116.770 1.00 48.59  ? 614 LYS C O   1 
ATOM   2289 C CB  . LYS C 1 61  ? 6.779   -13.970 117.278 1.00 40.12  ? 614 LYS C CB  1 
ATOM   2290 C CG  . LYS C 1 61  ? 6.578   -13.910 115.764 1.00 66.50  ? 614 LYS C CG  1 
ATOM   2291 C CD  . LYS C 1 61  ? 5.986   -15.198 115.181 1.00 71.43  ? 614 LYS C CD  1 
ATOM   2292 C CE  . LYS C 1 61  ? 4.490   -15.124 114.978 1.00 79.25  ? 614 LYS C CE  1 
ATOM   2293 N NZ  . LYS C 1 61  ? 4.066   -16.121 113.952 1.00 72.05  ? 614 LYS C NZ  1 
ATOM   2294 N N   . ARG C 1 62  ? 6.380   -11.051 118.185 1.00 39.75  ? 615 ARG C N   1 
ATOM   2295 C CA  . ARG C 1 62  ? 6.050   -9.637  118.214 1.00 34.78  ? 615 ARG C CA  1 
ATOM   2296 C C   . ARG C 1 62  ? 7.237   -8.750  118.642 1.00 34.40  ? 615 ARG C C   1 
ATOM   2297 O O   . ARG C 1 62  ? 7.479   -7.696  118.075 1.00 35.30  ? 615 ARG C O   1 
ATOM   2298 C CB  . ARG C 1 62  ? 4.865   -9.432  119.141 1.00 31.08  ? 615 ARG C CB  1 
ATOM   2299 C CG  . ARG C 1 62  ? 4.342   -8.043  119.125 1.00 33.98  ? 615 ARG C CG  1 
ATOM   2300 C CD  . ARG C 1 62  ? 3.023   -7.969  119.776 1.00 28.71  ? 615 ARG C CD  1 
ATOM   2301 N NE  . ARG C 1 62  ? 2.595   -6.581  119.876 1.00 44.48  ? 615 ARG C NE  1 
ATOM   2302 C CZ  . ARG C 1 62  ? 1.545   -6.152  120.575 1.00 45.70  ? 615 ARG C CZ  1 
ATOM   2303 N NH1 . ARG C 1 62  ? 0.787   -6.997  121.282 1.00 33.94  ? 615 ARG C NH1 1 
ATOM   2304 N NH2 . ARG C 1 62  ? 1.270   -4.857  120.580 1.00 34.23  ? 615 ARG C NH2 1 
ATOM   2305 N N   . LEU C 1 63  ? 8.007   -9.161  119.630 1.00 36.93  ? 616 LEU C N   1 
ATOM   2306 C CA  . LEU C 1 63  ? 9.114   -8.311  120.023 1.00 38.60  ? 616 LEU C CA  1 
ATOM   2307 C C   . LEU C 1 63  ? 10.081  -8.153  118.823 1.00 39.55  ? 616 LEU C C   1 
ATOM   2308 O O   . LEU C 1 63  ? 10.524  -7.049  118.506 1.00 41.14  ? 616 LEU C O   1 
ATOM   2309 C CB  . LEU C 1 63  ? 9.797   -8.859  121.262 1.00 41.17  ? 616 LEU C CB  1 
ATOM   2310 C CG  . LEU C 1 63  ? 11.008  -8.109  121.796 1.00 38.60  ? 616 LEU C CG  1 
ATOM   2311 C CD1 . LEU C 1 63  ? 10.642  -6.688  122.075 1.00 42.25  ? 616 LEU C CD1 1 
ATOM   2312 C CD2 . LEU C 1 63  ? 11.526  -8.794  123.048 1.00 39.59  ? 616 LEU C CD2 1 
ATOM   2313 N N   . GLU C 1 64  ? 10.345  -9.245  118.123 1.00 36.02  ? 617 GLU C N   1 
ATOM   2314 C CA  . GLU C 1 64  ? 11.284  -9.224  117.014 1.00 39.46  ? 617 GLU C CA  1 
ATOM   2315 C C   . GLU C 1 64  ? 10.742  -8.426  115.805 1.00 45.90  ? 617 GLU C C   1 
ATOM   2316 O O   . GLU C 1 64  ? 11.524  -7.820  115.066 1.00 45.25  ? 617 GLU C O   1 
ATOM   2317 C CB  . GLU C 1 64  ? 11.671  -10.661 116.595 1.00 38.26  ? 617 GLU C CB  1 
ATOM   2318 C CG  . GLU C 1 64  ? 12.353  -11.540 117.674 1.00 54.53  ? 617 GLU C CG  1 
ATOM   2319 C CD  . GLU C 1 64  ? 13.462  -10.849 118.503 1.00 78.85  ? 617 GLU C CD  1 
ATOM   2320 O OE1 . GLU C 1 64  ? 14.035  -9.824  118.070 1.00 71.67  ? 617 GLU C OE1 1 
ATOM   2321 O OE2 . GLU C 1 64  ? 13.782  -11.364 119.601 1.00 97.06  ? 617 GLU C OE2 1 
ATOM   2322 N N   . ALA C 1 65  ? 9.420   -8.398  115.619 1.00 36.76  ? 618 ALA C N   1 
ATOM   2323 C CA  . ALA C 1 65  ? 8.824   -7.595  114.546 1.00 44.90  ? 618 ALA C CA  1 
ATOM   2324 C C   . ALA C 1 65  ? 8.577   -6.125  114.936 1.00 48.67  ? 618 ALA C C   1 
ATOM   2325 O O   . ALA C 1 65  ? 7.713   -5.466  114.356 1.00 55.32  ? 618 ALA C O   1 
ATOM   2326 C CB  . ALA C 1 65  ? 7.495   -8.258  114.055 1.00 37.84  ? 618 ALA C CB  1 
ATOM   2327 N N   . GLN C 1 66  ? 9.305   -5.611  115.919 1.00 47.32  ? 619 GLN C N   1 
ATOM   2328 C CA  . GLN C 1 66  ? 9.091   -4.251  116.407 1.00 52.78  ? 619 GLN C CA  1 
ATOM   2329 C C   . GLN C 1 66  ? 7.601   -3.963  116.697 1.00 51.51  ? 619 GLN C C   1 
ATOM   2330 O O   . GLN C 1 66  ? 7.113   -2.842  116.491 1.00 43.84  ? 619 GLN C O   1 
ATOM   2331 C CB  . GLN C 1 66  ? 9.657   -3.249  115.398 1.00 53.59  ? 619 GLN C CB  1 
ATOM   2332 N N   . GLY C 1 67  ? 6.896   -4.985  117.182 1.00 46.56  ? 620 GLY C N   1 
ATOM   2333 C CA  . GLY C 1 67  ? 5.444   -4.918  117.412 1.00 46.38  ? 620 GLY C CA  1 
ATOM   2334 C C   . GLY C 1 67  ? 4.955   -4.350  118.746 1.00 44.36  ? 620 GLY C C   1 
ATOM   2335 O O   . GLY C 1 67  ? 3.742   -4.156  118.926 1.00 42.68  ? 620 GLY C O   1 
ATOM   2336 N N   . TYR C 1 68  ? 5.863   -4.073  119.686 1.00 36.86  ? 621 TYR C N   1 
ATOM   2337 C CA  . TYR C 1 68  ? 5.463   -3.388  120.939 1.00 37.58  ? 621 TYR C CA  1 
ATOM   2338 C C   . TYR C 1 68  ? 5.791   -1.890  120.904 1.00 41.18  ? 621 TYR C C   1 
ATOM   2339 O O   . TYR C 1 68  ? 6.948   -1.505  120.794 1.00 42.18  ? 621 TYR C O   1 
ATOM   2340 C CB  . TYR C 1 68  ? 6.092   -4.059  122.167 1.00 39.41  ? 621 TYR C CB  1 
ATOM   2341 C CG  . TYR C 1 68  ? 5.557   -5.455  122.444 1.00 30.23  ? 621 TYR C CG  1 
ATOM   2342 C CD1 . TYR C 1 68  ? 4.229   -5.645  122.825 1.00 37.53  ? 621 TYR C CD1 1 
ATOM   2343 C CD2 . TYR C 1 68  ? 6.373   -6.577  122.327 1.00 32.32  ? 621 TYR C CD2 1 
ATOM   2344 C CE1 . TYR C 1 68  ? 3.717   -6.919  123.087 1.00 41.51  ? 621 TYR C CE1 1 
ATOM   2345 C CE2 . TYR C 1 68  ? 5.875   -7.857  122.578 1.00 33.83  ? 621 TYR C CE2 1 
ATOM   2346 C CZ  . TYR C 1 68  ? 4.536   -8.018  122.967 1.00 38.11  ? 621 TYR C CZ  1 
ATOM   2347 O OH  . TYR C 1 68  ? 4.016   -9.286  123.205 1.00 27.83  ? 621 TYR C OH  1 
ATOM   2348 N N   . LYS C 1 69  ? 4.757   -1.056  120.989 1.00 45.45  ? 622 LYS C N   1 
ATOM   2349 C CA  . LYS C 1 69  ? 4.926   0.394   120.913 1.00 55.09  ? 622 LYS C CA  1 
ATOM   2350 C C   . LYS C 1 69  ? 5.527   0.951   122.197 1.00 53.10  ? 622 LYS C C   1 
ATOM   2351 O O   . LYS C 1 69  ? 6.334   1.869   122.146 1.00 55.91  ? 622 LYS C O   1 
ATOM   2352 C CB  . LYS C 1 69  ? 3.576   1.078   120.614 1.00 58.12  ? 622 LYS C CB  1 
ATOM   2353 C CG  . LYS C 1 69  ? 3.612   2.590   120.612 1.00 62.51  ? 622 LYS C CG  1 
ATOM   2354 C CD  . LYS C 1 69  ? 2.260   3.170   120.202 1.00 76.92  ? 622 LYS C CD  1 
ATOM   2355 N N   . ASN C 1 70  ? 5.110   0.407   123.338 1.00 50.76  ? 623 ASN C N   1 
ATOM   2356 C CA  . ASN C 1 70  ? 5.599   0.829   124.656 1.00 49.40  ? 623 ASN C CA  1 
ATOM   2357 C C   . ASN C 1 70  ? 5.628   -0.366  125.638 1.00 45.08  ? 623 ASN C C   1 
ATOM   2358 O O   . ASN C 1 70  ? 5.205   -1.459  125.288 1.00 43.52  ? 623 ASN C O   1 
ATOM   2359 C CB  . ASN C 1 70  ? 4.717   1.955   125.186 1.00 44.59  ? 623 ASN C CB  1 
ATOM   2360 C CG  . ASN C 1 70  ? 3.259   1.594   125.162 1.00 52.45  ? 623 ASN C CG  1 
ATOM   2361 O OD1 . ASN C 1 70  ? 2.863   0.597   125.746 1.00 54.89  ? 623 ASN C OD1 1 
ATOM   2362 N ND2 . ASN C 1 70  ? 2.447   2.394   124.470 1.00 56.16  ? 623 ASN C ND2 1 
ATOM   2363 N N   . LEU C 1 71  ? 6.140   -0.166  126.844 1.00 37.03  ? 624 LEU C N   1 
ATOM   2364 C CA  . LEU C 1 71  ? 6.217   -1.249  127.833 1.00 39.99  ? 624 LEU C CA  1 
ATOM   2365 C C   . LEU C 1 71  ? 4.793   -1.707  128.172 1.00 41.81  ? 624 LEU C C   1 
ATOM   2366 O O   . LEU C 1 71  ? 4.498   -2.908  128.257 1.00 34.75  ? 624 LEU C O   1 
ATOM   2367 C CB  . LEU C 1 71  ? 6.899   -0.778  129.116 1.00 32.65  ? 624 LEU C CB  1 
ATOM   2368 C CG  . LEU C 1 71  ? 7.481   -1.751  130.160 1.00 40.71  ? 624 LEU C CG  1 
ATOM   2369 C CD1 . LEU C 1 71  ? 7.261   -1.163  131.523 1.00 32.72  ? 624 LEU C CD1 1 
ATOM   2370 C CD2 . LEU C 1 71  ? 6.938   -3.148  130.121 1.00 39.16  ? 624 LEU C CD2 1 
ATOM   2371 N N   . HIS C 1 72  ? 3.892   -0.753  128.353 1.00 39.40  ? 625 HIS C N   1 
ATOM   2372 C CA  . HIS C 1 72  ? 2.512   -1.114  128.678 1.00 38.85  ? 625 HIS C CA  1 
ATOM   2373 C C   . HIS C 1 72  ? 1.889   -2.159  127.693 1.00 36.61  ? 625 HIS C C   1 
ATOM   2374 O O   . HIS C 1 72  ? 1.186   -3.097  128.105 1.00 32.56  ? 625 HIS C O   1 
ATOM   2375 C CB  . HIS C 1 72  ? 1.672   0.144   128.760 1.00 35.05  ? 625 HIS C CB  1 
ATOM   2376 C CG  . HIS C 1 72  ? 0.226   -0.124  128.946 1.00 44.17  ? 625 HIS C CG  1 
ATOM   2377 N ND1 . HIS C 1 72  ? -0.311  -0.453  130.169 1.00 57.88  ? 625 HIS C ND1 1 
ATOM   2378 C CD2 . HIS C 1 72  ? -0.800  -0.130  128.064 1.00 56.18  ? 625 HIS C CD2 1 
ATOM   2379 C CE1 . HIS C 1 72  ? -1.612  -0.642  130.035 1.00 63.03  ? 625 HIS C CE1 1 
ATOM   2380 N NE2 . HIS C 1 72  ? -1.934  -0.449  128.769 1.00 51.61  ? 625 HIS C NE2 1 
ATOM   2381 N N   . GLU C 1 73  ? 2.183   -2.031  126.402 1.00 35.53  ? 626 GLU C N   1 
ATOM   2382 C CA  . GLU C 1 73  ? 1.693   -3.029  125.419 1.00 39.06  ? 626 GLU C CA  1 
ATOM   2383 C C   . GLU C 1 73  ? 2.307   -4.392  125.694 1.00 33.62  ? 626 GLU C C   1 
ATOM   2384 O O   . GLU C 1 73  ? 1.645   -5.403  125.550 1.00 32.82  ? 626 GLU C O   1 
ATOM   2385 C CB  . GLU C 1 73  ? 1.946   -2.590  123.965 1.00 36.93  ? 626 GLU C CB  1 
ATOM   2386 C CG  . GLU C 1 73  ? 0.940   -1.503  123.449 1.00 41.49  ? 626 GLU C CG  1 
ATOM   2387 C CD  . GLU C 1 73  ? 1.096   -1.187  121.957 1.00 43.07  ? 626 GLU C CD  1 
ATOM   2388 O OE1 . GLU C 1 73  ? 0.375   -0.310  121.452 1.00 45.42  ? 626 GLU C OE1 1 
ATOM   2389 O OE2 . GLU C 1 73  ? 1.956   -1.800  121.289 1.00 51.57  ? 626 GLU C OE2 1 
ATOM   2390 N N   . PHE C 1 74  ? 3.565   -4.398  126.129 1.00 33.81  ? 627 PHE C N   1 
ATOM   2391 C CA  . PHE C 1 74  ? 4.265   -5.629  126.497 1.00 25.03  ? 627 PHE C CA  1 
ATOM   2392 C C   . PHE C 1 74  ? 3.642   -6.283  127.722 1.00 28.57  ? 627 PHE C C   1 
ATOM   2393 O O   . PHE C 1 74  ? 3.330   -7.480  127.645 1.00 25.69  ? 627 PHE C O   1 
ATOM   2394 C CB  . PHE C 1 74  ? 5.721   -5.309  126.741 1.00 33.91  ? 627 PHE C CB  1 
ATOM   2395 C CG  . PHE C 1 74  ? 6.566   -6.482  127.043 1.00 24.61  ? 627 PHE C CG  1 
ATOM   2396 C CD1 . PHE C 1 74  ? 6.927   -6.758  128.332 1.00 28.42  ? 627 PHE C CD1 1 
ATOM   2397 C CD2 . PHE C 1 74  ? 7.062   -7.281  126.016 1.00 23.38  ? 627 PHE C CD2 1 
ATOM   2398 C CE1 . PHE C 1 74  ? 7.779   -7.805  128.615 1.00 23.31  ? 627 PHE C CE1 1 
ATOM   2399 C CE2 . PHE C 1 74  ? 7.882   -8.354  126.288 1.00 21.35  ? 627 PHE C CE2 1 
ATOM   2400 C CZ  . PHE C 1 74  ? 8.238   -8.623  127.585 1.00 17.45  ? 627 PHE C CZ  1 
ATOM   2401 N N   . GLU C 1 75  ? 3.440   -5.515  128.825 1.00 23.48  ? 628 GLU C N   1 
ATOM   2402 C CA  . GLU C 1 75  ? 2.715   -6.005  130.038 1.00 34.43  ? 628 GLU C CA  1 
ATOM   2403 C C   . GLU C 1 75  ? 1.352   -6.627  129.685 1.00 31.30  ? 628 GLU C C   1 
ATOM   2404 O O   . GLU C 1 75  ? 0.969   -7.670  130.197 1.00 33.62  ? 628 GLU C O   1 
ATOM   2405 C CB  . GLU C 1 75  ? 2.459   -4.887  131.106 1.00 34.20  ? 628 GLU C CB  1 
ATOM   2406 C CG  . GLU C 1 75  ? 3.698   -4.294  131.819 1.00 53.82  ? 628 GLU C CG  1 
ATOM   2407 C CD  . GLU C 1 75  ? 3.415   -2.973  132.573 1.00 74.50  ? 628 GLU C CD  1 
ATOM   2408 O OE1 . GLU C 1 75  ? 2.239   -2.751  132.963 1.00 68.30  ? 628 GLU C OE1 1 
ATOM   2409 O OE2 . GLU C 1 75  ? 4.368   -2.157  132.766 1.00 54.80  ? 628 GLU C OE2 1 
ATOM   2410 N N   . GLU C 1 76  ? 0.630   -5.950  128.818 1.00 33.88  ? 629 GLU C N   1 
ATOM   2411 C CA  . GLU C 1 76  ? -0.679  -6.403  128.365 1.00 37.59  ? 629 GLU C CA  1 
ATOM   2412 C C   . GLU C 1 76  ? -0.617  -7.852  127.919 1.00 34.34  ? 629 GLU C C   1 
ATOM   2413 O O   . GLU C 1 76  ? -1.475  -8.651  128.274 1.00 32.26  ? 629 GLU C O   1 
ATOM   2414 C CB  . GLU C 1 76  ? -1.105  -5.555  127.177 1.00 37.20  ? 629 GLU C CB  1 
ATOM   2415 C CG  . GLU C 1 76  ? -2.579  -5.234  127.083 1.00 68.90  ? 629 GLU C CG  1 
ATOM   2416 C CD  . GLU C 1 76  ? -2.836  -3.732  127.087 1.00 82.74  ? 629 GLU C CD  1 
ATOM   2417 O OE1 . GLU C 1 76  ? -3.362  -3.228  128.100 1.00 80.18  ? 629 GLU C OE1 1 
ATOM   2418 O OE2 . GLU C 1 76  ? -2.495  -3.059  126.082 1.00 74.25  ? 629 GLU C OE2 1 
ATOM   2419 N N   . ASP C 1 77  ? 0.417   -8.200  127.154 1.00 28.29  ? 630 ASP C N   1 
ATOM   2420 C CA  . ASP C 1 77  ? 0.520   -9.560  126.639 1.00 29.19  ? 630 ASP C CA  1 
ATOM   2421 C C   . ASP C 1 77  ? 0.909   -10.520 127.750 1.00 26.65  ? 630 ASP C C   1 
ATOM   2422 O O   . ASP C 1 77  ? 0.392   -11.629 127.840 1.00 28.39  ? 630 ASP C O   1 
ATOM   2423 C CB  . ASP C 1 77  ? 1.497   -9.661  125.454 1.00 28.58  ? 630 ASP C CB  1 
ATOM   2424 C CG  . ASP C 1 77  ? 0.816   -9.476  124.124 1.00 33.52  ? 630 ASP C CG  1 
ATOM   2425 O OD1 . ASP C 1 77  ? -0.443  -9.477  124.088 1.00 42.37  ? 630 ASP C OD1 1 
ATOM   2426 O OD2 . ASP C 1 77  ? 1.524   -9.307  123.115 1.00 26.46  ? 630 ASP C OD2 1 
ATOM   2427 N N   . PHE C 1 78  ? 1.810   -10.091 128.610 1.00 30.09  ? 631 PHE C N   1 
ATOM   2428 C CA  . PHE C 1 78  ? 2.145   -10.890 129.768 1.00 26.45  ? 631 PHE C CA  1 
ATOM   2429 C C   . PHE C 1 78  ? 0.902   -11.182 130.640 1.00 37.24  ? 631 PHE C C   1 
ATOM   2430 O O   . PHE C 1 78  ? 0.740   -12.311 131.112 1.00 34.91  ? 631 PHE C O   1 
ATOM   2431 C CB  . PHE C 1 78  ? 3.221   -10.208 130.588 1.00 26.23  ? 631 PHE C CB  1 
ATOM   2432 C CG  . PHE C 1 78  ? 3.601   -10.980 131.798 1.00 29.31  ? 631 PHE C CG  1 
ATOM   2433 C CD1 . PHE C 1 78  ? 3.267   -10.521 133.060 1.00 46.07  ? 631 PHE C CD1 1 
ATOM   2434 C CD2 . PHE C 1 78  ? 4.188   -12.208 131.673 1.00 26.33  ? 631 PHE C CD2 1 
ATOM   2435 C CE1 . PHE C 1 78  ? 3.564   -11.267 134.179 1.00 43.51  ? 631 PHE C CE1 1 
ATOM   2436 C CE2 . PHE C 1 78  ? 4.493   -12.954 132.784 1.00 30.51  ? 631 PHE C CE2 1 
ATOM   2437 C CZ  . PHE C 1 78  ? 4.183   -12.472 134.041 1.00 37.18  ? 631 PHE C CZ  1 
ATOM   2438 N N   . ASP C 1 79  ? 0.024   -10.193 130.848 1.00 29.36  ? 632 ASP C N   1 
ATOM   2439 C CA  . ASP C 1 79  ? -1.158  -10.409 131.705 1.00 35.05  ? 632 ASP C CA  1 
ATOM   2440 C C   . ASP C 1 79  ? -2.133  -11.373 131.018 1.00 34.00  ? 632 ASP C C   1 
ATOM   2441 O O   . ASP C 1 79  ? -2.817  -12.157 131.669 1.00 30.77  ? 632 ASP C O   1 
ATOM   2442 C CB  . ASP C 1 79  ? -1.913  -9.103  132.051 1.00 38.71  ? 632 ASP C CB  1 
ATOM   2443 C CG  . ASP C 1 79  ? -1.138  -8.148  132.989 1.00 42.74  ? 632 ASP C CG  1 
ATOM   2444 O OD1 . ASP C 1 79  ? -0.220  -8.552  133.772 1.00 36.74  ? 632 ASP C OD1 1 
ATOM   2445 O OD2 . ASP C 1 79  ? -1.511  -6.942  132.936 1.00 42.29  ? 632 ASP C OD2 1 
ATOM   2446 N N   . LEU C 1 80  ? -2.213  -11.321 129.698 1.00 32.18  ? 633 LEU C N   1 
ATOM   2447 C CA  . LEU C 1 80  ? -2.930  -12.376 128.985 1.00 19.24  ? 633 LEU C CA  1 
ATOM   2448 C C   . LEU C 1 80  ? -2.452  -13.778 129.313 1.00 26.26  ? 633 LEU C C   1 
ATOM   2449 O O   . LEU C 1 80  ? -3.262  -14.688 129.438 1.00 23.73  ? 633 LEU C O   1 
ATOM   2450 C CB  . LEU C 1 80  ? -2.841  -12.188 127.473 1.00 30.58  ? 633 LEU C CB  1 
ATOM   2451 C CG  . LEU C 1 80  ? -4.115  -11.683 126.803 1.00 30.83  ? 633 LEU C CG  1 
ATOM   2452 C CD1 . LEU C 1 80  ? -3.863  -11.539 125.277 1.00 31.64  ? 633 LEU C CD1 1 
ATOM   2453 C CD2 . LEU C 1 80  ? -5.233  -12.639 127.093 1.00 34.27  ? 633 LEU C CD2 1 
ATOM   2454 N N   . ILE C 1 81  ? -1.136  -13.981 129.418 1.00 25.93  ? 634 ILE C N   1 
ATOM   2455 C CA  . ILE C 1 81  ? -0.656  -15.306 129.674 1.00 25.18  ? 634 ILE C CA  1 
ATOM   2456 C C   . ILE C 1 81  ? -1.244  -15.734 130.990 1.00 24.43  ? 634 ILE C C   1 
ATOM   2457 O O   . ILE C 1 81  ? -1.763  -16.819 131.093 1.00 26.85  ? 634 ILE C O   1 
ATOM   2458 C CB  . ILE C 1 81  ? 0.880   -15.398 129.776 1.00 27.56  ? 634 ILE C CB  1 
ATOM   2459 C CG1 . ILE C 1 81  ? 1.465   -15.190 128.371 1.00 31.40  ? 634 ILE C CG1 1 
ATOM   2460 C CG2 . ILE C 1 81  ? 1.248   -16.772 130.362 1.00 16.63  ? 634 ILE C CG2 1 
ATOM   2461 C CD1 . ILE C 1 81  ? 2.911   -15.058 128.290 1.00 20.95  ? 634 ILE C CD1 1 
ATOM   2462 N N   . ILE C 1 82  ? -1.182  -14.855 131.990 1.00 25.99  ? 635 ILE C N   1 
ATOM   2463 C CA  . ILE C 1 82  ? -1.644  -15.188 133.343 1.00 21.28  ? 635 ILE C CA  1 
ATOM   2464 C C   . ILE C 1 82  ? -3.184  -15.370 133.413 1.00 26.75  ? 635 ILE C C   1 
ATOM   2465 O O   . ILE C 1 82  ? -3.691  -16.325 133.999 1.00 28.44  ? 635 ILE C O   1 
ATOM   2466 C CB  . ILE C 1 82  ? -1.233  -14.066 134.308 1.00 26.06  ? 635 ILE C CB  1 
ATOM   2467 C CG1 . ILE C 1 82  ? 0.303   -13.869 134.367 1.00 32.24  ? 635 ILE C CG1 1 
ATOM   2468 C CG2 . ILE C 1 82  ? -1.868  -14.250 135.646 1.00 15.71  ? 635 ILE C CG2 1 
ATOM   2469 C CD1 . ILE C 1 82  ? 1.104   -15.102 134.520 1.00 15.97  ? 635 ILE C CD1 1 
ATOM   2470 N N   . ASP C 1 83  ? -3.901  -14.443 132.798 1.00 22.61  ? 636 ASP C N   1 
ATOM   2471 C CA  . ASP C 1 83  ? -5.387  -14.415 132.837 1.00 34.18  ? 636 ASP C CA  1 
ATOM   2472 C C   . ASP C 1 83  ? -6.046  -15.560 132.098 1.00 28.33  ? 636 ASP C C   1 
ATOM   2473 O O   . ASP C 1 83  ? -7.104  -16.040 132.526 1.00 42.79  ? 636 ASP C O   1 
ATOM   2474 C CB  . ASP C 1 83  ? -5.955  -13.079 132.301 1.00 24.40  ? 636 ASP C CB  1 
ATOM   2475 C CG  . ASP C 1 83  ? -5.774  -11.930 133.279 1.00 36.15  ? 636 ASP C CG  1 
ATOM   2476 O OD1 . ASP C 1 83  ? -5.749  -12.205 134.499 1.00 59.13  ? 636 ASP C OD1 1 
ATOM   2477 O OD2 . ASP C 1 83  ? -5.645  -10.755 132.835 1.00 43.16  ? 636 ASP C OD2 1 
ATOM   2478 N N   . ASN C 1 84  ? -5.452  -15.981 130.984 1.00 31.03  ? 637 ASN C N   1 
ATOM   2479 C CA  . ASN C 1 84  ? -5.966  -17.137 130.260 1.00 23.39  ? 637 ASN C CA  1 
ATOM   2480 C C   . ASN C 1 84  ? -5.723  -18.364 131.130 1.00 26.20  ? 637 ASN C C   1 
ATOM   2481 O O   . ASN C 1 84  ? -6.610  -19.191 131.332 1.00 24.16  ? 637 ASN C O   1 
ATOM   2482 C CB  . ASN C 1 84  ? -5.250  -17.334 128.922 1.00 29.83  ? 637 ASN C CB  1 
ATOM   2483 C CG  . ASN C 1 84  ? -5.564  -16.270 127.909 1.00 32.49  ? 637 ASN C CG  1 
ATOM   2484 O OD1 . ASN C 1 84  ? -6.589  -15.590 127.983 1.00 32.15  ? 637 ASN C OD1 1 
ATOM   2485 N ND2 . ASN C 1 84  ? -4.682  -16.153 126.898 1.00 39.80  ? 637 ASN C ND2 1 
ATOM   2486 N N   . CYS C 1 85  ? -4.504  -18.517 131.643 1.00 20.27  ? 638 CYS C N   1 
ATOM   2487 C CA  . CYS C 1 85  ? -4.274  -19.692 132.466 1.00 20.03  ? 638 CYS C CA  1 
ATOM   2488 C C   . CYS C 1 85  ? -5.188  -19.776 133.692 1.00 31.48  ? 638 CYS C C   1 
ATOM   2489 O O   . CYS C 1 85  ? -5.531  -20.884 134.137 1.00 32.03  ? 638 CYS C O   1 
ATOM   2490 C CB  . CYS C 1 85  ? -2.826  -19.765 132.864 1.00 25.82  ? 638 CYS C CB  1 
ATOM   2491 S SG  . CYS C 1 85  ? -2.545  -21.209 133.781 1.00 32.91  ? 638 CYS C SG  1 
ATOM   2492 N N   . MET C 1 86  ? -5.589  -18.616 134.235 1.00 35.90  ? 639 MET C N   1 
ATOM   2493 C CA  . MET C 1 86  ? -6.433  -18.583 135.434 1.00 30.32  ? 639 MET C CA  1 
ATOM   2494 C C   . MET C 1 86  ? -7.881  -18.831 135.073 1.00 39.29  ? 639 MET C C   1 
ATOM   2495 O O   . MET C 1 86  ? -8.571  -19.591 135.746 1.00 42.83  ? 639 MET C O   1 
ATOM   2496 C CB  . MET C 1 86  ? -6.272  -17.279 136.213 1.00 28.49  ? 639 MET C CB  1 
ATOM   2497 C CG  . MET C 1 86  ? -4.907  -17.244 136.959 1.00 28.32  ? 639 MET C CG  1 
ATOM   2498 S SD  . MET C 1 86  ? -4.497  -15.693 137.798 1.00 45.92  ? 639 MET C SD  1 
ATOM   2499 C CE  . MET C 1 86  ? -5.905  -15.561 138.900 1.00 33.42  ? 639 MET C CE  1 
ATOM   2500 N N   . LYS C 1 87  ? -8.323  -18.232 133.979 1.00 40.02  ? 640 LYS C N   1 
ATOM   2501 C CA  . LYS C 1 87  ? -9.661  -18.480 133.489 1.00 39.72  ? 640 LYS C CA  1 
ATOM   2502 C C   . LYS C 1 87  ? -9.874  -19.940 133.080 1.00 37.73  ? 640 LYS C C   1 
ATOM   2503 O O   . LYS C 1 87  ? -10.891 -20.527 133.422 1.00 42.10  ? 640 LYS C O   1 
ATOM   2504 C CB  . LYS C 1 87  ? -9.970  -17.567 132.317 1.00 46.43  ? 640 LYS C CB  1 
ATOM   2505 C CG  . LYS C 1 87  ? -11.441 -17.527 132.023 1.00 58.30  ? 640 LYS C CG  1 
ATOM   2506 C CD  . LYS C 1 87  ? -11.733 -17.829 130.587 1.00 58.79  ? 640 LYS C CD  1 
ATOM   2507 C CE  . LYS C 1 87  ? -11.767 -16.567 129.747 1.00 67.03  ? 640 LYS C CE  1 
ATOM   2508 N NZ  . LYS C 1 87  ? -12.936 -16.678 128.853 1.00 43.60  ? 640 LYS C NZ  1 
ATOM   2509 N N   . TYR C 1 88  ? -8.916  -20.543 132.386 1.00 36.05  ? 641 TYR C N   1 
ATOM   2510 C CA  . TYR C 1 88  ? -9.128  -21.883 131.865 1.00 33.42  ? 641 TYR C CA  1 
ATOM   2511 C C   . TYR C 1 88  ? -9.082  -22.972 132.932 1.00 32.96  ? 641 TYR C C   1 
ATOM   2512 O O   . TYR C 1 88  ? -9.991  -23.810 133.002 1.00 40.58  ? 641 TYR C O   1 
ATOM   2513 C CB  . TYR C 1 88  ? -8.125  -22.232 130.747 1.00 31.03  ? 641 TYR C CB  1 
ATOM   2514 C CG  . TYR C 1 88  ? -8.287  -23.674 130.346 1.00 21.77  ? 641 TYR C CG  1 
ATOM   2515 C CD1 . TYR C 1 88  ? -7.449  -24.658 130.853 1.00 40.42  ? 641 TYR C CD1 1 
ATOM   2516 C CD2 . TYR C 1 88  ? -9.356  -24.074 129.569 1.00 46.29  ? 641 TYR C CD2 1 
ATOM   2517 C CE1 . TYR C 1 88  ? -7.651  -26.004 130.532 1.00 45.48  ? 641 TYR C CE1 1 
ATOM   2518 C CE2 . TYR C 1 88  ? -9.554  -25.397 129.248 1.00 37.43  ? 641 TYR C CE2 1 
ATOM   2519 C CZ  . TYR C 1 88  ? -8.703  -26.356 129.728 1.00 35.28  ? 641 TYR C CZ  1 
ATOM   2520 O OH  . TYR C 1 88  ? -8.912  -27.666 129.369 1.00 43.30  ? 641 TYR C OH  1 
ATOM   2521 N N   . ASN C 1 89  ? -8.035  -22.976 133.745 1.00 27.41  ? 642 ASN C N   1 
ATOM   2522 C CA  . ASN C 1 89  ? -7.819  -24.057 134.732 1.00 29.24  ? 642 ASN C CA  1 
ATOM   2523 C C   . ASN C 1 89  ? -8.566  -23.863 136.035 1.00 41.24  ? 642 ASN C C   1 
ATOM   2524 O O   . ASN C 1 89  ? -8.747  -22.737 136.489 1.00 34.88  ? 642 ASN C O   1 
ATOM   2525 C CB  . ASN C 1 89  ? -6.329  -24.167 135.068 1.00 31.44  ? 642 ASN C CB  1 
ATOM   2526 C CG  . ASN C 1 89  ? -5.502  -24.538 133.834 1.00 50.74  ? 642 ASN C CG  1 
ATOM   2527 O OD1 . ASN C 1 89  ? -5.539  -25.682 133.399 1.00 28.37  ? 642 ASN C OD1 1 
ATOM   2528 N ND2 . ASN C 1 89  ? -4.819  -23.560 133.235 1.00 45.49  ? 642 ASN C ND2 1 
ATOM   2529 N N   . ALA C 1 90  ? -8.951  -24.981 136.655 1.00 42.80  ? 643 ALA C N   1 
ATOM   2530 C CA  . ALA C 1 90  ? -9.525  -24.976 137.990 1.00 37.55  ? 643 ALA C CA  1 
ATOM   2531 C C   . ALA C 1 90  ? -8.554  -24.405 139.042 1.00 39.90  ? 643 ALA C C   1 
ATOM   2532 O O   . ALA C 1 90  ? -7.317  -24.490 138.907 1.00 37.16  ? 643 ALA C O   1 
ATOM   2533 C CB  . ALA C 1 90  ? -9.943  -26.373 138.359 1.00 35.89  ? 643 ALA C CB  1 
ATOM   2534 N N   . ARG C 1 91  ? -9.122  -23.795 140.076 1.00 42.44  ? 644 ARG C N   1 
ATOM   2535 C CA  . ARG C 1 91  ? -8.342  -23.097 141.119 1.00 43.73  ? 644 ARG C CA  1 
ATOM   2536 C C   . ARG C 1 91  ? -7.324  -24.022 141.805 1.00 45.04  ? 644 ARG C C   1 
ATOM   2537 O O   . ARG C 1 91  ? -6.259  -23.585 142.208 1.00 35.34  ? 644 ARG C O   1 
ATOM   2538 C CB  . ARG C 1 91  ? -9.276  -22.497 142.187 1.00 39.98  ? 644 ARG C CB  1 
ATOM   2539 N N   . ASP C 1 92  ? -7.676  -25.293 141.961 1.00 48.72  ? 645 ASP C N   1 
ATOM   2540 C CA  . ASP C 1 92  ? -6.839  -26.240 142.711 1.00 55.65  ? 645 ASP C CA  1 
ATOM   2541 C C   . ASP C 1 92  ? -5.650  -26.841 141.920 1.00 48.99  ? 645 ASP C C   1 
ATOM   2542 O O   . ASP C 1 92  ? -4.869  -27.598 142.485 1.00 59.27  ? 645 ASP C O   1 
ATOM   2543 C CB  . ASP C 1 92  ? -7.720  -27.370 143.279 1.00 60.74  ? 645 ASP C CB  1 
ATOM   2544 C CG  . ASP C 1 92  ? -8.703  -27.935 142.247 1.00 62.07  ? 645 ASP C CG  1 
ATOM   2545 O OD1 . ASP C 1 92  ? -8.693  -27.469 141.092 1.00 95.68  ? 645 ASP C OD1 1 
ATOM   2546 O OD2 . ASP C 1 92  ? -9.500  -28.831 142.586 1.00 68.49  ? 645 ASP C OD2 1 
ATOM   2547 N N   . THR C 1 93  ? -5.486  -26.503 140.644 1.00 41.92  ? 646 THR C N   1 
ATOM   2548 C CA  . THR C 1 93  ? -4.471  -27.175 139.821 1.00 41.15  ? 646 THR C CA  1 
ATOM   2549 C C   . THR C 1 93  ? -3.111  -26.505 139.853 1.00 37.86  ? 646 THR C C   1 
ATOM   2550 O O   . THR C 1 93  ? -2.968  -25.333 140.208 1.00 38.60  ? 646 THR C O   1 
ATOM   2551 C CB  . THR C 1 93  ? -4.858  -27.265 138.338 1.00 37.00  ? 646 THR C CB  1 
ATOM   2552 O OG1 . THR C 1 93  ? -4.861  -25.944 137.759 1.00 31.43  ? 646 THR C OG1 1 
ATOM   2553 C CG2 . THR C 1 93  ? -6.204  -27.983 138.155 1.00 44.99  ? 646 THR C CG2 1 
ATOM   2554 N N   . VAL C 1 94  ? -2.132  -27.282 139.419 1.00 39.80  ? 647 VAL C N   1 
ATOM   2555 C CA  . VAL C 1 94  ? -0.741  -26.881 139.326 1.00 41.02  ? 647 VAL C CA  1 
ATOM   2556 C C   . VAL C 1 94  ? -0.589  -25.676 138.382 1.00 32.66  ? 647 VAL C C   1 
ATOM   2557 O O   . VAL C 1 94  ? 0.113   -24.738 138.701 1.00 34.52  ? 647 VAL C O   1 
ATOM   2558 C CB  . VAL C 1 94  ? 0.127   -28.102 138.873 1.00 45.90  ? 647 VAL C CB  1 
ATOM   2559 C CG1 . VAL C 1 94  ? 1.497   -27.680 138.403 1.00 47.32  ? 647 VAL C CG1 1 
ATOM   2560 C CG2 . VAL C 1 94  ? 0.247   -29.131 140.025 1.00 55.87  ? 647 VAL C CG2 1 
ATOM   2561 N N   . PHE C 1 95  ? -1.295  -25.674 137.257 1.00 37.47  ? 648 PHE C N   1 
ATOM   2562 C CA  . PHE C 1 95  ? -1.152  -24.581 136.314 1.00 37.36  ? 648 PHE C CA  1 
ATOM   2563 C C   . PHE C 1 95  ? -1.628  -23.271 136.908 1.00 33.02  ? 648 PHE C C   1 
ATOM   2564 O O   . PHE C 1 95  ? -0.892  -22.281 136.885 1.00 33.39  ? 648 PHE C O   1 
ATOM   2565 C CB  . PHE C 1 95  ? -1.848  -24.880 134.979 1.00 40.57  ? 648 PHE C CB  1 
ATOM   2566 C CG  . PHE C 1 95  ? -1.188  -25.994 134.179 1.00 52.87  ? 648 PHE C CG  1 
ATOM   2567 C CD1 . PHE C 1 95  ? 0.198   -26.134 134.144 1.00 50.68  ? 648 PHE C CD1 1 
ATOM   2568 C CD2 . PHE C 1 95  ? -1.967  -26.908 133.459 1.00 52.39  ? 648 PHE C CD2 1 
ATOM   2569 C CE1 . PHE C 1 95  ? 0.801   -27.158 133.405 1.00 62.76  ? 648 PHE C CE1 1 
ATOM   2570 C CE2 . PHE C 1 95  ? -1.370  -27.938 132.726 1.00 64.01  ? 648 PHE C CE2 1 
ATOM   2571 C CZ  . PHE C 1 95  ? 0.017   -28.059 132.700 1.00 60.32  ? 648 PHE C CZ  1 
ATOM   2572 N N   . TYR C 1 96  ? -2.843  -23.276 137.456 1.00 37.85  ? 649 TYR C N   1 
ATOM   2573 C CA  . TYR C 1 96  ? -3.454  -22.073 138.057 1.00 33.47  ? 649 TYR C CA  1 
ATOM   2574 C C   . TYR C 1 96  ? -2.484  -21.402 139.041 1.00 33.30  ? 649 TYR C C   1 
ATOM   2575 O O   . TYR C 1 96  ? -2.250  -20.199 138.986 1.00 31.68  ? 649 TYR C O   1 
ATOM   2576 C CB  . TYR C 1 96  ? -4.779  -22.452 138.741 1.00 32.30  ? 649 TYR C CB  1 
ATOM   2577 C CG  . TYR C 1 96  ? -5.608  -21.280 139.231 1.00 34.40  ? 649 TYR C CG  1 
ATOM   2578 C CD1 . TYR C 1 96  ? -6.675  -20.789 138.489 1.00 35.73  ? 649 TYR C CD1 1 
ATOM   2579 C CD2 . TYR C 1 96  ? -5.334  -20.682 140.449 1.00 23.91  ? 649 TYR C CD2 1 
ATOM   2580 C CE1 . TYR C 1 96  ? -7.436  -19.720 138.947 1.00 21.09  ? 649 TYR C CE1 1 
ATOM   2581 C CE2 . TYR C 1 96  ? -6.058  -19.633 140.912 1.00 27.35  ? 649 TYR C CE2 1 
ATOM   2582 C CZ  . TYR C 1 96  ? -7.138  -19.160 140.155 1.00 32.25  ? 649 TYR C CZ  1 
ATOM   2583 O OH  . TYR C 1 96  ? -7.876  -18.103 140.625 1.00 36.82  ? 649 TYR C OH  1 
ATOM   2584 N N   . ARG C 1 97  ? -1.900  -22.210 139.915 1.00 31.93  ? 650 ARG C N   1 
ATOM   2585 C CA  A ARG C 1 97  ? -0.954  -21.736 140.927 0.50 31.25  ? 650 ARG C CA  1 
ATOM   2586 C CA  B ARG C 1 97  ? -0.982  -21.690 140.920 0.50 32.05  ? 650 ARG C CA  1 
ATOM   2587 C C   . ARG C 1 97  ? 0.345   -21.250 140.294 1.00 34.26  ? 650 ARG C C   1 
ATOM   2588 O O   . ARG C 1 97  ? 0.976   -20.312 140.784 1.00 39.62  ? 650 ARG C O   1 
ATOM   2589 C CB  A ARG C 1 97  ? -0.661  -22.849 141.949 0.50 29.90  ? 650 ARG C CB  1 
ATOM   2590 C CB  B ARG C 1 97  ? -0.787  -22.704 142.062 0.50 31.58  ? 650 ARG C CB  1 
ATOM   2591 C CG  A ARG C 1 97  ? -1.604  -22.833 143.146 0.50 37.70  ? 650 ARG C CG  1 
ATOM   2592 C CG  B ARG C 1 97  ? -1.616  -22.347 143.306 0.50 43.19  ? 650 ARG C CG  1 
ATOM   2593 C CD  A ARG C 1 97  ? -2.142  -24.204 143.513 0.50 41.07  ? 650 ARG C CD  1 
ATOM   2594 C CD  B ARG C 1 97  ? -2.378  -23.525 143.908 0.50 45.61  ? 650 ARG C CD  1 
ATOM   2595 N NE  A ARG C 1 97  ? -1.127  -25.260 143.574 0.50 24.49  ? 650 ARG C NE  1 
ATOM   2596 N NE  B ARG C 1 97  ? -2.792  -23.237 145.283 0.50 46.55  ? 650 ARG C NE  1 
ATOM   2597 C CZ  A ARG C 1 97  ? -1.426  -26.538 143.792 0.50 36.97  ? 650 ARG C CZ  1 
ATOM   2598 C CZ  B ARG C 1 97  ? -3.878  -23.733 145.866 0.50 50.19  ? 650 ARG C CZ  1 
ATOM   2599 N NH1 A ARG C 1 97  ? -0.476  -27.457 143.814 0.50 46.11  ? 650 ARG C NH1 1 
ATOM   2600 N NH1 B ARG C 1 97  ? -4.682  -24.548 145.196 0.50 53.95  ? 650 ARG C NH1 1 
ATOM   2601 N NH2 A ARG C 1 97  ? -2.693  -26.892 143.985 0.50 44.10  ? 650 ARG C NH2 1 
ATOM   2602 N NH2 B ARG C 1 97  ? -4.159  -23.409 147.118 0.50 42.32  ? 650 ARG C NH2 1 
ATOM   2603 N N   . ALA C 1 98  ? 0.752   -21.902 139.204 1.00 30.56  ? 651 ALA C N   1 
ATOM   2604 C CA  . ALA C 1 98  ? 1.927   -21.481 138.477 1.00 31.72  ? 651 ALA C CA  1 
ATOM   2605 C C   . ALA C 1 98  ? 1.686   -20.084 137.951 1.00 28.11  ? 651 ALA C C   1 
ATOM   2606 O O   . ALA C 1 98  ? 2.564   -19.244 138.037 1.00 25.43  ? 651 ALA C O   1 
ATOM   2607 C CB  . ALA C 1 98  ? 2.232   -22.459 137.316 1.00 33.12  ? 651 ALA C CB  1 
ATOM   2608 N N   . ALA C 1 99  ? 0.493   -19.834 137.392 1.00 20.55  ? 652 ALA C N   1 
ATOM   2609 C CA  . ALA C 1 99  ? 0.194   -18.535 136.868 1.00 17.82  ? 652 ALA C CA  1 
ATOM   2610 C C   . ALA C 1 99  ? 0.213   -17.517 137.973 1.00 28.80  ? 652 ALA C C   1 
ATOM   2611 O O   . ALA C 1 99  ? 0.667   -16.401 137.765 1.00 33.21  ? 652 ALA C O   1 
ATOM   2612 C CB  . ALA C 1 99  ? -1.249  -18.507 136.136 1.00 23.72  ? 652 ALA C CB  1 
ATOM   2613 N N   . VAL C 1 100 ? -0.312  -17.868 139.145 1.00 30.52  ? 653 VAL C N   1 
ATOM   2614 C CA  . VAL C 1 100 ? -0.410  -16.876 140.229 1.00 28.34  ? 653 VAL C CA  1 
ATOM   2615 C C   . VAL C 1 100 ? 0.984   -16.431 140.641 1.00 29.87  ? 653 VAL C C   1 
ATOM   2616 O O   . VAL C 1 100 ? 1.207   -15.243 140.861 1.00 33.63  ? 653 VAL C O   1 
ATOM   2617 C CB  . VAL C 1 100 ? -1.199  -17.399 141.474 1.00 31.19  ? 653 VAL C CB  1 
ATOM   2618 C CG1 . VAL C 1 100 ? -1.151  -16.372 142.677 1.00 26.78  ? 653 VAL C CG1 1 
ATOM   2619 C CG2 . VAL C 1 100 ? -2.647  -17.720 141.108 1.00 29.83  ? 653 VAL C CG2 1 
ATOM   2620 N N   . ARG C 1 101 ? 1.911   -17.382 140.735 1.00 30.93  ? 654 ARG C N   1 
ATOM   2621 C CA  . ARG C 1 101 ? 3.274   -17.095 141.182 1.00 32.26  ? 654 ARG C CA  1 
ATOM   2622 C C   . ARG C 1 101 ? 4.067   -16.358 140.099 1.00 35.93  ? 654 ARG C C   1 
ATOM   2623 O O   . ARG C 1 101 ? 4.956   -15.578 140.410 1.00 34.47  ? 654 ARG C O   1 
ATOM   2624 C CB  . ARG C 1 101 ? 4.014   -18.374 141.631 1.00 27.20  ? 654 ARG C CB  1 
ATOM   2625 N N   . LEU C 1 102 ? 3.746   -16.599 138.831 1.00 40.10  ? 655 LEU C N   1 
ATOM   2626 C CA  . LEU C 1 102 ? 4.490   -15.969 137.755 1.00 34.93  ? 655 LEU C CA  1 
ATOM   2627 C C   . LEU C 1 102 ? 4.033   -14.513 137.641 1.00 36.22  ? 655 LEU C C   1 
ATOM   2628 O O   . LEU C 1 102 ? 4.835   -13.619 137.326 1.00 29.28  ? 655 LEU C O   1 
ATOM   2629 C CB  . LEU C 1 102 ? 4.280   -16.722 136.444 1.00 37.31  ? 655 LEU C CB  1 
ATOM   2630 C CG  . LEU C 1 102 ? 5.003   -16.163 135.208 1.00 37.37  ? 655 LEU C CG  1 
ATOM   2631 C CD1 . LEU C 1 102 ? 6.509   -16.041 135.440 1.00 37.25  ? 655 LEU C CD1 1 
ATOM   2632 C CD2 . LEU C 1 102 ? 4.737   -17.052 134.025 1.00 29.30  ? 655 LEU C CD2 1 
ATOM   2633 N N   . ARG C 1 103 ? 2.753   -14.271 137.920 1.00 23.73  ? 656 ARG C N   1 
ATOM   2634 C CA  . ARG C 1 103 ? 2.254   -12.898 138.008 1.00 32.12  ? 656 ARG C CA  1 
ATOM   2635 C C   . ARG C 1 103 ? 2.998   -12.125 139.082 1.00 34.88  ? 656 ARG C C   1 
ATOM   2636 O O   . ARG C 1 103 ? 3.349   -10.954 138.854 1.00 32.69  ? 656 ARG C O   1 
ATOM   2637 C CB  . ARG C 1 103 ? 0.754   -12.832 138.272 1.00 35.73  ? 656 ARG C CB  1 
ATOM   2638 C CG  . ARG C 1 103 ? 0.233   -11.423 138.650 1.00 38.97  ? 656 ARG C CG  1 
ATOM   2639 C CD  . ARG C 1 103 ? -1.305  -11.431 138.872 1.00 43.04  ? 656 ARG C CD  1 
ATOM   2640 N NE  . ARG C 1 103 ? -2.022  -11.411 137.594 1.00 58.12  ? 656 ARG C NE  1 
ATOM   2641 C CZ  . ARG C 1 103 ? -3.350  -11.466 137.447 1.00 82.66  ? 656 ARG C CZ  1 
ATOM   2642 N NH1 . ARG C 1 103 ? -4.164  -11.554 138.505 1.00 67.50  ? 656 ARG C NH1 1 
ATOM   2643 N NH2 . ARG C 1 103 ? -3.867  -11.431 136.216 1.00 83.04  ? 656 ARG C NH2 1 
ATOM   2644 N N   . ASP C 1 104 ? 3.272   -12.785 140.219 1.00 38.29  ? 657 ASP C N   1 
ATOM   2645 C CA  . ASP C 1 104 ? 4.022   -12.160 141.319 1.00 36.58  ? 657 ASP C CA  1 
ATOM   2646 C C   . ASP C 1 104 ? 5.493   -11.943 140.956 1.00 39.64  ? 657 ASP C C   1 
ATOM   2647 O O   . ASP C 1 104 ? 6.009   -10.844 141.126 1.00 36.26  ? 657 ASP C O   1 
ATOM   2648 C CB  . ASP C 1 104 ? 3.902   -12.962 142.630 1.00 34.75  ? 657 ASP C CB  1 
ATOM   2649 C CG  . ASP C 1 104 ? 2.524   -12.803 143.310 1.00 63.65  ? 657 ASP C CG  1 
ATOM   2650 O OD1 . ASP C 1 104 ? 1.747   -11.882 142.948 1.00 69.02  ? 657 ASP C OD1 1 
ATOM   2651 O OD2 . ASP C 1 104 ? 2.213   -13.606 144.220 1.00 73.00  ? 657 ASP C OD2 1 
ATOM   2652 N N   . GLN C 1 105 ? 6.168   -12.974 140.456 1.00 39.93  ? 658 GLN C N   1 
ATOM   2653 C CA  . GLN C 1 105 ? 7.603   -12.844 140.166 1.00 38.40  ? 658 GLN C CA  1 
ATOM   2654 C C   . GLN C 1 105 ? 7.861   -11.981 138.948 1.00 37.29  ? 658 GLN C C   1 
ATOM   2655 O O   . GLN C 1 105 ? 8.872   -11.290 138.857 1.00 39.46  ? 658 GLN C O   1 
ATOM   2656 C CB  . GLN C 1 105 ? 8.262   -14.202 140.009 1.00 39.43  ? 658 GLN C CB  1 
ATOM   2657 C CG  . GLN C 1 105 ? 8.474   -14.880 141.350 1.00 37.29  ? 658 GLN C CG  1 
ATOM   2658 C CD  . GLN C 1 105 ? 8.984   -16.259 141.191 1.00 52.31  ? 658 GLN C CD  1 
ATOM   2659 O OE1 . GLN C 1 105 ? 10.140  -16.462 140.820 1.00 80.44  ? 658 GLN C OE1 1 
ATOM   2660 N NE2 . GLN C 1 105 ? 8.138   -17.233 141.466 1.00 57.41  ? 658 GLN C NE2 1 
ATOM   2661 N N   . GLY C 1 106 ? 6.916   -11.997 138.031 1.00 35.00  ? 659 GLY C N   1 
ATOM   2662 C CA  . GLY C 1 106 ? 7.032   -11.217 136.818 1.00 33.28  ? 659 GLY C CA  1 
ATOM   2663 C C   . GLY C 1 106 ? 6.779   -9.760  137.090 1.00 28.72  ? 659 GLY C C   1 
ATOM   2664 O O   . GLY C 1 106 ? 7.461   -8.917  136.534 1.00 27.39  ? 659 GLY C O   1 
ATOM   2665 N N   . GLY C 1 107 ? 5.810   -9.485  137.968 1.00 33.52  ? 660 GLY C N   1 
ATOM   2666 C CA  . GLY C 1 107 ? 5.527   -8.135  138.444 1.00 37.15  ? 660 GLY C CA  1 
ATOM   2667 C C   . GLY C 1 107 ? 6.771   -7.411  138.943 1.00 38.17  ? 660 GLY C C   1 
ATOM   2668 O O   . GLY C 1 107 ? 6.946   -6.237  138.675 1.00 40.70  ? 660 GLY C O   1 
ATOM   2669 N N   . VAL C 1 108 ? 7.643   -8.113  139.660 1.00 38.52  ? 661 VAL C N   1 
ATOM   2670 C CA  . VAL C 1 108 ? 8.889   -7.516  140.142 1.00 31.89  ? 661 VAL C CA  1 
ATOM   2671 C C   . VAL C 1 108 ? 9.735   -7.044  138.967 1.00 31.30  ? 661 VAL C C   1 
ATOM   2672 O O   . VAL C 1 108 ? 10.263  -5.944  138.963 1.00 32.84  ? 661 VAL C O   1 
ATOM   2673 C CB  . VAL C 1 108 ? 9.723   -8.527  140.990 1.00 37.19  ? 661 VAL C CB  1 
ATOM   2674 C CG1 . VAL C 1 108 ? 10.927  -7.833  141.583 1.00 26.11  ? 661 VAL C CG1 1 
ATOM   2675 C CG2 . VAL C 1 108 ? 8.889   -9.127  142.101 1.00 31.31  ? 661 VAL C CG2 1 
ATOM   2676 N N   . VAL C 1 109 ? 9.829   -7.885  137.947 1.00 33.37  ? 662 VAL C N   1 
ATOM   2677 C CA  . VAL C 1 109 ? 10.590  -7.582  136.757 1.00 25.23  ? 662 VAL C CA  1 
ATOM   2678 C C   . VAL C 1 109 ? 10.002  -6.398  135.945 1.00 26.13  ? 662 VAL C C   1 
ATOM   2679 O O   . VAL C 1 109 ? 10.720  -5.525  135.467 1.00 31.28  ? 662 VAL C O   1 
ATOM   2680 C CB  . VAL C 1 109 ? 10.675  -8.856  135.878 1.00 28.08  ? 662 VAL C CB  1 
ATOM   2681 C CG1 . VAL C 1 109 ? 11.361  -8.565  134.569 1.00 24.57  ? 662 VAL C CG1 1 
ATOM   2682 C CG2 . VAL C 1 109 ? 11.456  -9.968  136.631 1.00 31.64  ? 662 VAL C CG2 1 
ATOM   2683 N N   . LEU C 1 110 ? 8.704   -6.408  135.760 1.00 23.89  ? 663 LEU C N   1 
ATOM   2684 C CA  . LEU C 1 110 ? 8.018   -5.366  135.009 1.00 28.51  ? 663 LEU C CA  1 
ATOM   2685 C C   . LEU C 1 110 ? 8.134   -4.033  135.744 1.00 29.35  ? 663 LEU C C   1 
ATOM   2686 O O   . LEU C 1 110 ? 8.562   -3.060  135.166 1.00 41.37  ? 663 LEU C O   1 
ATOM   2687 C CB  . LEU C 1 110 ? 6.562   -5.760  134.824 1.00 30.57  ? 663 LEU C CB  1 
ATOM   2688 C CG  . LEU C 1 110 ? 6.351   -6.986  133.943 1.00 45.23  ? 663 LEU C CG  1 
ATOM   2689 C CD1 . LEU C 1 110 ? 4.842   -7.214  133.731 1.00 24.39  ? 663 LEU C CD1 1 
ATOM   2690 C CD2 . LEU C 1 110 ? 7.127   -6.808  132.616 1.00 35.65  ? 663 LEU C CD2 1 
ATOM   2691 N N   . ARG C 1 111 ? 7.845   -4.013  137.040 1.00 40.87  ? 664 ARG C N   1 
ATOM   2692 C CA  . ARG C 1 111 ? 8.046   -2.786  137.838 1.00 44.09  ? 664 ARG C CA  1 
ATOM   2693 C C   . ARG C 1 111 ? 9.482   -2.275  137.697 1.00 40.54  ? 664 ARG C C   1 
ATOM   2694 O O   . ARG C 1 111 ? 9.705   -1.088  137.491 1.00 38.73  ? 664 ARG C O   1 
ATOM   2695 C CB  . ARG C 1 111 ? 7.687   -2.996  139.314 1.00 47.27  ? 664 ARG C CB  1 
ATOM   2696 C CG  . ARG C 1 111 ? 6.174   -3.145  139.588 1.00 59.76  ? 664 ARG C CG  1 
ATOM   2697 C CD  . ARG C 1 111 ? 5.841   -3.111  141.095 1.00 69.73  ? 664 ARG C CD  1 
ATOM   2698 N NE  . ARG C 1 111 ? 6.263   -4.326  141.790 1.00 56.19  ? 664 ARG C NE  1 
ATOM   2699 C CZ  . ARG C 1 111 ? 5.614   -5.490  141.745 1.00 46.37  ? 664 ARG C CZ  1 
ATOM   2700 N NH1 . ARG C 1 111 ? 6.088   -6.537  142.406 1.00 58.53  ? 664 ARG C NH1 1 
ATOM   2701 N NH2 . ARG C 1 111 ? 4.501   -5.629  141.030 1.00 53.11  ? 664 ARG C NH2 1 
ATOM   2702 N N   . GLN C 1 112 ? 10.459  -3.163  137.763 1.00 34.23  ? 665 GLN C N   1 
ATOM   2703 C CA  . GLN C 1 112 ? 11.825  -2.730  137.584 1.00 32.20  ? 665 GLN C CA  1 
ATOM   2704 C C   . GLN C 1 112 ? 12.049  -2.183  136.163 1.00 32.65  ? 665 GLN C C   1 
ATOM   2705 O O   . GLN C 1 112 ? 12.753  -1.196  135.955 1.00 38.79  ? 665 GLN C O   1 
ATOM   2706 C CB  . GLN C 1 112 ? 12.791  -3.873  137.891 1.00 37.97  ? 665 GLN C CB  1 
ATOM   2707 C CG  . GLN C 1 112 ? 14.252  -3.445  137.879 1.00 39.25  ? 665 GLN C CG  1 
ATOM   2708 C CD  . GLN C 1 112 ? 14.617  -2.485  139.016 1.00 46.04  ? 665 GLN C CD  1 
ATOM   2709 O OE1 . GLN C 1 112 ? 14.177  -2.646  140.164 1.00 41.95  ? 665 GLN C OE1 1 
ATOM   2710 N NE2 . GLN C 1 112 ? 15.444  -1.501  138.701 1.00 37.18  ? 665 GLN C NE2 1 
ATOM   2711 N N   . ALA C 1 113 ? 11.444  -2.805  135.171 1.00 35.61  ? 666 ALA C N   1 
ATOM   2712 C CA  . ALA C 1 113 ? 11.556  -2.302  133.818 1.00 34.08  ? 666 ALA C CA  1 
ATOM   2713 C C   . ALA C 1 113 ? 11.021  -0.849  133.766 1.00 37.12  ? 666 ALA C C   1 
ATOM   2714 O O   . ALA C 1 113 ? 11.645  0.067   133.202 1.00 31.80  ? 666 ALA C O   1 
ATOM   2715 C CB  . ALA C 1 113 ? 10.784  -3.243  132.837 1.00 37.38  ? 666 ALA C CB  1 
ATOM   2716 N N   . ARG C 1 114 ? 9.873   -0.646  134.394 1.00 34.52  ? 667 ARG C N   1 
ATOM   2717 C CA  . ARG C 1 114 ? 9.252   0.672   134.461 1.00 34.03  ? 667 ARG C CA  1 
ATOM   2718 C C   . ARG C 1 114 ? 10.240  1.717   134.976 1.00 32.69  ? 667 ARG C C   1 
ATOM   2719 O O   . ARG C 1 114 ? 10.233  2.863   134.538 1.00 32.07  ? 667 ARG C O   1 
ATOM   2720 C CB  . ARG C 1 114 ? 8.029   0.588   135.376 1.00 28.02  ? 667 ARG C CB  1 
ATOM   2721 C CG  . ARG C 1 114 ? 7.198   1.870   135.520 1.00 43.93  ? 667 ARG C CG  1 
ATOM   2722 C CD  . ARG C 1 114 ? 6.057   1.929   134.511 1.00 56.71  ? 667 ARG C CD  1 
ATOM   2723 N NE  . ARG C 1 114 ? 6.409   2.722   133.348 1.00 53.89  ? 667 ARG C NE  1 
ATOM   2724 C CZ  . ARG C 1 114 ? 5.873   2.593   132.136 1.00 47.52  ? 667 ARG C CZ  1 
ATOM   2725 N NH1 . ARG C 1 114 ? 4.924   1.695   131.874 1.00 40.10  ? 667 ARG C NH1 1 
ATOM   2726 N NH2 . ARG C 1 114 ? 6.318   3.376   131.165 1.00 42.99  ? 667 ARG C NH2 1 
ATOM   2727 N N   . ARG C 1 115 ? 11.087  1.322   135.916 1.00 28.81  ? 668 ARG C N   1 
ATOM   2728 C CA  . ARG C 1 115 ? 12.009  2.253   136.536 1.00 33.52  ? 668 ARG C CA  1 
ATOM   2729 C C   . ARG C 1 115 ? 13.120  2.658   135.579 1.00 32.10  ? 668 ARG C C   1 
ATOM   2730 O O   . ARG C 1 115 ? 13.631  3.781   135.628 1.00 31.00  ? 668 ARG C O   1 
ATOM   2731 C CB  . ARG C 1 115 ? 12.623  1.636   137.795 1.00 30.86  ? 668 ARG C CB  1 
ATOM   2732 C CG  . ARG C 1 115 ? 11.672  1.444   138.962 1.00 33.19  ? 668 ARG C CG  1 
ATOM   2733 C CD  . ARG C 1 115 ? 12.285  0.484   139.985 1.00 21.74  ? 668 ARG C CD  1 
ATOM   2734 N NE  . ARG C 1 115 ? 11.384  0.188   141.074 1.00 35.05  ? 668 ARG C NE  1 
ATOM   2735 C CZ  . ARG C 1 115 ? 11.711  -0.531  142.144 1.00 40.22  ? 668 ARG C CZ  1 
ATOM   2736 N NH1 . ARG C 1 115 ? 12.941  -1.045  142.289 1.00 30.52  ? 668 ARG C NH1 1 
ATOM   2737 N NH2 . ARG C 1 115 ? 10.795  -0.735  143.075 1.00 28.70  ? 668 ARG C NH2 1 
ATOM   2738 N N   . GLU C 1 116 ? 13.526  1.704   134.755 1.00 34.72  ? 669 GLU C N   1 
ATOM   2739 C CA  . GLU C 1 116 ? 14.480  1.953   133.706 1.00 33.43  ? 669 GLU C CA  1 
ATOM   2740 C C   . GLU C 1 116 ? 13.874  2.889   132.637 1.00 37.53  ? 669 GLU C C   1 
ATOM   2741 O O   . GLU C 1 116 ? 14.467  3.897   132.278 1.00 37.13  ? 669 GLU C O   1 
ATOM   2742 C CB  . GLU C 1 116 ? 14.907  0.618   133.115 1.00 32.67  ? 669 GLU C CB  1 
ATOM   2743 C CG  . GLU C 1 116 ? 15.706  -0.248  134.086 1.00 46.14  ? 669 GLU C CG  1 
ATOM   2744 C CD  . GLU C 1 116 ? 16.922  0.473   134.571 1.00 33.83  ? 669 GLU C CD  1 
ATOM   2745 O OE1 . GLU C 1 116 ? 17.176  0.443   135.779 1.00 52.47  ? 669 GLU C OE1 1 
ATOM   2746 O OE2 . GLU C 1 116 ? 17.597  1.111   133.735 1.00 36.57  ? 669 GLU C OE2 1 
ATOM   2747 N N   . VAL C 1 117 ? 12.672  2.587   132.166 1.00 31.32  ? 670 VAL C N   1 
ATOM   2748 C CA  . VAL C 1 117 ? 11.977  3.507   131.255 1.00 31.08  ? 670 VAL C CA  1 
ATOM   2749 C C   . VAL C 1 117 ? 11.863  4.917   131.835 1.00 37.22  ? 670 VAL C C   1 
ATOM   2750 O O   . VAL C 1 117 ? 12.105  5.889   131.130 1.00 43.66  ? 670 VAL C O   1 
ATOM   2751 C CB  . VAL C 1 117 ? 10.585  2.998   130.904 1.00 35.25  ? 670 VAL C CB  1 
ATOM   2752 C CG1 . VAL C 1 117 ? 9.728   4.117   130.125 1.00 29.22  ? 670 VAL C CG1 1 
ATOM   2753 C CG2 . VAL C 1 117 ? 10.717  1.756   130.105 1.00 32.20  ? 670 VAL C CG2 1 
ATOM   2754 N N   . ASP C 1 118 ? 11.518  5.030   133.118 1.00 34.49  ? 671 ASP C N   1 
ATOM   2755 C CA  . ASP C 1 118 ? 11.481  6.326   133.776 1.00 35.98  ? 671 ASP C CA  1 
ATOM   2756 C C   . ASP C 1 118 ? 12.820  7.049   133.589 1.00 38.11  ? 671 ASP C C   1 
ATOM   2757 O O   . ASP C 1 118 ? 12.857  8.227   133.269 1.00 36.46  ? 671 ASP C O   1 
ATOM   2758 C CB  . ASP C 1 118 ? 11.204  6.185   135.278 1.00 40.29  ? 671 ASP C CB  1 
ATOM   2759 C CG  . ASP C 1 118 ? 9.765   5.710   135.609 1.00 43.53  ? 671 ASP C CG  1 
ATOM   2760 O OD1 . ASP C 1 118 ? 8.845   5.797   134.769 1.00 56.49  ? 671 ASP C OD1 1 
ATOM   2761 O OD2 . ASP C 1 118 ? 9.567   5.253   136.758 1.00 40.67  ? 671 ASP C OD2 1 
ATOM   2762 N N   . SER C 1 119 ? 13.921  6.332   133.786 1.00 37.46  ? 672 SER C N   1 
ATOM   2763 C CA  . SER C 1 119 ? 15.239  6.933   133.714 1.00 42.82  ? 672 SER C CA  1 
ATOM   2764 C C   . SER C 1 119 ? 15.615  7.279   132.267 1.00 46.18  ? 672 SER C C   1 
ATOM   2765 O O   . SER C 1 119 ? 16.070  8.390   131.978 1.00 49.70  ? 672 SER C O   1 
ATOM   2766 C CB  . SER C 1 119 ? 16.293  5.981   134.326 1.00 47.62  ? 672 SER C CB  1 
ATOM   2767 O OG  . SER C 1 119 ? 16.832  5.093   133.347 1.00 55.57  ? 672 SER C OG  1 
ATOM   2768 N N   . ILE C 1 120 ? 15.406  6.319   131.367 1.00 44.93  ? 673 ILE C N   1 
ATOM   2769 C CA  . ILE C 1 120 ? 15.753  6.467   129.962 1.00 45.15  ? 673 ILE C CA  1 
ATOM   2770 C C   . ILE C 1 120 ? 14.984  7.610   129.347 1.00 49.50  ? 673 ILE C C   1 
ATOM   2771 O O   . ILE C 1 120 ? 15.543  8.372   128.564 1.00 55.39  ? 673 ILE C O   1 
ATOM   2772 C CB  . ILE C 1 120 ? 15.456  5.169   129.159 1.00 46.69  ? 673 ILE C CB  1 
ATOM   2773 C CG1 . ILE C 1 120 ? 16.421  4.047   129.557 1.00 54.86  ? 673 ILE C CG1 1 
ATOM   2774 C CG2 . ILE C 1 120 ? 15.578  5.409   127.675 1.00 53.73  ? 673 ILE C CG2 1 
ATOM   2775 C CD1 . ILE C 1 120 ? 16.028  2.691   129.006 1.00 61.44  ? 673 ILE C CD1 1 
ATOM   2776 N N   . GLY C 1 121 ? 13.711  7.746   129.720 1.00 52.69  ? 674 GLY C N   1 
ATOM   2777 C CA  . GLY C 1 121 ? 12.839  8.789   129.170 1.00 57.45  ? 674 GLY C CA  1 
ATOM   2778 C C   . GLY C 1 121 ? 13.087  10.195  129.705 1.00 64.50  ? 674 GLY C C   1 
ATOM   2779 O O   . GLY C 1 121 ? 12.386  11.140  129.327 1.00 59.68  ? 674 GLY C O   1 
ATOM   2780 N N   . LEU C 1 122 ? 14.081  10.342  130.582 1.00 73.38  ? 675 LEU C N   1 
ATOM   2781 C CA  . LEU C 1 122 ? 14.417  11.642  131.170 1.00 77.18  ? 675 LEU C CA  1 
ATOM   2782 C C   . LEU C 1 122 ? 15.427  12.378  130.284 1.00 80.89  ? 675 LEU C C   1 
ATOM   2783 O O   . LEU C 1 122 ? 15.062  13.301  129.548 1.00 83.25  ? 675 LEU C O   1 
ATOM   2784 C CB  . LEU C 1 122 ? 14.968  11.465  132.596 1.00 76.90  ? 675 LEU C CB  1 
ATOM   2785 C CG  . LEU C 1 122 ? 14.649  12.607  133.569 1.00 81.82  ? 675 LEU C CG  1 
ATOM   2786 C CD1 . LEU C 1 122 ? 13.157  12.648  133.881 1.00 75.13  ? 675 LEU C CD1 1 
ATOM   2787 C CD2 . LEU C 1 122 ? 15.459  12.505  134.854 1.00 86.42  ? 675 LEU C CD2 1 
ATOM   2788 N N   . LEU D 1 11  ? 28.886  35.714  68.767  1.00 57.40  ? 564 LEU D N   1 
ATOM   2789 C CA  . LEU D 1 11  ? 29.839  34.762  68.088  1.00 65.30  ? 564 LEU D CA  1 
ATOM   2790 C C   . LEU D 1 11  ? 30.052  33.460  68.887  1.00 65.65  ? 564 LEU D C   1 
ATOM   2791 O O   . LEU D 1 11  ? 29.426  32.447  68.588  1.00 60.00  ? 564 LEU D O   1 
ATOM   2792 C CB  . LEU D 1 11  ? 31.187  35.444  67.815  1.00 64.94  ? 564 LEU D CB  1 
ATOM   2793 N N   . THR D 1 12  ? 30.947  33.480  69.881  1.00 66.69  ? 565 THR D N   1 
ATOM   2794 C CA  . THR D 1 12  ? 31.056  32.373  70.840  1.00 66.30  ? 565 THR D CA  1 
ATOM   2795 C C   . THR D 1 12  ? 29.697  32.049  71.488  1.00 61.32  ? 565 THR D C   1 
ATOM   2796 O O   . THR D 1 12  ? 29.411  30.883  71.749  1.00 62.57  ? 565 THR D O   1 
ATOM   2797 C CB  . THR D 1 12  ? 32.094  32.653  71.966  1.00 66.18  ? 565 THR D CB  1 
ATOM   2798 N N   . PRO D 1 13  ? 28.869  33.076  71.776  1.00 57.10  ? 566 PRO D N   1 
ATOM   2799 C CA  . PRO D 1 13  ? 27.510  32.793  72.236  1.00 52.14  ? 566 PRO D CA  1 
ATOM   2800 C C   . PRO D 1 13  ? 26.613  32.110  71.211  1.00 49.41  ? 566 PRO D C   1 
ATOM   2801 O O   . PRO D 1 13  ? 25.810  31.259  71.606  1.00 46.10  ? 566 PRO D O   1 
ATOM   2802 C CB  . PRO D 1 13  ? 26.942  34.176  72.608  1.00 52.71  ? 566 PRO D CB  1 
ATOM   2803 C CG  . PRO D 1 13  ? 27.907  35.160  72.108  1.00 61.34  ? 566 PRO D CG  1 
ATOM   2804 C CD  . PRO D 1 13  ? 29.238  34.466  72.079  1.00 59.35  ? 566 PRO D CD  1 
ATOM   2805 N N   . LEU D 1 14  ? 26.733  32.458  69.924  1.00 45.18  ? 567 LEU D N   1 
ATOM   2806 C CA  . LEU D 1 14  ? 26.031  31.687  68.893  1.00 41.55  ? 567 LEU D CA  1 
ATOM   2807 C C   . LEU D 1 14  ? 26.519  30.254  68.927  1.00 39.43  ? 567 LEU D C   1 
ATOM   2808 O O   . LEU D 1 14  ? 25.709  29.347  68.975  1.00 41.13  ? 567 LEU D O   1 
ATOM   2809 C CB  . LEU D 1 14  ? 26.225  32.238  67.491  1.00 38.60  ? 567 LEU D CB  1 
ATOM   2810 C CG  . LEU D 1 14  ? 25.288  31.690  66.401  1.00 47.59  ? 567 LEU D CG  1 
ATOM   2811 C CD1 . LEU D 1 14  ? 23.816  32.022  66.642  1.00 29.79  ? 567 LEU D CD1 1 
ATOM   2812 C CD2 . LEU D 1 14  ? 25.696  32.243  65.063  1.00 43.61  ? 567 LEU D CD2 1 
ATOM   2813 N N   . THR D 1 15  ? 27.836  30.052  68.929  1.00 38.13  ? 568 THR D N   1 
ATOM   2814 C CA  . THR D 1 15  ? 28.380  28.704  68.920  1.00 41.72  ? 568 THR D CA  1 
ATOM   2815 C C   . THR D 1 15  ? 27.744  27.866  70.029  1.00 41.85  ? 568 THR D C   1 
ATOM   2816 O O   . THR D 1 15  ? 27.319  26.752  69.777  1.00 43.05  ? 568 THR D O   1 
ATOM   2817 C CB  . THR D 1 15  ? 29.933  28.674  69.027  1.00 46.41  ? 568 THR D CB  1 
ATOM   2818 O OG1 . THR D 1 15  ? 30.492  29.336  67.895  1.00 49.02  ? 568 THR D OG1 1 
ATOM   2819 C CG2 . THR D 1 15  ? 30.451  27.258  69.017  1.00 40.28  ? 568 THR D CG2 1 
ATOM   2820 N N   . VAL D 1 16  ? 27.651  28.411  71.239  1.00 43.93  ? 569 VAL D N   1 
ATOM   2821 C CA  . VAL D 1 16  ? 27.149  27.649  72.375  1.00 42.54  ? 569 VAL D CA  1 
ATOM   2822 C C   . VAL D 1 16  ? 25.663  27.323  72.188  1.00 37.92  ? 569 VAL D C   1 
ATOM   2823 O O   . VAL D 1 16  ? 25.203  26.222  72.486  1.00 29.73  ? 569 VAL D O   1 
ATOM   2824 C CB  . VAL D 1 16  ? 27.393  28.395  73.718  1.00 47.93  ? 569 VAL D CB  1 
ATOM   2825 C CG1 . VAL D 1 16  ? 26.778  27.613  74.895  1.00 41.73  ? 569 VAL D CG1 1 
ATOM   2826 C CG2 . VAL D 1 16  ? 28.898  28.619  73.942  1.00 45.06  ? 569 VAL D CG2 1 
ATOM   2827 N N   . LEU D 1 17  ? 24.913  28.281  71.676  1.00 33.17  ? 570 LEU D N   1 
ATOM   2828 C CA  . LEU D 1 17  ? 23.506  28.073  71.476  1.00 26.00  ? 570 LEU D CA  1 
ATOM   2829 C C   . LEU D 1 17  ? 23.262  26.993  70.409  1.00 28.48  ? 570 LEU D C   1 
ATOM   2830 O O   . LEU D 1 17  ? 22.432  26.099  70.580  1.00 36.45  ? 570 LEU D O   1 
ATOM   2831 C CB  . LEU D 1 17  ? 22.854  29.385  71.097  1.00 29.31  ? 570 LEU D CB  1 
ATOM   2832 C CG  . LEU D 1 17  ? 21.448  29.340  70.540  1.00 27.67  ? 570 LEU D CG  1 
ATOM   2833 C CD1 . LEU D 1 17  ? 20.467  28.850  71.614  1.00 31.23  ? 570 LEU D CD1 1 
ATOM   2834 C CD2 . LEU D 1 17  ? 21.102  30.742  70.029  1.00 29.29  ? 570 LEU D CD2 1 
ATOM   2835 N N   . LEU D 1 18  ? 23.974  27.051  69.301  1.00 26.76  ? 571 LEU D N   1 
ATOM   2836 C CA  . LEU D 1 18  ? 23.715  26.084  68.250  1.00 24.50  ? 571 LEU D CA  1 
ATOM   2837 C C   . LEU D 1 18  ? 24.103  24.669  68.662  1.00 32.27  ? 571 LEU D C   1 
ATOM   2838 O O   . LEU D 1 18  ? 23.385  23.724  68.307  1.00 30.24  ? 571 LEU D O   1 
ATOM   2839 C CB  . LEU D 1 18  ? 24.378  26.488  66.957  1.00 26.52  ? 571 LEU D CB  1 
ATOM   2840 C CG  . LEU D 1 18  ? 23.816  27.779  66.359  1.00 37.40  ? 571 LEU D CG  1 
ATOM   2841 C CD1 . LEU D 1 18  ? 24.710  28.177  65.195  1.00 32.17  ? 571 LEU D CD1 1 
ATOM   2842 C CD2 . LEU D 1 18  ? 22.350  27.608  65.925  1.00 39.43  ? 571 LEU D CD2 1 
ATOM   2843 N N   . ARG D 1 19  ? 25.203  24.517  69.417  1.00 24.81  ? 572 ARG D N   1 
ATOM   2844 C CA  . ARG D 1 19  ? 25.543  23.206  69.962  1.00 33.45  ? 572 ARG D CA  1 
ATOM   2845 C C   . ARG D 1 19  ? 24.314  22.608  70.609  1.00 29.59  ? 572 ARG D C   1 
ATOM   2846 O O   . ARG D 1 19  ? 23.974  21.474  70.328  1.00 37.87  ? 572 ARG D O   1 
ATOM   2847 C CB  . ARG D 1 19  ? 26.660  23.268  71.000  1.00 34.68  ? 572 ARG D CB  1 
ATOM   2848 C CG  . ARG D 1 19  ? 28.029  23.373  70.433  1.00 47.05  ? 572 ARG D CG  1 
ATOM   2849 C CD  . ARG D 1 19  ? 29.107  23.191  71.513  1.00 64.98  ? 572 ARG D CD  1 
ATOM   2850 N NE  . ARG D 1 19  ? 30.256  24.071  71.272  1.00 51.21  ? 572 ARG D NE  1 
ATOM   2851 C CZ  . ARG D 1 19  ? 31.273  24.248  72.111  1.00 85.91  ? 572 ARG D CZ  1 
ATOM   2852 N NH1 . ARG D 1 19  ? 32.252  25.086  71.785  1.00 87.36  ? 572 ARG D NH1 1 
ATOM   2853 N NH2 . ARG D 1 19  ? 31.326  23.595  73.271  1.00 99.93  ? 572 ARG D NH2 1 
ATOM   2854 N N   . SER D 1 20  ? 23.656  23.381  71.469  1.00 28.32  ? 573 SER D N   1 
ATOM   2855 C CA  . SER D 1 20  ? 22.490  22.907  72.206  1.00 31.05  ? 573 SER D CA  1 
ATOM   2856 C C   . SER D 1 20  ? 21.304  22.650  71.299  1.00 28.22  ? 573 SER D C   1 
ATOM   2857 O O   . SER D 1 20  ? 20.573  21.679  71.515  1.00 32.80  ? 573 SER D O   1 
ATOM   2858 C CB  . SER D 1 20  ? 22.050  23.901  73.301  1.00 39.26  ? 573 SER D CB  1 
ATOM   2859 O OG  . SER D 1 20  ? 22.907  23.887  74.435  1.00 42.15  ? 573 SER D OG  1 
ATOM   2860 N N   . VAL D 1 21  ? 21.060  23.544  70.343  1.00 27.06  ? 574 VAL D N   1 
ATOM   2861 C CA  . VAL D 1 21  ? 20.004  23.299  69.342  1.00 29.12  ? 574 VAL D CA  1 
ATOM   2862 C C   . VAL D 1 21  ? 20.323  21.991  68.579  1.00 28.16  ? 574 VAL D C   1 
ATOM   2863 O O   . VAL D 1 21  ? 19.444  21.165  68.355  1.00 20.50  ? 574 VAL D O   1 
ATOM   2864 C CB  . VAL D 1 21  ? 19.830  24.507  68.369  1.00 29.20  ? 574 VAL D CB  1 
ATOM   2865 C CG1 . VAL D 1 21  ? 18.904  24.163  67.247  1.00 32.01  ? 574 VAL D CG1 1 
ATOM   2866 C CG2 . VAL D 1 21  ? 19.322  25.792  69.117  1.00 20.29  ? 574 VAL D CG2 1 
ATOM   2867 N N   . LEU D 1 22  ? 21.595  21.760  68.257  1.00 19.57  ? 575 LEU D N   1 
ATOM   2868 C CA  . LEU D 1 22  ? 21.938  20.631  67.399  1.00 19.29  ? 575 LEU D CA  1 
ATOM   2869 C C   . LEU D 1 22  ? 21.714  19.363  68.187  1.00 21.35  ? 575 LEU D C   1 
ATOM   2870 O O   . LEU D 1 22  ? 21.129  18.404  67.654  1.00 22.70  ? 575 LEU D O   1 
ATOM   2871 C CB  . LEU D 1 22  ? 23.384  20.705  66.878  1.00 27.12  ? 575 LEU D CB  1 
ATOM   2872 C CG  . LEU D 1 22  ? 23.783  19.569  65.913  1.00 33.24  ? 575 LEU D CG  1 
ATOM   2873 C CD1 . LEU D 1 22  ? 22.918  19.521  64.685  1.00 14.59  ? 575 LEU D CD1 1 
ATOM   2874 C CD2 . LEU D 1 22  ? 25.246  19.709  65.468  1.00 31.79  ? 575 LEU D CD2 1 
ATOM   2875 N N   . ASP D 1 23  ? 22.181  19.373  69.443  1.00 24.53  ? 576 ASP D N   1 
ATOM   2876 C CA  . ASP D 1 23  ? 21.931  18.277  70.371  1.00 29.98  ? 576 ASP D CA  1 
ATOM   2877 C C   . ASP D 1 23  ? 20.466  17.952  70.527  1.00 24.79  ? 576 ASP D C   1 
ATOM   2878 O O   . ASP D 1 23  ? 20.126  16.790  70.553  1.00 25.15  ? 576 ASP D O   1 
ATOM   2879 C CB  . ASP D 1 23  ? 22.463  18.574  71.752  1.00 27.91  ? 576 ASP D CB  1 
ATOM   2880 C CG  . ASP D 1 23  ? 23.944  18.440  71.829  1.00 39.63  ? 576 ASP D CG  1 
ATOM   2881 O OD1 . ASP D 1 23  ? 24.561  17.945  70.865  1.00 26.75  ? 576 ASP D OD1 1 
ATOM   2882 O OD2 . ASP D 1 23  ? 24.485  18.877  72.854  1.00 39.13  ? 576 ASP D OD2 1 
ATOM   2883 N N   . GLN D 1 24  ? 19.616  18.967  70.652  1.00 24.30  ? 577 GLN D N   1 
ATOM   2884 C CA  . GLN D 1 24  ? 18.185  18.717  70.844  1.00 25.08  ? 577 GLN D CA  1 
ATOM   2885 C C   . GLN D 1 24  ? 17.573  18.222  69.562  1.00 26.51  ? 577 GLN D C   1 
ATOM   2886 O O   . GLN D 1 24  ? 16.520  17.587  69.579  1.00 39.10  ? 577 GLN D O   1 
ATOM   2887 C CB  . GLN D 1 24  ? 17.468  19.967  71.268  1.00 24.81  ? 577 GLN D CB  1 
ATOM   2888 C CG  . GLN D 1 24  ? 17.829  20.357  72.674  1.00 40.25  ? 577 GLN D CG  1 
ATOM   2889 C CD  . GLN D 1 24  ? 17.199  21.665  73.121  1.00 33.65  ? 577 GLN D CD  1 
ATOM   2890 O OE1 . GLN D 1 24  ? 16.294  22.201  72.473  1.00 45.05  ? 577 GLN D OE1 1 
ATOM   2891 N NE2 . GLN D 1 24  ? 17.665  22.174  74.267  1.00 39.01  ? 577 GLN D NE2 1 
ATOM   2892 N N   . LEU D 1 25  ? 18.219  18.539  68.447  1.00 29.06  ? 578 LEU D N   1 
ATOM   2893 C CA  . LEU D 1 25  ? 17.716  18.132  67.143  1.00 26.99  ? 578 LEU D CA  1 
ATOM   2894 C C   . LEU D 1 25  ? 18.041  16.670  66.983  1.00 20.10  ? 578 LEU D C   1 
ATOM   2895 O O   . LEU D 1 25  ? 17.149  15.879  66.675  1.00 24.26  ? 578 LEU D O   1 
ATOM   2896 C CB  . LEU D 1 25  ? 18.291  18.989  65.998  1.00 28.18  ? 578 LEU D CB  1 
ATOM   2897 C CG  . LEU D 1 25  ? 17.576  20.329  65.741  1.00 22.66  ? 578 LEU D CG  1 
ATOM   2898 C CD1 . LEU D 1 25  ? 18.320  21.123  64.714  1.00 12.34  ? 578 LEU D CD1 1 
ATOM   2899 C CD2 . LEU D 1 25  ? 16.122  20.132  65.298  1.00 27.90  ? 578 LEU D CD2 1 
ATOM   2900 N N   . GLN D 1 26  ? 19.296  16.295  67.250  1.00 22.78  ? 579 GLN D N   1 
ATOM   2901 C CA  . GLN D 1 26  ? 19.690  14.882  67.186  1.00 27.42  ? 579 GLN D CA  1 
ATOM   2902 C C   . GLN D 1 26  ? 18.860  13.995  68.084  1.00 29.35  ? 579 GLN D C   1 
ATOM   2903 O O   . GLN D 1 26  ? 18.623  12.855  67.707  1.00 34.57  ? 579 GLN D O   1 
ATOM   2904 C CB  . GLN D 1 26  ? 21.170  14.665  67.502  1.00 24.98  ? 579 GLN D CB  1 
ATOM   2905 C CG  . GLN D 1 26  ? 22.048  15.201  66.391  1.00 24.68  ? 579 GLN D CG  1 
ATOM   2906 C CD  . GLN D 1 26  ? 23.317  14.447  66.216  1.00 43.59  ? 579 GLN D CD  1 
ATOM   2907 O OE1 . GLN D 1 26  ? 24.384  14.989  66.478  1.00 37.46  ? 579 GLN D OE1 1 
ATOM   2908 N NE2 . GLN D 1 26  ? 23.229  13.194  65.736  1.00 27.36  ? 579 GLN D NE2 1 
ATOM   2909 N N   . ASP D 1 27  ? 18.424  14.522  69.243  1.00 32.94  ? 580 ASP D N   1 
ATOM   2910 C CA  . ASP D 1 27  ? 17.617  13.769  70.234  1.00 34.79  ? 580 ASP D CA  1 
ATOM   2911 C C   . ASP D 1 27  ? 16.213  13.504  69.728  1.00 28.36  ? 580 ASP D C   1 
ATOM   2912 O O   . ASP D 1 27  ? 15.515  12.648  70.248  1.00 29.78  ? 580 ASP D O   1 
ATOM   2913 C CB  . ASP D 1 27  ? 17.538  14.493  71.609  1.00 39.58  ? 580 ASP D CB  1 
ATOM   2914 C CG  . ASP D 1 27  ? 18.840  14.357  72.440  1.00 61.57  ? 580 ASP D CG  1 
ATOM   2915 O OD1 . ASP D 1 27  ? 19.595  13.386  72.210  1.00 67.46  ? 580 ASP D OD1 1 
ATOM   2916 O OD2 . ASP D 1 27  ? 19.116  15.221  73.321  1.00 43.75  ? 580 ASP D OD2 1 
ATOM   2917 N N   . LYS D 1 28  ? 15.790  14.214  68.701  1.00 31.53  ? 581 LYS D N   1 
ATOM   2918 C CA  . LYS D 1 28  ? 14.516  13.880  68.078  1.00 23.23  ? 581 LYS D CA  1 
ATOM   2919 C C   . LYS D 1 28  ? 14.667  12.819  66.954  1.00 26.17  ? 581 LYS D C   1 
ATOM   2920 O O   . LYS D 1 28  ? 13.673  12.426  66.310  1.00 29.32  ? 581 LYS D O   1 
ATOM   2921 C CB  . LYS D 1 28  ? 13.881  15.155  67.554  1.00 28.55  ? 581 LYS D CB  1 
ATOM   2922 C CG  . LYS D 1 28  ? 13.947  16.310  68.530  1.00 33.53  ? 581 LYS D CG  1 
ATOM   2923 C CD  . LYS D 1 28  ? 12.890  16.204  69.596  1.00 31.42  ? 581 LYS D CD  1 
ATOM   2924 C CE  . LYS D 1 28  ? 12.839  17.460  70.484  1.00 22.92  ? 581 LYS D CE  1 
ATOM   2925 N NZ  . LYS D 1 28  ? 13.981  17.462  71.432  1.00 57.28  ? 581 LYS D NZ  1 
ATOM   2926 N N   . ASP D 1 29  ? 15.908  12.388  66.692  1.00 26.07  ? 582 ASP D N   1 
ATOM   2927 C CA  . ASP D 1 29  ? 16.192  11.341  65.698  1.00 29.26  ? 582 ASP D CA  1 
ATOM   2928 C C   . ASP D 1 29  ? 16.996  10.229  66.395  1.00 33.94  ? 582 ASP D C   1 
ATOM   2929 O O   . ASP D 1 29  ? 18.180  10.027  66.093  1.00 28.64  ? 582 ASP D O   1 
ATOM   2930 C CB  . ASP D 1 29  ? 16.980  11.932  64.520  1.00 23.46  ? 582 ASP D CB  1 
ATOM   2931 C CG  . ASP D 1 29  ? 17.612  10.864  63.578  1.00 39.18  ? 582 ASP D CG  1 
ATOM   2932 O OD1 . ASP D 1 29  ? 16.923  9.861   63.211  1.00 31.45  ? 582 ASP D OD1 1 
ATOM   2933 O OD2 . ASP D 1 29  ? 18.812  11.064  63.166  1.00 19.16  ? 582 ASP D OD2 1 
ATOM   2934 N N   . PRO D 1 30  ? 16.359  9.523   67.354  1.00 30.62  ? 583 PRO D N   1 
ATOM   2935 C CA  . PRO D 1 30  ? 17.031  8.420   68.051  1.00 28.75  ? 583 PRO D CA  1 
ATOM   2936 C C   . PRO D 1 30  ? 17.309  7.198   67.146  1.00 29.77  ? 583 PRO D C   1 
ATOM   2937 O O   . PRO D 1 30  ? 18.197  6.369   67.425  1.00 31.39  ? 583 PRO D O   1 
ATOM   2938 C CB  . PRO D 1 30  ? 16.061  8.090   69.219  1.00 28.51  ? 583 PRO D CB  1 
ATOM   2939 C CG  . PRO D 1 30  ? 14.705  8.629   68.780  1.00 28.21  ? 583 PRO D CG  1 
ATOM   2940 C CD  . PRO D 1 30  ? 15.030  9.840   67.945  1.00 34.85  ? 583 PRO D CD  1 
ATOM   2941 N N   . ALA D 1 31  ? 16.596  7.110   66.046  1.00 24.89  ? 584 ALA D N   1 
ATOM   2942 C CA  . ALA D 1 31  ? 16.856  6.097   65.028  1.00 30.38  ? 584 ALA D CA  1 
ATOM   2943 C C   . ALA D 1 31  ? 18.197  6.328   64.283  1.00 36.52  ? 584 ALA D C   1 
ATOM   2944 O O   . ALA D 1 31  ? 18.655  5.464   63.543  1.00 40.31  ? 584 ALA D O   1 
ATOM   2945 C CB  . ALA D 1 31  ? 15.653  6.044   64.037  1.00 26.05  ? 584 ALA D CB  1 
ATOM   2946 N N   . ARG D 1 32  ? 18.818  7.492   64.490  1.00 37.23  ? 585 ARG D N   1 
ATOM   2947 C CA  . ARG D 1 32  ? 20.052  7.882   63.813  1.00 35.30  ? 585 ARG D CA  1 
ATOM   2948 C C   . ARG D 1 32  ? 19.932  7.802   62.282  1.00 33.75  ? 585 ARG D C   1 
ATOM   2949 O O   . ARG D 1 32  ? 20.912  7.530   61.594  1.00 24.03  ? 585 ARG D O   1 
ATOM   2950 C CB  . ARG D 1 32  ? 21.293  7.059   64.265  1.00 39.63  ? 585 ARG D CB  1 
ATOM   2951 C CG  . ARG D 1 32  ? 21.513  6.905   65.772  1.00 37.99  ? 585 ARG D CG  1 
ATOM   2952 C CD  . ARG D 1 32  ? 21.740  8.219   66.482  1.00 43.78  ? 585 ARG D CD  1 
ATOM   2953 N NE  . ARG D 1 32  ? 23.088  8.761   66.280  1.00 56.27  ? 585 ARG D NE  1 
ATOM   2954 C CZ  . ARG D 1 32  ? 23.562  9.860   66.873  1.00 62.78  ? 585 ARG D CZ  1 
ATOM   2955 N NH1 . ARG D 1 32  ? 24.806  10.268  66.626  1.00 67.86  ? 585 ARG D NH1 1 
ATOM   2956 N NH2 . ARG D 1 32  ? 22.804  10.552  67.727  1.00 56.25  ? 585 ARG D NH2 1 
ATOM   2957 N N   . ILE D 1 33  ? 18.745  8.090   61.750  1.00 33.36  ? 586 ILE D N   1 
ATOM   2958 C CA  . ILE D 1 33  ? 18.550  8.133   60.308  1.00 25.65  ? 586 ILE D CA  1 
ATOM   2959 C C   . ILE D 1 33  ? 19.305  9.320   59.672  1.00 26.28  ? 586 ILE D C   1 
ATOM   2960 O O   . ILE D 1 33  ? 19.777  9.246   58.543  1.00 22.52  ? 586 ILE D O   1 
ATOM   2961 C CB  . ILE D 1 33  ? 17.051  8.218   59.991  1.00 31.54  ? 586 ILE D CB  1 
ATOM   2962 C CG1 . ILE D 1 33  ? 16.397  6.871   60.325  1.00 30.99  ? 586 ILE D CG1 1 
ATOM   2963 C CG2 . ILE D 1 33  ? 16.839  8.562   58.554  1.00 14.99  ? 586 ILE D CG2 1 
ATOM   2964 C CD1 . ILE D 1 33  ? 14.898  6.872   60.323  1.00 26.87  ? 586 ILE D CD1 1 
ATOM   2965 N N   . PHE D 1 34  ? 19.459  10.410  60.406  1.00 24.10  ? 587 PHE D N   1 
ATOM   2966 C CA  . PHE D 1 34  ? 20.061  11.570  59.837  1.00 23.16  ? 587 PHE D CA  1 
ATOM   2967 C C   . PHE D 1 34  ? 21.398  11.929  60.506  1.00 29.43  ? 587 PHE D C   1 
ATOM   2968 O O   . PHE D 1 34  ? 21.933  13.029  60.288  1.00 30.54  ? 587 PHE D O   1 
ATOM   2969 C CB  . PHE D 1 34  ? 19.095  12.721  59.930  1.00 23.07  ? 587 PHE D CB  1 
ATOM   2970 C CG  . PHE D 1 34  ? 17.693  12.417  59.385  1.00 23.76  ? 587 PHE D CG  1 
ATOM   2971 C CD1 . PHE D 1 34  ? 17.391  12.583  58.032  1.00 20.43  ? 587 PHE D CD1 1 
ATOM   2972 C CD2 . PHE D 1 34  ? 16.686  12.054  60.233  1.00 19.22  ? 587 PHE D CD2 1 
ATOM   2973 C CE1 . PHE D 1 34  ? 16.107  12.339  57.542  1.00 30.90  ? 587 PHE D CE1 1 
ATOM   2974 C CE2 . PHE D 1 34  ? 15.363  11.819  59.763  1.00 24.39  ? 587 PHE D CE2 1 
ATOM   2975 C CZ  . PHE D 1 34  ? 15.083  11.968  58.412  1.00 23.97  ? 587 PHE D CZ  1 
ATOM   2976 N N   . ALA D 1 35  ? 21.931  10.995  61.289  1.00 26.93  ? 588 ALA D N   1 
ATOM   2977 C CA  . ALA D 1 35  ? 23.124  11.241  62.095  1.00 33.05  ? 588 ALA D CA  1 
ATOM   2978 C C   . ALA D 1 35  ? 24.339  11.377  61.218  1.00 27.96  ? 588 ALA D C   1 
ATOM   2979 O O   . ALA D 1 35  ? 25.213  12.204  61.475  1.00 36.15  ? 588 ALA D O   1 
ATOM   2980 C CB  . ALA D 1 35  ? 23.333  10.117  63.090  1.00 33.44  ? 588 ALA D CB  1 
ATOM   2981 N N   . GLN D 1 36  ? 24.400  10.552  60.182  1.00 32.74  ? 589 GLN D N   1 
ATOM   2982 C CA  . GLN D 1 36  ? 25.585  10.471  59.316  1.00 31.75  ? 589 GLN D CA  1 
ATOM   2983 C C   . GLN D 1 36  ? 25.180  10.591  57.869  1.00 30.59  ? 589 GLN D C   1 
ATOM   2984 O O   . GLN D 1 36  ? 23.987  10.445  57.542  1.00 25.74  ? 589 GLN D O   1 
ATOM   2985 C CB  . GLN D 1 36  ? 26.304  9.138   59.546  1.00 34.07  ? 589 GLN D CB  1 
ATOM   2986 C CG  . GLN D 1 36  ? 26.976  9.031   60.927  1.00 39.60  ? 589 GLN D CG  1 
ATOM   2987 C CD  . GLN D 1 36  ? 28.176  9.981   61.123  1.00 60.21  ? 589 GLN D CD  1 
ATOM   2988 O OE1 . GLN D 1 36  ? 28.850  10.417  60.166  1.00 42.29  ? 589 GLN D OE1 1 
ATOM   2989 N NE2 . GLN D 1 36  ? 28.455  10.285  62.386  1.00 42.64  ? 589 GLN D NE2 1 
ATOM   2990 N N   . PRO D 1 37  ? 26.148  10.900  56.987  1.00 30.54  ? 590 PRO D N   1 
ATOM   2991 C CA  . PRO D 1 37  ? 25.782  11.061  55.565  1.00 36.36  ? 590 PRO D CA  1 
ATOM   2992 C C   . PRO D 1 37  ? 25.183  9.763   54.978  1.00 34.84  ? 590 PRO D C   1 
ATOM   2993 O O   . PRO D 1 37  ? 25.576  8.673   55.398  1.00 31.73  ? 590 PRO D O   1 
ATOM   2994 C CB  . PRO D 1 37  ? 27.110  11.437  54.878  1.00 36.01  ? 590 PRO D CB  1 
ATOM   2995 C CG  . PRO D 1 37  ? 28.069  11.815  56.002  1.00 42.25  ? 590 PRO D CG  1 
ATOM   2996 C CD  . PRO D 1 37  ? 27.575  11.185  57.261  1.00 38.60  ? 590 PRO D CD  1 
ATOM   2997 N N   . VAL D 1 38  ? 24.214  9.893   54.060  1.00 33.59  ? 591 VAL D N   1 
ATOM   2998 C CA  . VAL D 1 38  ? 23.600  8.750   53.407  1.00 32.99  ? 591 VAL D CA  1 
ATOM   2999 C C   . VAL D 1 38  ? 24.724  7.901   52.781  1.00 40.76  ? 591 VAL D C   1 
ATOM   3000 O O   . VAL D 1 38  ? 25.624  8.430   52.135  1.00 41.70  ? 591 VAL D O   1 
ATOM   3001 C CB  . VAL D 1 38  ? 22.583  9.170   52.297  1.00 39.97  ? 591 VAL D CB  1 
ATOM   3002 C CG1 . VAL D 1 38  ? 22.210  7.977   51.451  1.00 36.71  ? 591 VAL D CG1 1 
ATOM   3003 C CG2 . VAL D 1 38  ? 21.298  9.784   52.891  1.00 33.10  ? 591 VAL D CG2 1 
ATOM   3004 N N   . SER D 1 39  ? 24.716  6.595   52.998  1.00 35.82  ? 592 SER D N   1 
ATOM   3005 C CA  . SER D 1 39  ? 25.790  5.778   52.411  1.00 44.73  ? 592 SER D CA  1 
ATOM   3006 C C   . SER D 1 39  ? 25.637  5.700   50.884  1.00 38.41  ? 592 SER D C   1 
ATOM   3007 O O   . SER D 1 39  ? 24.577  5.290   50.389  1.00 33.19  ? 592 SER D O   1 
ATOM   3008 C CB  . SER D 1 39  ? 25.824  4.372   53.021  1.00 42.82  ? 592 SER D CB  1 
ATOM   3009 O OG  . SER D 1 39  ? 26.482  3.452   52.157  1.00 56.35  ? 592 SER D OG  1 
ATOM   3010 N N   . LEU D 1 40  ? 26.672  6.115   50.144  1.00 32.22  ? 593 LEU D N   1 
ATOM   3011 C CA  . LEU D 1 40  ? 26.612  6.044   48.678  1.00 44.78  ? 593 LEU D CA  1 
ATOM   3012 C C   . LEU D 1 40  ? 26.760  4.573   48.169  1.00 45.46  ? 593 LEU D C   1 
ATOM   3013 O O   . LEU D 1 40  ? 26.349  4.242   47.053  1.00 47.99  ? 593 LEU D O   1 
ATOM   3014 C CB  . LEU D 1 40  ? 27.651  6.989   47.997  1.00 45.86  ? 593 LEU D CB  1 
ATOM   3015 C CG  . LEU D 1 40  ? 27.574  8.524   48.169  1.00 46.79  ? 593 LEU D CG  1 
ATOM   3016 C CD1 . LEU D 1 40  ? 28.562  9.274   47.240  1.00 37.71  ? 593 LEU D CD1 1 
ATOM   3017 C CD2 . LEU D 1 40  ? 26.184  9.066   47.951  1.00 42.93  ? 593 LEU D CD2 1 
ATOM   3018 N N   . LYS D 1 41  ? 27.344  3.708   48.998  1.00 44.56  ? 594 LYS D N   1 
ATOM   3019 C CA  . LYS D 1 41  ? 27.468  2.296   48.700  1.00 44.81  ? 594 LYS D CA  1 
ATOM   3020 C C   . LYS D 1 41  ? 26.103  1.644   48.868  1.00 43.50  ? 594 LYS D C   1 
ATOM   3021 O O   . LYS D 1 41  ? 25.738  0.760   48.119  1.00 46.03  ? 594 LYS D O   1 
ATOM   3022 C CB  . LYS D 1 41  ? 28.503  1.653   49.645  1.00 52.44  ? 594 LYS D CB  1 
ATOM   3023 C CG  . LYS D 1 41  ? 29.165  0.380   49.122  1.00 58.46  ? 594 LYS D CG  1 
ATOM   3024 N N   . GLU D 1 42  ? 25.343  2.090   49.856  1.00 41.49  ? 595 GLU D N   1 
ATOM   3025 C CA  . GLU D 1 42  ? 23.991  1.572   50.077  1.00 39.21  ? 595 GLU D CA  1 
ATOM   3026 C C   . GLU D 1 42  ? 23.026  2.162   49.097  1.00 38.88  ? 595 GLU D C   1 
ATOM   3027 O O   . GLU D 1 42  ? 22.060  1.515   48.738  1.00 46.54  ? 595 GLU D O   1 
ATOM   3028 C CB  . GLU D 1 42  ? 23.487  1.866   51.500  1.00 34.17  ? 595 GLU D CB  1 
ATOM   3029 C CG  . GLU D 1 42  ? 23.864  0.789   52.539  1.00 61.44  ? 595 GLU D CG  1 
ATOM   3030 C CD  . GLU D 1 42  ? 23.339  1.096   53.961  1.00 76.70  ? 595 GLU D CD  1 
ATOM   3031 O OE1 . GLU D 1 42  ? 22.669  0.226   54.559  1.00 83.81  ? 595 GLU D OE1 1 
ATOM   3032 O OE2 . GLU D 1 42  ? 23.596  2.199   54.493  1.00 68.10  ? 595 GLU D OE2 1 
ATOM   3033 N N   . VAL D 1 43  ? 23.259  3.409   48.688  1.00 35.63  ? 596 VAL D N   1 
ATOM   3034 C CA  . VAL D 1 43  ? 22.354  4.100   47.784  1.00 27.47  ? 596 VAL D CA  1 
ATOM   3035 C C   . VAL D 1 43  ? 23.164  4.783   46.672  1.00 37.23  ? 596 VAL D C   1 
ATOM   3036 O O   . VAL D 1 43  ? 23.338  6.002   46.675  1.00 38.28  ? 596 VAL D O   1 
ATOM   3037 C CB  . VAL D 1 43  ? 21.546  5.146   48.548  1.00 37.80  ? 596 VAL D CB  1 
ATOM   3038 C CG1 . VAL D 1 43  ? 20.355  5.591   47.700  1.00 29.27  ? 596 VAL D CG1 1 
ATOM   3039 C CG2 . VAL D 1 43  ? 21.125  4.582   49.928  1.00 30.03  ? 596 VAL D CG2 1 
ATOM   3040 N N   . PRO D 1 44  ? 23.657  3.994   45.700  1.00 40.00  ? 597 PRO D N   1 
ATOM   3041 C CA  . PRO D 1 44  ? 24.525  4.537   44.662  1.00 35.92  ? 597 PRO D CA  1 
ATOM   3042 C C   . PRO D 1 44  ? 23.911  5.563   43.708  1.00 31.94  ? 597 PRO D C   1 
ATOM   3043 O O   . PRO D 1 44  ? 24.661  6.257   43.061  1.00 35.75  ? 597 PRO D O   1 
ATOM   3044 C CB  . PRO D 1 44  ? 24.972  3.286   43.867  1.00 39.09  ? 597 PRO D CB  1 
ATOM   3045 C CG  . PRO D 1 44  ? 24.510  2.129   44.608  1.00 38.40  ? 597 PRO D CG  1 
ATOM   3046 C CD  . PRO D 1 44  ? 23.381  2.563   45.486  1.00 38.61  ? 597 PRO D CD  1 
ATOM   3047 N N   . ASP D 1 45  ? 22.589  5.662   43.588  1.00 32.18  ? 598 ASP D N   1 
ATOM   3048 C CA  . ASP D 1 45  ? 22.012  6.721   42.744  1.00 34.56  ? 598 ASP D CA  1 
ATOM   3049 C C   . ASP D 1 45  ? 21.661  8.014   43.529  1.00 36.19  ? 598 ASP D C   1 
ATOM   3050 O O   . ASP D 1 45  ? 20.940  8.904   43.005  1.00 30.48  ? 598 ASP D O   1 
ATOM   3051 C CB  . ASP D 1 45  ? 20.759  6.208   42.031  1.00 41.95  ? 598 ASP D CB  1 
ATOM   3052 C CG  . ASP D 1 45  ? 19.597  5.958   42.984  1.00 49.09  ? 598 ASP D CG  1 
ATOM   3053 O OD1 . ASP D 1 45  ? 19.850  5.682   44.174  1.00 33.49  ? 598 ASP D OD1 1 
ATOM   3054 O OD2 . ASP D 1 45  ? 18.432  6.041   42.542  1.00 38.46  ? 598 ASP D OD2 1 
ATOM   3055 N N   . TYR D 1 46  ? 22.139  8.128   44.775  1.00 24.89  ? 599 TYR D N   1 
ATOM   3056 C CA  . TYR D 1 46  ? 21.711  9.279   45.592  1.00 27.23  ? 599 TYR D CA  1 
ATOM   3057 C C   . TYR D 1 46  ? 21.954  10.584  44.855  1.00 28.32  ? 599 TYR D C   1 
ATOM   3058 O O   . TYR D 1 46  ? 21.054  11.416  44.757  1.00 30.71  ? 599 TYR D O   1 
ATOM   3059 C CB  . TYR D 1 46  ? 22.397  9.263   46.961  1.00 20.63  ? 599 TYR D CB  1 
ATOM   3060 C CG  . TYR D 1 46  ? 21.787  10.192  47.954  1.00 26.50  ? 599 TYR D CG  1 
ATOM   3061 C CD1 . TYR D 1 46  ? 20.436  10.104  48.296  1.00 34.19  ? 599 TYR D CD1 1 
ATOM   3062 C CD2 . TYR D 1 46  ? 22.557  11.160  48.585  1.00 20.37  ? 599 TYR D CD2 1 
ATOM   3063 C CE1 . TYR D 1 46  ? 19.881  10.957  49.235  1.00 26.67  ? 599 TYR D CE1 1 
ATOM   3064 C CE2 . TYR D 1 46  ? 22.002  12.017  49.521  1.00 41.04  ? 599 TYR D CE2 1 
ATOM   3065 C CZ  . TYR D 1 46  ? 20.670  11.924  49.836  1.00 27.06  ? 599 TYR D CZ  1 
ATOM   3066 O OH  . TYR D 1 46  ? 20.167  12.784  50.785  1.00 30.09  ? 599 TYR D OH  1 
ATOM   3067 N N   . LEU D 1 47  ? 23.138  10.719  44.257  1.00 32.25  ? 600 LEU D N   1 
ATOM   3068 C CA  . LEU D 1 47  ? 23.511  11.960  43.582  1.00 40.05  ? 600 LEU D CA  1 
ATOM   3069 C C   . LEU D 1 47  ? 22.781  12.255  42.270  1.00 40.45  ? 600 LEU D C   1 
ATOM   3070 O O   . LEU D 1 47  ? 22.843  13.402  41.791  1.00 35.86  ? 600 LEU D O   1 
ATOM   3071 C CB  . LEU D 1 47  ? 25.024  12.028  43.356  1.00 30.94  ? 600 LEU D CB  1 
ATOM   3072 C CG  . LEU D 1 47  ? 25.792  12.011  44.667  1.00 38.80  ? 600 LEU D CG  1 
ATOM   3073 C CD1 . LEU D 1 47  ? 27.259  12.305  44.433  1.00 31.14  ? 600 LEU D CD1 1 
ATOM   3074 C CD2 . LEU D 1 47  ? 25.198  12.989  45.672  1.00 38.75  ? 600 LEU D CD2 1 
ATOM   3075 N N   . ASP D 1 48  ? 22.096  11.261  41.694  1.00 35.49  ? 601 ASP D N   1 
ATOM   3076 C CA  . ASP D 1 48  ? 21.203  11.560  40.569  1.00 39.36  ? 601 ASP D CA  1 
ATOM   3077 C C   . ASP D 1 48  ? 19.975  12.348  41.027  1.00 34.59  ? 601 ASP D C   1 
ATOM   3078 O O   . ASP D 1 48  ? 19.329  12.995  40.216  1.00 43.30  ? 601 ASP D O   1 
ATOM   3079 C CB  . ASP D 1 48  ? 20.734  10.308  39.827  1.00 40.97  ? 601 ASP D CB  1 
ATOM   3080 C CG  . ASP D 1 48  ? 21.859  9.563   39.137  1.00 38.40  ? 601 ASP D CG  1 
ATOM   3081 O OD1 . ASP D 1 48  ? 22.882  10.170  38.766  1.00 41.78  ? 601 ASP D OD1 1 
ATOM   3082 O OD2 . ASP D 1 48  ? 21.705  8.336   38.968  1.00 32.60  ? 601 ASP D OD2 1 
ATOM   3083 N N   . HIS D 1 49  ? 19.645  12.300  42.313  1.00 35.63  ? 602 HIS D N   1 
ATOM   3084 C CA  . HIS D 1 49  ? 18.474  13.018  42.820  1.00 34.62  ? 602 HIS D CA  1 
ATOM   3085 C C   . HIS D 1 49  ? 18.813  14.148  43.754  1.00 32.62  ? 602 HIS D C   1 
ATOM   3086 O O   . HIS D 1 49  ? 18.139  15.166  43.713  1.00 31.77  ? 602 HIS D O   1 
ATOM   3087 C CB  . HIS D 1 49  ? 17.495  12.071  43.480  1.00 32.08  ? 602 HIS D CB  1 
ATOM   3088 C CG  . HIS D 1 49  ? 17.065  10.949  42.586  1.00 41.52  ? 602 HIS D CG  1 
ATOM   3089 N ND1 . HIS D 1 49  ? 17.661  9.704   42.610  1.00 46.83  ? 602 HIS D ND1 1 
ATOM   3090 C CD2 . HIS D 1 49  ? 16.112  10.891  41.629  1.00 52.34  ? 602 HIS D CD2 1 
ATOM   3091 C CE1 . HIS D 1 49  ? 17.078  8.924   41.720  1.00 52.58  ? 602 HIS D CE1 1 
ATOM   3092 N NE2 . HIS D 1 49  ? 16.138  9.620   41.108  1.00 42.23  ? 602 HIS D NE2 1 
ATOM   3093 N N   . ILE D 1 50  ? 19.881  14.015  44.543  1.00 30.37  ? 603 ILE D N   1 
ATOM   3094 C CA  . ILE D 1 50  ? 20.225  15.036  45.521  1.00 28.66  ? 603 ILE D CA  1 
ATOM   3095 C C   . ILE D 1 50  ? 21.508  15.821  45.184  1.00 34.55  ? 603 ILE D C   1 
ATOM   3096 O O   . ILE D 1 50  ? 22.603  15.261  45.069  1.00 37.94  ? 603 ILE D O   1 
ATOM   3097 C CB  . ILE D 1 50  ? 20.313  14.423  46.939  1.00 32.46  ? 603 ILE D CB  1 
ATOM   3098 C CG1 . ILE D 1 50  ? 18.971  13.765  47.331  1.00 39.68  ? 603 ILE D CG1 1 
ATOM   3099 C CG2 . ILE D 1 50  ? 20.704  15.499  47.954  1.00 37.58  ? 603 ILE D CG2 1 
ATOM   3100 C CD1 . ILE D 1 50  ? 17.732  14.686  47.176  1.00 44.97  ? 603 ILE D CD1 1 
ATOM   3101 N N   . LYS D 1 51  ? 21.364  17.134  45.071  1.00 36.15  ? 604 LYS D N   1 
ATOM   3102 C CA  . LYS D 1 51  ? 22.485  18.000  44.704  1.00 40.50  ? 604 LYS D CA  1 
ATOM   3103 C C   . LYS D 1 51  ? 23.441  18.256  45.892  1.00 40.99  ? 604 LYS D C   1 
ATOM   3104 O O   . LYS D 1 51  ? 24.671  18.233  45.719  1.00 40.63  ? 604 LYS D O   1 
ATOM   3105 C CB  . LYS D 1 51  ? 21.933  19.326  44.157  1.00 44.93  ? 604 LYS D CB  1 
ATOM   3106 C CG  . LYS D 1 51  ? 22.790  20.039  43.113  1.00 55.06  ? 604 LYS D CG  1 
ATOM   3107 C CD  . LYS D 1 51  ? 21.945  21.048  42.321  1.00 55.95  ? 604 LYS D CD  1 
ATOM   3108 N N   . HIS D 1 52  ? 22.881  18.517  47.085  1.00 39.02  ? 605 HIS D N   1 
ATOM   3109 C CA  . HIS D 1 52  ? 23.682  18.905  48.250  1.00 39.05  ? 605 HIS D CA  1 
ATOM   3110 C C   . HIS D 1 52  ? 23.283  18.098  49.478  1.00 40.01  ? 605 HIS D C   1 
ATOM   3111 O O   . HIS D 1 52  ? 22.410  18.534  50.250  1.00 39.69  ? 605 HIS D O   1 
ATOM   3112 C CB  . HIS D 1 52  ? 23.563  20.407  48.529  1.00 38.76  ? 605 HIS D CB  1 
ATOM   3113 C CG  . HIS D 1 52  ? 24.254  21.275  47.518  1.00 52.45  ? 605 HIS D CG  1 
ATOM   3114 N ND1 . HIS D 1 52  ? 23.599  22.264  46.806  1.00 54.34  ? 605 HIS D ND1 1 
ATOM   3115 C CD2 . HIS D 1 52  ? 25.548  21.309  47.109  1.00 70.47  ? 605 HIS D CD2 1 
ATOM   3116 C CE1 . HIS D 1 52  ? 24.460  22.865  46.002  1.00 74.93  ? 605 HIS D CE1 1 
ATOM   3117 N NE2 . HIS D 1 52  ? 25.648  22.302  46.162  1.00 76.27  ? 605 HIS D NE2 1 
ATOM   3118 N N   . PRO D 1 53  ? 23.923  16.923  49.665  1.00 37.25  ? 606 PRO D N   1 
ATOM   3119 C CA  . PRO D 1 53  ? 23.638  16.062  50.800  1.00 39.90  ? 606 PRO D CA  1 
ATOM   3120 C C   . PRO D 1 53  ? 23.999  16.730  52.116  1.00 37.69  ? 606 PRO D C   1 
ATOM   3121 O O   . PRO D 1 53  ? 25.044  17.370  52.220  1.00 38.22  ? 606 PRO D O   1 
ATOM   3122 C CB  . PRO D 1 53  ? 24.547  14.825  50.573  1.00 26.37  ? 606 PRO D CB  1 
ATOM   3123 C CG  . PRO D 1 53  ? 25.301  15.076  49.375  1.00 41.54  ? 606 PRO D CG  1 
ATOM   3124 C CD  . PRO D 1 53  ? 25.157  16.502  48.990  1.00 41.09  ? 606 PRO D CD  1 
ATOM   3125 N N   . MET D 1 54  ? 23.157  16.546  53.121  1.00 37.05  ? 607 MET D N   1 
ATOM   3126 C CA  . MET D 1 54  ? 23.461  17.029  54.472  1.00 36.46  ? 607 MET D CA  1 
ATOM   3127 C C   . MET D 1 54  ? 23.018  16.040  55.539  1.00 29.28  ? 607 MET D C   1 
ATOM   3128 O O   . MET D 1 54  ? 22.133  15.243  55.316  1.00 33.81  ? 607 MET D O   1 
ATOM   3129 C CB  . MET D 1 54  ? 22.793  18.386  54.685  1.00 35.96  ? 607 MET D CB  1 
ATOM   3130 C CG  . MET D 1 54  ? 23.235  19.154  55.939  1.00 23.90  ? 607 MET D CG  1 
ATOM   3131 S SD  . MET D 1 54  ? 24.978  19.514  56.185  1.00 36.97  ? 607 MET D SD  1 
ATOM   3132 C CE  . MET D 1 54  ? 25.287  20.469  54.682  1.00 30.94  ? 607 MET D CE  1 
ATOM   3133 N N   . ASP D 1 55  ? 23.647  16.117  56.700  1.00 36.02  ? 608 ASP D N   1 
ATOM   3134 C CA  . ASP D 1 55  ? 23.352  15.248  57.848  1.00 37.57  ? 608 ASP D CA  1 
ATOM   3135 C C   . ASP D 1 55  ? 23.855  15.971  59.108  1.00 34.54  ? 608 ASP D C   1 
ATOM   3136 O O   . ASP D 1 55  ? 24.545  16.980  59.010  1.00 32.55  ? 608 ASP D O   1 
ATOM   3137 C CB  . ASP D 1 55  ? 24.084  13.906  57.692  1.00 29.51  ? 608 ASP D CB  1 
ATOM   3138 C CG  . ASP D 1 55  ? 25.591  14.070  57.664  1.00 35.62  ? 608 ASP D CG  1 
ATOM   3139 O OD1 . ASP D 1 55  ? 26.139  14.350  56.561  1.00 47.98  ? 608 ASP D OD1 1 
ATOM   3140 O OD2 . ASP D 1 55  ? 26.225  13.932  58.753  1.00 39.30  ? 608 ASP D OD2 1 
ATOM   3141 N N   . PHE D 1 56  ? 23.582  15.414  60.281  1.00 30.86  ? 609 PHE D N   1 
ATOM   3142 C CA  . PHE D 1 56  ? 23.947  16.100  61.516  1.00 28.67  ? 609 PHE D CA  1 
ATOM   3143 C C   . PHE D 1 56  ? 25.449  16.092  61.812  1.00 32.19  ? 609 PHE D C   1 
ATOM   3144 O O   . PHE D 1 56  ? 25.930  17.048  62.409  1.00 31.31  ? 609 PHE D O   1 
ATOM   3145 C CB  . PHE D 1 56  ? 23.201  15.515  62.707  1.00 27.81  ? 609 PHE D CB  1 
ATOM   3146 C CG  . PHE D 1 56  ? 21.729  15.847  62.736  1.00 23.45  ? 609 PHE D CG  1 
ATOM   3147 C CD1 . PHE D 1 56  ? 21.282  17.135  62.517  1.00 23.19  ? 609 PHE D CD1 1 
ATOM   3148 C CD2 . PHE D 1 56  ? 20.798  14.879  63.007  1.00 32.01  ? 609 PHE D CD2 1 
ATOM   3149 C CE1 . PHE D 1 56  ? 19.931  17.436  62.564  1.00 34.91  ? 609 PHE D CE1 1 
ATOM   3150 C CE2 . PHE D 1 56  ? 19.438  15.199  63.054  1.00 26.75  ? 609 PHE D CE2 1 
ATOM   3151 C CZ  . PHE D 1 56  ? 19.028  16.475  62.844  1.00 23.97  ? 609 PHE D CZ  1 
ATOM   3152 N N   . ALA D 1 57  ? 26.182  15.037  61.439  1.00 28.07  ? 610 ALA D N   1 
ATOM   3153 C CA  . ALA D 1 57  ? 27.643  15.038  61.665  1.00 33.15  ? 610 ALA D CA  1 
ATOM   3154 C C   . ALA D 1 57  ? 28.305  16.159  60.862  1.00 31.55  ? 610 ALA D C   1 
ATOM   3155 O O   . ALA D 1 57  ? 29.140  16.882  61.382  1.00 34.22  ? 610 ALA D O   1 
ATOM   3156 C CB  . ALA D 1 57  ? 28.286  13.668  61.340  1.00 27.04  ? 610 ALA D CB  1 
ATOM   3157 N N   . THR D 1 58  ? 27.883  16.354  59.616  1.00 35.62  ? 611 THR D N   1 
ATOM   3158 C CA  . THR D 1 58  ? 28.453  17.433  58.789  1.00 38.57  ? 611 THR D CA  1 
ATOM   3159 C C   . THR D 1 58  ? 28.113  18.838  59.341  1.00 36.09  ? 611 THR D C   1 
ATOM   3160 O O   . THR D 1 58  ? 28.956  19.732  59.329  1.00 36.93  ? 611 THR D O   1 
ATOM   3161 C CB  . THR D 1 58  ? 28.003  17.302  57.316  1.00 38.30  ? 611 THR D CB  1 
ATOM   3162 O OG1 . THR D 1 58  ? 28.077  15.918  56.909  1.00 31.95  ? 611 THR D OG1 1 
ATOM   3163 C CG2 . THR D 1 58  ? 28.867  18.168  56.421  1.00 35.46  ? 611 THR D CG2 1 
ATOM   3164 N N   . MET D 1 59  ? 26.882  19.009  59.834  1.00 30.63  ? 612 MET D N   1 
ATOM   3165 C CA  . MET D 1 59  ? 26.462  20.237  60.528  1.00 29.77  ? 612 MET D CA  1 
ATOM   3166 C C   . MET D 1 59  ? 27.234  20.427  61.832  1.00 28.61  ? 612 MET D C   1 
ATOM   3167 O O   . MET D 1 59  ? 27.615  21.530  62.177  1.00 34.17  ? 612 MET D O   1 
ATOM   3168 C CB  . MET D 1 59  ? 24.944  20.224  60.850  1.00 28.39  ? 612 MET D CB  1 
ATOM   3169 C CG  . MET D 1 59  ? 24.024  20.577  59.705  1.00 27.92  ? 612 MET D CG  1 
ATOM   3170 S SD  . MET D 1 59  ? 22.278  20.505  60.230  1.00 32.18  ? 612 MET D SD  1 
ATOM   3171 C CE  . MET D 1 59  ? 22.176  21.996  61.239  1.00 25.69  ? 612 MET D CE  1 
ATOM   3172 N N   . ARG D 1 60  ? 27.452  19.352  62.565  1.00 33.15  ? 613 ARG D N   1 
ATOM   3173 C CA  . ARG D 1 60  ? 28.320  19.406  63.765  1.00 37.71  ? 613 ARG D CA  1 
ATOM   3174 C C   . ARG D 1 60  ? 29.704  19.919  63.399  1.00 32.46  ? 613 ARG D C   1 
ATOM   3175 O O   . ARG D 1 60  ? 30.196  20.858  64.019  1.00 31.10  ? 613 ARG D O   1 
ATOM   3176 C CB  . ARG D 1 60  ? 28.365  18.038  64.486  1.00 36.36  ? 613 ARG D CB  1 
ATOM   3177 C CG  . ARG D 1 60  ? 29.456  17.838  65.562  1.00 52.27  ? 613 ARG D CG  1 
ATOM   3178 C CD  . ARG D 1 60  ? 28.922  17.777  66.986  1.00 51.59  ? 613 ARG D CD  1 
ATOM   3179 N NE  . ARG D 1 60  ? 27.620  17.121  67.071  1.00 39.57  ? 613 ARG D NE  1 
ATOM   3180 C CZ  . ARG D 1 60  ? 26.692  17.391  67.992  1.00 47.43  ? 613 ARG D CZ  1 
ATOM   3181 N NH1 . ARG D 1 60  ? 26.918  18.271  68.963  1.00 37.98  ? 613 ARG D NH1 1 
ATOM   3182 N NH2 . ARG D 1 60  ? 25.516  16.776  67.943  1.00 35.66  ? 613 ARG D NH2 1 
ATOM   3183 N N   . LYS D 1 61  ? 30.304  19.333  62.367  1.00 41.08  ? 614 LYS D N   1 
ATOM   3184 C CA  . LYS D 1 61  ? 31.692  19.622  61.980  1.00 35.38  ? 614 LYS D CA  1 
ATOM   3185 C C   . LYS D 1 61  ? 31.874  21.088  61.624  1.00 39.68  ? 614 LYS D C   1 
ATOM   3186 O O   . LYS D 1 61  ? 32.751  21.788  62.156  1.00 46.23  ? 614 LYS D O   1 
ATOM   3187 C CB  . LYS D 1 61  ? 32.082  18.759  60.778  1.00 43.69  ? 614 LYS D CB  1 
ATOM   3188 C CG  . LYS D 1 61  ? 33.573  18.775  60.457  1.00 54.74  ? 614 LYS D CG  1 
ATOM   3189 C CD  . LYS D 1 61  ? 33.890  18.172  59.078  1.00 65.11  ? 614 LYS D CD  1 
ATOM   3190 C CE  . LYS D 1 61  ? 35.111  18.859  58.429  1.00 67.27  ? 614 LYS D CE  1 
ATOM   3191 N NZ  . LYS D 1 61  ? 35.192  18.605  56.958  1.00 79.56  ? 614 LYS D NZ  1 
ATOM   3192 N N   . ARG D 1 62  ? 31.029  21.537  60.713  1.00 34.27  ? 615 ARG D N   1 
ATOM   3193 C CA  . ARG D 1 62  ? 30.959  22.923  60.310  1.00 33.68  ? 615 ARG D CA  1 
ATOM   3194 C C   . ARG D 1 62  ? 30.741  23.882  61.510  1.00 40.98  ? 615 ARG D C   1 
ATOM   3195 O O   . ARG D 1 62  ? 31.307  24.963  61.565  1.00 44.72  ? 615 ARG D O   1 
ATOM   3196 C CB  . ARG D 1 62  ? 29.847  23.038  59.247  1.00 33.15  ? 615 ARG D CB  1 
ATOM   3197 C CG  . ARG D 1 62  ? 29.245  24.411  59.144  1.00 26.98  ? 615 ARG D CG  1 
ATOM   3198 C CD  . ARG D 1 62  ? 28.503  24.637  57.834  1.00 59.45  ? 615 ARG D CD  1 
ATOM   3199 N NE  . ARG D 1 62  ? 28.213  26.065  57.660  1.00 63.90  ? 615 ARG D NE  1 
ATOM   3200 C CZ  . ARG D 1 62  ? 27.279  26.573  56.855  1.00 70.58  ? 615 ARG D CZ  1 
ATOM   3201 N NH1 . ARG D 1 62  ? 27.117  27.894  56.805  1.00 77.03  ? 615 ARG D NH1 1 
ATOM   3202 N NH2 . ARG D 1 62  ? 26.498  25.784  56.115  1.00 62.09  ? 615 ARG D NH2 1 
ATOM   3203 N N   . LEU D 1 63  ? 29.919  23.475  62.470  1.00 46.14  ? 616 LEU D N   1 
ATOM   3204 C CA  . LEU D 1 63  ? 29.652  24.285  63.668  1.00 44.76  ? 616 LEU D CA  1 
ATOM   3205 C C   . LEU D 1 63  ? 30.876  24.375  64.583  1.00 41.25  ? 616 LEU D C   1 
ATOM   3206 O O   . LEU D 1 63  ? 31.138  25.415  65.158  1.00 29.47  ? 616 LEU D O   1 
ATOM   3207 C CB  . LEU D 1 63  ? 28.442  23.698  64.418  1.00 46.14  ? 616 LEU D CB  1 
ATOM   3208 C CG  . LEU D 1 63  ? 28.181  24.014  65.883  1.00 45.41  ? 616 LEU D CG  1 
ATOM   3209 C CD1 . LEU D 1 63  ? 27.915  25.484  66.053  1.00 59.87  ? 616 LEU D CD1 1 
ATOM   3210 C CD2 . LEU D 1 63  ? 27.019  23.171  66.394  1.00 38.16  ? 616 LEU D CD2 1 
ATOM   3211 N N   . GLU D 1 64  ? 31.626  23.290  64.725  1.00 44.68  ? 617 GLU D N   1 
ATOM   3212 C CA  . GLU D 1 64  ? 32.855  23.335  65.534  1.00 54.16  ? 617 GLU D CA  1 
ATOM   3213 C C   . GLU D 1 64  ? 34.042  24.043  64.814  1.00 56.80  ? 617 GLU D C   1 
ATOM   3214 O O   . GLU D 1 64  ? 35.096  24.263  65.417  1.00 59.53  ? 617 GLU D O   1 
ATOM   3215 C CB  . GLU D 1 64  ? 33.257  21.930  66.024  1.00 48.76  ? 617 GLU D CB  1 
ATOM   3216 C CG  . GLU D 1 64  ? 32.197  21.211  66.905  1.00 60.52  ? 617 GLU D CG  1 
ATOM   3217 C CD  . GLU D 1 64  ? 31.830  21.939  68.219  1.00 68.40  ? 617 GLU D CD  1 
ATOM   3218 O OE1 . GLU D 1 64  ? 32.623  22.767  68.704  1.00 72.23  ? 617 GLU D OE1 1 
ATOM   3219 O OE2 . GLU D 1 64  ? 30.740  21.665  68.782  1.00 75.18  ? 617 GLU D OE2 1 
ATOM   3220 N N   . ALA D 1 65  ? 33.861  24.409  63.548  1.00 52.60  ? 618 ALA D N   1 
ATOM   3221 C CA  . ALA D 1 65  ? 34.801  25.293  62.858  1.00 54.57  ? 618 ALA D CA  1 
ATOM   3222 C C   . ALA D 1 65  ? 34.172  26.672  62.634  1.00 52.65  ? 618 ALA D C   1 
ATOM   3223 O O   . ALA D 1 65  ? 34.500  27.357  61.672  1.00 59.64  ? 618 ALA D O   1 
ATOM   3224 C CB  . ALA D 1 65  ? 35.238  24.670  61.517  1.00 44.02  ? 618 ALA D CB  1 
ATOM   3225 N N   . GLN D 1 66  ? 33.267  27.073  63.515  1.00 50.92  ? 619 GLN D N   1 
ATOM   3226 C CA  . GLN D 1 66  ? 32.599  28.395  63.436  1.00 56.25  ? 619 GLN D CA  1 
ATOM   3227 C C   . GLN D 1 66  ? 32.139  28.790  62.023  1.00 48.55  ? 619 GLN D C   1 
ATOM   3228 O O   . GLN D 1 66  ? 32.364  29.913  61.552  1.00 42.63  ? 619 GLN D O   1 
ATOM   3229 C CB  . GLN D 1 66  ? 33.491  29.494  64.047  1.00 63.63  ? 619 GLN D CB  1 
ATOM   3230 C CG  . GLN D 1 66  ? 33.366  29.616  65.580  1.00 68.17  ? 619 GLN D CG  1 
ATOM   3231 C CD  . GLN D 1 66  ? 34.092  28.509  66.329  1.00 82.09  ? 619 GLN D CD  1 
ATOM   3232 O OE1 . GLN D 1 66  ? 35.209  28.121  65.961  1.00 79.73  ? 619 GLN D OE1 1 
ATOM   3233 N NE2 . GLN D 1 66  ? 33.465  27.997  67.391  1.00 68.14  ? 619 GLN D NE2 1 
ATOM   3234 N N   . GLY D 1 67  ? 31.490  27.849  61.357  1.00 39.56  ? 620 GLY D N   1 
ATOM   3235 C CA  . GLY D 1 67  ? 31.060  28.031  59.972  1.00 42.91  ? 620 GLY D CA  1 
ATOM   3236 C C   . GLY D 1 67  ? 29.625  28.513  59.780  1.00 41.05  ? 620 GLY D C   1 
ATOM   3237 O O   . GLY D 1 67  ? 29.175  28.665  58.636  1.00 44.72  ? 620 GLY D O   1 
ATOM   3238 N N   . TYR D 1 68  ? 28.904  28.723  60.879  1.00 35.39  ? 621 TYR D N   1 
ATOM   3239 C CA  . TYR D 1 68  ? 27.543  29.244  60.832  1.00 37.78  ? 621 TYR D CA  1 
ATOM   3240 C C   . TYR D 1 68  ? 27.649  30.618  61.422  1.00 35.83  ? 621 TYR D C   1 
ATOM   3241 O O   . TYR D 1 68  ? 27.983  30.771  62.584  1.00 35.87  ? 621 TYR D O   1 
ATOM   3242 C CB  . TYR D 1 68  ? 26.556  28.402  61.663  1.00 35.29  ? 621 TYR D CB  1 
ATOM   3243 C CG  . TYR D 1 68  ? 26.326  27.016  61.129  1.00 34.13  ? 621 TYR D CG  1 
ATOM   3244 C CD1 . TYR D 1 68  ? 25.546  26.800  60.010  1.00 41.73  ? 621 TYR D CD1 1 
ATOM   3245 C CD2 . TYR D 1 68  ? 26.876  25.916  61.765  1.00 45.57  ? 621 TYR D CD2 1 
ATOM   3246 C CE1 . TYR D 1 68  ? 25.337  25.514  59.519  1.00 38.88  ? 621 TYR D CE1 1 
ATOM   3247 C CE2 . TYR D 1 68  ? 26.671  24.632  61.288  1.00 39.91  ? 621 TYR D CE2 1 
ATOM   3248 C CZ  . TYR D 1 68  ? 25.908  24.434  60.172  1.00 20.44  ? 621 TYR D CZ  1 
ATOM   3249 O OH  . TYR D 1 68  ? 25.732  23.154  59.696  1.00 33.05  ? 621 TYR D OH  1 
ATOM   3250 N N   . LYS D 1 69  ? 27.381  31.631  60.623  1.00 39.31  ? 622 LYS D N   1 
ATOM   3251 C CA  . LYS D 1 69  ? 27.574  32.974  61.103  1.00 37.79  ? 622 LYS D CA  1 
ATOM   3252 C C   . LYS D 1 69  ? 26.263  33.506  61.658  1.00 38.99  ? 622 LYS D C   1 
ATOM   3253 O O   . LYS D 1 69  ? 26.240  34.563  62.254  1.00 39.43  ? 622 LYS D O   1 
ATOM   3254 C CB  . LYS D 1 69  ? 28.224  33.837  60.019  1.00 49.16  ? 622 LYS D CB  1 
ATOM   3255 C CG  . LYS D 1 69  ? 29.727  33.461  59.820  1.00 57.55  ? 622 LYS D CG  1 
ATOM   3256 C CD  . LYS D 1 69  ? 30.334  33.977  58.513  1.00 73.12  ? 622 LYS D CD  1 
ATOM   3257 C CE  . LYS D 1 69  ? 29.977  33.096  57.305  1.00 79.03  ? 622 LYS D CE  1 
ATOM   3258 N NZ  . LYS D 1 69  ? 30.262  33.787  56.000  1.00 43.44  ? 622 LYS D NZ  1 
ATOM   3259 N N   . ASN D 1 70  ? 25.181  32.739  61.518  1.00 37.41  ? 623 ASN D N   1 
ATOM   3260 C CA  . ASN D 1 70  ? 23.941  33.023  62.254  1.00 39.88  ? 623 ASN D CA  1 
ATOM   3261 C C   . ASN D 1 70  ? 22.929  31.840  62.288  1.00 40.98  ? 623 ASN D C   1 
ATOM   3262 O O   . ASN D 1 70  ? 23.094  30.824  61.602  1.00 40.26  ? 623 ASN D O   1 
ATOM   3263 C CB  . ASN D 1 70  ? 23.269  34.275  61.693  1.00 35.12  ? 623 ASN D CB  1 
ATOM   3264 C CG  . ASN D 1 70  ? 22.901  34.127  60.251  1.00 38.15  ? 623 ASN D CG  1 
ATOM   3265 O OD1 . ASN D 1 70  ? 22.126  33.251  59.883  1.00 37.67  ? 623 ASN D OD1 1 
ATOM   3266 N ND2 . ASN D 1 70  ? 23.421  35.013  59.419  1.00 40.18  ? 623 ASN D ND2 1 
ATOM   3267 N N   . LEU D 1 71  ? 21.869  32.012  63.065  1.00 36.72  ? 624 LEU D N   1 
ATOM   3268 C CA  . LEU D 1 71  ? 20.840  30.990  63.212  1.00 37.13  ? 624 LEU D CA  1 
ATOM   3269 C C   . LEU D 1 71  ? 20.236  30.549  61.878  1.00 32.66  ? 624 LEU D C   1 
ATOM   3270 O O   . LEU D 1 71  ? 19.982  29.366  61.665  1.00 35.42  ? 624 LEU D O   1 
ATOM   3271 C CB  . LEU D 1 71  ? 19.718  31.474  64.161  1.00 30.47  ? 624 LEU D CB  1 
ATOM   3272 C CG  . LEU D 1 71  ? 18.670  30.408  64.561  1.00 32.15  ? 624 LEU D CG  1 
ATOM   3273 C CD1 . LEU D 1 71  ? 19.277  29.016  64.873  1.00 18.83  ? 624 LEU D CD1 1 
ATOM   3274 C CD2 . LEU D 1 71  ? 17.818  30.900  65.733  1.00 30.51  ? 624 LEU D CD2 1 
ATOM   3275 N N   . HIS D 1 72  ? 19.970  31.506  61.005  1.00 35.00  ? 625 HIS D N   1 
ATOM   3276 C CA  . HIS D 1 72  ? 19.367  31.216  59.740  1.00 30.74  ? 625 HIS D CA  1 
ATOM   3277 C C   . HIS D 1 72  ? 20.257  30.293  58.882  1.00 33.18  ? 625 HIS D C   1 
ATOM   3278 O O   . HIS D 1 72  ? 19.762  29.437  58.178  1.00 25.92  ? 625 HIS D O   1 
ATOM   3279 C CB  . HIS D 1 72  ? 19.102  32.517  58.994  1.00 40.05  ? 625 HIS D CB  1 
ATOM   3280 C CG  . HIS D 1 72  ? 18.356  32.328  57.706  1.00 54.92  ? 625 HIS D CG  1 
ATOM   3281 N ND1 . HIS D 1 72  ? 17.033  31.943  57.663  1.00 72.03  ? 625 HIS D ND1 1 
ATOM   3282 C CD2 . HIS D 1 72  ? 18.751  32.460  56.416  1.00 62.44  ? 625 HIS D CD2 1 
ATOM   3283 C CE1 . HIS D 1 72  ? 16.643  31.854  56.402  1.00 64.62  ? 625 HIS D CE1 1 
ATOM   3284 N NE2 . HIS D 1 72  ? 17.665  32.165  55.626  1.00 47.19  ? 625 HIS D NE2 1 
ATOM   3285 N N   . GLU D 1 73  ? 21.576  30.446  58.957  1.00 34.17  ? 626 GLU D N   1 
ATOM   3286 C CA  . GLU D 1 73  ? 22.461  29.607  58.148  1.00 34.33  ? 626 GLU D CA  1 
ATOM   3287 C C   . GLU D 1 73  ? 22.377  28.160  58.628  1.00 32.99  ? 626 GLU D C   1 
ATOM   3288 O O   . GLU D 1 73  ? 22.373  27.198  57.824  1.00 29.75  ? 626 GLU D O   1 
ATOM   3289 C CB  . GLU D 1 73  ? 23.907  30.141  58.183  1.00 38.65  ? 626 GLU D CB  1 
ATOM   3290 C CG  . GLU D 1 73  ? 24.075  31.473  57.405  1.00 56.18  ? 626 GLU D CG  1 
ATOM   3291 C CD  . GLU D 1 73  ? 25.438  32.165  57.576  1.00 66.80  ? 626 GLU D CD  1 
ATOM   3292 O OE1 . GLU D 1 73  ? 26.421  31.537  58.036  1.00 50.30  ? 626 GLU D OE1 1 
ATOM   3293 O OE2 . GLU D 1 73  ? 25.508  33.366  57.239  1.00 53.82  ? 626 GLU D OE2 1 
ATOM   3294 N N   . PHE D 1 74  ? 22.330  28.009  59.944  1.00 24.16  ? 627 PHE D N   1 
ATOM   3295 C CA  . PHE D 1 74  ? 22.125  26.705  60.564  1.00 27.47  ? 627 PHE D CA  1 
ATOM   3296 C C   . PHE D 1 74  ? 20.776  26.131  60.107  1.00 26.20  ? 627 PHE D C   1 
ATOM   3297 O O   . PHE D 1 74  ? 20.719  24.989  59.695  1.00 29.47  ? 627 PHE D O   1 
ATOM   3298 C CB  . PHE D 1 74  ? 22.165  26.884  62.052  1.00 22.57  ? 627 PHE D CB  1 
ATOM   3299 C CG  . PHE D 1 74  ? 22.008  25.634  62.831  1.00 22.19  ? 627 PHE D CG  1 
ATOM   3300 C CD1 . PHE D 1 74  ? 20.749  25.143  63.146  1.00 17.92  ? 627 PHE D CD1 1 
ATOM   3301 C CD2 . PHE D 1 74  ? 23.119  24.995  63.364  1.00 25.44  ? 627 PHE D CD2 1 
ATOM   3302 C CE1 . PHE D 1 74  ? 20.599  24.030  63.868  1.00 19.85  ? 627 PHE D CE1 1 
ATOM   3303 C CE2 . PHE D 1 74  ? 22.945  23.868  64.153  1.00 19.55  ? 627 PHE D CE2 1 
ATOM   3304 C CZ  . PHE D 1 74  ? 21.696  23.381  64.389  1.00 29.99  ? 627 PHE D CZ  1 
ATOM   3305 N N   . GLU D 1 75  ? 19.716  26.940  60.153  1.00 27.11  ? 628 GLU D N   1 
ATOM   3306 C CA  . GLU D 1 75  ? 18.375  26.462  59.781  1.00 34.75  ? 628 GLU D CA  1 
ATOM   3307 C C   . GLU D 1 75  ? 18.385  25.966  58.358  1.00 32.21  ? 628 GLU D C   1 
ATOM   3308 O O   . GLU D 1 75  ? 17.670  25.014  58.020  1.00 32.30  ? 628 GLU D O   1 
ATOM   3309 C CB  . GLU D 1 75  ? 17.324  27.569  59.808  1.00 27.68  ? 628 GLU D CB  1 
ATOM   3310 C CG  . GLU D 1 75  ? 16.777  27.973  61.121  1.00 47.81  ? 628 GLU D CG  1 
ATOM   3311 C CD  . GLU D 1 75  ? 15.879  29.213  60.995  1.00 64.94  ? 628 GLU D CD  1 
ATOM   3312 O OE1 . GLU D 1 75  ? 15.459  29.532  59.850  1.00 52.67  ? 628 GLU D OE1 1 
ATOM   3313 O OE2 . GLU D 1 75  ? 15.616  29.874  62.033  1.00 61.25  ? 628 GLU D OE2 1 
ATOM   3314 N N   . GLU D 1 76  ? 19.156  26.656  57.505  1.00 38.48  ? 629 GLU D N   1 
ATOM   3315 C CA  . GLU D 1 76  ? 19.272  26.282  56.077  1.00 36.87  ? 629 GLU D CA  1 
ATOM   3316 C C   . GLU D 1 76  ? 19.819  24.870  55.903  1.00 26.58  ? 629 GLU D C   1 
ATOM   3317 O O   . GLU D 1 76  ? 19.432  24.152  54.988  1.00 31.68  ? 629 GLU D O   1 
ATOM   3318 C CB  . GLU D 1 76  ? 20.158  27.269  55.288  1.00 34.72  ? 629 GLU D CB  1 
ATOM   3319 C CG  . GLU D 1 76  ? 19.589  28.686  55.199  1.00 53.44  ? 629 GLU D CG  1 
ATOM   3320 C CD  . GLU D 1 76  ? 20.055  29.473  53.980  1.00 64.76  ? 629 GLU D CD  1 
ATOM   3321 O OE1 . GLU D 1 76  ? 19.272  30.343  53.528  1.00 69.37  ? 629 GLU D OE1 1 
ATOM   3322 O OE2 . GLU D 1 76  ? 21.181  29.233  53.474  1.00 62.91  ? 629 GLU D OE2 1 
ATOM   3323 N N   . ASP D 1 77  ? 20.760  24.484  56.748  1.00 25.19  ? 630 ASP D N   1 
ATOM   3324 C CA  . ASP D 1 77  ? 21.301  23.146  56.631  1.00 29.21  ? 630 ASP D CA  1 
ATOM   3325 C C   . ASP D 1 77  ? 20.256  22.129  57.087  1.00 30.11  ? 630 ASP D C   1 
ATOM   3326 O O   . ASP D 1 77  ? 20.047  21.104  56.419  1.00 28.53  ? 630 ASP D O   1 
ATOM   3327 C CB  . ASP D 1 77  ? 22.574  22.995  57.435  1.00 24.38  ? 630 ASP D CB  1 
ATOM   3328 C CG  . ASP D 1 77  ? 23.842  23.360  56.623  1.00 51.45  ? 630 ASP D CG  1 
ATOM   3329 O OD1 . ASP D 1 77  ? 23.711  23.669  55.424  1.00 51.26  ? 630 ASP D OD1 1 
ATOM   3330 O OD2 . ASP D 1 77  ? 24.969  23.312  57.187  1.00 36.25  ? 630 ASP D OD2 1 
ATOM   3331 N N   . PHE D 1 78  ? 19.554  22.448  58.175  1.00 23.23  ? 631 PHE D N   1 
ATOM   3332 C CA  . PHE D 1 78  ? 18.579  21.535  58.706  1.00 26.05  ? 631 PHE D CA  1 
ATOM   3333 C C   . PHE D 1 78  ? 17.507  21.265  57.679  1.00 27.26  ? 631 PHE D C   1 
ATOM   3334 O O   . PHE D 1 78  ? 17.106  20.121  57.487  1.00 34.68  ? 631 PHE D O   1 
ATOM   3335 C CB  . PHE D 1 78  ? 17.949  22.088  59.991  1.00 26.48  ? 631 PHE D CB  1 
ATOM   3336 C CG  . PHE D 1 78  ? 16.848  21.233  60.526  1.00 19.33  ? 631 PHE D CG  1 
ATOM   3337 C CD1 . PHE D 1 78  ? 17.130  20.015  61.138  1.00 12.64  ? 631 PHE D CD1 1 
ATOM   3338 C CD2 . PHE D 1 78  ? 15.527  21.624  60.402  1.00 16.01  ? 631 PHE D CD2 1 
ATOM   3339 C CE1 . PHE D 1 78  ? 16.150  19.225  61.619  1.00 22.57  ? 631 PHE D CE1 1 
ATOM   3340 C CE2 . PHE D 1 78  ? 14.543  20.860  60.920  1.00 32.46  ? 631 PHE D CE2 1 
ATOM   3341 C CZ  . PHE D 1 78  ? 14.830  19.654  61.513  1.00 19.70  ? 631 PHE D CZ  1 
ATOM   3342 N N   . ASP D 1 79  ? 17.030  22.315  57.024  1.00 25.66  ? 632 ASP D N   1 
ATOM   3343 C CA  . ASP D 1 79  ? 16.007  22.154  55.985  1.00 32.09  ? 632 ASP D CA  1 
ATOM   3344 C C   . ASP D 1 79  ? 16.535  21.274  54.862  1.00 30.55  ? 632 ASP D C   1 
ATOM   3345 O O   . ASP D 1 79  ? 15.804  20.457  54.316  1.00 29.24  ? 632 ASP D O   1 
ATOM   3346 C CB  . ASP D 1 79  ? 15.643  23.519  55.388  1.00 35.59  ? 632 ASP D CB  1 
ATOM   3347 C CG  . ASP D 1 79  ? 14.954  24.394  56.364  1.00 42.13  ? 632 ASP D CG  1 
ATOM   3348 O OD1 . ASP D 1 79  ? 14.291  23.820  57.245  1.00 39.14  ? 632 ASP D OD1 1 
ATOM   3349 O OD2 . ASP D 1 79  ? 15.069  25.637  56.252  1.00 45.36  ? 632 ASP D OD2 1 
ATOM   3350 N N   . LEU D 1 80  ? 17.811  21.459  54.517  1.00 21.04  ? 633 LEU D N   1 
ATOM   3351 C CA  . LEU D 1 80  ? 18.452  20.628  53.496  1.00 33.31  ? 633 LEU D CA  1 
ATOM   3352 C C   . LEU D 1 80  ? 18.297  19.159  53.888  1.00 33.03  ? 633 LEU D C   1 
ATOM   3353 O O   . LEU D 1 80  ? 17.914  18.344  53.060  1.00 44.05  ? 633 LEU D O   1 
ATOM   3354 C CB  . LEU D 1 80  ? 19.929  21.043  53.303  1.00 32.29  ? 633 LEU D CB  1 
ATOM   3355 C CG  . LEU D 1 80  ? 20.769  20.720  52.082  1.00 46.42  ? 633 LEU D CG  1 
ATOM   3356 C CD1 . LEU D 1 80  ? 19.980  20.887  50.782  1.00 54.88  ? 633 LEU D CD1 1 
ATOM   3357 C CD2 . LEU D 1 80  ? 22.048  21.616  52.092  1.00 39.45  ? 633 LEU D CD2 1 
ATOM   3358 N N   . ILE D 1 81  ? 18.539  18.822  55.149  1.00 28.46  ? 634 ILE D N   1 
ATOM   3359 C CA  . ILE D 1 81  ? 18.382  17.430  55.593  1.00 29.22  ? 634 ILE D CA  1 
ATOM   3360 C C   . ILE D 1 81  ? 16.948  16.977  55.367  1.00 25.91  ? 634 ILE D C   1 
ATOM   3361 O O   . ILE D 1 81  ? 16.696  15.912  54.809  1.00 30.52  ? 634 ILE D O   1 
ATOM   3362 C CB  . ILE D 1 81  ? 18.725  17.225  57.080  1.00 27.80  ? 634 ILE D CB  1 
ATOM   3363 C CG1 . ILE D 1 81  ? 20.238  17.474  57.313  1.00 29.00  ? 634 ILE D CG1 1 
ATOM   3364 C CG2 . ILE D 1 81  ? 18.303  15.779  57.529  1.00 21.63  ? 634 ILE D CG2 1 
ATOM   3365 C CD1 . ILE D 1 81  ? 20.660  17.682  58.822  1.00 22.01  ? 634 ILE D CD1 1 
ATOM   3366 N N   . ILE D 1 82  ? 16.008  17.800  55.765  1.00 22.05  ? 635 ILE D N   1 
ATOM   3367 C CA  . ILE D 1 82  ? 14.610  17.414  55.615  1.00 28.60  ? 635 ILE D CA  1 
ATOM   3368 C C   . ILE D 1 82  ? 14.322  17.233  54.142  1.00 25.43  ? 635 ILE D C   1 
ATOM   3369 O O   . ILE D 1 82  ? 13.881  16.155  53.731  1.00 21.42  ? 635 ILE D O   1 
ATOM   3370 C CB  . ILE D 1 82  ? 13.609  18.418  56.252  1.00 25.57  ? 635 ILE D CB  1 
ATOM   3371 C CG1 . ILE D 1 82  ? 13.933  18.644  57.730  1.00 24.69  ? 635 ILE D CG1 1 
ATOM   3372 C CG2 . ILE D 1 82  ? 12.158  17.924  56.062  1.00 18.54  ? 635 ILE D CG2 1 
ATOM   3373 C CD1 . ILE D 1 82  ? 13.972  17.374  58.576  1.00 34.13  ? 635 ILE D CD1 1 
ATOM   3374 N N   . ASP D 1 83  ? 14.616  18.260  53.348  1.00 31.91  ? 636 ASP D N   1 
ATOM   3375 C CA  . ASP D 1 83  ? 14.228  18.261  51.925  1.00 36.20  ? 636 ASP D CA  1 
ATOM   3376 C C   . ASP D 1 83  ? 14.904  17.144  51.103  1.00 30.41  ? 636 ASP D C   1 
ATOM   3377 O O   . ASP D 1 83  ? 14.228  16.410  50.382  1.00 36.03  ? 636 ASP D O   1 
ATOM   3378 C CB  . ASP D 1 83  ? 14.435  19.648  51.284  1.00 30.82  ? 636 ASP D CB  1 
ATOM   3379 C CG  . ASP D 1 83  ? 13.442  20.709  51.829  1.00 54.82  ? 636 ASP D CG  1 
ATOM   3380 O OD1 . ASP D 1 83  ? 12.298  20.338  52.176  1.00 59.91  ? 636 ASP D OD1 1 
ATOM   3381 O OD2 . ASP D 1 83  ? 13.793  21.916  51.902  1.00 34.88  ? 636 ASP D OD2 1 
ATOM   3382 N N   . ASN D 1 84  ? 16.210  16.981  51.236  1.00 26.05  ? 637 ASN D N   1 
ATOM   3383 C CA  . ASN D 1 84  ? 16.883  15.879  50.547  1.00 28.26  ? 637 ASN D CA  1 
ATOM   3384 C C   . ASN D 1 84  ? 16.100  14.591  50.793  1.00 23.74  ? 637 ASN D C   1 
ATOM   3385 O O   . ASN D 1 84  ? 15.815  13.833  49.859  1.00 29.98  ? 637 ASN D O   1 
ATOM   3386 C CB  . ASN D 1 84  ? 18.340  15.687  51.017  1.00 27.00  ? 637 ASN D CB  1 
ATOM   3387 C CG  . ASN D 1 84  ? 19.239  16.796  50.613  1.00 32.72  ? 637 ASN D CG  1 
ATOM   3388 O OD1 . ASN D 1 84  ? 18.880  17.648  49.804  1.00 28.98  ? 637 ASN D OD1 1 
ATOM   3389 N ND2 . ASN D 1 84  ? 20.444  16.816  51.200  1.00 25.83  ? 637 ASN D ND2 1 
ATOM   3390 N N   . CYS D 1 85  ? 15.725  14.356  52.046  1.00 30.44  ? 638 CYS D N   1 
ATOM   3391 C CA  . CYS D 1 85  ? 15.021  13.118  52.415  1.00 29.88  ? 638 CYS D CA  1 
ATOM   3392 C C   . CYS D 1 85  ? 13.625  13.060  51.842  1.00 34.32  ? 638 CYS D C   1 
ATOM   3393 O O   . CYS D 1 85  ? 13.195  12.017  51.344  1.00 29.05  ? 638 CYS D O   1 
ATOM   3394 C CB  . CYS D 1 85  ? 14.944  12.980  53.927  1.00 32.35  ? 638 CYS D CB  1 
ATOM   3395 S SG  . CYS D 1 85  ? 14.258  11.432  54.460  1.00 32.36  ? 638 CYS D SG  1 
ATOM   3396 N N   . MET D 1 86  ? 12.930  14.190  51.879  1.00 31.67  ? 639 MET D N   1 
ATOM   3397 C CA  . MET D 1 86  ? 11.582  14.268  51.320  1.00 36.04  ? 639 MET D CA  1 
ATOM   3398 C C   . MET D 1 86  ? 11.595  14.157  49.777  1.00 40.83  ? 639 MET D C   1 
ATOM   3399 O O   . MET D 1 86  ? 10.588  13.802  49.163  1.00 44.73  ? 639 MET D O   1 
ATOM   3400 C CB  . MET D 1 86  ? 10.876  15.560  51.765  1.00 36.82  ? 639 MET D CB  1 
ATOM   3401 C CG  . MET D 1 86  ? 10.544  15.641  53.301  1.00 46.00  ? 639 MET D CG  1 
ATOM   3402 S SD  . MET D 1 86  ? 9.197   16.826  53.676  1.00 36.21  ? 639 MET D SD  1 
ATOM   3403 C CE  . MET D 1 86  ? 9.797   18.232  52.705  1.00 49.66  ? 639 MET D CE  1 
ATOM   3404 N N   . LYS D 1 87  ? 12.736  14.439  49.164  1.00 40.34  ? 640 LYS D N   1 
ATOM   3405 C CA  . LYS D 1 87  ? 12.876  14.369  47.715  1.00 42.59  ? 640 LYS D CA  1 
ATOM   3406 C C   . LYS D 1 87  ? 13.322  12.962  47.314  1.00 37.54  ? 640 LYS D C   1 
ATOM   3407 O O   . LYS D 1 87  ? 12.828  12.428  46.366  1.00 33.35  ? 640 LYS D O   1 
ATOM   3408 C CB  . LYS D 1 87  ? 13.883  15.422  47.214  1.00 42.39  ? 640 LYS D CB  1 
ATOM   3409 C CG  . LYS D 1 87  ? 14.291  15.321  45.724  1.00 57.17  ? 640 LYS D CG  1 
ATOM   3410 C CD  . LYS D 1 87  ? 13.903  16.557  44.920  1.00 70.21  ? 640 LYS D CD  1 
ATOM   3411 C CE  . LYS D 1 87  ? 14.642  16.636  43.581  1.00 75.67  ? 640 LYS D CE  1 
ATOM   3412 N NZ  . LYS D 1 87  ? 16.111  16.880  43.729  1.00 67.71  ? 640 LYS D NZ  1 
ATOM   3413 N N   . TYR D 1 88  ? 14.282  12.364  48.007  1.00 41.15  ? 641 TYR D N   1 
ATOM   3414 C CA  . TYR D 1 88  ? 14.700  11.036  47.608  1.00 32.09  ? 641 TYR D CA  1 
ATOM   3415 C C   . TYR D 1 88  ? 13.559  10.072  47.725  1.00 37.69  ? 641 TYR D C   1 
ATOM   3416 O O   . TYR D 1 88  ? 13.319  9.347   46.790  1.00 40.65  ? 641 TYR D O   1 
ATOM   3417 C CB  . TYR D 1 88  ? 15.869  10.503  48.415  1.00 38.29  ? 641 TYR D CB  1 
ATOM   3418 C CG  . TYR D 1 88  ? 16.446  9.261   47.787  1.00 30.36  ? 641 TYR D CG  1 
ATOM   3419 C CD1 . TYR D 1 88  ? 17.217  9.339   46.642  1.00 35.23  ? 641 TYR D CD1 1 
ATOM   3420 C CD2 . TYR D 1 88  ? 16.183  7.995   48.319  1.00 48.40  ? 641 TYR D CD2 1 
ATOM   3421 C CE1 . TYR D 1 88  ? 17.744  8.185   46.038  1.00 48.37  ? 641 TYR D CE1 1 
ATOM   3422 C CE2 . TYR D 1 88  ? 16.690  6.839   47.724  1.00 34.99  ? 641 TYR D CE2 1 
ATOM   3423 C CZ  . TYR D 1 88  ? 17.474  6.944   46.589  1.00 33.96  ? 641 TYR D CZ  1 
ATOM   3424 O OH  . TYR D 1 88  ? 17.963  5.835   45.978  1.00 31.25  ? 641 TYR D OH  1 
ATOM   3425 N N   . ASN D 1 89  ? 12.848  10.074  48.858  1.00 37.18  ? 642 ASN D N   1 
ATOM   3426 C CA  . ASN D 1 89  ? 11.931  8.974   49.207  1.00 35.60  ? 642 ASN D CA  1 
ATOM   3427 C C   . ASN D 1 89  ? 10.462  9.233   48.889  1.00 36.16  ? 642 ASN D C   1 
ATOM   3428 O O   . ASN D 1 89  ? 9.986   10.333  48.994  1.00 35.20  ? 642 ASN D O   1 
ATOM   3429 C CB  . ASN D 1 89  ? 12.073  8.643   50.695  1.00 36.31  ? 642 ASN D CB  1 
ATOM   3430 C CG  . ASN D 1 89  ? 13.513  8.316   51.078  1.00 42.18  ? 642 ASN D CG  1 
ATOM   3431 O OD1 . ASN D 1 89  ? 14.011  7.252   50.755  1.00 30.95  ? 642 ASN D OD1 1 
ATOM   3432 N ND2 . ASN D 1 89  ? 14.189  9.246   51.750  1.00 46.75  ? 642 ASN D ND2 1 
ATOM   3433 N N   . ALA D 1 90  ? 9.739   8.189   48.516  1.00 37.48  ? 643 ALA D N   1 
ATOM   3434 C CA  . ALA D 1 90  ? 8.314   8.315   48.271  1.00 35.83  ? 643 ALA D CA  1 
ATOM   3435 C C   . ALA D 1 90  ? 7.503   8.646   49.554  1.00 38.26  ? 643 ALA D C   1 
ATOM   3436 O O   . ALA D 1 90  ? 7.964   8.440   50.672  1.00 43.11  ? 643 ALA D O   1 
ATOM   3437 C CB  . ALA D 1 90  ? 7.816   7.062   47.621  1.00 39.15  ? 643 ALA D CB  1 
ATOM   3438 N N   . ARG D 1 91  ? 6.296   9.160   49.360  1.00 39.81  ? 644 ARG D N   1 
ATOM   3439 C CA  . ARG D 1 91  ? 5.415   9.631   50.430  1.00 48.88  ? 644 ARG D CA  1 
ATOM   3440 C C   . ARG D 1 91  ? 5.097   8.569   51.469  1.00 48.43  ? 644 ARG D C   1 
ATOM   3441 O O   . ARG D 1 91  ? 5.066   8.858   52.654  1.00 46.51  ? 644 ARG D O   1 
ATOM   3442 C CB  . ARG D 1 91  ? 4.092   10.113  49.831  1.00 51.97  ? 644 ARG D CB  1 
ATOM   3443 C CG  . ARG D 1 91  ? 3.148   10.782  50.839  1.00 67.61  ? 644 ARG D CG  1 
ATOM   3444 C CD  . ARG D 1 91  ? 3.334   12.269  50.823  1.00 81.83  ? 644 ARG D CD  1 
ATOM   3445 N NE  . ARG D 1 91  ? 2.810   12.831  49.582  1.00 84.87  ? 644 ARG D NE  1 
ATOM   3446 C CZ  . ARG D 1 91  ? 1.698   13.554  49.471  1.00 82.05  ? 644 ARG D CZ  1 
ATOM   3447 N NH1 . ARG D 1 91  ? 0.955   13.860  50.527  1.00 83.55  ? 644 ARG D NH1 1 
ATOM   3448 N NH2 . ARG D 1 91  ? 1.329   13.988  48.275  1.00 100.04 ? 644 ARG D NH2 1 
ATOM   3449 N N   . ASP D 1 92  ? 4.848   7.346   51.009  1.00 57.28  ? 645 ASP D N   1 
ATOM   3450 C CA  . ASP D 1 92  ? 4.459   6.223   51.881  1.00 60.81  ? 645 ASP D CA  1 
ATOM   3451 C C   . ASP D 1 92  ? 5.664   5.412   52.401  1.00 57.44  ? 645 ASP D C   1 
ATOM   3452 O O   . ASP D 1 92  ? 5.607   4.172   52.434  1.00 59.80  ? 645 ASP D O   1 
ATOM   3453 C CB  . ASP D 1 92  ? 3.489   5.295   51.119  1.00 57.28  ? 645 ASP D CB  1 
ATOM   3454 C CG  . ASP D 1 92  ? 3.053   4.068   51.941  1.00 67.43  ? 645 ASP D CG  1 
ATOM   3455 O OD1 . ASP D 1 92  ? 2.911   4.170   53.181  1.00 54.18  ? 645 ASP D OD1 1 
ATOM   3456 O OD2 . ASP D 1 92  ? 2.856   2.989   51.335  1.00 71.82  ? 645 ASP D OD2 1 
ATOM   3457 N N   . THR D 1 93  ? 6.740   6.087   52.815  1.00 49.75  ? 646 THR D N   1 
ATOM   3458 C CA  . THR D 1 93  ? 7.913   5.374   53.347  1.00 41.30  ? 646 THR D CA  1 
ATOM   3459 C C   . THR D 1 93  ? 8.263   5.841   54.737  1.00 43.72  ? 646 THR D C   1 
ATOM   3460 O O   . THR D 1 93  ? 7.948   6.968   55.116  1.00 45.51  ? 646 THR D O   1 
ATOM   3461 C CB  . THR D 1 93  ? 9.168   5.557   52.490  1.00 42.53  ? 646 THR D CB  1 
ATOM   3462 O OG1 . THR D 1 93  ? 9.429   6.956   52.318  1.00 32.18  ? 646 THR D OG1 1 
ATOM   3463 C CG2 . THR D 1 93  ? 9.020   4.854   51.101  1.00 42.99  ? 646 THR D CG2 1 
ATOM   3464 N N   . VAL D 1 94  ? 8.949   4.962   55.473  1.00 36.67  ? 647 VAL D N   1 
ATOM   3465 C CA  . VAL D 1 94  ? 9.356   5.200   56.850  1.00 33.81  ? 647 VAL D CA  1 
ATOM   3466 C C   . VAL D 1 94  ? 10.166  6.485   56.933  1.00 32.51  ? 647 VAL D C   1 
ATOM   3467 O O   . VAL D 1 94  ? 9.930   7.336   57.788  1.00 35.60  ? 647 VAL D O   1 
ATOM   3468 C CB  . VAL D 1 94  ? 10.207  4.013   57.372  1.00 39.83  ? 647 VAL D CB  1 
ATOM   3469 C CG1 . VAL D 1 94  ? 10.654  4.271   58.810  1.00 38.70  ? 647 VAL D CG1 1 
ATOM   3470 C CG2 . VAL D 1 94  ? 9.414   2.680   57.285  1.00 35.07  ? 647 VAL D CG2 1 
ATOM   3471 N N   . PHE D 1 95  ? 11.127  6.594   56.023  1.00 30.08  ? 648 PHE D N   1 
ATOM   3472 C CA  . PHE D 1 95  ? 12.018  7.735   55.926  1.00 32.46  ? 648 PHE D CA  1 
ATOM   3473 C C   . PHE D 1 95  ? 11.337  9.058   55.540  1.00 33.14  ? 648 PHE D C   1 
ATOM   3474 O O   . PHE D 1 95  ? 11.717  10.107  56.074  1.00 30.68  ? 648 PHE D O   1 
ATOM   3475 C CB  . PHE D 1 95  ? 13.148  7.422   54.949  1.00 31.75  ? 648 PHE D CB  1 
ATOM   3476 C CG  . PHE D 1 95  ? 14.229  6.516   55.519  1.00 25.25  ? 648 PHE D CG  1 
ATOM   3477 C CD1 . PHE D 1 95  ? 14.012  5.751   56.653  1.00 30.63  ? 648 PHE D CD1 1 
ATOM   3478 C CD2 . PHE D 1 95  ? 15.454  6.414   54.868  1.00 46.54  ? 648 PHE D CD2 1 
ATOM   3479 C CE1 . PHE D 1 95  ? 15.028  4.901   57.153  1.00 43.92  ? 648 PHE D CE1 1 
ATOM   3480 C CE2 . PHE D 1 95  ? 16.480  5.583   55.353  1.00 42.67  ? 648 PHE D CE2 1 
ATOM   3481 C CZ  . PHE D 1 95  ? 16.270  4.829   56.494  1.00 38.26  ? 648 PHE D CZ  1 
ATOM   3482 N N   . TYR D 1 96  ? 10.360  9.040   54.634  1.00 29.53  ? 649 TYR D N   1 
ATOM   3483 C CA  . TYR D 1 96  ? 9.641   10.291  54.330  1.00 27.16  ? 649 TYR D CA  1 
ATOM   3484 C C   . TYR D 1 96  ? 8.982   10.738  55.624  1.00 28.27  ? 649 TYR D C   1 
ATOM   3485 O O   . TYR D 1 96  ? 9.239   11.834  56.085  1.00 28.24  ? 649 TYR D O   1 
ATOM   3486 C CB  . TYR D 1 96  ? 8.608   10.132  53.202  1.00 32.05  ? 649 TYR D CB  1 
ATOM   3487 C CG  . TYR D 1 96  ? 7.851   11.419  52.730  1.00 31.88  ? 649 TYR D CG  1 
ATOM   3488 C CD1 . TYR D 1 96  ? 6.779   11.923  53.449  1.00 30.42  ? 649 TYR D CD1 1 
ATOM   3489 C CD2 . TYR D 1 96  ? 8.186   12.074  51.539  1.00 46.17  ? 649 TYR D CD2 1 
ATOM   3490 C CE1 . TYR D 1 96  ? 6.065   13.061  53.030  1.00 27.08  ? 649 TYR D CE1 1 
ATOM   3491 C CE2 . TYR D 1 96  ? 7.472   13.216  51.102  1.00 44.35  ? 649 TYR D CE2 1 
ATOM   3492 C CZ  . TYR D 1 96  ? 6.421   13.704  51.873  1.00 34.73  ? 649 TYR D CZ  1 
ATOM   3493 O OH  . TYR D 1 96  ? 5.688   14.808  51.483  1.00 54.66  ? 649 TYR D OH  1 
ATOM   3494 N N   . ARG D 1 97  ? 8.165   9.869   56.231  1.00 35.18  ? 650 ARG D N   1 
ATOM   3495 C CA  . ARG D 1 97  ? 7.370   10.247  57.421  1.00 31.28  ? 650 ARG D CA  1 
ATOM   3496 C C   . ARG D 1 97  ? 8.251   10.687  58.596  1.00 32.00  ? 650 ARG D C   1 
ATOM   3497 O O   . ARG D 1 97  ? 7.863   11.548  59.380  1.00 24.24  ? 650 ARG D O   1 
ATOM   3498 C CB  . ARG D 1 97  ? 6.496   9.088   57.884  1.00 28.57  ? 650 ARG D CB  1 
ATOM   3499 C CG  . ARG D 1 97  ? 5.283   8.818   57.023  1.00 46.57  ? 650 ARG D CG  1 
ATOM   3500 C CD  . ARG D 1 97  ? 4.353   7.780   57.663  1.00 47.45  ? 650 ARG D CD  1 
ATOM   3501 N NE  . ARG D 1 97  ? 4.999   6.468   57.664  1.00 58.78  ? 650 ARG D NE  1 
ATOM   3502 C CZ  . ARG D 1 97  ? 4.890   5.556   56.696  1.00 64.63  ? 650 ARG D CZ  1 
ATOM   3503 N NH1 . ARG D 1 97  ? 4.131   5.762   55.617  1.00 66.24  ? 650 ARG D NH1 1 
ATOM   3504 N NH2 . ARG D 1 97  ? 5.546   4.415   56.818  1.00 44.34  ? 650 ARG D NH2 1 
ATOM   3505 N N   . ALA D 1 98  ? 9.424   10.066  58.702  1.00 26.85  ? 651 ALA D N   1 
ATOM   3506 C CA  . ALA D 1 98  ? 10.402  10.395  59.692  1.00 29.47  ? 651 ALA D CA  1 
ATOM   3507 C C   . ALA D 1 98  ? 10.881  11.822  59.494  1.00 35.45  ? 651 ALA D C   1 
ATOM   3508 O O   . ALA D 1 98  ? 11.058  12.572  60.478  1.00 32.06  ? 651 ALA D O   1 
ATOM   3509 C CB  . ALA D 1 98  ? 11.600  9.432   59.611  1.00 25.34  ? 651 ALA D CB  1 
ATOM   3510 N N   . ALA D 1 99  ? 11.121  12.178  58.232  1.00 34.61  ? 652 ALA D N   1 
ATOM   3511 C CA  . ALA D 1 99  ? 11.592  13.521  57.897  1.00 34.74  ? 652 ALA D CA  1 
ATOM   3512 C C   . ALA D 1 99  ? 10.498  14.569  58.147  1.00 33.98  ? 652 ALA D C   1 
ATOM   3513 O O   . ALA D 1 99  ? 10.783  15.677  58.578  1.00 25.54  ? 652 ALA D O   1 
ATOM   3514 C CB  . ALA D 1 99  ? 12.086  13.580  56.495  1.00 25.61  ? 652 ALA D CB  1 
ATOM   3515 N N   . VAL D 1 100 ? 9.245   14.211  57.927  1.00 33.15  ? 653 VAL D N   1 
ATOM   3516 C CA  . VAL D 1 100 ? 8.169   15.139  58.209  1.00 27.34  ? 653 VAL D CA  1 
ATOM   3517 C C   . VAL D 1 100 ? 8.079   15.403  59.706  1.00 36.03  ? 653 VAL D C   1 
ATOM   3518 O O   . VAL D 1 100 ? 7.825   16.526  60.133  1.00 28.40  ? 653 VAL D O   1 
ATOM   3519 C CB  . VAL D 1 100 ? 6.836   14.603  57.660  1.00 34.72  ? 653 VAL D CB  1 
ATOM   3520 C CG1 . VAL D 1 100 ? 5.671   15.462  58.096  1.00 23.63  ? 653 VAL D CG1 1 
ATOM   3521 C CG2 . VAL D 1 100 ? 6.913   14.542  56.133  1.00 34.97  ? 653 VAL D CG2 1 
ATOM   3522 N N   . ARG D 1 101 ? 8.308   14.375  60.517  1.00 40.30  ? 654 ARG D N   1 
ATOM   3523 C CA  . ARG D 1 101 ? 8.164   14.540  61.967  1.00 40.99  ? 654 ARG D CA  1 
ATOM   3524 C C   . ARG D 1 101 ? 9.356   15.290  62.539  1.00 31.54  ? 654 ARG D C   1 
ATOM   3525 O O   . ARG D 1 101 ? 9.214   16.062  63.509  1.00 24.03  ? 654 ARG D O   1 
ATOM   3526 C CB  . ARG D 1 101 ? 7.910   13.194  62.709  1.00 43.15  ? 654 ARG D CB  1 
ATOM   3527 C CG  . ARG D 1 101 ? 6.385   12.898  62.969  1.00 64.59  ? 654 ARG D CG  1 
ATOM   3528 C CD  . ARG D 1 101 ? 6.111   11.557  63.698  1.00 68.00  ? 654 ARG D CD  1 
ATOM   3529 N NE  . ARG D 1 101 ? 7.130   10.601  63.293  1.00 46.58  ? 654 ARG D NE  1 
ATOM   3530 C CZ  . ARG D 1 101 ? 6.986   9.615   62.416  1.00 52.45  ? 654 ARG D CZ  1 
ATOM   3531 N NH1 . ARG D 1 101 ? 5.807   9.332   61.865  1.00 48.07  ? 654 ARG D NH1 1 
ATOM   3532 N NH2 . ARG D 1 101 ? 8.052   8.879   62.116  1.00 22.50  ? 654 ARG D NH2 1 
ATOM   3533 N N   . LEU D 1 102 ? 10.521  15.081  61.945  1.00 23.69  ? 655 LEU D N   1 
ATOM   3534 C CA  . LEU D 1 102 ? 11.697  15.866  62.338  1.00 24.61  ? 655 LEU D CA  1 
ATOM   3535 C C   . LEU D 1 102 ? 11.548  17.331  61.945  1.00 22.74  ? 655 LEU D C   1 
ATOM   3536 O O   . LEU D 1 102 ? 11.952  18.227  62.681  1.00 21.69  ? 655 LEU D O   1 
ATOM   3537 C CB  . LEU D 1 102 ? 12.948  15.294  61.736  1.00 15.79  ? 655 LEU D CB  1 
ATOM   3538 C CG  . LEU D 1 102 ? 14.242  15.777  62.355  1.00 30.21  ? 655 LEU D CG  1 
ATOM   3539 C CD1 . LEU D 1 102 ? 14.365  15.140  63.739  1.00 35.93  ? 655 LEU D CD1 1 
ATOM   3540 C CD2 . LEU D 1 102 ? 15.430  15.416  61.471  1.00 13.82  ? 655 LEU D CD2 1 
ATOM   3541 N N   . ARG D 1 103 ? 10.918  17.597  60.810  1.00 34.57  ? 656 ARG D N   1 
ATOM   3542 C CA  . ARG D 1 103 ? 10.579  18.990  60.485  1.00 35.06  ? 656 ARG D CA  1 
ATOM   3543 C C   . ARG D 1 103 ? 9.723   19.633  61.586  1.00 27.77  ? 656 ARG D C   1 
ATOM   3544 O O   . ARG D 1 103 ? 9.983   20.760  61.995  1.00 32.87  ? 656 ARG D O   1 
ATOM   3545 C CB  . ARG D 1 103 ? 9.862   19.076  59.143  1.00 31.08  ? 656 ARG D CB  1 
ATOM   3546 C CG  . ARG D 1 103 ? 9.722   20.465  58.557  1.00 35.53  ? 656 ARG D CG  1 
ATOM   3547 C CD  . ARG D 1 103 ? 8.868   20.416  57.294  1.00 55.50  ? 656 ARG D CD  1 
ATOM   3548 N NE  . ARG D 1 103 ? 7.725   19.506  57.446  1.00 75.13  ? 656 ARG D NE  1 
ATOM   3549 C CZ  . ARG D 1 103 ? 6.486   19.851  57.802  1.00 89.06  ? 656 ARG D CZ  1 
ATOM   3550 N NH1 . ARG D 1 103 ? 6.154   21.119  58.043  1.00 101.69 ? 656 ARG D NH1 1 
ATOM   3551 N NH2 . ARG D 1 103 ? 5.559   18.908  57.923  1.00 80.24  ? 656 ARG D NH2 1 
ATOM   3552 N N   . ASP D 1 104 ? 8.722   18.917  62.077  1.00 34.06  ? 657 ASP D N   1 
ATOM   3553 C CA  . ASP D 1 104 ? 7.699   19.522  62.955  1.00 40.16  ? 657 ASP D CA  1 
ATOM   3554 C C   . ASP D 1 104 ? 8.281   19.725  64.336  1.00 36.54  ? 657 ASP D C   1 
ATOM   3555 O O   . ASP D 1 104 ? 8.138   20.774  64.929  1.00 36.25  ? 657 ASP D O   1 
ATOM   3556 C CB  . ASP D 1 104 ? 6.454   18.639  63.044  1.00 46.89  ? 657 ASP D CB  1 
ATOM   3557 C CG  . ASP D 1 104 ? 5.780   18.421  61.681  1.00 63.70  ? 657 ASP D CG  1 
ATOM   3558 O OD1 . ASP D 1 104 ? 6.128   19.125  60.705  1.00 61.73  ? 657 ASP D OD1 1 
ATOM   3559 O OD2 . ASP D 1 104 ? 4.897   17.538  61.590  1.00 67.62  ? 657 ASP D OD2 1 
ATOM   3560 N N   . GLN D 1 105 ? 8.992   18.712  64.814  1.00 38.60  ? 658 GLN D N   1 
ATOM   3561 C CA  . GLN D 1 105 ? 9.641   18.748  66.120  1.00 37.82  ? 658 GLN D CA  1 
ATOM   3562 C C   . GLN D 1 105 ? 10.881  19.631  66.100  1.00 33.34  ? 658 GLN D C   1 
ATOM   3563 O O   . GLN D 1 105 ? 11.098  20.435  67.011  1.00 33.33  ? 658 GLN D O   1 
ATOM   3564 C CB  . GLN D 1 105 ? 9.936   17.306  66.598  1.00 34.05  ? 658 GLN D CB  1 
ATOM   3565 C CG  . GLN D 1 105 ? 8.616   16.582  66.937  1.00 46.59  ? 658 GLN D CG  1 
ATOM   3566 C CD  . GLN D 1 105 ? 8.766   15.135  67.354  1.00 52.85  ? 658 GLN D CD  1 
ATOM   3567 O OE1 . GLN D 1 105 ? 9.768   14.496  67.082  1.00 33.01  ? 658 GLN D OE1 1 
ATOM   3568 N NE2 . GLN D 1 105 ? 7.737   14.605  68.008  1.00 53.26  ? 658 GLN D NE2 1 
ATOM   3569 N N   . GLY D 1 106 ? 11.696  19.496  65.062  1.00 26.66  ? 659 GLY D N   1 
ATOM   3570 C CA  . GLY D 1 106 ? 12.819  20.404  64.883  1.00 25.22  ? 659 GLY D CA  1 
ATOM   3571 C C   . GLY D 1 106 ? 12.376  21.862  64.770  1.00 22.85  ? 659 GLY D C   1 
ATOM   3572 O O   . GLY D 1 106 ? 12.987  22.726  65.325  1.00 18.14  ? 659 GLY D O   1 
ATOM   3573 N N   . GLY D 1 107 ? 11.261  22.143  64.091  1.00 27.86  ? 660 GLY D N   1 
ATOM   3574 C CA  . GLY D 1 107 ? 10.851  23.539  63.936  1.00 19.18  ? 660 GLY D CA  1 
ATOM   3575 C C   . GLY D 1 107 ? 10.696  24.210  65.284  1.00 26.79  ? 660 GLY D C   1 
ATOM   3576 O O   . GLY D 1 107 ? 11.203  25.320  65.485  1.00 31.78  ? 660 GLY D O   1 
ATOM   3577 N N   . VAL D 1 108 ? 10.058  23.514  66.234  1.00 30.89  ? 661 VAL D N   1 
ATOM   3578 C CA  . VAL D 1 108 ? 9.826   24.108  67.563  1.00 35.47  ? 661 VAL D CA  1 
ATOM   3579 C C   . VAL D 1 108 ? 11.143  24.391  68.250  1.00 31.02  ? 661 VAL D C   1 
ATOM   3580 O O   . VAL D 1 108 ? 11.272  25.399  68.928  1.00 34.54  ? 661 VAL D O   1 
ATOM   3581 C CB  . VAL D 1 108 ? 8.831   23.289  68.523  1.00 40.88  ? 661 VAL D CB  1 
ATOM   3582 C CG1 . VAL D 1 108 ? 7.836   22.411  67.761  1.00 27.68  ? 661 VAL D CG1 1 
ATOM   3583 C CG2 . VAL D 1 108 ? 9.582   22.490  69.526  1.00 48.40  ? 661 VAL D CG2 1 
ATOM   3584 N N   . VAL D 1 109 ? 12.141  23.531  68.057  1.00 34.04  ? 662 VAL D N   1 
ATOM   3585 C CA  . VAL D 1 109 ? 13.440  23.771  68.663  1.00 25.20  ? 662 VAL D CA  1 
ATOM   3586 C C   . VAL D 1 109 ? 13.959  25.078  68.048  1.00 30.87  ? 662 VAL D C   1 
ATOM   3587 O O   . VAL D 1 109 ? 14.490  25.943  68.749  1.00 30.80  ? 662 VAL D O   1 
ATOM   3588 C CB  . VAL D 1 109 ? 14.437  22.604  68.425  1.00 30.18  ? 662 VAL D CB  1 
ATOM   3589 C CG1 . VAL D 1 109 ? 15.845  22.939  68.973  1.00 15.22  ? 662 VAL D CG1 1 
ATOM   3590 C CG2 . VAL D 1 109 ? 13.909  21.331  69.051  1.00 22.92  ? 662 VAL D CG2 1 
ATOM   3591 N N   . LEU D 1 110 ? 13.764  25.239  66.747  1.00 24.79  ? 663 LEU D N   1 
ATOM   3592 C CA  . LEU D 1 110 ? 14.380  26.356  66.066  1.00 21.67  ? 663 LEU D CA  1 
ATOM   3593 C C   . LEU D 1 110 ? 13.645  27.658  66.384  1.00 26.88  ? 663 LEU D C   1 
ATOM   3594 O O   . LEU D 1 110 ? 14.289  28.685  66.530  1.00 29.46  ? 663 LEU D O   1 
ATOM   3595 C CB  . LEU D 1 110 ? 14.484  26.103  64.556  1.00 25.84  ? 663 LEU D CB  1 
ATOM   3596 C CG  . LEU D 1 110 ? 15.530  25.063  64.232  1.00 20.85  ? 663 LEU D CG  1 
ATOM   3597 C CD1 . LEU D 1 110 ? 15.275  24.376  62.894  1.00 11.44  ? 663 LEU D CD1 1 
ATOM   3598 C CD2 . LEU D 1 110 ? 16.927  25.739  64.313  1.00 22.71  ? 663 LEU D CD2 1 
ATOM   3599 N N   . ARG D 1 111 ? 12.328  27.616  66.540  1.00 19.98  ? 664 ARG D N   1 
ATOM   3600 C CA  . ARG D 1 111 ? 11.593  28.808  66.955  1.00 31.97  ? 664 ARG D CA  1 
ATOM   3601 C C   . ARG D 1 111 ? 12.005  29.237  68.362  1.00 31.23  ? 664 ARG D C   1 
ATOM   3602 O O   . ARG D 1 111 ? 12.071  30.413  68.671  1.00 30.08  ? 664 ARG D O   1 
ATOM   3603 C CB  . ARG D 1 111 ? 10.094  28.579  66.939  1.00 31.31  ? 664 ARG D CB  1 
ATOM   3604 C CG  . ARG D 1 111 ? 9.501   28.509  65.551  1.00 45.76  ? 664 ARG D CG  1 
ATOM   3605 C CD  . ARG D 1 111 ? 7.971   28.567  65.658  1.00 51.20  ? 664 ARG D CD  1 
ATOM   3606 N NE  . ARG D 1 111 ? 7.327   27.763  64.631  1.00 66.67  ? 664 ARG D NE  1 
ATOM   3607 C CZ  . ARG D 1 111 ? 7.286   26.433  64.615  1.00 74.23  ? 664 ARG D CZ  1 
ATOM   3608 N NH1 . ARG D 1 111 ? 7.856   25.718  65.570  1.00 78.61  ? 664 ARG D NH1 1 
ATOM   3609 N NH2 . ARG D 1 111 ? 6.669   25.812  63.628  1.00 93.76  ? 664 ARG D NH2 1 
ATOM   3610 N N   . GLN D 1 112 ? 12.301  28.274  69.214  1.00 31.21  ? 665 GLN D N   1 
ATOM   3611 C CA  . GLN D 1 112 ? 12.761  28.614  70.540  1.00 26.14  ? 665 GLN D CA  1 
ATOM   3612 C C   . GLN D 1 112 ? 14.146  29.214  70.441  1.00 20.75  ? 665 GLN D C   1 
ATOM   3613 O O   . GLN D 1 112 ? 14.469  30.119  71.187  1.00 26.47  ? 665 GLN D O   1 
ATOM   3614 C CB  . GLN D 1 112 ? 12.758  27.381  71.443  1.00 27.04  ? 665 GLN D CB  1 
ATOM   3615 C CG  . GLN D 1 112 ? 12.872  27.682  72.941  1.00 26.73  ? 665 GLN D CG  1 
ATOM   3616 C CD  . GLN D 1 112 ? 11.798  28.578  73.524  1.00 32.53  ? 665 GLN D CD  1 
ATOM   3617 O OE1 . GLN D 1 112 ? 10.560  28.485  73.232  1.00 19.64  ? 665 GLN D OE1 1 
ATOM   3618 N NE2 . GLN D 1 112 ? 12.265  29.473  74.370  1.00 25.58  ? 665 GLN D NE2 1 
ATOM   3619 N N   . ALA D 1 113 ? 14.966  28.733  69.511  1.00 20.78  ? 666 ALA D N   1 
ATOM   3620 C CA  . ALA D 1 113 ? 16.328  29.301  69.337  1.00 23.56  ? 666 ALA D CA  1 
ATOM   3621 C C   . ALA D 1 113 ? 16.202  30.765  68.901  1.00 22.97  ? 666 ALA D C   1 
ATOM   3622 O O   . ALA D 1 113 ? 16.921  31.607  69.370  1.00 27.35  ? 666 ALA D O   1 
ATOM   3623 C CB  . ALA D 1 113 ? 17.133  28.483  68.341  1.00 26.19  ? 666 ALA D CB  1 
ATOM   3624 N N   . ARG D 1 114 ? 15.196  31.061  68.079  1.00 23.52  ? 667 ARG D N   1 
ATOM   3625 C CA  . ARG D 1 114 ? 14.961  32.408  67.595  1.00 20.95  ? 667 ARG D CA  1 
ATOM   3626 C C   . ARG D 1 114 ? 14.613  33.326  68.765  1.00 24.61  ? 667 ARG D C   1 
ATOM   3627 O O   . ARG D 1 114 ? 15.169  34.409  68.850  1.00 30.29  ? 667 ARG D O   1 
ATOM   3628 C CB  . ARG D 1 114 ? 13.838  32.400  66.545  1.00 20.01  ? 667 ARG D CB  1 
ATOM   3629 C CG  . ARG D 1 114 ? 13.439  33.784  65.988  1.00 31.08  ? 667 ARG D CG  1 
ATOM   3630 C CD  . ARG D 1 114 ? 14.627  34.558  65.407  1.00 27.03  ? 667 ARG D CD  1 
ATOM   3631 N NE  . ARG D 1 114 ? 15.179  33.880  64.242  1.00 33.09  ? 667 ARG D NE  1 
ATOM   3632 C CZ  . ARG D 1 114 ? 16.354  34.169  63.690  1.00 38.50  ? 667 ARG D CZ  1 
ATOM   3633 N NH1 . ARG D 1 114 ? 17.116  35.140  64.188  1.00 32.90  ? 667 ARG D NH1 1 
ATOM   3634 N NH2 . ARG D 1 114 ? 16.779  33.466  62.645  1.00 22.80  ? 667 ARG D NH2 1 
ATOM   3635 N N   . ARG D 1 115 ? 13.687  32.901  69.641  1.00 19.51  ? 668 ARG D N   1 
ATOM   3636 C CA  . ARG D 1 115 ? 13.335  33.672  70.842  1.00 21.58  ? 668 ARG D CA  1 
ATOM   3637 C C   . ARG D 1 115 ? 14.596  33.984  71.678  1.00 30.58  ? 668 ARG D C   1 
ATOM   3638 O O   . ARG D 1 115 ? 14.781  35.108  72.136  1.00 30.64  ? 668 ARG D O   1 
ATOM   3639 C CB  . ARG D 1 115 ? 12.292  32.908  71.651  1.00 27.99  ? 668 ARG D CB  1 
ATOM   3640 C CG  . ARG D 1 115 ? 10.895  32.682  70.923  1.00 20.65  ? 668 ARG D CG  1 
ATOM   3641 C CD  . ARG D 1 115 ? 10.124  31.558  71.582  1.00 28.56  ? 668 ARG D CD  1 
ATOM   3642 N NE  . ARG D 1 115 ? 8.823   31.333  70.963  1.00 27.97  ? 668 ARG D NE  1 
ATOM   3643 C CZ  . ARG D 1 115 ? 7.958   30.370  71.296  1.00 39.16  ? 668 ARG D CZ  1 
ATOM   3644 N NH1 . ARG D 1 115 ? 8.255   29.476  72.245  1.00 18.71  ? 668 ARG D NH1 1 
ATOM   3645 N NH2 . ARG D 1 115 ? 6.771   30.302  70.671  1.00 22.47  ? 668 ARG D NH2 1 
ATOM   3646 N N   . GLU D 1 116 ? 15.496  33.021  71.841  1.00 23.89  ? 669 GLU D N   1 
ATOM   3647 C CA  . GLU D 1 116 ? 16.717  33.319  72.591  1.00 31.17  ? 669 GLU D CA  1 
ATOM   3648 C C   . GLU D 1 116 ? 17.533  34.334  71.832  1.00 28.20  ? 669 GLU D C   1 
ATOM   3649 O O   . GLU D 1 116 ? 18.064  35.250  72.431  1.00 37.86  ? 669 GLU D O   1 
ATOM   3650 C CB  . GLU D 1 116 ? 17.590  32.093  72.868  1.00 27.39  ? 669 GLU D CB  1 
ATOM   3651 C CG  . GLU D 1 116 ? 16.955  31.031  73.695  1.00 36.00  ? 669 GLU D CG  1 
ATOM   3652 C CD  . GLU D 1 116 ? 16.479  31.551  75.016  1.00 50.14  ? 669 GLU D CD  1 
ATOM   3653 O OE1 . GLU D 1 116 ? 17.330  31.999  75.824  1.00 45.22  ? 669 GLU D OE1 1 
ATOM   3654 O OE2 . GLU D 1 116 ? 15.243  31.529  75.220  1.00 46.46  ? 669 GLU D OE2 1 
ATOM   3655 N N   . VAL D 1 117 ? 17.610  34.189  70.515  1.00 31.47  ? 670 VAL D N   1 
ATOM   3656 C CA  . VAL D 1 117 ? 18.366  35.149  69.715  1.00 38.07  ? 670 VAL D CA  1 
ATOM   3657 C C   . VAL D 1 117 ? 17.722  36.527  69.857  1.00 37.06  ? 670 VAL D C   1 
ATOM   3658 O O   . VAL D 1 117 ? 18.448  37.504  69.983  1.00 27.99  ? 670 VAL D O   1 
ATOM   3659 C CB  . VAL D 1 117 ? 18.524  34.703  68.242  1.00 39.01  ? 670 VAL D CB  1 
ATOM   3660 C CG1 . VAL D 1 117 ? 19.157  35.834  67.369  1.00 35.81  ? 670 VAL D CG1 1 
ATOM   3661 C CG2 . VAL D 1 117 ? 19.406  33.436  68.182  1.00 37.27  ? 670 VAL D CG2 1 
ATOM   3662 N N   . ASP D 1 118 ? 16.373  36.590  69.886  1.00 39.01  ? 671 ASP D N   1 
ATOM   3663 C CA  . ASP D 1 118 ? 15.658  37.855  69.995  1.00 34.47  ? 671 ASP D CA  1 
ATOM   3664 C C   . ASP D 1 118 ? 16.166  38.629  71.211  1.00 35.93  ? 671 ASP D C   1 
ATOM   3665 O O   . ASP D 1 118 ? 16.373  39.838  71.144  1.00 33.92  ? 671 ASP D O   1 
ATOM   3666 C CB  . ASP D 1 118 ? 14.142  37.669  70.187  1.00 36.27  ? 671 ASP D CB  1 
ATOM   3667 C CG  . ASP D 1 118 ? 13.442  37.054  68.999  1.00 29.27  ? 671 ASP D CG  1 
ATOM   3668 O OD1 . ASP D 1 118 ? 13.751  37.371  67.819  1.00 28.71  ? 671 ASP D OD1 1 
ATOM   3669 O OD2 . ASP D 1 118 ? 12.489  36.281  69.258  1.00 50.59  ? 671 ASP D OD2 1 
ATOM   3670 N N   . SER D 1 119 ? 16.384  37.917  72.311  1.00 38.03  ? 672 SER D N   1 
ATOM   3671 C CA  . SER D 1 119 ? 16.686  38.545  73.606  1.00 41.09  ? 672 SER D CA  1 
ATOM   3672 C C   . SER D 1 119 ? 18.185  38.819  73.805  1.00 42.47  ? 672 SER D C   1 
ATOM   3673 O O   . SER D 1 119 ? 18.554  39.850  74.378  1.00 43.07  ? 672 SER D O   1 
ATOM   3674 C CB  . SER D 1 119 ? 16.106  37.695  74.756  1.00 37.67  ? 672 SER D CB  1 
ATOM   3675 O OG  . SER D 1 119 ? 16.903  36.543  75.005  1.00 43.68  ? 672 SER D OG  1 
ATOM   3676 N N   . ILE D 1 120 ? 19.037  37.904  73.340  1.00 49.59  ? 673 ILE D N   1 
ATOM   3677 C CA  . ILE D 1 120 ? 20.501  38.135  73.287  1.00 54.05  ? 673 ILE D CA  1 
ATOM   3678 C C   . ILE D 1 120 ? 20.816  39.338  72.401  1.00 54.50  ? 673 ILE D C   1 
ATOM   3679 O O   . ILE D 1 120 ? 21.650  40.169  72.736  1.00 54.01  ? 673 ILE D O   1 
ATOM   3680 C CB  . ILE D 1 120 ? 21.281  36.910  72.734  1.00 52.13  ? 673 ILE D CB  1 
ATOM   3681 C CG1 . ILE D 1 120 ? 21.263  35.742  73.721  1.00 58.59  ? 673 ILE D CG1 1 
ATOM   3682 C CG2 . ILE D 1 120 ? 22.733  37.282  72.437  1.00 65.44  ? 673 ILE D CG2 1 
ATOM   3683 C CD1 . ILE D 1 120 ? 21.695  34.407  73.074  1.00 59.34  ? 673 ILE D CD1 1 
ATOM   3684 N N   . GLY D 1 121 ? 20.138  39.411  71.260  1.00 61.69  ? 674 GLY D N   1 
ATOM   3685 C CA  . GLY D 1 121 ? 20.197  40.584  70.385  1.00 60.76  ? 674 GLY D CA  1 
ATOM   3686 C C   . GLY D 1 121 ? 19.925  41.882  71.127  1.00 61.64  ? 674 GLY D C   1 
ATOM   3687 O O   . GLY D 1 121 ? 20.538  42.900  70.823  1.00 65.95  ? 674 GLY D O   1 
ATOM   3688 N N   . LEU D 1 122 ? 19.008  41.857  72.095  1.00 60.27  ? 675 LEU D N   1 
ATOM   3689 C CA  . LEU D 1 122 ? 18.816  43.001  72.980  1.00 62.01  ? 675 LEU D CA  1 
ATOM   3690 C C   . LEU D 1 122 ? 20.040  43.165  73.878  1.00 64.01  ? 675 LEU D C   1 
ATOM   3691 O O   . LEU D 1 122 ? 20.804  44.108  73.708  1.00 70.11  ? 675 LEU D O   1 
ATOM   3692 C CB  . LEU D 1 122 ? 17.571  42.835  73.849  1.00 60.80  ? 675 LEU D CB  1 
ATOM   3693 C CG  . LEU D 1 122 ? 16.208  42.904  73.192  1.00 53.85  ? 675 LEU D CG  1 
ATOM   3694 C CD1 . LEU D 1 122 ? 15.158  42.864  74.299  1.00 46.60  ? 675 LEU D CD1 1 
ATOM   3695 C CD2 . LEU D 1 122 ? 16.083  44.161  72.347  1.00 38.07  ? 675 LEU D CD2 1 
ATOM   3696 N N   . ARG E 1 10  ? -1.438  19.448  14.389  1.00 80.35  ? 563 ARG E N   1 
ATOM   3697 C CA  . ARG E 1 10  ? -1.468  18.123  13.717  1.00 82.10  ? 563 ARG E CA  1 
ATOM   3698 C C   . ARG E 1 10  ? -2.804  17.381  13.946  1.00 82.14  ? 563 ARG E C   1 
ATOM   3699 O O   . ARG E 1 10  ? -2.836  16.147  13.898  1.00 84.28  ? 563 ARG E O   1 
ATOM   3700 C CB  . ARG E 1 10  ? -0.286  17.274  14.214  1.00 82.31  ? 563 ARG E CB  1 
ATOM   3701 N N   . LEU E 1 11  ? -3.897  18.137  14.144  1.00 76.59  ? 564 LEU E N   1 
ATOM   3702 C CA  . LEU E 1 11  ? -5.184  17.619  14.676  1.00 69.45  ? 564 LEU E CA  1 
ATOM   3703 C C   . LEU E 1 11  ? -6.330  17.636  13.661  1.00 65.69  ? 564 LEU E C   1 
ATOM   3704 O O   . LEU E 1 11  ? -6.726  18.705  13.229  1.00 65.37  ? 564 LEU E O   1 
ATOM   3705 C CB  . LEU E 1 11  ? -5.643  18.506  15.840  1.00 71.25  ? 564 LEU E CB  1 
ATOM   3706 C CG  . LEU E 1 11  ? -5.007  18.370  17.219  1.00 70.44  ? 564 LEU E CG  1 
ATOM   3707 C CD1 . LEU E 1 11  ? -5.544  19.459  18.118  1.00 64.58  ? 564 LEU E CD1 1 
ATOM   3708 C CD2 . LEU E 1 11  ? -5.279  16.991  17.824  1.00 82.45  ? 564 LEU E CD2 1 
ATOM   3709 N N   . THR E 1 12  ? -6.899  16.485  13.312  1.00 61.91  ? 565 THR E N   1 
ATOM   3710 C CA  . THR E 1 12  ? -7.956  16.465  12.290  1.00 61.55  ? 565 THR E CA  1 
ATOM   3711 C C   . THR E 1 12  ? -9.305  16.932  12.837  1.00 54.87  ? 565 THR E C   1 
ATOM   3712 O O   . THR E 1 12  ? -9.509  16.974  14.036  1.00 52.68  ? 565 THR E O   1 
ATOM   3713 C CB  . THR E 1 12  ? -8.155  15.065  11.676  1.00 64.00  ? 565 THR E CB  1 
ATOM   3714 O OG1 . THR E 1 12  ? -8.571  14.151  12.694  1.00 64.75  ? 565 THR E OG1 1 
ATOM   3715 C CG2 . THR E 1 12  ? -6.866  14.575  11.036  1.00 67.46  ? 565 THR E CG2 1 
ATOM   3716 N N   . PRO E 1 13  ? -10.241 17.282  11.946  1.00 54.22  ? 566 PRO E N   1 
ATOM   3717 C CA  . PRO E 1 13  ? -11.570 17.643  12.427  1.00 49.59  ? 566 PRO E CA  1 
ATOM   3718 C C   . PRO E 1 13  ? -12.294 16.523  13.212  1.00 48.57  ? 566 PRO E C   1 
ATOM   3719 O O   . PRO E 1 13  ? -13.151 16.818  14.041  1.00 44.22  ? 566 PRO E O   1 
ATOM   3720 C CB  . PRO E 1 13  ? -12.327 17.977  11.137  1.00 49.07  ? 566 PRO E CB  1 
ATOM   3721 C CG  . PRO E 1 13  ? -11.271 18.405  10.195  1.00 59.73  ? 566 PRO E CG  1 
ATOM   3722 C CD  . PRO E 1 13  ? -10.087 17.550  10.506  1.00 52.49  ? 566 PRO E CD  1 
ATOM   3723 N N   . LEU E 1 14  ? -11.962 15.262  12.955  1.00 41.09  ? 567 LEU E N   1 
ATOM   3724 C CA  . LEU E 1 14  ? -12.634 14.164  13.633  1.00 39.60  ? 567 LEU E CA  1 
ATOM   3725 C C   . LEU E 1 14  ? -12.106 14.133  15.049  1.00 36.83  ? 567 LEU E C   1 
ATOM   3726 O O   . LEU E 1 14  ? -12.865 14.029  16.002  1.00 31.53  ? 567 LEU E O   1 
ATOM   3727 C CB  . LEU E 1 14  ? -12.342 12.835  12.948  1.00 41.29  ? 567 LEU E CB  1 
ATOM   3728 C CG  . LEU E 1 14  ? -12.924 11.626  13.672  1.00 42.47  ? 567 LEU E CG  1 
ATOM   3729 C CD1 . LEU E 1 14  ? -14.439 11.756  13.701  1.00 33.29  ? 567 LEU E CD1 1 
ATOM   3730 C CD2 . LEU E 1 14  ? -12.481 10.311  13.021  1.00 40.03  ? 567 LEU E CD2 1 
ATOM   3731 N N   . THR E 1 15  ? -10.792 14.260  15.173  1.00 30.31  ? 568 THR E N   1 
ATOM   3732 C CA  . THR E 1 15  ? -10.148 14.132  16.441  1.00 35.70  ? 568 THR E CA  1 
ATOM   3733 C C   . THR E 1 15  ? -10.643 15.209  17.412  1.00 33.68  ? 568 THR E C   1 
ATOM   3734 O O   . THR E 1 15  ? -10.954 14.914  18.559  1.00 38.02  ? 568 THR E O   1 
ATOM   3735 C CB  . THR E 1 15  ? -8.605  14.143  16.245  1.00 39.24  ? 568 THR E CB  1 
ATOM   3736 O OG1 . THR E 1 15  ? -8.263  13.039  15.404  1.00 35.39  ? 568 THR E OG1 1 
ATOM   3737 C CG2 . THR E 1 15  ? -7.854  14.012  17.561  1.00 32.06  ? 568 THR E CG2 1 
ATOM   3738 N N   . VAL E 1 16  ? -10.713 16.445  16.950  1.00 30.18  ? 569 VAL E N   1 
ATOM   3739 C CA  . VAL E 1 16  ? -11.198 17.544  17.775  1.00 31.42  ? 569 VAL E CA  1 
ATOM   3740 C C   . VAL E 1 16  ? -12.624 17.244  18.233  1.00 30.15  ? 569 VAL E C   1 
ATOM   3741 O O   . VAL E 1 16  ? -13.004 17.502  19.370  1.00 34.87  ? 569 VAL E O   1 
ATOM   3742 C CB  . VAL E 1 16  ? -11.148 18.865  16.986  1.00 35.35  ? 569 VAL E CB  1 
ATOM   3743 C CG1 . VAL E 1 16  ? -11.973 19.940  17.638  1.00 37.11  ? 569 VAL E CG1 1 
ATOM   3744 C CG2 . VAL E 1 16  ? -9.706  19.310  16.826  1.00 44.47  ? 569 VAL E CG2 1 
ATOM   3745 N N   . LEU E 1 17  ? -13.411 16.662  17.355  1.00 33.17  ? 570 LEU E N   1 
ATOM   3746 C CA  . LEU E 1 17  ? -14.798 16.354  17.697  1.00 34.66  ? 570 LEU E CA  1 
ATOM   3747 C C   . LEU E 1 17  ? -14.864 15.190  18.714  1.00 34.45  ? 570 LEU E C   1 
ATOM   3748 O O   . LEU E 1 17  ? -15.685 15.226  19.651  1.00 30.88  ? 570 LEU E O   1 
ATOM   3749 C CB  . LEU E 1 17  ? -15.559 16.029  16.431  1.00 28.77  ? 570 LEU E CB  1 
ATOM   3750 C CG  . LEU E 1 17  ? -17.046 16.390  16.346  1.00 45.92  ? 570 LEU E CG  1 
ATOM   3751 C CD1 . LEU E 1 17  ? -17.763 15.694  17.464  1.00 29.75  ? 570 LEU E CD1 1 
ATOM   3752 C CD2 . LEU E 1 17  ? -17.303 17.932  16.372  1.00 46.34  ? 570 LEU E CD2 1 
ATOM   3753 N N   . LEU E 1 18  ? -13.984 14.190  18.569  1.00 25.70  ? 571 LEU E N   1 
ATOM   3754 C CA  . LEU E 1 18  ? -14.070 12.989  19.402  1.00 28.05  ? 571 LEU E CA  1 
ATOM   3755 C C   . LEU E 1 18  ? -13.557 13.341  20.765  1.00 35.23  ? 571 LEU E C   1 
ATOM   3756 O O   . LEU E 1 18  ? -14.050 12.829  21.770  1.00 37.54  ? 571 LEU E O   1 
ATOM   3757 C CB  . LEU E 1 18  ? -13.281 11.822  18.825  1.00 21.47  ? 571 LEU E CB  1 
ATOM   3758 C CG  . LEU E 1 18  ? -13.892 11.143  17.589  1.00 38.72  ? 571 LEU E CG  1 
ATOM   3759 C CD1 . LEU E 1 18  ? -13.005 10.052  17.095  1.00 24.31  ? 571 LEU E CD1 1 
ATOM   3760 C CD2 . LEU E 1 18  ? -15.252 10.565  17.885  1.00 32.13  ? 571 LEU E CD2 1 
ATOM   3761 N N   . ARG E 1 19  ? -12.577 14.238  20.790  1.00 28.66  ? 572 ARG E N   1 
ATOM   3762 C CA  . ARG E 1 19  ? -11.986 14.701  22.014  1.00 29.90  ? 572 ARG E CA  1 
ATOM   3763 C C   . ARG E 1 19  ? -13.017 15.460  22.879  1.00 33.83  ? 572 ARG E C   1 
ATOM   3764 O O   . ARG E 1 19  ? -13.227 15.165  24.060  1.00 27.01  ? 572 ARG E O   1 
ATOM   3765 C CB  . ARG E 1 19  ? -10.836 15.616  21.680  1.00 24.94  ? 572 ARG E CB  1 
ATOM   3766 C CG  . ARG E 1 19  ? -10.226 16.233  22.898  1.00 47.02  ? 572 ARG E CG  1 
ATOM   3767 C CD  . ARG E 1 19  ? -8.730  16.289  22.825  1.00 58.06  ? 572 ARG E CD  1 
ATOM   3768 N NE  . ARG E 1 19  ? -8.215  16.798  24.089  1.00 58.27  ? 572 ARG E NE  1 
ATOM   3769 C CZ  . ARG E 1 19  ? -7.157  16.312  24.727  1.00 63.29  ? 572 ARG E CZ  1 
ATOM   3770 N NH1 . ARG E 1 19  ? -6.477  15.282  24.231  1.00 50.14  ? 572 ARG E NH1 1 
ATOM   3771 N NH2 . ARG E 1 19  ? -6.785  16.861  25.878  1.00 61.83  ? 572 ARG E NH2 1 
ATOM   3772 N N   . SER E 1 20  ? -13.668 16.431  22.271  1.00 26.08  ? 573 SER E N   1 
ATOM   3773 C CA  . SER E 1 20  ? -14.753 17.089  22.935  1.00 27.11  ? 573 SER E CA  1 
ATOM   3774 C C   . SER E 1 20  ? -15.781 16.081  23.442  1.00 26.68  ? 573 SER E C   1 
ATOM   3775 O O   . SER E 1 20  ? -16.289 16.215  24.555  1.00 27.62  ? 573 SER E O   1 
ATOM   3776 C CB  . SER E 1 20  ? -15.395 18.102  22.017  1.00 14.49  ? 573 SER E CB  1 
ATOM   3777 O OG  . SER E 1 20  ? -16.560 18.603  22.661  1.00 50.23  ? 573 SER E OG  1 
ATOM   3778 N N   . VAL E 1 21  ? -16.087 15.061  22.646  1.00 33.44  ? 574 VAL E N   1 
ATOM   3779 C CA  . VAL E 1 21  ? -17.063 14.043  23.062  1.00 26.49  ? 574 VAL E CA  1 
ATOM   3780 C C   . VAL E 1 21  ? -16.532 13.273  24.281  1.00 28.38  ? 574 VAL E C   1 
ATOM   3781 O O   . VAL E 1 21  ? -17.253 13.049  25.258  1.00 28.84  ? 574 VAL E O   1 
ATOM   3782 C CB  . VAL E 1 21  ? -17.430 13.047  21.890  1.00 31.11  ? 574 VAL E CB  1 
ATOM   3783 C CG1 . VAL E 1 21  ? -18.315 11.844  22.401  1.00 20.92  ? 574 VAL E CG1 1 
ATOM   3784 C CG2 . VAL E 1 21  ? -18.130 13.813  20.758  1.00 33.43  ? 574 VAL E CG2 1 
ATOM   3785 N N   . LEU E 1 22  ? -15.263 12.898  24.228  1.00 28.14  ? 575 LEU E N   1 
ATOM   3786 C CA  . LEU E 1 22  ? -14.644 12.149  25.311  1.00 27.38  ? 575 LEU E CA  1 
ATOM   3787 C C   . LEU E 1 22  ? -14.643 12.931  26.649  1.00 27.32  ? 575 LEU E C   1 
ATOM   3788 O O   . LEU E 1 22  ? -14.952 12.369  27.690  1.00 25.17  ? 575 LEU E O   1 
ATOM   3789 C CB  . LEU E 1 22  ? -13.220 11.757  24.938  1.00 22.53  ? 575 LEU E CB  1 
ATOM   3790 C CG  . LEU E 1 22  ? -12.580 10.814  25.947  1.00 21.19  ? 575 LEU E CG  1 
ATOM   3791 C CD1 . LEU E 1 22  ? -13.463 9.595   26.151  1.00 20.79  ? 575 LEU E CD1 1 
ATOM   3792 C CD2 . LEU E 1 22  ? -11.191 10.418  25.458  1.00 25.60  ? 575 LEU E CD2 1 
ATOM   3793 N N   . ASP E 1 23  ? -14.302 14.212  26.614  1.00 24.48  ? 576 ASP E N   1 
ATOM   3794 C CA  . ASP E 1 23  ? -14.323 15.054  27.837  1.00 20.97  ? 576 ASP E CA  1 
ATOM   3795 C C   . ASP E 1 23  ? -15.743 15.209  28.431  1.00 25.43  ? 576 ASP E C   1 
ATOM   3796 O O   . ASP E 1 23  ? -15.932 15.081  29.621  1.00 22.56  ? 576 ASP E O   1 
ATOM   3797 C CB  . ASP E 1 23  ? -13.719 16.415  27.520  1.00 17.14  ? 576 ASP E CB  1 
ATOM   3798 C CG  . ASP E 1 23  ? -12.208 16.332  27.253  1.00 20.66  ? 576 ASP E CG  1 
ATOM   3799 O OD1 . ASP E 1 23  ? -11.634 15.278  27.544  1.00 29.25  ? 576 ASP E OD1 1 
ATOM   3800 O OD2 . ASP E 1 23  ? -11.613 17.282  26.673  1.00 18.80  ? 576 ASP E OD2 1 
ATOM   3801 N N   . GLN E 1 24  ? -16.718 15.478  27.571  1.00 16.72  ? 577 GLN E N   1 
ATOM   3802 C CA  . GLN E 1 24  ? -18.121 15.577  27.954  1.00 27.07  ? 577 GLN E CA  1 
ATOM   3803 C C   . GLN E 1 24  ? -18.658 14.288  28.556  1.00 28.02  ? 577 GLN E C   1 
ATOM   3804 O O   . GLN E 1 24  ? -19.381 14.342  29.541  1.00 30.00  ? 577 GLN E O   1 
ATOM   3805 C CB  . GLN E 1 24  ? -18.982 15.991  26.750  1.00 16.26  ? 577 GLN E CB  1 
ATOM   3806 C CG  . GLN E 1 24  ? -18.717 17.443  26.283  1.00 28.15  ? 577 GLN E CG  1 
ATOM   3807 C CD  . GLN E 1 24  ? -19.583 17.897  25.074  1.00 54.19  ? 577 GLN E CD  1 
ATOM   3808 O OE1 . GLN E 1 24  ? -20.812 17.792  25.083  1.00 38.83  ? 577 GLN E OE1 1 
ATOM   3809 N NE2 . GLN E 1 24  ? -18.928 18.414  24.048  1.00 40.53  ? 577 GLN E NE2 1 
ATOM   3810 N N   . LEU E 1 25  ? -18.289 13.149  27.974  1.00 31.45  ? 578 LEU E N   1 
ATOM   3811 C CA  . LEU E 1 25  ? -18.616 11.839  28.527  1.00 27.67  ? 578 LEU E CA  1 
ATOM   3812 C C   . LEU E 1 25  ? -17.993 11.628  29.893  1.00 22.30  ? 578 LEU E C   1 
ATOM   3813 O O   . LEU E 1 25  ? -18.679 11.204  30.823  1.00 26.91  ? 578 LEU E O   1 
ATOM   3814 C CB  . LEU E 1 25  ? -18.177 10.682  27.584  1.00 31.60  ? 578 LEU E CB  1 
ATOM   3815 C CG  . LEU E 1 25  ? -18.989 10.489  26.294  1.00 34.71  ? 578 LEU E CG  1 
ATOM   3816 C CD1 . LEU E 1 25  ? -18.509 9.267   25.485  1.00 25.12  ? 578 LEU E CD1 1 
ATOM   3817 C CD2 . LEU E 1 25  ? -20.453 10.374  26.594  1.00 20.93  ? 578 LEU E CD2 1 
ATOM   3818 N N   . GLN E 1 26  ? -16.704 11.935  30.035  1.00 33.42  ? 579 GLN E N   1 
ATOM   3819 C CA  . GLN E 1 26  ? -16.044 11.850  31.341  1.00 32.46  ? 579 GLN E CA  1 
ATOM   3820 C C   . GLN E 1 26  ? -16.624 12.855  32.348  1.00 30.64  ? 579 GLN E C   1 
ATOM   3821 O O   . GLN E 1 26  ? -16.498 12.651  33.552  1.00 26.91  ? 579 GLN E O   1 
ATOM   3822 C CB  . GLN E 1 26  ? -14.523 12.060  31.245  1.00 30.88  ? 579 GLN E CB  1 
ATOM   3823 C CG  . GLN E 1 26  ? -13.806 10.961  30.530  1.00 29.77  ? 579 GLN E CG  1 
ATOM   3824 C CD  . GLN E 1 26  ? -12.446 10.611  31.068  1.00 37.46  ? 579 GLN E CD  1 
ATOM   3825 O OE1 . GLN E 1 26  ? -11.425 10.808  30.401  1.00 24.33  ? 579 GLN E OE1 1 
ATOM   3826 N NE2 . GLN E 1 26  ? -12.421 10.021  32.236  1.00 26.22  ? 579 GLN E NE2 1 
ATOM   3827 N N   . ASP E 1 27  ? -17.255 13.929  31.866  1.00 29.93  ? 580 ASP E N   1 
ATOM   3828 C CA  . ASP E 1 27  ? -17.791 14.945  32.768  1.00 27.87  ? 580 ASP E CA  1 
ATOM   3829 C C   . ASP E 1 27  ? -19.033 14.362  33.379  1.00 34.97  ? 580 ASP E C   1 
ATOM   3830 O O   . ASP E 1 27  ? -19.472 14.799  34.430  1.00 32.45  ? 580 ASP E O   1 
ATOM   3831 C CB  . ASP E 1 27  ? -18.181 16.248  32.058  1.00 30.88  ? 580 ASP E CB  1 
ATOM   3832 C CG  . ASP E 1 27  ? -16.991 17.142  31.700  1.00 34.59  ? 580 ASP E CG  1 
ATOM   3833 O OD1 . ASP E 1 27  ? -15.875 16.995  32.259  1.00 22.87  ? 580 ASP E OD1 1 
ATOM   3834 O OD2 . ASP E 1 27  ? -17.218 18.027  30.843  1.00 24.59  ? 580 ASP E OD2 1 
ATOM   3835 N N   . LYS E 1 28  ? -19.616 13.367  32.722  1.00 30.92  ? 581 LYS E N   1 
ATOM   3836 C CA  . LYS E 1 28  ? -20.775 12.739  33.307  1.00 33.13  ? 581 LYS E CA  1 
ATOM   3837 C C   . LYS E 1 28  ? -20.378 11.619  34.262  1.00 35.18  ? 581 LYS E C   1 
ATOM   3838 O O   . LYS E 1 28  ? -21.234 10.977  34.839  1.00 42.19  ? 581 LYS E O   1 
ATOM   3839 C CB  . LYS E 1 28  ? -21.750 12.303  32.220  1.00 40.38  ? 581 LYS E CB  1 
ATOM   3840 C CG  . LYS E 1 28  ? -22.655 13.464  31.744  1.00 42.66  ? 581 LYS E CG  1 
ATOM   3841 C CD  . LYS E 1 28  ? -22.215 14.081  30.451  1.00 58.94  ? 581 LYS E CD  1 
ATOM   3842 C CE  . LYS E 1 28  ? -22.686 15.528  30.310  1.00 70.14  ? 581 LYS E CE  1 
ATOM   3843 N NZ  . LYS E 1 28  ? -24.174 15.661  30.379  1.00 64.73  ? 581 LYS E NZ  1 
ATOM   3844 N N   . ASP E 1 29  ? -19.082 11.439  34.505  1.00 34.44  ? 582 ASP E N   1 
ATOM   3845 C CA  . ASP E 1 29  ? -18.616 10.412  35.439  1.00 32.83  ? 582 ASP E CA  1 
ATOM   3846 C C   . ASP E 1 29  ? -17.672 11.069  36.402  1.00 29.40  ? 582 ASP E C   1 
ATOM   3847 O O   . ASP E 1 29  ? -16.504 10.709  36.462  1.00 29.96  ? 582 ASP E O   1 
ATOM   3848 C CB  . ASP E 1 29  ? -17.948 9.242   34.686  1.00 35.77  ? 582 ASP E CB  1 
ATOM   3849 C CG  . ASP E 1 29  ? -17.424 8.159   35.607  1.00 42.45  ? 582 ASP E CG  1 
ATOM   3850 O OD1 . ASP E 1 29  ? -18.157 7.759   36.540  1.00 45.03  ? 582 ASP E OD1 1 
ATOM   3851 O OD2 . ASP E 1 29  ? -16.277 7.707   35.384  1.00 39.90  ? 582 ASP E OD2 1 
ATOM   3852 N N   . PRO E 1 30  ? -18.173 12.067  37.166  1.00 33.68  ? 583 PRO E N   1 
ATOM   3853 C CA  . PRO E 1 30  ? -17.298 12.699  38.131  1.00 27.86  ? 583 PRO E CA  1 
ATOM   3854 C C   . PRO E 1 30  ? -16.879 11.716  39.239  1.00 28.05  ? 583 PRO E C   1 
ATOM   3855 O O   . PRO E 1 30  ? -15.788 11.853  39.792  1.00 30.17  ? 583 PRO E O   1 
ATOM   3856 C CB  . PRO E 1 30  ? -18.121 13.900  38.637  1.00 31.51  ? 583 PRO E CB  1 
ATOM   3857 C CG  . PRO E 1 30  ? -19.528 13.522  38.396  1.00 34.97  ? 583 PRO E CG  1 
ATOM   3858 C CD  . PRO E 1 30  ? -19.496 12.717  37.124  1.00 28.71  ? 583 PRO E CD  1 
ATOM   3859 N N   . ALA E 1 31  ? -17.654 10.673  39.481  1.00 27.00  ? 584 ALA E N   1 
ATOM   3860 C CA  . ALA E 1 31  ? -17.181 9.574   40.356  1.00 34.96  ? 584 ALA E CA  1 
ATOM   3861 C C   . ALA E 1 31  ? -15.971 8.784   39.835  1.00 37.00  ? 584 ALA E C   1 
ATOM   3862 O O   . ALA E 1 31  ? -15.448 7.968   40.577  1.00 29.21  ? 584 ALA E O   1 
ATOM   3863 C CB  . ALA E 1 31  ? -18.319 8.589   40.674  1.00 29.02  ? 584 ALA E CB  1 
ATOM   3864 N N   . ARG E 1 32  ? -15.579 8.973   38.568  1.00 35.68  ? 585 ARG E N   1 
ATOM   3865 C CA  . ARG E 1 32  ? -14.453 8.237   37.949  1.00 32.72  ? 585 ARG E CA  1 
ATOM   3866 C C   . ARG E 1 32  ? -14.563 6.709   38.085  1.00 35.90  ? 585 ARG E C   1 
ATOM   3867 O O   . ARG E 1 32  ? -13.575 6.018   38.273  1.00 29.59  ? 585 ARG E O   1 
ATOM   3868 C CB  . ARG E 1 32  ? -13.097 8.735   38.503  1.00 32.36  ? 585 ARG E CB  1 
ATOM   3869 C CG  . ARG E 1 32  ? -12.850 10.230  38.226  1.00 39.19  ? 585 ARG E CG  1 
ATOM   3870 C CD  . ARG E 1 32  ? -11.627 10.778  38.927  1.00 39.57  ? 585 ARG E CD  1 
ATOM   3871 N NE  . ARG E 1 32  ? -10.452 9.933   38.713  1.00 35.22  ? 585 ARG E NE  1 
ATOM   3872 C CZ  . ARG E 1 32  ? -9.758  9.881   37.579  1.00 32.52  ? 585 ARG E CZ  1 
ATOM   3873 N NH1 . ARG E 1 32  ? -10.101 10.614  36.511  1.00 32.41  ? 585 ARG E NH1 1 
ATOM   3874 N NH2 . ARG E 1 32  ? -8.728  9.074   37.503  1.00 29.55  ? 585 ARG E NH2 1 
ATOM   3875 N N   . ILE E 1 33  ? -15.783 6.196   38.009  1.00 36.54  ? 586 ILE E N   1 
ATOM   3876 C CA  . ILE E 1 33  ? -16.022 4.768   38.040  1.00 32.20  ? 586 ILE E CA  1 
ATOM   3877 C C   . ILE E 1 33  ? -15.457 4.122   36.768  1.00 38.19  ? 586 ILE E C   1 
ATOM   3878 O O   . ILE E 1 33  ? -14.886 3.038   36.812  1.00 31.93  ? 586 ILE E O   1 
ATOM   3879 C CB  . ILE E 1 33  ? -17.528 4.470   38.174  1.00 32.99  ? 586 ILE E CB  1 
ATOM   3880 C CG1 . ILE E 1 33  ? -17.943 4.671   39.621  1.00 37.24  ? 586 ILE E CG1 1 
ATOM   3881 C CG2 . ILE E 1 33  ? -17.855 3.058   37.729  1.00 27.85  ? 586 ILE E CG2 1 
ATOM   3882 C CD1 . ILE E 1 33  ? -19.395 4.711   39.803  1.00 35.82  ? 586 ILE E CD1 1 
ATOM   3883 N N   . PHE E 1 34  ? -15.595 4.824   35.651  1.00 34.11  ? 587 PHE E N   1 
ATOM   3884 C CA  . PHE E 1 34  ? -15.167 4.329   34.359  1.00 29.53  ? 587 PHE E CA  1 
ATOM   3885 C C   . PHE E 1 34  ? -13.835 4.923   33.842  1.00 32.76  ? 587 PHE E C   1 
ATOM   3886 O O   . PHE E 1 34  ? -13.490 4.682   32.698  1.00 27.99  ? 587 PHE E O   1 
ATOM   3887 C CB  . PHE E 1 34  ? -16.298 4.618   33.387  1.00 31.13  ? 587 PHE E CB  1 
ATOM   3888 C CG  . PHE E 1 34  ? -17.606 4.037   33.835  1.00 22.15  ? 587 PHE E CG  1 
ATOM   3889 C CD1 . PHE E 1 34  ? -17.841 2.671   33.701  1.00 32.67  ? 587 PHE E CD1 1 
ATOM   3890 C CD2 . PHE E 1 34  ? -18.551 4.813   34.472  1.00 32.29  ? 587 PHE E CD2 1 
ATOM   3891 C CE1 . PHE E 1 34  ? -19.041 2.101   34.150  1.00 33.77  ? 587 PHE E CE1 1 
ATOM   3892 C CE2 . PHE E 1 34  ? -19.756 4.252   34.916  1.00 31.39  ? 587 PHE E CE2 1 
ATOM   3893 C CZ  . PHE E 1 34  ? -19.992 2.896   34.748  1.00 34.10  ? 587 PHE E CZ  1 
ATOM   3894 N N   . ALA E 1 35  ? -13.100 5.651   34.698  1.00 24.24  ? 588 ALA E N   1 
ATOM   3895 C CA  . ALA E 1 35  ? -11.922 6.431   34.297  1.00 28.17  ? 588 ALA E CA  1 
ATOM   3896 C C   . ALA E 1 35  ? -10.707 5.625   33.923  1.00 36.40  ? 588 ALA E C   1 
ATOM   3897 O O   . ALA E 1 35  ? -9.902  6.065   33.083  1.00 33.66  ? 588 ALA E O   1 
ATOM   3898 C CB  . ALA E 1 35  ? -11.520 7.402   35.406  1.00 13.00  ? 588 ALA E CB  1 
ATOM   3899 N N   . GLN E 1 36  ? -10.551 4.477   34.572  1.00 37.04  ? 589 GLN E N   1 
ATOM   3900 C CA  . GLN E 1 36  ? -9.323  3.704   34.490  1.00 33.21  ? 589 GLN E CA  1 
ATOM   3901 C C   . GLN E 1 36  ? -9.657  2.242   34.342  1.00 34.57  ? 589 GLN E C   1 
ATOM   3902 O O   . GLN E 1 36  ? -10.775 1.814   34.654  1.00 27.25  ? 589 GLN E O   1 
ATOM   3903 C CB  . GLN E 1 36  ? -8.480  3.904   35.741  1.00 32.29  ? 589 GLN E CB  1 
ATOM   3904 C CG  . GLN E 1 36  ? -7.712  5.192   35.760  1.00 50.07  ? 589 GLN E CG  1 
ATOM   3905 C CD  . GLN E 1 36  ? -7.021  5.433   37.086  1.00 50.99  ? 589 GLN E CD  1 
ATOM   3906 O OE1 . GLN E 1 36  ? -7.671  5.680   38.101  1.00 43.20  ? 589 GLN E OE1 1 
ATOM   3907 N NE2 . GLN E 1 36  ? -5.700  5.360   37.081  1.00 41.16  ? 589 GLN E NE2 1 
ATOM   3908 N N   . PRO E 1 37  ? -8.697  1.466   33.823  1.00 41.13  ? 590 PRO E N   1 
ATOM   3909 C CA  . PRO E 1 37  ? -9.013  0.071   33.607  1.00 48.99  ? 590 PRO E CA  1 
ATOM   3910 C C   . PRO E 1 37  ? -9.343  -0.590  34.940  1.00 47.48  ? 590 PRO E C   1 
ATOM   3911 O O   . PRO E 1 37  ? -8.693  -0.303  35.959  1.00 43.76  ? 590 PRO E O   1 
ATOM   3912 C CB  . PRO E 1 37  ? -7.732  -0.515  32.985  1.00 51.34  ? 590 PRO E CB  1 
ATOM   3913 C CG  . PRO E 1 37  ? -6.726  0.543   32.987  1.00 53.47  ? 590 PRO E CG  1 
ATOM   3914 C CD  . PRO E 1 37  ? -7.365  1.839   33.330  1.00 41.18  ? 590 PRO E CD  1 
ATOM   3915 N N   . VAL E 1 38  ? -10.375 -1.421  34.932  1.00 46.58  ? 591 VAL E N   1 
ATOM   3916 C CA  . VAL E 1 38  ? -10.697 -2.271  36.082  1.00 52.92  ? 591 VAL E CA  1 
ATOM   3917 C C   . VAL E 1 38  ? -9.440  -3.034  36.553  1.00 51.59  ? 591 VAL E C   1 
ATOM   3918 O O   . VAL E 1 38  ? -8.625  -3.460  35.739  1.00 47.81  ? 591 VAL E O   1 
ATOM   3919 C CB  . VAL E 1 38  ? -11.803 -3.282  35.730  1.00 48.47  ? 591 VAL E CB  1 
ATOM   3920 C CG1 . VAL E 1 38  ? -11.998 -4.254  36.862  1.00 64.43  ? 591 VAL E CG1 1 
ATOM   3921 C CG2 . VAL E 1 38  ? -13.112 -2.572  35.439  1.00 49.04  ? 591 VAL E CG2 1 
ATOM   3922 N N   . SER E 1 39  ? -9.287  -3.174  37.862  1.00 51.88  ? 592 SER E N   1 
ATOM   3923 C CA  . SER E 1 39  ? -8.094  -3.784  38.472  1.00 60.76  ? 592 SER E CA  1 
ATOM   3924 C C   . SER E 1 39  ? -8.307  -5.280  38.695  1.00 62.32  ? 592 SER E C   1 
ATOM   3925 O O   . SER E 1 39  ? -9.307  -5.683  39.290  1.00 58.64  ? 592 SER E O   1 
ATOM   3926 C CB  . SER E 1 39  ? -7.777  -3.097  39.816  1.00 61.89  ? 592 SER E CB  1 
ATOM   3927 O OG  . SER E 1 39  ? -6.679  -3.715  40.482  1.00 68.61  ? 592 SER E OG  1 
ATOM   3928 N N   . LEU E 1 40  ? -7.382  -6.100  38.197  1.00 68.81  ? 593 LEU E N   1 
ATOM   3929 C CA  . LEU E 1 40  ? -7.455  -7.558  38.405  1.00 68.92  ? 593 LEU E CA  1 
ATOM   3930 C C   . LEU E 1 40  ? -7.162  -7.956  39.846  1.00 65.44  ? 593 LEU E C   1 
ATOM   3931 O O   . LEU E 1 40  ? -7.734  -8.908  40.351  1.00 63.77  ? 593 LEU E O   1 
ATOM   3932 C CB  . LEU E 1 40  ? -6.478  -8.299  37.499  1.00 69.53  ? 593 LEU E CB  1 
ATOM   3933 C CG  . LEU E 1 40  ? -6.610  -8.167  35.985  1.00 68.46  ? 593 LEU E CG  1 
ATOM   3934 C CD1 . LEU E 1 40  ? -5.795  -9.296  35.342  1.00 46.90  ? 593 LEU E CD1 1 
ATOM   3935 C CD2 . LEU E 1 40  ? -8.063  -8.171  35.510  1.00 61.31  ? 593 LEU E CD2 1 
ATOM   3936 N N   . LYS E 1 41  ? -6.260  -7.240  40.505  1.00 66.20  ? 594 LYS E N   1 
ATOM   3937 C CA  . LYS E 1 41  ? -6.042  -7.463  41.925  1.00 71.73  ? 594 LYS E CA  1 
ATOM   3938 C C   . LYS E 1 41  ? -7.387  -7.446  42.679  1.00 72.08  ? 594 LYS E C   1 
ATOM   3939 O O   . LYS E 1 41  ? -7.642  -8.315  43.514  1.00 79.64  ? 594 LYS E O   1 
ATOM   3940 C CB  . LYS E 1 41  ? -5.104  -6.397  42.525  1.00 74.86  ? 594 LYS E CB  1 
ATOM   3941 C CG  . LYS E 1 41  ? -3.660  -6.429  42.021  1.00 89.11  ? 594 LYS E CG  1 
ATOM   3942 C CD  . LYS E 1 41  ? -2.781  -7.457  42.742  1.00 89.72  ? 594 LYS E CD  1 
ATOM   3943 C CE  . LYS E 1 41  ? -1.464  -7.642  41.982  1.00 90.03  ? 594 LYS E CE  1 
ATOM   3944 N NZ  . LYS E 1 41  ? -0.624  -8.769  42.469  1.00 89.95  ? 594 LYS E NZ  1 
ATOM   3945 N N   . GLU E 1 42  ? -8.238  -6.464  42.369  1.00 64.99  ? 595 GLU E N   1 
ATOM   3946 C CA  . GLU E 1 42  ? -9.505  -6.250  43.076  1.00 60.81  ? 595 GLU E CA  1 
ATOM   3947 C C   . GLU E 1 42  ? -10.655 -7.130  42.573  1.00 56.14  ? 595 GLU E C   1 
ATOM   3948 O O   . GLU E 1 42  ? -11.609 -7.394  43.311  1.00 61.15  ? 595 GLU E O   1 
ATOM   3949 C CB  . GLU E 1 42  ? -9.921  -4.770  42.965  1.00 58.15  ? 595 GLU E CB  1 
ATOM   3950 N N   . VAL E 1 43  ? -10.571 -7.544  41.313  1.00 52.99  ? 596 VAL E N   1 
ATOM   3951 C CA  . VAL E 1 43  ? -11.642 -8.283  40.630  1.00 48.21  ? 596 VAL E CA  1 
ATOM   3952 C C   . VAL E 1 43  ? -10.959 -9.320  39.742  1.00 51.94  ? 596 VAL E C   1 
ATOM   3953 O O   . VAL E 1 43  ? -10.981 -9.218  38.509  1.00 53.04  ? 596 VAL E O   1 
ATOM   3954 C CB  . VAL E 1 43  ? -12.583 -7.353  39.787  1.00 45.03  ? 596 VAL E CB  1 
ATOM   3955 C CG1 . VAL E 1 43  ? -13.702 -8.167  39.178  1.00 48.49  ? 596 VAL E CG1 1 
ATOM   3956 C CG2 . VAL E 1 43  ? -13.183 -6.214  40.635  1.00 38.22  ? 596 VAL E CG2 1 
ATOM   3957 N N   . PRO E 1 44  ? -10.355 -10.346 40.373  1.00 56.26  ? 597 PRO E N   1 
ATOM   3958 C CA  . PRO E 1 44  ? -9.491  -11.298 39.654  1.00 53.60  ? 597 PRO E CA  1 
ATOM   3959 C C   . PRO E 1 44  ? -10.213 -12.219 38.700  1.00 54.29  ? 597 PRO E C   1 
ATOM   3960 O O   . PRO E 1 44  ? -9.555  -12.860 37.878  1.00 53.37  ? 597 PRO E O   1 
ATOM   3961 C CB  . PRO E 1 44  ? -8.810  -12.104 40.771  1.00 56.64  ? 597 PRO E CB  1 
ATOM   3962 C CG  . PRO E 1 44  ? -9.313  -11.543 42.084  1.00 59.62  ? 597 PRO E CG  1 
ATOM   3963 C CD  . PRO E 1 44  ? -10.537 -10.719 41.790  1.00 53.20  ? 597 PRO E CD  1 
ATOM   3964 N N   . ASP E 1 45  ? -11.544 -12.265 38.770  1.00 59.94  ? 598 ASP E N   1 
ATOM   3965 C CA  . ASP E 1 45  ? -12.346 -13.068 37.821  1.00 64.33  ? 598 ASP E CA  1 
ATOM   3966 C C   . ASP E 1 45  ? -12.891 -12.274 36.631  1.00 63.47  ? 598 ASP E C   1 
ATOM   3967 O O   . ASP E 1 45  ? -13.766 -12.774 35.932  1.00 66.89  ? 598 ASP E O   1 
ATOM   3968 C CB  . ASP E 1 45  ? -13.534 -13.734 38.551  1.00 71.66  ? 598 ASP E CB  1 
ATOM   3969 C CG  . ASP E 1 45  ? -14.657 -12.738 38.917  1.00 81.42  ? 598 ASP E CG  1 
ATOM   3970 O OD1 . ASP E 1 45  ? -14.441 -11.514 38.824  1.00 94.62  ? 598 ASP E OD1 1 
ATOM   3971 O OD2 . ASP E 1 45  ? -15.762 -13.181 39.296  1.00 85.09  ? 598 ASP E OD2 1 
ATOM   3972 N N   . TYR E 1 46  ? -12.392 -11.054 36.396  1.00 66.52  ? 599 TYR E N   1 
ATOM   3973 C CA  . TYR E 1 46  ? -12.996 -10.120 35.399  1.00 58.25  ? 599 TYR E CA  1 
ATOM   3974 C C   . TYR E 1 46  ? -12.936 -10.654 33.966  1.00 55.88  ? 599 TYR E C   1 
ATOM   3975 O O   . TYR E 1 46  ? -13.878 -10.482 33.203  1.00 54.59  ? 599 TYR E O   1 
ATOM   3976 C CB  . TYR E 1 46  ? -12.364 -8.703  35.504  1.00 59.71  ? 599 TYR E CB  1 
ATOM   3977 C CG  . TYR E 1 46  ? -13.131 -7.599  34.787  1.00 43.55  ? 599 TYR E CG  1 
ATOM   3978 C CD1 . TYR E 1 46  ? -12.553 -6.874  33.745  1.00 51.40  ? 599 TYR E CD1 1 
ATOM   3979 C CD2 . TYR E 1 46  ? -14.438 -7.297  35.137  1.00 47.92  ? 599 TYR E CD2 1 
ATOM   3980 C CE1 . TYR E 1 46  ? -13.274 -5.865  33.068  1.00 45.86  ? 599 TYR E CE1 1 
ATOM   3981 C CE2 . TYR E 1 46  ? -15.157 -6.298  34.484  1.00 50.12  ? 599 TYR E CE2 1 
ATOM   3982 C CZ  . TYR E 1 46  ? -14.573 -5.593  33.451  1.00 46.79  ? 599 TYR E CZ  1 
ATOM   3983 O OH  . TYR E 1 46  ? -15.296 -4.626  32.810  1.00 41.45  ? 599 TYR E OH  1 
ATOM   3984 N N   . LEU E 1 47  ? -11.854 -11.348 33.629  1.00 60.21  ? 600 LEU E N   1 
ATOM   3985 C CA  . LEU E 1 47  ? -11.621 -11.832 32.259  1.00 62.65  ? 600 LEU E CA  1 
ATOM   3986 C C   . LEU E 1 47  ? -12.320 -13.176 31.917  1.00 61.72  ? 600 LEU E C   1 
ATOM   3987 O O   . LEU E 1 47  ? -12.489 -13.509 30.758  1.00 68.28  ? 600 LEU E O   1 
ATOM   3988 C CB  . LEU E 1 47  ? -10.112 -11.909 32.003  1.00 60.84  ? 600 LEU E CB  1 
ATOM   3989 C CG  . LEU E 1 47  ? -9.395  -10.586 32.324  1.00 60.48  ? 600 LEU E CG  1 
ATOM   3990 C CD1 . LEU E 1 47  ? -7.873  -10.741 32.261  1.00 60.44  ? 600 LEU E CD1 1 
ATOM   3991 C CD2 . LEU E 1 47  ? -9.873  -9.473  31.403  1.00 53.19  ? 600 LEU E CD2 1 
ATOM   3992 N N   . ASP E 1 48  ? -12.731 -13.938 32.925  1.00 67.58  ? 601 ASP E N   1 
ATOM   3993 C CA  . ASP E 1 48  ? -13.620 -15.086 32.707  1.00 64.11  ? 601 ASP E CA  1 
ATOM   3994 C C   . ASP E 1 48  ? -14.878 -14.592 31.988  1.00 64.62  ? 601 ASP E C   1 
ATOM   3995 O O   . ASP E 1 48  ? -15.382 -15.219 31.052  1.00 64.52  ? 601 ASP E O   1 
ATOM   3996 C CB  . ASP E 1 48  ? -14.032 -15.720 34.047  1.00 70.44  ? 601 ASP E CB  1 
ATOM   3997 C CG  . ASP E 1 48  ? -12.833 -16.165 34.906  1.00 64.61  ? 601 ASP E CG  1 
ATOM   3998 O OD1 . ASP E 1 48  ? -11.802 -16.578 34.254  1.00 86.81  ? 601 ASP E OD1 1 
ATOM   3999 O OD2 . ASP E 1 48  ? -12.925 -16.116 36.175  1.00 64.08  ? 601 ASP E OD2 1 
ATOM   4000 N N   . HIS E 1 49  ? -15.355 -13.434 32.425  1.00 62.69  ? 602 HIS E N   1 
ATOM   4001 C CA  . HIS E 1 49  ? -16.636 -12.893 32.013  1.00 64.36  ? 602 HIS E CA  1 
ATOM   4002 C C   . HIS E 1 49  ? -16.516 -11.887 30.858  1.00 57.33  ? 602 HIS E C   1 
ATOM   4003 O O   . HIS E 1 49  ? -17.371 -11.844 29.979  1.00 58.20  ? 602 HIS E O   1 
ATOM   4004 C CB  . HIS E 1 49  ? -17.298 -12.207 33.226  1.00 65.36  ? 602 HIS E CB  1 
ATOM   4005 C CG  . HIS E 1 49  ? -17.760 -13.156 34.296  1.00 80.43  ? 602 HIS E CG  1 
ATOM   4006 N ND1 . HIS E 1 49  ? -17.433 -12.997 35.628  1.00 86.48  ? 602 HIS E ND1 1 
ATOM   4007 C CD2 . HIS E 1 49  ? -18.540 -14.262 34.233  1.00 79.46  ? 602 HIS E CD2 1 
ATOM   4008 C CE1 . HIS E 1 49  ? -17.990 -13.961 36.338  1.00 78.97  ? 602 HIS E CE1 1 
ATOM   4009 N NE2 . HIS E 1 49  ? -18.663 -14.745 35.515  1.00 91.76  ? 602 HIS E NE2 1 
ATOM   4010 N N   . ILE E 1 50  ? -15.465 -11.073 30.866  1.00 53.88  ? 603 ILE E N   1 
ATOM   4011 C CA  . ILE E 1 50  ? -15.387 -9.902  29.976  1.00 47.41  ? 603 ILE E CA  1 
ATOM   4012 C C   . ILE E 1 50  ? -14.256 -10.054 28.994  1.00 45.36  ? 603 ILE E C   1 
ATOM   4013 O O   . ILE E 1 50  ? -13.091 -10.064 29.379  1.00 49.00  ? 603 ILE E O   1 
ATOM   4014 C CB  . ILE E 1 50  ? -15.206 -8.587  30.800  1.00 40.77  ? 603 ILE E CB  1 
ATOM   4015 C CG1 . ILE E 1 50  ? -16.492 -8.253  31.552  1.00 40.24  ? 603 ILE E CG1 1 
ATOM   4016 C CG2 . ILE E 1 50  ? -14.823 -7.423  29.901  1.00 50.44  ? 603 ILE E CG2 1 
ATOM   4017 C CD1 . ILE E 1 50  ? -17.717 -8.047  30.650  1.00 43.51  ? 603 ILE E CD1 1 
ATOM   4018 N N   . LYS E 1 51  ? -14.588 -10.176 27.710  1.00 53.81  ? 604 LYS E N   1 
ATOM   4019 C CA  . LYS E 1 51  ? -13.564 -10.467 26.709  1.00 55.24  ? 604 LYS E CA  1 
ATOM   4020 C C   . LYS E 1 51  ? -12.842 -9.205  26.246  1.00 55.64  ? 604 LYS E C   1 
ATOM   4021 O O   . LYS E 1 51  ? -11.727 -9.276  25.741  1.00 49.06  ? 604 LYS E O   1 
ATOM   4022 C CB  . LYS E 1 51  ? -14.168 -11.220 25.508  1.00 58.81  ? 604 LYS E CB  1 
ATOM   4023 C CG  . LYS E 1 51  ? -14.893 -12.535 25.855  1.00 60.36  ? 604 LYS E CG  1 
ATOM   4024 C CD  . LYS E 1 51  ? -14.054 -13.457 26.743  1.00 60.99  ? 604 LYS E CD  1 
ATOM   4025 C CE  . LYS E 1 51  ? -14.915 -14.465 27.511  1.00 73.34  ? 604 LYS E CE  1 
ATOM   4026 N NZ  . LYS E 1 51  ? -14.298 -14.877 28.815  1.00 54.69  ? 604 LYS E NZ  1 
ATOM   4027 N N   . HIS E 1 52  ? -13.471 -8.051  26.448  1.00 53.92  ? 605 HIS E N   1 
ATOM   4028 C CA  . HIS E 1 52  ? -12.977 -6.824  25.879  1.00 52.74  ? 605 HIS E CA  1 
ATOM   4029 C C   . HIS E 1 52  ? -13.117 -5.649  26.882  1.00 46.93  ? 605 HIS E C   1 
ATOM   4030 O O   . HIS E 1 52  ? -13.980 -4.795  26.723  1.00 42.46  ? 605 HIS E O   1 
ATOM   4031 C CB  . HIS E 1 52  ? -13.734 -6.564  24.569  1.00 52.42  ? 605 HIS E CB  1 
ATOM   4032 C CG  . HIS E 1 52  ? -12.979 -5.729  23.585  1.00 67.04  ? 605 HIS E CG  1 
ATOM   4033 N ND1 . HIS E 1 52  ? -12.826 -6.094  22.263  1.00 78.73  ? 605 HIS E ND1 1 
ATOM   4034 C CD2 . HIS E 1 52  ? -12.322 -4.554  23.729  1.00 75.23  ? 605 HIS E CD2 1 
ATOM   4035 C CE1 . HIS E 1 52  ? -12.118 -5.174  21.634  1.00 75.58  ? 605 HIS E CE1 1 
ATOM   4036 N NE2 . HIS E 1 52  ? -11.800 -4.229  22.500  1.00 68.04  ? 605 HIS E NE2 1 
ATOM   4037 N N   . PRO E 1 53  ? -12.247 -5.604  27.911  1.00 44.61  ? 606 PRO E N   1 
ATOM   4038 C CA  . PRO E 1 53  ? -12.282 -4.492  28.869  1.00 48.58  ? 606 PRO E CA  1 
ATOM   4039 C C   . PRO E 1 53  ? -12.053 -3.153  28.167  1.00 50.02  ? 606 PRO E C   1 
ATOM   4040 O O   . PRO E 1 53  ? -11.390 -3.098  27.126  1.00 46.04  ? 606 PRO E O   1 
ATOM   4041 C CB  . PRO E 1 53  ? -11.110 -4.777  29.828  1.00 42.02  ? 606 PRO E CB  1 
ATOM   4042 C CG  . PRO E 1 53  ? -10.325 -5.907  29.222  1.00 54.32  ? 606 PRO E CG  1 
ATOM   4043 C CD  . PRO E 1 53  ? -11.203 -6.594  28.230  1.00 50.22  ? 606 PRO E CD  1 
ATOM   4044 N N   . MET E 1 54  ? -12.592 -2.093  28.750  1.00 46.86  ? 607 MET E N   1 
ATOM   4045 C CA  . MET E 1 54  ? -12.496 -0.759  28.183  1.00 44.48  ? 607 MET E CA  1 
ATOM   4046 C C   . MET E 1 54  ? -12.802 0.264   29.291  1.00 44.17  ? 607 MET E C   1 
ATOM   4047 O O   . MET E 1 54  ? -13.712 0.050   30.085  1.00 38.32  ? 607 MET E O   1 
ATOM   4048 C CB  . MET E 1 54  ? -13.493 -0.628  27.027  1.00 41.25  ? 607 MET E CB  1 
ATOM   4049 C CG  . MET E 1 54  ? -13.355 0.615   26.144  1.00 38.63  ? 607 MET E CG  1 
ATOM   4050 S SD  . MET E 1 54  ? -11.657 0.984   25.623  1.00 36.22  ? 607 MET E SD  1 
ATOM   4051 C CE  . MET E 1 54  ? -11.286 -0.534  24.677  1.00 36.86  ? 607 MET E CE  1 
ATOM   4052 N N   . ASP E 1 55  ? -12.052 1.368   29.301  1.00 41.64  ? 608 ASP E N   1 
ATOM   4053 C CA  . ASP E 1 55  ? -12.216 2.480   30.245  1.00 40.15  ? 608 ASP E CA  1 
ATOM   4054 C C   . ASP E 1 55  ? -11.910 3.780   29.476  1.00 40.32  ? 608 ASP E C   1 
ATOM   4055 O O   . ASP E 1 55  ? -11.435 3.707   28.335  1.00 32.14  ? 608 ASP E O   1 
ATOM   4056 C CB  . ASP E 1 55  ? -11.227 2.301   31.358  1.00 34.00  ? 608 ASP E CB  1 
ATOM   4057 C CG  . ASP E 1 55  ? -9.818  2.316   30.858  1.00 49.71  ? 608 ASP E CG  1 
ATOM   4058 O OD1 . ASP E 1 55  ? -9.280  3.443   30.789  1.00 46.53  ? 608 ASP E OD1 1 
ATOM   4059 O OD2 . ASP E 1 55  ? -9.266  1.229   30.520  1.00 50.96  ? 608 ASP E OD2 1 
ATOM   4060 N N   . PHE E 1 56  ? -12.173 4.944   30.074  1.00 34.14  ? 609 PHE E N   1 
ATOM   4061 C CA  . PHE E 1 56  ? -11.960 6.210   29.366  1.00 32.95  ? 609 PHE E CA  1 
ATOM   4062 C C   . PHE E 1 56  ? -10.477 6.486   29.073  1.00 26.72  ? 609 PHE E C   1 
ATOM   4063 O O   . PHE E 1 56  ? -10.135 6.960   27.987  1.00 35.14  ? 609 PHE E O   1 
ATOM   4064 C CB  . PHE E 1 56  ? -12.578 7.393   30.100  1.00 30.38  ? 609 PHE E CB  1 
ATOM   4065 C CG  . PHE E 1 56  ? -14.077 7.470   30.015  1.00 23.82  ? 609 PHE E CG  1 
ATOM   4066 C CD1 . PHE E 1 56  ? -14.729 7.412   28.825  1.00 34.96  ? 609 PHE E CD1 1 
ATOM   4067 C CD2 . PHE E 1 56  ? -14.824 7.666   31.169  1.00 34.00  ? 609 PHE E CD2 1 
ATOM   4068 C CE1 . PHE E 1 56  ? -16.101 7.506   28.766  1.00 26.27  ? 609 PHE E CE1 1 
ATOM   4069 C CE2 . PHE E 1 56  ? -16.182 7.771   31.130  1.00 27.78  ? 609 PHE E CE2 1 
ATOM   4070 C CZ  . PHE E 1 56  ? -16.835 7.690   29.911  1.00 36.23  ? 609 PHE E CZ  1 
ATOM   4071 N N   . ALA E 1 57  ? -9.607  6.190   30.020  1.00 27.03  ? 610 ALA E N   1 
ATOM   4072 C CA  . ALA E 1 57  ? -8.160  6.373   29.816  1.00 30.78  ? 610 ALA E CA  1 
ATOM   4073 C C   . ALA E 1 57  ? -7.682  5.561   28.610  1.00 25.46  ? 610 ALA E C   1 
ATOM   4074 O O   . ALA E 1 57  ? -6.907  6.056   27.806  1.00 24.94  ? 610 ALA E O   1 
ATOM   4075 C CB  . ALA E 1 57  ? -7.385  6.006   31.038  1.00 24.14  ? 610 ALA E CB  1 
ATOM   4076 N N   . THR E 1 58  ? -8.206  4.362   28.436  1.00 27.10  ? 611 THR E N   1 
ATOM   4077 C CA  . THR E 1 58  ? -7.882  3.595   27.234  1.00 32.30  ? 611 THR E CA  1 
ATOM   4078 C C   . THR E 1 58  ? -8.475  4.268   25.989  1.00 33.89  ? 611 THR E C   1 
ATOM   4079 O O   . THR E 1 58  ? -7.756  4.480   25.019  1.00 26.51  ? 611 THR E O   1 
ATOM   4080 C CB  . THR E 1 58  ? -8.276  2.117   27.376  1.00 39.10  ? 611 THR E CB  1 
ATOM   4081 O OG1 . THR E 1 58  ? -7.548  1.564   28.477  1.00 32.52  ? 611 THR E OG1 1 
ATOM   4082 C CG2 . THR E 1 58  ? -7.927  1.310   26.097  1.00 34.75  ? 611 THR E CG2 1 
ATOM   4083 N N   . MET E 1 59  ? -9.755  4.664   26.016  1.00 25.83  ? 612 MET E N   1 
ATOM   4084 C CA  . MET E 1 59  ? -10.288 5.423   24.891  1.00 22.50  ? 612 MET E CA  1 
ATOM   4085 C C   . MET E 1 59  ? -9.455  6.645   24.627  1.00 27.59  ? 612 MET E C   1 
ATOM   4086 O O   . MET E 1 59  ? -9.232  6.987   23.470  1.00 32.15  ? 612 MET E O   1 
ATOM   4087 C CB  . MET E 1 59  ? -11.748 5.869   25.093  1.00 23.83  ? 612 MET E CB  1 
ATOM   4088 C CG  . MET E 1 59  ? -12.656 4.725   25.215  1.00 21.20  ? 612 MET E CG  1 
ATOM   4089 S SD  . MET E 1 59  ? -14.342 5.174   25.255  1.00 33.74  ? 612 MET E SD  1 
ATOM   4090 C CE  . MET E 1 59  ? -14.522 6.025   23.683  1.00 29.29  ? 612 MET E CE  1 
ATOM   4091 N N   . ARG E 1 60  ? -9.003  7.320   25.686  1.00 29.91  ? 613 ARG E N   1 
ATOM   4092 C CA  . ARG E 1 60  ? -8.257  8.546   25.476  1.00 31.33  ? 613 ARG E CA  1 
ATOM   4093 C C   . ARG E 1 60  ? -6.873  8.256   24.891  1.00 32.08  ? 613 ARG E C   1 
ATOM   4094 O O   . ARG E 1 60  ? -6.356  9.038   24.104  1.00 35.47  ? 613 ARG E O   1 
ATOM   4095 C CB  . ARG E 1 60  ? -8.154  9.375   26.749  1.00 29.83  ? 613 ARG E CB  1 
ATOM   4096 C CG  . ARG E 1 60  ? -7.437  10.748  26.547  1.00 19.19  ? 613 ARG E CG  1 
ATOM   4097 C CD  . ARG E 1 60  ? -7.414  11.555  27.886  1.00 23.05  ? 613 ARG E CD  1 
ATOM   4098 N NE  . ARG E 1 60  ? -8.770  11.746  28.388  1.00 26.06  ? 613 ARG E NE  1 
ATOM   4099 C CZ  . ARG E 1 60  ? -9.602  12.708  27.980  1.00 16.92  ? 613 ARG E CZ  1 
ATOM   4100 N NH1 . ARG E 1 60  ? -9.220  13.597  27.073  1.00 21.39  ? 613 ARG E NH1 1 
ATOM   4101 N NH2 . ARG E 1 60  ? -10.825 12.784  28.492  1.00 39.72  ? 613 ARG E NH2 1 
ATOM   4102 N N   . LYS E 1 61  ? -6.269  7.152   25.284  1.00 30.17  ? 614 LYS E N   1 
ATOM   4103 C CA  . LYS E 1 61  ? -4.961  6.752   24.714  1.00 35.66  ? 614 LYS E CA  1 
ATOM   4104 C C   . LYS E 1 61  ? -5.049  6.436   23.213  1.00 32.03  ? 614 LYS E C   1 
ATOM   4105 O O   . LYS E 1 61  ? -4.203  6.844   22.439  1.00 30.79  ? 614 LYS E O   1 
ATOM   4106 C CB  . LYS E 1 61  ? -4.442  5.523   25.453  1.00 34.15  ? 614 LYS E CB  1 
ATOM   4107 C CG  . LYS E 1 61  ? -3.152  4.944   24.922  1.00 50.54  ? 614 LYS E CG  1 
ATOM   4108 C CD  . LYS E 1 61  ? -2.040  5.982   24.807  1.00 54.10  ? 614 LYS E CD  1 
ATOM   4109 C CE  . LYS E 1 61  ? -0.704  5.300   24.519  1.00 74.70  ? 614 LYS E CE  1 
ATOM   4110 N NZ  . LYS E 1 61  ? -0.482  4.083   25.373  1.00 65.44  ? 614 LYS E NZ  1 
ATOM   4111 N N   . ARG E 1 62  ? -6.095  5.716   22.807  1.00 38.06  ? 615 ARG E N   1 
ATOM   4112 C CA  . ARG E 1 62  ? -6.277  5.371   21.401  1.00 35.60  ? 615 ARG E CA  1 
ATOM   4113 C C   . ARG E 1 62  ? -6.515  6.667   20.628  1.00 27.96  ? 615 ARG E C   1 
ATOM   4114 O O   . ARG E 1 62  ? -5.965  6.835   19.552  1.00 28.27  ? 615 ARG E O   1 
ATOM   4115 C CB  . ARG E 1 62  ? -7.365  4.260   21.196  1.00 36.70  ? 615 ARG E CB  1 
ATOM   4116 C CG  . ARG E 1 62  ? -8.095  4.192   19.811  1.00 49.62  ? 615 ARG E CG  1 
ATOM   4117 C CD  . ARG E 1 62  ? -8.167  2.777   19.123  1.00 65.38  ? 615 ARG E CD  1 
ATOM   4118 N NE  . ARG E 1 62  ? -9.386  1.961   19.317  1.00 64.96  ? 615 ARG E NE  1 
ATOM   4119 C CZ  . ARG E 1 62  ? -10.345 1.692   18.408  1.00 41.80  ? 615 ARG E CZ  1 
ATOM   4120 N NH1 . ARG E 1 62  ? -10.358 2.211   17.200  1.00 34.72  ? 615 ARG E NH1 1 
ATOM   4121 N NH2 . ARG E 1 62  ? -11.360 0.897   18.740  1.00 26.05  ? 615 ARG E NH2 1 
ATOM   4122 N N   . LEU E 1 63  ? -7.288  7.592   21.178  1.00 35.20  ? 616 LEU E N   1 
ATOM   4123 C CA  . LEU E 1 63  ? -7.621  8.868   20.497  1.00 35.51  ? 616 LEU E CA  1 
ATOM   4124 C C   . LEU E 1 63  ? -6.355  9.629   20.159  1.00 38.39  ? 616 LEU E C   1 
ATOM   4125 O O   . LEU E 1 63  ? -6.075  9.945   19.003  1.00 39.20  ? 616 LEU E O   1 
ATOM   4126 C CB  . LEU E 1 63  ? -8.497  9.724   21.400  1.00 34.77  ? 616 LEU E CB  1 
ATOM   4127 C CG  . LEU E 1 63  ? -9.089  11.042  20.907  1.00 33.71  ? 616 LEU E CG  1 
ATOM   4128 C CD1 . LEU E 1 63  ? -9.675  10.962  19.509  1.00 39.49  ? 616 LEU E CD1 1 
ATOM   4129 C CD2 . LEU E 1 63  ? -10.176 11.436  21.893  1.00 30.96  ? 616 LEU E CD2 1 
ATOM   4130 N N   . GLU E 1 64  ? -5.544  9.848   21.173  1.00 41.83  ? 617 GLU E N   1 
ATOM   4131 C CA  . GLU E 1 64  ? -4.299  10.605  21.024  1.00 40.84  ? 617 GLU E CA  1 
ATOM   4132 C C   . GLU E 1 64  ? -3.245  9.881   20.168  1.00 46.03  ? 617 GLU E C   1 
ATOM   4133 O O   . GLU E 1 64  ? -2.315  10.517  19.676  1.00 46.37  ? 617 GLU E O   1 
ATOM   4134 C CB  . GLU E 1 64  ? -3.778  11.008  22.415  1.00 38.16  ? 617 GLU E CB  1 
ATOM   4135 C CG  . GLU E 1 64  ? -4.813  11.970  23.144  1.00 49.31  ? 617 GLU E CG  1 
ATOM   4136 C CD  . GLU E 1 64  ? -4.461  12.350  24.591  1.00 67.53  ? 617 GLU E CD  1 
ATOM   4137 O OE1 . GLU E 1 64  ? -3.473  11.825  25.148  1.00 58.11  ? 617 GLU E OE1 1 
ATOM   4138 O OE2 . GLU E 1 64  ? -5.188  13.191  25.175  1.00 65.95  ? 617 GLU E OE2 1 
ATOM   4139 N N   . ALA E 1 65  ? -3.394  8.568   19.964  1.00 43.99  ? 618 ALA E N   1 
ATOM   4140 C CA  . ALA E 1 65  ? -2.575  7.848   18.984  1.00 46.64  ? 618 ALA E CA  1 
ATOM   4141 C C   . ALA E 1 65  ? -3.258  7.801   17.604  1.00 44.56  ? 618 ALA E C   1 
ATOM   4142 O O   . ALA E 1 65  ? -2.860  7.019   16.745  1.00 53.58  ? 618 ALA E O   1 
ATOM   4143 C CB  . ALA E 1 65  ? -2.220  6.430   19.474  1.00 42.62  ? 618 ALA E CB  1 
ATOM   4144 N N   . GLN E 1 66  ? -4.251  8.669   17.395  1.00 44.16  ? 619 GLN E N   1 
ATOM   4145 C CA  . GLN E 1 66  ? -5.006  8.742   16.148  1.00 46.49  ? 619 GLN E CA  1 
ATOM   4146 C C   . GLN E 1 66  ? -5.543  7.368   15.709  1.00 43.75  ? 619 GLN E C   1 
ATOM   4147 O O   . GLN E 1 66  ? -5.452  6.989   14.536  1.00 48.84  ? 619 GLN E O   1 
ATOM   4148 C CB  . GLN E 1 66  ? -4.142  9.373   15.052  1.00 52.27  ? 619 GLN E CB  1 
ATOM   4149 C CG  . GLN E 1 66  ? -3.656  10.797  15.385  1.00 64.88  ? 619 GLN E CG  1 
ATOM   4150 C CD  . GLN E 1 66  ? -2.166  11.044  15.066  1.00 82.18  ? 619 GLN E CD  1 
ATOM   4151 O OE1 . GLN E 1 66  ? -1.487  10.230  14.418  1.00 58.30  ? 619 GLN E OE1 1 
ATOM   4152 N NE2 . GLN E 1 66  ? -1.658  12.178  15.536  1.00 89.17  ? 619 GLN E NE2 1 
ATOM   4153 N N   . GLY E 1 67  ? -6.117  6.643   16.666  1.00 32.79  ? 620 GLY E N   1 
ATOM   4154 C CA  . GLY E 1 67  ? -6.671  5.319   16.444  1.00 32.88  ? 620 GLY E CA  1 
ATOM   4155 C C   . GLY E 1 67  ? -8.172  5.256   16.173  1.00 31.68  ? 620 GLY E C   1 
ATOM   4156 O O   . GLY E 1 67  ? -8.732  4.176   16.133  1.00 33.01  ? 620 GLY E O   1 
ATOM   4157 N N   . TYR E 1 68  ? -8.824  6.389   15.964  1.00 24.24  ? 621 TYR E N   1 
ATOM   4158 C CA  . TYR E 1 68  ? -10.252 6.365   15.717  1.00 32.81  ? 621 TYR E CA  1 
ATOM   4159 C C   . TYR E 1 68  ? -10.443 6.918   14.351  1.00 31.15  ? 621 TYR E C   1 
ATOM   4160 O O   . TYR E 1 68  ? -10.151 8.100   14.104  1.00 27.60  ? 621 TYR E O   1 
ATOM   4161 C CB  . TYR E 1 68  ? -11.045 7.177   16.745  1.00 26.65  ? 621 TYR E CB  1 
ATOM   4162 C CG  . TYR E 1 68  ? -11.191 6.482   18.074  1.00 30.82  ? 621 TYR E CG  1 
ATOM   4163 C CD1 . TYR E 1 68  ? -11.782 5.217   18.172  1.00 35.74  ? 621 TYR E CD1 1 
ATOM   4164 C CD2 . TYR E 1 68  ? -10.768 7.085   19.230  1.00 26.61  ? 621 TYR E CD2 1 
ATOM   4165 C CE1 . TYR E 1 68  ? -11.913 4.581   19.397  1.00 46.48  ? 621 TYR E CE1 1 
ATOM   4166 C CE2 . TYR E 1 68  ? -10.894 6.447   20.473  1.00 24.11  ? 621 TYR E CE2 1 
ATOM   4167 C CZ  . TYR E 1 68  ? -11.452 5.214   20.550  1.00 35.01  ? 621 TYR E CZ  1 
ATOM   4168 O OH  . TYR E 1 68  ? -11.542 4.615   21.783  1.00 27.44  ? 621 TYR E OH  1 
ATOM   4169 N N   . LYS E 1 69  ? -10.879 6.041   13.445  1.00 26.93  ? 622 LYS E N   1 
ATOM   4170 C CA  . LYS E 1 69  ? -11.035 6.430   12.056  1.00 26.75  ? 622 LYS E CA  1 
ATOM   4171 C C   . LYS E 1 69  ? -12.393 7.132   11.850  1.00 29.29  ? 622 LYS E C   1 
ATOM   4172 O O   . LYS E 1 69  ? -12.584 7.827   10.879  1.00 27.24  ? 622 LYS E O   1 
ATOM   4173 C CB  . LYS E 1 69  ? -10.907 5.197   11.142  1.00 30.47  ? 622 LYS E CB  1 
ATOM   4174 C CG  . LYS E 1 69  ? -9.521  4.558   11.071  1.00 33.66  ? 622 LYS E CG  1 
ATOM   4175 C CD  . LYS E 1 69  ? -9.418  3.474   9.947   1.00 38.85  ? 622 LYS E CD  1 
ATOM   4176 C CE  . LYS E 1 69  ? -9.656  4.071   8.568   1.00 38.93  ? 622 LYS E CE  1 
ATOM   4177 N NZ  . LYS E 1 69  ? -9.173  3.205   7.479   1.00 45.11  ? 622 LYS E NZ  1 
ATOM   4178 N N   . ASN E 1 70  ? -13.329 6.944   12.764  1.00 31.74  ? 623 ASN E N   1 
ATOM   4179 C CA  . ASN E 1 70  ? -14.693 7.423   12.550  1.00 38.09  ? 623 ASN E CA  1 
ATOM   4180 C C   . ASN E 1 70  ? -15.522 7.326   13.836  1.00 32.36  ? 623 ASN E C   1 
ATOM   4181 O O   . ASN E 1 70  ? -15.152 6.594   14.733  1.00 38.43  ? 623 ASN E O   1 
ATOM   4182 C CB  . ASN E 1 70  ? -15.329 6.632   11.399  1.00 37.10  ? 623 ASN E CB  1 
ATOM   4183 C CG  . ASN E 1 70  ? -15.399 5.137   11.673  1.00 38.70  ? 623 ASN E CG  1 
ATOM   4184 O OD1 . ASN E 1 70  ? -15.912 4.707   12.697  1.00 43.72  ? 623 ASN E OD1 1 
ATOM   4185 N ND2 . ASN E 1 70  ? -14.914 4.339   10.734  1.00 38.22  ? 623 ASN E ND2 1 
ATOM   4186 N N   . LEU E 1 71  ? -16.629 8.055   13.920  1.00 34.57  ? 624 LEU E N   1 
ATOM   4187 C CA  . LEU E 1 71  ? -17.478 8.066   15.130  1.00 32.13  ? 624 LEU E CA  1 
ATOM   4188 C C   . LEU E 1 71  ? -17.827 6.640   15.572  1.00 36.24  ? 624 LEU E C   1 
ATOM   4189 O O   . LEU E 1 71  ? -17.702 6.290   16.746  1.00 37.09  ? 624 LEU E O   1 
ATOM   4190 C CB  . LEU E 1 71  ? -18.757 8.893   14.874  1.00 31.47  ? 624 LEU E CB  1 
ATOM   4191 C CG  . LEU E 1 71  ? -19.843 9.032   15.949  1.00 45.50  ? 624 LEU E CG  1 
ATOM   4192 C CD1 . LEU E 1 71  ? -19.211 9.545   17.207  1.00 24.17  ? 624 LEU E CD1 1 
ATOM   4193 C CD2 . LEU E 1 71  ? -21.054 9.942   15.525  1.00 26.78  ? 624 LEU E CD2 1 
ATOM   4194 N N   . HIS E 1 72  ? -18.230 5.819   14.605  1.00 38.50  ? 625 HIS E N   1 
ATOM   4195 C CA  . HIS E 1 72  ? -18.642 4.453   14.830  1.00 39.24  ? 625 HIS E CA  1 
ATOM   4196 C C   . HIS E 1 72  ? -17.636 3.679   15.709  1.00 36.25  ? 625 HIS E C   1 
ATOM   4197 O O   . HIS E 1 72  ? -18.032 2.998   16.647  1.00 40.80  ? 625 HIS E O   1 
ATOM   4198 C CB  . HIS E 1 72  ? -18.873 3.729   13.474  1.00 43.40  ? 625 HIS E CB  1 
ATOM   4199 C CG  . HIS E 1 72  ? -19.343 2.311   13.613  1.00 48.38  ? 625 HIS E CG  1 
ATOM   4200 N ND1 . HIS E 1 72  ? -20.680 1.962   13.609  1.00 58.50  ? 625 HIS E ND1 1 
ATOM   4201 C CD2 . HIS E 1 72  ? -18.655 1.158   13.802  1.00 50.46  ? 625 HIS E CD2 1 
ATOM   4202 C CE1 . HIS E 1 72  ? -20.791 0.655   13.772  1.00 53.72  ? 625 HIS E CE1 1 
ATOM   4203 N NE2 . HIS E 1 72  ? -19.578 0.145   13.891  1.00 49.95  ? 625 HIS E NE2 1 
ATOM   4204 N N   . GLU E 1 73  ? -16.349 3.772   15.414  1.00 30.29  ? 626 GLU E N   1 
ATOM   4205 C CA  . GLU E 1 73  ? -15.363 3.073   16.242  1.00 32.55  ? 626 GLU E CA  1 
ATOM   4206 C C   . GLU E 1 73  ? -15.346 3.642   17.672  1.00 29.93  ? 626 GLU E C   1 
ATOM   4207 O O   . GLU E 1 73  ? -15.248 2.891   18.613  1.00 37.83  ? 626 GLU E O   1 
ATOM   4208 C CB  . GLU E 1 73  ? -13.971 3.163   15.614  1.00 30.58  ? 626 GLU E CB  1 
ATOM   4209 C CG  . GLU E 1 73  ? -13.820 2.358   14.297  1.00 34.86  ? 626 GLU E CG  1 
ATOM   4210 C CD  . GLU E 1 73  ? -12.501 2.636   13.559  1.00 25.51  ? 626 GLU E CD  1 
ATOM   4211 O OE1 . GLU E 1 73  ? -11.591 3.299   14.125  1.00 51.67  ? 626 GLU E OE1 1 
ATOM   4212 O OE2 . GLU E 1 73  ? -12.360 2.165   12.414  1.00 35.34  ? 626 GLU E OE2 1 
ATOM   4213 N N   . PHE E 1 74  ? -15.450 4.965   17.820  1.00 27.41  ? 627 PHE E N   1 
ATOM   4214 C CA  . PHE E 1 74  ? -15.445 5.600   19.141  1.00 25.79  ? 627 PHE E CA  1 
ATOM   4215 C C   . PHE E 1 74  ? -16.591 4.988   19.889  1.00 29.05  ? 627 PHE E C   1 
ATOM   4216 O O   . PHE E 1 74  ? -16.377 4.337   20.917  1.00 29.07  ? 627 PHE E O   1 
ATOM   4217 C CB  . PHE E 1 74  ? -15.589 7.116   18.996  1.00 35.50  ? 627 PHE E CB  1 
ATOM   4218 C CG  . PHE E 1 74  ? -15.402 7.892   20.261  1.00 29.31  ? 627 PHE E CG  1 
ATOM   4219 C CD1 . PHE E 1 74  ? -16.483 8.170   21.082  1.00 40.69  ? 627 PHE E CD1 1 
ATOM   4220 C CD2 . PHE E 1 74  ? -14.157 8.400   20.602  1.00 40.41  ? 627 PHE E CD2 1 
ATOM   4221 C CE1 . PHE E 1 74  ? -16.327 8.900   22.248  1.00 37.58  ? 627 PHE E CE1 1 
ATOM   4222 C CE2 . PHE E 1 74  ? -14.000 9.156   21.755  1.00 34.30  ? 627 PHE E CE2 1 
ATOM   4223 C CZ  . PHE E 1 74  ? -15.102 9.395   22.579  1.00 25.58  ? 627 PHE E CZ  1 
ATOM   4224 N N   . GLU E 1 75  ? -17.796 5.111   19.318  1.00 23.40  ? 628 GLU E N   1 
ATOM   4225 C CA  . GLU E 1 75  ? -18.998 4.609   19.936  1.00 28.82  ? 628 GLU E CA  1 
ATOM   4226 C C   . GLU E 1 75  ? -18.889 3.177   20.353  1.00 32.87  ? 628 GLU E C   1 
ATOM   4227 O O   . GLU E 1 75  ? -19.376 2.803   21.399  1.00 38.87  ? 628 GLU E O   1 
ATOM   4228 C CB  . GLU E 1 75  ? -20.189 4.677   18.953  1.00 31.73  ? 628 GLU E CB  1 
ATOM   4229 C CG  . GLU E 1 75  ? -20.648 6.042   18.721  1.00 25.92  ? 628 GLU E CG  1 
ATOM   4230 C CD  . GLU E 1 75  ? -22.031 6.106   18.155  1.00 46.91  ? 628 GLU E CD  1 
ATOM   4231 O OE1 . GLU E 1 75  ? -22.973 5.620   18.826  1.00 60.92  ? 628 GLU E OE1 1 
ATOM   4232 O OE2 . GLU E 1 75  ? -22.166 6.675   17.056  1.00 52.81  ? 628 GLU E OE2 1 
ATOM   4233 N N   . GLU E 1 76  ? -18.305 2.367   19.481  1.00 35.63  ? 629 GLU E N   1 
ATOM   4234 C CA  . GLU E 1 76  ? -18.153 0.953   19.743  1.00 40.42  ? 629 GLU E CA  1 
ATOM   4235 C C   . GLU E 1 76  ? -17.407 0.754   21.057  1.00 33.22  ? 629 GLU E C   1 
ATOM   4236 O O   . GLU E 1 76  ? -17.840 -0.052  21.904  1.00 31.61  ? 629 GLU E O   1 
ATOM   4237 C CB  . GLU E 1 76  ? -17.436 0.259   18.560  1.00 43.44  ? 629 GLU E CB  1 
ATOM   4238 C CG  . GLU E 1 76  ? -17.388 -1.254  18.662  1.00 45.33  ? 629 GLU E CG  1 
ATOM   4239 C CD  . GLU E 1 76  ? -17.171 -1.963  17.317  1.00 58.01  ? 629 GLU E CD  1 
ATOM   4240 O OE1 . GLU E 1 76  ? -16.961 -1.305  16.251  1.00 49.61  ? 629 GLU E OE1 1 
ATOM   4241 O OE2 . GLU E 1 76  ? -17.207 -3.210  17.352  1.00 53.53  ? 629 GLU E OE2 1 
ATOM   4242 N N   . ASP E 1 77  ? -16.329 1.520   21.239  1.00 29.44  ? 630 ASP E N   1 
ATOM   4243 C CA  . ASP E 1 77  ? -15.592 1.546   22.527  1.00 36.98  ? 630 ASP E CA  1 
ATOM   4244 C C   . ASP E 1 77  ? -16.446 2.073   23.677  1.00 32.03  ? 630 ASP E C   1 
ATOM   4245 O O   . ASP E 1 77  ? -16.407 1.515   24.760  1.00 34.06  ? 630 ASP E O   1 
ATOM   4246 C CB  . ASP E 1 77  ? -14.273 2.359   22.452  1.00 37.57  ? 630 ASP E CB  1 
ATOM   4247 C CG  . ASP E 1 77  ? -13.094 1.544   21.901  1.00 47.22  ? 630 ASP E CG  1 
ATOM   4248 O OD1 . ASP E 1 77  ? -13.220 0.310   21.740  1.00 44.46  ? 630 ASP E OD1 1 
ATOM   4249 O OD2 . ASP E 1 77  ? -12.024 2.146   21.648  1.00 42.72  ? 630 ASP E OD2 1 
ATOM   4250 N N   . PHE E 1 78  ? -17.244 3.112   23.454  1.00 32.18  ? 631 PHE E N   1 
ATOM   4251 C CA  . PHE E 1 78  ? -18.068 3.605   24.544  1.00 32.29  ? 631 PHE E CA  1 
ATOM   4252 C C   . PHE E 1 78  ? -19.037 2.502   25.001  1.00 36.89  ? 631 PHE E C   1 
ATOM   4253 O O   . PHE E 1 78  ? -19.271 2.306   26.207  1.00 32.07  ? 631 PHE E O   1 
ATOM   4254 C CB  . PHE E 1 78  ? -18.849 4.863   24.156  1.00 33.25  ? 631 PHE E CB  1 
ATOM   4255 C CG  . PHE E 1 78  ? -19.734 5.352   25.250  1.00 22.12  ? 631 PHE E CG  1 
ATOM   4256 C CD1 . PHE E 1 78  ? -19.191 5.777   26.447  1.00 40.08  ? 631 PHE E CD1 1 
ATOM   4257 C CD2 . PHE E 1 78  ? -21.105 5.332   25.116  1.00 43.31  ? 631 PHE E CD2 1 
ATOM   4258 C CE1 . PHE E 1 78  ? -20.001 6.187   27.478  1.00 32.07  ? 631 PHE E CE1 1 
ATOM   4259 C CE2 . PHE E 1 78  ? -21.911 5.740   26.137  1.00 32.68  ? 631 PHE E CE2 1 
ATOM   4260 C CZ  . PHE E 1 78  ? -21.367 6.173   27.317  1.00 34.71  ? 631 PHE E CZ  1 
ATOM   4261 N N   . ASP E 1 79  ? -19.601 1.772   24.043  1.00 42.21  ? 632 ASP E N   1 
ATOM   4262 C CA  . ASP E 1 79  ? -20.633 0.770   24.366  1.00 43.82  ? 632 ASP E CA  1 
ATOM   4263 C C   . ASP E 1 79  ? -19.977 -0.396  25.110  1.00 36.03  ? 632 ASP E C   1 
ATOM   4264 O O   . ASP E 1 79  ? -20.572 -1.008  25.984  1.00 38.57  ? 632 ASP E O   1 
ATOM   4265 C CB  . ASP E 1 79  ? -21.367 0.312   23.098  1.00 50.68  ? 632 ASP E CB  1 
ATOM   4266 C CG  . ASP E 1 79  ? -22.126 1.446   22.415  1.00 64.66  ? 632 ASP E CG  1 
ATOM   4267 O OD1 . ASP E 1 79  ? -22.782 2.249   23.116  1.00 82.57  ? 632 ASP E OD1 1 
ATOM   4268 O OD2 . ASP E 1 79  ? -22.058 1.539   21.169  1.00 102.62 ? 632 ASP E OD2 1 
ATOM   4269 N N   . LEU E 1 80  ? -18.711 -0.643  24.810  1.00 40.61  ? 633 LEU E N   1 
ATOM   4270 C CA  . LEU E 1 80  ? -17.917 -1.607  25.564  1.00 42.44  ? 633 LEU E CA  1 
ATOM   4271 C C   . LEU E 1 80  ? -17.793 -1.224  27.028  1.00 41.09  ? 633 LEU E C   1 
ATOM   4272 O O   . LEU E 1 80  ? -17.776 -2.097  27.889  1.00 46.51  ? 633 LEU E O   1 
ATOM   4273 C CB  . LEU E 1 80  ? -16.524 -1.741  24.949  1.00 44.21  ? 633 LEU E CB  1 
ATOM   4274 C CG  . LEU E 1 80  ? -16.199 -3.122  24.383  1.00 58.37  ? 633 LEU E CG  1 
ATOM   4275 C CD1 . LEU E 1 80  ? -17.415 -3.820  23.693  1.00 46.72  ? 633 LEU E CD1 1 
ATOM   4276 C CD2 . LEU E 1 80  ? -15.018 -2.956  23.453  1.00 38.43  ? 633 LEU E CD2 1 
ATOM   4277 N N   . ILE E 1 81  ? -17.706 0.080   27.305  1.00 39.89  ? 634 ILE E N   1 
ATOM   4278 C CA  . ILE E 1 81  ? -17.660 0.573   28.676  1.00 34.86  ? 634 ILE E CA  1 
ATOM   4279 C C   . ILE E 1 81  ? -18.965 0.225   29.362  1.00 34.85  ? 634 ILE E C   1 
ATOM   4280 O O   . ILE E 1 81  ? -18.976 -0.352  30.477  1.00 40.71  ? 634 ILE E O   1 
ATOM   4281 C CB  . ILE E 1 81  ? -17.522 2.096   28.785  1.00 36.05  ? 634 ILE E CB  1 
ATOM   4282 C CG1 . ILE E 1 81  ? -16.321 2.650   27.990  1.00 40.39  ? 634 ILE E CG1 1 
ATOM   4283 C CG2 . ILE E 1 81  ? -17.453 2.505   30.271  1.00 29.08  ? 634 ILE E CG2 1 
ATOM   4284 C CD1 . ILE E 1 81  ? -14.971 2.429   28.616  1.00 33.36  ? 634 ILE E CD1 1 
ATOM   4285 N N   . ILE E 1 82  ? -20.049 0.594   28.681  1.00 33.91  ? 635 ILE E N   1 
ATOM   4286 C CA  . ILE E 1 82  ? -21.409 0.471   29.193  1.00 34.80  ? 635 ILE E CA  1 
ATOM   4287 C C   . ILE E 1 82  ? -21.848 -0.982  29.267  1.00 43.19  ? 635 ILE E C   1 
ATOM   4288 O O   . ILE E 1 82  ? -22.350 -1.424  30.297  1.00 43.01  ? 635 ILE E O   1 
ATOM   4289 C CB  . ILE E 1 82  ? -22.413 1.208   28.282  1.00 34.18  ? 635 ILE E CB  1 
ATOM   4290 C CG1 . ILE E 1 82  ? -22.122 2.716   28.262  1.00 43.71  ? 635 ILE E CG1 1 
ATOM   4291 C CG2 . ILE E 1 82  ? -23.854 0.957   28.762  1.00 36.12  ? 635 ILE E CG2 1 
ATOM   4292 C CD1 . ILE E 1 82  ? -22.212 3.378   29.597  1.00 33.42  ? 635 ILE E CD1 1 
ATOM   4293 N N   . ASP E 1 83  ? -21.649 -1.715  28.170  1.00 43.32  ? 636 ASP E N   1 
ATOM   4294 C CA  . ASP E 1 83  ? -22.149 -3.076  28.066  1.00 41.59  ? 636 ASP E CA  1 
ATOM   4295 C C   . ASP E 1 83  ? -21.407 -3.988  29.018  1.00 42.94  ? 636 ASP E C   1 
ATOM   4296 O O   . ASP E 1 83  ? -22.025 -4.802  29.693  1.00 45.05  ? 636 ASP E O   1 
ATOM   4297 C CB  . ASP E 1 83  ? -22.055 -3.594  26.631  1.00 45.31  ? 636 ASP E CB  1 
ATOM   4298 C CG  . ASP E 1 83  ? -22.896 -2.787  25.652  1.00 44.34  ? 636 ASP E CG  1 
ATOM   4299 O OD1 . ASP E 1 83  ? -23.817 -2.052  26.090  1.00 50.76  ? 636 ASP E OD1 1 
ATOM   4300 O OD2 . ASP E 1 83  ? -22.612 -2.881  24.433  1.00 65.69  ? 636 ASP E OD2 1 
ATOM   4301 N N   . ASN E 1 84  ? -20.090 -3.841  29.121  1.00 43.84  ? 637 ASN E N   1 
ATOM   4302 C CA  . ASN E 1 84  ? -19.339 -4.744  29.983  1.00 46.89  ? 637 ASN E CA  1 
ATOM   4303 C C   . ASN E 1 84  ? -19.831 -4.683  31.414  1.00 52.31  ? 637 ASN E C   1 
ATOM   4304 O O   . ASN E 1 84  ? -20.186 -5.723  32.003  1.00 48.42  ? 637 ASN E O   1 
ATOM   4305 C CB  . ASN E 1 84  ? -17.861 -4.424  29.954  1.00 47.86  ? 637 ASN E CB  1 
ATOM   4306 C CG  . ASN E 1 84  ? -17.228 -4.828  28.676  1.00 45.82  ? 637 ASN E CG  1 
ATOM   4307 O OD1 . ASN E 1 84  ? -17.846 -5.526  27.879  1.00 45.36  ? 637 ASN E OD1 1 
ATOM   4308 N ND2 . ASN E 1 84  ? -15.985 -4.385  28.452  1.00 51.83  ? 637 ASN E ND2 1 
ATOM   4309 N N   . CYS E 1 85  ? -19.855 -3.456  31.952  1.00 47.71  ? 638 CYS E N   1 
ATOM   4310 C CA  . CYS E 1 85  ? -20.335 -3.191  33.305  1.00 48.88  ? 638 CYS E CA  1 
ATOM   4311 C C   . CYS E 1 85  ? -21.737 -3.781  33.489  1.00 52.56  ? 638 CYS E C   1 
ATOM   4312 O O   . CYS E 1 85  ? -21.968 -4.483  34.465  1.00 50.74  ? 638 CYS E O   1 
ATOM   4313 C CB  . CYS E 1 85  ? -20.347 -1.678  33.607  1.00 46.54  ? 638 CYS E CB  1 
ATOM   4314 S SG  . CYS E 1 85  ? -20.599 -1.171  35.327  1.00 44.46  ? 638 CYS E SG  1 
ATOM   4315 N N   . MET E 1 86  ? -22.663 -3.500  32.566  1.00 47.33  ? 639 MET E N   1 
ATOM   4316 C CA  . MET E 1 86  ? -24.027 -4.017  32.704  1.00 49.69  ? 639 MET E CA  1 
ATOM   4317 C C   . MET E 1 86  ? -24.025 -5.552  32.623  1.00 60.36  ? 639 MET E C   1 
ATOM   4318 O O   . MET E 1 86  ? -24.841 -6.206  33.258  1.00 67.53  ? 639 MET E O   1 
ATOM   4319 C CB  . MET E 1 86  ? -24.974 -3.401  31.674  1.00 47.61  ? 639 MET E CB  1 
ATOM   4320 C CG  . MET E 1 86  ? -25.231 -1.918  31.897  1.00 51.51  ? 639 MET E CG  1 
ATOM   4321 S SD  . MET E 1 86  ? -26.540 -1.143  30.911  1.00 54.93  ? 639 MET E SD  1 
ATOM   4322 C CE  . MET E 1 86  ? -26.474 -2.076  29.377  1.00 77.90  ? 639 MET E CE  1 
ATOM   4323 N N   . LYS E 1 87  ? -23.087 -6.127  31.875  1.00 64.35  ? 640 LYS E N   1 
ATOM   4324 C CA  . LYS E 1 87  ? -22.966 -7.584  31.795  1.00 64.64  ? 640 LYS E CA  1 
ATOM   4325 C C   . LYS E 1 87  ? -22.512 -8.189  33.121  1.00 65.15  ? 640 LYS E C   1 
ATOM   4326 O O   . LYS E 1 87  ? -23.105 -9.154  33.597  1.00 68.47  ? 640 LYS E O   1 
ATOM   4327 C CB  . LYS E 1 87  ? -21.993 -7.989  30.685  1.00 65.23  ? 640 LYS E CB  1 
ATOM   4328 C CG  . LYS E 1 87  ? -22.135 -9.418  30.222  1.00 61.96  ? 640 LYS E CG  1 
ATOM   4329 C CD  . LYS E 1 87  ? -21.299 -9.664  28.984  1.00 70.86  ? 640 LYS E CD  1 
ATOM   4330 C CE  . LYS E 1 87  ? -21.235 -11.153 28.662  1.00 82.44  ? 640 LYS E CE  1 
ATOM   4331 N NZ  . LYS E 1 87  ? -20.636 -11.413 27.309  1.00 73.17  ? 640 LYS E NZ  1 
ATOM   4332 N N   . TYR E 1 88  ? -21.475 -7.610  33.718  1.00 64.74  ? 641 TYR E N   1 
ATOM   4333 C CA  . TYR E 1 88  ? -20.808 -8.206  34.886  1.00 61.91  ? 641 TYR E CA  1 
ATOM   4334 C C   . TYR E 1 88  ? -21.493 -7.951  36.249  1.00 64.12  ? 641 TYR E C   1 
ATOM   4335 O O   . TYR E 1 88  ? -21.368 -8.761  37.170  1.00 66.08  ? 641 TYR E O   1 
ATOM   4336 C CB  . TYR E 1 88  ? -19.358 -7.723  34.941  1.00 58.24  ? 641 TYR E CB  1 
ATOM   4337 C CG  . TYR E 1 88  ? -18.568 -8.228  36.120  1.00 59.22  ? 641 TYR E CG  1 
ATOM   4338 C CD1 . TYR E 1 88  ? -18.604 -7.571  37.355  1.00 56.23  ? 641 TYR E CD1 1 
ATOM   4339 C CD2 . TYR E 1 88  ? -17.767 -9.348  36.001  1.00 58.64  ? 641 TYR E CD2 1 
ATOM   4340 C CE1 . TYR E 1 88  ? -17.863 -8.047  38.439  1.00 73.83  ? 641 TYR E CE1 1 
ATOM   4341 C CE2 . TYR E 1 88  ? -17.021 -9.826  37.072  1.00 54.10  ? 641 TYR E CE2 1 
ATOM   4342 C CZ  . TYR E 1 88  ? -17.074 -9.187  38.282  1.00 68.67  ? 641 TYR E CZ  1 
ATOM   4343 O OH  . TYR E 1 88  ? -16.330 -9.689  39.327  1.00 64.25  ? 641 TYR E OH  1 
ATOM   4344 N N   . ASN E 1 89  ? -22.202 -6.843  36.396  1.00 60.18  ? 642 ASN E N   1 
ATOM   4345 C CA  . ASN E 1 89  ? -22.788 -6.496  37.685  1.00 60.21  ? 642 ASN E CA  1 
ATOM   4346 C C   . ASN E 1 89  ? -24.305 -6.683  37.607  1.00 63.85  ? 642 ASN E C   1 
ATOM   4347 O O   . ASN E 1 89  ? -24.882 -6.552  36.533  1.00 60.33  ? 642 ASN E O   1 
ATOM   4348 C CB  . ASN E 1 89  ? -22.395 -5.056  38.061  1.00 60.92  ? 642 ASN E CB  1 
ATOM   4349 C CG  . ASN E 1 89  ? -20.993 -4.955  38.698  1.00 47.68  ? 642 ASN E CG  1 
ATOM   4350 O OD1 . ASN E 1 89  ? -20.026 -4.563  38.047  1.00 61.24  ? 642 ASN E OD1 1 
ATOM   4351 N ND2 . ASN E 1 89  ? -20.899 -5.280  39.979  1.00 78.18  ? 642 ASN E ND2 1 
ATOM   4352 N N   . ALA E 1 90  ? -24.944 -6.983  38.741  1.00 66.53  ? 643 ALA E N   1 
ATOM   4353 C CA  . ALA E 1 90  ? -26.385 -7.312  38.778  1.00 67.36  ? 643 ALA E CA  1 
ATOM   4354 C C   . ALA E 1 90  ? -27.330 -6.108  38.673  1.00 66.19  ? 643 ALA E C   1 
ATOM   4355 O O   . ALA E 1 90  ? -27.015 -5.011  39.142  1.00 61.49  ? 643 ALA E O   1 
ATOM   4356 C CB  . ALA E 1 90  ? -26.713 -8.113  40.046  1.00 64.67  ? 643 ALA E CB  1 
ATOM   4357 N N   . ARG E 1 91  ? -28.518 -6.347  38.110  1.00 72.18  ? 644 ARG E N   1 
ATOM   4358 C CA  . ARG E 1 91  ? -29.514 -5.289  37.838  1.00 76.01  ? 644 ARG E CA  1 
ATOM   4359 C C   . ARG E 1 91  ? -29.798 -4.376  39.048  1.00 78.83  ? 644 ARG E C   1 
ATOM   4360 O O   . ARG E 1 91  ? -30.232 -3.228  38.897  1.00 79.56  ? 644 ARG E O   1 
ATOM   4361 C CB  . ARG E 1 91  ? -30.821 -5.905  37.298  1.00 77.86  ? 644 ARG E CB  1 
ATOM   4362 N N   . ASP E 1 92  ? -29.534 -4.881  40.246  1.00 78.83  ? 645 ASP E N   1 
ATOM   4363 C CA  . ASP E 1 92  ? -29.703 -4.094  41.442  1.00 76.97  ? 645 ASP E CA  1 
ATOM   4364 C C   . ASP E 1 92  ? -28.538 -3.125  41.712  1.00 70.71  ? 645 ASP E C   1 
ATOM   4365 O O   . ASP E 1 92  ? -28.775 -2.030  42.217  1.00 71.06  ? 645 ASP E O   1 
ATOM   4366 C CB  . ASP E 1 92  ? -29.909 -5.025  42.649  1.00 81.32  ? 645 ASP E CB  1 
ATOM   4367 N N   . THR E 1 93  ? -27.300 -3.505  41.384  1.00 66.95  ? 646 THR E N   1 
ATOM   4368 C CA  . THR E 1 93  ? -26.109 -2.838  41.986  1.00 63.61  ? 646 THR E CA  1 
ATOM   4369 C C   . THR E 1 93  ? -25.850 -1.371  41.620  1.00 58.81  ? 646 THR E C   1 
ATOM   4370 O O   . THR E 1 93  ? -26.460 -0.810  40.701  1.00 50.82  ? 646 THR E O   1 
ATOM   4371 C CB  . THR E 1 93  ? -24.783 -3.638  41.772  1.00 62.73  ? 646 THR E CB  1 
ATOM   4372 O OG1 . THR E 1 93  ? -24.629 -3.980  40.397  1.00 66.89  ? 646 THR E OG1 1 
ATOM   4373 C CG2 . THR E 1 93  ? -24.785 -4.914  42.597  1.00 70.64  ? 646 THR E CG2 1 
ATOM   4374 N N   . VAL E 1 94  ? -24.959 -0.757  42.407  1.00 54.90  ? 647 VAL E N   1 
ATOM   4375 C CA  . VAL E 1 94  ? -24.505 0.611   42.193  1.00 47.93  ? 647 VAL E CA  1 
ATOM   4376 C C   . VAL E 1 94  ? -23.800 0.725   40.844  1.00 49.60  ? 647 VAL E C   1 
ATOM   4377 O O   . VAL E 1 94  ? -24.104 1.630   40.078  1.00 45.44  ? 647 VAL E O   1 
ATOM   4378 C CB  . VAL E 1 94  ? -23.534 1.071   43.285  1.00 47.87  ? 647 VAL E CB  1 
ATOM   4379 C CG1 . VAL E 1 94  ? -23.303 2.588   43.203  1.00 35.70  ? 647 VAL E CG1 1 
ATOM   4380 C CG2 . VAL E 1 94  ? -24.076 0.747   44.645  1.00 55.46  ? 647 VAL E CG2 1 
ATOM   4381 N N   . PHE E 1 95  ? -22.882 -0.203  40.549  1.00 47.61  ? 648 PHE E N   1 
ATOM   4382 C CA  . PHE E 1 95  ? -22.058 -0.092  39.358  1.00 46.59  ? 648 PHE E CA  1 
ATOM   4383 C C   . PHE E 1 95  ? -22.938 -0.195  38.130  1.00 50.81  ? 648 PHE E C   1 
ATOM   4384 O O   . PHE E 1 95  ? -22.792 0.597   37.207  1.00 55.84  ? 648 PHE E O   1 
ATOM   4385 C CB  . PHE E 1 95  ? -20.967 -1.170  39.288  1.00 48.25  ? 648 PHE E CB  1 
ATOM   4386 C CG  . PHE E 1 95  ? -19.784 -0.920  40.191  1.00 62.92  ? 648 PHE E CG  1 
ATOM   4387 C CD1 . PHE E 1 95  ? -19.111 0.297   40.169  1.00 58.18  ? 648 PHE E CD1 1 
ATOM   4388 C CD2 . PHE E 1 95  ? -19.321 -1.927  41.037  1.00 68.40  ? 648 PHE E CD2 1 
ATOM   4389 C CE1 . PHE E 1 95  ? -18.011 0.509   40.976  1.00 49.04  ? 648 PHE E CE1 1 
ATOM   4390 C CE2 . PHE E 1 95  ? -18.229 -1.726  41.846  1.00 64.82  ? 648 PHE E CE2 1 
ATOM   4391 C CZ  . PHE E 1 95  ? -17.569 -0.501  41.824  1.00 66.55  ? 648 PHE E CZ  1 
ATOM   4392 N N   . TYR E 1 96  ? -23.834 -1.181  38.121  1.00 53.22  ? 649 TYR E N   1 
ATOM   4393 C CA  . TYR E 1 96  ? -24.832 -1.343  37.062  1.00 48.86  ? 649 TYR E CA  1 
ATOM   4394 C C   . TYR E 1 96  ? -25.576 -0.040  36.781  1.00 47.94  ? 649 TYR E C   1 
ATOM   4395 O O   . TYR E 1 96  ? -25.547 0.457   35.665  1.00 54.77  ? 649 TYR E O   1 
ATOM   4396 C CB  . TYR E 1 96  ? -25.857 -2.425  37.447  1.00 49.94  ? 649 TYR E CB  1 
ATOM   4397 C CG  . TYR E 1 96  ? -26.818 -2.823  36.328  1.00 55.79  ? 649 TYR E CG  1 
ATOM   4398 C CD1 . TYR E 1 96  ? -26.520 -3.880  35.466  1.00 54.04  ? 649 TYR E CD1 1 
ATOM   4399 C CD2 . TYR E 1 96  ? -28.024 -2.147  36.141  1.00 55.82  ? 649 TYR E CD2 1 
ATOM   4400 C CE1 . TYR E 1 96  ? -27.391 -4.242  34.437  1.00 56.80  ? 649 TYR E CE1 1 
ATOM   4401 C CE2 . TYR E 1 96  ? -28.892 -2.499  35.105  1.00 56.70  ? 649 TYR E CE2 1 
ATOM   4402 C CZ  . TYR E 1 96  ? -28.580 -3.548  34.277  1.00 52.72  ? 649 TYR E CZ  1 
ATOM   4403 O OH  . TYR E 1 96  ? -29.454 -3.895  33.279  1.00 55.93  ? 649 TYR E OH  1 
ATOM   4404 N N   . ARG E 1 97  ? -26.236 0.503   37.803  1.00 50.80  ? 650 ARG E N   1 
ATOM   4405 C CA  . ARG E 1 97  ? -27.092 1.688   37.655  1.00 48.34  ? 650 ARG E CA  1 
ATOM   4406 C C   . ARG E 1 97  ? -26.302 2.943   37.196  1.00 43.07  ? 650 ARG E C   1 
ATOM   4407 O O   . ARG E 1 97  ? -26.884 3.879   36.651  1.00 46.29  ? 650 ARG E O   1 
ATOM   4408 C CB  . ARG E 1 97  ? -27.884 1.947   38.969  1.00 44.57  ? 650 ARG E CB  1 
ATOM   4409 N N   . ALA E 1 98  ? -24.988 2.955   37.423  1.00 38.06  ? 651 ALA E N   1 
ATOM   4410 C CA  . ALA E 1 98  ? -24.117 4.039   36.960  1.00 37.90  ? 651 ALA E CA  1 
ATOM   4411 C C   . ALA E 1 98  ? -23.849 3.864   35.483  1.00 35.34  ? 651 ALA E C   1 
ATOM   4412 O O   . ALA E 1 98  ? -23.774 4.835   34.751  1.00 37.93  ? 651 ALA E O   1 
ATOM   4413 C CB  . ALA E 1 98  ? -22.824 4.024   37.707  1.00 41.37  ? 651 ALA E CB  1 
ATOM   4414 N N   . ALA E 1 99  ? -23.704 2.607   35.067  1.00 39.56  ? 652 ALA E N   1 
ATOM   4415 C CA  . ALA E 1 99  ? -23.623 2.240   33.662  1.00 37.31  ? 652 ALA E CA  1 
ATOM   4416 C C   . ALA E 1 99  ? -24.856 2.708   32.888  1.00 40.33  ? 652 ALA E C   1 
ATOM   4417 O O   . ALA E 1 99  ? -24.736 3.260   31.800  1.00 44.03  ? 652 ALA E O   1 
ATOM   4418 C CB  . ALA E 1 99  ? -23.475 0.762   33.532  1.00 41.17  ? 652 ALA E CB  1 
ATOM   4419 N N   . VAL E 1 100 ? -26.036 2.498   33.452  1.00 40.87  ? 653 VAL E N   1 
ATOM   4420 C CA  . VAL E 1 100 ? -27.276 2.899   32.788  1.00 44.94  ? 653 VAL E CA  1 
ATOM   4421 C C   . VAL E 1 100 ? -27.377 4.411   32.622  1.00 43.24  ? 653 VAL E C   1 
ATOM   4422 O O   . VAL E 1 100 ? -27.794 4.903   31.566  1.00 43.98  ? 653 VAL E O   1 
ATOM   4423 C CB  . VAL E 1 100 ? -28.508 2.379   33.554  1.00 48.21  ? 653 VAL E CB  1 
ATOM   4424 C CG1 . VAL E 1 100 ? -29.779 3.177   33.197  1.00 54.94  ? 653 VAL E CG1 1 
ATOM   4425 C CG2 . VAL E 1 100 ? -28.694 0.891   33.280  1.00 48.73  ? 653 VAL E CG2 1 
ATOM   4426 N N   . ARG E 1 101 ? -27.003 5.142   33.665  1.00 37.06  ? 654 ARG E N   1 
ATOM   4427 C CA  . ARG E 1 101 ? -27.123 6.583   33.644  1.00 36.97  ? 654 ARG E CA  1 
ATOM   4428 C C   . ARG E 1 101 ? -26.094 7.118   32.670  1.00 35.06  ? 654 ARG E C   1 
ATOM   4429 O O   . ARG E 1 101 ? -26.407 8.034   31.907  1.00 35.20  ? 654 ARG E O   1 
ATOM   4430 C CB  . ARG E 1 101 ? -26.962 7.205   35.055  1.00 40.61  ? 654 ARG E CB  1 
ATOM   4431 N N   . LEU E 1 102 ? -24.887 6.531   32.660  1.00 26.68  ? 655 LEU E N   1 
ATOM   4432 C CA  . LEU E 1 102 ? -23.846 6.965   31.720  1.00 28.39  ? 655 LEU E CA  1 
ATOM   4433 C C   . LEU E 1 102 ? -24.239 6.682   30.278  1.00 35.92  ? 655 LEU E C   1 
ATOM   4434 O O   . LEU E 1 102 ? -23.924 7.467   29.384  1.00 39.22  ? 655 LEU E O   1 
ATOM   4435 C CB  . LEU E 1 102 ? -22.475 6.351   32.052  1.00 26.06  ? 655 LEU E CB  1 
ATOM   4436 C CG  . LEU E 1 102 ? -21.306 6.656   31.111  1.00 39.06  ? 655 LEU E CG  1 
ATOM   4437 C CD1 . LEU E 1 102 ? -21.228 8.146   30.804  1.00 36.81  ? 655 LEU E CD1 1 
ATOM   4438 C CD2 . LEU E 1 102 ? -19.965 6.186   31.665  1.00 27.99  ? 655 LEU E CD2 1 
ATOM   4439 N N   . ARG E 1 103 ? -24.911 5.553   30.052  1.00 39.35  ? 656 ARG E N   1 
ATOM   4440 C CA  . ARG E 1 103 ? -25.463 5.234   28.744  1.00 42.40  ? 656 ARG E CA  1 
ATOM   4441 C C   . ARG E 1 103 ? -26.492 6.255   28.272  1.00 38.49  ? 656 ARG E C   1 
ATOM   4442 O O   . ARG E 1 103 ? -26.463 6.680   27.128  1.00 34.48  ? 656 ARG E O   1 
ATOM   4443 C CB  . ARG E 1 103 ? -26.119 3.854   28.749  1.00 43.01  ? 656 ARG E CB  1 
ATOM   4444 C CG  . ARG E 1 103 ? -26.525 3.354   27.347  1.00 49.24  ? 656 ARG E CG  1 
ATOM   4445 C CD  . ARG E 1 103 ? -27.412 2.116   27.423  1.00 58.95  ? 656 ARG E CD  1 
ATOM   4446 N NE  . ARG E 1 103 ? -28.649 2.385   28.164  1.00 69.41  ? 656 ARG E NE  1 
ATOM   4447 C CZ  . ARG E 1 103 ? -29.457 1.454   28.660  1.00 66.59  ? 656 ARG E CZ  1 
ATOM   4448 N NH1 . ARG E 1 103 ? -29.178 0.159   28.520  1.00 75.84  ? 656 ARG E NH1 1 
ATOM   4449 N NH2 . ARG E 1 103 ? -30.550 1.829   29.306  1.00 75.47  ? 656 ARG E NH2 1 
ATOM   4450 N N   . ASP E 1 104 ? -27.407 6.627   29.149  1.00 43.12  ? 657 ASP E N   1 
ATOM   4451 C CA  . ASP E 1 104 ? -28.494 7.515   28.765  1.00 51.25  ? 657 ASP E CA  1 
ATOM   4452 C C   . ASP E 1 104 ? -27.999 8.944   28.608  1.00 51.61  ? 657 ASP E C   1 
ATOM   4453 O O   . ASP E 1 104 ? -28.476 9.680   27.755  1.00 50.09  ? 657 ASP E O   1 
ATOM   4454 C CB  . ASP E 1 104 ? -29.629 7.442   29.790  1.00 58.86  ? 657 ASP E CB  1 
ATOM   4455 C CG  . ASP E 1 104 ? -30.437 6.161   29.667  1.00 56.25  ? 657 ASP E CG  1 
ATOM   4456 O OD1 . ASP E 1 104 ? -30.977 5.704   30.686  1.00 53.91  ? 657 ASP E OD1 1 
ATOM   4457 O OD2 . ASP E 1 104 ? -30.539 5.622   28.547  1.00 51.63  ? 657 ASP E OD2 1 
ATOM   4458 N N   . GLN E 1 105 ? -27.026 9.337   29.420  1.00 51.73  ? 658 GLN E N   1 
ATOM   4459 C CA  . GLN E 1 105 ? -26.440 10.656  29.262  1.00 44.21  ? 658 GLN E CA  1 
ATOM   4460 C C   . GLN E 1 105 ? -25.470 10.654  28.080  1.00 41.32  ? 658 GLN E C   1 
ATOM   4461 O O   . GLN E 1 105 ? -25.534 11.534  27.240  1.00 38.54  ? 658 GLN E O   1 
ATOM   4462 C CB  . GLN E 1 105 ? -25.789 11.118  30.551  1.00 47.20  ? 658 GLN E CB  1 
ATOM   4463 C CG  . GLN E 1 105 ? -26.784 11.450  31.653  1.00 48.36  ? 658 GLN E CG  1 
ATOM   4464 C CD  . GLN E 1 105 ? -26.095 11.918  32.908  1.00 60.62  ? 658 GLN E CD  1 
ATOM   4465 O OE1 . GLN E 1 105 ? -26.284 13.059  33.347  1.00 62.06  ? 658 GLN E OE1 1 
ATOM   4466 N NE2 . GLN E 1 105 ? -25.259 11.052  33.481  1.00 41.35  ? 658 GLN E NE2 1 
ATOM   4467 N N   . GLY E 1 106 ? -24.597 9.653   28.001  1.00 44.99  ? 659 GLY E N   1 
ATOM   4468 C CA  . GLY E 1 106 ? -23.646 9.544   26.903  1.00 40.71  ? 659 GLY E CA  1 
ATOM   4469 C C   . GLY E 1 106 ? -24.338 9.562   25.552  1.00 42.56  ? 659 GLY E C   1 
ATOM   4470 O O   . GLY E 1 106 ? -23.841 10.142  24.611  1.00 42.41  ? 659 GLY E O   1 
ATOM   4471 N N   . GLY E 1 107 ? -25.508 8.950   25.473  1.00 40.16  ? 660 GLY E N   1 
ATOM   4472 C CA  . GLY E 1 107 ? -26.268 8.904   24.242  1.00 36.70  ? 660 GLY E CA  1 
ATOM   4473 C C   . GLY E 1 107 ? -26.698 10.266  23.734  1.00 36.30  ? 660 GLY E C   1 
ATOM   4474 O O   . GLY E 1 107 ? -26.660 10.497  22.549  1.00 39.03  ? 660 GLY E O   1 
ATOM   4475 N N   . VAL E 1 108 ? -27.117 11.181  24.598  1.00 37.70  ? 661 VAL E N   1 
ATOM   4476 C CA  . VAL E 1 108 ? -27.428 12.535  24.119  1.00 36.47  ? 661 VAL E CA  1 
ATOM   4477 C C   . VAL E 1 108 ? -26.192 13.142  23.459  1.00 35.00  ? 661 VAL E C   1 
ATOM   4478 O O   . VAL E 1 108 ? -26.299 13.836  22.461  1.00 44.94  ? 661 VAL E O   1 
ATOM   4479 C CB  . VAL E 1 108 ? -27.926 13.483  25.241  1.00 35.11  ? 661 VAL E CB  1 
ATOM   4480 C CG1 . VAL E 1 108 ? -27.990 14.967  24.729  1.00 37.27  ? 661 VAL E CG1 1 
ATOM   4481 C CG2 . VAL E 1 108 ? -29.288 13.036  25.758  1.00 40.68  ? 661 VAL E CG2 1 
ATOM   4482 N N   . VAL E 1 109 ? -25.016 12.841  23.994  1.00 37.25  ? 662 VAL E N   1 
ATOM   4483 C CA  . VAL E 1 109 ? -23.779 13.457  23.527  1.00 35.18  ? 662 VAL E CA  1 
ATOM   4484 C C   . VAL E 1 109 ? -23.331 12.860  22.205  1.00 38.42  ? 662 VAL E C   1 
ATOM   4485 O O   . VAL E 1 109 ? -22.899 13.585  21.312  1.00 36.34  ? 662 VAL E O   1 
ATOM   4486 C CB  . VAL E 1 109 ? -22.672 13.311  24.568  1.00 37.94  ? 662 VAL E CB  1 
ATOM   4487 C CG1 . VAL E 1 109 ? -21.373 13.619  23.948  1.00 23.73  ? 662 VAL E CG1 1 
ATOM   4488 C CG2 . VAL E 1 109 ? -22.977 14.229  25.805  1.00 33.60  ? 662 VAL E CG2 1 
ATOM   4489 N N   . LEU E 1 110 ? -23.489 11.543  22.075  1.00 37.28  ? 663 LEU E N   1 
ATOM   4490 C CA  . LEU E 1 110 ? -23.124 10.819  20.858  1.00 32.20  ? 663 LEU E CA  1 
ATOM   4491 C C   . LEU E 1 110 ? -24.051 11.160  19.689  1.00 26.40  ? 663 LEU E C   1 
ATOM   4492 O O   . LEU E 1 110 ? -23.574 11.309  18.566  1.00 31.48  ? 663 LEU E O   1 
ATOM   4493 C CB  . LEU E 1 110 ? -23.027 9.315   21.131  1.00 27.89  ? 663 LEU E CB  1 
ATOM   4494 C CG  . LEU E 1 110 ? -21.762 8.988   21.955  1.00 33.18  ? 663 LEU E CG  1 
ATOM   4495 C CD1 . LEU E 1 110 ? -21.808 7.594   22.421  1.00 30.95  ? 663 LEU E CD1 1 
ATOM   4496 C CD2 . LEU E 1 110 ? -20.513 9.244   21.112  1.00 21.63  ? 663 LEU E CD2 1 
ATOM   4497 N N   . ARG E 1 111 ? -25.341 11.328  19.967  1.00 30.19  ? 664 ARG E N   1 
ATOM   4498 C CA  . ARG E 1 111 ? -26.309 11.837  18.974  1.00 38.63  ? 664 ARG E CA  1 
ATOM   4499 C C   . ARG E 1 111 ? -25.859 13.160  18.430  1.00 39.57  ? 664 ARG E C   1 
ATOM   4500 O O   . ARG E 1 111 ? -25.780 13.339  17.208  1.00 34.17  ? 664 ARG E O   1 
ATOM   4501 C CB  . ARG E 1 111 ? -27.712 12.052  19.573  1.00 47.20  ? 664 ARG E CB  1 
ATOM   4502 C CG  . ARG E 1 111 ? -28.766 11.073  19.086  1.00 53.91  ? 664 ARG E CG  1 
ATOM   4503 C CD  . ARG E 1 111 ? -29.066 10.020  20.120  1.00 61.26  ? 664 ARG E CD  1 
ATOM   4504 N NE  . ARG E 1 111 ? -29.732 10.608  21.280  1.00 77.44  ? 664 ARG E NE  1 
ATOM   4505 C CZ  . ARG E 1 111 ? -29.964 9.969   22.426  1.00 77.84  ? 664 ARG E CZ  1 
ATOM   4506 N NH1 . ARG E 1 111 ? -29.602 8.695   22.586  1.00 66.89  ? 664 ARG E NH1 1 
ATOM   4507 N NH2 . ARG E 1 111 ? -30.556 10.614  23.424  1.00 69.06  ? 664 ARG E NH2 1 
ATOM   4508 N N   . GLN E 1 112 ? -25.509 14.083  19.334  1.00 34.34  ? 665 GLN E N   1 
ATOM   4509 C CA  . GLN E 1 112 ? -25.066 15.405  18.883  1.00 34.80  ? 665 GLN E CA  1 
ATOM   4510 C C   . GLN E 1 112 ? -23.789 15.292  18.030  1.00 28.40  ? 665 GLN E C   1 
ATOM   4511 O O   . GLN E 1 112 ? -23.580 16.049  17.075  1.00 29.32  ? 665 GLN E O   1 
ATOM   4512 C CB  . GLN E 1 112 ? -24.910 16.368  20.078  1.00 32.41  ? 665 GLN E CB  1 
ATOM   4513 C CG  . GLN E 1 112 ? -25.277 17.798  19.791  1.00 46.31  ? 665 GLN E CG  1 
ATOM   4514 C CD  . GLN E 1 112 ? -26.745 17.981  19.382  1.00 76.17  ? 665 GLN E CD  1 
ATOM   4515 O OE1 . GLN E 1 112 ? -27.614 17.171  19.726  1.00 83.10  ? 665 GLN E OE1 1 
ATOM   4516 N NE2 . GLN E 1 112 ? -27.016 19.053  18.628  1.00 77.75  ? 665 GLN E NE2 1 
ATOM   4517 N N   . ALA E 1 113 ? -22.929 14.356  18.404  1.00 32.70  ? 666 ALA E N   1 
ATOM   4518 C CA  . ALA E 1 113 ? -21.748 14.032  17.634  1.00 31.69  ? 666 ALA E CA  1 
ATOM   4519 C C   . ALA E 1 113 ? -22.122 13.489  16.238  1.00 30.97  ? 666 ALA E C   1 
ATOM   4520 O O   . ALA E 1 113 ? -21.474 13.827  15.268  1.00 21.87  ? 666 ALA E O   1 
ATOM   4521 C CB  . ALA E 1 113 ? -20.899 13.009  18.387  1.00 35.11  ? 666 ALA E CB  1 
ATOM   4522 N N   . ARG E 1 114 ? -23.149 12.644  16.141  1.00 37.94  ? 667 ARG E N   1 
ATOM   4523 C CA  . ARG E 1 114 ? -23.552 12.102  14.831  1.00 39.56  ? 667 ARG E CA  1 
ATOM   4524 C C   . ARG E 1 114 ? -24.055 13.258  13.993  1.00 37.67  ? 667 ARG E C   1 
ATOM   4525 O O   . ARG E 1 114 ? -23.562 13.455  12.907  1.00 36.55  ? 667 ARG E O   1 
ATOM   4526 C CB  . ARG E 1 114 ? -24.620 11.010  14.960  1.00 34.12  ? 667 ARG E CB  1 
ATOM   4527 N N   . ARG E 1 115 ? -24.991 14.048  14.541  1.00 40.87  ? 668 ARG E N   1 
ATOM   4528 C CA  . ARG E 1 115 ? -25.535 15.269  13.888  1.00 36.49  ? 668 ARG E CA  1 
ATOM   4529 C C   . ARG E 1 115 ? -24.453 16.174  13.373  1.00 33.71  ? 668 ARG E C   1 
ATOM   4530 O O   . ARG E 1 115 ? -24.598 16.778  12.309  1.00 32.13  ? 668 ARG E O   1 
ATOM   4531 C CB  . ARG E 1 115 ? -26.408 16.109  14.836  1.00 43.28  ? 668 ARG E CB  1 
ATOM   4532 C CG  . ARG E 1 115 ? -27.779 15.504  15.252  1.00 49.30  ? 668 ARG E CG  1 
ATOM   4533 C CD  . ARG E 1 115 ? -28.535 16.422  16.254  1.00 52.94  ? 668 ARG E CD  1 
ATOM   4534 N N   . GLU E 1 116 ? -23.351 16.267  14.108  1.00 39.08  ? 669 GLU E N   1 
ATOM   4535 C CA  . GLU E 1 116 ? -22.315 17.228  13.757  1.00 32.93  ? 669 GLU E CA  1 
ATOM   4536 C C   . GLU E 1 116 ? -21.477 16.685  12.597  1.00 35.03  ? 669 GLU E C   1 
ATOM   4537 O O   . GLU E 1 116 ? -21.110 17.427  11.680  1.00 34.21  ? 669 GLU E O   1 
ATOM   4538 C CB  . GLU E 1 116 ? -21.481 17.602  14.998  1.00 35.39  ? 669 GLU E CB  1 
ATOM   4539 C CG  . GLU E 1 116 ? -20.524 18.793  14.817  1.00 39.01  ? 669 GLU E CG  1 
ATOM   4540 C CD  . GLU E 1 116 ? -21.200 20.007  14.187  1.00 41.23  ? 669 GLU E CD  1 
ATOM   4541 O OE1 . GLU E 1 116 ? -22.308 20.393  14.631  1.00 32.57  ? 669 GLU E OE1 1 
ATOM   4542 O OE2 . GLU E 1 116 ? -20.633 20.571  13.239  1.00 35.22  ? 669 GLU E OE2 1 
ATOM   4543 N N   . VAL E 1 117 ? -21.198 15.384  12.628  1.00 40.19  ? 670 VAL E N   1 
ATOM   4544 C CA  . VAL E 1 117 ? -20.588 14.685  11.488  1.00 38.47  ? 670 VAL E CA  1 
ATOM   4545 C C   . VAL E 1 117 ? -21.414 14.947  10.189  1.00 39.72  ? 670 VAL E C   1 
ATOM   4546 O O   . VAL E 1 117 ? -20.859 15.228  9.129   1.00 43.20  ? 670 VAL E O   1 
ATOM   4547 C CB  . VAL E 1 117 ? -20.482 13.132  11.780  1.00 38.49  ? 670 VAL E CB  1 
ATOM   4548 C CG1 . VAL E 1 117 ? -20.370 12.339  10.493  1.00 40.67  ? 670 VAL E CG1 1 
ATOM   4549 C CG2 . VAL E 1 117 ? -19.310 12.792  12.751  1.00 30.88  ? 670 VAL E CG2 1 
ATOM   4550 N N   . ASP E 1 118 ? -22.740 14.846  10.280  1.00 33.23  ? 671 ASP E N   1 
ATOM   4551 C CA  . ASP E 1 118 ? -23.610 15.168  9.155   1.00 40.51  ? 671 ASP E CA  1 
ATOM   4552 C C   . ASP E 1 118 ? -23.574 16.662  8.824   1.00 38.65  ? 671 ASP E C   1 
ATOM   4553 O O   . ASP E 1 118 ? -23.544 17.027  7.667   1.00 37.50  ? 671 ASP E O   1 
ATOM   4554 C CB  . ASP E 1 118 ? -25.051 14.748  9.440   1.00 42.93  ? 671 ASP E CB  1 
ATOM   4555 C CG  . ASP E 1 118 ? -25.210 13.242  9.555   1.00 54.41  ? 671 ASP E CG  1 
ATOM   4556 O OD1 . ASP E 1 118 ? -24.276 12.508  9.137   1.00 46.98  ? 671 ASP E OD1 1 
ATOM   4557 O OD2 . ASP E 1 118 ? -26.270 12.807  10.074  1.00 50.50  ? 671 ASP E OD2 1 
ATOM   4558 N N   . SER E 1 119 ? -23.583 17.522  9.839   1.00 36.65  ? 672 SER E N   1 
ATOM   4559 C CA  . SER E 1 119 ? -23.479 18.966  9.601   1.00 41.54  ? 672 SER E CA  1 
ATOM   4560 C C   . SER E 1 119 ? -22.250 19.313  8.735   1.00 39.26  ? 672 SER E C   1 
ATOM   4561 O O   . SER E 1 119 ? -22.334 20.149  7.837   1.00 33.06  ? 672 SER E O   1 
ATOM   4562 C CB  . SER E 1 119 ? -23.445 19.745  10.932  1.00 44.43  ? 672 SER E CB  1 
ATOM   4563 O OG  . SER E 1 119 ? -23.061 21.097  10.741  1.00 36.37  ? 672 SER E OG  1 
ATOM   4564 N N   . ILE E 1 120 ? -21.122 18.661  8.990   1.00 33.73  ? 673 ILE E N   1 
ATOM   4565 C CA  . ILE E 1 120 ? -19.910 18.993  8.277   1.00 41.44  ? 673 ILE E CA  1 
ATOM   4566 C C   . ILE E 1 120 ? -19.988 18.551  6.820   1.00 45.03  ? 673 ILE E C   1 
ATOM   4567 O O   . ILE E 1 120 ? -19.485 19.254  5.942   1.00 47.77  ? 673 ILE E O   1 
ATOM   4568 C CB  . ILE E 1 120 ? -18.659 18.394  8.957   1.00 38.77  ? 673 ILE E CB  1 
ATOM   4569 C CG1 . ILE E 1 120 ? -18.282 19.250  10.175  1.00 38.26  ? 673 ILE E CG1 1 
ATOM   4570 C CG2 . ILE E 1 120 ? -17.528 18.320  7.964   1.00 37.51  ? 673 ILE E CG2 1 
ATOM   4571 C CD1 . ILE E 1 120 ? -17.420 18.554  11.190  1.00 46.70  ? 673 ILE E CD1 1 
ATOM   4572 N N   . GLY E 1 121 ? -20.609 17.398  6.564   1.00 44.75  ? 674 GLY E N   1 
ATOM   4573 C CA  . GLY E 1 121 ? -20.888 16.968  5.185   1.00 48.57  ? 674 GLY E CA  1 
ATOM   4574 C C   . GLY E 1 121 ? -21.544 18.082  4.367   1.00 48.74  ? 674 GLY E C   1 
ATOM   4575 O O   . GLY E 1 121 ? -21.072 18.440  3.288   1.00 53.68  ? 674 GLY E O   1 
ATOM   4576 N N   . LEU E 1 122 ? -22.618 18.655  4.897   1.00 49.60  ? 675 LEU E N   1 
ATOM   4577 C CA  . LEU E 1 122 ? -23.351 19.738  4.206   1.00 52.36  ? 675 LEU E CA  1 
ATOM   4578 C C   . LEU E 1 122 ? -22.528 21.029  4.000   1.00 48.39  ? 675 LEU E C   1 
ATOM   4579 O O   . LEU E 1 122 ? -22.702 21.713  2.995   1.00 48.29  ? 675 LEU E O   1 
ATOM   4580 C CB  . LEU E 1 122 ? -24.663 20.053  4.945   1.00 48.56  ? 675 LEU E CB  1 
ATOM   4581 C CG  . LEU E 1 122 ? -25.887 19.177  4.680   1.00 49.09  ? 675 LEU E CG  1 
ATOM   4582 C CD1 . LEU E 1 122 ? -25.490 17.746  4.488   1.00 47.09  ? 675 LEU E CD1 1 
ATOM   4583 C CD2 . LEU E 1 122 ? -26.949 19.323  5.806   1.00 23.98  ? 675 LEU E CD2 1 
ATOM   4584 N N   . GLU E 1 123 ? -21.642 21.363  4.942   1.00 54.81  ? 676 GLU E N   1 
ATOM   4585 C CA  . GLU E 1 123 ? -20.740 22.534  4.788   1.00 59.26  ? 676 GLU E CA  1 
ATOM   4586 C C   . GLU E 1 123 ? -19.919 22.475  3.491   1.00 63.57  ? 676 GLU E C   1 
ATOM   4587 O O   . GLU E 1 123 ? -19.645 23.518  2.869   1.00 55.98  ? 676 GLU E O   1 
ATOM   4588 C CB  . GLU E 1 123 ? -19.783 22.675  5.982   1.00 55.11  ? 676 GLU E CB  1 
ATOM   4589 C CG  . GLU E 1 123 ? -18.587 23.613  5.745   1.00 61.21  ? 676 GLU E CG  1 
ATOM   4590 C CD  . GLU E 1 123 ? -17.864 23.974  7.029   1.00 79.01  ? 676 GLU E CD  1 
ATOM   4591 O OE1 . GLU E 1 123 ? -17.852 23.148  7.978   1.00 57.63  ? 676 GLU E OE1 1 
ATOM   4592 O OE2 . GLU E 1 123 ? -17.299 25.089  7.084   1.00 87.37  ? 676 GLU E OE2 1 
ATOM   4593 N N   . GLU E 1 124 ? -19.528 21.262  3.093   1.00 62.79  ? 677 GLU E N   1 
ATOM   4594 C CA  . GLU E 1 124 ? -18.736 21.069  1.876   1.00 65.06  ? 677 GLU E CA  1 
ATOM   4595 C C   . GLU E 1 124 ? -19.629 21.415  0.668   1.00 61.93  ? 677 GLU E C   1 
ATOM   4596 O O   . GLU E 1 124 ? -20.066 20.540  -0.070  1.00 60.45  ? 677 GLU E O   1 
ATOM   4597 C CB  . GLU E 1 124 ? -18.125 19.650  1.843   1.00 62.88  ? 677 GLU E CB  1 
ATOM   4598 C CG  . GLU E 1 124 ? -17.293 19.349  3.118   1.00 59.23  ? 677 GLU E CG  1 
ATOM   4599 C CD  . GLU E 1 124 ? -16.667 17.972  3.143   1.00 78.75  ? 677 GLU E CD  1 
ATOM   4600 O OE1 . GLU E 1 124 ? -17.231 17.043  2.524   1.00 80.33  ? 677 GLU E OE1 1 
ATOM   4601 O OE2 . GLU E 1 124 ? -15.612 17.816  3.801   1.00 88.66  ? 677 GLU E OE2 1 
ATOM   4602 N N   . ALA E 1 125 ? -19.842 22.730  0.508   1.00 60.82  ? 678 ALA E N   1 
ATOM   4603 C CA  . ALA E 1 125 ? -20.868 23.362  -0.336  1.00 59.56  ? 678 ALA E CA  1 
ATOM   4604 C C   . ALA E 1 125 ? -20.911 24.861  0.002   1.00 61.12  ? 678 ALA E C   1 
ATOM   4605 O O   . ALA E 1 125 ? -21.539 25.654  -0.703  1.00 59.81  ? 678 ALA E O   1 
ATOM   4606 C CB  . ALA E 1 125 ? -22.246 22.745  -0.107  1.00 49.73  ? 678 ALA E CB  1 
ATOM   4607 N N   . LEU F 1 11  ? 36.348  -28.786 7.447   1.00 57.02  ? 564 LEU F N   1 
ATOM   4608 C CA  . LEU F 1 11  ? 35.763  -27.928 8.519   1.00 59.82  ? 564 LEU F CA  1 
ATOM   4609 C C   . LEU F 1 11  ? 36.640  -27.944 9.766   1.00 59.23  ? 564 LEU F C   1 
ATOM   4610 O O   . LEU F 1 11  ? 37.129  -28.998 10.140  1.00 64.34  ? 564 LEU F O   1 
ATOM   4611 C CB  . LEU F 1 11  ? 34.354  -28.424 8.878   1.00 60.35  ? 564 LEU F CB  1 
ATOM   4612 C CG  . LEU F 1 11  ? 33.424  -28.879 7.739   1.00 71.31  ? 564 LEU F CG  1 
ATOM   4613 C CD1 . LEU F 1 11  ? 32.486  -29.991 8.214   1.00 78.02  ? 564 LEU F CD1 1 
ATOM   4614 C CD2 . LEU F 1 11  ? 32.639  -27.711 7.143   1.00 76.15  ? 564 LEU F CD2 1 
ATOM   4615 N N   . THR F 1 12  ? 36.820  -26.800 10.433  1.00 60.95  ? 565 THR F N   1 
ATOM   4616 C CA  . THR F 1 12  ? 37.656  -26.759 11.653  1.00 62.80  ? 565 THR F CA  1 
ATOM   4617 C C   . THR F 1 12  ? 36.876  -27.286 12.862  1.00 59.58  ? 565 THR F C   1 
ATOM   4618 O O   . THR F 1 12  ? 35.662  -27.417 12.798  1.00 61.53  ? 565 THR F O   1 
ATOM   4619 C CB  . THR F 1 12  ? 38.231  -25.335 11.962  1.00 66.01  ? 565 THR F CB  1 
ATOM   4620 O OG1 . THR F 1 12  ? 37.274  -24.556 12.690  1.00 60.10  ? 565 THR F OG1 1 
ATOM   4621 C CG2 . THR F 1 12  ? 38.641  -24.601 10.674  1.00 64.93  ? 565 THR F CG2 1 
ATOM   4622 N N   . PRO F 1 13  ? 37.575  -27.591 13.970  1.00 59.31  ? 566 PRO F N   1 
ATOM   4623 C CA  . PRO F 1 13  ? 36.907  -28.119 15.158  1.00 56.64  ? 566 PRO F CA  1 
ATOM   4624 C C   . PRO F 1 13  ? 35.874  -27.198 15.763  1.00 54.74  ? 566 PRO F C   1 
ATOM   4625 O O   . PRO F 1 13  ? 34.755  -27.632 16.045  1.00 53.66  ? 566 PRO F O   1 
ATOM   4626 C CB  . PRO F 1 13  ? 38.060  -28.328 16.145  1.00 54.26  ? 566 PRO F CB  1 
ATOM   4627 C CG  . PRO F 1 13  ? 39.218  -28.566 15.291  1.00 56.30  ? 566 PRO F CG  1 
ATOM   4628 C CD  . PRO F 1 13  ? 39.041  -27.663 14.114  1.00 59.27  ? 566 PRO F CD  1 
ATOM   4629 N N   . LEU F 1 14  ? 36.242  -25.937 15.963  1.00 54.58  ? 567 LEU F N   1 
ATOM   4630 C CA  . LEU F 1 14  ? 35.312  -24.961 16.516  1.00 50.26  ? 567 LEU F CA  1 
ATOM   4631 C C   . LEU F 1 14  ? 34.028  -24.927 15.687  1.00 48.38  ? 567 LEU F C   1 
ATOM   4632 O O   . LEU F 1 14  ? 32.934  -24.819 16.236  1.00 44.99  ? 567 LEU F O   1 
ATOM   4633 C CB  . LEU F 1 14  ? 35.942  -23.556 16.581  1.00 53.04  ? 567 LEU F CB  1 
ATOM   4634 C CG  . LEU F 1 14  ? 35.086  -22.451 17.228  1.00 51.84  ? 567 LEU F CG  1 
ATOM   4635 C CD1 . LEU F 1 14  ? 34.573  -22.893 18.586  1.00 44.44  ? 567 LEU F CD1 1 
ATOM   4636 C CD2 . LEU F 1 14  ? 35.822  -21.123 17.367  1.00 42.91  ? 567 LEU F CD2 1 
ATOM   4637 N N   . THR F 1 15  ? 34.163  -25.043 14.369  1.00 47.44  ? 568 THR F N   1 
ATOM   4638 C CA  . THR F 1 15  ? 33.014  -24.901 13.498  1.00 49.30  ? 568 THR F CA  1 
ATOM   4639 C C   . THR F 1 15  ? 32.093  -26.069 13.747  1.00 44.36  ? 568 THR F C   1 
ATOM   4640 O O   . THR F 1 15  ? 30.888  -25.902 13.879  1.00 35.35  ? 568 THR F O   1 
ATOM   4641 C CB  . THR F 1 15  ? 33.437  -24.774 12.020  1.00 49.63  ? 568 THR F CB  1 
ATOM   4642 O OG1 . THR F 1 15  ? 33.918  -23.446 11.814  1.00 51.60  ? 568 THR F OG1 1 
ATOM   4643 C CG2 . THR F 1 15  ? 32.261  -24.995 11.068  1.00 55.27  ? 568 THR F CG2 1 
ATOM   4644 N N   . VAL F 1 16  ? 32.689  -27.244 13.894  1.00 45.20  ? 569 VAL F N   1 
ATOM   4645 C CA  . VAL F 1 16  ? 31.922  -28.458 14.040  1.00 40.47  ? 569 VAL F CA  1 
ATOM   4646 C C   . VAL F 1 16  ? 31.131  -28.397 15.336  1.00 34.41  ? 569 VAL F C   1 
ATOM   4647 O O   . VAL F 1 16  ? 29.908  -28.610 15.328  1.00 34.83  ? 569 VAL F O   1 
ATOM   4648 C CB  . VAL F 1 16  ? 32.856  -29.678 13.909  1.00 46.42  ? 569 VAL F CB  1 
ATOM   4649 C CG1 . VAL F 1 16  ? 32.139  -30.990 14.241  1.00 42.24  ? 569 VAL F CG1 1 
ATOM   4650 C CG2 . VAL F 1 16  ? 33.425  -29.703 12.481  1.00 45.52  ? 569 VAL F CG2 1 
ATOM   4651 N N   . LEU F 1 17  ? 31.804  -28.021 16.425  1.00 24.82  ? 570 LEU F N   1 
ATOM   4652 C CA  . LEU F 1 17  ? 31.143  -27.821 17.712  1.00 30.93  ? 570 LEU F CA  1 
ATOM   4653 C C   . LEU F 1 17  ? 30.035  -26.791 17.667  1.00 29.52  ? 570 LEU F C   1 
ATOM   4654 O O   . LEU F 1 17  ? 28.952  -27.023 18.171  1.00 31.91  ? 570 LEU F O   1 
ATOM   4655 C CB  . LEU F 1 17  ? 32.123  -27.376 18.796  1.00 36.71  ? 570 LEU F CB  1 
ATOM   4656 C CG  . LEU F 1 17  ? 32.874  -28.509 19.468  1.00 41.63  ? 570 LEU F CG  1 
ATOM   4657 C CD1 . LEU F 1 17  ? 33.998  -27.936 20.321  1.00 46.00  ? 570 LEU F CD1 1 
ATOM   4658 C CD2 . LEU F 1 17  ? 31.933  -29.411 20.273  1.00 49.22  ? 570 LEU F CD2 1 
ATOM   4659 N N   . LEU F 1 18  ? 30.328  -25.638 17.101  1.00 36.33  ? 571 LEU F N   1 
ATOM   4660 C CA  . LEU F 1 18  ? 29.327  -24.583 16.962  1.00 36.90  ? 571 LEU F CA  1 
ATOM   4661 C C   . LEU F 1 18  ? 28.130  -25.060 16.130  1.00 29.71  ? 571 LEU F C   1 
ATOM   4662 O O   . LEU F 1 18  ? 27.012  -24.680 16.415  1.00 33.19  ? 571 LEU F O   1 
ATOM   4663 C CB  . LEU F 1 18  ? 29.931  -23.323 16.309  1.00 36.42  ? 571 LEU F CB  1 
ATOM   4664 C CG  . LEU F 1 18  ? 31.060  -22.553 17.005  1.00 42.66  ? 571 LEU F CG  1 
ATOM   4665 C CD1 . LEU F 1 18  ? 31.191  -21.191 16.360  1.00 44.81  ? 571 LEU F CD1 1 
ATOM   4666 C CD2 . LEU F 1 18  ? 30.835  -22.389 18.491  1.00 30.68  ? 571 LEU F CD2 1 
ATOM   4667 N N   . ARG F 1 19  ? 28.356  -25.860 15.093  1.00 28.80  ? 572 ARG F N   1 
ATOM   4668 C CA  . ARG F 1 19  ? 27.221  -26.347 14.301  1.00 23.75  ? 572 ARG F CA  1 
ATOM   4669 C C   . ARG F 1 19  ? 26.299  -27.221 15.161  1.00 31.88  ? 572 ARG F C   1 
ATOM   4670 O O   . ARG F 1 19  ? 25.087  -27.058 15.144  1.00 27.90  ? 572 ARG F O   1 
ATOM   4671 C CB  . ARG F 1 19  ? 27.706  -27.113 13.086  1.00 31.99  ? 572 ARG F CB  1 
ATOM   4672 C CG  . ARG F 1 19  ? 26.635  -27.221 12.012  1.00 24.26  ? 572 ARG F CG  1 
ATOM   4673 C CD  . ARG F 1 19  ? 26.925  -28.271 10.961  1.00 43.64  ? 572 ARG F CD  1 
ATOM   4674 N NE  . ARG F 1 19  ? 25.716  -28.473 10.166  1.00 52.51  ? 572 ARG F NE  1 
ATOM   4675 C CZ  . ARG F 1 19  ? 25.290  -27.642 9.220   1.00 46.27  ? 572 ARG F CZ  1 
ATOM   4676 N NH1 . ARG F 1 19  ? 24.161  -27.907 8.573   1.00 56.23  ? 572 ARG F NH1 1 
ATOM   4677 N NH2 . ARG F 1 19  ? 25.988  -26.547 8.907   1.00 54.78  ? 572 ARG F NH2 1 
ATOM   4678 N N   . SER F 1 20  ? 26.898  -28.103 15.964  1.00 31.48  ? 573 SER F N   1 
ATOM   4679 C CA  . SER F 1 20  ? 26.168  -28.902 16.936  1.00 29.96  ? 573 SER F CA  1 
ATOM   4680 C C   . SER F 1 20  ? 25.476  -28.003 17.918  1.00 33.91  ? 573 SER F C   1 
ATOM   4681 O O   . SER F 1 20  ? 24.266  -28.167 18.183  1.00 32.43  ? 573 SER F O   1 
ATOM   4682 C CB  . SER F 1 20  ? 27.119  -29.852 17.680  1.00 36.97  ? 573 SER F CB  1 
ATOM   4683 O OG  . SER F 1 20  ? 26.404  -30.712 18.558  1.00 44.98  ? 573 SER F OG  1 
ATOM   4684 N N   . VAL F 1 21  ? 26.209  -27.028 18.452  1.00 27.93  ? 574 VAL F N   1 
ATOM   4685 C CA  . VAL F 1 21  ? 25.551  -26.072 19.330  1.00 25.93  ? 574 VAL F CA  1 
ATOM   4686 C C   . VAL F 1 21  ? 24.383  -25.374 18.613  1.00 28.89  ? 574 VAL F C   1 
ATOM   4687 O O   . VAL F 1 21  ? 23.298  -25.301 19.171  1.00 30.00  ? 574 VAL F O   1 
ATOM   4688 C CB  . VAL F 1 21  ? 26.501  -25.030 19.907  1.00 27.42  ? 574 VAL F CB  1 
ATOM   4689 C CG1 . VAL F 1 21  ? 25.716  -23.951 20.634  1.00 28.30  ? 574 VAL F CG1 1 
ATOM   4690 C CG2 . VAL F 1 21  ? 27.526  -25.710 20.840  1.00 25.45  ? 574 VAL F CG2 1 
ATOM   4691 N N   . LEU F 1 22  ? 24.575  -24.904 17.381  1.00 26.35  ? 575 LEU F N   1 
ATOM   4692 C CA  . LEU F 1 22  ? 23.516  -24.122 16.712  1.00 26.27  ? 575 LEU F CA  1 
ATOM   4693 C C   . LEU F 1 22  ? 22.300  -24.999 16.510  1.00 29.09  ? 575 LEU F C   1 
ATOM   4694 O O   . LEU F 1 22  ? 21.177  -24.550 16.738  1.00 30.40  ? 575 LEU F O   1 
ATOM   4695 C CB  . LEU F 1 22  ? 24.003  -23.511 15.400  1.00 27.14  ? 575 LEU F CB  1 
ATOM   4696 C CG  . LEU F 1 22  ? 23.075  -22.658 14.510  1.00 34.62  ? 575 LEU F CG  1 
ATOM   4697 C CD1 . LEU F 1 22  ? 22.381  -21.453 15.184  1.00 18.11  ? 575 LEU F CD1 1 
ATOM   4698 C CD2 . LEU F 1 22  ? 23.920  -22.157 13.385  1.00 19.12  ? 575 LEU F CD2 1 
ATOM   4699 N N   . ASP F 1 23  ? 22.515  -26.259 16.130  1.00 25.84  ? 576 ASP F N   1 
ATOM   4700 C CA  . ASP F 1 23  ? 21.396  -27.128 15.815  1.00 28.35  ? 576 ASP F CA  1 
ATOM   4701 C C   . ASP F 1 23  ? 20.563  -27.397 17.067  1.00 31.49  ? 576 ASP F C   1 
ATOM   4702 O O   . ASP F 1 23  ? 19.334  -27.355 17.053  1.00 30.95  ? 576 ASP F O   1 
ATOM   4703 C CB  . ASP F 1 23  ? 21.876  -28.415 15.168  1.00 31.62  ? 576 ASP F CB  1 
ATOM   4704 C CG  . ASP F 1 23  ? 22.294  -28.217 13.702  1.00 34.77  ? 576 ASP F CG  1 
ATOM   4705 O OD1 . ASP F 1 23  ? 21.802  -27.287 13.056  1.00 36.78  ? 576 ASP F OD1 1 
ATOM   4706 O OD2 . ASP F 1 23  ? 23.132  -28.998 13.198  1.00 38.33  ? 576 ASP F OD2 1 
ATOM   4707 N N   . GLN F 1 24  ? 21.266  -27.626 18.160  1.00 31.60  ? 577 GLN F N   1 
ATOM   4708 C CA  . GLN F 1 24  ? 20.667  -27.870 19.427  1.00 29.27  ? 577 GLN F CA  1 
ATOM   4709 C C   . GLN F 1 24  ? 19.898  -26.670 19.895  1.00 27.40  ? 577 GLN F C   1 
ATOM   4710 O O   . GLN F 1 24  ? 18.879  -26.813 20.521  1.00 33.59  ? 577 GLN F O   1 
ATOM   4711 C CB  . GLN F 1 24  ? 21.742  -28.206 20.461  1.00 27.89  ? 577 GLN F CB  1 
ATOM   4712 C CG  . GLN F 1 24  ? 22.097  -29.636 20.495  1.00 23.30  ? 577 GLN F CG  1 
ATOM   4713 C CD  . GLN F 1 24  ? 23.148  -29.933 21.542  1.00 25.83  ? 577 GLN F CD  1 
ATOM   4714 O OE1 . GLN F 1 24  ? 22.879  -29.872 22.723  1.00 38.32  ? 577 GLN F OE1 1 
ATOM   4715 N NE2 . GLN F 1 24  ? 24.347  -30.273 21.105  1.00 38.64  ? 577 GLN F NE2 1 
ATOM   4716 N N   . LEU F 1 25  ? 20.435  -25.496 19.635  1.00 22.30  ? 578 LEU F N   1 
ATOM   4717 C CA  . LEU F 1 25  ? 19.771  -24.263 19.961  1.00 31.21  ? 578 LEU F CA  1 
ATOM   4718 C C   . LEU F 1 25  ? 18.472  -24.127 19.120  1.00 26.37  ? 578 LEU F C   1 
ATOM   4719 O O   . LEU F 1 25  ? 17.451  -23.714 19.664  1.00 33.99  ? 578 LEU F O   1 
ATOM   4720 C CB  . LEU F 1 25  ? 20.701  -23.067 19.734  1.00 24.13  ? 578 LEU F CB  1 
ATOM   4721 C CG  . LEU F 1 25  ? 21.672  -22.525 20.793  1.00 41.73  ? 578 LEU F CG  1 
ATOM   4722 C CD1 . LEU F 1 25  ? 21.984  -23.526 21.824  1.00 31.01  ? 578 LEU F CD1 1 
ATOM   4723 C CD2 . LEU F 1 25  ? 22.998  -22.019 20.144  1.00 27.43  ? 578 LEU F CD2 1 
ATOM   4724 N N   . GLN F 1 26  ? 18.499  -24.495 17.838  1.00 26.24  ? 579 GLN F N   1 
ATOM   4725 C CA  . GLN F 1 26  ? 17.269  -24.370 16.993  1.00 33.77  ? 579 GLN F CA  1 
ATOM   4726 C C   . GLN F 1 26  ? 16.207  -25.375 17.426  1.00 30.26  ? 579 GLN F C   1 
ATOM   4727 O O   . GLN F 1 26  ? 15.017  -25.097 17.341  1.00 38.74  ? 579 GLN F O   1 
ATOM   4728 C CB  . GLN F 1 26  ? 17.573  -24.527 15.494  1.00 29.27  ? 579 GLN F CB  1 
ATOM   4729 C CG  . GLN F 1 26  ? 18.421  -23.395 14.945  1.00 44.30  ? 579 GLN F CG  1 
ATOM   4730 C CD  . GLN F 1 26  ? 18.138  -23.043 13.499  1.00 26.38  ? 579 GLN F CD  1 
ATOM   4731 O OE1 . GLN F 1 26  ? 19.001  -23.175 12.646  1.00 41.21  ? 579 GLN F OE1 1 
ATOM   4732 N NE2 . GLN F 1 26  ? 16.948  -22.599 13.227  1.00 17.47  ? 579 GLN F NE2 1 
ATOM   4733 N N   . ASP F 1 27  ? 16.654  -26.519 17.948  1.00 26.06  ? 580 ASP F N   1 
ATOM   4734 C CA  . ASP F 1 27  ? 15.756  -27.523 18.466  1.00 28.82  ? 580 ASP F CA  1 
ATOM   4735 C C   . ASP F 1 27  ? 14.891  -27.029 19.627  1.00 23.15  ? 580 ASP F C   1 
ATOM   4736 O O   . ASP F 1 27  ? 13.937  -27.666 19.949  1.00 31.04  ? 580 ASP F O   1 
ATOM   4737 C CB  . ASP F 1 27  ? 16.536  -28.762 18.916  1.00 30.97  ? 580 ASP F CB  1 
ATOM   4738 C CG  . ASP F 1 27  ? 16.989  -29.635 17.754  1.00 34.58  ? 580 ASP F CG  1 
ATOM   4739 O OD1 . ASP F 1 27  ? 16.767  -29.291 16.563  1.00 41.99  ? 580 ASP F OD1 1 
ATOM   4740 O OD2 . ASP F 1 27  ? 17.583  -30.681 18.039  1.00 44.39  ? 580 ASP F OD2 1 
ATOM   4741 N N   . LYS F 1 28  ? 15.280  -25.935 20.260  1.00 24.78  ? 581 LYS F N   1 
ATOM   4742 C CA  . LYS F 1 28  ? 14.575  -25.349 21.372  1.00 26.44  ? 581 LYS F CA  1 
ATOM   4743 C C   . LYS F 1 28  ? 13.692  -24.178 20.912  1.00 27.35  ? 581 LYS F C   1 
ATOM   4744 O O   . LYS F 1 28  ? 13.125  -23.486 21.741  1.00 33.90  ? 581 LYS F O   1 
ATOM   4745 C CB  . LYS F 1 28  ? 15.581  -24.838 22.382  1.00 25.55  ? 581 LYS F CB  1 
ATOM   4746 C CG  . LYS F 1 28  ? 16.635  -25.881 22.811  1.00 44.17  ? 581 LYS F CG  1 
ATOM   4747 C CD  . LYS F 1 28  ? 15.997  -27.106 23.454  1.00 56.42  ? 581 LYS F CD  1 
ATOM   4748 C CE  . LYS F 1 28  ? 16.981  -27.852 24.346  1.00 62.45  ? 581 LYS F CE  1 
ATOM   4749 N NZ  . LYS F 1 28  ? 18.064  -28.448 23.530  1.00 57.47  ? 581 LYS F NZ  1 
ATOM   4750 N N   . ASP F 1 29  ? 13.628  -23.946 19.604  1.00 30.41  ? 582 ASP F N   1 
ATOM   4751 C CA  . ASP F 1 29  ? 12.718  -22.972 19.002  1.00 30.17  ? 582 ASP F CA  1 
ATOM   4752 C C   . ASP F 1 29  ? 11.833  -23.729 18.005  1.00 32.38  ? 582 ASP F C   1 
ATOM   4753 O O   . ASP F 1 29  ? 11.860  -23.458 16.820  1.00 38.18  ? 582 ASP F O   1 
ATOM   4754 C CB  . ASP F 1 29  ? 13.526  -21.875 18.317  1.00 30.47  ? 582 ASP F CB  1 
ATOM   4755 C CG  . ASP F 1 29  ? 12.656  -20.808 17.651  1.00 36.99  ? 582 ASP F CG  1 
ATOM   4756 O OD1 . ASP F 1 29  ? 11.512  -20.606 18.093  1.00 34.06  ? 582 ASP F OD1 1 
ATOM   4757 O OD2 . ASP F 1 29  ? 13.126  -20.159 16.688  1.00 31.44  ? 582 ASP F OD2 1 
ATOM   4758 N N   . PRO F 1 30  ? 11.012  -24.685 18.493  1.00 34.17  ? 583 PRO F N   1 
ATOM   4759 C CA  . PRO F 1 30  ? 10.278  -25.497 17.534  1.00 32.37  ? 583 PRO F CA  1 
ATOM   4760 C C   . PRO F 1 30  ? 9.266   -24.636 16.793  1.00 32.88  ? 583 PRO F C   1 
ATOM   4761 O O   . PRO F 1 30  ? 8.912   -24.968 15.663  1.00 35.90  ? 583 PRO F O   1 
ATOM   4762 C CB  . PRO F 1 30  ? 9.595   -26.548 18.413  1.00 31.49  ? 583 PRO F CB  1 
ATOM   4763 C CG  . PRO F 1 30  ? 9.282   -25.782 19.679  1.00 32.99  ? 583 PRO F CG  1 
ATOM   4764 C CD  . PRO F 1 30  ? 10.413  -24.766 19.837  1.00 35.55  ? 583 PRO F CD  1 
ATOM   4765 N N   . ALA F 1 31  ? 8.845   -23.509 17.369  1.00 25.57  ? 584 ALA F N   1 
ATOM   4766 C CA  . ALA F 1 31  ? 7.955   -22.613 16.610  1.00 35.24  ? 584 ALA F CA  1 
ATOM   4767 C C   . ALA F 1 31  ? 8.677   -21.797 15.553  1.00 27.23  ? 584 ALA F C   1 
ATOM   4768 O O   . ALA F 1 31  ? 8.038   -21.119 14.766  1.00 34.56  ? 584 ALA F O   1 
ATOM   4769 C CB  . ALA F 1 31  ? 7.126   -21.702 17.528  1.00 34.78  ? 584 ALA F CB  1 
ATOM   4770 N N   . ARG F 1 32  ? 10.001  -21.846 15.510  1.00 31.26  ? 585 ARG F N   1 
ATOM   4771 C CA  . ARG F 1 32  ? 10.730  -21.153 14.446  1.00 31.80  ? 585 ARG F CA  1 
ATOM   4772 C C   . ARG F 1 32  ? 10.573  -19.638 14.524  1.00 26.46  ? 585 ARG F C   1 
ATOM   4773 O O   . ARG F 1 32  ? 10.534  -18.962 13.523  1.00 34.48  ? 585 ARG F O   1 
ATOM   4774 C CB  . ARG F 1 32  ? 10.352  -21.693 13.041  1.00 26.26  ? 585 ARG F CB  1 
ATOM   4775 C CG  . ARG F 1 32  ? 10.866  -23.127 12.843  1.00 36.70  ? 585 ARG F CG  1 
ATOM   4776 C CD  . ARG F 1 32  ? 10.678  -23.733 11.436  1.00 39.13  ? 585 ARG F CD  1 
ATOM   4777 N NE  . ARG F 1 32  ? 10.782  -22.754 10.361  1.00 29.87  ? 585 ARG F NE  1 
ATOM   4778 C CZ  . ARG F 1 32  ? 11.895  -22.401 9.721   1.00 34.93  ? 585 ARG F CZ  1 
ATOM   4779 N NH1 . ARG F 1 32  ? 11.830  -21.468 8.758   1.00 33.30  ? 585 ARG F NH1 1 
ATOM   4780 N NH2 . ARG F 1 32  ? 13.059  -22.954 10.023  1.00 21.11  ? 585 ARG F NH2 1 
ATOM   4781 N N   . ILE F 1 33  ? 10.506  -19.124 15.738  1.00 28.04  ? 586 ILE F N   1 
ATOM   4782 C CA  . ILE F 1 33  ? 10.285  -17.727 15.975  1.00 32.10  ? 586 ILE F CA  1 
ATOM   4783 C C   . ILE F 1 33  ? 11.573  -16.943 15.620  1.00 33.16  ? 586 ILE F C   1 
ATOM   4784 O O   . ILE F 1 33  ? 11.501  -15.893 14.985  1.00 32.80  ? 586 ILE F O   1 
ATOM   4785 C CB  . ILE F 1 33  ? 9.794   -17.520 17.454  1.00 33.44  ? 586 ILE F CB  1 
ATOM   4786 C CG1 . ILE F 1 33  ? 8.472   -18.249 17.674  1.00 39.03  ? 586 ILE F CG1 1 
ATOM   4787 C CG2 . ILE F 1 33  ? 9.531   -16.080 17.754  1.00 22.29  ? 586 ILE F CG2 1 
ATOM   4788 C CD1 . ILE F 1 33  ? 7.938   -18.212 19.103  1.00 33.40  ? 586 ILE F CD1 1 
ATOM   4789 N N   . PHE F 1 34  ? 12.736  -17.506 15.934  1.00 26.47  ? 587 PHE F N   1 
ATOM   4790 C CA  . PHE F 1 34  ? 14.037  -16.884 15.657  1.00 26.73  ? 587 PHE F CA  1 
ATOM   4791 C C   . PHE F 1 34  ? 14.811  -17.525 14.528  1.00 29.56  ? 587 PHE F C   1 
ATOM   4792 O O   . PHE F 1 34  ? 16.060  -17.435 14.499  1.00 23.16  ? 587 PHE F O   1 
ATOM   4793 C CB  . PHE F 1 34  ? 14.928  -17.053 16.883  1.00 26.29  ? 587 PHE F CB  1 
ATOM   4794 C CG  . PHE F 1 34  ? 14.299  -16.619 18.127  1.00 17.55  ? 587 PHE F CG  1 
ATOM   4795 C CD1 . PHE F 1 34  ? 14.163  -15.273 18.404  1.00 26.53  ? 587 PHE F CD1 1 
ATOM   4796 C CD2 . PHE F 1 34  ? 13.768  -17.546 19.012  1.00 19.63  ? 587 PHE F CD2 1 
ATOM   4797 C CE1 . PHE F 1 34  ? 13.542  -14.857 19.559  1.00 36.98  ? 587 PHE F CE1 1 
ATOM   4798 C CE2 . PHE F 1 34  ? 13.145  -17.140 20.145  1.00 29.62  ? 587 PHE F CE2 1 
ATOM   4799 C CZ  . PHE F 1 34  ? 13.025  -15.789 20.430  1.00 31.00  ? 587 PHE F CZ  1 
ATOM   4800 N N   . ALA F 1 35  ? 14.095  -18.195 13.636  1.00 30.95  ? 588 ALA F N   1 
ATOM   4801 C CA  . ALA F 1 35  ? 14.699  -18.984 12.537  1.00 28.27  ? 588 ALA F CA  1 
ATOM   4802 C C   . ALA F 1 35  ? 15.237  -18.092 11.443  1.00 27.16  ? 588 ALA F C   1 
ATOM   4803 O O   . ALA F 1 35  ? 16.297  -18.367 10.856  1.00 21.12  ? 588 ALA F O   1 
ATOM   4804 C CB  . ALA F 1 35  ? 13.662  -19.944 11.947  1.00 24.76  ? 588 ALA F CB  1 
ATOM   4805 N N   . GLN F 1 36  ? 14.511  -17.003 11.192  1.00 26.22  ? 589 GLN F N   1 
ATOM   4806 C CA  . GLN F 1 36  ? 14.814  -16.097 10.116  1.00 24.74  ? 589 GLN F CA  1 
ATOM   4807 C C   . GLN F 1 36  ? 14.918  -14.659 10.604  1.00 29.01  ? 589 GLN F C   1 
ATOM   4808 O O   . GLN F 1 36  ? 14.469  -14.358 11.689  1.00 29.24  ? 589 GLN F O   1 
ATOM   4809 C CB  . GLN F 1 36  ? 13.707  -16.236 9.086   1.00 39.22  ? 589 GLN F CB  1 
ATOM   4810 C CG  . GLN F 1 36  ? 13.528  -17.692 8.656   1.00 47.51  ? 589 GLN F CG  1 
ATOM   4811 C CD  . GLN F 1 36  ? 12.671  -17.848 7.438   1.00 24.26  ? 589 GLN F CD  1 
ATOM   4812 O OE1 . GLN F 1 36  ? 13.175  -18.075 6.348   1.00 44.51  ? 589 GLN F OE1 1 
ATOM   4813 N NE2 . GLN F 1 36  ? 11.357  -17.766 7.622   1.00 58.21  ? 589 GLN F NE2 1 
ATOM   4814 N N   . PRO F 1 37  ? 15.517  -13.758 9.795   1.00 36.63  ? 590 PRO F N   1 
ATOM   4815 C CA  . PRO F 1 37  ? 15.580  -12.338 10.191  1.00 36.40  ? 590 PRO F CA  1 
ATOM   4816 C C   . PRO F 1 37  ? 14.185  -11.749 10.432  1.00 38.76  ? 590 PRO F C   1 
ATOM   4817 O O   . PRO F 1 37  ? 13.236  -12.157 9.787   1.00 29.73  ? 590 PRO F O   1 
ATOM   4818 C CB  . PRO F 1 37  ? 16.249  -11.653 8.996   1.00 27.44  ? 590 PRO F CB  1 
ATOM   4819 C CG  . PRO F 1 37  ? 16.919  -12.754 8.236   1.00 41.09  ? 590 PRO F CG  1 
ATOM   4820 C CD  . PRO F 1 37  ? 16.222  -14.028 8.528   1.00 35.39  ? 590 PRO F CD  1 
ATOM   4821 N N   . VAL F 1 38  ? 14.041  -10.836 11.386  1.00 39.43  ? 591 VAL F N   1 
ATOM   4822 C CA  . VAL F 1 38  ? 12.732  -10.231 11.601  1.00 32.60  ? 591 VAL F CA  1 
ATOM   4823 C C   . VAL F 1 38  ? 12.418  -9.477  10.326  1.00 31.63  ? 591 VAL F C   1 
ATOM   4824 O O   . VAL F 1 38  ? 13.303  -8.902  9.694   1.00 31.94  ? 591 VAL F O   1 
ATOM   4825 C CB  . VAL F 1 38  ? 12.704  -9.320  12.852  1.00 43.01  ? 591 VAL F CB  1 
ATOM   4826 C CG1 . VAL F 1 38  ? 11.657  -8.223  12.725  1.00 35.69  ? 591 VAL F CG1 1 
ATOM   4827 C CG2 . VAL F 1 38  ? 12.480  -10.164 14.130  1.00 41.54  ? 591 VAL F CG2 1 
ATOM   4828 N N   . SER F 1 39  ? 11.163  -9.548  9.906   1.00 35.92  ? 592 SER F N   1 
ATOM   4829 C CA  . SER F 1 39  ? 10.732  -8.871  8.724   1.00 28.38  ? 592 SER F CA  1 
ATOM   4830 C C   . SER F 1 39  ? 10.316  -7.476  9.086   1.00 30.57  ? 592 SER F C   1 
ATOM   4831 O O   . SER F 1 39  ? 9.394   -7.292  9.864   1.00 32.38  ? 592 SER F O   1 
ATOM   4832 C CB  . SER F 1 39  ? 9.545   -9.585  8.078   1.00 35.14  ? 592 SER F CB  1 
ATOM   4833 O OG  . SER F 1 39  ? 9.055   -8.833  6.980   1.00 41.05  ? 592 SER F OG  1 
ATOM   4834 N N   . LEU F 1 40  ? 10.971  -6.491  8.494   1.00 29.92  ? 593 LEU F N   1 
ATOM   4835 C CA  . LEU F 1 40  ? 10.555  -5.092  8.674   1.00 35.13  ? 593 LEU F CA  1 
ATOM   4836 C C   . LEU F 1 40  ? 9.110   -4.815  8.191   1.00 34.63  ? 593 LEU F C   1 
ATOM   4837 O O   . LEU F 1 40  ? 8.417   -3.935  8.731   1.00 31.90  ? 593 LEU F O   1 
ATOM   4838 C CB  . LEU F 1 40  ? 11.569  -4.148  7.996   1.00 34.50  ? 593 LEU F CB  1 
ATOM   4839 C CG  . LEU F 1 40  ? 12.987  -4.119  8.599   1.00 44.89  ? 593 LEU F CG  1 
ATOM   4840 C CD1 . LEU F 1 40  ? 13.828  -2.964  8.049   1.00 26.30  ? 593 LEU F CD1 1 
ATOM   4841 C CD2 . LEU F 1 40  ? 12.948  -4.038  10.130  1.00 35.98  ? 593 LEU F CD2 1 
ATOM   4842 N N   . LYS F 1 41  ? 8.664   -5.566  7.185   1.00 38.37  ? 594 LYS F N   1 
ATOM   4843 C CA  . LYS F 1 41  ? 7.278   -5.486  6.673   1.00 33.91  ? 594 LYS F CA  1 
ATOM   4844 C C   . LYS F 1 41  ? 6.245   -5.783  7.752   1.00 29.80  ? 594 LYS F C   1 
ATOM   4845 O O   . LYS F 1 41  ? 5.115   -5.265  7.719   1.00 32.39  ? 594 LYS F O   1 
ATOM   4846 C CB  . LYS F 1 41  ? 7.070   -6.498  5.526   1.00 41.27  ? 594 LYS F CB  1 
ATOM   4847 C CG  . LYS F 1 41  ? 7.902   -6.252  4.256   1.00 48.10  ? 594 LYS F CG  1 
ATOM   4848 C CD  . LYS F 1 41  ? 7.408   -5.023  3.523   1.00 39.23  ? 594 LYS F CD  1 
ATOM   4849 C CE  . LYS F 1 41  ? 8.178   -4.766  2.244   1.00 45.19  ? 594 LYS F CE  1 
ATOM   4850 N NZ  . LYS F 1 41  ? 7.964   -3.345  1.871   1.00 26.88  ? 594 LYS F NZ  1 
ATOM   4851 N N   . GLU F 1 42  ? 6.628   -6.657  8.677   1.00 31.56  ? 595 GLU F N   1 
ATOM   4852 C CA  . GLU F 1 42  ? 5.768   -7.077  9.776   1.00 39.92  ? 595 GLU F CA  1 
ATOM   4853 C C   . GLU F 1 42  ? 6.001   -6.204  11.008  1.00 36.70  ? 595 GLU F C   1 
ATOM   4854 O O   . GLU F 1 42  ? 5.064   -5.921  11.760  1.00 41.06  ? 595 GLU F O   1 
ATOM   4855 C CB  . GLU F 1 42  ? 5.998   -8.562  10.087  1.00 43.57  ? 595 GLU F CB  1 
ATOM   4856 C CG  . GLU F 1 42  ? 5.568   -9.501  8.934   1.00 52.31  ? 595 GLU F CG  1 
ATOM   4857 C CD  . GLU F 1 42  ? 6.002   -10.951 9.145   1.00 73.05  ? 595 GLU F CD  1 
ATOM   4858 O OE1 . GLU F 1 42  ? 5.902   -11.440 10.291  1.00 85.02  ? 595 GLU F OE1 1 
ATOM   4859 O OE2 . GLU F 1 42  ? 6.434   -11.604 8.166   1.00 72.46  ? 595 GLU F OE2 1 
ATOM   4860 N N   . VAL F 1 43  ? 7.240   -5.747  11.170  1.00 34.44  ? 596 VAL F N   1 
ATOM   4861 C CA  . VAL F 1 43  ? 7.686   -4.939  12.302  1.00 31.67  ? 596 VAL F CA  1 
ATOM   4862 C C   . VAL F 1 43  ? 8.462   -3.705  11.760  1.00 28.38  ? 596 VAL F C   1 
ATOM   4863 O O   . VAL F 1 43  ? 9.681   -3.631  11.886  1.00 29.97  ? 596 VAL F O   1 
ATOM   4864 C CB  . VAL F 1 43  ? 8.588   -5.818  13.239  1.00 38.40  ? 596 VAL F CB  1 
ATOM   4865 C CG1 . VAL F 1 43  ? 8.791   -5.182  14.592  1.00 35.56  ? 596 VAL F CG1 1 
ATOM   4866 C CG2 . VAL F 1 43  ? 7.968   -7.193  13.421  1.00 41.87  ? 596 VAL F CG2 1 
ATOM   4867 N N   . PRO F 1 44  ? 7.764   -2.736  11.143  1.00 34.29  ? 597 PRO F N   1 
ATOM   4868 C CA  . PRO F 1 44  ? 8.451   -1.575  10.506  1.00 34.41  ? 597 PRO F CA  1 
ATOM   4869 C C   . PRO F 1 44  ? 9.215   -0.604  11.440  1.00 33.36  ? 597 PRO F C   1 
ATOM   4870 O O   . PRO F 1 44  ? 10.070  0.143   10.970  1.00 27.53  ? 597 PRO F O   1 
ATOM   4871 C CB  . PRO F 1 44  ? 7.320   -0.824  9.782   1.00 35.79  ? 597 PRO F CB  1 
ATOM   4872 C CG  . PRO F 1 44  ? 6.122   -1.758  9.782   1.00 32.36  ? 597 PRO F CG  1 
ATOM   4873 C CD  . PRO F 1 44  ? 6.298   -2.642  11.013  1.00 32.35  ? 597 PRO F CD  1 
ATOM   4874 N N   . ASP F 1 45  ? 8.940   -0.604  12.738  1.00 32.36  ? 598 ASP F N   1 
ATOM   4875 C CA  . ASP F 1 45  ? 9.727   0.216   13.652  1.00 31.67  ? 598 ASP F CA  1 
ATOM   4876 C C   . ASP F 1 45  ? 10.908  -0.580  14.249  1.00 31.76  ? 598 ASP F C   1 
ATOM   4877 O O   . ASP F 1 45  ? 11.607  -0.063  15.109  1.00 32.17  ? 598 ASP F O   1 
ATOM   4878 C CB  . ASP F 1 45  ? 8.869   0.814   14.792  1.00 32.19  ? 598 ASP F CB  1 
ATOM   4879 C CG  . ASP F 1 45  ? 8.166   -0.253  15.634  1.00 49.31  ? 598 ASP F CG  1 
ATOM   4880 O OD1 . ASP F 1 45  ? 7.961   -1.370  15.117  1.00 38.90  ? 598 ASP F OD1 1 
ATOM   4881 O OD2 . ASP F 1 45  ? 7.801   0.034   16.791  1.00 40.02  ? 598 ASP F OD2 1 
ATOM   4882 N N   . TYR F 1 46  ? 11.144  -1.805  13.786  1.00 23.57  ? 599 TYR F N   1 
ATOM   4883 C CA  . TYR F 1 46  ? 12.107  -2.665  14.454  1.00 28.78  ? 599 TYR F CA  1 
ATOM   4884 C C   . TYR F 1 46  ? 13.457  -2.006  14.679  1.00 26.20  ? 599 TYR F C   1 
ATOM   4885 O O   . TYR F 1 46  ? 13.976  -2.061  15.803  1.00 31.83  ? 599 TYR F O   1 
ATOM   4886 C CB  . TYR F 1 46  ? 12.296  -3.984  13.715  1.00 32.37  ? 599 TYR F CB  1 
ATOM   4887 C CG  . TYR F 1 46  ? 13.015  -5.047  14.538  1.00 29.53  ? 599 TYR F CG  1 
ATOM   4888 C CD1 . TYR F 1 46  ? 12.425  -5.573  15.667  1.00 36.98  ? 599 TYR F CD1 1 
ATOM   4889 C CD2 . TYR F 1 46  ? 14.252  -5.538  14.167  1.00 33.76  ? 599 TYR F CD2 1 
ATOM   4890 C CE1 . TYR F 1 46  ? 13.051  -6.553  16.433  1.00 33.59  ? 599 TYR F CE1 1 
ATOM   4891 C CE2 . TYR F 1 46  ? 14.897  -6.564  14.928  1.00 29.45  ? 599 TYR F CE2 1 
ATOM   4892 C CZ  . TYR F 1 46  ? 14.273  -7.046  16.063  1.00 28.69  ? 599 TYR F CZ  1 
ATOM   4893 O OH  . TYR F 1 46  ? 14.838  -8.035  16.841  1.00 31.47  ? 599 TYR F OH  1 
ATOM   4894 N N   . LEU F 1 47  ? 14.015  -1.371  13.642  1.00 29.12  ? 600 LEU F N   1 
ATOM   4895 C CA  . LEU F 1 47  ? 15.362  -0.743  13.729  1.00 38.89  ? 600 LEU F CA  1 
ATOM   4896 C C   . LEU F 1 47  ? 15.456  0.591   14.498  1.00 37.66  ? 600 LEU F C   1 
ATOM   4897 O O   . LEU F 1 47  ? 16.561  1.101   14.722  1.00 34.52  ? 600 LEU F O   1 
ATOM   4898 C CB  . LEU F 1 47  ? 15.975  -0.537  12.344  1.00 40.97  ? 600 LEU F CB  1 
ATOM   4899 C CG  . LEU F 1 47  ? 16.069  -1.728  11.395  1.00 47.47  ? 600 LEU F CG  1 
ATOM   4900 C CD1 . LEU F 1 47  ? 16.773  -1.322  10.081  1.00 27.00  ? 600 LEU F CD1 1 
ATOM   4901 C CD2 . LEU F 1 47  ? 16.789  -2.878  12.080  1.00 29.67  ? 600 LEU F CD2 1 
ATOM   4902 N N   . ASP F 1 48  ? 14.316  1.157   14.879  1.00 37.93  ? 601 ASP F N   1 
ATOM   4903 C CA  . ASP F 1 48  ? 14.286  2.287   15.792  1.00 44.31  ? 601 ASP F CA  1 
ATOM   4904 C C   . ASP F 1 48  ? 14.774  1.820   17.181  1.00 49.22  ? 601 ASP F C   1 
ATOM   4905 O O   . ASP F 1 48  ? 15.442  2.561   17.880  1.00 48.16  ? 601 ASP F O   1 
ATOM   4906 C CB  . ASP F 1 48  ? 12.869  2.903   15.894  1.00 51.25  ? 601 ASP F CB  1 
ATOM   4907 C CG  . ASP F 1 48  ? 12.450  3.701   14.629  1.00 59.69  ? 601 ASP F CG  1 
ATOM   4908 O OD1 . ASP F 1 48  ? 13.332  4.077   13.833  1.00 67.40  ? 601 ASP F OD1 1 
ATOM   4909 O OD2 . ASP F 1 48  ? 11.236  3.973   14.437  1.00 50.85  ? 601 ASP F OD2 1 
ATOM   4910 N N   . HIS F 1 49  ? 14.462  0.582   17.557  1.00 49.62  ? 602 HIS F N   1 
ATOM   4911 C CA  . HIS F 1 49  ? 14.806  0.054   18.878  1.00 48.03  ? 602 HIS F CA  1 
ATOM   4912 C C   . HIS F 1 49  ? 16.000  -0.882  18.836  1.00 37.45  ? 602 HIS F C   1 
ATOM   4913 O O   . HIS F 1 49  ? 16.853  -0.823  19.684  1.00 37.48  ? 602 HIS F O   1 
ATOM   4914 C CB  . HIS F 1 49  ? 13.609  -0.682  19.502  1.00 51.78  ? 602 HIS F CB  1 
ATOM   4915 C CG  . HIS F 1 49  ? 12.416  0.195   19.737  1.00 61.36  ? 602 HIS F CG  1 
ATOM   4916 N ND1 . HIS F 1 49  ? 11.344  0.241   18.870  1.00 67.08  ? 602 HIS F ND1 1 
ATOM   4917 C CD2 . HIS F 1 49  ? 12.135  1.072   20.730  1.00 55.92  ? 602 HIS F CD2 1 
ATOM   4918 C CE1 . HIS F 1 49  ? 10.453  1.105   19.318  1.00 53.83  ? 602 HIS F CE1 1 
ATOM   4919 N NE2 . HIS F 1 49  ? 10.906  1.618   20.448  1.00 63.33  ? 602 HIS F NE2 1 
ATOM   4920 N N   . ILE F 1 50  ? 16.077  -1.743  17.841  1.00 39.81  ? 603 ILE F N   1 
ATOM   4921 C CA  . ILE F 1 50  ? 17.151  -2.728  17.800  1.00 34.82  ? 603 ILE F CA  1 
ATOM   4922 C C   . ILE F 1 50  ? 18.229  -2.287  16.856  1.00 32.90  ? 603 ILE F C   1 
ATOM   4923 O O   . ILE F 1 50  ? 17.987  -2.078  15.670  1.00 49.32  ? 603 ILE F O   1 
ATOM   4924 C CB  . ILE F 1 50  ? 16.599  -4.103  17.349  1.00 34.57  ? 603 ILE F CB  1 
ATOM   4925 C CG1 . ILE F 1 50  ? 15.580  -4.572  18.376  1.00 28.89  ? 603 ILE F CG1 1 
ATOM   4926 C CG2 . ILE F 1 50  ? 17.736  -5.120  17.152  1.00 28.14  ? 603 ILE F CG2 1 
ATOM   4927 C CD1 . ILE F 1 50  ? 16.076  -4.499  19.810  1.00 29.81  ? 603 ILE F CD1 1 
ATOM   4928 N N   . LYS F 1 51  ? 19.430  -2.132  17.360  1.00 37.69  ? 604 LYS F N   1 
ATOM   4929 C CA  . LYS F 1 51  ? 20.483  -1.605  16.512  1.00 36.64  ? 604 LYS F CA  1 
ATOM   4930 C C   . LYS F 1 51  ? 21.189  -2.760  15.823  1.00 39.38  ? 604 LYS F C   1 
ATOM   4931 O O   . LYS F 1 51  ? 21.749  -2.571  14.758  1.00 45.47  ? 604 LYS F O   1 
ATOM   4932 C CB  . LYS F 1 51  ? 21.439  -0.694  17.292  1.00 47.92  ? 604 LYS F CB  1 
ATOM   4933 C CG  . LYS F 1 51  ? 20.771  0.493   18.035  1.00 38.65  ? 604 LYS F CG  1 
ATOM   4934 C CD  . LYS F 1 51  ? 20.056  1.483   17.095  1.00 71.56  ? 604 LYS F CD  1 
ATOM   4935 N N   . HIS F 1 52  ? 21.088  -3.974  16.374  1.00 40.07  ? 605 HIS F N   1 
ATOM   4936 C CA  . HIS F 1 52  ? 21.791  -5.123  15.812  1.00 40.25  ? 605 HIS F CA  1 
ATOM   4937 C C   . HIS F 1 52  ? 20.895  -6.405  15.727  1.00 39.49  ? 605 HIS F C   1 
ATOM   4938 O O   . HIS F 1 52  ? 21.002  -7.304  16.570  1.00 35.72  ? 605 HIS F O   1 
ATOM   4939 C CB  . HIS F 1 52  ? 23.065  -5.326  16.654  1.00 36.68  ? 605 HIS F CB  1 
ATOM   4940 C CG  . HIS F 1 52  ? 24.119  -6.160  15.999  1.00 51.85  ? 605 HIS F CG  1 
ATOM   4941 N ND1 . HIS F 1 52  ? 23.847  -7.069  14.997  1.00 42.22  ? 605 HIS F ND1 1 
ATOM   4942 C CD2 . HIS F 1 52  ? 25.448  -6.253  16.243  1.00 30.15  ? 605 HIS F CD2 1 
ATOM   4943 C CE1 . HIS F 1 52  ? 24.967  -7.675  14.641  1.00 67.08  ? 605 HIS F CE1 1 
ATOM   4944 N NE2 . HIS F 1 52  ? 25.952  -7.201  15.383  1.00 56.74  ? 605 HIS F NE2 1 
ATOM   4945 N N   . PRO F 1 53  ? 19.995  -6.472  14.714  1.00 37.62  ? 606 PRO F N   1 
ATOM   4946 C CA  . PRO F 1 53  ? 19.172  -7.651  14.495  1.00 36.96  ? 606 PRO F CA  1 
ATOM   4947 C C   . PRO F 1 53  ? 20.030  -8.885  14.331  1.00 36.74  ? 606 PRO F C   1 
ATOM   4948 O O   . PRO F 1 53  ? 21.075  -8.810  13.724  1.00 30.00  ? 606 PRO F O   1 
ATOM   4949 C CB  . PRO F 1 53  ? 18.471  -7.391  13.154  1.00 30.51  ? 606 PRO F CB  1 
ATOM   4950 C CG  . PRO F 1 53  ? 18.642  -5.940  12.860  1.00 38.62  ? 606 PRO F CG  1 
ATOM   4951 C CD  . PRO F 1 53  ? 19.575  -5.337  13.870  1.00 40.96  ? 606 PRO F CD  1 
ATOM   4952 N N   . MET F 1 54  ? 19.535  -10.010 14.828  1.00 28.36  ? 607 MET F N   1 
ATOM   4953 C CA  . MET F 1 54  ? 20.168  -11.283 14.612  1.00 31.87  ? 607 MET F CA  1 
ATOM   4954 C C   . MET F 1 54  ? 19.107  -12.385 14.603  1.00 32.10  ? 607 MET F C   1 
ATOM   4955 O O   . MET F 1 54  ? 17.998  -12.212 15.122  1.00 36.87  ? 607 MET F O   1 
ATOM   4956 C CB  . MET F 1 54  ? 21.155  -11.504 15.752  1.00 24.36  ? 607 MET F CB  1 
ATOM   4957 C CG  . MET F 1 54  ? 21.997  -12.719 15.594  1.00 37.41  ? 607 MET F CG  1 
ATOM   4958 S SD  . MET F 1 54  ? 22.783  -12.814 14.014  1.00 37.10  ? 607 MET F SD  1 
ATOM   4959 C CE  . MET F 1 54  ? 23.638  -11.204 13.922  1.00 21.63  ? 607 MET F CE  1 
ATOM   4960 N N   . ASP F 1 55  ? 19.459  -13.521 14.024  1.00 33.04  ? 608 ASP F N   1 
ATOM   4961 C CA  . ASP F 1 55  ? 18.559  -14.647 13.888  1.00 30.62  ? 608 ASP F CA  1 
ATOM   4962 C C   . ASP F 1 55  ? 19.379  -15.891 13.596  1.00 30.94  ? 608 ASP F C   1 
ATOM   4963 O O   . ASP F 1 55  ? 20.628  -15.814 13.446  1.00 32.38  ? 608 ASP F O   1 
ATOM   4964 C CB  . ASP F 1 55  ? 17.562  -14.378 12.738  1.00 35.94  ? 608 ASP F CB  1 
ATOM   4965 C CG  . ASP F 1 55  ? 18.234  -14.391 11.396  1.00 45.08  ? 608 ASP F CG  1 
ATOM   4966 O OD1 . ASP F 1 55  ? 18.650  -13.302 10.918  1.00 38.76  ? 608 ASP F OD1 1 
ATOM   4967 O OD2 . ASP F 1 55  ? 18.372  -15.501 10.833  1.00 64.05  ? 608 ASP F OD2 1 
ATOM   4968 N N   . PHE F 1 56  ? 18.715  -17.048 13.535  1.00 22.38  ? 609 PHE F N   1 
ATOM   4969 C CA  . PHE F 1 56  ? 19.472  -18.305 13.483  1.00 30.16  ? 609 PHE F CA  1 
ATOM   4970 C C   . PHE F 1 56  ? 20.049  -18.534 12.100  1.00 29.07  ? 609 PHE F C   1 
ATOM   4971 O O   . PHE F 1 56  ? 21.171  -19.041 11.961  1.00 28.30  ? 609 PHE F O   1 
ATOM   4972 C CB  . PHE F 1 56  ? 18.603  -19.509 13.864  1.00 38.22  ? 609 PHE F CB  1 
ATOM   4973 C CG  . PHE F 1 56  ? 18.471  -19.748 15.351  1.00 34.69  ? 609 PHE F CG  1 
ATOM   4974 C CD1 . PHE F 1 56  ? 19.589  -19.834 16.162  1.00 27.55  ? 609 PHE F CD1 1 
ATOM   4975 C CD2 . PHE F 1 56  ? 17.214  -19.971 15.920  1.00 41.60  ? 609 PHE F CD2 1 
ATOM   4976 C CE1 . PHE F 1 56  ? 19.457  -20.061 17.538  1.00 33.55  ? 609 PHE F CE1 1 
ATOM   4977 C CE2 . PHE F 1 56  ? 17.064  -20.227 17.292  1.00 31.44  ? 609 PHE F CE2 1 
ATOM   4978 C CZ  . PHE F 1 56  ? 18.180  -20.271 18.108  1.00 30.35  ? 609 PHE F CZ  1 
ATOM   4979 N N   . ALA F 1 57  ? 19.277  -18.173 11.078  1.00 18.88  ? 610 ALA F N   1 
ATOM   4980 C CA  . ALA F 1 57  ? 19.716  -18.283 9.704   1.00 29.52  ? 610 ALA F CA  1 
ATOM   4981 C C   . ALA F 1 57  ? 21.012  -17.453 9.459   1.00 34.60  ? 610 ALA F C   1 
ATOM   4982 O O   . ALA F 1 57  ? 21.961  -17.911 8.795   1.00 34.19  ? 610 ALA F O   1 
ATOM   4983 C CB  . ALA F 1 57  ? 18.643  -17.812 8.812   1.00 28.09  ? 610 ALA F CB  1 
ATOM   4984 N N   . THR F 1 58  ? 21.056  -16.250 10.018  1.00 29.59  ? 611 THR F N   1 
ATOM   4985 C CA  . THR F 1 58  ? 22.174  -15.360 9.798   1.00 35.32  ? 611 THR F CA  1 
ATOM   4986 C C   . THR F 1 58  ? 23.380  -16.004 10.482  1.00 39.53  ? 611 THR F C   1 
ATOM   4987 O O   . THR F 1 58  ? 24.463  -16.111 9.890   1.00 38.79  ? 611 THR F O   1 
ATOM   4988 C CB  . THR F 1 58  ? 21.846  -13.949 10.308  1.00 42.15  ? 611 THR F CB  1 
ATOM   4989 O OG1 . THR F 1 58  ? 20.732  -13.445 9.561   1.00 49.48  ? 611 THR F OG1 1 
ATOM   4990 C CG2 . THR F 1 58  ? 23.022  -13.000 10.169  1.00 37.18  ? 611 THR F CG2 1 
ATOM   4991 N N   . MET F 1 59  ? 23.165  -16.503 11.697  1.00 34.92  ? 612 MET F N   1 
ATOM   4992 C CA  . MET F 1 59  ? 24.198  -17.272 12.365  1.00 35.55  ? 612 MET F CA  1 
ATOM   4993 C C   . MET F 1 59  ? 24.684  -18.460 11.529  1.00 36.26  ? 612 MET F C   1 
ATOM   4994 O O   . MET F 1 59  ? 25.891  -18.709 11.461  1.00 27.64  ? 612 MET F O   1 
ATOM   4995 C CB  . MET F 1 59  ? 23.751  -17.714 13.754  1.00 33.99  ? 612 MET F CB  1 
ATOM   4996 C CG  . MET F 1 59  ? 23.708  -16.564 14.745  1.00 30.01  ? 612 MET F CG  1 
ATOM   4997 S SD  . MET F 1 59  ? 23.230  -17.035 16.400  1.00 33.05  ? 612 MET F SD  1 
ATOM   4998 C CE  . MET F 1 59  ? 24.690  -18.029 16.937  1.00 23.57  ? 612 MET F CE  1 
ATOM   4999 N N   . ARG F 1 60  ? 23.768  -19.169 10.875  1.00 31.01  ? 613 ARG F N   1 
ATOM   5000 C CA  . ARG F 1 60  ? 24.152  -20.367 10.108  1.00 32.78  ? 613 ARG F CA  1 
ATOM   5001 C C   . ARG F 1 60  ? 25.075  -19.993 8.962   1.00 36.65  ? 613 ARG F C   1 
ATOM   5002 O O   . ARG F 1 60  ? 26.075  -20.666 8.706   1.00 43.45  ? 613 ARG F O   1 
ATOM   5003 C CB  . ARG F 1 60  ? 22.928  -21.135 9.565   1.00 38.47  ? 613 ARG F CB  1 
ATOM   5004 C CG  . ARG F 1 60  ? 23.205  -22.616 9.025   1.00 27.53  ? 613 ARG F CG  1 
ATOM   5005 C CD  . ARG F 1 60  ? 21.894  -23.418 8.856   1.00 23.55  ? 613 ARG F CD  1 
ATOM   5006 N NE  . ARG F 1 60  ? 21.296  -23.670 10.160  1.00 25.69  ? 613 ARG F NE  1 
ATOM   5007 C CZ  . ARG F 1 60  ? 21.700  -24.625 10.992  1.00 33.46  ? 613 ARG F CZ  1 
ATOM   5008 N NH1 . ARG F 1 60  ? 22.662  -25.471 10.635  1.00 41.11  ? 613 ARG F NH1 1 
ATOM   5009 N NH2 . ARG F 1 60  ? 21.116  -24.758 12.167  1.00 33.24  ? 613 ARG F NH2 1 
ATOM   5010 N N   . LYS F 1 61  ? 24.723  -18.901 8.303   1.00 39.89  ? 614 LYS F N   1 
ATOM   5011 C CA  . LYS F 1 61  ? 25.486  -18.342 7.205   1.00 37.80  ? 614 LYS F CA  1 
ATOM   5012 C C   . LYS F 1 61  ? 26.880  -17.981 7.653   1.00 33.35  ? 614 LYS F C   1 
ATOM   5013 O O   . LYS F 1 61  ? 27.843  -18.422 7.030   1.00 40.04  ? 614 LYS F O   1 
ATOM   5014 C CB  . LYS F 1 61  ? 24.783  -17.104 6.640   1.00 35.68  ? 614 LYS F CB  1 
ATOM   5015 C CG  . LYS F 1 61  ? 25.319  -16.612 5.298   1.00 47.59  ? 614 LYS F CG  1 
ATOM   5016 C CD  . LYS F 1 61  ? 24.359  -15.562 4.651   1.00 45.13  ? 614 LYS F CD  1 
ATOM   5017 N N   . ARG F 1 62  ? 26.994  -17.193 8.722   1.00 26.54  ? 615 ARG F N   1 
ATOM   5018 C CA  . ARG F 1 62  ? 28.329  -16.894 9.280   1.00 39.34  ? 615 ARG F CA  1 
ATOM   5019 C C   . ARG F 1 62  ? 29.090  -18.180 9.558   1.00 35.46  ? 615 ARG F C   1 
ATOM   5020 O O   . ARG F 1 62  ? 30.219  -18.337 9.103   1.00 47.75  ? 615 ARG F O   1 
ATOM   5021 C CB  . ARG F 1 62  ? 28.275  -16.028 10.550  1.00 43.82  ? 615 ARG F CB  1 
ATOM   5022 C CG  . ARG F 1 62  ? 29.636  -15.445 11.018  1.00 44.54  ? 615 ARG F CG  1 
ATOM   5023 C CD  . ARG F 1 62  ? 29.417  -14.195 11.928  1.00 48.26  ? 615 ARG F CD  1 
ATOM   5024 N NE  . ARG F 1 62  ? 30.607  -13.821 12.709  1.00 48.01  ? 615 ARG F NE  1 
ATOM   5025 C CZ  . ARG F 1 62  ? 30.610  -13.052 13.810  1.00 53.13  ? 615 ARG F CZ  1 
ATOM   5026 N NH1 . ARG F 1 62  ? 31.757  -12.793 14.412  1.00 48.87  ? 615 ARG F NH1 1 
ATOM   5027 N NH2 . ARG F 1 62  ? 29.494  -12.530 14.326  1.00 46.25  ? 615 ARG F NH2 1 
ATOM   5028 N N   . LEU F 1 63  ? 28.471  -19.105 10.275  1.00 33.00  ? 616 LEU F N   1 
ATOM   5029 C CA  . LEU F 1 63  ? 29.109  -20.388 10.627  1.00 39.28  ? 616 LEU F CA  1 
ATOM   5030 C C   . LEU F 1 63  ? 29.527  -21.195 9.415   1.00 43.82  ? 616 LEU F C   1 
ATOM   5031 O O   . LEU F 1 63  ? 30.579  -21.823 9.414   1.00 45.74  ? 616 LEU F O   1 
ATOM   5032 C CB  . LEU F 1 63  ? 28.161  -21.258 11.438  1.00 43.87  ? 616 LEU F CB  1 
ATOM   5033 C CG  . LEU F 1 63  ? 28.713  -22.578 11.969  1.00 48.22  ? 616 LEU F CG  1 
ATOM   5034 C CD1 . LEU F 1 63  ? 29.853  -22.273 12.893  1.00 34.65  ? 616 LEU F CD1 1 
ATOM   5035 C CD2 . LEU F 1 63  ? 27.625  -23.354 12.694  1.00 47.91  ? 616 LEU F CD2 1 
ATOM   5036 N N   . GLU F 1 64  ? 28.710  -21.180 8.375   1.00 48.36  ? 617 GLU F N   1 
ATOM   5037 C CA  . GLU F 1 64  ? 29.003  -22.012 7.219   1.00 45.33  ? 617 GLU F CA  1 
ATOM   5038 C C   . GLU F 1 64  ? 30.167  -21.428 6.414   1.00 50.23  ? 617 GLU F C   1 
ATOM   5039 O O   . GLU F 1 64  ? 30.800  -22.150 5.655   1.00 56.94  ? 617 GLU F O   1 
ATOM   5040 C CB  . GLU F 1 64  ? 27.739  -22.274 6.373   1.00 44.45  ? 617 GLU F CB  1 
ATOM   5041 C CG  . GLU F 1 64  ? 27.041  -23.575 6.767   1.00 41.85  ? 617 GLU F CG  1 
ATOM   5042 C CD  . GLU F 1 64  ? 25.607  -23.725 6.263   1.00 36.12  ? 617 GLU F CD  1 
ATOM   5043 O OE1 . GLU F 1 64  ? 25.163  -22.944 5.390   1.00 62.04  ? 617 GLU F OE1 1 
ATOM   5044 O OE2 . GLU F 1 64  ? 24.915  -24.646 6.758   1.00 40.83  ? 617 GLU F OE2 1 
ATOM   5045 N N   . ALA F 1 65  ? 30.473  -20.141 6.613   1.00 50.61  ? 618 ALA F N   1 
ATOM   5046 C CA  . ALA F 1 65  ? 31.706  -19.530 6.074   1.00 48.81  ? 618 ALA F CA  1 
ATOM   5047 C C   . ALA F 1 65  ? 32.833  -19.473 7.128   1.00 47.66  ? 618 ALA F C   1 
ATOM   5048 O O   . ALA F 1 65  ? 33.848  -18.815 6.938   1.00 54.51  ? 618 ALA F O   1 
ATOM   5049 C CB  . ALA F 1 65  ? 31.425  -18.166 5.548   1.00 41.49  ? 618 ALA F CB  1 
ATOM   5050 N N   . GLN F 1 66  ? 32.647  -20.173 8.230   1.00 42.58  ? 619 GLN F N   1 
ATOM   5051 C CA  . GLN F 1 66  ? 33.636  -20.225 9.299   1.00 52.21  ? 619 GLN F CA  1 
ATOM   5052 C C   . GLN F 1 66  ? 34.018  -18.829 9.812   1.00 51.26  ? 619 GLN F C   1 
ATOM   5053 O O   . GLN F 1 66  ? 35.185  -18.582 10.134  1.00 54.25  ? 619 GLN F O   1 
ATOM   5054 C CB  . GLN F 1 66  ? 34.873  -21.022 8.848   1.00 53.91  ? 619 GLN F CB  1 
ATOM   5055 C CG  . GLN F 1 66  ? 34.528  -22.347 8.095   1.00 52.61  ? 619 GLN F CG  1 
ATOM   5056 C CD  . GLN F 1 66  ? 35.406  -23.546 8.530   1.00 70.07  ? 619 GLN F CD  1 
ATOM   5057 O OE1 . GLN F 1 66  ? 35.696  -23.726 9.721   1.00 43.36  ? 619 GLN F OE1 1 
ATOM   5058 N NE2 . GLN F 1 66  ? 35.807  -24.374 7.565   1.00 49.03  ? 619 GLN F NE2 1 
ATOM   5059 N N   . GLY F 1 67  ? 33.022  -17.936 9.909   1.00 41.53  ? 620 GLY F N   1 
ATOM   5060 C CA  . GLY F 1 67  ? 33.220  -16.588 10.459  1.00 38.92  ? 620 GLY F CA  1 
ATOM   5061 C C   . GLY F 1 67  ? 33.040  -16.450 11.974  1.00 44.17  ? 620 GLY F C   1 
ATOM   5062 O O   . GLY F 1 67  ? 32.696  -15.352 12.480  1.00 43.71  ? 620 GLY F O   1 
ATOM   5063 N N   . TYR F 1 68  ? 33.243  -17.554 12.695  1.00 34.12  ? 621 TYR F N   1 
ATOM   5064 C CA  . TYR F 1 68  ? 33.319  -17.531 14.134  1.00 38.95  ? 621 TYR F CA  1 
ATOM   5065 C C   . TYR F 1 68  ? 34.717  -18.021 14.520  1.00 51.24  ? 621 TYR F C   1 
ATOM   5066 O O   . TYR F 1 68  ? 35.084  -19.170 14.236  1.00 48.11  ? 621 TYR F O   1 
ATOM   5067 C CB  . TYR F 1 68  ? 32.213  -18.408 14.755  1.00 43.21  ? 621 TYR F CB  1 
ATOM   5068 C CG  . TYR F 1 68  ? 30.817  -17.819 14.615  1.00 38.49  ? 621 TYR F CG  1 
ATOM   5069 C CD1 . TYR F 1 68  ? 30.473  -16.646 15.285  1.00 46.25  ? 621 TYR F CD1 1 
ATOM   5070 C CD2 . TYR F 1 68  ? 29.849  -18.426 13.814  1.00 38.68  ? 621 TYR F CD2 1 
ATOM   5071 C CE1 . TYR F 1 68  ? 29.192  -16.078 15.174  1.00 31.59  ? 621 TYR F CE1 1 
ATOM   5072 C CE2 . TYR F 1 68  ? 28.544  -17.871 13.698  1.00 18.94  ? 621 TYR F CE2 1 
ATOM   5073 C CZ  . TYR F 1 68  ? 28.238  -16.676 14.389  1.00 42.74  ? 621 TYR F CZ  1 
ATOM   5074 O OH  . TYR F 1 68  ? 26.989  -16.054 14.325  1.00 44.21  ? 621 TYR F OH  1 
ATOM   5075 N N   . LYS F 1 69  ? 35.492  -17.136 15.153  1.00 53.43  ? 622 LYS F N   1 
ATOM   5076 C CA  . LYS F 1 69  ? 36.865  -17.430 15.565  1.00 53.14  ? 622 LYS F CA  1 
ATOM   5077 C C   . LYS F 1 69  ? 36.967  -17.894 17.029  1.00 50.17  ? 622 LYS F C   1 
ATOM   5078 O O   . LYS F 1 69  ? 37.968  -18.464 17.438  1.00 45.62  ? 622 LYS F O   1 
ATOM   5079 C CB  . LYS F 1 69  ? 37.749  -16.192 15.320  1.00 55.49  ? 622 LYS F CB  1 
ATOM   5080 C CG  . LYS F 1 69  ? 37.828  -15.759 13.851  1.00 65.17  ? 622 LYS F CG  1 
ATOM   5081 C CD  . LYS F 1 69  ? 37.827  -16.958 12.883  1.00 66.04  ? 622 LYS F CD  1 
ATOM   5082 N N   . ASN F 1 70  ? 35.936  -17.640 17.822  1.00 47.32  ? 623 ASN F N   1 
ATOM   5083 C CA  . ASN F 1 70  ? 35.835  -18.232 19.147  1.00 47.54  ? 623 ASN F CA  1 
ATOM   5084 C C   . ASN F 1 70  ? 34.387  -18.353 19.585  1.00 46.17  ? 623 ASN F C   1 
ATOM   5085 O O   . ASN F 1 70  ? 33.486  -17.742 18.980  1.00 43.17  ? 623 ASN F O   1 
ATOM   5086 C CB  . ASN F 1 70  ? 36.635  -17.429 20.173  1.00 50.81  ? 623 ASN F CB  1 
ATOM   5087 C CG  . ASN F 1 70  ? 36.311  -15.946 20.148  1.00 56.21  ? 623 ASN F CG  1 
ATOM   5088 O OD1 . ASN F 1 70  ? 35.153  -15.535 20.072  1.00 52.68  ? 623 ASN F OD1 1 
ATOM   5089 N ND2 . ASN F 1 70  ? 37.342  -15.135 20.236  1.00 52.34  ? 623 ASN F ND2 1 
ATOM   5090 N N   . LEU F 1 71  ? 34.165  -19.157 20.623  1.00 39.97  ? 624 LEU F N   1 
ATOM   5091 C CA  . LEU F 1 71  ? 32.828  -19.356 21.158  1.00 39.84  ? 624 LEU F CA  1 
ATOM   5092 C C   . LEU F 1 71  ? 32.257  -18.015 21.612  1.00 45.45  ? 624 LEU F C   1 
ATOM   5093 O O   . LEU F 1 71  ? 31.045  -17.791 21.531  1.00 48.40  ? 624 LEU F O   1 
ATOM   5094 C CB  . LEU F 1 71  ? 32.827  -20.350 22.320  1.00 35.23  ? 624 LEU F CB  1 
ATOM   5095 C CG  . LEU F 1 71  ? 31.491  -20.603 23.048  1.00 52.26  ? 624 LEU F CG  1 
ATOM   5096 C CD1 . LEU F 1 71  ? 30.349  -20.996 22.063  1.00 37.60  ? 624 LEU F CD1 1 
ATOM   5097 C CD2 . LEU F 1 71  ? 31.671  -21.657 24.152  1.00 42.34  ? 624 LEU F CD2 1 
ATOM   5098 N N   . HIS F 1 72  ? 33.127  -17.119 22.071  1.00 48.27  ? 625 HIS F N   1 
ATOM   5099 C CA  . HIS F 1 72  ? 32.677  -15.828 22.540  1.00 47.58  ? 625 HIS F CA  1 
ATOM   5100 C C   . HIS F 1 72  ? 31.864  -15.081 21.482  1.00 43.19  ? 625 HIS F C   1 
ATOM   5101 O O   . HIS F 1 72  ? 30.794  -14.550 21.776  1.00 46.92  ? 625 HIS F O   1 
ATOM   5102 C CB  . HIS F 1 72  ? 33.837  -14.952 22.997  1.00 49.81  ? 625 HIS F CB  1 
ATOM   5103 C CG  . HIS F 1 72  ? 33.381  -13.676 23.611  1.00 50.56  ? 625 HIS F CG  1 
ATOM   5104 N ND1 . HIS F 1 72  ? 32.865  -13.613 24.887  1.00 69.91  ? 625 HIS F ND1 1 
ATOM   5105 C CD2 . HIS F 1 72  ? 33.291  -12.425 23.104  1.00 69.71  ? 625 HIS F CD2 1 
ATOM   5106 C CE1 . HIS F 1 72  ? 32.509  -12.370 25.153  1.00 64.97  ? 625 HIS F CE1 1 
ATOM   5107 N NE2 . HIS F 1 72  ? 32.755  -11.630 24.087  1.00 68.07  ? 625 HIS F NE2 1 
ATOM   5108 N N   . GLU F 1 73  ? 32.369  -15.065 20.257  1.00 42.42  ? 626 GLU F N   1 
ATOM   5109 C CA  . GLU F 1 73  ? 31.712  -14.380 19.163  1.00 39.48  ? 626 GLU F CA  1 
ATOM   5110 C C   . GLU F 1 73  ? 30.327  -14.943 18.966  1.00 39.33  ? 626 GLU F C   1 
ATOM   5111 O O   . GLU F 1 73  ? 29.376  -14.195 18.714  1.00 44.57  ? 626 GLU F O   1 
ATOM   5112 C CB  . GLU F 1 73  ? 32.512  -14.525 17.868  1.00 38.67  ? 626 GLU F CB  1 
ATOM   5113 C CG  . GLU F 1 73  ? 33.589  -13.483 17.675  1.00 43.70  ? 626 GLU F CG  1 
ATOM   5114 C CD  . GLU F 1 73  ? 34.602  -13.859 16.593  1.00 59.50  ? 626 GLU F CD  1 
ATOM   5115 O OE1 . GLU F 1 73  ? 34.426  -14.899 15.933  1.00 71.80  ? 626 GLU F OE1 1 
ATOM   5116 O OE2 . GLU F 1 73  ? 35.590  -13.116 16.407  1.00 67.43  ? 626 GLU F OE2 1 
ATOM   5117 N N   . PHE F 1 74  ? 30.226  -16.269 19.071  1.00 32.34  ? 627 PHE F N   1 
ATOM   5118 C CA  . PHE F 1 74  ? 28.972  -17.008 18.821  1.00 32.89  ? 627 PHE F CA  1 
ATOM   5119 C C   . PHE F 1 74  ? 27.997  -16.725 19.937  1.00 30.99  ? 627 PHE F C   1 
ATOM   5120 O O   . PHE F 1 74  ? 26.809  -16.492 19.683  1.00 33.80  ? 627 PHE F O   1 
ATOM   5121 C CB  . PHE F 1 74  ? 29.286  -18.499 18.722  1.00 34.42  ? 627 PHE F CB  1 
ATOM   5122 C CG  . PHE F 1 74  ? 28.123  -19.373 18.367  1.00 37.12  ? 627 PHE F CG  1 
ATOM   5123 C CD1 . PHE F 1 74  ? 27.890  -19.724 17.063  1.00 39.00  ? 627 PHE F CD1 1 
ATOM   5124 C CD2 . PHE F 1 74  ? 27.320  -19.920 19.351  1.00 32.02  ? 627 PHE F CD2 1 
ATOM   5125 C CE1 . PHE F 1 74  ? 26.850  -20.564 16.733  1.00 43.52  ? 627 PHE F CE1 1 
ATOM   5126 C CE2 . PHE F 1 74  ? 26.278  -20.753 19.023  1.00 25.74  ? 627 PHE F CE2 1 
ATOM   5127 C CZ  . PHE F 1 74  ? 26.053  -21.087 17.716  1.00 37.65  ? 627 PHE F CZ  1 
ATOM   5128 N N   . GLU F 1 75  ? 28.478  -16.720 21.180  1.00 34.34  ? 628 GLU F N   1 
ATOM   5129 C CA  . GLU F 1 75  ? 27.599  -16.394 22.304  1.00 35.41  ? 628 GLU F CA  1 
ATOM   5130 C C   . GLU F 1 75  ? 27.067  -14.969 22.202  1.00 45.51  ? 628 GLU F C   1 
ATOM   5131 O O   . GLU F 1 75  ? 25.929  -14.703 22.603  1.00 43.09  ? 628 GLU F O   1 
ATOM   5132 C CB  . GLU F 1 75  ? 28.300  -16.538 23.623  1.00 41.04  ? 628 GLU F CB  1 
ATOM   5133 C CG  . GLU F 1 75  ? 28.676  -17.945 24.040  1.00 50.41  ? 628 GLU F CG  1 
ATOM   5134 C CD  . GLU F 1 75  ? 29.424  -17.938 25.378  1.00 57.63  ? 628 GLU F CD  1 
ATOM   5135 O OE1 . GLU F 1 75  ? 28.974  -18.612 26.337  1.00 51.63  ? 628 GLU F OE1 1 
ATOM   5136 O OE2 . GLU F 1 75  ? 30.449  -17.222 25.469  1.00 52.11  ? 628 GLU F OE2 1 
ATOM   5137 N N   . GLU F 1 76  ? 27.901  -14.063 21.681  1.00 46.58  ? 629 GLU F N   1 
ATOM   5138 C CA  . GLU F 1 76  ? 27.505  -12.664 21.414  1.00 46.46  ? 629 GLU F CA  1 
ATOM   5139 C C   . GLU F 1 76  ? 26.310  -12.622 20.476  1.00 38.57  ? 629 GLU F C   1 
ATOM   5140 O O   . GLU F 1 76  ? 25.353  -11.896 20.710  1.00 42.90  ? 629 GLU F O   1 
ATOM   5141 C CB  . GLU F 1 76  ? 28.681  -11.872 20.811  1.00 43.88  ? 629 GLU F CB  1 
ATOM   5142 C CG  . GLU F 1 76  ? 28.732  -10.374 21.165  1.00 59.89  ? 629 GLU F CG  1 
ATOM   5143 C CD  . GLU F 1 76  ? 30.160  -9.774  21.131  1.00 64.46  ? 629 GLU F CD  1 
ATOM   5144 O OE1 . GLU F 1 76  ? 30.292  -8.571  21.442  1.00 61.35  ? 629 GLU F OE1 1 
ATOM   5145 O OE2 . GLU F 1 76  ? 31.147  -10.490 20.805  1.00 61.77  ? 629 GLU F OE2 1 
ATOM   5146 N N   . ASP F 1 77  ? 26.346  -13.417 19.420  1.00 38.66  ? 630 ASP F N   1 
ATOM   5147 C CA  . ASP F 1 77  ? 25.238  -13.394 18.452  1.00 40.26  ? 630 ASP F CA  1 
ATOM   5148 C C   . ASP F 1 77  ? 23.965  -13.977 19.019  1.00 40.31  ? 630 ASP F C   1 
ATOM   5149 O O   . ASP F 1 77  ? 22.879  -13.385 18.881  1.00 44.31  ? 630 ASP F O   1 
ATOM   5150 C CB  . ASP F 1 77  ? 25.608  -14.059 17.107  1.00 31.36  ? 630 ASP F CB  1 
ATOM   5151 C CG  . ASP F 1 77  ? 26.394  -13.112 16.192  1.00 29.66  ? 630 ASP F CG  1 
ATOM   5152 O OD1 . ASP F 1 77  ? 26.402  -11.895 16.475  1.00 42.94  ? 630 ASP F OD1 1 
ATOM   5153 O OD2 . ASP F 1 77  ? 27.016  -13.579 15.212  1.00 42.79  ? 630 ASP F OD2 1 
ATOM   5154 N N   . PHE F 1 78  ? 24.092  -15.125 19.664  1.00 35.13  ? 631 PHE F N   1 
ATOM   5155 C CA  . PHE F 1 78  ? 22.936  -15.781 20.281  1.00 33.52  ? 631 PHE F CA  1 
ATOM   5156 C C   . PHE F 1 78  ? 22.265  -14.881 21.300  1.00 35.34  ? 631 PHE F C   1 
ATOM   5157 O O   . PHE F 1 78  ? 21.030  -14.835 21.406  1.00 33.73  ? 631 PHE F O   1 
ATOM   5158 C CB  . PHE F 1 78  ? 23.384  -17.072 20.936  1.00 34.50  ? 631 PHE F CB  1 
ATOM   5159 C CG  . PHE F 1 78  ? 22.331  -17.759 21.732  1.00 38.12  ? 631 PHE F CG  1 
ATOM   5160 C CD1 . PHE F 1 78  ? 21.175  -18.233 21.129  1.00 36.25  ? 631 PHE F CD1 1 
ATOM   5161 C CD2 . PHE F 1 78  ? 22.511  -17.982 23.073  1.00 26.73  ? 631 PHE F CD2 1 
ATOM   5162 C CE1 . PHE F 1 78  ? 20.221  -18.896 21.862  1.00 28.31  ? 631 PHE F CE1 1 
ATOM   5163 C CE2 . PHE F 1 78  ? 21.545  -18.656 23.820  1.00 48.67  ? 631 PHE F CE2 1 
ATOM   5164 C CZ  . PHE F 1 78  ? 20.403  -19.104 23.213  1.00 45.19  ? 631 PHE F CZ  1 
ATOM   5165 N N   . ASP F 1 79  ? 23.085  -14.149 22.044  1.00 36.06  ? 632 ASP F N   1 
ATOM   5166 C CA  . ASP F 1 79  ? 22.571  -13.307 23.100  1.00 30.54  ? 632 ASP F CA  1 
ATOM   5167 C C   . ASP F 1 79  ? 21.822  -12.157 22.446  1.00 32.43  ? 632 ASP F C   1 
ATOM   5168 O O   . ASP F 1 79  ? 20.762  -11.743 22.941  1.00 39.34  ? 632 ASP F O   1 
ATOM   5169 C CB  . ASP F 1 79  ? 23.690  -12.858 24.061  1.00 37.19  ? 632 ASP F CB  1 
ATOM   5170 C CG  . ASP F 1 79  ? 23.784  -13.733 25.383  1.00 54.97  ? 632 ASP F CG  1 
ATOM   5171 O OD1 . ASP F 1 79  ? 24.497  -13.299 26.314  1.00 50.63  ? 632 ASP F OD1 1 
ATOM   5172 O OD2 . ASP F 1 79  ? 23.170  -14.825 25.514  1.00 57.45  ? 632 ASP F OD2 1 
ATOM   5173 N N   . LEU F 1 80  ? 22.296  -11.706 21.287  1.00 27.72  ? 633 LEU F N   1 
ATOM   5174 C CA  . LEU F 1 80  ? 21.565  -10.686 20.545  1.00 31.74  ? 633 LEU F CA  1 
ATOM   5175 C C   . LEU F 1 80  ? 20.166  -11.164 20.224  1.00 32.40  ? 633 LEU F C   1 
ATOM   5176 O O   . LEU F 1 80  ? 19.200  -10.379 20.289  1.00 35.34  ? 633 LEU F O   1 
ATOM   5177 C CB  . LEU F 1 80  ? 22.306  -10.248 19.265  1.00 34.58  ? 633 LEU F CB  1 
ATOM   5178 C CG  . LEU F 1 80  ? 23.352  -9.117  19.408  1.00 50.93  ? 633 LEU F CG  1 
ATOM   5179 C CD1 . LEU F 1 80  ? 24.438  -9.149  18.328  1.00 40.45  ? 633 LEU F CD1 1 
ATOM   5180 C CD2 . LEU F 1 80  ? 22.683  -7.743  19.422  1.00 50.22  ? 633 LEU F CD2 1 
ATOM   5181 N N   . ILE F 1 81  ? 20.036  -12.443 19.872  1.00 32.62  ? 634 ILE F N   1 
ATOM   5182 C CA  . ILE F 1 81  ? 18.724  -12.971 19.478  1.00 29.24  ? 634 ILE F CA  1 
ATOM   5183 C C   . ILE F 1 81  ? 17.760  -12.866 20.642  1.00 28.13  ? 634 ILE F C   1 
ATOM   5184 O O   . ILE F 1 81  ? 16.649  -12.369 20.507  1.00 28.97  ? 634 ILE F O   1 
ATOM   5185 C CB  . ILE F 1 81  ? 18.769  -14.433 19.041  1.00 28.31  ? 634 ILE F CB  1 
ATOM   5186 C CG1 . ILE F 1 81  ? 19.650  -14.598 17.795  1.00 32.44  ? 634 ILE F CG1 1 
ATOM   5187 C CG2 . ILE F 1 81  ? 17.343  -14.899 18.774  1.00 25.53  ? 634 ILE F CG2 1 
ATOM   5188 C CD1 . ILE F 1 81  ? 19.647  -16.005 17.199  1.00 22.58  ? 634 ILE F CD1 1 
ATOM   5189 N N   . ILE F 1 82  ? 18.229  -13.310 21.805  1.00 35.41  ? 635 ILE F N   1 
ATOM   5190 C CA  . ILE F 1 82  ? 17.459  -13.281 23.034  1.00 31.89  ? 635 ILE F CA  1 
ATOM   5191 C C   . ILE F 1 82  ? 17.223  -11.834 23.498  1.00 32.72  ? 635 ILE F C   1 
ATOM   5192 O O   . ILE F 1 82  ? 16.064  -11.398 23.684  1.00 34.99  ? 635 ILE F O   1 
ATOM   5193 C CB  . ILE F 1 82  ? 18.197  -14.081 24.130  1.00 34.56  ? 635 ILE F CB  1 
ATOM   5194 C CG1 . ILE F 1 82  ? 18.410  -15.536 23.690  1.00 32.40  ? 635 ILE F CG1 1 
ATOM   5195 C CG2 . ILE F 1 82  ? 17.426  -14.037 25.424  1.00 41.29  ? 635 ILE F CG2 1 
ATOM   5196 C CD1 . ILE F 1 82  ? 17.135  -16.401 23.776  1.00 33.75  ? 635 ILE F CD1 1 
ATOM   5197 N N   . ASP F 1 83  ? 18.314  -11.087 23.638  1.00 30.20  ? 636 ASP F N   1 
ATOM   5198 C CA  . ASP F 1 83  ? 18.275  -9.690  24.143  1.00 36.17  ? 636 ASP F CA  1 
ATOM   5199 C C   . ASP F 1 83  ? 17.385  -8.748  23.295  1.00 34.92  ? 636 ASP F C   1 
ATOM   5200 O O   . ASP F 1 83  ? 16.543  -8.019  23.828  1.00 38.11  ? 636 ASP F O   1 
ATOM   5201 C CB  . ASP F 1 83  ? 19.685  -9.087  24.205  1.00 32.42  ? 636 ASP F CB  1 
ATOM   5202 C CG  . ASP F 1 83  ? 20.625  -9.839  25.144  1.00 39.53  ? 636 ASP F CG  1 
ATOM   5203 O OD1 . ASP F 1 83  ? 20.167  -10.682 25.971  1.00 40.64  ? 636 ASP F OD1 1 
ATOM   5204 O OD2 . ASP F 1 83  ? 21.849  -9.578  25.034  1.00 49.74  ? 636 ASP F OD2 1 
ATOM   5205 N N   . ASN F 1 84  ? 17.577  -8.755  21.990  1.00 25.83  ? 637 ASN F N   1 
ATOM   5206 C CA  . ASN F 1 84  ? 16.679  -7.982  21.107  1.00 33.85  ? 637 ASN F CA  1 
ATOM   5207 C C   . ASN F 1 84  ? 15.221  -8.275  21.355  1.00 29.35  ? 637 ASN F C   1 
ATOM   5208 O O   . ASN F 1 84  ? 14.387  -7.368  21.458  1.00 39.87  ? 637 ASN F O   1 
ATOM   5209 C CB  . ASN F 1 84  ? 16.981  -8.246  19.632  1.00 29.52  ? 637 ASN F CB  1 
ATOM   5210 C CG  . ASN F 1 84  ? 18.381  -7.831  19.262  1.00 40.30  ? 637 ASN F CG  1 
ATOM   5211 O OD1 . ASN F 1 84  ? 19.023  -7.093  20.004  1.00 37.93  ? 637 ASN F OD1 1 
ATOM   5212 N ND2 . ASN F 1 84  ? 18.880  -8.328  18.135  1.00 29.09  ? 637 ASN F ND2 1 
ATOM   5213 N N   . CYS F 1 85  ? 14.911  -9.553  21.445  1.00 31.57  ? 638 CYS F N   1 
ATOM   5214 C CA  . CYS F 1 85  ? 13.544  -9.969  21.515  1.00 30.85  ? 638 CYS F CA  1 
ATOM   5215 C C   . CYS F 1 85  ? 13.011  -9.430  22.808  1.00 34.16  ? 638 CYS F C   1 
ATOM   5216 O O   . CYS F 1 85  ? 11.958  -8.813  22.818  1.00 46.93  ? 638 CYS F O   1 
ATOM   5217 C CB  . CYS F 1 85  ? 13.435  -11.494 21.396  1.00 30.49  ? 638 CYS F CB  1 
ATOM   5218 S SG  . CYS F 1 85  ? 11.789  -12.152 21.404  1.00 34.43  ? 638 CYS F SG  1 
ATOM   5219 N N   . MET F 1 86  ? 13.770  -9.593  23.884  1.00 38.45  ? 639 MET F N   1 
ATOM   5220 C CA  . MET F 1 86  ? 13.318  -9.165  25.221  1.00 46.99  ? 639 MET F CA  1 
ATOM   5221 C C   . MET F 1 86  ? 13.189  -7.641  25.327  1.00 47.12  ? 639 MET F C   1 
ATOM   5222 O O   . MET F 1 86  ? 12.355  -7.133  26.080  1.00 45.20  ? 639 MET F O   1 
ATOM   5223 C CB  . MET F 1 86  ? 14.241  -9.720  26.318  1.00 45.27  ? 639 MET F CB  1 
ATOM   5224 C CG  . MET F 1 86  ? 14.210  -11.250 26.405  1.00 49.95  ? 639 MET F CG  1 
ATOM   5225 S SD  . MET F 1 86  ? 15.025  -12.030 27.822  1.00 55.83  ? 639 MET F SD  1 
ATOM   5226 C CE  . MET F 1 86  ? 16.658  -11.259 27.817  1.00 49.08  ? 639 MET F CE  1 
ATOM   5227 N N   . LYS F 1 87  ? 14.000  -6.930  24.549  1.00 46.36  ? 640 LYS F N   1 
ATOM   5228 C CA  . LYS F 1 87  ? 13.953  -5.470  24.461  1.00 40.84  ? 640 LYS F CA  1 
ATOM   5229 C C   . LYS F 1 87  ? 12.725  -5.009  23.679  1.00 42.40  ? 640 LYS F C   1 
ATOM   5230 O O   . LYS F 1 87  ? 12.036  -4.085  24.098  1.00 37.13  ? 640 LYS F O   1 
ATOM   5231 C CB  . LYS F 1 87  ? 15.233  -4.968  23.785  1.00 42.64  ? 640 LYS F CB  1 
ATOM   5232 C CG  . LYS F 1 87  ? 15.550  -3.499  23.952  1.00 48.36  ? 640 LYS F CG  1 
ATOM   5233 C CD  . LYS F 1 87  ? 17.051  -3.248  23.702  1.00 51.47  ? 640 LYS F CD  1 
ATOM   5234 N N   . TYR F 1 88  ? 12.437  -5.651  22.551  1.00 35.58  ? 641 TYR F N   1 
ATOM   5235 C CA  . TYR F 1 88  ? 11.393  -5.143  21.669  1.00 36.99  ? 641 TYR F CA  1 
ATOM   5236 C C   . TYR F 1 88  ? 9.998   -5.506  22.150  1.00 43.22  ? 641 TYR F C   1 
ATOM   5237 O O   . TYR F 1 88  ? 9.072   -4.706  22.021  1.00 44.19  ? 641 TYR F O   1 
ATOM   5238 C CB  . TYR F 1 88  ? 11.580  -5.617  20.217  1.00 39.00  ? 641 TYR F CB  1 
ATOM   5239 C CG  . TYR F 1 88  ? 10.526  -5.058  19.306  1.00 30.26  ? 641 TYR F CG  1 
ATOM   5240 C CD1 . TYR F 1 88  ? 9.389   -5.773  19.020  1.00 39.67  ? 641 TYR F CD1 1 
ATOM   5241 C CD2 . TYR F 1 88  ? 10.650  -3.779  18.773  1.00 31.98  ? 641 TYR F CD2 1 
ATOM   5242 C CE1 . TYR F 1 88  ? 8.399   -5.241  18.194  1.00 40.52  ? 641 TYR F CE1 1 
ATOM   5243 C CE2 . TYR F 1 88  ? 9.667   -3.238  17.940  1.00 37.98  ? 641 TYR F CE2 1 
ATOM   5244 C CZ  . TYR F 1 88  ? 8.549   -3.970  17.668  1.00 41.75  ? 641 TYR F CZ  1 
ATOM   5245 O OH  . TYR F 1 88  ? 7.575   -3.442  16.863  1.00 41.98  ? 641 TYR F OH  1 
ATOM   5246 N N   . ASN F 1 89  ? 9.849   -6.712  22.690  1.00 44.58  ? 642 ASN F N   1 
ATOM   5247 C CA  . ASN F 1 89  ? 8.541   -7.243  23.068  1.00 44.97  ? 642 ASN F CA  1 
ATOM   5248 C C   . ASN F 1 89  ? 8.267   -7.043  24.548  1.00 49.81  ? 642 ASN F C   1 
ATOM   5249 O O   . ASN F 1 89  ? 9.174   -7.172  25.357  1.00 53.32  ? 642 ASN F O   1 
ATOM   5250 C CB  . ASN F 1 89  ? 8.469   -8.734  22.760  1.00 43.78  ? 642 ASN F CB  1 
ATOM   5251 C CG  . ASN F 1 89  ? 8.558   -9.027  21.280  1.00 41.88  ? 642 ASN F CG  1 
ATOM   5252 O OD1 . ASN F 1 89  ? 9.595   -9.447  20.783  1.00 43.60  ? 642 ASN F OD1 1 
ATOM   5253 N ND2 . ASN F 1 89  ? 7.481   -8.773  20.565  1.00 45.49  ? 642 ASN F ND2 1 
ATOM   5254 N N   . ALA F 1 90  ? 7.011   -6.761  24.891  1.00 50.59  ? 643 ALA F N   1 
ATOM   5255 C CA  . ALA F 1 90  ? 6.602   -6.564  26.286  1.00 52.59  ? 643 ALA F CA  1 
ATOM   5256 C C   . ALA F 1 90  ? 6.585   -7.888  27.068  1.00 54.98  ? 643 ALA F C   1 
ATOM   5257 O O   . ALA F 1 90  ? 6.365   -8.961  26.493  1.00 50.40  ? 643 ALA F O   1 
ATOM   5258 C CB  . ALA F 1 90  ? 5.217   -5.897  26.346  1.00 51.47  ? 643 ALA F CB  1 
ATOM   5259 N N   . ARG F 1 91  ? 6.775   -7.778  28.384  1.00 54.85  ? 644 ARG F N   1 
ATOM   5260 C CA  . ARG F 1 91  ? 6.890   -8.925  29.290  1.00 60.83  ? 644 ARG F CA  1 
ATOM   5261 C C   . ARG F 1 91  ? 5.786   -9.998  29.116  1.00 65.20  ? 644 ARG F C   1 
ATOM   5262 O O   . ARG F 1 91  ? 6.063   -11.201 29.254  1.00 63.18  ? 644 ARG F O   1 
ATOM   5263 C CB  . ARG F 1 91  ? 6.972   -8.443  30.757  1.00 56.52  ? 644 ARG F CB  1 
ATOM   5264 N N   . ASP F 1 92  ? 4.563   -9.579  28.787  1.00 63.68  ? 645 ASP F N   1 
ATOM   5265 C CA  . ASP F 1 92  ? 3.436   -10.519 28.642  1.00 66.83  ? 645 ASP F CA  1 
ATOM   5266 C C   . ASP F 1 92  ? 3.616   -11.499 27.472  1.00 65.07  ? 645 ASP F C   1 
ATOM   5267 O O   . ASP F 1 92  ? 3.400   -12.710 27.638  1.00 68.28  ? 645 ASP F O   1 
ATOM   5268 C CB  . ASP F 1 92  ? 2.097   -9.761  28.493  1.00 67.46  ? 645 ASP F CB  1 
ATOM   5269 N N   . THR F 1 93  ? 4.061   -10.970 26.323  1.00 62.48  ? 646 THR F N   1 
ATOM   5270 C CA  . THR F 1 93  ? 3.862   -11.597 24.993  1.00 51.96  ? 646 THR F CA  1 
ATOM   5271 C C   . THR F 1 93  ? 4.503   -12.964 24.773  1.00 51.16  ? 646 THR F C   1 
ATOM   5272 O O   . THR F 1 93  ? 5.406   -13.400 25.513  1.00 45.20  ? 646 THR F O   1 
ATOM   5273 C CB  . THR F 1 93  ? 4.354   -10.676 23.838  1.00 56.88  ? 646 THR F CB  1 
ATOM   5274 O OG1 . THR F 1 93  ? 5.773   -10.484 23.938  1.00 54.84  ? 646 THR F OG1 1 
ATOM   5275 C CG2 . THR F 1 93  ? 3.632   -9.305  23.850  1.00 52.09  ? 646 THR F CG2 1 
ATOM   5276 N N   . VAL F 1 94  ? 4.025   -13.631 23.729  1.00 49.74  ? 647 VAL F N   1 
ATOM   5277 C CA  . VAL F 1 94  ? 4.515   -14.954 23.370  1.00 52.44  ? 647 VAL F CA  1 
ATOM   5278 C C   . VAL F 1 94  ? 5.997   -14.921 23.026  1.00 50.27  ? 647 VAL F C   1 
ATOM   5279 O O   . VAL F 1 94  ? 6.768   -15.760 23.509  1.00 53.42  ? 647 VAL F O   1 
ATOM   5280 C CB  . VAL F 1 94  ? 3.714   -15.531 22.203  1.00 55.36  ? 647 VAL F CB  1 
ATOM   5281 C CG1 . VAL F 1 94  ? 4.429   -16.732 21.590  1.00 49.01  ? 647 VAL F CG1 1 
ATOM   5282 C CG2 . VAL F 1 94  ? 2.315   -15.917 22.697  1.00 58.03  ? 647 VAL F CG2 1 
ATOM   5283 N N   . PHE F 1 95  ? 6.395   -13.941 22.221  1.00 47.60  ? 648 PHE F N   1 
ATOM   5284 C CA  . PHE F 1 95  ? 7.792   -13.818 21.794  1.00 45.59  ? 648 PHE F CA  1 
ATOM   5285 C C   . PHE F 1 95  ? 8.734   -13.680 22.998  1.00 42.46  ? 648 PHE F C   1 
ATOM   5286 O O   . PHE F 1 95  ? 9.746   -14.383 23.081  1.00 36.70  ? 648 PHE F O   1 
ATOM   5287 C CB  . PHE F 1 95  ? 7.981   -12.635 20.842  1.00 49.43  ? 648 PHE F CB  1 
ATOM   5288 C CG  . PHE F 1 95  ? 7.256   -12.766 19.509  1.00 51.42  ? 648 PHE F CG  1 
ATOM   5289 C CD1 . PHE F 1 95  ? 7.178   -13.975 18.839  1.00 59.74  ? 648 PHE F CD1 1 
ATOM   5290 C CD2 . PHE F 1 95  ? 6.684   -11.648 18.913  1.00 70.09  ? 648 PHE F CD2 1 
ATOM   5291 C CE1 . PHE F 1 95  ? 6.524   -14.072 17.615  1.00 68.62  ? 648 PHE F CE1 1 
ATOM   5292 C CE2 . PHE F 1 95  ? 6.026   -11.739 17.687  1.00 78.56  ? 648 PHE F CE2 1 
ATOM   5293 C CZ  . PHE F 1 95  ? 5.949   -12.952 17.039  1.00 70.44  ? 648 PHE F CZ  1 
ATOM   5294 N N   . TYR F 1 96  ? 8.388   -12.795 23.935  1.00 39.29  ? 649 TYR F N   1 
ATOM   5295 C CA  . TYR F 1 96  ? 9.204   -12.567 25.140  1.00 41.00  ? 649 TYR F CA  1 
ATOM   5296 C C   . TYR F 1 96  ? 9.509   -13.868 25.886  1.00 44.55  ? 649 TYR F C   1 
ATOM   5297 O O   . TYR F 1 96  ? 10.668  -14.176 26.223  1.00 40.32  ? 649 TYR F O   1 
ATOM   5298 C CB  . TYR F 1 96  ? 8.476   -11.613 26.094  1.00 43.55  ? 649 TYR F CB  1 
ATOM   5299 C CG  . TYR F 1 96  ? 9.290   -11.190 27.290  1.00 44.49  ? 649 TYR F CG  1 
ATOM   5300 C CD1 . TYR F 1 96  ? 9.272   -11.925 28.480  1.00 53.93  ? 649 TYR F CD1 1 
ATOM   5301 C CD2 . TYR F 1 96  ? 10.082  -10.052 27.235  1.00 52.71  ? 649 TYR F CD2 1 
ATOM   5302 C CE1 . TYR F 1 96  ? 10.031  -11.521 29.589  1.00 53.09  ? 649 TYR F CE1 1 
ATOM   5303 C CE2 . TYR F 1 96  ? 10.839  -9.643  28.326  1.00 52.60  ? 649 TYR F CE2 1 
ATOM   5304 C CZ  . TYR F 1 96  ? 10.812  -10.376 29.495  1.00 52.78  ? 649 TYR F CZ  1 
ATOM   5305 O OH  . TYR F 1 96  ? 11.581  -9.946  30.553  1.00 53.91  ? 649 TYR F OH  1 
ATOM   5306 N N   . ARG F 1 97  ? 8.441   -14.614 26.158  1.00 46.82  ? 650 ARG F N   1 
ATOM   5307 C CA  . ARG F 1 97  ? 8.519   -15.860 26.907  1.00 44.37  ? 650 ARG F CA  1 
ATOM   5308 C C   . ARG F 1 97  ? 9.372   -16.879 26.131  1.00 42.62  ? 650 ARG F C   1 
ATOM   5309 O O   . ARG F 1 97  ? 10.304  -17.496 26.684  1.00 48.02  ? 650 ARG F O   1 
ATOM   5310 C CB  . ARG F 1 97  ? 7.093   -16.366 27.192  1.00 42.81  ? 650 ARG F CB  1 
ATOM   5311 N N   . ALA F 1 98  ? 9.087   -17.022 24.836  1.00 33.84  ? 651 ALA F N   1 
ATOM   5312 C CA  . ALA F 1 98  ? 9.893   -17.876 23.975  1.00 35.06  ? 651 ALA F CA  1 
ATOM   5313 C C   . ALA F 1 98  ? 11.384  -17.547 24.105  1.00 29.18  ? 651 ALA F C   1 
ATOM   5314 O O   . ALA F 1 98  ? 12.202  -18.448 24.233  1.00 31.67  ? 651 ALA F O   1 
ATOM   5315 C CB  . ALA F 1 98  ? 9.441   -17.763 22.519  1.00 40.29  ? 651 ALA F CB  1 
ATOM   5316 N N   . ALA F 1 99  ? 11.728  -16.263 24.117  1.00 33.18  ? 652 ALA F N   1 
ATOM   5317 C CA  . ALA F 1 99  ? 13.134  -15.862 24.233  1.00 35.70  ? 652 ALA F CA  1 
ATOM   5318 C C   . ALA F 1 99  ? 13.706  -16.232 25.599  1.00 35.82  ? 652 ALA F C   1 
ATOM   5319 O O   . ALA F 1 99  ? 14.872  -16.600 25.706  1.00 38.98  ? 652 ALA F O   1 
ATOM   5320 C CB  . ALA F 1 99  ? 13.270  -14.380 23.985  1.00 33.05  ? 652 ALA F CB  1 
ATOM   5321 N N   . VAL F 1 100 ? 12.884  -16.120 26.643  1.00 36.43  ? 653 VAL F N   1 
ATOM   5322 C CA  . VAL F 1 100 ? 13.287  -16.514 27.999  1.00 45.61  ? 653 VAL F CA  1 
ATOM   5323 C C   . VAL F 1 100 ? 13.531  -18.042 28.107  1.00 41.16  ? 653 VAL F C   1 
ATOM   5324 O O   . VAL F 1 100 ? 14.552  -18.454 28.638  1.00 41.22  ? 653 VAL F O   1 
ATOM   5325 C CB  . VAL F 1 100 ? 12.252  -15.991 29.090  1.00 51.94  ? 653 VAL F CB  1 
ATOM   5326 C CG1 . VAL F 1 100 ? 12.220  -16.869 30.318  1.00 44.76  ? 653 VAL F CG1 1 
ATOM   5327 C CG2 . VAL F 1 100 ? 12.548  -14.537 29.495  1.00 52.14  ? 653 VAL F CG2 1 
ATOM   5328 N N   . ARG F 1 101 ? 12.616  -18.869 27.597  1.00 42.84  ? 654 ARG F N   1 
ATOM   5329 C CA  . ARG F 1 101 ? 12.831  -20.332 27.586  1.00 42.87  ? 654 ARG F CA  1 
ATOM   5330 C C   . ARG F 1 101 ? 14.080  -20.683 26.790  1.00 41.00  ? 654 ARG F C   1 
ATOM   5331 O O   . ARG F 1 101 ? 14.916  -21.464 27.246  1.00 45.11  ? 654 ARG F O   1 
ATOM   5332 C CB  . ARG F 1 101 ? 11.632  -21.107 27.008  1.00 43.61  ? 654 ARG F CB  1 
ATOM   5333 C CG  . ARG F 1 101 ? 10.475  -21.360 28.000  1.00 59.71  ? 654 ARG F CG  1 
ATOM   5334 C CD  . ARG F 1 101 ? 9.143   -21.641 27.292  1.00 49.97  ? 654 ARG F CD  1 
ATOM   5335 N N   . LEU F 1 102 ? 14.206  -20.104 25.599  1.00 36.35  ? 655 LEU F N   1 
ATOM   5336 C CA  . LEU F 1 102 ? 15.399  -20.309 24.774  1.00 35.31  ? 655 LEU F CA  1 
ATOM   5337 C C   . LEU F 1 102 ? 16.669  -19.906 25.514  1.00 35.79  ? 655 LEU F C   1 
ATOM   5338 O O   . LEU F 1 102 ? 17.667  -20.578 25.395  1.00 30.61  ? 655 LEU F O   1 
ATOM   5339 C CB  . LEU F 1 102 ? 15.281  -19.534 23.457  1.00 38.96  ? 655 LEU F CB  1 
ATOM   5340 C CG  . LEU F 1 102 ? 16.321  -19.733 22.350  1.00 32.74  ? 655 LEU F CG  1 
ATOM   5341 C CD1 . LEU F 1 102 ? 16.384  -21.183 21.916  1.00 32.25  ? 655 LEU F CD1 1 
ATOM   5342 C CD2 . LEU F 1 102 ? 15.966  -18.859 21.168  1.00 33.74  ? 655 LEU F CD2 1 
ATOM   5343 N N   . ARG F 1 103 ? 16.622  -18.821 26.292  1.00 37.55  ? 656 ARG F N   1 
ATOM   5344 C CA  . ARG F 1 103 ? 17.800  -18.353 27.055  1.00 39.16  ? 656 ARG F CA  1 
ATOM   5345 C C   . ARG F 1 103 ? 18.227  -19.351 28.126  1.00 37.85  ? 656 ARG F C   1 
ATOM   5346 O O   . ARG F 1 103 ? 19.425  -19.662 28.276  1.00 39.38  ? 656 ARG F O   1 
ATOM   5347 C CB  . ARG F 1 103 ? 17.512  -16.987 27.701  1.00 44.55  ? 656 ARG F CB  1 
ATOM   5348 C CG  . ARG F 1 103 ? 18.693  -16.267 28.402  1.00 49.62  ? 656 ARG F CG  1 
ATOM   5349 C CD  . ARG F 1 103 ? 18.173  -15.212 29.432  1.00 55.54  ? 656 ARG F CD  1 
ATOM   5350 N NE  . ARG F 1 103 ? 17.366  -15.825 30.494  1.00 54.58  ? 656 ARG F NE  1 
ATOM   5351 C CZ  . ARG F 1 103 ? 16.657  -15.166 31.412  1.00 61.27  ? 656 ARG F CZ  1 
ATOM   5352 N NH1 . ARG F 1 103 ? 16.626  -13.837 31.444  1.00 47.34  ? 656 ARG F NH1 1 
ATOM   5353 N NH2 . ARG F 1 103 ? 15.965  -15.850 32.310  1.00 66.51  ? 656 ARG F NH2 1 
ATOM   5354 N N   . ASP F 1 104 ? 17.252  -19.872 28.860  1.00 39.99  ? 657 ASP F N   1 
ATOM   5355 C CA  . ASP F 1 104 ? 17.554  -20.796 29.933  1.00 44.84  ? 657 ASP F CA  1 
ATOM   5356 C C   . ASP F 1 104 ? 18.003  -22.129 29.363  1.00 47.30  ? 657 ASP F C   1 
ATOM   5357 O O   . ASP F 1 104 ? 19.056  -22.640 29.739  1.00 47.74  ? 657 ASP F O   1 
ATOM   5358 C CB  . ASP F 1 104 ? 16.358  -20.961 30.859  1.00 50.25  ? 657 ASP F CB  1 
ATOM   5359 C CG  . ASP F 1 104 ? 15.911  -19.643 31.479  1.00 49.40  ? 657 ASP F CG  1 
ATOM   5360 O OD1 . ASP F 1 104 ? 16.747  -18.739 31.652  1.00 49.85  ? 657 ASP F OD1 1 
ATOM   5361 O OD2 . ASP F 1 104 ? 14.718  -19.511 31.805  1.00 57.64  ? 657 ASP F OD2 1 
ATOM   5362 N N   . GLN F 1 105 ? 17.236  -22.687 28.433  1.00 45.69  ? 658 GLN F N   1 
ATOM   5363 C CA  . GLN F 1 105 ? 17.679  -23.943 27.788  1.00 43.79  ? 658 GLN F CA  1 
ATOM   5364 C C   . GLN F 1 105 ? 18.959  -23.722 26.985  1.00 39.74  ? 658 GLN F C   1 
ATOM   5365 O O   . GLN F 1 105 ? 19.849  -24.554 26.983  1.00 44.35  ? 658 GLN F O   1 
ATOM   5366 C CB  . GLN F 1 105 ? 16.600  -24.514 26.873  1.00 44.33  ? 658 GLN F CB  1 
ATOM   5367 C CG  . GLN F 1 105 ? 15.244  -24.766 27.532  1.00 43.37  ? 658 GLN F CG  1 
ATOM   5368 C CD  . GLN F 1 105 ? 14.343  -25.646 26.680  1.00 51.14  ? 658 GLN F CD  1 
ATOM   5369 O OE1 . GLN F 1 105 ? 14.717  -26.763 26.307  1.00 61.69  ? 658 GLN F OE1 1 
ATOM   5370 N NE2 . GLN F 1 105 ? 13.152  -25.154 26.376  1.00 42.47  ? 658 GLN F NE2 1 
ATOM   5371 N N   . GLY F 1 106 ? 19.061  -22.587 26.312  1.00 36.89  ? 659 GLY F N   1 
ATOM   5372 C CA  . GLY F 1 106 ? 20.218  -22.321 25.515  1.00 35.22  ? 659 GLY F CA  1 
ATOM   5373 C C   . GLY F 1 106 ? 21.445  -22.277 26.389  1.00 38.45  ? 659 GLY F C   1 
ATOM   5374 O O   . GLY F 1 106 ? 22.490  -22.797 26.016  1.00 39.11  ? 659 GLY F O   1 
ATOM   5375 N N   . GLY F 1 107 ? 21.304  -21.648 27.553  1.00 38.26  ? 660 GLY F N   1 
ATOM   5376 C CA  . GLY F 1 107 ? 22.374  -21.537 28.508  1.00 39.12  ? 660 GLY F CA  1 
ATOM   5377 C C   . GLY F 1 107 ? 23.010  -22.878 28.804  1.00 39.98  ? 660 GLY F C   1 
ATOM   5378 O O   . GLY F 1 107 ? 24.243  -23.011 28.791  1.00 31.71  ? 660 GLY F O   1 
ATOM   5379 N N   . VAL F 1 108 ? 22.167  -23.871 29.073  1.00 34.99  ? 661 VAL F N   1 
ATOM   5380 C CA  . VAL F 1 108 ? 22.626  -25.240 29.351  1.00 35.26  ? 661 VAL F CA  1 
ATOM   5381 C C   . VAL F 1 108 ? 23.530  -25.762 28.245  1.00 33.92  ? 661 VAL F C   1 
ATOM   5382 O O   . VAL F 1 108 ? 24.534  -26.410 28.529  1.00 40.17  ? 661 VAL F O   1 
ATOM   5383 C CB  . VAL F 1 108 ? 21.433  -26.226 29.479  1.00 36.77  ? 661 VAL F CB  1 
ATOM   5384 C CG1 . VAL F 1 108 ? 21.920  -27.660 29.760  1.00 30.99  ? 661 VAL F CG1 1 
ATOM   5385 C CG2 . VAL F 1 108 ? 20.464  -25.743 30.562  1.00 43.25  ? 661 VAL F CG2 1 
ATOM   5386 N N   . VAL F 1 109 ? 23.171  -25.473 26.989  1.00 32.85  ? 662 VAL F N   1 
ATOM   5387 C CA  . VAL F 1 109 ? 23.939  -25.949 25.820  1.00 36.38  ? 662 VAL F CA  1 
ATOM   5388 C C   . VAL F 1 109 ? 25.235  -25.176 25.618  1.00 35.66  ? 662 VAL F C   1 
ATOM   5389 O O   . VAL F 1 109 ? 26.263  -25.756 25.254  1.00 29.90  ? 662 VAL F O   1 
ATOM   5390 C CB  . VAL F 1 109 ? 23.128  -25.834 24.507  1.00 39.90  ? 662 VAL F CB  1 
ATOM   5391 C CG1 . VAL F 1 109 ? 24.011  -26.211 23.302  1.00 21.15  ? 662 VAL F CG1 1 
ATOM   5392 C CG2 . VAL F 1 109 ? 21.861  -26.718 24.580  1.00 40.70  ? 662 VAL F CG2 1 
ATOM   5393 N N   . LEU F 1 110 ? 25.165  -23.861 25.822  1.00 31.87  ? 663 LEU F N   1 
ATOM   5394 C CA  . LEU F 1 110 ? 26.330  -23.005 25.656  1.00 40.25  ? 663 LEU F CA  1 
ATOM   5395 C C   . LEU F 1 110 ? 27.404  -23.336 26.697  1.00 41.52  ? 663 LEU F C   1 
ATOM   5396 O O   . LEU F 1 110 ? 28.596  -23.449 26.372  1.00 47.44  ? 663 LEU F O   1 
ATOM   5397 C CB  . LEU F 1 110 ? 25.920  -21.517 25.646  1.00 33.45  ? 663 LEU F CB  1 
ATOM   5398 C CG  . LEU F 1 110 ? 25.618  -21.107 24.202  1.00 43.92  ? 663 LEU F CG  1 
ATOM   5399 C CD1 . LEU F 1 110 ? 24.953  -19.766 24.085  1.00 49.34  ? 663 LEU F CD1 1 
ATOM   5400 C CD2 . LEU F 1 110 ? 26.921  -21.143 23.413  1.00 27.02  ? 663 LEU F CD2 1 
ATOM   5401 N N   . ARG F 1 111 ? 26.964  -23.565 27.924  1.00 41.24  ? 664 ARG F N   1 
ATOM   5402 C CA  A ARG F 1 111 ? 27.866  -23.970 28.991  0.50 47.42  ? 664 ARG F CA  1 
ATOM   5403 C CA  B ARG F 1 111 ? 27.862  -23.974 28.991  0.50 47.77  ? 664 ARG F CA  1 
ATOM   5404 C C   . ARG F 1 111 ? 28.557  -25.294 28.656  1.00 47.29  ? 664 ARG F C   1 
ATOM   5405 O O   . ARG F 1 111 ? 29.755  -25.404 28.819  1.00 46.98  ? 664 ARG F O   1 
ATOM   5406 C CB  A ARG F 1 111 ? 27.130  -24.053 30.343  0.50 50.75  ? 664 ARG F CB  1 
ATOM   5407 C CB  B ARG F 1 111 ? 27.119  -24.085 30.332  0.50 51.33  ? 664 ARG F CB  1 
ATOM   5408 C CG  A ARG F 1 111 ? 27.255  -22.789 31.204  0.50 52.05  ? 664 ARG F CG  1 
ATOM   5409 C CG  B ARG F 1 111 ? 26.808  -22.740 30.984  0.50 54.47  ? 664 ARG F CG  1 
ATOM   5410 C CD  A ARG F 1 111 ? 25.994  -22.517 32.041  0.50 53.35  ? 664 ARG F CD  1 
ATOM   5411 C CD  B ARG F 1 111 ? 26.409  -22.889 32.458  0.50 55.99  ? 664 ARG F CD  1 
ATOM   5412 N NE  A ARG F 1 111 ? 25.415  -23.732 32.617  0.50 53.07  ? 664 ARG F NE  1 
ATOM   5413 N NE  B ARG F 1 111 ? 25.062  -23.428 32.649  0.50 53.74  ? 664 ARG F NE  1 
ATOM   5414 C CZ  A ARG F 1 111 ? 24.133  -23.855 32.949  0.50 54.38  ? 664 ARG F CZ  1 
ATOM   5415 C CZ  B ARG F 1 111 ? 23.946  -22.718 32.490  0.50 45.12  ? 664 ARG F CZ  1 
ATOM   5416 N NH1 A ARG F 1 111 ? 23.689  -24.997 33.465  0.50 41.14  ? 664 ARG F NH1 1 
ATOM   5417 N NH1 B ARG F 1 111 ? 22.756  -23.278 32.690  0.50 37.05  ? 664 ARG F NH1 1 
ATOM   5418 N NH2 A ARG F 1 111 ? 23.293  -22.831 32.761  0.50 42.26  ? 664 ARG F NH2 1 
ATOM   5419 N NH2 B ARG F 1 111 ? 24.023  -21.449 32.123  0.50 28.51  ? 664 ARG F NH2 1 
ATOM   5420 N N   . GLN F 1 112 ? 27.801  -26.293 28.180  1.00 44.82  ? 665 GLN F N   1 
ATOM   5421 C CA  . GLN F 1 112 ? 28.414  -27.584 27.774  1.00 46.30  ? 665 GLN F CA  1 
ATOM   5422 C C   . GLN F 1 112 ? 29.458  -27.351 26.682  1.00 47.19  ? 665 GLN F C   1 
ATOM   5423 O O   . GLN F 1 112 ? 30.526  -28.004 26.687  1.00 33.07  ? 665 GLN F O   1 
ATOM   5424 C CB  . GLN F 1 112 ? 27.385  -28.629 27.286  1.00 40.30  ? 665 GLN F CB  1 
ATOM   5425 N N   . ALA F 1 113 ? 29.135  -26.428 25.759  1.00 39.89  ? 666 ALA F N   1 
ATOM   5426 C CA  . ALA F 1 113 ? 30.078  -25.961 24.734  1.00 37.19  ? 666 ALA F CA  1 
ATOM   5427 C C   . ALA F 1 113 ? 31.386  -25.362 25.302  1.00 35.78  ? 666 ALA F C   1 
ATOM   5428 O O   . ALA F 1 113 ? 32.457  -25.657 24.799  1.00 34.18  ? 666 ALA F O   1 
ATOM   5429 C CB  . ALA F 1 113 ? 29.388  -24.939 23.777  1.00 27.63  ? 666 ALA F CB  1 
ATOM   5430 N N   . ARG F 1 114 ? 31.315  -24.513 26.323  1.00 43.23  ? 667 ARG F N   1 
ATOM   5431 C CA  . ARG F 1 114 ? 32.567  -23.966 26.909  1.00 44.39  ? 667 ARG F CA  1 
ATOM   5432 C C   . ARG F 1 114 ? 33.378  -25.120 27.540  1.00 43.49  ? 667 ARG F C   1 
ATOM   5433 O O   . ARG F 1 114 ? 34.590  -25.251 27.300  1.00 41.69  ? 667 ARG F O   1 
ATOM   5434 C CB  . ARG F 1 114 ? 32.275  -22.839 27.921  1.00 47.67  ? 667 ARG F CB  1 
ATOM   5435 C CG  . ARG F 1 114 ? 33.501  -21.969 28.382  1.00 53.95  ? 667 ARG F CG  1 
ATOM   5436 C CD  . ARG F 1 114 ? 33.760  -20.769 27.462  1.00 63.85  ? 667 ARG F CD  1 
ATOM   5437 N N   . ARG F 1 115 ? 32.699  -25.994 28.288  1.00 36.38  ? 668 ARG F N   1 
ATOM   5438 C CA  . ARG F 1 115 ? 33.362  -27.135 28.949  1.00 36.10  ? 668 ARG F CA  1 
ATOM   5439 C C   . ARG F 1 115 ? 34.102  -27.965 27.900  1.00 37.61  ? 668 ARG F C   1 
ATOM   5440 O O   . ARG F 1 115 ? 35.242  -28.418 28.102  1.00 40.52  ? 668 ARG F O   1 
ATOM   5441 C CB  . ARG F 1 115 ? 32.341  -28.022 29.715  1.00 39.39  ? 668 ARG F CB  1 
ATOM   5442 C CG  . ARG F 1 115 ? 31.583  -27.356 30.916  1.00 39.96  ? 668 ARG F CG  1 
ATOM   5443 C CD  . ARG F 1 115 ? 30.379  -28.208 31.441  1.00 46.91  ? 668 ARG F CD  1 
ATOM   5444 N N   . GLU F 1 116 ? 33.458  -28.136 26.750  1.00 33.38  ? 669 GLU F N   1 
ATOM   5445 C CA  . GLU F 1 116 ? 34.059  -28.889 25.666  1.00 34.29  ? 669 GLU F CA  1 
ATOM   5446 C C   . GLU F 1 116 ? 35.203  -28.131 25.011  1.00 35.15  ? 669 GLU F C   1 
ATOM   5447 O O   . GLU F 1 116 ? 36.167  -28.735 24.557  1.00 30.75  ? 669 GLU F O   1 
ATOM   5448 C CB  . GLU F 1 116 ? 33.006  -29.260 24.639  1.00 33.71  ? 669 GLU F CB  1 
ATOM   5449 C CG  . GLU F 1 116 ? 33.453  -30.310 23.665  1.00 40.02  ? 669 GLU F CG  1 
ATOM   5450 C CD  . GLU F 1 116 ? 34.046  -31.540 24.337  1.00 52.95  ? 669 GLU F CD  1 
ATOM   5451 O OE1 . GLU F 1 116 ? 35.101  -31.981 23.843  1.00 50.84  ? 669 GLU F OE1 1 
ATOM   5452 O OE2 . GLU F 1 116 ? 33.483  -32.047 25.344  1.00 47.59  ? 669 GLU F OE2 1 
ATOM   5453 N N   . VAL F 1 117 ? 35.097  -26.811 24.960  1.00 34.98  ? 670 VAL F N   1 
ATOM   5454 C CA  . VAL F 1 117 ? 36.185  -26.012 24.422  1.00 41.50  ? 670 VAL F CA  1 
ATOM   5455 C C   . VAL F 1 117 ? 37.432  -26.213 25.283  1.00 46.73  ? 670 VAL F C   1 
ATOM   5456 O O   . VAL F 1 117 ? 38.535  -26.225 24.752  1.00 55.03  ? 670 VAL F O   1 
ATOM   5457 C CB  . VAL F 1 117 ? 35.790  -24.506 24.290  1.00 42.14  ? 670 VAL F CB  1 
ATOM   5458 C CG1 . VAL F 1 117 ? 36.988  -23.639 23.969  1.00 39.07  ? 670 VAL F CG1 1 
ATOM   5459 C CG2 . VAL F 1 117 ? 34.671  -24.317 23.223  1.00 36.76  ? 670 VAL F CG2 1 
ATOM   5460 N N   . ASP F 1 118 ? 37.260  -26.407 26.594  1.00 49.88  ? 671 ASP F N   1 
ATOM   5461 C CA  . ASP F 1 118 ? 38.422  -26.635 27.495  1.00 52.28  ? 671 ASP F CA  1 
ATOM   5462 C C   . ASP F 1 118 ? 38.837  -28.096 27.483  1.00 44.58  ? 671 ASP F C   1 
ATOM   5463 O O   . ASP F 1 118 ? 40.013  -28.407 27.563  1.00 39.78  ? 671 ASP F O   1 
ATOM   5464 C CB  . ASP F 1 118 ? 38.156  -26.202 28.956  1.00 52.66  ? 671 ASP F CB  1 
ATOM   5465 C CG  . ASP F 1 118 ? 37.802  -24.703 29.100  1.00 70.91  ? 671 ASP F CG  1 
ATOM   5466 O OD1 . ASP F 1 118 ? 38.244  -23.870 28.258  1.00 55.12  ? 671 ASP F OD1 1 
ATOM   5467 O OD2 . ASP F 1 118 ? 37.068  -24.370 30.074  1.00 47.47  ? 671 ASP F OD2 1 
ATOM   5468 N N   . SER F 1 119 ? 37.879  -29.011 27.398  1.00 44.63  ? 672 SER F N   1 
ATOM   5469 C CA  . SER F 1 119 ? 38.246  -30.429 27.361  1.00 38.91  ? 672 SER F CA  1 
ATOM   5470 C C   . SER F 1 119 ? 39.166  -30.690 26.172  1.00 41.38  ? 672 SER F C   1 
ATOM   5471 O O   . SER F 1 119 ? 40.242  -31.272 26.329  1.00 34.05  ? 672 SER F O   1 
ATOM   5472 C CB  . SER F 1 119 ? 37.018  -31.313 27.274  1.00 37.17  ? 672 SER F CB  1 
ATOM   5473 O OG  . SER F 1 119 ? 37.349  -32.622 26.820  1.00 38.32  ? 672 SER F OG  1 
ATOM   5474 N N   . ILE F 1 120 ? 38.749  -30.238 24.984  1.00 35.54  ? 673 ILE F N   1 
ATOM   5475 C CA  . ILE F 1 120 ? 39.619  -30.293 23.798  1.00 41.32  ? 673 ILE F CA  1 
ATOM   5476 C C   . ILE F 1 120 ? 40.974  -29.674 24.093  1.00 41.52  ? 673 ILE F C   1 
ATOM   5477 O O   . ILE F 1 120 ? 42.006  -30.269 23.770  1.00 45.92  ? 673 ILE F O   1 
ATOM   5478 C CB  . ILE F 1 120 ? 38.994  -29.617 22.571  1.00 40.56  ? 673 ILE F CB  1 
ATOM   5479 C CG1 . ILE F 1 120 ? 37.843  -30.470 22.028  1.00 43.23  ? 673 ILE F CG1 1 
ATOM   5480 C CG2 . ILE F 1 120 ? 40.001  -29.441 21.437  1.00 36.38  ? 673 ILE F CG2 1 
ATOM   5481 C CD1 . ILE F 1 120 ? 36.968  -29.703 21.056  1.00 27.14  ? 673 ILE F CD1 1 
ATOM   5482 N N   . GLY F 1 121 ? 40.955  -28.493 24.706  1.00 45.25  ? 674 GLY F N   1 
ATOM   5483 C CA  . GLY F 1 121 ? 42.169  -27.834 25.169  1.00 53.34  ? 674 GLY F CA  1 
ATOM   5484 C C   . GLY F 1 121 ? 43.118  -28.749 25.933  1.00 56.58  ? 674 GLY F C   1 
ATOM   5485 O O   . GLY F 1 121 ? 44.320  -28.699 25.710  1.00 66.03  ? 674 GLY F O   1 
ATOM   5486 N N   . LEU F 1 122 ? 42.597  -29.598 26.818  1.00 60.12  ? 675 LEU F N   1 
ATOM   5487 C CA  . LEU F 1 122 ? 43.452  -30.468 27.647  1.00 63.93  ? 675 LEU F CA  1 
ATOM   5488 C C   . LEU F 1 122 ? 44.008  -31.703 26.902  1.00 67.97  ? 675 LEU F C   1 
ATOM   5489 O O   . LEU F 1 122 ? 45.027  -32.262 27.333  1.00 66.69  ? 675 LEU F O   1 
ATOM   5490 C CB  . LEU F 1 122 ? 42.720  -30.900 28.934  1.00 65.92  ? 675 LEU F CB  1 
ATOM   5491 N N   . GLU F 1 123 ? 43.358  -32.132 25.808  1.00 64.93  ? 676 GLU F N   1 
ATOM   5492 C CA  . GLU F 1 123 ? 43.884  -33.247 24.967  1.00 67.76  ? 676 GLU F CA  1 
ATOM   5493 C C   . GLU F 1 123 ? 45.088  -32.795 24.123  1.00 66.92  ? 676 GLU F C   1 
ATOM   5494 O O   . GLU F 1 123 ? 46.235  -32.826 24.581  1.00 69.24  ? 676 GLU F O   1 
ATOM   5495 C CB  . GLU F 1 123 ? 42.793  -33.849 24.044  1.00 56.36  ? 676 GLU F CB  1 
ATOM   5496 N N   . LEU G 1 11  ? 6.925   -28.798 115.257 1.00 79.83  ? 564 LEU G N   1 
ATOM   5497 C CA  . LEU G 1 11  ? 8.123   -29.638 114.927 1.00 79.38  ? 564 LEU G CA  1 
ATOM   5498 C C   . LEU G 1 11  ? 7.794   -30.878 114.064 1.00 75.53  ? 564 LEU G C   1 
ATOM   5499 O O   . LEU G 1 11  ? 8.698   -31.650 113.728 1.00 78.63  ? 564 LEU G O   1 
ATOM   5500 C CB  . LEU G 1 11  ? 8.849   -30.068 116.217 1.00 79.39  ? 564 LEU G CB  1 
ATOM   5501 N N   . THR G 1 12  ? 6.526   -31.068 113.690 1.00 69.03  ? 565 THR G N   1 
ATOM   5502 C CA  . THR G 1 12  ? 6.139   -32.222 112.860 1.00 58.99  ? 565 THR G CA  1 
ATOM   5503 C C   . THR G 1 12  ? 6.092   -31.865 111.359 1.00 61.36  ? 565 THR G C   1 
ATOM   5504 O O   . THR G 1 12  ? 6.035   -30.678 110.995 1.00 66.21  ? 565 THR G O   1 
ATOM   5505 C CB  . THR G 1 12  ? 4.788   -32.817 113.299 1.00 56.43  ? 565 THR G CB  1 
ATOM   5506 O OG1 . THR G 1 12  ? 3.705   -32.073 112.729 1.00 48.39  ? 565 THR G OG1 1 
ATOM   5507 C CG2 . THR G 1 12  ? 4.661   -32.826 114.831 1.00 63.08  ? 565 THR G CG2 1 
ATOM   5508 N N   . PRO G 1 13  ? 6.155   -32.888 110.481 1.00 58.95  ? 566 PRO G N   1 
ATOM   5509 C CA  . PRO G 1 13  ? 5.970   -32.741 109.041 1.00 50.85  ? 566 PRO G CA  1 
ATOM   5510 C C   . PRO G 1 13  ? 4.683   -32.008 108.668 1.00 48.76  ? 566 PRO G C   1 
ATOM   5511 O O   . PRO G 1 13  ? 4.729   -31.020 107.934 1.00 46.63  ? 566 PRO G O   1 
ATOM   5512 C CB  . PRO G 1 13  ? 5.907   -34.180 108.556 1.00 55.72  ? 566 PRO G CB  1 
ATOM   5513 C CG  . PRO G 1 13  ? 6.711   -34.943 109.527 1.00 59.14  ? 566 PRO G CG  1 
ATOM   5514 C CD  . PRO G 1 13  ? 6.718   -34.209 110.820 1.00 61.27  ? 566 PRO G CD  1 
ATOM   5515 N N   . LEU G 1 14  ? 3.560   -32.473 109.208 1.00 42.65  ? 567 LEU G N   1 
ATOM   5516 C CA  . LEU G 1 14  ? 2.239   -31.893 108.937 1.00 41.32  ? 567 LEU G CA  1 
ATOM   5517 C C   . LEU G 1 14  ? 2.180   -30.422 109.337 1.00 42.66  ? 567 LEU G C   1 
ATOM   5518 O O   . LEU G 1 14  ? 1.571   -29.618 108.642 1.00 43.41  ? 567 LEU G O   1 
ATOM   5519 C CB  . LEU G 1 14  ? 1.174   -32.681 109.701 1.00 43.38  ? 567 LEU G CB  1 
ATOM   5520 C CG  . LEU G 1 14  ? -0.322  -32.559 109.406 1.00 33.85  ? 567 LEU G CG  1 
ATOM   5521 C CD1 . LEU G 1 14  ? -1.073  -32.045 110.602 1.00 42.55  ? 567 LEU G CD1 1 
ATOM   5522 C CD2 . LEU G 1 14  ? -0.599  -31.748 108.182 1.00 47.70  ? 567 LEU G CD2 1 
ATOM   5523 N N   . THR G 1 15  ? 2.852   -30.078 110.433 1.00 40.85  ? 568 THR G N   1 
ATOM   5524 C CA  . THR G 1 15  ? 2.843   -28.719 110.968 1.00 44.77  ? 568 THR G CA  1 
ATOM   5525 C C   . THR G 1 15  ? 3.574   -27.756 110.028 1.00 40.46  ? 568 THR G C   1 
ATOM   5526 O O   . THR G 1 15  ? 3.034   -26.690 109.666 1.00 25.66  ? 568 THR G O   1 
ATOM   5527 C CB  . THR G 1 15  ? 3.477   -28.675 112.393 1.00 44.78  ? 568 THR G CB  1 
ATOM   5528 O OG1 . THR G 1 15  ? 2.542   -29.178 113.338 1.00 42.13  ? 568 THR G OG1 1 
ATOM   5529 C CG2 . THR G 1 15  ? 3.880   -27.257 112.817 1.00 35.02  ? 568 THR G CG2 1 
ATOM   5530 N N   . VAL G 1 16  ? 4.786   -28.136 109.632 1.00 36.01  ? 569 VAL G N   1 
ATOM   5531 C CA  . VAL G 1 16  ? 5.528   -27.353 108.642 1.00 40.27  ? 569 VAL G CA  1 
ATOM   5532 C C   . VAL G 1 16  ? 4.681   -27.160 107.374 1.00 40.80  ? 569 VAL G C   1 
ATOM   5533 O O   . VAL G 1 16  ? 4.639   -26.067 106.790 1.00 39.99  ? 569 VAL G O   1 
ATOM   5534 C CB  . VAL G 1 16  ? 6.879   -28.005 108.254 1.00 42.86  ? 569 VAL G CB  1 
ATOM   5535 C CG1 . VAL G 1 16  ? 7.633   -27.104 107.305 1.00 44.54  ? 569 VAL G CG1 1 
ATOM   5536 C CG2 . VAL G 1 16  ? 7.720   -28.285 109.479 1.00 31.75  ? 569 VAL G CG2 1 
ATOM   5537 N N   . LEU G 1 17  ? 3.984   -28.216 106.969 1.00 39.51  ? 570 LEU G N   1 
ATOM   5538 C CA  . LEU G 1 17  ? 3.178   -28.152 105.770 1.00 36.83  ? 570 LEU G CA  1 
ATOM   5539 C C   . LEU G 1 17  ? 2.045   -27.167 105.936 1.00 31.19  ? 570 LEU G C   1 
ATOM   5540 O O   . LEU G 1 17  ? 1.762   -26.390 105.035 1.00 43.53  ? 570 LEU G O   1 
ATOM   5541 C CB  . LEU G 1 17  ? 2.612   -29.520 105.392 1.00 29.00  ? 570 LEU G CB  1 
ATOM   5542 C CG  . LEU G 1 17  ? 1.841   -29.520 104.066 1.00 24.30  ? 570 LEU G CG  1 
ATOM   5543 C CD1 . LEU G 1 17  ? 2.815   -29.173 102.890 1.00 20.15  ? 570 LEU G CD1 1 
ATOM   5544 C CD2 . LEU G 1 17  ? 1.115   -30.867 103.761 1.00 21.89  ? 570 LEU G CD2 1 
ATOM   5545 N N   . LEU G 1 18  ? 1.371   -27.196 107.073 1.00 33.45  ? 571 LEU G N   1 
ATOM   5546 C CA  . LEU G 1 18  ? 0.158   -26.385 107.178 1.00 34.98  ? 571 LEU G CA  1 
ATOM   5547 C C   . LEU G 1 18  ? 0.537   -24.916 107.330 1.00 30.29  ? 571 LEU G C   1 
ATOM   5548 O O   . LEU G 1 18  ? -0.179  -24.023 106.863 1.00 27.23  ? 571 LEU G O   1 
ATOM   5549 C CB  . LEU G 1 18  ? -0.751  -26.886 108.295 1.00 30.59  ? 571 LEU G CB  1 
ATOM   5550 C CG  . LEU G 1 18  ? -1.287  -28.291 108.073 1.00 27.27  ? 571 LEU G CG  1 
ATOM   5551 C CD1 . LEU G 1 18  ? -2.037  -28.818 109.310 1.00 21.72  ? 571 LEU G CD1 1 
ATOM   5552 C CD2 . LEU G 1 18  ? -2.177  -28.368 106.830 1.00 29.21  ? 571 LEU G CD2 1 
ATOM   5553 N N   . ARG G 1 19  ? 1.676   -24.675 107.967 1.00 20.66  ? 572 ARG G N   1 
ATOM   5554 C CA  . ARG G 1 19  ? 2.275   -23.331 107.974 1.00 37.38  ? 572 ARG G CA  1 
ATOM   5555 C C   . ARG G 1 19  ? 2.382   -22.751 106.562 1.00 32.63  ? 572 ARG G C   1 
ATOM   5556 O O   . ARG G 1 19  ? 1.986   -21.616 106.319 1.00 27.91  ? 572 ARG G O   1 
ATOM   5557 C CB  . ARG G 1 19  ? 3.687   -23.336 108.584 1.00 35.24  ? 572 ARG G CB  1 
ATOM   5558 C CG  . ARG G 1 19  ? 3.748   -23.586 110.090 1.00 50.03  ? 572 ARG G CG  1 
ATOM   5559 C CD  . ARG G 1 19  ? 4.505   -22.490 110.826 1.00 55.13  ? 572 ARG G CD  1 
ATOM   5560 N NE  . ARG G 1 19  ? 4.486   -22.702 112.278 1.00 72.26  ? 572 ARG G NE  1 
ATOM   5561 C CZ  . ARG G 1 19  ? 5.372   -23.439 112.957 1.00 68.86  ? 572 ARG G CZ  1 
ATOM   5562 N NH1 . ARG G 1 19  ? 6.386   -24.045 112.341 1.00 59.90  ? 572 ARG G NH1 1 
ATOM   5563 N NH2 . ARG G 1 19  ? 5.254   -23.562 114.274 1.00 64.35  ? 572 ARG G NH2 1 
ATOM   5564 N N   . SER G 1 20  ? 2.917   -23.551 105.645 1.00 31.51  ? 573 SER G N   1 
ATOM   5565 C CA  . SER G 1 20  ? 3.195   -23.081 104.284 1.00 28.19  ? 573 SER G CA  1 
ATOM   5566 C C   . SER G 1 20  ? 1.886   -22.859 103.566 1.00 27.28  ? 573 SER G C   1 
ATOM   5567 O O   . SER G 1 20  ? 1.717   -21.839 102.893 1.00 24.63  ? 573 SER G O   1 
ATOM   5568 C CB  . SER G 1 20  ? 4.057   -24.093 103.540 1.00 26.42  ? 573 SER G CB  1 
ATOM   5569 O OG  . SER G 1 20  ? 5.339   -24.153 104.153 1.00 45.86  ? 573 SER G OG  1 
ATOM   5570 N N   . VAL G 1 21  ? 0.948   -23.792 103.769 1.00 20.79  ? 574 VAL G N   1 
ATOM   5571 C CA  . VAL G 1 21  ? -0.364  -23.699 103.139 1.00 26.04  ? 574 VAL G CA  1 
ATOM   5572 C C   . VAL G 1 21  ? -1.017  -22.430 103.641 1.00 23.98  ? 574 VAL G C   1 
ATOM   5573 O O   . VAL G 1 21  ? -1.374  -21.567 102.852 1.00 33.16  ? 574 VAL G O   1 
ATOM   5574 C CB  . VAL G 1 21  ? -1.212  -24.953 103.444 1.00 28.73  ? 574 VAL G CB  1 
ATOM   5575 C CG1 . VAL G 1 21  ? -2.623  -24.760 103.029 1.00 18.14  ? 574 VAL G CG1 1 
ATOM   5576 C CG2 . VAL G 1 21  ? -0.638  -26.135 102.740 1.00 16.11  ? 574 VAL G CG2 1 
ATOM   5577 N N   . LEU G 1 22  ? -1.092  -22.257 104.964 1.00 30.43  ? 575 LEU G N   1 
ATOM   5578 C CA  . LEU G 1 22  ? -1.744  -21.067 105.514 1.00 27.08  ? 575 LEU G CA  1 
ATOM   5579 C C   . LEU G 1 22  ? -1.076  -19.770 104.990 1.00 27.89  ? 575 LEU G C   1 
ATOM   5580 O O   . LEU G 1 22  ? -1.763  -18.855 104.514 1.00 23.09  ? 575 LEU G O   1 
ATOM   5581 C CB  . LEU G 1 22  ? -1.849  -21.128 107.041 1.00 22.85  ? 575 LEU G CB  1 
ATOM   5582 C CG  . LEU G 1 22  ? -2.697  -20.080 107.748 1.00 31.67  ? 575 LEU G CG  1 
ATOM   5583 C CD1 . LEU G 1 22  ? -4.107  -20.053 107.202 1.00 19.39  ? 575 LEU G CD1 1 
ATOM   5584 C CD2 . LEU G 1 22  ? -2.693  -20.338 109.267 1.00 21.22  ? 575 LEU G CD2 1 
ATOM   5585 N N   . ASP G 1 23  ? 0.244   -19.710 105.003 1.00 21.27  ? 576 ASP G N   1 
ATOM   5586 C CA  . ASP G 1 23  ? 0.953   -18.566 104.349 1.00 29.80  ? 576 ASP G CA  1 
ATOM   5587 C C   . ASP G 1 23  ? 0.478   -18.298 102.920 1.00 32.28  ? 576 ASP G C   1 
ATOM   5588 O O   . ASP G 1 23  ? 0.122   -17.158 102.567 1.00 24.86  ? 576 ASP G O   1 
ATOM   5589 C CB  . ASP G 1 23  ? 2.458   -18.792 104.289 1.00 28.32  ? 576 ASP G CB  1 
ATOM   5590 C CG  . ASP G 1 23  ? 3.136   -18.634 105.646 1.00 37.53  ? 576 ASP G CG  1 
ATOM   5591 O OD1 . ASP G 1 23  ? 2.444   -18.388 106.647 1.00 38.18  ? 576 ASP G OD1 1 
ATOM   5592 O OD2 . ASP G 1 23  ? 4.375   -18.740 105.708 1.00 56.88  ? 576 ASP G OD2 1 
ATOM   5593 N N   . GLN G 1 24  ? 0.439   -19.362 102.117 1.00 32.26  ? 577 GLN G N   1 
ATOM   5594 C CA  . GLN G 1 24  ? -0.012  -19.259 100.734 1.00 24.22  ? 577 GLN G CA  1 
ATOM   5595 C C   . GLN G 1 24  ? -1.461  -18.818 100.606 1.00 29.56  ? 577 GLN G C   1 
ATOM   5596 O O   . GLN G 1 24  ? -1.777  -17.966 99.772  1.00 26.10  ? 577 GLN G O   1 
ATOM   5597 C CB  . GLN G 1 24  ? 0.203   -20.581 99.997  1.00 18.72  ? 577 GLN G CB  1 
ATOM   5598 C CG  . GLN G 1 24  ? 1.719   -20.860 99.866  1.00 29.72  ? 577 GLN G CG  1 
ATOM   5599 C CD  . GLN G 1 24  ? 2.061   -21.873 98.798  1.00 29.54  ? 577 GLN G CD  1 
ATOM   5600 O OE1 . GLN G 1 24  ? 1.189   -22.557 98.269  1.00 38.24  ? 577 GLN G OE1 1 
ATOM   5601 N NE2 . GLN G 1 24  ? 3.350   -21.970 98.476  1.00 44.07  ? 577 GLN G NE2 1 
ATOM   5602 N N   . LEU G 1 25  ? -2.329  -19.407 101.431 1.00 34.35  ? 578 LEU G N   1 
ATOM   5603 C CA  . LEU G 1 25  ? -3.730  -19.098 101.385 1.00 30.77  ? 578 LEU G CA  1 
ATOM   5604 C C   . LEU G 1 25  ? -3.885  -17.601 101.686 1.00 34.44  ? 578 LEU G C   1 
ATOM   5605 O O   . LEU G 1 25  ? -4.658  -16.893 101.010 1.00 22.00  ? 578 LEU G O   1 
ATOM   5606 C CB  . LEU G 1 25  ? -4.512  -19.951 102.392 1.00 37.26  ? 578 LEU G CB  1 
ATOM   5607 C CG  . LEU G 1 25  ? -4.699  -21.443 102.131 1.00 33.93  ? 578 LEU G CG  1 
ATOM   5608 C CD1 . LEU G 1 25  ? -5.527  -22.031 103.224 1.00 25.85  ? 578 LEU G CD1 1 
ATOM   5609 C CD2 . LEU G 1 25  ? -5.414  -21.654 100.839 1.00 14.49  ? 578 LEU G CD2 1 
ATOM   5610 N N   . GLN G 1 26  ? -3.145  -17.106 102.675 1.00 26.88  ? 579 GLN G N   1 
ATOM   5611 C CA  . GLN G 1 26  ? -3.227  -15.670 103.010 1.00 30.98  ? 579 GLN G CA  1 
ATOM   5612 C C   . GLN G 1 26  ? -2.583  -14.781 101.948 1.00 36.14  ? 579 GLN G C   1 
ATOM   5613 O O   . GLN G 1 26  ? -2.985  -13.613 101.771 1.00 37.95  ? 579 GLN G O   1 
ATOM   5614 C CB  . GLN G 1 26  ? -2.530  -15.368 104.315 1.00 33.02  ? 579 GLN G CB  1 
ATOM   5615 C CG  . GLN G 1 26  ? -3.206  -15.952 105.505 1.00 47.32  ? 579 GLN G CG  1 
ATOM   5616 C CD  . GLN G 1 26  ? -2.950  -15.132 106.754 1.00 62.23  ? 579 GLN G CD  1 
ATOM   5617 O OE1 . GLN G 1 26  ? -2.251  -15.587 107.675 1.00 40.21  ? 579 GLN G OE1 1 
ATOM   5618 N NE2 . GLN G 1 26  ? -3.488  -13.897 106.780 1.00 23.68  ? 579 GLN G NE2 1 
ATOM   5619 N N   . ASP G 1 27  ? -1.575  -15.318 101.256 1.00 34.20  ? 580 ASP G N   1 
ATOM   5620 C CA  . ASP G 1 27  ? -1.005  -14.613 100.128 1.00 36.51  ? 580 ASP G CA  1 
ATOM   5621 C C   . ASP G 1 27  ? -2.074  -14.422 99.046  1.00 33.44  ? 580 ASP G C   1 
ATOM   5622 O O   . ASP G 1 27  ? -2.014  -13.456 98.292  1.00 31.37  ? 580 ASP G O   1 
ATOM   5623 C CB  . ASP G 1 27  ? 0.224   -15.339 99.577  1.00 39.05  ? 580 ASP G CB  1 
ATOM   5624 C CG  . ASP G 1 27  ? 1.479   -15.124 100.439 1.00 58.52  ? 580 ASP G CG  1 
ATOM   5625 O OD1 . ASP G 1 27  ? 1.525   -14.109 101.177 1.00 68.51  ? 580 ASP G OD1 1 
ATOM   5626 O OD2 . ASP G 1 27  ? 2.426   -15.960 100.360 1.00 58.25  ? 580 ASP G OD2 1 
ATOM   5627 N N   . LYS G 1 28  ? -3.070  -15.308 98.980  1.00 32.03  ? 581 LYS G N   1 
ATOM   5628 C CA  . LYS G 1 28  ? -4.214  -15.090 98.045  1.00 25.67  ? 581 LYS G CA  1 
ATOM   5629 C C   . LYS G 1 28  ? -5.203  -14.038 98.522  1.00 31.75  ? 581 LYS G C   1 
ATOM   5630 O O   . LYS G 1 28  ? -6.114  -13.711 97.775  1.00 33.83  ? 581 LYS G O   1 
ATOM   5631 C CB  . LYS G 1 28  ? -4.970  -16.401 97.755  1.00 35.92  ? 581 LYS G CB  1 
ATOM   5632 C CG  . LYS G 1 28  ? -4.431  -17.188 96.547  1.00 42.91  ? 581 LYS G CG  1 
ATOM   5633 C CD  . LYS G 1 28  ? -3.022  -17.692 96.756  1.00 35.79  ? 581 LYS G CD  1 
ATOM   5634 C CE  . LYS G 1 28  ? -2.463  -18.348 95.526  1.00 38.02  ? 581 LYS G CE  1 
ATOM   5635 N NZ  . LYS G 1 28  ? -1.011  -18.158 95.477  1.00 36.91  ? 581 LYS G NZ  1 
ATOM   5636 N N   . ASP G 1 29  ? -5.037  -13.515 99.746  1.00 32.34  ? 582 ASP G N   1 
ATOM   5637 C CA  . ASP G 1 29  ? -5.919  -12.477 100.286 1.00 39.17  ? 582 ASP G CA  1 
ATOM   5638 C C   . ASP G 1 29  ? -5.156  -11.211 100.708 1.00 34.13  ? 582 ASP G C   1 
ATOM   5639 O O   . ASP G 1 29  ? -5.156  -10.828 101.878 1.00 32.12  ? 582 ASP G O   1 
ATOM   5640 C CB  . ASP G 1 29  ? -6.740  -13.051 101.455 1.00 34.89  ? 582 ASP G CB  1 
ATOM   5641 C CG  . ASP G 1 29  ? -7.539  -11.977 102.233 1.00 33.76  ? 582 ASP G CG  1 
ATOM   5642 O OD1 . ASP G 1 29  ? -8.255  -11.138 101.611 1.00 29.13  ? 582 ASP G OD1 1 
ATOM   5643 O OD2 . ASP G 1 29  ? -7.443  -12.004 103.493 1.00 25.93  ? 582 ASP G OD2 1 
ATOM   5644 N N   . PRO G 1 30  ? -4.519  -10.543 99.749  1.00 28.59  ? 583 PRO G N   1 
ATOM   5645 C CA  . PRO G 1 30  ? -3.844  -9.285  100.020 1.00 29.84  ? 583 PRO G CA  1 
ATOM   5646 C C   . PRO G 1 30  ? -4.783  -8.152  100.473 1.00 28.92  ? 583 PRO G C   1 
ATOM   5647 O O   . PRO G 1 30  ? -4.351  -7.266  101.146 1.00 28.23  ? 583 PRO G O   1 
ATOM   5648 C CB  . PRO G 1 30  ? -3.188  -8.958  98.682  1.00 30.78  ? 583 PRO G CB  1 
ATOM   5649 C CG  . PRO G 1 30  ? -4.007  -9.652  97.714  1.00 39.47  ? 583 PRO G CG  1 
ATOM   5650 C CD  . PRO G 1 30  ? -4.393  -10.916 98.341  1.00 32.00  ? 583 PRO G CD  1 
ATOM   5651 N N   . ALA G 1 31  ? -6.076  -8.227  100.191 1.00 32.00  ? 584 ALA G N   1 
ATOM   5652 C CA  . ALA G 1 31  ? -7.011  -7.290  100.780 1.00 24.79  ? 584 ALA G CA  1 
ATOM   5653 C C   . ALA G 1 31  ? -7.156  -7.464  102.291 1.00 32.28  ? 584 ALA G C   1 
ATOM   5654 O O   . ALA G 1 31  ? -7.660  -6.545  102.962 1.00 28.04  ? 584 ALA G O   1 
ATOM   5655 C CB  . ALA G 1 31  ? -8.382  -7.424  100.107 1.00 32.40  ? 584 ALA G CB  1 
ATOM   5656 N N   . ARG G 1 32  ? -6.735  -8.616  102.843 1.00 33.40  ? 585 ARG G N   1 
ATOM   5657 C CA  . ARG G 1 32  ? -6.891  -8.906  104.302 1.00 34.18  ? 585 ARG G CA  1 
ATOM   5658 C C   . ARG G 1 32  ? -8.351  -8.860  104.738 1.00 32.57  ? 585 ARG G C   1 
ATOM   5659 O O   . ARG G 1 32  ? -8.657  -8.421  105.827 1.00 29.45  ? 585 ARG G O   1 
ATOM   5660 C CB  . ARG G 1 32  ? -6.124  -7.914  105.178 1.00 31.38  ? 585 ARG G CB  1 
ATOM   5661 C CG  . ARG G 1 32  ? -4.656  -7.806  104.852 1.00 42.99  ? 585 ARG G CG  1 
ATOM   5662 C CD  . ARG G 1 32  ? -3.882  -8.856  105.601 1.00 41.40  ? 585 ARG G CD  1 
ATOM   5663 N NE  . ARG G 1 32  ? -3.001  -9.618  104.729 1.00 71.82  ? 585 ARG G NE  1 
ATOM   5664 C CZ  . ARG G 1 32  ? -2.080  -10.471 105.167 1.00 77.38  ? 585 ARG G CZ  1 
ATOM   5665 N NH1 . ARG G 1 32  ? -1.335  -11.127 104.277 1.00 70.66  ? 585 ARG G NH1 1 
ATOM   5666 N NH2 . ARG G 1 32  ? -1.906  -10.667 106.487 1.00 56.13  ? 585 ARG G NH2 1 
ATOM   5667 N N   . ILE G 1 33  ? -9.247  -9.272  103.861 1.00 28.17  ? 586 ILE G N   1 
ATOM   5668 C CA  . ILE G 1 33  ? -10.652 -9.362  104.207 1.00 32.81  ? 586 ILE G CA  1 
ATOM   5669 C C   . ILE G 1 33  ? -10.885 -10.527 105.138 1.00 34.29  ? 586 ILE G C   1 
ATOM   5670 O O   . ILE G 1 33  ? -11.833 -10.463 105.924 1.00 33.25  ? 586 ILE G O   1 
ATOM   5671 C CB  . ILE G 1 33  ? -11.513 -9.544  102.946 1.00 36.27  ? 586 ILE G CB  1 
ATOM   5672 C CG1 . ILE G 1 33  ? -11.611 -8.196  102.230 1.00 26.21  ? 586 ILE G CG1 1 
ATOM   5673 C CG2 . ILE G 1 33  ? -12.888 -10.114 103.272 1.00 22.90  ? 586 ILE G CG2 1 
ATOM   5674 C CD1 . ILE G 1 33  ? -11.622 -8.296  100.752 1.00 27.45  ? 586 ILE G CD1 1 
ATOM   5675 N N   . PHE G 1 34  ? -10.038 -11.571 105.052 1.00 24.45  ? 587 PHE G N   1 
ATOM   5676 C CA  . PHE G 1 34  ? -10.256 -12.801 105.826 1.00 21.78  ? 587 PHE G CA  1 
ATOM   5677 C C   . PHE G 1 34  ? -9.107  -13.055 106.816 1.00 23.73  ? 587 PHE G C   1 
ATOM   5678 O O   . PHE G 1 34  ? -8.971  -14.166 107.328 1.00 23.32  ? 587 PHE G O   1 
ATOM   5679 C CB  . PHE G 1 34  ? -10.417 -14.021 104.893 1.00 18.94  ? 587 PHE G CB  1 
ATOM   5680 C CG  . PHE G 1 34  ? -11.373 -13.800 103.760 1.00 34.23  ? 587 PHE G CG  1 
ATOM   5681 C CD1 . PHE G 1 34  ? -12.742 -13.899 103.964 1.00 21.82  ? 587 PHE G CD1 1 
ATOM   5682 C CD2 . PHE G 1 34  ? -10.905 -13.439 102.501 1.00 30.17  ? 587 PHE G CD2 1 
ATOM   5683 C CE1 . PHE G 1 34  ? -13.633 -13.679 102.923 1.00 37.21  ? 587 PHE G CE1 1 
ATOM   5684 C CE2 . PHE G 1 34  ? -11.779 -13.202 101.458 1.00 30.20  ? 587 PHE G CE2 1 
ATOM   5685 C CZ  . PHE G 1 34  ? -13.161 -13.318 101.670 1.00 36.32  ? 587 PHE G CZ  1 
ATOM   5686 N N   . ALA G 1 35  ? -8.299  -12.037 107.100 1.00 23.83  ? 588 ALA G N   1 
ATOM   5687 C CA  . ALA G 1 35  ? -7.150  -12.213 108.000 1.00 33.56  ? 588 ALA G CA  1 
ATOM   5688 C C   . ALA G 1 35  ? -7.553  -12.224 109.461 1.00 34.13  ? 588 ALA G C   1 
ATOM   5689 O O   . ALA G 1 35  ? -6.904  -12.886 110.272 1.00 25.45  ? 588 ALA G O   1 
ATOM   5690 C CB  . ALA G 1 35  ? -6.082  -11.158 107.760 1.00 32.54  ? 588 ALA G CB  1 
ATOM   5691 N N   . GLN G 1 36  ? -8.628  -11.514 109.795 1.00 29.53  ? 589 GLN G N   1 
ATOM   5692 C CA  . GLN G 1 36  ? -9.049  -11.393 111.179 1.00 25.50  ? 589 GLN G CA  1 
ATOM   5693 C C   . GLN G 1 36  ? -10.546 -11.674 111.304 1.00 35.49  ? 589 GLN G C   1 
ATOM   5694 O O   . GLN G 1 36  ? -11.298 -11.522 110.323 1.00 31.61  ? 589 GLN G O   1 
ATOM   5695 C CB  . GLN G 1 36  ? -8.731  -9.971  111.698 1.00 31.36  ? 589 GLN G CB  1 
ATOM   5696 C CG  . GLN G 1 36  ? -7.235  -9.608  111.689 1.00 46.75  ? 589 GLN G CG  1 
ATOM   5697 C CD  . GLN G 1 36  ? -6.427  -10.397 112.723 1.00 47.83  ? 589 GLN G CD  1 
ATOM   5698 O OE1 . GLN G 1 36  ? -6.981  -10.867 113.708 1.00 50.44  ? 589 GLN G OE1 1 
ATOM   5699 N NE2 . GLN G 1 36  ? -5.113  -10.531 112.503 1.00 54.22  ? 589 GLN G NE2 1 
ATOM   5700 N N   . PRO G 1 37  ? -10.996 -12.068 112.513 1.00 33.91  ? 590 PRO G N   1 
ATOM   5701 C CA  . PRO G 1 37  ? -12.426 -12.281 112.738 1.00 36.98  ? 590 PRO G CA  1 
ATOM   5702 C C   . PRO G 1 37  ? -13.205 -11.101 112.281 1.00 33.07  ? 590 PRO G C   1 
ATOM   5703 O O   . PRO G 1 37  ? -12.708 -9.989  112.348 1.00 37.25  ? 590 PRO G O   1 
ATOM   5704 C CB  . PRO G 1 37  ? -12.544 -12.392 114.250 1.00 42.00  ? 590 PRO G CB  1 
ATOM   5705 C CG  . PRO G 1 37  ? -11.200 -12.837 114.708 1.00 45.89  ? 590 PRO G CG  1 
ATOM   5706 C CD  . PRO G 1 37  ? -10.201 -12.331 113.719 1.00 31.14  ? 590 PRO G CD  1 
ATOM   5707 N N   . VAL G 1 38  ? -14.400 -11.345 111.759 1.00 37.91  ? 591 VAL G N   1 
ATOM   5708 C CA  . VAL G 1 38  ? -15.323 -10.265 111.492 1.00 40.81  ? 591 VAL G CA  1 
ATOM   5709 C C   . VAL G 1 38  ? -15.633 -9.582  112.823 1.00 42.64  ? 591 VAL G C   1 
ATOM   5710 O O   . VAL G 1 38  ? -15.866 -10.253 113.844 1.00 38.39  ? 591 VAL G O   1 
ATOM   5711 C CB  . VAL G 1 38  ? -16.619 -10.764 110.816 1.00 41.66  ? 591 VAL G CB  1 
ATOM   5712 C CG1 . VAL G 1 38  ? -17.295 -11.793 111.697 1.00 71.19  ? 591 VAL G CG1 1 
ATOM   5713 C CG2 . VAL G 1 38  ? -17.584 -9.591  110.512 1.00 39.82  ? 591 VAL G CG2 1 
ATOM   5714 N N   . SER G 1 39  ? -15.588 -8.248  112.788 1.00 44.76  ? 592 SER G N   1 
ATOM   5715 C CA  . SER G 1 39  ? -15.753 -7.390  113.953 1.00 50.75  ? 592 SER G CA  1 
ATOM   5716 C C   . SER G 1 39  ? -17.230 -7.282  114.281 1.00 55.61  ? 592 SER G C   1 
ATOM   5717 O O   . SER G 1 39  ? -18.008 -6.741  113.484 1.00 51.43  ? 592 SER G O   1 
ATOM   5718 C CB  . SER G 1 39  ? -15.176 -5.985  113.668 1.00 53.36  ? 592 SER G CB  1 
ATOM   5719 O OG  . SER G 1 39  ? -15.784 -4.978  114.473 1.00 57.75  ? 592 SER G OG  1 
ATOM   5720 N N   . LEU G 1 40  ? -17.612 -7.770  115.458 1.00 62.42  ? 593 LEU G N   1 
ATOM   5721 C CA  . LEU G 1 40  ? -19.014 -7.682  115.909 1.00 66.44  ? 593 LEU G CA  1 
ATOM   5722 C C   . LEU G 1 40  ? -19.385 -6.227  116.184 1.00 67.61  ? 593 LEU G C   1 
ATOM   5723 O O   . LEU G 1 40  ? -20.556 -5.866  116.125 1.00 71.15  ? 593 LEU G O   1 
ATOM   5724 C CB  . LEU G 1 40  ? -19.269 -8.549  117.154 1.00 62.53  ? 593 LEU G CB  1 
ATOM   5725 C CG  . LEU G 1 40  ? -18.627 -9.941  117.174 1.00 69.06  ? 593 LEU G CG  1 
ATOM   5726 C CD1 . LEU G 1 40  ? -19.235 -10.789 118.272 1.00 73.20  ? 593 LEU G CD1 1 
ATOM   5727 C CD2 . LEU G 1 40  ? -18.738 -10.653 115.814 1.00 67.72  ? 593 LEU G CD2 1 
ATOM   5728 N N   . LYS G 1 41  ? -18.381 -5.399  116.471 1.00 70.55  ? 594 LYS G N   1 
ATOM   5729 C CA  . LYS G 1 41  ? -18.559 -3.949  116.598 1.00 72.31  ? 594 LYS G CA  1 
ATOM   5730 C C   . LYS G 1 41  ? -18.992 -3.261  115.284 1.00 70.84  ? 594 LYS G C   1 
ATOM   5731 O O   . LYS G 1 41  ? -19.745 -2.303  115.326 1.00 72.67  ? 594 LYS G O   1 
ATOM   5732 C CB  . LYS G 1 41  ? -17.271 -3.288  117.130 1.00 72.90  ? 594 LYS G CB  1 
ATOM   5733 N N   . GLU G 1 42  ? -18.522 -3.737  114.130 1.00 63.84  ? 595 GLU G N   1 
ATOM   5734 C CA  . GLU G 1 42  ? -18.868 -3.116  112.832 1.00 60.84  ? 595 GLU G CA  1 
ATOM   5735 C C   . GLU G 1 42  ? -20.052 -3.806  112.126 1.00 56.78  ? 595 GLU G C   1 
ATOM   5736 O O   . GLU G 1 42  ? -20.804 -3.172  111.376 1.00 56.80  ? 595 GLU G O   1 
ATOM   5737 C CB  . GLU G 1 42  ? -17.640 -3.106  111.897 1.00 62.38  ? 595 GLU G CB  1 
ATOM   5738 N N   . VAL G 1 43  ? -20.181 -5.107  112.371 1.00 50.02  ? 596 VAL G N   1 
ATOM   5739 C CA  . VAL G 1 43  ? -21.189 -5.983  111.779 1.00 47.46  ? 596 VAL G CA  1 
ATOM   5740 C C   . VAL G 1 43  ? -21.912 -6.676  112.961 1.00 51.47  ? 596 VAL G C   1 
ATOM   5741 O O   . VAL G 1 43  ? -21.588 -7.811  113.332 1.00 50.80  ? 596 VAL G O   1 
ATOM   5742 C CB  . VAL G 1 43  ? -20.506 -7.009  110.810 1.00 46.71  ? 596 VAL G CB  1 
ATOM   5743 C CG1 . VAL G 1 43  ? -21.506 -7.943  110.178 1.00 49.44  ? 596 VAL G CG1 1 
ATOM   5744 C CG2 . VAL G 1 43  ? -19.708 -6.265  109.715 1.00 33.76  ? 596 VAL G CG2 1 
ATOM   5745 N N   . PRO G 1 44  ? -22.880 -5.965  113.579 1.00 55.87  ? 597 PRO G N   1 
ATOM   5746 C CA  . PRO G 1 44  ? -23.444 -6.387  114.859 1.00 55.52  ? 597 PRO G CA  1 
ATOM   5747 C C   . PRO G 1 44  ? -24.281 -7.650  114.813 1.00 52.91  ? 597 PRO G C   1 
ATOM   5748 O O   . PRO G 1 44  ? -24.373 -8.356  115.825 1.00 47.90  ? 597 PRO G O   1 
ATOM   5749 C CB  . PRO G 1 44  ? -24.324 -5.193  115.268 1.00 58.83  ? 597 PRO G CB  1 
ATOM   5750 C CG  . PRO G 1 44  ? -23.895 -4.061  114.428 1.00 55.50  ? 597 PRO G CG  1 
ATOM   5751 C CD  . PRO G 1 44  ? -23.424 -4.659  113.159 1.00 58.18  ? 597 PRO G CD  1 
ATOM   5752 N N   . ASP G 1 45  ? -24.902 -7.911  113.668 1.00 51.88  ? 598 ASP G N   1 
ATOM   5753 C CA  . ASP G 1 45  ? -25.794 -9.061  113.516 1.00 51.75  ? 598 ASP G CA  1 
ATOM   5754 C C   . ASP G 1 45  ? -25.047 -10.336 113.121 1.00 54.51  ? 598 ASP G C   1 
ATOM   5755 O O   . ASP G 1 45  ? -25.672 -11.380 112.933 1.00 57.29  ? 598 ASP G O   1 
ATOM   5756 C CB  . ASP G 1 45  ? -26.881 -8.767  112.468 1.00 56.40  ? 598 ASP G CB  1 
ATOM   5757 C CG  . ASP G 1 45  ? -26.311 -8.476  111.073 1.00 52.69  ? 598 ASP G CG  1 
ATOM   5758 O OD1 . ASP G 1 45  ? -25.078 -8.386  110.917 1.00 68.78  ? 598 ASP G OD1 1 
ATOM   5759 O OD2 . ASP G 1 45  ? -27.107 -8.308  110.135 1.00 55.25  ? 598 ASP G OD2 1 
ATOM   5760 N N   . TYR G 1 46  ? -23.719 -10.263 113.021 1.00 49.96  ? 599 TYR G N   1 
ATOM   5761 C CA  . TYR G 1 46  ? -22.956 -11.345 112.422 1.00 48.59  ? 599 TYR G CA  1 
ATOM   5762 C C   . TYR G 1 46  ? -23.219 -12.660 113.088 1.00 47.42  ? 599 TYR G C   1 
ATOM   5763 O O   . TYR G 1 46  ? -23.459 -13.650 112.396 1.00 49.78  ? 599 TYR G O   1 
ATOM   5764 C CB  . TYR G 1 46  ? -21.444 -11.065 112.399 1.00 50.40  ? 599 TYR G CB  1 
ATOM   5765 C CG  . TYR G 1 46  ? -20.686 -12.023 111.491 1.00 41.71  ? 599 TYR G CG  1 
ATOM   5766 C CD1 . TYR G 1 46  ? -19.875 -13.023 112.021 1.00 35.25  ? 599 TYR G CD1 1 
ATOM   5767 C CD2 . TYR G 1 46  ? -20.801 -11.937 110.106 1.00 37.81  ? 599 TYR G CD2 1 
ATOM   5768 C CE1 . TYR G 1 46  ? -19.182 -13.910 111.198 1.00 45.96  ? 599 TYR G CE1 1 
ATOM   5769 C CE2 . TYR G 1 46  ? -20.110 -12.828 109.261 1.00 34.75  ? 599 TYR G CE2 1 
ATOM   5770 C CZ  . TYR G 1 46  ? -19.293 -13.809 109.825 1.00 51.03  ? 599 TYR G CZ  1 
ATOM   5771 O OH  . TYR G 1 46  ? -18.599 -14.699 109.029 1.00 35.30  ? 599 TYR G OH  1 
ATOM   5772 N N   . LEU G 1 47  ? -23.203 -12.685 114.416 1.00 51.07  ? 600 LEU G N   1 
ATOM   5773 C CA  . LEU G 1 47  ? -23.324 -13.958 115.132 1.00 53.59  ? 600 LEU G CA  1 
ATOM   5774 C C   . LEU G 1 47  ? -24.763 -14.479 115.191 1.00 53.26  ? 600 LEU G C   1 
ATOM   5775 O O   . LEU G 1 47  ? -24.991 -15.616 115.611 1.00 54.96  ? 600 LEU G O   1 
ATOM   5776 C CB  . LEU G 1 47  ? -22.705 -13.876 116.530 1.00 55.01  ? 600 LEU G CB  1 
ATOM   5777 C CG  . LEU G 1 47  ? -21.176 -13.788 116.621 1.00 64.88  ? 600 LEU G CG  1 
ATOM   5778 C CD1 . LEU G 1 47  ? -20.747 -14.047 118.069 1.00 65.10  ? 600 LEU G CD1 1 
ATOM   5779 C CD2 . LEU G 1 47  ? -20.465 -14.763 115.693 1.00 39.06  ? 600 LEU G CD2 1 
ATOM   5780 N N   . ASP G 1 48  ? -25.723 -13.671 114.747 1.00 53.47  ? 601 ASP G N   1 
ATOM   5781 C CA  . ASP G 1 48  ? -27.084 -14.179 114.519 1.00 57.93  ? 601 ASP G CA  1 
ATOM   5782 C C   . ASP G 1 48  ? -27.112 -15.145 113.331 1.00 60.18  ? 601 ASP G C   1 
ATOM   5783 O O   . ASP G 1 48  ? -27.714 -16.215 113.407 1.00 64.71  ? 601 ASP G O   1 
ATOM   5784 C CB  . ASP G 1 48  ? -28.083 -13.039 114.278 1.00 59.08  ? 601 ASP G CB  1 
ATOM   5785 C CG  . ASP G 1 48  ? -28.142 -12.048 115.433 1.00 63.62  ? 601 ASP G CG  1 
ATOM   5786 O OD1 . ASP G 1 48  ? -27.865 -12.450 116.583 1.00 70.82  ? 601 ASP G OD1 1 
ATOM   5787 O OD2 . ASP G 1 48  ? -28.464 -10.864 115.186 1.00 52.65  ? 601 ASP G OD2 1 
ATOM   5788 N N   . HIS G 1 49  ? -26.444 -14.772 112.242 1.00 58.83  ? 602 HIS G N   1 
ATOM   5789 C CA  . HIS G 1 49  ? -26.456 -15.568 111.004 1.00 54.82  ? 602 HIS G CA  1 
ATOM   5790 C C   . HIS G 1 49  ? -25.354 -16.635 110.947 1.00 48.92  ? 602 HIS G C   1 
ATOM   5791 O O   . HIS G 1 49  ? -25.489 -17.611 110.213 1.00 53.54  ? 602 HIS G O   1 
ATOM   5792 C CB  . HIS G 1 49  ? -26.308 -14.654 109.775 1.00 49.31  ? 602 HIS G CB  1 
ATOM   5793 C CG  . HIS G 1 49  ? -27.451 -13.703 109.573 1.00 55.88  ? 602 HIS G CG  1 
ATOM   5794 N ND1 . HIS G 1 49  ? -27.752 -12.692 110.459 1.00 48.68  ? 602 HIS G ND1 1 
ATOM   5795 C CD2 . HIS G 1 49  ? -28.345 -13.593 108.565 1.00 59.24  ? 602 HIS G CD2 1 
ATOM   5796 C CE1 . HIS G 1 49  ? -28.796 -12.014 110.019 1.00 63.12  ? 602 HIS G CE1 1 
ATOM   5797 N NE2 . HIS G 1 49  ? -29.177 -12.542 108.871 1.00 69.44  ? 602 HIS G NE2 1 
ATOM   5798 N N   . ILE G 1 50  ? -24.263 -16.453 111.691 1.00 43.20  ? 603 ILE G N   1 
ATOM   5799 C CA  . ILE G 1 50  ? -23.077 -17.305 111.520 1.00 45.10  ? 603 ILE G CA  1 
ATOM   5800 C C   . ILE G 1 50  ? -22.724 -17.990 112.831 1.00 45.67  ? 603 ILE G C   1 
ATOM   5801 O O   . ILE G 1 50  ? -22.325 -17.346 113.797 1.00 48.76  ? 603 ILE G O   1 
ATOM   5802 C CB  . ILE G 1 50  ? -21.864 -16.494 110.968 1.00 43.04  ? 603 ILE G CB  1 
ATOM   5803 C CG1 . ILE G 1 50  ? -22.207 -15.899 109.610 1.00 47.09  ? 603 ILE G CG1 1 
ATOM   5804 C CG2 . ILE G 1 50  ? -20.625 -17.364 110.849 1.00 43.21  ? 603 ILE G CG2 1 
ATOM   5805 C CD1 . ILE G 1 50  ? -22.788 -16.906 108.627 1.00 57.00  ? 603 ILE G CD1 1 
ATOM   5806 N N   . LYS G 1 51  ? -22.884 -19.305 112.848 1.00 48.67  ? 604 LYS G N   1 
ATOM   5807 C CA  . LYS G 1 51  ? -22.755 -20.090 114.067 1.00 49.18  ? 604 LYS G CA  1 
ATOM   5808 C C   . LYS G 1 51  ? -21.281 -20.256 114.409 1.00 43.93  ? 604 LYS G C   1 
ATOM   5809 O O   . LYS G 1 51  ? -20.887 -20.119 115.575 1.00 47.83  ? 604 LYS G O   1 
ATOM   5810 C CB  . LYS G 1 51  ? -23.426 -21.458 113.890 1.00 48.66  ? 604 LYS G CB  1 
ATOM   5811 N N   . HIS G 1 52  ? -20.460 -20.514 113.391 1.00 39.98  ? 605 HIS G N   1 
ATOM   5812 C CA  . HIS G 1 52  ? -19.038 -20.765 113.624 1.00 41.80  ? 605 HIS G CA  1 
ATOM   5813 C C   . HIS G 1 52  ? -18.140 -19.832 112.819 1.00 30.23  ? 605 HIS G C   1 
ATOM   5814 O O   . HIS G 1 52  ? -17.601 -20.200 111.765 1.00 36.45  ? 605 HIS G O   1 
ATOM   5815 C CB  . HIS G 1 52  ? -18.714 -22.249 113.418 1.00 41.37  ? 605 HIS G CB  1 
ATOM   5816 C CG  . HIS G 1 52  ? -19.348 -23.134 114.446 1.00 68.90  ? 605 HIS G CG  1 
ATOM   5817 N ND1 . HIS G 1 52  ? -20.146 -24.210 114.120 1.00 82.82  ? 605 HIS G ND1 1 
ATOM   5818 C CD2 . HIS G 1 52  ? -19.340 -23.070 115.800 1.00 82.21  ? 605 HIS G CD2 1 
ATOM   5819 C CE1 . HIS G 1 52  ? -20.579 -24.787 115.227 1.00 66.48  ? 605 HIS G CE1 1 
ATOM   5820 N NE2 . HIS G 1 52  ? -20.107 -24.114 116.260 1.00 76.81  ? 605 HIS G NE2 1 
ATOM   5821 N N   . PRO G 1 53  ? -17.962 -18.610 113.324 1.00 31.78  ? 606 PRO G N   1 
ATOM   5822 C CA  . PRO G 1 53  ? -16.955 -17.731 112.727 1.00 36.38  ? 606 PRO G CA  1 
ATOM   5823 C C   . PRO G 1 53  ? -15.588 -18.395 112.610 1.00 36.30  ? 606 PRO G C   1 
ATOM   5824 O O   . PRO G 1 53  ? -15.252 -19.293 113.383 1.00 37.23  ? 606 PRO G O   1 
ATOM   5825 C CB  . PRO G 1 53  ? -16.900 -16.526 113.688 1.00 32.82  ? 606 PRO G CB  1 
ATOM   5826 C CG  . PRO G 1 53  ? -17.727 -16.882 114.849 1.00 41.59  ? 606 PRO G CG  1 
ATOM   5827 C CD  . PRO G 1 53  ? -18.672 -17.952 114.435 1.00 31.15  ? 606 PRO G CD  1 
ATOM   5828 N N   . MET G 1 54  ? -14.833 -17.983 111.595 1.00 40.20  ? 607 MET G N   1 
ATOM   5829 C CA  . MET G 1 54  ? -13.473 -18.494 111.365 1.00 28.39  ? 607 MET G CA  1 
ATOM   5830 C C   . MET G 1 54  ? -12.834 -17.439 110.533 1.00 30.19  ? 607 MET G C   1 
ATOM   5831 O O   . MET G 1 54  ? -13.555 -16.703 109.838 1.00 26.07  ? 607 MET G O   1 
ATOM   5832 C CB  . MET G 1 54  ? -13.488 -19.819 110.583 1.00 24.28  ? 607 MET G CB  1 
ATOM   5833 C CG  . MET G 1 54  ? -12.174 -20.484 110.377 1.00 33.46  ? 607 MET G CG  1 
ATOM   5834 S SD  . MET G 1 54  ? -11.318 -20.642 111.932 1.00 31.94  ? 607 MET G SD  1 
ATOM   5835 C CE  . MET G 1 54  ? -12.716 -21.345 112.888 1.00 27.69  ? 607 MET G CE  1 
ATOM   5836 N N   . ASP G 1 55  ? -11.500 -17.363 110.612 1.00 18.21  ? 608 ASP G N   1 
ATOM   5837 C CA  . ASP G 1 55  ? -10.709 -16.472 109.801 1.00 20.99  ? 608 ASP G CA  1 
ATOM   5838 C C   . ASP G 1 55  ? -9.276  -16.991 109.836 1.00 22.01  ? 608 ASP G C   1 
ATOM   5839 O O   . ASP G 1 55  ? -8.986  -17.922 110.567 1.00 24.76  ? 608 ASP G O   1 
ATOM   5840 C CB  . ASP G 1 55  ? -10.694 -15.097 110.447 1.00 30.32  ? 608 ASP G CB  1 
ATOM   5841 C CG  . ASP G 1 55  ? -10.149 -15.151 111.856 1.00 32.76  ? 608 ASP G CG  1 
ATOM   5842 O OD1 . ASP G 1 55  ? -10.955 -15.447 112.794 1.00 38.24  ? 608 ASP G OD1 1 
ATOM   5843 O OD2 . ASP G 1 55  ? -8.925  -14.913 112.020 1.00 30.38  ? 608 ASP G OD2 1 
ATOM   5844 N N   . PHE G 1 56  ? -8.372  -16.373 109.080 1.00 25.74  ? 609 PHE G N   1 
ATOM   5845 C CA  . PHE G 1 56  ? -7.027  -16.904 108.958 1.00 20.08  ? 609 PHE G CA  1 
ATOM   5846 C C   . PHE G 1 56  ? -6.237  -16.809 110.264 1.00 27.07  ? 609 PHE G C   1 
ATOM   5847 O O   . PHE G 1 56  ? -5.408  -17.675 110.536 1.00 27.85  ? 609 PHE G O   1 
ATOM   5848 C CB  . PHE G 1 56  ? -6.220  -16.192 107.849 1.00 27.23  ? 609 PHE G CB  1 
ATOM   5849 C CG  . PHE G 1 56  ? -6.563  -16.628 106.425 1.00 18.05  ? 609 PHE G CG  1 
ATOM   5850 C CD1 . PHE G 1 56  ? -6.617  -17.972 106.074 1.00 31.10  ? 609 PHE G CD1 1 
ATOM   5851 C CD2 . PHE G 1 56  ? -6.804  -15.674 105.444 1.00 25.02  ? 609 PHE G CD2 1 
ATOM   5852 C CE1 . PHE G 1 56  ? -6.942  -18.351 104.762 1.00 32.05  ? 609 PHE G CE1 1 
ATOM   5853 C CE2 . PHE G 1 56  ? -7.106  -16.033 104.144 1.00 30.53  ? 609 PHE G CE2 1 
ATOM   5854 C CZ  . PHE G 1 56  ? -7.168  -17.369 103.794 1.00 22.28  ? 609 PHE G CZ  1 
ATOM   5855 N N   . ALA G 1 57  ? -6.411  -15.731 111.041 1.00 31.22  ? 610 ALA G N   1 
ATOM   5856 C CA  . ALA G 1 57  ? -5.623  -15.593 112.275 1.00 25.60  ? 610 ALA G CA  1 
ATOM   5857 C C   . ALA G 1 57  ? -6.114  -16.619 113.311 1.00 29.22  ? 610 ALA G C   1 
ATOM   5858 O O   . ALA G 1 57  ? -5.318  -17.238 114.029 1.00 19.66  ? 610 ALA G O   1 
ATOM   5859 C CB  . ALA G 1 57  ? -5.643  -14.153 112.821 1.00 22.02  ? 610 ALA G CB  1 
ATOM   5860 N N   . THR G 1 58  ? -7.416  -16.860 113.361 1.00 24.74  ? 611 THR G N   1 
ATOM   5861 C CA  . THR G 1 58  ? -7.904  -18.028 114.131 1.00 33.30  ? 611 THR G CA  1 
ATOM   5862 C C   . THR G 1 58  ? -7.351  -19.398 113.677 1.00 27.49  ? 611 THR G C   1 
ATOM   5863 O O   . THR G 1 58  ? -6.981  -20.234 114.496 1.00 27.90  ? 611 THR G O   1 
ATOM   5864 C CB  . THR G 1 58  ? -9.395  -18.048 114.144 1.00 26.51  ? 611 THR G CB  1 
ATOM   5865 O OG1 . THR G 1 58  ? -9.826  -16.771 114.607 1.00 33.65  ? 611 THR G OG1 1 
ATOM   5866 C CG2 . THR G 1 58  ? -9.934  -19.141 115.096 1.00 31.11  ? 611 THR G CG2 1 
ATOM   5867 N N   . MET G 1 59  ? -7.240  -19.624 112.389 1.00 28.47  ? 612 MET G N   1 
ATOM   5868 C CA  . MET G 1 59  ? -6.628  -20.891 111.946 1.00 30.36  ? 612 MET G CA  1 
ATOM   5869 C C   . MET G 1 59  ? -5.196  -20.972 112.427 1.00 26.98  ? 612 MET G C   1 
ATOM   5870 O O   . MET G 1 59  ? -4.720  -22.042 112.880 1.00 23.68  ? 612 MET G O   1 
ATOM   5871 C CB  . MET G 1 59  ? -6.672  -21.027 110.421 1.00 35.70  ? 612 MET G CB  1 
ATOM   5872 C CG  . MET G 1 59  ? -8.092  -21.087 109.857 1.00 19.14  ? 612 MET G CG  1 
ATOM   5873 S SD  . MET G 1 59  ? -8.209  -21.572 108.117 1.00 29.09  ? 612 MET G SD  1 
ATOM   5874 C CE  . MET G 1 59  ? -7.183  -23.041 108.121 1.00 31.13  ? 612 MET G CE  1 
ATOM   5875 N N   . ARG G 1 60  ? -4.514  -19.827 112.324 1.00 22.24  ? 613 ARG G N   1 
ATOM   5876 C CA  . ARG G 1 60  ? -3.128  -19.696 112.766 1.00 29.12  ? 613 ARG G CA  1 
ATOM   5877 C C   . ARG G 1 60  ? -2.963  -20.067 114.235 1.00 32.32  ? 613 ARG G C   1 
ATOM   5878 O O   . ARG G 1 60  ? -2.070  -20.835 114.570 1.00 29.02  ? 613 ARG G O   1 
ATOM   5879 C CB  . ARG G 1 60  ? -2.635  -18.270 112.522 1.00 33.45  ? 613 ARG G CB  1 
ATOM   5880 C CG  . ARG G 1 60  ? -1.108  -18.099 112.549 1.00 32.42  ? 613 ARG G CG  1 
ATOM   5881 C CD  . ARG G 1 60  ? -0.605  -17.086 111.489 1.00 32.61  ? 613 ARG G CD  1 
ATOM   5882 N NE  . ARG G 1 60  ? 0.450   -17.761 110.750 1.00 47.19  ? 613 ARG G NE  1 
ATOM   5883 C CZ  . ARG G 1 60  ? 0.542   -17.900 109.435 1.00 46.52  ? 613 ARG G CZ  1 
ATOM   5884 N NH1 . ARG G 1 60  ? 1.575   -18.589 108.963 1.00 67.32  ? 613 ARG G NH1 1 
ATOM   5885 N NH2 . ARG G 1 60  ? -0.323  -17.337 108.586 1.00 42.08  ? 613 ARG G NH2 1 
ATOM   5886 N N   . LYS G 1 61  ? -3.839  -19.560 115.102 1.00 31.81  ? 614 LYS G N   1 
ATOM   5887 C CA  . LYS G 1 61  ? -3.799  -19.956 116.530 1.00 36.73  ? 614 LYS G CA  1 
ATOM   5888 C C   . LYS G 1 61  ? -4.002  -21.477 116.687 1.00 37.11  ? 614 LYS G C   1 
ATOM   5889 O O   . LYS G 1 61  ? -3.237  -22.165 117.389 1.00 29.26  ? 614 LYS G O   1 
ATOM   5890 C CB  . LYS G 1 61  ? -4.841  -19.233 117.405 1.00 35.57  ? 614 LYS G CB  1 
ATOM   5891 C CG  . LYS G 1 61  ? -5.192  -17.770 117.056 1.00 44.86  ? 614 LYS G CG  1 
ATOM   5892 C CD  . LYS G 1 61  ? -4.571  -16.705 117.935 1.00 61.60  ? 614 LYS G CD  1 
ATOM   5893 C CE  . LYS G 1 61  ? -5.429  -15.428 117.891 1.00 72.58  ? 614 LYS G CE  1 
ATOM   5894 N NZ  . LYS G 1 61  ? -6.872  -15.686 118.272 1.00 56.14  ? 614 LYS G NZ  1 
ATOM   5895 N N   . ARG G 1 62  ? -5.024  -22.014 116.035 1.00 31.09  ? 615 ARG G N   1 
ATOM   5896 C CA  . ARG G 1 62  ? -5.252  -23.445 116.147 1.00 32.50  ? 615 ARG G CA  1 
ATOM   5897 C C   . ARG G 1 62  ? -4.063  -24.243 115.629 1.00 38.29  ? 615 ARG G C   1 
ATOM   5898 O O   . ARG G 1 62  ? -3.740  -25.297 116.176 1.00 35.99  ? 615 ARG G O   1 
ATOM   5899 C CB  . ARG G 1 62  ? -6.499  -23.879 115.399 1.00 35.84  ? 615 ARG G CB  1 
ATOM   5900 C CG  . ARG G 1 62  ? -6.705  -25.408 115.452 1.00 27.69  ? 615 ARG G CG  1 
ATOM   5901 C CD  . ARG G 1 62  ? -8.155  -25.783 115.119 1.00 20.36  ? 615 ARG G CD  1 
ATOM   5902 N NE  . ARG G 1 62  ? -8.358  -27.218 114.876 1.00 23.03  ? 615 ARG G NE  1 
ATOM   5903 C CZ  . ARG G 1 62  ? -9.481  -27.762 114.411 1.00 34.01  ? 615 ARG G CZ  1 
ATOM   5904 N NH1 . ARG G 1 62  ? -10.529 -27.009 114.082 1.00 39.47  ? 615 ARG G NH1 1 
ATOM   5905 N NH2 . ARG G 1 62  ? -9.557  -29.078 114.257 1.00 36.40  ? 615 ARG G NH2 1 
ATOM   5906 N N   . LEU G 1 63  ? -3.424  -23.741 114.574 1.00 35.06  ? 616 LEU G N   1 
ATOM   5907 C CA  . LEU G 1 63  ? -2.271  -24.409 114.004 1.00 32.74  ? 616 LEU G CA  1 
ATOM   5908 C C   . LEU G 1 63  ? -1.126  -24.393 114.995 1.00 38.37  ? 616 LEU G C   1 
ATOM   5909 O O   . LEU G 1 63  ? -0.544  -25.445 115.284 1.00 29.87  ? 616 LEU G O   1 
ATOM   5910 C CB  . LEU G 1 63  ? -1.813  -23.718 112.724 1.00 34.81  ? 616 LEU G CB  1 
ATOM   5911 C CG  . LEU G 1 63  ? -0.526  -24.298 112.096 1.00 33.89  ? 616 LEU G CG  1 
ATOM   5912 C CD1 . LEU G 1 63  ? -0.687  -25.764 111.866 1.00 26.23  ? 616 LEU G CD1 1 
ATOM   5913 C CD2 . LEU G 1 63  ? -0.179  -23.618 110.794 1.00 32.85  ? 616 LEU G CD2 1 
ATOM   5914 N N   . GLU G 1 64  ? -0.810  -23.195 115.500 1.00 38.01  ? 617 GLU G N   1 
ATOM   5915 C CA  . GLU G 1 64  ? 0.245   -23.027 116.495 1.00 43.14  ? 617 GLU G CA  1 
ATOM   5916 C C   . GLU G 1 64  ? 0.018   -23.873 117.771 1.00 45.39  ? 617 GLU G C   1 
ATOM   5917 O O   . GLU G 1 64  ? 0.989   -24.296 118.404 1.00 35.38  ? 617 GLU G O   1 
ATOM   5918 C CB  . GLU G 1 64  ? 0.407   -21.538 116.834 1.00 48.76  ? 617 GLU G CB  1 
ATOM   5919 C CG  . GLU G 1 64  ? 1.200   -20.753 115.768 1.00 56.15  ? 617 GLU G CG  1 
ATOM   5920 C CD  . GLU G 1 64  ? 2.623   -21.301 115.573 1.00 79.36  ? 617 GLU G CD  1 
ATOM   5921 O OE1 . GLU G 1 64  ? 2.889   -21.972 114.531 1.00 52.10  ? 617 GLU G OE1 1 
ATOM   5922 O OE2 . GLU G 1 64  ? 3.466   -21.074 116.479 1.00 92.35  ? 617 GLU G OE2 1 
ATOM   5923 N N   . ALA G 1 65  ? -1.256  -24.135 118.112 1.00 41.84  ? 618 ALA G N   1 
ATOM   5924 C CA  . ALA G 1 65  ? -1.628  -25.034 119.220 1.00 42.61  ? 618 ALA G CA  1 
ATOM   5925 C C   . ALA G 1 65  ? -1.595  -26.540 118.887 1.00 41.95  ? 618 ALA G C   1 
ATOM   5926 O O   . ALA G 1 65  ? -2.192  -27.339 119.623 1.00 33.70  ? 618 ALA G O   1 
ATOM   5927 C CB  . ALA G 1 65  ? -3.032  -24.670 119.737 1.00 34.32  ? 618 ALA G CB  1 
ATOM   5928 N N   . GLN G 1 66  ? -0.954  -26.917 117.776 1.00 37.55  ? 619 GLN G N   1 
ATOM   5929 C CA  . GLN G 1 66  ? -0.942  -28.301 117.299 1.00 40.95  ? 619 GLN G CA  1 
ATOM   5930 C C   . GLN G 1 66  ? -2.354  -28.952 117.242 1.00 40.60  ? 619 GLN G C   1 
ATOM   5931 O O   . GLN G 1 66  ? -2.518  -30.144 117.568 1.00 35.17  ? 619 GLN G O   1 
ATOM   5932 C CB  . GLN G 1 66  ? -0.017  -29.168 118.163 1.00 46.30  ? 619 GLN G CB  1 
ATOM   5933 C CG  . GLN G 1 66  ? 1.201   -28.478 118.812 1.00 43.67  ? 619 GLN G CG  1 
ATOM   5934 C CD  . GLN G 1 66  ? 2.096   -29.485 119.517 1.00 41.80  ? 619 GLN G CD  1 
ATOM   5935 O OE1 . GLN G 1 66  ? 2.043   -29.646 120.731 1.00 62.93  ? 619 GLN G OE1 1 
ATOM   5936 N NE2 . GLN G 1 66  ? 2.895   -30.196 118.743 1.00 55.18  ? 619 GLN G NE2 1 
ATOM   5937 N N   . GLY G 1 67  ? -3.345  -28.171 116.810 1.00 38.22  ? 620 GLY G N   1 
ATOM   5938 C CA  . GLY G 1 67  ? -4.775  -28.567 116.812 1.00 38.86  ? 620 GLY G CA  1 
ATOM   5939 C C   . GLY G 1 67  ? -5.427  -29.007 115.499 1.00 38.32  ? 620 GLY G C   1 
ATOM   5940 O O   . GLY G 1 67  ? -6.689  -29.128 115.411 1.00 34.64  ? 620 GLY G O   1 
ATOM   5941 N N   . TYR G 1 68  ? -4.596  -29.233 114.480 1.00 28.95  ? 621 TYR G N   1 
ATOM   5942 C CA  . TYR G 1 68  ? -5.026  -29.908 113.264 1.00 25.40  ? 621 TYR G CA  1 
ATOM   5943 C C   . TYR G 1 68  ? -4.383  -31.282 113.247 1.00 30.05  ? 621 TYR G C   1 
ATOM   5944 O O   . TYR G 1 68  ? -3.144  -31.389 113.164 1.00 32.62  ? 621 TYR G O   1 
ATOM   5945 C CB  . TYR G 1 68  ? -4.601  -29.115 112.041 1.00 31.56  ? 621 TYR G CB  1 
ATOM   5946 C CG  . TYR G 1 68  ? -5.319  -27.820 111.896 1.00 15.17  ? 621 TYR G CG  1 
ATOM   5947 C CD1 . TYR G 1 68  ? -6.677  -27.800 111.663 1.00 29.23  ? 621 TYR G CD1 1 
ATOM   5948 C CD2 . TYR G 1 68  ? -4.658  -26.616 112.030 1.00 33.16  ? 621 TYR G CD2 1 
ATOM   5949 C CE1 . TYR G 1 68  ? -7.358  -26.634 111.533 1.00 21.77  ? 621 TYR G CE1 1 
ATOM   5950 C CE2 . TYR G 1 68  ? -5.333  -25.430 111.913 1.00 15.49  ? 621 TYR G CE2 1 
ATOM   5951 C CZ  . TYR G 1 68  ? -6.695  -25.442 111.652 1.00 26.73  ? 621 TYR G CZ  1 
ATOM   5952 O OH  . TYR G 1 68  ? -7.415  -24.263 111.525 1.00 22.70  ? 621 TYR G OH  1 
ATOM   5953 N N   . LYS G 1 69  ? -5.220  -32.317 113.392 1.00 33.41  ? 622 LYS G N   1 
ATOM   5954 C CA  . LYS G 1 69  ? -4.811  -33.738 113.329 1.00 41.16  ? 622 LYS G CA  1 
ATOM   5955 C C   . LYS G 1 69  ? -4.440  -34.163 111.901 1.00 38.40  ? 622 LYS G C   1 
ATOM   5956 O O   . LYS G 1 69  ? -3.614  -35.049 111.711 1.00 41.41  ? 622 LYS G O   1 
ATOM   5957 C CB  . LYS G 1 69  ? -5.956  -34.651 113.809 1.00 43.33  ? 622 LYS G CB  1 
ATOM   5958 C CG  . LYS G 1 69  ? -5.777  -35.254 115.209 1.00 59.18  ? 622 LYS G CG  1 
ATOM   5959 C CD  . LYS G 1 69  ? -7.107  -35.811 115.758 1.00 51.79  ? 622 LYS G CD  1 
ATOM   5960 N N   . ASN G 1 70  ? -5.072  -33.534 110.908 1.00 36.27  ? 623 ASN G N   1 
ATOM   5961 C CA  . ASN G 1 70  ? -4.811  -33.815 109.490 1.00 35.05  ? 623 ASN G CA  1 
ATOM   5962 C C   . ASN G 1 70  ? -5.262  -32.660 108.548 1.00 34.52  ? 623 ASN G C   1 
ATOM   5963 O O   . ASN G 1 70  ? -5.791  -31.630 109.003 1.00 29.47  ? 623 ASN G O   1 
ATOM   5964 C CB  . ASN G 1 70  ? -5.522  -35.109 109.127 1.00 33.13  ? 623 ASN G CB  1 
ATOM   5965 C CG  . ASN G 1 70  ? -6.989  -35.100 109.537 1.00 33.94  ? 623 ASN G CG  1 
ATOM   5966 O OD1 . ASN G 1 70  ? -7.740  -34.193 109.185 1.00 37.12  ? 623 ASN G OD1 1 
ATOM   5967 N ND2 . ASN G 1 70  ? -7.398  -36.115 110.280 1.00 32.98  ? 623 ASN G ND2 1 
ATOM   5968 N N   . LEU G 1 71  ? -5.040  -32.829 107.247 1.00 28.56  ? 624 LEU G N   1 
ATOM   5969 C CA  . LEU G 1 71  ? -5.325  -31.778 106.270 1.00 28.76  ? 624 LEU G CA  1 
ATOM   5970 C C   . LEU G 1 71  ? -6.803  -31.583 106.241 1.00 33.46  ? 624 LEU G C   1 
ATOM   5971 O O   . LEU G 1 71  ? -7.274  -30.446 106.182 1.00 28.44  ? 624 LEU G O   1 
ATOM   5972 C CB  . LEU G 1 71  ? -4.809  -32.154 104.862 1.00 28.83  ? 624 LEU G CB  1 
ATOM   5973 C CG  . LEU G 1 71  ? -4.827  -31.110 103.737 1.00 35.69  ? 624 LEU G CG  1 
ATOM   5974 C CD1 . LEU G 1 71  ? -4.051  -29.836 104.147 1.00 26.30  ? 624 LEU G CD1 1 
ATOM   5975 C CD2 . LEU G 1 71  ? -4.251  -31.668 102.428 1.00 24.84  ? 624 LEU G CD2 1 
ATOM   5976 N N   . HIS G 1 72  ? -7.551  -32.689 106.325 1.00 30.75  ? 625 HIS G N   1 
ATOM   5977 C CA  . HIS G 1 72  ? -9.007  -32.568 106.290 1.00 35.53  ? 625 HIS G CA  1 
ATOM   5978 C C   . HIS G 1 72  ? -9.468  -31.536 107.330 1.00 26.76  ? 625 HIS G C   1 
ATOM   5979 O O   . HIS G 1 72  ? -10.275 -30.670 107.030 1.00 21.43  ? 625 HIS G O   1 
ATOM   5980 C CB  . HIS G 1 72  ? -9.734  -33.917 106.465 1.00 38.94  ? 625 HIS G CB  1 
ATOM   5981 C CG  . HIS G 1 72  ? -11.224 -33.817 106.294 1.00 33.88  ? 625 HIS G CG  1 
ATOM   5982 N ND1 . HIS G 1 72  ? -11.812 -33.414 105.113 1.00 56.01  ? 625 HIS G ND1 1 
ATOM   5983 C CD2 . HIS G 1 72  ? -12.238 -34.020 107.167 1.00 38.94  ? 625 HIS G CD2 1 
ATOM   5984 C CE1 . HIS G 1 72  ? -13.126 -33.402 105.255 1.00 65.98  ? 625 HIS G CE1 1 
ATOM   5985 N NE2 . HIS G 1 72  ? -13.412 -33.766 106.493 1.00 66.96  ? 625 HIS G NE2 1 
ATOM   5986 N N   . GLU G 1 73  ? -8.897  -31.570 108.523 1.00 27.87  ? 626 GLU G N   1 
ATOM   5987 C CA  . GLU G 1 73  ? -9.368  -30.646 109.586 1.00 32.03  ? 626 GLU G CA  1 
ATOM   5988 C C   . GLU G 1 73  ? -9.098  -29.172 109.250 1.00 31.04  ? 626 GLU G C   1 
ATOM   5989 O O   . GLU G 1 73  ? -9.951  -28.304 109.462 1.00 31.15  ? 626 GLU G O   1 
ATOM   5990 C CB  . GLU G 1 73  ? -8.795  -31.050 110.944 1.00 27.64  ? 626 GLU G CB  1 
ATOM   5991 C CG  . GLU G 1 73  ? -9.424  -32.347 111.516 1.00 42.99  ? 626 GLU G CG  1 
ATOM   5992 C CD  . GLU G 1 73  ? -9.036  -32.659 112.985 1.00 49.29  ? 626 GLU G CD  1 
ATOM   5993 O OE1 . GLU G 1 73  ? -9.677  -33.536 113.577 1.00 44.04  ? 626 GLU G OE1 1 
ATOM   5994 O OE2 . GLU G 1 73  ? -8.103  -32.049 113.549 1.00 42.24  ? 626 GLU G OE2 1 
ATOM   5995 N N   . PHE G 1 74  ? -7.923  -28.924 108.682 1.00 28.07  ? 627 PHE G N   1 
ATOM   5996 C CA  . PHE G 1 74  ? -7.511  -27.611 108.213 1.00 25.47  ? 627 PHE G CA  1 
ATOM   5997 C C   . PHE G 1 74  ? -8.466  -27.112 107.128 1.00 24.75  ? 627 PHE G C   1 
ATOM   5998 O O   . PHE G 1 74  ? -8.958  -25.976 107.202 1.00 24.85  ? 627 PHE G O   1 
ATOM   5999 C CB  . PHE G 1 74  ? -6.063  -27.749 107.719 1.00 29.07  ? 627 PHE G CB  1 
ATOM   6000 C CG  . PHE G 1 74  ? -5.400  -26.475 107.334 1.00 33.00  ? 627 PHE G CG  1 
ATOM   6001 C CD1 . PHE G 1 74  ? -4.543  -25.819 108.222 1.00 27.29  ? 627 PHE G CD1 1 
ATOM   6002 C CD2 . PHE G 1 74  ? -5.553  -25.969 106.044 1.00 32.21  ? 627 PHE G CD2 1 
ATOM   6003 C CE1 . PHE G 1 74  ? -3.893  -24.609 107.850 1.00 22.80  ? 627 PHE G CE1 1 
ATOM   6004 C CE2 . PHE G 1 74  ? -4.910  -24.780 105.653 1.00 31.30  ? 627 PHE G CE2 1 
ATOM   6005 C CZ  . PHE G 1 74  ? -4.070  -24.096 106.567 1.00 37.21  ? 627 PHE G CZ  1 
ATOM   6006 N N   . GLU G 1 75  ? -8.737  -27.960 106.133 1.00 29.99  ? 628 GLU G N   1 
ATOM   6007 C CA  . GLU G 1 75  ? -9.681  -27.635 105.043 1.00 31.59  ? 628 GLU G CA  1 
ATOM   6008 C C   . GLU G 1 75  ? -11.092 -27.282 105.489 1.00 32.86  ? 628 GLU G C   1 
ATOM   6009 O O   . GLU G 1 75  ? -11.735 -26.424 104.876 1.00 30.97  ? 628 GLU G O   1 
ATOM   6010 C CB  . GLU G 1 75  ? -9.843  -28.812 104.084 1.00 30.63  ? 628 GLU G CB  1 
ATOM   6011 C CG  . GLU G 1 75  ? -8.664  -29.155 103.219 1.00 41.76  ? 628 GLU G CG  1 
ATOM   6012 C CD  . GLU G 1 75  ? -8.934  -30.396 102.359 1.00 64.09  ? 628 GLU G CD  1 
ATOM   6013 O OE1 . GLU G 1 75  ? -10.110 -30.838 102.300 1.00 63.16  ? 628 GLU G OE1 1 
ATOM   6014 O OE2 . GLU G 1 75  ? -7.973  -30.934 101.761 1.00 65.82  ? 628 GLU G OE2 1 
ATOM   6015 N N   . GLU G 1 76  ? -11.629 -27.996 106.475 1.00 32.75  ? 629 GLU G N   1 
ATOM   6016 C CA  . GLU G 1 76  ? -12.927 -27.590 107.020 1.00 31.01  ? 629 GLU G CA  1 
ATOM   6017 C C   . GLU G 1 76  ? -12.854 -26.178 107.602 1.00 25.71  ? 629 GLU G C   1 
ATOM   6018 O O   . GLU G 1 76  ? -13.777 -25.418 107.417 1.00 34.40  ? 629 GLU G O   1 
ATOM   6019 C CB  . GLU G 1 76  ? -13.468 -28.541 108.074 1.00 31.62  ? 629 GLU G CB  1 
ATOM   6020 C CG  . GLU G 1 76  ? -14.007 -29.877 107.533 1.00 49.40  ? 629 GLU G CG  1 
ATOM   6021 C CD  . GLU G 1 76  ? -14.443 -30.801 108.672 1.00 72.30  ? 629 GLU G CD  1 
ATOM   6022 O OE1 . GLU G 1 76  ? -15.475 -30.503 109.329 1.00 77.48  ? 629 GLU G OE1 1 
ATOM   6023 O OE2 . GLU G 1 76  ? -13.741 -31.806 108.928 1.00 68.57  ? 629 GLU G OE2 1 
ATOM   6024 N N   . ASP G 1 77  ? -11.772 -25.820 108.278 1.00 24.77  ? 630 ASP G N   1 
ATOM   6025 C CA  . ASP G 1 77  ? -11.656 -24.440 108.777 1.00 31.60  ? 630 ASP G CA  1 
ATOM   6026 C C   . ASP G 1 77  ? -11.660 -23.464 107.590 1.00 35.80  ? 630 ASP G C   1 
ATOM   6027 O O   . ASP G 1 77  ? -12.454 -22.489 107.552 1.00 25.45  ? 630 ASP G O   1 
ATOM   6028 C CB  . ASP G 1 77  ? -10.436 -24.256 109.701 1.00 34.05  ? 630 ASP G CB  1 
ATOM   6029 C CG  . ASP G 1 77  ? -10.789 -24.460 111.186 1.00 34.76  ? 630 ASP G CG  1 
ATOM   6030 O OD1 . ASP G 1 77  ? -11.987 -24.603 111.446 1.00 31.68  ? 630 ASP G OD1 1 
ATOM   6031 O OD2 . ASP G 1 77  ? -9.902  -24.516 112.076 1.00 26.10  ? 630 ASP G OD2 1 
ATOM   6032 N N   . PHE G 1 78  ? -10.838 -23.770 106.590 1.00 26.92  ? 631 PHE G N   1 
ATOM   6033 C CA  . PHE G 1 78  ? -10.797 -22.939 105.413 1.00 28.60  ? 631 PHE G CA  1 
ATOM   6034 C C   . PHE G 1 78  ? -12.162 -22.800 104.756 1.00 18.94  ? 631 PHE G C   1 
ATOM   6035 O O   . PHE G 1 78  ? -12.584 -21.698 104.446 1.00 27.48  ? 631 PHE G O   1 
ATOM   6036 C CB  . PHE G 1 78  ? -9.791  -23.462 104.407 1.00 19.60  ? 631 PHE G CB  1 
ATOM   6037 C CG  . PHE G 1 78  ? -9.748  -22.675 103.123 1.00 19.31  ? 631 PHE G CG  1 
ATOM   6038 C CD1 . PHE G 1 78  ? -10.331 -23.160 101.974 1.00 26.92  ? 631 PHE G CD1 1 
ATOM   6039 C CD2 . PHE G 1 78  ? -9.109  -21.448 103.070 1.00 27.17  ? 631 PHE G CD2 1 
ATOM   6040 C CE1 . PHE G 1 78  ? -10.282 -22.438 100.789 1.00 30.90  ? 631 PHE G CE1 1 
ATOM   6041 C CE2 . PHE G 1 78  ? -9.052  -20.739 101.899 1.00 28.38  ? 631 PHE G CE2 1 
ATOM   6042 C CZ  . PHE G 1 78  ? -9.638  -21.236 100.754 1.00 29.55  ? 631 PHE G CZ  1 
ATOM   6043 N N   . ASP G 1 79  ? -12.846 -23.902 104.549 1.00 24.92  ? 632 ASP G N   1 
ATOM   6044 C CA  . ASP G 1 79  ? -14.222 -23.862 103.979 1.00 33.04  ? 632 ASP G CA  1 
ATOM   6045 C C   . ASP G 1 79  ? -15.219 -23.109 104.830 1.00 28.17  ? 632 ASP G C   1 
ATOM   6046 O O   . ASP G 1 79  ? -16.177 -22.536 104.306 1.00 37.15  ? 632 ASP G O   1 
ATOM   6047 C CB  . ASP G 1 79  ? -14.806 -25.264 103.769 1.00 30.90  ? 632 ASP G CB  1 
ATOM   6048 C CG  . ASP G 1 79  ? -14.037 -26.075 102.765 1.00 45.78  ? 632 ASP G CG  1 
ATOM   6049 O OD1 . ASP G 1 79  ? -13.185 -25.520 102.004 1.00 34.18  ? 632 ASP G OD1 1 
ATOM   6050 O OD2 . ASP G 1 79  ? -14.305 -27.294 102.765 1.00 40.65  ? 632 ASP G OD2 1 
ATOM   6051 N N   . LEU G 1 80  ? -15.036 -23.128 106.138 1.00 25.88  ? 633 LEU G N   1 
ATOM   6052 C CA  . LEU G 1 80  ? -15.828 -22.240 106.996 1.00 33.09  ? 633 LEU G CA  1 
ATOM   6053 C C   . LEU G 1 80  ? -15.667 -20.776 106.591 1.00 32.30  ? 633 LEU G C   1 
ATOM   6054 O O   . LEU G 1 80  ? -16.651 -20.012 106.504 1.00 25.77  ? 633 LEU G O   1 
ATOM   6055 C CB  . LEU G 1 80  ? -15.462 -22.396 108.474 1.00 33.19  ? 633 LEU G CB  1 
ATOM   6056 C CG  . LEU G 1 80  ? -16.405 -23.194 109.351 1.00 37.29  ? 633 LEU G CG  1 
ATOM   6057 C CD1 . LEU G 1 80  ? -15.809 -23.323 110.768 1.00 41.66  ? 633 LEU G CD1 1 
ATOM   6058 C CD2 . LEU G 1 80  ? -17.762 -22.484 109.368 1.00 38.27  ? 633 LEU G CD2 1 
ATOM   6059 N N   . ILE G 1 81  ? -14.428 -20.377 106.353 1.00 24.52  ? 634 ILE G N   1 
ATOM   6060 C CA  . ILE G 1 81  ? -14.177 -18.993 105.986 1.00 25.77  ? 634 ILE G CA  1 
ATOM   6061 C C   . ILE G 1 81  ? -15.071 -18.638 104.778 1.00 29.92  ? 634 ILE G C   1 
ATOM   6062 O O   . ILE G 1 81  ? -15.826 -17.663 104.813 1.00 31.27  ? 634 ILE G O   1 
ATOM   6063 C CB  . ILE G 1 81  ? -12.674 -18.741 105.715 1.00 32.03  ? 634 ILE G CB  1 
ATOM   6064 C CG1 . ILE G 1 81  ? -11.865 -18.815 107.022 1.00 17.91  ? 634 ILE G CG1 1 
ATOM   6065 C CG2 . ILE G 1 81  ? -12.441 -17.395 105.031 1.00 32.78  ? 634 ILE G CG2 1 
ATOM   6066 C CD1 . ILE G 1 81  ? -10.307 -18.747 106.778 1.00 29.60  ? 634 ILE G CD1 1 
ATOM   6067 N N   . ILE G 1 82  ? -15.001 -19.451 103.729 1.00 30.48  ? 635 ILE G N   1 
ATOM   6068 C CA  . ILE G 1 82  ? -15.713 -19.168 102.493 1.00 23.95  ? 635 ILE G CA  1 
ATOM   6069 C C   . ILE G 1 82  ? -17.221 -19.255 102.664 1.00 30.40  ? 635 ILE G C   1 
ATOM   6070 O O   . ILE G 1 82  ? -17.958 -18.416 102.157 1.00 36.15  ? 635 ILE G O   1 
ATOM   6071 C CB  . ILE G 1 82  ? -15.361 -20.176 101.400 1.00 28.18  ? 635 ILE G CB  1 
ATOM   6072 C CG1 . ILE G 1 82  ? -13.842 -20.236 101.198 1.00 26.34  ? 635 ILE G CG1 1 
ATOM   6073 C CG2 . ILE G 1 82  ? -16.111 -19.816 100.080 1.00 22.29  ? 635 ILE G CG2 1 
ATOM   6074 C CD1 . ILE G 1 82  ? -13.198 -18.868 100.957 1.00 25.05  ? 635 ILE G CD1 1 
ATOM   6075 N N   . ASP G 1 83  ? -17.676 -20.316 103.305 1.00 30.73  ? 636 ASP G N   1 
ATOM   6076 C CA  . ASP G 1 83  ? -19.103 -20.579 103.420 1.00 37.99  ? 636 ASP G CA  1 
ATOM   6077 C C   . ASP G 1 83  ? -19.774 -19.475 104.269 1.00 39.19  ? 636 ASP G C   1 
ATOM   6078 O O   . ASP G 1 83  ? -20.843 -18.951 103.905 1.00 36.65  ? 636 ASP G O   1 
ATOM   6079 C CB  . ASP G 1 83  ? -19.341 -22.002 103.979 1.00 41.75  ? 636 ASP G CB  1 
ATOM   6080 C CG  . ASP G 1 83  ? -18.905 -23.122 102.992 1.00 52.05  ? 636 ASP G CG  1 
ATOM   6081 O OD1 . ASP G 1 83  ? -18.806 -22.843 101.774 1.00 59.58  ? 636 ASP G OD1 1 
ATOM   6082 O OD2 . ASP G 1 83  ? -18.662 -24.279 103.425 1.00 39.55  ? 636 ASP G OD2 1 
ATOM   6083 N N   . ASN G 1 84  ? -19.107 -19.054 105.343 1.00 33.72  ? 637 ASN G N   1 
ATOM   6084 C CA  . ASN G 1 84  ? -19.645 -17.962 106.167 1.00 39.16  ? 637 ASN G CA  1 
ATOM   6085 C C   . ASN G 1 84  ? -19.841 -16.693 105.360 1.00 37.08  ? 637 ASN G C   1 
ATOM   6086 O O   . ASN G 1 84  ? -20.875 -16.013 105.447 1.00 35.06  ? 637 ASN G O   1 
ATOM   6087 C CB  . ASN G 1 84  ? -18.756 -17.680 107.387 1.00 32.55  ? 637 ASN G CB  1 
ATOM   6088 C CG  . ASN G 1 84  ? -18.813 -18.794 108.414 1.00 38.67  ? 637 ASN G CG  1 
ATOM   6089 O OD1 . ASN G 1 84  ? -19.703 -19.638 108.378 1.00 32.96  ? 637 ASN G OD1 1 
ATOM   6090 N ND2 . ASN G 1 84  ? -17.857 -18.814 109.317 1.00 28.41  ? 637 ASN G ND2 1 
ATOM   6091 N N   . CYS G 1 85  ? -18.833 -16.372 104.573 1.00 34.89  ? 638 CYS G N   1 
ATOM   6092 C CA  . CYS G 1 85  ? -18.865 -15.161 103.800 1.00 31.58  ? 638 CYS G CA  1 
ATOM   6093 C C   . CYS G 1 85  ? -19.952 -15.249 102.697 1.00 33.75  ? 638 CYS G C   1 
ATOM   6094 O O   . CYS G 1 85  ? -20.766 -14.330 102.528 1.00 31.43  ? 638 CYS G O   1 
ATOM   6095 C CB  . CYS G 1 85  ? -17.487 -14.913 103.216 1.00 34.26  ? 638 CYS G CB  1 
ATOM   6096 S SG  . CYS G 1 85  ? -17.312 -13.341 102.414 1.00 36.95  ? 638 CYS G SG  1 
ATOM   6097 N N   . MET G 1 86  ? -19.973 -16.353 101.958 1.00 32.99  ? 639 MET G N   1 
ATOM   6098 C CA  . MET G 1 86  ? -21.007 -16.555 100.929 1.00 33.33  ? 639 MET G CA  1 
ATOM   6099 C C   . MET G 1 86  ? -22.419 -16.747 101.499 1.00 37.01  ? 639 MET G C   1 
ATOM   6100 O O   . MET G 1 86  ? -23.381 -16.609 100.766 1.00 45.38  ? 639 MET G O   1 
ATOM   6101 C CB  . MET G 1 86  ? -20.667 -17.734 100.010 1.00 28.62  ? 639 MET G CB  1 
ATOM   6102 C CG  . MET G 1 86  ? -19.375 -17.561 99.219  1.00 26.95  ? 639 MET G CG  1 
ATOM   6103 S SD  . MET G 1 86  ? -18.991 -18.989 98.208  1.00 43.65  ? 639 MET G SD  1 
ATOM   6104 C CE  . MET G 1 86  ? -20.232 -18.806 96.917  1.00 49.18  ? 639 MET G CE  1 
ATOM   6105 N N   . LYS G 1 87  ? -22.549 -17.062 102.782 1.00 42.92  ? 640 LYS G N   1 
ATOM   6106 C CA  . LYS G 1 87  ? -23.873 -17.142 103.413 1.00 48.95  ? 640 LYS G CA  1 
ATOM   6107 C C   . LYS G 1 87  ? -24.333 -15.772 103.894 1.00 48.37  ? 640 LYS G C   1 
ATOM   6108 O O   . LYS G 1 87  ? -25.466 -15.375 103.641 1.00 48.26  ? 640 LYS G O   1 
ATOM   6109 C CB  . LYS G 1 87  ? -23.873 -18.115 104.587 1.00 50.97  ? 640 LYS G CB  1 
ATOM   6110 C CG  . LYS G 1 87  ? -23.997 -19.572 104.165 1.00 62.67  ? 640 LYS G CG  1 
ATOM   6111 N N   . TYR G 1 88  ? -23.447 -15.047 104.570 1.00 45.05  ? 641 TYR G N   1 
ATOM   6112 C CA  . TYR G 1 88  ? -23.818 -13.759 105.142 1.00 45.46  ? 641 TYR G CA  1 
ATOM   6113 C C   . TYR G 1 88  ? -23.914 -12.640 104.096 1.00 48.06  ? 641 TYR G C   1 
ATOM   6114 O O   . TYR G 1 88  ? -24.791 -11.774 104.215 1.00 44.37  ? 641 TYR G O   1 
ATOM   6115 C CB  . TYR G 1 88  ? -22.848 -13.346 106.257 1.00 46.85  ? 641 TYR G CB  1 
ATOM   6116 C CG  . TYR G 1 88  ? -23.198 -11.998 106.840 1.00 44.86  ? 641 TYR G CG  1 
ATOM   6117 C CD1 . TYR G 1 88  ? -22.631 -10.836 106.340 1.00 43.45  ? 641 TYR G CD1 1 
ATOM   6118 C CD2 . TYR G 1 88  ? -24.132 -11.886 107.859 1.00 53.90  ? 641 TYR G CD2 1 
ATOM   6119 C CE1 . TYR G 1 88  ? -22.973 -9.601  106.845 1.00 47.08  ? 641 TYR G CE1 1 
ATOM   6120 C CE2 . TYR G 1 88  ? -24.479 -10.646 108.380 1.00 53.79  ? 641 TYR G CE2 1 
ATOM   6121 C CZ  . TYR G 1 88  ? -23.905 -9.512  107.864 1.00 34.27  ? 641 TYR G CZ  1 
ATOM   6122 O OH  . TYR G 1 88  ? -24.243 -8.279  108.357 1.00 48.53  ? 641 TYR G OH  1 
ATOM   6123 N N   . ASN G 1 89  ? -23.023 -12.636 103.093 1.00 37.28  ? 642 ASN G N   1 
ATOM   6124 C CA  . ASN G 1 89  ? -22.994 -11.532 102.116 1.00 39.24  ? 642 ASN G CA  1 
ATOM   6125 C C   . ASN G 1 89  ? -23.728 -11.893 100.833 1.00 38.26  ? 642 ASN G C   1 
ATOM   6126 O O   . ASN G 1 89  ? -23.516 -12.977 100.316 1.00 37.26  ? 642 ASN G O   1 
ATOM   6127 C CB  . ASN G 1 89  ? -21.547 -11.164 101.784 1.00 42.17  ? 642 ASN G CB  1 
ATOM   6128 C CG  . ASN G 1 89  ? -20.768 -10.739 103.010 1.00 45.88  ? 642 ASN G CG  1 
ATOM   6129 O OD1 . ASN G 1 89  ? -20.888 -9.610  103.435 1.00 29.64  ? 642 ASN G OD1 1 
ATOM   6130 N ND2 . ASN G 1 89  ? -19.983 -11.648 103.591 1.00 35.86  ? 642 ASN G ND2 1 
ATOM   6131 N N   . ALA G 1 90  ? -24.586 -10.995 100.339 1.00 36.18  ? 643 ALA G N   1 
ATOM   6132 C CA  . ALA G 1 90  ? -25.286 -11.155 99.053  1.00 37.95  ? 643 ALA G CA  1 
ATOM   6133 C C   . ALA G 1 90  ? -24.348 -11.348 97.843  1.00 40.59  ? 643 ALA G C   1 
ATOM   6134 O O   . ALA G 1 90  ? -23.238 -10.774 97.788  1.00 39.42  ? 643 ALA G O   1 
ATOM   6135 C CB  . ALA G 1 90  ? -26.204 -9.912  98.799  1.00 38.44  ? 643 ALA G CB  1 
ATOM   6136 N N   . ARG G 1 91  ? -24.831 -12.098 96.857  1.00 42.74  ? 644 ARG G N   1 
ATOM   6137 C CA  . ARG G 1 91  ? -24.066 -12.408 95.634  1.00 54.04  ? 644 ARG G CA  1 
ATOM   6138 C C   . ARG G 1 91  ? -23.544 -11.182 94.863  1.00 57.04  ? 644 ARG G C   1 
ATOM   6139 O O   . ARG G 1 91  ? -22.655 -11.325 94.033  1.00 63.54  ? 644 ARG G O   1 
ATOM   6140 C CB  . ARG G 1 91  ? -24.874 -13.321 94.678  1.00 51.47  ? 644 ARG G CB  1 
ATOM   6141 N N   . ASP G 1 92  ? -24.073 -9.991  95.129  1.00 62.43  ? 645 ASP G N   1 
ATOM   6142 C CA  . ASP G 1 92  ? -23.642 -8.776  94.407  1.00 66.53  ? 645 ASP G CA  1 
ATOM   6143 C C   . ASP G 1 92  ? -22.802 -7.825  95.292  1.00 67.23  ? 645 ASP G C   1 
ATOM   6144 O O   . ASP G 1 92  ? -22.934 -6.596  95.215  1.00 75.03  ? 645 ASP G O   1 
ATOM   6145 C CB  . ASP G 1 92  ? -24.866 -8.051  93.802  1.00 63.89  ? 645 ASP G CB  1 
ATOM   6146 C CG  . ASP G 1 92  ? -25.829 -7.486  94.872  1.00 67.66  ? 645 ASP G CG  1 
ATOM   6147 O OD1 . ASP G 1 92  ? -25.831 -7.954  96.035  1.00 66.40  ? 645 ASP G OD1 1 
ATOM   6148 O OD2 . ASP G 1 92  ? -26.596 -6.562  94.534  1.00 66.86  ? 645 ASP G OD2 1 
ATOM   6149 N N   . THR G 1 93  ? -21.934 -8.395  96.124  1.00 58.62  ? 646 THR G N   1 
ATOM   6150 C CA  . THR G 1 93  ? -21.074 -7.596  96.990  1.00 51.18  ? 646 THR G CA  1 
ATOM   6151 C C   . THR G 1 93  ? -19.647 -8.010  96.781  1.00 49.37  ? 646 THR G C   1 
ATOM   6152 O O   . THR G 1 93  ? -19.362 -9.167  96.422  1.00 43.86  ? 646 THR G O   1 
ATOM   6153 C CB  . THR G 1 93  ? -21.389 -7.810  98.480  1.00 53.88  ? 646 THR G CB  1 
ATOM   6154 O OG1 . THR G 1 93  ? -21.068 -9.159  98.844  1.00 41.93  ? 646 THR G OG1 1 
ATOM   6155 C CG2 . THR G 1 93  ? -22.881 -7.502  98.785  1.00 48.94  ? 646 THR G CG2 1 
ATOM   6156 N N   . VAL G 1 94  ? -18.750 -7.066  97.038  1.00 44.63  ? 647 VAL G N   1 
ATOM   6157 C CA  . VAL G 1 94  ? -17.321 -7.316  96.946  1.00 45.95  ? 647 VAL G CA  1 
ATOM   6158 C C   . VAL G 1 94  ? -16.882 -8.485  97.833  1.00 42.76  ? 647 VAL G C   1 
ATOM   6159 O O   . VAL G 1 94  ? -16.005 -9.249  97.447  1.00 41.06  ? 647 VAL G O   1 
ATOM   6160 C CB  . VAL G 1 94  ? -16.455 -6.044  97.272  1.00 39.34  ? 647 VAL G CB  1 
ATOM   6161 C CG1 . VAL G 1 94  ? -16.794 -4.942  96.306  1.00 47.96  ? 647 VAL G CG1 1 
ATOM   6162 C CG2 . VAL G 1 94  ? -16.669 -5.581  98.721  1.00 44.65  ? 647 VAL G CG2 1 
ATOM   6163 N N   . PHE G 1 95  ? -17.473 -8.627  99.011  1.00 40.92  ? 648 PHE G N   1 
ATOM   6164 C CA  . PHE G 1 95  ? -17.052 -9.702  99.896  1.00 38.00  ? 648 PHE G CA  1 
ATOM   6165 C C   . PHE G 1 95  ? -17.405 -11.098 99.340  1.00 28.88  ? 648 PHE G C   1 
ATOM   6166 O O   . PHE G 1 95  ? -16.550 -11.993 99.321  1.00 31.66  ? 648 PHE G O   1 
ATOM   6167 C CB  . PHE G 1 95  ? -17.589 -9.475  101.309 1.00 45.12  ? 648 PHE G CB  1 
ATOM   6168 C CG  . PHE G 1 95  ? -16.927 -8.327  102.050 1.00 44.17  ? 648 PHE G CG  1 
ATOM   6169 C CD1 . PHE G 1 95  ? -15.728 -7.771  101.621 1.00 51.21  ? 648 PHE G CD1 1 
ATOM   6170 C CD2 . PHE G 1 95  ? -17.500 -7.835  103.212 1.00 55.79  ? 648 PHE G CD2 1 
ATOM   6171 C CE1 . PHE G 1 95  ? -15.124 -6.737  102.330 1.00 64.21  ? 648 PHE G CE1 1 
ATOM   6172 C CE2 . PHE G 1 95  ? -16.900 -6.808  103.924 1.00 63.98  ? 648 PHE G CE2 1 
ATOM   6173 C CZ  . PHE G 1 95  ? -15.712 -6.257  103.478 1.00 64.40  ? 648 PHE G CZ  1 
ATOM   6174 N N   . TYR G 1 96  ? -18.617 -11.272 98.826  1.00 40.69  ? 649 TYR G N   1 
ATOM   6175 C CA  . TYR G 1 96  ? -19.021 -12.560 98.232  1.00 41.50  ? 649 TYR G CA  1 
ATOM   6176 C C   . TYR G 1 96  ? -18.051 -12.948 97.112  1.00 38.67  ? 649 TYR G C   1 
ATOM   6177 O O   . TYR G 1 96  ? -17.427 -14.013 97.121  1.00 37.29  ? 649 TYR G O   1 
ATOM   6178 C CB  . TYR G 1 96  ? -20.451 -12.455 97.701  1.00 48.36  ? 649 TYR G CB  1 
ATOM   6179 C CG  . TYR G 1 96  ? -21.001 -13.718 97.046  1.00 54.87  ? 649 TYR G CG  1 
ATOM   6180 C CD1 . TYR G 1 96  ? -20.638 -14.065 95.747  1.00 62.83  ? 649 TYR G CD1 1 
ATOM   6181 C CD2 . TYR G 1 96  ? -21.910 -14.542 97.712  1.00 43.01  ? 649 TYR G CD2 1 
ATOM   6182 C CE1 . TYR G 1 96  ? -21.143 -15.202 95.139  1.00 63.49  ? 649 TYR G CE1 1 
ATOM   6183 C CE2 . TYR G 1 96  ? -22.425 -15.691 97.106  1.00 41.35  ? 649 TYR G CE2 1 
ATOM   6184 C CZ  . TYR G 1 96  ? -22.034 -16.009 95.820  1.00 50.23  ? 649 TYR G CZ  1 
ATOM   6185 O OH  . TYR G 1 96  ? -22.529 -17.121 95.181  1.00 54.83  ? 649 TYR G OH  1 
ATOM   6186 N N   . ARG G 1 97  ? -17.904 -12.048 96.156  1.00 36.58  ? 650 ARG G N   1 
ATOM   6187 C CA  . ARG G 1 97  ? -16.982 -12.244 95.056  1.00 34.19  ? 650 ARG G CA  1 
ATOM   6188 C C   . ARG G 1 97  ? -15.536 -12.538 95.529  1.00 33.67  ? 650 ARG G C   1 
ATOM   6189 O O   . ARG G 1 97  ? -14.782 -13.266 94.880  1.00 32.69  ? 650 ARG G O   1 
ATOM   6190 C CB  . ARG G 1 97  ? -17.017 -10.998 94.176  1.00 34.74  ? 650 ARG G CB  1 
ATOM   6191 C CG  . ARG G 1 97  ? -18.324 -10.839 93.338  1.00 47.42  ? 650 ARG G CG  1 
ATOM   6192 C CD  . ARG G 1 97  ? -18.220 -9.683  92.319  1.00 46.88  ? 650 ARG G CD  1 
ATOM   6193 N NE  . ARG G 1 97  ? -19.490 -8.957  92.145  1.00 67.52  ? 650 ARG G NE  1 
ATOM   6194 C CZ  . ARG G 1 97  ? -19.720 -7.675  92.470  1.00 68.90  ? 650 ARG G CZ  1 
ATOM   6195 N NH1 . ARG G 1 97  ? -18.774 -6.892  93.007  1.00 62.05  ? 650 ARG G NH1 1 
ATOM   6196 N NH2 . ARG G 1 97  ? -20.924 -7.160  92.245  1.00 78.49  ? 650 ARG G NH2 1 
ATOM   6197 N N   . ALA G 1 98  ? -15.127 -11.973 96.653  1.00 32.20  ? 651 ALA G N   1 
ATOM   6198 C CA  . ALA G 1 98  ? -13.760 -12.248 97.151  1.00 28.46  ? 651 ALA G CA  1 
ATOM   6199 C C   . ALA G 1 98  ? -13.645 -13.680 97.681  1.00 24.40  ? 651 ALA G C   1 
ATOM   6200 O O   . ALA G 1 98  ? -12.642 -14.365 97.490  1.00 29.49  ? 651 ALA G O   1 
ATOM   6201 C CB  . ALA G 1 98  ? -13.411 -11.271 98.197  1.00 22.04  ? 651 ALA G CB  1 
ATOM   6202 N N   . ALA G 1 99  ? -14.707 -14.129 98.326  1.00 31.49  ? 652 ALA G N   1 
ATOM   6203 C CA  . ALA G 1 99  ? -14.789 -15.476 98.841  1.00 30.61  ? 652 ALA G CA  1 
ATOM   6204 C C   . ALA G 1 99  ? -14.754 -16.509 97.699  1.00 28.07  ? 652 ALA G C   1 
ATOM   6205 O O   . ALA G 1 99  ? -13.988 -17.487 97.755  1.00 27.36  ? 652 ALA G O   1 
ATOM   6206 C CB  . ALA G 1 99  ? -16.057 -15.626 99.698  1.00 25.24  ? 652 ALA G CB  1 
ATOM   6207 N N   . VAL G 1 100 ? -15.546 -16.267 96.656  1.00 28.00  ? 653 VAL G N   1 
ATOM   6208 C CA  . VAL G 1 100 ? -15.550 -17.099 95.451  1.00 21.65  ? 653 VAL G CA  1 
ATOM   6209 C C   . VAL G 1 100 ? -14.130 -17.214 94.929  1.00 37.58  ? 653 VAL G C   1 
ATOM   6210 O O   . VAL G 1 100 ? -13.642 -18.320 94.685  1.00 41.65  ? 653 VAL G O   1 
ATOM   6211 C CB  . VAL G 1 100 ? -16.500 -16.538 94.360  1.00 38.22  ? 653 VAL G CB  1 
ATOM   6212 C CG1 . VAL G 1 100 ? -16.227 -17.196 93.008  1.00 33.28  ? 653 VAL G CG1 1 
ATOM   6213 C CG2 . VAL G 1 100 ? -18.036 -16.720 94.766  1.00 26.39  ? 653 VAL G CG2 1 
ATOM   6214 N N   . ARG G 1 101 ? -13.441 -16.079 94.826  1.00 32.94  ? 654 ARG G N   1 
ATOM   6215 C CA  . ARG G 1 101 ? -12.081 -16.075 94.312  1.00 39.50  ? 654 ARG G CA  1 
ATOM   6216 C C   . ARG G 1 101 ? -11.087 -16.791 95.221  1.00 33.81  ? 654 ARG G C   1 
ATOM   6217 O O   . ARG G 1 101 ? -10.200 -17.442 94.727  1.00 29.15  ? 654 ARG G O   1 
ATOM   6218 C CB  . ARG G 1 101 ? -11.569 -14.665 94.060  1.00 40.99  ? 654 ARG G CB  1 
ATOM   6219 C CG  . ARG G 1 101 ? -11.856 -14.189 92.685  1.00 58.60  ? 654 ARG G CG  1 
ATOM   6220 C CD  . ARG G 1 101 ? -11.255 -12.825 92.424  1.00 66.41  ? 654 ARG G CD  1 
ATOM   6221 N NE  . ARG G 1 101 ? -12.281 -11.962 91.840  1.00 65.23  ? 654 ARG G NE  1 
ATOM   6222 C CZ  . ARG G 1 101 ? -12.916 -10.979 92.475  1.00 61.05  ? 654 ARG G CZ  1 
ATOM   6223 N NH1 . ARG G 1 101 ? -12.623 -10.654 93.749  1.00 40.85  ? 654 ARG G NH1 1 
ATOM   6224 N NH2 . ARG G 1 101 ? -13.834 -10.287 91.806  1.00 64.79  ? 654 ARG G NH2 1 
ATOM   6225 N N   . LEU G 1 102 ? -11.238 -16.651 96.531  1.00 32.48  ? 655 LEU G N   1 
ATOM   6226 C CA  . LEU G 1 102 ? -10.331 -17.305 97.465  1.00 26.77  ? 655 LEU G CA  1 
ATOM   6227 C C   . LEU G 1 102 ? -10.608 -18.815 97.510  1.00 31.45  ? 655 LEU G C   1 
ATOM   6228 O O   . LEU G 1 102 ? -9.664  -19.605 97.631  1.00 28.70  ? 655 LEU G O   1 
ATOM   6229 C CB  . LEU G 1 102 ? -10.429 -16.661 98.846  1.00 23.10  ? 655 LEU G CB  1 
ATOM   6230 C CG  . LEU G 1 102 ? -9.670  -17.243 100.031 1.00 27.22  ? 655 LEU G CG  1 
ATOM   6231 C CD1 . LEU G 1 102 ? -8.157  -17.037 99.936  1.00 27.87  ? 655 LEU G CD1 1 
ATOM   6232 C CD2 . LEU G 1 102 ? -10.223 -16.607 101.307 1.00 19.26  ? 655 LEU G CD2 1 
ATOM   6233 N N   . ARG G 1 103 ? -11.875 -19.215 97.387  1.00 27.54  ? 656 ARG G N   1 
ATOM   6234 C CA  . ARG G 1 103 ? -12.213 -20.629 97.167  1.00 32.91  ? 656 ARG G CA  1 
ATOM   6235 C C   . ARG G 1 103 ? -11.471 -21.249 95.961  1.00 34.02  ? 656 ARG G C   1 
ATOM   6236 O O   . ARG G 1 103 ? -10.801 -22.319 96.073  1.00 28.55  ? 656 ARG G O   1 
ATOM   6237 C CB  . ARG G 1 103 ? -13.712 -20.788 96.953  1.00 36.53  ? 656 ARG G CB  1 
ATOM   6238 C CG  . ARG G 1 103 ? -14.196 -22.234 97.050  1.00 43.05  ? 656 ARG G CG  1 
ATOM   6239 C CD  . ARG G 1 103 ? -15.610 -22.328 96.541  1.00 37.59  ? 656 ARG G CD  1 
ATOM   6240 N NE  . ARG G 1 103 ? -15.645 -21.926 95.143  1.00 55.05  ? 656 ARG G NE  1 
ATOM   6241 C CZ  . ARG G 1 103 ? -16.748 -21.606 94.477  1.00 66.22  ? 656 ARG G CZ  1 
ATOM   6242 N NH1 . ARG G 1 103 ? -16.658 -21.239 93.205  1.00 69.22  ? 656 ARG G NH1 1 
ATOM   6243 N NH2 . ARG G 1 103 ? -17.935 -21.644 95.072  1.00 48.21  ? 656 ARG G NH2 1 
ATOM   6244 N N   . ASP G 1 104 ? -11.591 -20.594 94.808  1.00 29.01  ? 657 ASP G N   1 
ATOM   6245 C CA  . ASP G 1 104 ? -10.971 -21.122 93.595  1.00 31.79  ? 657 ASP G CA  1 
ATOM   6246 C C   . ASP G 1 104 ? -9.466  -21.189 93.784  1.00 32.72  ? 657 ASP G C   1 
ATOM   6247 O O   . ASP G 1 104 ? -8.847  -22.191 93.441  1.00 30.50  ? 657 ASP G O   1 
ATOM   6248 C CB  . ASP G 1 104 ? -11.278 -20.272 92.357  1.00 39.35  ? 657 ASP G CB  1 
ATOM   6249 C CG  . ASP G 1 104 ? -12.797 -20.060 92.129  1.00 65.46  ? 657 ASP G CG  1 
ATOM   6250 O OD1 . ASP G 1 104 ? -13.624 -20.976 92.441  1.00 56.05  ? 657 ASP G OD1 1 
ATOM   6251 O OD2 . ASP G 1 104 ? -13.149 -18.950 91.646  1.00 61.89  ? 657 ASP G OD2 1 
ATOM   6252 N N   . GLN G 1 105 ? -8.855  -20.152 94.350  1.00 21.87  ? 658 GLN G N   1 
ATOM   6253 C CA  . GLN G 1 105 ? -7.394  -20.125 94.353  1.00 33.78  ? 658 GLN G CA  1 
ATOM   6254 C C   . GLN G 1 105 ? -6.851  -20.963 95.511  1.00 28.49  ? 658 GLN G C   1 
ATOM   6255 O O   . GLN G 1 105 ? -5.858  -21.687 95.365  1.00 31.36  ? 658 GLN G O   1 
ATOM   6256 C CB  . GLN G 1 105 ? -6.888  -18.682 94.326  1.00 38.42  ? 658 GLN G CB  1 
ATOM   6257 C CG  . GLN G 1 105 ? -7.514  -17.843 93.127  1.00 41.01  ? 658 GLN G CG  1 
ATOM   6258 C CD  . GLN G 1 105 ? -7.127  -16.372 93.153  1.00 46.89  ? 658 GLN G CD  1 
ATOM   6259 O OE1 . GLN G 1 105 ? -6.130  -16.003 93.764  1.00 29.75  ? 658 GLN G OE1 1 
ATOM   6260 N NE2 . GLN G 1 105 ? -7.917  -15.527 92.491  1.00 47.78  ? 658 GLN G NE2 1 
ATOM   6261 N N   . GLY G 1 106 ? -7.547  -20.892 96.638  1.00 23.75  ? 659 GLY G N   1 
ATOM   6262 C CA  . GLY G 1 106 ? -7.286  -21.734 97.773  1.00 28.41  ? 659 GLY G CA  1 
ATOM   6263 C C   . GLY G 1 106 ? -7.439  -23.210 97.483  1.00 26.48  ? 659 GLY G C   1 
ATOM   6264 O O   . GLY G 1 106 ? -6.625  -24.005 97.928  1.00 25.46  ? 659 GLY G O   1 
ATOM   6265 N N   . GLY G 1 107 ? -8.479  -23.572 96.747  1.00 27.78  ? 660 GLY G N   1 
ATOM   6266 C CA  . GLY G 1 107 ? -8.662  -24.956 96.275  1.00 28.09  ? 660 GLY G CA  1 
ATOM   6267 C C   . GLY G 1 107 ? -7.421  -25.571 95.634  1.00 27.15  ? 660 GLY G C   1 
ATOM   6268 O O   . GLY G 1 107 ? -7.046  -26.708 95.951  1.00 27.83  ? 660 GLY G O   1 
ATOM   6269 N N   . VAL G 1 108 ? -6.758  -24.816 94.766  1.00 24.91  ? 661 VAL G N   1 
ATOM   6270 C CA  . VAL G 1 108 ? -5.515  -25.290 94.108  1.00 29.90  ? 661 VAL G CA  1 
ATOM   6271 C C   . VAL G 1 108 ? -4.398  -25.650 95.085  1.00 31.26  ? 661 VAL G C   1 
ATOM   6272 O O   . VAL G 1 108 ? -3.743  -26.677 94.962  1.00 36.48  ? 661 VAL G O   1 
ATOM   6273 C CB  . VAL G 1 108 ? -4.935  -24.214 93.170  1.00 39.67  ? 661 VAL G CB  1 
ATOM   6274 C CG1 . VAL G 1 108 ? -3.645  -24.742 92.462  1.00 28.45  ? 661 VAL G CG1 1 
ATOM   6275 C CG2 . VAL G 1 108 ? -6.016  -23.742 92.161  1.00 34.95  ? 661 VAL G CG2 1 
ATOM   6276 N N   . VAL G 1 109 ? -4.171  -24.757 96.039  1.00 30.46  ? 662 VAL G N   1 
ATOM   6277 C CA  . VAL G 1 109 ? -3.142  -24.893 97.062  1.00 20.85  ? 662 VAL G CA  1 
ATOM   6278 C C   . VAL G 1 109 ? -3.382  -26.117 97.949  1.00 30.55  ? 662 VAL G C   1 
ATOM   6279 O O   . VAL G 1 109 ? -2.450  -26.844 98.325  1.00 25.46  ? 662 VAL G O   1 
ATOM   6280 C CB  . VAL G 1 109 ? -3.180  -23.658 98.001  1.00 28.04  ? 662 VAL G CB  1 
ATOM   6281 C CG1 . VAL G 1 109 ? -2.232  -23.852 99.164  1.00 19.81  ? 662 VAL G CG1 1 
ATOM   6282 C CG2 . VAL G 1 109 ? -2.871  -22.359 97.210  1.00 16.07  ? 662 VAL G CG2 1 
ATOM   6283 N N   . LEU G 1 110 ? -4.648  -26.306 98.305  1.00 28.44  ? 663 LEU G N   1 
ATOM   6284 C CA  . LEU G 1 110 ? -5.078  -27.451 99.073  1.00 31.79  ? 663 LEU G CA  1 
ATOM   6285 C C   . LEU G 1 110 ? -5.022  -28.754 98.256  1.00 23.65  ? 663 LEU G C   1 
ATOM   6286 O O   . LEU G 1 110 ? -4.603  -29.786 98.774  1.00 29.81  ? 663 LEU G O   1 
ATOM   6287 C CB  . LEU G 1 110 ? -6.480  -27.203 99.641  1.00 28.07  ? 663 LEU G CB  1 
ATOM   6288 C CG  . LEU G 1 110 ? -6.545  -26.090 100.698 1.00 36.03  ? 663 LEU G CG  1 
ATOM   6289 C CD1 . LEU G 1 110 ? -7.994  -25.863 101.046 1.00 17.11  ? 663 LEU G CD1 1 
ATOM   6290 C CD2 . LEU G 1 110 ? -5.730  -26.412 101.985 1.00 20.47  ? 663 LEU G CD2 1 
ATOM   6291 N N   . ARG G 1 111 ? -5.398  -28.733 96.988  1.00 22.03  ? 664 ARG G N   1 
ATOM   6292 C CA  . ARG G 1 111 ? -5.140  -29.930 96.178  1.00 20.12  ? 664 ARG G CA  1 
ATOM   6293 C C   . ARG G 1 111 ? -3.642  -30.223 96.087  1.00 31.44  ? 664 ARG G C   1 
ATOM   6294 O O   . ARG G 1 111 ? -3.238  -31.403 96.098  1.00 30.82  ? 664 ARG G O   1 
ATOM   6295 C CB  . ARG G 1 111 ? -5.798  -29.881 94.823  1.00 24.69  ? 664 ARG G CB  1 
ATOM   6296 C CG  . ARG G 1 111 ? -7.357  -30.048 94.954  1.00 27.35  ? 664 ARG G CG  1 
ATOM   6297 C CD  . ARG G 1 111 ? -8.020  -30.226 93.599  1.00 43.17  ? 664 ARG G CD  1 
ATOM   6298 N NE  . ARG G 1 111 ? -7.864  -29.035 92.760  1.00 58.29  ? 664 ARG G NE  1 
ATOM   6299 C CZ  . ARG G 1 111 ? -8.594  -27.921 92.867  1.00 49.46  ? 664 ARG G CZ  1 
ATOM   6300 N NH1 . ARG G 1 111 ? -8.358  -26.909 92.050  1.00 44.50  ? 664 ARG G NH1 1 
ATOM   6301 N NH2 . ARG G 1 111 ? -9.561  -27.804 93.778  1.00 56.62  ? 664 ARG G NH2 1 
ATOM   6302 N N   . GLN G 1 112 ? -2.815  -29.179 96.101  1.00 26.44  ? 665 GLN G N   1 
ATOM   6303 C CA  . GLN G 1 112 ? -1.366  -29.403 96.037  1.00 25.03  ? 665 GLN G CA  1 
ATOM   6304 C C   . GLN G 1 112 ? -0.869  -29.951 97.373  1.00 25.07  ? 665 GLN G C   1 
ATOM   6305 O O   . GLN G 1 112 ? -0.039  -30.841 97.400  1.00 21.31  ? 665 GLN G O   1 
ATOM   6306 C CB  . GLN G 1 112 ? -0.590  -28.138 95.596  1.00 15.89  ? 665 GLN G CB  1 
ATOM   6307 C CG  . GLN G 1 112 ? 0.947   -28.344 95.302  1.00 28.00  ? 665 GLN G CG  1 
ATOM   6308 C CD  . GLN G 1 112 ? 1.265   -29.373 94.191  1.00 28.10  ? 665 GLN G CD  1 
ATOM   6309 O OE1 . GLN G 1 112 ? 0.565   -29.457 93.199  1.00 29.05  ? 665 GLN G OE1 1 
ATOM   6310 N NE2 . GLN G 1 112 ? 2.329   -30.164 94.389  1.00 26.74  ? 665 GLN G NE2 1 
ATOM   6311 N N   . ALA G 1 113 ? -1.401  -29.442 98.480  1.00 25.24  ? 666 ALA G N   1 
ATOM   6312 C CA  . ALA G 1 113 ? -1.023  -29.930 99.798  1.00 28.79  ? 666 ALA G CA  1 
ATOM   6313 C C   . ALA G 1 113 ? -1.440  -31.402 99.964  1.00 25.52  ? 666 ALA G C   1 
ATOM   6314 O O   . ALA G 1 113 ? -0.731  -32.214 100.554 1.00 24.22  ? 666 ALA G O   1 
ATOM   6315 C CB  . ALA G 1 113 ? -1.656  -29.064 100.892 1.00 31.47  ? 666 ALA G CB  1 
ATOM   6316 N N   . ARG G 1 114 ? -2.575  -31.756 99.408  1.00 26.76  ? 667 ARG G N   1 
ATOM   6317 C CA  . ARG G 1 114 ? -2.994  -33.158 99.443  1.00 30.00  ? 667 ARG G CA  1 
ATOM   6318 C C   . ARG G 1 114 ? -1.963  -34.101 98.790  1.00 28.81  ? 667 ARG G C   1 
ATOM   6319 O O   . ARG G 1 114 ? -1.781  -35.243 99.238  1.00 28.50  ? 667 ARG G O   1 
ATOM   6320 C CB  . ARG G 1 114 ? -4.380  -33.293 98.816  1.00 21.53  ? 667 ARG G CB  1 
ATOM   6321 C CG  . ARG G 1 114 ? -4.862  -34.744 98.614  1.00 39.47  ? 667 ARG G CG  1 
ATOM   6322 C CD  . ARG G 1 114 ? -4.991  -35.574 99.889  1.00 29.23  ? 667 ARG G CD  1 
ATOM   6323 N NE  . ARG G 1 114 ? -5.989  -35.010 100.811 1.00 40.88  ? 667 ARG G NE  1 
ATOM   6324 C CZ  . ARG G 1 114 ? -6.057  -35.276 102.116 1.00 34.80  ? 667 ARG G CZ  1 
ATOM   6325 N NH1 . ARG G 1 114 ? -6.978  -34.680 102.876 1.00 35.08  ? 667 ARG G NH1 1 
ATOM   6326 N NH2 . ARG G 1 114 ? -5.191  -36.114 102.684 1.00 32.29  ? 667 ARG G NH2 1 
ATOM   6327 N N   . ARG G 1 115 ? -1.289  -33.641 97.742  1.00 30.75  ? 668 ARG G N   1 
ATOM   6328 C CA  . ARG G 1 115 ? -0.347  -34.529 97.006  1.00 29.16  ? 668 ARG G CA  1 
ATOM   6329 C C   . ARG G 1 115 ? 0.929   -34.665 97.821  1.00 33.49  ? 668 ARG G C   1 
ATOM   6330 O O   . ARG G 1 115 ? 1.623   -35.704 97.751  1.00 26.80  ? 668 ARG G O   1 
ATOM   6331 C CB  . ARG G 1 115 ? -0.132  -34.081 95.551  1.00 28.20  ? 668 ARG G CB  1 
ATOM   6332 C CG  . ARG G 1 115 ? -1.393  -33.425 95.007  1.00 35.74  ? 668 ARG G CG  1 
ATOM   6333 C CD  . ARG G 1 115 ? -1.708  -33.518 93.562  1.00 42.67  ? 668 ARG G CD  1 
ATOM   6334 N NE  . ARG G 1 115 ? -1.176  -32.415 92.810  1.00 27.16  ? 668 ARG G NE  1 
ATOM   6335 C CZ  . ARG G 1 115 ? -1.716  -31.843 91.721  1.00 38.70  ? 668 ARG G CZ  1 
ATOM   6336 N NH1 . ARG G 1 115 ? -1.073  -30.838 91.118  1.00 31.51  ? 668 ARG G NH1 1 
ATOM   6337 N NH2 . ARG G 1 115 ? -2.871  -32.225 91.218  1.00 38.02  ? 668 ARG G NH2 1 
ATOM   6338 N N   . GLU G 1 116 ? 1.186   -33.641 98.645  1.00 27.16  ? 669 GLU G N   1 
ATOM   6339 C CA  . GLU G 1 116 ? 2.286   -33.665 99.573  1.00 30.36  ? 669 GLU G CA  1 
ATOM   6340 C C   . GLU G 1 116 ? 2.047   -34.728 100.639 1.00 33.75  ? 669 GLU G C   1 
ATOM   6341 O O   . GLU G 1 116 ? 2.899   -35.623 100.819 1.00 37.05  ? 669 GLU G O   1 
ATOM   6342 C CB  . GLU G 1 116 ? 2.526   -32.278 100.178 1.00 28.26  ? 669 GLU G CB  1 
ATOM   6343 C CG  . GLU G 1 116 ? 3.051   -31.255 99.167  1.00 35.52  ? 669 GLU G CG  1 
ATOM   6344 C CD  . GLU G 1 116 ? 4.296   -31.742 98.402  1.00 40.55  ? 669 GLU G CD  1 
ATOM   6345 O OE1 . GLU G 1 116 ? 5.231   -32.307 99.021  1.00 37.34  ? 669 GLU G OE1 1 
ATOM   6346 O OE2 . GLU G 1 116 ? 4.336   -31.561 97.178  1.00 29.48  ? 669 GLU G OE2 1 
ATOM   6347 N N   . VAL G 1 117 ? 0.873   -34.659 101.275 1.00 23.58  ? 670 VAL G N   1 
ATOM   6348 C CA  . VAL G 1 117 ? 0.414   -35.639 102.280 1.00 32.54  ? 670 VAL G CA  1 
ATOM   6349 C C   . VAL G 1 117 ? 0.412   -37.060 101.695 1.00 31.77  ? 670 VAL G C   1 
ATOM   6350 O O   . VAL G 1 117 ? 0.928   -37.976 102.307 1.00 35.94  ? 670 VAL G O   1 
ATOM   6351 C CB  . VAL G 1 117 ? -0.997  -35.290 102.807 1.00 31.29  ? 670 VAL G CB  1 
ATOM   6352 C CG1 . VAL G 1 117 ? -1.646  -36.492 103.544 1.00 24.58  ? 670 VAL G CG1 1 
ATOM   6353 C CG2 . VAL G 1 117 ? -0.940  -34.063 103.707 1.00 27.00  ? 670 VAL G CG2 1 
ATOM   6354 N N   . ASP G 1 118 ? -0.134  -37.227 100.495 1.00 27.31  ? 671 ASP G N   1 
ATOM   6355 C CA  . ASP G 1 118 ? -0.005  -38.508 99.778  1.00 26.43  ? 671 ASP G CA  1 
ATOM   6356 C C   . ASP G 1 118 ? 1.452   -39.025 99.833  1.00 28.62  ? 671 ASP G C   1 
ATOM   6357 O O   . ASP G 1 118 ? 1.717   -40.196 100.118 1.00 31.11  ? 671 ASP G O   1 
ATOM   6358 C CB  . ASP G 1 118 ? -0.335  -38.345 98.297  1.00 18.39  ? 671 ASP G CB  1 
ATOM   6359 C CG  . ASP G 1 118 ? -1.843  -38.044 97.992  1.00 44.67  ? 671 ASP G CG  1 
ATOM   6360 O OD1 . ASP G 1 118 ? -2.712  -38.378 98.816  1.00 36.51  ? 671 ASP G OD1 1 
ATOM   6361 O OD2 . ASP G 1 118 ? -2.150  -37.515 96.864  1.00 28.14  ? 671 ASP G OD2 1 
ATOM   6362 N N   . SER G 1 119 ? 2.384   -38.133 99.510  1.00 33.03  ? 672 SER G N   1 
ATOM   6363 C CA  . SER G 1 119 ? 3.773   -38.493 99.298  1.00 38.43  ? 672 SER G CA  1 
ATOM   6364 C C   . SER G 1 119 ? 4.475   -38.741 100.613 1.00 38.97  ? 672 SER G C   1 
ATOM   6365 O O   . SER G 1 119 ? 5.079   -39.791 100.814 1.00 47.60  ? 672 SER G O   1 
ATOM   6366 C CB  . SER G 1 119 ? 4.477   -37.356 98.565  1.00 41.32  ? 672 SER G CB  1 
ATOM   6367 O OG  . SER G 1 119 ? 5.866   -37.601 98.458  1.00 47.18  ? 672 SER G OG  1 
ATOM   6368 N N   . ILE G 1 120 ? 4.402   -37.760 101.504 1.00 40.31  ? 673 ILE G N   1 
ATOM   6369 C CA  . ILE G 1 120 ? 5.031   -37.862 102.822 1.00 43.89  ? 673 ILE G CA  1 
ATOM   6370 C C   . ILE G 1 120 ? 4.450   -39.018 103.615 1.00 47.61  ? 673 ILE G C   1 
ATOM   6371 O O   . ILE G 1 120 ? 5.164   -39.636 104.399 1.00 45.65  ? 673 ILE G O   1 
ATOM   6372 C CB  . ILE G 1 120 ? 4.816   -36.597 103.688 1.00 43.00  ? 673 ILE G CB  1 
ATOM   6373 C CG1 . ILE G 1 120 ? 5.417   -35.356 103.043 1.00 40.40  ? 673 ILE G CG1 1 
ATOM   6374 C CG2 . ILE G 1 120 ? 5.467   -36.783 105.041 1.00 53.74  ? 673 ILE G CG2 1 
ATOM   6375 C CD1 . ILE G 1 120 ? 4.968   -34.103 103.721 1.00 34.40  ? 673 ILE G CD1 1 
ATOM   6376 N N   . GLY G 1 121 ? 3.153   -39.285 103.421 1.00 45.82  ? 674 GLY G N   1 
ATOM   6377 C CA  . GLY G 1 121 ? 2.457   -40.384 104.107 1.00 53.53  ? 674 GLY G CA  1 
ATOM   6378 C C   . GLY G 1 121 ? 2.938   -41.805 103.790 1.00 63.55  ? 674 GLY G C   1 
ATOM   6379 O O   . GLY G 1 121 ? 2.582   -42.752 104.502 1.00 70.73  ? 674 GLY G O   1 
ATOM   6380 N N   . LEU G 1 122 ? 3.719   -41.969 102.719 1.00 66.90  ? 675 LEU G N   1 
ATOM   6381 C CA  . LEU G 1 122 ? 4.369   -43.255 102.402 1.00 64.45  ? 675 LEU G CA  1 
ATOM   6382 C C   . LEU G 1 122 ? 5.615   -43.416 103.265 1.00 66.30  ? 675 LEU G C   1 
ATOM   6383 O O   . LEU G 1 122 ? 6.606   -42.705 103.069 1.00 62.35  ? 675 LEU G O   1 
ATOM   6384 C CB  . LEU G 1 122 ? 4.785   -43.324 100.918 1.00 63.54  ? 675 LEU G CB  1 
ATOM   6385 C CG  . LEU G 1 122 ? 3.739   -43.398 99.800  1.00 51.76  ? 675 LEU G CG  1 
ATOM   6386 C CD1 . LEU G 1 122 ? 4.417   -43.644 98.439  1.00 37.75  ? 675 LEU G CD1 1 
ATOM   6387 C CD2 . LEU G 1 122 ? 2.714   -44.495 100.067 1.00 58.73  ? 675 LEU G CD2 1 
ATOM   6388 N N   . PRO H 1 13  ? 11.221  -38.221 32.394  1.00 98.46  ? 566 PRO H N   1 
ATOM   6389 C CA  . PRO H 1 13  ? 10.847  -37.031 31.622  1.00 93.87  ? 566 PRO H CA  1 
ATOM   6390 C C   . PRO H 1 13  ? 9.654   -36.273 32.214  1.00 86.96  ? 566 PRO H C   1 
ATOM   6391 O O   . PRO H 1 13  ? 8.884   -35.660 31.468  1.00 78.73  ? 566 PRO H O   1 
ATOM   6392 C CB  . PRO H 1 13  ? 10.444  -37.638 30.280  1.00 95.84  ? 566 PRO H CB  1 
ATOM   6393 C CG  . PRO H 1 13  ? 9.757   -38.940 30.685  1.00 95.71  ? 566 PRO H CG  1 
ATOM   6394 C CD  . PRO H 1 13  ? 10.375  -39.372 32.027  1.00 97.02  ? 566 PRO H CD  1 
ATOM   6395 N N   . LEU H 1 14  ? 9.493   -36.332 33.537  1.00 83.64  ? 567 LEU H N   1 
ATOM   6396 C CA  . LEU H 1 14  ? 8.452   -35.584 34.228  1.00 76.42  ? 567 LEU H CA  1 
ATOM   6397 C C   . LEU H 1 14  ? 8.763   -34.097 34.147  1.00 73.14  ? 567 LEU H C   1 
ATOM   6398 O O   . LEU H 1 14  ? 7.851   -33.284 34.069  1.00 73.82  ? 567 LEU H O   1 
ATOM   6399 C CB  . LEU H 1 14  ? 8.330   -36.015 35.695  1.00 74.51  ? 567 LEU H CB  1 
ATOM   6400 N N   . THR H 1 15  ? 10.047  -33.746 34.139  1.00 70.19  ? 568 THR H N   1 
ATOM   6401 C CA  . THR H 1 15  ? 10.460  -32.340 34.139  1.00 71.75  ? 568 THR H CA  1 
ATOM   6402 C C   . THR H 1 15  ? 9.809   -31.574 33.007  1.00 71.57  ? 568 THR H C   1 
ATOM   6403 O O   . THR H 1 15  ? 9.316   -30.466 33.189  1.00 77.32  ? 568 THR H O   1 
ATOM   6404 C CB  . THR H 1 15  ? 11.983  -32.177 33.992  1.00 72.05  ? 568 THR H CB  1 
ATOM   6405 O OG1 . THR H 1 15  ? 12.642  -33.256 34.657  1.00 77.11  ? 568 THR H OG1 1 
ATOM   6406 C CG2 . THR H 1 15  ? 12.448  -30.829 34.582  1.00 68.94  ? 568 THR H CG2 1 
ATOM   6407 N N   . VAL H 1 16  ? 9.819   -32.178 31.833  1.00 68.27  ? 569 VAL H N   1 
ATOM   6408 C CA  . VAL H 1 16  ? 9.180   -31.600 30.664  1.00 64.95  ? 569 VAL H CA  1 
ATOM   6409 C C   . VAL H 1 16  ? 7.719   -31.280 30.962  1.00 52.95  ? 569 VAL H C   1 
ATOM   6410 O O   . VAL H 1 16  ? 7.255   -30.160 30.756  1.00 52.84  ? 569 VAL H O   1 
ATOM   6411 C CB  . VAL H 1 16  ? 9.246   -32.590 29.467  1.00 69.33  ? 569 VAL H CB  1 
ATOM   6412 C CG1 . VAL H 1 16  ? 8.596   -31.971 28.213  1.00 52.00  ? 569 VAL H CG1 1 
ATOM   6413 C CG2 . VAL H 1 16  ? 10.719  -33.050 29.218  1.00 70.22  ? 569 VAL H CG2 1 
ATOM   6414 N N   . LEU H 1 17  ? 7.022   -32.286 31.472  1.00 50.60  ? 570 LEU H N   1 
ATOM   6415 C CA  . LEU H 1 17  ? 5.592   -32.237 31.693  1.00 45.93  ? 570 LEU H CA  1 
ATOM   6416 C C   . LEU H 1 17  ? 5.265   -31.209 32.789  1.00 44.81  ? 570 LEU H C   1 
ATOM   6417 O O   . LEU H 1 17  ? 4.361   -30.388 32.651  1.00 50.35  ? 570 LEU H O   1 
ATOM   6418 C CB  . LEU H 1 17  ? 5.116   -33.620 32.126  1.00 40.73  ? 570 LEU H CB  1 
ATOM   6419 C CG  . LEU H 1 17  ? 3.669   -34.061 31.938  1.00 48.59  ? 570 LEU H CG  1 
ATOM   6420 C CD1 . LEU H 1 17  ? 3.216   -34.806 33.173  1.00 46.68  ? 570 LEU H CD1 1 
ATOM   6421 C CD2 . LEU H 1 17  ? 2.729   -32.927 31.652  1.00 50.07  ? 570 LEU H CD2 1 
ATOM   6422 N N   . LEU H 1 18  ? 6.020   -31.254 33.874  1.00 46.91  ? 571 LEU H N   1 
ATOM   6423 C CA  . LEU H 1 18  ? 5.771   -30.383 35.028  1.00 45.86  ? 571 LEU H CA  1 
ATOM   6424 C C   . LEU H 1 18  ? 5.964   -28.921 34.678  1.00 46.70  ? 571 LEU H C   1 
ATOM   6425 O O   . LEU H 1 18  ? 5.168   -28.072 35.090  1.00 42.16  ? 571 LEU H O   1 
ATOM   6426 C CB  . LEU H 1 18  ? 6.653   -30.797 36.213  1.00 43.66  ? 571 LEU H CB  1 
ATOM   6427 C CG  . LEU H 1 18  ? 6.222   -32.142 36.840  1.00 37.61  ? 571 LEU H CG  1 
ATOM   6428 C CD1 . LEU H 1 18  ? 7.186   -32.586 37.918  1.00 42.10  ? 571 LEU H CD1 1 
ATOM   6429 C CD2 . LEU H 1 18  ? 4.813   -32.063 37.383  1.00 36.03  ? 571 LEU H CD2 1 
ATOM   6430 N N   . ARG H 1 19  ? 7.000   -28.648 33.890  1.00 48.79  ? 572 ARG H N   1 
ATOM   6431 C CA  . ARG H 1 19  ? 7.312   -27.305 33.451  1.00 49.52  ? 572 ARG H CA  1 
ATOM   6432 C C   . ARG H 1 19  ? 6.121   -26.791 32.713  1.00 40.29  ? 572 ARG H C   1 
ATOM   6433 O O   . ARG H 1 19  ? 5.733   -25.651 32.886  1.00 41.05  ? 572 ARG H O   1 
ATOM   6434 C CB  . ARG H 1 19  ? 8.556   -27.273 32.537  1.00 57.44  ? 572 ARG H CB  1 
ATOM   6435 C CG  . ARG H 1 19  ? 8.964   -25.861 32.059  1.00 72.87  ? 572 ARG H CG  1 
ATOM   6436 C CD  . ARG H 1 19  ? 10.321  -25.814 31.310  1.00 79.36  ? 572 ARG H CD  1 
ATOM   6437 N NE  . ARG H 1 19  ? 11.402  -26.456 32.066  1.00 74.28  ? 572 ARG H NE  1 
ATOM   6438 C CZ  . ARG H 1 19  ? 12.221  -27.405 31.603  1.00 77.00  ? 572 ARG H CZ  1 
ATOM   6439 N NH1 . ARG H 1 19  ? 13.153  -27.904 32.409  1.00 93.69  ? 572 ARG H NH1 1 
ATOM   6440 N NH2 . ARG H 1 19  ? 12.148  -27.847 30.346  1.00 69.59  ? 572 ARG H NH2 1 
ATOM   6441 N N   . SER H 1 20  ? 5.511   -27.634 31.905  1.00 44.00  ? 573 SER H N   1 
ATOM   6442 C CA  . SER H 1 20  ? 4.373   -27.157 31.129  1.00 48.23  ? 573 SER H CA  1 
ATOM   6443 C C   . SER H 1 20  ? 3.120   -27.073 32.014  1.00 45.96  ? 573 SER H C   1 
ATOM   6444 O O   . SER H 1 20  ? 2.271   -26.186 31.802  1.00 39.70  ? 573 SER H O   1 
ATOM   6445 C CB  . SER H 1 20  ? 4.167   -27.985 29.853  1.00 48.63  ? 573 SER H CB  1 
ATOM   6446 O OG  . SER H 1 20  ? 3.370   -29.130 30.078  1.00 65.43  ? 573 SER H OG  1 
ATOM   6447 N N   . VAL H 1 21  ? 3.021   -27.953 33.018  1.00 39.70  ? 574 VAL H N   1 
ATOM   6448 C CA  . VAL H 1 21  ? 1.924   -27.863 34.000  1.00 35.33  ? 574 VAL H CA  1 
ATOM   6449 C C   . VAL H 1 21  ? 2.016   -26.526 34.734  1.00 33.15  ? 574 VAL H C   1 
ATOM   6450 O O   . VAL H 1 21  ? 1.060   -25.740 34.793  1.00 38.61  ? 574 VAL H O   1 
ATOM   6451 C CB  . VAL H 1 21  ? 1.914   -29.069 34.961  1.00 26.98  ? 574 VAL H CB  1 
ATOM   6452 C CG1 . VAL H 1 21  ? 0.948   -28.871 36.139  1.00 22.79  ? 574 VAL H CG1 1 
ATOM   6453 C CG2 . VAL H 1 21  ? 1.554   -30.331 34.202  1.00 24.14  ? 574 VAL H CG2 1 
ATOM   6454 N N   . LEU H 1 22  ? 3.200   -26.244 35.232  1.00 33.17  ? 575 LEU H N   1 
ATOM   6455 C CA  . LEU H 1 22  ? 3.458   -25.000 35.936  1.00 37.39  ? 575 LEU H CA  1 
ATOM   6456 C C   . LEU H 1 22  ? 3.159   -23.751 35.117  1.00 37.84  ? 575 LEU H C   1 
ATOM   6457 O O   . LEU H 1 22  ? 2.596   -22.804 35.629  1.00 39.87  ? 575 LEU H O   1 
ATOM   6458 C CB  . LEU H 1 22  ? 4.916   -24.948 36.410  1.00 29.04  ? 575 LEU H CB  1 
ATOM   6459 C CG  . LEU H 1 22  ? 5.218   -23.883 37.439  1.00 28.43  ? 575 LEU H CG  1 
ATOM   6460 C CD1 . LEU H 1 22  ? 4.241   -23.965 38.658  1.00 23.37  ? 575 LEU H CD1 1 
ATOM   6461 C CD2 . LEU H 1 22  ? 6.671   -24.053 37.895  1.00 45.11  ? 575 LEU H CD2 1 
ATOM   6462 N N   . ASP H 1 23  ? 3.557   -23.740 33.855  1.00 39.57  ? 576 ASP H N   1 
ATOM   6463 C CA  . ASP H 1 23  ? 3.256   -22.605 32.997  1.00 42.87  ? 576 ASP H CA  1 
ATOM   6464 C C   . ASP H 1 23  ? 1.748   -22.460 32.913  1.00 42.10  ? 576 ASP H C   1 
ATOM   6465 O O   . ASP H 1 23  ? 1.221   -21.336 32.940  1.00 41.90  ? 576 ASP H O   1 
ATOM   6466 C CB  . ASP H 1 23  ? 3.840   -22.804 31.583  1.00 47.76  ? 576 ASP H CB  1 
ATOM   6467 C CG  . ASP H 1 23  ? 5.376   -22.838 31.565  1.00 52.51  ? 576 ASP H CG  1 
ATOM   6468 O OD1 . ASP H 1 23  ? 6.015   -22.466 32.580  1.00 56.07  ? 576 ASP H OD1 1 
ATOM   6469 O OD2 . ASP H 1 23  ? 5.935   -23.253 30.529  1.00 59.56  ? 576 ASP H OD2 1 
ATOM   6470 N N   . GLN H 1 24  ? 1.055   -23.603 32.820  1.00 38.47  ? 577 GLN H N   1 
ATOM   6471 C CA  . GLN H 1 24  ? -0.386  -23.587 32.658  1.00 34.98  ? 577 GLN H CA  1 
ATOM   6472 C C   . GLN H 1 24  ? -1.029  -23.129 33.940  1.00 40.55  ? 577 GLN H C   1 
ATOM   6473 O O   . GLN H 1 24  ? -2.030  -22.421 33.894  1.00 32.14  ? 577 GLN H O   1 
ATOM   6474 C CB  . GLN H 1 24  ? -0.933  -24.929 32.227  1.00 32.90  ? 577 GLN H CB  1 
ATOM   6475 C CG  . GLN H 1 24  ? -0.666  -25.257 30.774  1.00 40.95  ? 577 GLN H CG  1 
ATOM   6476 C CD  . GLN H 1 24  ? -1.504  -26.417 30.252  1.00 40.73  ? 577 GLN H CD  1 
ATOM   6477 O OE1 . GLN H 1 24  ? -2.304  -26.998 30.985  1.00 46.20  ? 577 GLN H OE1 1 
ATOM   6478 N NE2 . GLN H 1 24  ? -1.341  -26.742 28.971  1.00 41.95  ? 577 GLN H NE2 1 
ATOM   6479 N N   . LEU H 1 25  ? -0.432  -23.501 35.077  1.00 42.10  ? 578 LEU H N   1 
ATOM   6480 C CA  . LEU H 1 25  ? -0.948  -23.068 36.384  1.00 41.03  ? 578 LEU H CA  1 
ATOM   6481 C C   . LEU H 1 25  ? -0.716  -21.580 36.559  1.00 41.20  ? 578 LEU H C   1 
ATOM   6482 O O   . LEU H 1 25  ? -1.607  -20.849 36.999  1.00 39.01  ? 578 LEU H O   1 
ATOM   6483 C CB  . LEU H 1 25  ? -0.270  -23.821 37.543  1.00 36.26  ? 578 LEU H CB  1 
ATOM   6484 C CG  . LEU H 1 25  ? -0.617  -25.302 37.645  1.00 39.75  ? 578 LEU H CG  1 
ATOM   6485 C CD1 . LEU H 1 25  ? 0.284   -25.978 38.680  1.00 30.85  ? 578 LEU H CD1 1 
ATOM   6486 C CD2 . LEU H 1 25  ? -2.107  -25.466 37.966  1.00 28.09  ? 578 LEU H CD2 1 
ATOM   6487 N N   . GLN H 1 26  ? 0.491   -21.141 36.222  1.00 42.49  ? 579 GLN H N   1 
ATOM   6488 C CA  . GLN H 1 26  ? 0.853   -19.728 36.328  1.00 47.73  ? 579 GLN H CA  1 
ATOM   6489 C C   . GLN H 1 26  ? -0.066  -18.844 35.432  1.00 44.58  ? 579 GLN H C   1 
ATOM   6490 O O   . GLN H 1 26  ? -0.342  -17.704 35.774  1.00 49.97  ? 579 GLN H O   1 
ATOM   6491 C CB  . GLN H 1 26  ? 2.360   -19.547 36.042  1.00 48.67  ? 579 GLN H CB  1 
ATOM   6492 C CG  . GLN H 1 26  ? 2.998   -18.274 36.632  1.00 65.38  ? 579 GLN H CG  1 
ATOM   6493 C CD  . GLN H 1 26  ? 4.287   -18.527 37.449  1.00 66.30  ? 579 GLN H CD  1 
ATOM   6494 O OE1 . GLN H 1 26  ? 5.109   -19.377 37.098  1.00 47.43  ? 579 GLN H OE1 1 
ATOM   6495 N NE2 . GLN H 1 26  ? 4.461   -17.761 38.542  1.00 53.76  ? 579 GLN H NE2 1 
ATOM   6496 N N   . ASP H 1 27  ? -0.579  -19.403 34.335  1.00 43.42  ? 580 ASP H N   1 
ATOM   6497 C CA  . ASP H 1 27  ? -1.541  -18.715 33.451  1.00 54.31  ? 580 ASP H CA  1 
ATOM   6498 C C   . ASP H 1 27  ? -2.950  -18.605 34.037  1.00 54.48  ? 580 ASP H C   1 
ATOM   6499 O O   . ASP H 1 27  ? -3.793  -17.842 33.538  1.00 54.61  ? 580 ASP H O   1 
ATOM   6500 C CB  . ASP H 1 27  ? -1.667  -19.451 32.099  1.00 61.10  ? 580 ASP H CB  1 
ATOM   6501 C CG  . ASP H 1 27  ? -0.424  -19.316 31.215  1.00 71.48  ? 580 ASP H CG  1 
ATOM   6502 O OD1 . ASP H 1 27  ? 0.298   -18.303 31.328  1.00 67.71  ? 580 ASP H OD1 1 
ATOM   6503 O OD2 . ASP H 1 27  ? -0.183  -20.231 30.393  1.00 72.36  ? 580 ASP H OD2 1 
ATOM   6504 N N   . LYS H 1 28  ? -3.222  -19.410 35.054  1.00 50.81  ? 581 LYS H N   1 
ATOM   6505 C CA  . LYS H 1 28  ? -4.482  -19.328 35.778  1.00 51.30  ? 581 LYS H CA  1 
ATOM   6506 C C   . LYS H 1 28  ? -4.416  -18.252 36.841  1.00 49.92  ? 581 LYS H C   1 
ATOM   6507 O O   . LYS H 1 28  ? -5.418  -17.998 37.513  1.00 47.86  ? 581 LYS H O   1 
ATOM   6508 C CB  . LYS H 1 28  ? -4.825  -20.678 36.417  1.00 49.90  ? 581 LYS H CB  1 
ATOM   6509 C CG  . LYS H 1 28  ? -5.748  -21.569 35.607  1.00 49.65  ? 581 LYS H CG  1 
ATOM   6510 C CD  . LYS H 1 28  ? -5.383  -21.662 34.176  1.00 42.96  ? 581 LYS H CD  1 
ATOM   6511 C CE  . LYS H 1 28  ? -6.195  -22.713 33.492  1.00 61.43  ? 581 LYS H CE  1 
ATOM   6512 N NZ  . LYS H 1 28  ? -5.757  -22.811 32.107  1.00 44.34  ? 581 LYS H NZ  1 
ATOM   6513 N N   . ASP H 1 29  ? -3.241  -17.630 36.997  1.00 51.62  ? 582 ASP H N   1 
ATOM   6514 C CA  . ASP H 1 29  ? -3.022  -16.545 37.973  1.00 48.27  ? 582 ASP H CA  1 
ATOM   6515 C C   . ASP H 1 29  ? -2.485  -15.314 37.266  1.00 49.17  ? 582 ASP H C   1 
ATOM   6516 O O   . ASP H 1 29  ? -1.347  -14.914 37.502  1.00 44.26  ? 582 ASP H O   1 
ATOM   6517 C CB  . ASP H 1 29  ? -2.017  -17.003 39.033  1.00 49.24  ? 582 ASP H CB  1 
ATOM   6518 C CG  . ASP H 1 29  ? -1.623  -15.896 40.020  1.00 60.31  ? 582 ASP H CG  1 
ATOM   6519 O OD1 . ASP H 1 29  ? -0.430  -15.872 40.415  1.00 53.32  ? 582 ASP H OD1 1 
ATOM   6520 O OD2 . ASP H 1 29  ? -2.492  -15.057 40.394  1.00 63.49  ? 582 ASP H OD2 1 
ATOM   6521 N N   . PRO H 1 30  ? -3.286  -14.728 36.366  1.00 56.02  ? 583 PRO H N   1 
ATOM   6522 C CA  . PRO H 1 30  ? -2.804  -13.550 35.652  1.00 61.33  ? 583 PRO H CA  1 
ATOM   6523 C C   . PRO H 1 30  ? -2.493  -12.424 36.630  1.00 66.35  ? 583 PRO H C   1 
ATOM   6524 O O   . PRO H 1 30  ? -1.486  -11.735 36.464  1.00 67.94  ? 583 PRO H O   1 
ATOM   6525 C CB  . PRO H 1 30  ? -3.974  -13.186 34.727  1.00 62.96  ? 583 PRO H CB  1 
ATOM   6526 C CG  . PRO H 1 30  ? -5.169  -13.826 35.333  1.00 64.96  ? 583 PRO H CG  1 
ATOM   6527 C CD  . PRO H 1 30  ? -4.665  -15.078 35.983  1.00 60.65  ? 583 PRO H CD  1 
ATOM   6528 N N   . ALA H 1 31  ? -3.329  -12.290 37.664  1.00 67.55  ? 584 ALA H N   1 
ATOM   6529 C CA  . ALA H 1 31  ? -3.134  -11.317 38.751  1.00 67.84  ? 584 ALA H CA  1 
ATOM   6530 C C   . ALA H 1 31  ? -1.740  -11.327 39.409  1.00 63.43  ? 584 ALA H C   1 
ATOM   6531 O O   . ALA H 1 31  ? -1.355  -10.338 40.019  1.00 60.91  ? 584 ALA H O   1 
ATOM   6532 C CB  . ALA H 1 31  ? -4.237  -11.499 39.829  1.00 65.20  ? 584 ALA H CB  1 
ATOM   6533 N N   . ARG H 1 32  ? -1.011  -12.440 39.291  1.00 61.77  ? 585 ARG H N   1 
ATOM   6534 C CA  . ARG H 1 32  ? 0.363   -12.600 39.825  1.00 63.29  ? 585 ARG H CA  1 
ATOM   6535 C C   . ARG H 1 32  ? 0.412   -12.755 41.375  1.00 60.41  ? 585 ARG H C   1 
ATOM   6536 O O   . ARG H 1 32  ? 1.490   -12.765 41.996  1.00 53.76  ? 585 ARG H O   1 
ATOM   6537 C CB  . ARG H 1 32  ? 1.269   -11.460 39.336  1.00 67.45  ? 585 ARG H CB  1 
ATOM   6538 C CG  . ARG H 1 32  ? 2.575   -11.924 38.658  1.00 76.71  ? 585 ARG H CG  1 
ATOM   6539 C CD  . ARG H 1 32  ? 2.323   -12.597 37.317  1.00 57.18  ? 585 ARG H CD  1 
ATOM   6540 N N   . ILE H 1 33  ? -0.770  -12.939 41.966  1.00 56.90  ? 586 ILE H N   1 
ATOM   6541 C CA  . ILE H 1 33  ? -0.971  -13.061 43.416  1.00 51.78  ? 586 ILE H CA  1 
ATOM   6542 C C   . ILE H 1 33  ? -0.120  -14.143 44.079  1.00 44.66  ? 586 ILE H C   1 
ATOM   6543 O O   . ILE H 1 33  ? 0.161   -14.046 45.256  1.00 41.64  ? 586 ILE H O   1 
ATOM   6544 C CB  . ILE H 1 33  ? -2.462  -13.393 43.731  1.00 50.05  ? 586 ILE H CB  1 
ATOM   6545 C CG1 . ILE H 1 33  ? -3.386  -12.296 43.197  1.00 43.57  ? 586 ILE H CG1 1 
ATOM   6546 C CG2 . ILE H 1 33  ? -2.689  -13.596 45.241  1.00 51.50  ? 586 ILE H CG2 1 
ATOM   6547 C CD1 . ILE H 1 33  ? -4.718  -12.212 43.926  1.00 50.09  ? 586 ILE H CD1 1 
ATOM   6548 N N   . PHE H 1 34  ? 0.241   -15.175 43.322  1.00 38.05  ? 587 PHE H N   1 
ATOM   6549 C CA  . PHE H 1 34  ? 0.927   -16.358 43.836  1.00 34.11  ? 587 PHE H CA  1 
ATOM   6550 C C   . PHE H 1 34  ? 2.294   -16.587 43.203  1.00 42.17  ? 587 PHE H C   1 
ATOM   6551 O O   . PHE H 1 34  ? 2.863   -17.675 43.350  1.00 44.42  ? 587 PHE H O   1 
ATOM   6552 C CB  . PHE H 1 34  ? 0.041   -17.585 43.595  1.00 20.32  ? 587 PHE H CB  1 
ATOM   6553 C CG  . PHE H 1 34  ? -1.243  -17.508 44.307  1.00 31.36  ? 587 PHE H CG  1 
ATOM   6554 C CD1 . PHE H 1 34  ? -1.268  -17.644 45.672  1.00 40.40  ? 587 PHE H CD1 1 
ATOM   6555 C CD2 . PHE H 1 34  ? -2.414  -17.187 43.635  1.00 31.15  ? 587 PHE H CD2 1 
ATOM   6556 C CE1 . PHE H 1 34  ? -2.443  -17.523 46.348  1.00 55.39  ? 587 PHE H CE1 1 
ATOM   6557 C CE2 . PHE H 1 34  ? -3.578  -17.082 44.296  1.00 39.94  ? 587 PHE H CE2 1 
ATOM   6558 C CZ  . PHE H 1 34  ? -3.597  -17.244 45.668  1.00 30.82  ? 587 PHE H CZ  1 
ATOM   6559 N N   . ALA H 1 35  ? 2.801   -15.556 42.517  1.00 47.36  ? 588 ALA H N   1 
ATOM   6560 C CA  . ALA H 1 35  ? 3.991   -15.634 41.677  1.00 45.94  ? 588 ALA H CA  1 
ATOM   6561 C C   . ALA H 1 35  ? 5.257   -15.808 42.480  1.00 49.70  ? 588 ALA H C   1 
ATOM   6562 O O   . ALA H 1 35  ? 6.122   -16.601 42.122  1.00 42.21  ? 588 ALA H O   1 
ATOM   6563 C CB  . ALA H 1 35  ? 4.114   -14.364 40.858  1.00 54.84  ? 588 ALA H CB  1 
ATOM   6564 N N   . GLN H 1 36  ? 5.362   -15.029 43.553  1.00 56.39  ? 589 GLN H N   1 
ATOM   6565 C CA  . GLN H 1 36  ? 6.547   -15.005 44.411  1.00 61.91  ? 589 GLN H CA  1 
ATOM   6566 C C   . GLN H 1 36  ? 6.110   -15.185 45.875  1.00 60.97  ? 589 GLN H C   1 
ATOM   6567 O O   . GLN H 1 36  ? 4.929   -14.986 46.204  1.00 54.93  ? 589 GLN H O   1 
ATOM   6568 C CB  . GLN H 1 36  ? 7.319   -13.682 44.228  1.00 65.74  ? 589 GLN H CB  1 
ATOM   6569 C CG  . GLN H 1 36  ? 8.052   -13.532 42.872  1.00 74.89  ? 589 GLN H CG  1 
ATOM   6570 C CD  . GLN H 1 36  ? 9.470   -14.149 42.825  1.00 78.35  ? 589 GLN H CD  1 
ATOM   6571 O OE1 . GLN H 1 36  ? 10.124  -14.352 43.853  1.00 51.25  ? 589 GLN H OE1 1 
ATOM   6572 N NE2 . GLN H 1 36  ? 9.948   -14.423 41.607  1.00 65.57  ? 589 GLN H NE2 1 
ATOM   6573 N N   . PRO H 1 37  ? 7.058   -15.571 46.758  1.00 55.37  ? 590 PRO H N   1 
ATOM   6574 C CA  . PRO H 1 37  ? 6.700   -15.779 48.153  1.00 54.51  ? 590 PRO H CA  1 
ATOM   6575 C C   . PRO H 1 37  ? 6.074   -14.532 48.771  1.00 55.14  ? 590 PRO H C   1 
ATOM   6576 O O   . PRO H 1 37  ? 6.574   -13.434 48.561  1.00 64.85  ? 590 PRO H O   1 
ATOM   6577 C CB  . PRO H 1 37  ? 8.042   -16.090 48.830  1.00 56.68  ? 590 PRO H CB  1 
ATOM   6578 C CG  . PRO H 1 37  ? 8.960   -16.476 47.769  1.00 55.10  ? 590 PRO H CG  1 
ATOM   6579 C CD  . PRO H 1 37  ? 8.487   -15.825 46.507  1.00 58.54  ? 590 PRO H CD  1 
ATOM   6580 N N   . VAL H 1 38  ? 4.962   -14.707 49.478  1.00 50.53  ? 591 VAL H N   1 
ATOM   6581 C CA  . VAL H 1 38  ? 4.394   -13.670 50.320  1.00 49.73  ? 591 VAL H CA  1 
ATOM   6582 C C   . VAL H 1 38  ? 5.512   -13.053 51.173  1.00 53.21  ? 591 VAL H C   1 
ATOM   6583 O O   . VAL H 1 38  ? 6.191   -13.763 51.888  1.00 54.60  ? 591 VAL H O   1 
ATOM   6584 C CB  . VAL H 1 38  ? 3.319   -14.275 51.260  1.00 53.34  ? 591 VAL H CB  1 
ATOM   6585 C CG1 . VAL H 1 38  ? 3.810   -15.576 51.848  1.00 51.64  ? 591 VAL H CG1 1 
ATOM   6586 C CG2 . VAL H 1 38  ? 2.987   -13.321 52.392  1.00 34.70  ? 591 VAL H CG2 1 
ATOM   6587 N N   . SER H 1 39  ? 5.715   -11.746 51.100  1.00 55.16  ? 592 SER H N   1 
ATOM   6588 C CA  . SER H 1 39  ? 6.807   -11.124 51.877  1.00 61.96  ? 592 SER H CA  1 
ATOM   6589 C C   . SER H 1 39  ? 6.481   -11.063 53.369  1.00 58.35  ? 592 SER H C   1 
ATOM   6590 O O   . SER H 1 39  ? 5.430   -10.543 53.769  1.00 51.07  ? 592 SER H O   1 
ATOM   6591 C CB  . SER H 1 39  ? 7.139   -9.707  51.387  1.00 63.99  ? 592 SER H CB  1 
ATOM   6592 O OG  . SER H 1 39  ? 8.019   -9.043  52.297  1.00 59.15  ? 592 SER H OG  1 
ATOM   6593 N N   . LEU H 1 40  ? 7.412   -11.572 54.175  1.00 56.34  ? 593 LEU H N   1 
ATOM   6594 C CA  . LEU H 1 40  ? 7.276   -11.574 55.617  1.00 57.49  ? 593 LEU H CA  1 
ATOM   6595 C C   . LEU H 1 40  ? 7.220   -10.155 56.193  1.00 61.60  ? 593 LEU H C   1 
ATOM   6596 O O   . LEU H 1 40  ? 6.629   -9.928  57.251  1.00 58.12  ? 593 LEU H O   1 
ATOM   6597 C CB  . LEU H 1 40  ? 8.430   -12.354 56.261  1.00 60.03  ? 593 LEU H CB  1 
ATOM   6598 C CG  . LEU H 1 40  ? 8.573   -13.843 55.907  1.00 65.37  ? 593 LEU H CG  1 
ATOM   6599 C CD1 . LEU H 1 40  ? 9.570   -14.551 56.850  1.00 56.86  ? 593 LEU H CD1 1 
ATOM   6600 C CD2 . LEU H 1 40  ? 7.228   -14.527 55.926  1.00 52.92  ? 593 LEU H CD2 1 
ATOM   6601 N N   . LYS H 1 41  ? 7.834   -9.204  55.499  1.00 64.21  ? 594 LYS H N   1 
ATOM   6602 C CA  . LYS H 1 41  ? 7.790   -7.808  55.922  1.00 67.40  ? 594 LYS H CA  1 
ATOM   6603 C C   . LYS H 1 41  ? 6.396   -7.153  55.749  1.00 61.72  ? 594 LYS H C   1 
ATOM   6604 O O   . LYS H 1 41  ? 5.972   -6.377  56.601  1.00 59.41  ? 594 LYS H O   1 
ATOM   6605 C CB  . LYS H 1 41  ? 8.897   -7.008  55.216  1.00 74.29  ? 594 LYS H CB  1 
ATOM   6606 C CG  . LYS H 1 41  ? 10.305  -7.224  55.825  1.00 80.31  ? 594 LYS H CG  1 
ATOM   6607 C CD  . LYS H 1 41  ? 10.475  -6.536  57.193  1.00 90.04  ? 594 LYS H CD  1 
ATOM   6608 C CE  . LYS H 1 41  ? 10.560  -5.002  57.069  1.00 101.08 ? 594 LYS H CE  1 
ATOM   6609 N NZ  . LYS H 1 41  ? 10.275  -4.302  58.363  1.00 90.64  ? 594 LYS H NZ  1 
ATOM   6610 N N   . GLU H 1 42  ? 5.684   -7.488  54.679  1.00 55.38  ? 595 GLU H N   1 
ATOM   6611 C CA  . GLU H 1 42  ? 4.320   -6.987  54.451  1.00 56.52  ? 595 GLU H CA  1 
ATOM   6612 C C   . GLU H 1 42  ? 3.239   -7.714  55.272  1.00 55.10  ? 595 GLU H C   1 
ATOM   6613 O O   . GLU H 1 42  ? 2.230   -7.095  55.656  1.00 55.66  ? 595 GLU H O   1 
ATOM   6614 C CB  . GLU H 1 42  ? 3.976   -7.062  52.956  1.00 57.78  ? 595 GLU H CB  1 
ATOM   6615 C CG  . GLU H 1 42  ? 4.348   -5.796  52.192  1.00 75.49  ? 595 GLU H CG  1 
ATOM   6616 C CD  . GLU H 1 42  ? 4.623   -6.018  50.708  1.00 86.93  ? 595 GLU H CD  1 
ATOM   6617 O OE1 . GLU H 1 42  ? 5.273   -5.133  50.117  1.00 95.02  ? 595 GLU H OE1 1 
ATOM   6618 O OE2 . GLU H 1 42  ? 4.203   -7.053  50.131  1.00 75.10  ? 595 GLU H OE2 1 
ATOM   6619 N N   . VAL H 1 43  ? 3.445   -9.014  55.532  1.00 53.29  ? 596 VAL H N   1 
ATOM   6620 C CA  . VAL H 1 43  ? 2.539   -9.834  56.368  1.00 46.74  ? 596 VAL H CA  1 
ATOM   6621 C C   . VAL H 1 43  ? 3.388   -10.464 57.473  1.00 44.91  ? 596 VAL H C   1 
ATOM   6622 O O   . VAL H 1 43  ? 3.721   -11.637 57.424  1.00 46.69  ? 596 VAL H O   1 
ATOM   6623 C CB  . VAL H 1 43  ? 1.797   -10.952 55.558  1.00 45.00  ? 596 VAL H CB  1 
ATOM   6624 C CG1 . VAL H 1 43  ? 0.738   -11.592 56.404  1.00 53.88  ? 596 VAL H CG1 1 
ATOM   6625 C CG2 . VAL H 1 43  ? 1.167   -10.404 54.261  1.00 50.71  ? 596 VAL H CG2 1 
ATOM   6626 N N   . PRO H 1 44  ? 3.731   -9.679  58.496  1.00 50.63  ? 597 PRO H N   1 
ATOM   6627 C CA  . PRO H 1 44  ? 4.676   -10.116 59.531  1.00 44.95  ? 597 PRO H CA  1 
ATOM   6628 C C   . PRO H 1 44  ? 4.214   -11.217 60.491  1.00 37.57  ? 597 PRO H C   1 
ATOM   6629 O O   . PRO H 1 44  ? 5.055   -11.835 61.136  1.00 36.64  ? 597 PRO H O   1 
ATOM   6630 C CB  . PRO H 1 44  ? 4.977   -8.829  60.305  1.00 39.86  ? 597 PRO H CB  1 
ATOM   6631 C CG  . PRO H 1 44  ? 4.267   -7.741  59.635  1.00 57.07  ? 597 PRO H CG  1 
ATOM   6632 C CD  . PRO H 1 44  ? 3.225   -8.325  58.761  1.00 57.05  ? 597 PRO H CD  1 
ATOM   6633 N N   . ASP H 1 45  ? 2.911   -11.446 60.608  1.00 36.86  ? 598 ASP H N   1 
ATOM   6634 C CA  . ASP H 1 45  ? 2.397   -12.594 61.373  1.00 36.24  ? 598 ASP H CA  1 
ATOM   6635 C C   . ASP H 1 45  ? 2.257   -13.863 60.526  1.00 35.05  ? 598 ASP H C   1 
ATOM   6636 O O   . ASP H 1 45  ? 1.765   -14.865 61.008  1.00 34.47  ? 598 ASP H O   1 
ATOM   6637 C CB  . ASP H 1 45  ? 1.045   -12.245 62.003  1.00 39.81  ? 598 ASP H CB  1 
ATOM   6638 C CG  . ASP H 1 45  ? -0.041  -12.008 60.968  1.00 40.10  ? 598 ASP H CG  1 
ATOM   6639 O OD1 . ASP H 1 45  ? 0.307   -11.663 59.824  1.00 44.88  ? 598 ASP H OD1 1 
ATOM   6640 O OD2 . ASP H 1 45  ? -1.241  -12.170 61.298  1.00 34.45  ? 598 ASP H OD2 1 
ATOM   6641 N N   . TYR H 1 46  ? 2.719   -13.852 59.275  1.00 36.65  ? 599 TYR H N   1 
ATOM   6642 C CA  . TYR H 1 46  ? 2.442   -14.985 58.379  1.00 31.12  ? 599 TYR H CA  1 
ATOM   6643 C C   . TYR H 1 46  ? 2.829   -16.327 58.999  1.00 31.12  ? 599 TYR H C   1 
ATOM   6644 O O   . TYR H 1 46  ? 2.025   -17.255 59.025  1.00 27.94  ? 599 TYR H O   1 
ATOM   6645 C CB  . TYR H 1 46  ? 3.102   -14.776 57.022  1.00 28.52  ? 599 TYR H CB  1 
ATOM   6646 C CG  . TYR H 1 46  ? 2.534   -15.635 55.926  1.00 31.02  ? 599 TYR H CG  1 
ATOM   6647 C CD1 . TYR H 1 46  ? 1.209   -15.520 55.542  1.00 33.01  ? 599 TYR H CD1 1 
ATOM   6648 C CD2 . TYR H 1 46  ? 3.325   -16.550 55.265  1.00 23.98  ? 599 TYR H CD2 1 
ATOM   6649 C CE1 . TYR H 1 46  ? 0.700   -16.284 54.535  1.00 31.46  ? 599 TYR H CE1 1 
ATOM   6650 C CE2 . TYR H 1 46  ? 2.822   -17.329 54.233  1.00 38.26  ? 599 TYR H CE2 1 
ATOM   6651 C CZ  . TYR H 1 46  ? 1.508   -17.188 53.879  1.00 46.67  ? 599 TYR H CZ  1 
ATOM   6652 O OH  . TYR H 1 46  ? 1.006   -17.966 52.873  1.00 33.95  ? 599 TYR H OH  1 
ATOM   6653 N N   . LEU H 1 47  ? 4.034   -16.416 59.554  1.00 28.98  ? 600 LEU H N   1 
ATOM   6654 C CA  . LEU H 1 47  ? 4.492   -17.656 60.188  1.00 23.74  ? 600 LEU H CA  1 
ATOM   6655 C C   . LEU H 1 47  ? 3.820   -18.051 61.502  1.00 29.83  ? 600 LEU H C   1 
ATOM   6656 O O   . LEU H 1 47  ? 4.094   -19.135 62.023  1.00 31.29  ? 600 LEU H O   1 
ATOM   6657 C CB  . LEU H 1 47  ? 6.014   -17.628 60.359  1.00 25.23  ? 600 LEU H CB  1 
ATOM   6658 C CG  . LEU H 1 47  ? 6.747   -17.560 58.992  1.00 30.36  ? 600 LEU H CG  1 
ATOM   6659 C CD1 . LEU H 1 47  ? 8.210   -17.295 59.204  1.00 29.35  ? 600 LEU H CD1 1 
ATOM   6660 C CD2 . LEU H 1 47  ? 6.534   -18.819 58.121  1.00 30.05  ? 600 LEU H CD2 1 
ATOM   6661 N N   . ASP H 1 48  ? 2.981   -17.175 62.068  1.00 34.03  ? 601 ASP H N   1 
ATOM   6662 C CA  . ASP H 1 48  ? 2.130   -17.554 63.207  1.00 35.93  ? 601 ASP H CA  1 
ATOM   6663 C C   . ASP H 1 48  ? 1.021   -18.479 62.723  1.00 33.30  ? 601 ASP H C   1 
ATOM   6664 O O   . ASP H 1 48  ? 0.480   -19.233 63.498  1.00 36.28  ? 601 ASP H O   1 
ATOM   6665 C CB  . ASP H 1 48  ? 1.449   -16.341 63.888  1.00 35.46  ? 601 ASP H CB  1 
ATOM   6666 C CG  . ASP H 1 48  ? 2.387   -15.513 64.776  1.00 36.99  ? 601 ASP H CG  1 
ATOM   6667 O OD1 . ASP H 1 48  ? 3.459   -15.994 65.181  1.00 35.81  ? 601 ASP H OD1 1 
ATOM   6668 O OD2 . ASP H 1 48  ? 2.015   -14.362 65.101  1.00 35.72  ? 601 ASP H OD2 1 
ATOM   6669 N N   . HIS H 1 49  ? 0.653   -18.372 61.448  1.00 35.98  ? 602 HIS H N   1 
ATOM   6670 C CA  . HIS H 1 49  ? -0.504  -19.086 60.890  1.00 32.98  ? 602 HIS H CA  1 
ATOM   6671 C C   . HIS H 1 49  ? -0.143  -20.139 59.858  1.00 36.77  ? 602 HIS H C   1 
ATOM   6672 O O   . HIS H 1 49  ? -0.852  -21.116 59.690  1.00 37.12  ? 602 HIS H O   1 
ATOM   6673 C CB  . HIS H 1 49  ? -1.453  -18.052 60.277  1.00 37.76  ? 602 HIS H CB  1 
ATOM   6674 C CG  . HIS H 1 49  ? -2.040  -17.115 61.292  1.00 43.50  ? 602 HIS H CG  1 
ATOM   6675 N ND1 . HIS H 1 49  ? -1.810  -15.757 61.276  1.00 44.96  ? 602 HIS H ND1 1 
ATOM   6676 C CD2 . HIS H 1 49  ? -2.832  -17.350 62.369  1.00 44.32  ? 602 HIS H CD2 1 
ATOM   6677 C CE1 . HIS H 1 49  ? -2.461  -15.188 62.277  1.00 48.59  ? 602 HIS H CE1 1 
ATOM   6678 N NE2 . HIS H 1 49  ? -3.083  -16.134 62.960  1.00 57.33  ? 602 HIS H NE2 1 
ATOM   6679 N N   . ILE H 1 50  ? 0.989   -19.959 59.189  1.00 36.82  ? 603 ILE H N   1 
ATOM   6680 C CA  . ILE H 1 50  ? 1.425   -20.865 58.157  1.00 27.16  ? 603 ILE H CA  1 
ATOM   6681 C C   . ILE H 1 50  ? 2.775   -21.450 58.463  1.00 34.11  ? 603 ILE H C   1 
ATOM   6682 O O   . ILE H 1 50  ? 3.692   -20.748 58.845  1.00 32.27  ? 603 ILE H O   1 
ATOM   6683 C CB  . ILE H 1 50  ? 1.581   -20.110 56.852  1.00 30.83  ? 603 ILE H CB  1 
ATOM   6684 C CG1 . ILE H 1 50  ? 0.224   -19.576 56.396  1.00 32.94  ? 603 ILE H CG1 1 
ATOM   6685 C CG2 . ILE H 1 50  ? 2.257   -20.984 55.822  1.00 19.38  ? 603 ILE H CG2 1 
ATOM   6686 C CD1 . ILE H 1 50  ? -0.867  -20.601 56.430  1.00 29.71  ? 603 ILE H CD1 1 
ATOM   6687 N N   . LYS H 1 51  ? 2.898   -22.730 58.163  1.00 37.95  ? 604 LYS H N   1 
ATOM   6688 C CA  . LYS H 1 51  ? 3.983   -23.544 58.585  1.00 35.89  ? 604 LYS H CA  1 
ATOM   6689 C C   . LYS H 1 51  ? 4.954   -23.768 57.422  1.00 41.72  ? 604 LYS H C   1 
ATOM   6690 O O   . LYS H 1 51  ? 6.144   -23.967 57.672  1.00 39.89  ? 604 LYS H O   1 
ATOM   6691 C CB  . LYS H 1 51  ? 3.372   -24.849 59.059  1.00 39.94  ? 604 LYS H CB  1 
ATOM   6692 C CG  . LYS H 1 51  ? 4.118   -25.645 60.104  1.00 64.96  ? 604 LYS H CG  1 
ATOM   6693 C CD  . LYS H 1 51  ? 3.307   -26.918 60.503  1.00 83.27  ? 604 LYS H CD  1 
ATOM   6694 C CE  . LYS H 1 51  ? 3.404   -28.041 59.436  1.00 92.92  ? 604 LYS H CE  1 
ATOM   6695 N NZ  . LYS H 1 51  ? 2.435   -29.173 59.614  1.00 75.71  ? 604 LYS H NZ  1 
ATOM   6696 N N   . HIS H 1 52  ? 4.457   -23.785 56.166  1.00 37.95  ? 605 HIS H N   1 
ATOM   6697 C CA  . HIS H 1 52  ? 5.308   -23.999 54.953  1.00 24.62  ? 605 HIS H CA  1 
ATOM   6698 C C   . HIS H 1 52  ? 4.856   -23.129 53.789  1.00 34.37  ? 605 HIS H C   1 
ATOM   6699 O O   . HIS H 1 52  ? 4.015   -23.535 52.946  1.00 30.51  ? 605 HIS H O   1 
ATOM   6700 C CB  . HIS H 1 52  ? 5.367   -25.457 54.508  1.00 27.49  ? 605 HIS H CB  1 
ATOM   6701 C CG  . HIS H 1 52  ? 5.773   -26.414 55.587  1.00 60.95  ? 605 HIS H CG  1 
ATOM   6702 N ND1 . HIS H 1 52  ? 7.086   -26.599 55.971  1.00 73.88  ? 605 HIS H ND1 1 
ATOM   6703 C CD2 . HIS H 1 52  ? 5.032   -27.243 56.365  1.00 70.59  ? 605 HIS H CD2 1 
ATOM   6704 C CE1 . HIS H 1 52  ? 7.134   -27.497 56.941  1.00 70.02  ? 605 HIS H CE1 1 
ATOM   6705 N NE2 . HIS H 1 52  ? 5.901   -27.901 57.200  1.00 62.28  ? 605 HIS H NE2 1 
ATOM   6706 N N   . PRO H 1 53  ? 5.389   -21.903 53.731  1.00 37.84  ? 606 PRO H N   1 
ATOM   6707 C CA  . PRO H 1 53  ? 5.021   -20.989 52.658  1.00 32.91  ? 606 PRO H CA  1 
ATOM   6708 C C   . PRO H 1 53  ? 5.391   -21.594 51.313  1.00 34.17  ? 606 PRO H C   1 
ATOM   6709 O O   . PRO H 1 53  ? 6.381   -22.299 51.235  1.00 38.84  ? 606 PRO H O   1 
ATOM   6710 C CB  . PRO H 1 53  ? 5.885   -19.754 52.935  1.00 29.38  ? 606 PRO H CB  1 
ATOM   6711 C CG  . PRO H 1 53  ? 6.148   -19.793 54.333  1.00 39.91  ? 606 PRO H CG  1 
ATOM   6712 C CD  . PRO H 1 53  ? 6.218   -21.244 54.745  1.00 40.69  ? 606 PRO H CD  1 
ATOM   6713 N N   . MET H 1 54  ? 4.606   -21.306 50.275  1.00 32.92  ? 607 MET H N   1 
ATOM   6714 C CA  . MET H 1 54  ? 4.870   -21.814 48.956  1.00 31.08  ? 607 MET H CA  1 
ATOM   6715 C C   . MET H 1 54  ? 4.393   -20.826 47.916  1.00 36.48  ? 607 MET H C   1 
ATOM   6716 O O   . MET H 1 54  ? 3.438   -20.062 48.151  1.00 31.77  ? 607 MET H O   1 
ATOM   6717 C CB  . MET H 1 54  ? 4.173   -23.159 48.785  1.00 34.32  ? 607 MET H CB  1 
ATOM   6718 C CG  . MET H 1 54  ? 4.727   -24.106 47.713  1.00 35.85  ? 607 MET H CG  1 
ATOM   6719 S SD  . MET H 1 54  ? 6.452   -23.985 47.269  1.00 40.42  ? 607 MET H SD  1 
ATOM   6720 C CE  . MET H 1 54  ? 7.216   -25.061 48.523  1.00 31.15  ? 607 MET H CE  1 
ATOM   6721 N N   . ASP H 1 55  ? 5.058   -20.856 46.761  1.00 33.09  ? 608 ASP H N   1 
ATOM   6722 C CA  . ASP H 1 55  ? 4.634   -20.070 45.610  1.00 36.04  ? 608 ASP H CA  1 
ATOM   6723 C C   . ASP H 1 55  ? 5.234   -20.660 44.346  1.00 37.33  ? 608 ASP H C   1 
ATOM   6724 O O   . ASP H 1 55  ? 6.151   -21.477 44.397  1.00 34.35  ? 608 ASP H O   1 
ATOM   6725 C CB  . ASP H 1 55  ? 5.159   -18.655 45.750  1.00 42.83  ? 608 ASP H CB  1 
ATOM   6726 C CG  . ASP H 1 55  ? 6.669   -18.632 45.857  1.00 46.27  ? 608 ASP H CG  1 
ATOM   6727 O OD1 . ASP H 1 55  ? 7.194   -18.883 46.974  1.00 43.24  ? 608 ASP H OD1 1 
ATOM   6728 O OD2 . ASP H 1 55  ? 7.321   -18.419 44.811  1.00 61.22  ? 608 ASP H OD2 1 
ATOM   6729 N N   . PHE H 1 56  ? 4.749   -20.193 43.210  1.00 33.52  ? 609 PHE H N   1 
ATOM   6730 C CA  . PHE H 1 56  ? 5.181   -20.715 41.934  1.00 42.34  ? 609 PHE H CA  1 
ATOM   6731 C C   . PHE H 1 56  ? 6.676   -20.598 41.656  1.00 49.75  ? 609 PHE H C   1 
ATOM   6732 O O   . PHE H 1 56  ? 7.271   -21.534 41.117  1.00 50.02  ? 609 PHE H O   1 
ATOM   6733 C CB  . PHE H 1 56  ? 4.406   -20.046 40.823  1.00 38.95  ? 609 PHE H CB  1 
ATOM   6734 C CG  . PHE H 1 56  ? 2.962   -20.442 40.784  1.00 44.22  ? 609 PHE H CG  1 
ATOM   6735 C CD1 . PHE H 1 56  ? 2.582   -21.775 40.940  1.00 45.85  ? 609 PHE H CD1 1 
ATOM   6736 C CD2 . PHE H 1 56  ? 1.988   -19.502 40.554  1.00 35.79  ? 609 PHE H CD2 1 
ATOM   6737 C CE1 . PHE H 1 56  ? 1.274   -22.142 40.871  1.00 33.60  ? 609 PHE H CE1 1 
ATOM   6738 C CE2 . PHE H 1 56  ? 0.676   -19.867 40.488  1.00 31.31  ? 609 PHE H CE2 1 
ATOM   6739 C CZ  . PHE H 1 56  ? 0.311   -21.182 40.653  1.00 30.94  ? 609 PHE H CZ  1 
ATOM   6740 N N   . ALA H 1 57  ? 7.272   -19.468 42.022  1.00 46.72  ? 610 ALA H N   1 
ATOM   6741 C CA  . ALA H 1 57  ? 8.705   -19.266 41.842  1.00 51.07  ? 610 ALA H CA  1 
ATOM   6742 C C   . ALA H 1 57  ? 9.498   -20.344 42.576  1.00 48.60  ? 610 ALA H C   1 
ATOM   6743 O O   . ALA H 1 57  ? 10.419  -20.940 42.010  1.00 55.38  ? 610 ALA H O   1 
ATOM   6744 C CB  . ALA H 1 57  ? 9.120   -17.878 42.322  1.00 52.32  ? 610 ALA H CB  1 
ATOM   6745 N N   . THR H 1 58  ? 9.118   -20.609 43.818  1.00 45.62  ? 611 THR H N   1 
ATOM   6746 C CA  . THR H 1 58  ? 9.775   -21.640 44.626  1.00 50.53  ? 611 THR H CA  1 
ATOM   6747 C C   . THR H 1 58  ? 9.559   -23.036 44.052  1.00 47.84  ? 611 THR H C   1 
ATOM   6748 O O   . THR H 1 58  ? 10.428  -23.891 44.198  1.00 46.66  ? 611 THR H O   1 
ATOM   6749 C CB  . THR H 1 58  ? 9.276   -21.651 46.118  1.00 50.97  ? 611 THR H CB  1 
ATOM   6750 O OG1 . THR H 1 58  ? 9.237   -20.317 46.638  1.00 54.03  ? 611 THR H OG1 1 
ATOM   6751 C CG2 . THR H 1 58  ? 10.198  -22.503 46.996  1.00 38.77  ? 611 THR H CG2 1 
ATOM   6752 N N   . MET H 1 59  ? 8.393   -23.269 43.442  1.00 41.50  ? 612 MET H N   1 
ATOM   6753 C CA  . MET H 1 59  ? 8.117   -24.543 42.750  1.00 43.56  ? 612 MET H CA  1 
ATOM   6754 C C   . MET H 1 59  ? 9.013   -24.661 41.508  1.00 43.33  ? 612 MET H C   1 
ATOM   6755 O O   . MET H 1 59  ? 9.582   -25.730 41.275  1.00 45.77  ? 612 MET H O   1 
ATOM   6756 C CB  . MET H 1 59  ? 6.621   -24.691 42.353  1.00 34.93  ? 612 MET H CB  1 
ATOM   6757 C CG  . MET H 1 59  ? 5.611   -24.864 43.537  1.00 24.02  ? 612 MET H CG  1 
ATOM   6758 S SD  . MET H 1 59  ? 3.851   -24.892 42.968  1.00 33.61  ? 612 MET H SD  1 
ATOM   6759 C CE  . MET H 1 59  ? 3.870   -26.526 42.195  1.00 25.62  ? 612 MET H CE  1 
ATOM   6760 N N   . ARG H 1 60  ? 9.139   -23.574 40.734  1.00 44.84  ? 613 ARG H N   1 
ATOM   6761 C CA  . ARG H 1 60  ? 10.046  -23.532 39.577  1.00 55.17  ? 613 ARG H CA  1 
ATOM   6762 C C   . ARG H 1 60  ? 11.422  -23.994 39.983  1.00 57.27  ? 613 ARG H C   1 
ATOM   6763 O O   . ARG H 1 60  ? 12.003  -24.838 39.315  1.00 56.95  ? 613 ARG H O   1 
ATOM   6764 C CB  . ARG H 1 60  ? 10.220  -22.122 39.006  1.00 60.96  ? 613 ARG H CB  1 
ATOM   6765 C CG  . ARG H 1 60  ? 9.027   -21.576 38.275  1.00 76.95  ? 613 ARG H CG  1 
ATOM   6766 C CD  . ARG H 1 60  ? 9.362   -21.074 36.868  1.00 69.61  ? 613 ARG H CD  1 
ATOM   6767 N NE  . ARG H 1 60  ? 8.156   -20.482 36.292  1.00 73.66  ? 613 ARG H NE  1 
ATOM   6768 C CZ  . ARG H 1 60  ? 7.417   -21.001 35.311  1.00 81.95  ? 613 ARG H CZ  1 
ATOM   6769 N NH1 . ARG H 1 60  ? 7.749   -22.140 34.697  1.00 71.71  ? 613 ARG H NH1 1 
ATOM   6770 N NH2 . ARG H 1 60  ? 6.335   -20.344 34.915  1.00 93.87  ? 613 ARG H NH2 1 
ATOM   6771 N N   . LYS H 1 61  ? 11.935  -23.419 41.073  1.00 49.27  ? 614 LYS H N   1 
ATOM   6772 C CA  . LYS H 1 61  ? 13.272  -23.743 41.536  1.00 58.07  ? 614 LYS H CA  1 
ATOM   6773 C C   . LYS H 1 61  ? 13.358  -25.226 41.824  1.00 58.39  ? 614 LYS H C   1 
ATOM   6774 O O   . LYS H 1 61  ? 14.153  -25.921 41.211  1.00 65.52  ? 614 LYS H O   1 
ATOM   6775 C CB  . LYS H 1 61  ? 13.690  -22.898 42.758  1.00 63.27  ? 614 LYS H CB  1 
ATOM   6776 C CG  . LYS H 1 61  ? 14.424  -21.588 42.396  1.00 62.79  ? 614 LYS H CG  1 
ATOM   6777 N N   . ARG H 1 62  ? 12.518  -25.728 42.716  1.00 57.20  ? 615 ARG H N   1 
ATOM   6778 C CA  . ARG H 1 62  ? 12.562  -27.157 43.046  1.00 58.12  ? 615 ARG H CA  1 
ATOM   6779 C C   . ARG H 1 62  ? 12.472  -27.994 41.765  1.00 56.60  ? 615 ARG H C   1 
ATOM   6780 O O   . ARG H 1 62  ? 13.163  -28.998 41.605  1.00 65.80  ? 615 ARG H O   1 
ATOM   6781 C CB  . ARG H 1 62  ? 11.435  -27.526 44.035  1.00 58.25  ? 615 ARG H CB  1 
ATOM   6782 C CG  . ARG H 1 62  ? 11.524  -28.948 44.582  1.00 53.61  ? 615 ARG H CG  1 
ATOM   6783 C CD  . ARG H 1 62  ? 10.437  -29.277 45.613  1.00 55.76  ? 615 ARG H CD  1 
ATOM   6784 N NE  . ARG H 1 62  ? 10.252  -30.731 45.714  1.00 65.82  ? 615 ARG H NE  1 
ATOM   6785 C CZ  . ARG H 1 62  ? 9.356   -31.343 46.490  1.00 72.38  ? 615 ARG H CZ  1 
ATOM   6786 N NH1 . ARG H 1 62  ? 8.525   -30.642 47.265  1.00 61.84  ? 615 ARG H NH1 1 
ATOM   6787 N NH2 . ARG H 1 62  ? 9.286   -32.673 46.487  1.00 62.42  ? 615 ARG H NH2 1 
ATOM   6788 N N   . LEU H 1 63  ? 11.609  -27.569 40.854  1.00 61.31  ? 616 LEU H N   1 
ATOM   6789 C CA  . LEU H 1 63  ? 11.410  -28.258 39.594  1.00 60.01  ? 616 LEU H CA  1 
ATOM   6790 C C   . LEU H 1 63  ? 12.690  -28.347 38.775  1.00 65.34  ? 616 LEU H C   1 
ATOM   6791 O O   . LEU H 1 63  ? 13.050  -29.419 38.269  1.00 66.38  ? 616 LEU H O   1 
ATOM   6792 C CB  . LEU H 1 63  ? 10.338  -27.523 38.787  1.00 63.93  ? 616 LEU H CB  1 
ATOM   6793 C CG  . LEU H 1 63  ? 10.067  -27.958 37.347  1.00 64.40  ? 616 LEU H CG  1 
ATOM   6794 C CD1 . LEU H 1 63  ? 9.819   -29.443 37.277  1.00 75.75  ? 616 LEU H CD1 1 
ATOM   6795 C CD2 . LEU H 1 63  ? 8.891   -27.175 36.813  1.00 63.14  ? 616 LEU H CD2 1 
ATOM   6796 N N   . GLU H 1 64  ? 13.378  -27.216 38.658  1.00 64.95  ? 617 GLU H N   1 
ATOM   6797 C CA  . GLU H 1 64  ? 14.510  -27.094 37.743  1.00 65.83  ? 617 GLU H CA  1 
ATOM   6798 C C   . GLU H 1 64  ? 15.857  -27.420 38.415  1.00 70.40  ? 617 GLU H C   1 
ATOM   6799 O O   . GLU H 1 64  ? 16.910  -27.124 37.862  1.00 72.87  ? 617 GLU H O   1 
ATOM   6800 C CB  . GLU H 1 64  ? 14.473  -25.707 37.097  1.00 62.78  ? 617 GLU H CB  1 
ATOM   6801 C CG  . GLU H 1 64  ? 13.095  -25.440 36.468  1.00 67.68  ? 617 GLU H CG  1 
ATOM   6802 C CD  . GLU H 1 64  ? 13.093  -24.412 35.362  1.00 84.62  ? 617 GLU H CD  1 
ATOM   6803 O OE1 . GLU H 1 64  ? 13.839  -23.411 35.477  1.00 97.13  ? 617 GLU H OE1 1 
ATOM   6804 O OE2 . GLU H 1 64  ? 12.321  -24.603 34.388  1.00 82.23  ? 617 GLU H OE2 1 
ATOM   6805 N N   . ALA H 1 65  ? 15.795  -28.011 39.613  1.00 65.60  ? 618 ALA H N   1 
ATOM   6806 C CA  . ALA H 1 65  ? 16.889  -28.789 40.193  1.00 65.28  ? 618 ALA H CA  1 
ATOM   6807 C C   . ALA H 1 65  ? 16.464  -30.258 40.404  1.00 65.74  ? 618 ALA H C   1 
ATOM   6808 O O   . ALA H 1 65  ? 16.975  -30.940 41.287  1.00 64.03  ? 618 ALA H O   1 
ATOM   6809 C CB  . ALA H 1 65  ? 17.336  -28.174 41.517  1.00 64.90  ? 618 ALA H CB  1 
ATOM   6810 N N   . GLN H 1 66  ? 15.519  -30.741 39.602  1.00 69.23  ? 619 GLN H N   1 
ATOM   6811 C CA  . GLN H 1 66  ? 15.039  -32.130 39.716  1.00 71.70  ? 619 GLN H CA  1 
ATOM   6812 C C   . GLN H 1 66  ? 14.652  -32.488 41.163  1.00 67.84  ? 619 GLN H C   1 
ATOM   6813 O O   . GLN H 1 66  ? 14.932  -33.585 41.646  1.00 70.54  ? 619 GLN H O   1 
ATOM   6814 C CB  . GLN H 1 66  ? 16.087  -33.119 39.155  1.00 76.76  ? 619 GLN H CB  1 
ATOM   6815 N N   . GLY H 1 67  ? 14.010  -31.543 41.844  1.00 64.61  ? 620 GLY H N   1 
ATOM   6816 C CA  . GLY H 1 67  ? 13.533  -31.746 43.212  1.00 62.86  ? 620 GLY H CA  1 
ATOM   6817 C C   . GLY H 1 67  ? 12.224  -32.513 43.361  1.00 57.37  ? 620 GLY H C   1 
ATOM   6818 O O   . GLY H 1 67  ? 11.891  -32.936 44.478  1.00 53.65  ? 620 GLY H O   1 
ATOM   6819 N N   . TYR H 1 68  ? 11.492  -32.694 42.252  1.00 58.72  ? 621 TYR H N   1 
ATOM   6820 C CA  . TYR H 1 68  ? 10.206  -33.404 42.247  1.00 49.05  ? 621 TYR H CA  1 
ATOM   6821 C C   . TYR H 1 68  ? 10.326  -34.806 41.673  1.00 51.38  ? 621 TYR H C   1 
ATOM   6822 O O   . TYR H 1 68  ? 10.388  -34.980 40.459  1.00 55.13  ? 621 TYR H O   1 
ATOM   6823 C CB  . TYR H 1 68  ? 9.143   -32.620 41.459  1.00 41.04  ? 621 TYR H CB  1 
ATOM   6824 C CG  . TYR H 1 68  ? 8.717   -31.309 42.095  1.00 35.98  ? 621 TYR H CG  1 
ATOM   6825 C CD1 . TYR H 1 68  ? 8.953   -30.116 41.463  1.00 38.45  ? 621 TYR H CD1 1 
ATOM   6826 C CD2 . TYR H 1 68  ? 8.061   -31.270 43.317  1.00 32.82  ? 621 TYR H CD2 1 
ATOM   6827 C CE1 . TYR H 1 68  ? 8.565   -28.924 42.017  1.00 41.37  ? 621 TYR H CE1 1 
ATOM   6828 C CE2 . TYR H 1 68  ? 7.681   -30.073 43.880  1.00 26.85  ? 621 TYR H CE2 1 
ATOM   6829 C CZ  . TYR H 1 68  ? 7.920   -28.902 43.205  1.00 27.92  ? 621 TYR H CZ  1 
ATOM   6830 O OH  . TYR H 1 68  ? 7.572   -27.676 43.735  1.00 38.80  ? 621 TYR H OH  1 
ATOM   6831 N N   . LYS H 1 69  ? 10.324  -35.805 42.551  1.00 56.01  ? 622 LYS H N   1 
ATOM   6832 C CA  . LYS H 1 69  ? 10.378  -37.220 42.143  1.00 60.18  ? 622 LYS H CA  1 
ATOM   6833 C C   . LYS H 1 69  ? 9.131   -37.746 41.388  1.00 57.21  ? 622 LYS H C   1 
ATOM   6834 O O   . LYS H 1 69  ? 9.210   -38.782 40.749  1.00 56.65  ? 622 LYS H O   1 
ATOM   6835 C CB  . LYS H 1 69  ? 10.643  -38.140 43.362  1.00 65.98  ? 622 LYS H CB  1 
ATOM   6836 C CG  . LYS H 1 69  ? 12.071  -38.069 43.966  1.00 65.65  ? 622 LYS H CG  1 
ATOM   6837 C CD  . LYS H 1 69  ? 12.108  -37.401 45.367  1.00 76.76  ? 622 LYS H CD  1 
ATOM   6838 C CE  . LYS H 1 69  ? 12.031  -38.423 46.530  1.00 78.30  ? 622 LYS H CE  1 
ATOM   6839 N NZ  . LYS H 1 69  ? 13.392  -38.964 46.949  1.00 51.45  ? 622 LYS H NZ  1 
ATOM   6840 N N   . ASN H 1 70  ? 7.990   -37.069 41.480  1.00 47.64  ? 623 ASN H N   1 
ATOM   6841 C CA  . ASN H 1 70  ? 6.776   -37.532 40.793  1.00 45.87  ? 623 ASN H CA  1 
ATOM   6842 C C   . ASN H 1 70  ? 5.697   -36.459 40.836  1.00 41.83  ? 623 ASN H C   1 
ATOM   6843 O O   . ASN H 1 70  ? 5.865   -35.471 41.520  1.00 49.89  ? 623 ASN H O   1 
ATOM   6844 C CB  . ASN H 1 70  ? 6.235   -38.830 41.407  1.00 39.26  ? 623 ASN H CB  1 
ATOM   6845 C CG  . ASN H 1 70  ? 5.851   -38.664 42.861  1.00 43.10  ? 623 ASN H CG  1 
ATOM   6846 O OD1 . ASN H 1 70  ? 5.329   -37.627 43.272  1.00 44.69  ? 623 ASN H OD1 1 
ATOM   6847 N ND2 . ASN H 1 70  ? 6.103   -39.692 43.650  1.00 57.10  ? 623 ASN H ND2 1 
ATOM   6848 N N   . LEU H 1 71  ? 4.588   -36.663 40.130  1.00 42.81  ? 624 LEU H N   1 
ATOM   6849 C CA  . LEU H 1 71  ? 3.531   -35.654 40.091  1.00 46.17  ? 624 LEU H CA  1 
ATOM   6850 C C   . LEU H 1 71  ? 2.920   -35.354 41.455  1.00 43.33  ? 624 LEU H C   1 
ATOM   6851 O O   . LEU H 1 71  ? 2.600   -34.197 41.731  1.00 42.52  ? 624 LEU H O   1 
ATOM   6852 C CB  . LEU H 1 71  ? 2.416   -36.040 39.109  1.00 52.46  ? 624 LEU H CB  1 
ATOM   6853 C CG  . LEU H 1 71  ? 1.253   -35.024 38.996  1.00 56.92  ? 624 LEU H CG  1 
ATOM   6854 C CD1 . LEU H 1 71  ? 0.862   -34.811 37.562  1.00 60.19  ? 624 LEU H CD1 1 
ATOM   6855 C CD2 . LEU H 1 71  ? 0.039   -35.461 39.831  1.00 70.33  ? 624 LEU H CD2 1 
ATOM   6856 N N   . HIS H 1 72  ? 2.741   -36.371 42.300  1.00 42.66  ? 625 HIS H N   1 
ATOM   6857 C CA  . HIS H 1 72  ? 2.075   -36.142 43.591  1.00 46.03  ? 625 HIS H CA  1 
ATOM   6858 C C   . HIS H 1 72  ? 2.845   -35.129 44.449  1.00 36.95  ? 625 HIS H C   1 
ATOM   6859 O O   . HIS H 1 72  ? 2.238   -34.277 45.106  1.00 34.49  ? 625 HIS H O   1 
ATOM   6860 C CB  . HIS H 1 72  ? 1.795   -37.456 44.360  1.00 47.04  ? 625 HIS H CB  1 
ATOM   6861 C CG  . HIS H 1 72  ? 1.038   -37.250 45.641  1.00 59.38  ? 625 HIS H CG  1 
ATOM   6862 N ND1 . HIS H 1 72  ? -0.184  -36.608 45.690  1.00 60.03  ? 625 HIS H ND1 1 
ATOM   6863 C CD2 . HIS H 1 72  ? 1.342   -37.576 46.923  1.00 53.62  ? 625 HIS H CD2 1 
ATOM   6864 C CE1 . HIS H 1 72  ? -0.609  -36.566 46.941  1.00 68.43  ? 625 HIS H CE1 1 
ATOM   6865 N NE2 . HIS H 1 72  ? 0.299   -37.145 47.709  1.00 60.61  ? 625 HIS H NE2 1 
ATOM   6866 N N   . GLU H 1 73  ? 4.174   -35.178 44.408  1.00 41.80  ? 626 GLU H N   1 
ATOM   6867 C CA  . GLU H 1 73  ? 4.978   -34.181 45.124  1.00 39.46  ? 626 GLU H CA  1 
ATOM   6868 C C   . GLU H 1 73  ? 4.724   -32.773 44.593  1.00 40.32  ? 626 GLU H C   1 
ATOM   6869 O O   . GLU H 1 73  ? 4.630   -31.819 45.368  1.00 44.82  ? 626 GLU H O   1 
ATOM   6870 C CB  . GLU H 1 73  ? 6.472   -34.520 45.079  1.00 47.21  ? 626 GLU H CB  1 
ATOM   6871 C CG  . GLU H 1 73  ? 6.850   -35.713 45.966  1.00 57.49  ? 626 GLU H CG  1 
ATOM   6872 C CD  . GLU H 1 73  ? 8.345   -36.072 45.959  1.00 77.57  ? 626 GLU H CD  1 
ATOM   6873 O OE1 . GLU H 1 73  ? 9.176   -35.263 45.474  1.00 77.56  ? 626 GLU H OE1 1 
ATOM   6874 O OE2 . GLU H 1 73  ? 8.683   -37.175 46.455  1.00 66.75  ? 626 GLU H OE2 1 
ATOM   6875 N N   . PHE H 1 74  ? 4.598   -32.638 43.281  1.00 38.46  ? 627 PHE H N   1 
ATOM   6876 C CA  . PHE H 1 74  ? 4.313   -31.340 42.658  1.00 37.93  ? 627 PHE H CA  1 
ATOM   6877 C C   . PHE H 1 74  ? 2.974   -30.851 43.136  1.00 34.02  ? 627 PHE H C   1 
ATOM   6878 O O   . PHE H 1 74  ? 2.813   -29.690 43.554  1.00 33.77  ? 627 PHE H O   1 
ATOM   6879 C CB  . PHE H 1 74  ? 4.270   -31.479 41.142  1.00 38.57  ? 627 PHE H CB  1 
ATOM   6880 C CG  . PHE H 1 74  ? 4.166   -30.181 40.399  1.00 23.25  ? 627 PHE H CG  1 
ATOM   6881 C CD1 . PHE H 1 74  ? 5.312   -29.479 40.060  1.00 36.39  ? 627 PHE H CD1 1 
ATOM   6882 C CD2 . PHE H 1 74  ? 2.934   -29.688 39.976  1.00 24.38  ? 627 PHE H CD2 1 
ATOM   6883 C CE1 . PHE H 1 74  ? 5.228   -28.303 39.328  1.00 36.75  ? 627 PHE H CE1 1 
ATOM   6884 C CE2 . PHE H 1 74  ? 2.851   -28.543 39.238  1.00 18.30  ? 627 PHE H CE2 1 
ATOM   6885 C CZ  . PHE H 1 74  ? 3.978   -27.834 38.921  1.00 39.86  ? 627 PHE H CZ  1 
ATOM   6886 N N   . GLU H 1 75  ? 2.021   -31.765 43.053  1.00 37.27  ? 628 GLU H N   1 
ATOM   6887 C CA  . GLU H 1 75  ? 0.660   -31.569 43.558  1.00 32.43  ? 628 GLU H CA  1 
ATOM   6888 C C   . GLU H 1 75  ? 0.671   -31.054 44.977  1.00 32.52  ? 628 GLU H C   1 
ATOM   6889 O O   . GLU H 1 75  ? 0.012   -30.088 45.260  1.00 30.03  ? 628 GLU H O   1 
ATOM   6890 C CB  . GLU H 1 75  ? -0.106  -32.876 43.501  1.00 34.51  ? 628 GLU H CB  1 
ATOM   6891 C CG  . GLU H 1 75  ? -1.560  -32.757 43.064  1.00 58.03  ? 628 GLU H CG  1 
ATOM   6892 C CD  . GLU H 1 75  ? -2.184  -34.129 42.806  1.00 82.03  ? 628 GLU H CD  1 
ATOM   6893 O OE1 . GLU H 1 75  ? -2.772  -34.679 43.765  1.00 74.60  ? 628 GLU H OE1 1 
ATOM   6894 O OE2 . GLU H 1 75  ? -2.056  -34.660 41.668  1.00 76.73  ? 628 GLU H OE2 1 
ATOM   6895 N N   . GLU H 1 76  ? 1.438   -31.685 45.860  1.00 35.45  ? 629 GLU H N   1 
ATOM   6896 C CA  . GLU H 1 76  ? 1.559   -31.219 47.240  1.00 36.37  ? 629 GLU H CA  1 
ATOM   6897 C C   . GLU H 1 76  ? 1.894   -29.735 47.323  1.00 35.79  ? 629 GLU H C   1 
ATOM   6898 O O   . GLU H 1 76  ? 1.197   -28.981 48.002  1.00 29.03  ? 629 GLU H O   1 
ATOM   6899 C CB  . GLU H 1 76  ? 2.636   -32.015 48.014  1.00 37.95  ? 629 GLU H CB  1 
ATOM   6900 C CG  . GLU H 1 76  ? 2.153   -33.331 48.655  1.00 63.89  ? 629 GLU H CG  1 
ATOM   6901 C CD  . GLU H 1 76  ? 3.254   -34.008 49.471  1.00 74.06  ? 629 GLU H CD  1 
ATOM   6902 O OE1 . GLU H 1 76  ? 3.503   -33.618 50.642  1.00 72.56  ? 629 GLU H OE1 1 
ATOM   6903 O OE2 . GLU H 1 76  ? 3.890   -34.925 48.924  1.00 71.02  ? 629 GLU H OE2 1 
ATOM   6904 N N   . ASP H 1 77  ? 2.977   -29.322 46.654  1.00 37.33  ? 630 ASP H N   1 
ATOM   6905 C CA  . ASP H 1 77  ? 3.411   -27.916 46.697  1.00 32.47  ? 630 ASP H CA  1 
ATOM   6906 C C   . ASP H 1 77  ? 2.302   -26.991 46.183  1.00 19.82  ? 630 ASP H C   1 
ATOM   6907 O O   . ASP H 1 77  ? 2.050   -25.946 46.790  1.00 24.24  ? 630 ASP H O   1 
ATOM   6908 C CB  . ASP H 1 77  ? 4.699   -27.654 45.901  1.00 33.39  ? 630 ASP H CB  1 
ATOM   6909 C CG  . ASP H 1 77  ? 5.969   -27.967 46.688  1.00 42.94  ? 630 ASP H CG  1 
ATOM   6910 O OD1 . ASP H 1 77  ? 5.887   -28.299 47.878  1.00 38.65  ? 630 ASP H OD1 1 
ATOM   6911 O OD2 . ASP H 1 77  ? 7.066   -27.880 46.102  1.00 38.80  ? 630 ASP H OD2 1 
ATOM   6912 N N   . PHE H 1 78  ? 1.646   -27.366 45.102  1.00 22.44  ? 631 PHE H N   1 
ATOM   6913 C CA  . PHE H 1 78  ? 0.522   -26.554 44.602  1.00 29.32  ? 631 PHE H CA  1 
ATOM   6914 C C   . PHE H 1 78  ? -0.518  -26.439 45.711  1.00 32.57  ? 631 PHE H C   1 
ATOM   6915 O O   . PHE H 1 78  ? -1.041  -25.357 45.993  1.00 37.02  ? 631 PHE H O   1 
ATOM   6916 C CB  . PHE H 1 78  ? -0.097  -27.158 43.330  1.00 25.27  ? 631 PHE H CB  1 
ATOM   6917 C CG  . PHE H 1 78  ? -1.346  -26.410 42.821  1.00 19.18  ? 631 PHE H CG  1 
ATOM   6918 C CD1 . PHE H 1 78  ? -1.245  -25.123 42.292  1.00 27.14  ? 631 PHE H CD1 1 
ATOM   6919 C CD2 . PHE H 1 78  ? -2.611  -27.016 42.872  1.00 23.40  ? 631 PHE H CD2 1 
ATOM   6920 C CE1 . PHE H 1 78  ? -2.386  -24.442 41.814  1.00 38.70  ? 631 PHE H CE1 1 
ATOM   6921 C CE2 . PHE H 1 78  ? -3.751  -26.352 42.403  1.00 27.37  ? 631 PHE H CE2 1 
ATOM   6922 C CZ  . PHE H 1 78  ? -3.637  -25.067 41.856  1.00 21.96  ? 631 PHE H CZ  1 
ATOM   6923 N N   . ASP H 1 79  ? -0.805  -27.556 46.363  1.00 29.78  ? 632 ASP H N   1 
ATOM   6924 C CA  . ASP H 1 79  ? -1.787  -27.549 47.424  1.00 30.66  ? 632 ASP H CA  1 
ATOM   6925 C C   . ASP H 1 79  ? -1.420  -26.570 48.547  1.00 32.03  ? 632 ASP H C   1 
ATOM   6926 O O   . ASP H 1 79  ? -2.304  -25.872 49.071  1.00 22.63  ? 632 ASP H O   1 
ATOM   6927 C CB  . ASP H 1 79  ? -2.016  -28.957 47.974  1.00 33.06  ? 632 ASP H CB  1 
ATOM   6928 C CG  . ASP H 1 79  ? -2.891  -29.812 47.062  1.00 40.21  ? 632 ASP H CG  1 
ATOM   6929 O OD1 . ASP H 1 79  ? -3.566  -29.270 46.168  1.00 28.56  ? 632 ASP H OD1 1 
ATOM   6930 O OD2 . ASP H 1 79  ? -2.894  -31.045 47.240  1.00 53.58  ? 632 ASP H OD2 1 
ATOM   6931 N N   . LEU H 1 80  ? -0.129  -26.481 48.885  1.00 30.89  ? 633 LEU H N   1 
ATOM   6932 C CA  . LEU H 1 80  ? 0.319   -25.493 49.882  1.00 26.94  ? 633 LEU H CA  1 
ATOM   6933 C C   . LEU H 1 80  ? -0.052  -24.123 49.424  1.00 26.68  ? 633 LEU H C   1 
ATOM   6934 O O   . LEU H 1 80  ? -0.648  -23.373 50.179  1.00 33.29  ? 633 LEU H O   1 
ATOM   6935 C CB  . LEU H 1 80  ? 1.834   -25.540 50.123  1.00 32.30  ? 633 LEU H CB  1 
ATOM   6936 C CG  . LEU H 1 80  ? 2.334   -26.709 50.976  1.00 34.27  ? 633 LEU H CG  1 
ATOM   6937 C CD1 . LEU H 1 80  ? 3.869   -26.718 51.054  1.00 37.54  ? 633 LEU H CD1 1 
ATOM   6938 C CD2 . LEU H 1 80  ? 1.679   -26.681 52.366  1.00 26.64  ? 633 LEU H CD2 1 
ATOM   6939 N N   . ILE H 1 81  ? 0.278   -23.772 48.184  1.00 31.64  ? 634 ILE H N   1 
ATOM   6940 C CA  . ILE H 1 81  ? -0.114  -22.427 47.721  1.00 34.90  ? 634 ILE H CA  1 
ATOM   6941 C C   . ILE H 1 81  ? -1.570  -22.166 48.086  1.00 24.71  ? 634 ILE H C   1 
ATOM   6942 O O   . ILE H 1 81  ? -1.891  -21.144 48.716  1.00 26.96  ? 634 ILE H O   1 
ATOM   6943 C CB  . ILE H 1 81  ? 0.087   -22.193 46.229  1.00 28.57  ? 634 ILE H CB  1 
ATOM   6944 C CG1 . ILE H 1 81  ? 1.583   -22.281 45.904  1.00 38.98  ? 634 ILE H CG1 1 
ATOM   6945 C CG2 . ILE H 1 81  ? -0.413  -20.810 45.861  1.00 25.61  ? 634 ILE H CG2 1 
ATOM   6946 C CD1 . ILE H 1 81  ? 1.883   -22.252 44.431  1.00 26.94  ? 634 ILE H CD1 1 
ATOM   6947 N N   . ILE H 1 82  ? -2.437  -23.115 47.759  1.00 26.83  ? 635 ILE H N   1 
ATOM   6948 C CA  . ILE H 1 82  ? -3.875  -22.878 47.899  1.00 29.02  ? 635 ILE H CA  1 
ATOM   6949 C C   . ILE H 1 82  ? -4.314  -22.807 49.345  1.00 34.93  ? 635 ILE H C   1 
ATOM   6950 O O   . ILE H 1 82  ? -5.069  -21.906 49.721  1.00 33.11  ? 635 ILE H O   1 
ATOM   6951 C CB  . ILE H 1 82  ? -4.721  -23.963 47.268  1.00 27.10  ? 635 ILE H CB  1 
ATOM   6952 C CG1 . ILE H 1 82  ? -4.427  -24.069 45.783  1.00 34.51  ? 635 ILE H CG1 1 
ATOM   6953 C CG2 . ILE H 1 82  ? -6.220  -23.590 47.415  1.00 27.21  ? 635 ILE H CG2 1 
ATOM   6954 C CD1 . ILE H 1 82  ? -4.789  -22.779 44.976  1.00 34.69  ? 635 ILE H CD1 1 
ATOM   6955 N N   . ASP H 1 83  ? -3.846  -23.783 50.126  1.00 36.53  ? 636 ASP H N   1 
ATOM   6956 C CA  . ASP H 1 83  ? -4.283  -23.988 51.494  1.00 40.40  ? 636 ASP H CA  1 
ATOM   6957 C C   . ASP H 1 83  ? -3.727  -22.891 52.416  1.00 38.91  ? 636 ASP H C   1 
ATOM   6958 O O   . ASP H 1 83  ? -4.485  -22.326 53.258  1.00 30.69  ? 636 ASP H O   1 
ATOM   6959 C CB  . ASP H 1 83  ? -3.910  -25.414 51.987  1.00 40.56  ? 636 ASP H CB  1 
ATOM   6960 C CG  . ASP H 1 83  ? -4.579  -26.541 51.145  1.00 55.41  ? 636 ASP H CG  1 
ATOM   6961 O OD1 . ASP H 1 83  ? -5.590  -26.280 50.433  1.00 51.25  ? 636 ASP H OD1 1 
ATOM   6962 O OD2 . ASP H 1 83  ? -4.088  -27.699 51.195  1.00 31.31  ? 636 ASP H OD2 1 
ATOM   6963 N N   . ASN H 1 84  ? -2.425  -22.594 52.272  1.00 29.16  ? 637 ASN H N   1 
ATOM   6964 C CA  . ASN H 1 84  ? -1.825  -21.441 52.955  1.00 26.83  ? 637 ASN H CA  1 
ATOM   6965 C C   . ASN H 1 84  ? -2.659  -20.121 52.794  1.00 29.95  ? 637 ASN H C   1 
ATOM   6966 O O   . ASN H 1 84  ? -3.054  -19.481 53.770  1.00 30.53  ? 637 ASN H O   1 
ATOM   6967 C CB  . ASN H 1 84  ? -0.422  -21.182 52.419  1.00 17.86  ? 637 ASN H CB  1 
ATOM   6968 C CG  . ASN H 1 84  ? 0.616   -22.220 52.893  1.00 32.93  ? 637 ASN H CG  1 
ATOM   6969 O OD1 . ASN H 1 84  ? 0.348   -23.031 53.773  1.00 23.08  ? 637 ASN H OD1 1 
ATOM   6970 N ND2 . ASN H 1 84  ? 1.821   -22.172 52.302  1.00 18.64  ? 637 ASN H ND2 1 
ATOM   6971 N N   . CYS H 1 85  ? -2.867  -19.692 51.561  1.00 32.58  ? 638 CYS H N   1 
ATOM   6972 C CA  . CYS H 1 85  ? -3.564  -18.424 51.303  1.00 35.46  ? 638 CYS H CA  1 
ATOM   6973 C C   . CYS H 1 85  ? -4.988  -18.458 51.875  1.00 36.66  ? 638 CYS H C   1 
ATOM   6974 O O   . CYS H 1 85  ? -5.471  -17.443 52.362  1.00 30.05  ? 638 CYS H O   1 
ATOM   6975 C CB  . CYS H 1 85  ? -3.559  -18.088 49.804  1.00 38.00  ? 638 CYS H CB  1 
ATOM   6976 S SG  . CYS H 1 85  ? -4.779  -16.821 49.224  1.00 45.32  ? 638 CYS H SG  1 
ATOM   6977 N N   . MET H 1 86  ? -5.624  -19.630 51.830  1.00 40.44  ? 639 MET H N   1 
ATOM   6978 C CA  . MET H 1 86  ? -6.957  -19.854 52.397  1.00 46.71  ? 639 MET H CA  1 
ATOM   6979 C C   . MET H 1 86  ? -7.006  -20.039 53.915  1.00 45.67  ? 639 MET H C   1 
ATOM   6980 O O   . MET H 1 86  ? -8.055  -19.826 54.507  1.00 40.95  ? 639 MET H O   1 
ATOM   6981 C CB  . MET H 1 86  ? -7.606  -21.098 51.771  1.00 53.06  ? 639 MET H CB  1 
ATOM   6982 C CG  . MET H 1 86  ? -8.162  -20.929 50.347  1.00 55.11  ? 639 MET H CG  1 
ATOM   6983 S SD  . MET H 1 86  ? -8.947  -22.422 49.655  1.00 58.34  ? 639 MET H SD  1 
ATOM   6984 C CE  . MET H 1 86  ? -9.016  -23.533 51.075  1.00 57.69  ? 639 MET H CE  1 
ATOM   6985 N N   . LYS H 1 87  ? -5.928  -20.496 54.556  1.00 47.27  ? 640 LYS H N   1 
ATOM   6986 C CA  . LYS H 1 87  ? -5.895  -20.508 56.025  1.00 42.33  ? 640 LYS H CA  1 
ATOM   6987 C C   . LYS H 1 87  ? -5.755  -19.049 56.515  1.00 45.19  ? 640 LYS H C   1 
ATOM   6988 O O   . LYS H 1 87  ? -6.514  -18.603 57.378  1.00 48.98  ? 640 LYS H O   1 
ATOM   6989 C CB  . LYS H 1 87  ? -4.778  -21.416 56.590  1.00 42.32  ? 640 LYS H CB  1 
ATOM   6990 N N   . TYR H 1 88  ? -4.839  -18.293 55.904  1.00 41.09  ? 641 TYR H N   1 
ATOM   6991 C CA  . TYR H 1 88  ? -4.492  -16.949 56.381  1.00 41.71  ? 641 TYR H CA  1 
ATOM   6992 C C   . TYR H 1 88  ? -5.556  -15.900 56.093  1.00 45.30  ? 641 TYR H C   1 
ATOM   6993 O O   . TYR H 1 88  ? -6.122  -15.341 57.023  1.00 48.63  ? 641 TYR H O   1 
ATOM   6994 C CB  . TYR H 1 88  ? -3.159  -16.461 55.772  1.00 38.16  ? 641 TYR H CB  1 
ATOM   6995 C CG  . TYR H 1 88  ? -2.721  -15.148 56.363  1.00 44.84  ? 641 TYR H CG  1 
ATOM   6996 C CD1 . TYR H 1 88  ? -1.852  -15.102 57.444  1.00 33.10  ? 641 TYR H CD1 1 
ATOM   6997 C CD2 . TYR H 1 88  ? -3.246  -13.941 55.894  1.00 63.21  ? 641 TYR H CD2 1 
ATOM   6998 C CE1 . TYR H 1 88  ? -1.481  -13.878 58.019  1.00 35.40  ? 641 TYR H CE1 1 
ATOM   6999 C CE2 . TYR H 1 88  ? -2.890  -12.718 56.466  1.00 65.77  ? 641 TYR H CE2 1 
ATOM   7000 C CZ  . TYR H 1 88  ? -2.010  -12.689 57.518  1.00 44.85  ? 641 TYR H CZ  1 
ATOM   7001 O OH  . TYR H 1 88  ? -1.668  -11.477 58.063  1.00 45.38  ? 641 TYR H OH  1 
ATOM   7002 N N   . ASN H 1 89  ? -5.781  -15.618 54.804  1.00 48.93  ? 642 ASN H N   1 
ATOM   7003 C CA  . ASN H 1 89  ? -6.522  -14.418 54.350  1.00 53.14  ? 642 ASN H CA  1 
ATOM   7004 C C   . ASN H 1 89  ? -8.012  -14.635 54.550  1.00 54.59  ? 642 ASN H C   1 
ATOM   7005 O O   . ASN H 1 89  ? -8.458  -15.768 54.586  1.00 51.22  ? 642 ASN H O   1 
ATOM   7006 C CB  . ASN H 1 89  ? -6.230  -14.091 52.874  1.00 45.66  ? 642 ASN H CB  1 
ATOM   7007 C CG  . ASN H 1 89  ? -4.726  -13.805 52.583  1.00 62.40  ? 642 ASN H CG  1 
ATOM   7008 O OD1 . ASN H 1 89  ? -3.971  -14.688 52.122  1.00 46.62  ? 642 ASN H OD1 1 
ATOM   7009 N ND2 . ASN H 1 89  ? -4.305  -12.558 52.815  1.00 44.20  ? 642 ASN H ND2 1 
ATOM   7010 N N   . ALA H 1 90  ? -8.777  -13.557 54.701  1.00 69.47  ? 643 ALA H N   1 
ATOM   7011 C CA  . ALA H 1 90  ? -10.226 -13.664 54.945  1.00 74.89  ? 643 ALA H CA  1 
ATOM   7012 C C   . ALA H 1 90  ? -11.056 -13.993 53.676  1.00 80.55  ? 643 ALA H C   1 
ATOM   7013 O O   . ALA H 1 90  ? -10.683 -13.609 52.545  1.00 75.93  ? 643 ALA H O   1 
ATOM   7014 C CB  . ALA H 1 90  ? -10.741 -12.379 55.605  1.00 80.22  ? 643 ALA H CB  1 
ATOM   7015 N N   . ARG H 1 91  ? -12.180 -14.697 53.886  1.00 83.92  ? 644 ARG H N   1 
ATOM   7016 C CA  . ARG H 1 91  ? -13.138 -15.042 52.815  1.00 84.77  ? 644 ARG H CA  1 
ATOM   7017 C C   . ARG H 1 91  ? -13.549 -13.808 52.002  1.00 87.63  ? 644 ARG H C   1 
ATOM   7018 O O   . ARG H 1 91  ? -13.332 -13.757 50.803  1.00 82.30  ? 644 ARG H O   1 
ATOM   7019 C CB  . ARG H 1 91  ? -14.381 -15.744 53.379  1.00 82.17  ? 644 ARG H CB  1 
ATOM   7020 N N   . ASP H 1 92  ? -14.108 -12.807 52.677  1.00 96.87  ? 645 ASP H N   1 
ATOM   7021 C CA  . ASP H 1 92  ? -14.485 -11.522 52.053  1.00 103.31 ? 645 ASP H CA  1 
ATOM   7022 C C   . ASP H 1 92  ? -13.377 -10.837 51.217  1.00 103.15 ? 645 ASP H C   1 
ATOM   7023 O O   . ASP H 1 92  ? -13.694 -9.999  50.357  1.00 106.31 ? 645 ASP H O   1 
ATOM   7024 C CB  . ASP H 1 92  ? -14.983 -10.548 53.128  1.00 105.06 ? 645 ASP H CB  1 
ATOM   7025 N N   . THR H 1 93  ? -12.106 -11.178 51.482  1.00 97.02  ? 646 THR H N   1 
ATOM   7026 C CA  . THR H 1 93  ? -10.959 -10.733 50.665  1.00 92.37  ? 646 THR H CA  1 
ATOM   7027 C C   . THR H 1 93  ? -10.954 -11.439 49.315  1.00 86.81  ? 646 THR H C   1 
ATOM   7028 O O   . THR H 1 93  ? -11.527 -12.523 49.166  1.00 78.15  ? 646 THR H O   1 
ATOM   7029 C CB  . THR H 1 93  ? -9.591  -11.033 51.344  1.00 88.08  ? 646 THR H CB  1 
ATOM   7030 N N   . VAL H 1 94  ? -10.286 -10.829 48.339  1.00 83.60  ? 647 VAL H N   1 
ATOM   7031 C CA  . VAL H 1 94  ? -10.242 -11.374 46.987  1.00 81.53  ? 647 VAL H CA  1 
ATOM   7032 C C   . VAL H 1 94  ? -9.448  -12.678 46.976  1.00 71.86  ? 647 VAL H C   1 
ATOM   7033 O O   . VAL H 1 94  ? -9.694  -13.570 46.148  1.00 67.81  ? 647 VAL H O   1 
ATOM   7034 C CB  . VAL H 1 94  ? -9.633  -10.364 45.979  1.00 83.95  ? 647 VAL H CB  1 
ATOM   7035 N N   . PHE H 1 95  ? -8.523  -12.794 47.929  1.00 64.07  ? 648 PHE H N   1 
ATOM   7036 C CA  . PHE H 1 95  ? -7.573  -13.904 47.953  1.00 56.01  ? 648 PHE H CA  1 
ATOM   7037 C C   . PHE H 1 95  ? -8.262  -15.231 48.252  1.00 53.85  ? 648 PHE H C   1 
ATOM   7038 O O   . PHE H 1 95  ? -8.009  -16.222 47.556  1.00 44.02  ? 648 PHE H O   1 
ATOM   7039 C CB  . PHE H 1 95  ? -6.447  -13.626 48.940  1.00 45.64  ? 648 PHE H CB  1 
ATOM   7040 C CG  . PHE H 1 95  ? -5.537  -12.452 48.559  1.00 42.35  ? 648 PHE H CG  1 
ATOM   7041 C CD1 . PHE H 1 95  ? -5.837  -11.589 47.504  1.00 61.29  ? 648 PHE H CD1 1 
ATOM   7042 C CD2 . PHE H 1 95  ? -4.395  -12.188 49.321  1.00 57.77  ? 648 PHE H CD2 1 
ATOM   7043 C CE1 . PHE H 1 95  ? -4.996  -10.519 47.209  1.00 71.37  ? 648 PHE H CE1 1 
ATOM   7044 C CE2 . PHE H 1 95  ? -3.559  -11.126 49.038  1.00 60.53  ? 648 PHE H CE2 1 
ATOM   7045 C CZ  . PHE H 1 95  ? -3.849  -10.294 47.979  1.00 76.16  ? 648 PHE H CZ  1 
ATOM   7046 N N   . TYR H 1 96  ? -9.155  -15.277 49.242  1.00 53.43  ? 649 TYR H N   1 
ATOM   7047 C CA  . TYR H 1 96  ? -9.890  -16.527 49.434  1.00 56.78  ? 649 TYR H CA  1 
ATOM   7048 C C   . TYR H 1 96  ? -10.577 -16.992 48.132  1.00 66.55  ? 649 TYR H C   1 
ATOM   7049 O O   . TYR H 1 96  ? -10.423 -18.155 47.717  1.00 63.90  ? 649 TYR H O   1 
ATOM   7050 C CB  . TYR H 1 96  ? -10.917 -16.450 50.536  1.00 55.18  ? 649 TYR H CB  1 
ATOM   7051 C CG  . TYR H 1 96  ? -11.349 -17.837 50.999  1.00 51.09  ? 649 TYR H CG  1 
ATOM   7052 C CD1 . TYR H 1 96  ? -12.533 -18.426 50.534  1.00 46.74  ? 649 TYR H CD1 1 
ATOM   7053 C CD2 . TYR H 1 96  ? -10.566 -18.558 51.875  1.00 47.51  ? 649 TYR H CD2 1 
ATOM   7054 C CE1 . TYR H 1 96  ? -12.919 -19.707 50.950  1.00 56.27  ? 649 TYR H CE1 1 
ATOM   7055 C CE2 . TYR H 1 96  ? -10.937 -19.834 52.301  1.00 69.73  ? 649 TYR H CE2 1 
ATOM   7056 C CZ  . TYR H 1 96  ? -12.109 -20.402 51.837  1.00 71.25  ? 649 TYR H CZ  1 
ATOM   7057 O OH  . TYR H 1 96  ? -12.463 -21.659 52.273  1.00 64.36  ? 649 TYR H OH  1 
ATOM   7058 N N   . ARG H 1 97  ? -11.319 -16.094 47.484  1.00 68.65  ? 650 ARG H N   1 
ATOM   7059 C CA  . ARG H 1 97  ? -11.993 -16.456 46.245  1.00 68.06  ? 650 ARG H CA  1 
ATOM   7060 C C   . ARG H 1 97  ? -11.000 -16.681 45.081  1.00 65.21  ? 650 ARG H C   1 
ATOM   7061 O O   . ARG H 1 97  ? -11.209 -17.609 44.305  1.00 71.46  ? 650 ARG H O   1 
ATOM   7062 C CB  . ARG H 1 97  ? -13.093 -15.459 45.882  1.00 74.49  ? 650 ARG H CB  1 
ATOM   7063 C CG  . ARG H 1 97  ? -14.325 -15.495 46.826  1.00 73.73  ? 650 ARG H CG  1 
ATOM   7064 C CD  . ARG H 1 97  ? -14.386 -14.309 47.814  1.00 89.27  ? 650 ARG H CD  1 
ATOM   7065 N NE  . ARG H 1 97  ? -15.208 -13.184 47.333  1.00 98.25  ? 650 ARG H NE  1 
ATOM   7066 C CZ  . ARG H 1 97  ? -14.792 -12.184 46.545  1.00 98.21  ? 650 ARG H CZ  1 
ATOM   7067 N NH1 . ARG H 1 97  ? -13.544 -12.108 46.096  1.00 98.17  ? 650 ARG H NH1 1 
ATOM   7068 N NH2 . ARG H 1 97  ? -15.643 -11.236 46.192  1.00 108.40 ? 650 ARG H NH2 1 
ATOM   7069 N N   . ALA H 1 98  ? -9.933  -15.870 44.981  1.00 55.07  ? 651 ALA H N   1 
ATOM   7070 C CA  . ALA H 1 98  ? -8.842  -16.089 44.000  1.00 45.73  ? 651 ALA H CA  1 
ATOM   7071 C C   . ALA H 1 98  ? -8.167  -17.444 44.192  1.00 54.52  ? 651 ALA H C   1 
ATOM   7072 O O   . ALA H 1 98  ? -7.986  -18.217 43.222  1.00 54.25  ? 651 ALA H O   1 
ATOM   7073 C CB  . ALA H 1 98  ? -7.788  -15.038 44.120  1.00 37.33  ? 651 ALA H CB  1 
ATOM   7074 N N   . ALA H 1 99  ? -7.762  -17.706 45.440  1.00 47.49  ? 652 ALA H N   1 
ATOM   7075 C CA  . ALA H 1 99  ? -7.265  -19.014 45.805  1.00 41.13  ? 652 ALA H CA  1 
ATOM   7076 C C   . ALA H 1 99  ? -8.330  -20.064 45.496  1.00 38.85  ? 652 ALA H C   1 
ATOM   7077 O O   . ALA H 1 99  ? -7.979  -21.149 45.072  1.00 36.23  ? 652 ALA H O   1 
ATOM   7078 C CB  . ALA H 1 99  ? -6.810  -19.066 47.287  1.00 32.30  ? 652 ALA H CB  1 
ATOM   7079 N N   . VAL H 1 100 ? -9.627  -19.754 45.653  1.00 40.18  ? 653 VAL H N   1 
ATOM   7080 C CA  . VAL H 1 100 ? -10.651 -20.754 45.318  1.00 43.76  ? 653 VAL H CA  1 
ATOM   7081 C C   . VAL H 1 100 ? -10.629 -21.002 43.807  1.00 48.01  ? 653 VAL H C   1 
ATOM   7082 O O   . VAL H 1 100 ? -10.721 -22.145 43.367  1.00 53.14  ? 653 VAL H O   1 
ATOM   7083 C CB  . VAL H 1 100 ? -12.112 -20.418 45.833  1.00 52.42  ? 653 VAL H CB  1 
ATOM   7084 C CG1 . VAL H 1 100 ? -13.160 -20.960 44.908  1.00 54.91  ? 653 VAL H CG1 1 
ATOM   7085 C CG2 . VAL H 1 100 ? -12.364 -21.022 47.216  1.00 44.64  ? 653 VAL H CG2 1 
ATOM   7086 N N   . ARG H 1 101 ? -10.486 -19.945 43.016  1.00 54.41  ? 654 ARG H N   1 
ATOM   7087 C CA  . ARG H 1 101 ? -10.586 -20.087 41.562  1.00 56.37  ? 654 ARG H CA  1 
ATOM   7088 C C   . ARG H 1 101 ? -9.324  -20.771 41.012  1.00 48.76  ? 654 ARG H C   1 
ATOM   7089 O O   . ARG H 1 101 ? -9.415  -21.576 40.085  1.00 42.90  ? 654 ARG H O   1 
ATOM   7090 C CB  . ARG H 1 101 ? -10.849 -18.739 40.878  1.00 60.86  ? 654 ARG H CB  1 
ATOM   7091 N N   . LEU H 1 102 ? -8.166  -20.480 41.605  1.00 46.81  ? 655 LEU H N   1 
ATOM   7092 C CA  . LEU H 1 102 ? -6.921  -21.126 41.191  1.00 42.81  ? 655 LEU H CA  1 
ATOM   7093 C C   . LEU H 1 102 ? -6.953  -22.609 41.511  1.00 43.65  ? 655 LEU H C   1 
ATOM   7094 O O   . LEU H 1 102 ? -6.353  -23.439 40.791  1.00 41.53  ? 655 LEU H O   1 
ATOM   7095 C CB  . LEU H 1 102 ? -5.705  -20.478 41.839  1.00 30.38  ? 655 LEU H CB  1 
ATOM   7096 C CG  . LEU H 1 102 ? -4.384  -21.199 41.587  1.00 33.35  ? 655 LEU H CG  1 
ATOM   7097 C CD1 . LEU H 1 102 ? -4.179  -21.420 40.084  1.00 31.85  ? 655 LEU H CD1 1 
ATOM   7098 C CD2 . LEU H 1 102 ? -3.201  -20.434 42.190  1.00 26.94  ? 655 LEU H CD2 1 
ATOM   7099 N N   . ARG H 1 103 ? -7.650  -22.939 42.590  1.00 45.26  ? 656 ARG H N   1 
ATOM   7100 C CA  . ARG H 1 103 ? -7.777  -24.328 43.009  1.00 48.98  ? 656 ARG H CA  1 
ATOM   7101 C C   . ARG H 1 103 ? -8.658  -25.120 42.021  1.00 45.58  ? 656 ARG H C   1 
ATOM   7102 O O   . ARG H 1 103 ? -8.312  -26.244 41.651  1.00 35.53  ? 656 ARG H O   1 
ATOM   7103 C CB  . ARG H 1 103 ? -8.349  -24.395 44.421  1.00 52.52  ? 656 ARG H CB  1 
ATOM   7104 C CG  . ARG H 1 103 ? -8.447  -25.781 45.031  1.00 55.75  ? 656 ARG H CG  1 
ATOM   7105 C CD  . ARG H 1 103 ? -9.384  -25.749 46.249  1.00 59.19  ? 656 ARG H CD  1 
ATOM   7106 N NE  . ARG H 1 103 ? -10.797 -25.678 45.856  1.00 56.49  ? 656 ARG H NE  1 
ATOM   7107 C CZ  . ARG H 1 103 ? -11.827 -25.555 46.702  1.00 55.18  ? 656 ARG H CZ  1 
ATOM   7108 N NH1 . ARG H 1 103 ? -11.629 -25.479 48.013  1.00 55.53  ? 656 ARG H NH1 1 
ATOM   7109 N NH2 . ARG H 1 103 ? -13.072 -25.497 46.229  1.00 51.37  ? 656 ARG H NH2 1 
ATOM   7110 N N   . ASP H 1 104 ? -9.778  -24.536 41.599  1.00 43.14  ? 657 ASP H N   1 
ATOM   7111 C CA  . ASP H 1 104 ? -10.701 -25.235 40.709  1.00 47.24  ? 657 ASP H CA  1 
ATOM   7112 C C   . ASP H 1 104 ? -10.127 -25.353 39.273  1.00 45.47  ? 657 ASP H C   1 
ATOM   7113 O O   . ASP H 1 104 ? -10.175 -26.416 38.648  1.00 44.29  ? 657 ASP H O   1 
ATOM   7114 C CB  . ASP H 1 104 ? -12.083 -24.555 40.725  1.00 54.44  ? 657 ASP H CB  1 
ATOM   7115 C CG  . ASP H 1 104 ? -12.756 -24.570 42.130  1.00 62.32  ? 657 ASP H CG  1 
ATOM   7116 O OD1 . ASP H 1 104 ? -12.164 -25.078 43.112  1.00 47.14  ? 657 ASP H OD1 1 
ATOM   7117 O OD2 . ASP H 1 104 ? -13.892 -24.054 42.255  1.00 53.63  ? 657 ASP H OD2 1 
ATOM   7118 N N   . GLN H 1 105 ? -9.535  -24.275 38.783  1.00 39.46  ? 658 GLN H N   1 
ATOM   7119 C CA  . GLN H 1 105 ? -8.927  -24.261 37.455  1.00 43.04  ? 658 GLN H CA  1 
ATOM   7120 C C   . GLN H 1 105 ? -7.594  -25.010 37.453  1.00 33.59  ? 658 GLN H C   1 
ATOM   7121 O O   . GLN H 1 105 ? -7.291  -25.786 36.553  1.00 38.05  ? 658 GLN H O   1 
ATOM   7122 C CB  . GLN H 1 105 ? -8.748  -22.808 36.967  1.00 45.11  ? 658 GLN H CB  1 
ATOM   7123 C CG  . GLN H 1 105 ? -10.081 -22.069 36.627  1.00 54.28  ? 658 GLN H CG  1 
ATOM   7124 C CD  . GLN H 1 105 ? -9.938  -20.532 36.581  1.00 68.93  ? 658 GLN H CD  1 
ATOM   7125 O OE1 . GLN H 1 105 ? -8.825  -19.973 36.556  1.00 53.13  ? 658 GLN H OE1 1 
ATOM   7126 N NE2 . GLN H 1 105 ? -11.075 -19.849 36.583  1.00 77.48  ? 658 GLN H NE2 1 
ATOM   7127 N N   . GLY H 1 106 ? -6.787  -24.768 38.453  1.00 32.55  ? 659 GLY H N   1 
ATOM   7128 C CA  . GLY H 1 106 ? -5.565  -25.549 38.611  1.00 33.12  ? 659 GLY H CA  1 
ATOM   7129 C C   . GLY H 1 106 ? -5.800  -27.041 38.756  1.00 26.72  ? 659 GLY H C   1 
ATOM   7130 O O   . GLY H 1 106 ? -4.988  -27.823 38.315  1.00 27.73  ? 659 GLY H O   1 
ATOM   7131 N N   . GLY H 1 107 ? -6.897  -27.428 39.411  1.00 31.47  ? 660 GLY H N   1 
ATOM   7132 C CA  . GLY H 1 107 ? -7.177  -28.836 39.683  1.00 28.29  ? 660 GLY H CA  1 
ATOM   7133 C C   . GLY H 1 107 ? -7.389  -29.526 38.349  1.00 35.11  ? 660 GLY H C   1 
ATOM   7134 O O   . GLY H 1 107 ? -7.024  -30.678 38.177  1.00 29.61  ? 660 GLY H O   1 
ATOM   7135 N N   . VAL H 1 108 ? -7.956  -28.796 37.390  1.00 29.61  ? 661 VAL H N   1 
ATOM   7136 C CA  . VAL H 1 108 ? -8.239  -29.363 36.076  1.00 33.11  ? 661 VAL H CA  1 
ATOM   7137 C C   . VAL H 1 108 ? -6.961  -29.650 35.309  1.00 31.41  ? 661 VAL H C   1 
ATOM   7138 O O   . VAL H 1 108 ? -6.811  -30.704 34.712  1.00 42.96  ? 661 VAL H O   1 
ATOM   7139 C CB  . VAL H 1 108 ? -9.141  -28.446 35.250  1.00 27.61  ? 661 VAL H CB  1 
ATOM   7140 C CG1 . VAL H 1 108 ? -9.185  -28.948 33.776  1.00 25.08  ? 661 VAL H CG1 1 
ATOM   7141 C CG2 . VAL H 1 108 ? -10.520 -28.385 35.898  1.00 38.02  ? 661 VAL H CG2 1 
ATOM   7142 N N   . VAL H 1 109 ? -6.032  -28.709 35.358  1.00 33.17  ? 662 VAL H N   1 
ATOM   7143 C CA  . VAL H 1 109 ? -4.720  -28.888 34.769  1.00 28.27  ? 662 VAL H CA  1 
ATOM   7144 C C   . VAL H 1 109 ? -4.037  -30.099 35.353  1.00 29.87  ? 662 VAL H C   1 
ATOM   7145 O O   . VAL H 1 109 ? -3.460  -30.899 34.626  1.00 40.53  ? 662 VAL H O   1 
ATOM   7146 C CB  . VAL H 1 109 ? -3.840  -27.637 34.994  1.00 31.27  ? 662 VAL H CB  1 
ATOM   7147 C CG1 . VAL H 1 109 ? -2.442  -27.884 34.517  1.00 20.76  ? 662 VAL H CG1 1 
ATOM   7148 C CG2 . VAL H 1 109 ? -4.462  -26.405 34.303  1.00 23.84  ? 662 VAL H CG2 1 
ATOM   7149 N N   . LEU H 1 110 ? -4.102  -30.249 36.666  1.00 31.30  ? 663 LEU H N   1 
ATOM   7150 C CA  . LEU H 1 110 ? -3.414  -31.365 37.344  1.00 33.12  ? 663 LEU H CA  1 
ATOM   7151 C C   . LEU H 1 110 ? -4.062  -32.745 37.095  1.00 30.53  ? 663 LEU H C   1 
ATOM   7152 O O   . LEU H 1 110 ? -3.368  -33.749 36.987  1.00 26.75  ? 663 LEU H O   1 
ATOM   7153 C CB  . LEU H 1 110 ? -3.332  -31.098 38.847  1.00 31.18  ? 663 LEU H CB  1 
ATOM   7154 C CG  . LEU H 1 110 ? -2.307  -30.039 39.238  1.00 41.10  ? 663 LEU H CG  1 
ATOM   7155 C CD1 . LEU H 1 110 ? -2.518  -29.583 40.680  1.00 28.38  ? 663 LEU H CD1 1 
ATOM   7156 C CD2 . LEU H 1 110 ? -0.915  -30.597 39.063  1.00 22.63  ? 663 LEU H CD2 1 
ATOM   7157 N N   . ARG H 1 111 ? -5.384  -32.802 37.008  1.00 34.69  ? 664 ARG H N   1 
ATOM   7158 C CA  . ARG H 1 111 ? -6.048  -34.061 36.677  1.00 39.92  ? 664 ARG H CA  1 
ATOM   7159 C C   . ARG H 1 111 ? -5.696  -34.444 35.233  1.00 35.85  ? 664 ARG H C   1 
ATOM   7160 O O   . ARG H 1 111 ? -5.572  -35.603 34.926  1.00 39.18  ? 664 ARG H O   1 
ATOM   7161 C CB  . ARG H 1 111 ? -7.558  -33.974 36.912  1.00 47.45  ? 664 ARG H CB  1 
ATOM   7162 C CG  . ARG H 1 111 ? -7.918  -33.734 38.417  1.00 56.36  ? 664 ARG H CG  1 
ATOM   7163 C CD  . ARG H 1 111 ? -9.459  -33.775 38.720  1.00 59.33  ? 664 ARG H CD  1 
ATOM   7164 N NE  . ARG H 1 111 ? -10.280 -32.861 37.897  1.00 52.90  ? 664 ARG H NE  1 
ATOM   7165 C CZ  . ARG H 1 111 ? -10.825 -31.700 38.299  1.00 45.98  ? 664 ARG H CZ  1 
ATOM   7166 N NH1 . ARG H 1 111 ? -11.559 -31.001 37.438  1.00 61.39  ? 664 ARG H NH1 1 
ATOM   7167 N NH2 . ARG H 1 111 ? -10.656 -31.222 39.537  1.00 56.35  ? 664 ARG H NH2 1 
ATOM   7168 N N   . GLN H 1 112 ? -5.469  -33.453 34.378  1.00 34.13  ? 665 GLN H N   1 
ATOM   7169 C CA  . GLN H 1 112 ? -5.035  -33.696 33.005  1.00 32.61  ? 665 GLN H CA  1 
ATOM   7170 C C   . GLN H 1 112 ? -3.584  -34.171 32.932  1.00 36.96  ? 665 GLN H C   1 
ATOM   7171 O O   . GLN H 1 112 ? -3.229  -34.994 32.077  1.00 43.38  ? 665 GLN H O   1 
ATOM   7172 C CB  . GLN H 1 112 ? -5.210  -32.443 32.148  1.00 33.28  ? 665 GLN H CB  1 
ATOM   7173 C CG  . GLN H 1 112 ? -5.104  -32.674 30.635  1.00 34.48  ? 665 GLN H CG  1 
ATOM   7174 C CD  . GLN H 1 112 ? -5.994  -33.806 30.118  1.00 43.91  ? 665 GLN H CD  1 
ATOM   7175 O OE1 . GLN H 1 112 ? -7.210  -33.853 30.377  1.00 36.69  ? 665 GLN H OE1 1 
ATOM   7176 N NE2 . GLN H 1 112 ? -5.381  -34.730 29.366  1.00 46.62  ? 665 GLN H NE2 1 
ATOM   7177 N N   . ALA H 1 113 ? -2.752  -33.660 33.831  1.00 35.24  ? 666 ALA H N   1 
ATOM   7178 C CA  . ALA H 1 113 ? -1.365  -34.113 33.938  1.00 36.26  ? 666 ALA H CA  1 
ATOM   7179 C C   . ALA H 1 113 ? -1.347  -35.575 34.429  1.00 36.50  ? 666 ALA H C   1 
ATOM   7180 O O   . ALA H 1 113 ? -0.569  -36.394 33.958  1.00 34.88  ? 666 ALA H O   1 
ATOM   7181 C CB  . ALA H 1 113 ? -0.582  -33.180 34.892  1.00 35.26  ? 666 ALA H CB  1 
ATOM   7182 N N   . ARG H 1 114 ? -2.252  -35.896 35.344  1.00 35.29  ? 667 ARG H N   1 
ATOM   7183 C CA  . ARG H 1 114 ? -2.326  -37.214 35.939  1.00 38.50  ? 667 ARG H CA  1 
ATOM   7184 C C   . ARG H 1 114 ? -2.593  -38.261 34.857  1.00 38.61  ? 667 ARG H C   1 
ATOM   7185 O O   . ARG H 1 114 ? -2.054  -39.378 34.890  1.00 36.07  ? 667 ARG H O   1 
ATOM   7186 C CB  . ARG H 1 114 ? -3.436  -37.237 37.021  1.00 41.12  ? 667 ARG H CB  1 
ATOM   7187 C CG  . ARG H 1 114 ? -3.868  -38.635 37.514  1.00 49.55  ? 667 ARG H CG  1 
ATOM   7188 C CD  . ARG H 1 114 ? -2.702  -39.439 38.067  1.00 43.10  ? 667 ARG H CD  1 
ATOM   7189 N NE  . ARG H 1 114 ? -2.071  -38.750 39.176  1.00 45.36  ? 667 ARG H NE  1 
ATOM   7190 C CZ  . ARG H 1 114 ? -0.861  -39.024 39.652  1.00 35.99  ? 667 ARG H CZ  1 
ATOM   7191 N NH1 . ARG H 1 114 ? -0.386  -38.311 40.662  1.00 47.05  ? 667 ARG H NH1 1 
ATOM   7192 N NH2 . ARG H 1 114 ? -0.134  -40.005 39.125  1.00 46.30  ? 667 ARG H NH2 1 
ATOM   7193 N N   . ARG H 1 115 ? -3.435  -37.865 33.911  1.00 26.92  ? 668 ARG H N   1 
ATOM   7194 C CA  . ARG H 1 115 ? -3.874  -38.687 32.797  1.00 31.82  ? 668 ARG H CA  1 
ATOM   7195 C C   . ARG H 1 115 ? -2.734  -38.982 31.805  1.00 29.07  ? 668 ARG H C   1 
ATOM   7196 O O   . ARG H 1 115 ? -2.636  -40.070 31.224  1.00 31.36  ? 668 ARG H O   1 
ATOM   7197 C CB  . ARG H 1 115 ? -5.102  -37.975 32.122  1.00 27.65  ? 668 ARG H CB  1 
ATOM   7198 C CG  . ARG H 1 115 ? -6.375  -38.467 32.736  1.00 31.60  ? 668 ARG H CG  1 
ATOM   7199 C CD  . ARG H 1 115 ? -7.430  -37.466 33.246  1.00 44.96  ? 668 ARG H CD  1 
ATOM   7200 N NE  . ARG H 1 115 ? -8.089  -36.751 32.199  1.00 22.60  ? 668 ARG H NE  1 
ATOM   7201 C CZ  . ARG H 1 115 ? -9.321  -36.210 32.222  1.00 49.00  ? 668 ARG H CZ  1 
ATOM   7202 N NH1 . ARG H 1 115 ? -9.747  -35.530 31.162  1.00 31.42  ? 668 ARG H NH1 1 
ATOM   7203 N NH2 . ARG H 1 115 ? -10.156 -36.338 33.231  1.00 31.49  ? 668 ARG H NH2 1 
ATOM   7204 N N   . GLU H 1 116 ? -1.850  -38.014 31.643  1.00 33.23  ? 669 GLU H N   1 
ATOM   7205 C CA  . GLU H 1 116 ? -0.663  -38.218 30.840  1.00 37.46  ? 669 GLU H CA  1 
ATOM   7206 C C   . GLU H 1 116 ? 0.311   -39.135 31.576  1.00 40.40  ? 669 GLU H C   1 
ATOM   7207 O O   . GLU H 1 116 ? 0.896   -40.027 30.959  1.00 41.12  ? 669 GLU H O   1 
ATOM   7208 C CB  . GLU H 1 116 ? -0.022  -36.876 30.518  1.00 32.09  ? 669 GLU H CB  1 
ATOM   7209 C CG  . GLU H 1 116 ? -0.959  -35.921 29.766  1.00 43.51  ? 669 GLU H CG  1 
ATOM   7210 C CD  . GLU H 1 116 ? -1.414  -36.461 28.414  1.00 57.66  ? 669 GLU H CD  1 
ATOM   7211 O OE1 . GLU H 1 116 ? -0.613  -37.171 27.768  1.00 60.01  ? 669 GLU H OE1 1 
ATOM   7212 O OE2 . GLU H 1 116 ? -2.568  -36.173 27.993  1.00 57.22  ? 669 GLU H OE2 1 
ATOM   7213 N N   . VAL H 1 117 ? 0.478   -38.932 32.890  1.00 37.25  ? 670 VAL H N   1 
ATOM   7214 C CA  . VAL H 1 117 ? 1.317   -39.857 33.686  1.00 38.38  ? 670 VAL H CA  1 
ATOM   7215 C C   . VAL H 1 117 ? 0.807   -41.290 33.544  1.00 40.09  ? 670 VAL H C   1 
ATOM   7216 O O   . VAL H 1 117 ? 1.584   -42.202 33.276  1.00 47.82  ? 670 VAL H O   1 
ATOM   7217 C CB  . VAL H 1 117 ? 1.328   -39.503 35.159  1.00 35.84  ? 670 VAL H CB  1 
ATOM   7218 C CG1 . VAL H 1 117 ? 2.195   -40.526 35.962  1.00 43.74  ? 670 VAL H CG1 1 
ATOM   7219 C CG2 . VAL H 1 117 ? 1.831   -38.089 35.337  1.00 30.85  ? 670 VAL H CG2 1 
ATOM   7220 N N   . ASP H 1 118 ? -0.510  -41.461 33.689  1.00 37.78  ? 671 ASP H N   1 
ATOM   7221 C CA  . ASP H 1 118 ? -1.126  -42.754 33.545  1.00 40.54  ? 671 ASP H CA  1 
ATOM   7222 C C   . ASP H 1 118 ? -0.665  -43.463 32.266  1.00 45.62  ? 671 ASP H C   1 
ATOM   7223 O O   . ASP H 1 118 ? -0.362  -44.670 32.296  1.00 45.97  ? 671 ASP H O   1 
ATOM   7224 C CB  . ASP H 1 118 ? -2.640  -42.618 33.499  1.00 41.82  ? 671 ASP H CB  1 
ATOM   7225 C CG  . ASP H 1 118 ? -3.253  -42.279 34.835  1.00 42.17  ? 671 ASP H CG  1 
ATOM   7226 O OD1 . ASP H 1 118 ? -2.671  -42.537 35.910  1.00 47.28  ? 671 ASP H OD1 1 
ATOM   7227 O OD2 . ASP H 1 118 ? -4.375  -41.758 34.802  1.00 37.72  ? 671 ASP H OD2 1 
ATOM   7228 N N   . SER H 1 119 ? -0.640  -42.733 31.146  1.00 41.31  ? 672 SER H N   1 
ATOM   7229 C CA  . SER H 1 119 ? -0.223  -43.319 29.864  1.00 49.46  ? 672 SER H CA  1 
ATOM   7230 C C   . SER H 1 119 ? 1.294   -43.613 29.770  1.00 54.26  ? 672 SER H C   1 
ATOM   7231 O O   . SER H 1 119 ? 1.672   -44.611 29.181  1.00 62.29  ? 672 SER H O   1 
ATOM   7232 C CB  . SER H 1 119 ? -0.669  -42.466 28.678  1.00 43.43  ? 672 SER H CB  1 
ATOM   7233 O OG  . SER H 1 119 ? -0.136  -41.160 28.788  1.00 56.49  ? 672 SER H OG  1 
ATOM   7234 N N   . ILE H 1 120 ? 2.155   -42.768 30.339  1.00 57.83  ? 673 ILE H N   1 
ATOM   7235 C CA  . ILE H 1 120 ? 3.600   -43.071 30.369  1.00 62.41  ? 673 ILE H CA  1 
ATOM   7236 C C   . ILE H 1 120 ? 3.900   -44.509 30.838  1.00 61.12  ? 673 ILE H C   1 
ATOM   7237 O O   . ILE H 1 120 ? 3.858   -44.803 32.035  1.00 60.15  ? 673 ILE H O   1 
ATOM   7238 C CB  . ILE H 1 120 ? 4.357   -42.099 31.277  1.00 55.69  ? 673 ILE H CB  1 
HETATM 7239 C CAA . MB3 I 2 .   ? -0.341  -22.369 130.495 1.00 30.41  ? 1   MB3 C CAA 1 
HETATM 7240 O OAB . MB3 I 2 .   ? -3.137  -22.345 130.544 1.00 54.19  ? 1   MB3 C OAB 1 
HETATM 7241 C CAC . MB3 I 2 .   ? -2.171  -25.775 130.132 1.00 57.12  ? 1   MB3 C CAC 1 
HETATM 7242 C CAD . MB3 I 2 .   ? -3.300  -24.796 130.484 1.00 45.30  ? 1   MB3 C CAD 1 
HETATM 7243 C CAE . MB3 I 2 .   ? -0.870  -24.978 130.407 1.00 59.78  ? 1   MB3 C CAE 1 
HETATM 7244 C CAF . MB3 I 2 .   ? -2.588  -23.442 130.522 1.00 41.66  ? 1   MB3 C CAF 1 
HETATM 7245 N NAG . MB3 I 2 .   ? -1.263  -23.561 130.487 1.00 49.37  ? 1   MB3 C NAG 1 
HETATM 7246 C C   . ACT J 3 .   ? 24.401  28.271  54.839  1.00 52.44  ? 1   ACT D C   1 
HETATM 7247 O O   . ACT J 3 .   ? 25.343  27.615  55.352  1.00 51.40  ? 1   ACT D O   1 
HETATM 7248 O OXT . ACT J 3 .   ? 23.307  27.652  54.751  1.00 44.84  ? 1   ACT D OXT 1 
HETATM 7249 C CH3 . ACT J 3 .   ? 24.596  29.685  54.361  1.00 31.90  ? 1   ACT D CH3 1 
HETATM 7250 C C1  . EDO K 4 .   ? 27.761  -30.458 21.423  1.00 58.64  ? 2   EDO F C1  1 
HETATM 7251 O O1  . EDO K 4 .   ? 28.811  -29.490 21.644  1.00 43.28  ? 2   EDO F O1  1 
HETATM 7252 C C2  . EDO K 4 .   ? 28.212  -31.634 20.531  1.00 64.14  ? 2   EDO F C2  1 
HETATM 7253 O O2  . EDO K 4 .   ? 27.160  -32.575 20.223  1.00 58.06  ? 2   EDO F O2  1 
HETATM 7254 C C1  . EDO L 4 .   ? -5.811  -36.829 106.138 1.00 46.11  ? 1   EDO G C1  1 
HETATM 7255 O O1  . EDO L 4 .   ? -6.664  -35.688 105.848 1.00 30.36  ? 1   EDO G O1  1 
HETATM 7256 C C2  . EDO L 4 .   ? -4.267  -36.681 106.068 1.00 41.53  ? 1   EDO G C2  1 
HETATM 7257 O O2  . EDO L 4 .   ? -3.663  -35.473 106.625 1.00 40.52  ? 1   EDO G O2  1 
HETATM 7258 C C   . ACT M 3 .   ? 7.910   -16.189 52.429  1.00 48.74  ? 2   ACT H C   1 
HETATM 7259 O O   . ACT M 3 .   ? 8.382   -15.086 52.048  1.00 52.70  ? 2   ACT H O   1 
HETATM 7260 O OXT . ACT M 3 .   ? 6.654   -16.314 52.273  1.00 46.73  ? 2   ACT H OXT 1 
HETATM 7261 C CH3 . ACT M 3 .   ? 8.803   -17.258 53.023  1.00 42.25  ? 2   ACT H CH3 1 
HETATM 7262 O O   . HOH N 5 .   ? -1.469  14.189  95.238  1.00 25.15  ? 4   HOH A O   1 
HETATM 7263 O O   . HOH N 5 .   ? -11.859 -6.033  105.709 1.00 31.32  ? 12  HOH A O   1 
HETATM 7264 O O   . HOH N 5 .   ? 17.297  15.529  83.354  1.00 41.04  ? 14  HOH A O   1 
HETATM 7265 O O   . HOH N 5 .   ? -15.684 10.391  92.653  1.00 50.26  ? 15  HOH A O   1 
HETATM 7266 O O   . HOH N 5 .   ? -5.186  3.562   87.416  1.00 24.78  ? 18  HOH A O   1 
HETATM 7267 O O   . HOH N 5 .   ? 11.363  23.686  72.745  1.00 32.09  ? 26  HOH A O   1 
HETATM 7268 O O   . HOH N 5 .   ? 4.455   2.518   82.490  1.00 50.67  ? 28  HOH A O   1 
HETATM 7269 O O   . HOH N 5 .   ? -6.821  1.205   87.481  1.00 34.49  ? 42  HOH A O   1 
HETATM 7270 O O   . HOH N 5 .   ? -3.357  2.345   92.409  1.00 27.64  ? 53  HOH A O   1 
HETATM 7271 O O   . HOH N 5 .   ? -1.370  3.045   93.472  1.00 37.52  ? 56  HOH A O   1 
HETATM 7272 O O   . HOH N 5 .   ? -6.621  5.434   91.697  1.00 27.58  ? 58  HOH A O   1 
HETATM 7273 O O   . HOH N 5 .   ? 15.403  16.431  89.928  1.00 32.66  ? 60  HOH A O   1 
HETATM 7274 O O   . HOH N 5 .   ? 1.082   18.795  70.965  1.00 52.48  ? 61  HOH A O   1 
HETATM 7275 O O   . HOH N 5 .   ? 10.942  20.933  71.758  1.00 24.35  ? 62  HOH A O   1 
HETATM 7276 O O   . HOH N 5 .   ? 2.744   27.014  84.402  1.00 56.40  ? 102 HOH A O   1 
HETATM 7277 O O   . HOH N 5 .   ? -7.041  13.727  90.642  1.00 37.89  ? 103 HOH A O   1 
HETATM 7278 O O   . HOH N 5 .   ? -4.903  5.295   89.389  1.00 22.24  ? 104 HOH A O   1 
HETATM 7279 O O   . HOH N 5 .   ? -3.377  1.845   89.044  1.00 36.82  ? 105 HOH A O   1 
HETATM 7280 O O   . HOH N 5 .   ? -7.331  -9.696  98.090  1.00 39.21  ? 123 HOH A O   1 
HETATM 7281 O O   . HOH N 5 .   ? 0.631   -2.788  86.207  1.00 31.65  ? 126 HOH A O   1 
HETATM 7282 O O   . HOH N 5 .   ? -9.402  1.222   88.544  1.00 37.24  ? 129 HOH A O   1 
HETATM 7283 O O   . HOH N 5 .   ? -10.302 2.258   95.462  1.00 33.00  ? 130 HOH A O   1 
HETATM 7284 O O   . HOH N 5 .   ? 1.856   0.654   81.656  1.00 33.06  ? 136 HOH A O   1 
HETATM 7285 O O   . HOH N 5 .   ? 6.386   3.043   91.231  1.00 40.08  ? 139 HOH A O   1 
HETATM 7286 O O   . HOH N 5 .   ? 6.988   5.844   93.008  1.00 39.12  ? 140 HOH A O   1 
HETATM 7287 O O   . HOH N 5 .   ? -3.146  -0.714  95.677  1.00 41.91  ? 160 HOH A O   1 
HETATM 7288 O O   . HOH O 5 .   ? 0.558   -16.219 70.012  1.00 34.37  ? 3   HOH B O   1 
HETATM 7289 O O   . HOH O 5 .   ? -3.927  -12.107 60.515  1.00 35.26  ? 8   HOH B O   1 
HETATM 7290 O O   . HOH O 5 .   ? 10.548  -16.847 61.996  1.00 41.67  ? 24  HOH B O   1 
HETATM 7291 O O   . HOH O 5 .   ? 9.657   -14.996 69.833  1.00 19.30  ? 36  HOH B O   1 
HETATM 7292 O O   . HOH O 5 .   ? 3.374   0.130   78.191  1.00 36.47  ? 40  HOH B O   1 
HETATM 7293 O O   . HOH O 5 .   ? 9.855   -6.939  69.366  1.00 29.74  ? 46  HOH B O   1 
HETATM 7294 O O   . HOH O 5 .   ? 9.854   -19.742 64.686  1.00 28.30  ? 63  HOH B O   1 
HETATM 7295 O O   . HOH O 5 .   ? 13.662  -10.710 65.245  1.00 32.40  ? 64  HOH B O   1 
HETATM 7296 O O   . HOH O 5 .   ? 14.175  0.286   70.891  1.00 41.26  ? 65  HOH B O   1 
HETATM 7297 O O   . HOH O 5 .   ? 8.193   -3.268  73.175  1.00 36.01  ? 66  HOH B O   1 
HETATM 7298 O O   . HOH O 5 .   ? 5.428   -2.607  70.369  1.00 37.57  ? 67  HOH B O   1 
HETATM 7299 O O   . HOH O 5 .   ? 8.242   -6.545  71.584  1.00 31.87  ? 68  HOH B O   1 
HETATM 7300 O O   . HOH O 5 .   ? 11.470  5.682   75.590  1.00 32.27  ? 69  HOH B O   1 
HETATM 7301 O O   . HOH O 5 .   ? 0.642   -19.698 67.526  1.00 48.89  ? 97  HOH B O   1 
HETATM 7302 O O   . HOH O 5 .   ? 9.932   10.981  66.137  1.00 29.77  ? 106 HOH B O   1 
HETATM 7303 O O   . HOH O 5 .   ? 6.431   1.618   77.643  1.00 42.71  ? 141 HOH B O   1 
HETATM 7304 O O   . HOH O 5 .   ? 2.603   -26.523 88.500  1.00 42.89  ? 142 HOH B O   1 
HETATM 7305 O O   . HOH O 5 .   ? 10.287  -5.400  86.050  1.00 45.37  ? 172 HOH B O   1 
HETATM 7306 O O   . HOH P 5 .   ? 10.744  -28.245 131.519 1.00 39.49  ? 30  HOH C O   1 
HETATM 7307 O O   . HOH P 5 .   ? 1.509   -22.029 127.244 1.00 24.77  ? 38  HOH C O   1 
HETATM 7308 O O   . HOH P 5 .   ? -2.791  -18.679 126.246 1.00 22.55  ? 45  HOH C O   1 
HETATM 7309 O O   . HOH P 5 .   ? 6.956   -18.179 138.544 1.00 31.59  ? 71  HOH C O   1 
HETATM 7310 O O   . HOH P 5 .   ? -2.783  -22.312 122.554 1.00 26.14  ? 72  HOH C O   1 
HETATM 7311 O O   . HOH P 5 .   ? -1.637  -20.501 123.990 1.00 23.51  ? 73  HOH C O   1 
HETATM 7312 O O   . HOH P 5 .   ? 8.649   -4.367  143.414 1.00 41.78  ? 74  HOH C O   1 
HETATM 7313 O O   . HOH P 5 .   ? 2.542   -25.462 125.414 1.00 32.20  ? 109 HOH C O   1 
HETATM 7314 O O   . HOH P 5 .   ? 9.517   -19.745 124.782 1.00 35.82  ? 110 HOH C O   1 
HETATM 7315 O O   . HOH P 5 .   ? 10.322  -24.410 125.451 1.00 48.04  ? 111 HOH C O   1 
HETATM 7316 O O   . HOH P 5 .   ? 8.911   -17.174 118.608 1.00 44.61  ? 113 HOH C O   1 
HETATM 7317 O O   . HOH P 5 .   ? 0.449   -18.180 117.694 1.00 34.26  ? 114 HOH C O   1 
HETATM 7318 O O   . HOH P 5 .   ? -0.888  -18.934 119.680 1.00 27.57  ? 115 HOH C O   1 
HETATM 7319 O O   . HOH P 5 .   ? -1.532  -16.325 120.012 1.00 27.70  ? 116 HOH C O   1 
HETATM 7320 O O   . HOH P 5 .   ? -2.823  -8.111  124.744 1.00 34.34  ? 117 HOH C O   1 
HETATM 7321 O O   . HOH P 5 .   ? -4.201  -8.305  128.917 1.00 22.94  ? 118 HOH C O   1 
HETATM 7322 O O   . HOH P 5 .   ? -9.008  -14.653 134.586 1.00 39.92  ? 119 HOH C O   1 
HETATM 7323 O O   . HOH P 5 .   ? 4.426   -0.453  134.923 1.00 34.10  ? 121 HOH C O   1 
HETATM 7324 O O   . HOH P 5 .   ? 9.565   -20.160 129.877 1.00 37.27  ? 128 HOH C O   1 
HETATM 7325 O O   . HOH P 5 .   ? -3.527  -20.555 129.691 1.00 36.45  ? 132 HOH C O   1 
HETATM 7326 O O   . HOH P 5 .   ? -11.908 -23.619 140.145 1.00 41.69  ? 170 HOH C O   1 
HETATM 7327 O O   . HOH P 5 .   ? 5.182   -19.929 137.773 1.00 18.72  ? 689 HOH C O   1 
HETATM 7328 O O   . HOH Q 5 .   ? 13.794  30.832  63.126  1.00 29.35  ? 5   HOH D O   1 
HETATM 7329 O O   . HOH Q 5 .   ? 5.247   11.805  59.424  1.00 43.22  ? 6   HOH D O   1 
HETATM 7330 O O   . HOH Q 5 .   ? 17.906  24.262  52.682  1.00 37.52  ? 11  HOH D O   1 
HETATM 7331 O O   . HOH Q 5 .   ? 19.599  34.675  62.078  1.00 33.77  ? 16  HOH D O   1 
HETATM 7332 O O   . HOH Q 5 .   ? 7.690   32.778  68.414  1.00 37.81  ? 20  HOH D O   1 
HETATM 7333 O O   . HOH Q 5 .   ? 12.014  11.593  62.796  1.00 20.57  ? 23  HOH D O   1 
HETATM 7334 O O   . HOH Q 5 .   ? 21.203  14.280  52.753  1.00 26.48  ? 25  HOH D O   1 
HETATM 7335 O O   . HOH Q 5 .   ? 12.385  36.388  73.354  1.00 23.38  ? 27  HOH D O   1 
HETATM 7336 O O   . HOH Q 5 .   ? 10.898  36.916  71.138  1.00 20.29  ? 33  HOH D O   1 
HETATM 7337 O O   . HOH Q 5 .   ? 18.779  18.540  45.004  1.00 38.54  ? 50  HOH D O   1 
HETATM 7338 O O   . HOH Q 5 .   ? 14.526  8.340   65.305  1.00 28.01  ? 51  HOH D O   1 
HETATM 7339 O O   . HOH Q 5 .   ? 14.450  9.652   62.836  1.00 26.80  ? 75  HOH D O   1 
HETATM 7340 O O   . HOH Q 5 .   ? 22.885  8.134   59.894  1.00 46.78  ? 76  HOH D O   1 
HETATM 7341 O O   . HOH Q 5 .   ? 20.319  18.938  47.800  1.00 28.22  ? 77  HOH D O   1 
HETATM 7342 O O   . HOH Q 5 .   ? 18.883  14.029  54.542  1.00 29.18  ? 78  HOH D O   1 
HETATM 7343 O O   . HOH Q 5 .   ? 25.900  12.656  64.330  1.00 31.77  ? 79  HOH D O   1 
HETATM 7344 O O   . HOH Q 5 .   ? 6.626   4.864   60.218  1.00 34.77  ? 80  HOH D O   1 
HETATM 7345 O O   . HOH Q 5 .   ? 10.109  9.976   64.010  1.00 31.15  ? 81  HOH D O   1 
HETATM 7346 O O   . HOH Q 5 .   ? 10.186  19.471  69.851  1.00 29.07  ? 133 HOH D O   1 
HETATM 7347 O O   . HOH Q 5 .   ? 22.310  5.487   54.150  1.00 40.65  ? 143 HOH D O   1 
HETATM 7348 O O   . HOH Q 5 .   ? 20.676  16.131  41.154  1.00 45.79  ? 144 HOH D O   1 
HETATM 7349 O O   . HOH Q 5 .   ? 25.478  14.353  54.147  1.00 38.76  ? 145 HOH D O   1 
HETATM 7350 O O   . HOH Q 5 .   ? 23.393  12.977  53.172  1.00 32.76  ? 146 HOH D O   1 
HETATM 7351 O O   . HOH Q 5 .   ? 16.466  33.797  59.284  1.00 45.52  ? 147 HOH D O   1 
HETATM 7352 O O   . HOH Q 5 .   ? 25.147  8.669   44.201  1.00 36.02  ? 159 HOH D O   1 
HETATM 7353 O O   . HOH Q 5 .   ? 21.319  10.517  56.804  1.00 26.99  ? 162 HOH D O   1 
HETATM 7354 O O   . HOH Q 5 .   ? 25.142  7.536   64.698  1.00 36.84  ? 163 HOH D O   1 
HETATM 7355 O O   . HOH Q 5 .   ? 17.992  11.797  52.101  1.00 42.77  ? 171 HOH D O   1 
HETATM 7356 O O   . HOH R 5 .   ? -17.462 9.461   11.423  1.00 39.82  ? 21  HOH E O   1 
HETATM 7357 O O   . HOH R 5 .   ? -20.508 7.290   37.128  1.00 31.02  ? 22  HOH E O   1 
HETATM 7358 O O   . HOH R 5 .   ? 0.879   10.885  13.313  1.00 36.16  ? 32  HOH E O   1 
HETATM 7359 O O   . HOH R 5 .   ? -12.475 12.362  35.492  1.00 24.48  ? 82  HOH E O   1 
HETATM 7360 O O   . HOH R 5 .   ? -8.350  8.126   40.901  1.00 39.23  ? 83  HOH E O   1 
HETATM 7361 O O   . HOH R 5 .   ? -10.501 -16.160 37.764  1.00 48.00  ? 84  HOH E O   1 
HETATM 7362 O O   . HOH R 5 .   ? -8.330  9.764   30.412  1.00 25.97  ? 85  HOH E O   1 
HETATM 7363 O O   . HOH R 5 .   ? -28.175 15.050  21.091  1.00 50.93  ? 86  HOH E O   1 
HETATM 7364 O O   . HOH R 5 .   ? -28.057 14.102  11.126  1.00 36.27  ? 87  HOH E O   1 
HETATM 7365 O O   . HOH R 5 .   ? -7.643  -0.316  18.260  1.00 34.00  ? 120 HOH E O   1 
HETATM 7366 O O   . HOH R 5 .   ? -28.393 7.225   20.882  1.00 43.02  ? 127 HOH E O   1 
HETATM 7367 O O   . HOH R 5 .   ? -19.527 6.631   11.637  1.00 32.46  ? 131 HOH E O   1 
HETATM 7368 O O   . HOH R 5 .   ? -24.024 2.930   25.325  1.00 41.05  ? 134 HOH E O   1 
HETATM 7369 O O   . HOH R 5 .   ? -16.657 -1.112  32.172  1.00 29.76  ? 135 HOH E O   1 
HETATM 7370 O O   . HOH R 5 .   ? -14.441 18.976  30.361  1.00 38.43  ? 148 HOH E O   1 
HETATM 7371 O O   . HOH R 5 .   ? -23.929 13.226  35.462  1.00 44.44  ? 149 HOH E O   1 
HETATM 7372 O O   . HOH R 5 .   ? -10.343 -1.450  12.537  1.00 55.89  ? 150 HOH E O   1 
HETATM 7373 O O   . HOH R 5 .   ? -13.696 1.548   35.003  1.00 33.32  ? 164 HOH E O   1 
HETATM 7374 O O   . HOH R 5 .   ? -10.715 -1.865  21.508  1.00 30.80  ? 166 HOH E O   1 
HETATM 7375 O O   . HOH S 5 .   ? 11.994  -16.515 12.007  1.00 22.49  ? 17  HOH F O   1 
HETATM 7376 O O   . HOH S 5 .   ? 18.516  -10.680 11.826  1.00 28.69  ? 29  HOH F O   1 
HETATM 7377 O O   . HOH S 5 .   ? 19.363  -31.295 16.033  1.00 38.91  ? 31  HOH F O   1 
HETATM 7378 O O   . HOH S 5 .   ? 8.409   -15.281 13.337  1.00 47.87  ? 34  HOH F O   1 
HETATM 7379 O O   . HOH S 5 .   ? 5.227   -3.481  1.478   1.00 40.89  ? 57  HOH F O   1 
HETATM 7380 O O   . HOH S 5 .   ? 9.059   -20.063 9.115   1.00 51.33  ? 88  HOH F O   1 
HETATM 7381 O O   . HOH S 5 .   ? 16.307  -10.575 13.097  1.00 36.26  ? 89  HOH F O   1 
HETATM 7382 O O   . HOH S 5 .   ? 12.728  -20.487 31.669  1.00 38.66  ? 90  HOH F O   1 
HETATM 7383 O O   . HOH S 5 .   ? 9.632   3.873   12.623  1.00 42.71  ? 152 HOH F O   1 
HETATM 7384 O O   . HOH S 5 .   ? 16.670  -9.597  16.056  1.00 35.71  ? 153 HOH F O   1 
HETATM 7385 O O   . HOH S 5 .   ? 33.566  -20.452 12.591  1.00 46.75  ? 154 HOH F O   1 
HETATM 7386 O O   . HOH S 5 .   ? 24.748  -9.446  22.881  1.00 40.31  ? 155 HOH F O   1 
HETATM 7387 O O   . HOH S 5 .   ? 35.602  -26.272 31.621  1.00 31.17  ? 156 HOH F O   1 
HETATM 7388 O O   . HOH S 5 .   ? 16.817  -20.919 10.569  1.00 30.05  ? 161 HOH F O   1 
HETATM 7389 O O   . HOH S 5 .   ? 32.764  -8.014  22.241  1.00 46.92  ? 168 HOH F O   1 
HETATM 7390 O O   . HOH S 5 .   ? 32.205  -7.090  19.320  1.00 47.20  ? 169 HOH F O   1 
HETATM 7391 O O   . HOH S 5 .   ? 12.652  0.009   11.421  1.00 32.05  ? 173 HOH F O   1 
HETATM 7392 O O   . HOH T 5 .   ? -0.433  -38.032 94.650  1.00 24.25  ? 2   HOH G O   1 
HETATM 7393 O O   . HOH T 5 .   ? -9.470  -9.220  108.322 1.00 42.39  ? 9   HOH G O   1 
HETATM 7394 O O   . HOH T 5 .   ? -1.667  -28.777 113.679 1.00 42.70  ? 10  HOH G O   1 
HETATM 7395 O O   . HOH T 5 .   ? -7.903  -32.670 100.125 1.00 32.50  ? 13  HOH G O   1 
HETATM 7396 O O   . HOH T 5 .   ? -10.363 -28.763 96.559  1.00 35.51  ? 19  HOH G O   1 
HETATM 7397 O O   . HOH T 5 .   ? -14.774 -9.048  95.227  1.00 43.46  ? 35  HOH G O   1 
HETATM 7398 O O   . HOH T 5 .   ? -16.463 -15.909 109.654 1.00 24.71  ? 41  HOH G O   1 
HETATM 7399 O O   . HOH T 5 .   ? -12.040 -30.315 113.328 1.00 40.81  ? 43  HOH G O   1 
HETATM 7400 O O   . HOH T 5 .   ? -11.609 -28.558 111.743 1.00 30.51  ? 44  HOH G O   1 
HETATM 7401 O O   . HOH T 5 .   ? -15.146 -14.105 111.322 1.00 30.70  ? 52  HOH G O   1 
HETATM 7402 O O   . HOH T 5 .   ? -13.645 -15.452 112.930 1.00 26.43  ? 55  HOH G O   1 
HETATM 7403 O O   . HOH T 5 .   ? -5.092  -33.513 95.302  1.00 29.02  ? 59  HOH G O   1 
HETATM 7404 O O   . HOH T 5 .   ? -5.133  -12.737 104.687 1.00 27.37  ? 91  HOH G O   1 
HETATM 7405 O O   . HOH T 5 .   ? -13.007 -11.668 107.980 1.00 30.78  ? 92  HOH G O   1 
HETATM 7406 O O   . HOH T 5 .   ? -15.748 -15.657 106.585 1.00 26.89  ? 93  HOH G O   1 
HETATM 7407 O O   . HOH T 5 .   ? -15.304 -13.754 91.789  1.00 46.65  ? 94  HOH G O   1 
HETATM 7408 O O   . HOH T 5 .   ? -10.503 -12.912 97.459  1.00 24.98  ? 95  HOH G O   1 
HETATM 7409 O O   . HOH T 5 .   ? 4.846   -18.769 117.996 1.00 40.96  ? 112 HOH G O   1 
HETATM 7410 O O   . HOH T 5 .   ? -16.562 -12.785 114.232 1.00 35.65  ? 122 HOH G O   1 
HETATM 7411 O O   . HOH T 5 .   ? -9.365  -11.105 99.319  1.00 34.86  ? 124 HOH G O   1 
HETATM 7412 O O   . HOH T 5 .   ? -14.576 -7.988  92.247  1.00 49.37  ? 125 HOH G O   1 
HETATM 7413 O O   . HOH T 5 .   ? -7.734  -33.291 96.224  1.00 39.28  ? 157 HOH G O   1 
HETATM 7414 O O   . HOH T 5 .   ? -4.295  -13.040 109.796 1.00 34.93  ? 165 HOH G O   1 
HETATM 7415 O O   . HOH T 5 .   ? -13.575 -26.566 111.281 1.00 38.23  ? 167 HOH G O   1 
HETATM 7416 O O   . HOH U 5 .   ? 1.867   -24.403 55.560  1.00 23.37  ? 7   HOH H O   1 
HETATM 7417 O O   . HOH U 5 .   ? 5.659   -14.091 59.644  1.00 36.22  ? 37  HOH H O   1 
HETATM 7418 O O   . HOH U 5 .   ? 3.176   -13.605 67.038  1.00 20.36  ? 48  HOH H O   1 
HETATM 7419 O O   . HOH U 5 .   ? -3.247  -36.801 40.859  1.00 47.08  ? 49  HOH H O   1 
HETATM 7420 O O   . HOH U 5 .   ? -0.298  -7.825  56.814  1.00 39.75  ? 96  HOH H O   1 
HETATM 7421 O O   . HOH U 5 .   ? 1.789   -18.230 47.502  1.00 25.18  ? 98  HOH H O   1 
HETATM 7422 O O   . HOH U 5 .   ? -1.494  -28.257 51.634  1.00 29.57  ? 99  HOH H O   1 
HETATM 7423 O O   . HOH U 5 .   ? -6.853  -27.560 48.159  1.00 36.12  ? 100 HOH H O   1 
HETATM 7424 O O   . HOH U 5 .   ? -8.682  -25.066 34.068  1.00 46.59  ? 101 HOH H O   1 
HETATM 7425 O O   . HOH U 5 .   ? 5.296   -21.294 61.150  1.00 29.95  ? 137 HOH H O   1 
HETATM 7426 O O   . HOH U 5 .   ? 2.167   -21.592 63.395  1.00 47.75  ? 138 HOH H O   1 
HETATM 7427 O O   . HOH U 5 .   ? 6.792   -19.250 49.808  1.00 42.05  ? 158 HOH H O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . LEU A 9   ? 1.1668 1.0927 1.0361 -0.1468 -0.0079 -0.0032 562 LEU A N   
2    C CA  . LEU A 9   ? 1.1478 1.0888 1.0457 -0.1325 -0.0153 0.0051  562 LEU A CA  
3    C C   . LEU A 9   ? 1.1172 1.0627 1.0349 -0.1242 -0.0138 0.0068  562 LEU A C   
4    O O   . LEU A 9   ? 1.1569 1.0924 1.0680 -0.1217 -0.0031 -0.0006 562 LEU A O   
5    C CB  . LEU A 9   ? 1.1151 1.0537 1.0166 -0.1171 -0.0077 0.0009  562 LEU A CB  
6    C CG  . LEU A 9   ? 1.1150 1.0445 0.9960 -0.1219 -0.0032 -0.0041 562 LEU A CG  
7    C CD1 . LEU A 9   ? 0.9723 0.8934 0.8530 -0.1076 0.0106  -0.0122 562 LEU A CD1 
8    C CD2 . LEU A 9   ? 1.0313 0.9709 0.9172 -0.1248 -0.0146 0.0039  562 LEU A CD2 
9    N N   . ARG A 10  ? 1.0006 0.9604 0.9435 -0.1200 -0.0235 0.0169  563 ARG A N   
10   C CA  . ARG A 10  ? 0.9218 0.8869 0.8858 -0.1139 -0.0231 0.0202  563 ARG A CA  
11   C C   . ARG A 10  ? 0.7838 0.7511 0.7662 -0.0948 -0.0160 0.0185  563 ARG A C   
12   O O   . ARG A 10  ? 0.7037 0.6814 0.7100 -0.0896 -0.0210 0.0261  563 ARG A O   
13   C CB  . ARG A 10  ? 0.9347 0.9143 0.9173 -0.1236 -0.0378 0.0337  563 ARG A CB  
14   C CG  . ARG A 10  ? 0.9901 0.9710 0.9541 -0.1448 -0.0486 0.0380  563 ARG A CG  
15   C CD  . ARG A 10  ? 0.9082 0.9038 0.8922 -0.1551 -0.0626 0.0520  563 ARG A CD  
16   N N   . LEU A 11  ? 0.6536 0.6110 0.6253 -0.0853 -0.0040 0.0090  564 LEU A N   
17   C CA  . LEU A 11  ? 0.6786 0.6379 0.6608 -0.0698 0.0015  0.0069  564 LEU A CA  
18   C C   . LEU A 11  ? 0.5846 0.5458 0.5832 -0.0605 0.0065  0.0072  564 LEU A C   
19   O O   . LEU A 11  ? 0.6913 0.6459 0.6843 -0.0604 0.0129  0.0035  564 LEU A O   
20   C CB  . LEU A 11  ? 0.6294 0.5790 0.5939 -0.0643 0.0111  -0.0015 564 LEU A CB  
21   C CG  . LEU A 11  ? 0.6511 0.5971 0.5995 -0.0712 0.0092  -0.0032 564 LEU A CG  
22   C CD1 . LEU A 11  ? 0.4507 0.3870 0.3868 -0.0642 0.0205  -0.0108 564 LEU A CD1 
23   C CD2 . LEU A 11  ? 0.4893 0.4452 0.4481 -0.0705 0.0002  0.0026  564 LEU A CD2 
24   N N   . THR A 12  ? 0.5418 0.5107 0.5602 -0.0529 0.0050  0.0110  565 THR A N   
25   C CA  . THR A 12  ? 0.5148 0.4841 0.5478 -0.0441 0.0116  0.0104  565 THR A CA  
26   C C   . THR A 12  ? 0.5530 0.5157 0.5744 -0.0341 0.0218  0.0026  565 THR A C   
27   O O   . THR A 12  ? 0.5897 0.5497 0.5976 -0.0322 0.0231  -0.0011 565 THR A O   
28   C CB  . THR A 12  ? 0.5052 0.4829 0.5634 -0.0395 0.0097  0.0159  565 THR A CB  
29   O OG1 . THR A 12  ? 0.5609 0.5387 0.6165 -0.0320 0.0131  0.0118  565 THR A OG1 
30   C CG2 . THR A 12  ? 0.4821 0.4689 0.5555 -0.0485 -0.0014 0.0262  565 THR A CG2 
31   N N   . PRO A 13  ? 0.4832 0.4435 0.5102 -0.0281 0.0289  0.0010  566 PRO A N   
32   C CA  . PRO A 13  ? 0.4128 0.3683 0.4287 -0.0195 0.0373  -0.0045 566 PRO A CA  
33   C C   . PRO A 13  ? 0.4939 0.4536 0.5117 -0.0134 0.0374  -0.0061 566 PRO A C   
34   O O   . PRO A 13  ? 0.4127 0.3706 0.4181 -0.0091 0.0405  -0.0096 566 PRO A O   
35   C CB  . PRO A 13  ? 0.4375 0.3903 0.4601 -0.0155 0.0441  -0.0046 566 PRO A CB  
36   C CG  . PRO A 13  ? 0.4349 0.3904 0.4727 -0.0220 0.0398  0.0003  566 PRO A CG  
37   C CD  . PRO A 13  ? 0.5090 0.4693 0.5480 -0.0309 0.0295  0.0043  566 PRO A CD  
38   N N   . LEU A 14  ? 0.5002 0.4656 0.5344 -0.0134 0.0346  -0.0033 567 LEU A N   
39   C CA  . LEU A 14  ? 0.4677 0.4362 0.5031 -0.0089 0.0357  -0.0059 567 LEU A CA  
40   C C   . LEU A 14  ? 0.3720 0.3414 0.3954 -0.0107 0.0309  -0.0070 567 LEU A C   
41   O O   . LEU A 14  ? 0.3961 0.3651 0.4098 -0.0062 0.0336  -0.0109 567 LEU A O   
42   C CB  . LEU A 14  ? 0.4500 0.4235 0.5075 -0.0093 0.0347  -0.0025 567 LEU A CB  
43   C CG  . LEU A 14  ? 0.4191 0.3947 0.4786 -0.0057 0.0372  -0.0061 567 LEU A CG  
44   C CD1 . LEU A 14  ? 0.2908 0.2625 0.3377 -0.0004 0.0453  -0.0127 567 LEU A CD1 
45   C CD2 . LEU A 14  ? 0.4157 0.3949 0.5002 -0.0066 0.0380  -0.0021 567 LEU A CD2 
46   N N   . THR A 15  ? 0.3613 0.3321 0.3856 -0.0180 0.0237  -0.0030 568 THR A N   
47   C CA  . THR A 15  ? 0.4245 0.3949 0.4372 -0.0210 0.0198  -0.0037 568 THR A CA  
48   C C   . THR A 15  ? 0.4423 0.4060 0.4365 -0.0183 0.0255  -0.0088 568 THR A C   
49   O O   . THR A 15  ? 0.4562 0.4202 0.4443 -0.0148 0.0267  -0.0114 568 THR A O   
50   C CB  . THR A 15  ? 0.4653 0.4372 0.4782 -0.0315 0.0116  0.0016  568 THR A CB  
51   O OG1 . THR A 15  ? 0.4008 0.3807 0.4347 -0.0335 0.0059  0.0086  568 THR A OG1 
52   C CG2 . THR A 15  ? 0.3922 0.3620 0.3909 -0.0353 0.0090  0.0001  568 THR A CG2 
53   N N   . VAL A 16  ? 0.4208 0.3786 0.4086 -0.0196 0.0296  -0.0097 569 VAL A N   
54   C CA  . VAL A 16  ? 0.3955 0.3465 0.3698 -0.0167 0.0366  -0.0131 569 VAL A CA  
55   C C   . VAL A 16  ? 0.3948 0.3488 0.3696 -0.0073 0.0407  -0.0147 569 VAL A C   
56   O O   . VAL A 16  ? 0.3660 0.3194 0.3344 -0.0045 0.0427  -0.0159 569 VAL A O   
57   C CB  . VAL A 16  ? 0.3967 0.3411 0.3674 -0.0190 0.0418  -0.0135 569 VAL A CB  
58   C CG1 . VAL A 16  ? 0.4080 0.3451 0.3682 -0.0150 0.0508  -0.0160 569 VAL A CG1 
59   C CG2 . VAL A 16  ? 0.4457 0.3874 0.4134 -0.0305 0.0371  -0.0123 569 VAL A CG2 
60   N N   . LEU A 17  ? 0.3627 0.3204 0.3459 -0.0034 0.0418  -0.0143 570 LEU A N   
61   C CA  . LEU A 17  ? 0.3885 0.3495 0.3699 0.0033  0.0448  -0.0157 570 LEU A CA  
62   C C   . LEU A 17  ? 0.3639 0.3303 0.3462 0.0039  0.0408  -0.0170 570 LEU A C   
63   O O   . LEU A 17  ? 0.2876 0.2564 0.2640 0.0077  0.0418  -0.0178 570 LEU A O   
64   C CB  . LEU A 17  ? 0.4378 0.3999 0.4265 0.0053  0.0477  -0.0159 570 LEU A CB  
65   C CG  . LEU A 17  ? 0.6857 0.6499 0.6681 0.0106  0.0519  -0.0172 570 LEU A CG  
66   C CD1 . LEU A 17  ? 0.8191 0.7802 0.7921 0.0137  0.0558  -0.0150 570 LEU A CD1 
67   C CD2 . LEU A 17  ? 0.7462 0.7098 0.7343 0.0112  0.0562  -0.0185 570 LEU A CD2 
68   N N   . LEU A 18  ? 0.2759 0.2451 0.2673 0.0003  0.0360  -0.0165 571 LEU A N   
69   C CA  . LEU A 18  ? 0.3187 0.2927 0.3128 0.0009  0.0330  -0.0178 571 LEU A CA  
70   C C   . LEU A 18  ? 0.3775 0.3499 0.3625 -0.0001 0.0312  -0.0179 571 LEU A C   
71   O O   . LEU A 18  ? 0.2838 0.2594 0.2666 0.0025  0.0311  -0.0195 571 LEU A O   
72   C CB  . LEU A 18  ? 0.3409 0.3180 0.3497 -0.0023 0.0293  -0.0159 571 LEU A CB  
73   C CG  . LEU A 18  ? 0.3374 0.3155 0.3592 -0.0009 0.0333  -0.0162 571 LEU A CG  
74   C CD1 . LEU A 18  ? 0.3877 0.3695 0.4282 -0.0037 0.0304  -0.0128 571 LEU A CD1 
75   C CD2 . LEU A 18  ? 0.3581 0.3368 0.3749 0.0030  0.0387  -0.0212 571 LEU A CD2 
76   N N   . ARG A 19  ? 0.3643 0.3313 0.3436 -0.0047 0.0307  -0.0164 572 ARG A N   
77   C CA  . ARG A 19  ? 0.3386 0.3020 0.3086 -0.0061 0.0316  -0.0172 572 ARG A CA  
78   C C   . ARG A 19  ? 0.4499 0.4125 0.4151 0.0000  0.0373  -0.0180 572 ARG A C   
79   O O   . ARG A 19  ? 0.4338 0.3972 0.3969 0.0016  0.0379  -0.0184 572 ARG A O   
80   C CB  . ARG A 19  ? 0.3430 0.2986 0.3052 -0.0137 0.0322  -0.0167 572 ARG A CB  
81   C CG  . ARG A 19  ? 0.4412 0.3911 0.3935 -0.0167 0.0346  -0.0183 572 ARG A CG  
82   C CD  . ARG A 19  ? 0.5673 0.5082 0.5089 -0.0264 0.0361  -0.0190 572 ARG A CD  
83   N NE  . ARG A 19  ? 0.3918 0.3252 0.3232 -0.0295 0.0408  -0.0214 572 ARG A NE  
84   C CZ  . ARG A 19  ? 0.4415 0.3750 0.3686 -0.0352 0.0366  -0.0212 572 ARG A CZ  
85   N NH1 . ARG A 19  ? 0.6455 0.5869 0.5787 -0.0385 0.0268  -0.0177 572 ARG A NH1 
86   N NH2 . ARG A 19  ? 0.8256 0.7509 0.7435 -0.0378 0.0429  -0.0239 572 ARG A NH2 
87   N N   . SER A 20  ? 0.4391 0.4007 0.4040 0.0034  0.0415  -0.0172 573 SER A N   
88   C CA  . SER A 20  ? 0.4233 0.3858 0.3857 0.0093  0.0462  -0.0157 573 SER A CA  
89   C C   . SER A 20  ? 0.4217 0.3934 0.3869 0.0131  0.0430  -0.0157 573 SER A C   
90   O O   . SER A 20  ? 0.3992 0.3743 0.3640 0.0164  0.0438  -0.0137 573 SER A O   
91   C CB  . SER A 20  ? 0.4787 0.4384 0.4403 0.0117  0.0511  -0.0139 573 SER A CB  
92   O OG  . SER A 20  ? 0.4430 0.4054 0.4042 0.0173  0.0548  -0.0104 573 SER A OG  
93   N N   . VAL A 21  ? 0.3182 0.2937 0.2872 0.0121  0.0399  -0.0178 574 VAL A N   
94   C CA  . VAL A 21  ? 0.2806 0.2636 0.2510 0.0135  0.0375  -0.0194 574 VAL A CA  
95   C C   . VAL A 21  ? 0.3345 0.3198 0.3067 0.0125  0.0341  -0.0203 574 VAL A C   
96   O O   . VAL A 21  ? 0.2533 0.2437 0.2241 0.0148  0.0335  -0.0193 574 VAL A O   
97   C CB  . VAL A 21  ? 0.2731 0.2575 0.2487 0.0118  0.0374  -0.0225 574 VAL A CB  
98   C CG1 . VAL A 21  ? 0.3060 0.2965 0.2823 0.0113  0.0359  -0.0258 574 VAL A CG1 
99   C CG2 . VAL A 21  ? 0.2649 0.2470 0.2374 0.0133  0.0418  -0.0217 574 VAL A CG2 
100  N N   . LEU A 22  ? 0.2931 0.2753 0.2687 0.0087  0.0318  -0.0212 575 LEU A N   
101  C CA  . LEU A 22  ? 0.3780 0.3619 0.3556 0.0071  0.0288  -0.0220 575 LEU A CA  
102  C C   . LEU A 22  ? 0.3579 0.3400 0.3309 0.0088  0.0309  -0.0205 575 LEU A C   
103  O O   . LEU A 22  ? 0.3398 0.3260 0.3149 0.0099  0.0294  -0.0211 575 LEU A O   
104  C CB  . LEU A 22  ? 0.3337 0.3142 0.3144 0.0018  0.0257  -0.0212 575 LEU A CB  
105  C CG  . LEU A 22  ? 0.3993 0.3814 0.3821 0.0000  0.0226  -0.0216 575 LEU A CG  
106  C CD1 . LEU A 22  ? 0.2223 0.2115 0.2128 0.0024  0.0214  -0.0241 575 LEU A CD1 
107  C CD2 . LEU A 22  ? 0.4538 0.4336 0.4392 -0.0062 0.0187  -0.0190 575 LEU A CD2 
108  N N   . ASP A 23  ? 0.3402 0.3155 0.3083 0.0087  0.0354  -0.0188 576 ASP A N   
109  C CA  . ASP A 23  ? 0.3145 0.2866 0.2810 0.0106  0.0400  -0.0169 576 ASP A CA  
110  C C   . ASP A 23  ? 0.3651 0.3453 0.3358 0.0164  0.0404  -0.0137 576 ASP A C   
111  O O   . ASP A 23  ? 0.3685 0.3508 0.3429 0.0184  0.0415  -0.0117 576 ASP A O   
112  C CB  . ASP A 23  ? 0.3122 0.2741 0.2736 0.0089  0.0469  -0.0161 576 ASP A CB  
113  C CG  . ASP A 23  ? 0.3221 0.2756 0.2769 0.0010  0.0466  -0.0187 576 ASP A CG  
114  O OD1 . ASP A 23  ? 0.4057 0.3608 0.3604 -0.0024 0.0417  -0.0200 576 ASP A OD1 
115  O OD2 . ASP A 23  ? 0.4517 0.3971 0.4012 -0.0023 0.0512  -0.0192 576 ASP A OD2 
116  N N   . GLN A 24  ? 0.3534 0.3384 0.3237 0.0186  0.0394  -0.0126 577 GLN A N   
117  C CA  . GLN A 24  ? 0.3850 0.3792 0.3573 0.0225  0.0382  -0.0084 577 GLN A CA  
118  C C   . GLN A 24  ? 0.4503 0.4534 0.4246 0.0213  0.0323  -0.0107 577 GLN A C   
119  O O   . GLN A 24  ? 0.2213 0.2323 0.1989 0.0231  0.0304  -0.0069 577 GLN A O   
120  C CB  . GLN A 24  ? 0.4828 0.4791 0.4514 0.0237  0.0389  -0.0067 577 GLN A CB  
121  C CG  . GLN A 24  ? 0.3747 0.3649 0.3435 0.0264  0.0454  -0.0021 577 GLN A CG  
122  C CD  . GLN A 24  ? 0.6367 0.6290 0.6016 0.0276  0.0462  -0.0001 577 GLN A CD  
123  O OE1 . GLN A 24  ? 0.6378 0.6379 0.6022 0.0299  0.0449  0.0054  577 GLN A OE1 
124  N NE2 . GLN A 24  ? 0.3910 0.3765 0.3533 0.0255  0.0481  -0.0040 577 GLN A NE2 
125  N N   . LEU A 25  ? 0.3570 0.3591 0.3308 0.0179  0.0297  -0.0164 578 LEU A N   
126  C CA  . LEU A 25  ? 0.4269 0.4361 0.4032 0.0161  0.0255  -0.0198 578 LEU A CA  
127  C C   . LEU A 25  ? 0.4358 0.4455 0.4167 0.0166  0.0248  -0.0188 578 LEU A C   
128  O O   . LEU A 25  ? 0.3680 0.3857 0.3520 0.0171  0.0220  -0.0179 578 LEU A O   
129  C CB  . LEU A 25  ? 0.3668 0.3735 0.3451 0.0127  0.0248  -0.0253 578 LEU A CB  
130  C CG  . LEU A 25  ? 0.4904 0.4969 0.4660 0.0117  0.0268  -0.0273 578 LEU A CG  
131  C CD1 . LEU A 25  ? 0.4173 0.4217 0.3997 0.0086  0.0274  -0.0320 578 LEU A CD1 
132  C CD2 . LEU A 25  ? 0.4887 0.5026 0.4579 0.0114  0.0260  -0.0271 578 LEU A CD2 
133  N N   . GLN A 26  ? 0.3756 0.3765 0.3565 0.0158  0.0274  -0.0188 579 GLN A N   
134  C CA  . GLN A 26  ? 0.3265 0.3254 0.3106 0.0158  0.0285  -0.0181 579 GLN A CA  
135  C C   . GLN A 26  ? 0.3483 0.3500 0.3365 0.0198  0.0316  -0.0126 579 GLN A C   
136  O O   . GLN A 26  ? 0.3450 0.3502 0.3392 0.0207  0.0311  -0.0114 579 GLN A O   
137  C CB  . GLN A 26  ? 0.3734 0.3613 0.3534 0.0121  0.0312  -0.0195 579 GLN A CB  
138  C CG  . GLN A 26  ? 0.4636 0.4517 0.4443 0.0080  0.0267  -0.0226 579 GLN A CG  
139  C CD  . GLN A 26  ? 0.3793 0.3596 0.3563 0.0031  0.0272  -0.0229 579 GLN A CD  
140  O OE1 . GLN A 26  ? 0.3992 0.3743 0.3716 -0.0013 0.0264  -0.0224 579 GLN A OE1 
141  N NE2 . GLN A 26  ? 0.2668 0.2472 0.2459 0.0029  0.0277  -0.0233 579 GLN A NE2 
142  N N   . ASP A 27  ? 0.3750 0.3760 0.3621 0.0224  0.0348  -0.0084 580 ASP A N   
143  C CA  . ASP A 27  ? 0.3580 0.3621 0.3528 0.0266  0.0383  -0.0010 580 ASP A CA  
144  C C   . ASP A 27  ? 0.4958 0.5142 0.4966 0.0278  0.0320  0.0024  580 ASP A C   
145  O O   . ASP A 27  ? 0.4710 0.4936 0.4822 0.0305  0.0334  0.0085  580 ASP A O   
146  C CB  . ASP A 27  ? 0.4142 0.4156 0.4083 0.0294  0.0431  0.0038  580 ASP A CB  
147  C CG  . ASP A 27  ? 0.3449 0.3314 0.3350 0.0278  0.0515  0.0014  580 ASP A CG  
148  O OD1 . ASP A 27  ? 0.6362 0.6145 0.6253 0.0250  0.0549  -0.0020 580 ASP A OD1 
149  O OD2 . ASP A 27  ? 0.3988 0.3812 0.3855 0.0285  0.0548  0.0025  580 ASP A OD2 
150  N N   . LYS A 28  ? 0.5368 0.5620 0.5316 0.0251  0.0257  -0.0013 581 LYS A N   
151  C CA  . LYS A 28  ? 0.4721 0.5108 0.4691 0.0236  0.0190  0.0002  581 LYS A CA  
152  C C   . LYS A 28  ? 0.4883 0.5294 0.4900 0.0214  0.0163  -0.0042 581 LYS A C   
153  O O   . LYS A 28  ? 0.4657 0.5178 0.4694 0.0192  0.0108  -0.0034 581 LYS A O   
154  C CB  . LYS A 28  ? 0.4750 0.5179 0.4618 0.0199  0.0154  -0.0035 581 LYS A CB  
155  C CG  . LYS A 28  ? 0.5398 0.5791 0.5203 0.0215  0.0183  -0.0006 581 LYS A CG  
156  C CD  . LYS A 28  ? 0.7663 0.8128 0.7510 0.0248  0.0181  0.0106  581 LYS A CD  
157  C CE  . LYS A 28  ? 0.7355 0.7754 0.7162 0.0273  0.0232  0.0134  581 LYS A CE  
158  N NZ  . LYS A 28  ? 0.8217 0.8483 0.8066 0.0303  0.0309  0.0121  581 LYS A NZ  
159  N N   . ASP A 29  ? 0.4952 0.5263 0.4980 0.0213  0.0199  -0.0084 582 ASP A N   
160  C CA  . ASP A 29  ? 0.4068 0.4390 0.4145 0.0195  0.0182  -0.0122 582 ASP A CA  
161  C C   . ASP A 29  ? 0.3151 0.3420 0.3307 0.0220  0.0233  -0.0086 582 ASP A C   
162  O O   . ASP A 29  ? 0.3179 0.3366 0.3326 0.0205  0.0261  -0.0123 582 ASP A O   
163  C CB  . ASP A 29  ? 0.4289 0.4540 0.4313 0.0162  0.0182  -0.0197 582 ASP A CB  
164  C CG  . ASP A 29  ? 0.3670 0.3916 0.3747 0.0144  0.0174  -0.0232 582 ASP A CG  
165  O OD1 . ASP A 29  ? 0.4502 0.4826 0.4643 0.0146  0.0152  -0.0224 582 ASP A OD1 
166  O OD2 . ASP A 29  ? 0.4784 0.4953 0.4842 0.0124  0.0187  -0.0260 582 ASP A OD2 
167  N N   . PRO A 30  ? 0.4465 0.4783 0.4709 0.0256  0.0252  -0.0005 583 PRO A N   
168  C CA  . PRO A 30  ? 0.4133 0.4375 0.4464 0.0281  0.0330  0.0027  583 PRO A CA  
169  C C   . PRO A 30  ? 0.3778 0.3998 0.4153 0.0265  0.0337  -0.0009 583 PRO A C   
170  O O   . PRO A 30  ? 0.4416 0.4524 0.4808 0.0267  0.0418  -0.0013 583 PRO A O   
171  C CB  . PRO A 30  ? 0.5103 0.5447 0.5577 0.0323  0.0332  0.0136  583 PRO A CB  
172  C CG  . PRO A 30  ? 0.4447 0.4950 0.4900 0.0304  0.0225  0.0153  583 PRO A CG  
173  C CD  . PRO A 30  ? 0.5433 0.5889 0.5720 0.0269  0.0200  0.0065  583 PRO A CD  
174  N N   . ALA A 31  ? 0.2701 0.3018 0.3090 0.0244  0.0262  -0.0040 584 ALA A N   
175  C CA  . ALA A 31  ? 0.2954 0.3253 0.3392 0.0229  0.0269  -0.0075 584 ALA A CA  
176  C C   . ALA A 31  ? 0.2887 0.3086 0.3220 0.0194  0.0277  -0.0149 584 ALA A C   
177  O O   . ALA A 31  ? 0.3538 0.3710 0.3899 0.0178  0.0286  -0.0177 584 ALA A O   
178  C CB  . ALA A 31  ? 0.3882 0.4326 0.4390 0.0214  0.0192  -0.0078 584 ALA A CB  
179  N N   . ARG A 32  ? 0.2594 0.2745 0.2821 0.0178  0.0271  -0.0172 585 ARG A N   
180  C CA  . ARG A 32  ? 0.3867 0.3931 0.4015 0.0140  0.0273  -0.0219 585 ARG A CA  
181  C C   . ARG A 32  ? 0.4041 0.4164 0.4231 0.0120  0.0226  -0.0260 585 ARG A C   
182  O O   . ARG A 32  ? 0.4960 0.5030 0.5144 0.0095  0.0232  -0.0280 585 ARG A O   
183  C CB  . ARG A 32  ? 0.3852 0.3785 0.3955 0.0121  0.0342  -0.0216 585 ARG A CB  
184  C CG  . ARG A 32  ? 0.4594 0.4435 0.4620 0.0118  0.0399  -0.0198 585 ARG A CG  
185  C CD  . ARG A 32  ? 0.5034 0.4734 0.5006 0.0085  0.0488  -0.0204 585 ARG A CD  
186  N NE  . ARG A 32  ? 0.4401 0.4045 0.4287 0.0024  0.0466  -0.0235 585 ARG A NE  
187  C CZ  . ARG A 32  ? 0.4728 0.4330 0.4506 -0.0028 0.0434  -0.0247 585 ARG A CZ  
188  N NH1 . ARG A 32  ? 0.3162 0.2732 0.2883 -0.0085 0.0406  -0.0255 585 ARG A NH1 
189  N NH2 . ARG A 32  ? 0.3059 0.2656 0.2794 -0.0027 0.0428  -0.0242 585 ARG A NH2 
190  N N   . ILE A 33  ? 0.4170 0.4401 0.4398 0.0123  0.0181  -0.0273 586 ILE A N   
191  C CA  . ILE A 33  ? 0.3487 0.3767 0.3755 0.0097  0.0151  -0.0322 586 ILE A CA  
192  C C   . ILE A 33  ? 0.3354 0.3581 0.3589 0.0073  0.0152  -0.0352 586 ILE A C   
193  O O   . ILE A 33  ? 0.3036 0.3249 0.3320 0.0054  0.0152  -0.0376 586 ILE A O   
194  C CB  . ILE A 33  ? 0.3778 0.4178 0.4066 0.0087  0.0112  -0.0333 586 ILE A CB  
195  C CG1 . ILE A 33  ? 0.4230 0.4698 0.4599 0.0105  0.0101  -0.0289 586 ILE A CG1 
196  C CG2 . ILE A 33  ? 0.3940 0.4372 0.4254 0.0047  0.0099  -0.0402 586 ILE A CG2 
197  C CD1 . ILE A 33  ? 0.4556 0.5147 0.4929 0.0095  0.0053  -0.0259 586 ILE A CD1 
198  N N   . PHE A 34  ? 0.2911 0.3112 0.3081 0.0075  0.0154  -0.0342 587 PHE A N   
199  C CA  . PHE A 34  ? 0.3188 0.3352 0.3359 0.0053  0.0154  -0.0359 587 PHE A CA  
200  C C   . PHE A 34  ? 0.3588 0.3666 0.3705 0.0044  0.0162  -0.0323 587 PHE A C   
201  O O   . PHE A 34  ? 0.3888 0.3945 0.4007 0.0028  0.0157  -0.0318 587 PHE A O   
202  C CB  . PHE A 34  ? 0.3837 0.4040 0.3985 0.0050  0.0152  -0.0383 587 PHE A CB  
203  C CG  . PHE A 34  ? 0.3135 0.3423 0.3288 0.0041  0.0140  -0.0415 587 PHE A CG  
204  C CD1 . PHE A 34  ? 0.4604 0.4920 0.4813 0.0008  0.0148  -0.0472 587 PHE A CD1 
205  C CD2 . PHE A 34  ? 0.2600 0.2944 0.2706 0.0056  0.0122  -0.0382 587 PHE A CD2 
206  C CE1 . PHE A 34  ? 0.4449 0.4842 0.4638 -0.0020 0.0135  -0.0509 587 PHE A CE1 
207  C CE2 . PHE A 34  ? 0.3669 0.4107 0.3768 0.0030  0.0095  -0.0402 587 PHE A CE2 
208  C CZ  . PHE A 34  ? 0.3163 0.3623 0.3290 -0.0014 0.0100  -0.0471 587 PHE A CZ  
209  N N   . ALA A 35  ? 0.3678 0.3704 0.3751 0.0045  0.0182  -0.0299 588 ALA A N   
210  C CA  . ALA A 35  ? 0.2595 0.2529 0.2584 0.0018  0.0198  -0.0273 588 ALA A CA  
211  C C   . ALA A 35  ? 0.2925 0.2829 0.2921 -0.0029 0.0171  -0.0259 588 ALA A C   
212  O O   . ALA A 35  ? 0.3031 0.2892 0.2973 -0.0066 0.0159  -0.0235 588 ALA A O   
213  C CB  . ALA A 35  ? 0.3254 0.3127 0.3198 0.0023  0.0248  -0.0261 588 ALA A CB  
214  N N   . GLN A 36  ? 0.3358 0.3294 0.3432 -0.0033 0.0159  -0.0266 589 GLN A N   
215  C CA  . GLN A 36  ? 0.3234 0.3151 0.3336 -0.0077 0.0132  -0.0235 589 GLN A CA  
216  C C   . GLN A 36  ? 0.3350 0.3337 0.3606 -0.0065 0.0117  -0.0244 589 GLN A C   
217  O O   . GLN A 36  ? 0.2600 0.2638 0.2914 -0.0031 0.0134  -0.0290 589 GLN A O   
218  C CB  . GLN A 36  ? 0.3051 0.2903 0.3079 -0.0107 0.0154  -0.0224 589 GLN A CB  
219  C CG  . GLN A 36  ? 0.3763 0.3516 0.3630 -0.0143 0.0188  -0.0217 589 GLN A CG  
220  C CD  . GLN A 36  ? 0.5442 0.5107 0.5218 -0.0187 0.0228  -0.0215 589 GLN A CD  
221  O OE1 . GLN A 36  ? 0.4684 0.4335 0.4486 -0.0155 0.0278  -0.0237 589 GLN A OE1 
222  N NE2 . GLN A 36  ? 0.4678 0.4286 0.4348 -0.0270 0.0207  -0.0183 589 GLN A NE2 
223  N N   . PRO A 37  ? 0.2909 0.2900 0.3238 -0.0098 0.0089  -0.0196 590 PRO A N   
224  C CA  . PRO A 37  ? 0.3406 0.3446 0.3905 -0.0090 0.0093  -0.0196 590 PRO A CA  
225  C C   . PRO A 37  ? 0.3105 0.3157 0.3625 -0.0071 0.0118  -0.0237 590 PRO A C   
226  O O   . PRO A 37  ? 0.3360 0.3371 0.3789 -0.0081 0.0121  -0.0229 590 PRO A O   
227  C CB  . PRO A 37  ? 0.2272 0.2306 0.2822 -0.0137 0.0053  -0.0107 590 PRO A CB  
228  C CG  . PRO A 37  ? 0.3932 0.3928 0.4350 -0.0177 0.0020  -0.0069 590 PRO A CG  
229  C CD  . PRO A 37  ? 0.2391 0.2338 0.2646 -0.0157 0.0053  -0.0130 590 PRO A CD  
230  N N   . VAL A 38  ? 0.3831 0.3931 0.4468 -0.0050 0.0144  -0.0286 591 VAL A N   
231  C CA  . VAL A 38  ? 0.4180 0.4302 0.4874 -0.0040 0.0166  -0.0324 591 VAL A CA  
232  C C   . VAL A 38  ? 0.4322 0.4419 0.5068 -0.0060 0.0159  -0.0269 591 VAL A C   
233  O O   . VAL A 38  ? 0.2860 0.2957 0.3691 -0.0080 0.0144  -0.0208 591 VAL A O   
234  C CB  . VAL A 38  ? 0.4108 0.4276 0.4933 -0.0036 0.0202  -0.0383 591 VAL A CB  
235  C CG1 . VAL A 38  ? 0.5299 0.5460 0.6267 -0.0048 0.0216  -0.0339 591 VAL A CG1 
236  C CG2 . VAL A 38  ? 0.3557 0.3750 0.4453 -0.0035 0.0225  -0.0425 591 VAL A CG2 
237  N N   . SER A 39  ? 0.3559 0.3638 0.4264 -0.0058 0.0169  -0.0278 592 SER A N   
238  C CA  . SER A 39  ? 0.4215 0.4269 0.4965 -0.0082 0.0168  -0.0227 592 SER A CA  
239  C C   . SER A 39  ? 0.4193 0.4291 0.5131 -0.0069 0.0198  -0.0250 592 SER A C   
240  O O   . SER A 39  ? 0.3741 0.3872 0.4722 -0.0049 0.0227  -0.0323 592 SER A O   
241  C CB  . SER A 39  ? 0.5215 0.5215 0.5851 -0.0089 0.0184  -0.0229 592 SER A CB  
242  O OG  . SER A 39  ? 0.4558 0.4535 0.5237 -0.0114 0.0189  -0.0184 592 SER A OG  
243  N N   . LEU A 40  ? 0.3410 0.3511 0.4464 -0.0087 0.0191  -0.0180 593 LEU A N   
244  C CA  . LEU A 40  ? 0.2905 0.3035 0.4161 -0.0078 0.0233  -0.0188 593 LEU A CA  
245  C C   . LEU A 40  ? 0.3143 0.3257 0.4401 -0.0077 0.0253  -0.0198 593 LEU A C   
246  O O   . LEU A 40  ? 0.4432 0.4569 0.5822 -0.0064 0.0299  -0.0247 593 LEU A O   
247  C CB  . LEU A 40  ? 0.2912 0.3056 0.4319 -0.0096 0.0219  -0.0084 593 LEU A CB  
248  C CG  . LEU A 40  ? 0.2656 0.2823 0.4156 -0.0090 0.0226  -0.0078 593 LEU A CG  
249  C CD1 . LEU A 40  ? 0.3756 0.3950 0.5483 -0.0102 0.0224  0.0042  593 LEU A CD1 
250  C CD2 . LEU A 40  ? 0.3867 0.4045 0.5429 -0.0068 0.0295  -0.0196 593 LEU A CD2 
251  N N   . LYS A 41  ? 0.3901 0.3966 0.5004 -0.0097 0.0228  -0.0159 594 LYS A N   
252  C CA  . LYS A 41  ? 0.3064 0.3100 0.4152 -0.0096 0.0258  -0.0175 594 LYS A CA  
253  C C   . LYS A 41  ? 0.3858 0.3923 0.4957 -0.0063 0.0288  -0.0274 594 LYS A C   
254  O O   . LYS A 41  ? 0.4341 0.4417 0.5527 -0.0053 0.0323  -0.0307 594 LYS A O   
255  C CB  . LYS A 41  ? 0.4505 0.4464 0.5391 -0.0131 0.0244  -0.0134 594 LYS A CB  
256  C CG  . LYS A 41  ? 0.5571 0.5501 0.6387 -0.0189 0.0199  -0.0028 594 LYS A CG  
257  C CD  . LYS A 41  ? 0.4906 0.4859 0.5875 -0.0199 0.0202  0.0038  594 LYS A CD  
258  C CE  . LYS A 41  ? 0.5715 0.5639 0.6584 -0.0272 0.0152  0.0155  594 LYS A CE  
259  N NZ  . LYS A 41  ? 0.3131 0.3076 0.4158 -0.0274 0.0166  0.0221  594 LYS A NZ  
260  N N   . GLU A 42  ? 0.3810 0.3891 0.4819 -0.0051 0.0270  -0.0311 595 GLU A N   
261  C CA  A GLU A 42  ? 0.3918 0.4043 0.4923 -0.0029 0.0281  -0.0385 595 GLU A CA  
262  C CA  B GLU A 42  ? 0.3996 0.4121 0.5007 -0.0029 0.0282  -0.0384 595 GLU A CA  
263  C C   . GLU A 42  ? 0.4376 0.4568 0.5497 -0.0029 0.0292  -0.0447 595 GLU A C   
264  O O   . GLU A 42  ? 0.4172 0.4416 0.5329 -0.0029 0.0300  -0.0508 595 GLU A O   
265  C CB  A GLU A 42  ? 0.3862 0.3978 0.4725 -0.0020 0.0258  -0.0384 595 GLU A CB  
266  C CB  B GLU A 42  ? 0.4120 0.4228 0.4984 -0.0019 0.0264  -0.0381 595 GLU A CB  
267  C CG  A GLU A 42  ? 0.4511 0.4551 0.5251 -0.0023 0.0272  -0.0349 595 GLU A CG  
268  C CG  B GLU A 42  ? 0.4671 0.4692 0.5422 -0.0029 0.0284  -0.0339 595 GLU A CG  
269  C CD  A GLU A 42  ? 0.5387 0.5419 0.6019 -0.0011 0.0265  -0.0349 595 GLU A CD  
270  C CD  B GLU A 42  ? 0.5819 0.5827 0.6630 -0.0020 0.0325  -0.0352 595 GLU A CD  
271  O OE1 A GLU A 42  ? 0.7258 0.7207 0.7767 -0.0028 0.0281  -0.0317 595 GLU A OE1 
272  O OE1 B GLU A 42  ? 0.7522 0.7602 0.8460 -0.0004 0.0329  -0.0395 595 GLU A OE1 
273  O OE2 A GLU A 42  ? 0.4103 0.4208 0.4767 0.0009  0.0246  -0.0381 595 GLU A OE2 
274  O OE2 B GLU A 42  ? 0.5746 0.5667 0.6472 -0.0036 0.0360  -0.0324 595 GLU A OE2 
275  N N   . VAL A 43  ? 0.4588 0.4778 0.5770 -0.0039 0.0295  -0.0430 596 VAL A N   
276  C CA  . VAL A 43  ? 0.4256 0.4487 0.5542 -0.0049 0.0330  -0.0499 596 VAL A CA  
277  C C   . VAL A 43  ? 0.3932 0.4146 0.5391 -0.0057 0.0371  -0.0467 596 VAL A C   
278  O O   . VAL A 43  ? 0.3280 0.3486 0.4770 -0.0059 0.0374  -0.0440 596 VAL A O   
279  C CB  . VAL A 43  ? 0.4822 0.5075 0.6007 -0.0053 0.0312  -0.0535 596 VAL A CB  
280  C CG1 . VAL A 43  ? 0.4157 0.4446 0.5410 -0.0082 0.0357  -0.0629 596 VAL A CG1 
281  C CG2 . VAL A 43  ? 0.4390 0.4659 0.5422 -0.0038 0.0267  -0.0532 596 VAL A CG2 
282  N N   . PRO A 44  ? 0.3729 0.3940 0.5324 -0.0059 0.0410  -0.0464 597 PRO A N   
283  C CA  . PRO A 44  ? 0.3575 0.3769 0.5355 -0.0059 0.0444  -0.0393 597 PRO A CA  
284  C C   . PRO A 44  ? 0.3412 0.3609 0.5352 -0.0069 0.0517  -0.0439 597 PRO A C   
285  O O   . PRO A 44  ? 0.3268 0.3455 0.5380 -0.0065 0.0545  -0.0363 597 PRO A O   
286  C CB  . PRO A 44  ? 0.2724 0.2912 0.4599 -0.0057 0.0472  -0.0382 597 PRO A CB  
287  C CG  . PRO A 44  ? 0.4538 0.4729 0.6256 -0.0053 0.0441  -0.0427 597 PRO A CG  
288  C CD  . PRO A 44  ? 0.4121 0.4342 0.5713 -0.0057 0.0418  -0.0500 597 PRO A CD  
289  N N   . ASP A 45  ? 0.3830 0.4040 0.5722 -0.0090 0.0552  -0.0559 598 ASP A N   
290  C CA  . ASP A 45  ? 0.3477 0.3669 0.5500 -0.0115 0.0646  -0.0625 598 ASP A CA  
291  C C   . ASP A 45  ? 0.3609 0.3794 0.5535 -0.0118 0.0631  -0.0632 598 ASP A C   
292  O O   . ASP A 45  ? 0.3530 0.3688 0.5533 -0.0144 0.0714  -0.0694 598 ASP A O   
293  C CB  . ASP A 45  ? 0.3061 0.3264 0.5071 -0.0158 0.0702  -0.0761 598 ASP A CB  
294  C CG  . ASP A 45  ? 0.5268 0.5518 0.7043 -0.0176 0.0628  -0.0819 598 ASP A CG  
295  O OD1 . ASP A 45  ? 0.5110 0.5373 0.6752 -0.0143 0.0544  -0.0752 598 ASP A OD1 
296  O OD2 . ASP A 45  ? 0.4344 0.4620 0.6076 -0.0227 0.0654  -0.0925 598 ASP A OD2 
297  N N   . TYR A 46  ? 0.3542 0.3741 0.5301 -0.0097 0.0538  -0.0573 599 TYR A N   
298  C CA  . TYR A 46  ? 0.3507 0.3704 0.5147 -0.0101 0.0520  -0.0592 599 TYR A CA  
299  C C   . TYR A 46  ? 0.3239 0.3402 0.5045 -0.0106 0.0593  -0.0575 599 TYR A C   
300  O O   . TYR A 46  ? 0.3691 0.3836 0.5464 -0.0131 0.0646  -0.0653 599 TYR A O   
301  C CB  . TYR A 46  ? 0.3031 0.3234 0.4508 -0.0077 0.0424  -0.0515 599 TYR A CB  
302  C CG  . TYR A 46  ? 0.3009 0.3215 0.4331 -0.0079 0.0400  -0.0545 599 TYR A CG  
303  C CD1 . TYR A 46  ? 0.2298 0.2485 0.3629 -0.0070 0.0387  -0.0485 599 TYR A CD1 
304  C CD2 . TYR A 46  ? 0.3639 0.3876 0.4819 -0.0094 0.0389  -0.0624 599 TYR A CD2 
305  C CE1 . TYR A 46  ? 0.3905 0.4090 0.5099 -0.0071 0.0371  -0.0510 599 TYR A CE1 
306  C CE2 . TYR A 46  ? 0.2577 0.2820 0.3618 -0.0096 0.0367  -0.0639 599 TYR A CE2 
307  C CZ  . TYR A 46  ? 0.5862 0.6072 0.6909 -0.0081 0.0363  -0.0585 599 TYR A CZ  
308  O OH  . TYR A 46  ? 0.3216 0.3425 0.4137 -0.0081 0.0349  -0.0596 599 TYR A OH  
309  N N   . LEU A 47  ? 0.3545 0.3701 0.5545 -0.0088 0.0602  -0.0471 600 LEU A N   
310  C CA  . LEU A 47  ? 0.3323 0.3455 0.5526 -0.0087 0.0673  -0.0430 600 LEU A CA  
311  C C   . LEU A 47  ? 0.4156 0.4248 0.6571 -0.0109 0.0819  -0.0509 600 LEU A C   
312  O O   . LEU A 47  ? 0.4235 0.4293 0.6857 -0.0108 0.0906  -0.0480 600 LEU A O   
313  C CB  . LEU A 47  ? 0.1313 0.1468 0.3657 -0.0065 0.0615  -0.0264 600 LEU A CB  
314  C CG  . LEU A 47  ? 0.3034 0.3214 0.5175 -0.0061 0.0484  -0.0183 600 LEU A CG  
315  C CD1 . LEU A 47  ? 0.4165 0.4377 0.6448 -0.0064 0.0423  -0.0012 600 LEU A CD1 
316  C CD2 . LEU A 47  ? 0.4170 0.4340 0.6182 -0.0063 0.0465  -0.0209 600 LEU A CD2 
317  N N   . ASP A 48  ? 0.2682 0.2770 0.5063 -0.0133 0.0858  -0.0607 601 ASP A N   
318  C CA  . ASP A 48  ? 0.4010 0.4045 0.6520 -0.0177 0.1008  -0.0724 601 ASP A CA  
319  C C   . ASP A 48  ? 0.4647 0.4649 0.6992 -0.0221 0.1050  -0.0837 601 ASP A C   
320  O O   . ASP A 48  ? 0.4541 0.4476 0.7018 -0.0253 0.1186  -0.0895 601 ASP A O   
321  C CB  . ASP A 48  ? 0.4390 0.4434 0.6887 -0.0204 0.1032  -0.0807 601 ASP A CB  
322  C CG  . ASP A 48  ? 0.5715 0.5773 0.8424 -0.0165 0.1029  -0.0700 601 ASP A CG  
323  O OD1 . ASP A 48  ? 0.5658 0.5713 0.8568 -0.0130 0.1038  -0.0570 601 ASP A OD1 
324  O OD2 . ASP A 48  ? 0.5121 0.5198 0.7803 -0.0172 0.1015  -0.0734 601 ASP A OD2 
325  N N   . HIS A 49  ? 0.5111 0.5156 0.7180 -0.0224 0.0940  -0.0858 602 HIS A N   
326  C CA  . HIS A 49  ? 0.4739 0.4765 0.6616 -0.0275 0.0966  -0.0963 602 HIS A CA  
327  C C   . HIS A 49  ? 0.4008 0.4022 0.5837 -0.0247 0.0937  -0.0902 602 HIS A C   
328  O O   . HIS A 49  ? 0.4437 0.4400 0.6227 -0.0287 0.1018  -0.0975 602 HIS A O   
329  C CB  . HIS A 49  ? 0.5537 0.5628 0.7157 -0.0303 0.0871  -0.1022 602 HIS A CB  
330  C CG  . HIS A 49  ? 0.7247 0.7359 0.8910 -0.0335 0.0890  -0.1081 602 HIS A CG  
331  N ND1 . HIS A 49  ? 0.8179 0.8322 0.9939 -0.0286 0.0838  -0.1005 602 HIS A ND1 
332  C CD2 . HIS A 49  ? 0.8802 0.8907 1.0422 -0.0419 0.0958  -0.1211 602 HIS A CD2 
333  C CE1 . HIS A 49  ? 0.6500 0.6656 0.8288 -0.0329 0.0874  -0.1083 602 HIS A CE1 
334  N NE2 . HIS A 49  ? 0.7822 0.7958 0.9526 -0.0412 0.0944  -0.1209 602 HIS A NE2 
335  N N   . ILE A 50  ? 0.3967 0.4019 0.5798 -0.0187 0.0829  -0.0774 603 ILE A N   
336  C CA  . ILE A 50  ? 0.3496 0.3548 0.5247 -0.0163 0.0777  -0.0713 603 ILE A CA  
337  C C   . ILE A 50  ? 0.3371 0.3410 0.5360 -0.0129 0.0793  -0.0591 603 ILE A C   
338  O O   . ILE A 50  ? 0.4560 0.4631 0.6659 -0.0102 0.0737  -0.0486 603 ILE A O   
339  C CB  . ILE A 50  ? 0.3671 0.3777 0.5208 -0.0134 0.0634  -0.0658 603 ILE A CB  
340  C CG1 . ILE A 50  ? 0.4709 0.4845 0.6016 -0.0163 0.0603  -0.0752 603 ILE A CG1 
341  C CG2 . ILE A 50  ? 0.4019 0.4122 0.5520 -0.0106 0.0580  -0.0573 603 ILE A CG2 
342  C CD1 . ILE A 50  ? 0.5238 0.5347 0.6457 -0.0215 0.0675  -0.0855 603 ILE A CD1 
343  N N   . LYS A 51  ? 0.4312 0.4309 0.6377 -0.0135 0.0864  -0.0596 604 LYS A N   
344  C CA  . LYS A 51  ? 0.3636 0.3628 0.5975 -0.0108 0.0889  -0.0473 604 LYS A CA  
345  C C   . LYS A 51  ? 0.4046 0.4084 0.6314 -0.0080 0.0760  -0.0352 604 LYS A C   
346  O O   . LYS A 51  ? 0.4345 0.4417 0.6814 -0.0063 0.0723  -0.0214 604 LYS A O   
347  C CB  . LYS A 51  ? 0.4589 0.4506 0.7088 -0.0128 0.1045  -0.0528 604 LYS A CB  
348  C CG  . LYS A 51  ? 0.4433 0.4281 0.7022 -0.0173 0.1206  -0.0658 604 LYS A CG  
349  C CD  . LYS A 51  ? 0.3604 0.3473 0.6389 -0.0162 0.1224  -0.0618 604 LYS A CD  
350  C CE  . LYS A 51  ? 0.8699 0.8488 1.1559 -0.0218 0.1396  -0.0764 604 LYS A CE  
351  N NZ  . LYS A 51  ? 0.7424 0.7155 1.0019 -0.0290 0.1460  -0.0938 604 LYS A NZ  
352  N N   . HIS A 52  ? 0.3801 0.3844 0.5790 -0.0083 0.0694  -0.0401 605 HIS A N   
353  C CA  . HIS A 52  ? 0.3203 0.3271 0.5091 -0.0068 0.0592  -0.0316 605 HIS A CA  
354  C C   . HIS A 52  ? 0.3719 0.3808 0.5310 -0.0066 0.0500  -0.0355 605 HIS A C   
355  O O   . HIS A 52  ? 0.3370 0.3444 0.4777 -0.0072 0.0508  -0.0433 605 HIS A O   
356  C CB  . HIS A 52  ? 0.3450 0.3478 0.5349 -0.0071 0.0654  -0.0344 605 HIS A CB  
357  C CG  . HIS A 52  ? 0.6151 0.6202 0.8069 -0.0059 0.0577  -0.0233 605 HIS A CG  
358  N ND1 . HIS A 52  ? 0.4495 0.4528 0.6608 -0.0056 0.0636  -0.0186 605 HIS A ND1 
359  C CD2 . HIS A 52  ? 0.5875 0.5964 0.7650 -0.0057 0.0454  -0.0162 605 HIS A CD2 
360  C CE1 . HIS A 52  ? 0.5028 0.5096 0.7113 -0.0054 0.0539  -0.0089 605 HIS A CE1 
361  N NE2 . HIS A 52  ? 0.4363 0.4460 0.6235 -0.0059 0.0431  -0.0076 605 HIS A NE2 
362  N N   . PRO A 53  ? 0.4151 0.4270 0.5701 -0.0061 0.0422  -0.0300 606 PRO A N   
363  C CA  . PRO A 53  ? 0.3934 0.4064 0.5234 -0.0057 0.0346  -0.0321 606 PRO A CA  
364  C C   . PRO A 53  ? 0.4005 0.4126 0.5175 -0.0054 0.0295  -0.0283 606 PRO A C   
365  O O   . PRO A 53  ? 0.3043 0.3164 0.4320 -0.0059 0.0281  -0.0205 606 PRO A O   
366  C CB  . PRO A 53  ? 0.3574 0.3721 0.4894 -0.0059 0.0290  -0.0254 606 PRO A CB  
367  C CG  . PRO A 53  ? 0.3873 0.4028 0.5442 -0.0062 0.0348  -0.0230 606 PRO A CG  
368  C CD  . PRO A 53  ? 0.4048 0.4190 0.5788 -0.0062 0.0412  -0.0216 606 PRO A CD  
369  N N   . MET A 54  ? 0.3691 0.3809 0.4653 -0.0046 0.0271  -0.0333 607 MET A N   
370  C CA  . MET A 54  ? 0.3460 0.3562 0.4293 -0.0042 0.0232  -0.0302 607 MET A CA  
371  C C   . MET A 54  ? 0.3276 0.3378 0.3915 -0.0032 0.0197  -0.0326 607 MET A C   
372  O O   . MET A 54  ? 0.2868 0.2992 0.3467 -0.0025 0.0210  -0.0381 607 MET A O   
373  C CB  . MET A 54  ? 0.2888 0.2974 0.3733 -0.0039 0.0285  -0.0341 607 MET A CB  
374  C CG  . MET A 54  ? 0.2430 0.2496 0.3171 -0.0034 0.0255  -0.0307 607 MET A CG  
375  S SD  . MET A 54  ? 0.3930 0.3995 0.4731 -0.0056 0.0186  -0.0193 607 MET A SD  
376  C CE  . MET A 54  ? 0.2280 0.2368 0.3384 -0.0065 0.0223  -0.0141 607 MET A CE  
377  N N   . ASP A 55  ? 0.4023 0.4099 0.4554 -0.0035 0.0158  -0.0281 608 ASP A N   
378  C CA  . ASP A 55  ? 0.3750 0.3812 0.4121 -0.0024 0.0143  -0.0293 608 ASP A CA  
379  C C   . ASP A 55  ? 0.3098 0.3120 0.3370 -0.0029 0.0132  -0.0263 608 ASP A C   
380  O O   . ASP A 55  ? 0.2416 0.2428 0.2740 -0.0049 0.0121  -0.0226 608 ASP A O   
381  C CB  . ASP A 55  ? 0.2751 0.2797 0.3107 -0.0039 0.0121  -0.0266 608 ASP A CB  
382  C CG  . ASP A 55  ? 0.3940 0.3958 0.4309 -0.0081 0.0087  -0.0197 608 ASP A CG  
383  O OD1 . ASP A 55  ? 0.4299 0.4343 0.4813 -0.0095 0.0076  -0.0160 608 ASP A OD1 
384  O OD2 . ASP A 55  ? 0.4848 0.4817 0.5088 -0.0106 0.0073  -0.0174 608 ASP A OD2 
385  N N   . PHE A 56  ? 0.2640 0.2641 0.2789 -0.0014 0.0139  -0.0272 609 PHE A N   
386  C CA  . PHE A 56  ? 0.3233 0.3189 0.3295 -0.0019 0.0144  -0.0251 609 PHE A CA  
387  C C   . PHE A 56  ? 0.3091 0.2996 0.3117 -0.0072 0.0118  -0.0206 609 PHE A C   
388  O O   . PHE A 56  ? 0.3141 0.3021 0.3144 -0.0096 0.0109  -0.0181 609 PHE A O   
389  C CB  . PHE A 56  ? 0.4164 0.4103 0.4127 0.0008  0.0172  -0.0261 609 PHE A CB  
390  C CG  . PHE A 56  ? 0.3520 0.3518 0.3491 0.0046  0.0184  -0.0286 609 PHE A CG  
391  C CD1 . PHE A 56  ? 0.4250 0.4266 0.4230 0.0051  0.0192  -0.0298 609 PHE A CD1 
392  C CD2 . PHE A 56  ? 0.2516 0.2554 0.2482 0.0070  0.0187  -0.0291 609 PHE A CD2 
393  C CE1 . PHE A 56  ? 0.3203 0.3271 0.3158 0.0070  0.0201  -0.0319 609 PHE A CE1 
394  C CE2 . PHE A 56  ? 0.4492 0.4599 0.4453 0.0089  0.0185  -0.0302 609 PHE A CE2 
395  C CZ  . PHE A 56  ? 0.4701 0.4821 0.4641 0.0085  0.0190  -0.0318 609 PHE A CZ  
396  N N   . ALA A 57  ? 0.3125 0.3014 0.3135 -0.0097 0.0106  -0.0194 610 ALA A N   
397  C CA  . ALA A 57  ? 0.3438 0.3282 0.3389 -0.0168 0.0075  -0.0147 610 ALA A CA  
398  C C   . ALA A 57  ? 0.3225 0.3111 0.3289 -0.0199 0.0026  -0.0093 610 ALA A C   
399  O O   . ALA A 57  ? 0.3486 0.3348 0.3497 -0.0254 -0.0002 -0.0053 610 ALA A O   
400  C CB  . ALA A 57  ? 0.2712 0.2536 0.2636 -0.0195 0.0071  -0.0139 610 ALA A CB  
401  N N   . THR A 58  ? 0.2803 0.2750 0.3033 -0.0168 0.0023  -0.0089 611 THR A N   
402  C CA  . THR A 58  ? 0.3517 0.3508 0.3908 -0.0192 -0.0010 -0.0022 611 THR A CA  
403  C C   . THR A 58  ? 0.3228 0.3217 0.3640 -0.0179 0.0003  -0.0027 611 THR A C   
404  O O   . THR A 58  ? 0.3863 0.3871 0.4356 -0.0217 -0.0033 0.0040  611 THR A O   
405  C CB  . THR A 58  ? 0.4534 0.4578 0.5126 -0.0161 0.0009  -0.0021 611 THR A CB  
406  O OG1 . THR A 58  ? 0.3651 0.3693 0.4218 -0.0168 0.0001  -0.0024 611 THR A OG1 
407  C CG2 . THR A 58  ? 0.1824 0.1915 0.2635 -0.0185 -0.0017 0.0069  611 THR A CG2 
408  N N   . MET A 59  ? 0.4086 0.4057 0.4431 -0.0130 0.0054  -0.0097 612 MET A N   
409  C CA  . MET A 59  ? 0.3698 0.3659 0.4048 -0.0115 0.0078  -0.0106 612 MET A CA  
410  C C   . MET A 59  ? 0.2640 0.2555 0.2860 -0.0157 0.0054  -0.0079 612 MET A C   
411  O O   . MET A 59  ? 0.3382 0.3300 0.3654 -0.0181 0.0038  -0.0042 612 MET A O   
412  C CB  . MET A 59  ? 0.3322 0.3281 0.3613 -0.0061 0.0133  -0.0178 612 MET A CB  
413  C CG  . MET A 59  ? 0.2755 0.2750 0.3157 -0.0037 0.0169  -0.0219 612 MET A CG  
414  S SD  . MET A 59  ? 0.3752 0.3754 0.4047 -0.0001 0.0220  -0.0296 612 MET A SD  
415  C CE  . MET A 59  ? 0.3090 0.3061 0.3402 0.0000  0.0252  -0.0284 612 MET A CE  
416  N N   . ARG A 60  ? 0.3026 0.2894 0.3087 -0.0170 0.0060  -0.0100 613 ARG A N   
417  C CA  . ARG A 60  ? 0.2804 0.2609 0.2728 -0.0224 0.0055  -0.0087 613 ARG A CA  
418  C C   . ARG A 60  ? 0.3608 0.3425 0.3558 -0.0312 -0.0014 -0.0016 613 ARG A C   
419  O O   . ARG A 60  ? 0.3474 0.3275 0.3394 -0.0361 -0.0032 0.0009  613 ARG A O   
420  C CB  . ARG A 60  ? 0.2551 0.2289 0.2321 -0.0231 0.0093  -0.0122 613 ARG A CB  
421  C CG  . ARG A 60  ? 0.2210 0.1859 0.1827 -0.0293 0.0117  -0.0126 613 ARG A CG  
422  C CD  . ARG A 60  ? 0.4695 0.4265 0.4194 -0.0283 0.0189  -0.0168 613 ARG A CD  
423  N NE  . ARG A 60  ? 0.2759 0.2359 0.2315 -0.0186 0.0236  -0.0194 613 ARG A NE  
424  C CZ  . ARG A 60  ? 0.3363 0.2949 0.2913 -0.0140 0.0284  -0.0204 613 ARG A CZ  
425  N NH1 . ARG A 60  ? 0.3008 0.2540 0.2503 -0.0174 0.0305  -0.0201 613 ARG A NH1 
426  N NH2 . ARG A 60  ? 0.3169 0.2804 0.2775 -0.0063 0.0308  -0.0211 613 ARG A NH2 
427  N N   . LYS A 61  ? 0.4059 0.3914 0.4071 -0.0338 -0.0057 0.0023  614 LYS A N   
428  C CA  . LYS A 61  ? 0.3994 0.3888 0.4059 -0.0426 -0.0139 0.0116  614 LYS A CA  
429  C C   . LYS A 61  ? 0.4174 0.4134 0.4435 -0.0421 -0.0168 0.0176  614 LYS A C   
430  O O   . LYS A 61  ? 0.3864 0.3837 0.4115 -0.0499 -0.0226 0.0239  614 LYS A O   
431  C CB  . LYS A 61  ? 0.4500 0.4436 0.4641 -0.0437 -0.0172 0.0158  614 LYS A CB  
432  C CG  . LYS A 61  ? 0.5924 0.5881 0.6025 -0.0551 -0.0260 0.0255  614 LYS A CG  
433  C CD  . LYS A 61  ? 0.7642 0.7693 0.7966 -0.0552 -0.0313 0.0351  614 LYS A CD  
434  C CE  . LYS A 61  ? 0.9395 0.9451 0.9612 -0.0660 -0.0387 0.0429  614 LYS A CE  
435  N NZ  . LYS A 61  ? 0.9115 0.9280 0.9576 -0.0675 -0.0456 0.0561  614 LYS A NZ  
436  N N   . ARG A 62  ? 0.4173 0.4171 0.4614 -0.0339 -0.0124 0.0157  615 ARG A N   
437  C CA  . ARG A 62  ? 0.3217 0.3259 0.3854 -0.0327 -0.0125 0.0204  615 ARG A CA  
438  C C   . ARG A 62  ? 0.4028 0.4023 0.4553 -0.0334 -0.0105 0.0172  615 ARG A C   
439  O O   . ARG A 62  ? 0.3285 0.3307 0.3896 -0.0379 -0.0145 0.0238  615 ARG A O   
440  C CB  . ARG A 62  ? 0.4063 0.4127 0.4885 -0.0246 -0.0053 0.0167  615 ARG A CB  
441  C CG  . ARG A 62  ? 0.4624 0.4697 0.5613 -0.0220 -0.0009 0.0179  615 ARG A CG  
442  C CD  . ARG A 62  ? 0.6098 0.6229 0.7406 -0.0212 0.0005  0.0254  615 ARG A CD  
443  N NE  . ARG A 62  ? 0.6257 0.6367 0.7645 -0.0152 0.0102  0.0176  615 ARG A NE  
444  C CZ  . ARG A 62  ? 0.3698 0.3787 0.5241 -0.0116 0.0198  0.0143  615 ARG A CZ  
445  N NH1 . ARG A 62  ? 0.4192 0.4281 0.5873 -0.0119 0.0221  0.0186  615 ARG A NH1 
446  N NH2 . ARG A 62  ? 0.3078 0.3141 0.4637 -0.0084 0.0281  0.0060  615 ARG A NH2 
447  N N   . LEU A 63  ? 0.3572 0.3502 0.3922 -0.0293 -0.0045 0.0081  616 LEU A N   
448  C CA  . LEU A 63  ? 0.3057 0.2938 0.3314 -0.0290 -0.0012 0.0051  616 LEU A CA  
449  C C   . LEU A 63  ? 0.4092 0.3945 0.4239 -0.0387 -0.0063 0.0090  616 LEU A C   
450  O O   . LEU A 63  ? 0.4445 0.4304 0.4640 -0.0419 -0.0078 0.0122  616 LEU A O   
451  C CB  . LEU A 63  ? 0.4235 0.4059 0.4338 -0.0231 0.0058  -0.0032 616 LEU A CB  
452  C CG  . LEU A 63  ? 0.4278 0.4048 0.4294 -0.0220 0.0104  -0.0058 616 LEU A CG  
453  C CD1 . LEU A 63  ? 0.4121 0.3921 0.4285 -0.0197 0.0118  -0.0039 616 LEU A CD1 
454  C CD2 . LEU A 63  ? 0.4063 0.3796 0.3967 -0.0157 0.0170  -0.0116 616 LEU A CD2 
455  N N   . GLU A 64  ? 0.4225 0.4041 0.4216 -0.0442 -0.0082 0.0082  617 GLU A N   
456  C CA  . GLU A 64  ? 0.4015 0.3786 0.3854 -0.0556 -0.0121 0.0104  617 GLU A CA  
457  C C   . GLU A 64  ? 0.5081 0.4933 0.5038 -0.0647 -0.0225 0.0212  617 GLU A C   
458  O O   . GLU A 64  ? 0.5070 0.4899 0.4924 -0.0748 -0.0260 0.0233  617 GLU A O   
459  C CB  . GLU A 64  ? 0.4908 0.4612 0.4554 -0.0602 -0.0104 0.0068  617 GLU A CB  
460  C CG  . GLU A 64  ? 0.5493 0.5107 0.5022 -0.0531 0.0003  -0.0023 617 GLU A CG  
461  C CD  . GLU A 64  ? 0.5823 0.5366 0.5203 -0.0557 0.0042  -0.0061 617 GLU A CD  
462  O OE1 . GLU A 64  ? 0.7108 0.6677 0.6482 -0.0607 -0.0011 -0.0025 617 GLU A OE1 
463  O OE2 . GLU A 64  ? 0.6705 0.6165 0.5991 -0.0524 0.0133  -0.0121 617 GLU A OE2 
464  N N   . ALA A 65  ? 0.4495 0.4444 0.4681 -0.0615 -0.0269 0.0284  618 ALA A N   
465  C CA  . ALA A 65  ? 0.4519 0.4566 0.4898 -0.0680 -0.0362 0.0409  618 ALA A CA  
466  C C   . ALA A 65  ? 0.4706 0.4782 0.5287 -0.0618 -0.0326 0.0419  618 ALA A C   
467  O O   . ALA A 65  ? 0.5824 0.5988 0.6640 -0.0642 -0.0380 0.0525  618 ALA A O   
468  C CB  . ALA A 65  ? 0.3870 0.4003 0.4427 -0.0678 -0.0415 0.0497  618 ALA A CB  
469  N N   . GLN A 66  ? 0.5590 0.5593 0.6093 -0.0539 -0.0229 0.0316  619 GLN A N   
470  C CA  . GLN A 66  ? 0.5410 0.5418 0.6066 -0.0478 -0.0176 0.0309  619 GLN A CA  
471  C C   . GLN A 66  ? 0.5202 0.5281 0.6155 -0.0423 -0.0162 0.0363  619 GLN A C   
472  O O   . GLN A 66  ? 0.4401 0.4514 0.5561 -0.0414 -0.0150 0.0414  619 GLN A O   
473  C CB  . GLN A 66  ? 0.4837 0.4849 0.5487 -0.0557 -0.0218 0.0354  619 GLN A CB  
474  C CG  . GLN A 66  ? 0.6413 0.6331 0.6771 -0.0615 -0.0203 0.0285  619 GLN A CG  
475  C CD  . GLN A 66  ? 0.4830 0.4706 0.5179 -0.0612 -0.0157 0.0257  619 GLN A CD  
476  O OE1 . GLN A 66  ? 0.8428 0.8281 0.8845 -0.0514 -0.0075 0.0212  619 GLN A OE1 
477  N NE2 . GLN A 66  ? 0.6775 0.6637 0.7025 -0.0726 -0.0207 0.0282  619 GLN A NE2 
478  N N   . GLY A 67  ? 0.4833 0.4922 0.5807 -0.0383 -0.0145 0.0343  620 GLY A N   
479  C CA  . GLY A 67  ? 0.4046 0.4189 0.5295 -0.0336 -0.0115 0.0385  620 GLY A CA  
480  C C   . GLY A 67  ? 0.4392 0.4491 0.5709 -0.0246 0.0004  0.0296  620 GLY A C   
481  O O   . GLY A 67  ? 0.4492 0.4616 0.6025 -0.0213 0.0052  0.0313  620 GLY A O   
482  N N   . TYR A 68  ? 0.4298 0.4330 0.5427 -0.0213 0.0060  0.0203  621 TYR A N   
483  C CA  . TYR A 68  ? 0.3417 0.3406 0.4583 -0.0149 0.0168  0.0128  621 TYR A CA  
484  C C   . TYR A 68  ? 0.4434 0.4411 0.5704 -0.0152 0.0196  0.0158  621 TYR A C   
485  O O   . TYR A 68  ? 0.4599 0.4559 0.5749 -0.0181 0.0160  0.0167  621 TYR A O   
486  C CB  . TYR A 68  ? 0.4022 0.3956 0.4927 -0.0111 0.0209  0.0023  621 TYR A CB  
487  C CG  . TYR A 68  ? 0.2550 0.2497 0.3383 -0.0100 0.0198  -0.0012 621 TYR A CG  
488  C CD1 . TYR A 68  ? 0.1827 0.1789 0.2793 -0.0076 0.0249  -0.0038 621 TYR A CD1 
489  C CD2 . TYR A 68  ? 0.5211 0.5147 0.5854 -0.0119 0.0147  -0.0022 621 TYR A CD2 
490  C CE1 . TYR A 68  ? 0.3730 0.3705 0.4636 -0.0069 0.0239  -0.0072 621 TYR A CE1 
491  C CE2 . TYR A 68  ? 0.2320 0.2268 0.2910 -0.0108 0.0140  -0.0052 621 TYR A CE2 
492  C CZ  . TYR A 68  ? 0.3489 0.3462 0.4211 -0.0083 0.0179  -0.0075 621 TYR A CZ  
493  O OH  . TYR A 68  ? 0.2515 0.2502 0.3195 -0.0075 0.0172  -0.0104 621 TYR A OH  
494  N N   . LYS A 69  ? 0.4523 0.4501 0.6025 -0.0125 0.0273  0.0169  622 LYS A N   
495  C CA  . LYS A 69  ? 0.4426 0.4393 0.6082 -0.0125 0.0313  0.0205  622 LYS A CA  
496  C C   . LYS A 69  ? 0.4359 0.4242 0.5877 -0.0079 0.0422  0.0100  622 LYS A C   
497  O O   . LYS A 69  ? 0.4641 0.4496 0.6199 -0.0077 0.0458  0.0109  622 LYS A O   
498  C CB  . LYS A 69  ? 0.4906 0.4912 0.6928 -0.0122 0.0354  0.0286  622 LYS A CB  
499  C CG  . LYS A 69  ? 0.6566 0.6677 0.8806 -0.0180 0.0235  0.0441  622 LYS A CG  
500  C CD  . LYS A 69  ? 0.8184 0.8349 1.0784 -0.0170 0.0266  0.0531  622 LYS A CD  
501  C CE  . LYS A 69  ? 0.8904 0.8995 1.1681 -0.0111 0.0443  0.0460  622 LYS A CE  
502  N NZ  . LYS A 69  ? 0.9618 0.9643 1.2442 -0.0090 0.0542  0.0422  622 LYS A NZ  
503  N N   . ASN A 70  ? 0.3290 0.3139 0.4653 -0.0049 0.0473  0.0007  623 ASN A N   
504  C CA  . ASN A 70  ? 0.3807 0.3588 0.5009 -0.0018 0.0566  -0.0085 623 ASN A CA  
505  C C   . ASN A 70  ? 0.2812 0.2587 0.3775 -0.0004 0.0563  -0.0165 623 ASN A C   
506  O O   . ASN A 70  ? 0.3052 0.2864 0.4012 -0.0011 0.0513  -0.0160 623 ASN A O   
507  C CB  . ASN A 70  ? 0.4487 0.4223 0.5877 -0.0008 0.0691  -0.0110 623 ASN A CB  
508  C CG  . ASN A 70  ? 0.4887 0.4637 0.6443 -0.0012 0.0730  -0.0116 623 ASN A CG  
509  O OD1 . ASN A 70  ? 0.4181 0.3932 0.5598 -0.0012 0.0729  -0.0179 623 ASN A OD1 
510  N ND2 . ASN A 70  ? 0.4116 0.3880 0.5991 -0.0018 0.0767  -0.0043 623 ASN A ND2 
511  N N   . LEU A 71  ? 0.3336 0.3071 0.4106 0.0013  0.0610  -0.0227 624 LEU A N   
512  C CA  . LEU A 71  ? 0.3929 0.3676 0.4487 0.0022  0.0595  -0.0285 624 LEU A CA  
513  C C   . LEU A 71  ? 0.4095 0.3846 0.4717 0.0009  0.0641  -0.0336 624 LEU A C   
514  O O   . LEU A 71  ? 0.4300 0.4085 0.4834 0.0006  0.0604  -0.0362 624 LEU A O   
515  C CB  . LEU A 71  ? 0.3215 0.2930 0.3579 0.0037  0.0638  -0.0325 624 LEU A CB  
516  C CG  . LEU A 71  ? 0.3712 0.3450 0.3875 0.0039  0.0632  -0.0373 624 LEU A CG  
517  C CD1 . LEU A 71  ? 0.2406 0.2196 0.2497 0.0050  0.0542  -0.0347 624 LEU A CD1 
518  C CD2 . LEU A 71  ? 0.5372 0.5085 0.5380 0.0048  0.0672  -0.0383 624 LEU A CD2 
519  N N   . HIS A 72  ? 0.3944 0.3656 0.4734 -0.0001 0.0734  -0.0353 625 HIS A N   
520  C CA  . HIS A 72  ? 0.4135 0.3831 0.4996 -0.0021 0.0806  -0.0412 625 HIS A CA  
521  C C   . HIS A 72  ? 0.2707 0.2459 0.3692 -0.0022 0.0740  -0.0373 625 HIS A C   
522  O O   . HIS A 72  ? 0.2638 0.2399 0.3583 -0.0036 0.0756  -0.0428 625 HIS A O   
523  C CB  . HIS A 72  ? 0.4241 0.3867 0.5297 -0.0034 0.0941  -0.0430 625 HIS A CB  
524  C CG  . HIS A 72  ? 0.6573 0.6171 0.7778 -0.0058 0.1032  -0.0477 625 HIS A CG  
525  N ND1 . HIS A 72  ? 0.8432 0.8059 0.9931 -0.0050 0.1029  -0.0408 625 HIS A ND1 
526  C CD2 . HIS A 72  ? 0.7054 0.6597 0.8157 -0.0097 0.1133  -0.0585 625 HIS A CD2 
527  C CE1 . HIS A 72  ? 0.9178 0.8763 1.0765 -0.0074 0.1134  -0.0473 625 HIS A CE1 
528  N NE2 . HIS A 72  ? 0.8449 0.7979 0.9791 -0.0108 0.1201  -0.0589 625 HIS A NE2 
529  N N   . GLU A 73  ? 0.3562 0.3355 0.4689 -0.0015 0.0664  -0.0276 626 GLU A N   
530  C CA  . GLU A 73  ? 0.3842 0.3691 0.5070 -0.0022 0.0592  -0.0225 626 GLU A CA  
531  C C   . GLU A 73  ? 0.3540 0.3419 0.4539 -0.0019 0.0513  -0.0253 626 GLU A C   
532  O O   . GLU A 73  ? 0.3120 0.3026 0.4145 -0.0024 0.0494  -0.0263 626 GLU A O   
533  C CB  . GLU A 73  ? 0.4547 0.4441 0.5959 -0.0033 0.0516  -0.0103 626 GLU A CB  
534  C CG  . GLU A 73  ? 0.4434 0.4324 0.6175 -0.0036 0.0589  -0.0045 626 GLU A CG  
535  C CD  . GLU A 73  ? 0.5959 0.5919 0.7892 -0.0058 0.0494  0.0095  626 GLU A CD  
536  O OE1 . GLU A 73  ? 0.5463 0.5462 0.7244 -0.0082 0.0376  0.0134  626 GLU A OE1 
537  O OE2 . GLU A 73  ? 0.6061 0.6036 0.8299 -0.0060 0.0538  0.0171  626 GLU A OE2 
538  N N   . PHE A 74  ? 0.3240 0.3111 0.4034 -0.0009 0.0477  -0.0263 627 PHE A N   
539  C CA  . PHE A 74  ? 0.3528 0.3422 0.4129 -0.0003 0.0412  -0.0277 627 PHE A CA  
540  C C   . PHE A 74  ? 0.3424 0.3323 0.3926 0.0000  0.0452  -0.0357 627 PHE A C   
541  O O   . PHE A 74  ? 0.3487 0.3418 0.3962 -0.0003 0.0417  -0.0369 627 PHE A O   
542  C CB  . PHE A 74  ? 0.3867 0.3742 0.4312 0.0007  0.0386  -0.0262 627 PHE A CB  
543  C CG  . PHE A 74  ? 0.2513 0.2402 0.2794 0.0016  0.0337  -0.0265 627 PHE A CG  
544  C CD1 . PHE A 74  ? 0.2706 0.2593 0.2967 -0.0001 0.0278  -0.0220 627 PHE A CD1 
545  C CD2 . PHE A 74  ? 0.2984 0.2885 0.3131 0.0036  0.0355  -0.0309 627 PHE A CD2 
546  C CE1 . PHE A 74  ? 0.3937 0.3820 0.4064 0.0005  0.0256  -0.0226 627 PHE A CE1 
547  C CE2 . PHE A 74  ? 0.4537 0.4452 0.4574 0.0048  0.0320  -0.0299 627 PHE A CE2 
548  C CZ  . PHE A 74  ? 0.4043 0.3942 0.4076 0.0037  0.0279  -0.0262 627 PHE A CZ  
549  N N   . GLU A 75  ? 0.4064 0.3933 0.4509 -0.0005 0.0525  -0.0411 628 GLU A N   
550  C CA  . GLU A 75  ? 0.4332 0.4210 0.4656 -0.0025 0.0560  -0.0489 628 GLU A CA  
551  C C   . GLU A 75  ? 0.3914 0.3796 0.4361 -0.0049 0.0595  -0.0528 628 GLU A C   
552  O O   . GLU A 75  ? 0.3549 0.3465 0.3910 -0.0064 0.0576  -0.0569 628 GLU A O   
553  C CB  . GLU A 75  ? 0.5128 0.4960 0.5360 -0.0045 0.0644  -0.0541 628 GLU A CB  
554  C CG  . GLU A 75  ? 0.5502 0.5331 0.5591 -0.0023 0.0621  -0.0508 628 GLU A CG  
555  C CD  . GLU A 75  ? 0.7583 0.7357 0.7598 -0.0048 0.0713  -0.0552 628 GLU A CD  
556  O OE1 . GLU A 75  ? 1.0295 1.0086 1.0122 -0.0054 0.0700  -0.0556 628 GLU A OE1 
557  O OE2 . GLU A 75  ? 0.8283 0.7995 0.8436 -0.0062 0.0800  -0.0575 628 GLU A OE2 
558  N N   . GLU A 76  ? 0.3564 0.3416 0.4234 -0.0051 0.0647  -0.0507 629 GLU A N   
559  C CA  . GLU A 76  ? 0.2940 0.2791 0.3767 -0.0070 0.0692  -0.0533 629 GLU A CA  
560  C C   . GLU A 76  ? 0.3343 0.3256 0.4156 -0.0058 0.0596  -0.0498 629 GLU A C   
561  O O   . GLU A 76  ? 0.3280 0.3208 0.4060 -0.0076 0.0608  -0.0554 629 GLU A O   
562  C CB  . GLU A 76  ? 0.3945 0.3765 0.5057 -0.0066 0.0759  -0.0485 629 GLU A CB  
563  C CG  . GLU A 76  ? 0.4156 0.3942 0.5443 -0.0091 0.0866  -0.0534 629 GLU A CG  
564  C CD  . GLU A 76  ? 0.5245 0.5001 0.6856 -0.0082 0.0944  -0.0468 629 GLU A CD  
565  O OE1 . GLU A 76  ? 0.5426 0.5166 0.7097 -0.0069 0.0952  -0.0420 629 GLU A OE1 
566  O OE2 . GLU A 76  ? 0.6633 0.6385 0.8461 -0.0087 0.1000  -0.0458 629 GLU A OE2 
567  N N   . ASP A 77  ? 0.3192 0.3134 0.4010 -0.0036 0.0505  -0.0413 630 ASP A N   
568  C CA  . ASP A 77  ? 0.3356 0.3341 0.4141 -0.0031 0.0425  -0.0383 630 ASP A CA  
569  C C   . ASP A 77  ? 0.3615 0.3620 0.4187 -0.0027 0.0397  -0.0436 630 ASP A C   
570  O O   . ASP A 77  ? 0.3094 0.3128 0.3661 -0.0031 0.0378  -0.0455 630 ASP A O   
571  C CB  . ASP A 77  ? 0.3507 0.3506 0.4312 -0.0028 0.0342  -0.0287 630 ASP A CB  
572  C CG  . ASP A 77  ? 0.4811 0.4823 0.5860 -0.0042 0.0339  -0.0207 630 ASP A CG  
573  O OD1 . ASP A 77  ? 0.5058 0.5067 0.6286 -0.0043 0.0404  -0.0221 630 ASP A OD1 
574  O OD2 . ASP A 77  ? 0.4120 0.4145 0.5187 -0.0057 0.0273  -0.0124 630 ASP A OD2 
575  N N   . PHE A 78  ? 0.3026 0.3025 0.3444 -0.0018 0.0395  -0.0449 631 PHE A N   
576  C CA  . PHE A 78  ? 0.3166 0.3202 0.3415 -0.0015 0.0365  -0.0478 631 PHE A CA  
577  C C   . PHE A 78  ? 0.3556 0.3613 0.3792 -0.0049 0.0404  -0.0554 631 PHE A C   
578  O O   . PHE A 78  ? 0.4695 0.4798 0.4891 -0.0054 0.0368  -0.0567 631 PHE A O   
579  C CB  . PHE A 78  ? 0.3523 0.3555 0.3629 -0.0001 0.0359  -0.0464 631 PHE A CB  
580  C CG  . PHE A 78  ? 0.2673 0.2760 0.2641 0.0000  0.0327  -0.0472 631 PHE A CG  
581  C CD1 . PHE A 78  ? 0.5522 0.5630 0.5382 -0.0024 0.0350  -0.0507 631 PHE A CD1 
582  C CD2 . PHE A 78  ? 0.3778 0.3899 0.3733 0.0020  0.0275  -0.0440 631 PHE A CD2 
583  C CE1 . PHE A 78  ? 0.3373 0.3551 0.3126 -0.0030 0.0308  -0.0494 631 PHE A CE1 
584  C CE2 . PHE A 78  ? 0.2879 0.3063 0.2746 0.0023  0.0245  -0.0431 631 PHE A CE2 
585  C CZ  . PHE A 78  ? 0.4393 0.4613 0.4167 -0.0001 0.0253  -0.0450 631 PHE A CZ  
586  N N   . ASP A 79  ? 0.3319 0.3337 0.3592 -0.0080 0.0486  -0.0608 632 ASP A N   
587  C CA  . ASP A 79  ? 0.3909 0.3928 0.4164 -0.0133 0.0543  -0.0695 632 ASP A CA  
588  C C   . ASP A 79  ? 0.4304 0.4341 0.4688 -0.0139 0.0541  -0.0709 632 ASP A C   
589  O O   . ASP A 79  ? 0.3902 0.3977 0.4214 -0.0175 0.0535  -0.0764 632 ASP A O   
590  C CB  . ASP A 79  ? 0.4979 0.4923 0.5275 -0.0171 0.0659  -0.0754 632 ASP A CB  
591  C CG  . ASP A 79  ? 0.5463 0.5397 0.5562 -0.0194 0.0673  -0.0777 632 ASP A CG  
592  O OD1 . ASP A 79  ? 0.5747 0.5736 0.5712 -0.0169 0.0589  -0.0728 632 ASP A OD1 
593  O OD2 . ASP A 79  ? 0.8796 0.8663 0.8882 -0.0240 0.0777  -0.0840 632 ASP A OD2 
594  N N   . LEU A 80  ? 0.4002 0.4020 0.4574 -0.0110 0.0542  -0.0653 633 LEU A N   
595  C CA  . LEU A 80  ? 0.4049 0.4085 0.4756 -0.0107 0.0531  -0.0640 633 LEU A CA  
596  C C   . LEU A 80  ? 0.4536 0.4631 0.5127 -0.0096 0.0446  -0.0631 633 LEU A C   
597  O O   . LEU A 80  ? 0.4762 0.4880 0.5379 -0.0117 0.0456  -0.0674 633 LEU A O   
598  C CB  . LEU A 80  ? 0.4098 0.4124 0.4992 -0.0077 0.0510  -0.0545 633 LEU A CB  
599  C CG  . LEU A 80  ? 0.4114 0.4097 0.5233 -0.0082 0.0596  -0.0525 633 LEU A CG  
600  C CD1 . LEU A 80  ? 0.3702 0.3707 0.4986 -0.0061 0.0537  -0.0403 633 LEU A CD1 
601  C CD2 . LEU A 80  ? 0.4341 0.4298 0.5597 -0.0112 0.0698  -0.0595 633 LEU A CD2 
602  N N   . ILE A 81  ? 0.4149 0.4263 0.4626 -0.0065 0.0374  -0.0576 634 ILE A N   
603  C CA  . ILE A 81  ? 0.3279 0.3438 0.3670 -0.0050 0.0308  -0.0557 634 ILE A CA  
604  C C   . ILE A 81  ? 0.4332 0.4542 0.4636 -0.0081 0.0310  -0.0620 634 ILE A C   
605  O O   . ILE A 81  ? 0.3318 0.3567 0.3648 -0.0089 0.0289  -0.0635 634 ILE A O   
606  C CB  . ILE A 81  ? 0.3902 0.4059 0.4181 -0.0019 0.0259  -0.0498 634 ILE A CB  
607  C CG1 . ILE A 81  ? 0.2750 0.2864 0.3091 -0.0005 0.0240  -0.0432 634 ILE A CG1 
608  C CG2 . ILE A 81  ? 0.2085 0.2289 0.2286 -0.0006 0.0216  -0.0487 634 ILE A CG2 
609  C CD1 . ILE A 81  ? 0.3464 0.3558 0.3695 0.0013  0.0206  -0.0384 634 ILE A CD1 
610  N N   . ILE A 82  ? 0.3636 0.3850 0.3834 -0.0105 0.0331  -0.0652 635 ILE A N   
611  C CA  . ILE A 82  ? 0.3968 0.4237 0.4051 -0.0156 0.0326  -0.0706 635 ILE A CA  
612  C C   . ILE A 82  ? 0.4724 0.4982 0.4870 -0.0217 0.0388  -0.0797 635 ILE A C   
613  O O   . ILE A 82  ? 0.3984 0.4298 0.4120 -0.0248 0.0362  -0.0826 635 ILE A O   
614  C CB  . ILE A 82  ? 0.3747 0.4007 0.3693 -0.0179 0.0345  -0.0716 635 ILE A CB  
615  C CG1 . ILE A 82  ? 0.3227 0.3500 0.3117 -0.0121 0.0292  -0.0628 635 ILE A CG1 
616  C CG2 . ILE A 82  ? 0.3897 0.4221 0.3702 -0.0254 0.0333  -0.0767 635 ILE A CG2 
617  C CD1 . ILE A 82  ? 0.3364 0.3713 0.3233 -0.0092 0.0215  -0.0568 635 ILE A CD1 
618  N N   . ASP A 83  ? 0.4089 0.4270 0.4318 -0.0235 0.0479  -0.0839 636 ASP A N   
619  C CA  . ASP A 83  ? 0.4930 0.5076 0.5221 -0.0300 0.0569  -0.0934 636 ASP A CA  
620  C C   . ASP A 83  ? 0.5081 0.5245 0.5526 -0.0283 0.0560  -0.0927 636 ASP A C   
621  O O   . ASP A 83  ? 0.5622 0.5799 0.6068 -0.0339 0.0591  -0.1000 636 ASP A O   
622  C CB  . ASP A 83  ? 0.5740 0.5787 0.6139 -0.0312 0.0688  -0.0966 636 ASP A CB  
623  C CG  . ASP A 83  ? 0.5024 0.5041 0.5270 -0.0335 0.0714  -0.0981 636 ASP A CG  
624  O OD1 . ASP A 83  ? 0.6333 0.6404 0.6370 -0.0367 0.0658  -0.0990 636 ASP A OD1 
625  O OD2 . ASP A 83  ? 0.6104 0.6047 0.6454 -0.0320 0.0792  -0.0974 636 ASP A OD2 
626  N N   . ASN A 84  ? 0.4381 0.4543 0.4944 -0.0213 0.0516  -0.0838 637 ASN A N   
627  C CA  . ASN A 84  ? 0.4418 0.4590 0.5120 -0.0198 0.0510  -0.0822 637 ASN A CA  
628  C C   . ASN A 84  ? 0.5192 0.5437 0.5801 -0.0213 0.0447  -0.0841 637 ASN A C   
629  O O   . ASN A 84  ? 0.4666 0.4920 0.5352 -0.0240 0.0475  -0.0886 637 ASN A O   
630  C CB  . ASN A 84  ? 0.4144 0.4306 0.4949 -0.0138 0.0464  -0.0717 637 ASN A CB  
631  C CG  . ASN A 84  ? 0.5685 0.5792 0.6664 -0.0129 0.0527  -0.0683 637 ASN A CG  
632  O OD1 . ASN A 84  ? 0.3253 0.3318 0.4318 -0.0162 0.0627  -0.0744 637 ASN A OD1 
633  N ND2 . ASN A 84  ? 0.2813 0.2920 0.3847 -0.0092 0.0473  -0.0582 637 ASN A ND2 
634  N N   . CYS A 85  ? 0.4841 0.5138 0.5306 -0.0194 0.0367  -0.0800 638 CYS A N   
635  C CA  . CYS A 85  ? 0.5497 0.5873 0.5898 -0.0199 0.0300  -0.0792 638 CYS A CA  
636  C C   . CYS A 85  ? 0.4918 0.5341 0.5248 -0.0283 0.0317  -0.0880 638 CYS A C   
637  O O   . CYS A 85  ? 0.5698 0.6174 0.6058 -0.0307 0.0295  -0.0902 638 CYS A O   
638  C CB  . CYS A 85  ? 0.4474 0.4888 0.4768 -0.0158 0.0229  -0.0716 638 CYS A CB  
639  S SG  . CYS A 85  ? 0.4424 0.4942 0.4682 -0.0156 0.0152  -0.0679 638 CYS A SG  
640  N N   . MET A 86  ? 0.4742 0.5141 0.4973 -0.0335 0.0361  -0.0931 639 MET A N   
641  C CA  . MET A 86  ? 0.5356 0.5791 0.5475 -0.0439 0.0380  -0.1022 639 MET A CA  
642  C C   . MET A 86  ? 0.5058 0.5434 0.5293 -0.0492 0.0481  -0.1120 639 MET A C   
643  O O   . MET A 86  ? 0.4672 0.5095 0.4870 -0.0566 0.0477  -0.1184 639 MET A O   
644  C CB  . MET A 86  ? 0.5060 0.5482 0.5005 -0.0488 0.0397  -0.1044 639 MET A CB  
645  C CG  . MET A 86  ? 0.5796 0.6293 0.5636 -0.0440 0.0295  -0.0939 639 MET A CG  
646  S SD  . MET A 86  ? 0.6240 0.6746 0.5864 -0.0491 0.0290  -0.0934 639 MET A SD  
647  C CE  . MET A 86  ? 0.8865 0.9215 0.8537 -0.0506 0.0439  -0.1021 639 MET A CE  
648  N N   . LYS A 87  ? 0.4653 0.4933 0.5047 -0.0453 0.0569  -0.1122 640 LYS A N   
649  C CA  . LYS A 87  ? 0.4686 0.4906 0.5240 -0.0488 0.0675  -0.1196 640 LYS A CA  
650  C C   . LYS A 87  ? 0.4876 0.5146 0.5543 -0.0458 0.0629  -0.1169 640 LYS A C   
651  O O   . LYS A 87  ? 0.4676 0.4942 0.5391 -0.0518 0.0684  -0.1249 640 LYS A O   
652  C CB  . LYS A 87  ? 0.4972 0.5091 0.5719 -0.0445 0.0777  -0.1176 640 LYS A CB  
653  C CG  . LYS A 87  ? 0.5272 0.5307 0.5969 -0.0497 0.0887  -0.1241 640 LYS A CG  
654  C CD  . LYS A 87  ? 0.7537 0.7466 0.8482 -0.0500 0.1043  -0.1272 640 LYS A CD  
655  C CE  . LYS A 87  ? 0.7849 0.7766 0.9021 -0.0399 0.1026  -0.1143 640 LYS A CE  
656  N NZ  . LYS A 87  ? 0.5653 0.5530 0.6822 -0.0372 0.1044  -0.1099 640 LYS A NZ  
657  N N   . TYR A 88  ? 0.5027 0.5333 0.5732 -0.0372 0.0540  -0.1062 641 TYR A N   
658  C CA  . TYR A 88  ? 0.4690 0.5030 0.5503 -0.0344 0.0508  -0.1035 641 TYR A CA  
659  C C   . TYR A 88  ? 0.5014 0.5451 0.5724 -0.0382 0.0433  -0.1054 641 TYR A C   
660  O O   . TYR A 88  ? 0.5523 0.5981 0.6304 -0.0416 0.0452  -0.1101 641 TYR A O   
661  C CB  . TYR A 88  ? 0.4720 0.5047 0.5610 -0.0252 0.0457  -0.0920 641 TYR A CB  
662  C CG  . TYR A 88  ? 0.4721 0.5064 0.5723 -0.0230 0.0443  -0.0895 641 TYR A CG  
663  C CD1 . TYR A 88  ? 0.5522 0.5820 0.6705 -0.0236 0.0521  -0.0915 641 TYR A CD1 
664  C CD2 . TYR A 88  ? 0.4641 0.5040 0.5583 -0.0203 0.0364  -0.0850 641 TYR A CD2 
665  C CE1 . TYR A 88  ? 0.4144 0.4455 0.5428 -0.0218 0.0513  -0.0892 641 TYR A CE1 
666  C CE2 . TYR A 88  ? 0.3644 0.4050 0.4686 -0.0186 0.0361  -0.0832 641 TYR A CE2 
667  C CZ  . TYR A 88  ? 0.5110 0.5472 0.6314 -0.0194 0.0433  -0.0855 641 TYR A CZ  
668  O OH  . TYR A 88  ? 0.4463 0.4828 0.5767 -0.0178 0.0435  -0.0835 641 TYR A OH  
669  N N   . ASN A 89  ? 0.4799 0.5302 0.5360 -0.0376 0.0350  -0.1010 642 ASN A N   
670  C CA  . ASN A 89  ? 0.4624 0.5235 0.5129 -0.0403 0.0268  -0.0997 642 ASN A CA  
671  C C   . ASN A 89  ? 0.4859 0.5532 0.5225 -0.0517 0.0260  -0.1074 642 ASN A C   
672  O O   . ASN A 89  ? 0.5335 0.5980 0.5577 -0.0558 0.0286  -0.1105 642 ASN A O   
673  C CB  . ASN A 89  ? 0.4097 0.4755 0.4559 -0.0331 0.0182  -0.0885 642 ASN A CB  
674  C CG  . ASN A 89  ? 0.5324 0.5911 0.5886 -0.0238 0.0192  -0.0815 642 ASN A CG  
675  O OD1 . ASN A 89  ? 0.4868 0.5462 0.5524 -0.0208 0.0182  -0.0788 642 ASN A OD1 
676  N ND2 . ASN A 89  ? 0.5018 0.5538 0.5553 -0.0202 0.0212  -0.0784 642 ASN A ND2 
677  N N   . ALA A 90  ? 0.6030 0.6786 0.6410 -0.0574 0.0223  -0.1103 643 ALA A N   
678  C CA  . ALA A 90  ? 0.6304 0.7142 0.6537 -0.0704 0.0192  -0.1167 643 ALA A CA  
679  C C   . ALA A 90  ? 0.5808 0.6739 0.5891 -0.0711 0.0094  -0.1085 643 ALA A C   
680  O O   . ALA A 90  ? 0.4698 0.5666 0.4832 -0.0614 0.0031  -0.0971 643 ALA A O   
681  C CB  . ALA A 90  ? 0.6941 0.7872 0.7249 -0.0752 0.0149  -0.1184 643 ALA A CB  
682  N N   . ARG A 91  ? 0.6409 0.7374 0.6306 -0.0833 0.0088  -0.1143 644 ARG A N   
683  C CA  . ARG A 91  ? 0.7101 0.8174 0.6846 -0.0859 -0.0012 -0.1058 644 ARG A CA  
684  C C   . ARG A 91  ? 0.7686 0.8917 0.7514 -0.0820 -0.0143 -0.0928 644 ARG A C   
685  O O   . ARG A 91  ? 0.7822 0.9129 0.7609 -0.0783 -0.0220 -0.0813 644 ARG A O   
686  C CB  . ARG A 91  ? 0.7107 0.8206 0.6625 -0.1029 -0.0005 -0.1148 644 ARG A CB  
687  N N   . ASP A 92  ? 0.8415 0.9688 0.8382 -0.0822 -0.0156 -0.0941 645 ASP A N   
688  C CA  . ASP A 92  ? 0.8732 1.0161 0.8809 -0.0805 -0.0268 -0.0829 645 ASP A CA  
689  C C   . ASP A 92  ? 0.8412 0.9823 0.8649 -0.0648 -0.0280 -0.0705 645 ASP A C   
690  O O   . ASP A 92  ? 0.8510 1.0040 0.8860 -0.0619 -0.0359 -0.0595 645 ASP A O   
691  C CB  . ASP A 92  ? 0.9016 1.0474 0.9195 -0.0866 -0.0256 -0.0905 645 ASP A CB  
692  C CG  . ASP A 92  ? 1.0202 1.1852 1.0461 -0.0908 -0.0381 -0.0810 645 ASP A CG  
693  O OD1 . ASP A 92  ? 1.1726 1.3509 1.1898 -0.0955 -0.0483 -0.0718 645 ASP A OD1 
694  O OD2 . ASP A 92  ? 0.8024 0.9697 0.8445 -0.0896 -0.0377 -0.0822 645 ASP A OD2 
695  N N   . THR A 93  ? 0.7755 0.9019 0.8008 -0.0556 -0.0199 -0.0720 646 THR A N   
696  C CA  . THR A 93  ? 0.6718 0.7925 0.7114 -0.0427 -0.0180 -0.0641 646 THR A CA  
697  C C   . THR A 93  ? 0.6462 0.7660 0.6820 -0.0354 -0.0200 -0.0540 646 THR A C   
698  O O   . THR A 93  ? 0.5898 0.7120 0.6121 -0.0392 -0.0221 -0.0532 646 THR A O   
699  C CB  . THR A 93  ? 0.7291 0.8346 0.7743 -0.0382 -0.0082 -0.0715 646 THR A CB  
700  O OG1 . THR A 93  ? 0.7131 0.8093 0.7474 -0.0390 -0.0028 -0.0764 646 THR A OG1 
701  C CG2 . THR A 93  ? 0.6342 0.7400 0.6861 -0.0447 -0.0049 -0.0811 646 THR A CG2 
702  N N   . VAL A 94  ? 0.6720 0.7877 0.7197 -0.0255 -0.0184 -0.0464 647 VAL A N   
703  C CA  . VAL A 94  ? 0.6287 0.7410 0.6751 -0.0179 -0.0180 -0.0374 647 VAL A CA  
704  C C   . VAL A 94  ? 0.5877 0.6860 0.6240 -0.0156 -0.0115 -0.0429 647 VAL A C   
705  O O   . VAL A 94  ? 0.5604 0.6574 0.5876 -0.0145 -0.0118 -0.0398 647 VAL A O   
706  C CB  . VAL A 94  ? 0.6376 0.7474 0.6996 -0.0096 -0.0158 -0.0295 647 VAL A CB  
707  C CG1 . VAL A 94  ? 0.7949 0.9023 0.8571 -0.0030 -0.0147 -0.0198 647 VAL A CG1 
708  C CG2 . VAL A 94  ? 0.5850 0.7080 0.6606 -0.0120 -0.0212 -0.0248 647 VAL A CG2 
709  N N   . PHE A 95  ? 0.4546 0.5433 0.4939 -0.0153 -0.0058 -0.0506 648 PHE A N   
710  C CA  . PHE A 95  ? 0.4628 0.5399 0.4965 -0.0135 -0.0003 -0.0543 648 PHE A CA  
711  C C   . PHE A 95  ? 0.4196 0.4984 0.4406 -0.0197 -0.0003 -0.0592 648 PHE A C   
712  O O   . PHE A 95  ? 0.3247 0.3995 0.3384 -0.0174 0.0007  -0.0567 648 PHE A O   
713  C CB  . PHE A 95  ? 0.5304 0.5990 0.5723 -0.0129 0.0051  -0.0601 648 PHE A CB  
714  C CG  . PHE A 95  ? 0.5710 0.6356 0.6226 -0.0073 0.0060  -0.0552 648 PHE A CG  
715  C CD1 . PHE A 95  ? 0.7265 0.7864 0.7764 -0.0016 0.0062  -0.0479 648 PHE A CD1 
716  C CD2 . PHE A 95  ? 0.7451 0.8094 0.8067 -0.0084 0.0078  -0.0585 648 PHE A CD2 
717  C CE1 . PHE A 95  ? 0.4028 0.4573 0.4591 0.0019  0.0086  -0.0444 648 PHE A CE1 
718  C CE2 . PHE A 95  ? 0.7093 0.7688 0.7781 -0.0039 0.0095  -0.0543 648 PHE A CE2 
719  C CZ  . PHE A 95  ? 0.6109 0.6652 0.6762 0.0008  0.0101  -0.0475 648 PHE A CZ  
720  N N   . TYR A 96  ? 0.4803 0.5648 0.4976 -0.0283 -0.0010 -0.0662 649 TYR A N   
721  C CA  . TYR A 96  ? 0.5080 0.5930 0.5106 -0.0360 0.0001  -0.0718 649 TYR A CA  
722  C C   . TYR A 96  ? 0.5243 0.6169 0.5159 -0.0362 -0.0060 -0.0635 649 TYR A C   
723  O O   . TYR A 96  ? 0.5552 0.6427 0.5364 -0.0368 -0.0031 -0.0646 649 TYR A O   
724  C CB  . TYR A 96  ? 0.4741 0.5643 0.4732 -0.0471 0.0004  -0.0809 649 TYR A CB  
725  C CG  . TYR A 96  ? 0.4962 0.5835 0.4790 -0.0569 0.0047  -0.0894 649 TYR A CG  
726  C CD1 . TYR A 96  ? 0.6989 0.7742 0.6834 -0.0601 0.0160  -0.1003 649 TYR A CD1 
727  C CD2 . TYR A 96  ? 0.6800 0.7766 0.6464 -0.0637 -0.0018 -0.0859 649 TYR A CD2 
728  C CE1 . TYR A 96  ? 0.6254 0.6962 0.5946 -0.0702 0.0222  -0.1092 649 TYR A CE1 
729  C CE2 . TYR A 96  ? 0.6558 0.7485 0.6043 -0.0742 0.0030  -0.0944 649 TYR A CE2 
730  C CZ  . TYR A 96  ? 0.5541 0.6332 0.5037 -0.0776 0.0157  -0.1067 649 TYR A CZ  
731  O OH  . TYR A 96  ? 0.6764 0.7500 0.6084 -0.0885 0.0225  -0.1157 649 TYR A OH  
732  N N   . ARG A 97  ? 0.6209 0.7256 0.6167 -0.0353 -0.0142 -0.0544 650 ARG A N   
733  C CA  . ARG A 97  ? 0.6487 0.7626 0.6373 -0.0354 -0.0206 -0.0443 650 ARG A CA  
734  C C   . ARG A 97  ? 0.7169 0.8219 0.7067 -0.0257 -0.0169 -0.0384 650 ARG A C   
735  O O   . ARG A 97  ? 0.7444 0.8488 0.7229 -0.0268 -0.0168 -0.0364 650 ARG A O   
736  C CB  . ARG A 97  ? 0.7218 0.8511 0.7208 -0.0355 -0.0296 -0.0338 650 ARG A CB  
737  C CG  . ARG A 97  ? 0.8624 1.0041 0.8566 -0.0479 -0.0358 -0.0379 650 ARG A CG  
738  C CD  . ARG A 97  ? 0.9524 1.1080 0.9637 -0.0470 -0.0434 -0.0287 650 ARG A CD  
739  N NE  . ARG A 97  ? 1.0003 1.1646 1.0207 -0.0404 -0.0487 -0.0122 650 ARG A NE  
740  C CZ  . ARG A 97  ? 1.0019 1.1637 1.0413 -0.0294 -0.0461 -0.0036 650 ARG A CZ  
741  N NH1 . ARG A 97  ? 1.0255 1.1769 1.0755 -0.0239 -0.0393 -0.0094 650 ARG A NH1 
742  N NH2 . ARG A 97  ? 1.0189 1.1883 1.0671 -0.0242 -0.0495 0.0112  650 ARG A NH2 
743  N N   . ALA A 98  ? 0.7183 0.8161 0.7207 -0.0171 -0.0134 -0.0359 651 ALA A N   
744  C CA  . ALA A 98  ? 0.6216 0.7103 0.6247 -0.0091 -0.0095 -0.0308 651 ALA A CA  
745  C C   . ALA A 98  ? 0.5505 0.6293 0.5431 -0.0106 -0.0043 -0.0377 651 ALA A C   
746  O O   . ALA A 98  ? 0.5389 0.6149 0.5256 -0.0080 -0.0033 -0.0337 651 ALA A O   
747  C CB  . ALA A 98  ? 0.5315 0.6123 0.5464 -0.0025 -0.0057 -0.0294 651 ALA A CB  
748  N N   . ALA A 99  ? 0.5078 0.5815 0.5000 -0.0148 -0.0006 -0.0476 652 ALA A N   
749  C CA  . ALA A 99  ? 0.4731 0.5374 0.4596 -0.0164 0.0054  -0.0540 652 ALA A CA  
750  C C   . ALA A 99  ? 0.4450 0.5129 0.4166 -0.0220 0.0047  -0.0548 652 ALA A C   
751  O O   . ALA A 99  ? 0.4914 0.5532 0.4578 -0.0200 0.0081  -0.0540 652 ALA A O   
752  C CB  . ALA A 99  ? 0.4642 0.5238 0.4566 -0.0205 0.0104  -0.0636 652 ALA A CB  
753  N N   . VAL A 100 ? 0.5772 0.6555 0.5413 -0.0296 0.0000  -0.0557 653 VAL A N   
754  C CA  . VAL A 100 ? 0.6190 0.7013 0.5661 -0.0366 -0.0013 -0.0558 653 VAL A CA  
755  C C   . VAL A 100 ? 0.5413 0.6270 0.4866 -0.0303 -0.0052 -0.0436 653 VAL A C   
756  O O   . VAL A 100 ? 0.5541 0.6348 0.4898 -0.0305 -0.0019 -0.0436 653 VAL A O   
757  C CB  . VAL A 100 ? 0.6586 0.7527 0.5964 -0.0484 -0.0071 -0.0586 653 VAL A CB  
758  C CG1 . VAL A 100 ? 0.5622 0.6594 0.4787 -0.0580 -0.0080 -0.0595 653 VAL A CG1 
759  C CG2 . VAL A 100 ? 0.6533 0.7423 0.5945 -0.0542 -0.0014 -0.0711 653 VAL A CG2 
760  N N   . ARG A 101 ? 0.4782 0.5716 0.4345 -0.0245 -0.0109 -0.0335 654 ARG A N   
761  C CA  . ARG A 101 ? 0.5452 0.6412 0.5044 -0.0175 -0.0130 -0.0211 654 ARG A CA  
762  C C   . ARG A 101 ? 0.5765 0.6584 0.5362 -0.0107 -0.0055 -0.0226 654 ARG A C   
763  O O   . ARG A 101 ? 0.4891 0.5698 0.4424 -0.0089 -0.0045 -0.0177 654 ARG A O   
764  C CB  . ARG A 101 ? 0.5026 0.6051 0.4785 -0.0115 -0.0167 -0.0118 654 ARG A CB  
765  C CG  . ARG A 101 ? 0.7590 0.8700 0.7408 -0.0070 -0.0204 0.0029  654 ARG A CG  
766  C CD  . ARG A 101 ? 0.7284 0.8529 0.7255 -0.0066 -0.0268 0.0121  654 ARG A CD  
767  N N   . LEU A 102 ? 0.5371 0.6090 0.5046 -0.0075 -0.0007 -0.0288 655 LEU A N   
768  C CA  . LEU A 102 ? 0.4871 0.5467 0.4562 -0.0024 0.0052  -0.0300 655 LEU A CA  
769  C C   . LEU A 102 ? 0.4888 0.5425 0.4483 -0.0063 0.0097  -0.0365 655 LEU A C   
770  O O   . LEU A 102 ? 0.4676 0.5150 0.4250 -0.0030 0.0129  -0.0343 655 LEU A O   
771  C CB  . LEU A 102 ? 0.4939 0.5461 0.4735 0.0003  0.0078  -0.0336 655 LEU A CB  
772  C CG  . LEU A 102 ? 0.5858 0.6265 0.5675 0.0045  0.0124  -0.0333 655 LEU A CG  
773  C CD1 . LEU A 102 ? 0.4901 0.5296 0.4724 0.0096  0.0127  -0.0251 655 LEU A CD1 
774  C CD2 . LEU A 102 ? 0.4044 0.4391 0.3945 0.0048  0.0140  -0.0367 655 LEU A CD2 
775  N N   . ARG A 103 ? 0.5214 0.5763 0.4758 -0.0137 0.0109  -0.0448 656 ARG A N   
776  C CA  . ARG A 103 ? 0.5726 0.6207 0.5185 -0.0183 0.0173  -0.0518 656 ARG A CA  
777  C C   . ARG A 103 ? 0.5745 0.6260 0.5064 -0.0201 0.0159  -0.0469 656 ARG A C   
778  O O   . ARG A 103 ? 0.5801 0.6244 0.5094 -0.0177 0.0206  -0.0463 656 ARG A O   
779  C CB  . ARG A 103 ? 0.5541 0.6023 0.4966 -0.0272 0.0204  -0.0621 656 ARG A CB  
780  C CG  . ARG A 103 ? 0.6338 0.6728 0.5691 -0.0328 0.0298  -0.0707 656 ARG A CG  
781  C CD  . ARG A 103 ? 0.7401 0.7804 0.6676 -0.0439 0.0329  -0.0808 656 ARG A CD  
782  N NE  . ARG A 103 ? 0.7417 0.7938 0.6527 -0.0510 0.0249  -0.0777 656 ARG A NE  
783  C CZ  . ARG A 103 ? 0.7167 0.7731 0.6167 -0.0627 0.0247  -0.0850 656 ARG A CZ  
784  N NH1 . ARG A 103 ? 0.7581 0.8272 0.6436 -0.0694 0.0154  -0.0797 656 ARG A NH1 
785  N NH2 . ARG A 103 ? 0.6553 0.7037 0.5597 -0.0682 0.0339  -0.0971 656 ARG A NH2 
786  N N   . ASP A 104 ? 0.5621 0.6255 0.4861 -0.0247 0.0089  -0.0424 657 ASP A N   
787  C CA  . ASP A 104 ? 0.5962 0.6655 0.5077 -0.0266 0.0058  -0.0350 657 ASP A CA  
788  C C   . ASP A 104 ? 0.5674 0.6339 0.4859 -0.0167 0.0064  -0.0252 657 ASP A C   
789  O O   . ASP A 104 ? 0.6288 0.6892 0.5404 -0.0159 0.0109  -0.0249 657 ASP A O   
790  C CB  . ASP A 104 ? 0.6439 0.7293 0.5507 -0.0323 -0.0039 -0.0283 657 ASP A CB  
791  C CG  . ASP A 104 ? 0.7407 0.8292 0.6352 -0.0451 -0.0044 -0.0384 657 ASP A CG  
792  O OD1 . ASP A 104 ? 0.7143 0.7913 0.6033 -0.0495 0.0044  -0.0507 657 ASP A OD1 
793  O OD2 . ASP A 104 ? 0.6308 0.7332 0.5223 -0.0513 -0.0133 -0.0338 657 ASP A OD2 
794  N N   . GLN A 105 ? 0.4920 0.5613 0.4244 -0.0094 0.0034  -0.0181 658 GLN A N   
795  C CA  . GLN A 105 ? 0.3986 0.4640 0.3378 -0.0010 0.0055  -0.0096 658 GLN A CA  
796  C C   . GLN A 105 ? 0.4391 0.4903 0.3791 0.0022  0.0132  -0.0152 658 GLN A C   
797  O O   . GLN A 105 ? 0.4713 0.5185 0.4095 0.0057  0.0162  -0.0106 658 GLN A O   
798  C CB  . GLN A 105 ? 0.4502 0.5192 0.4043 0.0046  0.0031  -0.0027 658 GLN A CB  
799  C CG  . GLN A 105 ? 0.5202 0.6052 0.4771 0.0026  -0.0046 0.0071  658 GLN A CG  
800  C CD  . GLN A 105 ? 0.5167 0.6046 0.4911 0.0084  -0.0054 0.0142  658 GLN A CD  
801  O OE1 . GLN A 105 ? 0.6549 0.7327 0.6366 0.0126  -0.0003 0.0099  658 GLN A OE1 
802  N NE2 . GLN A 105 ? 0.6335 0.7357 0.6150 0.0079  -0.0117 0.0255  658 GLN A NE2 
803  N N   . GLY A 106 ? 0.4928 0.5371 0.4364 0.0006  0.0162  -0.0244 659 GLY A N   
804  C CA  . GLY A 106 ? 0.4435 0.4761 0.3913 0.0032  0.0221  -0.0282 659 GLY A CA  
805  C C   . GLY A 106 ? 0.5698 0.5975 0.5096 -0.0004 0.0272  -0.0331 659 GLY A C   
806  O O   . GLY A 106 ? 0.5745 0.5939 0.5174 0.0020  0.0319  -0.0335 659 GLY A O   
807  N N   . GLY A 107 ? 0.5900 0.6223 0.5192 -0.0073 0.0268  -0.0371 660 GLY A N   
808  C CA  . GLY A 107 ? 0.5647 0.5922 0.4832 -0.0119 0.0327  -0.0415 660 GLY A CA  
809  C C   . GLY A 107 ? 0.5608 0.5876 0.4744 -0.0079 0.0331  -0.0336 660 GLY A C   
810  O O   . GLY A 107 ? 0.5407 0.5591 0.4537 -0.0071 0.0396  -0.0358 660 GLY A O   
811  N N   . VAL A 108 ? 0.5288 0.5646 0.4409 -0.0052 0.0267  -0.0239 661 VAL A N   
812  C CA  . VAL A 108 ? 0.5799 0.6160 0.4891 -0.0011 0.0274  -0.0150 661 VAL A CA  
813  C C   . VAL A 108 ? 0.4637 0.4891 0.3834 0.0054  0.0327  -0.0153 661 VAL A C   
814  O O   . VAL A 108 ? 0.4785 0.4978 0.3952 0.0066  0.0377  -0.0147 661 VAL A O   
815  C CB  . VAL A 108 ? 0.6215 0.6689 0.5346 0.0024  0.0206  -0.0025 661 VAL A CB  
816  C CG1 . VAL A 108 ? 0.5711 0.6168 0.4852 0.0079  0.0234  0.0069  661 VAL A CG1 
817  C CG2 . VAL A 108 ? 0.6267 0.6874 0.5295 -0.0051 0.0134  0.0003  661 VAL A CG2 
818  N N   . VAL A 109 ? 0.4378 0.4613 0.3692 0.0087  0.0315  -0.0162 662 VAL A N   
819  C CA  . VAL A 109 ? 0.4394 0.4539 0.3794 0.0134  0.0351  -0.0156 662 VAL A CA  
820  C C   . VAL A 109 ? 0.3821 0.3880 0.3241 0.0112  0.0401  -0.0227 662 VAL A C   
821  O O   . VAL A 109 ? 0.3996 0.3990 0.3443 0.0134  0.0439  -0.0214 662 VAL A O   
822  C CB  . VAL A 109 ? 0.3935 0.4077 0.3431 0.0160  0.0326  -0.0145 662 VAL A CB  
823  C CG1 . VAL A 109 ? 0.3881 0.3934 0.3431 0.0191  0.0362  -0.0131 662 VAL A CG1 
824  C CG2 . VAL A 109 ? 0.4394 0.4628 0.3903 0.0180  0.0285  -0.0071 662 VAL A CG2 
825  N N   . LEU A 110 ? 0.3860 0.3920 0.3283 0.0067  0.0409  -0.0298 663 LEU A N   
826  C CA  . LEU A 110 ? 0.4466 0.4446 0.3959 0.0052  0.0466  -0.0353 663 LEU A CA  
827  C C   . LEU A 110 ? 0.4459 0.4401 0.3870 0.0034  0.0527  -0.0364 663 LEU A C   
828  O O   . LEU A 110 ? 0.4781 0.4653 0.4255 0.0046  0.0576  -0.0368 663 LEU A O   
829  C CB  . LEU A 110 ? 0.3563 0.3544 0.3120 0.0013  0.0475  -0.0421 663 LEU A CB  
830  C CG  . LEU A 110 ? 0.3760 0.3758 0.3421 0.0035  0.0424  -0.0403 663 LEU A CG  
831  C CD1 . LEU A 110 ? 0.4338 0.4365 0.4039 0.0000  0.0421  -0.0458 663 LEU A CD1 
832  C CD2 . LEU A 110 ? 0.5841 0.5778 0.5626 0.0054  0.0437  -0.0382 663 LEU A CD2 
833  N N   . ARG A 111 ? 0.4781 0.4774 0.4046 0.0000  0.0519  -0.0361 664 ARG A N   
834  C CA  . ARG A 111 ? 0.5445 0.5404 0.4598 -0.0024 0.0574  -0.0363 664 ARG A CA  
835  C C   . ARG A 111 ? 0.5232 0.5166 0.4409 0.0036  0.0580  -0.0289 664 ARG A C   
836  O O   . ARG A 111 ? 0.4453 0.4314 0.3640 0.0039  0.0646  -0.0301 664 ARG A O   
837  C CB  . ARG A 111 ? 0.5928 0.5963 0.4899 -0.0086 0.0546  -0.0359 664 ARG A CB  
838  C CG  . ARG A 111 ? 0.8031 0.8033 0.6927 -0.0177 0.0600  -0.0466 664 ARG A CG  
839  C CD  . ARG A 111 ? 0.8048 0.8150 0.6821 -0.0246 0.0535  -0.0476 664 ARG A CD  
840  N NE  . ARG A 111 ? 0.8069 0.8281 0.6741 -0.0240 0.0451  -0.0367 664 ARG A NE  
841  C CZ  . ARG A 111 ? 0.8573 0.8909 0.7203 -0.0270 0.0359  -0.0324 664 ARG A CZ  
842  N NH1 . ARG A 111 ? 0.8271 0.8712 0.6848 -0.0257 0.0287  -0.0203 664 ARG A NH1 
843  N NH2 . ARG A 111 ? 0.5925 0.6284 0.4586 -0.0312 0.0341  -0.0392 664 ARG A NH2 
844  N N   . GLN A 112 ? 0.4899 0.4885 0.4104 0.0083  0.0523  -0.0214 665 GLN A N   
845  C CA  . GLN A 112 ? 0.4904 0.4851 0.4155 0.0138  0.0545  -0.0153 665 GLN A CA  
846  C C   . GLN A 112 ? 0.4969 0.4827 0.4339 0.0151  0.0580  -0.0189 665 GLN A C   
847  O O   . GLN A 112 ? 0.3709 0.3509 0.3095 0.0167  0.0628  -0.0174 665 GLN A O   
848  C CB  . GLN A 112 ? 0.5412 0.5411 0.4701 0.0182  0.0500  -0.0075 665 GLN A CB  
849  C CG  . GLN A 112 ? 0.5621 0.5569 0.4950 0.0230  0.0541  -0.0016 665 GLN A CG  
850  C CD  . GLN A 112 ? 0.8400 0.8351 0.7644 0.0232  0.0577  0.0028  665 GLN A CD  
851  O OE1 . GLN A 112 ? 0.8042 0.8070 0.7185 0.0204  0.0549  0.0058  665 GLN A OE1 
852  N NE2 . GLN A 112 ? 0.5988 0.5858 0.5265 0.0257  0.0637  0.0035  665 GLN A NE2 
853  N N   . ALA A 113 ? 0.5034 0.4889 0.4493 0.0139  0.0554  -0.0228 666 ALA A N   
854  C CA  . ALA A 113 ? 0.4924 0.4716 0.4507 0.0139  0.0570  -0.0246 666 ALA A CA  
855  C C   . ALA A 113 ? 0.4485 0.4222 0.4108 0.0119  0.0637  -0.0281 666 ALA A C   
856  O O   . ALA A 113 ? 0.4669 0.4355 0.4377 0.0127  0.0662  -0.0266 666 ALA A O   
857  C CB  . ALA A 113 ? 0.5617 0.5429 0.5284 0.0123  0.0526  -0.0269 666 ALA A CB  
858  N N   . ARG A 114 ? 0.4017 0.3759 0.3585 0.0085  0.0673  -0.0330 667 ARG A N   
859  C CA  . ARG A 114 ? 0.4203 0.3875 0.3813 0.0062  0.0762  -0.0370 667 ARG A CA  
860  C C   . ARG A 114 ? 0.4051 0.3682 0.3600 0.0083  0.0805  -0.0335 667 ARG A C   
861  O O   . ARG A 114 ? 0.4615 0.4188 0.4274 0.0092  0.0851  -0.0331 667 ARG A O   
862  C CB  . ARG A 114 ? 0.4916 0.4582 0.4451 0.0007  0.0812  -0.0442 667 ARG A CB  
863  C CG  . ARG A 114 ? 0.5883 0.5457 0.5481 -0.0022 0.0930  -0.0494 667 ARG A CG  
864  C CD  . ARG A 114 ? 0.6939 0.6478 0.6793 -0.0012 0.0958  -0.0498 667 ARG A CD  
865  N N   . ARG A 115 ? 0.3852 0.3523 0.3246 0.0092  0.0785  -0.0299 668 ARG A N   
866  C CA  . ARG A 115 ? 0.4836 0.4474 0.4174 0.0116  0.0824  -0.0253 668 ARG A CA  
867  C C   . ARG A 115 ? 0.4182 0.3784 0.3648 0.0157  0.0821  -0.0217 668 ARG A C   
868  O O   . ARG A 115 ? 0.3909 0.3450 0.3414 0.0167  0.0878  -0.0208 668 ARG A O   
869  C CB  . ARG A 115 ? 0.5416 0.5125 0.4608 0.0128  0.0784  -0.0188 668 ARG A CB  
870  C CG  . ARG A 115 ? 0.6573 0.6333 0.5608 0.0070  0.0774  -0.0212 668 ARG A CG  
871  C CD  . ARG A 115 ? 0.5945 0.5791 0.4859 0.0077  0.0724  -0.0123 668 ARG A CD  
872  N NE  . ARG A 115 ? 0.9144 0.9062 0.7918 0.0006  0.0685  -0.0146 668 ARG A NE  
873  C CZ  . ARG A 115 ? 1.1693 1.1720 1.0450 0.0000  0.0598  -0.0102 668 ARG A CZ  
874  N NH1 . ARG A 115 ? 1.1906 1.1978 1.0781 0.0068  0.0549  -0.0029 668 ARG A NH1 
875  N NH2 . ARG A 115 ? 1.1946 1.2034 1.0567 -0.0080 0.0565  -0.0133 668 ARG A NH2 
876  N N   . GLU A 116 ? 0.4015 0.3648 0.3540 0.0171  0.0756  -0.0199 669 GLU A N   
877  C CA  . GLU A 116 ? 0.4463 0.4059 0.4079 0.0190  0.0751  -0.0171 669 GLU A CA  
878  C C   . GLU A 116 ? 0.4348 0.3902 0.4114 0.0165  0.0763  -0.0196 669 GLU A C   
879  O O   . GLU A 116 ? 0.5007 0.4517 0.4835 0.0167  0.0785  -0.0176 669 GLU A O   
880  C CB  . GLU A 116 ? 0.4845 0.4474 0.4458 0.0200  0.0692  -0.0147 669 GLU A CB  
881  C CG  . GLU A 116 ? 0.5962 0.5540 0.5611 0.0209  0.0704  -0.0118 669 GLU A CG  
882  C CD  . GLU A 116 ? 0.5923 0.5462 0.5535 0.0239  0.0768  -0.0081 669 GLU A CD  
883  O OE1 . GLU A 116 ? 0.4658 0.4231 0.4190 0.0268  0.0784  -0.0045 669 GLU A OE1 
884  O OE2 . GLU A 116 ? 0.5285 0.4765 0.4956 0.0228  0.0799  -0.0083 669 GLU A OE2 
885  N N   . VAL A 117 ? 0.4197 0.3767 0.4038 0.0140  0.0753  -0.0232 670 VAL A N   
886  C CA  . VAL A 117 ? 0.4341 0.3881 0.4364 0.0119  0.0773  -0.0234 670 VAL A CA  
887  C C   . VAL A 117 ? 0.5065 0.4546 0.5114 0.0123  0.0865  -0.0243 670 VAL A C   
888  O O   . VAL A 117 ? 0.6010 0.5461 0.6193 0.0118  0.0882  -0.0218 670 VAL A O   
889  C CB  . VAL A 117 ? 0.5048 0.4613 0.5184 0.0095  0.0764  -0.0263 670 VAL A CB  
890  C CG1 . VAL A 117 ? 0.4465 0.4009 0.4837 0.0077  0.0791  -0.0241 670 VAL A CG1 
891  C CG2 . VAL A 117 ? 0.3470 0.3090 0.3588 0.0089  0.0676  -0.0253 670 VAL A CG2 
892  N N   . ASP A 118 ? 0.5361 0.4825 0.5275 0.0124  0.0923  -0.0274 671 ASP A N   
893  C CA  . ASP A 118 ? 0.5161 0.4558 0.5057 0.0125  0.1020  -0.0282 671 ASP A CA  
894  C C   . ASP A 118 ? 0.5041 0.4418 0.4906 0.0156  0.1021  -0.0232 671 ASP A C   
895  O O   . ASP A 118 ? 0.4554 0.3879 0.4522 0.0159  0.1074  -0.0222 671 ASP A O   
896  C CB  . ASP A 118 ? 0.4991 0.4377 0.4696 0.0103  0.1074  -0.0321 671 ASP A CB  
897  C CG  . ASP A 118 ? 0.7366 0.6732 0.7103 0.0058  0.1125  -0.0391 671 ASP A CG  
898  O OD1 . ASP A 118 ? 0.7164 0.6503 0.7110 0.0051  0.1155  -0.0405 671 ASP A OD1 
899  O OD2 . ASP A 118 ? 0.6701 0.6079 0.6255 0.0022  0.1138  -0.0428 671 ASP A OD2 
900  N N   . SER A 119 ? 0.4486 0.3901 0.4223 0.0179  0.0972  -0.0198 672 SER A N   
901  C CA  . SER A 119 ? 0.5225 0.4616 0.4946 0.0209  0.0982  -0.0150 672 SER A CA  
902  C C   . SER A 119 ? 0.5487 0.4846 0.5367 0.0197  0.0971  -0.0141 672 SER A C   
903  O O   . SER A 119 ? 0.5209 0.4518 0.5138 0.0203  0.1023  -0.0126 672 SER A O   
904  C CB  . SER A 119 ? 0.4828 0.4269 0.4450 0.0233  0.0929  -0.0111 672 SER A CB  
905  O OG  . SER A 119 ? 0.5764 0.5173 0.5383 0.0261  0.0956  -0.0066 672 SER A OG  
906  N N   . ILE A 120 ? 0.5541 0.4934 0.5499 0.0172  0.0900  -0.0146 673 ILE A N   
907  C CA  . ILE A 120 ? 0.5994 0.5373 0.6087 0.0140  0.0870  -0.0129 673 ILE A CA  
908  C C   . ILE A 120 ? 0.6114 0.5469 0.6370 0.0127  0.0918  -0.0131 673 ILE A C   
909  O O   . ILE A 120 ? 0.6407 0.5734 0.6762 0.0111  0.0932  -0.0108 673 ILE A O   
910  C CB  . ILE A 120 ? 0.6013 0.5441 0.6145 0.0105  0.0779  -0.0127 673 ILE A CB  
911  C CG1 . ILE A 120 ? 0.7663 0.7100 0.7649 0.0118  0.0749  -0.0125 673 ILE A CG1 
912  C CG2 . ILE A 120 ? 0.6702 0.6126 0.6962 0.0054  0.0739  -0.0100 673 ILE A CG2 
913  C CD1 . ILE A 120 ? 0.6719 0.6204 0.6707 0.0093  0.0673  -0.0133 673 ILE A CD1 
914  N N   . GLY A 121 ? 0.5813 0.5173 0.6104 0.0130  0.0953  -0.0159 674 GLY A N   
915  C CA  . GLY A 121 ? 0.6832 0.6151 0.7286 0.0122  0.1031  -0.0163 674 GLY A CA  
916  C C   . GLY A 121 ? 0.6943 0.6196 0.7372 0.0141  0.1115  -0.0157 674 GLY A C   
917  O O   . GLY A 121 ? 0.7150 0.6376 0.7756 0.0131  0.1152  -0.0136 674 GLY A O   
918  N N   . LEU A 122 ? 0.6381 0.5615 0.6605 0.0168  0.1143  -0.0164 675 LEU A N   
919  C CA  . LEU A 122 ? 0.6430 0.5602 0.6615 0.0189  0.1226  -0.0152 675 LEU A CA  
920  C C   . LEU A 122 ? 0.6023 0.5183 0.6272 0.0190  0.1202  -0.0115 675 LEU A C   
921  O O   . LEU A 122 ? 0.6702 0.5812 0.7040 0.0192  0.1266  -0.0104 675 LEU A O   
922  C CB  . LEU A 122 ? 0.6272 0.5439 0.6225 0.0213  0.1258  -0.0153 675 LEU A CB  
923  C CG  . LEU A 122 ? 0.5877 0.5029 0.5736 0.0191  0.1312  -0.0198 675 LEU A CG  
924  C CD1 . LEU A 122 ? 0.5350 0.4514 0.4970 0.0198  0.1328  -0.0183 675 LEU A CD1 
925  C CD2 . LEU A 122 ? 0.5276 0.4348 0.5262 0.0175  0.1421  -0.0227 675 LEU A CD2 
926  N N   . GLU A 123 ? 0.7314 0.6512 0.7522 0.0181  0.1121  -0.0100 676 GLU A N   
927  C CA  . GLU A 123 ? 0.7959 0.7134 0.8205 0.0164  0.1108  -0.0078 676 GLU A CA  
928  C C   . GLU A 123 ? 0.8531 0.7693 0.8977 0.0125  0.1113  -0.0065 676 GLU A C   
929  O O   . GLU A 123 ? 0.8961 0.8080 0.9437 0.0115  0.1146  -0.0052 676 GLU A O   
930  C CB  . GLU A 123 ? 0.7643 0.6851 0.7833 0.0136  0.1025  -0.0076 676 GLU A CB  
931  C CG  . GLU A 123 ? 0.7544 0.6709 0.7747 0.0100  0.1029  -0.0066 676 GLU A CG  
932  C CD  . GLU A 123 ? 0.9872 0.9040 0.9981 0.0069  0.0980  -0.0074 676 GLU A CD  
933  O OE1 . GLU A 123 ? 0.9705 0.8912 0.9740 0.0088  0.0942  -0.0080 676 GLU A OE1 
934  O OE2 . GLU A 123 ? 1.0448 0.9571 1.0555 0.0018  0.0987  -0.0079 676 GLU A OE2 
935  N N   . GLU A 124 ? 0.9444 0.8644 1.0044 0.0101  0.1083  -0.0062 677 GLU A N   
936  C CA  . GLU A 124 ? 0.9926 0.9130 1.0766 0.0067  0.1088  -0.0031 677 GLU A CA  
937  C C   . GLU A 124 ? 0.9847 0.8996 1.0783 0.0100  0.1207  -0.0041 677 GLU A C   
938  O O   . GLU A 124 ? 0.9391 0.8550 1.0432 0.0102  0.1232  -0.0050 677 GLU A O   
939  C CB  . GLU A 124 ? 0.9896 0.9179 1.0893 0.0022  0.0994  -0.0001 677 GLU A CB  
940  C CG  . GLU A 124 ? 1.1318 1.0650 1.2197 -0.0016 0.0882  0.0001  677 GLU A CG  
941  C CD  . GLU A 124 ? 1.2064 1.1453 1.2952 -0.0017 0.0825  0.0000  677 GLU A CD  
942  O OE1 . GLU A 124 ? 1.0352 0.9744 1.1342 0.0010  0.0874  -0.0008 677 GLU A OE1 
943  O OE2 . GLU A 124 ? 1.1665 1.1088 1.2457 -0.0049 0.0741  0.0002  677 GLU A OE2 
944  N N   . ALA A 125 ? 0.9886 0.8968 1.0796 0.0122  0.1293  -0.0043 678 ALA A N   
945  C CA  . ALA A 125 ? 0.9767 0.8823 1.0584 0.0120  0.1289  -0.0033 678 ALA A CA  
946  C C   . ALA A 125 ? 0.9475 0.8462 1.0119 0.0175  0.1390  -0.0048 678 ALA A C   
947  O O   . ALA A 125 ? 0.8593 0.7563 0.9108 0.0190  0.1391  -0.0041 678 ALA A O   
948  C CB  . ALA A 125 ? 0.9960 0.9013 1.0982 0.0076  0.1284  0.0000  678 ALA A CB  
949  N N   . ARG B 10  ? 0.6713 0.7098 0.7471 -0.0387 -0.0506 0.0741  563 ARG B N   
950  C CA  . ARG B 10  ? 0.7697 0.7858 0.8223 -0.0353 -0.0456 0.0602  563 ARG B CA  
951  C C   . ARG B 10  ? 0.8152 0.8138 0.8473 -0.0381 -0.0406 0.0475  563 ARG B C   
952  O O   . ARG B 10  ? 0.7740 0.7599 0.7943 -0.0485 -0.0483 0.0479  563 ARG B O   
953  C CB  . ARG B 10  ? 0.8221 0.8215 0.8627 -0.0430 -0.0577 0.0624  563 ARG B CB  
954  N N   . LEU B 11  ? 0.7664 0.7638 0.7937 -0.0289 -0.0281 0.0372  564 LEU B N   
955  C CA  . LEU B 11  ? 0.7545 0.7391 0.7665 -0.0301 -0.0225 0.0264  564 LEU B CA  
956  C C   . LEU B 11  ? 0.7073 0.6668 0.6959 -0.0346 -0.0243 0.0184  564 LEU B C   
957  O O   . LEU B 11  ? 0.7932 0.7462 0.7764 -0.0316 -0.0230 0.0154  564 LEU B O   
958  C CB  . LEU B 11  ? 0.7987 0.7906 0.8141 -0.0197 -0.0099 0.0196  564 LEU B CB  
959  C CG  . LEU B 11  ? 0.8515 0.8621 0.8831 -0.0138 -0.0039 0.0239  564 LEU B CG  
960  C CD1 . LEU B 11  ? 0.8750 0.8910 0.9121 -0.0215 -0.0098 0.0296  564 LEU B CD1 
961  C CD2 . LEU B 11  ? 0.8378 0.8640 0.8855 -0.0055 -0.0010 0.0324  564 LEU B CD2 
962  N N   . THR B 12  ? 0.6941 0.6378 0.6672 -0.0411 -0.0262 0.0149  565 THR B N   
963  C CA  . THR B 12  ? 0.6767 0.5949 0.6262 -0.0442 -0.0256 0.0078  565 THR B CA  
964  C C   . THR B 12  ? 0.6842 0.6002 0.6292 -0.0371 -0.0135 -0.0023 565 THR B C   
965  O O   . THR B 12  ? 0.7114 0.6393 0.6652 -0.0324 -0.0067 -0.0050 565 THR B O   
966  C CB  . THR B 12  ? 0.7307 0.6284 0.6610 -0.0525 -0.0305 0.0080  565 THR B CB  
967  O OG1 . THR B 12  ? 0.5641 0.4637 0.4931 -0.0488 -0.0219 0.0025  565 THR B OG1 
968  C CG2 . THR B 12  ? 0.5664 0.4677 0.5018 -0.0614 -0.0438 0.0193  565 THR B CG2 
969  N N   . PRO B 13  ? 0.6857 0.5853 0.6162 -0.0373 -0.0113 -0.0075 566 PRO B N   
970  C CA  . PRO B 13  ? 0.6496 0.5469 0.5762 -0.0324 -0.0009 -0.0155 566 PRO B CA  
971  C C   . PRO B 13  ? 0.5758 0.4784 0.5055 -0.0304 0.0050  -0.0181 566 PRO B C   
972  O O   . PRO B 13  ? 0.6387 0.5529 0.5776 -0.0252 0.0117  -0.0216 566 PRO B O   
973  C CB  . PRO B 13  ? 0.6728 0.5450 0.5777 -0.0361 -0.0006 -0.0189 566 PRO B CB  
974  C CG  . PRO B 13  ? 0.7366 0.6032 0.6387 -0.0402 -0.0108 -0.0137 566 PRO B CG  
975  C CD  . PRO B 13  ? 0.6544 0.5384 0.5731 -0.0418 -0.0185 -0.0054 566 PRO B CD  
976  N N   . LEU B 14  ? 0.5561 0.4481 0.4762 -0.0348 0.0021  -0.0162 567 LEU B N   
977  C CA  . LEU B 14  ? 0.5865 0.4799 0.5061 -0.0325 0.0082  -0.0188 567 LEU B CA  
978  C C   . LEU B 14  ? 0.4639 0.3796 0.4026 -0.0297 0.0081  -0.0166 567 LEU B C   
979  O O   . LEU B 14  ? 0.4077 0.3314 0.3525 -0.0253 0.0144  -0.0200 567 LEU B O   
980  C CB  . LEU B 14  ? 0.6609 0.5328 0.5606 -0.0377 0.0050  -0.0170 567 LEU B CB  
981  C CG  . LEU B 14  ? 0.7262 0.5964 0.6225 -0.0353 0.0103  -0.0186 567 LEU B CG  
982  C CD1 . LEU B 14  ? 0.7443 0.6079 0.6350 -0.0293 0.0220  -0.0238 567 LEU B CD1 
983  C CD2 . LEU B 14  ? 0.6922 0.5412 0.5680 -0.0421 0.0034  -0.0146 567 LEU B CD2 
984  N N   . THR B 15  ? 0.3855 0.3111 0.3337 -0.0323 0.0008  -0.0102 568 THR B N   
985  C CA  . THR B 15  ? 0.4639 0.4099 0.4297 -0.0289 0.0019  -0.0073 568 THR B CA  
986  C C   . THR B 15  ? 0.4222 0.3798 0.3978 -0.0212 0.0091  -0.0112 568 THR B C   
987  O O   . THR B 15  ? 0.4446 0.4091 0.4250 -0.0175 0.0141  -0.0139 568 THR B O   
988  C CB  . THR B 15  ? 0.5333 0.4888 0.5092 -0.0329 -0.0064 0.0020  568 THR B CB  
989  O OG1 . THR B 15  ? 0.5775 0.5217 0.5429 -0.0410 -0.0135 0.0056  568 THR B OG1 
990  C CG2 . THR B 15  ? 0.3793 0.3572 0.3753 -0.0274 -0.0031 0.0060  568 THR B CG2 
991  N N   . VAL B 16  ? 0.3887 0.3450 0.3640 -0.0194 0.0090  -0.0115 569 VAL B N   
992  C CA  . VAL B 16  ? 0.3206 0.2828 0.3001 -0.0132 0.0146  -0.0146 569 VAL B CA  
993  C C   . VAL B 16  ? 0.3449 0.3027 0.3192 -0.0120 0.0205  -0.0214 569 VAL B C   
994  O O   . VAL B 16  ? 0.3302 0.2946 0.3091 -0.0081 0.0241  -0.0229 569 VAL B O   
995  C CB  . VAL B 16  ? 0.2504 0.2068 0.2254 -0.0125 0.0130  -0.0144 569 VAL B CB  
996  C CG1 . VAL B 16  ? 0.3300 0.2871 0.3036 -0.0067 0.0188  -0.0184 569 VAL B CG1 
997  C CG2 . VAL B 16  ? 0.5151 0.4788 0.4988 -0.0130 0.0067  -0.0058 569 VAL B CG2 
998  N N   . LEU B 17  ? 0.3684 0.3147 0.3330 -0.0153 0.0214  -0.0244 570 LEU B N   
999  C CA  . LEU B 17  ? 0.4260 0.3708 0.3891 -0.0141 0.0272  -0.0289 570 LEU B CA  
1000 C C   . LEU B 17  ? 0.4843 0.4357 0.4528 -0.0129 0.0289  -0.0287 570 LEU B C   
1001 O O   . LEU B 17  ? 0.4118 0.3687 0.3852 -0.0107 0.0323  -0.0307 570 LEU B O   
1002 C CB  . LEU B 17  ? 0.3822 0.3118 0.3330 -0.0168 0.0292  -0.0306 570 LEU B CB  
1003 C CG  . LEU B 17  ? 0.6899 0.6156 0.6383 -0.0159 0.0360  -0.0336 570 LEU B CG  
1004 C CD1 . LEU B 17  ? 0.7286 0.6619 0.6834 -0.0148 0.0373  -0.0352 570 LEU B CD1 
1005 C CD2 . LEU B 17  ? 0.6839 0.5907 0.6166 -0.0183 0.0378  -0.0341 570 LEU B CD2 
1006 N N   . LEU B 18  ? 0.4911 0.4409 0.4579 -0.0151 0.0255  -0.0258 571 LEU B N   
1007 C CA  . LEU B 18  ? 0.5024 0.4565 0.4721 -0.0141 0.0268  -0.0257 571 LEU B CA  
1008 C C   . LEU B 18  ? 0.4404 0.4083 0.4215 -0.0110 0.0267  -0.0247 571 LEU B C   
1009 O O   . LEU B 18  ? 0.3599 0.3324 0.3448 -0.0086 0.0293  -0.0265 571 LEU B O   
1010 C CB  . LEU B 18  ? 0.5112 0.4564 0.4723 -0.0182 0.0226  -0.0226 571 LEU B CB  
1011 C CG  . LEU B 18  ? 0.4173 0.3429 0.3612 -0.0203 0.0242  -0.0239 571 LEU B CG  
1012 C CD1 . LEU B 18  ? 0.3969 0.3089 0.3271 -0.0254 0.0187  -0.0204 571 LEU B CD1 
1013 C CD2 . LEU B 18  ? 0.2946 0.2199 0.2388 -0.0156 0.0322  -0.0273 571 LEU B CD2 
1014 N N   . ARG B 19  ? 0.3340 0.3072 0.3199 -0.0105 0.0243  -0.0214 572 ARG B N   
1015 C CA  . ARG B 19  ? 0.4085 0.3918 0.4025 -0.0063 0.0259  -0.0195 572 ARG B CA  
1016 C C   . ARG B 19  ? 0.3610 0.3431 0.3532 -0.0028 0.0296  -0.0237 572 ARG B C   
1017 O O   . ARG B 19  ? 0.4501 0.4348 0.4438 -0.0008 0.0313  -0.0246 572 ARG B O   
1018 C CB  . ARG B 19  ? 0.3456 0.3345 0.3452 -0.0048 0.0241  -0.0140 572 ARG B CB  
1019 C CG  . ARG B 19  ? 0.6093 0.6055 0.6145 0.0014  0.0282  -0.0119 572 ARG B CG  
1020 C CD  . ARG B 19  ? 0.6850 0.6920 0.7009 0.0032  0.0275  -0.0036 572 ARG B CD  
1021 N NE  . ARG B 19  ? 0.8000 0.8105 0.8179 0.0104  0.0338  -0.0021 572 ARG B NE  
1022 C CZ  . ARG B 19  ? 0.8363 0.8566 0.8635 0.0129  0.0361  0.0042  572 ARG B CZ  
1023 N NH1 . ARG B 19  ? 0.8547 0.8737 0.8794 0.0203  0.0432  0.0048  572 ARG B NH1 
1024 N NH2 . ARG B 19  ? 1.0052 1.0349 1.0424 0.0075  0.0313  0.0103  572 ARG B NH2 
1025 N N   . SER B 20  ? 0.3804 0.3568 0.3678 -0.0032 0.0301  -0.0260 573 SER B N   
1026 C CA  . SER B 20  ? 0.4134 0.3869 0.3976 -0.0022 0.0321  -0.0293 573 SER B CA  
1027 C C   . SER B 20  ? 0.2926 0.2677 0.2793 -0.0038 0.0328  -0.0311 573 SER B C   
1028 O O   . SER B 20  ? 0.3108 0.2866 0.2978 -0.0030 0.0328  -0.0319 573 SER B O   
1029 C CB  . SER B 20  ? 0.4392 0.4059 0.4175 -0.0038 0.0321  -0.0311 573 SER B CB  
1030 O OG  . SER B 20  ? 0.3892 0.3536 0.3653 -0.0051 0.0328  -0.0334 573 SER B OG  
1031 N N   . VAL B 21  ? 0.3645 0.3383 0.3514 -0.0058 0.0333  -0.0312 574 VAL B N   
1032 C CA  . VAL B 21  ? 0.3038 0.2794 0.2937 -0.0058 0.0352  -0.0320 574 VAL B CA  
1033 C C   . VAL B 21  ? 0.3227 0.3031 0.3159 -0.0041 0.0341  -0.0314 574 VAL B C   
1034 O O   . VAL B 21  ? 0.4160 0.3993 0.4128 -0.0035 0.0343  -0.0318 574 VAL B O   
1035 C CB  . VAL B 21  ? 0.2997 0.2690 0.2852 -0.0066 0.0377  -0.0318 574 VAL B CB  
1036 C CG1 . VAL B 21  ? 0.2687 0.2409 0.2579 -0.0046 0.0401  -0.0314 574 VAL B CG1 
1037 C CG2 . VAL B 21  ? 0.3134 0.2771 0.2955 -0.0078 0.0404  -0.0325 574 VAL B CG2 
1038 N N   . LEU B 22  ? 0.3702 0.3516 0.3628 -0.0039 0.0326  -0.0296 575 LEU B N   
1039 C CA  . LEU B 22  ? 0.3626 0.3475 0.3572 -0.0028 0.0320  -0.0286 575 LEU B CA  
1040 C C   . LEU B 22  ? 0.3316 0.3180 0.3268 -0.0001 0.0324  -0.0289 575 LEU B C   
1041 O O   . LEU B 22  ? 0.3207 0.3072 0.3160 0.0005  0.0321  -0.0297 575 LEU B O   
1042 C CB  . LEU B 22  ? 0.3382 0.3244 0.3328 -0.0043 0.0301  -0.0252 575 LEU B CB  
1043 C CG  . LEU B 22  ? 0.3856 0.3754 0.3820 -0.0039 0.0297  -0.0235 575 LEU B CG  
1044 C CD1 . LEU B 22  ? 0.2835 0.2688 0.2757 -0.0045 0.0298  -0.0257 575 LEU B CD1 
1045 C CD2 . LEU B 22  ? 0.3415 0.3347 0.3403 -0.0067 0.0270  -0.0182 575 LEU B CD2 
1046 N N   . ASP B 23  ? 0.2827 0.2678 0.2760 0.0014  0.0330  -0.0280 576 ASP B N   
1047 C CA  . ASP B 23  ? 0.3200 0.3005 0.3079 0.0043  0.0340  -0.0284 576 ASP B CA  
1048 C C   . ASP B 23  ? 0.3228 0.2988 0.3076 0.0021  0.0318  -0.0308 576 ASP B C   
1049 O O   . ASP B 23  ? 0.3942 0.3661 0.3749 0.0030  0.0309  -0.0309 576 ASP B O   
1050 C CB  . ASP B 23  ? 0.2120 0.1887 0.1954 0.0069  0.0355  -0.0271 576 ASP B CB  
1051 C CG  . ASP B 23  ? 0.4209 0.4040 0.4098 0.0099  0.0375  -0.0225 576 ASP B CG  
1052 O OD1 . ASP B 23  ? 0.3637 0.3527 0.3582 0.0099  0.0378  -0.0203 576 ASP B OD1 
1053 O OD2 . ASP B 23  ? 0.3248 0.3078 0.3136 0.0120  0.0384  -0.0203 576 ASP B OD2 
1054 N N   . GLN B 24  ? 0.3038 0.2801 0.2904 -0.0008 0.0307  -0.0319 577 GLN B N   
1055 C CA  . GLN B 24  ? 0.2924 0.2680 0.2802 -0.0039 0.0279  -0.0322 577 GLN B CA  
1056 C C   . GLN B 24  ? 0.3336 0.3143 0.3278 -0.0039 0.0270  -0.0317 577 GLN B C   
1057 O O   . GLN B 24  ? 0.4541 0.4324 0.4469 -0.0051 0.0235  -0.0310 577 GLN B O   
1058 C CB  . GLN B 24  ? 0.2904 0.2684 0.2824 -0.0069 0.0284  -0.0322 577 GLN B CB  
1059 C CG  . GLN B 24  ? 0.3947 0.3654 0.3781 -0.0078 0.0282  -0.0329 577 GLN B CG  
1060 C CD  . GLN B 24  ? 0.4097 0.3816 0.3960 -0.0111 0.0290  -0.0328 577 GLN B CD  
1061 O OE1 . GLN B 24  ? 0.6543 0.6273 0.6433 -0.0151 0.0267  -0.0313 577 GLN B OE1 
1062 N NE2 . GLN B 24  ? 0.5448 0.5161 0.5306 -0.0101 0.0319  -0.0337 577 GLN B NE2 
1063 N N   . LEU B 25  ? 0.4459 0.4314 0.4448 -0.0026 0.0295  -0.0317 578 LEU B N   
1064 C CA  . LEU B 25  ? 0.3746 0.3632 0.3773 -0.0015 0.0293  -0.0312 578 LEU B CA  
1065 C C   . LEU B 25  ? 0.3751 0.3602 0.3731 -0.0004 0.0272  -0.0315 578 LEU B C   
1066 O O   . LEU B 25  ? 0.2490 0.2337 0.2481 -0.0009 0.0244  -0.0311 578 LEU B O   
1067 C CB  . LEU B 25  ? 0.4348 0.4236 0.4370 -0.0005 0.0321  -0.0312 578 LEU B CB  
1068 C CG  . LEU B 25  ? 0.4337 0.4228 0.4384 0.0001  0.0353  -0.0304 578 LEU B CG  
1069 C CD1 . LEU B 25  ? 0.3588 0.3516 0.3698 -0.0009 0.0360  -0.0293 578 LEU B CD1 
1070 C CD2 . LEU B 25  ? 0.5247 0.5074 0.5221 -0.0004 0.0373  -0.0306 578 LEU B CD2 
1071 N N   . GLN B 26  ? 0.3128 0.2952 0.3057 0.0011  0.0288  -0.0315 579 GLN B N   
1072 C CA  . GLN B 26  ? 0.3468 0.3243 0.3339 0.0030  0.0287  -0.0312 579 GLN B CA  
1073 C C   . GLN B 26  ? 0.2910 0.2586 0.2692 0.0025  0.0261  -0.0315 579 GLN B C   
1074 O O   . GLN B 26  ? 0.4028 0.3633 0.3744 0.0030  0.0244  -0.0316 579 GLN B O   
1075 C CB  . GLN B 26  ? 0.3191 0.2979 0.3050 0.0056  0.0324  -0.0293 579 GLN B CB  
1076 C CG  . GLN B 26  ? 0.3519 0.3376 0.3436 0.0043  0.0328  -0.0279 579 GLN B CG  
1077 C CD  . GLN B 26  ? 0.2512 0.2396 0.2437 0.0060  0.0352  -0.0244 579 GLN B CD  
1078 O OE1 . GLN B 26  ? 0.3589 0.3530 0.3563 0.0057  0.0362  -0.0208 579 GLN B OE1 
1079 N NE2 . GLN B 26  ? 0.2349 0.2194 0.2231 0.0074  0.0361  -0.0246 579 GLN B NE2 
1080 N N   . ASP B 27  ? 0.3509 0.3156 0.3267 0.0008  0.0250  -0.0316 580 ASP B N   
1081 C CA  . ASP B 27  ? 0.3697 0.3215 0.3335 -0.0011 0.0210  -0.0314 580 ASP B CA  
1082 C C   . ASP B 27  ? 0.3849 0.3381 0.3531 -0.0054 0.0146  -0.0304 580 ASP B C   
1083 O O   . ASP B 27  ? 0.4032 0.3438 0.3601 -0.0079 0.0095  -0.0296 580 ASP B O   
1084 C CB  . ASP B 27  ? 0.3684 0.3160 0.3277 -0.0030 0.0203  -0.0313 580 ASP B CB  
1085 C CG  . ASP B 27  ? 0.5367 0.4795 0.4886 0.0019  0.0259  -0.0313 580 ASP B CG  
1086 O OD1 . ASP B 27  ? 0.4226 0.3636 0.3714 0.0070  0.0302  -0.0304 580 ASP B OD1 
1087 O OD2 . ASP B 27  ? 0.4811 0.4223 0.4309 0.0011  0.0262  -0.0315 580 ASP B OD2 
1088 N N   . LYS B 28  ? 0.2707 0.2375 0.2539 -0.0059 0.0150  -0.0299 581 LYS B N   
1089 C CA  . LYS B 28  ? 0.3939 0.3647 0.3844 -0.0088 0.0095  -0.0275 581 LYS B CA  
1090 C C   . LYS B 28  ? 0.3833 0.3514 0.3712 -0.0065 0.0086  -0.0282 581 LYS B C   
1091 O O   . LYS B 28  ? 0.3521 0.3230 0.3456 -0.0082 0.0038  -0.0260 581 LYS B O   
1092 C CB  . LYS B 28  ? 0.3324 0.3179 0.3396 -0.0090 0.0115  -0.0255 581 LYS B CB  
1093 C CG  . LYS B 28  ? 0.5002 0.4891 0.5110 -0.0111 0.0135  -0.0248 581 LYS B CG  
1094 C CD  . LYS B 28  ? 0.6190 0.6017 0.6249 -0.0171 0.0069  -0.0226 581 LYS B CD  
1095 C CE  . LYS B 28  ? 0.5542 0.5386 0.5612 -0.0191 0.0096  -0.0226 581 LYS B CE  
1096 N NZ  . LYS B 28  ? 0.5992 0.5742 0.5930 -0.0160 0.0138  -0.0267 581 LYS B NZ  
1097 N N   . ASP B 29  ? 0.3354 0.2984 0.3153 -0.0028 0.0132  -0.0305 582 ASP B N   
1098 C CA  . ASP B 29  ? 0.3789 0.3383 0.3548 -0.0009 0.0131  -0.0312 582 ASP B CA  
1099 C C   . ASP B 29  ? 0.4216 0.3659 0.3809 0.0009  0.0148  -0.0320 582 ASP B C   
1100 O O   . ASP B 29  ? 0.3447 0.2895 0.3020 0.0044  0.0204  -0.0324 582 ASP B O   
1101 C CB  . ASP B 29  ? 0.4510 0.4202 0.4345 0.0017  0.0182  -0.0320 582 ASP B CB  
1102 C CG  . ASP B 29  ? 0.6770 0.6420 0.6551 0.0034  0.0187  -0.0328 582 ASP B CG  
1103 O OD1 . ASP B 29  ? 0.4800 0.4390 0.4541 0.0027  0.0143  -0.0328 582 ASP B OD1 
1104 O OD2 . ASP B 29  ? 0.3226 0.2901 0.3002 0.0047  0.0229  -0.0329 582 ASP B OD2 
1105 N N   . PRO B 30  ? 0.4226 0.3518 0.3686 -0.0014 0.0102  -0.0313 583 PRO B N   
1106 C CA  . PRO B 30  ? 0.4317 0.3427 0.3582 0.0019  0.0139  -0.0317 583 PRO B CA  
1107 C C   . PRO B 30  ? 0.4941 0.3981 0.4136 0.0041  0.0152  -0.0323 583 PRO B C   
1108 O O   . PRO B 30  ? 0.4512 0.3446 0.3585 0.0088  0.0220  -0.0320 583 PRO B O   
1109 C CB  . PRO B 30  ? 0.4597 0.3513 0.3688 -0.0020 0.0073  -0.0307 583 PRO B CB  
1110 C CG  . PRO B 30  ? 0.4848 0.3878 0.4078 -0.0084 -0.0006 -0.0291 583 PRO B CG  
1111 C CD  . PRO B 30  ? 0.3784 0.3049 0.3249 -0.0072 0.0017  -0.0294 583 PRO B CD  
1112 N N   . ALA B 31  ? 0.3938 0.3032 0.3208 0.0012  0.0094  -0.0326 584 ALA B N   
1113 C CA  . ALA B 31  ? 0.4425 0.3473 0.3647 0.0030  0.0103  -0.0335 584 ALA B CA  
1114 C C   . ALA B 31  ? 0.4033 0.3207 0.3345 0.0066  0.0182  -0.0339 584 ALA B C   
1115 O O   . ALA B 31  ? 0.4867 0.3994 0.4123 0.0082  0.0206  -0.0343 584 ALA B O   
1116 C CB  . ALA B 31  ? 0.3564 0.2646 0.2854 -0.0005 0.0015  -0.0330 584 ALA B CB  
1117 N N   . ARG B 32  ? 0.4058 0.3382 0.3501 0.0070  0.0216  -0.0333 585 ARG B N   
1118 C CA  . ARG B 32  ? 0.3420 0.2847 0.2934 0.0089  0.0276  -0.0323 585 ARG B CA  
1119 C C   . ARG B 32  ? 0.4268 0.3737 0.3815 0.0078  0.0260  -0.0332 585 ARG B C   
1120 O O   . ARG B 32  ? 0.3437 0.2928 0.2982 0.0083  0.0296  -0.0320 585 ARG B O   
1121 C CB  . ARG B 32  ? 0.3963 0.3320 0.3392 0.0128  0.0346  -0.0301 585 ARG B CB  
1122 C CG  . ARG B 32  ? 0.5485 0.4816 0.4888 0.0152  0.0378  -0.0286 585 ARG B CG  
1123 C CD  . ARG B 32  ? 0.5399 0.4657 0.4719 0.0211  0.0465  -0.0252 585 ARG B CD  
1124 N NE  . ARG B 32  ? 0.5180 0.4550 0.4592 0.0222  0.0513  -0.0218 585 ARG B NE  
1125 C CZ  . ARG B 32  ? 0.3603 0.3149 0.3173 0.0215  0.0533  -0.0181 585 ARG B CZ  
1126 N NH1 . ARG B 32  ? 0.3381 0.3010 0.3034 0.0203  0.0511  -0.0181 585 ARG B NH1 
1127 N NH2 . ARG B 32  ? 0.2902 0.2536 0.2544 0.0211  0.0565  -0.0140 585 ARG B NH2 
1128 N N   . ILE B 33  ? 0.3960 0.3437 0.3538 0.0063  0.0205  -0.0344 586 ILE B N   
1129 C CA  . ILE B 33  ? 0.4796 0.4298 0.4392 0.0063  0.0192  -0.0351 586 ILE B CA  
1130 C C   . ILE B 33  ? 0.3875 0.3467 0.3532 0.0059  0.0225  -0.0343 586 ILE B C   
1131 O O   . ILE B 33  ? 0.4009 0.3587 0.3628 0.0055  0.0232  -0.0344 586 ILE B O   
1132 C CB  . ILE B 33  ? 0.4388 0.3905 0.4037 0.0060  0.0132  -0.0349 586 ILE B CB  
1133 C CG1 . ILE B 33  ? 0.3828 0.3220 0.3382 0.0049  0.0076  -0.0350 586 ILE B CG1 
1134 C CG2 . ILE B 33  ? 0.4719 0.4279 0.4403 0.0077  0.0138  -0.0348 586 ILE B CG2 
1135 C CD1 . ILE B 33  ? 0.3177 0.2596 0.2808 0.0030  -0.0003 -0.0325 586 ILE B CD1 
1136 N N   . PHE B 34  ? 0.3471 0.3133 0.3200 0.0054  0.0237  -0.0336 587 PHE B N   
1137 C CA  . PHE B 34  ? 0.2359 0.2071 0.2119 0.0044  0.0256  -0.0326 587 PHE B CA  
1138 C C   . PHE B 34  ? 0.2942 0.2691 0.2717 0.0029  0.0282  -0.0304 587 PHE B C   
1139 O O   . PHE B 34  ? 0.2882 0.2660 0.2675 0.0010  0.0285  -0.0289 587 PHE B O   
1140 C CB  . PHE B 34  ? 0.3171 0.2922 0.2995 0.0052  0.0254  -0.0327 587 PHE B CB  
1141 C CG  . PHE B 34  ? 0.2000 0.1749 0.1852 0.0073  0.0230  -0.0328 587 PHE B CG  
1142 C CD1 . PHE B 34  ? 0.1669 0.1389 0.1487 0.0095  0.0237  -0.0326 587 PHE B CD1 
1143 C CD2 . PHE B 34  ? 0.2966 0.2735 0.2871 0.0068  0.0197  -0.0320 587 PHE B CD2 
1144 C CE1 . PHE B 34  ? 0.3943 0.3678 0.3807 0.0123  0.0218  -0.0314 587 PHE B CE1 
1145 C CE2 . PHE B 34  ? 0.4647 0.4436 0.4606 0.0081  0.0165  -0.0303 587 PHE B CE2 
1146 C CZ  . PHE B 34  ? 0.2638 0.2421 0.2589 0.0114  0.0179  -0.0298 587 PHE B CZ  
1147 N N   . ALA B 35  ? 0.2733 0.2467 0.2490 0.0042  0.0302  -0.0294 588 ALA B N   
1148 C CA  . ALA B 35  ? 0.3560 0.3348 0.3358 0.0045  0.0336  -0.0257 588 ALA B CA  
1149 C C   . ALA B 35  ? 0.2569 0.2411 0.2396 0.0015  0.0339  -0.0217 588 ALA B C   
1150 O O   . ALA B 35  ? 0.3713 0.3630 0.3609 0.0002  0.0347  -0.0175 588 ALA B O   
1151 C CB  . ALA B 35  ? 0.2503 0.2235 0.2251 0.0082  0.0372  -0.0248 588 ALA B CB  
1152 N N   . GLN B 36  ? 0.2488 0.2289 0.2260 0.0000  0.0327  -0.0222 589 GLN B N   
1153 C CA  . GLN B 36  ? 0.3227 0.3068 0.3011 -0.0040 0.0325  -0.0173 589 GLN B CA  
1154 C C   . GLN B 36  ? 0.3640 0.3406 0.3333 -0.0072 0.0286  -0.0196 589 GLN B C   
1155 O O   . GLN B 36  ? 0.3296 0.2992 0.2932 -0.0046 0.0277  -0.0243 589 GLN B O   
1156 C CB  . GLN B 36  ? 0.4311 0.4157 0.4096 -0.0016 0.0373  -0.0143 589 GLN B CB  
1157 C CG  . GLN B 36  ? 0.4489 0.4400 0.4351 0.0026  0.0429  -0.0102 589 GLN B CG  
1158 C CD  . GLN B 36  ? 0.5502 0.5395 0.5346 0.0065  0.0499  -0.0063 589 GLN B CD  
1159 O OE1 . GLN B 36  ? 0.5525 0.5292 0.5254 0.0103  0.0523  -0.0102 589 GLN B OE1 
1160 N NE2 . GLN B 36  ? 0.4274 0.4290 0.4230 0.0055  0.0533  0.0021  589 GLN B NE2 
1161 N N   . PRO B 37  ? 0.3125 0.2896 0.2797 -0.0131 0.0260  -0.0153 590 PRO B N   
1162 C CA  . PRO B 37  ? 0.3521 0.3177 0.3059 -0.0158 0.0224  -0.0176 590 PRO B CA  
1163 C C   . PRO B 37  ? 0.4385 0.3973 0.3852 -0.0127 0.0237  -0.0212 590 PRO B C   
1164 O O   . PRO B 37  ? 0.4266 0.3886 0.3766 -0.0114 0.0267  -0.0198 590 PRO B O   
1165 C CB  . PRO B 37  ? 0.3294 0.2957 0.2809 -0.0240 0.0185  -0.0112 590 PRO B CB  
1166 C CG  . PRO B 37  ? 0.4458 0.4264 0.4128 -0.0256 0.0192  -0.0050 590 PRO B CG  
1167 C CD  . PRO B 37  ? 0.3942 0.3816 0.3707 -0.0177 0.0254  -0.0075 590 PRO B CD  
1168 N N   . VAL B 38  ? 0.3699 0.3183 0.3061 -0.0110 0.0218  -0.0252 591 VAL B N   
1169 C CA  . VAL B 38  ? 0.3605 0.3007 0.2881 -0.0088 0.0217  -0.0282 591 VAL B CA  
1170 C C   . VAL B 38  ? 0.4362 0.3742 0.3580 -0.0141 0.0212  -0.0248 591 VAL B C   
1171 O O   . VAL B 38  ? 0.5379 0.4763 0.4574 -0.0204 0.0188  -0.0204 591 VAL B O   
1172 C CB  . VAL B 38  ? 0.4811 0.4107 0.3983 -0.0060 0.0200  -0.0313 591 VAL B CB  
1173 C CG1 . VAL B 38  ? 0.5481 0.4683 0.4553 -0.0040 0.0189  -0.0338 591 VAL B CG1 
1174 C CG2 . VAL B 38  ? 0.5045 0.4391 0.4308 -0.0005 0.0212  -0.0332 591 VAL B CG2 
1175 N N   . SER B 39  ? 0.4689 0.4044 0.3887 -0.0122 0.0234  -0.0258 592 SER B N   
1176 C CA  . SER B 39  ? 0.5254 0.4586 0.4397 -0.0170 0.0239  -0.0223 592 SER B CA  
1177 C C   . SER B 39  ? 0.4578 0.3758 0.3545 -0.0182 0.0203  -0.0256 592 SER B C   
1178 O O   . SER B 39  ? 0.5038 0.4134 0.3940 -0.0131 0.0200  -0.0306 592 SER B O   
1179 C CB  . SER B 39  ? 0.5714 0.5058 0.4886 -0.0139 0.0294  -0.0215 592 SER B CB  
1180 O OG  . SER B 39  ? 0.5588 0.4907 0.4705 -0.0184 0.0306  -0.0177 592 SER B OG  
1181 N N   . LEU B 40  ? 0.4952 0.4088 0.3834 -0.0252 0.0169  -0.0222 593 LEU B N   
1182 C CA  . LEU B 40  ? 0.5627 0.4593 0.4306 -0.0270 0.0137  -0.0246 593 LEU B CA  
1183 C C   . LEU B 40  ? 0.5540 0.4452 0.4166 -0.0256 0.0158  -0.0265 593 LEU B C   
1184 O O   . LEU B 40  ? 0.5961 0.4737 0.4449 -0.0221 0.0141  -0.0313 593 LEU B O   
1185 C CB  . LEU B 40  ? 0.5924 0.4834 0.4500 -0.0370 0.0089  -0.0192 593 LEU B CB  
1186 C CG  . LEU B 40  ? 0.5100 0.3992 0.3658 -0.0390 0.0058  -0.0176 593 LEU B CG  
1187 C CD1 . LEU B 40  ? 0.5258 0.4043 0.3663 -0.0505 -0.0009 -0.0116 593 LEU B CD1 
1188 C CD2 . LEU B 40  ? 0.5908 0.4681 0.4365 -0.0304 0.0070  -0.0240 593 LEU B CD2 
1189 N N   . LYS B 41  ? 0.5869 0.4880 0.4600 -0.0271 0.0201  -0.0225 594 LYS B N   
1190 C CA  . LYS B 41  ? 0.5576 0.4512 0.4238 -0.0250 0.0234  -0.0242 594 LYS B CA  
1191 C C   . LYS B 41  ? 0.5022 0.3868 0.3636 -0.0170 0.0231  -0.0313 594 LYS B C   
1192 O O   . LYS B 41  ? 0.5174 0.3877 0.3646 -0.0156 0.0216  -0.0351 594 LYS B O   
1193 C CB  . LYS B 41  ? 0.6059 0.5110 0.4847 -0.0255 0.0306  -0.0181 594 LYS B CB  
1194 C CG  . LYS B 41  ? 0.4813 0.3990 0.3692 -0.0343 0.0304  -0.0084 594 LYS B CG  
1195 C CD  . LYS B 41  ? 0.5851 0.4959 0.4625 -0.0408 0.0303  -0.0051 594 LYS B CD  
1196 C CE  . LYS B 41  ? 0.5965 0.5248 0.4895 -0.0491 0.0313  0.0069  594 LYS B CE  
1197 N NZ  . LYS B 41  ? 0.6739 0.5946 0.5545 -0.0591 0.0269  0.0107  594 LYS B NZ  
1198 N N   . GLU B 42  ? 0.5451 0.4373 0.4178 -0.0125 0.0234  -0.0327 595 GLU B N   
1199 C CA  . GLU B 42  ? 0.5719 0.4571 0.4421 -0.0063 0.0214  -0.0378 595 GLU B CA  
1200 C C   . GLU B 42  ? 0.4570 0.3365 0.3215 -0.0040 0.0163  -0.0410 595 GLU B C   
1201 O O   . GLU B 42  ? 0.5219 0.3934 0.3814 -0.0001 0.0133  -0.0441 595 GLU B O   
1202 C CB  . GLU B 42  ? 0.6232 0.5178 0.5068 -0.0029 0.0235  -0.0373 595 GLU B CB  
1203 C CG  . GLU B 42  ? 0.7456 0.6383 0.6289 -0.0017 0.0294  -0.0352 595 GLU B CG  
1204 C CD  . GLU B 42  ? 0.9174 0.8169 0.8106 0.0013  0.0319  -0.0342 595 GLU B CD  
1205 O OE1 . GLU B 42  ? 0.9780 0.8851 0.8800 0.0020  0.0285  -0.0353 595 GLU B OE1 
1206 O OE2 . GLU B 42  ? 1.2075 1.1031 1.0982 0.0036  0.0379  -0.0321 595 GLU B OE2 
1207 N N   . VAL B 43  ? 0.4155 0.2978 0.2796 -0.0063 0.0154  -0.0394 596 VAL B N   
1208 C CA  . VAL B 43  ? 0.5048 0.3804 0.3623 -0.0024 0.0128  -0.0414 596 VAL B CA  
1209 C C   . VAL B 43  ? 0.5027 0.3684 0.3446 -0.0071 0.0116  -0.0397 596 VAL B C   
1210 O O   . VAL B 43  ? 0.5728 0.4408 0.4158 -0.0090 0.0117  -0.0375 596 VAL B O   
1211 C CB  . VAL B 43  ? 0.5191 0.4060 0.3916 0.0018  0.0137  -0.0409 596 VAL B CB  
1212 C CG1 . VAL B 43  ? 0.6008 0.4818 0.4684 0.0077  0.0130  -0.0417 596 VAL B CG1 
1213 C CG2 . VAL B 43  ? 0.5681 0.4629 0.4536 0.0044  0.0136  -0.0417 596 VAL B CG2 
1214 N N   . PRO B 44  ? 0.4696 0.3217 0.2945 -0.0098 0.0098  -0.0405 597 PRO B N   
1215 C CA  . PRO B 44  ? 0.5204 0.3624 0.3293 -0.0173 0.0077  -0.0377 597 PRO B CA  
1216 C C   . PRO B 44  ? 0.5405 0.3677 0.3324 -0.0153 0.0061  -0.0381 597 PRO B C   
1217 O O   . PRO B 44  ? 0.4712 0.2881 0.2482 -0.0229 0.0034  -0.0350 597 PRO B O   
1218 C CB  . PRO B 44  ? 0.5139 0.3446 0.3088 -0.0204 0.0065  -0.0388 597 PRO B CB  
1219 C CG  . PRO B 44  ? 0.5650 0.4038 0.3726 -0.0166 0.0092  -0.0407 597 PRO B CG  
1220 C CD  . PRO B 44  ? 0.4519 0.2994 0.2736 -0.0089 0.0098  -0.0428 597 PRO B CD  
1221 N N   . ASP B 45  ? 0.5069 0.3313 0.2994 -0.0053 0.0078  -0.0411 598 ASP B N   
1222 C CA  . ASP B 45  ? 0.5268 0.3364 0.3034 -0.0001 0.0090  -0.0409 598 ASP B CA  
1223 C C   . ASP B 45  ? 0.5141 0.3339 0.3044 0.0035  0.0123  -0.0394 598 ASP B C   
1224 O O   . ASP B 45  ? 0.5617 0.3716 0.3429 0.0110  0.0155  -0.0391 598 ASP B O   
1225 C CB  . ASP B 45  ? 0.5447 0.3453 0.3144 0.0102  0.0100  -0.0435 598 ASP B CB  
1226 C CG  . ASP B 45  ? 0.5930 0.4119 0.3880 0.0177  0.0113  -0.0442 598 ASP B CG  
1227 O OD1 . ASP B 45  ? 0.6057 0.4412 0.4198 0.0138  0.0107  -0.0441 598 ASP B OD1 
1228 O OD2 . ASP B 45  ? 0.6574 0.4735 0.4527 0.0273  0.0127  -0.0439 598 ASP B OD2 
1229 N N   . TYR B 46  ? 0.5393 0.3777 0.3501 -0.0008 0.0123  -0.0380 599 TYR B N   
1230 C CA  . TYR B 46  ? 0.5090 0.3571 0.3328 0.0019  0.0152  -0.0367 599 TYR B CA  
1231 C C   . TYR B 46  ? 0.5426 0.3727 0.3454 0.0000  0.0156  -0.0346 599 TYR B C   
1232 O O   . TYR B 46  ? 0.4817 0.3079 0.2830 0.0066  0.0198  -0.0342 599 TYR B O   
1233 C CB  . TYR B 46  ? 0.4662 0.3337 0.3110 -0.0035 0.0147  -0.0352 599 TYR B CB  
1234 C CG  . TYR B 46  ? 0.4022 0.2821 0.2636 0.0001  0.0176  -0.0347 599 TYR B CG  
1235 C CD1 . TYR B 46  ? 0.4892 0.3761 0.3622 0.0085  0.0201  -0.0362 599 TYR B CD1 
1236 C CD2 . TYR B 46  ? 0.3638 0.2485 0.2294 -0.0052 0.0172  -0.0320 599 TYR B CD2 
1237 C CE1 . TYR B 46  ? 0.4261 0.3244 0.3142 0.0112  0.0227  -0.0353 599 TYR B CE1 
1238 C CE2 . TYR B 46  ? 0.4607 0.3558 0.3405 -0.0019 0.0199  -0.0319 599 TYR B CE2 
1239 C CZ  . TYR B 46  ? 0.5028 0.4045 0.3935 0.0061  0.0230  -0.0337 599 TYR B CZ  
1240 O OH  . TYR B 46  ? 0.4601 0.3717 0.3643 0.0088  0.0257  -0.0331 599 TYR B OH  
1241 N N   . LEU B 47  ? 0.6266 0.4440 0.4118 -0.0094 0.0111  -0.0325 600 LEU B N   
1242 C CA  . LEU B 47  ? 0.6049 0.4024 0.3675 -0.0134 0.0097  -0.0298 600 LEU B CA  
1243 C C   . LEU B 47  ? 0.6561 0.4255 0.3886 -0.0061 0.0124  -0.0311 600 LEU B C   
1244 O O   . LEU B 47  ? 0.6565 0.4053 0.3673 -0.0064 0.0132  -0.0293 600 LEU B O   
1245 C CB  . LEU B 47  ? 0.6070 0.4015 0.3624 -0.0280 0.0021  -0.0253 600 LEU B CB  
1246 C CG  . LEU B 47  ? 0.5632 0.3847 0.3477 -0.0344 0.0004  -0.0222 600 LEU B CG  
1247 C CD1 . LEU B 47  ? 0.5607 0.3782 0.3373 -0.0488 -0.0074 -0.0156 600 LEU B CD1 
1248 C CD2 . LEU B 47  ? 0.4865 0.3199 0.2875 -0.0301 0.0038  -0.0223 600 LEU B CD2 
1249 N N   . ASP B 48  ? 0.6477 0.4148 0.3780 0.0012  0.0144  -0.0339 601 ASP B N   
1250 C CA  . ASP B 48  ? 0.6544 0.3977 0.3602 0.0117  0.0191  -0.0346 601 ASP B CA  
1251 C C   . ASP B 48  ? 0.7625 0.5105 0.4783 0.0241  0.0276  -0.0336 601 ASP B C   
1252 O O   . ASP B 48  ? 0.7632 0.4896 0.4572 0.0338  0.0336  -0.0325 601 ASP B O   
1253 C CB  . ASP B 48  ? 0.6315 0.3744 0.3366 0.0173  0.0187  -0.0372 601 ASP B CB  
1254 C CG  . ASP B 48  ? 0.7427 0.4744 0.4307 0.0064  0.0118  -0.0379 601 ASP B CG  
1255 O OD1 . ASP B 48  ? 0.7933 0.5224 0.4754 -0.0061 0.0068  -0.0354 601 ASP B OD1 
1256 O OD2 . ASP B 48  ? 0.9439 0.6701 0.6255 0.0100  0.0110  -0.0403 601 ASP B OD2 
1257 N N   . HIS B 49  ? 0.6157 0.3909 0.3636 0.0243  0.0288  -0.0335 602 HIS B N   
1258 C CA  . HIS B 49  ? 0.6209 0.4054 0.3837 0.0355  0.0367  -0.0319 602 HIS B CA  
1259 C C   . HIS B 49  ? 0.5749 0.3656 0.3456 0.0314  0.0380  -0.0305 602 HIS B C   
1260 O O   . HIS B 49  ? 0.6067 0.3906 0.3734 0.0391  0.0454  -0.0284 602 HIS B O   
1261 C CB  . HIS B 49  ? 0.7114 0.5229 0.5063 0.0410  0.0368  -0.0325 602 HIS B CB  
1262 C CG  . HIS B 49  ? 0.7039 0.5099 0.4929 0.0468  0.0357  -0.0333 602 HIS B CG  
1263 N ND1 . HIS B 49  ? 0.6040 0.4147 0.3961 0.0405  0.0288  -0.0362 602 HIS B ND1 
1264 C CD2 . HIS B 49  ? 0.9465 0.7416 0.7260 0.0589  0.0409  -0.0312 602 HIS B CD2 
1265 C CE1 . HIS B 49  ? 0.7192 0.5217 0.5034 0.0477  0.0288  -0.0364 602 HIS B CE1 
1266 N NE2 . HIS B 49  ? 0.8166 0.6105 0.5940 0.0591  0.0360  -0.0332 602 HIS B NE2 
1267 N N   . ILE B 50  ? 0.5417 0.3451 0.3239 0.0198  0.0315  -0.0311 603 ILE B N   
1268 C CA  . ILE B 50  ? 0.5492 0.3645 0.3458 0.0160  0.0319  -0.0299 603 ILE B CA  
1269 C C   . ILE B 50  ? 0.6210 0.4181 0.3955 0.0053  0.0266  -0.0279 603 ILE B C   
1270 O O   . ILE B 50  ? 0.6477 0.4440 0.4176 -0.0046 0.0194  -0.0272 603 ILE B O   
1271 C CB  . ILE B 50  ? 0.4862 0.3312 0.3148 0.0119  0.0286  -0.0310 603 ILE B CB  
1272 C CG1 . ILE B 50  ? 0.5449 0.4060 0.3939 0.0205  0.0314  -0.0323 603 ILE B CG1 
1273 C CG2 . ILE B 50  ? 0.4716 0.3268 0.3127 0.0087  0.0291  -0.0298 603 ILE B CG2 
1274 C CD1 . ILE B 50  ? 0.4430 0.3037 0.2957 0.0313  0.0387  -0.0305 603 ILE B CD1 
1275 N N   . LYS B 51  ? 0.6108 0.3924 0.3710 0.0069  0.0300  -0.0263 604 LYS B N   
1276 C CA  . LYS B 51  ? 0.5992 0.3564 0.3318 -0.0032 0.0242  -0.0236 604 LYS B CA  
1277 C C   . LYS B 51  ? 0.6853 0.4579 0.4348 -0.0124 0.0190  -0.0217 604 LYS B C   
1278 O O   . LYS B 51  ? 0.6739 0.4370 0.4112 -0.0247 0.0102  -0.0183 604 LYS B O   
1279 C CB  . LYS B 51  ? 0.6187 0.3423 0.3180 0.0038  0.0308  -0.0226 604 LYS B CB  
1280 C CG  . LYS B 51  ? 0.7069 0.4143 0.3887 0.0154  0.0375  -0.0237 604 LYS B CG  
1281 C CD  . LYS B 51  ? 0.8649 0.5684 0.5376 0.0089  0.0299  -0.0247 604 LYS B CD  
1282 C CE  . LYS B 51  ? 0.9184 0.6061 0.5741 0.0210  0.0362  -0.0258 604 LYS B CE  
1283 N NZ  . LYS B 51  ? 0.9887 0.6595 0.6213 0.0128  0.0283  -0.0263 604 LYS B NZ  
1284 N N   . HIS B 52  ? 0.6295 0.4257 0.4072 -0.0071 0.0238  -0.0230 605 HIS B N   
1285 C CA  . HIS B 52  ? 0.5712 0.3821 0.3652 -0.0148 0.0194  -0.0212 605 HIS B CA  
1286 C C   . HIS B 52  ? 0.4977 0.3421 0.3274 -0.0123 0.0206  -0.0230 605 HIS B C   
1287 O O   . HIS B 52  ? 0.5128 0.3689 0.3581 -0.0055 0.0262  -0.0247 605 HIS B O   
1288 C CB  . HIS B 52  ? 0.6225 0.4198 0.4061 -0.0119 0.0237  -0.0206 605 HIS B CB  
1289 C CG  . HIS B 52  ? 0.7163 0.5171 0.5042 -0.0220 0.0168  -0.0177 605 HIS B CG  
1290 N ND1 . HIS B 52  ? 0.9000 0.7243 0.7107 -0.0297 0.0100  -0.0156 605 HIS B ND1 
1291 C CD2 . HIS B 52  ? 0.7301 0.5135 0.5027 -0.0248 0.0161  -0.0159 605 HIS B CD2 
1292 C CE1 . HIS B 52  ? 0.5956 0.4185 0.4064 -0.0369 0.0048  -0.0123 605 HIS B CE1 
1293 N NE2 . HIS B 52  ? 0.8025 0.6001 0.5896 -0.0347 0.0077  -0.0128 605 HIS B NE2 
1294 N N   . PRO B 53  ? 0.5389 0.3968 0.3798 -0.0180 0.0156  -0.0222 606 PRO B N   
1295 C CA  . PRO B 53  ? 0.5380 0.4222 0.4074 -0.0151 0.0173  -0.0238 606 PRO B CA  
1296 C C   . PRO B 53  ? 0.4994 0.3974 0.3853 -0.0169 0.0173  -0.0225 606 PRO B C   
1297 O O   . PRO B 53  ? 0.5362 0.4289 0.4161 -0.0241 0.0129  -0.0189 606 PRO B O   
1298 C CB  . PRO B 53  ? 0.4707 0.3607 0.3426 -0.0217 0.0127  -0.0218 606 PRO B CB  
1299 C CG  . PRO B 53  ? 0.5066 0.3736 0.3517 -0.0254 0.0095  -0.0208 606 PRO B CG  
1300 C CD  . PRO B 53  ? 0.4980 0.3460 0.3244 -0.0270 0.0088  -0.0193 606 PRO B CD  
1301 N N   . MET B 54  ? 0.4308 0.3447 0.3357 -0.0110 0.0213  -0.0249 607 MET B N   
1302 C CA  . MET B 54  ? 0.3609 0.2871 0.2803 -0.0124 0.0214  -0.0239 607 MET B CA  
1303 C C   . MET B 54  ? 0.3529 0.2962 0.2912 -0.0086 0.0234  -0.0257 607 MET B C   
1304 O O   . MET B 54  ? 0.3452 0.2898 0.2854 -0.0042 0.0250  -0.0281 607 MET B O   
1305 C CB  . MET B 54  ? 0.3327 0.2510 0.2470 -0.0093 0.0248  -0.0247 607 MET B CB  
1306 C CG  . MET B 54  ? 0.3555 0.2813 0.2793 -0.0120 0.0239  -0.0234 607 MET B CG  
1307 S SD  . MET B 54  ? 0.4652 0.3916 0.3874 -0.0222 0.0161  -0.0179 607 MET B SD  
1308 C CE  . MET B 54  ? 0.4733 0.3717 0.3653 -0.0282 0.0116  -0.0156 607 MET B CE  
1309 N N   . ASP B 55  ? 0.2127 0.1669 0.1627 -0.0106 0.0229  -0.0239 608 ASP B N   
1310 C CA  . ASP B 55  ? 0.2906 0.2570 0.2541 -0.0078 0.0247  -0.0248 608 ASP B CA  
1311 C C   . ASP B 55  ? 0.3573 0.3312 0.3295 -0.0089 0.0249  -0.0228 608 ASP B C   
1312 O O   . ASP B 55  ? 0.3550 0.3259 0.3238 -0.0130 0.0225  -0.0201 608 ASP B O   
1313 C CB  . ASP B 55  ? 0.3251 0.2952 0.2900 -0.0095 0.0240  -0.0226 608 ASP B CB  
1314 C CG  . ASP B 55  ? 0.4033 0.3777 0.3708 -0.0153 0.0216  -0.0168 608 ASP B CG  
1315 O OD1 . ASP B 55  ? 0.3832 0.3678 0.3619 -0.0145 0.0231  -0.0140 608 ASP B OD1 
1316 O OD2 . ASP B 55  ? 0.4845 0.4510 0.4419 -0.0207 0.0177  -0.0145 608 ASP B OD2 
1317 N N   . PHE B 56  ? 0.2805 0.2619 0.2614 -0.0056 0.0271  -0.0235 609 PHE B N   
1318 C CA  . PHE B 56  ? 0.3327 0.3193 0.3201 -0.0053 0.0279  -0.0224 609 PHE B CA  
1319 C C   . PHE B 56  ? 0.3125 0.3055 0.3051 -0.0081 0.0268  -0.0167 609 PHE B C   
1320 O O   . PHE B 56  ? 0.4287 0.4236 0.4240 -0.0100 0.0253  -0.0145 609 PHE B O   
1321 C CB  . PHE B 56  ? 0.3804 0.3690 0.3714 -0.0010 0.0302  -0.0248 609 PHE B CB  
1322 C CG  . PHE B 56  ? 0.2692 0.2549 0.2596 0.0003  0.0301  -0.0283 609 PHE B CG  
1323 C CD1 . PHE B 56  ? 0.4344 0.4186 0.4246 -0.0006 0.0303  -0.0288 609 PHE B CD1 
1324 C CD2 . PHE B 56  ? 0.2616 0.2456 0.2516 0.0023  0.0295  -0.0302 609 PHE B CD2 
1325 C CE1 . PHE B 56  ? 0.2837 0.2678 0.2764 0.0010  0.0312  -0.0305 609 PHE B CE1 
1326 C CE2 . PHE B 56  ? 0.3380 0.3222 0.3310 0.0028  0.0285  -0.0315 609 PHE B CE2 
1327 C CZ  . PHE B 56  ? 0.3914 0.3772 0.3871 0.0024  0.0300  -0.0312 609 PHE B CZ  
1328 N N   . ALA B 57  ? 0.2785 0.2752 0.2730 -0.0087 0.0273  -0.0135 610 ALA B N   
1329 C CA  . ALA B 57  ? 0.3832 0.3896 0.3867 -0.0112 0.0267  -0.0059 610 ALA B CA  
1330 C C   . ALA B 57  ? 0.3136 0.3175 0.3141 -0.0190 0.0201  -0.0020 610 ALA B C   
1331 O O   . ALA B 57  ? 0.3470 0.3572 0.3547 -0.0217 0.0174  0.0035  610 ALA B O   
1332 C CB  . ALA B 57  ? 0.3001 0.3113 0.3070 -0.0100 0.0299  -0.0022 610 ALA B CB  
1333 N N   . THR B 58  ? 0.3397 0.3323 0.3275 -0.0224 0.0172  -0.0046 611 THR B N   
1334 C CA  . THR B 58  ? 0.4096 0.3920 0.3867 -0.0301 0.0105  -0.0018 611 THR B CA  
1335 C C   . THR B 58  ? 0.3658 0.3429 0.3402 -0.0300 0.0095  -0.0034 611 THR B C   
1336 O O   . THR B 58  ? 0.3731 0.3487 0.3467 -0.0362 0.0037  0.0018  611 THR B O   
1337 C CB  . THR B 58  ? 0.4415 0.4083 0.4011 -0.0313 0.0095  -0.0056 611 THR B CB  
1338 O OG1 . THR B 58  ? 0.3825 0.3544 0.3449 -0.0322 0.0099  -0.0035 611 THR B OG1 
1339 C CG2 . THR B 58  ? 0.3463 0.2958 0.2877 -0.0390 0.0029  -0.0030 611 THR B CG2 
1340 N N   . MET B 59  ? 0.3663 0.3409 0.3397 -0.0236 0.0146  -0.0099 612 MET B N   
1341 C CA  . MET B 59  ? 0.3218 0.2912 0.2924 -0.0230 0.0149  -0.0117 612 MET B CA  
1342 C C   . MET B 59  ? 0.3476 0.3283 0.3307 -0.0234 0.0137  -0.0078 612 MET B C   
1343 O O   . MET B 59  ? 0.3638 0.3392 0.3433 -0.0271 0.0100  -0.0057 612 MET B O   
1344 C CB  . MET B 59  ? 0.3950 0.3630 0.3657 -0.0164 0.0208  -0.0181 612 MET B CB  
1345 C CG  . MET B 59  ? 0.3511 0.3069 0.3096 -0.0147 0.0227  -0.0211 612 MET B CG  
1346 S SD  . MET B 59  ? 0.4271 0.3841 0.3897 -0.0079 0.0291  -0.0256 612 MET B SD  
1347 C CE  . MET B 59  ? 0.3430 0.2936 0.3017 -0.0095 0.0299  -0.0254 612 MET B CE  
1348 N N   . ARG B 60  ? 0.3707 0.3648 0.3666 -0.0193 0.0170  -0.0063 613 ARG B N   
1349 C CA  . ARG B 60  ? 0.3232 0.3277 0.3306 -0.0173 0.0176  -0.0022 613 ARG B CA  
1350 C C   . ARG B 60  ? 0.3538 0.3641 0.3672 -0.0238 0.0114  0.0068  613 ARG B C   
1351 O O   . ARG B 60  ? 0.3516 0.3651 0.3700 -0.0250 0.0086  0.0107  613 ARG B O   
1352 C CB  . ARG B 60  ? 0.2915 0.3049 0.3072 -0.0100 0.0242  -0.0023 613 ARG B CB  
1353 C CG  . ARG B 60  ? 0.3550 0.3777 0.3809 -0.0062 0.0265  0.0028  613 ARG B CG  
1354 C CD  . ARG B 60  ? 0.5194 0.5433 0.5461 0.0022  0.0342  0.0016  613 ARG B CD  
1355 N NE  . ARG B 60  ? 0.2136 0.2266 0.2295 0.0042  0.0357  -0.0068 613 ARG B NE  
1356 C CZ  . ARG B 60  ? 0.3224 0.3295 0.3334 0.0059  0.0361  -0.0109 613 ARG B CZ  
1357 N NH1 . ARG B 60  ? 0.2955 0.3047 0.3093 0.0073  0.0362  -0.0083 613 ARG B NH1 
1358 N NH2 . ARG B 60  ? 0.2029 0.2022 0.2064 0.0061  0.0362  -0.0170 613 ARG B NH2 
1359 N N   . LYS B 61  ? 0.4744 0.4861 0.4874 -0.0285 0.0084  0.0108  614 LYS B N   
1360 C CA  . LYS B 61  ? 0.4412 0.4588 0.4604 -0.0368 0.0006  0.0212  614 LYS B CA  
1361 C C   . LYS B 61  ? 0.4579 0.4610 0.4642 -0.0447 -0.0079 0.0220  614 LYS B C   
1362 O O   . LYS B 61  ? 0.3595 0.3679 0.3733 -0.0490 -0.0139 0.0294  614 LYS B O   
1363 C CB  . LYS B 61  ? 0.5544 0.5723 0.5713 -0.0417 -0.0014 0.0244  614 LYS B CB  
1364 C CG  . LYS B 61  ? 0.6271 0.6533 0.6524 -0.0519 -0.0104 0.0371  614 LYS B CG  
1365 C CD  . LYS B 61  ? 0.8469 0.8751 0.8713 -0.0557 -0.0108 0.0402  614 LYS B CD  
1366 C CE  . LYS B 61  ? 0.7346 0.7647 0.7606 -0.0691 -0.0223 0.0520  614 LYS B CE  
1367 N NZ  . LYS B 61  ? 0.8324 0.8521 0.8444 -0.0748 -0.0246 0.0511  614 LYS B NZ  
1368 N N   . ARG B 62  ? 0.4371 0.4201 0.4227 -0.0461 -0.0082 0.0151  615 ARG B N   
1369 C CA  . ARG B 62  ? 0.4142 0.3769 0.3812 -0.0523 -0.0145 0.0147  615 ARG B CA  
1370 C C   . ARG B 62  ? 0.4115 0.3763 0.3835 -0.0483 -0.0125 0.0126  615 ARG B C   
1371 O O   . ARG B 62  ? 0.5772 0.5358 0.5454 -0.0542 -0.0197 0.0172  615 ARG B O   
1372 C CB  . ARG B 62  ? 0.4481 0.3884 0.3916 -0.0510 -0.0116 0.0073  615 ARG B CB  
1373 C CG  . ARG B 62  ? 0.5492 0.4628 0.4677 -0.0576 -0.0176 0.0080  615 ARG B CG  
1374 C CD  . ARG B 62  ? 0.5081 0.3991 0.4028 -0.0543 -0.0125 0.0018  615 ARG B CD  
1375 N NE  . ARG B 62  ? 0.6209 0.4845 0.4908 -0.0563 -0.0135 0.0005  615 ARG B NE  
1376 C CZ  . ARG B 62  ? 0.6869 0.5262 0.5325 -0.0524 -0.0078 -0.0037 615 ARG B CZ  
1377 N NH1 . ARG B 62  ? 0.7036 0.5165 0.5256 -0.0538 -0.0077 -0.0041 615 ARG B NH1 
1378 N NH2 . ARG B 62  ? 0.5362 0.3758 0.3797 -0.0465 -0.0015 -0.0070 615 ARG B NH2 
1379 N N   . LEU B 63  ? 0.4665 0.4392 0.4464 -0.0390 -0.0035 0.0062  616 LEU B N   
1380 C CA  . LEU B 63  ? 0.3625 0.3362 0.3458 -0.0356 -0.0017 0.0043  616 LEU B CA  
1381 C C   . LEU B 63  ? 0.3019 0.2906 0.3014 -0.0371 -0.0061 0.0130  616 LEU B C   
1382 O O   . LEU B 63  ? 0.4310 0.4144 0.4277 -0.0401 -0.0109 0.0153  616 LEU B O   
1383 C CB  . LEU B 63  ? 0.2900 0.2687 0.2778 -0.0268 0.0072  -0.0028 616 LEU B CB  
1384 C CG  . LEU B 63  ? 0.4101 0.3892 0.4000 -0.0233 0.0095  -0.0052 616 LEU B CG  
1385 C CD1 . LEU B 63  ? 0.5286 0.4898 0.5029 -0.0276 0.0067  -0.0072 616 LEU B CD1 
1386 C CD2 . LEU B 63  ? 0.3813 0.3635 0.3736 -0.0164 0.0171  -0.0115 616 LEU B CD2 
1387 N N   . GLU B 64  ? 0.3763 0.3830 0.3924 -0.0347 -0.0042 0.0186  617 GLU B N   
1388 C CA  . GLU B 64  ? 0.5387 0.5620 0.5730 -0.0344 -0.0068 0.0286  617 GLU B CA  
1389 C C   . GLU B 64  ? 0.5467 0.5706 0.5836 -0.0454 -0.0191 0.0394  617 GLU B C   
1390 O O   . GLU B 64  ? 0.6499 0.6873 0.7026 -0.0455 -0.0226 0.0486  617 GLU B O   
1391 C CB  . GLU B 64  ? 0.4987 0.5402 0.5495 -0.0269 0.0009  0.0323  617 GLU B CB  
1392 C CG  . GLU B 64  ? 0.5339 0.5722 0.5806 -0.0165 0.0110  0.0233  617 GLU B CG  
1393 C CD  . GLU B 64  ? 0.4996 0.5491 0.5562 -0.0082 0.0198  0.0259  617 GLU B CD  
1394 O OE1 . GLU B 64  ? 0.5082 0.5689 0.5754 -0.0099 0.0197  0.0338  617 GLU B OE1 
1395 O OE2 . GLU B 64  ? 0.6053 0.6503 0.6570 -0.0002 0.0268  0.0203  617 GLU B OE2 
1396 N N   . ALA B 65  ? 0.5752 0.5833 0.5956 -0.0546 -0.0261 0.0389  618 ALA B N   
1397 C CA  . ALA B 65  ? 0.6311 0.6303 0.6451 -0.0669 -0.0399 0.0476  618 ALA B CA  
1398 C C   . ALA B 65  ? 0.6016 0.5735 0.5904 -0.0698 -0.0433 0.0407  618 ALA B C   
1399 O O   . ALA B 65  ? 0.6649 0.6182 0.6368 -0.0805 -0.0542 0.0449  618 ALA B O   
1400 C CB  . ALA B 65  ? 0.5982 0.5932 0.6059 -0.0769 -0.0472 0.0533  618 ALA B CB  
1401 N N   . GLN B 66  ? 0.6177 0.5856 0.6027 -0.0606 -0.0337 0.0308  619 GLN B N   
1402 C CA  . GLN B 66  ? 0.6481 0.5906 0.6095 -0.0616 -0.0337 0.0236  619 GLN B CA  
1403 C C   . GLN B 66  ? 0.6675 0.5829 0.6017 -0.0700 -0.0395 0.0233  619 GLN B C   
1404 O O   . GLN B 66  ? 0.6614 0.5540 0.5757 -0.0774 -0.0474 0.0253  619 GLN B O   
1405 C CB  . GLN B 66  ? 0.6689 0.6095 0.6323 -0.0640 -0.0398 0.0276  619 GLN B CB  
1406 C CG  . GLN B 66  ? 0.5681 0.5351 0.5581 -0.0568 -0.0364 0.0316  619 GLN B CG  
1407 C CD  . GLN B 66  ? 0.6983 0.6594 0.6855 -0.0550 -0.0377 0.0304  619 GLN B CD  
1408 O OE1 . GLN B 66  ? 0.6220 0.5668 0.5932 -0.0522 -0.0324 0.0211  619 GLN B OE1 
1409 N NE2 . GLN B 66  ? 0.5264 0.5018 0.5302 -0.0563 -0.0443 0.0405  619 GLN B NE2 
1410 N N   . GLY B 67  ? 0.5973 0.5128 0.5284 -0.0687 -0.0356 0.0209  620 GLY B N   
1411 C CA  . GLY B 67  ? 0.6571 0.5452 0.5598 -0.0748 -0.0393 0.0200  620 GLY B CA  
1412 C C   . GLY B 67  ? 0.5855 0.4555 0.4699 -0.0669 -0.0282 0.0098  620 GLY B C   
1413 O O   . GLY B 67  ? 0.5045 0.3540 0.3670 -0.0679 -0.0272 0.0078  620 GLY B O   
1414 N N   . TYR B 68  ? 0.5582 0.4366 0.4524 -0.0585 -0.0197 0.0040  621 TYR B N   
1415 C CA  . TYR B 68  ? 0.6463 0.5072 0.5242 -0.0521 -0.0102 -0.0034 621 TYR B CA  
1416 C C   . TYR B 68  ? 0.7101 0.5489 0.5697 -0.0557 -0.0131 -0.0031 621 TYR B C   
1417 O O   . TYR B 68  ? 0.6798 0.5287 0.5514 -0.0553 -0.0145 -0.0027 621 TYR B O   
1418 C CB  . TYR B 68  ? 0.5702 0.4516 0.4677 -0.0419 0.0006  -0.0093 621 TYR B CB  
1419 C CG  . TYR B 68  ? 0.6128 0.5080 0.5210 -0.0379 0.0044  -0.0106 621 TYR B CG  
1420 C CD1 . TYR B 68  ? 0.4786 0.3594 0.3712 -0.0359 0.0083  -0.0128 621 TYR B CD1 
1421 C CD2 . TYR B 68  ? 0.5152 0.4357 0.4469 -0.0356 0.0045  -0.0094 621 TYR B CD2 
1422 C CE1 . TYR B 68  ? 0.6133 0.5060 0.5151 -0.0324 0.0110  -0.0140 621 TYR B CE1 
1423 C CE2 . TYR B 68  ? 0.3411 0.2716 0.2802 -0.0324 0.0076  -0.0107 621 TYR B CE2 
1424 C CZ  . TYR B 68  ? 0.5807 0.4981 0.5057 -0.0311 0.0103  -0.0131 621 TYR B CZ  
1425 O OH  . TYR B 68  ? 0.4062 0.3334 0.3386 -0.0279 0.0128  -0.0143 621 TYR B OH  
1426 N N   . LYS B 69  ? 0.7234 0.5292 0.5511 -0.0590 -0.0141 -0.0032 622 LYS B N   
1427 C CA  . LYS B 69  ? 0.7335 0.5090 0.5349 -0.0619 -0.0153 -0.0036 622 LYS B CA  
1428 C C   . LYS B 69  ? 0.6141 0.3932 0.4210 -0.0523 -0.0024 -0.0101 622 LYS B C   
1429 O O   . LYS B 69  ? 0.5174 0.2874 0.3183 -0.0539 -0.0036 -0.0106 622 LYS B O   
1430 C CB  . LYS B 69  ? 0.8260 0.5624 0.5885 -0.0651 -0.0159 -0.0028 622 LYS B CB  
1431 C CG  . LYS B 69  ? 0.8862 0.5817 0.6120 -0.0705 -0.0197 -0.0015 622 LYS B CG  
1432 C CD  . LYS B 69  ? 0.8557 0.5095 0.5395 -0.0701 -0.0159 -0.0018 622 LYS B CD  
1433 N N   . ASN B 70  ? 0.5172 0.3095 0.3354 -0.0429 0.0092  -0.0145 623 ASN B N   
1434 C CA  . ASN B 70  ? 0.6136 0.4106 0.4384 -0.0347 0.0211  -0.0192 623 ASN B CA  
1435 C C   . ASN B 70  ? 0.5958 0.4172 0.4428 -0.0262 0.0302  -0.0221 623 ASN B C   
1436 O O   . ASN B 70  ? 0.6124 0.4440 0.4667 -0.0261 0.0281  -0.0212 623 ASN B O   
1437 C CB  . ASN B 70  ? 0.6017 0.3634 0.3945 -0.0328 0.0280  -0.0201 623 ASN B CB  
1438 C CG  . ASN B 70  ? 0.8383 0.5896 0.6199 -0.0257 0.0379  -0.0208 623 ASN B CG  
1439 O OD1 . ASN B 70  ? 1.1003 0.8474 0.8797 -0.0172 0.0509  -0.0225 623 ASN B OD1 
1440 N ND2 . ASN B 70  ? 0.7509 0.5002 0.5274 -0.0285 0.0322  -0.0188 623 ASN B ND2 
1441 N N   . LEU B 71  ? 0.4964 0.3258 0.3531 -0.0199 0.0398  -0.0250 624 LEU B N   
1442 C CA  . LEU B 71  ? 0.5226 0.3759 0.4018 -0.0133 0.0464  -0.0266 624 LEU B CA  
1443 C C   . LEU B 71  ? 0.5815 0.4287 0.4538 -0.0085 0.0517  -0.0259 624 LEU B C   
1444 O O   . LEU B 71  ? 0.5322 0.3984 0.4215 -0.0054 0.0525  -0.0262 624 LEU B O   
1445 C CB  . LEU B 71  ? 0.5465 0.4064 0.4349 -0.0087 0.0553  -0.0282 624 LEU B CB  
1446 C CG  . LEU B 71  ? 0.5047 0.3875 0.4155 -0.0030 0.0611  -0.0284 624 LEU B CG  
1447 C CD1 . LEU B 71  ? 0.4772 0.3816 0.4064 -0.0053 0.0536  -0.0292 624 LEU B CD1 
1448 C CD2 . LEU B 71  ? 0.5647 0.4538 0.4845 -0.0007 0.0681  -0.0285 624 LEU B CD2 
1449 N N   . HIS B 72  ? 0.5675 0.3854 0.4123 -0.0074 0.0558  -0.0247 625 HIS B N   
1450 C CA  . HIS B 72  ? 0.5533 0.3602 0.3866 -0.0012 0.0628  -0.0237 625 HIS B CA  
1451 C C   . HIS B 72  ? 0.4913 0.3032 0.3256 -0.0049 0.0544  -0.0231 625 HIS B C   
1452 O O   . HIS B 72  ? 0.4186 0.2398 0.2608 0.0006  0.0586  -0.0231 625 HIS B O   
1453 C CB  . HIS B 72  ? 0.6563 0.4243 0.4533 0.0004  0.0686  -0.0223 625 HIS B CB  
1454 C CG  . HIS B 72  ? 0.7546 0.5062 0.5348 0.0083  0.0773  -0.0207 625 HIS B CG  
1455 N ND1 . HIS B 72  ? 0.8148 0.5479 0.5736 0.0048  0.0709  -0.0197 625 HIS B ND1 
1456 C CD2 . HIS B 72  ? 0.9127 0.6637 0.6947 0.0200  0.0920  -0.0190 625 HIS B CD2 
1457 C CE1 . HIS B 72  ? 0.9259 0.6454 0.6713 0.0144  0.0816  -0.0183 625 HIS B CE1 
1458 N NE2 . HIS B 72  ? 1.0085 0.7396 0.7690 0.0243  0.0949  -0.0175 625 HIS B NE2 
1459 N N   . GLU B 73  ? 0.4957 0.3027 0.3233 -0.0145 0.0423  -0.0217 626 GLU B N   
1460 C CA  . GLU B 73  ? 0.4470 0.2595 0.2764 -0.0194 0.0338  -0.0200 626 GLU B CA  
1461 C C   . GLU B 73  ? 0.5228 0.3691 0.3839 -0.0164 0.0342  -0.0216 626 GLU B C   
1462 O O   . GLU B 73  ? 0.5166 0.3680 0.3806 -0.0132 0.0359  -0.0220 626 GLU B O   
1463 C CB  . GLU B 73  ? 0.5853 0.3900 0.4063 -0.0311 0.0204  -0.0163 626 GLU B CB  
1464 C CG  . GLU B 73  ? 0.5813 0.3447 0.3624 -0.0369 0.0165  -0.0137 626 GLU B CG  
1465 C CD  . GLU B 73  ? 0.8720 0.6288 0.6461 -0.0505 0.0003  -0.0080 626 GLU B CD  
1466 O OE1 . GLU B 73  ? 0.7804 0.5635 0.5808 -0.0543 -0.0060 -0.0058 626 GLU B OE1 
1467 O OE2 . GLU B 73  ? 0.9307 0.6548 0.6722 -0.0575 -0.0061 -0.0047 626 GLU B OE2 
1468 N N   . PHE B 74  ? 0.5086 0.3748 0.3904 -0.0171 0.0328  -0.0224 627 PHE B N   
1469 C CA  . PHE B 74  ? 0.4618 0.3556 0.3700 -0.0140 0.0337  -0.0240 627 PHE B CA  
1470 C C   . PHE B 74  ? 0.4304 0.3307 0.3456 -0.0061 0.0418  -0.0258 627 PHE B C   
1471 O O   . PHE B 74  ? 0.5401 0.4526 0.4656 -0.0046 0.0407  -0.0262 627 PHE B O   
1472 C CB  . PHE B 74  ? 0.4808 0.3868 0.4027 -0.0145 0.0332  -0.0248 627 PHE B CB  
1473 C CG  . PHE B 74  ? 0.4154 0.3442 0.3589 -0.0117 0.0339  -0.0262 627 PHE B CG  
1474 C CD1 . PHE B 74  ? 0.3079 0.2448 0.2606 -0.0065 0.0398  -0.0281 627 PHE B CD1 
1475 C CD2 . PHE B 74  ? 0.3181 0.2591 0.2718 -0.0143 0.0284  -0.0245 627 PHE B CD2 
1476 C CE1 . PHE B 74  ? 0.4630 0.4161 0.4311 -0.0051 0.0390  -0.0290 627 PHE B CE1 
1477 C CE2 . PHE B 74  ? 0.3794 0.3359 0.3478 -0.0113 0.0296  -0.0257 627 PHE B CE2 
1478 C CZ  . PHE B 74  ? 0.2963 0.2573 0.2701 -0.0073 0.0341  -0.0282 627 PHE B CZ  
1479 N N   . GLU B 75  ? 0.4209 0.3126 0.3305 -0.0011 0.0500  -0.0261 628 GLU B N   
1480 C CA  . GLU B 75  ? 0.4408 0.3412 0.3603 0.0065  0.0577  -0.0259 628 GLU B CA  
1481 C C   . GLU B 75  ? 0.5223 0.4125 0.4302 0.0102  0.0596  -0.0249 628 GLU B C   
1482 O O   . GLU B 75  ? 0.6106 0.5133 0.5311 0.0152  0.0622  -0.0244 628 GLU B O   
1483 C CB  . GLU B 75  ? 0.4911 0.3853 0.4085 0.0119  0.0676  -0.0246 628 GLU B CB  
1484 C CG  . GLU B 75  ? 0.6998 0.5980 0.6231 0.0089  0.0678  -0.0254 628 GLU B CG  
1485 C CD  . GLU B 75  ? 0.8014 0.7010 0.7302 0.0151  0.0788  -0.0230 628 GLU B CD  
1486 O OE1 . GLU B 75  ? 0.7576 0.6361 0.6677 0.0179  0.0862  -0.0218 628 GLU B OE1 
1487 O OE2 . GLU B 75  ? 0.7186 0.6395 0.6698 0.0171  0.0802  -0.0215 628 GLU B OE2 
1488 N N   . GLU B 76  ? 0.5148 0.3803 0.3968 0.0077  0.0580  -0.0242 629 GLU B N   
1489 C CA  . GLU B 76  ? 0.5554 0.4070 0.4213 0.0105  0.0591  -0.0233 629 GLU B CA  
1490 C C   . GLU B 76  ? 0.5389 0.4071 0.4179 0.0070  0.0515  -0.0243 629 GLU B C   
1491 O O   . GLU B 76  ? 0.5193 0.3925 0.4028 0.0123  0.0543  -0.0243 629 GLU B O   
1492 C CB  . GLU B 76  ? 0.5573 0.3755 0.3890 0.0061  0.0567  -0.0220 629 GLU B CB  
1493 C CG  . GLU B 76  ? 0.7362 0.5327 0.5437 0.0085  0.0578  -0.0210 629 GLU B CG  
1494 C CD  . GLU B 76  ? 0.6801 0.4364 0.4472 0.0044  0.0562  -0.0192 629 GLU B CD  
1495 O OE1 . GLU B 76  ? 0.8293 0.5629 0.5712 0.0053  0.0560  -0.0182 629 GLU B OE1 
1496 O OE2 . GLU B 76  ? 0.7082 0.4534 0.4667 0.0001  0.0547  -0.0187 629 GLU B OE2 
1497 N N   . ASP B 77  ? 0.5394 0.4162 0.4252 -0.0012 0.0427  -0.0244 630 ASP B N   
1498 C CA  . ASP B 77  ? 0.5903 0.4849 0.4911 -0.0038 0.0371  -0.0247 630 ASP B CA  
1499 C C   . ASP B 77  ? 0.5600 0.4755 0.4830 0.0017  0.0404  -0.0265 630 ASP B C   
1500 O O   . ASP B 77  ? 0.4933 0.4148 0.4205 0.0027  0.0387  -0.0270 630 ASP B O   
1501 C CB  . ASP B 77  ? 0.5247 0.4284 0.4335 -0.0117 0.0294  -0.0231 630 ASP B CB  
1502 C CG  . ASP B 77  ? 0.4352 0.3234 0.3263 -0.0197 0.0222  -0.0197 630 ASP B CG  
1503 O OD1 . ASP B 77  ? 0.5525 0.4240 0.4253 -0.0193 0.0227  -0.0196 630 ASP B OD1 
1504 O OD2 . ASP B 77  ? 0.4766 0.3692 0.3720 -0.0266 0.0156  -0.0165 630 ASP B OD2 
1505 N N   . PHE B 78  ? 0.4779 0.4031 0.4137 0.0044  0.0441  -0.0271 631 PHE B N   
1506 C CA  . PHE B 78  ? 0.3646 0.3079 0.3199 0.0078  0.0451  -0.0277 631 PHE B CA  
1507 C C   . PHE B 78  ? 0.4519 0.3931 0.4066 0.0146  0.0502  -0.0265 631 PHE B C   
1508 O O   . PHE B 78  ? 0.4892 0.4407 0.4543 0.0165  0.0484  -0.0266 631 PHE B O   
1509 C CB  . PHE B 78  ? 0.3494 0.3025 0.3171 0.0076  0.0467  -0.0279 631 PHE B CB  
1510 C CG  . PHE B 78  ? 0.2700 0.2389 0.2553 0.0095  0.0461  -0.0276 631 PHE B CG  
1511 C CD1 . PHE B 78  ? 0.2782 0.2552 0.2700 0.0070  0.0407  -0.0288 631 PHE B CD1 
1512 C CD2 . PHE B 78  ? 0.4058 0.3802 0.4002 0.0136  0.0510  -0.0251 631 PHE B CD2 
1513 C CE1 . PHE B 78  ? 0.4032 0.3898 0.4065 0.0075  0.0387  -0.0282 631 PHE B CE1 
1514 C CE2 . PHE B 78  ? 0.3703 0.3585 0.3805 0.0135  0.0485  -0.0235 631 PHE B CE2 
1515 C CZ  . PHE B 78  ? 0.3794 0.3722 0.3925 0.0100  0.0416  -0.0253 631 PHE B CZ  
1516 N N   . ASP B 79  ? 0.4643 0.3908 0.4056 0.0189  0.0567  -0.0249 632 ASP B N   
1517 C CA  . ASP B 79  ? 0.4778 0.4008 0.4171 0.0270  0.0627  -0.0227 632 ASP B CA  
1518 C C   . ASP B 79  ? 0.4707 0.3870 0.3996 0.0261  0.0582  -0.0240 632 ASP B C   
1519 O O   . ASP B 79  ? 0.4402 0.3619 0.3752 0.0313  0.0596  -0.0228 632 ASP B O   
1520 C CB  . ASP B 79  ? 0.5278 0.4312 0.4495 0.0328  0.0723  -0.0203 632 ASP B CB  
1521 C CG  . ASP B 79  ? 0.7440 0.6577 0.6805 0.0367  0.0795  -0.0175 632 ASP B CG  
1522 O OD1 . ASP B 79  ? 0.8439 0.7767 0.8006 0.0324  0.0753  -0.0182 632 ASP B OD1 
1523 O OD2 . ASP B 79  ? 0.8082 0.7090 0.7345 0.0441  0.0900  -0.0142 632 ASP B OD2 
1524 N N   . LEU B 80  ? 0.4775 0.3830 0.3918 0.0190  0.0523  -0.0256 633 LEU B N   
1525 C CA  . LEU B 80  ? 0.4801 0.3794 0.3845 0.0171  0.0478  -0.0264 633 LEU B CA  
1526 C C   . LEU B 80  ? 0.4726 0.3911 0.3963 0.0170  0.0440  -0.0276 633 LEU B C   
1527 O O   . LEU B 80  ? 0.5256 0.4433 0.4480 0.0208  0.0442  -0.0277 633 LEU B O   
1528 C CB  . LEU B 80  ? 0.4445 0.3310 0.3324 0.0081  0.0412  -0.0262 633 LEU B CB  
1529 C CG  . LEU B 80  ? 0.6063 0.4640 0.4647 0.0075  0.0430  -0.0246 633 LEU B CG  
1530 C CD1 . LEU B 80  ? 0.5214 0.3693 0.3670 -0.0040 0.0337  -0.0230 633 LEU B CD1 
1531 C CD2 . LEU B 80  ? 0.4055 0.2453 0.2448 0.0145  0.0478  -0.0243 633 LEU B CD2 
1532 N N   . ILE B 81  ? 0.4543 0.3880 0.3939 0.0131  0.0409  -0.0284 634 ILE B N   
1533 C CA  . ILE B 81  ? 0.3864 0.3340 0.3402 0.0126  0.0372  -0.0296 634 ILE B CA  
1534 C C   . ILE B 81  ? 0.4008 0.3549 0.3645 0.0189  0.0393  -0.0284 634 ILE B C   
1535 O O   . ILE B 81  ? 0.4521 0.4066 0.4158 0.0204  0.0369  -0.0289 634 ILE B O   
1536 C CB  . ILE B 81  ? 0.4085 0.3673 0.3741 0.0086  0.0348  -0.0301 634 ILE B CB  
1537 C CG1 . ILE B 81  ? 0.5147 0.4694 0.4730 0.0027  0.0321  -0.0295 634 ILE B CG1 
1538 C CG2 . ILE B 81  ? 0.4520 0.4200 0.4274 0.0086  0.0317  -0.0310 634 ILE B CG2 
1539 C CD1 . ILE B 81  ? 0.3754 0.3378 0.3423 0.0002  0.0314  -0.0291 634 ILE B CD1 
1540 N N   . ILE B 82  ? 0.4013 0.3603 0.3735 0.0227  0.0439  -0.0262 635 ILE B N   
1541 C CA  . ILE B 82  ? 0.3692 0.3385 0.3558 0.0280  0.0453  -0.0230 635 ILE B CA  
1542 C C   . ILE B 82  ? 0.4147 0.3744 0.3912 0.0346  0.0488  -0.0215 635 ILE B C   
1543 O O   . ILE B 82  ? 0.3796 0.3430 0.3607 0.0367  0.0456  -0.0207 635 ILE B O   
1544 C CB  . ILE B 82  ? 0.3983 0.3751 0.3963 0.0306  0.0509  -0.0194 635 ILE B CB  
1545 C CG1 . ILE B 82  ? 0.4465 0.4302 0.4515 0.0242  0.0476  -0.0211 635 ILE B CG1 
1546 C CG2 . ILE B 82  ? 0.4390 0.4286 0.4547 0.0362  0.0525  -0.0137 635 ILE B CG2 
1547 C CD1 . ILE B 82  ? 0.3210 0.3125 0.3334 0.0191  0.0396  -0.0227 635 ILE B CD1 
1548 N N   . ASP B 83  ? 0.5032 0.4475 0.4631 0.0377  0.0551  -0.0210 636 ASP B N   
1549 C CA  . ASP B 83  ? 0.5369 0.4679 0.4833 0.0458  0.0607  -0.0189 636 ASP B CA  
1550 C C   . ASP B 83  ? 0.5435 0.4648 0.4760 0.0436  0.0551  -0.0218 636 ASP B C   
1551 O O   . ASP B 83  ? 0.5194 0.4405 0.4527 0.0497  0.0558  -0.0201 636 ASP B O   
1552 C CB  . ASP B 83  ? 0.5439 0.4547 0.4695 0.0489  0.0687  -0.0179 636 ASP B CB  
1553 C CG  . ASP B 83  ? 0.6844 0.6038 0.6234 0.0528  0.0763  -0.0142 636 ASP B CG  
1554 O OD1 . ASP B 83  ? 0.5479 0.4862 0.5101 0.0577  0.0786  -0.0098 636 ASP B OD1 
1555 O OD2 . ASP B 83  ? 0.6883 0.5955 0.6147 0.0505  0.0794  -0.0150 636 ASP B OD2 
1556 N N   . ASN B 84  ? 0.4344 0.3486 0.3555 0.0350  0.0495  -0.0254 637 ASN B N   
1557 C CA  . ASN B 84  ? 0.4892 0.3967 0.3998 0.0318  0.0440  -0.0277 637 ASN B CA  
1558 C C   . ASN B 84  ? 0.4987 0.4205 0.4259 0.0337  0.0403  -0.0278 637 ASN B C   
1559 O O   . ASN B 84  ? 0.4176 0.3330 0.3379 0.0378  0.0398  -0.0277 637 ASN B O   
1560 C CB  . ASN B 84  ? 0.4371 0.3428 0.3420 0.0216  0.0381  -0.0298 637 ASN B CB  
1561 C CG  . ASN B 84  ? 0.3432 0.2303 0.2267 0.0177  0.0387  -0.0289 637 ASN B CG  
1562 O OD1 . ASN B 84  ? 0.4968 0.3678 0.3647 0.0231  0.0440  -0.0276 637 ASN B OD1 
1563 N ND2 . ASN B 84  ? 0.4328 0.3211 0.3151 0.0084  0.0332  -0.0288 637 ASN B ND2 
1564 N N   . CYS B 85  ? 0.5061 0.4445 0.4527 0.0306  0.0374  -0.0279 638 CYS B N   
1565 C CA  . CYS B 85  ? 0.4579 0.4064 0.4170 0.0304  0.0321  -0.0279 638 CYS B CA  
1566 C C   . CYS B 85  ? 0.4539 0.4082 0.4234 0.0381  0.0337  -0.0236 638 CYS B C   
1567 O O   . CYS B 85  ? 0.4825 0.4380 0.4546 0.0391  0.0290  -0.0232 638 CYS B O   
1568 C CB  . CYS B 85  ? 0.4847 0.4452 0.4577 0.0252  0.0287  -0.0284 638 CYS B CB  
1569 S SG  . CYS B 85  ? 0.4725 0.4379 0.4533 0.0231  0.0209  -0.0285 638 CYS B SG  
1570 N N   . MET B 86  ? 0.5738 0.5313 0.5491 0.0439  0.0407  -0.0196 639 MET B N   
1571 C CA  . MET B 86  ? 0.5333 0.4983 0.5209 0.0527  0.0439  -0.0135 639 MET B CA  
1572 C C   . MET B 86  ? 0.5826 0.5313 0.5517 0.0607  0.0487  -0.0129 639 MET B C   
1573 O O   . MET B 86  ? 0.5540 0.5076 0.5315 0.0683  0.0498  -0.0081 639 MET B O   
1574 C CB  . MET B 86  ? 0.4642 0.4398 0.4664 0.0565  0.0512  -0.0082 639 MET B CB  
1575 C CG  . MET B 86  ? 0.5128 0.5030 0.5315 0.0487  0.0464  -0.0083 639 MET B CG  
1576 S SD  . MET B 86  ? 0.5303 0.5366 0.5708 0.0525  0.0537  -0.0005 639 MET B SD  
1577 C CE  . MET B 86  ? 0.4512 0.4693 0.5091 0.0627  0.0563  0.0091  639 MET B CE  
1578 N N   . LYS B 87  ? 0.5237 0.4525 0.4674 0.0586  0.0509  -0.0172 640 LYS B N   
1579 C CA  . LYS B 87  ? 0.6402 0.5483 0.5600 0.0644  0.0542  -0.0176 640 LYS B CA  
1580 C C   . LYS B 87  ? 0.5312 0.4350 0.4439 0.0606  0.0460  -0.0211 640 LYS B C   
1581 O O   . LYS B 87  ? 0.5914 0.4888 0.4982 0.0675  0.0468  -0.0194 640 LYS B O   
1582 C CB  . LYS B 87  ? 0.6971 0.5821 0.5888 0.0616  0.0579  -0.0201 640 LYS B CB  
1583 C CG  . LYS B 87  ? 0.7558 0.6315 0.6404 0.0696  0.0688  -0.0161 640 LYS B CG  
1584 C CD  . LYS B 87  ? 0.8757 0.7331 0.7385 0.0625  0.0692  -0.0187 640 LYS B CD  
1585 C CE  . LYS B 87  ? 0.9953 0.8201 0.8200 0.0611  0.0687  -0.0203 640 LYS B CE  
1586 N NZ  . LYS B 87  ? 0.8590 0.6642 0.6620 0.0543  0.0686  -0.0210 640 LYS B NZ  
1587 N N   . TYR B 88  ? 0.4964 0.4026 0.4088 0.0502  0.0390  -0.0256 641 TYR B N   
1588 C CA  . TYR B 88  ? 0.4588 0.3590 0.3627 0.0465  0.0325  -0.0288 641 TYR B CA  
1589 C C   . TYR B 88  ? 0.5070 0.4188 0.4272 0.0486  0.0272  -0.0274 641 TYR B C   
1590 O O   . TYR B 88  ? 0.5217 0.4247 0.4323 0.0509  0.0244  -0.0282 641 TYR B O   
1591 C CB  . TYR B 88  ? 0.4741 0.3738 0.3738 0.0359  0.0282  -0.0326 641 TYR B CB  
1592 C CG  . TYR B 88  ? 0.5768 0.4689 0.4661 0.0321  0.0230  -0.0355 641 TYR B CG  
1593 C CD1 . TYR B 88  ? 0.5090 0.4097 0.4094 0.0292  0.0180  -0.0367 641 TYR B CD1 
1594 C CD2 . TYR B 88  ? 0.4894 0.3629 0.3551 0.0312  0.0231  -0.0367 641 TYR B CD2 
1595 C CE1 . TYR B 88  ? 0.5329 0.4245 0.4219 0.0261  0.0142  -0.0392 641 TYR B CE1 
1596 C CE2 . TYR B 88  ? 0.5975 0.4636 0.4531 0.0275  0.0188  -0.0391 641 TYR B CE2 
1597 C CZ  . TYR B 88  ? 0.4847 0.3602 0.3525 0.0253  0.0148  -0.0404 641 TYR B CZ  
1598 O OH  . TYR B 88  ? 0.5574 0.4231 0.4131 0.0218  0.0115  -0.0428 641 TYR B OH  
1599 N N   . ASN B 89  ? 0.5103 0.4397 0.4530 0.0470  0.0247  -0.0251 642 ASN B N   
1600 C CA  . ASN B 89  ? 0.5480 0.4861 0.5041 0.0462  0.0170  -0.0234 642 ASN B CA  
1601 C C   . ASN B 89  ? 0.4734 0.4236 0.4476 0.0546  0.0188  -0.0159 642 ASN B C   
1602 O O   . ASN B 89  ? 0.4922 0.4476 0.4724 0.0596  0.0265  -0.0124 642 ASN B O   
1603 C CB  . ASN B 89  ? 0.4567 0.4038 0.4235 0.0380  0.0119  -0.0247 642 ASN B CB  
1604 C CG  . ASN B 89  ? 0.4710 0.4094 0.4237 0.0311  0.0122  -0.0304 642 ASN B CG  
1605 O OD1 . ASN B 89  ? 0.6845 0.6139 0.6264 0.0278  0.0085  -0.0334 642 ASN B OD1 
1606 N ND2 . ASN B 89  ? 0.4382 0.3801 0.3923 0.0289  0.0167  -0.0309 642 ASN B ND2 
1607 N N   . ALA B 90  ? 0.6009 0.5557 0.5842 0.0562  0.0118  -0.0124 643 ALA B N   
1608 C CA  . ALA B 90  ? 0.5988 0.5679 0.6027 0.0646  0.0132  -0.0031 643 ALA B CA  
1609 C C   . ALA B 90  ? 0.6436 0.6340 0.6748 0.0606  0.0091  0.0031  643 ALA B C   
1610 O O   . ALA B 90  ? 0.7053 0.6964 0.7367 0.0510  0.0035  -0.0003 643 ALA B O   
1611 C CB  . ALA B 90  ? 0.6666 0.6313 0.6687 0.0680  0.0063  -0.0009 643 ALA B CB  
1612 N N   . ARG B 91  ? 0.6632 0.6703 0.7169 0.0680  0.0123  0.0132  644 ARG B N   
1613 C CA  . ARG B 91  ? 0.6828 0.7116 0.7644 0.0636  0.0080  0.0212  644 ARG B CA  
1614 C C   . ARG B 91  ? 0.6628 0.6934 0.7497 0.0523  -0.0080 0.0215  644 ARG B C   
1615 O O   . ARG B 91  ? 0.5167 0.5564 0.6150 0.0441  -0.0133 0.0238  644 ARG B O   
1616 C CB  . ARG B 91  ? 0.7394 0.7878 0.8473 0.0740  0.0132  0.0344  644 ARG B CB  
1617 C CG  . ARG B 91  ? 0.8359 0.8896 0.9485 0.0830  0.0295  0.0380  644 ARG B CG  
1618 C CD  . ARG B 91  ? 0.6852 0.7639 0.8310 0.0917  0.0340  0.0536  644 ARG B CD  
1619 N N   . ASP B 92  ? 0.6673 0.6863 0.7428 0.0518  -0.0158 0.0193  645 ASP B N   
1620 C CA  . ASP B 92  ? 0.6493 0.6659 0.7269 0.0424  -0.0317 0.0211  645 ASP B CA  
1621 C C   . ASP B 92  ? 0.7021 0.7014 0.7582 0.0320  -0.0361 0.0114  645 ASP B C   
1622 O O   . ASP B 92  ? 0.7696 0.7637 0.8242 0.0232  -0.0485 0.0128  645 ASP B O   
1623 C CB  . ASP B 92  ? 0.5739 0.5821 0.6453 0.0464  -0.0380 0.0226  645 ASP B CB  
1624 N N   . THR B 93  ? 0.6424 0.6322 0.6818 0.0330  -0.0262 0.0026  646 THR B N   
1625 C CA  . THR B 93  ? 0.5797 0.5526 0.5980 0.0255  -0.0284 -0.0059 646 THR B CA  
1626 C C   . THR B 93  ? 0.5449 0.5218 0.5665 0.0191  -0.0277 -0.0070 646 THR B C   
1627 O O   . THR B 93  ? 0.5320 0.5245 0.5710 0.0199  -0.0245 -0.0023 646 THR B O   
1628 C CB  . THR B 93  ? 0.5781 0.5376 0.5756 0.0289  -0.0195 -0.0141 646 THR B CB  
1629 O OG1 . THR B 93  ? 0.4157 0.3822 0.4165 0.0317  -0.0092 -0.0151 646 THR B OG1 
1630 C CG2 . THR B 93  ? 0.5872 0.5407 0.5785 0.0358  -0.0190 -0.0134 646 THR B CG2 
1631 N N   . VAL B 94  ? 0.5402 0.5010 0.5430 0.0134  -0.0301 -0.0132 647 VAL B N   
1632 C CA  . VAL B 94  ? 0.5995 0.5581 0.5990 0.0076  -0.0301 -0.0150 647 VAL B CA  
1633 C C   . VAL B 94  ? 0.5574 0.5215 0.5570 0.0104  -0.0186 -0.0188 647 VAL B C   
1634 O O   . VAL B 94  ? 0.6016 0.5728 0.6083 0.0081  -0.0168 -0.0177 647 VAL B O   
1635 C CB  . VAL B 94  ? 0.6059 0.5419 0.5818 0.0027  -0.0346 -0.0198 647 VAL B CB  
1636 C CG1 . VAL B 94  ? 0.4640 0.3948 0.4316 -0.0002 -0.0302 -0.0231 647 VAL B CG1 
1637 C CG2 . VAL B 94  ? 0.7122 0.6392 0.6854 -0.0026 -0.0483 -0.0153 647 VAL B CG2 
1638 N N   . PHE B 95  ? 0.5095 0.4686 0.4994 0.0147  -0.0117 -0.0230 648 PHE B N   
1639 C CA  . PHE B 95  ? 0.4354 0.3984 0.4246 0.0167  -0.0024 -0.0255 648 PHE B CA  
1640 C C   . PHE B 95  ? 0.4526 0.4297 0.4577 0.0210  0.0022  -0.0209 648 PHE B C   
1641 O O   . PHE B 95  ? 0.3777 0.3600 0.3868 0.0201  0.0070  -0.0213 648 PHE B O   
1642 C CB  . PHE B 95  ? 0.5467 0.4998 0.5210 0.0190  0.0018  -0.0294 648 PHE B CB  
1643 C CG  . PHE B 95  ? 0.5488 0.4901 0.5082 0.0150  0.0012  -0.0336 648 PHE B CG  
1644 C CD1 . PHE B 95  ? 0.5062 0.4482 0.4646 0.0118  0.0038  -0.0349 648 PHE B CD1 
1645 C CD2 . PHE B 95  ? 0.5313 0.4605 0.4773 0.0154  -0.0007 -0.0357 648 PHE B CD2 
1646 C CE1 . PHE B 95  ? 0.4990 0.4312 0.4451 0.0097  0.0053  -0.0373 648 PHE B CE1 
1647 C CE2 . PHE B 95  ? 0.5860 0.5046 0.5188 0.0124  0.0004  -0.0387 648 PHE B CE2 
1648 C CZ  . PHE B 95  ? 0.7264 0.6470 0.6599 0.0099  0.0039  -0.0390 648 PHE B CZ  
1649 N N   . TYR B 96  ? 0.4920 0.4751 0.5068 0.0260  0.0012  -0.0160 649 TYR B N   
1650 C CA  . TYR B 96  ? 0.4435 0.4395 0.4734 0.0316  0.0077  -0.0106 649 TYR B CA  
1651 C C   . TYR B 96  ? 0.4955 0.5045 0.5423 0.0268  0.0048  -0.0062 649 TYR B C   
1652 O O   . TYR B 96  ? 0.4813 0.4962 0.5333 0.0277  0.0115  -0.0056 649 TYR B O   
1653 C CB  . TYR B 96  ? 0.4963 0.4967 0.5341 0.0390  0.0079  -0.0048 649 TYR B CB  
1654 C CG  . TYR B 96  ? 0.3871 0.3992 0.4394 0.0472  0.0170  0.0019  649 TYR B CG  
1655 C CD1 . TYR B 96  ? 0.5642 0.5955 0.6418 0.0469  0.0149  0.0108  649 TYR B CD1 
1656 C CD2 . TYR B 96  ? 0.4710 0.4735 0.5103 0.0553  0.0277  0.0006  649 TYR B CD2 
1657 C CE1 . TYR B 96  ? 0.3890 0.4318 0.4811 0.0556  0.0250  0.0184  649 TYR B CE1 
1658 C CE2 . TYR B 96  ? 0.5898 0.5997 0.6392 0.0643  0.0378  0.0073  649 TYR B CE2 
1659 C CZ  . TYR B 96  ? 0.5224 0.5536 0.5996 0.0650  0.0372  0.0164  649 TYR B CZ  
1660 O OH  . TYR B 96  ? 0.4042 0.4436 0.4929 0.0748  0.0489  0.0244  649 TYR B OH  
1661 N N   . ARG B 97  ? 0.5137 0.5240 0.5655 0.0207  -0.0059 -0.0037 650 ARG B N   
1662 C CA  . ARG B 97  ? 0.5201 0.5403 0.5853 0.0145  -0.0106 0.0008  650 ARG B CA  
1663 C C   . ARG B 97  ? 0.4473 0.4620 0.5030 0.0102  -0.0072 -0.0046 650 ARG B C   
1664 O O   . ARG B 97  ? 0.4021 0.4267 0.4692 0.0083  -0.0054 -0.0013 650 ARG B O   
1665 C CB  . ARG B 97  ? 0.5698 0.5876 0.6375 0.0077  -0.0247 0.0051  650 ARG B CB  
1666 C CG  . ARG B 97  ? 0.6335 0.6630 0.7186 0.0119  -0.0288 0.0138  650 ARG B CG  
1667 C CD  . ARG B 97  ? 0.7876 0.8171 0.8790 0.0037  -0.0448 0.0207  650 ARG B CD  
1668 N NE  . ARG B 97  ? 0.8034 0.8156 0.8775 0.0031  -0.0518 0.0170  650 ARG B NE  
1669 C CZ  . ARG B 97  ? 1.0322 1.0222 1.0828 -0.0038 -0.0590 0.0112  650 ARG B CZ  
1670 N NH1 . ARG B 97  ? 1.0700 1.0441 1.1051 -0.0034 -0.0643 0.0084  650 ARG B NH1 
1671 N NH2 . ARG B 97  ? 0.9350 0.9169 0.9758 -0.0106 -0.0604 0.0085  650 ARG B NH2 
1672 N N   . ALA B 98  ? 0.3436 0.3434 0.3795 0.0092  -0.0058 -0.0122 651 ALA B N   
1673 C CA  . ALA B 98  ? 0.3728 0.3670 0.3995 0.0061  -0.0027 -0.0168 651 ALA B CA  
1674 C C   . ALA B 98  ? 0.3287 0.3300 0.3602 0.0097  0.0068  -0.0174 651 ALA B C   
1675 O O   . ALA B 98  ? 0.4482 0.4525 0.4824 0.0073  0.0086  -0.0174 651 ALA B O   
1676 C CB  . ALA B 98  ? 0.3272 0.3060 0.3342 0.0055  -0.0020 -0.0229 651 ALA B CB  
1677 N N   . ALA B 99  ? 0.4145 0.4155 0.4443 0.0156  0.0125  -0.0177 652 ALA B N   
1678 C CA  . ALA B 99  ? 0.3608 0.3633 0.3905 0.0194  0.0213  -0.0178 652 ALA B CA  
1679 C C   . ALA B 99  ? 0.4135 0.4291 0.4606 0.0209  0.0241  -0.0118 652 ALA B C   
1680 O O   . ALA B 99  ? 0.4069 0.4239 0.4547 0.0200  0.0287  -0.0123 652 ALA B O   
1681 C CB  . ALA B 99  ? 0.4165 0.4118 0.4369 0.0254  0.0260  -0.0186 652 ALA B CB  
1682 N N   . VAL B 100 ? 0.3120 0.3376 0.3739 0.0228  0.0209  -0.0054 653 VAL B N   
1683 C CA  . VAL B 100 ? 0.3571 0.3981 0.4392 0.0237  0.0229  0.0022  653 VAL B CA  
1684 C C   . VAL B 100 ? 0.3268 0.3724 0.4144 0.0154  0.0182  0.0028  653 VAL B C   
1685 O O   . VAL B 100 ? 0.2967 0.3487 0.3916 0.0160  0.0241  0.0053  653 VAL B O   
1686 C CB  . VAL B 100 ? 0.3754 0.4287 0.4754 0.0262  0.0183  0.0109  653 VAL B CB  
1687 C CG1 . VAL B 100 ? 0.2496 0.3212 0.3735 0.0232  0.0163  0.0203  653 VAL B CG1 
1688 C CG2 . VAL B 100 ? 0.3463 0.3981 0.4448 0.0371  0.0273  0.0128  653 VAL B CG2 
1689 N N   . ARG B 101 ? 0.3824 0.4224 0.4641 0.0080  0.0078  0.0009  654 ARG B N   
1690 C CA  . ARG B 101 ? 0.4110 0.4501 0.4918 0.0003  0.0033  0.0007  654 ARG B CA  
1691 C C   . ARG B 101 ? 0.4182 0.4500 0.4871 0.0011  0.0108  -0.0057 654 ARG B C   
1692 O O   . ARG B 101 ? 0.4716 0.5063 0.5436 -0.0021 0.0119  -0.0048 654 ARG B O   
1693 C CB  . ARG B 101 ? 0.5005 0.5274 0.5691 -0.0066 -0.0080 -0.0011 654 ARG B CB  
1694 C CG  . ARG B 101 ? 0.6270 0.6593 0.7066 -0.0105 -0.0189 0.0064  654 ARG B CG  
1695 C CD  . ARG B 101 ? 0.7455 0.7597 0.8071 -0.0181 -0.0305 0.0046  654 ARG B CD  
1696 N NE  . ARG B 101 ? 0.9319 0.9342 0.9807 -0.0150 -0.0322 0.0007  654 ARG B NE  
1697 C CZ  . ARG B 101 ? 0.4942 0.4792 0.5212 -0.0134 -0.0290 -0.0072 654 ARG B CZ  
1698 N NH1 . ARG B 101 ? 0.7352 0.7129 0.7509 -0.0139 -0.0238 -0.0119 654 ARG B NH1 
1699 N NH2 . ARG B 101 ? 0.7492 0.7247 0.7665 -0.0110 -0.0307 -0.0096 654 ARG B NH2 
1700 N N   . LEU B 102 ? 0.3710 0.3933 0.4263 0.0050  0.0153  -0.0116 655 LEU B N   
1701 C CA  . LEU B 102 ? 0.3584 0.3735 0.4024 0.0047  0.0203  -0.0169 655 LEU B CA  
1702 C C   . LEU B 102 ? 0.3954 0.4151 0.4447 0.0085  0.0288  -0.0151 655 LEU B C   
1703 O O   . LEU B 102 ? 0.3675 0.3852 0.4136 0.0067  0.0316  -0.0168 655 LEU B O   
1704 C CB  . LEU B 102 ? 0.1950 0.1998 0.2244 0.0063  0.0212  -0.0220 655 LEU B CB  
1705 C CG  . LEU B 102 ? 0.5865 0.5857 0.6064 0.0060  0.0257  -0.0257 655 LEU B CG  
1706 C CD1 . LEU B 102 ? 0.3304 0.3287 0.3491 0.0022  0.0237  -0.0266 655 LEU B CD1 
1707 C CD2 . LEU B 102 ? 0.3214 0.3128 0.3297 0.0067  0.0260  -0.0288 655 LEU B CD2 
1708 N N   . ARG B 103 ? 0.4738 0.4979 0.5297 0.0143  0.0333  -0.0114 656 ARG B N   
1709 C CA  . ARG B 103 ? 0.5097 0.5364 0.5699 0.0191  0.0428  -0.0082 656 ARG B CA  
1710 C C   . ARG B 103 ? 0.4728 0.5116 0.5490 0.0160  0.0429  -0.0029 656 ARG B C   
1711 O O   . ARG B 103 ? 0.4371 0.4733 0.5102 0.0153  0.0479  -0.0038 656 ARG B O   
1712 C CB  . ARG B 103 ? 0.5049 0.5328 0.5684 0.0274  0.0485  -0.0040 656 ARG B CB  
1713 C CG  . ARG B 103 ? 0.6125 0.6410 0.6792 0.0343  0.0603  0.0006  656 ARG B CG  
1714 C CD  . ARG B 103 ? 0.5666 0.6066 0.6496 0.0422  0.0648  0.0093  656 ARG B CD  
1715 N NE  . ARG B 103 ? 0.8681 0.8939 0.9355 0.0516  0.0732  0.0089  656 ARG B NE  
1716 C CZ  . ARG B 103 ? 0.8725 0.9033 0.9480 0.0608  0.0782  0.0156  656 ARG B CZ  
1717 N NH1 . ARG B 103 ? 0.8663 0.9191 0.9692 0.0614  0.0750  0.0243  656 ARG B NH1 
1718 N NH2 . ARG B 103 ? 0.7918 0.8046 0.8473 0.0692  0.0861  0.0143  656 ARG B NH2 
1719 N N   . ASP B 104 ? 0.5452 0.5966 0.6377 0.0134  0.0364  0.0031  657 ASP B N   
1720 C CA  . ASP B 104 ? 0.5744 0.6389 0.6839 0.0091  0.0350  0.0099  657 ASP B CA  
1721 C C   . ASP B 104 ? 0.6028 0.6604 0.7027 0.0016  0.0316  0.0052  657 ASP B C   
1722 O O   . ASP B 104 ? 0.6295 0.6896 0.7327 0.0009  0.0369  0.0068  657 ASP B O   
1723 C CB  . ASP B 104 ? 0.5380 0.6147 0.6640 0.0048  0.0247  0.0174  657 ASP B CB  
1724 C CG  . ASP B 104 ? 0.6264 0.7140 0.7672 0.0129  0.0286  0.0246  657 ASP B CG  
1725 O OD1 . ASP B 104 ? 0.5223 0.6092 0.6625 0.0223  0.0411  0.0254  657 ASP B OD1 
1726 O OD2 . ASP B 104 ? 0.6235 0.7183 0.7747 0.0102  0.0189  0.0298  657 ASP B OD2 
1727 N N   . GLN B 105 ? 0.5846 0.6318 0.6709 -0.0030 0.0235  -0.0003 658 GLN B N   
1728 C CA  . GLN B 105 ? 0.5102 0.5488 0.5853 -0.0088 0.0203  -0.0044 658 GLN B CA  
1729 C C   . GLN B 105 ? 0.4414 0.4713 0.5041 -0.0057 0.0281  -0.0104 658 GLN B C   
1730 O O   . GLN B 105 ? 0.5078 0.5332 0.5647 -0.0092 0.0279  -0.0124 658 GLN B O   
1731 C CB  . GLN B 105 ? 0.5690 0.5966 0.6311 -0.0131 0.0111  -0.0077 658 GLN B CB  
1732 C CG  . GLN B 105 ? 0.4946 0.5258 0.5640 -0.0188 0.0006  -0.0017 658 GLN B CG  
1733 C CD  . GLN B 105 ? 0.4240 0.4386 0.4749 -0.0217 -0.0070 -0.0055 658 GLN B CD  
1734 O OE1 . GLN B 105 ? 0.6522 0.6620 0.6972 -0.0176 -0.0062 -0.0086 658 GLN B OE1 
1735 N NE2 . GLN B 105 ? 0.5114 0.5150 0.5510 -0.0287 -0.0142 -0.0051 658 GLN B NE2 
1736 N N   . GLY B 106 ? 0.4729 0.4989 0.5304 0.0002  0.0341  -0.0129 659 GLY B N   
1737 C CA  . GLY B 106 ? 0.4590 0.4750 0.5034 0.0016  0.0390  -0.0178 659 GLY B CA  
1738 C C   . GLY B 106 ? 0.4901 0.5060 0.5363 0.0042  0.0473  -0.0157 659 GLY B C   
1739 O O   . GLY B 106 ? 0.4875 0.4942 0.5228 0.0036  0.0501  -0.0190 659 GLY B O   
1740 N N   . GLY B 107 ? 0.4804 0.5058 0.5402 0.0072  0.0517  -0.0096 660 GLY B N   
1741 C CA  . GLY B 107 ? 0.4763 0.5002 0.5370 0.0108  0.0616  -0.0068 660 GLY B CA  
1742 C C   . GLY B 107 ? 0.4575 0.4821 0.5191 0.0051  0.0607  -0.0071 660 GLY B C   
1743 O O   . GLY B 107 ? 0.4946 0.5097 0.5468 0.0062  0.0669  -0.0087 660 GLY B O   
1744 N N   . VAL B 108 ? 0.4675 0.5007 0.5381 -0.0012 0.0523  -0.0054 661 VAL B N   
1745 C CA  . VAL B 108 ? 0.4466 0.4788 0.5156 -0.0077 0.0494  -0.0059 661 VAL B CA  
1746 C C   . VAL B 108 ? 0.5008 0.5178 0.5506 -0.0085 0.0492  -0.0134 661 VAL B C   
1747 O O   . VAL B 108 ? 0.4700 0.4817 0.5148 -0.0100 0.0527  -0.0143 661 VAL B O   
1748 C CB  . VAL B 108 ? 0.5415 0.5793 0.6161 -0.0149 0.0382  -0.0036 661 VAL B CB  
1749 C CG1 . VAL B 108 ? 0.4791 0.5124 0.5482 -0.0221 0.0346  -0.0042 661 VAL B CG1 
1750 C CG2 . VAL B 108 ? 0.4590 0.5136 0.5552 -0.0152 0.0364  0.0055  661 VAL B CG2 
1751 N N   . VAL B 109 ? 0.4223 0.4326 0.4623 -0.0075 0.0452  -0.0181 662 VAL B N   
1752 C CA  . VAL B 109 ? 0.4117 0.4105 0.4368 -0.0082 0.0442  -0.0235 662 VAL B CA  
1753 C C   . VAL B 109 ? 0.4306 0.4211 0.4479 -0.0049 0.0509  -0.0246 662 VAL B C   
1754 O O   . VAL B 109 ? 0.4918 0.4737 0.4998 -0.0064 0.0517  -0.0269 662 VAL B O   
1755 C CB  . VAL B 109 ? 0.2840 0.2800 0.3030 -0.0074 0.0391  -0.0264 662 VAL B CB  
1756 C CG1 . VAL B 109 ? 0.3471 0.3343 0.3544 -0.0075 0.0384  -0.0300 662 VAL B CG1 
1757 C CG2 . VAL B 109 ? 0.3821 0.3815 0.4046 -0.0106 0.0327  -0.0251 662 VAL B CG2 
1758 N N   . LEU B 110 ? 0.4475 0.4381 0.4663 -0.0003 0.0556  -0.0228 663 LEU B N   
1759 C CA  . LEU B 110 ? 0.5051 0.4821 0.5107 0.0026  0.0615  -0.0237 663 LEU B CA  
1760 C C   . LEU B 110 ? 0.4845 0.4567 0.4886 0.0037  0.0694  -0.0214 663 LEU B C   
1761 O O   . LEU B 110 ? 0.4761 0.4331 0.4651 0.0033  0.0718  -0.0235 663 LEU B O   
1762 C CB  . LEU B 110 ? 0.5024 0.4763 0.5050 0.0076  0.0644  -0.0224 663 LEU B CB  
1763 C CG  . LEU B 110 ? 0.4658 0.4377 0.4626 0.0060  0.0576  -0.0253 663 LEU B CG  
1764 C CD1 . LEU B 110 ? 0.5187 0.4874 0.5123 0.0107  0.0602  -0.0239 663 LEU B CD1 
1765 C CD2 . LEU B 110 ? 0.3573 0.3166 0.3396 0.0027  0.0548  -0.0279 663 LEU B CD2 
1766 N N   . ARG B 111 ? 0.3687 0.3538 0.3887 0.0046  0.0730  -0.0165 664 ARG B N   
1767 C CA  . ARG B 111 ? 0.4557 0.4394 0.4777 0.0051  0.0809  -0.0133 664 ARG B CA  
1768 C C   . ARG B 111 ? 0.4626 0.4412 0.4780 -0.0010 0.0767  -0.0168 664 ARG B C   
1769 O O   . ARG B 111 ? 0.5388 0.5044 0.5424 -0.0008 0.0819  -0.0179 664 ARG B O   
1770 C CB  . ARG B 111 ? 0.4445 0.4475 0.4895 0.0063  0.0843  -0.0054 664 ARG B CB  
1771 C CG  . ARG B 111 ? 0.5868 0.5922 0.6371 0.0152  0.0931  -0.0002 664 ARG B CG  
1772 C CD  . ARG B 111 ? 0.6487 0.6745 0.7243 0.0175  0.0986  0.0100  664 ARG B CD  
1773 N NE  . ARG B 111 ? 0.7669 0.8120 0.8619 0.0118  0.0875  0.0131  664 ARG B NE  
1774 C CZ  . ARG B 111 ? 0.7649 0.8168 0.8663 0.0139  0.0825  0.0142  664 ARG B CZ  
1775 N NH1 . ARG B 111 ? 0.6873 0.7534 0.8034 0.0074  0.0714  0.0173  664 ARG B NH1 
1776 N NH2 . ARG B 111 ? 0.5964 0.6385 0.6872 0.0218  0.0876  0.0122  664 ARG B NH2 
1777 N N   . GLN B 112 ? 0.4763 0.4623 0.4964 -0.0062 0.0673  -0.0187 665 GLN B N   
1778 C CA  . GLN B 112 ? 0.4608 0.4392 0.4712 -0.0110 0.0629  -0.0226 665 GLN B CA  
1779 C C   . GLN B 112 ? 0.3964 0.3587 0.3891 -0.0099 0.0626  -0.0271 665 GLN B C   
1780 O O   . GLN B 112 ? 0.4708 0.4229 0.4536 -0.0120 0.0633  -0.0290 665 GLN B O   
1781 C CB  . GLN B 112 ? 0.4710 0.4551 0.4842 -0.0152 0.0534  -0.0239 665 GLN B CB  
1782 C CG  . GLN B 112 ? 0.5496 0.5246 0.5513 -0.0191 0.0497  -0.0272 665 GLN B CG  
1783 C CD  . GLN B 112 ? 0.9591 0.9325 0.9615 -0.0222 0.0540  -0.0252 665 GLN B CD  
1784 O OE1 . GLN B 112 ? 0.6469 0.6309 0.6629 -0.0236 0.0571  -0.0197 665 GLN B OE1 
1785 N NE2 . GLN B 112 ? 0.6655 0.6262 0.6542 -0.0234 0.0543  -0.0286 665 GLN B NE2 
1786 N N   . ALA B 113 ? 0.4292 0.3891 0.4181 -0.0073 0.0608  -0.0283 666 ALA B N   
1787 C CA  . ALA B 113 ? 0.4154 0.3615 0.3893 -0.0076 0.0585  -0.0309 666 ALA B CA  
1788 C C   . ALA B 113 ? 0.4146 0.3439 0.3747 -0.0062 0.0655  -0.0303 666 ALA B C   
1789 O O   . ALA B 113 ? 0.3949 0.3101 0.3412 -0.0086 0.0635  -0.0321 666 ALA B O   
1790 C CB  . ALA B 113 ? 0.4662 0.4144 0.4402 -0.0061 0.0551  -0.0310 666 ALA B CB  
1791 N N   . ARG B 114 ? 0.3985 0.3281 0.3616 -0.0018 0.0738  -0.0273 667 ARG B N   
1792 C CA  . ARG B 114 ? 0.5125 0.4232 0.4600 0.0011  0.0830  -0.0259 667 ARG B CA  
1793 C C   . ARG B 114 ? 0.4930 0.3990 0.4377 -0.0016 0.0859  -0.0263 667 ARG B C   
1794 O O   . ARG B 114 ? 0.4885 0.3732 0.4133 -0.0029 0.0868  -0.0281 667 ARG B O   
1795 C CB  . ARG B 114 ? 0.5103 0.4241 0.4636 0.0084  0.0933  -0.0212 667 ARG B CB  
1796 C CG  . ARG B 114 ? 0.7271 0.6162 0.6594 0.0141  0.1054  -0.0190 667 ARG B CG  
1797 C CD  . ARG B 114 ? 0.7697 0.6316 0.6735 0.0138  0.1024  -0.0215 667 ARG B CD  
1798 N N   . ARG B 115 ? 0.4344 0.3581 0.3970 -0.0036 0.0858  -0.0247 668 ARG B N   
1799 C CA  . ARG B 115 ? 0.4817 0.4014 0.4412 -0.0078 0.0866  -0.0255 668 ARG B CA  
1800 C C   . ARG B 115 ? 0.4431 0.3493 0.3868 -0.0119 0.0784  -0.0307 668 ARG B C   
1801 O O   . ARG B 115 ? 0.4214 0.3123 0.3515 -0.0137 0.0805  -0.0321 668 ARG B O   
1802 C CB  . ARG B 115 ? 0.4781 0.4171 0.4558 -0.0120 0.0829  -0.0235 668 ARG B CB  
1803 C CG  . ARG B 115 ? 0.7099 0.6699 0.7098 -0.0108 0.0844  -0.0178 668 ARG B CG  
1804 C CD  . ARG B 115 ? 0.7339 0.6990 0.7436 -0.0080 0.0958  -0.0109 668 ARG B CD  
1805 N NE  . ARG B 115 ? 1.0720 1.0340 1.0811 0.0003  0.1048  -0.0079 668 ARG B NE  
1806 C CZ  . ARG B 115 ? 1.0661 1.0445 1.0945 0.0049  0.1104  -0.0005 668 ARG B CZ  
1807 N NH1 . ARG B 115 ? 0.7108 0.7116 0.7628 0.0007  0.1069  0.0055  668 ARG B NH1 
1808 N NH2 . ARG B 115 ? 1.1243 1.0952 1.1471 0.0137  0.1193  0.0016  668 ARG B NH2 
1809 N N   . GLU B 116 ? 0.3699 0.2821 0.3162 -0.0132 0.0693  -0.0328 669 GLU B N   
1810 C CA  . GLU B 116 ? 0.3544 0.2597 0.2917 -0.0166 0.0615  -0.0359 669 GLU B CA  
1811 C C   . GLU B 116 ? 0.3758 0.2619 0.2953 -0.0170 0.0596  -0.0367 669 GLU B C   
1812 O O   . GLU B 116 ? 0.5327 0.4073 0.4411 -0.0199 0.0556  -0.0382 669 GLU B O   
1813 C CB  . GLU B 116 ? 0.4436 0.3633 0.3915 -0.0170 0.0538  -0.0366 669 GLU B CB  
1814 C CG  . GLU B 116 ? 0.5950 0.5098 0.5359 -0.0187 0.0469  -0.0384 669 GLU B CG  
1815 C CD  . GLU B 116 ? 0.6568 0.5639 0.5905 -0.0212 0.0477  -0.0400 669 GLU B CD  
1816 O OE1 . GLU B 116 ? 0.3526 0.2646 0.2915 -0.0227 0.0512  -0.0395 669 GLU B OE1 
1817 O OE2 . GLU B 116 ? 0.7087 0.6049 0.6317 -0.0222 0.0440  -0.0411 669 GLU B OE2 
1818 N N   . VAL B 117 ? 0.4259 0.3067 0.3408 -0.0148 0.0615  -0.0352 670 VAL B N   
1819 C CA  . VAL B 117 ? 0.4793 0.3357 0.3720 -0.0162 0.0604  -0.0349 670 VAL B CA  
1820 C C   . VAL B 117 ? 0.4456 0.2819 0.3221 -0.0160 0.0680  -0.0353 670 VAL B C   
1821 O O   . VAL B 117 ? 0.5205 0.3383 0.3801 -0.0197 0.0638  -0.0364 670 VAL B O   
1822 C CB  . VAL B 117 ? 0.5326 0.3826 0.4190 -0.0134 0.0628  -0.0330 670 VAL B CB  
1823 C CG1 . VAL B 117 ? 0.6426 0.4614 0.5007 -0.0147 0.0640  -0.0323 670 VAL B CG1 
1824 C CG2 . VAL B 117 ? 0.5641 0.4260 0.4590 -0.0153 0.0536  -0.0325 670 VAL B CG2 
1825 N N   . ASP B 118 ? 0.5361 0.3761 0.4183 -0.0117 0.0793  -0.0337 671 ASP B N   
1826 C CA  . ASP B 118 ? 0.4397 0.2628 0.3088 -0.0111 0.0883  -0.0334 671 ASP B CA  
1827 C C   . ASP B 118 ? 0.4869 0.3092 0.3546 -0.0163 0.0828  -0.0362 671 ASP B C   
1828 O O   . ASP B 118 ? 0.5438 0.3426 0.3906 -0.0185 0.0830  -0.0375 671 ASP B O   
1829 C CB  . ASP B 118 ? 0.4677 0.3042 0.3521 -0.0060 0.1008  -0.0295 671 ASP B CB  
1830 C CG  . ASP B 118 ? 0.6548 0.4847 0.5344 0.0010  0.1096  -0.0261 671 ASP B CG  
1831 O OD1 . ASP B 118 ? 0.8482 0.6529 0.7033 0.0014  0.1084  -0.0271 671 ASP B OD1 
1832 O OD2 . ASP B 118 ? 0.6123 0.4613 0.5118 0.0057  0.1168  -0.0218 671 ASP B OD2 
1833 N N   . SER B 119 ? 0.4972 0.3424 0.3845 -0.0182 0.0774  -0.0370 672 SER B N   
1834 C CA  . SER B 119 ? 0.4919 0.3359 0.3770 -0.0223 0.0730  -0.0394 672 SER B CA  
1835 C C   . SER B 119 ? 0.5074 0.3356 0.3765 -0.0254 0.0634  -0.0417 672 SER B C   
1836 O O   . SER B 119 ? 0.5680 0.3817 0.4240 -0.0280 0.0626  -0.0434 672 SER B O   
1837 C CB  . SER B 119 ? 0.4797 0.3475 0.3847 -0.0236 0.0686  -0.0395 672 SER B CB  
1838 O OG  . SER B 119 ? 0.3678 0.2311 0.2664 -0.0269 0.0622  -0.0422 672 SER B OG  
1839 N N   . ILE B 120 ? 0.5216 0.3527 0.3921 -0.0254 0.0559  -0.0409 673 ILE B N   
1840 C CA  . ILE B 120 ? 0.5441 0.3631 0.4029 -0.0289 0.0458  -0.0410 673 ILE B CA  
1841 C C   . ILE B 120 ? 0.5927 0.3811 0.4255 -0.0311 0.0472  -0.0407 673 ILE B C   
1842 O O   . ILE B 120 ? 0.6412 0.4129 0.4593 -0.0349 0.0410  -0.0411 673 ILE B O   
1843 C CB  . ILE B 120 ? 0.6207 0.4518 0.4893 -0.0290 0.0373  -0.0385 673 ILE B CB  
1844 C CG1 . ILE B 120 ? 0.4875 0.3437 0.3770 -0.0266 0.0353  -0.0387 673 ILE B CG1 
1845 C CG2 . ILE B 120 ? 0.7047 0.5222 0.5615 -0.0334 0.0268  -0.0363 673 ILE B CG2 
1846 C CD1 . ILE B 120 ? 0.5857 0.4561 0.4871 -0.0255 0.0305  -0.0360 673 ILE B CD1 
1847 N N   . GLY B 121 ? 0.4965 0.2754 0.3217 -0.0284 0.0556  -0.0396 674 GLY B N   
1848 C CA  . GLY B 121 ? 0.6090 0.3537 0.4047 -0.0291 0.0605  -0.0393 674 GLY B CA  
1849 C C   . GLY B 121 ? 0.7073 0.4379 0.4917 -0.0297 0.0668  -0.0414 674 GLY B C   
1850 O O   . GLY B 121 ? 0.7921 0.4906 0.5484 -0.0323 0.0663  -0.0417 674 GLY B O   
1851 N N   . LEU B 122 ? 0.5883 0.3395 0.3915 -0.0281 0.0722  -0.0424 675 LEU B N   
1852 C CA  . LEU B 122 ? 0.6360 0.3733 0.4278 -0.0296 0.0778  -0.0441 675 LEU B CA  
1853 C C   . LEU B 122 ? 0.6447 0.3810 0.4340 -0.0344 0.0668  -0.0468 675 LEU B C   
1854 O O   . LEU B 122 ? 0.6432 0.3678 0.4224 -0.0361 0.0705  -0.0486 675 LEU B O   
1855 C CB  . LEU B 122 ? 0.5554 0.3105 0.3647 -0.0267 0.0897  -0.0426 675 LEU B CB  
1856 C CG  . LEU B 122 ? 0.5636 0.3252 0.3812 -0.0205 0.1027  -0.0384 675 LEU B CG  
1857 C CD1 . LEU B 122 ? 0.5231 0.3036 0.3598 -0.0199 0.1119  -0.0357 675 LEU B CD1 
1858 C CD2 . LEU B 122 ? 0.6796 0.4077 0.4686 -0.0170 0.1117  -0.0371 675 LEU B CD2 
1859 N N   . GLU B 123 ? 0.6598 0.4075 0.4578 -0.0360 0.0543  -0.0466 676 GLU B N   
1860 C CA  . GLU B 123 ? 0.6820 0.4307 0.4795 -0.0389 0.0445  -0.0481 676 GLU B CA  
1861 C C   . GLU B 123 ? 0.8489 0.5669 0.6201 -0.0430 0.0387  -0.0485 676 GLU B C   
1862 O O   . GLU B 123 ? 0.9185 0.6315 0.6846 -0.0449 0.0334  -0.0500 676 GLU B O   
1863 C CB  . GLU B 123 ? 0.6699 0.4385 0.4840 -0.0383 0.0340  -0.0459 676 GLU B CB  
1864 C CG  . GLU B 123 ? 0.5390 0.3338 0.3743 -0.0353 0.0347  -0.0466 676 GLU B CG  
1865 C CD  . GLU B 123 ? 0.8744 0.6798 0.7178 -0.0343 0.0247  -0.0449 676 GLU B CD  
1866 O OE1 . GLU B 123 ? 0.6554 0.4479 0.4884 -0.0366 0.0171  -0.0433 676 GLU B OE1 
1867 O OE2 . GLU B 123 ? 1.1533 0.9786 1.0125 -0.0310 0.0248  -0.0445 676 GLU B OE2 
1868 N N   . GLU B 124 ? 0.9397 0.6352 0.6923 -0.0446 0.0386  -0.0467 677 GLU B N   
1869 C CA  . GLU B 124 ? 1.0297 0.6935 0.7552 -0.0499 0.0301  -0.0460 677 GLU B CA  
1870 C C   . GLU B 124 ? 1.0193 0.6683 0.7316 -0.0514 0.0321  -0.0494 677 GLU B C   
1871 O O   . GLU B 124 ? 1.0298 0.6707 0.7352 -0.0550 0.0206  -0.0490 677 GLU B O   
1872 C CB  . GLU B 124 ? 1.0501 0.6833 0.7492 -0.0510 0.0338  -0.0444 677 GLU B CB  
1873 C CG  . GLU B 124 ? 1.3041 0.8948 0.9667 -0.0569 0.0276  -0.0440 677 GLU B CG  
1874 C CD  . GLU B 124 ? 1.4259 1.0135 1.0865 -0.0640 0.0077  -0.0402 677 GLU B CD  
1875 O OE1 . GLU B 124 ? 1.4621 1.0800 1.1495 -0.0635 0.0002  -0.0392 677 GLU B OE1 
1876 O OE2 . GLU B 124 ? 1.2449 0.7980 0.8758 -0.0702 -0.0001 -0.0375 677 GLU B OE2 
1877 N N   . ALA B 125 ? 0.9357 0.5831 0.6466 -0.0486 0.0463  -0.0520 678 ALA B N   
1878 C CA  . ALA B 125 ? 0.9560 0.5853 0.6508 -0.0505 0.0497  -0.0551 678 ALA B CA  
1879 C C   . ALA B 125 ? 0.9394 0.5840 0.6458 -0.0519 0.0403  -0.0568 678 ALA B C   
1880 O O   . ALA B 125 ? 0.9547 0.5793 0.6434 -0.0551 0.0341  -0.0583 678 ALA B O   
1881 C CB  . ALA B 125 ? 0.9640 0.5947 0.6606 -0.0474 0.0672  -0.0558 678 ALA B CB  
1882 N N   . SER B 126 ? 0.9111 0.5886 0.6449 -0.0490 0.0394  -0.0563 679 SER B N   
1883 C CA  . SER B 126 ? 0.9917 0.6822 0.7347 -0.0487 0.0310  -0.0572 679 SER B CA  
1884 C C   . SER B 126 ? 1.0516 0.7338 0.7882 -0.0504 0.0164  -0.0548 679 SER B C   
1885 O O   . SER B 126 ? 1.0840 0.7651 0.8182 -0.0501 0.0105  -0.0555 679 SER B O   
1886 C CB  . SER B 126 ? 0.8969 0.6204 0.6671 -0.0449 0.0321  -0.0563 679 SER B CB  
1887 O OG  . SER B 126 ? 0.8564 0.5934 0.6398 -0.0431 0.0287  -0.0529 679 SER B OG  
1888 N N   . GLY B 127 ? 1.0730 0.7492 0.8067 -0.0522 0.0104  -0.0510 680 GLY B N   
1889 C CA  . GLY B 127 ? 1.0843 0.7523 0.8127 -0.0554 -0.0044 -0.0466 680 GLY B CA  
1890 C C   . GLY B 127 ? 1.0602 0.6923 0.7584 -0.0606 -0.0091 -0.0479 680 GLY B C   
1891 O O   . GLY B 127 ? 1.0585 0.6859 0.7517 -0.0603 -0.0119 -0.0498 680 GLY B O   
1892 N N   . THR C 12  ? 0.7733 0.6681 0.6096 0.0341  0.0061  0.0016  565 THR C N   
1893 C CA  . THR C 12  ? 0.8514 0.7461 0.6824 0.0423  -0.0017 0.0065  565 THR C CA  
1894 C C   . THR C 12  ? 0.8524 0.7619 0.7053 0.0455  -0.0055 0.0066  565 THR C C   
1895 O O   . THR C 12  ? 0.8962 0.8180 0.7672 0.0441  -0.0049 0.0046  565 THR C O   
1896 C CB  . THR C 12  ? 0.8829 0.7787 0.7011 0.0494  -0.0097 0.0114  565 THR C CB  
1897 O OG1 . THR C 12  ? 0.6467 0.5598 0.4811 0.0541  -0.0149 0.0119  565 THR C OG1 
1898 C CG2 . THR C 12  ? 0.8118 0.6998 0.6130 0.0451  -0.0081 0.0114  565 THR C CG2 
1899 N N   . PRO C 13  ? 0.9025 0.8096 0.7528 0.0494  -0.0093 0.0090  566 PRO C N   
1900 C CA  . PRO C 13  ? 0.8740 0.7937 0.7420 0.0510  -0.0133 0.0092  566 PRO C CA  
1901 C C   . PRO C 13  ? 0.8004 0.7320 0.6739 0.0571  -0.0199 0.0117  566 PRO C C   
1902 O O   . PRO C 13  ? 0.6556 0.5984 0.5451 0.0568  -0.0224 0.0114  566 PRO C O   
1903 C CB  . PRO C 13  ? 0.8648 0.7756 0.7248 0.0513  -0.0138 0.0102  566 PRO C CB  
1904 C CG  . PRO C 13  ? 0.9798 0.8733 0.8213 0.0489  -0.0082 0.0096  566 PRO C CG  
1905 C CD  . PRO C 13  ? 0.9664 0.8580 0.7983 0.0508  -0.0086 0.0109  566 PRO C CD  
1906 N N   . LEU C 14  ? 0.7378 0.6669 0.5987 0.0624  -0.0229 0.0140  567 LEU C N   
1907 C CA  . LEU C 14  ? 0.6646 0.6055 0.5315 0.0672  -0.0279 0.0152  567 LEU C CA  
1908 C C   . LEU C 14  ? 0.5320 0.4841 0.4132 0.0640  -0.0262 0.0128  567 LEU C C   
1909 O O   . LEU C 14  ? 0.5773 0.5398 0.4709 0.0653  -0.0287 0.0128  567 LEU C O   
1910 C CB  . LEU C 14  ? 0.6312 0.5690 0.4848 0.0723  -0.0310 0.0175  567 LEU C CB  
1911 C CG  . LEU C 14  ? 0.6666 0.6169 0.5277 0.0778  -0.0360 0.0181  567 LEU C CG  
1912 C CD1 . LEU C 14  ? 0.5096 0.4595 0.3738 0.0809  -0.0377 0.0189  567 LEU C CD1 
1913 C CD2 . LEU C 14  ? 0.5764 0.5276 0.4291 0.0826  -0.0402 0.0202  567 LEU C CD2 
1914 N N   . THR C 15  ? 0.5493 0.4975 0.4277 0.0592  -0.0211 0.0106  568 THR C N   
1915 C CA  . THR C 15  ? 0.5659 0.5225 0.4557 0.0558  -0.0178 0.0079  568 THR C CA  
1916 C C   . THR C 15  ? 0.5743 0.5378 0.4857 0.0530  -0.0155 0.0063  568 THR C C   
1917 O O   . THR C 15  ? 0.5431 0.5165 0.4682 0.0532  -0.0156 0.0056  568 THR C O   
1918 C CB  . THR C 15  ? 0.6462 0.5937 0.5244 0.0498  -0.0116 0.0054  568 THR C CB  
1919 O OG1 . THR C 15  ? 0.7969 0.7349 0.6536 0.0524  -0.0151 0.0083  568 THR C OG1 
1920 C CG2 . THR C 15  ? 0.5212 0.4760 0.4045 0.0467  -0.0086 0.0027  568 THR C CG2 
1921 N N   . VAL C 16  ? 0.5569 0.5153 0.4721 0.0503  -0.0138 0.0058  569 VAL C N   
1922 C CA  . VAL C 16  ? 0.5992 0.5653 0.5368 0.0480  -0.0135 0.0051  569 VAL C CA  
1923 C C   . VAL C 16  ? 0.5617 0.5355 0.5039 0.0526  -0.0218 0.0088  569 VAL C C   
1924 O O   . VAL C 16  ? 0.6072 0.5898 0.5659 0.0526  -0.0238 0.0097  569 VAL C O   
1925 C CB  . VAL C 16  ? 0.6150 0.5752 0.5572 0.0433  -0.0101 0.0034  569 VAL C CB  
1926 C CG1 . VAL C 16  ? 0.7426 0.7128 0.7106 0.0415  -0.0118 0.0035  569 VAL C CG1 
1927 C CG2 . VAL C 16  ? 0.6714 0.6220 0.6074 0.0376  -0.0005 -0.0009 569 VAL C CG2 
1928 N N   . LEU C 17  ? 0.5276 0.4967 0.4542 0.0562  -0.0259 0.0110  570 LEU C N   
1929 C CA  . LEU C 17  ? 0.5143 0.4886 0.4422 0.0595  -0.0324 0.0136  570 LEU C CA  
1930 C C   . LEU C 17  ? 0.4117 0.3945 0.3440 0.0624  -0.0339 0.0138  570 LEU C C   
1931 O O   . LEU C 17  ? 0.4127 0.4022 0.3566 0.0620  -0.0366 0.0150  570 LEU C O   
1932 C CB  . LEU C 17  ? 0.4695 0.4359 0.3803 0.0626  -0.0346 0.0149  570 LEU C CB  
1933 C CG  . LEU C 17  ? 0.6042 0.5732 0.5146 0.0641  -0.0397 0.0167  570 LEU C CG  
1934 C CD1 . LEU C 17  ? 0.5367 0.5108 0.4604 0.0596  -0.0429 0.0179  570 LEU C CD1 
1935 C CD2 . LEU C 17  ? 0.6431 0.6021 0.5390 0.0655  -0.0395 0.0172  570 LEU C CD2 
1936 N N   . LEU C 18  ? 0.4635 0.4456 0.3859 0.0650  -0.0325 0.0128  571 LEU C N   
1937 C CA  . LEU C 18  ? 0.4357 0.4264 0.3616 0.0672  -0.0335 0.0122  571 LEU C CA  
1938 C C   . LEU C 18  ? 0.4314 0.4286 0.3730 0.0639  -0.0300 0.0107  571 LEU C C   
1939 O O   . LEU C 18  ? 0.4118 0.4158 0.3598 0.0651  -0.0312 0.0108  571 LEU C O   
1940 C CB  . LEU C 18  ? 0.4328 0.4225 0.3462 0.0698  -0.0332 0.0114  571 LEU C CB  
1941 C CG  . LEU C 18  ? 0.5112 0.4962 0.4123 0.0749  -0.0372 0.0133  571 LEU C CG  
1942 C CD1 . LEU C 18  ? 0.4646 0.4509 0.3569 0.0775  -0.0384 0.0131  571 LEU C CD1 
1943 C CD2 . LEU C 18  ? 0.3518 0.3410 0.2566 0.0777  -0.0404 0.0138  571 LEU C CD2 
1944 N N   . ARG C 19  ? 0.4600 0.4542 0.4083 0.0597  -0.0248 0.0090  572 ARG C N   
1945 C CA  . ARG C 19  ? 0.4200 0.4196 0.3862 0.0566  -0.0202 0.0073  572 ARG C CA  
1946 C C   . ARG C 19  ? 0.4258 0.4308 0.4073 0.0577  -0.0248 0.0104  572 ARG C C   
1947 O O   . ARG C 19  ? 0.4814 0.4920 0.4741 0.0580  -0.0240 0.0106  572 ARG C O   
1948 C CB  . ARG C 19  ? 0.5162 0.5109 0.4887 0.0513  -0.0126 0.0042  572 ARG C CB  
1949 C CG  . ARG C 19  ? 0.6312 0.6225 0.5946 0.0477  -0.0053 0.0003  572 ARG C CG  
1950 C CD  . ARG C 19  ? 0.7086 0.6914 0.6727 0.0415  0.0028  -0.0032 572 ARG C CD  
1951 N NE  . ARG C 19  ? 0.7745 0.7521 0.7273 0.0362  0.0103  -0.0073 572 ARG C NE  
1952 C CZ  . ARG C 19  ? 0.8707 0.8389 0.8201 0.0291  0.0192  -0.0114 572 ARG C CZ  
1953 N NH1 . ARG C 19  ? 0.6536 0.6177 0.6120 0.0272  0.0219  -0.0123 572 ARG C NH1 
1954 N NH2 . ARG C 19  ? 0.7884 0.7508 0.7247 0.0230  0.0259  -0.0151 572 ARG C NH2 
1955 N N   . SER C 20  ? 0.4383 0.4408 0.4199 0.0577  -0.0297 0.0130  573 SER C N   
1956 C CA  . SER C 20  ? 0.4588 0.4658 0.4536 0.0577  -0.0356 0.0166  573 SER C CA  
1957 C C   . SER C 20  ? 0.3719 0.3806 0.3571 0.0606  -0.0408 0.0188  573 SER C C   
1958 O O   . SER C 20  ? 0.4154 0.4281 0.4098 0.0609  -0.0432 0.0209  573 SER C O   
1959 C CB  . SER C 20  ? 0.4874 0.4919 0.4850 0.0552  -0.0395 0.0184  573 SER C CB  
1960 O OG  . SER C 20  ? 0.6254 0.6308 0.6394 0.0520  -0.0344 0.0163  573 SER C OG  
1961 N N   . VAL C 21  ? 0.3917 0.3965 0.3589 0.0627  -0.0419 0.0180  574 VAL C N   
1962 C CA  . VAL C 21  ? 0.3483 0.3542 0.3068 0.0651  -0.0449 0.0185  574 VAL C CA  
1963 C C   . VAL C 21  ? 0.3226 0.3347 0.2879 0.0660  -0.0419 0.0170  574 VAL C C   
1964 O O   . VAL C 21  ? 0.4120 0.4260 0.3798 0.0660  -0.0443 0.0185  574 VAL C O   
1965 C CB  . VAL C 21  ? 0.3534 0.3553 0.2953 0.0681  -0.0445 0.0169  574 VAL C CB  
1966 C CG1 . VAL C 21  ? 0.4346 0.4391 0.3710 0.0704  -0.0458 0.0161  574 VAL C CG1 
1967 C CG2 . VAL C 21  ? 0.3055 0.2998 0.2394 0.0669  -0.0467 0.0183  574 VAL C CG2 
1968 N N   . LEU C 22  ? 0.4111 0.4250 0.3777 0.0659  -0.0363 0.0139  575 LEU C N   
1969 C CA  . LEU C 22  ? 0.3711 0.3905 0.3425 0.0658  -0.0324 0.0116  575 LEU C CA  
1970 C C   . LEU C 22  ? 0.3472 0.3687 0.3363 0.0639  -0.0312 0.0133  575 LEU C C   
1971 O O   . LEU C 22  ? 0.3502 0.3744 0.3426 0.0643  -0.0312 0.0137  575 LEU C O   
1972 C CB  . LEU C 22  ? 0.4226 0.4425 0.3893 0.0645  -0.0267 0.0077  575 LEU C CB  
1973 C CG  . LEU C 22  ? 0.3969 0.4225 0.3668 0.0631  -0.0219 0.0044  575 LEU C CG  
1974 C CD1 . LEU C 22  ? 0.3237 0.3537 0.2862 0.0660  -0.0251 0.0037  575 LEU C CD1 
1975 C CD2 . LEU C 22  ? 0.3651 0.3895 0.3289 0.0599  -0.0165 0.0009  575 LEU C CD2 
1976 N N   . ASP C 23  ? 0.4012 0.4214 0.4028 0.0620  -0.0300 0.0145  576 ASP C N   
1977 C CA  . ASP C 23  ? 0.4351 0.4575 0.4566 0.0611  -0.0302 0.0172  576 ASP C CA  
1978 C C   . ASP C 23  ? 0.4343 0.4565 0.4532 0.0625  -0.0384 0.0221  576 ASP C C   
1979 O O   . ASP C 23  ? 0.3988 0.4222 0.4250 0.0629  -0.0382 0.0237  576 ASP C O   
1980 C CB  . ASP C 23  ? 0.4866 0.5083 0.5233 0.0592  -0.0299 0.0183  576 ASP C CB  
1981 C CG  . ASP C 23  ? 0.6419 0.6625 0.6846 0.0563  -0.0197 0.0130  576 ASP C CG  
1982 O OD1 . ASP C 23  ? 0.5619 0.5831 0.6017 0.0554  -0.0129 0.0094  576 ASP C OD1 
1983 O OD2 . ASP C 23  ? 0.5148 0.5334 0.5644 0.0540  -0.0178 0.0119  576 ASP C OD2 
1984 N N   . GLN C 24  ? 0.4545 0.4735 0.4616 0.0625  -0.0450 0.0242  577 GLN C N   
1985 C CA  . GLN C 24  ? 0.3902 0.4067 0.3916 0.0620  -0.0527 0.0287  577 GLN C CA  
1986 C C   . GLN C 24  ? 0.4418 0.4578 0.4309 0.0631  -0.0512 0.0267  577 GLN C C   
1987 O O   . GLN C 24  ? 0.4470 0.4605 0.4345 0.0619  -0.0552 0.0300  577 GLN C O   
1988 C CB  . GLN C 24  ? 0.3920 0.4042 0.3821 0.0603  -0.0587 0.0304  577 GLN C CB  
1989 C CG  . GLN C 24  ? 0.4341 0.4471 0.4375 0.0578  -0.0635 0.0340  577 GLN C CG  
1990 C CD  . GLN C 24  ? 0.4499 0.4581 0.4400 0.0553  -0.0674 0.0342  577 GLN C CD  
1991 O OE1 . GLN C 24  ? 0.6412 0.6445 0.6127 0.0553  -0.0675 0.0328  577 GLN C OE1 
1992 N NE2 . GLN C 24  ? 0.4113 0.4210 0.4123 0.0529  -0.0697 0.0354  577 GLN C NE2 
1993 N N   . LEU C 25  ? 0.3688 0.3865 0.3487 0.0648  -0.0460 0.0217  578 LEU C N   
1994 C CA  . LEU C 25  ? 0.3928 0.4116 0.3647 0.0654  -0.0441 0.0191  578 LEU C CA  
1995 C C   . LEU C 25  ? 0.3898 0.4113 0.3734 0.0648  -0.0401 0.0191  578 LEU C C   
1996 O O   . LEU C 25  ? 0.4284 0.4480 0.4090 0.0639  -0.0404 0.0197  578 LEU C O   
1997 C CB  . LEU C 25  ? 0.3002 0.3222 0.2626 0.0676  -0.0404 0.0140  578 LEU C CB  
1998 C CG  . LEU C 25  ? 0.4608 0.4794 0.4123 0.0691  -0.0430 0.0138  578 LEU C CG  
1999 C CD1 . LEU C 25  ? 0.2418 0.2645 0.1870 0.0721  -0.0401 0.0095  578 LEU C CD1 
2000 C CD2 . LEU C 25  ? 0.3471 0.3601 0.2900 0.0678  -0.0469 0.0155  578 LEU C CD2 
2001 N N   . GLN C 26  ? 0.4024 0.4267 0.3989 0.0646  -0.0353 0.0180  579 GLN C N   
2002 C CA  . GLN C 26  ? 0.4280 0.4540 0.4368 0.0638  -0.0296 0.0173  579 GLN C CA  
2003 C C   . GLN C 26  ? 0.4797 0.5021 0.4995 0.0636  -0.0345 0.0237  579 GLN C C   
2004 O O   . GLN C 26  ? 0.4515 0.4724 0.4749 0.0633  -0.0321 0.0245  579 GLN C O   
2005 C CB  . GLN C 26  ? 0.4327 0.4613 0.4527 0.0626  -0.0220 0.0140  579 GLN C CB  
2006 C CG  . GLN C 26  ? 0.6478 0.6793 0.6559 0.0617  -0.0173 0.0081  579 GLN C CG  
2007 C CD  . GLN C 26  ? 0.7769 0.8103 0.7919 0.0586  -0.0072 0.0033  579 GLN C CD  
2008 O OE1 . GLN C 26  ? 0.4290 0.4639 0.4473 0.0575  -0.0027 0.0015  579 GLN C OE1 
2009 N NE2 . GLN C 26  ? 0.4720 0.5044 0.4876 0.0562  -0.0029 0.0007  579 GLN C NE2 
2010 N N   . ASP C 27  ? 0.4624 0.4831 0.4876 0.0636  -0.0416 0.0286  580 ASP C N   
2011 C CA  . ASP C 27  ? 0.4110 0.4285 0.4456 0.0633  -0.0490 0.0360  580 ASP C CA  
2012 C C   . ASP C 27  ? 0.4234 0.4351 0.4414 0.0620  -0.0538 0.0384  580 ASP C C   
2013 O O   . ASP C 27  ? 0.4213 0.4289 0.4445 0.0614  -0.0584 0.0442  580 ASP C O   
2014 C CB  . ASP C 27  ? 0.4683 0.4859 0.5080 0.0624  -0.0571 0.0403  580 ASP C CB  
2015 C CG  . ASP C 27  ? 0.7156 0.7380 0.7772 0.0630  -0.0528 0.0391  580 ASP C CG  
2016 O OD1 . ASP C 27  ? 0.7194 0.7437 0.7965 0.0639  -0.0450 0.0371  580 ASP C OD1 
2017 O OD2 . ASP C 27  ? 0.7817 0.8052 0.8452 0.0619  -0.0563 0.0395  580 ASP C OD2 
2018 N N   . LYS C 28  ? 0.3894 0.3999 0.3877 0.0612  -0.0525 0.0340  581 LYS C N   
2019 C CA  . LYS C 28  ? 0.3859 0.3901 0.3683 0.0590  -0.0544 0.0346  581 LYS C CA  
2020 C C   . LYS C 28  ? 0.3526 0.3578 0.3350 0.0593  -0.0463 0.0304  581 LYS C C   
2021 O O   . LYS C 28  ? 0.4235 0.4231 0.3933 0.0571  -0.0460 0.0297  581 LYS C O   
2022 C CB  . LYS C 28  ? 0.4133 0.4149 0.3764 0.0576  -0.0561 0.0316  581 LYS C CB  
2023 C CG  . LYS C 28  ? 0.4937 0.4939 0.4545 0.0566  -0.0626 0.0345  581 LYS C CG  
2024 C CD  . LYS C 28  ? 0.5284 0.5244 0.4950 0.0538  -0.0722 0.0428  581 LYS C CD  
2025 C CE  . LYS C 28  ? 0.6298 0.6263 0.5967 0.0524  -0.0777 0.0447  581 LYS C CE  
2026 N NZ  . LYS C 28  ? 0.5043 0.5085 0.4896 0.0556  -0.0743 0.0432  581 LYS C NZ  
2027 N N   . ASP C 29  ? 0.3917 0.4029 0.3876 0.0611  -0.0390 0.0271  582 ASP C N   
2028 C CA  . ASP C 29  ? 0.3125 0.3248 0.3094 0.0605  -0.0304 0.0226  582 ASP C CA  
2029 C C   . ASP C 29  ? 0.3604 0.3729 0.3771 0.0612  -0.0259 0.0247  582 ASP C C   
2030 O O   . ASP C 29  ? 0.2541 0.2717 0.2777 0.0610  -0.0170 0.0192  582 ASP C O   
2031 C CB  . ASP C 29  ? 0.4584 0.4784 0.4487 0.0608  -0.0241 0.0143  582 ASP C CB  
2032 C CG  . ASP C 29  ? 0.2877 0.3113 0.2821 0.0593  -0.0143 0.0087  582 ASP C CG  
2033 O OD1 . ASP C 29  ? 0.3270 0.3457 0.3202 0.0578  -0.0119 0.0093  582 ASP C OD1 
2034 O OD2 . ASP C 29  ? 0.3520 0.3821 0.3498 0.0590  -0.0090 0.0039  582 ASP C OD2 
2035 N N   . PRO C 30  ? 0.3823 0.3888 0.4086 0.0617  -0.0318 0.0328  583 PRO C N   
2036 C CA  . PRO C 30  ? 0.3699 0.3760 0.4185 0.0631  -0.0271 0.0351  583 PRO C CA  
2037 C C   . PRO C 30  ? 0.3684 0.3720 0.4168 0.0619  -0.0169 0.0311  583 PRO C C   
2038 O O   . PRO C 30  ? 0.3707 0.3749 0.4365 0.0624  -0.0089 0.0300  583 PRO C O   
2039 C CB  . PRO C 30  ? 0.4053 0.4056 0.4623 0.0642  -0.0383 0.0457  583 PRO C CB  
2040 C CG  . PRO C 30  ? 0.4163 0.4104 0.4496 0.0617  -0.0463 0.0480  583 PRO C CG  
2041 C CD  . PRO C 30  ? 0.3744 0.3734 0.3910 0.0606  -0.0429 0.0400  583 PRO C CD  
2042 N N   . ALA C 31  ? 0.4489 0.4495 0.4782 0.0597  -0.0158 0.0280  584 ALA C N   
2043 C CA  . ALA C 31  ? 0.3946 0.3947 0.4220 0.0576  -0.0047 0.0220  584 ALA C CA  
2044 C C   . ALA C 31  ? 0.4052 0.4148 0.4369 0.0564  0.0052  0.0131  584 ALA C C   
2045 O O   . ALA C 31  ? 0.4500 0.4598 0.4844 0.0540  0.0156  0.0079  584 ALA C O   
2046 C CB  . ALA C 31  ? 0.4325 0.4286 0.4389 0.0549  -0.0051 0.0192  584 ALA C CB  
2047 N N   . ARG C 32  ? 0.3687 0.3850 0.3998 0.0574  0.0021  0.0115  585 ARG C N   
2048 C CA  . ARG C 32  ? 0.3609 0.3850 0.3907 0.0554  0.0093  0.0037  585 ARG C CA  
2049 C C   . ARG C 32  ? 0.3487 0.3772 0.3643 0.0527  0.0139  -0.0035 585 ARG C C   
2050 O O   . ARG C 32  ? 0.3635 0.3969 0.3795 0.0494  0.0223  -0.0101 585 ARG C O   
2051 C CB  . ARG C 32  ? 0.3394 0.3632 0.3864 0.0536  0.0194  0.0016  585 ARG C CB  
2052 C CG  . ARG C 32  ? 0.4951 0.5140 0.5628 0.0563  0.0173  0.0087  585 ARG C CG  
2053 C CD  . ARG C 32  ? 0.5205 0.5422 0.5924 0.0580  0.0107  0.0113  585 ARG C CD  
2054 N NE  . ARG C 32  ? 0.7472 0.7733 0.8172 0.0549  0.0177  0.0045  585 ARG C NE  
2055 C CZ  . ARG C 32  ? 0.6916 0.7195 0.7609 0.0553  0.0140  0.0048  585 ARG C CZ  
2056 N NH1 . ARG C 32  ? 0.8410 0.8680 0.9128 0.0585  0.0035  0.0112  585 ARG C NH1 
2057 N NH2 . ARG C 32  ? 0.5083 0.5381 0.5729 0.0516  0.0207  -0.0012 585 ARG C NH2 
2058 N N   . ILE C 33  ? 0.3768 0.4037 0.3798 0.0532  0.0088  -0.0030 586 ILE C N   
2059 C CA  . ILE C 33  ? 0.3148 0.3474 0.3066 0.0508  0.0129  -0.0106 586 ILE C CA  
2060 C C   . ILE C 33  ? 0.3746 0.4171 0.3611 0.0514  0.0109  -0.0150 586 ILE C C   
2061 O O   . ILE C 33  ? 0.3092 0.3593 0.2916 0.0488  0.0154  -0.0219 586 ILE C O   
2062 C CB  . ILE C 33  ? 0.3119 0.3390 0.2920 0.0507  0.0088  -0.0093 586 ILE C CB  
2063 C CG1 . ILE C 33  ? 0.4502 0.4669 0.4322 0.0487  0.0126  -0.0064 586 ILE C CG1 
2064 C CG2 . ILE C 33  ? 0.2732 0.3083 0.2429 0.0491  0.0110  -0.0176 586 ILE C CG2 
2065 C CD1 . ILE C 33  ? 0.3776 0.3839 0.3479 0.0482  0.0064  -0.0017 586 ILE C CD1 
2066 N N   . PHE C 34  ? 0.3278 0.3702 0.3139 0.0545  0.0038  -0.0109 587 PHE C N   
2067 C CA  . PHE C 34  ? 0.4238 0.4739 0.4033 0.0555  0.0010  -0.0142 587 PHE C CA  
2068 C C   . PHE C 34  ? 0.4526 0.5036 0.4368 0.0550  0.0022  -0.0137 587 PHE C C   
2069 O O   . PHE C 34  ? 0.3003 0.3552 0.2780 0.0560  -0.0010 -0.0147 587 PHE C O   
2070 C CB  . PHE C 34  ? 0.5056 0.5540 0.4771 0.0591  -0.0072 -0.0114 587 PHE C CB  
2071 C CG  . PHE C 34  ? 0.3346 0.3799 0.3001 0.0585  -0.0075 -0.0123 587 PHE C CG  
2072 C CD1 . PHE C 34  ? 0.4919 0.5440 0.4528 0.0576  -0.0047 -0.0189 587 PHE C CD1 
2073 C CD2 . PHE C 34  ? 0.5248 0.5601 0.4893 0.0580  -0.0104 -0.0068 587 PHE C CD2 
2074 C CE1 . PHE C 34  ? 0.4910 0.5392 0.4460 0.0561  -0.0035 -0.0208 587 PHE C CE1 
2075 C CE2 . PHE C 34  ? 0.4802 0.5103 0.4363 0.0561  -0.0099 -0.0080 587 PHE C CE2 
2076 C CZ  . PHE C 34  ? 0.4864 0.5225 0.4375 0.0550  -0.0058 -0.0153 587 PHE C CZ  
2077 N N   . ALA C 35  ? 0.3250 0.3716 0.3206 0.0531  0.0076  -0.0121 588 ALA C N   
2078 C CA  . ALA C 35  ? 0.3344 0.3798 0.3365 0.0515  0.0109  -0.0121 588 ALA C CA  
2079 C C   . ALA C 35  ? 0.3176 0.3680 0.3132 0.0469  0.0165  -0.0184 588 ALA C C   
2080 O O   . ALA C 35  ? 0.4303 0.4796 0.4233 0.0458  0.0162  -0.0184 588 ALA C O   
2081 C CB  . ALA C 35  ? 0.2945 0.3342 0.3138 0.0503  0.0171  -0.0098 588 ALA C CB  
2082 N N   . GLN C 36  ? 0.3820 0.4369 0.3744 0.0434  0.0220  -0.0237 589 GLN C N   
2083 C CA  . GLN C 36  ? 0.3468 0.4065 0.3324 0.0373  0.0276  -0.0300 589 GLN C CA  
2084 C C   . GLN C 36  ? 0.3923 0.4612 0.3686 0.0368  0.0249  -0.0343 589 GLN C C   
2085 O O   . GLN C 36  ? 0.4250 0.4950 0.4023 0.0399  0.0226  -0.0336 589 GLN C O   
2086 C CB  . GLN C 36  ? 0.2834 0.3390 0.2780 0.0312  0.0404  -0.0338 589 GLN C CB  
2087 C CG  . GLN C 36  ? 0.4252 0.4725 0.4330 0.0311  0.0451  -0.0308 589 GLN C CG  
2088 C CD  . GLN C 36  ? 0.7264 0.7720 0.7279 0.0278  0.0454  -0.0320 589 GLN C CD  
2089 O OE1 . GLN C 36  ? 0.6853 0.7343 0.6729 0.0225  0.0465  -0.0366 589 GLN C OE1 
2090 N NE2 . GLN C 36  ? 0.6415 0.6816 0.6530 0.0304  0.0442  -0.0279 589 GLN C NE2 
2091 N N   . PRO C 37  ? 0.4244 0.5000 0.3916 0.0323  0.0252  -0.0388 590 PRO C N   
2092 C CA  . PRO C 37  ? 0.3582 0.4445 0.3200 0.0320  0.0220  -0.0430 590 PRO C CA  
2093 C C   . PRO C 37  ? 0.3951 0.4823 0.3623 0.0292  0.0298  -0.0472 590 PRO C C   
2094 O O   . PRO C 37  ? 0.3729 0.4528 0.3467 0.0259  0.0392  -0.0478 590 PRO C O   
2095 C CB  . PRO C 37  ? 0.3621 0.4546 0.3142 0.0256  0.0220  -0.0471 590 PRO C CB  
2096 C CG  . PRO C 37  ? 0.3778 0.4615 0.3264 0.0244  0.0222  -0.0437 590 PRO C CG  
2097 C CD  . PRO C 37  ? 0.3717 0.4453 0.3322 0.0274  0.0269  -0.0399 590 PRO C CD  
2098 N N   . VAL C 38  ? 0.3210 0.4159 0.2865 0.0312  0.0262  -0.0498 591 VAL C N   
2099 C CA  . VAL C 38  ? 0.3640 0.4594 0.3326 0.0285  0.0332  -0.0542 591 VAL C CA  
2100 C C   . VAL C 38  ? 0.4101 0.5109 0.3766 0.0196  0.0418  -0.0614 591 VAL C C   
2101 O O   . VAL C 38  ? 0.5128 0.6233 0.4733 0.0164  0.0380  -0.0645 591 VAL C O   
2102 C CB  . VAL C 38  ? 0.4569 0.5602 0.4241 0.0319  0.0278  -0.0566 591 VAL C CB  
2103 C CG1 . VAL C 38  ? 0.3612 0.4676 0.3295 0.0269  0.0362  -0.0638 591 VAL C CG1 
2104 C CG2 . VAL C 38  ? 0.3517 0.4470 0.3194 0.0390  0.0216  -0.0501 591 VAL C CG2 
2105 N N   . SER C 39  ? 0.3510 0.4449 0.3218 0.0151  0.0529  -0.0639 592 SER C N   
2106 C CA  . SER C 39  ? 0.4451 0.5414 0.4138 0.0056  0.0633  -0.0711 592 SER C CA  
2107 C C   . SER C 39  ? 0.5069 0.6126 0.4733 0.0009  0.0672  -0.0791 592 SER C C   
2108 O O   . SER C 39  ? 0.4615 0.5643 0.4308 0.0037  0.0687  -0.0792 592 SER C O   
2109 C CB  . SER C 39  ? 0.4281 0.5111 0.4045 0.0031  0.0750  -0.0699 592 SER C CB  
2110 O OG  . SER C 39  ? 0.5794 0.6638 0.5535 -0.0068 0.0872  -0.0781 592 SER C OG  
2111 N N   . LEU C 40  ? 0.4554 0.5719 0.4158 -0.0069 0.0687  -0.0859 593 LEU C N   
2112 C CA  . LEU C 40  ? 0.4750 0.6021 0.4342 -0.0125 0.0727  -0.0945 593 LEU C CA  
2113 C C   . LEU C 40  ? 0.4754 0.5939 0.4359 -0.0204 0.0890  -0.1000 593 LEU C C   
2114 O O   . LEU C 40  ? 0.5166 0.6406 0.4768 -0.0254 0.0950  -0.1073 593 LEU C O   
2115 C CB  . LEU C 40  ? 0.4939 0.6372 0.4467 -0.0183 0.0665  -0.0994 593 LEU C CB  
2116 C CG  . LEU C 40  ? 0.3857 0.5384 0.3363 -0.0121 0.0507  -0.0945 593 LEU C CG  
2117 C CD1 . LEU C 40  ? 0.4405 0.6113 0.3868 -0.0192 0.0455  -0.1010 593 LEU C CD1 
2118 C CD2 . LEU C 40  ? 0.2478 0.4010 0.2052 -0.0010 0.0426  -0.0900 593 LEU C CD2 
2119 N N   . LYS C 41  ? 0.5217 0.6267 0.4851 -0.0216 0.0967  -0.0967 594 LYS C N   
2120 C CA  . LYS C 41  ? 0.6367 0.7300 0.6047 -0.0259 0.1119  -0.0997 594 LYS C CA  
2121 C C   . LYS C 41  ? 0.6123 0.6991 0.5847 -0.0189 0.1109  -0.0962 594 LYS C C   
2122 O O   . LYS C 41  ? 0.6423 0.7261 0.6142 -0.0233 0.1205  -0.1016 594 LYS C O   
2123 C CB  . LYS C 41  ? 0.6596 0.7387 0.6340 -0.0267 0.1202  -0.0959 594 LYS C CB  
2124 C CG  . LYS C 41  ? 0.6922 0.7739 0.6601 -0.0356 0.1240  -0.1001 594 LYS C CG  
2125 C CD  . LYS C 41  ? 0.9406 1.0221 0.9037 -0.0488 0.1394  -0.1103 594 LYS C CD  
2126 N N   . GLU C 42  ? 0.6513 0.7352 0.6263 -0.0090 0.0995  -0.0877 595 GLU C N   
2127 C CA  . GLU C 42  ? 0.6269 0.7026 0.6033 -0.0032 0.0975  -0.0835 595 GLU C CA  
2128 C C   . GLU C 42  ? 0.5771 0.6639 0.5481 -0.0025 0.0915  -0.0880 595 GLU C C   
2129 O O   . GLU C 42  ? 0.5639 0.6448 0.5330 -0.0024 0.0949  -0.0893 595 GLU C O   
2130 C CB  . GLU C 42  ? 0.5974 0.6633 0.5786 0.0057  0.0887  -0.0722 595 GLU C CB  
2131 C CG  . GLU C 42  ? 0.8585 0.9113 0.8495 0.0060  0.0957  -0.0673 595 GLU C CG  
2132 C CD  . GLU C 42  ? 0.8115 0.8584 0.8092 0.0140  0.0861  -0.0570 595 GLU C CD  
2133 O OE1 . GLU C 42  ? 0.9130 0.9544 0.9203 0.0137  0.0906  -0.0545 595 GLU C OE1 
2134 O OE2 . GLU C 42  ? 0.8418 0.8894 0.8357 0.0199  0.0749  -0.0520 595 GLU C OE2 
2135 N N   . VAL C 43  ? 0.5416 0.6437 0.5107 -0.0021 0.0829  -0.0904 596 VAL C N   
2136 C CA  . VAL C 43  ? 0.5334 0.6465 0.5015 0.0004  0.0758  -0.0935 596 VAL C CA  
2137 C C   . VAL C 43  ? 0.5550 0.6875 0.5228 -0.0042 0.0724  -0.1007 596 VAL C C   
2138 O O   . VAL C 43  ? 0.6143 0.7559 0.5826 0.0001  0.0611  -0.0978 596 VAL C O   
2139 C CB  . VAL C 43  ? 0.6015 0.7117 0.5702 0.0101  0.0635  -0.0851 596 VAL C CB  
2140 C CG1 . VAL C 43  ? 0.5206 0.6392 0.4899 0.0124  0.0592  -0.0889 596 VAL C CG1 
2141 C CG2 . VAL C 43  ? 0.4791 0.5708 0.4479 0.0145  0.0643  -0.0765 596 VAL C CG2 
2142 N N   . PRO C 44  ? 0.6099 0.7486 0.5766 -0.0134 0.0819  -0.1100 597 PRO C N   
2143 C CA  . PRO C 44  ? 0.5745 0.7309 0.5398 -0.0203 0.0794  -0.1167 597 PRO C CA  
2144 C C   . PRO C 44  ? 0.4954 0.6700 0.4649 -0.0162 0.0663  -0.1178 597 PRO C C   
2145 O O   . PRO C 44  ? 0.5662 0.7515 0.5333 -0.0180 0.0583  -0.1173 597 PRO C O   
2146 C CB  . PRO C 44  ? 0.5568 0.7149 0.5211 -0.0306 0.0931  -0.1270 597 PRO C CB  
2147 C CG  . PRO C 44  ? 0.6610 0.7983 0.6245 -0.0298 0.1042  -0.1238 597 PRO C CG  
2148 C CD  . PRO C 44  ? 0.6345 0.7627 0.6003 -0.0187 0.0959  -0.1146 597 PRO C CD  
2149 N N   . ASP C 45  ? 0.5488 0.7262 0.5243 -0.0110 0.0640  -0.1192 598 ASP C N   
2150 C CA  . ASP C 45  ? 0.5974 0.7921 0.5804 -0.0062 0.0522  -0.1203 598 ASP C CA  
2151 C C   . ASP C 45  ? 0.6086 0.7990 0.5926 0.0047  0.0402  -0.1103 598 ASP C C   
2152 O O   . ASP C 45  ? 0.6084 0.8106 0.6002 0.0100  0.0311  -0.1105 598 ASP C O   
2153 C CB  . ASP C 45  ? 0.6888 0.8903 0.6797 -0.0072 0.0570  -0.1286 598 ASP C CB  
2154 C CG  . ASP C 45  ? 0.7572 0.9415 0.7464 -0.0020 0.0613  -0.1252 598 ASP C CG  
2155 O OD1 . ASP C 45  ? 0.5858 0.7535 0.5684 0.0018  0.0608  -0.1164 598 ASP C OD1 
2156 O OD2 . ASP C 45  ? 0.8103 0.9976 0.8047 -0.0024 0.0652  -0.1315 598 ASP C OD2 
2157 N N   . TYR C 46  ? 0.5518 0.7261 0.5293 0.0078  0.0403  -0.1020 599 TYR C N   
2158 C CA  . TYR C 46  ? 0.4962 0.6643 0.4740 0.0174  0.0308  -0.0931 599 TYR C CA  
2159 C C   . TYR C 46  ? 0.5150 0.6964 0.4958 0.0221  0.0178  -0.0907 599 TYR C C   
2160 O O   . TYR C 46  ? 0.6151 0.7980 0.6013 0.0296  0.0115  -0.0882 599 TYR C O   
2161 C CB  . TYR C 46  ? 0.4570 0.6085 0.4287 0.0188  0.0324  -0.0852 599 TYR C CB  
2162 C CG  . TYR C 46  ? 0.4956 0.6394 0.4672 0.0278  0.0241  -0.0768 599 TYR C CG  
2163 C CD1 . TYR C 46  ? 0.4930 0.6278 0.4657 0.0319  0.0253  -0.0750 599 TYR C CD1 
2164 C CD2 . TYR C 46  ? 0.4731 0.6175 0.4419 0.0315  0.0154  -0.0710 599 TYR C CD2 
2165 C CE1 . TYR C 46  ? 0.5195 0.6471 0.4912 0.0390  0.0182  -0.0679 599 TYR C CE1 
2166 C CE2 . TYR C 46  ? 0.4830 0.6200 0.4515 0.0394  0.0085  -0.0638 599 TYR C CE2 
2167 C CZ  . TYR C 46  ? 0.4719 0.6010 0.4421 0.0429  0.0101  -0.0625 599 TYR C CZ  
2168 O OH  . TYR C 46  ? 0.4353 0.5566 0.4041 0.0494  0.0040  -0.0561 599 TYR C OH  
2169 N N   . LEU C 47  ? 0.5015 0.6911 0.4782 0.0174  0.0139  -0.0913 600 LEU C N   
2170 C CA  . LEU C 47  ? 0.4407 0.6409 0.4182 0.0216  0.0003  -0.0874 600 LEU C CA  
2171 C C   . LEU C 47  ? 0.4562 0.6771 0.4447 0.0215  -0.0053 -0.0936 600 LEU C C   
2172 O O   . LEU C 47  ? 0.3776 0.6089 0.3696 0.0258  -0.0176 -0.0903 600 LEU C O   
2173 C CB  . LEU C 47  ? 0.5430 0.7410 0.5084 0.0155  -0.0019 -0.0847 600 LEU C CB  
2174 C CG  . LEU C 47  ? 0.4842 0.6632 0.4408 0.0165  0.0017  -0.0780 600 LEU C CG  
2175 C CD1 . LEU C 47  ? 0.4638 0.6401 0.4086 0.0072  0.0042  -0.0785 600 LEU C CD1 
2176 C CD2 . LEU C 47  ? 0.3720 0.5453 0.3288 0.0267  -0.0080 -0.0695 600 LEU C CD2 
2177 N N   . ASP C 48  ? 0.4816 0.7088 0.4764 0.0163  0.0034  -0.1025 601 ASP C N   
2178 C CA  . ASP C 48  ? 0.5826 0.8299 0.5918 0.0167  -0.0006 -0.1094 601 ASP C CA  
2179 C C   . ASP C 48  ? 0.5607 0.8068 0.5814 0.0272  -0.0041 -0.1072 601 ASP C C   
2180 O O   . ASP C 48  ? 0.5297 0.7914 0.5643 0.0316  -0.0123 -0.1088 601 ASP C O   
2181 C CB  . ASP C 48  ? 0.6209 0.8741 0.6329 0.0070  0.0114  -0.1206 601 ASP C CB  
2182 C CG  . ASP C 48  ? 0.7254 0.9813 0.7266 -0.0046 0.0154  -0.1239 601 ASP C CG  
2183 O OD1 . ASP C 48  ? 0.7667 1.0200 0.7577 -0.0058 0.0087  -0.1179 601 ASP C OD1 
2184 O OD2 . ASP C 48  ? 0.6638 0.9230 0.6654 -0.0134 0.0263  -0.1331 601 ASP C OD2 
2185 N N   . HIS C 49  ? 0.5896 0.8165 0.6043 0.0309  0.0017  -0.1030 602 HIS C N   
2186 C CA  . HIS C 49  ? 0.5618 0.7824 0.5831 0.0391  0.0011  -0.1011 602 HIS C CA  
2187 C C   . HIS C 49  ? 0.5215 0.7315 0.5378 0.0476  -0.0073 -0.0905 602 HIS C C   
2188 O O   . HIS C 49  ? 0.6277 0.8404 0.6530 0.0549  -0.0124 -0.0890 602 HIS C O   
2189 C CB  . HIS C 49  ? 0.5979 0.8028 0.6135 0.0358  0.0137  -0.1041 602 HIS C CB  
2190 C CG  . HIS C 49  ? 0.8167 1.0291 0.8372 0.0280  0.0237  -0.1152 602 HIS C CG  
2191 N ND1 . HIS C 49  ? 0.9858 1.2019 1.0014 0.0192  0.0295  -0.1196 602 HIS C ND1 
2192 C CD2 . HIS C 49  ? 0.7100 0.9259 0.7393 0.0269  0.0303  -0.1233 602 HIS C CD2 
2193 C CE1 . HIS C 49  ? 0.9161 1.1379 0.9372 0.0133  0.0387  -0.1298 602 HIS C CE1 
2194 N NE2 . HIS C 49  ? 0.8746 1.0963 0.9041 0.0178  0.0394  -0.1323 602 HIS C NE2 
2195 N N   . ILE C 50  ? 0.3800 0.5772 0.3831 0.0464  -0.0076 -0.0837 603 ILE C N   
2196 C CA  . ILE C 50  ? 0.3939 0.5806 0.3914 0.0534  -0.0148 -0.0741 603 ILE C CA  
2197 C C   . ILE C 50  ? 0.3742 0.5676 0.3680 0.0544  -0.0252 -0.0694 603 ILE C C   
2198 O O   . ILE C 50  ? 0.4479 0.6409 0.4328 0.0479  -0.0242 -0.0692 603 ILE C O   
2199 C CB  . ILE C 50  ? 0.3547 0.5224 0.3409 0.0519  -0.0093 -0.0690 603 ILE C CB  
2200 C CG1 . ILE C 50  ? 0.3807 0.5391 0.3676 0.0507  -0.0005 -0.0720 603 ILE C CG1 
2201 C CG2 . ILE C 50  ? 0.2796 0.4381 0.2612 0.0585  -0.0165 -0.0604 603 ILE C CG2 
2202 C CD1 . ILE C 50  ? 0.5374 0.6975 0.5318 0.0559  -0.0017 -0.0742 603 ILE C CD1 
2203 N N   . LYS C 51  ? 0.3865 0.5837 0.3860 0.0623  -0.0346 -0.0653 604 LYS C N   
2204 C CA  . LYS C 51  ? 0.4854 0.6907 0.4829 0.0639  -0.0461 -0.0610 604 LYS C CA  
2205 C C   . LYS C 51  ? 0.4838 0.6736 0.4659 0.0649  -0.0492 -0.0523 604 LYS C C   
2206 O O   . LYS C 51  ? 0.5322 0.7234 0.5047 0.0612  -0.0548 -0.0495 604 LYS C O   
2207 C CB  . LYS C 51  ? 0.5509 0.7659 0.5638 0.0731  -0.0543 -0.0601 604 LYS C CB  
2208 C CG  . LYS C 51  ? 0.6201 0.8519 0.6390 0.0741  -0.0666 -0.0588 604 LYS C CG  
2209 C CD  . LYS C 51  ? 0.7726 1.0149 0.8125 0.0839  -0.0726 -0.0591 604 LYS C CD  
2210 N N   . HIS C 52  ? 0.4937 0.6685 0.4729 0.0692  -0.0456 -0.0484 605 HIS C N   
2211 C CA  . HIS C 52  ? 0.5365 0.6965 0.5031 0.0704  -0.0478 -0.0409 605 HIS C CA  
2212 C C   . HIS C 52  ? 0.3991 0.5453 0.3611 0.0674  -0.0383 -0.0407 605 HIS C C   
2213 O O   . HIS C 52  ? 0.3634 0.4995 0.3258 0.0720  -0.0374 -0.0374 605 HIS C O   
2214 C CB  . HIS C 52  ? 0.4960 0.6513 0.4649 0.0799  -0.0551 -0.0349 605 HIS C CB  
2215 C CG  . HIS C 52  ? 0.6336 0.8015 0.6087 0.0842  -0.0658 -0.0335 605 HIS C CG  
2216 N ND1 . HIS C 52  ? 0.7348 0.9025 0.6994 0.0830  -0.0744 -0.0283 605 HIS C ND1 
2217 C CD2 . HIS C 52  ? 0.5238 0.7051 0.5153 0.0893  -0.0693 -0.0366 605 HIS C CD2 
2218 C CE1 . HIS C 52  ? 0.3792 0.5596 0.3534 0.0878  -0.0842 -0.0273 605 HIS C CE1 
2219 N NE2 . HIS C 52  ? 0.7503 0.9400 0.7425 0.0920  -0.0812 -0.0325 605 HIS C NE2 
2220 N N   . PRO C 53  ? 0.4024 0.5479 0.3602 0.0593  -0.0315 -0.0439 606 PRO C N   
2221 C CA  . PRO C 53  ? 0.4103 0.5433 0.3661 0.0566  -0.0229 -0.0432 606 PRO C CA  
2222 C C   . PRO C 53  ? 0.3408 0.4603 0.2900 0.0590  -0.0248 -0.0362 606 PRO C C   
2223 O O   . PRO C 53  ? 0.3469 0.4658 0.2895 0.0601  -0.0310 -0.0328 606 PRO C O   
2224 C CB  . PRO C 53  ? 0.4030 0.5390 0.3562 0.0473  -0.0156 -0.0481 606 PRO C CB  
2225 C CG  . PRO C 53  ? 0.4668 0.6118 0.4142 0.0445  -0.0221 -0.0486 606 PRO C CG  
2226 C CD  . PRO C 53  ? 0.4161 0.5711 0.3697 0.0518  -0.0318 -0.0476 606 PRO C CD  
2227 N N   . MET C 54  ? 0.1920 0.3008 0.1429 0.0594  -0.0198 -0.0342 607 MET C N   
2228 C CA  . MET C 54  ? 0.1931 0.2902 0.1403 0.0617  -0.0214 -0.0282 607 MET C CA  
2229 C C   . MET C 54  ? 0.1996 0.2879 0.1511 0.0596  -0.0149 -0.0272 607 MET C C   
2230 O O   . MET C 54  ? 0.1844 0.2736 0.1404 0.0587  -0.0110 -0.0297 607 MET C O   
2231 C CB  . MET C 54  ? 0.2386 0.3331 0.1855 0.0691  -0.0281 -0.0244 607 MET C CB  
2232 C CG  . MET C 54  ? 0.4624 0.5450 0.4043 0.0714  -0.0305 -0.0183 607 MET C CG  
2233 S SD  . MET C 54  ? 0.4526 0.5306 0.3856 0.0675  -0.0310 -0.0162 607 MET C SD  
2234 C CE  . MET C 54  ? 0.3162 0.4053 0.2441 0.0684  -0.0380 -0.0176 607 MET C CE  
2235 N N   . ASP C 55  ? 0.2157 0.2953 0.1662 0.0585  -0.0136 -0.0234 608 ASP C N   
2236 C CA  . ASP C 55  ? 0.2704 0.3418 0.2280 0.0571  -0.0085 -0.0214 608 ASP C CA  
2237 C C   . ASP C 55  ? 0.2906 0.3537 0.2480 0.0583  -0.0105 -0.0165 608 ASP C C   
2238 O O   . ASP C 55  ? 0.2313 0.2938 0.1815 0.0594  -0.0144 -0.0154 608 ASP C O   
2239 C CB  . ASP C 55  ? 0.3403 0.4126 0.3023 0.0508  0.0002  -0.0253 608 ASP C CB  
2240 C CG  . ASP C 55  ? 0.5473 0.6203 0.5037 0.0461  0.0026  -0.0273 608 ASP C CG  
2241 O OD1 . ASP C 55  ? 0.3808 0.4620 0.3304 0.0441  0.0006  -0.0309 608 ASP C OD1 
2242 O OD2 . ASP C 55  ? 0.3040 0.3694 0.2628 0.0439  0.0062  -0.0255 608 ASP C OD2 
2243 N N   . PHE C 56  ? 0.3017 0.3582 0.2677 0.0578  -0.0078 -0.0137 609 PHE C N   
2244 C CA  . PHE C 56  ? 0.2018 0.2515 0.1697 0.0586  -0.0095 -0.0097 609 PHE C CA  
2245 C C   . PHE C 56  ? 0.2667 0.3143 0.2328 0.0541  -0.0045 -0.0118 609 PHE C C   
2246 O O   . PHE C 56  ? 0.3279 0.3707 0.2896 0.0547  -0.0069 -0.0097 609 PHE C O   
2247 C CB  . PHE C 56  ? 0.3511 0.3954 0.3306 0.0593  -0.0092 -0.0057 609 PHE C CB  
2248 C CG  . PHE C 56  ? 0.3657 0.4084 0.3424 0.0628  -0.0157 -0.0024 609 PHE C CG  
2249 C CD1 . PHE C 56  ? 0.3686 0.4103 0.3358 0.0658  -0.0219 -0.0009 609 PHE C CD1 
2250 C CD2 . PHE C 56  ? 0.3714 0.4120 0.3537 0.0624  -0.0152 -0.0007 609 PHE C CD2 
2251 C CE1 . PHE C 56  ? 0.4135 0.4523 0.3768 0.0676  -0.0263 0.0012  609 PHE C CE1 
2252 C CE2 . PHE C 56  ? 0.3987 0.4358 0.3754 0.0640  -0.0208 0.0020  609 PHE C CE2 
2253 C CZ  . PHE C 56  ? 0.4647 0.5010 0.4319 0.0662  -0.0259 0.0026  609 PHE C CZ  
2254 N N   . ALA C 57  ? 0.2524 0.3021 0.2215 0.0489  0.0032  -0.0161 610 ALA C N   
2255 C CA  . ALA C 57  ? 0.2813 0.3274 0.2475 0.0427  0.0097  -0.0191 610 ALA C CA  
2256 C C   . ALA C 57  ? 0.3579 0.4055 0.3070 0.0420  0.0046  -0.0197 610 ALA C C   
2257 O O   . ALA C 57  ? 0.4110 0.4518 0.3532 0.0394  0.0053  -0.0190 610 ALA C O   
2258 C CB  . ALA C 57  ? 0.2338 0.2815 0.2057 0.0362  0.0204  -0.0244 610 ALA C CB  
2259 N N   . THR C 58  ? 0.3830 0.4388 0.3254 0.0441  -0.0007 -0.0207 611 THR C N   
2260 C CA  . THR C 58  ? 0.4219 0.4797 0.3500 0.0451  -0.0080 -0.0198 611 THR C CA  
2261 C C   . THR C 58  ? 0.4482 0.5000 0.3721 0.0512  -0.0152 -0.0144 611 THR C C   
2262 O O   . THR C 58  ? 0.5245 0.5719 0.4364 0.0505  -0.0186 -0.0128 611 THR C O   
2263 C CB  . THR C 58  ? 0.4464 0.5156 0.3736 0.0476  -0.0129 -0.0218 611 THR C CB  
2264 O OG1 . THR C 58  ? 0.3727 0.4470 0.3043 0.0416  -0.0054 -0.0271 611 THR C OG1 
2265 C CG2 . THR C 58  ? 0.4621 0.5349 0.3763 0.0483  -0.0214 -0.0205 611 THR C CG2 
2266 N N   . MET C 59  ? 0.4242 0.4747 0.3563 0.0567  -0.0174 -0.0116 612 MET C N   
2267 C CA  . MET C 59  ? 0.4199 0.4637 0.3482 0.0614  -0.0227 -0.0071 612 MET C CA  
2268 C C   . MET C 59  ? 0.3711 0.4053 0.2983 0.0574  -0.0183 -0.0063 612 MET C C   
2269 O O   . MET C 59  ? 0.3780 0.4054 0.2950 0.0578  -0.0209 -0.0042 612 MET C O   
2270 C CB  . MET C 59  ? 0.3280 0.3718 0.2643 0.0661  -0.0252 -0.0049 612 MET C CB  
2271 C CG  . MET C 59  ? 0.4433 0.4946 0.3792 0.0702  -0.0291 -0.0062 612 MET C CG  
2272 S SD  . MET C 59  ? 0.4369 0.4848 0.3766 0.0741  -0.0318 -0.0038 612 MET C SD  
2273 C CE  . MET C 59  ? 0.4352 0.4728 0.3690 0.0764  -0.0354 0.0007  612 MET C CE  
2274 N N   . ARG C 60  ? 0.3863 0.4194 0.3249 0.0534  -0.0111 -0.0081 613 ARG C N   
2275 C CA  . ARG C 60  ? 0.4239 0.4486 0.3650 0.0488  -0.0052 -0.0085 613 ARG C CA  
2276 C C   . ARG C 60  ? 0.3976 0.4171 0.3234 0.0430  -0.0023 -0.0109 613 ARG C C   
2277 O O   . ARG C 60  ? 0.4343 0.4448 0.3552 0.0404  0.0000  -0.0105 613 ARG C O   
2278 C CB  . ARG C 60  ? 0.3471 0.3726 0.3056 0.0453  0.0030  -0.0108 613 ARG C CB  
2279 C CG  . ARG C 60  ? 0.4081 0.4257 0.3734 0.0401  0.0110  -0.0125 613 ARG C CG  
2280 C CD  . ARG C 60  ? 0.7119 0.7273 0.6902 0.0435  0.0083  -0.0088 613 ARG C CD  
2281 N NE  . ARG C 60  ? 0.6455 0.6664 0.6405 0.0470  0.0064  -0.0064 613 ARG C NE  
2282 C CZ  . ARG C 60  ? 0.7199 0.7407 0.7255 0.0505  0.0009  -0.0020 613 ARG C CZ  
2283 N NH1 . ARG C 60  ? 0.6384 0.6548 0.6408 0.0509  -0.0020 -0.0003 613 ARG C NH1 
2284 N NH2 . ARG C 60  ? 0.7084 0.7329 0.7264 0.0532  -0.0016 0.0008  613 ARG C NH2 
2285 N N   . LYS C 61  ? 0.3941 0.4189 0.3115 0.0401  -0.0024 -0.0135 614 LYS C N   
2286 C CA  . LYS C 61  ? 0.5070 0.5264 0.4080 0.0329  0.0000  -0.0157 614 LYS C CA  
2287 C C   . LYS C 61  ? 0.5368 0.5511 0.4215 0.0367  -0.0091 -0.0112 614 LYS C C   
2288 O O   . LYS C 61  ? 0.6566 0.6595 0.5300 0.0328  -0.0070 -0.0105 614 LYS C O   
2289 C CB  . LYS C 61  ? 0.5330 0.5608 0.4302 0.0282  0.0015  -0.0198 614 LYS C CB  
2290 C CG  . LYS C 61  ? 0.8755 0.8977 0.7532 0.0188  0.0036  -0.0222 614 LYS C CG  
2291 C CD  . LYS C 61  ? 0.9361 0.9647 0.8130 0.0107  0.0098  -0.0281 614 LYS C CD  
2292 C CE  . LYS C 61  ? 1.0345 1.0743 0.9021 0.0120  0.0000  -0.0276 614 LYS C CE  
2293 N NZ  . LYS C 61  ? 0.9455 0.9876 0.8042 0.0003  0.0060  -0.0335 614 LYS C NZ  
2294 N N   . ARG C 62  ? 0.5346 0.5564 0.4190 0.0444  -0.0185 -0.0082 615 ARG C N   
2295 C CA  . ARG C 62  ? 0.4768 0.4938 0.3507 0.0504  -0.0270 -0.0031 615 ARG C CA  
2296 C C   . ARG C 62  ? 0.4752 0.4811 0.3504 0.0522  -0.0251 -0.0007 615 ARG C C   
2297 O O   . ARG C 62  ? 0.4947 0.4901 0.3563 0.0520  -0.0272 0.0020  615 ARG C O   
2298 C CB  . ARG C 62  ? 0.4242 0.4519 0.3046 0.0588  -0.0348 -0.0014 615 ARG C CB  
2299 C CG  . ARG C 62  ? 0.4652 0.4888 0.3367 0.0654  -0.0433 0.0034  615 ARG C CG  
2300 C CD  . ARG C 62  ? 0.3922 0.4274 0.2709 0.0723  -0.0498 0.0038  615 ARG C CD  
2301 N NE  . ARG C 62  ? 0.5954 0.6256 0.4687 0.0796  -0.0569 0.0087  615 ARG C NE  
2302 C CZ  . ARG C 62  ? 0.6059 0.6434 0.4871 0.0872  -0.0621 0.0096  615 ARG C CZ  
2303 N NH1 . ARG C 62  ? 0.4483 0.4987 0.3423 0.0882  -0.0611 0.0056  615 ARG C NH1 
2304 N NH2 . ARG C 62  ? 0.4643 0.4951 0.3409 0.0936  -0.0674 0.0143  615 ARG C NH2 
2305 N N   . LEU C 63  ? 0.5016 0.5091 0.3924 0.0534  -0.0212 -0.0014 616 LEU C N   
2306 C CA  . LEU C 63  ? 0.5252 0.5235 0.4176 0.0543  -0.0200 0.0005  616 LEU C CA  
2307 C C   . LEU C 63  ? 0.5439 0.5308 0.4278 0.0464  -0.0128 -0.0015 616 LEU C C   
2308 O O   . LEU C 63  ? 0.5712 0.5474 0.4442 0.0462  -0.0135 0.0004  616 LEU C O   
2309 C CB  . LEU C 63  ? 0.5501 0.5528 0.4611 0.0561  -0.0183 0.0005  616 LEU C CB  
2310 C CG  . LEU C 63  ? 0.5183 0.5139 0.4342 0.0563  -0.0174 0.0022  616 LEU C CG  
2311 C CD1 . LEU C 63  ? 0.5708 0.5603 0.4741 0.0611  -0.0234 0.0056  616 LEU C CD1 
2312 C CD2 . LEU C 63  ? 0.5228 0.5245 0.4569 0.0579  -0.0179 0.0030  616 LEU C CD2 
2313 N N   . GLU C 64  ? 0.4975 0.4858 0.3852 0.0392  -0.0051 -0.0060 617 GLU C N   
2314 C CA  . GLU C 64  ? 0.5471 0.5241 0.4281 0.0302  0.0038  -0.0093 617 GLU C CA  
2315 C C   . GLU C 64  ? 0.6408 0.6080 0.4951 0.0265  0.0009  -0.0080 617 GLU C C   
2316 O O   . GLU C 64  ? 0.6408 0.5944 0.4840 0.0207  0.0060  -0.0090 617 GLU C O   
2317 C CB  . GLU C 64  ? 0.5268 0.5071 0.4197 0.0230  0.0144  -0.0151 617 GLU C CB  
2318 C CG  . GLU C 64  ? 0.7211 0.7092 0.6413 0.0260  0.0180  -0.0158 617 GLU C CG  
2319 C CD  . GLU C 64  ? 1.0259 1.0111 0.9586 0.0297  0.0168  -0.0133 617 GLU C CD  
2320 O OE1 . GLU C 64  ? 0.9416 0.9169 0.8645 0.0275  0.0177  -0.0131 617 GLU C OE1 
2321 O OE2 . GLU C 64  ? 1.2476 1.2402 1.1998 0.0341  0.0149  -0.0116 617 GLU C OE2 
2322 N N   . ALA C 65  ? 0.5262 0.4998 0.3704 0.0295  -0.0075 -0.0056 618 ALA C N   
2323 C CA  . ALA C 65  ? 0.6405 0.6054 0.4598 0.0270  -0.0131 -0.0028 618 ALA C CA  
2324 C C   . ALA C 65  ? 0.6930 0.6518 0.5042 0.0355  -0.0221 0.0036  618 ALA C C   
2325 O O   . ALA C 65  ? 0.7837 0.7395 0.5786 0.0374  -0.0305 0.0078  618 ALA C O   
2326 C CB  . ALA C 65  ? 0.5497 0.5252 0.3628 0.0257  -0.0190 -0.0031 618 ALA C CB  
2327 N N   . GLN C 66  ? 0.6727 0.6296 0.4955 0.0405  -0.0205 0.0045  619 GLN C N   
2328 C CA  . GLN C 66  ? 0.7459 0.6968 0.5625 0.0483  -0.0274 0.0098  619 GLN C CA  
2329 C C   . GLN C 66  ? 0.7272 0.6872 0.5426 0.0569  -0.0384 0.0140  619 GLN C C   
2330 O O   . GLN C 66  ? 0.6364 0.5891 0.4399 0.0618  -0.0451 0.0191  619 GLN C O   
2331 C CB  . GLN C 66  ? 0.7697 0.7015 0.5647 0.0434  -0.0253 0.0115  619 GLN C CB  
2332 N N   . GLY C 67  ? 0.6546 0.6304 0.4837 0.0586  -0.0398 0.0117  620 GLY C N   
2333 C CA  . GLY C 67  ? 0.6479 0.6349 0.4794 0.0656  -0.0491 0.0140  620 GLY C CA  
2334 C C   . GLY C 67  ? 0.6165 0.6088 0.4602 0.0754  -0.0530 0.0160  620 GLY C C   
2335 O O   . GLY C 67  ? 0.5913 0.5920 0.4383 0.0816  -0.0601 0.0177  620 GLY C O   
2336 N N   . TYR C 68  ? 0.5205 0.5081 0.3715 0.0765  -0.0485 0.0155  621 TYR C N   
2337 C CA  . TYR C 68  ? 0.5264 0.5158 0.3854 0.0843  -0.0514 0.0172  621 TYR C CA  
2338 C C   . TYR C 68  ? 0.5805 0.5553 0.4288 0.0877  -0.0527 0.0213  621 TYR C C   
2339 O O   . TYR C 68  ? 0.5985 0.5625 0.4415 0.0836  -0.0480 0.0212  621 TYR C O   
2340 C CB  . TYR C 68  ? 0.5434 0.5375 0.4165 0.0831  -0.0468 0.0143  621 TYR C CB  
2341 C CG  . TYR C 68  ? 0.4188 0.4265 0.3031 0.0815  -0.0457 0.0107  621 TYR C CG  
2342 C CD1 . TYR C 68  ? 0.5061 0.5241 0.3955 0.0862  -0.0498 0.0100  621 TYR C CD1 
2343 C CD2 . TYR C 68  ? 0.4423 0.4523 0.3333 0.0753  -0.0399 0.0078  621 TYR C CD2 
2344 C CE1 . TYR C 68  ? 0.5495 0.5792 0.4483 0.0842  -0.0481 0.0062  621 TYR C CE1 
2345 C CE2 . TYR C 68  ? 0.4547 0.4756 0.3552 0.0738  -0.0382 0.0045  621 TYR C CE2 
2346 C CZ  . TYR C 68  ? 0.5047 0.5352 0.4080 0.0780  -0.0422 0.0036  621 TYR C CZ  
2347 O OH  . TYR C 68  ? 0.3684 0.4090 0.2800 0.0759  -0.0398 0.0000  621 TYR C OH  
2348 N N   . LYS C 69  ? 0.6352 0.6099 0.4815 0.0952  -0.0588 0.0247  622 LYS C N   
2349 C CA  . LYS C 69  ? 0.7657 0.7256 0.6017 0.0991  -0.0599 0.0291  622 LYS C CA  
2350 C C   . LYS C 69  ? 0.7401 0.6952 0.5820 0.1006  -0.0553 0.0279  622 LYS C C   
2351 O O   . LYS C 69  ? 0.7835 0.7245 0.6162 0.0992  -0.0523 0.0294  622 LYS C O   
2352 C CB  . LYS C 69  ? 0.8038 0.7655 0.6388 0.1075  -0.0680 0.0334  622 LYS C CB  
2353 C CG  . LYS C 69  ? 0.8676 0.8136 0.6937 0.1129  -0.0690 0.0384  622 LYS C CG  
2354 C CD  . LYS C 69  ? 1.0486 0.9974 0.8766 0.1216  -0.0779 0.0433  622 LYS C CD  
2355 N N   . ASN C 70  ? 0.7023 0.6681 0.5581 0.1024  -0.0547 0.0251  623 ASN C N   
2356 C CA  . ASN C 70  ? 0.6848 0.6467 0.5452 0.1024  -0.0509 0.0237  623 ASN C CA  
2357 C C   . ASN C 70  ? 0.6220 0.5957 0.4949 0.0995  -0.0493 0.0199  623 ASN C C   
2358 O O   . ASN C 70  ? 0.5967 0.5813 0.4753 0.0983  -0.0505 0.0181  623 ASN C O   
2359 C CB  . ASN C 70  ? 0.6256 0.5825 0.4860 0.1098  -0.0522 0.0256  623 ASN C CB  
2360 C CG  . ASN C 70  ? 0.7179 0.6869 0.5879 0.1157  -0.0565 0.0252  623 ASN C CG  
2361 O OD1 . ASN C 70  ? 0.7415 0.7224 0.6216 0.1143  -0.0560 0.0215  623 ASN C OD1 
2362 N ND2 . ASN C 70  ? 0.7669 0.7327 0.6342 0.1222  -0.0611 0.0291  623 ASN C ND2 
2363 N N   . LEU C 71  ? 0.5202 0.4908 0.3959 0.0976  -0.0466 0.0187  624 LEU C N   
2364 C CA  . LEU C 71  ? 0.5516 0.5309 0.4368 0.0944  -0.0458 0.0160  624 LEU C CA  
2365 C C   . LEU C 71  ? 0.5692 0.5582 0.4610 0.0986  -0.0473 0.0140  624 LEU C C   
2366 O O   . LEU C 71  ? 0.4742 0.4732 0.3730 0.0968  -0.0473 0.0118  624 LEU C O   
2367 C CB  . LEU C 71  ? 0.4613 0.4339 0.3453 0.0913  -0.0439 0.0158  624 LEU C CB  
2368 C CG  . LEU C 71  ? 0.5597 0.5369 0.4502 0.0859  -0.0440 0.0147  624 LEU C CG  
2369 C CD1 . LEU C 71  ? 0.4615 0.4332 0.3482 0.0847  -0.0430 0.0139  624 LEU C CD1 
2370 C CD2 . LEU C 71  ? 0.5334 0.5220 0.4324 0.0858  -0.0447 0.0131  624 LEU C CD2 
2371 N N   . HIS C 72  ? 0.5401 0.5258 0.4308 0.1042  -0.0478 0.0145  625 HIS C N   
2372 C CA  . HIS C 72  ? 0.5270 0.5225 0.4266 0.1083  -0.0485 0.0118  625 HIS C CA  
2373 C C   . HIS C 72  ? 0.4925 0.5011 0.3973 0.1087  -0.0518 0.0109  625 HIS C C   
2374 O O   . HIS C 72  ? 0.4350 0.4540 0.3481 0.1079  -0.0510 0.0073  625 HIS C O   
2375 C CB  . HIS C 72  ? 0.4805 0.4706 0.3806 0.1151  -0.0486 0.0129  625 HIS C CB  
2376 C CG  . HIS C 72  ? 0.5883 0.5892 0.5004 0.1199  -0.0494 0.0100  625 HIS C CG  
2377 N ND1 . HIS C 72  ? 0.7589 0.7625 0.6777 0.1183  -0.0448 0.0052  625 HIS C ND1 
2378 C CD2 . HIS C 72  ? 0.7353 0.7452 0.6542 0.1256  -0.0543 0.0110  625 HIS C CD2 
2379 C CE1 . HIS C 72  ? 0.8165 0.8307 0.7473 0.1231  -0.0459 0.0026  625 HIS C CE1 
2380 N NE2 . HIS C 72  ? 0.6699 0.6890 0.6020 0.1278  -0.0523 0.0063  625 HIS C NE2 
2381 N N   . GLU C 73  ? 0.4815 0.4885 0.3799 0.1087  -0.0549 0.0138  626 GLU C N   
2382 C CA  . GLU C 73  ? 0.5216 0.5399 0.4224 0.1071  -0.0576 0.0127  626 GLU C CA  
2383 C C   . GLU C 73  ? 0.4497 0.4732 0.3544 0.1005  -0.0537 0.0095  626 GLU C C   
2384 O O   . GLU C 73  ? 0.4337 0.4684 0.3446 0.0992  -0.0537 0.0064  626 GLU C O   
2385 C CB  . GLU C 73  ? 0.5002 0.5132 0.3898 0.1067  -0.0613 0.0165  626 GLU C CB  
2386 C CG  . GLU C 73  ? 0.5591 0.5704 0.4467 0.1143  -0.0676 0.0204  626 GLU C CG  
2387 C CD  . GLU C 73  ? 0.5857 0.5913 0.4595 0.1128  -0.0725 0.0247  626 GLU C CD  
2388 O OE1 . GLU C 73  ? 0.6173 0.6202 0.4883 0.1188  -0.0788 0.0291  626 GLU C OE1 
2389 O OE2 . GLU C 73  ? 0.6970 0.6996 0.5625 0.1053  -0.0697 0.0237  626 GLU C OE2 
2390 N N   . PHE C 74  ? 0.4555 0.4712 0.3578 0.0965  -0.0504 0.0102  627 PHE C N   
2391 C CA  . PHE C 74  ? 0.3411 0.3605 0.2493 0.0909  -0.0470 0.0081  627 PHE C CA  
2392 C C   . PHE C 74  ? 0.3815 0.4068 0.2972 0.0912  -0.0459 0.0054  627 PHE C C   
2393 O O   . PHE C 74  ? 0.3405 0.3739 0.2618 0.0887  -0.0443 0.0028  627 PHE C O   
2394 C CB  . PHE C 74  ? 0.4574 0.4674 0.3634 0.0874  -0.0450 0.0101  627 PHE C CB  
2395 C CG  . PHE C 74  ? 0.3359 0.3489 0.2500 0.0824  -0.0422 0.0090  627 PHE C CG  
2396 C CD1 . PHE C 74  ? 0.3828 0.3951 0.3018 0.0811  -0.0424 0.0095  627 PHE C CD1 
2397 C CD2 . PHE C 74  ? 0.3188 0.3341 0.2354 0.0786  -0.0392 0.0079  627 PHE C CD2 
2398 C CE1 . PHE C 74  ? 0.3145 0.3289 0.2423 0.0771  -0.0408 0.0097  627 PHE C CE1 
2399 C CE2 . PHE C 74  ? 0.2889 0.3063 0.2157 0.0746  -0.0361 0.0071  627 PHE C CE2 
2400 C CZ  . PHE C 74  ? 0.2374 0.2548 0.1706 0.0745  -0.0374 0.0085  627 PHE C CZ  
2401 N N   . GLU C 75  ? 0.3192 0.3392 0.2336 0.0932  -0.0458 0.0057  628 GLU C N   
2402 C CA  . GLU C 75  ? 0.4553 0.4786 0.3741 0.0927  -0.0440 0.0026  628 GLU C CA  
2403 C C   . GLU C 75  ? 0.4095 0.4446 0.3350 0.0950  -0.0439 -0.0012 628 GLU C C   
2404 O O   . GLU C 75  ? 0.4356 0.4762 0.3656 0.0923  -0.0415 -0.0044 628 GLU C O   
2405 C CB  . GLU C 75  ? 0.4565 0.4714 0.3715 0.0944  -0.0429 0.0025  628 GLU C CB  
2406 C CG  . GLU C 75  ? 0.7112 0.7146 0.6191 0.0905  -0.0426 0.0053  628 GLU C CG  
2407 C CD  . GLU C 75  ? 0.9782 0.9719 0.8804 0.0920  -0.0406 0.0049  628 GLU C CD  
2408 O OE1 . GLU C 75  ? 0.8979 0.8936 0.8033 0.0950  -0.0383 0.0017  628 GLU C OE1 
2409 O OE2 . GLU C 75  ? 0.7342 0.7183 0.6295 0.0899  -0.0407 0.0073  628 GLU C OE2 
2410 N N   . GLU C 76  ? 0.4408 0.4794 0.3669 0.0999  -0.0469 -0.0006 629 GLU C N   
2411 C CA  . GLU C 76  ? 0.4809 0.5322 0.4148 0.1024  -0.0482 -0.0039 629 GLU C CA  
2412 C C   . GLU C 76  ? 0.4362 0.4958 0.3725 0.0973  -0.0466 -0.0065 629 GLU C C   
2413 O O   . GLU C 76  ? 0.4046 0.4731 0.3477 0.0962  -0.0445 -0.0112 629 GLU C O   
2414 C CB  . GLU C 76  ? 0.4761 0.5290 0.4082 0.1073  -0.0539 -0.0008 629 GLU C CB  
2415 C CG  . GLU C 76  ? 0.8708 0.9338 0.8132 0.1131  -0.0568 -0.0028 629 GLU C CG  
2416 C CD  . GLU C 76  ? 1.0487 1.1040 0.9909 0.1202  -0.0595 0.0008  629 GLU C CD  
2417 O OE1 . GLU C 76  ? 1.0145 1.0678 0.9638 0.1232  -0.0558 -0.0016 629 GLU C OE1 
2418 O OE2 . GLU C 76  ? 0.9455 0.9956 0.8798 0.1223  -0.0645 0.0061  629 GLU C OE2 
2419 N N   . ASP C 77  ? 0.3626 0.4187 0.2935 0.0936  -0.0466 -0.0041 630 ASP C N   
2420 C CA  . ASP C 77  ? 0.3709 0.4337 0.3043 0.0884  -0.0438 -0.0068 630 ASP C CA  
2421 C C   . ASP C 77  ? 0.3380 0.3990 0.2755 0.0849  -0.0390 -0.0086 630 ASP C C   
2422 O O   . ASP C 77  ? 0.3562 0.4241 0.2983 0.0821  -0.0359 -0.0125 630 ASP C O   
2423 C CB  . ASP C 77  ? 0.3667 0.4252 0.2939 0.0848  -0.0435 -0.0045 630 ASP C CB  
2424 C CG  . ASP C 77  ? 0.4290 0.4931 0.3514 0.0849  -0.0474 -0.0046 630 ASP C CG  
2425 O OD1 . ASP C 77  ? 0.5363 0.6104 0.4631 0.0877  -0.0507 -0.0067 630 ASP C OD1 
2426 O OD2 . ASP C 77  ? 0.3443 0.4025 0.2584 0.0817  -0.0473 -0.0027 630 ASP C OD2 
2427 N N   . PHE C 78  ? 0.3857 0.4369 0.3208 0.0846  -0.0388 -0.0056 631 PHE C N   
2428 C CA  . PHE C 78  ? 0.3398 0.3879 0.2772 0.0814  -0.0361 -0.0061 631 PHE C CA  
2429 C C   . PHE C 78  ? 0.4744 0.5267 0.4138 0.0818  -0.0340 -0.0105 631 PHE C C   
2430 O O   . PHE C 78  ? 0.4436 0.4975 0.3853 0.0783  -0.0306 -0.0128 631 PHE C O   
2431 C CB  . PHE C 78  ? 0.3419 0.3793 0.2754 0.0807  -0.0378 -0.0018 631 PHE C CB  
2432 C CG  . PHE C 78  ? 0.3821 0.4153 0.3163 0.0770  -0.0367 -0.0011 631 PHE C CG  
2433 C CD1 . PHE C 78  ? 0.5983 0.6254 0.5267 0.0761  -0.0371 -0.0014 631 PHE C CD1 
2434 C CD2 . PHE C 78  ? 0.3420 0.3766 0.2819 0.0739  -0.0349 -0.0003 631 PHE C CD2 
2435 C CE1 . PHE C 78  ? 0.5684 0.5902 0.4946 0.0718  -0.0368 -0.0003 631 PHE C CE1 
2436 C CE2 . PHE C 78  ? 0.3965 0.4263 0.3364 0.0707  -0.0349 0.0012  631 PHE C CE2 
2437 C CZ  . PHE C 78  ? 0.4859 0.5090 0.4178 0.0694  -0.0364 0.0015  631 PHE C CZ  
2438 N N   . ASP C 79  ? 0.3743 0.4277 0.3134 0.0858  -0.0353 -0.0120 632 ASP C N   
2439 C CA  . ASP C 79  ? 0.4441 0.5010 0.3865 0.0858  -0.0320 -0.0172 632 ASP C CA  
2440 C C   . ASP C 79  ? 0.4240 0.4941 0.3737 0.0851  -0.0304 -0.0222 632 ASP C C   
2441 O O   . ASP C 79  ? 0.3811 0.4542 0.3336 0.0823  -0.0259 -0.0271 632 ASP C O   
2442 C CB  . ASP C 79  ? 0.4905 0.5458 0.4342 0.0906  -0.0326 -0.0183 632 ASP C CB  
2443 C CG  . ASP C 79  ? 0.5491 0.5902 0.4844 0.0897  -0.0324 -0.0151 632 ASP C CG  
2444 O OD1 . ASP C 79  ? 0.4782 0.5109 0.4067 0.0846  -0.0317 -0.0129 632 ASP C OD1 
2445 O OD2 . ASP C 79  ? 0.5440 0.5826 0.4802 0.0943  -0.0330 -0.0147 632 ASP C OD2 
2446 N N   . LEU C 80  ? 0.3978 0.4754 0.3495 0.0868  -0.0338 -0.0213 633 LEU C N   
2447 C CA  . LEU C 80  ? 0.2281 0.3178 0.1849 0.0842  -0.0322 -0.0258 633 LEU C CA  
2448 C C   . LEU C 80  ? 0.3180 0.4056 0.2740 0.0781  -0.0265 -0.0275 633 LEU C C   
2449 O O   . LEU C 80  ? 0.2822 0.3770 0.2424 0.0753  -0.0224 -0.0331 633 LEU C O   
2450 C CB  . LEU C 80  ? 0.3704 0.4658 0.3254 0.0848  -0.0368 -0.0237 633 LEU C CB  
2451 C CG  . LEU C 80  ? 0.3675 0.4751 0.3285 0.0887  -0.0418 -0.0257 633 LEU C CG  
2452 C CD1 . LEU C 80  ? 0.3790 0.4893 0.3337 0.0875  -0.0471 -0.0226 633 LEU C CD1 
2453 C CD2 . LEU C 80  ? 0.4042 0.5239 0.3740 0.0861  -0.0381 -0.0330 633 LEU C CD2 
2454 N N   . ILE C 81  ? 0.3185 0.3963 0.2702 0.0761  -0.0260 -0.0229 634 ILE C N   
2455 C CA  . ILE C 81  ? 0.3094 0.3848 0.2623 0.0712  -0.0209 -0.0237 634 ILE C CA  
2456 C C   . ILE C 81  ? 0.3012 0.3735 0.2535 0.0696  -0.0175 -0.0266 634 ILE C C   
2457 O O   . ILE C 81  ? 0.3300 0.4057 0.2844 0.0660  -0.0125 -0.0310 634 ILE C O   
2458 C CB  . ILE C 81  ? 0.3434 0.4086 0.2951 0.0699  -0.0214 -0.0179 634 ILE C CB  
2459 C CG1 . ILE C 81  ? 0.3912 0.4586 0.3432 0.0697  -0.0223 -0.0165 634 ILE C CG1 
2460 C CG2 . ILE C 81  ? 0.2052 0.2666 0.1598 0.0658  -0.0164 -0.0182 634 ILE C CG2 
2461 C CD1 . ILE C 81  ? 0.2613 0.3204 0.2143 0.0689  -0.0226 -0.0116 634 ILE C CD1 
2462 N N   . ILE C 82  ? 0.3248 0.3895 0.2728 0.0714  -0.0196 -0.0247 635 ILE C N   
2463 C CA  . ILE C 82  ? 0.2686 0.3271 0.2128 0.0684  -0.0160 -0.0272 635 ILE C CA  
2464 C C   . ILE C 82  ? 0.3331 0.4010 0.2822 0.0682  -0.0116 -0.0354 635 ILE C C   
2465 O O   . ILE C 82  ? 0.3552 0.4220 0.3032 0.0639  -0.0060 -0.0398 635 ILE C O   
2466 C CB  . ILE C 82  ? 0.3351 0.3828 0.2722 0.0693  -0.0188 -0.0238 635 ILE C CB  
2467 C CG1 . ILE C 82  ? 0.4175 0.4565 0.3508 0.0688  -0.0235 -0.0160 635 ILE C CG1 
2468 C CG2 . ILE C 82  ? 0.2085 0.2489 0.1394 0.0653  -0.0144 -0.0274 635 ILE C CG2 
2469 C CD1 . ILE C 82  ? 0.2124 0.2476 0.1466 0.0652  -0.0227 -0.0131 635 ILE C CD1 
2470 N N   . ASP C 83  ? 0.2757 0.3526 0.2307 0.0730  -0.0144 -0.0373 636 ASP C N   
2471 C CA  . ASP C 83  ? 0.4157 0.5035 0.3794 0.0739  -0.0114 -0.0450 636 ASP C CA  
2472 C C   . ASP C 83  ? 0.3354 0.4357 0.3053 0.0709  -0.0086 -0.0503 636 ASP C C   
2473 O O   . ASP C 83  ? 0.5148 0.6208 0.4899 0.0685  -0.0032 -0.0577 636 ASP C O   
2474 C CB  . ASP C 83  ? 0.2871 0.3817 0.2581 0.0809  -0.0165 -0.0445 636 ASP C CB  
2475 C CG  . ASP C 83  ? 0.4411 0.5241 0.4081 0.0830  -0.0160 -0.0426 636 ASP C CG  
2476 O OD1 . ASP C 83  ? 0.7376 0.8106 0.6983 0.0784  -0.0105 -0.0449 636 ASP C OD1 
2477 O OD2 . ASP C 83  ? 0.5296 0.6120 0.4982 0.0887  -0.0209 -0.0388 636 ASP C OD2 
2478 N N   . ASN C 84  ? 0.3685 0.4727 0.3376 0.0703  -0.0113 -0.0473 637 ASN C N   
2479 C CA  . ASN C 84  ? 0.2671 0.3816 0.2400 0.0660  -0.0078 -0.0524 637 ASN C CA  
2480 C C   . ASN C 84  ? 0.3070 0.4129 0.2755 0.0601  0.0001  -0.0546 637 ASN C C   
2481 O O   . ASN C 84  ? 0.2782 0.3897 0.2499 0.0561  0.0061  -0.0617 637 ASN C O   
2482 C CB  . ASN C 84  ? 0.3484 0.4658 0.3191 0.0651  -0.0110 -0.0488 637 ASN C CB  
2483 C CG  . ASN C 84  ? 0.3786 0.5042 0.3514 0.0696  -0.0191 -0.0466 637 ASN C CG  
2484 O OD1 . ASN C 84  ? 0.3691 0.5033 0.3490 0.0736  -0.0224 -0.0490 637 ASN C OD1 
2485 N ND2 . ASN C 84  ? 0.4742 0.5967 0.4411 0.0688  -0.0220 -0.0419 637 ASN C ND2 
2486 N N   . CYS C 85  ? 0.2390 0.3308 0.2004 0.0594  0.0000  -0.0483 638 CYS C N   
2487 C CA  . CYS C 85  ? 0.2406 0.3229 0.1974 0.0542  0.0065  -0.0492 638 CYS C CA  
2488 C C   . CYS C 85  ? 0.3879 0.4662 0.3416 0.0516  0.0113  -0.0545 638 CYS C C   
2489 O O   . CYS C 85  ? 0.3970 0.4718 0.3481 0.0464  0.0184  -0.0586 638 CYS C O   
2490 C CB  . CYS C 85  ? 0.3201 0.3888 0.2718 0.0543  0.0039  -0.0407 638 CYS C CB  
2491 S SG  . CYS C 85  ? 0.4156 0.4723 0.3624 0.0487  0.0104  -0.0404 638 CYS C SG  
2492 N N   . MET C 86  ? 0.4443 0.5219 0.3979 0.0548  0.0086  -0.0549 639 MET C N   
2493 C CA  . MET C 86  ? 0.3766 0.4486 0.3267 0.0515  0.0144  -0.0607 639 MET C CA  
2494 C C   . MET C 86  ? 0.4815 0.5686 0.4427 0.0507  0.0194  -0.0707 639 MET C C   
2495 O O   . MET C 86  ? 0.5279 0.6122 0.4870 0.0452  0.0275  -0.0775 639 MET C O   
2496 C CB  . MET C 86  ? 0.3577 0.4213 0.3033 0.0541  0.0113  -0.0580 639 MET C CB  
2497 C CG  . MET C 86  ? 0.3659 0.4121 0.2980 0.0520  0.0077  -0.0492 639 MET C CG  
2498 S SD  . MET C 86  ? 0.5950 0.6302 0.5195 0.0537  0.0038  -0.0453 639 MET C SD  
2499 C CE  . MET C 86  ? 0.4386 0.4701 0.3610 0.0490  0.0135  -0.0555 639 MET C CE  
2500 N N   . LYS C 87  ? 0.4816 0.5844 0.4544 0.0558  0.0142  -0.0716 640 LYS C N   
2501 C CA  . LYS C 87  ? 0.4677 0.5878 0.4536 0.0553  0.0170  -0.0805 640 LYS C CA  
2502 C C   . LYS C 87  ? 0.4411 0.5659 0.4263 0.0488  0.0229  -0.0853 640 LYS C C   
2503 O O   . LYS C 87  ? 0.4929 0.6234 0.4832 0.0445  0.0301  -0.0943 640 LYS C O   
2504 C CB  . LYS C 87  ? 0.5439 0.6792 0.5409 0.0619  0.0081  -0.0786 640 LYS C CB  
2505 C CG  . LYS C 87  ? 0.6827 0.8362 0.6962 0.0625  0.0093  -0.0874 640 LYS C CG  
2506 C CD  . LYS C 87  ? 0.6810 0.8515 0.7010 0.0627  0.0032  -0.0876 640 LYS C CD  
2507 C CE  . LYS C 87  ? 0.7808 0.9588 0.8072 0.0706  -0.0080 -0.0817 640 LYS C CE  
2508 N NZ  . LYS C 87  ? 0.4717 0.6715 0.5131 0.0708  -0.0124 -0.0869 640 LYS C NZ  
2509 N N   . TYR C 88  ? 0.4228 0.5445 0.4023 0.0476  0.0211  -0.0800 641 TYR C N   
2510 C CA  . TYR C 88  ? 0.3878 0.5143 0.3675 0.0414  0.0273  -0.0848 641 TYR C CA  
2511 C C   . TYR C 88  ? 0.3894 0.5020 0.3606 0.0351  0.0371  -0.0876 641 TYR C C   
2512 O O   . TYR C 88  ? 0.4831 0.6014 0.4571 0.0297  0.0450  -0.0964 641 TYR C O   
2513 C CB  . TYR C 88  ? 0.3586 0.4850 0.3354 0.0412  0.0242  -0.0791 641 TYR C CB  
2514 C CG  . TYR C 88  ? 0.2410 0.3692 0.2169 0.0338  0.0328  -0.0844 641 TYR C CG  
2515 C CD1 . TYR C 88  ? 0.4848 0.5975 0.4535 0.0304  0.0392  -0.0815 641 TYR C CD1 
2516 C CD2 . TYR C 88  ? 0.5436 0.6886 0.5264 0.0300  0.0349  -0.0927 641 TYR C CD2 
2517 C CE1 . TYR C 88  ? 0.5489 0.6619 0.5170 0.0236  0.0486  -0.0868 641 TYR C CE1 
2518 C CE2 . TYR C 88  ? 0.4315 0.5777 0.4128 0.0224  0.0439  -0.0985 641 TYR C CE2 
2519 C CZ  . TYR C 88  ? 0.4124 0.5419 0.3861 0.0193  0.0514  -0.0957 641 TYR C CZ  
2520 O OH  . TYR C 88  ? 0.5143 0.6440 0.4868 0.0116  0.0614  -0.1016 641 TYR C OH  
2521 N N   . ASN C 89  ? 0.3287 0.4232 0.2894 0.0355  0.0364  -0.0801 642 ASN C N   
2522 C CA  . ASN C 89  ? 0.3607 0.4391 0.3110 0.0296  0.0442  -0.0805 642 ASN C CA  
2523 C C   . ASN C 89  ? 0.5176 0.5877 0.4617 0.0264  0.0492  -0.0854 642 ASN C C   
2524 O O   . ASN C 89  ? 0.4369 0.5066 0.3815 0.0296  0.0453  -0.0848 642 ASN C O   
2525 C CB  . ASN C 89  ? 0.3966 0.4589 0.3388 0.0312  0.0399  -0.0693 642 ASN C CB  
2526 C CG  . ASN C 89  ? 0.6372 0.7049 0.5855 0.0330  0.0377  -0.0652 642 ASN C CG  
2527 O OD1 . ASN C 89  ? 0.3533 0.4215 0.3031 0.0289  0.0445  -0.0682 642 ASN C OD1 
2528 N ND2 . ASN C 89  ? 0.5682 0.6399 0.5201 0.0384  0.0293  -0.0594 642 ASN C ND2 
2529 N N   . ALA C 90  ? 0.5426 0.6039 0.4795 0.0194  0.0587  -0.0904 643 ALA C N   
2530 C CA  . ALA C 90  ? 0.4839 0.5323 0.4105 0.0143  0.0651  -0.0948 643 ALA C CA  
2531 C C   . ALA C 90  ? 0.5250 0.5536 0.4370 0.0148  0.0595  -0.0853 643 ALA C C   
2532 O O   . ALA C 90  ? 0.4943 0.5154 0.4022 0.0176  0.0525  -0.0748 643 ALA C O   
2533 C CB  . ALA C 90  ? 0.4680 0.5082 0.3873 0.0063  0.0762  -0.1006 643 ALA C CB  
2534 N N   . ARG C 91  ? 0.5623 0.5829 0.4671 0.0117  0.0628  -0.0894 644 ARG C N   
2535 C CA  . ARG C 91  ? 0.5897 0.5922 0.4793 0.0108  0.0577  -0.0817 644 ARG C CA  
2536 C C   . ARG C 91  ? 0.6191 0.6009 0.4913 0.0064  0.0560  -0.0727 644 ARG C C   
2537 O O   . ARG C 91  ? 0.5023 0.4738 0.3664 0.0079  0.0473  -0.0626 644 ARG C O   
2538 C CB  . ARG C 91  ? 0.5471 0.5421 0.4298 0.0053  0.0651  -0.0899 644 ARG C CB  
2539 N N   . ASP C 92  ? 0.6694 0.6450 0.5364 0.0009  0.0642  -0.0764 645 ASP C N   
2540 C CA  . ASP C 92  ? 0.7701 0.7241 0.6202 -0.0035 0.0632  -0.0680 645 ASP C CA  
2541 C C   . ASP C 92  ? 0.6823 0.6385 0.5406 0.0020  0.0563  -0.0579 645 ASP C C   
2542 O O   . ASP C 92  ? 0.8216 0.7608 0.6693 -0.0002 0.0541  -0.0496 645 ASP C O   
2543 C CB  . ASP C 92  ? 0.8417 0.7850 0.6811 -0.0123 0.0760  -0.0762 645 ASP C CB  
2544 C CG  . ASP C 92  ? 0.8464 0.8093 0.7027 -0.0118 0.0849  -0.0874 645 ASP C CG  
2545 O OD1 . ASP C 92  ? 1.2587 1.2427 1.1337 -0.0049 0.0804  -0.0882 645 ASP C OD1 
2546 O OD2 . ASP C 92  ? 0.9319 0.8887 0.7818 -0.0191 0.0964  -0.0957 645 ASP C OD2 
2547 N N   . THR C 93  ? 0.5799 0.5558 0.4569 0.0090  0.0530  -0.0583 646 THR C N   
2548 C CA  . THR C 93  ? 0.5665 0.5445 0.4526 0.0130  0.0497  -0.0510 646 THR C CA  
2549 C C   . THR C 93  ? 0.5254 0.4996 0.4133 0.0183  0.0376  -0.0390 646 THR C C   
2550 O O   . THR C 93  ? 0.5357 0.5104 0.4204 0.0201  0.0310  -0.0369 646 THR C O   
2551 C CB  . THR C 93  ? 0.5008 0.5002 0.4045 0.0163  0.0526  -0.0571 646 THR C CB  
2552 O OG1 . THR C 93  ? 0.4228 0.4361 0.3350 0.0220  0.0453  -0.0570 646 THR C OG1 
2553 C CG2 . THR C 93  ? 0.5993 0.6057 0.5042 0.0108  0.0644  -0.0697 646 THR C CG2 
2554 N N   . VAL C 94  ? 0.5487 0.5198 0.4435 0.0205  0.0359  -0.0319 647 VAL C N   
2555 C CA  . VAL C 94  ? 0.5631 0.5316 0.4636 0.0255  0.0254  -0.0208 647 VAL C CA  
2556 C C   . VAL C 94  ? 0.4480 0.4331 0.3598 0.0310  0.0204  -0.0220 647 VAL C C   
2557 O O   . VAL C 94  ? 0.4727 0.4557 0.3829 0.0335  0.0115  -0.0158 647 VAL C O   
2558 C CB  . VAL C 94  ? 0.6231 0.5870 0.5337 0.0268  0.0276  -0.0151 647 VAL C CB  
2559 C CG1 . VAL C 94  ? 0.6357 0.6027 0.5594 0.0326  0.0187  -0.0061 647 VAL C CG1 
2560 C CG2 . VAL C 94  ? 0.7608 0.7039 0.6581 0.0222  0.0292  -0.0101 647 VAL C CG2 
2561 N N   . PHE C 95  ? 0.5004 0.5012 0.4218 0.0322  0.0258  -0.0301 648 PHE C N   
2562 C CA  . PHE C 95  ? 0.4914 0.5061 0.4217 0.0371  0.0208  -0.0306 648 PHE C CA  
2563 C C   . PHE C 95  ? 0.4383 0.4540 0.3620 0.0382  0.0161  -0.0319 648 PHE C C   
2564 O O   . PHE C 95  ? 0.4429 0.4584 0.3674 0.0418  0.0083  -0.0263 648 PHE C O   
2565 C CB  . PHE C 95  ? 0.5235 0.5542 0.4636 0.0372  0.0267  -0.0385 648 PHE C CB  
2566 C CG  . PHE C 95  ? 0.6767 0.7069 0.6249 0.0362  0.0317  -0.0370 648 PHE C CG  
2567 C CD1 . PHE C 95  ? 0.6497 0.6723 0.6035 0.0387  0.0277  -0.0281 648 PHE C CD1 
2568 C CD2 . PHE C 95  ? 0.6673 0.7047 0.6186 0.0321  0.0411  -0.0452 648 PHE C CD2 
2569 C CE1 . PHE C 95  ? 0.7998 0.8212 0.7632 0.0378  0.0338  -0.0274 648 PHE C CE1 
2570 C CE2 . PHE C 95  ? 0.8126 0.8482 0.7710 0.0304  0.0473  -0.0446 648 PHE C CE2 
2571 C CZ  . PHE C 95  ? 0.7665 0.7937 0.7315 0.0334  0.0441  -0.0357 648 PHE C CZ  
2572 N N   . TYR C 96  ? 0.5015 0.5175 0.4190 0.0347  0.0217  -0.0397 649 TYR C N   
2573 C CA  . TYR C 96  ? 0.4475 0.4639 0.3601 0.0351  0.0197  -0.0427 649 TYR C CA  
2574 C C   . TYR C 96  ? 0.4538 0.4558 0.3556 0.0347  0.0123  -0.0340 649 TYR C C   
2575 O O   . TYR C 96  ? 0.4321 0.4367 0.3348 0.0381  0.0069  -0.0321 649 TYR C O   
2576 C CB  . TYR C 96  ? 0.4353 0.4498 0.3422 0.0296  0.0289  -0.0524 649 TYR C CB  
2577 C CG  . TYR C 96  ? 0.4613 0.4783 0.3673 0.0299  0.0296  -0.0578 649 TYR C CG  
2578 C CD1 . TYR C 96  ? 0.4678 0.5023 0.3874 0.0331  0.0320  -0.0659 649 TYR C CD1 
2579 C CD2 . TYR C 96  ? 0.3384 0.3396 0.2302 0.0266  0.0281  -0.0548 649 TYR C CD2 
2580 C CE1 . TYR C 96  ? 0.2810 0.3174 0.2026 0.0340  0.0334  -0.0708 649 TYR C CE1 
2581 C CE2 . TYR C 96  ? 0.3820 0.3838 0.2733 0.0263  0.0304  -0.0601 649 TYR C CE2 
2582 C CZ  . TYR C 96  ? 0.4326 0.4523 0.3403 0.0305  0.0336  -0.0684 649 TYR C CZ  
2583 O OH  . TYR C 96  ? 0.4896 0.5097 0.3998 0.0309  0.0366  -0.0738 649 TYR C OH  
2584 N N   . ARG C 97  ? 0.4452 0.4315 0.3364 0.0304  0.0118  -0.0286 650 ARG C N   
2585 C CA  A ARG C 97  ? 0.4453 0.4171 0.3247 0.0285  0.0039  -0.0198 650 ARG C CA  
2586 C CA  B ARG C 97  ? 0.4553 0.4275 0.3349 0.0285  0.0039  -0.0201 650 ARG C CA  
2587 C C   . ARG C 97  ? 0.4785 0.4551 0.3680 0.0341  -0.0052 -0.0114 650 ARG C C   
2588 O O   . ARG C 97  ? 0.5497 0.5215 0.4339 0.0342  -0.0124 -0.0064 650 ARG C O   
2589 C CB  A ARG C 97  ? 0.4387 0.3926 0.3047 0.0223  0.0045  -0.0152 650 ARG C CB  
2590 C CB  B ARG C 97  ? 0.4607 0.4141 0.3249 0.0217  0.0049  -0.0161 650 ARG C CB  
2591 C CG  A ARG C 97  ? 0.5482 0.4891 0.3951 0.0142  0.0105  -0.0208 650 ARG C CG  
2592 C CG  B ARG C 97  ? 0.6185 0.5591 0.4633 0.0140  0.0091  -0.0210 650 ARG C CG  
2593 C CD  A ARG C 97  ? 0.5966 0.5279 0.4359 0.0087  0.0188  -0.0239 650 ARG C CD  
2594 C CD  B ARG C 97  ? 0.6566 0.5861 0.4901 0.0071  0.0183  -0.0258 650 ARG C CD  
2595 N NE  A ARG C 97  ? 0.3896 0.3116 0.2291 0.0093  0.0142  -0.0140 650 ARG C NE  
2596 N NE  B ARG C 97  ? 0.6822 0.5935 0.4928 -0.0019 0.0207  -0.0276 650 ARG C NE  
2597 C CZ  A ARG C 97  ? 0.5525 0.4652 0.3868 0.0055  0.0210  -0.0150 650 ARG C CZ  
2598 C CZ  B ARG C 97  ? 0.7347 0.6380 0.5343 -0.0092 0.0318  -0.0366 650 ARG C CZ  
2599 N NH1 A ARG C 97  ? 0.6703 0.5745 0.5072 0.0070  0.0168  -0.0054 650 ARG C NH1 
2600 N NH1 B ARG C 97  ? 0.7755 0.6885 0.5858 -0.0082 0.0411  -0.0446 650 ARG C NH1 
2601 N NH2 A ARG C 97  ? 0.6455 0.5571 0.4729 0.0002  0.0327  -0.0261 650 ARG C NH2 
2602 N NH2 B ARG C 97  ? 0.6486 0.5335 0.4257 -0.0184 0.0341  -0.0381 650 ARG C NH2 
2603 N N   . ALA C 98  ? 0.4238 0.4094 0.3279 0.0379  -0.0041 -0.0104 651 ALA C N   
2604 C CA  . ALA C 98  ? 0.4329 0.4238 0.3484 0.0428  -0.0107 -0.0040 651 ALA C CA  
2605 C C   . ALA C 98  ? 0.3834 0.3836 0.3010 0.0464  -0.0132 -0.0069 651 ALA C C   
2606 O O   . ALA C 98  ? 0.3499 0.3483 0.2679 0.0482  -0.0202 -0.0014 651 ALA C O   
2607 C CB  . ALA C 98  ? 0.4431 0.4416 0.3735 0.0451  -0.0062 -0.0047 651 ALA C CB  
2608 N N   . ALA C 99  ? 0.2834 0.2938 0.2033 0.0474  -0.0076 -0.0154 652 ALA C N   
2609 C CA  . ALA C 99  ? 0.2452 0.2639 0.1678 0.0513  -0.0101 -0.0176 652 ALA C CA  
2610 C C   . ALA C 99  ? 0.3911 0.4003 0.3025 0.0497  -0.0134 -0.0160 652 ALA C C   
2611 O O   . ALA C 99  ? 0.4464 0.4566 0.3585 0.0528  -0.0181 -0.0134 652 ALA C O   
2612 C CB  . ALA C 99  ? 0.3134 0.3457 0.2419 0.0527  -0.0043 -0.0272 652 ALA C CB  
2613 N N   . VAL C 100 ? 0.4203 0.4191 0.3201 0.0441  -0.0099 -0.0183 653 VAL C N   
2614 C CA  . VAL C 100 ? 0.4003 0.3888 0.2874 0.0409  -0.0113 -0.0181 653 VAL C CA  
2615 C C   . VAL C 100 ? 0.4243 0.4043 0.3062 0.0402  -0.0203 -0.0087 653 VAL C C   
2616 O O   . VAL C 100 ? 0.4740 0.4517 0.3519 0.0407  -0.0232 -0.0077 653 VAL C O   
2617 C CB  . VAL C 100 ? 0.4454 0.4215 0.3180 0.0330  -0.0050 -0.0226 653 VAL C CB  
2618 C CG1 . VAL C 100 ? 0.3994 0.3618 0.2560 0.0277  -0.0060 -0.0222 653 VAL C CG1 
2619 C CG2 . VAL C 100 ? 0.4226 0.4083 0.3022 0.0333  0.0044  -0.0333 653 VAL C CG2 
2620 N N   . ARG C 101 ? 0.4388 0.4144 0.3218 0.0390  -0.0244 -0.0019 654 ARG C N   
2621 C CA  . ARG C 101 ? 0.4589 0.4275 0.3394 0.0379  -0.0339 0.0074  654 ARG C CA  
2622 C C   . ARG C 101 ? 0.4972 0.4763 0.3915 0.0441  -0.0379 0.0098  654 ARG C C   
2623 O O   . ARG C 101 ? 0.4808 0.4561 0.3725 0.0434  -0.0445 0.0148  654 ARG C O   
2624 C CB  . ARG C 101 ? 0.3974 0.3582 0.2777 0.0353  -0.0376 0.0145  654 ARG C CB  
2625 N N   . LEU C 102 ? 0.5415 0.5329 0.4491 0.0492  -0.0336 0.0060  655 LEU C N   
2626 C CA  . LEU C 102 ? 0.4697 0.4691 0.3884 0.0540  -0.0364 0.0079  655 LEU C CA  
2627 C C   . LEU C 102 ? 0.4871 0.4882 0.4008 0.0560  -0.0366 0.0048  655 LEU C C   
2628 O O   . LEU C 102 ? 0.3984 0.3997 0.3141 0.0578  -0.0407 0.0080  655 LEU C O   
2629 C CB  . LEU C 102 ? 0.4920 0.5020 0.4235 0.0573  -0.0315 0.0047  655 LEU C CB  
2630 C CG  . LEU C 102 ? 0.4870 0.5042 0.4286 0.0611  -0.0329 0.0059  655 LEU C CG  
2631 C CD1 . LEU C 102 ? 0.4853 0.4977 0.4323 0.0607  -0.0389 0.0133  655 LEU C CD1 
2632 C CD2 . LEU C 102 ? 0.3788 0.4043 0.3299 0.0621  -0.0271 0.0023  655 LEU C CD2 
2633 N N   . ARG C 103 ? 0.3304 0.3323 0.2386 0.0556  -0.0315 -0.0016 656 ARG C N   
2634 C CA  . ARG C 103 ? 0.4383 0.4398 0.3422 0.0574  -0.0309 -0.0045 656 ARG C CA  
2635 C C   . ARG C 103 ? 0.4812 0.4705 0.3734 0.0531  -0.0351 -0.0002 656 ARG C C   
2636 O O   . ARG C 103 ? 0.4539 0.4425 0.3455 0.0552  -0.0371 0.0008  656 ARG C O   
2637 C CB  . ARG C 103 ? 0.4837 0.4876 0.3861 0.0572  -0.0241 -0.0124 656 ARG C CB  
2638 C CG  . ARG C 103 ? 0.5274 0.5277 0.4255 0.0583  -0.0225 -0.0153 656 ARG C CG  
2639 C CD  . ARG C 103 ? 0.5765 0.5809 0.4777 0.0584  -0.0148 -0.0241 656 ARG C CD  
2640 N NE  . ARG C 103 ? 0.7575 0.7774 0.6733 0.0653  -0.0145 -0.0272 656 ARG C NE  
2641 C CZ  . ARG C 103 ? 1.0626 1.0911 0.9869 0.0671  -0.0094 -0.0345 656 ARG C CZ  
2642 N NH1 . ARG C 103 ? 0.8739 0.8965 0.7942 0.0624  -0.0024 -0.0407 656 ARG C NH1 
2643 N NH2 . ARG C 103 ? 1.0584 1.1014 0.9952 0.0730  -0.0114 -0.0359 656 ARG C NH2 
2644 N N   . ASP C 104 ? 0.5312 0.5102 0.4133 0.0465  -0.0367 0.0023  657 ASP C N   
2645 C CA  . ASP C 104 ? 0.5181 0.4849 0.3869 0.0406  -0.0417 0.0068  657 ASP C CA  
2646 C C   . ASP C 104 ? 0.5540 0.5226 0.4295 0.0419  -0.0500 0.0143  657 ASP C C   
2647 O O   . ASP C 104 ? 0.5137 0.4790 0.3848 0.0409  -0.0528 0.0158  657 ASP C O   
2648 C CB  . ASP C 104 ? 0.5041 0.4581 0.3580 0.0322  -0.0421 0.0083  657 ASP C CB  
2649 C CG  . ASP C 104 ? 0.8758 0.8238 0.7187 0.0281  -0.0330 0.0000  657 ASP C CG  
2650 O OD1 . ASP C 104 ? 0.9409 0.8936 0.7878 0.0315  -0.0273 -0.0063 657 ASP C OD1 
2651 O OD2 . ASP C 104 ? 1.0017 0.9395 0.8324 0.0213  -0.0311 -0.0003 657 ASP C OD2 
2652 N N   . GLN C 105 ? 0.5520 0.5257 0.4392 0.0440  -0.0531 0.0186  658 GLN C N   
2653 C CA  . GLN C 105 ? 0.5289 0.5046 0.4253 0.0449  -0.0604 0.0253  658 GLN C CA  
2654 C C   . GLN C 105 ? 0.5087 0.4929 0.4151 0.0505  -0.0587 0.0233  658 GLN C C   
2655 O O   . GLN C 105 ? 0.5354 0.5192 0.4446 0.0501  -0.0633 0.0267  658 GLN C O   
2656 C CB  . GLN C 105 ? 0.5373 0.5152 0.4456 0.0456  -0.0632 0.0303  658 GLN C CB  
2657 C CG  . GLN C 105 ? 0.5176 0.4842 0.4148 0.0393  -0.0688 0.0356  658 GLN C CG  
2658 C CD  . GLN C 105 ? 0.7033 0.6711 0.6130 0.0409  -0.0706 0.0405  658 GLN C CD  
2659 O OE1 . GLN C 105 ? 1.0528 1.0250 0.9784 0.0432  -0.0759 0.0461  658 GLN C OE1 
2660 N NE2 . GLN C 105 ? 0.7712 0.7347 0.6752 0.0395  -0.0655 0.0382  658 GLN C NE2 
2661 N N   . GLY C 106 ? 0.4759 0.4672 0.3865 0.0550  -0.0522 0.0176  659 GLY C N   
2662 C CA  . GLY C 106 ? 0.4497 0.4476 0.3671 0.0599  -0.0506 0.0158  659 GLY C CA  
2663 C C   . GLY C 106 ? 0.3968 0.3898 0.3044 0.0601  -0.0504 0.0142  659 GLY C C   
2664 O O   . GLY C 106 ? 0.3792 0.3723 0.2889 0.0617  -0.0519 0.0156  659 GLY C O   
2665 N N   . GLY C 107 ? 0.4629 0.4505 0.3600 0.0578  -0.0476 0.0108  660 GLY C N   
2666 C CA  . GLY C 107 ? 0.5144 0.4952 0.4018 0.0569  -0.0461 0.0088  660 GLY C CA  
2667 C C   . GLY C 107 ? 0.5317 0.5052 0.4134 0.0527  -0.0512 0.0135  660 GLY C C   
2668 O O   . GLY C 107 ? 0.5655 0.5363 0.4445 0.0542  -0.0503 0.0129  660 GLY C O   
2669 N N   . VAL C 108 ? 0.5376 0.5080 0.4178 0.0474  -0.0570 0.0184  661 VAL C N   
2670 C CA  . VAL C 108 ? 0.4564 0.4220 0.3331 0.0427  -0.0633 0.0230  661 VAL C CA  
2671 C C   . VAL C 108 ? 0.4427 0.4149 0.3317 0.0474  -0.0641 0.0243  661 VAL C C   
2672 O O   . VAL C 108 ? 0.4648 0.4331 0.3496 0.0459  -0.0647 0.0244  661 VAL C O   
2673 C CB  . VAL C 108 ? 0.5242 0.4875 0.4011 0.0372  -0.0712 0.0293  661 VAL C CB  
2674 C CG1 . VAL C 108 ? 0.3867 0.3456 0.2596 0.0314  -0.0786 0.0338  661 VAL C CG1 
2675 C CG2 . VAL C 108 ? 0.4572 0.4122 0.3201 0.0319  -0.0700 0.0282  661 VAL C CG2 
2676 N N   . VAL C 109 ? 0.4612 0.4423 0.3643 0.0522  -0.0631 0.0245  662 VAL C N   
2677 C CA  . VAL C 109 ? 0.3527 0.3391 0.2669 0.0557  -0.0626 0.0249  662 VAL C CA  
2678 C C   . VAL C 109 ? 0.3663 0.3515 0.2751 0.0598  -0.0576 0.0211  662 VAL C C   
2679 O O   . VAL C 109 ? 0.4320 0.4151 0.3411 0.0598  -0.0576 0.0216  662 VAL C O   
2680 C CB  . VAL C 109 ? 0.3809 0.3758 0.3099 0.0588  -0.0609 0.0251  662 VAL C CB  
2681 C CG1 . VAL C 109 ? 0.3318 0.3308 0.2706 0.0614  -0.0585 0.0244  662 VAL C CG1 
2682 C CG2 . VAL C 109 ? 0.4234 0.4185 0.3603 0.0555  -0.0664 0.0302  662 VAL C CG2 
2683 N N   . LEU C 110 ? 0.3387 0.3252 0.2436 0.0633  -0.0534 0.0173  663 LEU C N   
2684 C CA  . LEU C 110 ? 0.3987 0.3843 0.3000 0.0681  -0.0497 0.0146  663 LEU C CA  
2685 C C   . LEU C 110 ? 0.4165 0.3920 0.3067 0.0657  -0.0491 0.0144  663 LEU C C   
2686 O O   . LEU C 110 ? 0.5705 0.5424 0.4587 0.0673  -0.0482 0.0149  663 LEU C O   
2687 C CB  . LEU C 110 ? 0.4229 0.4135 0.3250 0.0719  -0.0463 0.0107  663 LEU C CB  
2688 C CG  . LEU C 110 ? 0.6020 0.6026 0.5139 0.0739  -0.0458 0.0100  663 LEU C CG  
2689 C CD1 . LEU C 110 ? 0.3356 0.3421 0.2486 0.0774  -0.0427 0.0055  663 LEU C CD1 
2690 C CD2 . LEU C 110 ? 0.4782 0.4811 0.3949 0.0756  -0.0462 0.0115  663 LEU C CD2 
2691 N N   . ARG C 111 ? 0.5671 0.5366 0.4489 0.0609  -0.0491 0.0136  664 ARG C N   
2692 C CA  . ARG C 111 ? 0.6156 0.5741 0.4855 0.0567  -0.0477 0.0131  664 ARG C CA  
2693 C C   . ARG C 111 ? 0.5713 0.5274 0.4414 0.0533  -0.0515 0.0164  664 ARG C C   
2694 O O   . ARG C 111 ? 0.5524 0.5021 0.4170 0.0535  -0.0489 0.0156  664 ARG C O   
2695 C CB  . ARG C 111 ? 0.6619 0.6131 0.5208 0.0495  -0.0473 0.0119  664 ARG C CB  
2696 C CG  . ARG C 111 ? 0.8207 0.7716 0.6781 0.0518  -0.0409 0.0066  664 ARG C CG  
2697 C CD  . ARG C 111 ? 0.9556 0.8954 0.7984 0.0429  -0.0384 0.0044  664 ARG C CD  
2698 N NE  . ARG C 111 ? 0.7851 0.7250 0.6247 0.0369  -0.0439 0.0076  664 ARG C NE  
2699 C CZ  . ARG C 111 ? 0.6573 0.6027 0.5018 0.0384  -0.0431 0.0065  664 ARG C CZ  
2700 N NH1 . ARG C 111 ? 0.8133 0.7566 0.6538 0.0329  -0.0483 0.0103  664 ARG C NH1 
2701 N NH2 . ARG C 111 ? 0.7371 0.6898 0.5908 0.0454  -0.0374 0.0018  664 ARG C NH2 
2702 N N   . GLN C 112 ? 0.4871 0.4484 0.3648 0.0504  -0.0572 0.0201  665 GLN C N   
2703 C CA  . GLN C 112 ? 0.4603 0.4212 0.3417 0.0472  -0.0607 0.0227  665 GLN C CA  
2704 C C   . GLN C 112 ? 0.4633 0.4264 0.3507 0.0527  -0.0569 0.0214  665 GLN C C   
2705 O O   . GLN C 112 ? 0.5438 0.5019 0.4279 0.0507  -0.0558 0.0212  665 GLN C O   
2706 C CB  . GLN C 112 ? 0.5275 0.4949 0.4202 0.0439  -0.0678 0.0270  665 GLN C CB  
2707 C CG  . GLN C 112 ? 0.5413 0.5096 0.4403 0.0397  -0.0722 0.0295  665 GLN C CG  
2708 C CD  . GLN C 112 ? 0.6349 0.5945 0.5196 0.0317  -0.0749 0.0299  665 GLN C CD  
2709 O OE1 . GLN C 112 ? 0.5889 0.5431 0.4616 0.0267  -0.0774 0.0307  665 GLN C OE1 
2710 N NE2 . GLN C 112 ? 0.5234 0.4809 0.4082 0.0294  -0.0739 0.0290  665 GLN C NE2 
2711 N N   . ALA C 113 ? 0.4963 0.4657 0.3907 0.0586  -0.0546 0.0204  666 ALA C N   
2712 C CA  . ALA C 113 ? 0.4762 0.4457 0.3727 0.0628  -0.0511 0.0194  666 ALA C CA  
2713 C C   . ALA C 113 ? 0.5221 0.4819 0.4061 0.0649  -0.0474 0.0178  666 ALA C C   
2714 O O   . ALA C 113 ? 0.4580 0.4118 0.3384 0.0645  -0.0454 0.0179  666 ALA C O   
2715 C CB  . ALA C 113 ? 0.5131 0.4907 0.4165 0.0679  -0.0495 0.0182  666 ALA C CB  
2716 N N   . ARG C 114 ? 0.4920 0.4495 0.3701 0.0668  -0.0457 0.0161  667 ARG C N   
2717 C CA  . ARG C 114 ? 0.4921 0.4400 0.3606 0.0693  -0.0414 0.0145  667 ARG C CA  
2718 C C   . ARG C 114 ? 0.4813 0.4191 0.3415 0.0635  -0.0404 0.0149  667 ARG C C   
2719 O O   . ARG C 114 ? 0.4784 0.4076 0.3322 0.0656  -0.0366 0.0145  667 ARG C O   
2720 C CB  . ARG C 114 ? 0.4172 0.3642 0.2829 0.0701  -0.0391 0.0119  667 ARG C CB  
2721 C CG  . ARG C 114 ? 0.6240 0.5615 0.4833 0.0735  -0.0335 0.0097  667 ARG C CG  
2722 C CD  . ARG C 114 ? 0.7819 0.7246 0.6480 0.0829  -0.0325 0.0093  667 ARG C CD  
2723 N NE  . ARG C 114 ? 0.7483 0.6868 0.6124 0.0872  -0.0328 0.0119  667 ARG C NE  
2724 C CZ  . ARG C 114 ? 0.6643 0.6082 0.5329 0.0939  -0.0350 0.0134  667 ARG C CZ  
2725 N NH1 . ARG C 114 ? 0.5636 0.5190 0.4408 0.0974  -0.0370 0.0122  667 ARG C NH1 
2726 N NH2 . ARG C 114 ? 0.6111 0.5480 0.4741 0.0961  -0.0351 0.0161  667 ARG C NH2 
2727 N N   . ARG C 115 ? 0.4320 0.3706 0.2920 0.0560  -0.0441 0.0159  668 ARG C N   
2728 C CA  . ARG C 115 ? 0.4972 0.4273 0.3491 0.0489  -0.0438 0.0159  668 ARG C CA  
2729 C C   . ARG C 115 ? 0.4777 0.4078 0.3340 0.0487  -0.0436 0.0167  668 ARG C C   
2730 O O   . ARG C 115 ? 0.4695 0.3905 0.3178 0.0455  -0.0404 0.0156  668 ARG C O   
2731 C CB  . ARG C 115 ? 0.4632 0.3952 0.3139 0.0403  -0.0497 0.0174  668 ARG C CB  
2732 C CG  . ARG C 115 ? 0.4974 0.4249 0.3385 0.0372  -0.0486 0.0159  668 ARG C CG  
2733 C CD  . ARG C 115 ? 0.3513 0.2822 0.1924 0.0295  -0.0566 0.0190  668 ARG C CD  
2734 N NE  . ARG C 115 ? 0.5254 0.4507 0.3556 0.0256  -0.0552 0.0174  668 ARG C NE  
2735 C CZ  . ARG C 115 ? 0.5931 0.5173 0.4176 0.0177  -0.0615 0.0202  668 ARG C CZ  
2736 N NH1 . ARG C 115 ? 0.4661 0.3959 0.2974 0.0137  -0.0710 0.0253  668 ARG C NH1 
2737 N NH2 . ARG C 115 ? 0.4538 0.3707 0.2660 0.0136  -0.0584 0.0178  668 ARG C NH2 
2738 N N   . GLU C 116 ? 0.5034 0.4432 0.3723 0.0511  -0.0463 0.0181  669 GLU C N   
2739 C CA  . GLU C 116 ? 0.4853 0.4252 0.3595 0.0509  -0.0447 0.0180  669 GLU C CA  
2740 C C   . GLU C 116 ? 0.5430 0.4744 0.4083 0.0566  -0.0388 0.0169  669 GLU C C   
2741 O O   . GLU C 116 ? 0.5432 0.4656 0.4019 0.0545  -0.0352 0.0160  669 GLU C O   
2742 C CB  . GLU C 116 ? 0.4665 0.4180 0.3568 0.0519  -0.0475 0.0192  669 GLU C CB  
2743 C CG  . GLU C 116 ? 0.6310 0.5900 0.5320 0.0466  -0.0541 0.0214  669 GLU C CG  
2744 C CD  . GLU C 116 ? 0.4759 0.4321 0.3772 0.0396  -0.0559 0.0215  669 GLU C CD  
2745 O OE1 . GLU C 116 ? 0.7129 0.6691 0.6114 0.0341  -0.0614 0.0232  669 GLU C OE1 
2746 O OE2 . GLU C 116 ? 0.5111 0.4642 0.4139 0.0388  -0.0516 0.0195  669 GLU C OE2 
2747 N N   . VAL C 117 ? 0.4639 0.3975 0.3284 0.0634  -0.0383 0.0171  670 VAL C N   
2748 C CA  . VAL C 117 ? 0.4666 0.3917 0.3223 0.0693  -0.0345 0.0172  670 VAL C CA  
2749 C C   . VAL C 117 ? 0.5528 0.4645 0.3967 0.0685  -0.0304 0.0165  670 VAL C C   
2750 O O   . VAL C 117 ? 0.6405 0.5417 0.4764 0.0697  -0.0268 0.0168  670 VAL C O   
2751 C CB  . VAL C 117 ? 0.5166 0.4478 0.3749 0.0765  -0.0358 0.0176  670 VAL C CB  
2752 C CG1 . VAL C 117 ? 0.4463 0.3679 0.2958 0.0834  -0.0333 0.0188  670 VAL C CG1 
2753 C CG2 . VAL C 117 ? 0.4712 0.4132 0.3388 0.0768  -0.0382 0.0179  670 VAL C CG2 
2754 N N   . ASP C 118 ? 0.5195 0.4299 0.3610 0.0658  -0.0302 0.0152  671 ASP C N   
2755 C CA  . ASP C 118 ? 0.5467 0.4436 0.3769 0.0633  -0.0251 0.0137  671 ASP C CA  
2756 C C   . ASP C 118 ? 0.5777 0.4675 0.4027 0.0570  -0.0231 0.0133  671 ASP C C   
2757 O O   . ASP C 118 ? 0.5643 0.4411 0.3798 0.0579  -0.0176 0.0128  671 ASP C O   
2758 C CB  . ASP C 118 ? 0.6023 0.4988 0.4295 0.0577  -0.0251 0.0118  671 ASP C CB  
2759 C CG  . ASP C 118 ? 0.6408 0.5414 0.4717 0.0632  -0.0244 0.0108  671 ASP C CG  
2760 O OD1 . ASP C 118 ? 0.8030 0.7052 0.6381 0.0720  -0.0233 0.0114  671 ASP C OD1 
2761 O OD2 . ASP C 118 ? 0.6048 0.5066 0.4338 0.0577  -0.0250 0.0092  671 ASP C OD2 
2762 N N   . SER C 119 ? 0.5642 0.4623 0.3966 0.0506  -0.0275 0.0135  672 SER C N   
2763 C CA  . SER C 119 ? 0.6343 0.5279 0.4648 0.0436  -0.0260 0.0123  672 SER C CA  
2764 C C   . SER C 119 ? 0.6785 0.5675 0.5084 0.0468  -0.0223 0.0124  672 SER C C   
2765 O O   . SER C 119 ? 0.7305 0.6071 0.5507 0.0444  -0.0167 0.0110  672 SER C O   
2766 C CB  . SER C 119 ? 0.6870 0.5928 0.5296 0.0365  -0.0328 0.0129  672 SER C CB  
2767 O OG  . SER C 119 ? 0.7798 0.6951 0.6363 0.0386  -0.0348 0.0138  672 SER C OG  
2768 N N   . ILE C 120 ? 0.6568 0.5546 0.4957 0.0514  -0.0247 0.0138  673 ILE C N   
2769 C CA  . ILE C 120 ? 0.6616 0.5550 0.4989 0.0530  -0.0214 0.0137  673 ILE C CA  
2770 C C   . ILE C 120 ? 0.7268 0.6052 0.5485 0.0584  -0.0169 0.0148  673 ILE C C   
2771 O O   . ILE C 120 ? 0.8081 0.6751 0.6211 0.0565  -0.0121 0.0142  673 ILE C O   
2772 C CB  . ILE C 120 ? 0.6737 0.5787 0.5216 0.0565  -0.0245 0.0147  673 ILE C CB  
2773 C CG1 . ILE C 120 ? 0.7670 0.6852 0.6323 0.0513  -0.0278 0.0139  673 ILE C CG1 
2774 C CG2 . ILE C 120 ? 0.7675 0.6651 0.6088 0.0578  -0.0205 0.0146  673 ILE C CG2 
2775 C CD1 . ILE C 120 ? 0.8428 0.7723 0.7192 0.0545  -0.0302 0.0146  673 ILE C CD1 
2776 N N   . GLY C 121 ? 0.7684 0.6462 0.5872 0.0649  -0.0182 0.0164  674 GLY C N   
2777 C CA  . GLY C 121 ? 0.8369 0.7014 0.6442 0.0717  -0.0151 0.0185  674 GLY C CA  
2778 C C   . GLY C 121 ? 0.9356 0.7839 0.7312 0.0692  -0.0087 0.0173  674 GLY C C   
2779 O O   . GLY C 121 ? 0.8818 0.7173 0.6685 0.0751  -0.0055 0.0193  674 GLY C O   
2780 N N   . LEU C 122 ? 1.0478 0.8962 0.8438 0.0603  -0.0069 0.0142  675 LEU C N   
2781 C CA  . LEU C 122 ? 1.1049 0.9381 0.8892 0.0559  -0.0001 0.0121  675 LEU C CA  
2782 C C   . LEU C 122 ? 1.1586 0.9801 0.9344 0.0519  0.0049  0.0112  675 LEU C C   
2783 O O   . LEU C 122 ? 1.1976 1.0036 0.9617 0.0565  0.0096  0.0130  675 LEU C O   
2784 C CB  . LEU C 122 ? 1.0986 0.9374 0.8857 0.0467  -0.0012 0.0091  675 LEU C CB  
2785 C CG  . LEU C 122 ? 1.1694 0.9943 0.9449 0.0436  0.0056  0.0068  675 LEU C CG  
2786 C CD1 . LEU C 122 ? 1.0851 0.9081 0.8612 0.0519  0.0068  0.0079  675 LEU C CD1 
2787 C CD2 . LEU C 122 ? 1.2266 1.0554 1.0012 0.0317  0.0041  0.0036  675 LEU C CD2 
2788 N N   . LEU D 11  ? 0.6899 0.7624 0.7283 -0.0914 0.0568  -0.0358 564 LEU D N   
2789 C CA  . LEU D 11  ? 0.7762 0.8727 0.8321 -0.0929 0.0607  -0.0412 564 LEU D CA  
2790 C C   . LEU D 11  ? 0.7660 0.8855 0.8428 -0.0813 0.0535  -0.0437 564 LEU D C   
2791 O O   . LEU D 11  ? 0.6937 0.8135 0.7724 -0.0710 0.0508  -0.0402 564 LEU D O   
2792 C CB  . LEU D 11  ? 0.7664 0.8741 0.8268 -0.1088 0.0684  -0.0492 564 LEU D CB  
2793 N N   . THR D 12  ? 0.7685 0.9059 0.8594 -0.0831 0.0501  -0.0501 565 THR D N   
2794 C CA  . THR D 12  ? 0.7538 0.9066 0.8588 -0.0708 0.0416  -0.0521 565 THR D CA  
2795 C C   . THR D 12  ? 0.7001 0.8348 0.7946 -0.0599 0.0355  -0.0440 565 THR D C   
2796 O O   . THR D 12  ? 0.7126 0.8523 0.8121 -0.0491 0.0307  -0.0431 565 THR D O   
2797 C CB  . THR D 12  ? 0.7423 0.9122 0.8601 -0.0737 0.0372  -0.0600 565 THR D CB  
2798 N N   . PRO D 13  ? 0.6590 0.7725 0.7380 -0.0628 0.0357  -0.0389 566 PRO D N   
2799 C CA  . PRO D 13  ? 0.6043 0.7025 0.6741 -0.0531 0.0314  -0.0320 566 PRO D CA  
2800 C C   . PRO D 13  ? 0.5733 0.6653 0.6387 -0.0477 0.0333  -0.0274 566 PRO D C   
2801 O O   . PRO D 13  ? 0.5316 0.6220 0.5977 -0.0387 0.0293  -0.0245 566 PRO D O   
2802 C CB  . PRO D 13  ? 0.6235 0.7015 0.6774 -0.0578 0.0320  -0.0288 566 PRO D CB  
2803 C CG  . PRO D 13  ? 0.7337 0.8121 0.7848 -0.0709 0.0375  -0.0328 566 PRO D CG  
2804 C CD  . PRO D 13  ? 0.6931 0.7980 0.7639 -0.0738 0.0381  -0.0404 566 PRO D CD  
2805 N N   . LEU D 14  ? 0.5231 0.6105 0.5827 -0.0537 0.0393  -0.0270 567 LEU D N   
2806 C CA  . LEU D 14  ? 0.4793 0.5630 0.5362 -0.0483 0.0404  -0.0236 567 LEU D CA  
2807 C C   . LEU D 14  ? 0.4417 0.5434 0.5129 -0.0421 0.0383  -0.0263 567 LEU D C   
2808 O O   . LEU D 14  ? 0.4643 0.5634 0.5349 -0.0340 0.0350  -0.0232 567 LEU D O   
2809 C CB  . LEU D 14  ? 0.4482 0.5230 0.4951 -0.0557 0.0473  -0.0234 567 LEU D CB  
2810 C CG  . LEU D 14  ? 0.5680 0.6330 0.6072 -0.0500 0.0476  -0.0191 567 LEU D CG  
2811 C CD1 . LEU D 14  ? 0.3516 0.4002 0.3797 -0.0432 0.0431  -0.0141 567 LEU D CD1 
2812 C CD2 . LEU D 14  ? 0.5245 0.5798 0.5524 -0.0579 0.0547  -0.0198 567 LEU D CD2 
2813 N N   . THR D 15  ? 0.4153 0.5349 0.4985 -0.0459 0.0399  -0.0328 568 THR D N   
2814 C CA  . THR D 15  ? 0.4513 0.5874 0.5464 -0.0385 0.0373  -0.0362 568 THR D CA  
2815 C C   . THR D 15  ? 0.4541 0.5870 0.5488 -0.0282 0.0297  -0.0340 568 THR D C   
2816 O O   . THR D 15  ? 0.4702 0.6018 0.5636 -0.0209 0.0277  -0.0322 568 THR D O   
2817 C CB  . THR D 15  ? 0.4978 0.6573 0.6082 -0.0425 0.0386  -0.0454 568 THR D CB  
2818 O OG1 . THR D 15  ? 0.5303 0.6921 0.6399 -0.0533 0.0474  -0.0477 568 THR D OG1 
2819 C CG2 . THR D 15  ? 0.4117 0.5865 0.5322 -0.0325 0.0348  -0.0493 568 THR D CG2 
2820 N N   . VAL D 16  ? 0.4820 0.6114 0.5755 -0.0282 0.0258  -0.0342 569 VAL D N   
2821 C CA  . VAL D 16  ? 0.4668 0.5916 0.5579 -0.0194 0.0193  -0.0328 569 VAL D CA  
2822 C C   . VAL D 16  ? 0.4170 0.5261 0.4976 -0.0159 0.0198  -0.0260 569 VAL D C   
2823 O O   . VAL D 16  ? 0.3153 0.4212 0.3931 -0.0091 0.0169  -0.0248 569 VAL D O   
2824 C CB  . VAL D 16  ? 0.5358 0.6587 0.6264 -0.0207 0.0155  -0.0347 569 VAL D CB  
2825 C CG1 . VAL D 16  ? 0.4623 0.5764 0.5467 -0.0119 0.0096  -0.0329 569 VAL D CG1 
2826 C CG2 . VAL D 16  ? 0.4890 0.6308 0.5922 -0.0240 0.0141  -0.0430 569 VAL D CG2 
2827 N N   . LEU D 17  ? 0.3627 0.4613 0.4363 -0.0206 0.0233  -0.0222 570 LEU D N   
2828 C CA  . LEU D 17  ? 0.2782 0.3653 0.3441 -0.0172 0.0234  -0.0172 570 LEU D CA  
2829 C C   . LEU D 17  ? 0.3087 0.3979 0.3753 -0.0143 0.0246  -0.0161 570 LEU D C   
2830 O O   . LEU D 17  ? 0.4118 0.4972 0.4757 -0.0096 0.0228  -0.0141 570 LEU D O   
2831 C CB  . LEU D 17  ? 0.3268 0.4025 0.3843 -0.0214 0.0259  -0.0145 570 LEU D CB  
2832 C CG  . LEU D 17  ? 0.3115 0.3777 0.3621 -0.0180 0.0261  -0.0107 570 LEU D CG  
2833 C CD1 . LEU D 17  ? 0.3572 0.4215 0.4077 -0.0128 0.0233  -0.0095 570 LEU D CD1 
2834 C CD2 . LEU D 17  ? 0.3395 0.3934 0.3796 -0.0213 0.0278  -0.0094 570 LEU D CD2 
2835 N N   . LEU D 18  ? 0.2842 0.3788 0.3534 -0.0176 0.0280  -0.0177 571 LEU D N   
2836 C CA  . LEU D 18  ? 0.2560 0.3507 0.3242 -0.0147 0.0291  -0.0164 571 LEU D CA  
2837 C C   . LEU D 18  ? 0.3507 0.4523 0.4228 -0.0083 0.0257  -0.0184 571 LEU D C   
2838 O O   . LEU D 18  ? 0.3284 0.4246 0.3959 -0.0045 0.0247  -0.0161 571 LEU D O   
2839 C CB  . LEU D 18  ? 0.2809 0.3777 0.3489 -0.0198 0.0342  -0.0177 571 LEU D CB  
2840 C CG  . LEU D 18  ? 0.4266 0.5099 0.4843 -0.0251 0.0373  -0.0150 571 LEU D CG  
2841 C CD1 . LEU D 18  ? 0.3607 0.4451 0.4163 -0.0318 0.0434  -0.0172 571 LEU D CD1 
2842 C CD2 . LEU D 18  ? 0.4591 0.5303 0.5085 -0.0206 0.0351  -0.0107 571 LEU D CD2 
2843 N N   . ARG D 19  ? 0.2505 0.3626 0.3295 -0.0068 0.0234  -0.0232 572 ARG D N   
2844 C CA  . ARG D 19  ? 0.3590 0.4738 0.4378 0.0010  0.0187  -0.0255 572 ARG D CA  
2845 C C   . ARG D 19  ? 0.3183 0.4189 0.3870 0.0043  0.0163  -0.0214 572 ARG D C   
2846 O O   . ARG D 19  ? 0.4270 0.5223 0.4896 0.0084  0.0151  -0.0203 572 ARG D O   
2847 C CB  . ARG D 19  ? 0.3689 0.4942 0.4544 0.0036  0.0145  -0.0314 572 ARG D CB  
2848 C CG  . ARG D 19  ? 0.5154 0.6594 0.6129 0.0024  0.0160  -0.0379 572 ARG D CG  
2849 C CD  . ARG D 19  ? 0.7360 0.8921 0.8407 0.0075  0.0098  -0.0452 572 ARG D CD  
2850 N NE  . ARG D 19  ? 0.5504 0.7258 0.6693 0.0007  0.0128  -0.0517 572 ARG D NE  
2851 C CZ  . ARG D 19  ? 0.9819 1.1718 1.1105 0.0024  0.0081  -0.0593 572 ARG D CZ  
2852 N NH1 . ARG D 19  ? 0.9896 1.1979 1.1316 -0.0060 0.0121  -0.0656 572 ARG D NH1 
2853 N NH2 . ARG D 19  ? 1.1625 1.3479 1.2865 0.0122  -0.0005 -0.0611 572 ARG D NH2 
2854 N N   . SER D 20  ? 0.3053 0.3993 0.3713 0.0018  0.0159  -0.0194 573 SER D N   
2855 C CA  . SER D 20  ? 0.3468 0.4287 0.4040 0.0036  0.0148  -0.0164 573 SER D CA  
2856 C C   . SER D 20  ? 0.3139 0.3906 0.3678 0.0019  0.0177  -0.0128 573 SER D C   
2857 O O   . SER D 20  ? 0.3765 0.4460 0.4234 0.0035  0.0172  -0.0117 573 SER D O   
2858 C CB  . SER D 20  ? 0.4529 0.5300 0.5085 0.0014  0.0145  -0.0156 573 SER D CB  
2859 O OG  . SER D 20  ? 0.4893 0.5673 0.5446 0.0041  0.0105  -0.0189 573 SER D OG  
2860 N N   . VAL D 21  ? 0.2973 0.3762 0.3544 -0.0016 0.0205  -0.0114 574 VAL D N   
2861 C CA  . VAL D 21  ? 0.3257 0.4006 0.3801 -0.0022 0.0221  -0.0089 574 VAL D CA  
2862 C C   . VAL D 21  ? 0.3140 0.3895 0.3664 0.0002  0.0217  -0.0092 574 VAL D C   
2863 O O   . VAL D 21  ? 0.2203 0.2906 0.2679 0.0008  0.0213  -0.0079 574 VAL D O   
2864 C CB  . VAL D 21  ? 0.3268 0.4008 0.3816 -0.0053 0.0243  -0.0078 574 VAL D CB  
2865 C CG1 . VAL D 21  ? 0.3647 0.4349 0.4163 -0.0045 0.0246  -0.0061 574 VAL D CG1 
2866 C CG2 . VAL D 21  ? 0.2158 0.2859 0.2692 -0.0067 0.0241  -0.0073 574 VAL D CG2 
2867 N N   . LEU D 22  ? 0.2019 0.2840 0.2576 0.0017  0.0216  -0.0117 575 LEU D N   
2868 C CA  . LEU D 22  ? 0.1991 0.2814 0.2521 0.0049  0.0214  -0.0121 575 LEU D CA  
2869 C C   . LEU D 22  ? 0.2303 0.3055 0.2752 0.0092  0.0181  -0.0125 575 LEU D C   
2870 O O   . LEU D 22  ? 0.2523 0.3202 0.2897 0.0101  0.0179  -0.0109 575 LEU D O   
2871 C CB  . LEU D 22  ? 0.2925 0.3859 0.3519 0.0059  0.0227  -0.0158 575 LEU D CB  
2872 C CG  . LEU D 22  ? 0.3710 0.4648 0.4270 0.0100  0.0228  -0.0167 575 LEU D CG  
2873 C CD1 . LEU D 22  ? 0.1391 0.2251 0.1899 0.0076  0.0252  -0.0129 575 LEU D CD1 
2874 C CD2 . LEU D 22  ? 0.3450 0.4532 0.4097 0.0110  0.0248  -0.0217 575 LEU D CD2 
2875 N N   . ASP D 23  ? 0.2709 0.3460 0.3151 0.0116  0.0154  -0.0147 576 ASP D N   
2876 C CA  . ASP D 23  ? 0.3478 0.4114 0.3799 0.0154  0.0122  -0.0150 576 ASP D CA  
2877 C C   . ASP D 23  ? 0.2882 0.3408 0.3126 0.0111  0.0143  -0.0119 576 ASP D C   
2878 O O   . ASP D 23  ? 0.3005 0.3421 0.3128 0.0124  0.0135  -0.0115 576 ASP D O   
2879 C CB  . ASP D 23  ? 0.3221 0.3849 0.3533 0.0179  0.0090  -0.0175 576 ASP D CB  
2880 C CG  . ASP D 23  ? 0.4654 0.5382 0.5018 0.0239  0.0053  -0.0226 576 ASP D CG  
2881 O OD1 . ASP D 23  ? 0.2991 0.3787 0.3384 0.0269  0.0054  -0.0243 576 ASP D OD1 
2882 O OD2 . ASP D 23  ? 0.4578 0.5328 0.4960 0.0258  0.0021  -0.0253 576 ASP D OD2 
2883 N N   . GLN D 24  ? 0.2791 0.3345 0.3095 0.0062  0.0168  -0.0102 577 GLN D N   
2884 C CA  . GLN D 24  ? 0.2926 0.3417 0.3184 0.0020  0.0191  -0.0087 577 GLN D CA  
2885 C C   . GLN D 24  ? 0.3105 0.3602 0.3364 0.0003  0.0202  -0.0075 577 GLN D C   
2886 O O   . GLN D 24  ? 0.4735 0.5178 0.4941 -0.0031 0.0215  -0.0073 577 GLN D O   
2887 C CB  . GLN D 24  ? 0.2852 0.3390 0.3182 -0.0009 0.0209  -0.0082 577 GLN D CB  
2888 C CG  . GLN D 24  ? 0.4828 0.5331 0.5132 0.0000  0.0200  -0.0092 577 GLN D CG  
2889 C CD  . GLN D 24  ? 0.3960 0.4501 0.4323 -0.0021 0.0217  -0.0088 577 GLN D CD  
2890 O OE1 . GLN D 24  ? 0.5372 0.5959 0.5786 -0.0039 0.0234  -0.0082 577 GLN D OE1 
2891 N NE2 . GLN D 24  ? 0.4655 0.5166 0.4998 -0.0010 0.0205  -0.0096 577 GLN D NE2 
2892 N N   . LEU D 25  ? 0.3389 0.3947 0.3703 0.0020  0.0199  -0.0071 578 LEU D N   
2893 C CA  . LEU D 25  ? 0.3133 0.3684 0.3437 0.0011  0.0204  -0.0059 578 LEU D CA  
2894 C C   . LEU D 25  ? 0.2325 0.2791 0.2519 0.0034  0.0191  -0.0062 578 LEU D C   
2895 O O   . LEU D 25  ? 0.2896 0.3296 0.3023 0.0007  0.0193  -0.0056 578 LEU D O   
2896 C CB  . LEU D 25  ? 0.3241 0.3854 0.3609 0.0017  0.0213  -0.0054 578 LEU D CB  
2897 C CG  . LEU D 25  ? 0.2516 0.3157 0.2937 -0.0006 0.0222  -0.0048 578 LEU D CG  
2898 C CD1 . LEU D 25  ? 0.1200 0.1854 0.1634 -0.0006 0.0236  -0.0045 578 LEU D CD1 
2899 C CD2 . LEU D 25  ? 0.3189 0.3811 0.3600 -0.0020 0.0214  -0.0045 578 LEU D CD2 
2900 N N   . GLN D 26  ? 0.2672 0.3139 0.2841 0.0086  0.0173  -0.0078 579 GLN D N   
2901 C CA  . GLN D 26  ? 0.3340 0.3703 0.3374 0.0129  0.0151  -0.0085 579 GLN D CA  
2902 C C   . GLN D 26  ? 0.3684 0.3895 0.3572 0.0103  0.0147  -0.0082 579 GLN D C   
2903 O O   . GLN D 26  ? 0.4429 0.4521 0.4182 0.0105  0.0140  -0.0078 579 GLN D O   
2904 C CB  . GLN D 26  ? 0.3018 0.3419 0.3052 0.0206  0.0121  -0.0117 579 GLN D CB  
2905 C CG  . GLN D 26  ? 0.2896 0.3434 0.3045 0.0222  0.0137  -0.0128 579 GLN D CG  
2906 C CD  . GLN D 26  ? 0.5289 0.5859 0.5411 0.0306  0.0111  -0.0166 579 GLN D CD  
2907 O OE1 . GLN D 26  ? 0.4433 0.5138 0.4659 0.0334  0.0105  -0.0205 579 GLN D OE1 
2908 N NE2 . GLN D 26  ? 0.3321 0.3771 0.3301 0.0347  0.0093  -0.0162 579 GLN D NE2 
2909 N N   . ASP D 27  ? 0.4137 0.4341 0.4038 0.0073  0.0157  -0.0085 580 ASP D N   
2910 C CA  . ASP D 27  ? 0.4474 0.4522 0.4222 0.0034  0.0169  -0.0088 580 ASP D CA  
2911 C C   . ASP D 27  ? 0.3663 0.3701 0.3409 -0.0048 0.0205  -0.0079 580 ASP D C   
2912 O O   . ASP D 27  ? 0.3937 0.3839 0.3540 -0.0099 0.0225  -0.0085 580 ASP D O   
2913 C CB  . ASP D 27  ? 0.5075 0.5122 0.4839 0.0024  0.0176  -0.0096 580 ASP D CB  
2914 C CG  . ASP D 27  ? 0.7899 0.7895 0.7597 0.0106  0.0129  -0.0116 580 ASP D CG  
2915 O OD1 . ASP D 27  ? 0.8713 0.8623 0.8294 0.0169  0.0093  -0.0128 580 ASP D OD1 
2916 O OD2 . ASP D 27  ? 0.5608 0.5648 0.5365 0.0114  0.0123  -0.0124 580 ASP D OD2 
2917 N N   . LYS D 28  ? 0.3971 0.4145 0.3864 -0.0065 0.0213  -0.0071 581 LYS D N   
2918 C CA  . LYS D 28  ? 0.2914 0.3098 0.2814 -0.0132 0.0233  -0.0074 581 LYS D CA  
2919 C C   . LYS D 28  ? 0.3344 0.3449 0.3149 -0.0123 0.0215  -0.0066 581 LYS D C   
2920 O O   . LYS D 28  ? 0.3744 0.3850 0.3545 -0.0178 0.0224  -0.0071 581 LYS D O   
2921 C CB  . LYS D 28  ? 0.3474 0.3820 0.3552 -0.0142 0.0238  -0.0077 581 LYS D CB  
2922 C CG  . LYS D 28  ? 0.4054 0.4469 0.4216 -0.0133 0.0248  -0.0082 581 LYS D CG  
2923 C CD  . LYS D 28  ? 0.3796 0.4201 0.3941 -0.0193 0.0283  -0.0103 581 LYS D CD  
2924 C CE  . LYS D 28  ? 0.2667 0.3143 0.2898 -0.0179 0.0292  -0.0108 581 LYS D CE  
2925 N NZ  . LYS D 28  ? 0.7071 0.7462 0.7228 -0.0142 0.0280  -0.0098 581 LYS D NZ  
2926 N N   . ASP D 29  ? 0.3373 0.3422 0.3110 -0.0050 0.0189  -0.0058 582 ASP D N   
2927 C CA  . ASP D 29  ? 0.3847 0.3801 0.3469 -0.0026 0.0171  -0.0050 582 ASP D CA  
2928 C C   . ASP D 29  ? 0.4566 0.4343 0.3985 0.0025  0.0148  -0.0058 582 ASP D C   
2929 O O   . ASP D 29  ? 0.3901 0.3681 0.3299 0.0113  0.0120  -0.0063 582 ASP D O   
2930 C CB  . ASP D 29  ? 0.3040 0.3103 0.2770 0.0028  0.0160  -0.0042 582 ASP D CB  
2931 C CG  . ASP D 29  ? 0.5105 0.5070 0.4709 0.0079  0.0140  -0.0037 582 ASP D CG  
2932 O OD1 . ASP D 29  ? 0.4213 0.4050 0.3684 0.0044  0.0136  -0.0031 582 ASP D OD1 
2933 O OD2 . ASP D 29  ? 0.2535 0.2562 0.2180 0.0151  0.0132  -0.0043 582 ASP D OD2 
2934 N N   . PRO D 30  ? 0.4252 0.3871 0.3510 -0.0027 0.0162  -0.0065 583 PRO D N   
2935 C CA  . PRO D 30  ? 0.4173 0.3569 0.3182 0.0025  0.0134  -0.0074 583 PRO D CA  
2936 C C   . PRO D 30  ? 0.4413 0.3656 0.3240 0.0061  0.0109  -0.0069 583 PRO D C   
2937 O O   . PRO D 30  ? 0.4736 0.3817 0.3370 0.0150  0.0068  -0.0080 583 PRO D O   
2938 C CB  . PRO D 30  ? 0.4236 0.3486 0.3108 -0.0067 0.0172  -0.0082 583 PRO D CB  
2939 C CG  . PRO D 30  ? 0.4096 0.3492 0.3131 -0.0180 0.0221  -0.0081 583 PRO D CG  
2940 C CD  . PRO D 30  ? 0.4765 0.4409 0.4065 -0.0134 0.0207  -0.0072 583 PRO D CD  
2941 N N   . ALA D 31  ? 0.3760 0.3051 0.2644 0.0004  0.0125  -0.0056 584 ALA D N   
2942 C CA  . ALA D 31  ? 0.4548 0.3713 0.3282 0.0039  0.0102  -0.0048 584 ALA D CA  
2943 C C   . ALA D 31  ? 0.5265 0.4532 0.4078 0.0164  0.0069  -0.0050 584 ALA D C   
2944 O O   . ALA D 31  ? 0.5827 0.4984 0.4502 0.0221  0.0045  -0.0048 584 ALA D O   
2945 C CB  . ALA D 31  ? 0.3966 0.3173 0.2757 -0.0061 0.0125  -0.0038 584 ALA D CB  
2946 N N   . ARG D 32  ? 0.5214 0.4689 0.4243 0.0201  0.0073  -0.0058 585 ARG D N   
2947 C CA  . ARG D 32  ? 0.4886 0.4499 0.4027 0.0296  0.0058  -0.0070 585 ARG D CA  
2948 C C   . ARG D 32  ? 0.4667 0.4313 0.3841 0.0290  0.0070  -0.0053 585 ARG D C   
2949 O O   . ARG D 32  ? 0.3432 0.3103 0.2593 0.0373  0.0059  -0.0066 585 ARG D O   
2950 C CB  . ARG D 32  ? 0.5513 0.5036 0.4508 0.0420  0.0011  -0.0103 585 ARG D CB  
2951 C CG  . ARG D 32  ? 0.5370 0.4798 0.4265 0.0448  -0.0016 -0.0124 585 ARG D CG  
2952 C CD  . ARG D 32  ? 0.5962 0.5590 0.5079 0.0430  -0.0002 -0.0135 585 ARG D CD  
2953 N NE  . ARG D 32  ? 0.7427 0.7252 0.6700 0.0520  -0.0022 -0.0173 585 ARG D NE  
2954 C CZ  . ARG D 32  ? 0.8131 0.8132 0.7588 0.0518  -0.0018 -0.0193 585 ARG D CZ  
2955 N NH1 . ARG D 32  ? 0.8666 0.8855 0.8263 0.0588  -0.0031 -0.0237 585 ARG D NH1 
2956 N NH2 . ARG D 32  ? 0.7292 0.7287 0.6791 0.0442  0.0000  -0.0174 585 ARG D NH2 
2957 N N   . ILE D 33  ? 0.4599 0.4256 0.3821 0.0198  0.0092  -0.0031 586 ILE D N   
2958 C CA  . ILE D 33  ? 0.3605 0.3284 0.2855 0.0192  0.0098  -0.0015 586 ILE D CA  
2959 C C   . ILE D 33  ? 0.3562 0.3424 0.2998 0.0224  0.0119  -0.0018 586 ILE D C   
2960 O O   . ILE D 33  ? 0.3087 0.2954 0.2513 0.0259  0.0126  -0.0014 586 ILE D O   
2961 C CB  . ILE D 33  ? 0.4350 0.4012 0.3618 0.0090  0.0105  -0.0003 586 ILE D CB  
2962 C CG1 . ILE D 33  ? 0.4421 0.3879 0.3472 0.0045  0.0093  -0.0004 586 ILE D CG1 
2963 C CG2 . ILE D 33  ? 0.2223 0.1926 0.1544 0.0090  0.0104  0.0009  586 ILE D CG2 
2964 C CD1 . ILE D 33  ? 0.3889 0.3354 0.2966 -0.0070 0.0105  -0.0009 586 ILE D CD1 
2965 N N   . PHE D 34  ? 0.3190 0.3187 0.2777 0.0209  0.0134  -0.0027 587 PHE D N   
2966 C CA  . PHE D 34  ? 0.2974 0.3116 0.2709 0.0217  0.0160  -0.0031 587 PHE D CA  
2967 C C   . PHE D 34  ? 0.3704 0.3959 0.3517 0.0271  0.0166  -0.0063 587 PHE D C   
2968 O O   . PHE D 34  ? 0.3757 0.4143 0.3702 0.0259  0.0196  -0.0073 587 PHE D O   
2969 C CB  . PHE D 34  ? 0.2904 0.3110 0.2750 0.0149  0.0173  -0.0019 587 PHE D CB  
2970 C CG  . PHE D 34  ? 0.3032 0.3164 0.2829 0.0098  0.0159  -0.0003 587 PHE D CG  
2971 C CD1 . PHE D 34  ? 0.2624 0.2730 0.2406 0.0096  0.0157  0.0008  587 PHE D CD1 
2972 C CD2 . PHE D 34  ? 0.2476 0.2575 0.2251 0.0048  0.0149  -0.0007 587 PHE D CD2 
2973 C CE1 . PHE D 34  ? 0.3976 0.4035 0.3729 0.0053  0.0133  0.0011  587 PHE D CE1 
2974 C CE2 . PHE D 34  ? 0.3145 0.3216 0.2905 -0.0007 0.0137  -0.0008 587 PHE D CE2 
2975 C CZ  . PHE D 34  ? 0.3097 0.3156 0.2854 0.0000  0.0123  0.0000  587 PHE D CZ  
2976 N N   . ALA D 35  ? 0.3440 0.3634 0.3156 0.0331  0.0134  -0.0084 588 ALA D N   
2977 C CA  . ALA D 35  ? 0.4155 0.4459 0.3942 0.0392  0.0122  -0.0126 588 ALA D CA  
2978 C C   . ALA D 35  ? 0.3442 0.3875 0.3305 0.0445  0.0143  -0.0159 588 ALA D C   
2979 O O   . ALA D 35  ? 0.4373 0.4978 0.4383 0.0450  0.0160  -0.0195 588 ALA D O   
2980 C CB  . ALA D 35  ? 0.4304 0.4473 0.3927 0.0458  0.0072  -0.0145 588 ALA D CB  
2981 N N   . GLN D 36  ? 0.4109 0.4461 0.3867 0.0479  0.0145  -0.0152 589 GLN D N   
2982 C CA  . GLN D 36  ? 0.3930 0.4394 0.3737 0.0540  0.0170  -0.0190 589 GLN D CA  
2983 C C   . GLN D 36  ? 0.3810 0.4225 0.3587 0.0498  0.0212  -0.0158 589 GLN D C   
2984 O O   . GLN D 36  ? 0.3271 0.3544 0.2963 0.0445  0.0203  -0.0109 589 GLN D O   
2985 C CB  . GLN D 36  ? 0.4294 0.4689 0.3962 0.0661  0.0120  -0.0227 589 GLN D CB  
2986 C CG  . GLN D 36  ? 0.4968 0.5421 0.4658 0.0729  0.0069  -0.0276 589 GLN D CG  
2987 C CD  . GLN D 36  ? 0.7409 0.8140 0.7327 0.0744  0.0092  -0.0340 589 GLN D CD  
2988 O OE1 . GLN D 36  ? 0.5049 0.5935 0.5084 0.0734  0.0147  -0.0366 589 GLN D OE1 
2989 N NE2 . GLN D 36  ? 0.5147 0.5935 0.5118 0.0763  0.0053  -0.0370 589 GLN D NE2 
2990 N N   . PRO D 37  ? 0.3740 0.4274 0.3589 0.0518  0.0260  -0.0189 590 PRO D N   
2991 C CA  . PRO D 37  ? 0.4520 0.4978 0.4315 0.0479  0.0303  -0.0157 590 PRO D CA  
2992 C C   . PRO D 37  ? 0.4463 0.4716 0.4057 0.0521  0.0265  -0.0127 590 PRO D C   
2993 O O   . PRO D 37  ? 0.4119 0.4320 0.3615 0.0605  0.0223  -0.0148 590 PRO D O   
2994 C CB  . PRO D 37  ? 0.4389 0.5013 0.4279 0.0500  0.0367  -0.0210 590 PRO D CB  
2995 C CG  . PRO D 37  ? 0.5059 0.5889 0.5105 0.0525  0.0361  -0.0271 590 PRO D CG  
2996 C CD  . PRO D 37  ? 0.4643 0.5392 0.4629 0.0567  0.0281  -0.0261 590 PRO D CD  
2997 N N   . VAL D 38  ? 0.4371 0.4497 0.3892 0.0465  0.0272  -0.0081 591 VAL D N   
2998 C CA  . VAL D 38  ? 0.4423 0.4354 0.3756 0.0489  0.0238  -0.0053 591 VAL D CA  
2999 C C   . VAL D 38  ? 0.5437 0.5363 0.4688 0.0586  0.0251  -0.0085 591 VAL D C   
3000 O O   . VAL D 38  ? 0.5487 0.5534 0.4820 0.0599  0.0309  -0.0113 591 VAL D O   
3001 C CB  . VAL D 38  ? 0.5358 0.5183 0.4644 0.0423  0.0247  -0.0011 591 VAL D CB  
3002 C CG1 . VAL D 38  ? 0.5074 0.4709 0.4163 0.0454  0.0217  0.0007  591 VAL D CG1 
3003 C CG2 . VAL D 38  ? 0.4472 0.4289 0.3815 0.0344  0.0218  0.0011  591 VAL D CG2 
3004 N N   . SER D 39  ? 0.4914 0.4700 0.3995 0.0655  0.0201  -0.0086 592 SER D N   
3005 C CA  . SER D 39  ? 0.6072 0.5853 0.5067 0.0765  0.0208  -0.0123 592 SER D CA  
3006 C C   . SER D 39  ? 0.5333 0.5018 0.4241 0.0753  0.0245  -0.0098 592 SER D C   
3007 O O   . SER D 39  ? 0.4783 0.4275 0.3551 0.0709  0.0216  -0.0050 592 SER D O   
3008 C CB  . SER D 39  ? 0.5956 0.5567 0.4745 0.0854  0.0138  -0.0131 592 SER D CB  
3009 O OG  . SER D 39  ? 0.7746 0.7274 0.6387 0.0955  0.0136  -0.0150 592 SER D OG  
3010 N N   . LEU D 40  ? 0.4476 0.4298 0.3466 0.0784  0.0310  -0.0135 593 LEU D N   
3011 C CA  . LEU D 40  ? 0.6138 0.5852 0.5024 0.0777  0.0352  -0.0114 593 LEU D CA  
3012 C C   . LEU D 40  ? 0.6362 0.5891 0.5018 0.0878  0.0313  -0.0113 593 LEU D C   
3013 O O   . LEU D 40  ? 0.6789 0.6148 0.5296 0.0870  0.0320  -0.0080 593 LEU D O   
3014 C CB  . LEU D 40  ? 0.6167 0.6066 0.5192 0.0760  0.0452  -0.0156 593 LEU D CB  
3015 C CG  . LEU D 40  ? 0.6181 0.6213 0.5381 0.0650  0.0508  -0.0156 593 LEU D CG  
3016 C CD1 . LEU D 40  ? 0.4972 0.5118 0.4236 0.0620  0.0619  -0.0196 593 LEU D CD1 
3017 C CD2 . LEU D 40  ? 0.5767 0.5635 0.4908 0.0562  0.0477  -0.0089 593 LEU D CD2 
3018 N N   . LYS D 41  ? 0.6257 0.5804 0.4867 0.0979  0.0266  -0.0152 594 LYS D N   
3019 C CA  . LYS D 41  ? 0.6439 0.5784 0.4801 0.1084  0.0218  -0.0153 594 LYS D CA  
3020 C C   . LYS D 41  ? 0.6428 0.5501 0.4595 0.1022  0.0152  -0.0090 594 LYS D C   
3021 O O   . LYS D 41  ? 0.6897 0.5746 0.4843 0.1044  0.0128  -0.0063 594 LYS D O   
3022 C CB  . LYS D 41  ? 0.7376 0.6813 0.5736 0.1220  0.0177  -0.0221 594 LYS D CB  
3023 C CG  . LYS D 41  ? 0.8256 0.7560 0.6395 0.1369  0.0149  -0.0252 594 LYS D CG  
3024 N N   . GLU D 42  ? 0.6139 0.5236 0.4389 0.0937  0.0127  -0.0070 595 GLU D N   
3025 C CA  . GLU D 42  ? 0.5973 0.4851 0.4071 0.0855  0.0078  -0.0021 595 GLU D CA  
3026 C C   . GLU D 42  ? 0.5933 0.4774 0.4065 0.0753  0.0097  0.0020  595 GLU D C   
3027 O O   . GLU D 42  ? 0.7024 0.5666 0.4992 0.0705  0.0060  0.0052  595 GLU D O   
3028 C CB  . GLU D 42  ? 0.5292 0.4218 0.3470 0.0797  0.0052  -0.0022 595 GLU D CB  
3029 C CG  . GLU D 42  ? 0.8852 0.7643 0.6847 0.0880  -0.0001 -0.0047 595 GLU D CG  
3030 C CD  . GLU D 42  ? 1.0758 0.9573 0.8810 0.0816  -0.0019 -0.0047 595 GLU D CD  
3031 O OE1 . GLU D 42  ? 1.1806 1.0393 0.9643 0.0786  -0.0058 -0.0033 595 GLU D OE1 
3032 O OE2 . GLU D 42  ? 0.9511 0.8556 0.7807 0.0790  0.0007  -0.0062 595 GLU D OE2 
3033 N N   . VAL D 43  ? 0.5394 0.4416 0.3725 0.0716  0.0152  0.0016  596 VAL D N   
3034 C CA  . VAL D 43  ? 0.4368 0.3346 0.2722 0.0631  0.0163  0.0051  596 VAL D CA  
3035 C C   . VAL D 43  ? 0.5566 0.4612 0.3966 0.0655  0.0233  0.0040  596 VAL D C   
3036 O O   . VAL D 43  ? 0.5596 0.4786 0.4159 0.0609  0.0280  0.0032  596 VAL D O   
3037 C CB  . VAL D 43  ? 0.5577 0.4674 0.4108 0.0537  0.0158  0.0059  596 VAL D CB  
3038 C CG1 . VAL D 43  ? 0.4534 0.3543 0.3042 0.0463  0.0138  0.0089  596 VAL D CG1 
3039 C CG2 . VAL D 43  ? 0.4602 0.3686 0.3120 0.0520  0.0114  0.0054  596 VAL D CG2 
3040 N N   . PRO D 44  ? 0.6013 0.4935 0.4248 0.0725  0.0243  0.0038  597 PRO D N   
3041 C CA  . PRO D 44  ? 0.5470 0.4447 0.3728 0.0749  0.0323  0.0020  597 PRO D CA  
3042 C C   . PRO D 44  ? 0.4985 0.3902 0.3247 0.0669  0.0352  0.0049  597 PRO D C   
3043 O O   . PRO D 44  ? 0.5433 0.4414 0.3735 0.0665  0.0432  0.0030  597 PRO D O   
3044 C CB  . PRO D 44  ? 0.6000 0.4813 0.4039 0.0844  0.0314  0.0017  597 PRO D CB  
3045 C CG  . PRO D 44  ? 0.6000 0.4683 0.3906 0.0877  0.0232  0.0027  597 PRO D CG  
3046 C CD  . PRO D 44  ? 0.5992 0.4691 0.3987 0.0776  0.0186  0.0053  597 PRO D CD  
3047 N N   . ASP D 45  ? 0.5076 0.3865 0.3286 0.0606  0.0290  0.0088  598 ASP D N   
3048 C CA  . ASP D 45  ? 0.5397 0.4126 0.3605 0.0547  0.0305  0.0107  598 ASP D CA  
3049 C C   . ASP D 45  ? 0.5489 0.4371 0.3888 0.0479  0.0312  0.0102  598 ASP D C   
3050 O O   . ASP D 45  ? 0.4795 0.3607 0.3179 0.0433  0.0301  0.0117  598 ASP D O   
3051 C CB  . ASP D 45  ? 0.6460 0.4973 0.4505 0.0528  0.0226  0.0140  598 ASP D CB  
3052 C CG  . ASP D 45  ? 0.7332 0.5874 0.5443 0.0477  0.0146  0.0146  598 ASP D CG  
3053 O OD1 . ASP D 45  ? 0.5283 0.3949 0.3493 0.0478  0.0145  0.0132  598 ASP D OD1 
3054 O OD2 . ASP D 45  ? 0.6035 0.4480 0.4097 0.0436  0.0084  0.0159  598 ASP D OD2 
3055 N N   . TYR D 46  ? 0.3941 0.3013 0.2502 0.0479  0.0324  0.0079  599 TYR D N   
3056 C CA  . TYR D 46  ? 0.4140 0.3339 0.2867 0.0416  0.0322  0.0076  599 TYR D CA  
3057 C C   . TYR D 46  ? 0.4278 0.3467 0.3015 0.0378  0.0383  0.0075  599 TYR D C   
3058 O O   . TYR D 46  ? 0.4595 0.3734 0.3337 0.0335  0.0352  0.0090  599 TYR D O   
3059 C CB  . TYR D 46  ? 0.3185 0.2581 0.2070 0.0429  0.0334  0.0047  599 TYR D CB  
3060 C CG  . TYR D 46  ? 0.3845 0.3346 0.2877 0.0370  0.0316  0.0049  599 TYR D CG  
3061 C CD1 . TYR D 46  ? 0.4842 0.4282 0.3865 0.0332  0.0248  0.0070  599 TYR D CD1 
3062 C CD2 . TYR D 46  ? 0.2961 0.2633 0.2145 0.0349  0.0368  0.0023  599 TYR D CD2 
3063 C CE1 . TYR D 46  ? 0.3809 0.3354 0.2968 0.0285  0.0234  0.0067  599 TYR D CE1 
3064 C CE2 . TYR D 46  ? 0.5510 0.5266 0.4816 0.0300  0.0349  0.0025  599 TYR D CE2 
3065 C CZ  . TYR D 46  ? 0.3766 0.3457 0.3057 0.0273  0.0284  0.0048  599 TYR D CZ  
3066 O OH  . TYR D 46  ? 0.4078 0.3861 0.3491 0.0231  0.0271  0.0045  599 TYR D OH  
3067 N N   . LEU D 47  ? 0.4773 0.3992 0.3488 0.0395  0.0469  0.0052  600 LEU D N   
3068 C CA  . LEU D 47  ? 0.5776 0.4968 0.4473 0.0344  0.0546  0.0045  600 LEU D CA  
3069 C C   . LEU D 47  ? 0.5980 0.4915 0.4472 0.0334  0.0531  0.0076  600 LEU D C   
3070 O O   . LEU D 47  ? 0.5441 0.4303 0.3881 0.0285  0.0579  0.0075  600 LEU D O   
3071 C CB  . LEU D 47  ? 0.4564 0.3883 0.3308 0.0351  0.0656  0.0000  600 LEU D CB  
3072 C CG  . LEU D 47  ? 0.5398 0.4985 0.4357 0.0359  0.0667  -0.0042 600 LEU D CG  
3073 C CD1 . LEU D 47  ? 0.4347 0.4100 0.3385 0.0351  0.0780  -0.0102 600 LEU D CD1 
3074 C CD2 . LEU D 47  ? 0.5325 0.4986 0.4410 0.0299  0.0635  -0.0032 600 LEU D CD2 
3075 N N   . ASP D 48  ? 0.5448 0.4230 0.3805 0.0377  0.0462  0.0100  601 ASP D N   
3076 C CA  . ASP D 48  ? 0.6081 0.4621 0.4251 0.0372  0.0421  0.0126  601 ASP D CA  
3077 C C   . ASP D 48  ? 0.5458 0.3995 0.3687 0.0341  0.0340  0.0134  601 ASP D C   
3078 O O   . ASP D 48  ? 0.6665 0.5026 0.4760 0.0339  0.0310  0.0144  601 ASP D O   
3079 C CB  . ASP D 48  ? 0.6394 0.4769 0.4403 0.0422  0.0360  0.0145  601 ASP D CB  
3080 C CG  . ASP D 48  ? 0.6118 0.4449 0.4022 0.0467  0.0435  0.0137  601 ASP D CG  
3081 O OD1 . ASP D 48  ? 0.6535 0.4900 0.4437 0.0453  0.0541  0.0116  601 ASP D OD1 
3082 O OD2 . ASP D 48  ? 0.5437 0.3695 0.3252 0.0515  0.0388  0.0147  601 ASP D OD2 
3083 N N   . HIS D 49  ? 0.5466 0.4189 0.3881 0.0325  0.0304  0.0126  602 HIS D N   
3084 C CA  . HIS D 49  ? 0.5306 0.4055 0.3794 0.0301  0.0231  0.0126  602 HIS D CA  
3085 C C   . HIS D 49  ? 0.4953 0.3851 0.3590 0.0264  0.0273  0.0112  602 HIS D C   
3086 O O   . HIS D 49  ? 0.4865 0.3714 0.3489 0.0251  0.0242  0.0110  602 HIS D O   
3087 C CB  . HIS D 49  ? 0.4940 0.3751 0.3497 0.0303  0.0145  0.0126  602 HIS D CB  
3088 C CG  . HIS D 49  ? 0.6240 0.4893 0.4641 0.0329  0.0095  0.0137  602 HIS D CG  
3089 N ND1 . HIS D 49  ? 0.6937 0.5573 0.5283 0.0353  0.0113  0.0144  602 HIS D ND1 
3090 C CD2 . HIS D 49  ? 0.7707 0.6200 0.5980 0.0341  0.0024  0.0140  602 HIS D CD2 
3091 C CE1 . HIS D 49  ? 0.7774 0.6240 0.5962 0.0369  0.0059  0.0154  602 HIS D CE1 
3092 N NE2 . HIS D 49  ? 0.6503 0.4888 0.4652 0.0361  0.0003  0.0151  602 HIS D NE2 
3093 N N   . ILE D 50  ? 0.4571 0.3636 0.3331 0.0253  0.0339  0.0099  603 ILE D N   
3094 C CA  . ILE D 50  ? 0.4255 0.3469 0.3163 0.0213  0.0375  0.0083  603 ILE D CA  
3095 C C   . ILE D 50  ? 0.4999 0.4234 0.3893 0.0179  0.0485  0.0065  603 ILE D C   
3096 O O   . ILE D 50  ? 0.5393 0.4708 0.4312 0.0190  0.0549  0.0045  603 ILE D O   
3097 C CB  . ILE D 50  ? 0.4613 0.4025 0.3696 0.0217  0.0352  0.0072  603 ILE D CB  
3098 C CG1 . ILE D 50  ? 0.5531 0.4922 0.4624 0.0226  0.0257  0.0084  603 ILE D CG1 
3099 C CG2 . ILE D 50  ? 0.5163 0.4722 0.4392 0.0178  0.0387  0.0055  603 ILE D CG2 
3100 C CD1 . ILE D 50  ? 0.6221 0.5555 0.5307 0.0209  0.0200  0.0086  603 ILE D CD1 
3101 N N   . LYS D 51  ? 0.5238 0.4404 0.4092 0.0135  0.0507  0.0064  604 LYS D N   
3102 C CA  . LYS D 51  ? 0.5806 0.4961 0.4619 0.0079  0.0619  0.0043  604 LYS D CA  
3103 C C   . LYS D 51  ? 0.5711 0.5124 0.4737 0.0041  0.0672  0.0009  604 LYS D C   
3104 O O   . LYS D 51  ? 0.5620 0.5132 0.4684 0.0012  0.0767  -0.0024 604 LYS D O   
3105 C CB  . LYS D 51  ? 0.6495 0.5435 0.5141 0.0044  0.0618  0.0055  604 LYS D CB  
3106 C CG  . LYS D 51  ? 0.7895 0.6668 0.6354 -0.0012 0.0729  0.0043  604 LYS D CG  
3107 C CD  . LYS D 51  ? 0.8196 0.6659 0.6402 -0.0013 0.0693  0.0062  604 LYS D CD  
3108 N N   . HIS D 52  ? 0.5379 0.4905 0.4542 0.0041  0.0612  0.0013  605 HIS D N   
3109 C CA  . HIS D 52  ? 0.5248 0.4993 0.4595 0.0006  0.0650  -0.0017 605 HIS D CA  
3110 C C   . HIS D 52  ? 0.5268 0.5164 0.4767 0.0052  0.0574  -0.0015 605 HIS D C   
3111 O O   . HIS D 52  ? 0.5210 0.5111 0.4756 0.0047  0.0517  -0.0001 605 HIS D O   
3112 C CB  . HIS D 52  ? 0.5237 0.4929 0.4561 -0.0061 0.0674  -0.0019 605 HIS D CB  
3113 C CG  . HIS D 52  ? 0.7068 0.6621 0.6238 -0.0130 0.0773  -0.0032 605 HIS D CG  
3114 N ND1 . HIS D 52  ? 0.7464 0.6757 0.6423 -0.0153 0.0767  -0.0010 605 HIS D ND1 
3115 C CD2 . HIS D 52  ? 0.9320 0.8950 0.8504 -0.0183 0.0883  -0.0072 605 HIS D CD2 
3116 C CE1 . HIS D 52  ? 1.0152 0.9339 0.8977 -0.0226 0.0875  -0.0029 605 HIS D CE1 
3117 N NE2 . HIS D 52  ? 1.0200 0.9604 0.9172 -0.0252 0.0952  -0.0069 605 HIS D NE2 
3118 N N   . PRO D 53  ? 0.4863 0.4867 0.4420 0.0101  0.0575  -0.0034 606 PRO D N   
3119 C CA  . PRO D 53  ? 0.5134 0.5239 0.4787 0.0145  0.0509  -0.0034 606 PRO D CA  
3120 C C   . PRO D 53  ? 0.4747 0.5016 0.4557 0.0118  0.0512  -0.0058 606 PRO D C   
3121 O O   . PRO D 53  ? 0.4750 0.5134 0.4636 0.0083  0.0577  -0.0094 606 PRO D O   
3122 C CB  . PRO D 53  ? 0.3403 0.3567 0.3048 0.0209  0.0523  -0.0060 606 PRO D CB  
3123 C CG  . PRO D 53  ? 0.5361 0.5487 0.4935 0.0194  0.0603  -0.0075 606 PRO D CG  
3124 C CD  . PRO D 53  ? 0.5335 0.5395 0.4880 0.0112  0.0651  -0.0068 606 PRO D CD  
3125 N N   . MET D 54  ? 0.4646 0.4928 0.4502 0.0128  0.0446  -0.0041 607 MET D N   
3126 C CA  . MET D 54  ? 0.4480 0.4902 0.4470 0.0113  0.0440  -0.0062 607 MET D CA  
3127 C C   . MET D 54  ? 0.3555 0.3999 0.3568 0.0156  0.0376  -0.0059 607 MET D C   
3128 O O   . MET D 54  ? 0.4193 0.4531 0.4121 0.0175  0.0334  -0.0033 607 MET D O   
3129 C CB  . MET D 54  ? 0.4426 0.4808 0.4426 0.0055  0.0442  -0.0046 607 MET D CB  
3130 C CG  . MET D 54  ? 0.2815 0.3326 0.2939 0.0026  0.0449  -0.0068 607 MET D CG  
3131 S SD  . MET D 54  ? 0.4371 0.5065 0.4609 0.0001  0.0518  -0.0127 607 MET D SD  
3132 C CE  . MET D 54  ? 0.3683 0.4264 0.3807 -0.0068 0.0603  -0.0125 607 MET D CE  
3133 N N   . ASP D 55  ? 0.4333 0.4903 0.4447 0.0167  0.0371  -0.0088 608 ASP D N   
3134 C CA  . ASP D 55  ? 0.4531 0.5100 0.4641 0.0207  0.0315  -0.0089 608 ASP D CA  
3135 C C   . ASP D 55  ? 0.4066 0.4760 0.4295 0.0194  0.0314  -0.0116 608 ASP D C   
3136 O O   . ASP D 55  ? 0.3753 0.4545 0.4068 0.0157  0.0356  -0.0138 608 ASP D O   
3137 C CB  . ASP D 55  ? 0.3535 0.4095 0.3579 0.0286  0.0299  -0.0112 608 ASP D CB  
3138 C CG  . ASP D 55  ? 0.4223 0.4948 0.4361 0.0321  0.0333  -0.0169 608 ASP D CG  
3139 O OD1 . ASP D 55  ? 0.5776 0.6533 0.5921 0.0307  0.0388  -0.0181 608 ASP D OD1 
3140 O OD2 . ASP D 55  ? 0.4633 0.5458 0.4838 0.0360  0.0305  -0.0208 608 ASP D OD2 
3141 N N   . PHE D 56  ? 0.3611 0.4288 0.3826 0.0221  0.0268  -0.0118 609 PHE D N   
3142 C CA  . PHE D 56  ? 0.3270 0.4041 0.3580 0.0211  0.0259  -0.0141 609 PHE D CA  
3143 C C   . PHE D 56  ? 0.3636 0.4561 0.4034 0.0254  0.0265  -0.0201 609 PHE D C   
3144 O O   . PHE D 56  ? 0.3452 0.4486 0.3956 0.0221  0.0278  -0.0225 609 PHE D O   
3145 C CB  . PHE D 56  ? 0.3210 0.3895 0.3458 0.0225  0.0212  -0.0128 609 PHE D CB  
3146 C CG  . PHE D 56  ? 0.2698 0.3296 0.2916 0.0167  0.0212  -0.0087 609 PHE D CG  
3147 C CD1 . PHE D 56  ? 0.2628 0.3263 0.2918 0.0114  0.0236  -0.0074 609 PHE D CD1 
3148 C CD2 . PHE D 56  ? 0.3858 0.4336 0.3968 0.0165  0.0188  -0.0070 609 PHE D CD2 
3149 C CE1 . PHE D 56  ? 0.4137 0.4715 0.4411 0.0077  0.0229  -0.0050 609 PHE D CE1 
3150 C CE2 . PHE D 56  ? 0.3205 0.3643 0.3316 0.0109  0.0190  -0.0048 609 PHE D CE2 
3151 C CZ  . PHE D 56  ? 0.2801 0.3302 0.3004 0.0074  0.0207  -0.0041 609 PHE D CZ  
3152 N N   . ALA D 57  ? 0.3122 0.4064 0.3477 0.0330  0.0251  -0.0231 610 ALA D N   
3153 C CA  . ALA D 57  ? 0.3667 0.4796 0.4130 0.0381  0.0254  -0.0305 610 ALA D CA  
3154 C C   . ALA D 57  ? 0.3376 0.4648 0.3963 0.0307  0.0331  -0.0329 610 ALA D C   
3155 O O   . ALA D 57  ? 0.3614 0.5053 0.4334 0.0283  0.0346  -0.0380 610 ALA D O   
3156 C CB  . ALA D 57  ? 0.2925 0.4041 0.3306 0.0493  0.0222  -0.0339 610 ALA D CB  
3157 N N   . THR D 58  ? 0.3939 0.5128 0.4467 0.0260  0.0382  -0.0293 611 THR D N   
3158 C CA  . THR D 58  ? 0.4261 0.5536 0.4858 0.0178  0.0465  -0.0313 611 THR D CA  
3159 C C   . THR D 58  ? 0.3930 0.5203 0.4576 0.0085  0.0483  -0.0297 611 THR D C   
3160 O O   . THR D 58  ? 0.3963 0.5363 0.4702 0.0021  0.0537  -0.0341 611 THR D O   
3161 C CB  . THR D 58  ? 0.4312 0.5449 0.4790 0.0156  0.0510  -0.0274 611 THR D CB  
3162 O OG1 . THR D 58  ? 0.3549 0.4640 0.3948 0.0248  0.0479  -0.0276 611 THR D OG1 
3163 C CG2 . THR D 58  ? 0.3911 0.5130 0.4432 0.0081  0.0606  -0.0311 611 THR D CG2 
3164 N N   . MET D 59  ? 0.3309 0.4440 0.3888 0.0076  0.0440  -0.0240 612 MET D N   
3165 C CA  . MET D 59  ? 0.3195 0.4310 0.3804 0.0010  0.0442  -0.0225 612 MET D CA  
3166 C C   . MET D 59  ? 0.2961 0.4223 0.3686 0.0021  0.0416  -0.0272 612 MET D C   
3167 O O   . MET D 59  ? 0.3625 0.4947 0.4411 -0.0045 0.0444  -0.0292 612 MET D O   
3168 C CB  . MET D 59  ? 0.3101 0.4058 0.3625 0.0015  0.0397  -0.0165 612 MET D CB  
3169 C CG  . MET D 59  ? 0.3125 0.3937 0.3545 -0.0012 0.0414  -0.0122 612 MET D CG  
3170 S SD  . MET D 59  ? 0.3722 0.4416 0.4088 0.0000  0.0355  -0.0076 612 MET D SD  
3171 C CE  . MET D 59  ? 0.2874 0.3592 0.3291 -0.0046 0.0359  -0.0080 612 MET D CE  
3172 N N   . ARG D 60  ? 0.3520 0.4819 0.4254 0.0106  0.0358  -0.0293 613 ARG D N   
3173 C CA  . ARG D 60  ? 0.4018 0.5458 0.4853 0.0137  0.0322  -0.0350 613 ARG D CA  
3174 C C   . ARG D 60  ? 0.3237 0.4888 0.4208 0.0104  0.0370  -0.0425 613 ARG D C   
3175 O O   . ARG D 60  ? 0.3000 0.4752 0.4064 0.0048  0.0380  -0.0459 613 ARG D O   
3176 C CB  . ARG D 60  ? 0.3878 0.5282 0.4653 0.0251  0.0246  -0.0364 613 ARG D CB  
3177 C CG  . ARG D 60  ? 0.5816 0.7366 0.6675 0.0317  0.0193  -0.0439 613 ARG D CG  
3178 C CD  . ARG D 60  ? 0.5786 0.7231 0.6582 0.0343  0.0129  -0.0422 613 ARG D CD  
3179 N NE  . ARG D 60  ? 0.4393 0.5614 0.5026 0.0350  0.0114  -0.0352 613 ARG D NE  
3180 C CZ  . ARG D 60  ? 0.5451 0.6548 0.6020 0.0321  0.0097  -0.0313 613 ARG D CZ  
3181 N NH1 . ARG D 60  ? 0.4214 0.5365 0.4850 0.0296  0.0084  -0.0330 613 ARG D NH1 
3182 N NH2 . ARG D 60  ? 0.4063 0.4984 0.4499 0.0313  0.0095  -0.0260 613 ARG D NH2 
3183 N N   . LYS D 61  ? 0.4303 0.6021 0.5284 0.0130  0.0407  -0.0454 614 LYS D N   
3184 C CA  . LYS D 61  ? 0.3455 0.5408 0.4578 0.0105  0.0460  -0.0543 614 LYS D CA  
3185 C C   . LYS D 61  ? 0.3976 0.5957 0.5142 -0.0038 0.0544  -0.0547 614 LYS D C   
3186 O O   . LYS D 61  ? 0.4701 0.6861 0.6000 -0.0091 0.0561  -0.0614 614 LYS D O   
3187 C CB  . LYS D 61  ? 0.4510 0.6488 0.5602 0.0153  0.0497  -0.0561 614 LYS D CB  
3188 C CG  . LYS D 61  ? 0.5761 0.8020 0.7016 0.0154  0.0546  -0.0671 614 LYS D CG  
3189 C CD  . LYS D 61  ? 0.7087 0.9351 0.8297 0.0173  0.0610  -0.0683 614 LYS D CD  
3190 C CE  . LYS D 61  ? 0.7231 0.9737 0.8590 0.0084  0.0718  -0.0774 614 LYS D CE  
3191 N NZ  . LYS D 61  ? 0.8837 1.1281 1.0110 0.0061  0.0807  -0.0765 614 LYS D NZ  
3192 N N   . ARG D 62  ? 0.3398 0.5187 0.4434 -0.0100 0.0591  -0.0478 615 ARG D N   
3193 C CA  . ARG D 62  ? 0.3358 0.5081 0.4358 -0.0231 0.0664  -0.0465 615 ARG D CA  
3194 C C   . ARG D 62  ? 0.4275 0.5989 0.5306 -0.0276 0.0631  -0.0459 615 ARG D C   
3195 O O   . ARG D 62  ? 0.4719 0.6486 0.5786 -0.0381 0.0685  -0.0494 615 ARG D O   
3196 C CB  . ARG D 62  ? 0.3437 0.4905 0.4251 -0.0247 0.0686  -0.0385 615 ARG D CB  
3197 C CG  . ARG D 62  ? 0.2748 0.4048 0.3455 -0.0344 0.0717  -0.0345 615 ARG D CG  
3198 C CD  . ARG D 62  ? 0.6998 0.8069 0.7519 -0.0367 0.0754  -0.0293 615 ARG D CD  
3199 N NE  . ARG D 62  ? 0.7657 0.8565 0.8054 -0.0463 0.0793  -0.0274 615 ARG D NE  
3200 C CZ  . ARG D 62  ? 0.8653 0.9308 0.8854 -0.0473 0.0795  -0.0221 615 ARG D CZ  
3201 N NH1 . ARG D 62  ? 0.9567 1.0063 0.9637 -0.0552 0.0825  -0.0212 615 ARG D NH1 
3202 N NH2 . ARG D 62  ? 0.7640 0.8189 0.7760 -0.0399 0.0760  -0.0182 615 ARG D NH2 
3203 N N   . LEU D 63  ? 0.4963 0.6599 0.5967 -0.0202 0.0546  -0.0418 616 LEU D N   
3204 C CA  . LEU D 63  ? 0.4790 0.6405 0.5812 -0.0231 0.0508  -0.0409 616 LEU D CA  
3205 C C   . LEU D 63  ? 0.4216 0.6058 0.5398 -0.0231 0.0489  -0.0495 616 LEU D C   
3206 O O   . LEU D 63  ? 0.2704 0.4572 0.3919 -0.0308 0.0501  -0.0513 616 LEU D O   
3207 C CB  . LEU D 63  ? 0.5037 0.6511 0.5982 -0.0151 0.0431  -0.0348 616 LEU D CB  
3208 C CG  . LEU D 63  ? 0.4941 0.6405 0.5906 -0.0135 0.0373  -0.0346 616 LEU D CG  
3209 C CD1 . LEU D 63  ? 0.6807 0.8199 0.7739 -0.0228 0.0405  -0.0328 616 LEU D CD1 
3210 C CD2 . LEU D 63  ? 0.4096 0.5426 0.4974 -0.0060 0.0316  -0.0294 616 LEU D CD2 
3211 N N   . GLU D 64  ? 0.4566 0.6568 0.5839 -0.0141 0.0454  -0.0552 617 GLU D N   
3212 C CA  . GLU D 64  ? 0.5631 0.7876 0.7069 -0.0127 0.0426  -0.0650 617 GLU D CA  
3213 C C   . GLU D 64  ? 0.5853 0.8309 0.7419 -0.0235 0.0518  -0.0733 617 GLU D C   
3214 O O   . GLU D 64  ? 0.6067 0.8755 0.7793 -0.0248 0.0504  -0.0827 617 GLU D O   
3215 C CB  . GLU D 64  ? 0.4906 0.7240 0.6379 0.0026  0.0341  -0.0693 617 GLU D CB  
3216 C CG  . GLU D 64  ? 0.6513 0.8635 0.7844 0.0120  0.0254  -0.0625 617 GLU D CG  
3217 C CD  . GLU D 64  ? 0.7538 0.9593 0.8856 0.0095  0.0208  -0.0607 617 GLU D CD  
3218 O OE1 . GLU D 64  ? 0.7934 1.0140 0.9370 0.0040  0.0212  -0.0667 617 GLU D OE1 
3219 O OE2 . GLU D 64  ? 0.8508 1.0360 0.9695 0.0126  0.0170  -0.0538 617 GLU D OE2 
3220 N N   . ALA D 65  ? 0.5374 0.7744 0.6865 -0.0317 0.0612  -0.0704 618 ALA D N   
3221 C CA  . ALA D 65  ? 0.5555 0.8060 0.7118 -0.0457 0.0721  -0.0770 618 ALA D CA  
3222 C C   . ALA D 65  ? 0.5436 0.7716 0.6849 -0.0595 0.0779  -0.0709 618 ALA D C   
3223 O O   . ALA D 65  ? 0.6354 0.8598 0.7710 -0.0715 0.0884  -0.0724 618 ALA D O   
3224 C CB  . ALA D 65  ? 0.4198 0.6764 0.5760 -0.0451 0.0797  -0.0796 618 ALA D CB  
3225 N N   . GLN D 66  ? 0.5300 0.7414 0.6631 -0.0573 0.0712  -0.0645 619 GLN D N   
3226 C CA  . GLN D 66  ? 0.6106 0.7988 0.7275 -0.0680 0.0749  -0.0588 619 GLN D CA  
3227 C C   . GLN D 66  ? 0.5262 0.6933 0.6248 -0.0745 0.0832  -0.0541 619 GLN D C   
3228 O O   . GLN D 66  ? 0.4583 0.6148 0.5463 -0.0878 0.0912  -0.0549 619 GLN D O   
3229 C CB  . GLN D 66  ? 0.6979 0.8974 0.8223 -0.0805 0.0782  -0.0656 619 GLN D CB  
3230 C CG  . GLN D 66  ? 0.7518 0.9554 0.8829 -0.0754 0.0685  -0.0659 619 GLN D CG  
3231 C CD  . GLN D 66  ? 0.9127 1.1426 1.0636 -0.0640 0.0609  -0.0729 619 GLN D CD  
3232 O OE1 . GLN D 66  ? 0.8691 1.1243 1.0356 -0.0652 0.0642  -0.0821 619 GLN D OE1 
3233 N NE2 . GLN D 66  ? 0.7387 0.9621 0.8878 -0.0526 0.0507  -0.0691 619 GLN D NE2 
3234 N N   . GLY D 67  ? 0.4171 0.5761 0.5098 -0.0651 0.0811  -0.0494 620 GLY D N   
3235 C CA  . GLY D 67  ? 0.4720 0.6111 0.5471 -0.0689 0.0877  -0.0453 620 GLY D CA  
3236 C C   . GLY D 67  ? 0.4655 0.5743 0.5199 -0.0665 0.0838  -0.0362 620 GLY D C   
3237 O O   . GLY D 67  ? 0.5240 0.6136 0.5615 -0.0681 0.0877  -0.0328 620 GLY D O   
3238 N N   . TYR D 68  ? 0.3948 0.4996 0.4502 -0.0618 0.0759  -0.0330 621 TYR D N   
3239 C CA  . TYR D 68  ? 0.4391 0.5189 0.4775 -0.0587 0.0717  -0.0259 621 TYR D CA  
3240 C C   . TYR D 68  ? 0.4197 0.4907 0.4509 -0.0672 0.0733  -0.0264 621 TYR D C   
3241 O O   . TYR D 68  ? 0.4123 0.4955 0.4549 -0.0675 0.0701  -0.0288 621 TYR D O   
3242 C CB  . TYR D 68  ? 0.4049 0.4868 0.4492 -0.0468 0.0621  -0.0221 621 TYR D CB  
3243 C CG  . TYR D 68  ? 0.3872 0.4741 0.4354 -0.0385 0.0598  -0.0210 621 TYR D CG  
3244 C CD1 . TYR D 68  ? 0.4930 0.5642 0.5282 -0.0360 0.0602  -0.0171 621 TYR D CD1 
3245 C CD2 . TYR D 68  ? 0.5211 0.6265 0.5838 -0.0324 0.0565  -0.0242 621 TYR D CD2 
3246 C CE1 . TYR D 68  ? 0.4551 0.5296 0.4925 -0.0289 0.0580  -0.0161 621 TYR D CE1 
3247 C CE2 . TYR D 68  ? 0.4487 0.5557 0.5118 -0.0248 0.0543  -0.0232 621 TYR D CE2 
3248 C CZ  . TYR D 68  ? 0.2112 0.3031 0.2621 -0.0236 0.0553  -0.0190 621 TYR D CZ  
3249 O OH  . TYR D 68  ? 0.3710 0.4636 0.4211 -0.0166 0.0530  -0.0181 621 TYR D OH  
3250 N N   . LYS D 69  ? 0.4788 0.5262 0.4887 -0.0740 0.0780  -0.0244 622 LYS D N   
3251 C CA  . LYS D 69  ? 0.4668 0.5027 0.4662 -0.0833 0.0803  -0.0253 622 LYS D CA  
3252 C C   . LYS D 69  ? 0.4925 0.5094 0.4796 -0.0757 0.0724  -0.0198 622 LYS D C   
3253 O O   . LYS D 69  ? 0.5047 0.5108 0.4825 -0.0806 0.0722  -0.0198 622 LYS D O   
3254 C CB  . LYS D 69  ? 0.6222 0.6424 0.6033 -0.0967 0.0909  -0.0276 622 LYS D CB  
3255 C CG  . LYS D 69  ? 0.7137 0.7603 0.7126 -0.1064 0.0996  -0.0356 622 LYS D CG  
3256 C CD  . LYS D 69  ? 0.9212 0.9540 0.9029 -0.1192 0.1118  -0.0381 622 LYS D CD  
3257 C CE  . LYS D 69  ? 1.0002 1.0266 0.9758 -0.1121 0.1131  -0.0354 622 LYS D CE  
3258 N NZ  . LYS D 69  ? 0.5664 0.5680 0.5159 -0.1237 0.1242  -0.0360 622 LYS D NZ  
3259 N N   . ASN D 70  ? 0.4729 0.4875 0.4610 -0.0638 0.0660  -0.0157 623 ASN D N   
3260 C CA  . ASN D 70  ? 0.5088 0.5141 0.4923 -0.0553 0.0580  -0.0120 623 ASN D CA  
3261 C C   . ASN D 70  ? 0.5170 0.5299 0.5100 -0.0434 0.0515  -0.0094 623 ASN D C   
3262 O O   . ASN D 70  ? 0.5032 0.5240 0.5024 -0.0411 0.0526  -0.0096 623 ASN D O   
3263 C CB  . ASN D 70  ? 0.4676 0.4427 0.4240 -0.0564 0.0581  -0.0096 623 ASN D CB  
3264 C CG  . ASN D 70  ? 0.5166 0.4754 0.4573 -0.0546 0.0597  -0.0081 623 ASN D CG  
3265 O OD1 . ASN D 70  ? 0.5075 0.4703 0.4534 -0.0454 0.0551  -0.0062 623 ASN D OD1 
3266 N ND2 . ASN D 70  ? 0.5565 0.4946 0.4756 -0.0637 0.0664  -0.0089 623 ASN D ND2 
3267 N N   . LEU D 71  ? 0.4642 0.4738 0.4569 -0.0364 0.0452  -0.0073 624 LEU D N   
3268 C CA  . LEU D 71  ? 0.4642 0.4810 0.4653 -0.0271 0.0397  -0.0056 624 LEU D CA  
3269 C C   . LEU D 71  ? 0.4135 0.4213 0.4061 -0.0233 0.0390  -0.0042 624 LEU D C   
3270 O O   . LEU D 71  ? 0.4420 0.4597 0.4438 -0.0192 0.0373  -0.0038 624 LEU D O   
3271 C CB  . LEU D 71  ? 0.3816 0.3945 0.3813 -0.0213 0.0343  -0.0045 624 LEU D CB  
3272 C CG  . LEU D 71  ? 0.3958 0.4193 0.4065 -0.0137 0.0297  -0.0039 624 LEU D CG  
3273 C CD1 . LEU D 71  ? 0.2167 0.2566 0.2420 -0.0141 0.0306  -0.0046 624 LEU D CD1 
3274 C CD2 . LEU D 71  ? 0.3744 0.3981 0.3865 -0.0098 0.0262  -0.0040 624 LEU D CD2 
3275 N N   . HIS D 72  ? 0.4566 0.4436 0.4296 -0.0243 0.0399  -0.0034 625 HIS D N   
3276 C CA  . HIS D 72  ? 0.4101 0.3855 0.3722 -0.0200 0.0383  -0.0023 625 HIS D CA  
3277 C C   . HIS D 72  ? 0.4373 0.4193 0.4037 -0.0239 0.0435  -0.0028 625 HIS D C   
3278 O O   . HIS D 72  ? 0.3450 0.3275 0.3121 -0.0189 0.0411  -0.0019 625 HIS D O   
3279 C CB  . HIS D 72  ? 0.5461 0.4936 0.4818 -0.0207 0.0384  -0.0019 625 HIS D CB  
3280 C CG  . HIS D 72  ? 0.7445 0.6765 0.6656 -0.0145 0.0351  -0.0011 625 HIS D CG  
3281 N ND1 . HIS D 72  ? 0.9591 0.8938 0.8837 -0.0040 0.0268  -0.0012 625 HIS D ND1 
3282 C CD2 . HIS D 72  ? 0.8517 0.7657 0.7547 -0.0176 0.0390  -0.0008 625 HIS D CD2 
3283 C CE1 . HIS D 72  ? 0.8756 0.7945 0.7849 -0.0002 0.0246  -0.0010 625 HIS D CE1 
3284 N NE2 . HIS D 72  ? 0.6645 0.5691 0.5593 -0.0081 0.0320  -0.0004 625 HIS D NE2 
3285 N N   . GLU D 73  ? 0.4465 0.4350 0.4166 -0.0326 0.0507  -0.0048 626 GLU D N   
3286 C CA  . GLU D 73  ? 0.4444 0.4408 0.4191 -0.0357 0.0561  -0.0062 626 GLU D CA  
3287 C C   . GLU D 73  ? 0.4141 0.4312 0.4081 -0.0294 0.0524  -0.0064 626 GLU D C   
3288 O O   . GLU D 73  ? 0.3724 0.3909 0.3667 -0.0264 0.0526  -0.0059 626 GLU D O   
3289 C CB  . GLU D 73  ? 0.4964 0.4988 0.4731 -0.0470 0.0649  -0.0100 626 GLU D CB  
3290 C CG  . GLU D 73  ? 0.7354 0.7120 0.6871 -0.0552 0.0706  -0.0100 626 GLU D CG  
3291 C CD  . GLU D 73  ? 0.8675 0.8499 0.8206 -0.0688 0.0800  -0.0145 626 GLU D CD  
3292 O OE1 . GLU D 73  ? 0.6425 0.6513 0.6172 -0.0718 0.0830  -0.0186 626 GLU D OE1 
3293 O OE2 . GLU D 73  ? 0.7180 0.6774 0.6491 -0.0766 0.0842  -0.0144 626 GLU D OE2 
3294 N N   . PHE D 74  ? 0.2934 0.3238 0.3008 -0.0277 0.0490  -0.0070 627 PHE D N   
3295 C CA  . PHE D 74  ? 0.3257 0.3708 0.3470 -0.0216 0.0448  -0.0070 627 PHE D CA  
3296 C C   . PHE D 74  ? 0.3139 0.3512 0.3302 -0.0151 0.0396  -0.0042 627 PHE D C   
3297 O O   . PHE D 74  ? 0.3531 0.3944 0.3722 -0.0119 0.0386  -0.0039 627 PHE D O   
3298 C CB  . PHE D 74  ? 0.2572 0.3118 0.2884 -0.0212 0.0420  -0.0080 627 PHE D CB  
3299 C CG  . PHE D 74  ? 0.2452 0.3111 0.2867 -0.0158 0.0381  -0.0083 627 PHE D CG  
3300 C CD1 . PHE D 74  ? 0.1926 0.2549 0.2331 -0.0110 0.0335  -0.0060 627 PHE D CD1 
3301 C CD2 . PHE D 74  ? 0.2784 0.3583 0.3299 -0.0155 0.0388  -0.0116 627 PHE D CD2 
3302 C CE1 . PHE D 74  ? 0.2130 0.2818 0.2592 -0.0074 0.0307  -0.0063 627 PHE D CE1 
3303 C CE2 . PHE D 74  ? 0.2003 0.2858 0.2567 -0.0099 0.0345  -0.0118 627 PHE D CE2 
3304 C CZ  . PHE D 74  ? 0.3361 0.4146 0.3886 -0.0065 0.0310  -0.0089 627 PHE D CZ  
3305 N N   . GLU D 75  ? 0.3317 0.3580 0.3401 -0.0130 0.0361  -0.0028 628 GLU D N   
3306 C CA  . GLU D 75  ? 0.4307 0.4530 0.4367 -0.0069 0.0306  -0.0016 628 GLU D CA  
3307 C C   . GLU D 75  ? 0.4043 0.4179 0.4013 -0.0058 0.0313  -0.0009 628 GLU D C   
3308 O O   . GLU D 75  ? 0.4040 0.4198 0.4032 -0.0019 0.0276  -0.0005 628 GLU D O   
3309 C CB  . GLU D 75  ? 0.3479 0.3589 0.3448 -0.0037 0.0266  -0.0016 628 GLU D CB  
3310 C CG  . GLU D 75  ? 0.5980 0.6159 0.6024 -0.0021 0.0241  -0.0023 628 GLU D CG  
3311 C CD  . GLU D 75  ? 0.8234 0.8281 0.8158 0.0020  0.0203  -0.0028 628 GLU D CD  
3312 O OE1 . GLU D 75  ? 0.6772 0.6679 0.6560 0.0052  0.0181  -0.0029 628 GLU D OE1 
3313 O OE2 . GLU D 75  ? 0.7751 0.7819 0.7699 0.0028  0.0193  -0.0035 628 GLU D OE2 
3314 N N   . GLU D 76  ? 0.4916 0.4937 0.4767 -0.0100 0.0363  -0.0009 629 GLU D N   
3315 C CA  . GLU D 76  ? 0.4789 0.4695 0.4522 -0.0095 0.0380  -0.0002 629 GLU D CA  
3316 C C   . GLU D 76  ? 0.3411 0.3443 0.3242 -0.0088 0.0396  -0.0005 629 GLU D C   
3317 O O   . GLU D 76  ? 0.4098 0.4068 0.3870 -0.0055 0.0377  0.0004  629 GLU D O   
3318 C CB  . GLU D 76  ? 0.4620 0.4376 0.4195 -0.0161 0.0451  -0.0007 629 GLU D CB  
3319 C CG  . GLU D 76  ? 0.7118 0.6670 0.6517 -0.0161 0.0432  -0.0003 629 GLU D CG  
3320 C CD  . GLU D 76  ? 0.8716 0.8020 0.7868 -0.0209 0.0487  -0.0002 629 GLU D CD  
3321 O OE1 . GLU D 76  ? 0.9445 0.8519 0.8391 -0.0171 0.0445  0.0004  629 GLU D OE1 
3322 O OE2 . GLU D 76  ? 0.8475 0.7804 0.7623 -0.0281 0.0572  -0.0013 629 GLU D OE2 
3323 N N   . ASP D 77  ? 0.3137 0.3331 0.3102 -0.0112 0.0426  -0.0022 630 ASP D N   
3324 C CA  . ASP D 77  ? 0.3588 0.3886 0.3625 -0.0088 0.0433  -0.0029 630 ASP D CA  
3325 C C   . ASP D 77  ? 0.3679 0.4004 0.3757 -0.0035 0.0366  -0.0015 630 ASP D C   
3326 O O   . ASP D 77  ? 0.3502 0.3796 0.3542 -0.0005 0.0351  -0.0007 630 ASP D O   
3327 C CB  . ASP D 77  ? 0.2878 0.3343 0.3039 -0.0112 0.0470  -0.0062 630 ASP D CB  
3328 C CG  . ASP D 77  ? 0.6308 0.6792 0.6446 -0.0166 0.0553  -0.0091 630 ASP D CG  
3329 O OD1 . ASP D 77  ? 0.6378 0.6716 0.6379 -0.0186 0.0585  -0.0078 630 ASP D OD1 
3330 O OD2 . ASP D 77  ? 0.4289 0.4937 0.4544 -0.0189 0.0585  -0.0133 630 ASP D OD2 
3331 N N   . PHE D 78  ? 0.2773 0.3139 0.2912 -0.0030 0.0330  -0.0014 631 PHE D N   
3332 C CA  . PHE D 78  ? 0.3107 0.3505 0.3285 0.0000  0.0281  -0.0009 631 PHE D CA  
3333 C C   . PHE D 78  ? 0.3318 0.3622 0.3418 0.0023  0.0245  0.0000  631 PHE D C   
3334 O O   . PHE D 78  ? 0.4258 0.4565 0.4353 0.0037  0.0223  0.0003  631 PHE D O   
3335 C CB  . PHE D 78  ? 0.3121 0.3571 0.3367 -0.0004 0.0259  -0.0014 631 PHE D CB  
3336 C CG  . PHE D 78  ? 0.2196 0.2675 0.2473 0.0010  0.0221  -0.0016 631 PHE D CG  
3337 C CD1 . PHE D 78  ? 0.1330 0.1846 0.1626 0.0012  0.0221  -0.0018 631 PHE D CD1 
3338 C CD2 . PHE D 78  ? 0.1780 0.2245 0.2056 0.0020  0.0187  -0.0022 631 PHE D CD2 
3339 C CE1 . PHE D 78  ? 0.2585 0.3105 0.2884 0.0006  0.0199  -0.0023 631 PHE D CE1 
3340 C CE2 . PHE D 78  ? 0.3834 0.4347 0.4151 0.0016  0.0165  -0.0034 631 PHE D CE2 
3341 C CZ  . PHE D 78  ? 0.2211 0.2742 0.2532 0.0000  0.0176  -0.0032 631 PHE D CZ  
3342 N N   . ASP D 79  ? 0.3172 0.3380 0.3195 0.0027  0.0235  0.0002  632 ASP D N   
3343 C CA  . ASP D 79  ? 0.4045 0.4159 0.3986 0.0060  0.0189  0.0004  632 ASP D CA  
3344 C C   . ASP D 79  ? 0.3899 0.3945 0.3762 0.0064  0.0206  0.0015  632 ASP D C   
3345 O O   . ASP D 79  ? 0.3751 0.3770 0.3587 0.0086  0.0165  0.0015  632 ASP D O   
3346 C CB  . ASP D 79  ? 0.4572 0.4552 0.4398 0.0077  0.0174  0.0001  632 ASP D CB  
3347 C CG  . ASP D 79  ? 0.5366 0.5393 0.5246 0.0091  0.0146  -0.0012 632 ASP D CG  
3348 O OD1 . ASP D 79  ? 0.4902 0.5061 0.4906 0.0096  0.0122  -0.0024 632 ASP D OD1 
3349 O OD2 . ASP D 79  ? 0.5844 0.5763 0.5627 0.0094  0.0151  -0.0013 632 ASP D OD2 
3350 N N   . LEU D 80  ? 0.2714 0.2738 0.2540 0.0039  0.0269  0.0019  633 LEU D N   
3351 C CA  . LEU D 80  ? 0.4310 0.4281 0.4065 0.0045  0.0297  0.0025  633 LEU D CA  
3352 C C   . LEU D 80  ? 0.4228 0.4277 0.4044 0.0067  0.0270  0.0026  633 LEU D C   
3353 O O   . LEU D 80  ? 0.5674 0.5647 0.5414 0.0089  0.0246  0.0034  633 LEU D O   
3354 C CB  . LEU D 80  ? 0.4175 0.4168 0.3923 0.0007  0.0381  0.0014  633 LEU D CB  
3355 C CG  . LEU D 80  ? 0.6024 0.5941 0.5672 0.0000  0.0437  0.0012  633 LEU D CG  
3356 C CD1 . LEU D 80  ? 0.7225 0.6932 0.6693 0.0021  0.0410  0.0031  633 LEU D CD1 
3357 C CD2 . LEU D 80  ? 0.5125 0.5082 0.4782 -0.0063 0.0527  -0.0011 633 LEU D CD2 
3358 N N   . ILE D 81  ? 0.3569 0.3744 0.3497 0.0061  0.0270  0.0016  634 ILE D N   
3359 C CA  . ILE D 81  ? 0.3651 0.3857 0.3592 0.0080  0.0245  0.0016  634 ILE D CA  
3360 C C   . ILE D 81  ? 0.3260 0.3414 0.3170 0.0079  0.0190  0.0021  634 ILE D C   
3361 O O   . ILE D 81  ? 0.3888 0.3980 0.3727 0.0090  0.0171  0.0027  634 ILE D O   
3362 C CB  . ILE D 81  ? 0.3404 0.3717 0.3439 0.0076  0.0246  0.0004  634 ILE D CB  
3363 C CG1 . ILE D 81  ? 0.3513 0.3908 0.3595 0.0082  0.0292  -0.0014 634 ILE D CG1 
3364 C CG2 . ILE D 81  ? 0.2645 0.2932 0.2640 0.0089  0.0214  0.0004  634 ILE D CG2 
3365 C CD1 . ILE D 81  ? 0.2560 0.3061 0.2739 0.0080  0.0288  -0.0033 634 ILE D CD1 
3366 N N   . ILE D 82  ? 0.2744 0.2927 0.2705 0.0068  0.0165  0.0013  635 ILE D N   
3367 C CA  . ILE D 82  ? 0.3575 0.3753 0.3538 0.0064  0.0112  0.0002  635 ILE D CA  
3368 C C   . ILE D 82  ? 0.3248 0.3311 0.3103 0.0087  0.0086  0.0007  635 ILE D C   
3369 O O   . ILE D 82  ? 0.2767 0.2794 0.2577 0.0083  0.0060  0.0006  635 ILE D O   
3370 C CB  . ILE D 82  ? 0.3139 0.3389 0.3185 0.0061  0.0086  -0.0019 635 ILE D CB  
3371 C CG1 . ILE D 82  ? 0.2966 0.3312 0.3103 0.0039  0.0115  -0.0022 635 ILE D CG1 
3372 C CG2 . ILE D 82  ? 0.2229 0.2514 0.2301 0.0055  0.0033  -0.0047 635 ILE D CG2 
3373 C CD1 . ILE D 82  ? 0.4147 0.4524 0.4297 0.0011  0.0126  -0.0023 635 ILE D CD1 
3374 N N   . ASP D 83  ? 0.4118 0.4099 0.3906 0.0108  0.0094  0.0013  636 ASP D N   
3375 C CA  . ASP D 83  ? 0.4751 0.4592 0.4409 0.0137  0.0061  0.0015  636 ASP D CA  
3376 C C   . ASP D 83  ? 0.4077 0.3836 0.3641 0.0140  0.0083  0.0034  636 ASP D C   
3377 O O   . ASP D 83  ? 0.4832 0.4525 0.4332 0.0153  0.0037  0.0031  636 ASP D O   
3378 C CB  . ASP D 83  ? 0.4142 0.3865 0.3702 0.0157  0.0070  0.0017  636 ASP D CB  
3379 C CG  . ASP D 83  ? 0.7151 0.6914 0.6761 0.0178  0.0021  -0.0006 636 ASP D CG  
3380 O OD1 . ASP D 83  ? 0.7735 0.7594 0.7432 0.0190  -0.0036 -0.0033 636 ASP D OD1 
3381 O OD2 . ASP D 83  ? 0.4667 0.4364 0.4221 0.0181  0.0043  -0.0004 636 ASP D OD2 
3382 N N   . ASN D 84  ? 0.3520 0.3294 0.3081 0.0132  0.0149  0.0046  637 ASN D N   
3383 C CA  . ASN D 84  ? 0.3850 0.3561 0.3326 0.0147  0.0170  0.0057  637 ASN D CA  
3384 C C   . ASN D 84  ? 0.3276 0.2991 0.2750 0.0147  0.0119  0.0055  637 ASN D C   
3385 O O   . ASN D 84  ? 0.4141 0.3745 0.3504 0.0161  0.0093  0.0063  637 ASN D O   
3386 C CB  . ASN D 84  ? 0.3648 0.3441 0.3170 0.0147  0.0238  0.0053  637 ASN D CB  
3387 C CG  . ASN D 84  ? 0.4380 0.4163 0.3887 0.0130  0.0303  0.0048  637 ASN D CG  
3388 O OD1 . ASN D 84  ? 0.3979 0.3641 0.3391 0.0122  0.0302  0.0054  637 ASN D OD1 
3389 N ND2 . ASN D 84  ? 0.3439 0.3344 0.3029 0.0121  0.0359  0.0030  637 ASN D ND2 
3390 N N   . CYS D 85  ? 0.4053 0.3878 0.3632 0.0122  0.0108  0.0045  638 CYS D N   
3391 C CA  . CYS D 85  ? 0.3992 0.3808 0.3551 0.0101  0.0073  0.0039  638 CYS D CA  
3392 C C   . CYS D 85  ? 0.4569 0.4357 0.4115 0.0083  0.0013  0.0024  638 CYS D C   
3393 O O   . CYS D 85  ? 0.3955 0.3665 0.3415 0.0071  -0.0015 0.0023  638 CYS D O   
3394 C CB  . CYS D 85  ? 0.4239 0.4159 0.3892 0.0072  0.0084  0.0028  638 CYS D CB  
3395 S SG  . CYS D 85  ? 0.4282 0.4148 0.3862 0.0030  0.0061  0.0020  638 CYS D SG  
3396 N N   . MET D 86  ? 0.4186 0.4036 0.3810 0.0086  -0.0009 0.0006  639 MET D N   
3397 C CA  . MET D 86  ? 0.4736 0.4588 0.4368 0.0084  -0.0077 -0.0023 639 MET D CA  
3398 C C   . MET D 86  ? 0.5445 0.5138 0.4930 0.0124  -0.0111 -0.0013 639 MET D C   
3399 O O   . MET D 86  ? 0.5954 0.5626 0.5415 0.0123  -0.0175 -0.0039 639 MET D O   
3400 C CB  . MET D 86  ? 0.4764 0.4719 0.4506 0.0099  -0.0101 -0.0052 639 MET D CB  
3401 C CG  . MET D 86  ? 0.5822 0.5940 0.5712 0.0056  -0.0078 -0.0071 639 MET D CG  
3402 S SD  . MET D 86  ? 0.4493 0.4750 0.4513 0.0077  -0.0129 -0.0126 639 MET D SD  
3403 C CE  . MET D 86  ? 0.6283 0.6396 0.6188 0.0156  -0.0142 -0.0105 639 MET D CE  
3404 N N   . LYS D 87  ? 0.5452 0.5037 0.4837 0.0154  -0.0065 0.0017  640 LYS D N   
3405 C CA  . LYS D 87  ? 0.5851 0.5260 0.5072 0.0191  -0.0082 0.0030  640 LYS D CA  
3406 C C   . LYS D 87  ? 0.5270 0.4599 0.4394 0.0185  -0.0070 0.0048  640 LYS D C   
3407 O O   . LYS D 87  ? 0.4813 0.4028 0.3829 0.0198  -0.0116 0.0047  640 LYS D O   
3408 C CB  . LYS D 87  ? 0.5881 0.5200 0.5023 0.0215  -0.0026 0.0049  640 LYS D CB  
3409 C CG  . LYS D 87  ? 0.7891 0.6999 0.6831 0.0247  -0.0018 0.0066  640 LYS D CG  
3410 C CD  . LYS D 87  ? 0.9630 0.8593 0.8452 0.0280  -0.0047 0.0058  640 LYS D CD  
3411 C CE  . LYS D 87  ? 1.0471 0.9206 0.9073 0.0299  -0.0006 0.0078  640 LYS D CE  
3412 N NZ  . LYS D 87  ? 0.9459 0.8211 0.8056 0.0266  0.0111  0.0095  640 LYS D NZ  
3413 N N   . TYR D 88  ? 0.5703 0.5079 0.4851 0.0175  -0.0012 0.0064  641 TYR D N   
3414 C CA  . TYR D 88  ? 0.4629 0.3907 0.3658 0.0184  -0.0007 0.0078  641 TYR D CA  
3415 C C   . TYR D 88  ? 0.5350 0.4609 0.4359 0.0145  -0.0069 0.0063  641 TYR D C   
3416 O O   . TYR D 88  ? 0.5814 0.4939 0.4689 0.0155  -0.0101 0.0069  641 TYR D O   
3417 C CB  . TYR D 88  ? 0.5388 0.4720 0.4438 0.0195  0.0049  0.0086  641 TYR D CB  
3418 C CG  . TYR D 88  ? 0.4480 0.3681 0.3371 0.0230  0.0054  0.0099  641 TYR D CG  
3419 C CD1 . TYR D 88  ? 0.5166 0.4269 0.3951 0.0274  0.0087  0.0110  641 TYR D CD1 
3420 C CD2 . TYR D 88  ? 0.6803 0.5957 0.5627 0.0216  0.0028  0.0098  641 TYR D CD2 
3421 C CE1 . TYR D 88  ? 0.6923 0.5901 0.5552 0.0315  0.0092  0.0120  641 TYR D CE1 
3422 C CE2 . TYR D 88  ? 0.5212 0.4218 0.3861 0.0256  0.0027  0.0109  641 TYR D CE2 
3423 C CZ  . TYR D 88  ? 0.5138 0.4066 0.3699 0.0311  0.0057  0.0120  641 TYR D CZ  
3424 O OH  . TYR D 88  ? 0.4902 0.3684 0.3285 0.0359  0.0056  0.0129  641 TYR D OH  
3425 N N   . ASN D 89  ? 0.5200 0.4590 0.4335 0.0095  -0.0081 0.0041  642 ASN D N   
3426 C CA  . ASN D 89  ? 0.5012 0.4391 0.4121 0.0034  -0.0116 0.0022  642 ASN D CA  
3427 C C   . ASN D 89  ? 0.5038 0.4482 0.4218 -0.0003 -0.0182 -0.0019 642 ASN D C   
3428 O O   . ASN D 89  ? 0.4838 0.4394 0.4140 0.0011  -0.0200 -0.0041 642 ASN D O   
3429 C CB  . ASN D 89  ? 0.5051 0.4517 0.4228 -0.0008 -0.0079 0.0016  642 ASN D CB  
3430 C CG  . ASN D 89  ? 0.5832 0.5248 0.4944 0.0040  -0.0029 0.0045  642 ASN D CG  
3431 O OD1 . ASN D 89  ? 0.4508 0.3788 0.3464 0.0061  -0.0028 0.0059  642 ASN D OD1 
3432 N ND2 . ASN D 89  ? 0.6334 0.5864 0.5562 0.0065  0.0008  0.0046  642 ASN D ND2 
3433 N N   . ALA D 90  ? 0.5255 0.4631 0.4354 -0.0051 -0.0221 -0.0035 643 ALA D N   
3434 C CA  . ALA D 90  ? 0.4985 0.4457 0.4171 -0.0094 -0.0286 -0.0091 643 ALA D CA  
3435 C C   . ALA D 90  ? 0.5159 0.4842 0.4535 -0.0162 -0.0272 -0.0137 643 ALA D C   
3436 O O   . ALA D 90  ? 0.5755 0.5469 0.5153 -0.0194 -0.0212 -0.0121 643 ALA D O   
3437 C CB  . ALA D 90  ? 0.5492 0.4841 0.4541 -0.0144 -0.0325 -0.0101 643 ALA D CB  
3438 N N   . ARG D 91  ? 0.5264 0.5092 0.4770 -0.0175 -0.0330 -0.0198 644 ARG D N   
3439 C CA  . ARG D 91  ? 0.6270 0.6325 0.5975 -0.0227 -0.0320 -0.0255 644 ARG D CA  
3440 C C   . ARG D 91  ? 0.6204 0.6289 0.5907 -0.0350 -0.0267 -0.0272 644 ARG D C   
3441 O O   . ARG D 91  ? 0.5891 0.6086 0.5692 -0.0385 -0.0215 -0.0282 644 ARG D O   
3442 C CB  . ARG D 91  ? 0.6571 0.6774 0.6398 -0.0216 -0.0406 -0.0334 644 ARG D CB  
3443 C CG  . ARG D 91  ? 0.8389 0.8856 0.8441 -0.0247 -0.0400 -0.0405 644 ARG D CG  
3444 C CD  . ARG D 91  ? 1.0150 1.0669 1.0272 -0.0135 -0.0423 -0.0402 644 ARG D CD  
3445 N NE  . ARG D 91  ? 1.0552 1.1044 1.0649 -0.0044 -0.0524 -0.0437 644 ARG D NE  
3446 C CZ  . ARG D 91  ? 1.0087 1.0760 1.0326 0.0001  -0.0600 -0.0523 644 ARG D CZ  
3447 N NH1 . ARG D 91  ? 1.0129 1.1047 1.0566 -0.0037 -0.0579 -0.0586 644 ARG D NH1 
3448 N NH2 . ARG D 91  ? 1.2414 1.3014 1.2584 0.0096  -0.0701 -0.0552 644 ARG D NH2 
3449 N N   . ASP D 92  ? 0.7409 0.7375 0.6979 -0.0417 -0.0280 -0.0277 645 ASP D N   
3450 C CA  . ASP D 92  ? 0.7882 0.7826 0.7396 -0.0550 -0.0231 -0.0298 645 ASP D CA  
3451 C C   . ASP D 92  ? 0.7599 0.7318 0.6904 -0.0547 -0.0171 -0.0228 645 ASP D C   
3452 O O   . ASP D 92  ? 0.8015 0.7568 0.7137 -0.0625 -0.0158 -0.0224 645 ASP D O   
3453 C CB  . ASP D 92  ? 0.7463 0.7380 0.6920 -0.0637 -0.0279 -0.0348 645 ASP D CB  
3454 C CG  . ASP D 92  ? 0.8803 0.8657 0.8159 -0.0796 -0.0223 -0.0373 645 ASP D CG  
3455 O OD1 . ASP D 92  ? 0.7073 0.7014 0.6498 -0.0861 -0.0156 -0.0390 645 ASP D OD1 
3456 O OD2 . ASP D 92  ? 0.9470 0.9163 0.8654 -0.0860 -0.0243 -0.0376 645 ASP D OD2 
3457 N N   . THR D 93  ? 0.6624 0.6332 0.5944 -0.0457 -0.0140 -0.0179 646 THR D N   
3458 C CA  . THR D 93  ? 0.5677 0.5199 0.4816 -0.0435 -0.0094 -0.0125 646 THR D CA  
3459 C C   . THR D 93  ? 0.5929 0.5531 0.5148 -0.0440 -0.0040 -0.0122 646 THR D C   
3460 O O   . THR D 93  ? 0.6028 0.5820 0.5444 -0.0424 -0.0036 -0.0143 646 THR D O   
3461 C CB  . THR D 93  ? 0.5902 0.5307 0.4950 -0.0312 -0.0105 -0.0071 646 THR D CB  
3462 O OG1 . THR D 93  ? 0.4487 0.4036 0.3702 -0.0238 -0.0109 -0.0066 646 THR D OG1 
3463 C CG2 . THR D 93  ? 0.6059 0.5314 0.4959 -0.0300 -0.0153 -0.0063 646 THR D CG2 
3464 N N   . VAL D 94  ? 0.5152 0.4587 0.4194 -0.0452 -0.0004 -0.0097 647 VAL D N   
3465 C CA  . VAL D 94  ? 0.4774 0.4234 0.3838 -0.0456 0.0042  -0.0094 647 VAL D CA  
3466 C C   . VAL D 94  ? 0.4511 0.4105 0.3734 -0.0352 0.0043  -0.0072 647 VAL D C   
3467 O O   . VAL D 94  ? 0.4804 0.4544 0.4178 -0.0364 0.0066  -0.0088 647 VAL D O   
3468 C CB  . VAL D 94  ? 0.5711 0.4916 0.4506 -0.0443 0.0060  -0.0066 647 VAL D CB  
3469 C CG1 . VAL D 94  ? 0.5563 0.4776 0.4364 -0.0437 0.0099  -0.0065 647 VAL D CG1 
3470 C CG2 . VAL D 94  ? 0.5239 0.4261 0.3824 -0.0560 0.0063  -0.0086 647 VAL D CG2 
3471 N N   . PHE D 95  ? 0.4239 0.3774 0.3415 -0.0256 0.0024  -0.0038 648 PHE D N   
3472 C CA  . PHE D 95  ? 0.4466 0.4102 0.3763 -0.0167 0.0031  -0.0019 648 PHE D CA  
3473 C C   . PHE D 95  ? 0.4432 0.4239 0.3920 -0.0164 0.0015  -0.0037 648 PHE D C   
3474 O O   . PHE D 95  ? 0.4045 0.3959 0.3652 -0.0133 0.0033  -0.0034 648 PHE D O   
3475 C CB  . PHE D 95  ? 0.4451 0.3977 0.3635 -0.0081 0.0024  0.0011  648 PHE D CB  
3476 C CG  . PHE D 95  ? 0.3721 0.3120 0.2752 -0.0035 0.0039  0.0025  648 PHE D CG  
3477 C CD1 . PHE D 95  ? 0.4464 0.3778 0.3394 -0.0081 0.0048  0.0014  648 PHE D CD1 
3478 C CD2 . PHE D 95  ? 0.6452 0.5807 0.5424 0.0057  0.0043  0.0041  648 PHE D CD2 
3479 C CE1 . PHE D 95  ? 0.6254 0.5423 0.5010 -0.0018 0.0049  0.0021  648 PHE D CE1 
3480 C CE2 . PHE D 95  ? 0.6041 0.5294 0.4876 0.0122  0.0046  0.0042  648 PHE D CE2 
3481 C CZ  . PHE D 95  ? 0.5555 0.4707 0.4274 0.0091  0.0042  0.0033  648 PHE D CZ  
3482 N N   . TYR D 96  ? 0.3963 0.3787 0.3469 -0.0190 -0.0025 -0.0059 649 TYR D N   
3483 C CA  . TYR D 96  ? 0.3558 0.3532 0.3226 -0.0173 -0.0053 -0.0086 649 TYR D CA  
3484 C C   . TYR D 96  ? 0.3602 0.3729 0.3410 -0.0224 -0.0028 -0.0120 649 TYR D C   
3485 O O   . TYR D 96  ? 0.3534 0.3750 0.3444 -0.0185 -0.0015 -0.0117 649 TYR D O   
3486 C CB  . TYR D 96  ? 0.4179 0.4154 0.3843 -0.0185 -0.0114 -0.0118 649 TYR D CB  
3487 C CG  . TYR D 96  ? 0.4070 0.4173 0.3869 -0.0140 -0.0162 -0.0153 649 TYR D CG  
3488 C CD1 . TYR D 96  ? 0.3768 0.4058 0.3730 -0.0176 -0.0172 -0.0210 649 TYR D CD1 
3489 C CD2 . TYR D 96  ? 0.5929 0.5946 0.5666 -0.0059 -0.0199 -0.0135 649 TYR D CD2 
3490 C CE1 . TYR D 96  ? 0.3273 0.3672 0.3341 -0.0118 -0.0228 -0.0251 649 TYR D CE1 
3491 C CE2 . TYR D 96  ? 0.5647 0.5739 0.5462 -0.0007 -0.0254 -0.0172 649 TYR D CE2 
3492 C CZ  . TYR D 96  ? 0.4308 0.4595 0.4291 -0.0030 -0.0272 -0.0230 649 TYR D CZ  
3493 O OH  . TYR D 96  ? 0.6785 0.7145 0.6836 0.0037  -0.0335 -0.0275 649 TYR D OH  
3494 N N   . ARG D 97  ? 0.4477 0.4618 0.4271 -0.0319 -0.0014 -0.0152 650 ARG D N   
3495 C CA  . ARG D 97  ? 0.3888 0.4181 0.3814 -0.0381 0.0015  -0.0195 650 ARG D CA  
3496 C C   . ARG D 97  ? 0.3980 0.4265 0.3912 -0.0354 0.0063  -0.0165 650 ARG D C   
3497 O O   . ARG D 97  ? 0.2907 0.3329 0.2972 -0.0358 0.0080  -0.0189 650 ARG D O   
3498 C CB  . ARG D 97  ? 0.3573 0.3843 0.3439 -0.0505 0.0040  -0.0234 650 ARG D CB  
3499 C CG  . ARG D 97  ? 0.5801 0.6161 0.5729 -0.0558 -0.0003 -0.0292 650 ARG D CG  
3500 C CD  . ARG D 97  ? 0.5924 0.6291 0.5813 -0.0708 0.0037  -0.0343 650 ARG D CD  
3501 N NE  . ARG D 97  ? 0.7534 0.7636 0.7164 -0.0750 0.0059  -0.0300 650 ARG D NE  
3502 C CZ  . ARG D 97  ? 0.8366 0.8333 0.7857 -0.0776 0.0025  -0.0297 650 ARG D CZ  
3503 N NH1 . ARG D 97  ? 0.8499 0.8576 0.8090 -0.0772 -0.0036 -0.0336 650 ARG D NH1 
3504 N NH2 . ARG D 97  ? 0.5968 0.5675 0.5201 -0.0800 0.0046  -0.0256 650 ARG D NH2 
3505 N N   . ALA D 98  ? 0.3431 0.3556 0.3214 -0.0322 0.0079  -0.0120 651 ALA D N   
3506 C CA  . ALA D 98  ? 0.3772 0.3878 0.3546 -0.0284 0.0111  -0.0095 651 ALA D CA  
3507 C C   . ALA D 98  ? 0.4448 0.4665 0.4356 -0.0210 0.0102  -0.0083 651 ALA D C   
3508 O O   . ALA D 98  ? 0.3967 0.4258 0.3955 -0.0203 0.0125  -0.0086 651 ALA D O   
3509 C CB  . ALA D 98  ? 0.3371 0.3296 0.2960 -0.0241 0.0114  -0.0060 651 ALA D CB  
3510 N N   . ALA D 99  ? 0.4347 0.4549 0.4253 -0.0159 0.0072  -0.0070 652 ALA D N   
3511 C CA  . ALA D 99  ? 0.4315 0.4579 0.4304 -0.0098 0.0068  -0.0059 652 ALA D CA  
3512 C C   . ALA D 99  ? 0.4128 0.4527 0.4253 -0.0106 0.0050  -0.0094 652 ALA D C   
3513 O O   . ALA D 99  ? 0.3019 0.3472 0.3211 -0.0076 0.0060  -0.0091 652 ALA D O   
3514 C CB  . ALA D 99  ? 0.3210 0.3391 0.3127 -0.0049 0.0048  -0.0038 652 ALA D CB  
3515 N N   . VAL D 100 ? 0.3991 0.4449 0.4155 -0.0147 0.0023  -0.0135 653 VAL D N   
3516 C CA  . VAL D 100 ? 0.3159 0.3768 0.3461 -0.0145 0.0002  -0.0182 653 VAL D CA  
3517 C C   . VAL D 100 ? 0.4207 0.4899 0.4583 -0.0180 0.0049  -0.0194 653 VAL D C   
3518 O O   . VAL D 100 ? 0.3179 0.3963 0.3647 -0.0146 0.0045  -0.0210 653 VAL D O   
3519 C CB  . VAL D 100 ? 0.4052 0.4739 0.4399 -0.0186 -0.0038 -0.0239 653 VAL D CB  
3520 C CG1 . VAL D 100 ? 0.2529 0.3409 0.3038 -0.0180 -0.0058 -0.0304 653 VAL D CG1 
3521 C CG2 . VAL D 100 ? 0.4142 0.4734 0.4409 -0.0134 -0.0095 -0.0228 653 VAL D CG2 
3522 N N   . ARG D 101 ? 0.4789 0.5424 0.5098 -0.0245 0.0092  -0.0185 654 ARG D N   
3523 C CA  . ARG D 101 ? 0.4844 0.5532 0.5196 -0.0284 0.0139  -0.0198 654 ARG D CA  
3524 C C   . ARG D 101 ? 0.3665 0.4311 0.4005 -0.0226 0.0154  -0.0157 654 ARG D C   
3525 O O   . ARG D 101 ? 0.2667 0.3384 0.3079 -0.0224 0.0174  -0.0168 654 ARG D O   
3526 C CB  . ARG D 101 ? 0.5179 0.5786 0.5428 -0.0379 0.0181  -0.0209 654 ARG D CB  
3527 C CG  . ARG D 101 ? 0.7822 0.8562 0.8158 -0.0475 0.0199  -0.0278 654 ARG D CG  
3528 C CD  . ARG D 101 ? 0.8338 0.8963 0.8534 -0.0591 0.0254  -0.0291 654 ARG D CD  
3529 N NE  . ARG D 101 ? 0.5767 0.6169 0.5761 -0.0570 0.0242  -0.0239 654 ARG D NE  
3530 C CZ  . ARG D 101 ? 0.6580 0.6883 0.6466 -0.0603 0.0221  -0.0238 654 ARG D CZ  
3531 N NH1 . ARG D 101 ? 0.5968 0.6373 0.5924 -0.0678 0.0211  -0.0291 654 ARG D NH1 
3532 N NH2 . ARG D 101 ? 0.2916 0.3016 0.2617 -0.0558 0.0207  -0.0188 654 ARG D NH2 
3533 N N   . LEU D 102 ? 0.2736 0.3276 0.2989 -0.0181 0.0145  -0.0115 655 LEU D N   
3534 C CA  . LEU D 102 ? 0.2854 0.3380 0.3115 -0.0129 0.0156  -0.0087 655 LEU D CA  
3535 C C   . LEU D 102 ? 0.2565 0.3163 0.2912 -0.0087 0.0139  -0.0091 655 LEU D C   
3536 O O   . LEU D 102 ? 0.2407 0.3036 0.2796 -0.0071 0.0153  -0.0086 655 LEU D O   
3537 C CB  . LEU D 102 ? 0.1802 0.2229 0.1966 -0.0093 0.0155  -0.0056 655 LEU D CB  
3538 C CG  . LEU D 102 ? 0.3626 0.4054 0.3797 -0.0056 0.0172  -0.0040 655 LEU D CG  
3539 C CD1 . LEU D 102 ? 0.4377 0.4769 0.4503 -0.0077 0.0188  -0.0047 655 LEU D CD1 
3540 C CD2 . LEU D 102 ? 0.1588 0.1963 0.1699 -0.0012 0.0172  -0.0023 655 LEU D CD2 
3541 N N   . ARG D 103 ? 0.4057 0.4664 0.4413 -0.0067 0.0103  -0.0103 656 ARG D N   
3542 C CA  . ARG D 103 ? 0.4090 0.4736 0.4494 -0.0021 0.0078  -0.0115 656 ARG D CA  
3543 C C   . ARG D 103 ? 0.3095 0.3856 0.3600 -0.0029 0.0084  -0.0149 656 ARG D C   
3544 O O   . ARG D 103 ? 0.3734 0.4499 0.4255 0.0002  0.0087  -0.0144 656 ARG D O   
3545 C CB  . ARG D 103 ? 0.3601 0.4227 0.3981 0.0010  0.0027  -0.0133 656 ARG D CB  
3546 C CG  . ARG D 103 ? 0.4181 0.4775 0.4541 0.0075  -0.0007 -0.0140 656 ARG D CG  
3547 C CD  . ARG D 103 ? 0.6731 0.7298 0.7056 0.0114  -0.0071 -0.0168 656 ARG D CD  
3548 N NE  . ARG D 103 ? 0.9146 0.9837 0.9560 0.0076  -0.0093 -0.0215 656 ARG D NE  
3549 C CZ  . ARG D 103 ? 1.0821 1.1664 1.1350 0.0087  -0.0127 -0.0278 656 ARG D CZ  
3550 N NH1 . ARG D 103 ? 1.2401 1.3277 1.2959 0.0153  -0.0152 -0.0301 656 ARG D NH1 
3551 N NH2 . ARG D 103 ? 0.9637 1.0598 1.0248 0.0031  -0.0133 -0.0324 656 ARG D NH2 
3552 N N   . ASP D 104 ? 0.3843 0.4690 0.4405 -0.0078 0.0091  -0.0187 657 ASP D N   
3553 C CA  . ASP D 104 ? 0.4535 0.5517 0.5205 -0.0085 0.0097  -0.0235 657 ASP D CA  
3554 C C   . ASP D 104 ? 0.4084 0.5051 0.4749 -0.0106 0.0146  -0.0215 657 ASP D C   
3555 O O   . ASP D 104 ? 0.4017 0.5028 0.4728 -0.0073 0.0147  -0.0225 657 ASP D O   
3556 C CB  . ASP D 104 ? 0.5327 0.6422 0.6065 -0.0149 0.0101  -0.0291 657 ASP D CB  
3557 C CG  . ASP D 104 ? 0.7442 0.8567 0.8193 -0.0127 0.0041  -0.0322 657 ASP D CG  
3558 O OD1 . ASP D 104 ? 0.7230 0.8287 0.7936 -0.0050 -0.0006 -0.0302 657 ASP D OD1 
3559 O OD2 . ASP D 104 ? 0.7898 0.9103 0.8692 -0.0193 0.0043  -0.0367 657 ASP D OD2 
3560 N N   . GLN D 105 ? 0.4399 0.5279 0.4987 -0.0152 0.0180  -0.0187 658 GLN D N   
3561 C CA  . GLN D 105 ? 0.4326 0.5163 0.4881 -0.0167 0.0218  -0.0169 658 GLN D CA  
3562 C C   . GLN D 105 ? 0.3782 0.4566 0.4316 -0.0112 0.0208  -0.0131 658 GLN D C   
3563 O O   . GLN D 105 ? 0.3770 0.4567 0.4326 -0.0099 0.0221  -0.0130 658 GLN D O   
3564 C CB  . GLN D 105 ? 0.3917 0.4653 0.4364 -0.0224 0.0247  -0.0160 658 GLN D CB  
3565 C CG  . GLN D 105 ? 0.5481 0.6272 0.5946 -0.0306 0.0277  -0.0207 658 GLN D CG  
3566 C CD  . GLN D 105 ? 0.6372 0.7022 0.6686 -0.0374 0.0308  -0.0201 658 GLN D CD  
3567 O OE1 . GLN D 105 ? 0.3944 0.4459 0.4139 -0.0347 0.0293  -0.0165 658 GLN D OE1 
3568 N NE2 . GLN D 105 ? 0.6416 0.7093 0.6723 -0.0465 0.0355  -0.0244 658 GLN D NE2 
3569 N N   . GLY D 106 ? 0.2972 0.3696 0.3460 -0.0084 0.0190  -0.0105 659 GLY D N   
3570 C CA  . GLY D 106 ? 0.2805 0.3496 0.3281 -0.0047 0.0188  -0.0080 659 GLY D CA  
3571 C C   . GLY D 106 ? 0.2482 0.3203 0.2996 -0.0017 0.0173  -0.0090 659 GLY D C   
3572 O O   . GLY D 106 ? 0.1891 0.2597 0.2404 -0.0007 0.0182  -0.0080 659 GLY D O   
3573 N N   . GLY D 107 ? 0.3096 0.3854 0.3636 0.0002  0.0143  -0.0115 660 GLY D N   
3574 C CA  . GLY D 107 ? 0.1996 0.2752 0.2538 0.0050  0.0118  -0.0129 660 GLY D CA  
3575 C C   . GLY D 107 ? 0.2931 0.3731 0.3514 0.0048  0.0137  -0.0139 660 GLY D C   
3576 O O   . GLY D 107 ? 0.3597 0.4339 0.4138 0.0071  0.0136  -0.0125 660 GLY D O   
3577 N N   . VAL D 108 ? 0.3403 0.4285 0.4048 0.0012  0.0160  -0.0161 661 VAL D N   
3578 C CA  . VAL D 108 ? 0.3960 0.4878 0.4636 0.0011  0.0183  -0.0174 661 VAL D CA  
3579 C C   . VAL D 108 ? 0.3444 0.4276 0.4065 0.0001  0.0202  -0.0135 661 VAL D C   
3580 O O   . VAL D 108 ? 0.3899 0.4714 0.4511 0.0020  0.0204  -0.0134 661 VAL D O   
3581 C CB  . VAL D 108 ? 0.4594 0.5607 0.5332 -0.0038 0.0219  -0.0212 661 VAL D CB  
3582 C CG1 . VAL D 108 ? 0.2877 0.3974 0.3665 -0.0065 0.0210  -0.0249 661 VAL D CG1 
3583 C CG2 . VAL D 108 ? 0.5590 0.6530 0.6269 -0.0088 0.0259  -0.0187 661 VAL D CG2 
3584 N N   . VAL D 109 ? 0.3855 0.4637 0.4438 -0.0023 0.0212  -0.0109 662 VAL D N   
3585 C CA  . VAL D 109 ? 0.2765 0.3495 0.3314 -0.0027 0.0222  -0.0087 662 VAL D CA  
3586 C C   . VAL D 109 ? 0.3502 0.4195 0.4029 -0.0004 0.0210  -0.0076 662 VAL D C   
3587 O O   . VAL D 109 ? 0.3507 0.4174 0.4020 -0.0005 0.0214  -0.0071 662 VAL D O   
3588 C CB  . VAL D 109 ? 0.3418 0.4115 0.3931 -0.0040 0.0227  -0.0072 662 VAL D CB  
3589 C CG1 . VAL D 109 ? 0.1534 0.2211 0.2036 -0.0034 0.0228  -0.0064 662 VAL D CG1 
3590 C CG2 . VAL D 109 ? 0.2513 0.3195 0.2997 -0.0066 0.0240  -0.0083 662 VAL D CG2 
3591 N N   . LEU D 110 ? 0.2749 0.3418 0.3252 0.0011  0.0194  -0.0073 663 LEU D N   
3592 C CA  . LEU D 110 ? 0.2401 0.2992 0.2839 0.0020  0.0190  -0.0062 663 LEU D CA  
3593 C C   . LEU D 110 ? 0.3085 0.3639 0.3489 0.0054  0.0171  -0.0074 663 LEU D C   
3594 O O   . LEU D 110 ? 0.3459 0.3935 0.3798 0.0046  0.0178  -0.0065 663 LEU D O   
3595 C CB  . LEU D 110 ? 0.2963 0.3503 0.3350 0.0028  0.0182  -0.0055 663 LEU D CB  
3596 C CG  . LEU D 110 ? 0.2322 0.2879 0.2720 0.0000  0.0206  -0.0042 663 LEU D CG  
3597 C CD1 . LEU D 110 ? 0.1154 0.1677 0.1512 0.0012  0.0195  -0.0038 663 LEU D CD1 
3598 C CD2 . LEU D 110 ? 0.2574 0.3106 0.2949 -0.0030 0.0237  -0.0036 663 LEU D CD2 
3599 N N   . ARG D 111 ? 0.2176 0.2790 0.2622 0.0090  0.0148  -0.0101 664 ARG D N   
3600 C CA  . ARG D 111 ? 0.3713 0.4305 0.4129 0.0139  0.0126  -0.0121 664 ARG D CA  
3601 C C   . ARG D 111 ? 0.3615 0.4207 0.4041 0.0118  0.0152  -0.0114 664 ARG D C   
3602 O O   . ARG D 111 ? 0.3521 0.4033 0.3873 0.0142  0.0142  -0.0113 664 ARG D O   
3603 C CB  . ARG D 111 ? 0.3567 0.4270 0.4059 0.0183  0.0100  -0.0167 664 ARG D CB  
3604 C CG  . ARG D 111 ? 0.5411 0.6099 0.5874 0.0227  0.0054  -0.0185 664 ARG D CG  
3605 C CD  . ARG D 111 ? 0.6027 0.6850 0.6577 0.0283  0.0018  -0.0249 664 ARG D CD  
3606 N NE  . ARG D 111 ? 0.7949 0.8837 0.8544 0.0291  -0.0013 -0.0275 664 ARG D NE  
3607 C CZ  . ARG D 111 ? 0.8852 0.9825 0.9527 0.0223  0.0014  -0.0274 664 ARG D CZ  
3608 N NH1 . ARG D 111 ? 0.9389 1.0381 1.0096 0.0150  0.0073  -0.0248 664 ARG D NH1 
3609 N NH2 . ARG D 111 ? 1.1301 1.2320 1.2002 0.0233  -0.0021 -0.0302 664 ARG D NH2 
3610 N N   . GLN D 112 ? 0.3569 0.4227 0.4061 0.0076  0.0181  -0.0110 665 GLN D N   
3611 C CA  . GLN D 112 ? 0.2935 0.3575 0.3421 0.0059  0.0199  -0.0103 665 GLN D CA  
3612 C C   . GLN D 112 ? 0.2300 0.2857 0.2726 0.0033  0.0202  -0.0079 665 GLN D C   
3613 O O   . GLN D 112 ? 0.3056 0.3560 0.3440 0.0031  0.0202  -0.0076 665 GLN D O   
3614 C CB  . GLN D 112 ? 0.3015 0.3710 0.3549 0.0024  0.0225  -0.0107 665 GLN D CB  
3615 C CG  . GLN D 112 ? 0.2988 0.3659 0.3505 0.0017  0.0242  -0.0109 665 GLN D CG  
3616 C CD  . GLN D 112 ? 0.3716 0.4405 0.4236 0.0052  0.0244  -0.0132 665 GLN D CD  
3617 O OE1 . GLN D 112 ? 0.2038 0.2812 0.2611 0.0074  0.0245  -0.0165 665 GLN D OE1 
3618 N NE2 . GLN D 112 ? 0.2878 0.3496 0.3344 0.0060  0.0242  -0.0123 665 GLN D NE2 
3619 N N   . ALA D 113 ? 0.2307 0.2858 0.2730 0.0008  0.0207  -0.0067 666 ALA D N   
3620 C CA  . ALA D 113 ? 0.2688 0.3189 0.3071 -0.0029 0.0220  -0.0056 666 ALA D CA  
3621 C C   . ALA D 113 ? 0.2691 0.3072 0.2963 -0.0022 0.0213  -0.0053 666 ALA D C   
3622 O O   . ALA D 113 ? 0.3281 0.3606 0.3505 -0.0054 0.0222  -0.0052 666 ALA D O   
3623 C CB  . ALA D 113 ? 0.3006 0.3536 0.3409 -0.0052 0.0234  -0.0052 666 ALA D CB  
3624 N N   . ARG D 114 ? 0.2795 0.3128 0.3014 0.0023  0.0191  -0.0058 667 ARG D N   
3625 C CA  . ARG D 114 ? 0.2569 0.2749 0.2640 0.0047  0.0174  -0.0058 667 ARG D CA  
3626 C C   . ARG D 114 ? 0.3058 0.3200 0.3093 0.0070  0.0163  -0.0065 667 ARG D C   
3627 O O   . ARG D 114 ? 0.3863 0.3870 0.3774 0.0046  0.0168  -0.0058 667 ARG D O   
3628 C CB  . ARG D 114 ? 0.2477 0.2624 0.2502 0.0116  0.0136  -0.0072 667 ARG D CB  
3629 C CG  . ARG D 114 ? 0.4008 0.3960 0.3838 0.0166  0.0104  -0.0078 667 ARG D CG  
3630 C CD  . ARG D 114 ? 0.3611 0.3381 0.3278 0.0098  0.0137  -0.0057 667 ARG D CD  
3631 N NE  . ARG D 114 ? 0.4382 0.4144 0.4043 0.0060  0.0161  -0.0047 667 ARG D NE  
3632 C CZ  . ARG D 114 ? 0.5130 0.4796 0.4702 -0.0022 0.0211  -0.0035 667 ARG D CZ  
3633 N NH1 . ARG D 114 ? 0.4484 0.4052 0.3963 -0.0084 0.0241  -0.0033 667 ARG D NH1 
3634 N NH2 . ARG D 114 ? 0.3137 0.2811 0.2713 -0.0048 0.0235  -0.0030 667 ARG D NH2 
3635 N N   . ARG D 115 ? 0.2343 0.2594 0.2474 0.0111  0.0153  -0.0081 668 ARG D N   
3636 C CA  . ARG D 115 ? 0.2624 0.2848 0.2727 0.0136  0.0148  -0.0089 668 ARG D CA  
3637 C C   . ARG D 115 ? 0.3786 0.3964 0.3866 0.0069  0.0170  -0.0071 668 ARG D C   
3638 O O   . ARG D 115 ? 0.3870 0.3930 0.3840 0.0070  0.0163  -0.0068 668 ARG D O   
3639 C CB  . ARG D 115 ? 0.3346 0.3716 0.3572 0.0166  0.0152  -0.0113 668 ARG D CB  
3640 C CG  . ARG D 115 ? 0.2373 0.2825 0.2646 0.0234  0.0125  -0.0149 668 ARG D CG  
3641 C CD  . ARG D 115 ? 0.3271 0.3892 0.3688 0.0220  0.0151  -0.0175 668 ARG D CD  
3642 N NE  . ARG D 115 ? 0.3136 0.3869 0.3621 0.0272  0.0127  -0.0222 668 ARG D NE  
3643 C CZ  . ARG D 115 ? 0.4459 0.5351 0.5069 0.0252  0.0151  -0.0258 668 ARG D CZ  
3644 N NH1 . ARG D 115 ? 0.1842 0.2768 0.2495 0.0181  0.0202  -0.0246 668 ARG D NH1 
3645 N NH2 . ARG D 115 ? 0.2281 0.3292 0.2962 0.0302  0.0122  -0.0312 668 ARG D NH2 
3646 N N   . GLU D 116 ? 0.2880 0.3144 0.3052 0.0015  0.0192  -0.0063 669 GLU D N   
3647 C CA  . GLU D 116 ? 0.3812 0.4055 0.3975 -0.0040 0.0203  -0.0059 669 GLU D CA  
3648 C C   . GLU D 116 ? 0.3510 0.3638 0.3563 -0.0089 0.0212  -0.0055 669 GLU D C   
3649 O O   . GLU D 116 ? 0.4787 0.4832 0.4766 -0.0122 0.0213  -0.0056 669 GLU D O   
3650 C CB  . GLU D 116 ? 0.3257 0.3616 0.3532 -0.0073 0.0213  -0.0063 669 GLU D CB  
3651 C CG  . GLU D 116 ? 0.4301 0.4732 0.4644 -0.0043 0.0211  -0.0068 669 GLU D CG  
3652 C CD  . GLU D 116 ? 0.6119 0.6506 0.6426 -0.0023 0.0206  -0.0071 669 GLU D CD  
3653 O OE1 . GLU D 116 ? 0.5517 0.5865 0.5797 -0.0046 0.0197  -0.0073 669 GLU D OE1 
3654 O OE2 . GLU D 116 ? 0.5649 0.6047 0.5957 0.0015  0.0211  -0.0078 669 GLU D OE2 
3655 N N   . VAL D 117 ? 0.3942 0.4046 0.3966 -0.0098 0.0223  -0.0051 670 VAL D N   
3656 C CA  . VAL D 117 ? 0.4869 0.4836 0.4757 -0.0158 0.0244  -0.0049 670 VAL D CA  
3657 C C   . VAL D 117 ? 0.4869 0.4640 0.4570 -0.0125 0.0222  -0.0045 670 VAL D C   
3658 O O   . VAL D 117 ? 0.3804 0.3448 0.3382 -0.0188 0.0239  -0.0046 670 VAL D O   
3659 C CB  . VAL D 117 ? 0.5000 0.4953 0.4866 -0.0171 0.0263  -0.0047 670 VAL D CB  
3660 C CG1 . VAL D 117 ? 0.4725 0.4483 0.4397 -0.0237 0.0294  -0.0046 670 VAL D CG1 
3661 C CG2 . VAL D 117 ? 0.4663 0.4798 0.4696 -0.0208 0.0287  -0.0055 670 VAL D CG2 
3662 N N   . ASP D 118 ? 0.5129 0.4883 0.4809 -0.0027 0.0184  -0.0048 671 ASP D N   
3663 C CA  . ASP D 118 ? 0.4677 0.4248 0.4172 0.0031  0.0153  -0.0051 671 ASP D CA  
3664 C C   . ASP D 118 ? 0.4899 0.4408 0.4343 -0.0005 0.0159  -0.0048 671 ASP D C   
3665 O O   . ASP D 118 ? 0.4784 0.4082 0.4021 -0.0021 0.0155  -0.0045 671 ASP D O   
3666 C CB  . ASP D 118 ? 0.4866 0.4505 0.4408 0.0149  0.0110  -0.0071 671 ASP D CB  
3667 C CG  . ASP D 118 ? 0.3954 0.3639 0.3528 0.0200  0.0089  -0.0082 671 ASP D CG  
3668 O OD1 . ASP D 118 ? 0.3976 0.3519 0.3412 0.0187  0.0086  -0.0075 671 ASP D OD1 
3669 O OD2 . ASP D 118 ? 0.6547 0.6403 0.6270 0.0254  0.0073  -0.0104 671 ASP D OD2 
3670 N N   . SER D 119 ? 0.5057 0.4727 0.4666 -0.0020 0.0167  -0.0050 672 SER D N   
3671 C CA  . SER D 119 ? 0.5472 0.5095 0.5044 -0.0037 0.0163  -0.0050 672 SER D CA  
3672 C C   . SER D 119 ? 0.5658 0.5260 0.5219 -0.0151 0.0188  -0.0050 672 SER D C   
3673 O O   . SER D 119 ? 0.5822 0.5287 0.5254 -0.0185 0.0184  -0.0050 672 SER D O   
3674 C CB  . SER D 119 ? 0.4937 0.4714 0.4660 0.0008  0.0158  -0.0056 672 SER D CB  
3675 O OG  . SER D 119 ? 0.5597 0.5524 0.5474 -0.0042 0.0175  -0.0057 672 SER D OG  
3676 N N   . ILE D 120 ? 0.6467 0.6211 0.6163 -0.0208 0.0213  -0.0057 673 ILE D N   
3677 C CA  . ILE D 120 ? 0.7022 0.6783 0.6729 -0.0320 0.0240  -0.0074 673 ILE D CA  
3678 C C   . ILE D 120 ? 0.7218 0.6772 0.6716 -0.0386 0.0266  -0.0072 673 ILE D C   
3679 O O   . ILE D 120 ? 0.7211 0.6683 0.6625 -0.0475 0.0282  -0.0086 673 ILE D O   
3680 C CB  . ILE D 120 ? 0.6654 0.6612 0.6539 -0.0353 0.0263  -0.0089 673 ILE D CB  
3681 C CG1 . ILE D 120 ? 0.7360 0.7488 0.7413 -0.0305 0.0237  -0.0097 673 ILE D CG1 
3682 C CG2 . ILE D 120 ? 0.8327 0.8315 0.8220 -0.0471 0.0300  -0.0120 673 ILE D CG2 
3683 C CD1 . ILE D 120 ? 0.7353 0.7644 0.7549 -0.0302 0.0249  -0.0108 673 ILE D CD1 
3684 N N   . GLY D 121 ? 0.8195 0.7650 0.7593 -0.0346 0.0269  -0.0059 674 GLY D N   
3685 C CA  . GLY D 121 ? 0.8253 0.7445 0.7389 -0.0387 0.0287  -0.0055 674 GLY D CA  
3686 C C   . GLY D 121 ? 0.8505 0.7480 0.7434 -0.0378 0.0263  -0.0050 674 GLY D C   
3687 O O   . GLY D 121 ? 0.9190 0.7958 0.7911 -0.0468 0.0291  -0.0054 674 GLY D O   
3688 N N   . LEU D 122 ? 0.8305 0.7315 0.7277 -0.0275 0.0217  -0.0043 675 LEU D N   
3689 C CA  . LEU D 122 ? 0.8646 0.7472 0.7442 -0.0261 0.0193  -0.0040 675 LEU D CA  
3690 C C   . LEU D 122 ? 0.8860 0.7742 0.7716 -0.0378 0.0215  -0.0052 675 LEU D C   
3691 O O   . LEU D 122 ? 0.9749 0.8457 0.8431 -0.0481 0.0239  -0.0059 675 LEU D O   
3692 C CB  . LEU D 122 ? 0.8453 0.7338 0.7306 -0.0125 0.0147  -0.0038 675 LEU D CB  
3693 C CG  . LEU D 122 ? 0.7615 0.6446 0.6397 0.0007  0.0110  -0.0042 675 LEU D CG  
3694 C CD1 . LEU D 122 ? 0.6648 0.5558 0.5498 0.0117  0.0078  -0.0052 675 LEU D CD1 
3695 C CD2 . LEU D 122 ? 0.5832 0.4342 0.4289 0.0020  0.0094  -0.0040 675 LEU D CD2 
3696 N N   . ARG E 10  ? 0.8534 1.0898 1.1094 0.0481  0.0207  0.1742  563 ARG E N   
3697 C CA  . ARG E 10  ? 0.8835 1.1157 1.1203 0.0576  0.0293  0.1728  563 ARG E CA  
3698 C C   . ARG E 10  ? 0.8995 1.1127 1.1087 0.0581  0.0271  0.1623  563 ARG E C   
3699 O O   . ARG E 10  ? 0.9349 1.1410 1.1262 0.0647  0.0307  0.1587  563 ARG E O   
3700 C CB  . ARG E 10  ? 0.8802 1.1218 1.1253 0.0644  0.0301  0.1740  563 ARG E CB  
3701 N N   . LEU E 11  ? 0.8332 1.0384 1.0383 0.0510  0.0215  0.1574  564 LEU E N   
3702 C CA  . LEU E 11  ? 0.7549 0.9447 0.9392 0.0488  0.0175  0.1460  564 LEU E CA  
3703 C C   . LEU E 11  ? 0.7153 0.8976 0.8827 0.0491  0.0213  0.1427  564 LEU E C   
3704 O O   . LEU E 11  ? 0.7087 0.8928 0.8822 0.0456  0.0193  0.1444  564 LEU E O   
3705 C CB  . LEU E 11  ? 0.7755 0.9627 0.9689 0.0407  0.0069  0.1413  564 LEU E CB  
3706 C CG  . LEU E 11  ? 0.7624 0.9489 0.9649 0.0392  -0.0002 0.1395  564 LEU E CG  
3707 C CD1 . LEU E 11  ? 0.6866 0.8697 0.8973 0.0315  -0.0102 0.1363  564 LEU E CD1 
3708 C CD2 . LEU E 11  ? 0.9259 1.0993 1.1073 0.0426  0.0006  0.1311  564 LEU E CD2 
3709 N N   . THR E 12  ? 0.6782 0.8506 0.8231 0.0532  0.0258  0.1374  565 THR E N   
3710 C CA  . THR E 12  ? 0.6813 0.8466 0.8105 0.0542  0.0289  0.1341  565 THR E CA  
3711 C C   . THR E 12  ? 0.6001 0.7598 0.7248 0.0471  0.0217  0.1234  565 THR E C   
3712 O O   . THR E 12  ? 0.5718 0.7300 0.6999 0.0419  0.0157  0.1176  565 THR E O   
3713 C CB  . THR E 12  ? 0.7236 0.8793 0.8289 0.0607  0.0356  0.1320  565 THR E CB  
3714 O OG1 . THR E 12  ? 0.7405 0.8870 0.8325 0.0579  0.0326  0.1230  565 THR E OG1 
3715 C CG2 . THR E 12  ? 0.7645 0.9260 0.8725 0.0693  0.0433  0.1423  565 THR E CG2 
3716 N N   . PRO E 13  ? 0.5959 0.7521 0.7122 0.0475  0.0222  0.1202  566 PRO E N   
3717 C CA  . PRO E 13  ? 0.5398 0.6926 0.6516 0.0418  0.0156  0.1088  566 PRO E CA  
3718 C C   . PRO E 13  ? 0.5344 0.6796 0.6311 0.0384  0.0154  0.0981  566 PRO E C   
3719 O O   . PRO E 13  ? 0.4792 0.6239 0.5768 0.0322  0.0098  0.0890  566 PRO E O   
3720 C CB  . PRO E 13  ? 0.5374 0.6868 0.6401 0.0453  0.0173  0.1075  566 PRO E CB  
3721 C CG  . PRO E 13  ? 0.6692 0.8215 0.7787 0.0506  0.0225  0.1200  566 PRO E CG  
3722 C CD  . PRO E 13  ? 0.5753 0.7309 0.6879 0.0534  0.0280  0.1270  566 PRO E CD  
3723 N N   . LEU E 14  ? 0.4470 0.5855 0.5285 0.0424  0.0216  0.0992  567 LEU E N   
3724 C CA  . LEU E 14  ? 0.4375 0.5660 0.5010 0.0386  0.0219  0.0892  567 LEU E CA  
3725 C C   . LEU E 14  ? 0.4005 0.5279 0.4708 0.0346  0.0180  0.0880  567 LEU E C   
3726 O O   . LEU E 14  ? 0.3368 0.4590 0.4022 0.0277  0.0146  0.0784  567 LEU E O   
3727 C CB  . LEU E 14  ? 0.4690 0.5881 0.5114 0.0446  0.0290  0.0915  567 LEU E CB  
3728 C CG  . LEU E 14  ? 0.4959 0.6015 0.5161 0.0400  0.0297  0.0817  567 LEU E CG  
3729 C CD1 . LEU E 14  ? 0.3820 0.4865 0.3964 0.0324  0.0274  0.0698  567 LEU E CD1 
3730 C CD2 . LEU E 14  ? 0.4766 0.5707 0.4735 0.0470  0.0359  0.0852  567 LEU E CD2 
3731 N N   . THR E 15  ? 0.3124 0.4446 0.3945 0.0392  0.0185  0.0976  568 THR E N   
3732 C CA  . THR E 15  ? 0.3798 0.5093 0.4671 0.0373  0.0145  0.0970  568 THR E CA  
3733 C C   . THR E 15  ? 0.3486 0.4809 0.4499 0.0299  0.0064  0.0926  568 THR E C   
3734 O O   . THR E 15  ? 0.4089 0.5320 0.5036 0.0253  0.0030  0.0853  568 THR E O   
3735 C CB  . THR E 15  ? 0.4175 0.5552 0.5181 0.0445  0.0163  0.1083  568 THR E CB  
3736 O OG1 . THR E 15  ? 0.3759 0.5091 0.4596 0.0520  0.0237  0.1111  568 THR E OG1 
3737 C CG2 . THR E 15  ? 0.3257 0.4602 0.4323 0.0437  0.0108  0.1074  568 THR E CG2 
3738 N N   . VAL E 16  ? 0.2952 0.4381 0.4133 0.0290  0.0035  0.0971  569 VAL E N   
3739 C CA  . VAL E 16  ? 0.3063 0.4512 0.4360 0.0230  -0.0045 0.0935  569 VAL E CA  
3740 C C   . VAL E 16  ? 0.2973 0.4353 0.4130 0.0175  -0.0057 0.0804  569 VAL E C   
3741 O O   . VAL E 16  ? 0.3581 0.4917 0.4749 0.0125  -0.0109 0.0744  569 VAL E O   
3742 C CB  . VAL E 16  ? 0.3479 0.5028 0.4924 0.0237  -0.0070 0.1000  569 VAL E CB  
3743 C CG1 . VAL E 16  ? 0.3682 0.5233 0.5185 0.0185  -0.0154 0.0943  569 VAL E CG1 
3744 C CG2 . VAL E 16  ? 0.4550 0.6176 0.6167 0.0265  -0.0066 0.1124  569 VAL E CG2 
3745 N N   . LEU E 17  ? 0.3405 0.4771 0.4424 0.0185  -0.0006 0.0756  570 LEU E N   
3746 C CA  . LEU E 17  ? 0.3648 0.4974 0.4547 0.0127  -0.0010 0.0624  570 LEU E CA  
3747 C C   . LEU E 17  ? 0.3719 0.4914 0.4456 0.0084  0.0013  0.0558  570 LEU E C   
3748 O O   . LEU E 17  ? 0.3293 0.4448 0.3992 0.0016  -0.0009 0.0460  570 LEU E O   
3749 C CB  . LEU E 17  ? 0.2928 0.4273 0.3728 0.0150  0.0031  0.0593  570 LEU E CB  
3750 C CG  . LEU E 17  ? 0.5093 0.6481 0.5872 0.0106  0.0003  0.0472  570 LEU E CG  
3751 C CD1 . LEU E 17  ? 0.3099 0.4426 0.3778 0.0026  0.0010  0.0360  570 LEU E CD1 
3752 C CD2 . LEU E 17  ? 0.5058 0.6541 0.6007 0.0112  -0.0074 0.0478  570 LEU E CD2 
3753 N N   . LEU E 18  ? 0.2672 0.3789 0.3302 0.0128  0.0059  0.0608  571 LEU E N   
3754 C CA  . LEU E 18  ? 0.3095 0.4049 0.3513 0.0094  0.0085  0.0540  571 LEU E CA  
3755 C C   . LEU E 18  ? 0.4000 0.4897 0.4488 0.0072  0.0030  0.0538  571 LEU E C   
3756 O O   . LEU E 18  ? 0.4385 0.5147 0.4731 0.0013  0.0029  0.0449  571 LEU E O   
3757 C CB  . LEU E 18  ? 0.2344 0.3215 0.2598 0.0161  0.0141  0.0591  571 LEU E CB  
3758 C CG  . LEU E 18  ? 0.4583 0.5444 0.4684 0.0179  0.0200  0.0577  571 LEU E CG  
3759 C CD1 . LEU E 18  ? 0.2844 0.3612 0.2777 0.0258  0.0248  0.0637  571 LEU E CD1 
3760 C CD2 . LEU E 18  ? 0.3835 0.4612 0.3759 0.0088  0.0217  0.0446  571 LEU E CD2 
3761 N N   . ARG E 19  ? 0.3064 0.4056 0.3767 0.0116  -0.0015 0.0635  572 ARG E N   
3762 C CA  . ARG E 19  ? 0.3206 0.4151 0.4003 0.0104  -0.0082 0.0646  572 ARG E CA  
3763 C C   . ARG E 19  ? 0.3698 0.4626 0.4527 0.0029  -0.0132 0.0565  572 ARG E C   
3764 O O   . ARG E 19  ? 0.2915 0.3702 0.3645 -0.0010 -0.0152 0.0499  572 ARG E O   
3765 C CB  . ARG E 19  ? 0.2452 0.3531 0.3491 0.0156  -0.0121 0.0767  572 ARG E CB  
3766 C CG  . ARG E 19  ? 0.5221 0.6261 0.6380 0.0144  -0.0204 0.0784  572 ARG E CG  
3767 C CD  . ARG E 19  ? 0.6551 0.7654 0.7855 0.0206  -0.0222 0.0885  572 ARG E CD  
3768 N NE  . ARG E 19  ? 0.6566 0.7606 0.7965 0.0193  -0.0312 0.0888  572 ARG E NE  
3769 C CZ  . ARG E 19  ? 0.7220 0.8198 0.8626 0.0238  -0.0342 0.0907  572 ARG E CZ  
3770 N NH1 . ARG E 19  ? 0.5583 0.6561 0.6904 0.0305  -0.0287 0.0924  572 ARG E NH1 
3771 N NH2 . ARG E 19  ? 0.7032 0.7938 0.8522 0.0225  -0.0434 0.0905  572 ARG E NH2 
3772 N N   . SER E 20  ? 0.2632 0.3693 0.3583 0.0017  -0.0150 0.0567  573 SER E N   
3773 C CA  . SER E 20  ? 0.2757 0.3820 0.3723 -0.0041 -0.0190 0.0482  573 SER E CA  
3774 C C   . SER E 20  ? 0.2809 0.3763 0.3564 -0.0105 -0.0139 0.0354  573 SER E C   
3775 O O   . SER E 20  ? 0.2968 0.3841 0.3683 -0.0157 -0.0163 0.0282  573 SER E O   
3776 C CB  . SER E 20  ? 0.1069 0.2283 0.2150 -0.0032 -0.0212 0.0487  573 SER E CB  
3777 O OG  . SER E 20  ? 0.5596 0.6818 0.6669 -0.0083 -0.0246 0.0386  573 SER E OG  
3778 N N   . VAL E 21  ? 0.3721 0.4658 0.4327 -0.0105 -0.0065 0.0325  574 VAL E N   
3779 C CA  . VAL E 21  ? 0.2949 0.3776 0.3339 -0.0179 -0.0009 0.0203  574 VAL E CA  
3780 C C   . VAL E 21  ? 0.3313 0.3926 0.3542 -0.0201 -0.0004 0.0182  574 VAL E C   
3781 O O   . VAL E 21  ? 0.3444 0.3949 0.3562 -0.0276 0.0006  0.0085  574 VAL E O   
3782 C CB  . VAL E 21  ? 0.3583 0.4414 0.3823 -0.0172 0.0062  0.0185  574 VAL E CB  
3783 C CG1 . VAL E 21  ? 0.2426 0.3110 0.2409 -0.0263 0.0124  0.0062  574 VAL E CG1 
3784 C CG2 . VAL E 21  ? 0.3770 0.4786 0.4145 -0.0153 0.0050  0.0182  574 VAL E CG2 
3785 N N   . LEU E 22  ? 0.3310 0.3857 0.3524 -0.0131 -0.0012 0.0271  575 LEU E N   
3786 C CA  . LEU E 22  ? 0.3344 0.3670 0.3390 -0.0131 -0.0019 0.0252  575 LEU E CA  
3787 C C   . LEU E 22  ? 0.3332 0.3589 0.3458 -0.0160 -0.0087 0.0229  575 LEU E C   
3788 O O   . LEU E 22  ? 0.3192 0.3245 0.3126 -0.0210 -0.0075 0.0149  575 LEU E O   
3789 C CB  . LEU E 22  ? 0.2730 0.3041 0.2790 -0.0033 -0.0029 0.0353  575 LEU E CB  
3790 C CG  . LEU E 22  ? 0.2716 0.2777 0.2557 -0.0016 -0.0037 0.0323  575 LEU E CG  
3791 C CD1 . LEU E 22  ? 0.2844 0.2705 0.2349 -0.0085 0.0031  0.0213  575 LEU E CD1 
3792 C CD2 . LEU E 22  ? 0.3257 0.3340 0.3127 0.0093  -0.0048 0.0416  575 LEU E CD2 
3793 N N   . ASP E 23  ? 0.2836 0.3242 0.3222 -0.0130 -0.0157 0.0300  576 ASP E N   
3794 C CA  . ASP E 23  ? 0.2388 0.2726 0.2851 -0.0152 -0.0232 0.0286  576 ASP E CA  
3795 C C   . ASP E 23  ? 0.2992 0.3296 0.3373 -0.0238 -0.0210 0.0168  576 ASP E C   
3796 O O   . ASP E 23  ? 0.2725 0.2851 0.2993 -0.0274 -0.0223 0.0110  576 ASP E O   
3797 C CB  . ASP E 23  ? 0.1752 0.2260 0.2497 -0.0107 -0.0311 0.0390  576 ASP E CB  
3798 C CG  . ASP E 23  ? 0.2156 0.2687 0.3003 -0.0032 -0.0339 0.0501  576 ASP E CG  
3799 O OD1 . ASP E 23  ? 0.3343 0.3734 0.4036 -0.0005 -0.0314 0.0488  576 ASP E OD1 
3800 O OD2 . ASP E 23  ? 0.1793 0.2486 0.2863 0.0001  -0.0381 0.0597  576 ASP E OD2 
3801 N N   . GLN E 24  ? 0.1812 0.2289 0.2249 -0.0266 -0.0176 0.0130  577 GLN E N   
3802 C CA  . GLN E 24  ? 0.3135 0.3631 0.3516 -0.0345 -0.0147 0.0009  577 GLN E CA  
3803 C C   . GLN E 24  ? 0.3411 0.3715 0.3519 -0.0422 -0.0064 -0.0095 577 GLN E C   
3804 O O   . GLN E 24  ? 0.3718 0.3932 0.3749 -0.0486 -0.0053 -0.0183 577 GLN E O   
3805 C CB  . GLN E 24  ? 0.1653 0.2379 0.2143 -0.0346 -0.0129 -0.0013 577 GLN E CB  
3806 C CG  . GLN E 24  ? 0.3024 0.3917 0.3754 -0.0284 -0.0215 0.0067  577 GLN E CG  
3807 C CD  . GLN E 24  ? 0.6227 0.7321 0.7041 -0.0272 -0.0208 0.0036  577 GLN E CD  
3808 O OE1 . GLN E 24  ? 0.4273 0.5432 0.5048 -0.0322 -0.0180 -0.0079 577 GLN E OE1 
3809 N NE2 . GLN E 24  ? 0.4427 0.5614 0.5355 -0.0205 -0.0235 0.0136  577 GLN E NE2 
3810 N N   . LEU E 25  ? 0.3924 0.4152 0.3872 -0.0414 -0.0007 -0.0085 578 LEU E N   
3811 C CA  . LEU E 25  ? 0.3623 0.3622 0.3267 -0.0483 0.0066  -0.0173 578 LEU E CA  
3812 C C   . LEU E 25  ? 0.3078 0.2812 0.2583 -0.0481 0.0037  -0.0180 578 LEU E C   
3813 O O   . LEU E 25  ? 0.3781 0.3342 0.3099 -0.0564 0.0079  -0.0280 578 LEU E O   
3814 C CB  . LEU E 25  ? 0.4192 0.4140 0.3671 -0.0455 0.0118  -0.0144 578 LEU E CB  
3815 C CG  . LEU E 25  ? 0.4516 0.4645 0.4025 -0.0477 0.0166  -0.0168 578 LEU E CG  
3816 C CD1 . LEU E 25  ? 0.3405 0.3432 0.2705 -0.0444 0.0214  -0.0137 578 LEU E CD1 
3817 C CD2 . LEU E 25  ? 0.2781 0.2942 0.2230 -0.0594 0.0217  -0.0304 578 LEU E CD2 
3818 N N   . GLN E 26  ? 0.4468 0.4165 0.4064 -0.0387 -0.0035 -0.0077 579 GLN E N   
3819 C CA  . GLN E 26  ? 0.4468 0.3912 0.3954 -0.0369 -0.0083 -0.0081 579 GLN E CA  
3820 C C   . GLN E 26  ? 0.4209 0.3640 0.3790 -0.0408 -0.0127 -0.0118 579 GLN E C   
3821 O O   . GLN E 26  ? 0.3875 0.3051 0.3296 -0.0423 -0.0144 -0.0159 579 GLN E O   
3822 C CB  . GLN E 26  ? 0.4226 0.3672 0.3832 -0.0257 -0.0162 0.0034  579 GLN E CB  
3823 C CG  . GLN E 26  ? 0.4150 0.3547 0.3613 -0.0203 -0.0124 0.0064  579 GLN E CG  
3824 C CD  . GLN E 26  ? 0.5197 0.4432 0.4604 -0.0111 -0.0186 0.0111  579 GLN E CD  
3825 O OE1 . GLN E 26  ? 0.3426 0.2809 0.3006 -0.0024 -0.0221 0.0208  579 GLN E OE1 
3826 N NE2 . GLN E 26  ? 0.3962 0.2887 0.3112 -0.0129 -0.0196 0.0038  579 GLN E NE2 
3827 N N   . ASP E 27  ? 0.3955 0.3640 0.3774 -0.0417 -0.0149 -0.0105 580 ASP E N   
3828 C CA  . ASP E 27  ? 0.3666 0.3348 0.3574 -0.0440 -0.0198 -0.0134 580 ASP E CA  
3829 C C   . ASP E 27  ? 0.4668 0.4243 0.4374 -0.0544 -0.0110 -0.0272 580 ASP E C   
3830 O O   . ASP E 27  ? 0.4396 0.3864 0.4066 -0.0574 -0.0126 -0.0321 580 ASP E O   
3831 C CB  . ASP E 27  ? 0.3858 0.3829 0.4044 -0.0415 -0.0249 -0.0092 580 ASP E CB  
3832 C CG  . ASP E 27  ? 0.4224 0.4287 0.4629 -0.0326 -0.0348 0.0045  580 ASP E CG  
3833 O OD1 . ASP E 27  ? 0.2797 0.2708 0.3181 -0.0280 -0.0398 0.0107  580 ASP E OD1 
3834 O OD2 . ASP E 27  ? 0.2819 0.3108 0.3415 -0.0303 -0.0377 0.0086  580 ASP E OD2 
3835 N N   . LYS E 28  ? 0.4192 0.3793 0.3760 -0.0603 -0.0015 -0.0336 581 LYS E N   
3836 C CA  . LYS E 28  ? 0.4572 0.4070 0.3942 -0.0718 0.0077  -0.0472 581 LYS E CA  
3837 C C   . LYS E 28  ? 0.5069 0.4194 0.4102 -0.0752 0.0119  -0.0514 581 LYS E C   
3838 O O   . LYS E 28  ? 0.6076 0.5058 0.4895 -0.0857 0.0205  -0.0626 581 LYS E O   
3839 C CB  . LYS E 28  ? 0.5415 0.5122 0.4802 -0.0780 0.0155  -0.0535 581 LYS E CB  
3840 C CG  . LYS E 28  ? 0.5508 0.5532 0.5168 -0.0778 0.0126  -0.0558 581 LYS E CG  
3841 C CD  . LYS E 28  ? 0.7416 0.7676 0.7300 -0.0688 0.0068  -0.0462 581 LYS E CD  
3842 C CE  . LYS E 28  ? 0.8673 0.9162 0.8813 -0.0648 -0.0005 -0.0453 581 LYS E CE  
3843 N NZ  . LYS E 28  ? 0.7930 0.8569 0.8093 -0.0724 0.0042  -0.0590 581 LYS E NZ  
3844 N N   . ASP E 29  ? 0.5048 0.4004 0.4030 -0.0664 0.0053  -0.0430 582 ASP E N   
3845 C CA  . ASP E 29  ? 0.5087 0.3657 0.3728 -0.0676 0.0075  -0.0471 582 ASP E CA  
3846 C C   . ASP E 29  ? 0.4687 0.3101 0.3382 -0.0592 -0.0031 -0.0411 582 ASP E C   
3847 O O   . ASP E 29  ? 0.4823 0.3101 0.3459 -0.0507 -0.0088 -0.0351 582 ASP E O   
3848 C CB  . ASP E 29  ? 0.5547 0.4034 0.4008 -0.0643 0.0104  -0.0446 582 ASP E CB  
3849 C CG  . ASP E 29  ? 0.6661 0.4728 0.4737 -0.0642 0.0116  -0.0493 582 ASP E CG  
3850 O OD1 . ASP E 29  ? 0.7151 0.4978 0.4980 -0.0738 0.0177  -0.0597 582 ASP E OD1 
3851 O OD2 . ASP E 29  ? 0.6391 0.4365 0.4404 -0.0543 0.0066  -0.0429 582 ASP E OD2 
3852 N N   . PRO E 30  ? 0.5182 0.3618 0.3995 -0.0610 -0.0066 -0.0428 583 PRO E N   
3853 C CA  . PRO E 30  ? 0.4492 0.2753 0.3341 -0.0532 -0.0175 -0.0372 583 PRO E CA  
3854 C C   . PRO E 30  ? 0.4786 0.2604 0.3266 -0.0535 -0.0164 -0.0430 583 PRO E C   
3855 O O   . PRO E 30  ? 0.5115 0.2761 0.3585 -0.0444 -0.0262 -0.0375 583 PRO E O   
3856 C CB  . PRO E 30  ? 0.4860 0.3235 0.3875 -0.0560 -0.0201 -0.0389 583 PRO E CB  
3857 C CG  . PRO E 30  ? 0.5291 0.3768 0.4228 -0.0674 -0.0078 -0.0501 583 PRO E CG  
3858 C CD  . PRO E 30  ? 0.4445 0.3083 0.3380 -0.0689 -0.0018 -0.0494 583 PRO E CD  
3859 N N   . ALA E 31  ? 0.4820 0.2449 0.2990 -0.0634 -0.0049 -0.0541 584 ALA E N   
3860 C CA  . ALA E 31  ? 0.6113 0.3292 0.3878 -0.0632 -0.0033 -0.0597 584 ALA E CA  
3861 C C   . ALA E 31  ? 0.6428 0.3526 0.4101 -0.0537 -0.0078 -0.0542 584 ALA E C   
3862 O O   . ALA E 31  ? 0.5680 0.2396 0.3023 -0.0510 -0.0090 -0.0585 584 ALA E O   
3863 C CB  . ALA E 31  ? 0.5538 0.2523 0.2964 -0.0775 0.0110  -0.0731 584 ALA E CB  
3864 N N   . ARG E 32  ? 0.6062 0.3497 0.3994 -0.0486 -0.0096 -0.0458 585 ARG E N   
3865 C CA  . ARG E 32  ? 0.5719 0.3124 0.3586 -0.0390 -0.0131 -0.0403 585 ARG E CA  
3866 C C   . ARG E 32  ? 0.6386 0.3459 0.3793 -0.0428 -0.0053 -0.0491 585 ARG E C   
3867 O O   . ARG E 32  ? 0.5726 0.2576 0.2938 -0.0338 -0.0101 -0.0481 585 ARG E O   
3868 C CB  . ARG E 32  ? 0.5662 0.2984 0.3648 -0.0257 -0.0268 -0.0327 585 ARG E CB  
3869 C CG  . ARG E 32  ? 0.6265 0.3921 0.4702 -0.0217 -0.0352 -0.0226 585 ARG E CG  
3870 C CD  . ARG E 32  ? 0.6308 0.3864 0.4859 -0.0108 -0.0490 -0.0163 585 ARG E CD  
3871 N NE  . ARG E 32  ? 0.5828 0.3283 0.4271 -0.0008 -0.0528 -0.0141 585 ARG E NE  
3872 C CZ  . ARG E 32  ? 0.5326 0.3057 0.3969 0.0053  -0.0533 -0.0061 585 ARG E CZ  
3873 N NH1 . ARG E 32  ? 0.5083 0.3194 0.4035 0.0024  -0.0503 0.0007  585 ARG E NH1 
3874 N NH2 . ARG E 32  ? 0.5031 0.2647 0.3547 0.0150  -0.0568 -0.0055 585 ARG E NH2 
3875 N N   . ILE E 33  ? 0.6541 0.3576 0.3766 -0.0564 0.0064  -0.0582 586 ILE E N   
3876 C CA  . ILE E 33  ? 0.6240 0.2973 0.3020 -0.0623 0.0147  -0.0666 586 ILE E CA  
3877 C C   . ILE E 33  ? 0.6947 0.3827 0.3733 -0.0557 0.0149  -0.0605 586 ILE E C   
3878 O O   . ILE E 33  ? 0.6361 0.2962 0.2807 -0.0513 0.0148  -0.0627 586 ILE E O   
3879 C CB  . ILE E 33  ? 0.6394 0.3109 0.3030 -0.0800 0.0278  -0.0775 586 ILE E CB  
3880 C CG1 . ILE E 33  ? 0.7093 0.3505 0.3550 -0.0861 0.0292  -0.0856 586 ILE E CG1 
3881 C CG2 . ILE E 33  ? 0.5935 0.2459 0.2186 -0.0874 0.0370  -0.0841 586 ILE E CG2 
3882 C CD1 . ILE E 33  ? 0.6900 0.3379 0.3328 -0.1025 0.0412  -0.0953 586 ILE E CD1 
3883 N N   . PHE E 34  ? 0.6164 0.3468 0.3328 -0.0540 0.0145  -0.0529 587 PHE E N   
3884 C CA  . PHE E 34  ? 0.5514 0.2989 0.2715 -0.0480 0.0155  -0.0466 587 PHE E CA  
3885 C C   . PHE E 34  ? 0.5757 0.3434 0.3253 -0.0321 0.0054  -0.0339 587 PHE E C   
3886 O O   . PHE E 34  ? 0.5063 0.2926 0.2643 -0.0266 0.0065  -0.0276 587 PHE E O   
3887 C CB  . PHE E 34  ? 0.5551 0.3340 0.2935 -0.0574 0.0229  -0.0477 587 PHE E CB  
3888 C CG  . PHE E 34  ? 0.4552 0.2185 0.1679 -0.0737 0.0333  -0.0604 587 PHE E CG  
3889 C CD1 . PHE E 34  ? 0.6108 0.3480 0.2822 -0.0798 0.0404  -0.0670 587 PHE E CD1 
3890 C CD2 . PHE E 34  ? 0.5761 0.3478 0.3027 -0.0830 0.0358  -0.0663 587 PHE E CD2 
3891 C CE1 . PHE E 34  ? 0.6384 0.3601 0.2847 -0.0965 0.0507  -0.0793 587 PHE E CE1 
3892 C CE2 . PHE E 34  ? 0.5770 0.3353 0.2803 -0.0989 0.0464  -0.0788 587 PHE E CE2 
3893 C CZ  . PHE E 34  ? 0.6327 0.3664 0.2965 -0.1061 0.0540  -0.0852 587 PHE E CZ  
3894 N N   . ALA E 35  ? 0.4650 0.2274 0.2286 -0.0252 -0.0040 -0.0306 588 ALA E N   
3895 C CA  . ALA E 35  ? 0.4956 0.2811 0.2934 -0.0124 -0.0136 -0.0189 588 ALA E CA  
3896 C C   . ALA E 35  ? 0.6065 0.3841 0.3923 0.0001  -0.0172 -0.0148 588 ALA E C   
3897 O O   . ALA E 35  ? 0.5529 0.3584 0.3675 0.0090  -0.0210 -0.0047 588 ALA E O   
3898 C CB  . ALA E 35  ? 0.3003 0.0795 0.1140 -0.0095 -0.0233 -0.0174 588 ALA E CB  
3899 N N   . GLN E 36  ? 0.6418 0.3809 0.3847 0.0011  -0.0163 -0.0229 589 GLN E N   
3900 C CA  . GLN E 36  ? 0.6030 0.3285 0.3301 0.0150  -0.0218 -0.0208 589 GLN E CA  
3901 C C   . GLN E 36  ? 0.6467 0.3421 0.3248 0.0124  -0.0148 -0.0286 589 GLN E C   
3902 O O   . GLN E 36  ? 0.5686 0.2457 0.2210 -0.0009 -0.0066 -0.0372 589 GLN E O   
3903 C CB  . GLN E 36  ? 0.6010 0.3023 0.3233 0.0229  -0.0328 -0.0230 589 GLN E CB  
3904 C CG  . GLN E 36  ? 0.8008 0.5313 0.5703 0.0296  -0.0424 -0.0134 589 GLN E CG  
3905 C CD  . GLN E 36  ? 0.8231 0.5273 0.5869 0.0360  -0.0537 -0.0166 589 GLN E CD  
3906 O OE1 . GLN E 36  ? 0.7365 0.4176 0.4873 0.0286  -0.0539 -0.0229 589 GLN E OE1 
3907 N NE2 . GLN E 36  ? 0.6942 0.4017 0.4678 0.0502  -0.0633 -0.0125 589 GLN E NE2 
3908 N N   . PRO E 37  ? 0.7356 0.4267 0.4004 0.0251  -0.0176 -0.0256 590 PRO E N   
3909 C CA  . PRO E 37  ? 0.8613 0.5229 0.4770 0.0230  -0.0113 -0.0325 590 PRO E CA  
3910 C C   . PRO E 37  ? 0.8740 0.4859 0.4440 0.0173  -0.0116 -0.0448 590 PRO E C   
3911 O O   . PRO E 37  ? 0.8330 0.4274 0.4023 0.0241  -0.0204 -0.0469 590 PRO E O   
3912 C CB  . PRO E 37  ? 0.8914 0.5563 0.5027 0.0408  -0.0168 -0.0269 590 PRO E CB  
3913 C CG  . PRO E 37  ? 0.8930 0.5876 0.5507 0.0514  -0.0258 -0.0181 590 PRO E CG  
3914 C CD  . PRO E 37  ? 0.7185 0.4336 0.4126 0.0409  -0.0257 -0.0159 590 PRO E CD  
3915 N N   . VAL E 38  ? 0.8825 0.4718 0.4154 0.0043  -0.0018 -0.0529 591 VAL E N   
3916 C CA  . VAL E 38  ? 0.9978 0.5346 0.4780 -0.0017 -0.0002 -0.0652 591 VAL E CA  
3917 C C   . VAL E 38  ? 1.0026 0.5063 0.4511 0.0152  -0.0101 -0.0673 591 VAL E C   
3918 O O   . VAL E 38  ? 0.9509 0.4655 0.4001 0.0283  -0.0136 -0.0617 591 VAL E O   
3919 C CB  . VAL E 38  ? 0.9609 0.4790 0.4017 -0.0167 0.0118  -0.0726 591 VAL E CB  
3920 C CG1 . VAL E 38  ? 1.2021 0.6623 0.5836 -0.0221 0.0135  -0.0850 591 VAL E CG1 
3921 C CG2 . VAL E 38  ? 0.9490 0.4962 0.4181 -0.0340 0.0211  -0.0732 591 VAL E CG2 
3922 N N   . SER E 39  ? 1.0289 0.4924 0.4500 0.0158  -0.0147 -0.0756 592 SER E N   
3923 C CA  . SER E 39  ? 1.1622 0.5921 0.5541 0.0329  -0.0260 -0.0791 592 SER E CA  
3924 C C   . SER E 39  ? 1.2225 0.6004 0.5446 0.0308  -0.0219 -0.0895 592 SER E C   
3925 O O   . SER E 39  ? 1.1981 0.5443 0.4856 0.0149  -0.0134 -0.0985 592 SER E O   
3926 C CB  . SER E 39  ? 1.1811 0.5915 0.5789 0.0359  -0.0346 -0.0828 592 SER E CB  
3927 O OG  . SER E 39  ? 1.2887 0.6628 0.6551 0.0525  -0.0462 -0.0879 592 SER E OG  
3928 N N   . LEU E 40  ? 1.3148 0.6839 0.6155 0.0466  -0.0278 -0.0883 593 LEU E N   
3929 C CA  . LEU E 40  ? 1.3575 0.6736 0.5873 0.0470  -0.0259 -0.0981 593 LEU E CA  
3930 C C   . LEU E 40  ? 1.3476 0.6065 0.5323 0.0507  -0.0327 -0.1097 593 LEU E C   
3931 O O   . LEU E 40  ? 1.3627 0.5719 0.4881 0.0416  -0.0272 -0.1200 593 LEU E O   
3932 C CB  . LEU E 40  ? 1.3670 0.6890 0.5855 0.0652  -0.0315 -0.0937 593 LEU E CB  
3933 C CG  . LEU E 40  ? 1.3266 0.6966 0.5779 0.0650  -0.0255 -0.0825 593 LEU E CG  
3934 C CD1 . LEU E 40  ? 1.0709 0.4253 0.2856 0.0817  -0.0299 -0.0822 593 LEU E CD1 
3935 C CD2 . LEU E 40  ? 1.2332 0.6121 0.4840 0.0423  -0.0114 -0.0829 593 LEU E CD2 
3936 N N   . LYS E 41  ? 1.3468 0.6107 0.5576 0.0641  -0.0449 -0.1083 594 LYS E N   
3937 C CA  . LYS E 41  ? 1.4477 0.6578 0.6198 0.0674  -0.0518 -0.1192 594 LYS E CA  
3938 C C   . LYS E 41  ? 1.4696 0.6514 0.6173 0.0445  -0.0396 -0.1268 594 LYS E C   
3939 O O   . LYS E 41  ? 1.6057 0.7285 0.6916 0.0405  -0.0379 -0.1385 594 LYS E O   
3940 C CB  . LYS E 41  ? 1.4666 0.6946 0.6828 0.0810  -0.0655 -0.1152 594 LYS E CB  
3941 C CG  . LYS E 41  ? 1.6326 0.8831 0.8701 0.1046  -0.0789 -0.1099 594 LYS E CG  
3942 C CD  . LYS E 41  ? 1.6773 0.8735 0.8582 0.1220  -0.0905 -0.1209 594 LYS E CD  
3943 C CE  . LYS E 41  ? 1.6650 0.8897 0.8660 0.1445  -0.1010 -0.1157 594 LYS E CE  
3944 N NZ  . LYS E 41  ? 1.6997 0.8748 0.8431 0.1631  -0.1121 -0.1267 594 LYS E NZ  
3945 N N   . GLU E 42  ? 1.3501 0.5738 0.5454 0.0298  -0.0312 -0.1205 595 GLU E N   
3946 C CA  . GLU E 42  ? 1.3069 0.5132 0.4901 0.0087  -0.0197 -0.1270 595 GLU E CA  
3947 C C   . GLU E 42  ? 1.2632 0.4581 0.4117 -0.0101 -0.0042 -0.1321 595 GLU E C   
3948 O O   . GLU E 42  ? 1.3482 0.5106 0.4645 -0.0270 0.0055  -0.1413 595 GLU E O   
3949 C CB  . GLU E 42  ? 1.2339 0.4915 0.4840 0.0023  -0.0182 -0.1186 595 GLU E CB  
3950 N N   . VAL E 43  ? 1.2114 0.4339 0.3679 -0.0077 -0.0018 -0.1260 596 VAL E N   
3951 C CA  . VAL E 43  ? 1.1594 0.3803 0.2918 -0.0252 0.0118  -0.1289 596 VAL E CA  
3952 C C   . VAL E 43  ? 1.2189 0.4318 0.3226 -0.0128 0.0079  -0.1265 596 VAL E C   
3953 O O   . VAL E 43  ? 1.2092 0.4636 0.3424 -0.0111 0.0100  -0.1176 596 VAL E O   
3954 C CB  . VAL E 43  ? 1.0802 0.3602 0.2703 -0.0388 0.0209  -0.1216 596 VAL E CB  
3955 C CG1 . VAL E 43  ? 1.1351 0.4096 0.2975 -0.0572 0.0343  -0.1261 596 VAL E CG1 
3956 C CG2 . VAL E 43  ? 0.9790 0.2712 0.2018 -0.0484 0.0234  -0.1230 596 VAL E CG2 
3957 N N   . PRO E 44  ? 1.3128 0.4692 0.3553 -0.0035 0.0019  -0.1348 597 PRO E N   
3958 C CA  . PRO E 44  ? 1.2925 0.4382 0.3059 0.0129  -0.0048 -0.1328 597 PRO E CA  
3959 C C   . PRO E 44  ? 1.3122 0.4545 0.2960 0.0016  0.0051  -0.1328 597 PRO E C   
3960 O O   . PRO E 44  ? 1.3045 0.4490 0.2742 0.0155  0.0002  -0.1286 597 PRO E O   
3961 C CB  . PRO E 44  ? 1.3736 0.4536 0.3246 0.0240  -0.0137 -0.1440 597 PRO E CB  
3962 C CG  . PRO E 44  ? 1.4202 0.4760 0.3689 0.0129  -0.0114 -0.1514 597 PRO E CG  
3963 C CD  . PRO E 44  ? 1.3108 0.4071 0.3034 -0.0089 0.0018  -0.1474 597 PRO E CD  
3964 N N   . ASP E 45  ? 1.3874 0.5265 0.3635 -0.0228 0.0187  -0.1374 598 ASP E N   
3965 C CA  . ASP E 45  ? 1.4506 0.5904 0.4032 -0.0360 0.0286  -0.1372 598 ASP E CA  
3966 C C   . ASP E 45  ? 1.3969 0.6020 0.4124 -0.0423 0.0343  -0.1267 598 ASP E C   
3967 O O   . ASP E 45  ? 1.4433 0.6523 0.4459 -0.0567 0.0434  -0.1274 598 ASP E O   
3968 C CB  . ASP E 45  ? 1.5753 0.6702 0.4769 -0.0609 0.0408  -0.1498 598 ASP E CB  
3969 C CG  . ASP E 45  ? 1.6747 0.7993 0.6194 -0.0812 0.0514  -0.1514 598 ASP E CG  
3970 O OD1 . ASP E 45  ? 1.8050 0.9765 0.8133 -0.0748 0.0476  -0.1437 598 ASP E OD1 
3971 O OD2 . ASP E 45  ? 1.7392 0.8402 0.6534 -0.1038 0.0636  -0.1605 598 ASP E OD2 
3972 N N   . TYR E 46  ? 1.3972 0.6517 0.4785 -0.0318 0.0286  -0.1173 599 TYR E N   
3973 C CA  . TYR E 46  ? 1.2514 0.5670 0.3947 -0.0388 0.0341  -0.1082 599 TYR E CA  
3974 C C   . TYR E 46  ? 1.2149 0.5504 0.3578 -0.0341 0.0354  -0.1008 599 TYR E C   
3975 O O   . TYR E 46  ? 1.1830 0.5456 0.3454 -0.0476 0.0437  -0.0987 599 TYR E O   
3976 C CB  . TYR E 46  ? 1.2334 0.5925 0.4425 -0.0275 0.0266  -0.0997 599 TYR E CB  
3977 C CG  . TYR E 46  ? 0.9901 0.4050 0.2595 -0.0372 0.0324  -0.0929 599 TYR E CG  
3978 C CD1 . TYR E 46  ? 1.0566 0.5199 0.3764 -0.0249 0.0279  -0.0805 599 TYR E CD1 
3979 C CD2 . TYR E 46  ? 1.0425 0.4609 0.3171 -0.0585 0.0426  -0.0994 599 TYR E CD2 
3980 C CE1 . TYR E 46  ? 0.9531 0.4645 0.3247 -0.0333 0.0327  -0.0748 599 TYR E CE1 
3981 C CE2 . TYR E 46  ? 1.0361 0.5044 0.3638 -0.0662 0.0470  -0.0943 599 TYR E CE2 
3982 C CZ  . TYR E 46  ? 0.9634 0.4765 0.3379 -0.0534 0.0417  -0.0821 599 TYR E CZ  
3983 O OH  . TYR E 46  ? 0.8644 0.4230 0.2872 -0.0607 0.0455  -0.0778 599 TYR E OH  
3984 N N   . LEU E 47  ? 1.2835 0.6030 0.4010 -0.0149 0.0271  -0.0975 600 LEU E N   
3985 C CA  . LEU E 47  ? 1.3084 0.6462 0.4255 -0.0066 0.0271  -0.0892 600 LEU E CA  
3986 C C   . LEU E 47  ? 1.3303 0.6296 0.3851 -0.0179 0.0336  -0.0953 600 LEU E C   
3987 O O   . LEU E 47  ? 1.4073 0.7233 0.4636 -0.0168 0.0359  -0.0890 600 LEU E O   
3988 C CB  . LEU E 47  ? 1.2823 0.6249 0.4042 0.0202  0.0154  -0.0825 600 LEU E CB  
3989 C CG  . LEU E 47  ? 1.2444 0.6252 0.4281 0.0304  0.0088  -0.0764 600 LEU E CG  
3990 C CD1 . LEU E 47  ? 1.2437 0.6247 0.4280 0.0564  -0.0030 -0.0722 600 LEU E CD1 
3991 C CD2 . LEU E 47  ? 1.1111 0.5504 0.3594 0.0243  0.0139  -0.0664 600 LEU E CD2 
3992 N N   . ASP E 48  ? 1.4408 0.6872 0.4396 -0.0292 0.0364  -0.1075 601 ASP E N   
3993 C CA  . ASP E 48  ? 1.4275 0.6383 0.3700 -0.0457 0.0443  -0.1143 601 ASP E CA  
3994 C C   . ASP E 48  ? 1.4083 0.6587 0.3883 -0.0658 0.0550  -0.1121 601 ASP E C   
3995 O O   . ASP E 48  ? 1.4121 0.6637 0.3756 -0.0722 0.0591  -0.1102 601 ASP E O   
3996 C CB  . ASP E 48  ? 1.5464 0.6984 0.4316 -0.0591 0.0479  -0.1285 601 ASP E CB  
3997 C CG  . ASP E 48  ? 1.5001 0.6085 0.3459 -0.0393 0.0365  -0.1326 601 ASP E CG  
3998 O OD1 . ASP E 48  ? 1.7838 0.8935 0.6208 -0.0172 0.0271  -0.1263 601 ASP E OD1 
3999 O OD2 . ASP E 48  ? 1.5124 0.5861 0.3361 -0.0451 0.0369  -0.1422 601 ASP E OD2 
4000 N N   . HIS E 49  ? 1.3557 0.6388 0.3871 -0.0745 0.0585  -0.1125 602 HIS E N   
4001 C CA  . HIS E 49  ? 1.3540 0.6713 0.4198 -0.0947 0.0685  -0.1134 602 HIS E CA  
4002 C C   . HIS E 49  ? 1.2222 0.6014 0.3547 -0.0859 0.0661  -0.1012 602 HIS E C   
4003 O O   . HIS E 49  ? 1.2195 0.6235 0.3681 -0.0966 0.0720  -0.0997 602 HIS E O   
4004 C CB  . HIS E 49  ? 1.3629 0.6776 0.4428 -0.1096 0.0741  -0.1221 602 HIS E CB  
4005 C CG  . HIS E 49  ? 1.5948 0.8507 0.6104 -0.1245 0.0800  -0.1354 602 HIS E CG  
4006 N ND1 . HIS E 49  ? 1.6877 0.9117 0.6863 -0.1230 0.0780  -0.1421 602 HIS E ND1 
4007 C CD2 . HIS E 49  ? 1.6115 0.8330 0.5745 -0.1419 0.0882  -0.1435 602 HIS E CD2 
4008 C CE1 . HIS E 49  ? 1.6304 0.8022 0.5678 -0.1386 0.0852  -0.1537 602 HIS E CE1 
4009 N NE2 . HIS E 49  ? 1.8007 0.9703 0.7154 -0.1508 0.0916  -0.1548 602 HIS E NE2 
4010 N N   . ILE E 50  ? 1.1579 0.5610 0.3283 -0.0666 0.0575  -0.0928 603 ILE E N   
4011 C CA  . ILE E 50  ? 1.0341 0.4955 0.2715 -0.0601 0.0558  -0.0820 603 ILE E CA  
4012 C C   . ILE E 50  ? 1.0011 0.4761 0.2459 -0.0380 0.0485  -0.0706 603 ILE E C   
4013 O O   . ILE E 50  ? 1.0520 0.5169 0.2926 -0.0207 0.0403  -0.0679 603 ILE E O   
4014 C CB  . ILE E 50  ? 0.9265 0.4112 0.2111 -0.0585 0.0528  -0.0813 603 ILE E CB  
4015 C CG1 . ILE E 50  ? 0.9193 0.4020 0.2074 -0.0810 0.0616  -0.0913 603 ILE E CG1 
4016 C CG2 . ILE E 50  ? 1.0097 0.5489 0.3577 -0.0478 0.0490  -0.0691 603 ILE E CG2 
4017 C CD1 . ILE E 50  ? 0.9426 0.4571 0.2532 -0.0961 0.0698  -0.0918 603 ILE E CD1 
4018 N N   . LYS E 51  ? 1.0969 0.5949 0.3527 -0.0381 0.0513  -0.0643 604 LYS E N   
4019 C CA  . LYS E 51  ? 1.1118 0.6189 0.3679 -0.0175 0.0457  -0.0536 604 LYS E CA  
4020 C C   . LYS E 51  ? 1.0798 0.6350 0.3991 -0.0040 0.0413  -0.0426 604 LYS E C   
4021 O O   . LYS E 51  ? 0.9921 0.5551 0.3167 0.0152  0.0357  -0.0343 604 LYS E O   
4022 C CB  . LYS E 51  ? 1.1645 0.6704 0.3996 -0.0221 0.0502  -0.0511 604 LYS E CB  
4023 C CG  . LYS E 51  ? 1.2222 0.6793 0.3917 -0.0365 0.0546  -0.0615 604 LYS E CG  
4024 C CD  . LYS E 51  ? 1.2652 0.6725 0.3796 -0.0272 0.0492  -0.0668 604 LYS E CD  
4025 C CE  . LYS E 51  ? 1.4581 0.8157 0.5125 -0.0467 0.0548  -0.0799 604 LYS E CE  
4026 N NZ  . LYS E 51  ? 1.2496 0.5632 0.2648 -0.0420 0.0504  -0.0880 604 LYS E NZ  
4027 N N   . HIS E 52  ? 1.0320 0.6187 0.3978 -0.0142 0.0439  -0.0428 605 HIS E N   
4028 C CA  . HIS E 52  ? 0.9820 0.6148 0.4067 -0.0044 0.0408  -0.0323 605 HIS E CA  
4029 C C   . HIS E 52  ? 0.8912 0.5393 0.3527 -0.0103 0.0391  -0.0351 605 HIS E C   
4030 O O   . HIS E 52  ? 0.8143 0.4893 0.3094 -0.0213 0.0428  -0.0356 605 HIS E O   
4031 C CB  . HIS E 52  ? 0.9608 0.6233 0.4077 -0.0095 0.0459  -0.0272 605 HIS E CB  
4032 C CG  . HIS E 52  ? 1.1183 0.8193 0.6094 0.0052  0.0428  -0.0143 605 HIS E CG  
4033 N ND1 . HIS E 52  ? 1.2642 0.9748 0.7523 0.0135  0.0442  -0.0064 605 HIS E ND1 
4034 C CD2 . HIS E 52  ? 1.1966 0.9273 0.7342 0.0130  0.0387  -0.0079 605 HIS E CD2 
4035 C CE1 . HIS E 52  ? 1.1986 0.9432 0.7296 0.0253  0.0418  0.0040  605 HIS E CE1 
4036 N NE2 . HIS E 52  ? 1.0885 0.8462 0.6503 0.0248  0.0384  0.0033  605 HIS E NE2 
4037 N N   . PRO E 53  ? 0.8702 0.5002 0.3245 -0.0019 0.0327  -0.0370 606 PRO E N   
4038 C CA  . PRO E 53  ? 0.9053 0.5475 0.3928 -0.0058 0.0298  -0.0387 606 PRO E CA  
4039 C C   . PRO E 53  ? 0.8867 0.5784 0.4351 -0.0005 0.0277  -0.0281 606 PRO E C   
4040 O O   . PRO E 53  ? 0.8240 0.5369 0.3884 0.0114  0.0261  -0.0185 606 PRO E O   
4041 C CB  . PRO E 53  ? 0.8375 0.4526 0.3061 0.0074  0.0212  -0.0404 606 PRO E CB  
4042 C CG  . PRO E 53  ? 1.0113 0.6080 0.4445 0.0211  0.0189  -0.0380 606 PRO E CG  
4043 C CD  . PRO E 53  ? 0.9663 0.5623 0.3794 0.0121  0.0270  -0.0381 606 PRO E CD  
4044 N N   . MET E 54  ? 0.8308 0.5388 0.4105 -0.0094 0.0277  -0.0300 607 MET E N   
4045 C CA  . MET E 54  ? 0.7679 0.5196 0.4024 -0.0064 0.0256  -0.0211 607 MET E CA  
4046 C C   . MET E 54  ? 0.7551 0.5107 0.4122 -0.0132 0.0227  -0.0248 607 MET E C   
4047 O O   . MET E 54  ? 0.6941 0.4301 0.3315 -0.0264 0.0270  -0.0349 607 MET E O   
4048 C CB  . MET E 54  ? 0.7149 0.4904 0.3621 -0.0145 0.0324  -0.0196 607 MET E CB  
4049 C CG  . MET E 54  ? 0.6504 0.4690 0.3483 -0.0095 0.0305  -0.0096 607 MET E CG  
4050 S SD  . MET E 54  ? 0.6062 0.4419 0.3279 0.0110  0.0235  0.0039  607 MET E SD  
4051 C CE  . MET E 54  ? 0.6346 0.4512 0.3148 0.0195  0.0270  0.0057  607 MET E CE  
4052 N N   . ASP E 55  ? 0.7012 0.4819 0.3987 -0.0045 0.0159  -0.0165 608 ASP E N   
4053 C CA  . ASP E 55  ? 0.6716 0.4591 0.3946 -0.0087 0.0116  -0.0178 608 ASP E CA  
4054 C C   . ASP E 55  ? 0.6428 0.4725 0.4165 -0.0036 0.0081  -0.0068 608 ASP E C   
4055 O O   . ASP E 55  ? 0.5290 0.3779 0.3142 0.0040  0.0090  0.0011  608 ASP E O   
4056 C CB  . ASP E 55  ? 0.6070 0.3685 0.3164 -0.0002 0.0037  -0.0194 608 ASP E CB  
4057 C CG  . ASP E 55  ? 0.7970 0.5706 0.5208 0.0164  -0.0030 -0.0100 608 ASP E CG  
4058 O OD1 . ASP E 55  ? 0.7342 0.5348 0.4989 0.0213  -0.0088 -0.0021 608 ASP E OD1 
4059 O OD2 . ASP E 55  ? 0.8282 0.5852 0.5227 0.0245  -0.0025 -0.0105 608 ASP E OD2 
4060 N N   . PHE E 56  ? 0.5511 0.3933 0.3525 -0.0077 0.0043  -0.0065 609 PHE E N   
4061 C CA  . PHE E 56  ? 0.5088 0.3881 0.3548 -0.0041 0.0009  0.0032  609 PHE E CA  
4062 C C   . PHE E 56  ? 0.4196 0.3104 0.2850 0.0099  -0.0059 0.0138  609 PHE E C   
4063 O O   . PHE E 56  ? 0.5088 0.4271 0.3991 0.0149  -0.0053 0.0229  609 PHE E O   
4064 C CB  . PHE E 56  ? 0.4661 0.3539 0.3343 -0.0112 -0.0022 0.0011  609 PHE E CB  
4065 C CG  . PHE E 56  ? 0.3830 0.2753 0.2468 -0.0243 0.0048  -0.0071 609 PHE E CG  
4066 C CD1 . PHE E 56  ? 0.5150 0.4276 0.3855 -0.0271 0.0105  -0.0062 609 PHE E CD1 
4067 C CD2 . PHE E 56  ? 0.5202 0.3968 0.3746 -0.0332 0.0054  -0.0160 609 PHE E CD2 
4068 C CE1 . PHE E 56  ? 0.4035 0.3223 0.2723 -0.0388 0.0162  -0.0148 609 PHE E CE1 
4069 C CE2 . PHE E 56  ? 0.4397 0.3231 0.2927 -0.0450 0.0120  -0.0243 609 PHE E CE2 
4070 C CZ  . PHE E 56  ? 0.5365 0.4424 0.3976 -0.0479 0.0172  -0.0240 609 PHE E CZ  
4071 N N   . ALA E 57  ? 0.4344 0.3042 0.2883 0.0164  -0.0124 0.0124  610 ALA E N   
4072 C CA  . ALA E 57  ? 0.4721 0.3530 0.3441 0.0300  -0.0193 0.0211  610 ALA E CA  
4073 C C   . ALA E 57  ? 0.4047 0.2942 0.2685 0.0381  -0.0143 0.0259  610 ALA E C   
4074 O O   . ALA E 57  ? 0.3798 0.2960 0.2717 0.0457  -0.0156 0.0357  610 ALA E O   
4075 C CB  . ALA E 57  ? 0.4028 0.2560 0.2582 0.0362  -0.0272 0.0165  610 ALA E CB  
4076 N N   . THR E 58  ? 0.4456 0.3130 0.2710 0.0356  -0.0081 0.0193  611 THR E N   
4077 C CA  . THR E 58  ? 0.5126 0.3869 0.3277 0.0429  -0.0032 0.0239  611 THR E CA  
4078 C C   . THR E 58  ? 0.5135 0.4191 0.3549 0.0388  0.0024  0.0306  611 THR E C   
4079 O O   . THR E 58  ? 0.4063 0.3338 0.2668 0.0477  0.0030  0.0401  611 THR E O   
4080 C CB  . THR E 58  ? 0.6275 0.4670 0.3912 0.0413  0.0010  0.0153  611 THR E CB  
4081 O OG1 . THR E 58  ? 0.5617 0.3719 0.3018 0.0478  -0.0054 0.0098  611 THR E OG1 
4082 C CG2 . THR E 58  ? 0.5747 0.4199 0.3257 0.0500  0.0056  0.0208  611 THR E CG2 
4083 N N   . MET E 59  ? 0.4095 0.3182 0.2534 0.0258  0.0063  0.0256  612 MET E N   
4084 C CA  . MET E 59  ? 0.3489 0.2868 0.2191 0.0230  0.0099  0.0313  612 MET E CA  
4085 C C   . MET E 59  ? 0.3906 0.3559 0.3017 0.0293  0.0049  0.0417  612 MET E C   
4086 O O   . MET E 59  ? 0.4354 0.4222 0.3639 0.0338  0.0076  0.0498  612 MET E O   
4087 C CB  . MET E 59  ? 0.3642 0.3046 0.2365 0.0090  0.0130  0.0236  612 MET E CB  
4088 C CG  . MET E 59  ? 0.3511 0.2683 0.1860 0.0008  0.0191  0.0136  612 MET E CG  
4089 S SD  . MET E 59  ? 0.5054 0.4310 0.3455 -0.0148 0.0236  0.0043  612 MET E SD  
4090 C CE  . MET E 59  ? 0.4264 0.3875 0.2988 -0.0105 0.0245  0.0131  612 MET E CE  
4091 N N   . ARG E 60  ? 0.4159 0.3791 0.3414 0.0293  -0.0023 0.0414  613 ARG E N   
4092 C CA  . ARG E 60  ? 0.4124 0.4010 0.3769 0.0335  -0.0074 0.0511  613 ARG E CA  
4093 C C   . ARG E 60  ? 0.4157 0.4145 0.3887 0.0463  -0.0083 0.0598  613 ARG E C   
4094 O O   . ARG E 60  ? 0.4405 0.4647 0.4424 0.0498  -0.0081 0.0692  613 ARG E O   
4095 C CB  . ARG E 60  ? 0.3908 0.3741 0.3684 0.0300  -0.0158 0.0489  613 ARG E CB  
4096 C CG  . ARG E 60  ? 0.2339 0.2432 0.2520 0.0327  -0.0217 0.0591  613 ARG E CG  
4097 C CD  . ARG E 60  ? 0.2825 0.2828 0.3103 0.0290  -0.0309 0.0566  613 ARG E CD  
4098 N NE  . ARG E 60  ? 0.3280 0.3179 0.3441 0.0187  -0.0290 0.0481  613 ARG E NE  
4099 C CZ  . ARG E 60  ? 0.2011 0.2077 0.2339 0.0125  -0.0282 0.0493  613 ARG E CZ  
4100 N NH1 . ARG E 60  ? 0.2403 0.2720 0.3003 0.0151  -0.0292 0.0588  613 ARG E NH1 
4101 N NH2 . ARG E 60  ? 0.4968 0.4942 0.5180 0.0038  -0.0262 0.0404  613 ARG E NH2 
4102 N N   . LYS E 61  ? 0.4068 0.3855 0.3540 0.0534  -0.0092 0.0562  614 LYS E N   
4103 C CA  . LYS E 61  ? 0.4711 0.4597 0.4239 0.0668  -0.0096 0.0633  614 LYS E CA  
4104 C C   . LYS E 61  ? 0.4205 0.4239 0.3724 0.0706  -0.0010 0.0697  614 LYS E C   
4105 O O   . LYS E 61  ? 0.3892 0.4156 0.3649 0.0779  0.0000  0.0791  614 LYS E O   
4106 C CB  . LYS E 61  ? 0.4730 0.4328 0.3915 0.0743  -0.0127 0.0563  614 LYS E CB  
4107 C CG  . LYS E 61  ? 0.6778 0.6454 0.5968 0.0894  -0.0133 0.0617  614 LYS E CG  
4108 C CD  . LYS E 61  ? 0.6981 0.6961 0.6612 0.0950  -0.0180 0.0707  614 LYS E CD  
4109 C CE  . LYS E 61  ? 0.9576 0.9613 0.9193 0.1108  -0.0195 0.0736  614 LYS E CE  
4110 N NZ  . LYS E 61  ? 0.8652 0.8348 0.7865 0.1179  -0.0243 0.0637  614 LYS E NZ  
4111 N N   . ARG E 62  ? 0.5109 0.5003 0.4349 0.0652  0.0050  0.0644  615 ARG E N   
4112 C CA  . ARG E 62  ? 0.4780 0.4773 0.3974 0.0687  0.0126  0.0698  615 ARG E CA  
4113 C C   . ARG E 62  ? 0.3598 0.3874 0.3151 0.0649  0.0142  0.0773  615 ARG E C   
4114 O O   . ARG E 62  ? 0.3536 0.3983 0.3219 0.0720  0.0180  0.0862  615 ARG E O   
4115 C CB  . ARG E 62  ? 0.5131 0.4887 0.3924 0.0631  0.0178  0.0617  615 ARG E CB  
4116 C CG  . ARG E 62  ? 0.6742 0.6594 0.5514 0.0615  0.0249  0.0652  615 ARG E CG  
4117 C CD  . ARG E 62  ? 0.8935 0.8593 0.7313 0.0671  0.0298  0.0641  615 ARG E CD  
4118 N NE  . ARG E 62  ? 0.9072 0.8497 0.7112 0.0566  0.0325  0.0541  615 ARG E NE  
4119 C CZ  . ARG E 62  ? 0.6175 0.5597 0.4107 0.0516  0.0374  0.0529  615 ARG E CZ  
4120 N NH1 . ARG E 62  ? 0.5148 0.4770 0.3271 0.0560  0.0402  0.0608  615 ARG E NH1 
4121 N NH2 . ARG E 62  ? 0.4358 0.3560 0.1979 0.0413  0.0394  0.0429  615 ARG E NH2 
4122 N N   . LEU E 63  ? 0.4452 0.4768 0.4154 0.0545  0.0111  0.0737  616 LEU E N   
4123 C CA  . LEU E 63  ? 0.4311 0.4863 0.4317 0.0505  0.0116  0.0796  616 LEU E CA  
4124 C C   . LEU E 63  ? 0.4504 0.5268 0.4814 0.0578  0.0097  0.0906  616 LEU E C   
4125 O O   . LEU E 63  ? 0.4512 0.5437 0.4945 0.0619  0.0144  0.0987  616 LEU E O   
4126 C CB  . LEU E 63  ? 0.4190 0.4728 0.4291 0.0397  0.0068  0.0733  616 LEU E CB  
4127 C CG  . LEU E 63  ? 0.3908 0.4636 0.4262 0.0345  0.0058  0.0764  616 LEU E CG  
4128 C CD1 . LEU E 63  ? 0.4624 0.5436 0.4943 0.0354  0.0123  0.0786  616 LEU E CD1 
4129 C CD2 . LEU E 63  ? 0.3598 0.4243 0.3919 0.0243  0.0021  0.0667  616 LEU E CD2 
4130 N N   . GLU E 64  ? 0.4909 0.5659 0.5324 0.0597  0.0029  0.0906  617 GLU E N   
4131 C CA  . GLU E 64  ? 0.4610 0.5569 0.5337 0.0653  0.0000  0.1001  617 GLU E CA  
4132 C C   . GLU E 64  ? 0.5246 0.6288 0.5954 0.0772  0.0053  0.1066  617 GLU E C   
4133 O O   . GLU E 64  ? 0.5126 0.6387 0.6105 0.0812  0.0060  0.1155  617 GLU E O   
4134 C CB  . GLU E 64  ? 0.4254 0.5157 0.5088 0.0639  -0.0098 0.0973  617 GLU E CB  
4135 C CG  . GLU E 64  ? 0.5660 0.6516 0.6558 0.0523  -0.0147 0.0927  617 GLU E CG  
4136 C CD  . GLU E 64  ? 0.7983 0.8733 0.8941 0.0505  -0.0249 0.0892  617 GLU E CD  
4137 O OE1 . GLU E 64  ? 0.6819 0.7506 0.7752 0.0579  -0.0291 0.0887  617 GLU E OE1 
4138 O OE2 . GLU E 64  ? 0.7770 0.8492 0.8794 0.0424  -0.0292 0.0866  617 GLU E OE2 
4139 N N   . ALA E 65  ? 0.5153 0.6024 0.5535 0.0828  0.0092  0.1022  618 ALA E N   
4140 C CA  . ALA E 65  ? 0.5485 0.6426 0.5808 0.0947  0.0153  0.1083  618 ALA E CA  
4141 C C   . ALA E 65  ? 0.5230 0.6215 0.5483 0.0940  0.0241  0.1126  618 ALA E C   
4142 O O   . ALA E 65  ? 0.6421 0.7400 0.6533 0.1035  0.0299  0.1164  618 ALA E O   
4143 C CB  . ALA E 65  ? 0.5165 0.5879 0.5148 0.1032  0.0139  0.1019  618 ALA E CB  
4144 N N   . GLN E 66  ? 0.5132 0.6160 0.5485 0.0838  0.0244  0.1119  619 GLN E N   
4145 C CA  . GLN E 66  ? 0.5438 0.6493 0.5731 0.0827  0.0312  0.1146  619 GLN E CA  
4146 C C   . GLN E 66  ? 0.5286 0.6138 0.5198 0.0863  0.0357  0.1100  619 GLN E C   
4147 O O   . GLN E 66  ? 0.5953 0.6823 0.5779 0.0931  0.0421  0.1155  619 GLN E O   
4148 C CB  . GLN E 66  ? 0.6020 0.7292 0.6546 0.0891  0.0363  0.1265  619 GLN E CB  
4149 C CG  . GLN E 66  ? 0.7431 0.8897 0.8323 0.0840  0.0322  0.1316  619 GLN E CG  
415