data_3REI
# 
_entry.id   3REI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3REI         
NDB   NA1063       
RCSB  RCSB064831   
WWPDB D_1000064831 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1KX3 .                       unspecified 
PDB 1KX4 .                       unspecified 
PDB 1KX5 .                       unspecified 
PDB 2NZD 'Molrep starting model' unspecified 
PDB 3REH .                       unspecified 
PDB 3REJ .                       unspecified 
PDB 3REK .                       unspecified 
PDB 3REL .                       unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3REI 
_pdbx_database_status.recvd_initial_deposition_date   2011-04-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wu, B.'      1 
'Davey, C.A.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.' 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            39 
_citation.page_first                8200 
_citation.page_last                 8212 
_citation.year                      2011 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21724603 
_citation.pdbx_database_id_DOI      10.1093/nar/gkr491 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wu, B.'        1 
primary 'Davey, G.E.'   2 
primary 'Nazarov, A.A.' 3 
primary 'Dyson, P.J.'   4 
primary 'Davey, C.A.'   5 
# 
_cell.entry_id           3REI 
_cell.length_a           105.877 
_cell.length_b           109.904 
_cell.length_c           181.701 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3REI 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone H3.2'       15303.930 2  ? ? ? ? 
2 polymer     man 'Histone H4'         11263.231 2  ? ? ? ? 
3 polymer     man 'Histone H2A type1'  13978.241 2  ? ? ? ? 
4 polymer     man 'Histone H2B 1.1'    13524.752 2  ? ? ? ? 
5 polymer     syn 'DNA (145-MER)'      44749.664 1  ? ? ? ? 
6 polymer     syn 'DNA (145-MER)'      44740.648 1  ? ? ? ? 
7 non-polymer syn 'PLATINUM (II) ION'  195.078   49 ? ? ? ? 
8 non-polymer syn 'SULFATE ION'        96.063    3  ? ? ? ? 
9 non-polymer syn 'MANGANESE (II) ION' 54.938    2  ? ? ? ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        H2B1.1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
C,G ? 
4 'polypeptide(L)'        no no 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DA)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGAATCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DA)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)
(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DG)
(DG)(DT)(DA)(DG)(DT)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)(DA)
(DT)(DT)(DG)(DA)(DT)
;
;ATCAATATCCACCTGCAGATACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGATTCAGCTG
AACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTATCTGCAGGTGGATATTGAT
;
J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   THR n 
1 4   LYS n 
1 5   GLN n 
1 6   THR n 
1 7   ALA n 
1 8   ARG n 
1 9   LYS n 
1 10  SER n 
1 11  THR n 
1 12  GLY n 
1 13  GLY n 
1 14  LYS n 
1 15  ALA n 
1 16  PRO n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  LEU n 
1 21  ALA n 
1 22  THR n 
1 23  LYS n 
1 24  ALA n 
1 25  ALA n 
1 26  ARG n 
1 27  LYS n 
1 28  SER n 
1 29  ALA n 
1 30  PRO n 
1 31  ALA n 
1 32  THR n 
1 33  GLY n 
1 34  GLY n 
1 35  VAL n 
1 36  LYS n 
1 37  LYS n 
1 38  PRO n 
1 39  HIS n 
1 40  ARG n 
1 41  TYR n 
1 42  ARG n 
1 43  PRO n 
1 44  GLY n 
1 45  THR n 
1 46  VAL n 
1 47  ALA n 
1 48  LEU n 
1 49  ARG n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  ARG n 
1 54  TYR n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  GLU n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  GLN n 
1 69  ARG n 
1 70  LEU n 
1 71  VAL n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  ALA n 
1 76  GLN n 
1 77  ASP n 
1 78  PHE n 
1 79  LYS n 
1 80  THR n 
1 81  ASP n 
1 82  LEU n 
1 83  ARG n 
1 84  PHE n 
1 85  GLN n 
1 86  SER n 
1 87  SER n 
1 88  ALA n 
1 89  VAL n 
1 90  MET n 
1 91  ALA n 
1 92  LEU n 
1 93  GLN n 
1 94  GLU n 
1 95  ALA n 
1 96  SER n 
1 97  GLU n 
1 98  ALA n 
1 99  TYR n 
1 100 LEU n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 PHE n 
1 105 GLU n 
1 106 ASP n 
1 107 THR n 
1 108 ASN n 
1 109 LEU n 
1 110 CYS n 
1 111 ALA n 
1 112 ILE n 
1 113 HIS n 
1 114 ALA n 
1 115 LYS n 
1 116 ARG n 
1 117 VAL n 
1 118 THR n 
1 119 ILE n 
1 120 MET n 
1 121 PRO n 
1 122 LYS n 
1 123 ASP n 
1 124 ILE n 
1 125 GLN n 
1 126 LEU n 
1 127 ALA n 
1 128 ARG n 
1 129 ARG n 
1 130 ILE n 
1 131 ARG n 
1 132 GLY n 
1 133 GLU n 
1 134 ARG n 
1 135 ALA n 
2 1   SER n 
2 2   GLY n 
2 3   ARG n 
2 4   GLY n 
2 5   LYS n 
2 6   GLY n 
2 7   GLY n 
2 8   LYS n 
2 9   GLY n 
2 10  LEU n 
2 11  GLY n 
2 12  LYS n 
2 13  GLY n 
2 14  GLY n 
2 15  ALA n 
2 16  LYS n 
2 17  ARG n 
2 18  HIS n 
2 19  ARG n 
2 20  LYS n 
2 21  VAL n 
2 22  LEU n 
2 23  ARG n 
2 24  ASP n 
2 25  ASN n 
2 26  ILE n 
2 27  GLN n 
2 28  GLY n 
2 29  ILE n 
2 30  THR n 
2 31  LYS n 
2 32  PRO n 
2 33  ALA n 
2 34  ILE n 
2 35  ARG n 
2 36  ARG n 
2 37  LEU n 
2 38  ALA n 
2 39  ARG n 
2 40  ARG n 
2 41  GLY n 
2 42  GLY n 
2 43  VAL n 
2 44  LYS n 
2 45  ARG n 
2 46  ILE n 
2 47  SER n 
2 48  GLY n 
2 49  LEU n 
2 50  ILE n 
2 51  TYR n 
2 52  GLU n 
2 53  GLU n 
2 54  THR n 
2 55  ARG n 
2 56  GLY n 
2 57  VAL n 
2 58  LEU n 
2 59  LYS n 
2 60  VAL n 
2 61  PHE n 
2 62  LEU n 
2 63  GLU n 
2 64  ASN n 
2 65  VAL n 
2 66  ILE n 
2 67  ARG n 
2 68  ASP n 
2 69  ALA n 
2 70  VAL n 
2 71  THR n 
2 72  TYR n 
2 73  THR n 
2 74  GLU n 
2 75  HIS n 
2 76  ALA n 
2 77  LYS n 
2 78  ARG n 
2 79  LYS n 
2 80  THR n 
2 81  VAL n 
2 82  THR n 
2 83  ALA n 
2 84  MET n 
2 85  ASP n 
2 86  VAL n 
2 87  VAL n 
2 88  TYR n 
2 89  ALA n 
2 90  LEU n 
2 91  LYS n 
2 92  ARG n 
2 93  GLN n 
2 94  GLY n 
2 95  ARG n 
2 96  THR n 
2 97  LEU n 
2 98  TYR n 
2 99  GLY n 
2 100 PHE n 
2 101 GLY n 
2 102 GLY n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLN n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  THR n 
3 11  ARG n 
3 12  ALA n 
3 13  LYS n 
3 14  ALA n 
3 15  LYS n 
3 16  THR n 
3 17  ARG n 
3 18  SER n 
3 19  SER n 
3 20  ARG n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  GLN n 
3 25  PHE n 
3 26  PRO n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  VAL n 
3 31  HIS n 
3 32  ARG n 
3 33  LEU n 
3 34  LEU n 
3 35  ARG n 
3 36  LYS n 
3 37  GLY n 
3 38  ASN n 
3 39  TYR n 
3 40  ALA n 
3 41  GLU n 
3 42  ARG n 
3 43  VAL n 
3 44  GLY n 
3 45  ALA n 
3 46  GLY n 
3 47  ALA n 
3 48  PRO n 
3 49  VAL n 
3 50  TYR n 
3 51  LEU n 
3 52  ALA n 
3 53  ALA n 
3 54  VAL n 
3 55  LEU n 
3 56  GLU n 
3 57  TYR n 
3 58  LEU n 
3 59  THR n 
3 60  ALA n 
3 61  GLU n 
3 62  ILE n 
3 63  LEU n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  GLY n 
3 68  ASN n 
3 69  ALA n 
3 70  ALA n 
3 71  ARG n 
3 72  ASP n 
3 73  ASN n 
3 74  LYS n 
3 75  LYS n 
3 76  THR n 
3 77  ARG n 
3 78  ILE n 
3 79  ILE n 
3 80  PRO n 
3 81  ARG n 
3 82  HIS n 
3 83  LEU n 
3 84  GLN n 
3 85  LEU n 
3 86  ALA n 
3 87  VAL n 
3 88  ARG n 
3 89  ASN n 
3 90  ASP n 
3 91  GLU n 
3 92  GLU n 
3 93  LEU n 
3 94  ASN n 
3 95  LYS n 
3 96  LEU n 
3 97  LEU n 
3 98  GLY n 
3 99  ARG n 
3 100 VAL n 
3 101 THR n 
3 102 ILE n 
3 103 ALA n 
3 104 GLN n 
3 105 GLY n 
3 106 GLY n 
3 107 VAL n 
3 108 LEU n 
3 109 PRO n 
3 110 ASN n 
3 111 ILE n 
3 112 GLN n 
3 113 SER n 
3 114 VAL n 
3 115 LEU n 
3 116 LEU n 
3 117 PRO n 
3 118 LYS n 
3 119 LYS n 
3 120 THR n 
3 121 GLU n 
3 122 SER n 
3 123 SER n 
3 124 LYS n 
3 125 SER n 
3 126 ALA n 
3 127 LYS n 
3 128 SER n 
3 129 LYS n 
4 1   ALA n 
4 2   LYS n 
4 3   SER n 
4 4   ALA n 
4 5   PRO n 
4 6   ALA n 
4 7   PRO n 
4 8   LYS n 
4 9   LYS n 
4 10  GLY n 
4 11  SER n 
4 12  LYS n 
4 13  LYS n 
4 14  ALA n 
4 15  VAL n 
4 16  THR n 
4 17  LYS n 
4 18  THR n 
4 19  GLN n 
4 20  LYS n 
4 21  LYS n 
4 22  ASP n 
4 23  GLY n 
4 24  LYS n 
4 25  LYS n 
4 26  ARG n 
4 27  ARG n 
4 28  LYS n 
4 29  THR n 
4 30  ARG n 
4 31  LYS n 
4 32  GLU n 
4 33  SER n 
4 34  TYR n 
4 35  ALA n 
4 36  ILE n 
4 37  TYR n 
4 38  VAL n 
4 39  TYR n 
4 40  LYS n 
4 41  VAL n 
4 42  LEU n 
4 43  LYS n 
4 44  GLN n 
4 45  VAL n 
4 46  HIS n 
4 47  PRO n 
4 48  ASP n 
4 49  THR n 
4 50  GLY n 
4 51  ILE n 
4 52  SER n 
4 53  SER n 
4 54  LYS n 
4 55  ALA n 
4 56  MET n 
4 57  SER n 
4 58  ILE n 
4 59  MET n 
4 60  ASN n 
4 61  SER n 
4 62  PHE n 
4 63  VAL n 
4 64  ASN n 
4 65  ASP n 
4 66  VAL n 
4 67  PHE n 
4 68  GLU n 
4 69  ARG n 
4 70  ILE n 
4 71  ALA n 
4 72  GLY n 
4 73  GLU n 
4 74  ALA n 
4 75  SER n 
4 76  ARG n 
4 77  LEU n 
4 78  ALA n 
4 79  HIS n 
4 80  TYR n 
4 81  ASN n 
4 82  LYS n 
4 83  ARG n 
4 84  SER n 
4 85  THR n 
4 86  ILE n 
4 87  THR n 
4 88  SER n 
4 89  ARG n 
4 90  GLU n 
4 91  ILE n 
4 92  GLN n 
4 93  THR n 
4 94  ALA n 
4 95  VAL n 
4 96  ARG n 
4 97  LEU n 
4 98  LEU n 
4 99  LEU n 
4 100 PRO n 
4 101 GLY n 
4 102 GLU n 
4 103 LEU n 
4 104 ALA n 
4 105 LYS n 
4 106 HIS n 
4 107 ALA n 
4 108 VAL n 
4 109 SER n 
4 110 GLU n 
4 111 GLY n 
4 112 THR n 
4 113 LYS n 
4 114 ALA n 
4 115 VAL n 
4 116 THR n 
4 117 LYS n 
4 118 TYR n 
4 119 THR n 
4 120 SER n 
4 121 ALA n 
4 122 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DA  n 
5 5   DA  n 
5 6   DT  n 
5 7   DA  n 
5 8   DT  n 
5 9   DC  n 
5 10  DC  n 
5 11  DA  n 
5 12  DC  n 
5 13  DC  n 
5 14  DT  n 
5 15  DG  n 
5 16  DC  n 
5 17  DA  n 
5 18  DG  n 
5 19  DA  n 
5 20  DT  n 
5 21  DA  n 
5 22  DC  n 
5 23  DT  n 
5 24  DA  n 
5 25  DC  n 
5 26  DC  n 
5 27  DA  n 
5 28  DA  n 
5 29  DA  n 
5 30  DA  n 
5 31  DG  n 
5 32  DT  n 
5 33  DG  n 
5 34  DT  n 
5 35  DA  n 
5 36  DT  n 
5 37  DT  n 
5 38  DT  n 
5 39  DG  n 
5 40  DG  n 
5 41  DA  n 
5 42  DA  n 
5 43  DA  n 
5 44  DC  n 
5 45  DT  n 
5 46  DG  n 
5 47  DC  n 
5 48  DT  n 
5 49  DC  n 
5 50  DC  n 
5 51  DA  n 
5 52  DT  n 
5 53  DC  n 
5 54  DA  n 
5 55  DA  n 
5 56  DA  n 
5 57  DA  n 
5 58  DG  n 
5 59  DG  n 
5 60  DC  n 
5 61  DA  n 
5 62  DT  n 
5 63  DG  n 
5 64  DT  n 
5 65  DT  n 
5 66  DC  n 
5 67  DA  n 
5 68  DG  n 
5 69  DC  n 
5 70  DT  n 
5 71  DG  n 
5 72  DA  n 
5 73  DA  n 
5 74  DT  n 
5 75  DC  n 
5 76  DA  n 
5 77  DG  n 
5 78  DC  n 
5 79  DT  n 
5 80  DG  n 
5 81  DA  n 
5 82  DA  n 
5 83  DC  n 
5 84  DA  n 
5 85  DT  n 
5 86  DG  n 
5 87  DC  n 
5 88  DC  n 
5 89  DT  n 
5 90  DT  n 
5 91  DT  n 
5 92  DT  n 
5 93  DG  n 
5 94  DA  n 
5 95  DT  n 
5 96  DG  n 
5 97  DG  n 
5 98  DA  n 
5 99  DG  n 
5 100 DC  n 
5 101 DA  n 
5 102 DG  n 
5 103 DT  n 
5 104 DT  n 
5 105 DT  n 
5 106 DC  n 
5 107 DC  n 
5 108 DA  n 
5 109 DA  n 
5 110 DA  n 
5 111 DT  n 
5 112 DA  n 
5 113 DC  n 
5 114 DA  n 
5 115 DC  n 
5 116 DT  n 
5 117 DT  n 
5 118 DT  n 
5 119 DT  n 
5 120 DG  n 
5 121 DG  n 
5 122 DT  n 
5 123 DA  n 
5 124 DG  n 
5 125 DT  n 
5 126 DA  n 
5 127 DT  n 
5 128 DC  n 
5 129 DT  n 
5 130 DG  n 
5 131 DC  n 
5 132 DA  n 
5 133 DG  n 
5 134 DG  n 
5 135 DT  n 
5 136 DG  n 
5 137 DG  n 
5 138 DA  n 
5 139 DT  n 
5 140 DA  n 
5 141 DT  n 
5 142 DT  n 
5 143 DG  n 
5 144 DA  n 
5 145 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DA  n 
6 5   DA  n 
6 6   DT  n 
6 7   DA  n 
6 8   DT  n 
6 9   DC  n 
6 10  DC  n 
6 11  DA  n 
6 12  DC  n 
6 13  DC  n 
6 14  DT  n 
6 15  DG  n 
6 16  DC  n 
6 17  DA  n 
6 18  DG  n 
6 19  DA  n 
6 20  DT  n 
6 21  DA  n 
6 22  DC  n 
6 23  DT  n 
6 24  DA  n 
6 25  DC  n 
6 26  DC  n 
6 27  DA  n 
6 28  DA  n 
6 29  DA  n 
6 30  DA  n 
6 31  DG  n 
6 32  DT  n 
6 33  DG  n 
6 34  DT  n 
6 35  DA  n 
6 36  DT  n 
6 37  DT  n 
6 38  DT  n 
6 39  DG  n 
6 40  DG  n 
6 41  DA  n 
6 42  DA  n 
6 43  DA  n 
6 44  DC  n 
6 45  DT  n 
6 46  DG  n 
6 47  DC  n 
6 48  DT  n 
6 49  DC  n 
6 50  DC  n 
6 51  DA  n 
6 52  DT  n 
6 53  DC  n 
6 54  DA  n 
6 55  DA  n 
6 56  DA  n 
6 57  DA  n 
6 58  DG  n 
6 59  DG  n 
6 60  DC  n 
6 61  DA  n 
6 62  DT  n 
6 63  DG  n 
6 64  DT  n 
6 65  DT  n 
6 66  DC  n 
6 67  DA  n 
6 68  DG  n 
6 69  DC  n 
6 70  DT  n 
6 71  DG  n 
6 72  DA  n 
6 73  DT  n 
6 74  DT  n 
6 75  DC  n 
6 76  DA  n 
6 77  DG  n 
6 78  DC  n 
6 79  DT  n 
6 80  DG  n 
6 81  DA  n 
6 82  DA  n 
6 83  DC  n 
6 84  DA  n 
6 85  DT  n 
6 86  DG  n 
6 87  DC  n 
6 88  DC  n 
6 89  DT  n 
6 90  DT  n 
6 91  DT  n 
6 92  DT  n 
6 93  DG  n 
6 94  DA  n 
6 95  DT  n 
6 96  DG  n 
6 97  DG  n 
6 98  DA  n 
6 99  DG  n 
6 100 DC  n 
6 101 DA  n 
6 102 DG  n 
6 103 DT  n 
6 104 DT  n 
6 105 DT  n 
6 106 DC  n 
6 107 DC  n 
6 108 DA  n 
6 109 DA  n 
6 110 DA  n 
6 111 DT  n 
6 112 DA  n 
6 113 DC  n 
6 114 DA  n 
6 115 DC  n 
6 116 DT  n 
6 117 DT  n 
6 118 DT  n 
6 119 DT  n 
6 120 DG  n 
6 121 DG  n 
6 122 DT  n 
6 123 DA  n 
6 124 DG  n 
6 125 DT  n 
6 126 DA  n 
6 127 DT  n 
6 128 DC  n 
6 129 DT  n 
6 130 DG  n 
6 131 DC  n 
6 132 DA  n 
6 133 DG  n 
6 134 DG  n 
6 135 DT  n 
6 136 DG  n 
6 137 DG  n 
6 138 DA  n 
6 139 DT  n 
6 140 DA  n 
6 141 DT  n 
6 142 DT  n 
6 143 DG  n 
6 144 DA  n 
6 145 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample ? ? 'Homo sapiens' ? 9606 ? 
6 1 sample ? ? 'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP H32_XENLA   P84233 1 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2 ? 
2 UNP H4_XENLA    P62799 2 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2 ? 
3 UNP H2A1_XENLA  P06897 3 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
2 ? 
4 UNP H2B11_XENLA P02281 4 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
5 ? 
5 PDB 3REI        3REI   5 ? ? ? 
6 PDB 3REI        3REI   6 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3REI A 1 ? 135 ? P84233 2   ? 136 ? 1   135 
2  2 3REI B 1 ? 102 ? P62799 2   ? 103 ? 1   102 
3  3 3REI C 1 ? 129 ? P06897 2   ? 130 ? 1   129 
4  4 3REI D 1 ? 122 ? P02281 5   ? 126 ? 1   122 
5  1 3REI E 1 ? 135 ? P84233 2   ? 136 ? 1   135 
6  2 3REI F 1 ? 102 ? P62799 2   ? 103 ? 1   102 
7  3 3REI G 1 ? 129 ? P06897 2   ? 130 ? 1   129 
8  4 3REI H 1 ? 122 ? P02281 5   ? 126 ? 1   122 
9  5 3REI I 1 ? 145 ? 3REI   -72 ? 72  ? -72 72  
10 6 3REI J 1 ? 145 ? 3REI   -72 ? 72  ? -72 72  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3REI ALA A 102 ? UNP P84233 GLY 103 VARIANT 102 1 
3 3REI ARG C 99  ? UNP P06897 GLY 100 VARIANT 99  2 
3 3REI SER C 123 ? UNP P06897 ALA 124 VARIANT 123 3 
4 3REI THR D 29  ? UNP P02281 SER 33  VARIANT 29  4 
5 3REI ALA E 102 ? UNP P84233 GLY 103 VARIANT 102 5 
7 3REI ARG G 99  ? UNP P06897 GLY 100 VARIANT 99  6 
7 3REI SER G 123 ? UNP P06897 ALA 124 VARIANT 123 7 
8 3REI THR H 29  ? UNP P02281 SER 33  VARIANT 29  8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
PT  non-polymer         . 'PLATINUM (II) ION'                  ? 'Pt 2'            195.078 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                        ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3REI 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.66 
_exptl_crystal.density_percent_sol   53.78 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.07 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.07 
# 
_reflns.entry_id                     3REI 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             58 
_reflns.d_resolution_high            2.65 
_reflns.number_obs                   53670 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         88.4 
_reflns.pdbx_Rmerge_I_obs            0.048 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        26.0 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.3 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 3REI 
_refine.ls_number_reflns_obs                     53670 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             58 
_refine.ls_d_res_high                            2.65 
_refine.ls_percent_reflns_obs                    87.96 
_refine.ls_R_factor_obs                          0.26014 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.25980 
_refine.ls_R_factor_R_free                       0.27581 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.1 
_refine.ls_number_reflns_R_free                  1124 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.909 
_refine.correlation_coeff_Fo_to_Fc_free          0.908 
_refine.B_iso_mean                               95.354 
_refine.aniso_B[1][1]                            1.71 
_refine.aniso_B[2][2]                            -3.61 
_refine.aniso_B[3][3]                            1.90 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      2NZD 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.364 
_refine.overall_SU_ML                            0.274 
_refine.overall_SU_B                             12.721 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6086 
_refine_hist.pdbx_number_atoms_nucleic_acid   5939 
_refine_hist.pdbx_number_atoms_ligand         66 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               12091 
_refine_hist.d_res_high                       2.65 
_refine_hist.d_res_low                        58 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.010  0.021  ? 12841 ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.480  2.543  ? 18584 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       5.170  5.000  ? 757   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       32.598 21.255 ? 271   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       17.317 15.000 ? 1183  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       21.274 15.000 ? 86    ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.077  0.200  ? 2113  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.004  0.020  ? 7555  ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_refined                0.207  0.200  ? 4943  ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              0.306  0.200  ? 8054  ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        0.151  0.200  ? 332   ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       0.171  0.200  ? 28    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     0.357  0.200  ? 1     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  0.814  1.500  ? 3865  ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 1.431  2.000  ? 6110  ? 'X-RAY DIFFRACTION' 
r_scbond_it                  1.330  3.000  ? 12092 ? 'X-RAY DIFFRACTION' 
r_scangle_it                 2.355  4.500  ? 12474 ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.650 
_refine_ls_shell.d_res_low                        2.719 
_refine_ls_shell.number_reflns_R_work             2304 
_refine_ls_shell.R_factor_R_work                  0.298 
_refine_ls_shell.percent_reflns_obs               51.67 
_refine_ls_shell.R_factor_R_free                  0.396 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             47 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3REI 
_struct.title                     
;2.65 Angstrom Crystal Structure of the Nucleosome Core Particle Assembled with a 145 bp Alpha-Satellite DNA (NCP145) Derivatized with Triamminechloroplatinum(II) Chloride
;
_struct.pdbx_descriptor           'Histone H3.2, Histone H4, Histone H2A type1, Histone H2B 1.1/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3REI 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
_struct_keywords.text            'nucleosome, STRUCTURAL PROTEIN-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 4 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 3 ? 
H  N N 4 ? 
I  N N 5 ? 
J  N N 6 ? 
K  N N 7 ? 
L  N N 7 ? 
M  N N 7 ? 
N  N N 7 ? 
O  N N 8 ? 
P  N N 9 ? 
Q  N N 7 ? 
R  N N 7 ? 
S  N N 7 ? 
T  N N 9 ? 
U  N N 8 ? 
V  N N 8 ? 
W  N N 7 ? 
X  N N 7 ? 
Y  N N 7 ? 
Z  N N 7 ? 
AA N N 7 ? 
BA N N 7 ? 
CA N N 7 ? 
DA N N 7 ? 
EA N N 7 ? 
FA N N 7 ? 
GA N N 7 ? 
HA N N 7 ? 
IA N N 7 ? 
JA N N 7 ? 
KA N N 7 ? 
LA N N 7 ? 
MA N N 7 ? 
NA N N 7 ? 
OA N N 7 ? 
PA N N 7 ? 
QA N N 7 ? 
RA N N 7 ? 
SA N N 7 ? 
TA N N 7 ? 
UA N N 7 ? 
VA N N 7 ? 
WA N N 7 ? 
XA N N 7 ? 
YA N N 7 ? 
ZA N N 7 ? 
AB N N 7 ? 
BB N N 7 ? 
CB N N 7 ? 
DB N N 7 ? 
EB N N 7 ? 
FB N N 7 ? 
GB N N 7 ? 
HB N N 7 ? 
IB N N 7 ? 
JB N N 7 ? 
KB N N 7 ? 
LB N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 44  ? SER A 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  2  ARG A 63  ? ASP A 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  3  GLN A 85  ? ALA A 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  4  MET A 120 ? ARG A 131 ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  5  ASN B 25  ? ILE B 29  ? ASN B 25  ILE B 29  5 ? 5  
HELX_P HELX_P6  6  THR B 30  ? GLY B 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  7  LEU B 49  ? ALA B 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  8  THR B 82  ? GLN B 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  9  THR C 16  ? GLY C 22  ? THR C 16  GLY C 22  1 ? 7  
HELX_P HELX_P10 10 PRO C 26  ? GLY C 37  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 11 GLY C 46  ? ASN C 73  ? GLY C 46  ASN C 73  1 ? 28 
HELX_P HELX_P12 12 ILE C 79  ? ASP C 90  ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P13 13 ASP C 90  ? LEU C 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 14 GLN C 112 ? LEU C 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 15 TYR D 34  ? HIS D 46  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 16 SER D 52  ? ASN D 81  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 17 THR D 87  ? LEU D 99  ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 18 PRO D 100 ? SER D 120 ? PRO D 100 SER D 120 1 ? 21 
HELX_P HELX_P19 19 GLY E 44  ? SER E 57  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 20 ARG E 63  ? ASP E 77  ? ARG E 63  ASP E 77  1 ? 15 
HELX_P HELX_P21 21 GLN E 85  ? ALA E 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 22 MET E 120 ? ARG E 131 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P23 23 ASP F 24  ? ILE F 29  ? ASP F 24  ILE F 29  5 ? 6  
HELX_P HELX_P24 24 THR F 30  ? GLY F 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 25 LEU F 49  ? ALA F 76  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P26 26 THR F 82  ? GLN F 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 27 THR G 16  ? GLY G 22  ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P28 28 PRO G 26  ? GLY G 37  ? PRO G 26  GLY G 37  1 ? 12 
HELX_P HELX_P29 29 GLY G 46  ? ASN G 73  ? GLY G 46  ASN G 73  1 ? 28 
HELX_P HELX_P30 30 ILE G 79  ? ASN G 89  ? ILE G 79  ASN G 89  1 ? 11 
HELX_P HELX_P31 31 ASP G 90  ? LEU G 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 32 GLN G 112 ? LEU G 116 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 33 TYR H 34  ? HIS H 46  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 34 SER H 52  ? ASN H 81  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 35 THR H 87  ? LEU H 99  ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 36 PRO H 100 ? SER H 120 ? PRO H 100 SER H 120 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? I DG  40  N7  ? ? ? 1_555 AA PT .   PT ? ? I DG  -33 I PT 77   1_555 ? ? ? ? ? ? ?               1.878 ? 
metalc2   metalc ? ? I DG  120 N7  ? ? ? 1_555 JA PT .   PT ? ? I DG  47  I PT 86   1_555 ? ? ? ? ? ? ?               1.882 ? 
metalc3   metalc ? ? J DG  133 O6  ? ? ? 1_555 PA PT .   PT ? ? J DG  60  J PT 73   1_555 ? ? ? ? ? ? ?               1.907 ? 
metalc4   metalc ? ? I DG  133 N7  ? ? ? 1_555 W  PT .   PT ? ? I DG  60  I PT 73   1_555 ? ? ? ? ? ? ?               1.986 ? 
metalc5   metalc ? ? J DG  80  N7  ? ? ? 1_555 QA PT .   PT ? ? J DG  7   J PT 74   1_555 ? ? ? ? ? ? ?               2.014 ? 
metalc6   metalc ? ? J DG  99  N7  ? ? ? 1_555 BB PT .   PT ? ? J DG  26  J PT 85   1_555 ? ? ? ? ? ? ?               2.021 ? 
metalc7   metalc ? ? J DG  97  N7  ? ? ? 1_555 YA PT .   PT ? ? J DG  24  J PT 82   1_555 ? ? ? ? ? ? ?               2.053 ? 
metalc8   metalc ? ? I DG  80  N7  ? ? ? 1_555 X  PT .   PT ? ? I DG  7   I PT 74   1_555 ? ? ? ? ? ? ?               2.072 ? 
metalc9   metalc ? ? I DG  39  N7  ? ? ? 1_555 Z  PT .   PT ? ? I DG  -34 I PT 76   1_555 ? ? ? ? ? ? ?               2.073 ? 
metalc10  metalc ? ? J DG  77  N7  ? ? ? 1_555 VA PT .   PT ? ? J DG  4   J PT 79   1_555 ? ? ? ? ? ? ?               2.078 ? 
metalc11  metalc ? ? J DG  120 N7  ? ? ? 1_555 TA PT .   PT ? ? J DG  47  J PT 77   1_555 ? ? ? ? ? ? ?               2.096 ? 
metalc12  metalc ? ? E ASP 77  OD1 ? ? ? 1_555 P  MN .   MN ? ? E ASP 77  E MN 1001 1_555 ? ? ? ? ? ? ?               2.107 ? 
metalc13  metalc ? ? E MET 120 SD  ? ? ? 1_555 Q  PT .   PT ? ? E MET 120 E PT 136  1_555 ? ? ? ? ? ? ?               2.121 ? 
metalc14  metalc ? ? J DG  133 N7  ? ? ? 1_555 PA PT .   PT ? ? J DG  60  J PT 73   1_555 ? ? ? ? ? ? ?               2.148 ? 
metalc15  metalc ? ? J DG  86  O6  ? ? ? 1_555 ZA PT .   PT ? ? J DG  13  J PT 83   1_555 ? ? ? ? ? ? ?               2.164 ? 
metalc16  metalc ? ? I DG  96  N9  ? ? ? 1_555 IA PT .   PT ? ? I DG  23  I PT 85   1_555 ? ? ? ? ? ? ?               2.167 ? 
metalc17  metalc ? ? I DG  58  N7  ? ? ? 1_555 FA PT .   PT ? ? I DG  -15 I PT 82   1_555 ? ? ? ? ? ? ?               2.188 ? 
metalc18  metalc ? ? I DG  133 O6  ? ? ? 1_555 W  PT .   PT ? ? I DG  60  I PT 73   1_555 ? ? ? ? ? ? ?               2.264 ? 
metalc19  metalc ? ? J DG  68  N7  ? ? ? 1_555 UA PT .   PT ? ? J DG  -5  J PT 78   1_555 ? ? ? ? ? ? ?               2.266 ? 
metalc20  metalc ? ? I DG  68  N7  ? ? ? 1_555 GA PT .   PT ? ? I DG  -5  I PT 83   1_555 ? ? ? ? ? ? ?               2.280 ? 
metalc21  metalc ? ? I DG  136 N7  ? ? ? 1_555 CA PT .   PT ? ? I DG  63  I PT 79   1_555 ? ? ? ? ? ? ?               2.320 ? 
metalc22  metalc ? ? I DG  31  N7  ? ? ? 1_555 NA PT .   PT ? ? I DG  -42 I PT 90   1_555 ? ? ? ? ? ? ?               2.324 ? 
metalc23  metalc ? ? J DG  136 N7  ? ? ? 1_555 LB PT .   PT ? ? J DG  63  J PT 133  1_555 ? ? ? ? ? ? ?               2.346 ? 
metalc24  metalc ? ? I DG  137 N7  ? ? ? 1_555 HA PT .   PT ? ? I DG  64  I PT 84   1_555 ? ? ? ? ? ? ?               2.376 ? 
metalc25  metalc ? ? J DG  137 N7  ? ? ? 1_555 AB PT .   PT ? ? J DG  64  J PT 84   1_555 ? ? ? ? ? ? ?               2.381 ? 
metalc26  metalc ? ? J DG  137 O6  ? ? ? 1_555 AB PT .   PT ? ? J DG  64  J PT 84   1_555 ? ? ? ? ? ? ?               2.390 ? 
metalc27  metalc ? ? E MET 90  SD  ? ? ? 1_555 R  PT .   PT ? ? E MET 90  E PT 137  1_555 ? ? ? ? ? ? ?               2.391 ? 
metalc28  metalc ? ? J DA  1   N7  ? ? ? 1_555 KB PT .   PT ? ? J DA  -72 J PT 128  1_555 ? ? ? ? ? ? ?               2.421 ? 
metalc29  metalc ? ? J DG  136 N7  ? ? ? 1_555 AB PT .   PT ? ? J DG  63  J PT 84   1_555 ? ? ? ? ? ? ?               2.446 ? 
metalc30  metalc ? ? I DG  77  N7  ? ? ? 1_555 DA PT .   PT ? ? I DG  4   I PT 80   1_555 ? ? ? ? ? ? ?               2.455 ? 
metalc31  metalc ? ? J DG  59  N7  ? ? ? 1_555 JB PT .   PT ? ? J DG  -14 J PT 93   1_555 ? ? ? ? ? ? ?               2.457 ? 
metalc32  metalc ? ? A MET 120 SD  ? ? ? 1_555 L  PT .   PT ? ? A MET 120 A PT 137  1_555 ? ? ? ? ? ? ?               2.495 ? 
metalc33  metalc ? ? I DG  18  O6  ? ? ? 1_555 Y  PT .   PT ? ? I DG  -55 I PT 75   1_555 ? ? ? ? ? ? ?               2.517 ? 
metalc34  metalc ? ? J DG  136 O6  ? ? ? 1_555 LB PT .   PT ? ? J DG  63  J PT 133  1_555 ? ? ? ? ? ? ?               2.542 ? 
metalc35  metalc ? ? I DG  99  N7  ? ? ? 1_555 OA PT .   PT ? ? I DG  26  I PT 91   1_555 ? ? ? ? ? ? ?               2.555 ? 
metalc36  metalc ? ? I DA  101 N7  ? ? ? 1_555 EA PT .   PT ? ? I DA  28  I PT 81   1_555 ? ? ? ? ? ? ?               2.559 ? 
metalc37  metalc ? ? I DG  58  O6  ? ? ? 1_555 FA PT .   PT ? ? I DG  -15 I PT 82   1_555 ? ? ? ? ? ? ?               2.563 ? 
metalc38  metalc ? ? I DG  137 O6  ? ? ? 1_555 HA PT .   PT ? ? I DG  64  I PT 84   1_555 ? ? ? ? ? ? ?               2.630 ? 
metalc39  metalc ? ? F MET 84  SD  ? ? ? 1_555 S  PT .   PT ? ? F MET 84  F PT 103  1_555 ? ? ? ? ? ? ?               2.662 ? 
metalc40  metalc ? ? J DA  123 N7  ? ? ? 1_555 GB PT .   PT ? ? J DA  50  J PT 90   1_555 ? ? ? ? ? ? ?               2.666 ? 
metalc41  metalc ? ? J DG  97  O6  ? ? ? 1_555 YA PT .   PT ? ? J DG  24  J PT 82   1_555 ? ? ? ? ? ? ?               2.715 ? 
metalc42  metalc ? ? I DG  120 O6  ? ? ? 1_555 JA PT .   PT ? ? I DG  47  I PT 86   1_555 ? ? ? ? ? ? ?               2.731 ? 
metalc43  metalc ? ? B MET 84  SD  ? ? ? 1_555 M  PT .   PT ? ? B MET 84  B PT 103  1_555 ? ? ? ? ? ? ?               2.793 ? 
metalc44  metalc ? ? I DG  136 N7  ? ? ? 1_555 HA PT .   PT ? ? I DG  63  I PT 84   1_555 ? ? ? ? ? ? ?               2.797 ? 
hydrog1   hydrog ? ? I DA  1   N1  ? ? ? 1_555 J  DT 145 N3 ? ? I DA  -72 J DT 72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? I DA  1   N6  ? ? ? 1_555 J  DT 145 O4 ? ? I DA  -72 J DT 72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? I DT  2   N3  ? ? ? 1_555 J  DA 144 N1 ? ? I DT  -71 J DA 71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? I DT  2   O4  ? ? ? 1_555 J  DA 144 N6 ? ? I DT  -71 J DA 71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? I DC  3   N3  ? ? ? 1_555 J  DG 143 N1 ? ? I DC  -70 J DG 70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? I DC  3   N4  ? ? ? 1_555 J  DG 143 O6 ? ? I DC  -70 J DG 70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? I DC  3   O2  ? ? ? 1_555 J  DG 143 N2 ? ? I DC  -70 J DG 70   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? I DA  4   N1  ? ? ? 1_555 J  DT 142 N3 ? ? I DA  -69 J DT 69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? I DA  4   N6  ? ? ? 1_555 J  DT 142 O4 ? ? I DA  -69 J DT 69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? I DA  5   N1  ? ? ? 1_555 J  DT 141 N3 ? ? I DA  -68 J DT 68   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog11  hydrog ? ? I DT  6   N3  ? ? ? 1_555 J  DA 140 N1 ? ? I DT  -67 J DA 67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? I DT  6   O4  ? ? ? 1_555 J  DA 140 N6 ? ? I DT  -67 J DA 67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? I DA  7   N1  ? ? ? 1_555 J  DT 139 N3 ? ? I DA  -66 J DT 66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? I DA  7   N6  ? ? ? 1_555 J  DT 139 O4 ? ? I DA  -66 J DT 66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? I DT  8   N3  ? ? ? 1_555 J  DA 138 N1 ? ? I DT  -65 J DA 65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? I DT  8   O4  ? ? ? 1_555 J  DA 138 N6 ? ? I DT  -65 J DA 65   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? I DC  9   O2  ? ? ? 1_555 J  DG 137 N2 ? ? I DC  -64 J DG 64   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog18  hydrog ? ? I DC  10  O2  ? ? ? 1_555 J  DG 136 N2 ? ? I DC  -63 J DG 63   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog19  hydrog ? ? I DA  11  N1  ? ? ? 1_555 J  DT 135 N3 ? ? I DA  -62 J DT 62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? I DA  11  N6  ? ? ? 1_555 J  DT 135 O4 ? ? I DA  -62 J DT 62   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? I DC  12  N3  ? ? ? 1_555 J  DG 134 N1 ? ? I DC  -61 J DG 61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? I DC  12  N4  ? ? ? 1_555 J  DG 134 O6 ? ? I DC  -61 J DG 61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? I DC  12  O2  ? ? ? 1_555 J  DG 134 N2 ? ? I DC  -61 J DG 61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? I DC  13  O2  ? ? ? 1_555 J  DG 133 N2 ? ? I DC  -60 J DG 60   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog25  hydrog ? ? I DG  15  N1  ? ? ? 1_555 J  DC 131 N3 ? ? I DG  -58 J DC 58   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog26  hydrog ? ? I DC  16  O2  ? ? ? 1_555 J  DG 130 N2 ? ? I DC  -57 J DG 57   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog27  hydrog ? ? I DA  17  N1  ? ? ? 1_555 J  DT 129 N3 ? ? I DA  -56 J DT 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? I DA  17  N6  ? ? ? 1_555 J  DT 129 O4 ? ? I DA  -56 J DT 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? I DG  18  N2  ? ? ? 1_555 J  DC 128 O2 ? ? I DG  -55 J DC 55   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog30  hydrog ? ? I DA  19  N1  ? ? ? 1_555 J  DT 127 N3 ? ? I DA  -54 J DT 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? I DA  19  N6  ? ? ? 1_555 J  DT 127 O4 ? ? I DA  -54 J DT 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? I DT  20  N3  ? ? ? 1_555 J  DA 126 N1 ? ? I DT  -53 J DA 53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? I DT  20  O4  ? ? ? 1_555 J  DA 126 N6 ? ? I DT  -53 J DA 53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? I DA  21  N1  ? ? ? 1_555 J  DT 125 N3 ? ? I DA  -52 J DT 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? I DA  21  N6  ? ? ? 1_555 J  DT 125 O4 ? ? I DA  -52 J DT 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? I DC  22  N3  ? ? ? 1_555 J  DG 124 N1 ? ? I DC  -51 J DG 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? I DC  22  N4  ? ? ? 1_555 J  DG 124 O6 ? ? I DC  -51 J DG 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? I DC  22  O2  ? ? ? 1_555 J  DG 124 N2 ? ? I DC  -51 J DG 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? I DA  24  N1  ? ? ? 1_555 J  DT 122 N3 ? ? I DA  -49 J DT 49   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog40  hydrog ? ? I DC  25  N4  ? ? ? 1_555 J  DG 120 O6 ? ? I DC  -48 J DG 47   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog41  hydrog ? ? I DC  25  N3  ? ? ? 1_555 J  DG 121 N1 ? ? I DC  -48 J DG 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? I DC  25  N4  ? ? ? 1_555 J  DG 121 O6 ? ? I DC  -48 J DG 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? I DC  25  O2  ? ? ? 1_555 J  DG 121 N2 ? ? I DC  -48 J DG 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? I DC  26  O2  ? ? ? 1_555 J  DG 120 N2 ? ? I DC  -47 J DG 47   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog45  hydrog ? ? I DA  27  N1  ? ? ? 1_555 J  DT 119 N3 ? ? I DA  -46 J DT 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? I DA  27  N6  ? ? ? 1_555 J  DT 119 O4 ? ? I DA  -46 J DT 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? I DA  28  N1  ? ? ? 1_555 J  DT 118 N3 ? ? I DA  -45 J DT 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? I DA  28  N6  ? ? ? 1_555 J  DT 118 O4 ? ? I DA  -45 J DT 45   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? I DA  29  N1  ? ? ? 1_555 J  DT 117 N3 ? ? I DA  -44 J DT 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? I DA  29  N6  ? ? ? 1_555 J  DT 117 O4 ? ? I DA  -44 J DT 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? I DA  30  N1  ? ? ? 1_555 J  DT 116 N3 ? ? I DA  -43 J DT 43   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog52  hydrog ? ? I DG  31  N2  ? ? ? 1_555 J  DC 115 O2 ? ? I DG  -42 J DC 42   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog53  hydrog ? ? I DT  32  N3  ? ? ? 1_555 J  DA 114 N1 ? ? I DT  -41 J DA 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? I DT  32  O4  ? ? ? 1_555 J  DA 114 N6 ? ? I DT  -41 J DA 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? I DG  33  N1  ? ? ? 1_555 J  DC 113 N3 ? ? I DG  -40 J DC 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? I DG  33  N2  ? ? ? 1_555 J  DC 113 O2 ? ? I DG  -40 J DC 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? I DG  33  O6  ? ? ? 1_555 J  DC 113 N4 ? ? I DG  -40 J DC 40   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? I DT  34  N3  ? ? ? 1_555 J  DA 112 N1 ? ? I DT  -39 J DA 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? I DT  34  O4  ? ? ? 1_555 J  DA 112 N6 ? ? I DT  -39 J DA 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? I DA  35  N1  ? ? ? 1_555 J  DT 111 N3 ? ? I DA  -38 J DT 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? I DA  35  N6  ? ? ? 1_555 J  DT 111 O4 ? ? I DA  -38 J DT 38   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? I DT  36  O4  ? ? ? 1_555 J  DA 109 N6 ? ? I DT  -37 J DA 36   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog63  hydrog ? ? I DT  36  N3  ? ? ? 1_555 J  DA 110 N1 ? ? I DT  -37 J DA 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? I DT  36  O4  ? ? ? 1_555 J  DA 110 N6 ? ? I DT  -37 J DA 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? I DT  37  O4  ? ? ? 1_555 J  DA 108 N6 ? ? I DT  -36 J DA 35   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog66  hydrog ? ? I DT  37  N3  ? ? ? 1_555 J  DA 109 N1 ? ? I DT  -36 J DA 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? I DT  37  O4  ? ? ? 1_555 J  DA 109 N6 ? ? I DT  -36 J DA 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? I DT  38  N3  ? ? ? 1_555 J  DA 108 N1 ? ? I DT  -35 J DA 35   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog69  hydrog ? ? I DG  39  O6  ? ? ? 1_555 J  DC 106 N4 ? ? I DG  -34 J DC 33   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog70  hydrog ? ? I DG  39  N1  ? ? ? 1_555 J  DC 107 N3 ? ? I DG  -34 J DC 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? I DG  39  N2  ? ? ? 1_555 J  DC 107 O2 ? ? I DG  -34 J DC 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? I DG  39  O6  ? ? ? 1_555 J  DC 107 N4 ? ? I DG  -34 J DC 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? I DG  40  N1  ? ? ? 1_555 J  DC 106 N3 ? ? I DG  -33 J DC 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? I DG  40  N2  ? ? ? 1_555 J  DC 106 O2 ? ? I DG  -33 J DC 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? I DG  40  O6  ? ? ? 1_555 J  DC 106 N4 ? ? I DG  -33 J DC 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? I DA  41  N1  ? ? ? 1_555 J  DT 105 N3 ? ? I DA  -32 J DT 32   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog77  hydrog ? ? I DA  42  N1  ? ? ? 1_555 J  DT 104 N3 ? ? I DA  -31 J DT 31   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog78  hydrog ? ? I DA  43  N1  ? ? ? 1_555 J  DT 103 N3 ? ? I DA  -30 J DT 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? I DA  43  N6  ? ? ? 1_555 J  DT 103 O4 ? ? I DA  -30 J DT 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? I DC  44  O2  ? ? ? 1_555 J  DG 102 N2 ? ? I DC  -29 J DG 29   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog81  hydrog ? ? I DT  45  N3  ? ? ? 1_555 J  DA 101 N1 ? ? I DT  -28 J DA 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? I DT  45  O4  ? ? ? 1_555 J  DA 101 N6 ? ? I DT  -28 J DA 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? I DG  46  N1  ? ? ? 1_555 J  DC 100 N3 ? ? I DG  -27 J DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? I DG  46  N2  ? ? ? 1_555 J  DC 100 O2 ? ? I DG  -27 J DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? I DG  46  O6  ? ? ? 1_555 J  DC 100 N4 ? ? I DG  -27 J DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? I DC  47  O2  ? ? ? 1_555 J  DG 99  N1 ? ? I DC  -26 J DG 26   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog87  hydrog ? ? I DT  48  N3  ? ? ? 1_555 J  DA 98  N1 ? ? I DT  -25 J DA 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? I DT  48  O4  ? ? ? 1_555 J  DA 98  N6 ? ? I DT  -25 J DA 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? I DC  49  N3  ? ? ? 1_555 J  DG 97  N1 ? ? I DC  -24 J DG 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? I DC  49  N4  ? ? ? 1_555 J  DG 97  O6 ? ? I DC  -24 J DG 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? I DC  49  O2  ? ? ? 1_555 J  DG 97  N2 ? ? I DC  -24 J DG 24   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? I DC  50  O2  ? ? ? 1_555 J  DG 96  N2 ? ? I DC  -23 J DG 23   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog93  hydrog ? ? I DA  51  N1  ? ? ? 1_555 J  DT 95  N3 ? ? I DA  -22 J DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? I DA  51  N6  ? ? ? 1_555 J  DT 95  O4 ? ? I DA  -22 J DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? I DT  52  N3  ? ? ? 1_555 J  DA 94  N1 ? ? I DT  -21 J DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? I DT  52  O4  ? ? ? 1_555 J  DA 94  N6 ? ? I DT  -21 J DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? I DC  53  N3  ? ? ? 1_555 J  DG 93  N1 ? ? I DC  -20 J DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? I DC  53  N4  ? ? ? 1_555 J  DG 93  O6 ? ? I DC  -20 J DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? I DC  53  O2  ? ? ? 1_555 J  DG 93  N2 ? ? I DC  -20 J DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? I DA  54  N1  ? ? ? 1_555 J  DT 92  N3 ? ? I DA  -19 J DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? I DA  54  N6  ? ? ? 1_555 J  DT 92  O4 ? ? I DA  -19 J DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? I DA  55  N1  ? ? ? 1_555 J  DT 91  N3 ? ? I DA  -18 J DT 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? I DA  55  N6  ? ? ? 1_555 J  DT 91  O4 ? ? I DA  -18 J DT 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? I DA  56  N6  ? ? ? 1_555 J  DT 89  O4 ? ? I DA  -17 J DT 16   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog105 hydrog ? ? I DA  56  N1  ? ? ? 1_555 J  DT 90  N3 ? ? I DA  -17 J DT 17   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog106 hydrog ? ? I DA  57  N1  ? ? ? 1_555 J  DT 89  N3 ? ? I DA  -16 J DT 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? I DA  57  N6  ? ? ? 1_555 J  DT 89  O4 ? ? I DA  -16 J DT 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? I DG  58  N1  ? ? ? 1_555 J  DC 88  N3 ? ? I DG  -15 J DC 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? I DG  58  N2  ? ? ? 1_555 J  DC 88  O2 ? ? I DG  -15 J DC 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? I DG  58  O6  ? ? ? 1_555 J  DC 88  N4 ? ? I DG  -15 J DC 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? I DG  59  N1  ? ? ? 1_555 J  DC 87  N3 ? ? I DG  -14 J DC 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? I DG  59  N2  ? ? ? 1_555 J  DC 87  O2 ? ? I DG  -14 J DC 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? I DG  59  O6  ? ? ? 1_555 J  DC 87  N4 ? ? I DG  -14 J DC 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? I DC  60  O2  ? ? ? 1_555 J  DG 86  N2 ? ? I DC  -13 J DG 13   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog115 hydrog ? ? I DA  61  N1  ? ? ? 1_555 J  DT 85  N3 ? ? I DA  -12 J DT 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? I DA  61  N6  ? ? ? 1_555 J  DT 85  O4 ? ? I DA  -12 J DT 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? I DT  62  N3  ? ? ? 1_555 J  DA 84  N1 ? ? I DT  -11 J DA 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? I DT  62  O4  ? ? ? 1_555 J  DA 84  N6 ? ? I DT  -11 J DA 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? I DG  63  N1  ? ? ? 1_555 J  DC 83  N3 ? ? I DG  -10 J DC 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? I DG  63  N2  ? ? ? 1_555 J  DC 83  O2 ? ? I DG  -10 J DC 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? I DG  63  O6  ? ? ? 1_555 J  DC 83  N4 ? ? I DG  -10 J DC 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? I DT  64  N3  ? ? ? 1_555 J  DA 82  N1 ? ? I DT  -9  J DA 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? I DT  64  O4  ? ? ? 1_555 J  DA 82  N6 ? ? I DT  -9  J DA 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? I DT  65  N3  ? ? ? 1_555 J  DA 81  N1 ? ? I DT  -8  J DA 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? I DT  65  O4  ? ? ? 1_555 J  DA 81  N6 ? ? I DT  -8  J DA 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? I DC  66  O2  ? ? ? 1_555 J  DG 80  N1 ? ? I DC  -7  J DG 7    1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog127 hydrog ? ? I DA  67  N1  ? ? ? 1_555 J  DT 79  N3 ? ? I DA  -6  J DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? I DA  67  N6  ? ? ? 1_555 J  DT 79  O4 ? ? I DA  -6  J DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? I DG  68  N1  ? ? ? 1_555 J  DC 78  N3 ? ? I DG  -5  J DC 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? I DG  68  N2  ? ? ? 1_555 J  DC 78  O2 ? ? I DG  -5  J DC 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? I DG  68  O6  ? ? ? 1_555 J  DC 78  N4 ? ? I DG  -5  J DC 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? I DC  69  N3  ? ? ? 1_555 J  DG 77  N1 ? ? I DC  -4  J DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? I DC  69  N4  ? ? ? 1_555 J  DG 77  O6 ? ? I DC  -4  J DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? I DC  69  O2  ? ? ? 1_555 J  DG 77  N2 ? ? I DC  -4  J DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? I DT  70  N3  ? ? ? 1_555 J  DA 76  N1 ? ? I DT  -3  J DA 3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? I DT  70  O4  ? ? ? 1_555 J  DA 76  N6 ? ? I DT  -3  J DA 3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? I DG  71  N1  ? ? ? 1_555 J  DC 75  N3 ? ? I DG  -2  J DC 2    1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog138 hydrog ? ? I DA  72  N1  ? ? ? 1_555 J  DT 74  N3 ? ? I DA  -1  J DT 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? I DA  72  N6  ? ? ? 1_555 J  DT 74  O4 ? ? I DA  -1  J DT 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? I DA  73  N1  ? ? ? 1_555 J  DT 73  N3 ? ? I DA  0   J DT 0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? I DA  73  N6  ? ? ? 1_555 J  DT 73  O4 ? ? I DA  0   J DT 0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? I DT  74  N3  ? ? ? 1_555 J  DA 72  N1 ? ? I DT  1   J DA -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? I DT  74  O4  ? ? ? 1_555 J  DA 72  N6 ? ? I DT  1   J DA -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? I DC  75  N3  ? ? ? 1_555 J  DG 71  N1 ? ? I DC  2   J DG -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? I DC  75  N4  ? ? ? 1_555 J  DG 71  O6 ? ? I DC  2   J DG -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? I DC  75  O2  ? ? ? 1_555 J  DG 71  N2 ? ? I DC  2   J DG -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? I DA  76  N1  ? ? ? 1_555 J  DT 70  N3 ? ? I DA  3   J DT -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? I DA  76  N6  ? ? ? 1_555 J  DT 70  O4 ? ? I DA  3   J DT -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? I DG  77  N1  ? ? ? 1_555 J  DC 69  N3 ? ? I DG  4   J DC -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? I DG  77  N2  ? ? ? 1_555 J  DC 69  O2 ? ? I DG  4   J DC -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? I DG  77  O6  ? ? ? 1_555 J  DC 69  N4 ? ? I DG  4   J DC -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? I DC  78  N3  ? ? ? 1_555 J  DG 68  N1 ? ? I DC  5   J DG -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? I DC  78  N4  ? ? ? 1_555 J  DG 68  O6 ? ? I DC  5   J DG -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? I DC  78  O2  ? ? ? 1_555 J  DG 68  N2 ? ? I DC  5   J DG -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? I DT  79  N3  ? ? ? 1_555 J  DA 67  N1 ? ? I DT  6   J DA -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? I DT  79  O4  ? ? ? 1_555 J  DA 67  N6 ? ? I DT  6   J DA -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? I DG  80  N1  ? ? ? 1_555 J  DC 66  N3 ? ? I DG  7   J DC -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? I DG  80  N2  ? ? ? 1_555 J  DC 66  O2 ? ? I DG  7   J DC -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? I DG  80  O6  ? ? ? 1_555 J  DC 66  N4 ? ? I DG  7   J DC -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? I DA  81  N1  ? ? ? 1_555 J  DT 65  N3 ? ? I DA  8   J DT -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? I DA  81  N6  ? ? ? 1_555 J  DT 65  O4 ? ? I DA  8   J DT -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? I DA  82  N1  ? ? ? 1_555 J  DT 64  N3 ? ? I DA  9   J DT -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? I DA  82  N6  ? ? ? 1_555 J  DT 64  O4 ? ? I DA  9   J DT -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? I DC  83  N3  ? ? ? 1_555 J  DG 63  N1 ? ? I DC  10  J DG -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? I DC  83  N4  ? ? ? 1_555 J  DG 63  O6 ? ? I DC  10  J DG -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? I DC  83  O2  ? ? ? 1_555 J  DG 63  N2 ? ? I DC  10  J DG -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? I DA  84  N1  ? ? ? 1_555 J  DT 62  N3 ? ? I DA  11  J DT -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? I DA  84  N6  ? ? ? 1_555 J  DT 62  O4 ? ? I DA  11  J DT -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? I DT  85  N3  ? ? ? 1_555 J  DA 61  N1 ? ? I DT  12  J DA -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? I DT  85  O4  ? ? ? 1_555 J  DA 61  N6 ? ? I DT  12  J DA -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? I DG  86  N1  ? ? ? 1_555 J  DC 60  N3 ? ? I DG  13  J DC -13  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog172 hydrog ? ? I DC  87  N3  ? ? ? 1_555 J  DG 59  N1 ? ? I DC  14  J DG -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? I DC  87  N4  ? ? ? 1_555 J  DG 59  O6 ? ? I DC  14  J DG -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? I DC  87  O2  ? ? ? 1_555 J  DG 59  N2 ? ? I DC  14  J DG -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? I DC  88  N3  ? ? ? 1_555 J  DG 58  N1 ? ? I DC  15  J DG -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? I DC  88  N4  ? ? ? 1_555 J  DG 58  O6 ? ? I DC  15  J DG -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? I DC  88  O2  ? ? ? 1_555 J  DG 58  N2 ? ? I DC  15  J DG -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? I DT  89  N3  ? ? ? 1_555 J  DA 57  N1 ? ? I DT  16  J DA -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? I DT  89  O4  ? ? ? 1_555 J  DA 57  N6 ? ? I DT  16  J DA -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? I DT  90  N3  ? ? ? 1_555 J  DA 56  N1 ? ? I DT  17  J DA -17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? I DT  90  O4  ? ? ? 1_555 J  DA 56  N6 ? ? I DT  17  J DA -17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? I DT  91  N3  ? ? ? 1_555 J  DA 55  N1 ? ? I DT  18  J DA -18  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog183 hydrog ? ? I DT  92  N3  ? ? ? 1_555 J  DA 54  N1 ? ? I DT  19  J DA -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? I DT  92  O4  ? ? ? 1_555 J  DA 54  N6 ? ? I DT  19  J DA -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? I DG  93  N1  ? ? ? 1_555 J  DC 53  N3 ? ? I DG  20  J DC -20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? I DG  93  N2  ? ? ? 1_555 J  DC 53  O2 ? ? I DG  20  J DC -20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? I DG  93  O6  ? ? ? 1_555 J  DC 53  N4 ? ? I DG  20  J DC -20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? I DA  94  N1  ? ? ? 1_555 J  DT 52  N3 ? ? I DA  21  J DT -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? I DA  94  N6  ? ? ? 1_555 J  DT 52  O4 ? ? I DA  21  J DT -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? I DT  95  N3  ? ? ? 1_555 J  DA 51  N1 ? ? I DT  22  J DA -22  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog191 hydrog ? ? I DG  96  O6  ? ? ? 1_555 J  DC 50  N4 ? ? I DG  23  J DC -23  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog192 hydrog ? ? I DG  97  N1  ? ? ? 1_555 J  DC 49  N3 ? ? I DG  24  J DC -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? I DG  97  N2  ? ? ? 1_555 J  DC 49  O2 ? ? I DG  24  J DC -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? I DG  97  O6  ? ? ? 1_555 J  DC 49  N4 ? ? I DG  24  J DC -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? I DA  98  N6  ? ? ? 1_555 J  DC 47  N3 ? ? I DA  25  J DC -26  1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog196 hydrog ? ? I DA  98  N1  ? ? ? 1_555 J  DT 48  N3 ? ? I DA  25  J DT -25  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog197 hydrog ? ? I DG  99  N1  ? ? ? 1_555 J  DC 47  N3 ? ? I DG  26  J DC -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? I DG  99  N2  ? ? ? 1_555 J  DC 47  O2 ? ? I DG  26  J DC -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? I DG  99  O6  ? ? ? 1_555 J  DC 47  N4 ? ? I DG  26  J DC -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? I DC  100 O2  ? ? ? 1_555 J  DG 46  N2 ? ? I DC  27  J DG -27  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog201 hydrog ? ? I DA  101 N1  ? ? ? 1_555 J  DT 45  N3 ? ? I DA  28  J DT -28  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog202 hydrog ? ? I DG  102 N1  ? ? ? 1_555 J  DC 44  N3 ? ? I DG  29  J DC -29  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog203 hydrog ? ? I DT  104 N3  ? ? ? 1_555 J  DA 42  N1 ? ? I DT  31  J DA -31  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog204 hydrog ? ? I DT  105 O4  ? ? ? 1_555 J  DA 41  N6 ? ? I DT  32  J DA -32  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog205 hydrog ? ? I DC  106 N3  ? ? ? 1_555 J  DG 40  N1 ? ? I DC  33  J DG -33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog206 hydrog ? ? I DC  106 N4  ? ? ? 1_555 J  DG 40  O6 ? ? I DC  33  J DG -33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? I DC  106 O2  ? ? ? 1_555 J  DG 40  N2 ? ? I DC  33  J DG -33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? I DC  107 N3  ? ? ? 1_555 J  DG 39  N1 ? ? I DC  34  J DG -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? I DC  107 N4  ? ? ? 1_555 J  DG 39  O6 ? ? I DC  34  J DG -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? I DC  107 O2  ? ? ? 1_555 J  DG 39  N2 ? ? I DC  34  J DG -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ? ? I DA  108 N1  ? ? ? 1_555 J  DT 38  N3 ? ? I DA  35  J DT -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? I DA  108 N6  ? ? ? 1_555 J  DT 38  O4 ? ? I DA  35  J DT -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? I DA  109 N1  ? ? ? 1_555 J  DT 37  N3 ? ? I DA  36  J DT -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? I DA  109 N6  ? ? ? 1_555 J  DT 37  O4 ? ? I DA  36  J DT -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog215 hydrog ? ? I DA  110 N1  ? ? ? 1_555 J  DT 36  N3 ? ? I DA  37  J DT -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? I DA  110 N6  ? ? ? 1_555 J  DT 36  O4 ? ? I DA  37  J DT -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? I DT  111 N3  ? ? ? 1_555 J  DA 35  N1 ? ? I DT  38  J DA -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? I DT  111 O4  ? ? ? 1_555 J  DA 35  N6 ? ? I DT  38  J DA -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? I DA  112 N1  ? ? ? 1_555 J  DT 34  N3 ? ? I DA  39  J DT -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? I DA  112 N6  ? ? ? 1_555 J  DT 34  O4 ? ? I DA  39  J DT -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? I DC  113 N3  ? ? ? 1_555 J  DG 33  N1 ? ? I DC  40  J DG -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? I DC  113 N4  ? ? ? 1_555 J  DG 33  O6 ? ? I DC  40  J DG -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? I DC  113 O2  ? ? ? 1_555 J  DG 33  N2 ? ? I DC  40  J DG -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? I DA  114 N1  ? ? ? 1_555 J  DT 32  N3 ? ? I DA  41  J DT -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? I DA  114 N6  ? ? ? 1_555 J  DT 32  O4 ? ? I DA  41  J DT -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? I DC  115 N3  ? ? ? 1_555 J  DG 31  N1 ? ? I DC  42  J DG -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? I DC  115 N4  ? ? ? 1_555 J  DG 31  O6 ? ? I DC  42  J DG -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ? ? I DC  115 O2  ? ? ? 1_555 J  DG 31  N2 ? ? I DC  42  J DG -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? I DT  116 N3  ? ? ? 1_555 J  DA 30  N1 ? ? I DT  43  J DA -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? I DT  116 O4  ? ? ? 1_555 J  DA 30  N6 ? ? I DT  43  J DA -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? I DT  117 N3  ? ? ? 1_555 J  DA 29  N1 ? ? I DT  44  J DA -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? I DT  117 O4  ? ? ? 1_555 J  DA 29  N6 ? ? I DT  44  J DA -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? I DT  118 N3  ? ? ? 1_555 J  DA 28  N1 ? ? I DT  45  J DA -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? I DT  118 O4  ? ? ? 1_555 J  DA 28  N6 ? ? I DT  45  J DA -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? I DT  119 N3  ? ? ? 1_555 J  DA 27  N1 ? ? I DT  46  J DA -46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? I DT  119 O4  ? ? ? 1_555 J  DA 27  N6 ? ? I DT  46  J DA -46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? I DG  120 N2  ? ? ? 1_555 J  DC 26  O2 ? ? I DG  47  J DC -47  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog238 hydrog ? ? I DG  121 N1  ? ? ? 1_555 J  DC 25  N3 ? ? I DG  48  J DC -48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? I DG  121 N2  ? ? ? 1_555 J  DC 25  O2 ? ? I DG  48  J DC -48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? I DG  121 O6  ? ? ? 1_555 J  DC 25  N4 ? ? I DG  48  J DC -48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? I DA  123 N1  ? ? ? 1_555 J  DT 23  N3 ? ? I DA  50  J DT -50  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog242 hydrog ? ? I DG  124 N2  ? ? ? 1_555 J  DC 22  O2 ? ? I DG  51  J DC -51  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog243 hydrog ? ? I DA  126 N1  ? ? ? 1_555 J  DT 20  N3 ? ? I DA  53  J DT -53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? I DA  126 N6  ? ? ? 1_555 J  DT 20  O4 ? ? I DA  53  J DT -53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? I DT  127 N3  ? ? ? 1_555 J  DA 19  N1 ? ? I DT  54  J DA -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? I DT  127 O4  ? ? ? 1_555 J  DA 19  N6 ? ? I DT  54  J DA -54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? I DC  128 N3  ? ? ? 1_555 J  DG 18  N1 ? ? I DC  55  J DG -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? I DC  128 N4  ? ? ? 1_555 J  DG 18  O6 ? ? I DC  55  J DG -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? I DC  128 O2  ? ? ? 1_555 J  DG 18  N2 ? ? I DC  55  J DG -55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? I DT  129 N3  ? ? ? 1_555 J  DC 16  N3 ? ? I DT  56  J DC -57  1_555 ? ? ? ? ? ? TYPE_18_PAIR    ?     ? 
hydrog251 hydrog ? ? I DT  129 O4  ? ? ? 1_555 J  DC 16  N4 ? ? I DT  56  J DC -57  1_555 ? ? ? ? ? ? TYPE_18_PAIR    ?     ? 
hydrog252 hydrog ? ? I DT  129 N3  ? ? ? 1_555 J  DA 17  N1 ? ? I DT  56  J DA -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog253 hydrog ? ? I DT  129 O4  ? ? ? 1_555 J  DA 17  N6 ? ? I DT  56  J DA -56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog254 hydrog ? ? I DG  130 N1  ? ? ? 1_555 J  DC 16  N3 ? ? I DG  57  J DC -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog255 hydrog ? ? I DG  130 N2  ? ? ? 1_555 J  DC 16  O2 ? ? I DG  57  J DC -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog256 hydrog ? ? I DG  130 O6  ? ? ? 1_555 J  DC 16  N4 ? ? I DG  57  J DC -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog257 hydrog ? ? I DC  131 N3  ? ? ? 1_555 J  DG 15  N1 ? ? I DC  58  J DG -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog258 hydrog ? ? I DC  131 N4  ? ? ? 1_555 J  DG 15  O6 ? ? I DC  58  J DG -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog259 hydrog ? ? I DC  131 O2  ? ? ? 1_555 J  DG 15  N2 ? ? I DC  58  J DG -58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog260 hydrog ? ? I DA  132 N1  ? ? ? 1_555 J  DT 14  N3 ? ? I DA  59  J DT -59  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog261 hydrog ? ? I DG  133 N1  ? ? ? 1_555 J  DC 13  N3 ? ? I DG  60  J DC -60  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog262 hydrog ? ? I DG  134 N1  ? ? ? 1_555 J  DC 12  N3 ? ? I DG  61  J DC -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog263 hydrog ? ? I DG  134 N2  ? ? ? 1_555 J  DC 12  O2 ? ? I DG  61  J DC -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? I DG  134 O6  ? ? ? 1_555 J  DC 12  N4 ? ? I DG  61  J DC -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ? ? I DT  135 N3  ? ? ? 1_555 J  DA 11  N1 ? ? I DT  62  J DA -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog266 hydrog ? ? I DT  135 O4  ? ? ? 1_555 J  DA 11  N6 ? ? I DT  62  J DA -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog267 hydrog ? ? I DG  136 N1  ? ? ? 1_555 J  DC 10  N3 ? ? I DG  63  J DC -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog268 hydrog ? ? I DG  136 N2  ? ? ? 1_555 J  DC 10  O2 ? ? I DG  63  J DC -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog269 hydrog ? ? I DG  136 O6  ? ? ? 1_555 J  DC 10  N4 ? ? I DG  63  J DC -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog270 hydrog ? ? I DG  137 N1  ? ? ? 1_555 J  DC 9   N3 ? ? I DG  64  J DC -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? I DG  137 N2  ? ? ? 1_555 J  DC 9   O2 ? ? I DG  64  J DC -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? I DG  137 O6  ? ? ? 1_555 J  DC 9   N4 ? ? I DG  64  J DC -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? I DA  138 N1  ? ? ? 1_555 J  DT 8   N3 ? ? I DA  65  J DT -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog274 hydrog ? ? I DA  138 N6  ? ? ? 1_555 J  DT 8   O4 ? ? I DA  65  J DT -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog275 hydrog ? ? I DT  139 N3  ? ? ? 1_555 J  DA 7   N1 ? ? I DT  66  J DA -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog276 hydrog ? ? I DT  139 O4  ? ? ? 1_555 J  DA 7   N6 ? ? I DT  66  J DA -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog277 hydrog ? ? I DA  140 N1  ? ? ? 1_555 J  DT 6   N3 ? ? I DA  67  J DT -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog278 hydrog ? ? I DA  140 N6  ? ? ? 1_555 J  DT 6   O4 ? ? I DA  67  J DT -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog279 hydrog ? ? I DT  141 N3  ? ? ? 1_555 J  DA 5   N1 ? ? I DT  68  J DA -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog280 hydrog ? ? I DT  141 O4  ? ? ? 1_555 J  DA 5   N6 ? ? I DT  68  J DA -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog281 hydrog ? ? I DT  142 N3  ? ? ? 1_555 J  DA 4   N1 ? ? I DT  69  J DA -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog282 hydrog ? ? I DT  142 O4  ? ? ? 1_555 J  DA 4   N6 ? ? I DT  69  J DA -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog283 hydrog ? ? I DG  143 N1  ? ? ? 1_555 J  DC 3   N3 ? ? I DG  70  J DC -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ? ? I DG  143 N2  ? ? ? 1_555 J  DC 3   O2 ? ? I DG  70  J DC -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog285 hydrog ? ? I DG  143 O6  ? ? ? 1_555 J  DC 3   N4 ? ? I DG  70  J DC -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ? ? I DA  144 N1  ? ? ? 1_555 J  DT 2   N3 ? ? I DA  71  J DT -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog287 hydrog ? ? I DA  144 N6  ? ? ? 1_555 J  DT 2   O4 ? ? I DA  71  J DT -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog288 hydrog ? ? I DT  145 N3  ? ? ? 1_555 J  DA 1   N1 ? ? I DT  72  J DA -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog289 hydrog ? ? I DT  145 O4  ? ? ? 1_555 J  DA 1   N6 ? ? I DT  72  J DA -72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 83  ? PHE A 84  ? ARG A 83  PHE A 84  
A 2 THR B 80  ? VAL B 81  ? THR B 80  VAL B 81  
B 1 THR A 118 ? ILE A 119 ? THR A 118 ILE A 119 
B 2 ARG B 45  ? ILE B 46  ? ARG B 45  ILE B 46  
C 1 THR B 96  ? TYR B 98  ? THR B 96  TYR B 98  
C 2 VAL G 100 ? ILE G 102 ? VAL G 100 ILE G 102 
D 1 ARG C 42  ? VAL C 43  ? ARG C 42  VAL C 43  
D 2 THR D 85  ? ILE D 86  ? THR D 85  ILE D 86  
E 1 ARG C 77  ? ILE C 78  ? ARG C 77  ILE C 78  
E 2 GLY D 50  ? ILE D 51  ? GLY D 50  ILE D 51  
F 1 VAL C 100 ? ILE C 102 ? VAL C 100 ILE C 102 
F 2 THR F 96  ? TYR F 98  ? THR F 96  TYR F 98  
G 1 ARG E 83  ? PHE E 84  ? ARG E 83  PHE E 84  
G 2 THR F 80  ? VAL F 81  ? THR F 80  VAL F 81  
H 1 THR E 118 ? ILE E 119 ? THR E 118 ILE E 119 
H 2 ARG F 45  ? ILE F 46  ? ARG F 45  ILE F 46  
I 1 ARG G 42  ? VAL G 43  ? ARG G 42  VAL G 43  
I 2 THR H 85  ? ILE H 86  ? THR H 85  ILE H 86  
J 1 ARG G 77  ? ILE G 78  ? ARG G 77  ILE G 78  
J 2 GLY H 50  ? ILE H 51  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 83  ? N ARG A 83  O VAL B 81  ? O VAL B 81  
B 1 2 N ILE A 119 ? N ILE A 119 O ARG B 45  ? O ARG B 45  
C 1 2 N TYR B 98  ? N TYR B 98  O THR G 101 ? O THR G 101 
D 1 2 N ARG C 42  ? N ARG C 42  O ILE D 86  ? O ILE D 86  
E 1 2 N ILE C 78  ? N ILE C 78  O GLY D 50  ? O GLY D 50  
F 1 2 N THR C 101 ? N THR C 101 O TYR F 98  ? O TYR F 98  
G 1 2 N ARG E 83  ? N ARG E 83  O VAL F 81  ? O VAL F 81  
H 1 2 N ILE E 119 ? N ILE E 119 O ARG F 45  ? O ARG F 45  
I 1 2 N ARG G 42  ? N ARG G 42  O ILE H 86  ? O ILE H 86  
J 1 2 N ILE G 78  ? N ILE G 78  O GLY H 50  ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN E 1001'  
AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN H 1013'  
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 D 1101' 
AC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 H 1102' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 H 1103' 
AC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 73'    
AC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 73'    
AC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 74'    
AC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 74'    
BC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 75'    
BC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 76'    
BC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 77'    
BC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 75'    
BC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT I 76'    
BC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 77'    
BC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 78'    
BC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 78'    
BC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 79'    
CC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE PT I 79'    
CC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT B 103'   
CC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 80'    
CC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 80'    
CC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 81'    
CC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 82'    
CC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 83'    
CC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT F 103'   
CC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 82'    
DC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 83'    
DC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE PT I 84'    
DC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE PT J 84'    
DC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 85'    
DC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 86'    
DC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 85'    
DC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 87'    
DC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 86'    
DC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT E 136'   
EC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT A 136'   
EC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT E 137'   
EC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE PT I 88'    
EC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT A 137'   
EC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 87'    
EC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 89'    
EC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 88'    
EC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 89'    
EC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE PT J 90'    
FC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 91'    
FC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT I 90'    
FC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 92'    
FC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 93'    
FC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT C 130'   
FC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 91'    
FC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 128'   
FC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE PT J 133'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 VAL D  45  ? VAL D 45  . ? 3_545 ? 
2  AC1 2 ASP E  77  ? ASP E 77  . ? 1_555 ? 
3  AC2 1 VAL H  45  ? VAL H 45  . ? 1_555 ? 
4  AC3 5 GLY C  44  ? GLY C 44  . ? 1_555 ? 
5  AC3 5 ALA C  45  ? ALA C 45  . ? 1_555 ? 
6  AC3 5 GLY C  46  ? GLY C 46  . ? 1_555 ? 
7  AC3 5 THR D  87  ? THR D 87  . ? 1_555 ? 
8  AC3 5 SER D  88  ? SER D 88  . ? 1_555 ? 
9  AC4 6 GLY G  44  ? GLY G 44  . ? 1_555 ? 
10 AC4 6 ALA G  45  ? ALA G 45  . ? 1_555 ? 
11 AC4 6 GLY G  46  ? GLY G 46  . ? 1_555 ? 
12 AC4 6 ALA G  47  ? ALA G 47  . ? 1_555 ? 
13 AC4 6 THR H  87  ? THR H 87  . ? 1_555 ? 
14 AC4 6 SER H  88  ? SER H 88  . ? 1_555 ? 
15 AC5 4 HIS H  46  ? HIS H 46  . ? 1_555 ? 
16 AC5 4 PRO H  47  ? PRO H 47  . ? 1_555 ? 
17 AC5 4 ASP H  48  ? ASP H 48  . ? 1_555 ? 
18 AC5 4 THR H  49  ? THR H 49  . ? 1_555 ? 
19 AC6 1 DG  I  133 ? DG  I 60  . ? 1_555 ? 
20 AC7 2 DG  J  133 ? DG  J 60  . ? 1_555 ? 
21 AC7 2 DG  J  134 ? DG  J 61  . ? 1_555 ? 
22 AC8 1 DG  I  80  ? DG  I 7   . ? 1_555 ? 
23 AC9 1 DG  J  80  ? DG  J 7   . ? 1_555 ? 
24 BC1 2 DA  J  19  ? DA  J -54 . ? 1_555 ? 
25 BC1 2 DG  J  18  ? DG  J -55 . ? 1_555 ? 
26 BC2 1 DG  J  40  ? DG  J -33 . ? 1_555 ? 
27 BC3 1 DG  J  120 ? DG  J 47  . ? 1_555 ? 
28 BC4 1 DG  I  18  ? DG  I -55 . ? 1_555 ? 
29 BC5 2 DG  I  40  ? DG  I -33 . ? 1_555 ? 
30 BC5 2 DG  I  39  ? DG  I -34 . ? 1_555 ? 
31 BC6 1 DG  I  40  ? DG  I -33 . ? 1_555 ? 
32 BC7 1 DG  I  71  ? DG  I -2  . ? 1_555 ? 
33 BC8 1 DG  J  68  ? DG  J -5  . ? 1_555 ? 
34 BC9 1 DG  J  77  ? DG  J 4   . ? 1_555 ? 
35 CC1 3 DG  I  136 ? DG  I 63  . ? 1_555 ? 
36 CC1 3 DG  I  137 ? DG  I 64  . ? 1_555 ? 
37 CC1 3 PT  HA .   ? PT  I 84  . ? 1_555 ? 
38 CC2 1 MET B  84  ? MET B 84  . ? 1_555 ? 
39 CC3 1 DG  I  77  ? DG  I 4   . ? 1_555 ? 
40 CC4 1 DG  J  71  ? DG  J -2  . ? 1_555 ? 
41 CC5 1 DA  I  101 ? DA  I 28  . ? 1_555 ? 
42 CC6 1 DG  I  58  ? DG  I -15 . ? 1_555 ? 
43 CC7 1 DG  I  68  ? DG  I -5  . ? 1_555 ? 
44 CC8 2 MET F  84  ? MET F 84  . ? 1_555 ? 
45 CC8 2 GLY F  101 ? GLY F 101 . ? 1_555 ? 
46 CC9 2 DG  J  96  ? DG  J 23  . ? 1_555 ? 
47 CC9 2 DG  J  97  ? DG  J 24  . ? 1_555 ? 
48 DC1 2 DG  I  59  ? DG  I -14 . ? 1_555 ? 
49 DC1 2 DG  J  86  ? DG  J 13  . ? 1_555 ? 
50 DC2 3 DG  I  136 ? DG  I 63  . ? 1_555 ? 
51 DC2 3 DG  I  137 ? DG  I 64  . ? 1_555 ? 
52 DC2 3 PT  CA .   ? PT  I 79  . ? 1_555 ? 
53 DC3 3 DG  J  136 ? DG  J 63  . ? 1_555 ? 
54 DC3 3 DG  J  137 ? DG  J 64  . ? 1_555 ? 
55 DC3 3 PT  LB .   ? PT  J 133 . ? 1_555 ? 
56 DC4 1 DG  I  96  ? DG  I 23  . ? 1_555 ? 
57 DC5 1 DG  I  120 ? DG  I 47  . ? 1_555 ? 
58 DC6 2 DG  J  99  ? DG  J 26  . ? 1_555 ? 
59 DC6 2 PT  DB .   ? PT  J 87  . ? 1_555 ? 
60 DC7 1 DT  I  119 ? DT  I 46  . ? 1_555 ? 
61 DC8 1 DA  J  101 ? DA  J 28  . ? 1_555 ? 
62 DC9 2 MET E  120 ? MET E 120 . ? 1_555 ? 
63 DC9 2 DG  J  71  ? DG  J -2  . ? 1_555 ? 
64 EC1 2 LYS A  64  ? LYS A 64  . ? 1_555 ? 
65 EC1 2 MET A  90  ? MET A 90  . ? 1_555 ? 
66 EC2 2 LYS E  64  ? LYS E 64  . ? 1_555 ? 
67 EC2 2 MET E  90  ? MET E 90  . ? 1_555 ? 
68 EC3 3 DT  I  118 ? DT  I 45  . ? 1_555 ? 
69 EC3 3 DA  J  30  ? DA  J -43 . ? 1_555 ? 
70 EC3 3 DA  J  29  ? DA  J -44 . ? 1_555 ? 
71 EC4 2 MET A  120 ? MET A 120 . ? 1_555 ? 
72 EC4 2 DG  I  71  ? DG  I -2  . ? 1_555 ? 
73 EC5 2 DA  I  140 ? DA  I 67  . ? 3_455 ? 
74 EC5 2 PT  BB .   ? PT  J 85  . ? 1_555 ? 
75 EC6 1 DA  I  98  ? DA  I 25  . ? 1_555 ? 
76 EC7 1 DT  J  119 ? DT  J 46  . ? 1_555 ? 
77 EC8 2 DG  J  39  ? DG  J -34 . ? 1_555 ? 
78 EC8 2 DG  J  40  ? DG  J -33 . ? 1_555 ? 
79 EC9 3 DA  J  123 ? DA  J 50  . ? 1_555 ? 
80 EC9 3 DG  J  124 ? DG  J 51  . ? 1_555 ? 
81 EC9 3 DT  J  125 ? DT  J 52  . ? 1_555 ? 
82 FC1 1 DG  J  15  ? DG  J -58 . ? 1_555 ? 
83 FC2 2 DG  I  31  ? DG  I -42 . ? 1_555 ? 
84 FC2 2 DA  I  30  ? DA  I -43 . ? 1_555 ? 
85 FC3 2 DG  J  31  ? DG  J -42 . ? 1_555 ? 
86 FC3 2 DT  J  32  ? DT  J -41 . ? 1_555 ? 
87 FC4 1 DG  J  59  ? DG  J -14 . ? 1_555 ? 
88 FC5 2 ASN C  38  ? ASN C 38  . ? 1_555 ? 
89 FC5 2 ASN G  38  ? ASN G 38  . ? 1_555 ? 
90 FC6 1 DG  I  99  ? DG  I 26  . ? 1_555 ? 
91 FC7 1 DA  J  1   ? DA  J -72 . ? 1_555 ? 
92 FC8 3 DG  J  136 ? DG  J 63  . ? 1_555 ? 
93 FC8 3 DG  J  137 ? DG  J 64  . ? 1_555 ? 
94 FC8 3 PT  AB .   ? PT  J 84  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3REI 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3REI 
_atom_sites.fract_transf_matrix[1][1]   0.009445 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009099 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005504 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
PT 
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . PRO A  1 38  ? -60.758 -29.836 80.666 1.00 104.25 ? 38   PRO A N     1 
ATOM   2     C  CA    . PRO A  1 38  ? -59.780 -28.901 80.097 1.00 104.05 ? 38   PRO A CA    1 
ATOM   3     C  C     . PRO A  1 38  ? -58.455 -29.603 79.739 1.00 103.64 ? 38   PRO A C     1 
ATOM   4     O  O     . PRO A  1 38  ? -57.829 -30.234 80.606 1.00 103.64 ? 38   PRO A O     1 
ATOM   5     C  CB    . PRO A  1 38  ? -59.580 -27.881 81.229 1.00 104.20 ? 38   PRO A CB    1 
ATOM   6     C  CG    . PRO A  1 38  ? -59.806 -28.688 82.506 1.00 104.39 ? 38   PRO A CG    1 
ATOM   7     C  CD    . PRO A  1 38  ? -60.749 -29.834 82.144 1.00 104.38 ? 38   PRO A CD    1 
ATOM   8     N  N     . HIS A  1 39  ? -58.039 -29.488 78.475 1.00 102.89 ? 39   HIS A N     1 
ATOM   9     C  CA    . HIS A  1 39  ? -56.886 -30.248 77.950 1.00 101.89 ? 39   HIS A CA    1 
ATOM   10    C  C     . HIS A  1 39  ? -55.706 -29.394 77.460 1.00 100.33 ? 39   HIS A C     1 
ATOM   11    O  O     . HIS A  1 39  ? -55.894 -28.352 76.823 1.00 100.02 ? 39   HIS A O     1 
ATOM   12    C  CB    . HIS A  1 39  ? -57.331 -31.191 76.827 1.00 102.39 ? 39   HIS A CB    1 
ATOM   13    C  CG    . HIS A  1 39  ? -56.249 -32.114 76.365 1.00 104.17 ? 39   HIS A CG    1 
ATOM   14    N  ND1   . HIS A  1 39  ? -55.420 -31.814 75.303 1.00 105.25 ? 39   HIS A ND1   1 
ATOM   15    C  CD2   . HIS A  1 39  ? -55.840 -33.318 76.841 1.00 105.31 ? 39   HIS A CD2   1 
ATOM   16    C  CE1   . HIS A  1 39  ? -54.559 -32.804 75.133 1.00 105.98 ? 39   HIS A CE1   1 
ATOM   17    N  NE2   . HIS A  1 39  ? -54.792 -33.728 76.053 1.00 105.75 ? 39   HIS A NE2   1 
ATOM   18    N  N     . ARG A  1 40  ? -54.491 -29.865 77.734 1.00 98.46  ? 40   ARG A N     1 
ATOM   19    C  CA    . ARG A  1 40  ? -53.299 -29.081 77.421 1.00 96.69  ? 40   ARG A CA    1 
ATOM   20    C  C     . ARG A  1 40  ? -52.070 -29.907 77.017 1.00 95.37  ? 40   ARG A C     1 
ATOM   21    O  O     . ARG A  1 40  ? -51.619 -30.797 77.761 1.00 94.94  ? 40   ARG A O     1 
ATOM   22    C  CB    . ARG A  1 40  ? -52.959 -28.167 78.596 1.00 96.71  ? 40   ARG A CB    1 
ATOM   23    C  CG    . ARG A  1 40  ? -52.235 -26.921 78.190 1.00 96.33  ? 40   ARG A CG    1 
ATOM   24    C  CD    . ARG A  1 40  ? -52.158 -25.946 79.341 1.00 95.46  ? 40   ARG A CD    1 
ATOM   25    N  NE    . ARG A  1 40  ? -51.188 -24.888 79.079 1.00 94.58  ? 40   ARG A NE    1 
ATOM   26    C  CZ    . ARG A  1 40  ? -51.403 -23.856 78.271 1.00 94.62  ? 40   ARG A CZ    1 
ATOM   27    N  NH1   . ARG A  1 40  ? -52.563 -23.722 77.633 1.00 94.13  ? 40   ARG A NH1   1 
ATOM   28    N  NH2   . ARG A  1 40  ? -50.452 -22.950 78.103 1.00 94.90  ? 40   ARG A NH2   1 
ATOM   29    N  N     . TYR A  1 41  ? -51.539 -29.587 75.834 1.00 93.65  ? 41   TYR A N     1 
ATOM   30    C  CA    . TYR A  1 41  ? -50.318 -30.206 75.315 1.00 91.97  ? 41   TYR A CA    1 
ATOM   31    C  C     . TYR A  1 41  ? -49.085 -29.488 75.865 1.00 90.74  ? 41   TYR A C     1 
ATOM   32    O  O     . TYR A  1 41  ? -49.063 -28.263 75.938 1.00 90.28  ? 41   TYR A O     1 
ATOM   33    C  CB    . TYR A  1 41  ? -50.305 -30.189 73.777 1.00 91.74  ? 41   TYR A CB    1 
ATOM   34    C  CG    . TYR A  1 41  ? -51.224 -31.194 73.116 1.00 91.03  ? 41   TYR A CG    1 
ATOM   35    C  CD1   . TYR A  1 41  ? -52.264 -30.778 72.285 1.00 90.60  ? 41   TYR A CD1   1 
ATOM   36    C  CD2   . TYR A  1 41  ? -51.046 -32.566 73.314 1.00 91.14  ? 41   TYR A CD2   1 
ATOM   37    C  CE1   . TYR A  1 41  ? -53.111 -31.706 71.674 1.00 90.83  ? 41   TYR A CE1   1 
ATOM   38    C  CE2   . TYR A  1 41  ? -51.886 -33.503 72.712 1.00 90.82  ? 41   TYR A CE2   1 
ATOM   39    C  CZ    . TYR A  1 41  ? -52.910 -33.068 71.891 1.00 90.90  ? 41   TYR A CZ    1 
ATOM   40    O  OH    . TYR A  1 41  ? -53.732 -33.998 71.298 1.00 91.26  ? 41   TYR A OH    1 
ATOM   41    N  N     . ARG A  1 42  ? -48.069 -30.255 76.246 1.00 89.52  ? 42   ARG A N     1 
ATOM   42    C  CA    . ARG A  1 42  ? -46.875 -29.692 76.871 1.00 88.85  ? 42   ARG A CA    1 
ATOM   43    C  C     . ARG A  1 42  ? -46.014 -28.934 75.859 1.00 88.19  ? 42   ARG A C     1 
ATOM   44    O  O     . ARG A  1 42  ? -45.981 -29.294 74.669 1.00 88.28  ? 42   ARG A O     1 
ATOM   45    C  CB    . ARG A  1 42  ? -46.051 -30.779 77.572 1.00 88.88  ? 42   ARG A CB    1 
ATOM   46    C  CG    . ARG A  1 42  ? -46.894 -31.919 78.119 1.00 89.79  ? 42   ARG A CG    1 
ATOM   47    C  CD    . ARG A  1 42  ? -46.649 -32.168 79.586 1.00 91.08  ? 42   ARG A CD    1 
ATOM   48    N  NE    . ARG A  1 42  ? -45.633 -33.189 79.811 1.00 93.60  ? 42   ARG A NE    1 
ATOM   49    C  CZ    . ARG A  1 42  ? -45.256 -33.609 81.016 1.00 95.29  ? 42   ARG A CZ    1 
ATOM   50    N  NH1   . ARG A  1 42  ? -45.810 -33.088 82.104 1.00 95.89  ? 42   ARG A NH1   1 
ATOM   51    N  NH2   . ARG A  1 42  ? -44.326 -34.554 81.141 1.00 96.12  ? 42   ARG A NH2   1 
ATOM   52    N  N     . PRO A  1 43  ? -45.322 -27.872 76.325 1.00 87.22  ? 43   PRO A N     1 
ATOM   53    C  CA    . PRO A  1 43  ? -44.416 -27.091 75.488 1.00 86.21  ? 43   PRO A CA    1 
ATOM   54    C  C     . PRO A  1 43  ? -43.525 -28.000 74.667 1.00 85.03  ? 43   PRO A C     1 
ATOM   55    O  O     . PRO A  1 43  ? -42.768 -28.774 75.244 1.00 84.66  ? 43   PRO A O     1 
ATOM   56    C  CB    . PRO A  1 43  ? -43.572 -26.344 76.512 1.00 86.28  ? 43   PRO A CB    1 
ATOM   57    C  CG    . PRO A  1 43  ? -44.494 -26.126 77.637 1.00 87.04  ? 43   PRO A CG    1 
ATOM   58    C  CD    . PRO A  1 43  ? -45.370 -27.349 77.704 1.00 87.14  ? 43   PRO A CD    1 
ATOM   59    N  N     . GLY A  1 44  ? -43.645 -27.922 73.341 1.00 83.93  ? 44   GLY A N     1 
ATOM   60    C  CA    . GLY A  1 44  ? -42.788 -28.692 72.430 1.00 82.76  ? 44   GLY A CA    1 
ATOM   61    C  C     . GLY A  1 44  ? -43.473 -29.875 71.769 1.00 82.02  ? 44   GLY A C     1 
ATOM   62    O  O     . GLY A  1 44  ? -42.972 -30.428 70.788 1.00 82.23  ? 44   GLY A O     1 
ATOM   63    N  N     . THR A  1 45  ? -44.620 -30.270 72.311 1.00 81.12  ? 45   THR A N     1 
ATOM   64    C  CA    . THR A  1 45  ? -45.371 -31.389 71.775 1.00 80.01  ? 45   THR A CA    1 
ATOM   65    C  C     . THR A  1 45  ? -45.964 -30.969 70.455 1.00 79.27  ? 45   THR A C     1 
ATOM   66    O  O     . THR A  1 45  ? -45.938 -31.719 69.486 1.00 79.53  ? 45   THR A O     1 
ATOM   67    C  CB    . THR A  1 45  ? -46.486 -31.836 72.750 1.00 80.13  ? 45   THR A CB    1 
ATOM   68    O  OG1   . THR A  1 45  ? -45.874 -32.368 73.939 1.00 80.32  ? 45   THR A OG1   1 
ATOM   69    C  CG2   . THR A  1 45  ? -47.370 -32.920 72.123 1.00 79.75  ? 45   THR A CG2   1 
ATOM   70    N  N     . VAL A  1 46  ? -46.488 -29.755 70.417 1.00 78.37  ? 46   VAL A N     1 
ATOM   71    C  CA    . VAL A  1 46  ? -47.094 -29.241 69.201 1.00 77.50  ? 46   VAL A CA    1 
ATOM   72    C  C     . VAL A  1 46  ? -45.993 -28.857 68.213 1.00 76.83  ? 46   VAL A C     1 
ATOM   73    O  O     . VAL A  1 46  ? -46.172 -28.991 66.996 1.00 76.74  ? 46   VAL A O     1 
ATOM   74    C  CB    . VAL A  1 46  ? -48.042 -28.048 69.484 1.00 77.41  ? 46   VAL A CB    1 
ATOM   75    C  CG1   . VAL A  1 46  ? -48.967 -27.808 68.303 1.00 77.20  ? 46   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A  1 46  ? -48.869 -28.323 70.730 1.00 77.29  ? 46   VAL A CG2   1 
ATOM   77    N  N     . ALA A  1 47  ? -44.854 -28.400 68.739 1.00 75.75  ? 47   ALA A N     1 
ATOM   78    C  CA    . ALA A  1 47  ? -43.729 -28.010 67.892 1.00 74.64  ? 47   ALA A CA    1 
ATOM   79    C  C     . ALA A  1 47  ? -43.282 -29.204 67.042 1.00 74.22  ? 47   ALA A C     1 
ATOM   80    O  O     . ALA A  1 47  ? -43.240 -29.115 65.810 1.00 74.00  ? 47   ALA A O     1 
ATOM   81    C  CB    . ALA A  1 47  ? -42.598 -27.454 68.719 1.00 74.23  ? 47   ALA A CB    1 
ATOM   82    N  N     . LEU A  1 48  ? -42.999 -30.331 67.694 1.00 73.58  ? 48   LEU A N     1 
ATOM   83    C  CA    . LEU A  1 48  ? -42.665 -31.566 66.988 1.00 73.30  ? 48   LEU A CA    1 
ATOM   84    C  C     . LEU A  1 48  ? -43.733 -31.920 65.947 1.00 73.16  ? 48   LEU A C     1 
ATOM   85    O  O     . LEU A  1 48  ? -43.433 -32.355 64.829 1.00 72.88  ? 48   LEU A O     1 
ATOM   86    C  CB    . LEU A  1 48  ? -42.508 -32.705 67.989 1.00 73.34  ? 48   LEU A CB    1 
ATOM   87    C  CG    . LEU A  1 48  ? -41.130 -33.085 68.534 1.00 73.61  ? 48   LEU A CG    1 
ATOM   88    C  CD1   . LEU A  1 48  ? -40.067 -32.017 68.300 1.00 74.83  ? 48   LEU A CD1   1 
ATOM   89    C  CD2   . LEU A  1 48  ? -41.246 -33.406 70.006 1.00 73.82  ? 48   LEU A CD2   1 
ATOM   90    N  N     . ARG A  1 49  ? -44.985 -31.707 66.331 1.00 72.99  ? 49   ARG A N     1 
ATOM   91    C  CA    . ARG A  1 49  ? -46.122 -31.994 65.478 1.00 72.92  ? 49   ARG A CA    1 
ATOM   92    C  C     . ARG A  1 49  ? -46.092 -31.119 64.229 1.00 72.40  ? 49   ARG A C     1 
ATOM   93    O  O     . ARG A  1 49  ? -46.463 -31.566 63.142 1.00 72.40  ? 49   ARG A O     1 
ATOM   94    C  CB    . ARG A  1 49  ? -47.413 -31.802 66.280 1.00 73.03  ? 49   ARG A CB    1 
ATOM   95    C  CG    . ARG A  1 49  ? -48.687 -32.111 65.532 1.00 74.03  ? 49   ARG A CG    1 
ATOM   96    C  CD    . ARG A  1 49  ? -49.755 -32.728 66.442 1.00 75.42  ? 49   ARG A CD    1 
ATOM   97    N  NE    . ARG A  1 49  ? -50.543 -31.726 67.149 1.00 74.85  ? 49   ARG A NE    1 
ATOM   98    C  CZ    . ARG A  1 49  ? -50.710 -31.706 68.468 1.00 75.35  ? 49   ARG A CZ    1 
ATOM   99    N  NH1   . ARG A  1 49  ? -50.162 -32.653 69.230 1.00 74.08  ? 49   ARG A NH1   1 
ATOM   100   N  NH2   . ARG A  1 49  ? -51.434 -30.737 69.021 1.00 75.94  ? 49   ARG A NH2   1 
ATOM   101   N  N     . GLU A  1 50  ? -45.626 -29.882 64.389 1.00 72.03  ? 50   GLU A N     1 
ATOM   102   C  CA    . GLU A  1 50  ? -45.480 -28.954 63.264 1.00 71.74  ? 50   GLU A CA    1 
ATOM   103   C  C     . GLU A  1 50  ? -44.265 -29.298 62.370 1.00 70.96  ? 50   GLU A C     1 
ATOM   104   O  O     . GLU A  1 50  ? -44.353 -29.230 61.126 1.00 70.78  ? 50   GLU A O     1 
ATOM   105   C  CB    . GLU A  1 50  ? -45.439 -27.509 63.760 1.00 71.35  ? 50   GLU A CB    1 
ATOM   106   C  CG    . GLU A  1 50  ? -46.695 -27.091 64.535 1.00 72.61  ? 50   GLU A CG    1 
ATOM   107   C  CD    . GLU A  1 50  ? -46.689 -25.627 64.992 1.00 73.47  ? 50   GLU A CD    1 
ATOM   108   O  OE1   . GLU A  1 50  ? -45.721 -24.885 64.699 1.00 76.73  ? 50   GLU A OE1   1 
ATOM   109   O  OE2   . GLU A  1 50  ? -47.674 -25.201 65.646 1.00 75.85  ? 50   GLU A OE2   1 
ATOM   110   N  N     . ILE A  1 51  ? -43.147 -29.684 62.983 1.00 70.00  ? 51   ILE A N     1 
ATOM   111   C  CA    . ILE A  1 51  ? -41.993 -30.106 62.193 1.00 69.61  ? 51   ILE A CA    1 
ATOM   112   C  C     . ILE A  1 51  ? -42.419 -31.189 61.224 1.00 70.24  ? 51   ILE A C     1 
ATOM   113   O  O     . ILE A  1 51  ? -42.209 -31.055 60.023 1.00 70.53  ? 51   ILE A O     1 
ATOM   114   C  CB    . ILE A  1 51  ? -40.802 -30.593 63.047 1.00 69.24  ? 51   ILE A CB    1 
ATOM   115   C  CG1   . ILE A  1 51  ? -40.164 -29.419 63.789 1.00 68.23  ? 51   ILE A CG1   1 
ATOM   116   C  CG2   . ILE A  1 51  ? -39.765 -31.235 62.169 1.00 68.07  ? 51   ILE A CG2   1 
ATOM   117   C  CD1   . ILE A  1 51  ? -39.315 -29.815 64.976 1.00 66.75  ? 51   ILE A CD1   1 
ATOM   118   N  N     . ARG A  1 52  ? -43.052 -32.239 61.752 1.00 70.94  ? 52   ARG A N     1 
ATOM   119   C  CA    . ARG A  1 52  ? -43.519 -33.376 60.956 1.00 71.62  ? 52   ARG A CA    1 
ATOM   120   C  C     . ARG A  1 52  ? -44.451 -32.928 59.845 1.00 71.35  ? 52   ARG A C     1 
ATOM   121   O  O     . ARG A  1 52  ? -44.308 -33.352 58.693 1.00 71.23  ? 52   ARG A O     1 
ATOM   122   C  CB    . ARG A  1 52  ? -44.190 -34.425 61.849 1.00 71.38  ? 52   ARG A CB    1 
ATOM   123   C  CG    . ARG A  1 52  ? -43.225 -35.074 62.830 1.00 72.69  ? 52   ARG A CG    1 
ATOM   124   C  CD    . ARG A  1 52  ? -43.760 -36.332 63.505 1.00 74.14  ? 52   ARG A CD    1 
ATOM   125   N  NE    . ARG A  1 52  ? -42.644 -37.108 64.058 1.00 80.87  ? 52   ARG A NE    1 
ATOM   126   C  CZ    . ARG A  1 52  ? -42.216 -37.041 65.325 1.00 83.53  ? 52   ARG A CZ    1 
ATOM   127   N  NH1   . ARG A  1 52  ? -42.824 -36.256 66.218 1.00 83.32  ? 52   ARG A NH1   1 
ATOM   128   N  NH2   . ARG A  1 52  ? -41.171 -37.774 65.704 1.00 85.57  ? 52   ARG A NH2   1 
ATOM   129   N  N     . ARG A  1 53  ? -45.379 -32.042 60.193 1.00 71.51  ? 53   ARG A N     1 
ATOM   130   C  CA    . ARG A  1 53  ? -46.320 -31.499 59.234 1.00 72.26  ? 53   ARG A CA    1 
ATOM   131   C  C     . ARG A  1 53  ? -45.663 -30.735 58.083 1.00 72.30  ? 53   ARG A C     1 
ATOM   132   O  O     . ARG A  1 53  ? -45.989 -30.959 56.914 1.00 72.65  ? 53   ARG A O     1 
ATOM   133   C  CB    . ARG A  1 53  ? -47.314 -30.583 59.933 1.00 72.64  ? 53   ARG A CB    1 
ATOM   134   C  CG    . ARG A  1 53  ? -48.405 -30.107 59.014 1.00 74.60  ? 53   ARG A CG    1 
ATOM   135   C  CD    . ARG A  1 53  ? -49.178 -28.980 59.628 1.00 78.55  ? 53   ARG A CD    1 
ATOM   136   N  NE    . ARG A  1 53  ? -50.108 -28.425 58.649 1.00 81.88  ? 53   ARG A NE    1 
ATOM   137   C  CZ    . ARG A  1 53  ? -50.915 -27.388 58.870 1.00 83.36  ? 53   ARG A CZ    1 
ATOM   138   N  NH1   . ARG A  1 53  ? -50.919 -26.767 60.046 1.00 83.07  ? 53   ARG A NH1   1 
ATOM   139   N  NH2   . ARG A  1 53  ? -51.724 -26.972 57.901 1.00 84.74  ? 53   ARG A NH2   1 
ATOM   140   N  N     . TYR A  1 54  ? -44.758 -29.816 58.406 1.00 72.23  ? 54   TYR A N     1 
ATOM   141   C  CA    . TYR A  1 54  ? -44.188 -28.956 57.362 1.00 71.69  ? 54   TYR A CA    1 
ATOM   142   C  C     . TYR A  1 54  ? -43.025 -29.612 56.627 1.00 70.98  ? 54   TYR A C     1 
ATOM   143   O  O     . TYR A  1 54  ? -42.667 -29.185 55.529 1.00 70.82  ? 54   TYR A O     1 
ATOM   144   C  CB    . TYR A  1 54  ? -43.832 -27.573 57.916 1.00 71.99  ? 54   TYR A CB    1 
ATOM   145   C  CG    . TYR A  1 54  ? -45.063 -26.816 58.337 1.00 72.10  ? 54   TYR A CG    1 
ATOM   146   C  CD1   . TYR A  1 54  ? -45.329 -26.558 59.681 1.00 73.20  ? 54   TYR A CD1   1 
ATOM   147   C  CD2   . TYR A  1 54  ? -45.989 -26.397 57.389 1.00 72.99  ? 54   TYR A CD2   1 
ATOM   148   C  CE1   . TYR A  1 54  ? -46.494 -25.862 60.075 1.00 73.56  ? 54   TYR A CE1   1 
ATOM   149   C  CE2   . TYR A  1 54  ? -47.150 -25.718 57.758 1.00 74.24  ? 54   TYR A CE2   1 
ATOM   150   C  CZ    . TYR A  1 54  ? -47.403 -25.451 59.103 1.00 73.67  ? 54   TYR A CZ    1 
ATOM   151   O  OH    . TYR A  1 54  ? -48.565 -24.780 59.447 1.00 72.74  ? 54   TYR A OH    1 
ATOM   152   N  N     . GLN A  1 55  ? -42.448 -30.651 57.218 1.00 70.00  ? 55   GLN A N     1 
ATOM   153   C  CA    . GLN A  1 55  ? -41.429 -31.401 56.512 1.00 69.55  ? 55   GLN A CA    1 
ATOM   154   C  C     . GLN A  1 55  ? -42.062 -32.381 55.539 1.00 69.96  ? 55   GLN A C     1 
ATOM   155   O  O     . GLN A  1 55  ? -41.403 -32.868 54.624 1.00 70.31  ? 55   GLN A O     1 
ATOM   156   C  CB    . GLN A  1 55  ? -40.470 -32.082 57.471 1.00 68.92  ? 55   GLN A CB    1 
ATOM   157   C  CG    . GLN A  1 55  ? -39.498 -31.107 58.093 1.00 67.91  ? 55   GLN A CG    1 
ATOM   158   C  CD    . GLN A  1 55  ? -38.413 -31.775 58.892 1.00 66.83  ? 55   GLN A CD    1 
ATOM   159   O  OE1   . GLN A  1 55  ? -38.356 -32.991 58.993 1.00 68.03  ? 55   GLN A OE1   1 
ATOM   160   N  NE2   . GLN A  1 55  ? -37.543 -30.978 59.470 1.00 66.73  ? 55   GLN A NE2   1 
ATOM   161   N  N     . LYS A  1 56  ? -43.349 -32.655 55.720 1.00 70.45  ? 56   LYS A N     1 
ATOM   162   C  CA    . LYS A  1 56  ? -44.077 -33.505 54.788 1.00 70.97  ? 56   LYS A CA    1 
ATOM   163   C  C     . LYS A  1 56  ? -44.513 -32.731 53.561 1.00 70.62  ? 56   LYS A C     1 
ATOM   164   O  O     . LYS A  1 56  ? -44.497 -33.264 52.452 1.00 70.55  ? 56   LYS A O     1 
ATOM   165   C  CB    . LYS A  1 56  ? -45.305 -34.119 55.450 1.00 71.36  ? 56   LYS A CB    1 
ATOM   166   C  CG    . LYS A  1 56  ? -45.177 -35.593 55.710 1.00 74.00  ? 56   LYS A CG    1 
ATOM   167   C  CD    . LYS A  1 56  ? -46.161 -36.015 56.809 1.00 79.60  ? 56   LYS A CD    1 
ATOM   168   C  CE    . LYS A  1 56  ? -45.524 -37.043 57.793 1.00 81.01  ? 56   LYS A CE    1 
ATOM   169   N  NZ    . LYS A  1 56  ? -46.162 -36.986 59.155 1.00 80.62  ? 56   LYS A NZ    1 
ATOM   170   N  N     . SER A  1 57  ? -44.909 -31.474 53.758 1.00 70.40  ? 57   SER A N     1 
ATOM   171   C  CA    . SER A  1 57  ? -45.455 -30.682 52.663 1.00 70.20  ? 57   SER A CA    1 
ATOM   172   C  C     . SER A  1 57  ? -44.433 -29.792 51.953 1.00 70.38  ? 57   SER A C     1 
ATOM   173   O  O     . SER A  1 57  ? -43.258 -29.726 52.331 1.00 70.10  ? 57   SER A O     1 
ATOM   174   C  CB    . SER A  1 57  ? -46.625 -29.854 53.155 1.00 70.03  ? 57   SER A CB    1 
ATOM   175   O  OG    . SER A  1 57  ? -46.216 -29.024 54.211 1.00 70.17  ? 57   SER A OG    1 
ATOM   176   N  N     . THR A  1 58  ? -44.906 -29.103 50.915 1.00 70.75  ? 58   THR A N     1 
ATOM   177   C  CA    . THR A  1 58  ? -44.064 -28.269 50.066 1.00 70.46  ? 58   THR A CA    1 
ATOM   178   C  C     . THR A  1 58  ? -44.677 -26.890 49.761 1.00 70.54  ? 58   THR A C     1 
ATOM   179   O  O     . THR A  1 58  ? -44.109 -26.110 48.989 1.00 70.55  ? 58   THR A O     1 
ATOM   180   C  CB    . THR A  1 58  ? -43.791 -28.976 48.739 1.00 70.22  ? 58   THR A CB    1 
ATOM   181   O  OG1   . THR A  1 58  ? -44.987 -28.976 47.973 1.00 71.27  ? 58   THR A OG1   1 
ATOM   182   C  CG2   . THR A  1 58  ? -43.373 -30.414 48.958 1.00 70.42  ? 58   THR A CG2   1 
ATOM   183   N  N     . GLU A  1 59  ? -45.837 -26.580 50.338 1.00 70.64  ? 59   GLU A N     1 
ATOM   184   C  CA    . GLU A  1 59  ? -46.427 -25.265 50.079 1.00 71.01  ? 59   GLU A CA    1 
ATOM   185   C  C     . GLU A  1 59  ? -45.603 -24.150 50.709 1.00 70.82  ? 59   GLU A C     1 
ATOM   186   O  O     . GLU A  1 59  ? -44.903 -24.360 51.719 1.00 70.60  ? 59   GLU A O     1 
ATOM   187   C  CB    . GLU A  1 59  ? -47.913 -25.135 50.472 1.00 71.06  ? 59   GLU A CB    1 
ATOM   188   C  CG    . GLU A  1 59  ? -48.524 -26.198 51.388 1.00 74.24  ? 59   GLU A CG    1 
ATOM   189   C  CD    . GLU A  1 59  ? -47.949 -26.203 52.791 1.00 78.10  ? 59   GLU A CD    1 
ATOM   190   O  OE1   . GLU A  1 59  ? -48.600 -25.645 53.706 1.00 78.89  ? 59   GLU A OE1   1 
ATOM   191   O  OE2   . GLU A  1 59  ? -46.845 -26.772 52.976 1.00 80.42  ? 59   GLU A OE2   1 
ATOM   192   N  N     . LEU A  1 60  ? -45.681 -22.979 50.080 1.00 70.21  ? 60   LEU A N     1 
ATOM   193   C  CA    . LEU A  1 60  ? -45.074 -21.783 50.602 1.00 69.89  ? 60   LEU A CA    1 
ATOM   194   C  C     . LEU A  1 60  ? -45.688 -21.460 51.941 1.00 69.62  ? 60   LEU A C     1 
ATOM   195   O  O     . LEU A  1 60  ? -46.880 -21.647 52.155 1.00 69.63  ? 60   LEU A O     1 
ATOM   196   C  CB    . LEU A  1 60  ? -45.253 -20.618 49.639 1.00 70.05  ? 60   LEU A CB    1 
ATOM   197   C  CG    . LEU A  1 60  ? -44.625 -20.788 48.252 1.00 71.24  ? 60   LEU A CG    1 
ATOM   198   C  CD1   . LEU A  1 60  ? -44.973 -19.567 47.394 1.00 72.48  ? 60   LEU A CD1   1 
ATOM   199   C  CD2   . LEU A  1 60  ? -43.096 -21.015 48.325 1.00 72.28  ? 60   LEU A CD2   1 
ATOM   200   N  N     . LEU A  1 61  ? -44.853 -20.983 52.848 1.00 69.46  ? 61   LEU A N     1 
ATOM   201   C  CA    . LEU A  1 61  ? -45.253 -20.832 54.219 1.00 69.45  ? 61   LEU A CA    1 
ATOM   202   C  C     . LEU A  1 61  ? -45.340 -19.365 54.572 1.00 69.72  ? 61   LEU A C     1 
ATOM   203   O  O     . LEU A  1 61  ? -45.650 -19.012 55.705 1.00 69.62  ? 61   LEU A O     1 
ATOM   204   C  CB    . LEU A  1 61  ? -44.280 -21.596 55.122 1.00 69.48  ? 61   LEU A CB    1 
ATOM   205   C  CG    . LEU A  1 61  ? -44.032 -23.067 54.736 1.00 68.91  ? 61   LEU A CG    1 
ATOM   206   C  CD1   . LEU A  1 61  ? -42.847 -23.659 55.487 1.00 67.08  ? 61   LEU A CD1   1 
ATOM   207   C  CD2   . LEU A  1 61  ? -45.292 -23.918 54.926 1.00 67.81  ? 61   LEU A CD2   1 
ATOM   208   N  N     . ILE A  1 62  ? -45.075 -18.514 53.584 1.00 70.33  ? 62   ILE A N     1 
ATOM   209   C  CA    . ILE A  1 62  ? -45.309 -17.077 53.708 1.00 71.24  ? 62   ILE A CA    1 
ATOM   210   C  C     . ILE A  1 62  ? -46.507 -16.710 52.841 1.00 72.07  ? 62   ILE A C     1 
ATOM   211   O  O     . ILE A  1 62  ? -46.621 -17.186 51.710 1.00 72.43  ? 62   ILE A O     1 
ATOM   212   C  CB    . ILE A  1 62  ? -44.073 -16.264 53.267 1.00 71.25  ? 62   ILE A CB    1 
ATOM   213   C  CG1   . ILE A  1 62  ? -42.865 -16.644 54.106 1.00 69.92  ? 62   ILE A CG1   1 
ATOM   214   C  CG2   . ILE A  1 62  ? -44.329 -14.736 53.367 1.00 71.38  ? 62   ILE A CG2   1 
ATOM   215   C  CD1   . ILE A  1 62  ? -41.591 -16.138 53.535 1.00 71.51  ? 62   ILE A CD1   1 
ATOM   216   N  N     . ARG A  1 63  ? -47.403 -15.874 53.362 1.00 73.17  ? 63   ARG A N     1 
ATOM   217   C  CA    . ARG A  1 63  ? -48.594 -15.459 52.594 1.00 74.25  ? 63   ARG A CA    1 
ATOM   218   C  C     . ARG A  1 63  ? -48.157 -14.644 51.378 1.00 74.11  ? 63   ARG A C     1 
ATOM   219   O  O     . ARG A  1 63  ? -47.326 -13.752 51.500 1.00 74.03  ? 63   ARG A O     1 
ATOM   220   C  CB    . ARG A  1 63  ? -49.566 -14.636 53.456 1.00 74.71  ? 63   ARG A CB    1 
ATOM   221   C  CG    . ARG A  1 63  ? -49.720 -15.085 54.910 1.00 76.81  ? 63   ARG A CG    1 
ATOM   222   C  CD    . ARG A  1 63  ? -50.851 -16.082 55.109 1.00 82.49  ? 63   ARG A CD    1 
ATOM   223   N  NE    . ARG A  1 63  ? -52.181 -15.548 54.750 1.00 87.12  ? 63   ARG A NE    1 
ATOM   224   C  CZ    . ARG A  1 63  ? -52.910 -14.700 55.490 1.00 88.27  ? 63   ARG A CZ    1 
ATOM   225   N  NH1   . ARG A  1 63  ? -52.462 -14.223 56.652 1.00 88.61  ? 63   ARG A NH1   1 
ATOM   226   N  NH2   . ARG A  1 63  ? -54.102 -14.308 55.051 1.00 89.28  ? 63   ARG A NH2   1 
ATOM   227   N  N     . LYS A  1 64  ? -48.708 -14.956 50.210 1.00 74.52  ? 64   LYS A N     1 
ATOM   228   C  CA    . LYS A  1 64  ? -48.262 -14.331 48.955 1.00 75.16  ? 64   LYS A CA    1 
ATOM   229   C  C     . LYS A  1 64  ? -48.240 -12.789 48.940 1.00 75.01  ? 64   LYS A C     1 
ATOM   230   O  O     . LYS A  1 64  ? -47.265 -12.176 48.498 1.00 75.24  ? 64   LYS A O     1 
ATOM   231   C  CB    . LYS A  1 64  ? -49.056 -14.880 47.768 1.00 75.22  ? 64   LYS A CB    1 
ATOM   232   C  CG    . LYS A  1 64  ? -48.872 -16.381 47.599 1.00 78.19  ? 64   LYS A CG    1 
ATOM   233   C  CD    . LYS A  1 64  ? -49.134 -16.847 46.171 1.00 82.13  ? 64   LYS A CD    1 
ATOM   234   C  CE    . LYS A  1 64  ? -48.808 -18.348 46.044 1.00 84.55  ? 64   LYS A CE    1 
ATOM   235   N  NZ    . LYS A  1 64  ? -48.842 -18.758 44.587 1.00 86.77  ? 64   LYS A NZ    1 
ATOM   236   N  N     . LEU A  1 65  ? -49.296 -12.162 49.434 1.00 74.76  ? 65   LEU A N     1 
ATOM   237   C  CA    . LEU A  1 65  ? -49.443 -10.724 49.252 1.00 74.71  ? 65   LEU A CA    1 
ATOM   238   C  C     . LEU A  1 65  ? -48.406 -9.902  50.017 1.00 73.74  ? 65   LEU A C     1 
ATOM   239   O  O     . LEU A  1 65  ? -47.773 -9.037  49.414 1.00 73.74  ? 65   LEU A O     1 
ATOM   240   C  CB    . LEU A  1 65  ? -50.880 -10.256 49.563 1.00 75.07  ? 65   LEU A CB    1 
ATOM   241   C  CG    . LEU A  1 65  ? -51.143 -8.741  49.590 1.00 75.74  ? 65   LEU A CG    1 
ATOM   242   C  CD1   . LEU A  1 65  ? -51.161 -8.143  48.182 1.00 75.69  ? 65   LEU A CD1   1 
ATOM   243   C  CD2   . LEU A  1 65  ? -52.449 -8.453  50.316 1.00 75.60  ? 65   LEU A CD2   1 
ATOM   244   N  N     . PRO A  1 66  ? -48.250 -10.149 51.341 1.00 72.98  ? 66   PRO A N     1 
ATOM   245   C  CA    . PRO A  1 66  ? -47.235 -9.434  52.113 1.00 72.42  ? 66   PRO A CA    1 
ATOM   246   C  C     . PRO A  1 66  ? -45.848 -9.550  51.491 1.00 72.21  ? 66   PRO A C     1 
ATOM   247   O  O     . PRO A  1 66  ? -45.121 -8.553  51.433 1.00 72.26  ? 66   PRO A O     1 
ATOM   248   C  CB    . PRO A  1 66  ? -47.250 -10.130 53.482 1.00 72.38  ? 66   PRO A CB    1 
ATOM   249   C  CG    . PRO A  1 66  ? -48.179 -11.245 53.385 1.00 72.68  ? 66   PRO A CG    1 
ATOM   250   C  CD    . PRO A  1 66  ? -49.040 -11.057 52.191 1.00 72.84  ? 66   PRO A CD    1 
ATOM   251   N  N     . PHE A  1 67  ? -45.501 -10.754 51.024 1.00 71.64  ? 67   PHE A N     1 
ATOM   252   C  CA    . PHE A  1 67  ? -44.229 -10.999 50.358 1.00 70.75  ? 67   PHE A CA    1 
ATOM   253   C  C     . PHE A  1 67  ? -44.099 -10.147 49.112 1.00 71.10  ? 67   PHE A C     1 
ATOM   254   O  O     . PHE A  1 67  ? -43.022 -9.632  48.818 1.00 71.68  ? 67   PHE A O     1 
ATOM   255   C  CB    . PHE A  1 67  ? -44.075 -12.478 49.991 1.00 70.21  ? 67   PHE A CB    1 
ATOM   256   C  CG    . PHE A  1 67  ? -42.724 -12.824 49.404 1.00 68.74  ? 67   PHE A CG    1 
ATOM   257   C  CD1   . PHE A  1 67  ? -41.627 -13.059 50.234 1.00 66.15  ? 67   PHE A CD1   1 
ATOM   258   C  CD2   . PHE A  1 67  ? -42.550 -12.916 48.022 1.00 66.93  ? 67   PHE A CD2   1 
ATOM   259   C  CE1   . PHE A  1 67  ? -40.393 -13.355 49.699 1.00 65.14  ? 67   PHE A CE1   1 
ATOM   260   C  CE2   . PHE A  1 67  ? -41.303 -13.225 47.485 1.00 65.13  ? 67   PHE A CE2   1 
ATOM   261   C  CZ    . PHE A  1 67  ? -40.229 -13.441 48.322 1.00 64.97  ? 67   PHE A CZ    1 
ATOM   262   N  N     . GLN A  1 68  ? -45.190 -9.989  48.378 1.00 71.33  ? 68   GLN A N     1 
ATOM   263   C  CA    . GLN A  1 68  ? -45.138 -9.225  47.140 1.00 71.84  ? 68   GLN A CA    1 
ATOM   264   C  C     . GLN A  1 68  ? -44.907 -7.731  47.386 1.00 71.26  ? 68   GLN A C     1 
ATOM   265   O  O     . GLN A  1 68  ? -44.146 -7.078  46.650 1.00 71.23  ? 68   GLN A O     1 
ATOM   266   C  CB    . GLN A  1 68  ? -46.401 -9.435  46.327 1.00 72.23  ? 68   GLN A CB    1 
ATOM   267   C  CG    . GLN A  1 68  ? -46.113 -9.401  44.859 1.00 76.01  ? 68   GLN A CG    1 
ATOM   268   C  CD    . GLN A  1 68  ? -47.362 -9.238  44.034 1.00 81.32  ? 68   GLN A CD    1 
ATOM   269   O  OE1   . GLN A  1 68  ? -48.211 -8.385  44.344 1.00 84.91  ? 68   GLN A OE1   1 
ATOM   270   N  NE2   . GLN A  1 68  ? -47.489 -10.041 42.966 1.00 80.77  ? 68   GLN A NE2   1 
ATOM   271   N  N     . ARG A  1 69  ? -45.554 -7.183  48.412 1.00 70.03  ? 69   ARG A N     1 
ATOM   272   C  CA    . ARG A  1 69  ? -45.329 -5.789  48.722 1.00 69.22  ? 69   ARG A CA    1 
ATOM   273   C  C     . ARG A  1 69  ? -43.853 -5.593  49.004 1.00 68.61  ? 69   ARG A C     1 
ATOM   274   O  O     . ARG A  1 69  ? -43.225 -4.693  48.427 1.00 68.65  ? 69   ARG A O     1 
ATOM   275   C  CB    . ARG A  1 69  ? -46.170 -5.317  49.907 1.00 69.40  ? 69   ARG A CB    1 
ATOM   276   C  CG    . ARG A  1 69  ? -47.649 -5.148  49.604 1.00 69.71  ? 69   ARG A CG    1 
ATOM   277   C  CD    . ARG A  1 69  ? -48.311 -4.258  50.647 1.00 70.89  ? 69   ARG A CD    1 
ATOM   278   N  NE    . ARG A  1 69  ? -48.209 -4.783  52.015 1.00 71.22  ? 69   ARG A NE    1 
ATOM   279   C  CZ    . ARG A  1 69  ? -49.054 -5.665  52.556 1.00 71.79  ? 69   ARG A CZ    1 
ATOM   280   N  NH1   . ARG A  1 69  ? -50.071 -6.157  51.846 1.00 71.63  ? 69   ARG A NH1   1 
ATOM   281   N  NH2   . ARG A  1 69  ? -48.876 -6.074  53.812 1.00 72.08  ? 69   ARG A NH2   1 
ATOM   282   N  N     . LEU A  1 70  ? -43.296 -6.462  49.858 1.00 67.51  ? 70   LEU A N     1 
ATOM   283   C  CA    . LEU A  1 70  ? -41.893 -6.357  50.263 1.00 66.65  ? 70   LEU A CA    1 
ATOM   284   C  C     . LEU A  1 70  ? -40.954 -6.426  49.070 1.00 66.02  ? 70   LEU A C     1 
ATOM   285   O  O     . LEU A  1 70  ? -40.035 -5.626  48.959 1.00 66.03  ? 70   LEU A O     1 
ATOM   286   C  CB    . LEU A  1 70  ? -41.529 -7.411  51.302 1.00 66.37  ? 70   LEU A CB    1 
ATOM   287   C  CG    . LEU A  1 70  ? -40.095 -7.323  51.848 1.00 66.31  ? 70   LEU A CG    1 
ATOM   288   C  CD1   . LEU A  1 70  ? -39.840 -6.100  52.713 1.00 64.87  ? 70   LEU A CD1   1 
ATOM   289   C  CD2   . LEU A  1 70  ? -39.739 -8.600  52.617 1.00 67.23  ? 70   LEU A CD2   1 
ATOM   290   N  N     . VAL A  1 71  ? -41.208 -7.358  48.166 1.00 65.35  ? 71   VAL A N     1 
ATOM   291   C  CA    . VAL A  1 71  ? -40.451 -7.444  46.932 1.00 65.25  ? 71   VAL A CA    1 
ATOM   292   C  C     . VAL A  1 71  ? -40.480 -6.118  46.163 1.00 65.40  ? 71   VAL A C     1 
ATOM   293   O  O     . VAL A  1 71  ? -39.444 -5.635  45.718 1.00 65.31  ? 71   VAL A O     1 
ATOM   294   C  CB    . VAL A  1 71  ? -40.954 -8.630  46.068 1.00 65.50  ? 71   VAL A CB    1 
ATOM   295   C  CG1   . VAL A  1 71  ? -40.348 -8.614  44.678 1.00 65.49  ? 71   VAL A CG1   1 
ATOM   296   C  CG2   . VAL A  1 71  ? -40.644 -9.949  46.747 1.00 64.60  ? 71   VAL A CG2   1 
ATOM   297   N  N     . ARG A  1 72  ? -41.658 -5.509  46.044 1.00 66.13  ? 72   ARG A N     1 
ATOM   298   C  CA    . ARG A  1 72  ? -41.826 -4.263  45.254 1.00 66.42  ? 72   ARG A CA    1 
ATOM   299   C  C     . ARG A  1 72  ? -41.169 -3.043  45.893 1.00 66.25  ? 72   ARG A C     1 
ATOM   300   O  O     . ARG A  1 72  ? -40.543 -2.242  45.198 1.00 65.96  ? 72   ARG A O     1 
ATOM   301   C  CB    . ARG A  1 72  ? -43.304 -4.007  44.951 1.00 66.53  ? 72   ARG A CB    1 
ATOM   302   C  CG    . ARG A  1 72  ? -43.915 -5.067  44.005 1.00 66.91  ? 72   ARG A CG    1 
ATOM   303   C  CD    . ARG A  1 72  ? -45.434 -4.937  43.892 1.00 66.98  ? 72   ARG A CD    1 
ATOM   304   N  NE    . ARG A  1 72  ? -46.035 -6.083  43.202 1.00 68.68  ? 72   ARG A NE    1 
ATOM   305   C  CZ    . ARG A  1 72  ? -46.088 -6.240  41.873 1.00 68.64  ? 72   ARG A CZ    1 
ATOM   306   N  NH1   . ARG A  1 72  ? -45.572 -5.324  41.059 1.00 67.19  ? 72   ARG A NH1   1 
ATOM   307   N  NH2   . ARG A  1 72  ? -46.653 -7.332  41.358 1.00 68.43  ? 72   ARG A NH2   1 
ATOM   308   N  N     . GLU A  1 73  ? -41.295 -2.927  47.211 1.00 66.39  ? 73   GLU A N     1 
ATOM   309   C  CA    . GLU A  1 73  ? -40.611 -1.901  47.985 1.00 67.34  ? 73   GLU A CA    1 
ATOM   310   C  C     . GLU A  1 73  ? -39.094 -1.969  47.802 1.00 67.43  ? 73   GLU A C     1 
ATOM   311   O  O     . GLU A  1 73  ? -38.443 -0.954  47.529 1.00 67.78  ? 73   GLU A O     1 
ATOM   312   C  CB    . GLU A  1 73  ? -40.972 -2.054  49.461 1.00 67.16  ? 73   GLU A CB    1 
ATOM   313   C  CG    . GLU A  1 73  ? -40.292 -1.065  50.402 1.00 68.84  ? 73   GLU A CG    1 
ATOM   314   C  CD    . GLU A  1 73  ? -40.524 -1.401  51.886 1.00 70.04  ? 73   GLU A CD    1 
ATOM   315   O  OE1   . GLU A  1 73  ? -41.690 -1.661  52.269 1.00 73.09  ? 73   GLU A OE1   1 
ATOM   316   O  OE2   . GLU A  1 73  ? -39.540 -1.397  52.672 1.00 73.37  ? 73   GLU A OE2   1 
ATOM   317   N  N     . ILE A  1 74  ? -38.525 -3.165  47.955 1.00 67.54  ? 74   ILE A N     1 
ATOM   318   C  CA    . ILE A  1 74  ? -37.091 -3.349  47.766 1.00 67.36  ? 74   ILE A CA    1 
ATOM   319   C  C     . ILE A  1 74  ? -36.681 -3.000  46.331 1.00 67.92  ? 74   ILE A C     1 
ATOM   320   O  O     . ILE A  1 74  ? -35.626 -2.411  46.117 1.00 68.06  ? 74   ILE A O     1 
ATOM   321   C  CB    . ILE A  1 74  ? -36.623 -4.786  48.190 1.00 67.09  ? 74   ILE A CB    1 
ATOM   322   C  CG1   . ILE A  1 74  ? -36.647 -4.917  49.716 1.00 66.13  ? 74   ILE A CG1   1 
ATOM   323   C  CG2   . ILE A  1 74  ? -35.230 -5.077  47.693 1.00 65.59  ? 74   ILE A CG2   1 
ATOM   324   C  CD1   . ILE A  1 74  ? -36.768 -6.329  50.256 1.00 64.55  ? 74   ILE A CD1   1 
ATOM   325   N  N     . ALA A  1 75  ? -37.516 -3.349  45.356 1.00 68.60  ? 75   ALA A N     1 
ATOM   326   C  CA    . ALA A  1 75  ? -37.198 -3.076  43.955 1.00 69.79  ? 75   ALA A CA    1 
ATOM   327   C  C     . ALA A  1 75  ? -37.322 -1.591  43.615 1.00 70.96  ? 75   ALA A C     1 
ATOM   328   O  O     . ALA A  1 75  ? -36.565 -1.070  42.786 1.00 71.15  ? 75   ALA A O     1 
ATOM   329   C  CB    . ALA A  1 75  ? -38.057 -3.909  43.041 1.00 69.17  ? 75   ALA A CB    1 
ATOM   330   N  N     . GLN A  1 76  ? -38.264 -0.912  44.268 1.00 72.34  ? 76   GLN A N     1 
ATOM   331   C  CA    . GLN A  1 76  ? -38.457 0.527   44.086 1.00 74.09  ? 76   GLN A CA    1 
ATOM   332   C  C     . GLN A  1 76  ? -37.151 1.301   44.293 1.00 74.80  ? 76   GLN A C     1 
ATOM   333   O  O     . GLN A  1 76  ? -36.915 2.296   43.607 1.00 75.32  ? 76   GLN A O     1 
ATOM   334   C  CB    . GLN A  1 76  ? -39.551 1.045   45.036 1.00 74.37  ? 76   GLN A CB    1 
ATOM   335   C  CG    . GLN A  1 76  ? -40.044 2.486   44.791 1.00 76.37  ? 76   GLN A CG    1 
ATOM   336   C  CD    . GLN A  1 76  ? -40.816 2.675   43.474 1.00 78.94  ? 76   GLN A CD    1 
ATOM   337   O  OE1   . GLN A  1 76  ? -41.482 1.760   42.981 1.00 80.53  ? 76   GLN A OE1   1 
ATOM   338   N  NE2   . GLN A  1 76  ? -40.728 3.875   42.910 1.00 78.91  ? 76   GLN A NE2   1 
ATOM   339   N  N     . ASP A  1 77  ? -36.312 0.834   45.225 1.00 75.45  ? 77   ASP A N     1 
ATOM   340   C  CA    . ASP A  1 77  ? -35.005 1.439   45.501 1.00 75.86  ? 77   ASP A CA    1 
ATOM   341   C  C     . ASP A  1 77  ? -33.987 1.259   44.375 1.00 76.07  ? 77   ASP A C     1 
ATOM   342   O  O     . ASP A  1 77  ? -32.906 1.839   44.432 1.00 76.22  ? 77   ASP A O     1 
ATOM   343   C  CB    . ASP A  1 77  ? -34.410 0.868   46.784 1.00 76.12  ? 77   ASP A CB    1 
ATOM   344   C  CG    . ASP A  1 77  ? -35.042 1.443   48.045 1.00 78.20  ? 77   ASP A CG    1 
ATOM   345   O  OD1   . ASP A  1 77  ? -35.494 0.645   48.897 1.00 79.25  ? 77   ASP A OD1   1 
ATOM   346   O  OD2   . ASP A  1 77  ? -35.073 2.690   48.206 1.00 81.28  ? 77   ASP A OD2   1 
ATOM   347   N  N     . PHE A  1 78  ? -34.307 0.459   43.361 1.00 76.25  ? 78   PHE A N     1 
ATOM   348   C  CA    . PHE A  1 78  ? -33.341 0.202   42.295 1.00 76.99  ? 78   PHE A CA    1 
ATOM   349   C  C     . PHE A  1 78  ? -33.800 0.808   40.996 1.00 77.49  ? 78   PHE A C     1 
ATOM   350   O  O     . PHE A  1 78  ? -33.001 1.308   40.218 1.00 77.44  ? 78   PHE A O     1 
ATOM   351   C  CB    . PHE A  1 78  ? -33.071 -1.311  42.122 1.00 77.04  ? 78   PHE A CB    1 
ATOM   352   C  CG    . PHE A  1 78  ? -32.484 -1.972  43.353 1.00 77.10  ? 78   PHE A CG    1 
ATOM   353   C  CD1   . PHE A  1 78  ? -33.128 -3.051  43.953 1.00 76.25  ? 78   PHE A CD1   1 
ATOM   354   C  CD2   . PHE A  1 78  ? -31.309 -1.486  43.933 1.00 76.34  ? 78   PHE A CD2   1 
ATOM   355   C  CE1   . PHE A  1 78  ? -32.595 -3.654  45.095 1.00 75.64  ? 78   PHE A CE1   1 
ATOM   356   C  CE2   . PHE A  1 78  ? -30.783 -2.075  45.077 1.00 76.63  ? 78   PHE A CE2   1 
ATOM   357   C  CZ    . PHE A  1 78  ? -31.425 -3.161  45.656 1.00 76.01  ? 78   PHE A CZ    1 
ATOM   358   N  N     . LYS A  1 79  ? -35.098 0.717   40.753 1.00 78.59  ? 79   LYS A N     1 
ATOM   359   C  CA    . LYS A  1 79  ? -35.736 1.365   39.618 1.00 79.48  ? 79   LYS A CA    1 
ATOM   360   C  C     . LYS A  1 79  ? -37.170 1.666   39.992 1.00 79.72  ? 79   LYS A C     1 
ATOM   361   O  O     . LYS A  1 79  ? -37.834 0.863   40.665 1.00 79.98  ? 79   LYS A O     1 
ATOM   362   C  CB    . LYS A  1 79  ? -35.704 0.491   38.372 1.00 79.55  ? 79   LYS A CB    1 
ATOM   363   C  CG    . LYS A  1 79  ? -35.976 1.288   37.107 1.00 81.22  ? 79   LYS A CG    1 
ATOM   364   C  CD    . LYS A  1 79  ? -35.984 0.403   35.881 1.00 83.46  ? 79   LYS A CD    1 
ATOM   365   C  CE    . LYS A  1 79  ? -36.300 1.200   34.610 1.00 84.72  ? 79   LYS A CE    1 
ATOM   366   N  NZ    . LYS A  1 79  ? -36.355 0.273   33.417 1.00 84.86  ? 79   LYS A NZ    1 
ATOM   367   N  N     . THR A  1 80  ? -37.638 2.833   39.564 1.00 80.11  ? 80   THR A N     1 
ATOM   368   C  CA    . THR A  1 80  ? -39.001 3.268   39.841 1.00 80.27  ? 80   THR A CA    1 
ATOM   369   C  C     . THR A  1 80  ? -39.960 2.777   38.757 1.00 80.07  ? 80   THR A C     1 
ATOM   370   O  O     . THR A  1 80  ? -39.549 2.503   37.628 1.00 79.56  ? 80   THR A O     1 
ATOM   371   C  CB    . THR A  1 80  ? -39.065 4.791   39.979 1.00 80.51  ? 80   THR A CB    1 
ATOM   372   O  OG1   . THR A  1 80  ? -38.496 5.411   38.810 1.00 81.11  ? 80   THR A OG1   1 
ATOM   373   C  CG2   . THR A  1 80  ? -38.293 5.241   41.222 1.00 80.81  ? 80   THR A CG2   1 
ATOM   374   N  N     . ASP A  1 81  ? -41.231 2.638   39.126 1.00 80.47  ? 81   ASP A N     1 
ATOM   375   C  CA    . ASP A  1 81  ? -42.301 2.196   38.206 1.00 81.08  ? 81   ASP A CA    1 
ATOM   376   C  C     . ASP A  1 81  ? -41.983 0.878   37.504 1.00 80.67  ? 81   ASP A C     1 
ATOM   377   O  O     . ASP A  1 81  ? -41.855 0.823   36.284 1.00 80.74  ? 81   ASP A O     1 
ATOM   378   C  CB    . ASP A  1 81  ? -42.673 3.290   37.175 1.00 81.49  ? 81   ASP A CB    1 
ATOM   379   C  CG    . ASP A  1 81  ? -44.008 3.010   36.480 1.00 83.04  ? 81   ASP A CG    1 
ATOM   380   O  OD1   . ASP A  1 81  ? -44.967 2.584   37.177 1.00 83.92  ? 81   ASP A OD1   1 
ATOM   381   O  OD2   . ASP A  1 81  ? -44.095 3.210   35.240 1.00 84.50  ? 81   ASP A OD2   1 
ATOM   382   N  N     . LEU A  1 82  ? -41.847 -0.179  38.291 1.00 80.45  ? 82   LEU A N     1 
ATOM   383   C  CA    . LEU A  1 82  ? -41.590 -1.494  37.745 1.00 80.07  ? 82   LEU A CA    1 
ATOM   384   C  C     . LEU A  1 82  ? -42.823 -2.357  37.853 1.00 79.93  ? 82   LEU A C     1 
ATOM   385   O  O     . LEU A  1 82  ? -43.587 -2.253  38.805 1.00 80.15  ? 82   LEU A O     1 
ATOM   386   C  CB    . LEU A  1 82  ? -40.428 -2.177  38.474 1.00 79.98  ? 82   LEU A CB    1 
ATOM   387   C  CG    . LEU A  1 82  ? -38.980 -1.959  38.017 1.00 79.47  ? 82   LEU A CG    1 
ATOM   388   C  CD1   . LEU A  1 82  ? -38.062 -2.773  38.910 1.00 78.55  ? 82   LEU A CD1   1 
ATOM   389   C  CD2   . LEU A  1 82  ? -38.743 -2.325  36.549 1.00 78.08  ? 82   LEU A CD2   1 
ATOM   390   N  N     . ARG A  1 83  ? -43.011 -3.217  36.866 1.00 79.87  ? 83   ARG A N     1 
ATOM   391   C  CA    . ARG A  1 83  ? -44.016 -4.258  36.967 1.00 79.93  ? 83   ARG A CA    1 
ATOM   392   C  C     . ARG A  1 83  ? -43.319 -5.612  37.121 1.00 79.18  ? 83   ARG A C     1 
ATOM   393   O  O     . ARG A  1 83  ? -42.126 -5.766  36.796 1.00 78.80  ? 83   ARG A O     1 
ATOM   394   C  CB    . ARG A  1 83  ? -44.938 -4.228  35.752 1.00 80.58  ? 83   ARG A CB    1 
ATOM   395   C  CG    . ARG A  1 83  ? -45.429 -2.813  35.425 1.00 83.36  ? 83   ARG A CG    1 
ATOM   396   C  CD    . ARG A  1 83  ? -46.426 -2.826  34.286 1.00 87.93  ? 83   ARG A CD    1 
ATOM   397   N  NE    . ARG A  1 83  ? -47.793 -2.735  34.796 1.00 91.71  ? 83   ARG A NE    1 
ATOM   398   C  CZ    . ARG A  1 83  ? -48.870 -3.191  34.157 1.00 93.47  ? 83   ARG A CZ    1 
ATOM   399   N  NH1   . ARG A  1 83  ? -48.743 -3.795  32.976 1.00 94.18  ? 83   ARG A NH1   1 
ATOM   400   N  NH2   . ARG A  1 83  ? -50.076 -3.056  34.708 1.00 93.84  ? 83   ARG A NH2   1 
ATOM   401   N  N     . PHE A  1 84  ? -44.065 -6.587  37.623 1.00 78.00  ? 84   PHE A N     1 
ATOM   402   C  CA    . PHE A  1 84  ? -43.508 -7.885  37.925 1.00 76.83  ? 84   PHE A CA    1 
ATOM   403   C  C     . PHE A  1 84  ? -44.324 -8.988  37.284 1.00 75.86  ? 84   PHE A C     1 
ATOM   404   O  O     . PHE A  1 84  ? -45.522 -9.079  37.541 1.00 75.92  ? 84   PHE A O     1 
ATOM   405   C  CB    . PHE A  1 84  ? -43.521 -8.088  39.438 1.00 77.06  ? 84   PHE A CB    1 
ATOM   406   C  CG    . PHE A  1 84  ? -42.278 -7.621  40.126 1.00 77.70  ? 84   PHE A CG    1 
ATOM   407   C  CD1   . PHE A  1 84  ? -42.210 -6.346  40.676 1.00 78.33  ? 84   PHE A CD1   1 
ATOM   408   C  CD2   . PHE A  1 84  ? -41.168 -8.467  40.242 1.00 78.38  ? 84   PHE A CD2   1 
ATOM   409   C  CE1   . PHE A  1 84  ? -41.045 -5.906  41.323 1.00 79.24  ? 84   PHE A CE1   1 
ATOM   410   C  CE2   . PHE A  1 84  ? -39.999 -8.045  40.888 1.00 77.85  ? 84   PHE A CE2   1 
ATOM   411   C  CZ    . PHE A  1 84  ? -39.934 -6.764  41.426 1.00 78.42  ? 84   PHE A CZ    1 
ATOM   412   N  N     . GLN A  1 85  ? -43.697 -9.840  36.471 1.00 74.57  ? 85   GLN A N     1 
ATOM   413   C  CA    . GLN A  1 85  ? -44.348 -11.114 36.132 1.00 73.55  ? 85   GLN A CA    1 
ATOM   414   C  C     . GLN A  1 85  ? -44.731 -11.876 37.396 1.00 73.09  ? 85   GLN A C     1 
ATOM   415   O  O     . GLN A  1 85  ? -43.990 -11.881 38.379 1.00 73.23  ? 85   GLN A O     1 
ATOM   416   C  CB    . GLN A  1 85  ? -43.479 -11.986 35.246 1.00 73.09  ? 85   GLN A CB    1 
ATOM   417   C  CG    . GLN A  1 85  ? -43.743 -11.733 33.810 1.00 72.71  ? 85   GLN A CG    1 
ATOM   418   C  CD    . GLN A  1 85  ? -42.808 -12.459 32.890 1.00 72.99  ? 85   GLN A CD    1 
ATOM   419   O  OE1   . GLN A  1 85  ? -42.158 -13.442 33.264 1.00 73.42  ? 85   GLN A OE1   1 
ATOM   420   N  NE2   . GLN A  1 85  ? -42.732 -11.976 31.658 1.00 73.05  ? 85   GLN A NE2   1 
ATOM   421   N  N     . SER A  1 86  ? -45.904 -12.502 37.365 1.00 72.40  ? 86   SER A N     1 
ATOM   422   C  CA    . SER A  1 86  ? -46.406 -13.295 38.476 1.00 71.54  ? 86   SER A CA    1 
ATOM   423   C  C     . SER A  1 86  ? -45.441 -14.418 38.824 1.00 70.37  ? 86   SER A C     1 
ATOM   424   O  O     . SER A  1 86  ? -45.168 -14.656 39.987 1.00 70.24  ? 86   SER A O     1 
ATOM   425   C  CB    . SER A  1 86  ? -47.771 -13.884 38.122 1.00 71.82  ? 86   SER A CB    1 
ATOM   426   O  OG    . SER A  1 86  ? -48.271 -14.645 39.211 1.00 73.46  ? 86   SER A OG    1 
ATOM   427   N  N     . SER A  1 87  ? -44.935 -15.104 37.809 1.00 69.28  ? 87   SER A N     1 
ATOM   428   C  CA    . SER A  1 87  ? -43.991 -16.184 38.007 1.00 68.68  ? 87   SER A CA    1 
ATOM   429   C  C     . SER A  1 87  ? -42.670 -15.676 38.561 1.00 68.44  ? 87   SER A C     1 
ATOM   430   O  O     . SER A  1 87  ? -41.953 -16.424 39.214 1.00 68.36  ? 87   SER A O     1 
ATOM   431   C  CB    . SER A  1 87  ? -43.725 -16.864 36.687 1.00 68.24  ? 87   SER A CB    1 
ATOM   432   O  OG    . SER A  1 87  ? -43.274 -15.895 35.767 1.00 68.80  ? 87   SER A OG    1 
ATOM   433   N  N     . ALA A  1 88  ? -42.351 -14.409 38.283 1.00 68.26  ? 88   ALA A N     1 
ATOM   434   C  CA    . ALA A  1 88  ? -41.124 -13.773 38.781 1.00 67.43  ? 88   ALA A CA    1 
ATOM   435   C  C     . ALA A  1 88  ? -41.156 -13.625 40.283 1.00 66.76  ? 88   ALA A C     1 
ATOM   436   O  O     . ALA A  1 88  ? -40.171 -13.907 40.959 1.00 66.81  ? 88   ALA A O     1 
ATOM   437   C  CB    . ALA A  1 88  ? -40.909 -12.424 38.138 1.00 67.55  ? 88   ALA A CB    1 
ATOM   438   N  N     . VAL A  1 89  ? -42.291 -13.179 40.801 1.00 66.11  ? 89   VAL A N     1 
ATOM   439   C  CA    . VAL A  1 89  ? -42.473 -13.064 42.243 1.00 65.73  ? 89   VAL A CA    1 
ATOM   440   C  C     . VAL A  1 89  ? -42.446 -14.447 42.858 1.00 65.60  ? 89   VAL A C     1 
ATOM   441   O  O     . VAL A  1 89  ? -41.829 -14.643 43.901 1.00 65.63  ? 89   VAL A O     1 
ATOM   442   C  CB    . VAL A  1 89  ? -43.787 -12.355 42.604 1.00 65.20  ? 89   VAL A CB    1 
ATOM   443   C  CG1   . VAL A  1 89  ? -43.920 -12.226 44.103 1.00 65.40  ? 89   VAL A CG1   1 
ATOM   444   C  CG2   . VAL A  1 89  ? -43.812 -10.986 41.984 1.00 65.37  ? 89   VAL A CG2   1 
ATOM   445   N  N     . MET A  1 90  ? -43.105 -15.395 42.188 1.00 65.65  ? 90   MET A N     1 
ATOM   446   C  CA    . MET A  1 90  ? -43.143 -16.788 42.611 1.00 65.81  ? 90   MET A CA    1 
ATOM   447   C  C     . MET A  1 90  ? -41.735 -17.395 42.693 1.00 64.58  ? 90   MET A C     1 
ATOM   448   O  O     . MET A  1 90  ? -41.377 -17.982 43.710 1.00 64.50  ? 90   MET A O     1 
ATOM   449   C  CB    . MET A  1 90  ? -44.039 -17.601 41.683 1.00 66.47  ? 90   MET A CB    1 
ATOM   450   C  CG    . MET A  1 90  ? -45.511 -17.419 41.952 1.00 70.56  ? 90   MET A CG    1 
ATOM   451   S  SD    . MET A  1 90  ? -45.966 -17.783 43.676 1.00 81.97  ? 90   MET A SD    1 
ATOM   452   C  CE    . MET A  1 90  ? -45.894 -19.597 43.699 1.00 79.87  ? 90   MET A CE    1 
ATOM   453   N  N     . ALA A  1 91  ? -40.936 -17.223 41.642 1.00 62.97  ? 91   ALA A N     1 
ATOM   454   C  CA    . ALA A  1 91  ? -39.555 -17.661 41.667 1.00 61.78  ? 91   ALA A CA    1 
ATOM   455   C  C     . ALA A  1 91  ? -38.828 -17.115 42.908 1.00 61.33  ? 91   ALA A C     1 
ATOM   456   O  O     . ALA A  1 91  ? -38.122 -17.851 43.592 1.00 61.20  ? 91   ALA A O     1 
ATOM   457   C  CB    . ALA A  1 91  ? -38.843 -17.260 40.391 1.00 61.14  ? 91   ALA A CB    1 
ATOM   458   N  N     . LEU A  1 92  ? -39.033 -15.838 43.216 1.00 60.50  ? 92   LEU A N     1 
ATOM   459   C  CA    . LEU A  1 92  ? -38.358 -15.224 44.347 1.00 59.96  ? 92   LEU A CA    1 
ATOM   460   C  C     . LEU A  1 92  ? -38.814 -15.822 45.642 1.00 59.49  ? 92   LEU A C     1 
ATOM   461   O  O     . LEU A  1 92  ? -38.011 -15.989 46.562 1.00 59.34  ? 92   LEU A O     1 
ATOM   462   C  CB    . LEU A  1 92  ? -38.579 -13.711 44.393 1.00 60.14  ? 92   LEU A CB    1 
ATOM   463   C  CG    . LEU A  1 92  ? -37.686 -12.851 43.495 1.00 60.73  ? 92   LEU A CG    1 
ATOM   464   C  CD1   . LEU A  1 92  ? -38.285 -11.458 43.336 1.00 60.70  ? 92   LEU A CD1   1 
ATOM   465   C  CD2   . LEU A  1 92  ? -36.248 -12.784 43.986 1.00 59.70  ? 92   LEU A CD2   1 
ATOM   466   N  N     . GLN A  1 93  ? -40.097 -16.145 45.732 1.00 59.18  ? 93   GLN A N     1 
ATOM   467   C  CA    . GLN A  1 93  ? -40.585 -16.713 46.972 1.00 59.26  ? 93   GLN A CA    1 
ATOM   468   C  C     . GLN A  1 93  ? -40.010 -18.102 47.202 1.00 59.17  ? 93   GLN A C     1 
ATOM   469   O  O     . GLN A  1 93  ? -39.509 -18.408 48.294 1.00 59.57  ? 93   GLN A O     1 
ATOM   470   C  CB    . GLN A  1 93  ? -42.100 -16.717 47.059 1.00 58.92  ? 93   GLN A CB    1 
ATOM   471   C  CG    . GLN A  1 93  ? -42.537 -16.738 48.512 1.00 60.34  ? 93   GLN A CG    1 
ATOM   472   C  CD    . GLN A  1 93  ? -44.028 -16.602 48.704 1.00 62.59  ? 93   GLN A CD    1 
ATOM   473   O  OE1   . GLN A  1 93  ? -44.735 -16.115 47.827 1.00 65.10  ? 93   GLN A OE1   1 
ATOM   474   N  NE2   . GLN A  1 93  ? -44.517 -17.033 49.865 1.00 62.88  ? 93   GLN A NE2   1 
ATOM   475   N  N     . GLU A  1 94  ? -40.068 -18.926 46.167 1.00 58.41  ? 94   GLU A N     1 
ATOM   476   C  CA    . GLU A  1 94  ? -39.502 -20.235 46.225 1.00 58.26  ? 94   GLU A CA    1 
ATOM   477   C  C     . GLU A  1 94  ? -38.049 -20.172 46.693 1.00 57.55  ? 94   GLU A C     1 
ATOM   478   O  O     . GLU A  1 94  ? -37.668 -20.910 47.597 1.00 57.60  ? 94   GLU A O     1 
ATOM   479   C  CB    . GLU A  1 94  ? -39.601 -20.904 44.860 1.00 58.83  ? 94   GLU A CB    1 
ATOM   480   C  CG    . GLU A  1 94  ? -41.010 -21.273 44.463 1.00 61.65  ? 94   GLU A CG    1 
ATOM   481   C  CD    . GLU A  1 94  ? -41.561 -22.490 45.195 1.00 65.55  ? 94   GLU A CD    1 
ATOM   482   O  OE1   . GLU A  1 94  ? -42.805 -22.591 45.293 1.00 69.33  ? 94   GLU A OE1   1 
ATOM   483   O  OE2   . GLU A  1 94  ? -40.774 -23.349 45.665 1.00 66.47  ? 94   GLU A OE2   1 
ATOM   484   N  N     . ALA A  1 95  ? -37.256 -19.284 46.093 1.00 56.69  ? 95   ALA A N     1 
ATOM   485   C  CA    . ALA A  1 95  ? -35.831 -19.175 46.397 1.00 55.83  ? 95   ALA A CA    1 
ATOM   486   C  C     . ALA A  1 95  ? -35.596 -18.664 47.799 1.00 56.07  ? 95   ALA A C     1 
ATOM   487   O  O     . ALA A  1 95  ? -34.684 -19.130 48.473 1.00 56.36  ? 95   ALA A O     1 
ATOM   488   C  CB    . ALA A  1 95  ? -35.133 -18.302 45.407 1.00 55.26  ? 95   ALA A CB    1 
ATOM   489   N  N     . SER A  1 96  ? -36.418 -17.713 48.238 1.00 56.08  ? 96   SER A N     1 
ATOM   490   C  CA    . SER A  1 96  ? -36.276 -17.131 49.563 1.00 56.21  ? 96   SER A CA    1 
ATOM   491   C  C     . SER A  1 96  ? -36.643 -18.106 50.645 1.00 56.28  ? 96   SER A C     1 
ATOM   492   O  O     . SER A  1 96  ? -36.029 -18.121 51.705 1.00 56.70  ? 96   SER A O     1 
ATOM   493   C  CB    . SER A  1 96  ? -37.154 -15.898 49.712 1.00 56.10  ? 96   SER A CB    1 
ATOM   494   O  OG    . SER A  1 96  ? -36.645 -14.859 48.909 1.00 57.33  ? 96   SER A OG    1 
ATOM   495   N  N     . GLU A  1 97  ? -37.660 -18.915 50.396 1.00 56.39  ? 97   GLU A N     1 
ATOM   496   C  CA    . GLU A  1 97  ? -38.088 -19.856 51.402 1.00 56.75  ? 97   GLU A CA    1 
ATOM   497   C  C     . GLU A  1 97  ? -37.125 -21.050 51.456 1.00 55.66  ? 97   GLU A C     1 
ATOM   498   O  O     . GLU A  1 97  ? -36.772 -21.508 52.532 1.00 55.80  ? 97   GLU A O     1 
ATOM   499   C  CB    . GLU A  1 97  ? -39.531 -20.270 51.162 1.00 56.72  ? 97   GLU A CB    1 
ATOM   500   C  CG    . GLU A  1 97  ? -40.542 -19.125 51.298 1.00 58.81  ? 97   GLU A CG    1 
ATOM   501   C  CD    . GLU A  1 97  ? -41.982 -19.622 51.608 1.00 59.89  ? 97   GLU A CD    1 
ATOM   502   O  OE1   . GLU A  1 97  ? -42.166 -20.813 51.974 1.00 61.47  ? 97   GLU A OE1   1 
ATOM   503   O  OE2   . GLU A  1 97  ? -42.935 -18.811 51.481 1.00 64.89  ? 97   GLU A OE2   1 
ATOM   504   N  N     . ALA A  1 98  ? -36.683 -21.531 50.298 1.00 54.83  ? 98   ALA A N     1 
ATOM   505   C  CA    . ALA A  1 98  ? -35.598 -22.509 50.234 1.00 53.85  ? 98   ALA A CA    1 
ATOM   506   C  C     . ALA A  1 98  ? -34.414 -22.004 51.068 1.00 53.86  ? 98   ALA A C     1 
ATOM   507   O  O     . ALA A  1 98  ? -33.937 -22.695 51.970 1.00 54.58  ? 98   ALA A O     1 
ATOM   508   C  CB    . ALA A  1 98  ? -35.192 -22.718 48.827 1.00 52.93  ? 98   ALA A CB    1 
ATOM   509   N  N     . TYR A  1 99  ? -33.984 -20.778 50.794 1.00 53.44  ? 99   TYR A N     1 
ATOM   510   C  CA    . TYR A  1 99  ? -32.880 -20.155 51.492 1.00 52.96  ? 99   TYR A CA    1 
ATOM   511   C  C     . TYR A  1 99  ? -33.092 -20.168 52.995 1.00 53.33  ? 99   TYR A C     1 
ATOM   512   O  O     . TYR A  1 99  ? -32.253 -20.702 53.736 1.00 53.99  ? 99   TYR A O     1 
ATOM   513   C  CB    . TYR A  1 99  ? -32.653 -18.726 50.986 1.00 53.03  ? 99   TYR A CB    1 
ATOM   514   C  CG    . TYR A  1 99  ? -31.647 -17.953 51.808 1.00 52.88  ? 99   TYR A CG    1 
ATOM   515   C  CD1   . TYR A  1 99  ? -30.271 -18.138 51.630 1.00 53.31  ? 99   TYR A CD1   1 
ATOM   516   C  CD2   . TYR A  1 99  ? -32.065 -17.073 52.788 1.00 51.77  ? 99   TYR A CD2   1 
ATOM   517   C  CE1   . TYR A  1 99  ? -29.340 -17.454 52.405 1.00 51.47  ? 99   TYR A CE1   1 
ATOM   518   C  CE2   . TYR A  1 99  ? -31.154 -16.390 53.566 1.00 52.29  ? 99   TYR A CE2   1 
ATOM   519   C  CZ    . TYR A  1 99  ? -29.793 -16.584 53.374 1.00 52.83  ? 99   TYR A CZ    1 
ATOM   520   O  OH    . TYR A  1 99  ? -28.894 -15.873 54.151 1.00 54.10  ? 99   TYR A OH    1 
ATOM   521   N  N     . LEU A  1 100 ? -34.202 -19.600 53.458 1.00 53.05  ? 100  LEU A N     1 
ATOM   522   C  CA    . LEU A  1 100 ? -34.419 -19.477 54.894 1.00 52.45  ? 100  LEU A CA    1 
ATOM   523   C  C     . LEU A  1 100 ? -34.598 -20.810 55.579 1.00 52.79  ? 100  LEU A C     1 
ATOM   524   O  O     . LEU A  1 100 ? -34.130 -20.979 56.705 1.00 53.74  ? 100  LEU A O     1 
ATOM   525   C  CB    . LEU A  1 100 ? -35.604 -18.582 55.204 1.00 52.44  ? 100  LEU A CB    1 
ATOM   526   C  CG    . LEU A  1 100 ? -35.433 -17.087 54.911 1.00 52.28  ? 100  LEU A CG    1 
ATOM   527   C  CD1   . LEU A  1 100 ? -36.757 -16.409 55.115 1.00 53.02  ? 100  LEU A CD1   1 
ATOM   528   C  CD2   . LEU A  1 100 ? -34.343 -16.407 55.752 1.00 49.09  ? 100  LEU A CD2   1 
ATOM   529   N  N     . VAL A  1 101 ? -35.251 -21.763 54.914 1.00 52.04  ? 101  VAL A N     1 
ATOM   530   C  CA    . VAL A  1 101 ? -35.404 -23.103 55.476 1.00 51.66  ? 101  VAL A CA    1 
ATOM   531   C  C     . VAL A  1 101 ? -34.033 -23.743 55.691 1.00 51.50  ? 101  VAL A C     1 
ATOM   532   O  O     . VAL A  1 101 ? -33.760 -24.328 56.747 1.00 51.69  ? 101  VAL A O     1 
ATOM   533   C  CB    . VAL A  1 101 ? -36.306 -24.045 54.596 1.00 52.03  ? 101  VAL A CB    1 
ATOM   534   C  CG1   . VAL A  1 101 ? -36.194 -25.483 55.053 1.00 50.41  ? 101  VAL A CG1   1 
ATOM   535   C  CG2   . VAL A  1 101 ? -37.770 -23.615 54.651 1.00 51.47  ? 101  VAL A CG2   1 
ATOM   536   N  N     . ALA A  1 102 ? -33.160 -23.617 54.699 1.00 51.04  ? 102  ALA A N     1 
ATOM   537   C  CA    . ALA A  1 102 ? -31.809 -24.154 54.832 1.00 50.97  ? 102  ALA A CA    1 
ATOM   538   C  C     . ALA A  1 102 ? -31.004 -23.446 55.924 1.00 51.63  ? 102  ALA A C     1 
ATOM   539   O  O     . ALA A  1 102 ? -30.227 -24.087 56.628 1.00 52.69  ? 102  ALA A O     1 
ATOM   540   C  CB    . ALA A  1 102 ? -31.094 -24.098 53.530 1.00 50.17  ? 102  ALA A CB    1 
ATOM   541   N  N     . LEU A  1 103 ? -31.196 -22.138 56.094 1.00 52.01  ? 103  LEU A N     1 
ATOM   542   C  CA    . LEU A  1 103 ? -30.435 -21.407 57.095 1.00 52.04  ? 103  LEU A CA    1 
ATOM   543   C  C     . LEU A  1 103 ? -30.846 -21.810 58.490 1.00 52.60  ? 103  LEU A C     1 
ATOM   544   O  O     . LEU A  1 103 ? -30.021 -21.865 59.391 1.00 52.53  ? 103  LEU A O     1 
ATOM   545   C  CB    . LEU A  1 103 ? -30.598 -19.898 56.918 1.00 52.58  ? 103  LEU A CB    1 
ATOM   546   C  CG    . LEU A  1 103 ? -29.921 -18.946 57.914 1.00 52.18  ? 103  LEU A CG    1 
ATOM   547   C  CD1   . LEU A  1 103 ? -28.418 -19.114 57.858 1.00 50.95  ? 103  LEU A CD1   1 
ATOM   548   C  CD2   . LEU A  1 103 ? -30.334 -17.464 57.657 1.00 51.43  ? 103  LEU A CD2   1 
ATOM   549   N  N     . PHE A  1 104 ? -32.134 -22.082 58.666 1.00 53.49  ? 104  PHE A N     1 
ATOM   550   C  CA    . PHE A  1 104 ? -32.652 -22.609 59.935 1.00 53.75  ? 104  PHE A CA    1 
ATOM   551   C  C     . PHE A  1 104 ? -32.114 -24.006 60.274 1.00 54.32  ? 104  PHE A C     1 
ATOM   552   O  O     . PHE A  1 104 ? -31.964 -24.327 61.444 1.00 54.80  ? 104  PHE A O     1 
ATOM   553   C  CB    . PHE A  1 104 ? -34.190 -22.595 59.954 1.00 53.49  ? 104  PHE A CB    1 
ATOM   554   C  CG    . PHE A  1 104 ? -34.798 -21.215 60.196 1.00 52.25  ? 104  PHE A CG    1 
ATOM   555   C  CD1   . PHE A  1 104 ? -35.700 -20.666 59.293 1.00 51.81  ? 104  PHE A CD1   1 
ATOM   556   C  CD2   . PHE A  1 104 ? -34.477 -20.482 61.330 1.00 49.87  ? 104  PHE A CD2   1 
ATOM   557   C  CE1   . PHE A  1 104 ? -36.280 -19.405 59.527 1.00 50.89  ? 104  PHE A CE1   1 
ATOM   558   C  CE2   . PHE A  1 104 ? -35.025 -19.239 61.551 1.00 50.03  ? 104  PHE A CE2   1 
ATOM   559   C  CZ    . PHE A  1 104 ? -35.939 -18.698 60.647 1.00 49.89  ? 104  PHE A CZ    1 
ATOM   560   N  N     . GLU A  1 105 ? -31.803 -24.834 59.271 1.00 54.55  ? 105  GLU A N     1 
ATOM   561   C  CA    . GLU A  1 105 ? -31.129 -26.103 59.564 1.00 55.11  ? 105  GLU A CA    1 
ATOM   562   C  C     . GLU A  1 105 ? -29.748 -25.847 60.128 1.00 55.04  ? 105  GLU A C     1 
ATOM   563   O  O     . GLU A  1 105 ? -29.419 -26.349 61.188 1.00 56.03  ? 105  GLU A O     1 
ATOM   564   C  CB    . GLU A  1 105 ? -31.057 -27.028 58.357 1.00 54.79  ? 105  GLU A CB    1 
ATOM   565   C  CG    . GLU A  1 105 ? -32.403 -27.461 57.854 1.00 57.88  ? 105  GLU A CG    1 
ATOM   566   C  CD    . GLU A  1 105 ? -32.367 -27.921 56.405 1.00 61.83  ? 105  GLU A CD    1 
ATOM   567   O  OE1   . GLU A  1 105 ? -31.287 -28.401 55.996 1.00 64.69  ? 105  GLU A OE1   1 
ATOM   568   O  OE2   . GLU A  1 105 ? -33.401 -27.802 55.681 1.00 61.89  ? 105  GLU A OE2   1 
ATOM   569   N  N     . ASP A  1 106 ? -28.943 -25.058 59.437 1.00 55.23  ? 106  ASP A N     1 
ATOM   570   C  CA    . ASP A  1 106 ? -27.633 -24.700 59.946 1.00 55.63  ? 106  ASP A CA    1 
ATOM   571   C  C     . ASP A  1 106 ? -27.720 -24.015 61.302 1.00 55.49  ? 106  ASP A C     1 
ATOM   572   O  O     . ASP A  1 106 ? -26.908 -24.279 62.198 1.00 55.74  ? 106  ASP A O     1 
ATOM   573   C  CB    . ASP A  1 106 ? -26.926 -23.819 58.945 1.00 55.85  ? 106  ASP A CB    1 
ATOM   574   C  CG    . ASP A  1 106 ? -26.727 -24.516 57.599 1.00 59.25  ? 106  ASP A CG    1 
ATOM   575   O  OD1   . ASP A  1 106 ? -27.059 -25.728 57.497 1.00 63.19  ? 106  ASP A OD1   1 
ATOM   576   O  OD2   . ASP A  1 106 ? -26.229 -23.866 56.640 1.00 60.33  ? 106  ASP A OD2   1 
ATOM   577   N  N     . THR A  1 107 ? -28.723 -23.155 61.472 1.00 55.24  ? 107  THR A N     1 
ATOM   578   C  CA    . THR A  1 107 ? -28.894 -22.410 62.718 1.00 54.78  ? 107  THR A CA    1 
ATOM   579   C  C     . THR A  1 107 ? -29.113 -23.408 63.858 1.00 54.80  ? 107  THR A C     1 
ATOM   580   O  O     . THR A  1 107 ? -28.471 -23.333 64.907 1.00 54.72  ? 107  THR A O     1 
ATOM   581   C  CB    . THR A  1 107 ? -30.051 -21.403 62.599 1.00 54.85  ? 107  THR A CB    1 
ATOM   582   O  OG1   . THR A  1 107 ? -29.738 -20.443 61.582 1.00 55.94  ? 107  THR A OG1   1 
ATOM   583   C  CG2   . THR A  1 107 ? -30.262 -20.654 63.876 1.00 54.17  ? 107  THR A CG2   1 
ATOM   584   N  N     . ASN A  1 108 ? -29.993 -24.373 63.606 1.00 54.60  ? 108  ASN A N     1 
ATOM   585   C  CA    . ASN A  1 108 ? -30.351 -25.385 64.571 1.00 53.84  ? 108  ASN A CA    1 
ATOM   586   C  C     . ASN A  1 108 ? -29.158 -26.245 64.943 1.00 53.51  ? 108  ASN A C     1 
ATOM   587   O  O     . ASN A  1 108 ? -29.002 -26.605 66.107 1.00 54.17  ? 108  ASN A O     1 
ATOM   588   C  CB    . ASN A  1 108 ? -31.480 -26.247 64.023 1.00 54.07  ? 108  ASN A CB    1 
ATOM   589   C  CG    . ASN A  1 108 ? -32.337 -26.843 65.116 1.00 55.21  ? 108  ASN A CG    1 
ATOM   590   O  OD1   . ASN A  1 108 ? -32.503 -26.253 66.178 1.00 57.56  ? 108  ASN A OD1   1 
ATOM   591   N  ND2   . ASN A  1 108 ? -32.895 -28.015 64.860 1.00 56.09  ? 108  ASN A ND2   1 
ATOM   592   N  N     . LEU A  1 109 ? -28.298 -26.559 63.982 1.00 52.64  ? 109  LEU A N     1 
ATOM   593   C  CA    . LEU A  1 109 ? -27.078 -27.271 64.322 1.00 52.56  ? 109  LEU A CA    1 
ATOM   594   C  C     . LEU A  1 109 ? -26.198 -26.419 65.217 1.00 52.66  ? 109  LEU A C     1 
ATOM   595   O  O     . LEU A  1 109 ? -25.597 -26.927 66.149 1.00 53.63  ? 109  LEU A O     1 
ATOM   596   C  CB    . LEU A  1 109 ? -26.313 -27.749 63.085 1.00 52.16  ? 109  LEU A CB    1 
ATOM   597   C  CG    . LEU A  1 109 ? -27.074 -28.720 62.171 1.00 51.51  ? 109  LEU A CG    1 
ATOM   598   C  CD1   . LEU A  1 109 ? -26.355 -28.923 60.881 1.00 51.31  ? 109  LEU A CD1   1 
ATOM   599   C  CD2   . LEU A  1 109 ? -27.298 -30.049 62.824 1.00 48.97  ? 109  LEU A CD2   1 
ATOM   600   N  N     . CYS A  1 110 ? -26.166 -25.117 64.979 1.00 52.80  ? 110  CYS A N     1 
ATOM   601   C  CA    . CYS A  1 110 ? -25.370 -24.217 65.815 1.00 53.09  ? 110  CYS A CA    1 
ATOM   602   C  C     . CYS A  1 110 ? -25.877 -24.111 67.268 1.00 53.21  ? 110  CYS A C     1 
ATOM   603   O  O     . CYS A  1 110 ? -25.094 -24.126 68.213 1.00 52.71  ? 110  CYS A O     1 
ATOM   604   C  CB    . CYS A  1 110 ? -25.292 -22.852 65.143 1.00 53.18  ? 110  CYS A CB    1 
ATOM   605   S  SG    . CYS A  1 110 ? -24.309 -22.890 63.621 1.00 54.87  ? 110  CYS A SG    1 
ATOM   606   N  N     . ALA A  1 111 ? -27.194 -24.031 67.432 1.00 53.56  ? 111  ALA A N     1 
ATOM   607   C  CA    . ALA A  1 111 ? -27.818 -24.067 68.728 1.00 53.82  ? 111  ALA A CA    1 
ATOM   608   C  C     . ALA A  1 111 ? -27.442 -25.362 69.429 1.00 55.06  ? 111  ALA A C     1 
ATOM   609   O  O     . ALA A  1 111 ? -27.001 -25.356 70.580 1.00 55.93  ? 111  ALA A O     1 
ATOM   610   C  CB    . ALA A  1 111 ? -29.301 -23.972 68.570 1.00 54.08  ? 111  ALA A CB    1 
ATOM   611   N  N     . ILE A  1 112 ? -27.594 -26.478 68.729 1.00 55.35  ? 112  ILE A N     1 
ATOM   612   C  CA    . ILE A  1 112 ? -27.296 -27.765 69.310 1.00 55.57  ? 112  ILE A CA    1 
ATOM   613   C  C     . ILE A  1 112 ? -25.808 -27.926 69.633 1.00 56.44  ? 112  ILE A C     1 
ATOM   614   O  O     . ILE A  1 112 ? -25.436 -28.588 70.606 1.00 57.08  ? 112  ILE A O     1 
ATOM   615   C  CB    . ILE A  1 112 ? -27.793 -28.882 68.389 1.00 55.91  ? 112  ILE A CB    1 
ATOM   616   C  CG1   . ILE A  1 112 ? -29.324 -28.928 68.420 1.00 54.55  ? 112  ILE A CG1   1 
ATOM   617   C  CG2   . ILE A  1 112 ? -27.158 -30.234 68.747 1.00 54.22  ? 112  ILE A CG2   1 
ATOM   618   C  CD1   . ILE A  1 112 ? -29.915 -29.635 67.228 1.00 54.81  ? 112  ILE A CD1   1 
ATOM   619   N  N     . HIS A  1 113 ? -24.946 -27.316 68.835 1.00 56.59  ? 113  HIS A N     1 
ATOM   620   C  CA    . HIS A  1 113 ? -23.524 -27.378 69.139 1.00 56.93  ? 113  HIS A CA    1 
ATOM   621   C  C     . HIS A  1 113 ? -23.226 -26.735 70.496 1.00 57.82  ? 113  HIS A C     1 
ATOM   622   O  O     . HIS A  1 113 ? -22.298 -27.128 71.181 1.00 58.06  ? 113  HIS A O     1 
ATOM   623   C  CB    . HIS A  1 113 ? -22.737 -26.672 68.041 1.00 56.56  ? 113  HIS A CB    1 
ATOM   624   C  CG    . HIS A  1 113 ? -21.249 -26.762 68.197 1.00 55.18  ? 113  HIS A CG    1 
ATOM   625   N  ND1   . HIS A  1 113 ? -20.531 -27.884 67.843 1.00 53.16  ? 113  HIS A ND1   1 
ATOM   626   C  CD2   . HIS A  1 113 ? -20.341 -25.857 68.637 1.00 53.10  ? 113  HIS A CD2   1 
ATOM   627   C  CE1   . HIS A  1 113 ? -19.245 -27.665 68.056 1.00 52.29  ? 113  HIS A CE1   1 
ATOM   628   N  NE2   . HIS A  1 113 ? -19.103 -26.447 68.548 1.00 49.67  ? 113  HIS A NE2   1 
ATOM   629   N  N     . ALA A  1 114 ? -24.003 -25.716 70.855 1.00 58.66  ? 114  ALA A N     1 
ATOM   630   C  CA    . ALA A  1 114 ? -23.826 -25.005 72.113 1.00 59.16  ? 114  ALA A CA    1 
ATOM   631   C  C     . ALA A  1 114 ? -24.699 -25.665 73.184 1.00 60.06  ? 114  ALA A C     1 
ATOM   632   O  O     . ALA A  1 114 ? -24.928 -25.107 74.255 1.00 60.09  ? 114  ALA A O     1 
ATOM   633   C  CB    . ALA A  1 114 ? -24.186 -23.551 71.943 1.00 58.56  ? 114  ALA A CB    1 
ATOM   634   N  N     . LYS A  1 115 ? -25.198 -26.861 72.887 1.00 60.83  ? 115  LYS A N     1 
ATOM   635   C  CA    . LYS A  1 115 ? -25.955 -27.629 73.877 1.00 61.93  ? 115  LYS A CA    1 
ATOM   636   C  C     . LYS A  1 115 ? -27.269 -26.958 74.297 1.00 61.08  ? 115  LYS A C     1 
ATOM   637   O  O     . LYS A  1 115 ? -27.748 -27.155 75.414 1.00 61.39  ? 115  LYS A O     1 
ATOM   638   C  CB    . LYS A  1 115 ? -25.068 -27.966 75.092 1.00 61.51  ? 115  LYS A CB    1 
ATOM   639   C  CG    . LYS A  1 115 ? -23.939 -28.917 74.710 1.00 63.44  ? 115  LYS A CG    1 
ATOM   640   C  CD    . LYS A  1 115 ? -22.909 -29.103 75.815 1.00 64.83  ? 115  LYS A CD    1 
ATOM   641   C  CE    . LYS A  1 115 ? -22.133 -30.426 75.542 1.00 70.81  ? 115  LYS A CE    1 
ATOM   642   N  NZ    . LYS A  1 115 ? -21.026 -30.686 76.534 1.00 73.89  ? 115  LYS A NZ    1 
ATOM   643   N  N     . ARG A  1 116 ? -27.846 -26.174 73.393 1.00 60.39  ? 116  ARG A N     1 
ATOM   644   C  CA    . ARG A  1 116 ? -29.189 -25.635 73.588 1.00 59.93  ? 116  ARG A CA    1 
ATOM   645   C  C     . ARG A  1 116 ? -30.145 -26.331 72.625 1.00 59.53  ? 116  ARG A C     1 
ATOM   646   O  O     . ARG A  1 116 ? -29.722 -27.030 71.704 1.00 59.37  ? 116  ARG A O     1 
ATOM   647   C  CB    . ARG A  1 116 ? -29.228 -24.113 73.358 1.00 60.03  ? 116  ARG A CB    1 
ATOM   648   C  CG    . ARG A  1 116 ? -28.476 -23.275 74.391 1.00 60.08  ? 116  ARG A CG    1 
ATOM   649   C  CD    . ARG A  1 116 ? -28.475 -21.802 74.021 1.00 59.89  ? 116  ARG A CD    1 
ATOM   650   N  NE    . ARG A  1 116 ? -27.427 -21.426 73.064 1.00 60.86  ? 116  ARG A NE    1 
ATOM   651   C  CZ    . ARG A  1 116 ? -27.634 -21.208 71.759 1.00 61.98  ? 116  ARG A CZ    1 
ATOM   652   N  NH1   . ARG A  1 116 ? -28.848 -21.355 71.243 1.00 62.70  ? 116  ARG A NH1   1 
ATOM   653   N  NH2   . ARG A  1 116 ? -26.631 -20.855 70.955 1.00 60.39  ? 116  ARG A NH2   1 
ATOM   654   N  N     . VAL A  1 117 ? -31.436 -26.139 72.856 1.00 59.19  ? 117  VAL A N     1 
ATOM   655   C  CA    . VAL A  1 117 ? -32.469 -26.584 71.932 1.00 58.96  ? 117  VAL A CA    1 
ATOM   656   C  C     . VAL A  1 117 ? -33.251 -25.380 71.391 1.00 59.10  ? 117  VAL A C     1 
ATOM   657   O  O     . VAL A  1 117 ? -34.249 -25.545 70.683 1.00 59.43  ? 117  VAL A O     1 
ATOM   658   C  CB    . VAL A  1 117 ? -33.447 -27.610 72.596 1.00 58.94  ? 117  VAL A CB    1 
ATOM   659   C  CG1   . VAL A  1 117 ? -32.767 -28.962 72.807 1.00 58.68  ? 117  VAL A CG1   1 
ATOM   660   C  CG2   . VAL A  1 117 ? -34.003 -27.081 73.907 1.00 58.20  ? 117  VAL A CG2   1 
ATOM   661   N  N     . THR A  1 118 ? -32.802 -24.175 71.742 1.00 59.10  ? 118  THR A N     1 
ATOM   662   C  CA    . THR A  1 118 ? -33.474 -22.937 71.363 1.00 59.46  ? 118  THR A CA    1 
ATOM   663   C  C     . THR A  1 118 ? -32.565 -22.153 70.432 1.00 59.77  ? 118  THR A C     1 
ATOM   664   O  O     . THR A  1 118 ? -31.423 -21.851 70.796 1.00 59.59  ? 118  THR A O     1 
ATOM   665   C  CB    . THR A  1 118 ? -33.732 -22.039 72.606 1.00 59.62  ? 118  THR A CB    1 
ATOM   666   O  OG1   . THR A  1 118 ? -34.248 -22.831 73.691 1.00 60.53  ? 118  THR A OG1   1 
ATOM   667   C  CG2   . THR A  1 118 ? -34.695 -20.879 72.272 1.00 58.75  ? 118  THR A CG2   1 
ATOM   668   N  N     . ILE A  1 119 ? -33.058 -21.807 69.240 1.00 59.83  ? 119  ILE A N     1 
ATOM   669   C  CA    . ILE A  1 119 ? -32.248 -21.003 68.325 1.00 59.54  ? 119  ILE A CA    1 
ATOM   670   C  C     . ILE A  1 119 ? -32.233 -19.522 68.709 1.00 60.07  ? 119  ILE A C     1 
ATOM   671   O  O     . ILE A  1 119 ? -33.257 -18.966 69.096 1.00 60.53  ? 119  ILE A O     1 
ATOM   672   C  CB    . ILE A  1 119 ? -32.642 -21.190 66.846 1.00 59.02  ? 119  ILE A CB    1 
ATOM   673   C  CG1   . ILE A  1 119 ? -34.065 -20.690 66.578 1.00 58.65  ? 119  ILE A CG1   1 
ATOM   674   C  CG2   . ILE A  1 119 ? -32.419 -22.612 66.426 1.00 58.39  ? 119  ILE A CG2   1 
ATOM   675   C  CD1   . ILE A  1 119 ? -34.338 -20.409 65.108 1.00 56.51  ? 119  ILE A CD1   1 
ATOM   676   N  N     . MET A  1 120 ? -31.069 -18.895 68.585 1.00 60.43  ? 120  MET A N     1 
ATOM   677   C  CA    . MET A  1 120 ? -30.865 -17.512 68.988 1.00 61.66  ? 120  MET A CA    1 
ATOM   678   C  C     . MET A  1 120 ? -30.160 -16.775 67.870 1.00 61.41  ? 120  MET A C     1 
ATOM   679   O  O     . MET A  1 120 ? -29.558 -17.415 67.030 1.00 62.25  ? 120  MET A O     1 
ATOM   680   C  CB    . MET A  1 120 ? -30.032 -17.472 70.258 1.00 61.26  ? 120  MET A CB    1 
ATOM   681   C  CG    . MET A  1 120 ? -30.796 -17.985 71.445 1.00 62.27  ? 120  MET A CG    1 
ATOM   682   S  SD    . MET A  1 120 ? -29.817 -18.203 72.921 1.00 64.58  ? 120  MET A SD    1 
ATOM   683   C  CE    . MET A  1 120 ? -30.999 -19.081 73.979 1.00 62.50  ? 120  MET A CE    1 
ATOM   684   N  N     . PRO A  1 121 ? -30.249 -15.430 67.827 1.00 61.30  ? 121  PRO A N     1 
ATOM   685   C  CA    . PRO A  1 121 ? -29.631 -14.750 66.692 1.00 60.57  ? 121  PRO A CA    1 
ATOM   686   C  C     . PRO A  1 121 ? -28.155 -15.083 66.536 1.00 59.89  ? 121  PRO A C     1 
ATOM   687   O  O     . PRO A  1 121 ? -27.658 -15.131 65.411 1.00 60.20  ? 121  PRO A O     1 
ATOM   688   C  CB    . PRO A  1 121 ? -29.826 -13.260 67.018 1.00 60.65  ? 121  PRO A CB    1 
ATOM   689   C  CG    . PRO A  1 121 ? -31.042 -13.231 67.857 1.00 61.01  ? 121  PRO A CG    1 
ATOM   690   C  CD    . PRO A  1 121 ? -30.920 -14.469 68.727 1.00 61.68  ? 121  PRO A CD    1 
ATOM   691   N  N     . LYS A  1 122 ? -27.458 -15.330 67.637 1.00 58.83  ? 122  LYS A N     1 
ATOM   692   C  CA    . LYS A  1 122 ? -26.041 -15.655 67.529 1.00 57.73  ? 122  LYS A CA    1 
ATOM   693   C  C     . LYS A  1 122 ? -25.811 -16.969 66.771 1.00 57.16  ? 122  LYS A C     1 
ATOM   694   O  O     . LYS A  1 122 ? -24.759 -17.158 66.173 1.00 57.38  ? 122  LYS A O     1 
ATOM   695   C  CB    . LYS A  1 122 ? -25.373 -15.674 68.895 1.00 57.12  ? 122  LYS A CB    1 
ATOM   696   C  CG    . LYS A  1 122 ? -25.781 -16.817 69.745 1.00 58.22  ? 122  LYS A CG    1 
ATOM   697   C  CD    . LYS A  1 122 ? -25.110 -16.723 71.062 1.00 60.03  ? 122  LYS A CD    1 
ATOM   698   C  CE    . LYS A  1 122 ? -26.083 -17.138 72.129 1.00 62.06  ? 122  LYS A CE    1 
ATOM   699   N  NZ    . LYS A  1 122 ? -25.586 -16.582 73.404 1.00 65.37  ? 122  LYS A NZ    1 
ATOM   700   N  N     . ASP A  1 123 ? -26.800 -17.862 66.788 1.00 56.43  ? 123  ASP A N     1 
ATOM   701   C  CA    . ASP A  1 123 ? -26.772 -19.081 65.972 1.00 55.57  ? 123  ASP A CA    1 
ATOM   702   C  C     . ASP A  1 123 ? -26.914 -18.742 64.492 1.00 55.13  ? 123  ASP A C     1 
ATOM   703   O  O     . ASP A  1 123 ? -26.145 -19.219 63.675 1.00 55.29  ? 123  ASP A O     1 
ATOM   704   C  CB    . ASP A  1 123 ? -27.883 -20.043 66.396 1.00 55.20  ? 123  ASP A CB    1 
ATOM   705   C  CG    . ASP A  1 123 ? -27.787 -20.444 67.852 1.00 56.01  ? 123  ASP A CG    1 
ATOM   706   O  OD1   . ASP A  1 123 ? -26.676 -20.815 68.298 1.00 56.90  ? 123  ASP A OD1   1 
ATOM   707   O  OD2   . ASP A  1 123 ? -28.818 -20.405 68.563 1.00 55.47  ? 123  ASP A OD2   1 
ATOM   708   N  N     . ILE A  1 124 ? -27.903 -17.924 64.149 1.00 54.60  ? 124  ILE A N     1 
ATOM   709   C  CA    . ILE A  1 124 ? -28.038 -17.416 62.782 1.00 54.62  ? 124  ILE A CA    1 
ATOM   710   C  C     . ILE A  1 124 ? -26.740 -16.747 62.340 1.00 54.08  ? 124  ILE A C     1 
ATOM   711   O  O     . ILE A  1 124 ? -26.308 -16.919 61.208 1.00 53.87  ? 124  ILE A O     1 
ATOM   712   C  CB    . ILE A  1 124 ? -29.242 -16.405 62.620 1.00 54.42  ? 124  ILE A CB    1 
ATOM   713   C  CG1   . ILE A  1 124 ? -30.581 -17.125 62.813 1.00 55.85  ? 124  ILE A CG1   1 
ATOM   714   C  CG2   . ILE A  1 124 ? -29.253 -15.776 61.250 1.00 53.70  ? 124  ILE A CG2   1 
ATOM   715   C  CD1   . ILE A  1 124 ? -31.821 -16.248 62.759 1.00 55.02  ? 124  ILE A CD1   1 
ATOM   716   N  N     . GLN A  1 125 ? -26.130 -15.998 63.254 1.00 53.83  ? 125  GLN A N     1 
ATOM   717   C  CA    . GLN A  1 125 ? -24.969 -15.164 62.955 1.00 53.61  ? 125  GLN A CA    1 
ATOM   718   C  C     . GLN A  1 125 ? -23.811 -16.036 62.590 1.00 52.76  ? 125  GLN A C     1 
ATOM   719   O  O     . GLN A  1 125 ? -23.166 -15.826 61.576 1.00 52.89  ? 125  GLN A O     1 
ATOM   720   C  CB    . GLN A  1 125 ? -24.643 -14.259 64.143 1.00 53.79  ? 125  GLN A CB    1 
ATOM   721   C  CG    . GLN A  1 125 ? -25.425 -12.942 64.078 1.00 57.41  ? 125  GLN A CG    1 
ATOM   722   C  CD    . GLN A  1 125 ? -25.628 -12.274 65.432 1.00 62.81  ? 125  GLN A CD    1 
ATOM   723   O  OE1   . GLN A  1 125 ? -24.779 -12.355 66.321 1.00 65.37  ? 125  GLN A OE1   1 
ATOM   724   N  NE2   . GLN A  1 125 ? -26.769 -11.599 65.589 1.00 64.35  ? 125  GLN A NE2   1 
ATOM   725   N  N     . LEU A  1 126 ? -23.602 -17.065 63.399 1.00 52.52  ? 126  LEU A N     1 
ATOM   726   C  CA    . LEU A  1 126 ? -22.522 -18.023 63.205 1.00 51.24  ? 126  LEU A CA    1 
ATOM   727   C  C     . LEU A  1 126 ? -22.704 -18.836 61.938 1.00 50.76  ? 126  LEU A C     1 
ATOM   728   O  O     . LEU A  1 126 ? -21.742 -19.046 61.190 1.00 50.93  ? 126  LEU A O     1 
ATOM   729   C  CB    . LEU A  1 126 ? -22.436 -18.951 64.401 1.00 50.91  ? 126  LEU A CB    1 
ATOM   730   C  CG    . LEU A  1 126 ? -21.259 -19.911 64.332 1.00 51.64  ? 126  LEU A CG    1 
ATOM   731   C  CD1   . LEU A  1 126 ? -19.902 -19.192 64.450 1.00 48.97  ? 126  LEU A CD1   1 
ATOM   732   C  CD2   . LEU A  1 126 ? -21.435 -20.975 65.402 1.00 52.34  ? 126  LEU A CD2   1 
ATOM   733   N  N     . ALA A  1 127 ? -23.926 -19.292 61.690 1.00 49.86  ? 127  ALA A N     1 
ATOM   734   C  CA    . ALA A  1 127 ? -24.199 -19.990 60.456 1.00 50.17  ? 127  ALA A CA    1 
ATOM   735   C  C     . ALA A  1 127 ? -23.792 -19.118 59.255 1.00 50.83  ? 127  ALA A C     1 
ATOM   736   O  O     . ALA A  1 127 ? -23.050 -19.550 58.399 1.00 50.48  ? 127  ALA A O     1 
ATOM   737   C  CB    . ALA A  1 127 ? -25.646 -20.411 60.387 1.00 49.68  ? 127  ALA A CB    1 
ATOM   738   N  N     . ARG A  1 128 ? -24.211 -17.861 59.236 1.00 52.34  ? 128  ARG A N     1 
ATOM   739   C  CA    . ARG A  1 128 ? -23.857 -16.965 58.133 1.00 53.76  ? 128  ARG A CA    1 
ATOM   740   C  C     . ARG A  1 128 ? -22.378 -16.644 58.001 1.00 54.06  ? 128  ARG A C     1 
ATOM   741   O  O     . ARG A  1 128 ? -21.849 -16.626 56.911 1.00 54.08  ? 128  ARG A O     1 
ATOM   742   C  CB    . ARG A  1 128 ? -24.707 -15.711 58.181 1.00 53.66  ? 128  ARG A CB    1 
ATOM   743   C  CG    . ARG A  1 128 ? -26.167 -16.053 57.975 1.00 55.24  ? 128  ARG A CG    1 
ATOM   744   C  CD    . ARG A  1 128 ? -27.030 -14.825 57.924 1.00 57.05  ? 128  ARG A CD    1 
ATOM   745   N  NE    . ARG A  1 128 ? -26.819 -14.080 56.695 1.00 57.34  ? 128  ARG A NE    1 
ATOM   746   C  CZ    . ARG A  1 128 ? -26.436 -12.813 56.668 1.00 57.47  ? 128  ARG A CZ    1 
ATOM   747   N  NH1   . ARG A  1 128 ? -26.247 -12.163 57.808 1.00 57.42  ? 128  ARG A NH1   1 
ATOM   748   N  NH2   . ARG A  1 128 ? -26.261 -12.202 55.510 1.00 57.30  ? 128  ARG A NH2   1 
ATOM   749   N  N     . ARG A  1 129 ? -21.707 -16.399 59.106 1.00 55.39  ? 129  ARG A N     1 
ATOM   750   C  CA    . ARG A  1 129 ? -20.265 -16.172 59.066 1.00 57.23  ? 129  ARG A CA    1 
ATOM   751   C  C     . ARG A  1 129 ? -19.532 -17.381 58.459 1.00 58.30  ? 129  ARG A C     1 
ATOM   752   O  O     . ARG A  1 129 ? -18.740 -17.236 57.526 1.00 58.66  ? 129  ARG A O     1 
ATOM   753   C  CB    . ARG A  1 129 ? -19.755 -15.792 60.457 1.00 56.87  ? 129  ARG A CB    1 
ATOM   754   C  CG    . ARG A  1 129 ? -18.293 -15.924 60.661 1.00 59.66  ? 129  ARG A CG    1 
ATOM   755   C  CD    . ARG A  1 129 ? -17.433 -15.131 59.671 1.00 65.75  ? 129  ARG A CD    1 
ATOM   756   N  NE    . ARG A  1 129 ? -16.016 -15.518 59.786 1.00 69.49  ? 129  ARG A NE    1 
ATOM   757   C  CZ    . ARG A  1 129 ? -15.481 -16.638 59.269 1.00 69.70  ? 129  ARG A CZ    1 
ATOM   758   N  NH1   . ARG A  1 129 ? -16.223 -17.495 58.562 1.00 67.10  ? 129  ARG A NH1   1 
ATOM   759   N  NH2   . ARG A  1 129 ? -14.190 -16.900 59.463 1.00 68.35  ? 129  ARG A NH2   1 
ATOM   760   N  N     . ILE A  1 130 ? -19.848 -18.576 58.948 1.00 59.49  ? 130  ILE A N     1 
ATOM   761   C  CA    . ILE A  1 130 ? -19.239 -19.797 58.426 1.00 60.16  ? 130  ILE A CA    1 
ATOM   762   C  C     . ILE A  1 130 ? -19.587 -20.069 56.962 1.00 61.26  ? 130  ILE A C     1 
ATOM   763   O  O     . ILE A  1 130 ? -18.719 -20.468 56.190 1.00 62.30  ? 130  ILE A O     1 
ATOM   764   C  CB    . ILE A  1 130 ? -19.524 -20.993 59.340 1.00 59.90  ? 130  ILE A CB    1 
ATOM   765   C  CG1   . ILE A  1 130 ? -18.817 -20.766 60.667 1.00 58.88  ? 130  ILE A CG1   1 
ATOM   766   C  CG2   . ILE A  1 130 ? -19.042 -22.283 58.729 1.00 59.58  ? 130  ILE A CG2   1 
ATOM   767   C  CD1   . ILE A  1 130 ? -19.327 -21.608 61.727 1.00 59.33  ? 130  ILE A CD1   1 
ATOM   768   N  N     . ARG A  1 131 ? -20.832 -19.833 56.570 1.00 62.44  ? 131  ARG A N     1 
ATOM   769   C  CA    . ARG A  1 131 ? -21.219 -19.897 55.150 1.00 63.63  ? 131  ARG A CA    1 
ATOM   770   C  C     . ARG A  1 131 ? -20.478 -18.910 54.247 1.00 65.32  ? 131  ARG A C     1 
ATOM   771   O  O     . ARG A  1 131 ? -20.560 -19.013 53.044 1.00 65.26  ? 131  ARG A O     1 
ATOM   772   C  CB    . ARG A  1 131 ? -22.713 -19.655 54.983 1.00 62.90  ? 131  ARG A CB    1 
ATOM   773   C  CG    . ARG A  1 131 ? -23.559 -20.858 55.192 1.00 60.64  ? 131  ARG A CG    1 
ATOM   774   C  CD    . ARG A  1 131 ? -24.924 -20.365 55.636 1.00 61.11  ? 131  ARG A CD    1 
ATOM   775   N  NE    . ARG A  1 131 ? -25.946 -21.384 55.424 1.00 61.81  ? 131  ARG A NE    1 
ATOM   776   C  CZ    . ARG A  1 131 ? -26.993 -21.266 54.603 1.00 61.94  ? 131  ARG A CZ    1 
ATOM   777   N  NH1   . ARG A  1 131 ? -27.210 -20.145 53.905 1.00 61.34  ? 131  ARG A NH1   1 
ATOM   778   N  NH2   . ARG A  1 131 ? -27.850 -22.274 54.501 1.00 62.18  ? 131  ARG A NH2   1 
ATOM   779   N  N     . GLY A  1 132 ? -19.775 -17.942 54.818 1.00 67.73  ? 132  GLY A N     1 
ATOM   780   C  CA    . GLY A  1 132 ? -19.077 -16.964 53.999 1.00 70.85  ? 132  GLY A CA    1 
ATOM   781   C  C     . GLY A  1 132 ? -19.983 -15.835 53.560 1.00 73.11  ? 132  GLY A C     1 
ATOM   782   O  O     . GLY A  1 132 ? -19.633 -15.060 52.665 1.00 74.27  ? 132  GLY A O     1 
ATOM   783   N  N     . GLU A  1 133 ? -21.142 -15.721 54.199 1.00 74.69  ? 133  GLU A N     1 
ATOM   784   C  CA    . GLU A  1 133 ? -22.076 -14.651 53.900 1.00 76.23  ? 133  GLU A CA    1 
ATOM   785   C  C     . GLU A  1 133 ? -21.757 -13.357 54.656 1.00 78.32  ? 133  GLU A C     1 
ATOM   786   O  O     . GLU A  1 133 ? -22.064 -12.263 54.166 1.00 78.79  ? 133  GLU A O     1 
ATOM   787   C  CB    . GLU A  1 133 ? -23.513 -15.104 54.169 1.00 76.06  ? 133  GLU A CB    1 
ATOM   788   C  CG    . GLU A  1 133 ? -24.121 -15.887 53.011 1.00 75.52  ? 133  GLU A CG    1 
ATOM   789   C  CD    . GLU A  1 133 ? -25.368 -16.668 53.385 1.00 75.14  ? 133  GLU A CD    1 
ATOM   790   O  OE1   . GLU A  1 133 ? -26.277 -16.095 54.015 1.00 73.40  ? 133  GLU A OE1   1 
ATOM   791   O  OE2   . GLU A  1 133 ? -25.446 -17.862 53.027 1.00 74.38  ? 133  GLU A OE2   1 
ATOM   792   N  N     . ARG A  1 134 ? -21.144 -13.471 55.840 1.00 80.31  ? 134  ARG A N     1 
ATOM   793   C  CA    . ARG A  1 134 ? -20.793 -12.274 56.627 1.00 81.99  ? 134  ARG A CA    1 
ATOM   794   C  C     . ARG A  1 134 ? -19.415 -11.697 56.219 1.00 82.72  ? 134  ARG A C     1 
ATOM   795   O  O     . ARG A  1 134 ? -18.421 -11.781 56.965 1.00 83.66  ? 134  ARG A O     1 
ATOM   796   C  CB    . ARG A  1 134 ? -20.876 -12.534 58.147 1.00 82.20  ? 134  ARG A CB    1 
ATOM   797   C  CG    . ARG A  1 134 ? -22.264 -12.930 58.659 1.00 83.77  ? 134  ARG A CG    1 
ATOM   798   C  CD    . ARG A  1 134 ? -22.669 -12.170 59.932 1.00 87.10  ? 134  ARG A CD    1 
ATOM   799   N  NE    . ARG A  1 134 ? -22.945 -10.747 59.645 1.00 89.64  ? 134  ARG A NE    1 
ATOM   800   C  CZ    . ARG A  1 134 ? -23.379 -9.848  60.533 1.00 89.69  ? 134  ARG A CZ    1 
ATOM   801   N  NH1   . ARG A  1 134 ? -23.614 -10.186 61.798 1.00 89.44  ? 134  ARG A NH1   1 
ATOM   802   N  NH2   . ARG A  1 134 ? -23.582 -8.593  60.148 1.00 90.26  ? 134  ARG A NH2   1 
ATOM   803   N  N     . VAL B  2 21  ? -54.094 1.977   60.948 1.00 102.26 ? 21   VAL B N     1 
ATOM   804   C  CA    . VAL B  2 21  ? -53.291 0.799   61.410 1.00 102.00 ? 21   VAL B CA    1 
ATOM   805   C  C     . VAL B  2 21  ? -52.125 0.487   60.438 1.00 102.00 ? 21   VAL B C     1 
ATOM   806   O  O     . VAL B  2 21  ? -51.930 -0.666  60.028 1.00 102.00 ? 21   VAL B O     1 
ATOM   807   C  CB    . VAL B  2 21  ? -54.184 -0.465  61.617 1.00 101.94 ? 21   VAL B CB    1 
ATOM   808   C  CG1   . VAL B  2 21  ? -53.659 -1.292  62.784 1.00 101.92 ? 21   VAL B CG1   1 
ATOM   809   C  CG2   . VAL B  2 21  ? -55.653 -0.083  61.837 1.00 101.56 ? 21   VAL B CG2   1 
ATOM   810   N  N     . LEU B  2 22  ? -51.358 1.521   60.076 1.00 101.75 ? 22   LEU B N     1 
ATOM   811   C  CA    . LEU B  2 22  ? -50.192 1.380   59.179 1.00 101.36 ? 22   LEU B CA    1 
ATOM   812   C  C     . LEU B  2 22  ? -49.103 0.437   59.716 1.00 100.85 ? 22   LEU B C     1 
ATOM   813   O  O     . LEU B  2 22  ? -48.917 0.303   60.937 1.00 101.05 ? 22   LEU B O     1 
ATOM   814   C  CB    . LEU B  2 22  ? -49.577 2.747   58.825 1.00 101.36 ? 22   LEU B CB    1 
ATOM   815   C  CG    . LEU B  2 22  ? -49.391 3.917   59.814 1.00 101.98 ? 22   LEU B CG    1 
ATOM   816   C  CD1   . LEU B  2 22  ? -49.198 3.524   61.303 1.00 101.76 ? 22   LEU B CD1   1 
ATOM   817   C  CD2   . LEU B  2 22  ? -48.236 4.815   59.328 1.00 101.65 ? 22   LEU B CD2   1 
ATOM   818   N  N     . ARG B  2 23  ? -48.387 -0.208  58.795 1.00 99.84  ? 23   ARG B N     1 
ATOM   819   C  CA    . ARG B  2 23  ? -47.352 -1.178  59.155 1.00 98.81  ? 23   ARG B CA    1 
ATOM   820   C  C     . ARG B  2 23  ? -46.317 -1.348  58.040 1.00 97.33  ? 23   ARG B C     1 
ATOM   821   O  O     . ARG B  2 23  ? -46.667 -1.337  56.855 1.00 97.26  ? 23   ARG B O     1 
ATOM   822   C  CB    . ARG B  2 23  ? -47.992 -2.529  59.506 1.00 98.74  ? 23   ARG B CB    1 
ATOM   823   C  CG    . ARG B  2 23  ? -47.007 -3.598  59.965 1.00 99.29  ? 23   ARG B CG    1 
ATOM   824   C  CD    . ARG B  2 23  ? -47.698 -4.798  60.636 1.00 100.04 ? 23   ARG B CD    1 
ATOM   825   N  NE    . ARG B  2 23  ? -48.678 -5.541  59.817 1.00 103.14 ? 23   ARG B NE    1 
ATOM   826   C  CZ    . ARG B  2 23  ? -48.597 -5.813  58.508 1.00 104.25 ? 23   ARG B CZ    1 
ATOM   827   N  NH1   . ARG B  2 23  ? -47.558 -5.420  57.774 1.00 105.33 ? 23   ARG B NH1   1 
ATOM   828   N  NH2   . ARG B  2 23  ? -49.572 -6.499  57.924 1.00 104.40 ? 23   ARG B NH2   1 
ATOM   829   N  N     . ASP B  2 24  ? -45.050 -1.503  58.434 1.00 95.45  ? 24   ASP B N     1 
ATOM   830   C  CA    . ASP B  2 24  ? -43.960 -1.813  57.504 1.00 93.55  ? 24   ASP B CA    1 
ATOM   831   C  C     . ASP B  2 24  ? -44.249 -3.083  56.715 1.00 91.50  ? 24   ASP B C     1 
ATOM   832   O  O     . ASP B  2 24  ? -44.870 -4.013  57.238 1.00 91.28  ? 24   ASP B O     1 
ATOM   833   C  CB    . ASP B  2 24  ? -42.648 -1.996  58.270 1.00 94.23  ? 24   ASP B CB    1 
ATOM   834   C  CG    . ASP B  2 24  ? -41.877 -0.697  58.429 1.00 95.78  ? 24   ASP B CG    1 
ATOM   835   O  OD1   . ASP B  2 24  ? -41.029 -0.398  57.550 1.00 97.78  ? 24   ASP B OD1   1 
ATOM   836   O  OD2   . ASP B  2 24  ? -42.107 0.012   59.440 1.00 97.27  ? 24   ASP B OD2   1 
ATOM   837   N  N     . ASN B  2 25  ? -43.797 -3.121  55.465 1.00 88.89  ? 25   ASN B N     1 
ATOM   838   C  CA    . ASN B  2 25  ? -43.940 -4.318  54.644 1.00 86.70  ? 25   ASN B CA    1 
ATOM   839   C  C     . ASN B  2 25  ? -43.132 -5.502  55.177 1.00 85.40  ? 25   ASN B C     1 
ATOM   840   O  O     . ASN B  2 25  ? -43.623 -6.638  55.210 1.00 85.15  ? 25   ASN B O     1 
ATOM   841   C  CB    . ASN B  2 25  ? -43.579 -4.024  53.198 1.00 86.54  ? 25   ASN B CB    1 
ATOM   842   C  CG    . ASN B  2 25  ? -44.572 -3.099  52.540 1.00 86.30  ? 25   ASN B CG    1 
ATOM   843   O  OD1   . ASN B  2 25  ? -45.788 -3.315  52.615 1.00 86.48  ? 25   ASN B OD1   1 
ATOM   844   N  ND2   . ASN B  2 25  ? -44.065 -2.053  51.898 1.00 85.63  ? 25   ASN B ND2   1 
ATOM   845   N  N     . ILE B  2 26  ? -41.904 -5.229  55.611 1.00 83.49  ? 26   ILE B N     1 
ATOM   846   C  CA    . ILE B  2 26  ? -41.091 -6.241  56.252 1.00 81.86  ? 26   ILE B CA    1 
ATOM   847   C  C     . ILE B  2 26  ? -41.851 -6.920  57.411 1.00 80.95  ? 26   ILE B C     1 
ATOM   848   O  O     . ILE B  2 26  ? -41.742 -8.140  57.618 1.00 80.93  ? 26   ILE B O     1 
ATOM   849   C  CB    . ILE B  2 26  ? -39.697 -5.687  56.678 1.00 81.67  ? 26   ILE B CB    1 
ATOM   850   C  CG1   . ILE B  2 26  ? -38.731 -6.828  57.021 1.00 82.01  ? 26   ILE B CG1   1 
ATOM   851   C  CG2   . ILE B  2 26  ? -39.798 -4.714  57.824 1.00 81.52  ? 26   ILE B CG2   1 
ATOM   852   C  CD1   . ILE B  2 26  ? -38.301 -7.660  55.815 1.00 80.66  ? 26   ILE B CD1   1 
ATOM   853   N  N     . GLN B  2 27  ? -42.654 -6.143  58.133 1.00 79.57  ? 27   GLN B N     1 
ATOM   854   C  CA    . GLN B  2 27  ? -43.392 -6.677  59.277 1.00 78.37  ? 27   GLN B CA    1 
ATOM   855   C  C     . GLN B  2 27  ? -44.548 -7.546  58.834 1.00 77.24  ? 27   GLN B C     1 
ATOM   856   O  O     . GLN B  2 27  ? -45.156 -8.243  59.644 1.00 76.81  ? 27   GLN B O     1 
ATOM   857   C  CB    . GLN B  2 27  ? -43.873 -5.562  60.193 1.00 78.40  ? 27   GLN B CB    1 
ATOM   858   C  CG    . GLN B  2 27  ? -42.741 -4.817  60.863 1.00 78.77  ? 27   GLN B CG    1 
ATOM   859   C  CD    . GLN B  2 27  ? -41.889 -5.724  61.716 1.00 79.80  ? 27   GLN B CD    1 
ATOM   860   O  OE1   . GLN B  2 27  ? -42.391 -6.666  62.343 1.00 80.85  ? 27   GLN B OE1   1 
ATOM   861   N  NE2   . GLN B  2 27  ? -40.589 -5.449  61.752 1.00 80.53  ? 27   GLN B NE2   1 
ATOM   862   N  N     . GLY B  2 28  ? -44.822 -7.515  57.534 1.00 76.22  ? 28   GLY B N     1 
ATOM   863   C  CA    . GLY B  2 28  ? -45.823 -8.380  56.939 1.00 75.53  ? 28   GLY B CA    1 
ATOM   864   C  C     . GLY B  2 28  ? -45.361 -9.822  56.917 1.00 75.16  ? 28   GLY B C     1 
ATOM   865   O  O     . GLY B  2 28  ? -46.182 -10.732 56.834 1.00 75.56  ? 28   GLY B O     1 
ATOM   866   N  N     . ILE B  2 29  ? -44.041 -10.026 56.963 1.00 74.43  ? 29   ILE B N     1 
ATOM   867   C  CA    . ILE B  2 29  ? -43.460 -11.347 57.157 1.00 73.23  ? 29   ILE B CA    1 
ATOM   868   C  C     . ILE B  2 29  ? -43.624 -11.611 58.647 1.00 72.89  ? 29   ILE B C     1 
ATOM   869   O  O     . ILE B  2 29  ? -42.863 -11.120 59.482 1.00 72.74  ? 29   ILE B O     1 
ATOM   870   C  CB    . ILE B  2 29  ? -41.970 -11.407 56.717 1.00 73.22  ? 29   ILE B CB    1 
ATOM   871   C  CG1   . ILE B  2 29  ? -41.778 -10.790 55.323 1.00 73.10  ? 29   ILE B CG1   1 
ATOM   872   C  CG2   . ILE B  2 29  ? -41.441 -12.827 56.759 1.00 71.96  ? 29   ILE B CG2   1 
ATOM   873   C  CD1   . ILE B  2 29  ? -42.258 -11.639 54.166 1.00 71.98  ? 29   ILE B CD1   1 
ATOM   874   N  N     . THR B  2 30  ? -44.655 -12.370 58.970 1.00 72.30  ? 30   THR B N     1 
ATOM   875   C  CA    . THR B  2 30  ? -45.148 -12.417 60.325 1.00 72.27  ? 30   THR B CA    1 
ATOM   876   C  C     . THR B  2 30  ? -44.429 -13.466 61.149 1.00 71.94  ? 30   THR B C     1 
ATOM   877   O  O     . THR B  2 30  ? -43.825 -14.386 60.605 1.00 72.04  ? 30   THR B O     1 
ATOM   878   C  CB    . THR B  2 30  ? -46.673 -12.684 60.342 1.00 72.53  ? 30   THR B CB    1 
ATOM   879   O  OG1   . THR B  2 30  ? -46.952 -13.967 59.753 1.00 73.68  ? 30   THR B OG1   1 
ATOM   880   C  CG2   . THR B  2 30  ? -47.411 -11.604 59.560 1.00 71.85  ? 30   THR B CG2   1 
ATOM   881   N  N     . LYS B  2 31  ? -44.515 -13.327 62.467 1.00 71.48  ? 31   LYS B N     1 
ATOM   882   C  CA    . LYS B  2 31  ? -43.993 -14.323 63.384 1.00 71.24  ? 31   LYS B CA    1 
ATOM   883   C  C     . LYS B  2 31  ? -44.448 -15.761 63.048 1.00 70.76  ? 31   LYS B C     1 
ATOM   884   O  O     . LYS B  2 31  ? -43.621 -16.663 62.936 1.00 70.46  ? 31   LYS B O     1 
ATOM   885   C  CB    . LYS B  2 31  ? -44.341 -13.945 64.822 1.00 71.22  ? 31   LYS B CB    1 
ATOM   886   C  CG    . LYS B  2 31  ? -44.209 -15.098 65.789 1.00 73.52  ? 31   LYS B CG    1 
ATOM   887   C  CD    . LYS B  2 31  ? -44.684 -14.742 67.181 1.00 76.78  ? 31   LYS B CD    1 
ATOM   888   C  CE    . LYS B  2 31  ? -44.572 -15.942 68.105 1.00 78.18  ? 31   LYS B CE    1 
ATOM   889   N  NZ    . LYS B  2 31  ? -44.273 -15.479 69.491 1.00 79.59  ? 31   LYS B NZ    1 
ATOM   890   N  N     . PRO B  2 32  ? -45.759 -15.983 62.859 1.00 70.79  ? 32   PRO B N     1 
ATOM   891   C  CA    . PRO B  2 32  ? -46.145 -17.367 62.577 1.00 70.44  ? 32   PRO B CA    1 
ATOM   892   C  C     . PRO B  2 32  ? -45.568 -17.901 61.270 1.00 69.86  ? 32   PRO B C     1 
ATOM   893   O  O     . PRO B  2 32  ? -45.262 -19.091 61.175 1.00 70.08  ? 32   PRO B O     1 
ATOM   894   C  CB    . PRO B  2 32  ? -47.671 -17.298 62.490 1.00 70.93  ? 32   PRO B CB    1 
ATOM   895   C  CG    . PRO B  2 32  ? -48.048 -15.989 63.154 1.00 71.42  ? 32   PRO B CG    1 
ATOM   896   C  CD    . PRO B  2 32  ? -46.924 -15.074 62.873 1.00 70.72  ? 32   PRO B CD    1 
ATOM   897   N  N     . ALA B  2 33  ? -45.429 -17.029 60.273 1.00 69.15  ? 33   ALA B N     1 
ATOM   898   C  CA    . ALA B  2 33  ? -44.811 -17.396 58.989 1.00 68.23  ? 33   ALA B CA    1 
ATOM   899   C  C     . ALA B  2 33  ? -43.346 -17.815 59.171 1.00 67.54  ? 33   ALA B C     1 
ATOM   900   O  O     . ALA B  2 33  ? -42.910 -18.863 58.657 1.00 67.33  ? 33   ALA B O     1 
ATOM   901   C  CB    . ALA B  2 33  ? -44.925 -16.244 57.994 1.00 67.97  ? 33   ALA B CB    1 
ATOM   902   N  N     . ILE B  2 34  ? -42.596 -16.993 59.908 1.00 66.42  ? 34   ILE B N     1 
ATOM   903   C  CA    . ILE B  2 34  ? -41.225 -17.315 60.264 1.00 65.41  ? 34   ILE B CA    1 
ATOM   904   C  C     . ILE B  2 34  ? -41.204 -18.619 61.080 1.00 65.45  ? 34   ILE B C     1 
ATOM   905   O  O     . ILE B  2 34  ? -40.329 -19.454 60.904 1.00 65.82  ? 34   ILE B O     1 
ATOM   906   C  CB    . ILE B  2 34  ? -40.518 -16.139 61.006 1.00 65.24  ? 34   ILE B CB    1 
ATOM   907   C  CG1   . ILE B  2 34  ? -40.528 -14.856 60.163 1.00 64.97  ? 34   ILE B CG1   1 
ATOM   908   C  CG2   . ILE B  2 34  ? -39.080 -16.484 61.324 1.00 64.76  ? 34   ILE B CG2   1 
ATOM   909   C  CD1   . ILE B  2 34  ? -40.174 -13.586 60.952 1.00 64.33  ? 34   ILE B CD1   1 
ATOM   910   N  N     . ARG B  2 35  ? -42.193 -18.811 61.937 1.00 65.40  ? 35   ARG B N     1 
ATOM   911   C  CA    . ARG B  2 35  ? -42.261 -20.008 62.774 1.00 65.95  ? 35   ARG B CA    1 
ATOM   912   C  C     . ARG B  2 35  ? -42.403 -21.275 61.935 1.00 64.85  ? 35   ARG B C     1 
ATOM   913   O  O     . ARG B  2 35  ? -41.751 -22.294 62.217 1.00 64.46  ? 35   ARG B O     1 
ATOM   914   C  CB    . ARG B  2 35  ? -43.406 -19.876 63.779 1.00 65.98  ? 35   ARG B CB    1 
ATOM   915   C  CG    . ARG B  2 35  ? -43.486 -20.964 64.823 1.00 68.07  ? 35   ARG B CG    1 
ATOM   916   C  CD    . ARG B  2 35  ? -44.560 -20.642 65.837 1.00 68.79  ? 35   ARG B CD    1 
ATOM   917   N  NE    . ARG B  2 35  ? -44.021 -19.881 66.961 1.00 75.02  ? 35   ARG B NE    1 
ATOM   918   C  CZ    . ARG B  2 35  ? -43.904 -20.354 68.206 1.00 77.34  ? 35   ARG B CZ    1 
ATOM   919   N  NH1   . ARG B  2 35  ? -44.300 -21.589 68.510 1.00 77.93  ? 35   ARG B NH1   1 
ATOM   920   N  NH2   . ARG B  2 35  ? -43.406 -19.581 69.163 1.00 78.83  ? 35   ARG B NH2   1 
ATOM   921   N  N     . ARG B  2 36  ? -43.240 -21.195 60.898 1.00 64.23  ? 36   ARG B N     1 
ATOM   922   C  CA    . ARG B  2 36  ? -43.413 -22.284 59.929 1.00 63.57  ? 36   ARG B CA    1 
ATOM   923   C  C     . ARG B  2 36  ? -42.135 -22.618 59.153 1.00 62.67  ? 36   ARG B C     1 
ATOM   924   O  O     . ARG B  2 36  ? -41.804 -23.794 58.973 1.00 62.54  ? 36   ARG B O     1 
ATOM   925   C  CB    . ARG B  2 36  ? -44.539 -21.961 58.945 1.00 63.83  ? 36   ARG B CB    1 
ATOM   926   C  CG    . ARG B  2 36  ? -45.951 -22.118 59.524 1.00 64.58  ? 36   ARG B CG    1 
ATOM   927   C  CD    . ARG B  2 36  ? -47.035 -22.080 58.415 1.00 64.01  ? 36   ARG B CD    1 
ATOM   928   N  NE    . ARG B  2 36  ? -47.128 -20.773 57.765 1.00 64.72  ? 36   ARG B NE    1 
ATOM   929   C  CZ    . ARG B  2 36  ? -47.794 -19.727 58.258 1.00 65.09  ? 36   ARG B CZ    1 
ATOM   930   N  NH1   . ARG B  2 36  ? -48.439 -19.824 59.416 1.00 65.41  ? 36   ARG B NH1   1 
ATOM   931   N  NH2   . ARG B  2 36  ? -47.819 -18.579 57.588 1.00 63.45  ? 36   ARG B NH2   1 
ATOM   932   N  N     . LEU B  2 37  ? -41.425 -21.586 58.695 1.00 61.69  ? 37   LEU B N     1 
ATOM   933   C  CA    . LEU B  2 37  ? -40.154 -21.774 57.994 1.00 60.58  ? 37   LEU B CA    1 
ATOM   934   C  C     . LEU B  2 37  ? -39.173 -22.510 58.875 1.00 59.71  ? 37   LEU B C     1 
ATOM   935   O  O     . LEU B  2 37  ? -38.612 -23.518 58.475 1.00 60.17  ? 37   LEU B O     1 
ATOM   936   C  CB    . LEU B  2 37  ? -39.569 -20.439 57.550 1.00 60.48  ? 37   LEU B CB    1 
ATOM   937   C  CG    . LEU B  2 37  ? -40.268 -19.834 56.335 1.00 61.12  ? 37   LEU B CG    1 
ATOM   938   C  CD1   . LEU B  2 37  ? -39.942 -18.333 56.196 1.00 60.29  ? 37   LEU B CD1   1 
ATOM   939   C  CD2   . LEU B  2 37  ? -39.927 -20.607 55.061 1.00 60.31  ? 37   LEU B CD2   1 
ATOM   940   N  N     . ALA B  2 38  ? -38.995 -22.017 60.086 1.00 58.67  ? 38   ALA B N     1 
ATOM   941   C  CA    . ALA B  2 38  ? -38.173 -22.685 61.070 1.00 58.19  ? 38   ALA B CA    1 
ATOM   942   C  C     . ALA B  2 38  ? -38.579 -24.151 61.260 1.00 58.00  ? 38   ALA B C     1 
ATOM   943   O  O     . ALA B  2 38  ? -37.713 -25.019 61.332 1.00 57.68  ? 38   ALA B O     1 
ATOM   944   C  CB    . ALA B  2 38  ? -38.219 -21.926 62.398 1.00 57.88  ? 38   ALA B CB    1 
ATOM   945   N  N     . ARG B  2 39  ? -39.889 -24.415 61.319 1.00 57.87  ? 39   ARG B N     1 
ATOM   946   C  CA    . ARG B  2 39  ? -40.414 -25.767 61.521 1.00 57.57  ? 39   ARG B CA    1 
ATOM   947   C  C     . ARG B  2 39  ? -40.006 -26.679 60.393 1.00 57.58  ? 39   ARG B C     1 
ATOM   948   O  O     . ARG B  2 39  ? -39.526 -27.787 60.629 1.00 57.50  ? 39   ARG B O     1 
ATOM   949   C  CB    . ARG B  2 39  ? -41.937 -25.761 61.624 1.00 57.87  ? 39   ARG B CB    1 
ATOM   950   C  CG    . ARG B  2 39  ? -42.489 -25.104 62.875 1.00 59.37  ? 39   ARG B CG    1 
ATOM   951   C  CD    . ARG B  2 39  ? -42.135 -25.862 64.149 1.00 61.37  ? 39   ARG B CD    1 
ATOM   952   N  NE    . ARG B  2 39  ? -42.785 -25.239 65.290 1.00 64.14  ? 39   ARG B NE    1 
ATOM   953   C  CZ    . ARG B  2 39  ? -42.155 -24.661 66.308 1.00 66.71  ? 39   ARG B CZ    1 
ATOM   954   N  NH1   . ARG B  2 39  ? -40.828 -24.643 66.360 1.00 65.75  ? 39   ARG B NH1   1 
ATOM   955   N  NH2   . ARG B  2 39  ? -42.868 -24.110 67.290 1.00 67.71  ? 39   ARG B NH2   1 
ATOM   956   N  N     . ARG B  2 40  ? -40.181 -26.217 59.156 1.00 57.18  ? 40   ARG B N     1 
ATOM   957   C  CA    . ARG B  2 40  ? -39.718 -27.002 58.024 1.00 56.93  ? 40   ARG B CA    1 
ATOM   958   C  C     . ARG B  2 40  ? -38.214 -27.230 58.110 1.00 56.86  ? 40   ARG B C     1 
ATOM   959   O  O     . ARG B  2 40  ? -37.705 -28.255 57.643 1.00 57.60  ? 40   ARG B O     1 
ATOM   960   C  CB    . ARG B  2 40  ? -40.103 -26.349 56.705 1.00 56.85  ? 40   ARG B CB    1 
ATOM   961   C  CG    . ARG B  2 40  ? -39.716 -27.137 55.477 1.00 56.75  ? 40   ARG B CG    1 
ATOM   962   C  CD    . ARG B  2 40  ? -40.421 -26.584 54.269 1.00 58.59  ? 40   ARG B CD    1 
ATOM   963   N  NE    . ARG B  2 40  ? -41.807 -27.023 54.256 1.00 61.68  ? 40   ARG B NE    1 
ATOM   964   C  CZ    . ARG B  2 40  ? -42.755 -26.551 53.451 1.00 63.67  ? 40   ARG B CZ    1 
ATOM   965   N  NH1   . ARG B  2 40  ? -42.488 -25.583 52.575 1.00 63.38  ? 40   ARG B NH1   1 
ATOM   966   N  NH2   . ARG B  2 40  ? -43.988 -27.047 53.540 1.00 65.38  ? 40   ARG B NH2   1 
ATOM   967   N  N     . GLY B  2 41  ? -37.510 -26.272 58.712 1.00 56.51  ? 41   GLY B N     1 
ATOM   968   C  CA    . GLY B  2 41  ? -36.082 -26.412 58.988 1.00 56.01  ? 41   GLY B CA    1 
ATOM   969   C  C     . GLY B  2 41  ? -35.759 -27.291 60.184 1.00 55.55  ? 41   GLY B C     1 
ATOM   970   O  O     . GLY B  2 41  ? -34.597 -27.421 60.552 1.00 54.66  ? 41   GLY B O     1 
ATOM   971   N  N     . GLY B  2 42  ? -36.792 -27.885 60.785 1.00 55.91  ? 42   GLY B N     1 
ATOM   972   C  CA    . GLY B  2 42  ? -36.653 -28.777 61.940 1.00 56.44  ? 42   GLY B CA    1 
ATOM   973   C  C     . GLY B  2 42  ? -36.360 -28.103 63.262 1.00 57.24  ? 42   GLY B C     1 
ATOM   974   O  O     . GLY B  2 42  ? -35.793 -28.705 64.156 1.00 58.08  ? 42   GLY B O     1 
ATOM   975   N  N     . VAL B  2 43  ? -36.742 -26.848 63.398 1.00 58.02  ? 43   VAL B N     1 
ATOM   976   C  CA    . VAL B  2 43  ? -36.482 -26.101 64.620 1.00 58.62  ? 43   VAL B CA    1 
ATOM   977   C  C     . VAL B  2 43  ? -37.604 -26.289 65.641 1.00 59.13  ? 43   VAL B C     1 
ATOM   978   O  O     . VAL B  2 43  ? -38.779 -26.140 65.316 1.00 59.18  ? 43   VAL B O     1 
ATOM   979   C  CB    . VAL B  2 43  ? -36.283 -24.610 64.317 1.00 58.46  ? 43   VAL B CB    1 
ATOM   980   C  CG1   . VAL B  2 43  ? -35.935 -23.857 65.586 1.00 59.16  ? 43   VAL B CG1   1 
ATOM   981   C  CG2   . VAL B  2 43  ? -35.165 -24.434 63.305 1.00 58.37  ? 43   VAL B CG2   1 
ATOM   982   N  N     . LYS B  2 44  ? -37.236 -26.595 66.880 1.00 59.97  ? 44   LYS B N     1 
ATOM   983   C  CA    . LYS B  2 44  ? -38.222 -26.924 67.911 1.00 60.94  ? 44   LYS B CA    1 
ATOM   984   C  C     . LYS B  2 44  ? -38.585 -25.751 68.800 1.00 61.10  ? 44   LYS B C     1 
ATOM   985   O  O     . LYS B  2 44  ? -39.739 -25.549 69.113 1.00 61.69  ? 44   LYS B O     1 
ATOM   986   C  CB    . LYS B  2 44  ? -37.725 -28.080 68.774 1.00 61.07  ? 44   LYS B CB    1 
ATOM   987   C  CG    . LYS B  2 44  ? -38.777 -28.620 69.729 1.00 62.85  ? 44   LYS B CG    1 
ATOM   988   C  CD    . LYS B  2 44  ? -38.160 -29.757 70.564 1.00 66.17  ? 44   LYS B CD    1 
ATOM   989   C  CE    . LYS B  2 44  ? -39.164 -30.292 71.585 1.00 65.92  ? 44   LYS B CE    1 
ATOM   990   N  NZ    . LYS B  2 44  ? -38.390 -31.128 72.553 1.00 68.33  ? 44   LYS B NZ    1 
ATOM   991   N  N     . ARG B  2 45  ? -37.594 -24.985 69.213 1.00 61.55  ? 45   ARG B N     1 
ATOM   992   C  CA    . ARG B  2 45  ? -37.816 -23.878 70.116 1.00 61.91  ? 45   ARG B CA    1 
ATOM   993   C  C     . ARG B  2 45  ? -37.172 -22.588 69.551 1.00 61.86  ? 45   ARG B C     1 
ATOM   994   O  O     . ARG B  2 45  ? -36.023 -22.603 69.074 1.00 61.63  ? 45   ARG B O     1 
ATOM   995   C  CB    . ARG B  2 45  ? -37.216 -24.254 71.460 1.00 62.36  ? 45   ARG B CB    1 
ATOM   996   C  CG    . ARG B  2 45  ? -37.794 -23.527 72.612 1.00 63.61  ? 45   ARG B CG    1 
ATOM   997   C  CD    . ARG B  2 45  ? -37.428 -24.214 73.920 1.00 66.43  ? 45   ARG B CD    1 
ATOM   998   N  NE    . ARG B  2 45  ? -38.104 -23.534 75.019 1.00 68.50  ? 45   ARG B NE    1 
ATOM   999   C  CZ    . ARG B  2 45  ? -37.688 -22.390 75.554 1.00 70.13  ? 45   ARG B CZ    1 
ATOM   1000  N  NH1   . ARG B  2 45  ? -36.578 -21.799 75.122 1.00 70.09  ? 45   ARG B NH1   1 
ATOM   1001  N  NH2   . ARG B  2 45  ? -38.379 -21.840 76.541 1.00 72.90  ? 45   ARG B NH2   1 
ATOM   1002  N  N     . ILE B  2 46  ? -37.908 -21.480 69.617 1.00 61.43  ? 46   ILE B N     1 
ATOM   1003  C  CA    . ILE B  2 46  ? -37.496 -20.238 68.970 1.00 61.41  ? 46   ILE B CA    1 
ATOM   1004  C  C     . ILE B  2 46  ? -37.427 -19.061 69.949 1.00 62.00  ? 46   ILE B C     1 
ATOM   1005  O  O     . ILE B  2 46  ? -38.429 -18.682 70.537 1.00 62.83  ? 46   ILE B O     1 
ATOM   1006  C  CB    . ILE B  2 46  ? -38.424 -19.926 67.770 1.00 61.03  ? 46   ILE B CB    1 
ATOM   1007  C  CG1   . ILE B  2 46  ? -38.457 -21.139 66.827 1.00 61.72  ? 46   ILE B CG1   1 
ATOM   1008  C  CG2   . ILE B  2 46  ? -37.973 -18.687 67.032 1.00 59.43  ? 46   ILE B CG2   1 
ATOM   1009  C  CD1   . ILE B  2 46  ? -39.543 -21.112 65.788 1.00 62.11  ? 46   ILE B CD1   1 
ATOM   1010  N  N     . SER B  2 47  ? -36.240 -18.489 70.127 1.00 62.24  ? 47   SER B N     1 
ATOM   1011  C  CA    . SER B  2 47  ? -36.093 -17.257 70.899 1.00 62.56  ? 47   SER B CA    1 
ATOM   1012  C  C     . SER B  2 47  ? -36.779 -16.074 70.225 1.00 62.38  ? 47   SER B C     1 
ATOM   1013  O  O     . SER B  2 47  ? -36.752 -15.951 69.000 1.00 61.86  ? 47   SER B O     1 
ATOM   1014  C  CB    . SER B  2 47  ? -34.625 -16.915 71.103 1.00 62.50  ? 47   SER B CB    1 
ATOM   1015  O  OG    . SER B  2 47  ? -34.408 -15.574 70.688 1.00 65.02  ? 47   SER B OG    1 
ATOM   1016  N  N     . GLY B  2 48  ? -37.336 -15.186 71.055 1.00 62.65  ? 48   GLY B N     1 
ATOM   1017  C  CA    . GLY B  2 48  ? -38.092 -13.997 70.627 1.00 62.36  ? 48   GLY B CA    1 
ATOM   1018  C  C     . GLY B  2 48  ? -37.395 -13.055 69.668 1.00 62.55  ? 48   GLY B C     1 
ATOM   1019  O  O     . GLY B  2 48  ? -38.032 -12.478 68.783 1.00 62.16  ? 48   GLY B O     1 
ATOM   1020  N  N     . LEU B  2 49  ? -36.079 -12.916 69.825 1.00 62.91  ? 49   LEU B N     1 
ATOM   1021  C  CA    . LEU B  2 49  ? -35.278 -12.027 68.973 1.00 62.82  ? 49   LEU B CA    1 
ATOM   1022  C  C     . LEU B  2 49  ? -35.027 -12.548 67.549 1.00 62.77  ? 49   LEU B C     1 
ATOM   1023  O  O     . LEU B  2 49  ? -34.487 -11.827 66.707 1.00 62.66  ? 49   LEU B O     1 
ATOM   1024  C  CB    . LEU B  2 49  ? -33.948 -11.745 69.659 1.00 63.10  ? 49   LEU B CB    1 
ATOM   1025  C  CG    . LEU B  2 49  ? -34.043 -11.022 71.004 1.00 63.83  ? 49   LEU B CG    1 
ATOM   1026  C  CD1   . LEU B  2 49  ? -32.761 -11.242 71.790 1.00 64.17  ? 49   LEU B CD1   1 
ATOM   1027  C  CD2   . LEU B  2 49  ? -34.334 -9.533  70.788 1.00 62.02  ? 49   LEU B CD2   1 
ATOM   1028  N  N     . ILE B  2 50  ? -35.422 -13.793 67.288 1.00 62.76  ? 50   ILE B N     1 
ATOM   1029  C  CA    . ILE B  2 50  ? -35.155 -14.444 66.007 1.00 62.53  ? 50   ILE B CA    1 
ATOM   1030  C  C     . ILE B  2 50  ? -35.987 -13.846 64.895 1.00 62.56  ? 50   ILE B C     1 
ATOM   1031  O  O     . ILE B  2 50  ? -35.536 -13.794 63.754 1.00 63.16  ? 50   ILE B O     1 
ATOM   1032  C  CB    . ILE B  2 50  ? -35.385 -15.981 66.071 1.00 62.43  ? 50   ILE B CB    1 
ATOM   1033  C  CG1   . ILE B  2 50  ? -34.252 -16.673 66.841 1.00 63.09  ? 50   ILE B CG1   1 
ATOM   1034  C  CG2   . ILE B  2 50  ? -35.532 -16.582 64.688 1.00 61.27  ? 50   ILE B CG2   1 
ATOM   1035  C  CD1   . ILE B  2 50  ? -32.920 -16.792 66.073 1.00 65.11  ? 50   ILE B CD1   1 
ATOM   1036  N  N     . TYR B  2 51  ? -37.190 -13.383 65.221 1.00 62.11  ? 51   TYR B N     1 
ATOM   1037  C  CA    . TYR B  2 51  ? -38.091 -12.886 64.184 1.00 61.68  ? 51   TYR B CA    1 
ATOM   1038  C  C     . TYR B  2 51  ? -37.506 -11.642 63.551 1.00 62.26  ? 51   TYR B C     1 
ATOM   1039  O  O     . TYR B  2 51  ? -37.429 -11.550 62.315 1.00 62.32  ? 51   TYR B O     1 
ATOM   1040  C  CB    . TYR B  2 51  ? -39.540 -12.724 64.694 1.00 60.25  ? 51   TYR B CB    1 
ATOM   1041  C  CG    . TYR B  2 51  ? -40.010 -13.981 65.409 1.00 58.68  ? 51   TYR B CG    1 
ATOM   1042  C  CD1   . TYR B  2 51  ? -40.422 -15.116 64.694 1.00 55.74  ? 51   TYR B CD1   1 
ATOM   1043  C  CD2   . TYR B  2 51  ? -39.970 -14.061 66.803 1.00 57.46  ? 51   TYR B CD2   1 
ATOM   1044  C  CE1   . TYR B  2 51  ? -40.812 -16.278 65.349 1.00 54.85  ? 51   TYR B CE1   1 
ATOM   1045  C  CE2   . TYR B  2 51  ? -40.354 -15.218 67.471 1.00 56.94  ? 51   TYR B CE2   1 
ATOM   1046  C  CZ    . TYR B  2 51  ? -40.775 -16.327 66.747 1.00 57.01  ? 51   TYR B CZ    1 
ATOM   1047  O  OH    . TYR B  2 51  ? -41.160 -17.471 67.453 1.00 57.48  ? 51   TYR B OH    1 
ATOM   1048  N  N     . GLU B  2 52  ? -37.036 -10.708 64.374 1.00 62.86  ? 52   GLU B N     1 
ATOM   1049  C  CA    . GLU B  2 52  ? -36.398 -9.524  63.792 1.00 63.73  ? 52   GLU B CA    1 
ATOM   1050  C  C     . GLU B  2 52  ? -35.149 -9.909  63.018 1.00 63.16  ? 52   GLU B C     1 
ATOM   1051  O  O     . GLU B  2 52  ? -34.995 -9.472  61.872 1.00 63.46  ? 52   GLU B O     1 
ATOM   1052  C  CB    . GLU B  2 52  ? -36.116 -8.426  64.809 1.00 64.08  ? 52   GLU B CB    1 
ATOM   1053  C  CG    . GLU B  2 52  ? -37.333 -7.556  65.071 1.00 67.94  ? 52   GLU B CG    1 
ATOM   1054  C  CD    . GLU B  2 52  ? -37.833 -6.845  63.812 1.00 72.74  ? 52   GLU B CD    1 
ATOM   1055  O  OE1   . GLU B  2 52  ? -37.073 -6.003  63.265 1.00 74.76  ? 52   GLU B OE1   1 
ATOM   1056  O  OE2   . GLU B  2 52  ? -38.983 -7.118  63.376 1.00 73.07  ? 52   GLU B OE2   1 
ATOM   1057  N  N     . GLU B  2 53  ? -34.301 -10.764 63.602 1.00 62.30  ? 53   GLU B N     1 
ATOM   1058  C  CA    . GLU B  2 53  ? -33.077 -11.210 62.906 1.00 61.47  ? 53   GLU B CA    1 
ATOM   1059  C  C     . GLU B  2 53  ? -33.378 -11.829 61.520 1.00 60.33  ? 53   GLU B C     1 
ATOM   1060  O  O     . GLU B  2 53  ? -32.643 -11.603 60.552 1.00 59.68  ? 53   GLU B O     1 
ATOM   1061  C  CB    . GLU B  2 53  ? -32.253 -12.164 63.775 1.00 61.65  ? 53   GLU B CB    1 
ATOM   1062  C  CG    . GLU B  2 53  ? -30.800 -12.363 63.322 1.00 63.15  ? 53   GLU B CG    1 
ATOM   1063  C  CD    . GLU B  2 53  ? -29.843 -11.271 63.833 1.00 67.63  ? 53   GLU B CD    1 
ATOM   1064  O  OE1   . GLU B  2 53  ? -30.227 -10.552 64.794 1.00 68.39  ? 53   GLU B OE1   1 
ATOM   1065  O  OE2   . GLU B  2 53  ? -28.705 -11.135 63.279 1.00 67.65  ? 53   GLU B OE2   1 
ATOM   1066  N  N     . THR B  2 54  ? -34.484 -12.560 61.432 1.00 59.18  ? 54   THR B N     1 
ATOM   1067  C  CA    . THR B  2 54  ? -34.852 -13.244 60.205 1.00 58.94  ? 54   THR B CA    1 
ATOM   1068  C  C     . THR B  2 54  ? -35.244 -12.272 59.124 1.00 58.77  ? 54   THR B C     1 
ATOM   1069  O  O     . THR B  2 54  ? -34.847 -12.434 57.950 1.00 58.38  ? 54   THR B O     1 
ATOM   1070  C  CB    . THR B  2 54  ? -36.000 -14.228 60.424 1.00 58.90  ? 54   THR B CB    1 
ATOM   1071  O  OG1   . THR B  2 54  ? -35.641 -15.157 61.452 1.00 59.51  ? 54   THR B OG1   1 
ATOM   1072  C  CG2   . THR B  2 54  ? -36.303 -14.999 59.156 1.00 58.79  ? 54   THR B CG2   1 
ATOM   1073  N  N     . ARG B  2 55  ? -36.029 -11.266 59.520 1.00 58.98  ? 55   ARG B N     1 
ATOM   1074  C  CA    . ARG B  2 55  ? -36.494 -10.250 58.576 1.00 58.45  ? 55   ARG B CA    1 
ATOM   1075  C  C     . ARG B  2 55  ? -35.302 -9.508  57.987 1.00 57.96  ? 55   ARG B C     1 
ATOM   1076  O  O     . ARG B  2 55  ? -35.239 -9.306  56.771 1.00 58.16  ? 55   ARG B O     1 
ATOM   1077  C  CB    . ARG B  2 55  ? -37.478 -9.296  59.232 1.00 58.81  ? 55   ARG B CB    1 
ATOM   1078  C  CG    . ARG B  2 55  ? -38.744 -9.974  59.773 1.00 59.31  ? 55   ARG B CG    1 
ATOM   1079  C  CD    . ARG B  2 55  ? -39.812 -8.935  60.192 1.00 58.53  ? 55   ARG B CD    1 
ATOM   1080  N  NE    . ARG B  2 55  ? -41.027 -9.584  60.665 1.00 55.33  ? 55   ARG B NE    1 
ATOM   1081  C  CZ    . ARG B  2 55  ? -41.304 -9.819  61.940 1.00 55.56  ? 55   ARG B CZ    1 
ATOM   1082  N  NH1   . ARG B  2 55  ? -40.472 -9.444  62.902 1.00 56.84  ? 55   ARG B NH1   1 
ATOM   1083  N  NH2   . ARG B  2 55  ? -42.423 -10.443 62.252 1.00 56.39  ? 55   ARG B NH2   1 
ATOM   1084  N  N     . GLY B  2 56  ? -34.341 -9.145  58.832 1.00 56.87  ? 56   GLY B N     1 
ATOM   1085  C  CA    . GLY B  2 56  ? -33.093 -8.581  58.336 1.00 56.57  ? 56   GLY B CA    1 
ATOM   1086  C  C     . GLY B  2 56  ? -32.384 -9.447  57.301 1.00 56.24  ? 56   GLY B C     1 
ATOM   1087  O  O     . GLY B  2 56  ? -31.947 -8.964  56.243 1.00 56.09  ? 56   GLY B O     1 
ATOM   1088  N  N     . VAL B  2 57  ? -32.278 -10.735 57.609 1.00 55.66  ? 57   VAL B N     1 
ATOM   1089  C  CA    . VAL B  2 57  ? -31.596 -11.681 56.732 1.00 54.91  ? 57   VAL B CA    1 
ATOM   1090  C  C     . VAL B  2 57  ? -32.309 -11.802 55.390 1.00 54.56  ? 57   VAL B C     1 
ATOM   1091  O  O     . VAL B  2 57  ? -31.680 -11.771 54.347 1.00 53.95  ? 57   VAL B O     1 
ATOM   1092  C  CB    . VAL B  2 57  ? -31.453 -13.049 57.416 1.00 54.72  ? 57   VAL B CB    1 
ATOM   1093  C  CG1   . VAL B  2 57  ? -31.232 -14.134 56.406 1.00 55.09  ? 57   VAL B CG1   1 
ATOM   1094  C  CG2   . VAL B  2 57  ? -30.300 -13.013 58.410 1.00 54.50  ? 57   VAL B CG2   1 
ATOM   1095  N  N     . LEU B  2 58  ? -33.628 -11.926 55.430 1.00 54.68  ? 58   LEU B N     1 
ATOM   1096  C  CA    . LEU B  2 58  ? -34.423 -11.970 54.216 1.00 55.18  ? 58   LEU B CA    1 
ATOM   1097  C  C     . LEU B  2 58  ? -34.272 -10.702 53.384 1.00 55.79  ? 58   LEU B C     1 
ATOM   1098  O  O     . LEU B  2 58  ? -34.211 -10.739 52.143 1.00 55.99  ? 58   LEU B O     1 
ATOM   1099  C  CB    . LEU B  2 58  ? -35.886 -12.147 54.578 1.00 55.28  ? 58   LEU B CB    1 
ATOM   1100  C  CG    . LEU B  2 58  ? -36.872 -12.189 53.409 1.00 55.82  ? 58   LEU B CG    1 
ATOM   1101  C  CD1   . LEU B  2 58  ? -36.500 -13.240 52.376 1.00 54.79  ? 58   LEU B CD1   1 
ATOM   1102  C  CD2   . LEU B  2 58  ? -38.253 -12.476 53.963 1.00 58.00  ? 58   LEU B CD2   1 
ATOM   1103  N  N     . LYS B  2 59  ? -34.228 -9.573  54.071 1.00 55.82  ? 59   LYS B N     1 
ATOM   1104  C  CA    . LYS B  2 59  ? -34.107 -8.317  53.395 1.00 56.14  ? 59   LYS B CA    1 
ATOM   1105  C  C     . LYS B  2 59  ? -32.791 -8.259  52.626 1.00 55.47  ? 59   LYS B C     1 
ATOM   1106  O  O     . LYS B  2 59  ? -32.792 -7.863  51.471 1.00 55.79  ? 59   LYS B O     1 
ATOM   1107  C  CB    . LYS B  2 59  ? -34.238 -7.176  54.401 1.00 57.14  ? 59   LYS B CB    1 
ATOM   1108  C  CG    . LYS B  2 59  ? -34.412 -5.800  53.792 1.00 59.52  ? 59   LYS B CG    1 
ATOM   1109  C  CD    . LYS B  2 59  ? -34.656 -4.768  54.898 1.00 64.57  ? 59   LYS B CD    1 
ATOM   1110  C  CE    . LYS B  2 59  ? -34.582 -3.338  54.340 1.00 68.49  ? 59   LYS B CE    1 
ATOM   1111  N  NZ    . LYS B  2 59  ? -33.151 -2.853  54.215 1.00 70.84  ? 59   LYS B NZ    1 
ATOM   1112  N  N     . VAL B  2 60  ? -31.681 -8.661  53.247 1.00 54.66  ? 60   VAL B N     1 
ATOM   1113  C  CA    . VAL B  2 60  ? -30.392 -8.696  52.550 1.00 53.80  ? 60   VAL B CA    1 
ATOM   1114  C  C     . VAL B  2 60  ? -30.431 -9.705  51.400 1.00 53.63  ? 60   VAL B C     1 
ATOM   1115  O  O     . VAL B  2 60  ? -29.931 -9.444  50.313 1.00 53.83  ? 60   VAL B O     1 
ATOM   1116  C  CB    . VAL B  2 60  ? -29.232 -9.055  53.493 1.00 54.21  ? 60   VAL B CB    1 
ATOM   1117  C  CG1   . VAL B  2 60  ? -28.010 -9.446  52.689 1.00 54.51  ? 60   VAL B CG1   1 
ATOM   1118  C  CG2   . VAL B  2 60  ? -28.890 -7.914  54.425 1.00 53.23  ? 60   VAL B CG2   1 
ATOM   1119  N  N     . PHE B  2 61  ? -31.039 -10.857 51.636 1.00 53.29  ? 61   PHE B N     1 
ATOM   1120  C  CA    . PHE B  2 61  ? -31.193 -11.848 50.581 1.00 53.28  ? 61   PHE B CA    1 
ATOM   1121  C  C     . PHE B  2 61  ? -31.888 -11.232 49.372 1.00 53.66  ? 61   PHE B C     1 
ATOM   1122  O  O     . PHE B  2 61  ? -31.336 -11.247 48.273 1.00 53.84  ? 61   PHE B O     1 
ATOM   1123  C  CB    . PHE B  2 61  ? -31.922 -13.116 51.073 1.00 52.53  ? 61   PHE B CB    1 
ATOM   1124  C  CG    . PHE B  2 61  ? -32.037 -14.184 50.025 1.00 52.22  ? 61   PHE B CG    1 
ATOM   1125  C  CD1   . PHE B  2 61  ? -30.975 -15.047 49.766 1.00 52.72  ? 61   PHE B CD1   1 
ATOM   1126  C  CD2   . PHE B  2 61  ? -33.200 -14.322 49.274 1.00 52.34  ? 61   PHE B CD2   1 
ATOM   1127  C  CE1   . PHE B  2 61  ? -31.075 -16.043 48.779 1.00 51.55  ? 61   PHE B CE1   1 
ATOM   1128  C  CE2   . PHE B  2 61  ? -33.307 -15.306 48.278 1.00 51.62  ? 61   PHE B CE2   1 
ATOM   1129  C  CZ    . PHE B  2 61  ? -32.243 -16.164 48.031 1.00 51.32  ? 61   PHE B CZ    1 
ATOM   1130  N  N     . LEU B  2 62  ? -33.082 -10.671 49.580 1.00 54.21  ? 62   LEU B N     1 
ATOM   1131  C  CA    . LEU B  2 62  ? -33.867 -10.072 48.478 1.00 53.97  ? 62   LEU B CA    1 
ATOM   1132  C  C     . LEU B  2 62  ? -33.208 -8.892  47.789 1.00 54.23  ? 62   LEU B C     1 
ATOM   1133  O  O     . LEU B  2 62  ? -33.218 -8.842  46.556 1.00 54.55  ? 62   LEU B O     1 
ATOM   1134  C  CB    . LEU B  2 62  ? -35.287 -9.733  48.912 1.00 53.63  ? 62   LEU B CB    1 
ATOM   1135  C  CG    . LEU B  2 62  ? -36.165 -10.946 49.249 1.00 53.22  ? 62   LEU B CG    1 
ATOM   1136  C  CD1   . LEU B  2 62  ? -37.423 -10.472 49.943 1.00 52.66  ? 62   LEU B CD1   1 
ATOM   1137  C  CD2   . LEU B  2 62  ? -36.505 -11.811 48.025 1.00 50.26  ? 62   LEU B CD2   1 
ATOM   1138  N  N     . GLU B  2 63  ? -32.637 -7.958  48.552 1.00 53.89  ? 63   GLU B N     1 
ATOM   1139  C  CA    . GLU B  2 63  ? -31.868 -6.867  47.952 1.00 55.30  ? 63   GLU B CA    1 
ATOM   1140  C  C     . GLU B  2 63  ? -30.841 -7.377  46.940 1.00 54.55  ? 63   GLU B C     1 
ATOM   1141  O  O     . GLU B  2 63  ? -30.805 -6.919  45.809 1.00 54.44  ? 63   GLU B O     1 
ATOM   1142  C  CB    . GLU B  2 63  ? -31.156 -6.036  49.019 1.00 55.20  ? 63   GLU B CB    1 
ATOM   1143  C  CG    . GLU B  2 63  ? -32.065 -5.103  49.779 1.00 57.85  ? 63   GLU B CG    1 
ATOM   1144  C  CD    . GLU B  2 63  ? -31.475 -4.620  51.116 1.00 59.73  ? 63   GLU B CD    1 
ATOM   1145  O  OE1   . GLU B  2 63  ? -30.283 -4.915  51.432 1.00 64.38  ? 63   GLU B OE1   1 
ATOM   1146  O  OE2   . GLU B  2 63  ? -32.228 -3.936  51.869 1.00 66.34  ? 63   GLU B OE2   1 
ATOM   1147  N  N     . ASN B  2 64  ? -30.015 -8.341  47.346 1.00 54.47  ? 64   ASN B N     1 
ATOM   1148  C  CA    . ASN B  2 64  ? -28.955 -8.843  46.489 1.00 54.01  ? 64   ASN B CA    1 
ATOM   1149  C  C     . ASN B  2 64  ? -29.468 -9.472  45.218 1.00 53.84  ? 64   ASN B C     1 
ATOM   1150  O  O     . ASN B  2 64  ? -28.860 -9.312  44.157 1.00 54.30  ? 64   ASN B O     1 
ATOM   1151  C  CB    . ASN B  2 64  ? -28.102 -9.845  47.233 1.00 54.27  ? 64   ASN B CB    1 
ATOM   1152  C  CG    . ASN B  2 64  ? -27.151 -9.188  48.183 1.00 56.32  ? 64   ASN B CG    1 
ATOM   1153  O  OD1   . ASN B  2 64  ? -26.582 -8.143  47.872 1.00 61.80  ? 64   ASN B OD1   1 
ATOM   1154  N  ND2   . ASN B  2 64  ? -26.952 -9.791  49.353 1.00 57.17  ? 64   ASN B ND2   1 
ATOM   1155  N  N     . VAL B  2 65  ? -30.585 -10.187 45.334 1.00 53.46  ? 65   VAL B N     1 
ATOM   1156  C  CA    . VAL B  2 65  ? -31.160 -10.926 44.217 1.00 52.98  ? 65   VAL B CA    1 
ATOM   1157  C  C     . VAL B  2 65  ? -31.933 -9.994  43.290 1.00 52.79  ? 65   VAL B C     1 
ATOM   1158  O  O     . VAL B  2 65  ? -31.743 -10.041 42.075 1.00 51.84  ? 65   VAL B O     1 
ATOM   1159  C  CB    . VAL B  2 65  ? -32.062 -12.108 44.714 1.00 53.24  ? 65   VAL B CB    1 
ATOM   1160  C  CG1   . VAL B  2 65  ? -32.564 -12.940 43.559 1.00 51.66  ? 65   VAL B CG1   1 
ATOM   1161  C  CG2   . VAL B  2 65  ? -31.292 -12.995 45.658 1.00 53.77  ? 65   VAL B CG2   1 
ATOM   1162  N  N     . ILE B  2 66  ? -32.794 -9.157  43.879 1.00 52.89  ? 66   ILE B N     1 
ATOM   1163  C  CA    . ILE B  2 66  ? -33.580 -8.190  43.124 1.00 53.40  ? 66   ILE B CA    1 
ATOM   1164  C  C     . ILE B  2 66  ? -32.679 -7.179  42.429 1.00 53.38  ? 66   ILE B C     1 
ATOM   1165  O  O     . ILE B  2 66  ? -32.872 -6.891  41.265 1.00 53.04  ? 66   ILE B O     1 
ATOM   1166  C  CB    . ILE B  2 66  ? -34.628 -7.460  43.999 1.00 53.90  ? 66   ILE B CB    1 
ATOM   1167  C  CG1   . ILE B  2 66  ? -35.747 -8.413  44.420 1.00 54.28  ? 66   ILE B CG1   1 
ATOM   1168  C  CG2   . ILE B  2 66  ? -35.249 -6.298  43.233 1.00 53.46  ? 66   ILE B CG2   1 
ATOM   1169  C  CD1   . ILE B  2 66  ? -36.535 -7.905  45.605 1.00 54.13  ? 66   ILE B CD1   1 
ATOM   1170  N  N     . ARG B  2 67  ? -31.673 -6.672  43.131 1.00 53.61  ? 67   ARG B N     1 
ATOM   1171  C  CA    . ARG B  2 67  ? -30.734 -5.761  42.509 1.00 54.69  ? 67   ARG B CA    1 
ATOM   1172  C  C     . ARG B  2 67  ? -30.236 -6.328  41.200 1.00 54.69  ? 67   ARG B C     1 
ATOM   1173  O  O     . ARG B  2 67  ? -30.194 -5.622  40.206 1.00 54.97  ? 67   ARG B O     1 
ATOM   1174  C  CB    . ARG B  2 67  ? -29.567 -5.448  43.439 1.00 54.43  ? 67   ARG B CB    1 
ATOM   1175  C  CG    . ARG B  2 67  ? -28.445 -4.656  42.780 1.00 55.76  ? 67   ARG B CG    1 
ATOM   1176  C  CD    . ARG B  2 67  ? -27.235 -4.515  43.703 1.00 57.46  ? 67   ARG B CD    1 
ATOM   1177  N  NE    . ARG B  2 67  ? -27.548 -3.797  44.948 1.00 63.92  ? 67   ARG B NE    1 
ATOM   1178  C  CZ    . ARG B  2 67  ? -27.399 -4.292  46.182 1.00 65.45  ? 67   ARG B CZ    1 
ATOM   1179  N  NH1   . ARG B  2 67  ? -26.919 -5.525  46.376 1.00 64.37  ? 67   ARG B NH1   1 
ATOM   1180  N  NH2   . ARG B  2 67  ? -27.721 -3.538  47.233 1.00 65.29  ? 67   ARG B NH2   1 
ATOM   1181  N  N     . ASP B  2 68  ? -29.885 -7.613  41.198 1.00 55.28  ? 68   ASP B N     1 
ATOM   1182  C  CA    . ASP B  2 68  ? -29.318 -8.258  40.019 1.00 55.44  ? 68   ASP B CA    1 
ATOM   1183  C  C     . ASP B  2 68  ? -30.368 -8.500  38.962 1.00 55.03  ? 68   ASP B C     1 
ATOM   1184  O  O     . ASP B  2 68  ? -30.090 -8.350  37.792 1.00 54.85  ? 68   ASP B O     1 
ATOM   1185  C  CB    . ASP B  2 68  ? -28.608 -9.558  40.384 1.00 55.68  ? 68   ASP B CB    1 
ATOM   1186  C  CG    . ASP B  2 68  ? -27.155 -9.344  40.790 1.00 58.99  ? 68   ASP B CG    1 
ATOM   1187  O  OD1   . ASP B  2 68  ? -26.783 -8.196  41.155 1.00 61.05  ? 68   ASP B OD1   1 
ATOM   1188  O  OD2   . ASP B  2 68  ? -26.370 -10.338 40.751 1.00 62.09  ? 68   ASP B OD2   1 
ATOM   1189  N  N     . ALA B  2 69  ? -31.573 -8.881  39.366 1.00 55.23  ? 69   ALA B N     1 
ATOM   1190  C  CA    . ALA B  2 69  ? -32.643 -9.147  38.393 1.00 55.68  ? 69   ALA B CA    1 
ATOM   1191  C  C     . ALA B  2 69  ? -33.012 -7.849  37.685 1.00 55.66  ? 69   ALA B C     1 
ATOM   1192  O  O     . ALA B  2 69  ? -33.082 -7.787  36.449 1.00 55.27  ? 69   ALA B O     1 
ATOM   1193  C  CB    . ALA B  2 69  ? -33.885 -9.771  39.072 1.00 55.84  ? 69   ALA B CB    1 
ATOM   1194  N  N     . VAL B  2 70  ? -33.216 -6.808  38.482 1.00 55.57  ? 70   VAL B N     1 
ATOM   1195  C  CA    . VAL B  2 70  ? -33.472 -5.472  37.950 1.00 55.85  ? 70   VAL B CA    1 
ATOM   1196  C  C     . VAL B  2 70  ? -32.364 -5.049  36.982 1.00 56.10  ? 70   VAL B C     1 
ATOM   1197  O  O     . VAL B  2 70  ? -32.658 -4.508  35.932 1.00 56.64  ? 70   VAL B O     1 
ATOM   1198  C  CB    . VAL B  2 70  ? -33.654 -4.433  39.067 1.00 55.55  ? 70   VAL B CB    1 
ATOM   1199  C  CG1   . VAL B  2 70  ? -33.800 -3.056  38.474 1.00 56.38  ? 70   VAL B CG1   1 
ATOM   1200  C  CG2   . VAL B  2 70  ? -34.866 -4.778  39.912 1.00 54.98  ? 70   VAL B CG2   1 
ATOM   1201  N  N     . THR B  2 71  ? -31.103 -5.314  37.312 1.00 56.13  ? 71   THR B N     1 
ATOM   1202  C  CA    . THR B  2 71  ? -30.026 -5.035  36.373 1.00 56.37  ? 71   THR B CA    1 
ATOM   1203  C  C     . THR B  2 71  ? -30.264 -5.761  35.073 1.00 57.41  ? 71   THR B C     1 
ATOM   1204  O  O     . THR B  2 71  ? -29.946 -5.247  34.027 1.00 58.05  ? 71   THR B O     1 
ATOM   1205  C  CB    . THR B  2 71  ? -28.656 -5.396  36.937 1.00 55.86  ? 71   THR B CB    1 
ATOM   1206  O  OG1   . THR B  2 71  ? -28.427 -4.619  38.109 1.00 55.45  ? 71   THR B OG1   1 
ATOM   1207  C  CG2   . THR B  2 71  ? -27.544 -5.098  35.940 1.00 54.73  ? 71   THR B CG2   1 
ATOM   1208  N  N     . TYR B  2 72  ? -30.828 -6.960  35.139 1.00 58.90  ? 72   TYR B N     1 
ATOM   1209  C  CA    . TYR B  2 72  ? -31.088 -7.741  33.929 1.00 60.08  ? 72   TYR B CA    1 
ATOM   1210  C  C     . TYR B  2 72  ? -32.256 -7.128  33.142 1.00 61.36  ? 72   TYR B C     1 
ATOM   1211  O  O     . TYR B  2 72  ? -32.235 -7.101  31.921 1.00 61.61  ? 72   TYR B O     1 
ATOM   1212  C  CB    . TYR B  2 72  ? -31.382 -9.199  34.280 1.00 59.15  ? 72   TYR B CB    1 
ATOM   1213  C  CG    . TYR B  2 72  ? -30.152 -10.063 34.493 1.00 59.00  ? 72   TYR B CG    1 
ATOM   1214  C  CD1   . TYR B  2 72  ? -29.940 -10.743 35.699 1.00 57.77  ? 72   TYR B CD1   1 
ATOM   1215  C  CD2   . TYR B  2 72  ? -29.213 -10.232 33.467 1.00 59.04  ? 72   TYR B CD2   1 
ATOM   1216  C  CE1   . TYR B  2 72  ? -28.807 -11.547 35.882 1.00 56.17  ? 72   TYR B CE1   1 
ATOM   1217  C  CE2   . TYR B  2 72  ? -28.099 -11.033 33.636 1.00 58.75  ? 72   TYR B CE2   1 
ATOM   1218  C  CZ    . TYR B  2 72  ? -27.901 -11.691 34.842 1.00 57.84  ? 72   TYR B CZ    1 
ATOM   1219  O  OH    . TYR B  2 72  ? -26.781 -12.465 34.976 1.00 57.24  ? 72   TYR B OH    1 
ATOM   1220  N  N     . THR B  2 73  ? -33.263 -6.640  33.863 1.00 62.58  ? 73   THR B N     1 
ATOM   1221  C  CA    . THR B  2 73  ? -34.403 -5.974  33.266 1.00 63.52  ? 73   THR B CA    1 
ATOM   1222  C  C     . THR B  2 73  ? -33.973 -4.732  32.494 1.00 65.04  ? 73   THR B C     1 
ATOM   1223  O  O     . THR B  2 73  ? -34.223 -4.641  31.284 1.00 65.22  ? 73   THR B O     1 
ATOM   1224  C  CB    . THR B  2 73  ? -35.412 -5.562  34.329 1.00 63.32  ? 73   THR B CB    1 
ATOM   1225  O  OG1   . THR B  2 73  ? -35.744 -6.703  35.122 1.00 62.03  ? 73   THR B OG1   1 
ATOM   1226  C  CG2   . THR B  2 73  ? -36.674 -5.017  33.685 1.00 62.55  ? 73   THR B CG2   1 
ATOM   1227  N  N     . GLU B  2 74  ? -33.320 -3.800  33.197 1.00 66.16  ? 74   GLU B N     1 
ATOM   1228  C  CA    . GLU B  2 74  ? -32.755 -2.588  32.600 1.00 67.75  ? 74   GLU B CA    1 
ATOM   1229  C  C     . GLU B  2 74  ? -31.939 -2.868  31.348 1.00 67.34  ? 74   GLU B C     1 
ATOM   1230  O  O     . GLU B  2 74  ? -32.162 -2.252  30.304 1.00 67.77  ? 74   GLU B O     1 
ATOM   1231  C  CB    . GLU B  2 74  ? -31.909 -1.808  33.610 1.00 67.41  ? 74   GLU B CB    1 
ATOM   1232  C  CG    . GLU B  2 74  ? -32.740 -0.888  34.514 1.00 70.23  ? 74   GLU B CG    1 
ATOM   1233  C  CD    . GLU B  2 74  ? -31.889 -0.030  35.445 1.00 71.66  ? 74   GLU B CD    1 
ATOM   1234  O  OE1   . GLU B  2 74  ? -31.883 1.213   35.276 1.00 77.38  ? 74   GLU B OE1   1 
ATOM   1235  O  OE2   . GLU B  2 74  ? -31.219 -0.592  36.348 1.00 77.76  ? 74   GLU B OE2   1 
ATOM   1236  N  N     . HIS B  2 75  ? -31.004 -3.803  31.425 1.00 67.23  ? 75   HIS B N     1 
ATOM   1237  C  CA    . HIS B  2 75  ? -30.232 -4.120  30.238 1.00 67.07  ? 75   HIS B CA    1 
ATOM   1238  C  C     . HIS B  2 75  ? -31.156 -4.424  29.044 1.00 68.17  ? 75   HIS B C     1 
ATOM   1239  O  O     . HIS B  2 75  ? -30.875 -4.016  27.926 1.00 68.12  ? 75   HIS B O     1 
ATOM   1240  C  CB    . HIS B  2 75  ? -29.271 -5.276  30.487 1.00 66.25  ? 75   HIS B CB    1 
ATOM   1241  C  CG    . HIS B  2 75  ? -28.377 -5.558  29.327 1.00 63.20  ? 75   HIS B CG    1 
ATOM   1242  N  ND1   . HIS B  2 75  ? -27.208 -4.871  29.111 1.00 61.02  ? 75   HIS B ND1   1 
ATOM   1243  C  CD2   . HIS B  2 75  ? -28.491 -6.437  28.306 1.00 62.17  ? 75   HIS B CD2   1 
ATOM   1244  C  CE1   . HIS B  2 75  ? -26.634 -5.319  28.008 1.00 61.47  ? 75   HIS B CE1   1 
ATOM   1245  N  NE2   . HIS B  2 75  ? -27.390 -6.275  27.502 1.00 59.67  ? 75   HIS B NE2   1 
ATOM   1246  N  N     . ALA B  2 76  ? -32.267 -5.112  29.305 1.00 69.04  ? 76   ALA B N     1 
ATOM   1247  C  CA    . ALA B  2 76  ? -33.187 -5.536  28.264 1.00 69.83  ? 76   ALA B CA    1 
ATOM   1248  C  C     . ALA B  2 76  ? -34.151 -4.407  27.845 1.00 70.75  ? 76   ALA B C     1 
ATOM   1249  O  O     . ALA B  2 76  ? -34.939 -4.559  26.899 1.00 71.30  ? 76   ALA B O     1 
ATOM   1250  C  CB    . ALA B  2 76  ? -33.959 -6.766  28.734 1.00 69.48  ? 76   ALA B CB    1 
ATOM   1251  N  N     . LYS B  2 77  ? -34.088 -3.274  28.546 1.00 71.29  ? 77   LYS B N     1 
ATOM   1252  C  CA    . LYS B  2 77  ? -34.982 -2.137  28.284 1.00 71.45  ? 77   LYS B CA    1 
ATOM   1253  C  C     . LYS B  2 77  ? -36.449 -2.553  28.453 1.00 71.40  ? 77   LYS B C     1 
ATOM   1254  O  O     . LYS B  2 77  ? -37.304 -2.188  27.647 1.00 71.70  ? 77   LYS B O     1 
ATOM   1255  C  CB    . LYS B  2 77  ? -34.757 -1.562  26.872 1.00 71.55  ? 77   LYS B CB    1 
ATOM   1256  C  CG    . LYS B  2 77  ? -33.362 -1.006  26.590 1.00 72.56  ? 77   LYS B CG    1 
ATOM   1257  C  CD    . LYS B  2 77  ? -33.058 -1.114  25.107 1.00 74.66  ? 77   LYS B CD    1 
ATOM   1258  C  CE    . LYS B  2 77  ? -31.570 -0.896  24.802 1.00 77.17  ? 77   LYS B CE    1 
ATOM   1259  N  NZ    . LYS B  2 77  ? -31.227 -1.328  23.385 1.00 78.09  ? 77   LYS B NZ    1 
ATOM   1260  N  N     . ARG B  2 78  ? -36.736 -3.339  29.485 1.00 71.10  ? 78   ARG B N     1 
ATOM   1261  C  CA    . ARG B  2 78  ? -38.115 -3.666  29.825 1.00 70.73  ? 78   ARG B CA    1 
ATOM   1262  C  C     . ARG B  2 78  ? -38.464 -2.919  31.090 1.00 71.11  ? 78   ARG B C     1 
ATOM   1263  O  O     . ARG B  2 78  ? -37.582 -2.348  31.727 1.00 70.70  ? 78   ARG B O     1 
ATOM   1264  C  CB    . ARG B  2 78  ? -38.311 -5.177  30.012 1.00 70.97  ? 78   ARG B CB    1 
ATOM   1265  C  CG    . ARG B  2 78  ? -38.031 -6.006  28.765 1.00 70.08  ? 78   ARG B CG    1 
ATOM   1266  C  CD    . ARG B  2 78  ? -38.355 -7.469  28.971 1.00 69.76  ? 78   ARG B CD    1 
ATOM   1267  N  NE    . ARG B  2 78  ? -37.164 -8.259  29.289 1.00 67.98  ? 78   ARG B NE    1 
ATOM   1268  C  CZ    . ARG B  2 78  ? -36.722 -8.499  30.525 1.00 67.14  ? 78   ARG B CZ    1 
ATOM   1269  N  NH1   . ARG B  2 78  ? -37.365 -8.002  31.586 1.00 65.96  ? 78   ARG B NH1   1 
ATOM   1270  N  NH2   . ARG B  2 78  ? -35.631 -9.234  30.698 1.00 63.63  ? 78   ARG B NH2   1 
ATOM   1271  N  N     . LYS B  2 79  ? -39.751 -2.897  31.431 1.00 71.94  ? 79   LYS B N     1 
ATOM   1272  C  CA    . LYS B  2 79  ? -40.231 -2.283  32.673 1.00 73.26  ? 79   LYS B CA    1 
ATOM   1273  C  C     . LYS B  2 79  ? -40.832 -3.342  33.586 1.00 72.50  ? 79   LYS B C     1 
ATOM   1274  O  O     . LYS B  2 79  ? -41.309 -3.038  34.695 1.00 72.65  ? 79   LYS B O     1 
ATOM   1275  C  CB    . LYS B  2 79  ? -41.273 -1.191  32.396 1.00 73.61  ? 79   LYS B CB    1 
ATOM   1276  C  CG    . LYS B  2 79  ? -40.747 0.057   31.674 1.00 75.49  ? 79   LYS B CG    1 
ATOM   1277  C  CD    . LYS B  2 79  ? -41.838 1.127   31.614 1.00 76.22  ? 79   LYS B CD    1 
ATOM   1278  C  CE    . LYS B  2 79  ? -41.724 1.938   30.319 1.00 82.50  ? 79   LYS B CE    1 
ATOM   1279  N  NZ    . LYS B  2 79  ? -42.955 2.781   30.054 1.00 85.68  ? 79   LYS B NZ    1 
ATOM   1280  N  N     . THR B  2 80  ? -40.814 -4.583  33.105 1.00 71.89  ? 80   THR B N     1 
ATOM   1281  C  CA    . THR B  2 80  ? -41.287 -5.724  33.879 1.00 71.61  ? 80   THR B CA    1 
ATOM   1282  C  C     . THR B  2 80  ? -40.127 -6.655  34.170 1.00 70.30  ? 80   THR B C     1 
ATOM   1283  O  O     . THR B  2 80  ? -39.353 -6.995  33.266 1.00 70.70  ? 80   THR B O     1 
ATOM   1284  C  CB    . THR B  2 80  ? -42.340 -6.514  33.097 1.00 72.00  ? 80   THR B CB    1 
ATOM   1285  O  OG1   . THR B  2 80  ? -43.096 -5.608  32.280 1.00 74.43  ? 80   THR B OG1   1 
ATOM   1286  C  CG2   . THR B  2 80  ? -43.272 -7.257  34.041 1.00 72.56  ? 80   THR B CG2   1 
ATOM   1287  N  N     . VAL B  2 81  ? -39.998 -7.052  35.431 1.00 68.87  ? 81   VAL B N     1 
ATOM   1288  C  CA    . VAL B  2 81  ? -39.052 -8.101  35.822 1.00 66.71  ? 81   VAL B CA    1 
ATOM   1289  C  C     . VAL B  2 81  ? -39.651 -9.441  35.439 1.00 65.77  ? 81   VAL B C     1 
ATOM   1290  O  O     . VAL B  2 81  ? -40.733 -9.824  35.933 1.00 65.17  ? 81   VAL B O     1 
ATOM   1291  C  CB    . VAL B  2 81  ? -38.784 -8.102  37.326 1.00 66.70  ? 81   VAL B CB    1 
ATOM   1292  C  CG1   . VAL B  2 81  ? -37.676 -9.111  37.678 1.00 66.74  ? 81   VAL B CG1   1 
ATOM   1293  C  CG2   . VAL B  2 81  ? -38.408 -6.709  37.798 1.00 66.73  ? 81   VAL B CG2   1 
ATOM   1294  N  N     . THR B  2 82  ? -38.955 -10.147 34.550 1.00 64.48  ? 82   THR B N     1 
ATOM   1295  C  CA    . THR B  2 82  ? -39.394 -11.473 34.139 1.00 63.23  ? 82   THR B CA    1 
ATOM   1296  C  C     . THR B  2 82  ? -38.837 -12.530 35.067 1.00 62.47  ? 82   THR B C     1 
ATOM   1297  O  O     . THR B  2 82  ? -37.753 -12.375 35.617 1.00 62.33  ? 82   THR B O     1 
ATOM   1298  C  CB    . THR B  2 82  ? -38.963 -11.782 32.698 1.00 63.21  ? 82   THR B CB    1 
ATOM   1299  O  OG1   . THR B  2 82  ? -37.538 -11.844 32.620 1.00 62.92  ? 82   THR B OG1   1 
ATOM   1300  C  CG2   . THR B  2 82  ? -39.452 -10.704 31.757 1.00 63.86  ? 82   THR B CG2   1 
ATOM   1301  N  N     . ALA B  2 83  ? -39.575 -13.618 35.228 1.00 62.05  ? 83   ALA B N     1 
ATOM   1302  C  CA    . ALA B  2 83  ? -39.030 -14.826 35.848 1.00 61.44  ? 83   ALA B CA    1 
ATOM   1303  C  C     . ALA B  2 83  ? -37.597 -15.137 35.432 1.00 61.11  ? 83   ALA B C     1 
ATOM   1304  O  O     . ALA B  2 83  ? -36.799 -15.444 36.302 1.00 61.19  ? 83   ALA B O     1 
ATOM   1305  C  CB    . ALA B  2 83  ? -39.908 -16.007 35.566 1.00 61.66  ? 83   ALA B CB    1 
ATOM   1306  N  N     . MET B  2 84  ? -37.275 -15.065 34.136 1.00 60.66  ? 84   MET B N     1 
ATOM   1307  C  CA    . MET B  2 84  ? -35.923 -15.343 33.659 1.00 61.11  ? 84   MET B CA    1 
ATOM   1308  C  C     . MET B  2 84  ? -34.907 -14.399 34.269 1.00 61.15  ? 84   MET B C     1 
ATOM   1309  O  O     . MET B  2 84  ? -33.781 -14.799 34.564 1.00 61.07  ? 84   MET B O     1 
ATOM   1310  C  CB    . MET B  2 84  ? -35.798 -15.238 32.141 1.00 61.61  ? 84   MET B CB    1 
ATOM   1311  C  CG    . MET B  2 84  ? -36.332 -16.417 31.375 1.00 64.79  ? 84   MET B CG    1 
ATOM   1312  S  SD    . MET B  2 84  ? -36.005 -18.007 32.173 1.00 75.74  ? 84   MET B SD    1 
ATOM   1313  C  CE    . MET B  2 84  ? -34.224 -18.223 31.863 1.00 69.74  ? 84   MET B CE    1 
ATOM   1314  N  N     . ASP B  2 85  ? -35.300 -13.140 34.447 1.00 60.72  ? 85   ASP B N     1 
ATOM   1315  C  CA    . ASP B  2 85  ? -34.432 -12.181 35.083 1.00 60.28  ? 85   ASP B CA    1 
ATOM   1316  C  C     . ASP B  2 85  ? -34.066 -12.687 36.453 1.00 59.63  ? 85   ASP B C     1 
ATOM   1317  O  O     . ASP B  2 85  ? -32.905 -12.570 36.858 1.00 60.24  ? 85   ASP B O     1 
ATOM   1318  C  CB    . ASP B  2 85  ? -35.103 -10.815 35.235 1.00 60.71  ? 85   ASP B CB    1 
ATOM   1319  C  CG    . ASP B  2 85  ? -35.220 -10.072 33.927 1.00 62.34  ? 85   ASP B CG    1 
ATOM   1320  O  OD1   . ASP B  2 85  ? -34.380 -10.316 33.020 1.00 62.92  ? 85   ASP B OD1   1 
ATOM   1321  O  OD2   . ASP B  2 85  ? -36.162 -9.245  33.810 1.00 64.52  ? 85   ASP B OD2   1 
ATOM   1322  N  N     . VAL B  2 86  ? -35.051 -13.216 37.172 1.00 58.20  ? 86   VAL B N     1 
ATOM   1323  C  CA    . VAL B  2 86  ? -34.827 -13.685 38.519 1.00 57.97  ? 86   VAL B CA    1 
ATOM   1324  C  C     . VAL B  2 86  ? -33.981 -14.950 38.476 1.00 58.20  ? 86   VAL B C     1 
ATOM   1325  O  O     . VAL B  2 86  ? -33.033 -15.103 39.264 1.00 59.07  ? 86   VAL B O     1 
ATOM   1326  C  CB    . VAL B  2 86  ? -36.145 -13.974 39.250 1.00 57.89  ? 86   VAL B CB    1 
ATOM   1327  C  CG1   . VAL B  2 86  ? -35.893 -14.620 40.598 1.00 56.82  ? 86   VAL B CG1   1 
ATOM   1328  C  CG2   . VAL B  2 86  ? -36.935 -12.701 39.424 1.00 59.08  ? 86   VAL B CG2   1 
ATOM   1329  N  N     . VAL B  2 87  ? -34.309 -15.848 37.555 1.00 56.88  ? 87   VAL B N     1 
ATOM   1330  C  CA    . VAL B  2 87  ? -33.588 -17.092 37.454 1.00 55.65  ? 87   VAL B CA    1 
ATOM   1331  C  C     . VAL B  2 87  ? -32.132 -16.821 37.124 1.00 55.82  ? 87   VAL B C     1 
ATOM   1332  O  O     . VAL B  2 87  ? -31.258 -17.418 37.718 1.00 55.65  ? 87   VAL B O     1 
ATOM   1333  C  CB    . VAL B  2 87  ? -34.262 -18.077 36.455 1.00 55.69  ? 87   VAL B CB    1 
ATOM   1334  C  CG1   . VAL B  2 87  ? -33.321 -19.235 36.079 1.00 52.63  ? 87   VAL B CG1   1 
ATOM   1335  C  CG2   . VAL B  2 87  ? -35.554 -18.593 37.053 1.00 54.18  ? 87   VAL B CG2   1 
ATOM   1336  N  N     . TYR B  2 88  ? -31.862 -15.912 36.200 1.00 56.18  ? 88   TYR B N     1 
ATOM   1337  C  CA    . TYR B  2 88  ? -30.479 -15.537 35.925 1.00 56.30  ? 88   TYR B CA    1 
ATOM   1338  C  C     . TYR B  2 88  ? -29.792 -14.947 37.148 1.00 55.83  ? 88   TYR B C     1 
ATOM   1339  O  O     . TYR B  2 88  ? -28.602 -15.207 37.389 1.00 55.21  ? 88   TYR B O     1 
ATOM   1340  C  CB    . TYR B  2 88  ? -30.412 -14.536 34.810 1.00 57.52  ? 88   TYR B CB    1 
ATOM   1341  C  CG    . TYR B  2 88  ? -30.882 -15.068 33.495 1.00 59.92  ? 88   TYR B CG    1 
ATOM   1342  C  CD1   . TYR B  2 88  ? -31.739 -14.325 32.709 1.00 61.42  ? 88   TYR B CD1   1 
ATOM   1343  C  CD2   . TYR B  2 88  ? -30.469 -16.306 33.033 1.00 61.82  ? 88   TYR B CD2   1 
ATOM   1344  C  CE1   . TYR B  2 88  ? -32.181 -14.795 31.501 1.00 63.36  ? 88   TYR B CE1   1 
ATOM   1345  C  CE2   . TYR B  2 88  ? -30.906 -16.791 31.809 1.00 63.60  ? 88   TYR B CE2   1 
ATOM   1346  C  CZ    . TYR B  2 88  ? -31.768 -16.022 31.049 1.00 62.56  ? 88   TYR B CZ    1 
ATOM   1347  O  OH    . TYR B  2 88  ? -32.235 -16.467 29.832 1.00 63.28  ? 88   TYR B OH    1 
ATOM   1348  N  N     . ALA B  2 89  ? -30.542 -14.161 37.919 1.00 55.19  ? 89   ALA B N     1 
ATOM   1349  C  CA    . ALA B  2 89  ? -29.992 -13.501 39.096 1.00 54.94  ? 89   ALA B CA    1 
ATOM   1350  C  C     . ALA B  2 89  ? -29.602 -14.560 40.109 1.00 54.94  ? 89   ALA B C     1 
ATOM   1351  O  O     . ALA B  2 89  ? -28.471 -14.574 40.600 1.00 55.02  ? 89   ALA B O     1 
ATOM   1352  C  CB    . ALA B  2 89  ? -30.988 -12.549 39.686 1.00 54.92  ? 89   ALA B CB    1 
ATOM   1353  N  N     . LEU B  2 90  ? -30.532 -15.464 40.387 1.00 54.42  ? 90   LEU B N     1 
ATOM   1354  C  CA    . LEU B  2 90  ? -30.267 -16.604 41.253 1.00 54.65  ? 90   LEU B CA    1 
ATOM   1355  C  C     . LEU B  2 90  ? -29.063 -17.454 40.820 1.00 55.08  ? 90   LEU B C     1 
ATOM   1356  O  O     . LEU B  2 90  ? -28.233 -17.815 41.640 1.00 54.74  ? 90   LEU B O     1 
ATOM   1357  C  CB    . LEU B  2 90  ? -31.510 -17.475 41.354 1.00 53.90  ? 90   LEU B CB    1 
ATOM   1358  C  CG    . LEU B  2 90  ? -32.621 -16.819 42.166 1.00 53.35  ? 90   LEU B CG    1 
ATOM   1359  C  CD1   . LEU B  2 90  ? -33.940 -17.545 41.945 1.00 51.26  ? 90   LEU B CD1   1 
ATOM   1360  C  CD2   . LEU B  2 90  ? -32.266 -16.697 43.674 1.00 50.66  ? 90   LEU B CD2   1 
ATOM   1361  N  N     . LYS B  2 91  ? -28.964 -17.750 39.533 1.00 56.09  ? 91   LYS B N     1 
ATOM   1362  C  CA    . LYS B  2 91  ? -27.873 -18.563 39.042 1.00 57.59  ? 91   LYS B CA    1 
ATOM   1363  C  C     . LYS B  2 91  ? -26.540 -17.922 39.361 1.00 58.04  ? 91   LYS B C     1 
ATOM   1364  O  O     . LYS B  2 91  ? -25.603 -18.599 39.779 1.00 58.97  ? 91   LYS B O     1 
ATOM   1365  C  CB    . LYS B  2 91  ? -28.002 -18.813 37.547 1.00 57.83  ? 91   LYS B CB    1 
ATOM   1366  C  CG    . LYS B  2 91  ? -26.771 -19.459 36.943 1.00 61.78  ? 91   LYS B CG    1 
ATOM   1367  C  CD    . LYS B  2 91  ? -27.110 -20.721 36.121 1.00 66.40  ? 91   LYS B CD    1 
ATOM   1368  C  CE    . LYS B  2 91  ? -27.796 -20.390 34.758 1.00 69.33  ? 91   LYS B CE    1 
ATOM   1369  N  NZ    . LYS B  2 91  ? -27.820 -21.612 33.831 1.00 69.11  ? 91   LYS B NZ    1 
ATOM   1370  N  N     . ARG B  2 92  ? -26.445 -16.614 39.203 1.00 58.15  ? 92   ARG B N     1 
ATOM   1371  C  CA    . ARG B  2 92  ? -25.168 -15.987 39.443 1.00 58.13  ? 92   ARG B CA    1 
ATOM   1372  C  C     . ARG B  2 92  ? -24.888 -15.662 40.915 1.00 57.96  ? 92   ARG B C     1 
ATOM   1373  O  O     . ARG B  2 92  ? -23.744 -15.372 41.249 1.00 58.15  ? 92   ARG B O     1 
ATOM   1374  C  CB    . ARG B  2 92  ? -24.966 -14.775 38.537 1.00 58.25  ? 92   ARG B CB    1 
ATOM   1375  C  CG    . ARG B  2 92  ? -25.753 -13.558 38.959 1.00 59.63  ? 92   ARG B CG    1 
ATOM   1376  C  CD    . ARG B  2 92  ? -25.348 -12.380 38.098 1.00 62.10  ? 92   ARG B CD    1 
ATOM   1377  N  NE    . ARG B  2 92  ? -23.901 -12.231 38.086 1.00 61.53  ? 92   ARG B NE    1 
ATOM   1378  C  CZ    . ARG B  2 92  ? -23.203 -11.701 39.087 1.00 63.61  ? 92   ARG B CZ    1 
ATOM   1379  N  NH1   . ARG B  2 92  ? -23.825 -11.258 40.191 1.00 63.67  ? 92   ARG B NH1   1 
ATOM   1380  N  NH2   . ARG B  2 92  ? -21.879 -11.616 38.986 1.00 63.47  ? 92   ARG B NH2   1 
ATOM   1381  N  N     . GLN B  2 93  ? -25.898 -15.701 41.789 1.00 57.68  ? 93   GLN B N     1 
ATOM   1382  C  CA    . GLN B  2 93  ? -25.623 -15.697 43.233 1.00 57.74  ? 93   GLN B CA    1 
ATOM   1383  C  C     . GLN B  2 93  ? -25.301 -17.118 43.710 1.00 57.29  ? 93   GLN B C     1 
ATOM   1384  O  O     . GLN B  2 93  ? -25.217 -17.353 44.908 1.00 57.18  ? 93   GLN B O     1 
ATOM   1385  C  CB    . GLN B  2 93  ? -26.804 -15.193 44.079 1.00 58.52  ? 93   GLN B CB    1 
ATOM   1386  C  CG    . GLN B  2 93  ? -27.521 -13.908 43.645 1.00 60.97  ? 93   GLN B CG    1 
ATOM   1387  C  CD    . GLN B  2 93  ? -26.733 -12.647 43.889 1.00 64.71  ? 93   GLN B CD    1 
ATOM   1388  O  OE1   . GLN B  2 93  ? -25.850 -12.590 44.762 1.00 66.32  ? 93   GLN B OE1   1 
ATOM   1389  N  NE2   . GLN B  2 93  ? -27.051 -11.604 43.110 1.00 65.79  ? 93   GLN B NE2   1 
ATOM   1390  N  N     . GLY B  2 94  ? -25.152 -18.062 42.779 1.00 56.84  ? 94   GLY B N     1 
ATOM   1391  C  CA    . GLY B  2 94  ? -24.915 -19.465 43.103 1.00 55.67  ? 94   GLY B CA    1 
ATOM   1392  C  C     . GLY B  2 94  ? -26.069 -20.136 43.832 1.00 55.46  ? 94   GLY B C     1 
ATOM   1393  O  O     . GLY B  2 94  ? -25.852 -21.062 44.604 1.00 55.95  ? 94   GLY B O     1 
ATOM   1394  N  N     . ARG B  2 95  ? -27.291 -19.657 43.601 1.00 54.70  ? 95   ARG B N     1 
ATOM   1395  C  CA    . ARG B  2 95  ? -28.507 -20.266 44.139 1.00 53.60  ? 95   ARG B CA    1 
ATOM   1396  C  C     . ARG B  2 95  ? -29.456 -20.657 42.986 1.00 52.58  ? 95   ARG B C     1 
ATOM   1397  O  O     . ARG B  2 95  ? -30.601 -20.201 42.974 1.00 52.48  ? 95   ARG B O     1 
ATOM   1398  C  CB    . ARG B  2 95  ? -29.271 -19.312 45.088 1.00 53.37  ? 95   ARG B CB    1 
ATOM   1399  C  CG    . ARG B  2 95  ? -28.471 -18.501 46.087 1.00 56.14  ? 95   ARG B CG    1 
ATOM   1400  C  CD    . ARG B  2 95  ? -28.583 -18.940 47.550 1.00 59.24  ? 95   ARG B CD    1 
ATOM   1401  N  NE    . ARG B  2 95  ? -29.705 -19.856 47.781 1.00 65.63  ? 95   ARG B NE    1 
ATOM   1402  C  CZ    . ARG B  2 95  ? -29.675 -20.909 48.612 1.00 65.45  ? 95   ARG B CZ    1 
ATOM   1403  N  NH1   . ARG B  2 95  ? -28.576 -21.208 49.308 1.00 66.29  ? 95   ARG B NH1   1 
ATOM   1404  N  NH2   . ARG B  2 95  ? -30.748 -21.663 48.751 1.00 62.83  ? 95   ARG B NH2   1 
ATOM   1405  N  N     . THR B  2 96  ? -28.991 -21.483 42.043 1.00 51.56  ? 96   THR B N     1 
ATOM   1406  C  CA    . THR B  2 96  ? -29.797 -22.047 40.930 1.00 51.28  ? 96   THR B CA    1 
ATOM   1407  C  C     . THR B  2 96  ? -31.184 -22.582 41.299 1.00 52.39  ? 96   THR B C     1 
ATOM   1408  O  O     . THR B  2 96  ? -31.331 -23.397 42.216 1.00 53.36  ? 96   THR B O     1 
ATOM   1409  C  CB    . THR B  2 96  ? -29.046 -23.187 40.254 1.00 50.86  ? 96   THR B CB    1 
ATOM   1410  O  OG1   . THR B  2 96  ? -27.762 -22.713 39.841 1.00 51.40  ? 96   THR B OG1   1 
ATOM   1411  C  CG2   . THR B  2 96  ? -29.780 -23.712 39.051 1.00 49.10  ? 96   THR B CG2   1 
ATOM   1412  N  N     . LEU B  2 97  ? -32.196 -22.119 40.566 1.00 53.12  ? 97   LEU B N     1 
ATOM   1413  C  CA    . LEU B  2 97  ? -33.570 -22.515 40.770 1.00 53.54  ? 97   LEU B CA    1 
ATOM   1414  C  C     . LEU B  2 97  ? -34.103 -23.227 39.530 1.00 54.60  ? 97   LEU B C     1 
ATOM   1415  O  O     . LEU B  2 97  ? -33.899 -22.771 38.397 1.00 54.30  ? 97   LEU B O     1 
ATOM   1416  C  CB    . LEU B  2 97  ? -34.418 -21.288 41.079 1.00 53.51  ? 97   LEU B CB    1 
ATOM   1417  C  CG    . LEU B  2 97  ? -35.921 -21.416 41.380 1.00 53.72  ? 97   LEU B CG    1 
ATOM   1418  C  CD1   . LEU B  2 97  ? -36.187 -22.085 42.716 1.00 53.79  ? 97   LEU B CD1   1 
ATOM   1419  C  CD2   . LEU B  2 97  ? -36.582 -20.051 41.353 1.00 53.35  ? 97   LEU B CD2   1 
ATOM   1420  N  N     . TYR B  2 98  ? -34.765 -24.364 39.758 1.00 55.41  ? 98   TYR B N     1 
ATOM   1421  C  CA    . TYR B  2 98  ? -35.393 -25.122 38.687 1.00 56.12  ? 98   TYR B CA    1 
ATOM   1422  C  C     . TYR B  2 98  ? -36.895 -24.956 38.798 1.00 57.45  ? 98   TYR B C     1 
ATOM   1423  O  O     . TYR B  2 98  ? -37.446 -24.883 39.902 1.00 57.30  ? 98   TYR B O     1 
ATOM   1424  C  CB    . TYR B  2 98  ? -35.088 -26.602 38.811 1.00 55.35  ? 98   TYR B CB    1 
ATOM   1425  C  CG    . TYR B  2 98  ? -33.698 -27.064 38.455 1.00 54.11  ? 98   TYR B CG    1 
ATOM   1426  C  CD1   . TYR B  2 98  ? -32.717 -26.189 38.026 1.00 53.32  ? 98   TYR B CD1   1 
ATOM   1427  C  CD2   . TYR B  2 98  ? -33.385 -28.407 38.522 1.00 52.58  ? 98   TYR B CD2   1 
ATOM   1428  C  CE1   . TYR B  2 98  ? -31.460 -26.646 37.677 1.00 52.51  ? 98   TYR B CE1   1 
ATOM   1429  C  CE2   . TYR B  2 98  ? -32.149 -28.865 38.190 1.00 52.50  ? 98   TYR B CE2   1 
ATOM   1430  C  CZ    . TYR B  2 98  ? -31.185 -27.991 37.760 1.00 53.38  ? 98   TYR B CZ    1 
ATOM   1431  O  OH    . TYR B  2 98  ? -29.939 -28.493 37.428 1.00 53.18  ? 98   TYR B OH    1 
ATOM   1432  N  N     . GLY B  2 99  ? -37.556 -24.900 37.645 1.00 59.03  ? 99   GLY B N     1 
ATOM   1433  C  CA    . GLY B  2 99  ? -38.997 -24.763 37.612 1.00 60.69  ? 99   GLY B CA    1 
ATOM   1434  C  C     . GLY B  2 99  ? -39.570 -23.527 36.961 1.00 62.03  ? 99   GLY B C     1 
ATOM   1435  O  O     . GLY B  2 99  ? -40.767 -23.456 36.729 1.00 62.75  ? 99   GLY B O     1 
ATOM   1436  N  N     . PHE B  2 100 ? -38.747 -22.545 36.642 1.00 63.55  ? 100  PHE B N     1 
ATOM   1437  C  CA    . PHE B  2 100 ? -39.308 -21.321 36.115 1.00 64.83  ? 100  PHE B CA    1 
ATOM   1438  C  C     . PHE B  2 100 ? -38.768 -20.913 34.746 1.00 66.53  ? 100  PHE B C     1 
ATOM   1439  O  O     . PHE B  2 100 ? -38.986 -19.795 34.292 1.00 67.17  ? 100  PHE B O     1 
ATOM   1440  C  CB    . PHE B  2 100 ? -39.177 -20.212 37.150 1.00 64.33  ? 100  PHE B CB    1 
ATOM   1441  C  CG    . PHE B  2 100 ? -39.969 -20.462 38.403 1.00 63.27  ? 100  PHE B CG    1 
ATOM   1442  C  CD1   . PHE B  2 100 ? -39.440 -21.225 39.439 1.00 62.71  ? 100  PHE B CD1   1 
ATOM   1443  C  CD2   . PHE B  2 100 ? -41.246 -19.928 38.552 1.00 62.30  ? 100  PHE B CD2   1 
ATOM   1444  C  CE1   . PHE B  2 100 ? -40.185 -21.454 40.612 1.00 63.05  ? 100  PHE B CE1   1 
ATOM   1445  C  CE2   . PHE B  2 100 ? -41.998 -20.140 39.716 1.00 61.69  ? 100  PHE B CE2   1 
ATOM   1446  C  CZ    . PHE B  2 100 ? -41.466 -20.909 40.749 1.00 62.46  ? 100  PHE B CZ    1 
ATOM   1447  N  N     . GLY B  2 101 ? -38.115 -21.833 34.056 1.00 68.54  ? 101  GLY B N     1 
ATOM   1448  C  CA    . GLY B  2 101 ? -37.598 -21.535 32.732 1.00 71.38  ? 101  GLY B CA    1 
ATOM   1449  C  C     . GLY B  2 101 ? -36.087 -21.617 32.726 1.00 73.70  ? 101  GLY B C     1 
ATOM   1450  O  O     . GLY B  2 101 ? -35.454 -21.843 33.776 1.00 74.73  ? 101  GLY B O     1 
ATOM   1451  N  N     . GLY B  2 102 ? -35.491 -21.441 31.548 1.00 75.06  ? 102  GLY B N     1 
ATOM   1452  C  CA    . GLY B  2 102 ? -34.038 -21.600 31.419 1.00 76.24  ? 102  GLY B CA    1 
ATOM   1453  C  C     . GLY B  2 102 ? -33.605 -23.048 31.534 1.00 76.83  ? 102  GLY B C     1 
ATOM   1454  O  O     . GLY B  2 102 ? -32.422 -23.324 31.771 1.00 77.37  ? 102  GLY B O     1 
ATOM   1455  O  OXT   . GLY B  2 102 ? -34.427 -23.966 31.374 1.00 77.21  ? 102  GLY B OXT   1 
ATOM   1456  N  N     . ALA C  3 14  ? -0.249  7.531   13.087 1.00 91.19  ? 14   ALA C N     1 
ATOM   1457  C  CA    . ALA C  3 14  ? -0.788  6.265   13.653 1.00 91.32  ? 14   ALA C CA    1 
ATOM   1458  C  C     . ALA C  3 14  ? -0.845  6.281   15.189 1.00 91.18  ? 14   ALA C C     1 
ATOM   1459  O  O     . ALA C  3 14  ? 0.113   5.888   15.872 1.00 91.44  ? 14   ALA C O     1 
ATOM   1460  C  CB    . ALA C  3 14  ? 0.024   5.057   13.145 1.00 91.54  ? 14   ALA C CB    1 
ATOM   1461  N  N     . LYS C  3 15  ? -1.967  6.736   15.736 1.00 90.53  ? 15   LYS C N     1 
ATOM   1462  C  CA    . LYS C  3 15  ? -2.132  6.715   17.183 1.00 89.77  ? 15   LYS C CA    1 
ATOM   1463  C  C     . LYS C  3 15  ? -2.807  5.431   17.633 1.00 88.46  ? 15   LYS C C     1 
ATOM   1464  O  O     . LYS C  3 15  ? -3.857  5.058   17.092 1.00 88.83  ? 15   LYS C O     1 
ATOM   1465  C  CB    . LYS C  3 15  ? -2.888  7.954   17.667 1.00 90.21  ? 15   LYS C CB    1 
ATOM   1466  C  CG    . LYS C  3 15  ? -1.956  9.149   17.861 1.00 91.97  ? 15   LYS C CG    1 
ATOM   1467  C  CD    . LYS C  3 15  ? -2.725  10.405  18.272 1.00 94.65  ? 15   LYS C CD    1 
ATOM   1468  C  CE    . LYS C  3 15  ? -1.849  11.659  18.120 1.00 95.19  ? 15   LYS C CE    1 
ATOM   1469  N  NZ    . LYS C  3 15  ? -2.492  12.884  18.702 1.00 95.58  ? 15   LYS C NZ    1 
ATOM   1470  N  N     . THR C  3 16  ? -2.195  4.749   18.604 1.00 86.36  ? 16   THR C N     1 
ATOM   1471  C  CA    . THR C  3 16  ? -2.804  3.563   19.201 1.00 84.32  ? 16   THR C CA    1 
ATOM   1472  C  C     . THR C  3 16  ? -4.182  3.907   19.743 1.00 83.24  ? 16   THR C C     1 
ATOM   1473  O  O     . THR C  3 16  ? -4.428  5.040   20.188 1.00 82.69  ? 16   THR C O     1 
ATOM   1474  C  CB    . THR C  3 16  ? -1.994  2.965   20.386 1.00 84.34  ? 16   THR C CB    1 
ATOM   1475  O  OG1   . THR C  3 16  ? -2.176  3.774   21.559 1.00 83.43  ? 16   THR C OG1   1 
ATOM   1476  C  CG2   . THR C  3 16  ? -0.505  2.799   20.049 1.00 83.47  ? 16   THR C CG2   1 
ATOM   1477  N  N     . ARG C  3 17  ? -5.070  2.920   19.707 1.00 81.71  ? 17   ARG C N     1 
ATOM   1478  C  CA    . ARG C  3 17  ? -6.399  3.068   20.275 1.00 80.75  ? 17   ARG C CA    1 
ATOM   1479  C  C     . ARG C  3 17  ? -6.365  3.335   21.775 1.00 79.77  ? 17   ARG C C     1 
ATOM   1480  O  O     . ARG C  3 17  ? -7.268  3.967   22.323 1.00 79.57  ? 17   ARG C O     1 
ATOM   1481  C  CB    . ARG C  3 17  ? -7.223  1.831   19.990 1.00 80.94  ? 17   ARG C CB    1 
ATOM   1482  C  CG    . ARG C  3 17  ? -7.702  1.760   18.567 1.00 82.04  ? 17   ARG C CG    1 
ATOM   1483  C  CD    . ARG C  3 17  ? -8.878  0.840   18.452 1.00 81.80  ? 17   ARG C CD    1 
ATOM   1484  N  NE    . ARG C  3 17  ? -8.455  -0.552  18.355 1.00 82.34  ? 17   ARG C NE    1 
ATOM   1485  C  CZ    . ARG C  3 17  ? -9.287  -1.583  18.475 1.00 82.15  ? 17   ARG C CZ    1 
ATOM   1486  N  NH1   . ARG C  3 17  ? -10.584 -1.373  18.712 1.00 82.39  ? 17   ARG C NH1   1 
ATOM   1487  N  NH2   . ARG C  3 17  ? -8.819  -2.816  18.366 1.00 81.27  ? 17   ARG C NH2   1 
ATOM   1488  N  N     . SER C  3 18  ? -5.315  2.849   22.431 1.00 78.78  ? 18   SER C N     1 
ATOM   1489  C  CA    . SER C  3 18  ? -5.065  3.165   23.824 1.00 77.80  ? 18   SER C CA    1 
ATOM   1490  C  C     . SER C  3 18  ? -4.986  4.687   23.992 1.00 77.52  ? 18   SER C C     1 
ATOM   1491  O  O     . SER C  3 18  ? -5.841  5.279   24.645 1.00 77.43  ? 18   SER C O     1 
ATOM   1492  C  CB    . SER C  3 18  ? -3.788  2.471   24.305 1.00 77.69  ? 18   SER C CB    1 
ATOM   1493  O  OG    . SER C  3 18  ? -3.898  1.066   24.181 1.00 75.84  ? 18   SER C OG    1 
ATOM   1494  N  N     . SER C  3 19  ? -3.991  5.314   23.365 1.00 77.29  ? 19   SER C N     1 
ATOM   1495  C  CA    . SER C  3 19  ? -3.874  6.776   23.364 1.00 76.98  ? 19   SER C CA    1 
ATOM   1496  C  C     . SER C  3 19  ? -5.140  7.525   22.929 1.00 76.35  ? 19   SER C C     1 
ATOM   1497  O  O     . SER C  3 19  ? -5.489  8.514   23.550 1.00 76.38  ? 19   SER C O     1 
ATOM   1498  C  CB    . SER C  3 19  ? -2.643  7.243   22.585 1.00 77.19  ? 19   SER C CB    1 
ATOM   1499  O  OG    . SER C  3 19  ? -2.402  6.425   21.449 1.00 79.17  ? 19   SER C OG    1 
ATOM   1500  N  N     . ARG C  3 20  ? -5.851  7.047   21.909 1.00 76.03  ? 20   ARG C N     1 
ATOM   1501  C  CA    . ARG C  3 20  ? -7.124  7.680   21.513 1.00 76.22  ? 20   ARG C CA    1 
ATOM   1502  C  C     . ARG C  3 20  ? -8.156  7.748   22.643 1.00 75.51  ? 20   ARG C C     1 
ATOM   1503  O  O     . ARG C  3 20  ? -9.016  8.649   22.668 1.00 75.69  ? 20   ARG C O     1 
ATOM   1504  C  CB    . ARG C  3 20  ? -7.777  6.952   20.337 1.00 76.13  ? 20   ARG C CB    1 
ATOM   1505  C  CG    . ARG C  3 20  ? -7.049  6.975   19.003 1.00 77.72  ? 20   ARG C CG    1 
ATOM   1506  C  CD    . ARG C  3 20  ? -7.963  6.425   17.896 1.00 78.39  ? 20   ARG C CD    1 
ATOM   1507  N  NE    . ARG C  3 20  ? -7.221  5.967   16.716 1.00 84.68  ? 20   ARG C NE    1 
ATOM   1508  C  CZ    . ARG C  3 20  ? -6.890  6.740   15.672 1.00 87.25  ? 20   ARG C CZ    1 
ATOM   1509  N  NH1   . ARG C  3 20  ? -7.218  8.037   15.638 1.00 87.81  ? 20   ARG C NH1   1 
ATOM   1510  N  NH2   . ARG C  3 20  ? -6.225  6.214   14.650 1.00 88.23  ? 20   ARG C NH2   1 
ATOM   1511  N  N     . ALA C  3 21  ? -8.097  6.766   23.548 1.00 74.99  ? 21   ALA C N     1 
ATOM   1512  C  CA    . ALA C  3 21  ? -9.053  6.643   24.666 1.00 73.97  ? 21   ALA C CA    1 
ATOM   1513  C  C     . ALA C  3 21  ? -8.420  7.197   25.925 1.00 73.24  ? 21   ALA C C     1 
ATOM   1514  O  O     . ALA C  3 21  ? -9.099  7.458   26.918 1.00 73.24  ? 21   ALA C O     1 
ATOM   1515  C  CB    . ALA C  3 21  ? -9.443  5.192   24.870 1.00 74.01  ? 21   ALA C CB    1 
ATOM   1516  N  N     . GLY C  3 22  ? -7.105  7.370   25.864 1.00 72.36  ? 22   GLY C N     1 
ATOM   1517  C  CA    . GLY C  3 22  ? -6.357  8.019   26.918 1.00 71.51  ? 22   GLY C CA    1 
ATOM   1518  C  C     . GLY C  3 22  ? -6.061  7.026   28.003 1.00 70.89  ? 22   GLY C C     1 
ATOM   1519  O  O     . GLY C  3 22  ? -6.300  7.304   29.182 1.00 70.96  ? 22   GLY C O     1 
ATOM   1520  N  N     . LEU C  3 23  ? -5.521  5.877   27.587 1.00 70.24  ? 23   LEU C N     1 
ATOM   1521  C  CA    . LEU C  3 23  ? -5.353  4.716   28.454 1.00 69.22  ? 23   LEU C CA    1 
ATOM   1522  C  C     . LEU C  3 23  ? -3.982  4.098   28.350 1.00 68.94  ? 23   LEU C C     1 
ATOM   1523  O  O     . LEU C  3 23  ? -3.369  4.098   27.283 1.00 68.61  ? 23   LEU C O     1 
ATOM   1524  C  CB    . LEU C  3 23  ? -6.392  3.648   28.133 1.00 69.01  ? 23   LEU C CB    1 
ATOM   1525  C  CG    . LEU C  3 23  ? -7.863  3.912   28.446 1.00 68.20  ? 23   LEU C CG    1 
ATOM   1526  C  CD1   . LEU C  3 23  ? -8.649  2.709   27.998 1.00 68.61  ? 23   LEU C CD1   1 
ATOM   1527  C  CD2   . LEU C  3 23  ? -8.104  4.163   29.914 1.00 67.06  ? 23   LEU C CD2   1 
ATOM   1528  N  N     . GLN C  3 24  ? -3.534  3.566   29.487 1.00 68.78  ? 24   GLN C N     1 
ATOM   1529  C  CA    . GLN C  3 24  ? -2.270  2.862   29.634 1.00 68.83  ? 24   GLN C CA    1 
ATOM   1530  C  C     . GLN C  3 24  ? -2.392  1.412   29.196 1.00 69.01  ? 24   GLN C C     1 
ATOM   1531  O  O     . GLN C  3 24  ? -1.443  0.825   28.684 1.00 69.21  ? 24   GLN C O     1 
ATOM   1532  C  CB    . GLN C  3 24  ? -1.840  2.857   31.104 1.00 68.87  ? 24   GLN C CB    1 
ATOM   1533  C  CG    . GLN C  3 24  ? -1.686  4.221   31.754 1.00 68.29  ? 24   GLN C CG    1 
ATOM   1534  C  CD    . GLN C  3 24  ? -0.751  5.146   30.981 1.00 67.58  ? 24   GLN C CD    1 
ATOM   1535  O  OE1   . GLN C  3 24  ? 0.353   4.756   30.563 1.00 65.36  ? 24   GLN C OE1   1 
ATOM   1536  N  NE2   . GLN C  3 24  ? -1.197  6.382   30.787 1.00 67.03  ? 24   GLN C NE2   1 
ATOM   1537  N  N     . PHE C  3 25  ? -3.565  0.835   29.421 1.00 68.99  ? 25   PHE C N     1 
ATOM   1538  C  CA    . PHE C  3 25  ? -3.778  -0.583  29.190 1.00 68.94  ? 25   PHE C CA    1 
ATOM   1539  C  C     . PHE C  3 25  ? -4.001  -0.850  27.694 1.00 69.26  ? 25   PHE C C     1 
ATOM   1540  O  O     . PHE C  3 25  ? -4.547  0.006   26.996 1.00 69.61  ? 25   PHE C O     1 
ATOM   1541  C  CB    . PHE C  3 25  ? -4.922  -1.088  30.092 1.00 68.44  ? 25   PHE C CB    1 
ATOM   1542  C  CG    . PHE C  3 25  ? -4.446  -1.784  31.350 1.00 67.46  ? 25   PHE C CG    1 
ATOM   1543  C  CD1   . PHE C  3 25  ? -3.553  -1.167  32.217 1.00 65.81  ? 25   PHE C CD1   1 
ATOM   1544  C  CD2   . PHE C  3 25  ? -4.897  -3.070  31.667 1.00 67.74  ? 25   PHE C CD2   1 
ATOM   1545  C  CE1   . PHE C  3 25  ? -3.108  -1.812  33.366 1.00 64.18  ? 25   PHE C CE1   1 
ATOM   1546  C  CE2   . PHE C  3 25  ? -4.464  -3.722  32.818 1.00 64.36  ? 25   PHE C CE2   1 
ATOM   1547  C  CZ    . PHE C  3 25  ? -3.566  -3.089  33.664 1.00 65.85  ? 25   PHE C CZ    1 
ATOM   1548  N  N     . PRO C  3 26  ? -3.557  -2.024  27.191 1.00 69.49  ? 26   PRO C N     1 
ATOM   1549  C  CA    . PRO C  3 26  ? -3.532  -2.238  25.743 1.00 69.19  ? 26   PRO C CA    1 
ATOM   1550  C  C     . PRO C  3 26  ? -4.882  -2.616  25.189 1.00 68.94  ? 26   PRO C C     1 
ATOM   1551  O  O     . PRO C  3 26  ? -5.319  -3.757  25.348 1.00 68.45  ? 26   PRO C O     1 
ATOM   1552  C  CB    . PRO C  3 26  ? -2.514  -3.372  25.559 1.00 69.21  ? 26   PRO C CB    1 
ATOM   1553  C  CG    . PRO C  3 26  ? -2.494  -4.098  26.835 1.00 69.34  ? 26   PRO C CG    1 
ATOM   1554  C  CD    . PRO C  3 26  ? -3.059  -3.205  27.925 1.00 69.88  ? 26   PRO C CD    1 
ATOM   1555  N  N     . VAL C  3 27  ? -5.529  -1.638  24.553 1.00 69.19  ? 27   VAL C N     1 
ATOM   1556  C  CA    . VAL C  3 27  ? -6.833  -1.808  23.891 1.00 69.19  ? 27   VAL C CA    1 
ATOM   1557  C  C     . VAL C  3 27  ? -6.759  -2.824  22.753 1.00 69.74  ? 27   VAL C C     1 
ATOM   1558  O  O     . VAL C  3 27  ? -7.674  -3.633  22.582 1.00 69.58  ? 27   VAL C O     1 
ATOM   1559  C  CB    . VAL C  3 27  ? -7.356  -0.472  23.340 1.00 68.86  ? 27   VAL C CB    1 
ATOM   1560  C  CG1   . VAL C  3 27  ? -8.524  -0.688  22.400 1.00 68.47  ? 27   VAL C CG1   1 
ATOM   1561  C  CG2   . VAL C  3 27  ? -7.745  0.454   24.473 1.00 68.11  ? 27   VAL C CG2   1 
ATOM   1562  N  N     . GLY C  3 28  ? -5.666  -2.780  21.986 1.00 70.20  ? 28   GLY C N     1 
ATOM   1563  C  CA    . GLY C  3 28  ? -5.462  -3.726  20.900 1.00 70.67  ? 28   GLY C CA    1 
ATOM   1564  C  C     . GLY C  3 28  ? -5.543  -5.137  21.438 1.00 71.05  ? 28   GLY C C     1 
ATOM   1565  O  O     . GLY C  3 28  ? -6.382  -5.945  21.007 1.00 71.52  ? 28   GLY C O     1 
ATOM   1566  N  N     . ARG C  3 29  ? -4.673  -5.413  22.404 1.00 71.03  ? 29   ARG C N     1 
ATOM   1567  C  CA    . ARG C  3 29  ? -4.617  -6.696  23.092 1.00 70.83  ? 29   ARG C CA    1 
ATOM   1568  C  C     . ARG C  3 29  ? -5.993  -7.139  23.595 1.00 70.94  ? 29   ARG C C     1 
ATOM   1569  O  O     . ARG C  3 29  ? -6.421  -8.243  23.330 1.00 71.30  ? 29   ARG C O     1 
ATOM   1570  C  CB    . ARG C  3 29  ? -3.648  -6.596  24.270 1.00 70.63  ? 29   ARG C CB    1 
ATOM   1571  C  CG    . ARG C  3 29  ? -3.321  -7.921  24.905 1.00 70.61  ? 29   ARG C CG    1 
ATOM   1572  C  CD    . ARG C  3 29  ? -1.862  -8.235  24.748 1.00 70.49  ? 29   ARG C CD    1 
ATOM   1573  N  NE    . ARG C  3 29  ? -1.166  -7.983  26.001 1.00 71.39  ? 29   ARG C NE    1 
ATOM   1574  C  CZ    . ARG C  3 29  ? 0.153   -8.022  26.171 1.00 71.72  ? 29   ARG C CZ    1 
ATOM   1575  N  NH1   . ARG C  3 29  ? 0.976   -8.289  25.162 1.00 70.89  ? 29   ARG C NH1   1 
ATOM   1576  N  NH2   . ARG C  3 29  ? 0.650   -7.782  27.373 1.00 72.96  ? 29   ARG C NH2   1 
ATOM   1577  N  N     . VAL C  3 30  ? -6.683  -6.271  24.322 1.00 71.03  ? 30   VAL C N     1 
ATOM   1578  C  CA    . VAL C  3 30  ? -7.968  -6.618  24.902 1.00 71.03  ? 30   VAL C CA    1 
ATOM   1579  C  C     . VAL C  3 30  ? -8.992  -6.958  23.814 1.00 72.05  ? 30   VAL C C     1 
ATOM   1580  O  O     . VAL C  3 30  ? -9.834  -7.828  24.012 1.00 72.29  ? 30   VAL C O     1 
ATOM   1581  C  CB    . VAL C  3 30  ? -8.489  -5.484  25.827 1.00 70.66  ? 30   VAL C CB    1 
ATOM   1582  C  CG1   . VAL C  3 30  ? -9.952  -5.686  26.193 1.00 70.19  ? 30   VAL C CG1   1 
ATOM   1583  C  CG2   . VAL C  3 30  ? -7.657  -5.401  27.070 1.00 69.52  ? 30   VAL C CG2   1 
ATOM   1584  N  N     . HIS C  3 31  ? -8.917  -6.275  22.667 1.00 72.93  ? 31   HIS C N     1 
ATOM   1585  C  CA    . HIS C  3 31  ? -9.845  -6.518  21.569 1.00 73.41  ? 31   HIS C CA    1 
ATOM   1586  C  C     . HIS C  3 31  ? -9.608  -7.892  21.002 1.00 73.51  ? 31   HIS C C     1 
ATOM   1587  O  O     . HIS C  3 31  ? -10.544 -8.593  20.655 1.00 73.48  ? 31   HIS C O     1 
ATOM   1588  C  CB    . HIS C  3 31  ? -9.640  -5.511  20.446 1.00 73.81  ? 31   HIS C CB    1 
ATOM   1589  C  CG    . HIS C  3 31  ? -10.818 -5.383  19.526 1.00 75.38  ? 31   HIS C CG    1 
ATOM   1590  N  ND1   . HIS C  3 31  ? -11.749 -6.387  19.358 1.00 77.43  ? 31   HIS C ND1   1 
ATOM   1591  C  CD2   . HIS C  3 31  ? -11.211 -4.372  18.716 1.00 76.43  ? 31   HIS C CD2   1 
ATOM   1592  C  CE1   . HIS C  3 31  ? -12.672 -5.991  18.499 1.00 77.99  ? 31   HIS C CE1   1 
ATOM   1593  N  NE2   . HIS C  3 31  ? -12.365 -4.775  18.088 1.00 77.14  ? 31   HIS C NE2   1 
ATOM   1594  N  N     . ARG C  3 32  ? -8.337  -8.252  20.894 1.00 73.76  ? 32   ARG C N     1 
ATOM   1595  C  CA    . ARG C  3 32  ? -7.922  -9.501  20.289 1.00 74.14  ? 32   ARG C CA    1 
ATOM   1596  C  C     . ARG C  3 32  ? -8.422  -10.666 21.117 1.00 74.19  ? 32   ARG C C     1 
ATOM   1597  O  O     . ARG C  3 32  ? -9.038  -11.603 20.582 1.00 74.79  ? 32   ARG C O     1 
ATOM   1598  C  CB    . ARG C  3 32  ? -6.400  -9.536  20.228 1.00 74.36  ? 32   ARG C CB    1 
ATOM   1599  C  CG    . ARG C  3 32  ? -5.852  -10.527 19.257 1.00 75.74  ? 32   ARG C CG    1 
ATOM   1600  C  CD    . ARG C  3 32  ? -4.344  -10.454 19.227 1.00 77.90  ? 32   ARG C CD    1 
ATOM   1601  N  NE    . ARG C  3 32  ? -3.748  -11.233 20.306 1.00 79.15  ? 32   ARG C NE    1 
ATOM   1602  C  CZ    . ARG C  3 32  ? -2.805  -10.792 21.132 1.00 80.33  ? 32   ARG C CZ    1 
ATOM   1603  N  NH1   . ARG C  3 32  ? -2.319  -9.563  21.020 1.00 82.09  ? 32   ARG C NH1   1 
ATOM   1604  N  NH2   . ARG C  3 32  ? -2.340  -11.593 22.073 1.00 80.80  ? 32   ARG C NH2   1 
ATOM   1605  N  N     . LEU C  3 33  ? -8.156  -10.579 22.426 1.00 73.67  ? 33   LEU C N     1 
ATOM   1606  C  CA    . LEU C  3 33  ? -8.497  -11.605 23.402 1.00 72.99  ? 33   LEU C CA    1 
ATOM   1607  C  C     . LEU C  3 33  ? -9.992  -11.832 23.528 1.00 73.35  ? 33   LEU C C     1 
ATOM   1608  O  O     . LEU C  3 33  ? -10.409 -12.891 23.969 1.00 73.84  ? 33   LEU C O     1 
ATOM   1609  C  CB    . LEU C  3 33  ? -7.930  -11.262 24.776 1.00 72.20  ? 33   LEU C CB    1 
ATOM   1610  C  CG    . LEU C  3 33  ? -6.424  -11.170 24.985 1.00 70.80  ? 33   LEU C CG    1 
ATOM   1611  C  CD1   . LEU C  3 33  ? -6.160  -10.480 26.304 1.00 69.02  ? 33   LEU C CD1   1 
ATOM   1612  C  CD2   . LEU C  3 33  ? -5.749  -12.527 24.951 1.00 67.72  ? 33   LEU C CD2   1 
ATOM   1613  N  N     . LEU C  3 34  ? -10.799 -10.847 23.165 1.00 73.72  ? 34   LEU C N     1 
ATOM   1614  C  CA    . LEU C  3 34  ? -12.236 -11.049 23.186 1.00 75.04  ? 34   LEU C CA    1 
ATOM   1615  C  C     . LEU C  3 34  ? -12.688 -11.961 22.040 1.00 76.21  ? 34   LEU C C     1 
ATOM   1616  O  O     . LEU C  3 34  ? -13.613 -12.758 22.203 1.00 76.12  ? 34   LEU C O     1 
ATOM   1617  C  CB    . LEU C  3 34  ? -12.991 -9.717  23.174 1.00 74.56  ? 34   LEU C CB    1 
ATOM   1618  C  CG    . LEU C  3 34  ? -13.132 -8.936  24.491 1.00 73.98  ? 34   LEU C CG    1 
ATOM   1619  C  CD1   . LEU C  3 34  ? -13.762 -7.559  24.235 1.00 72.94  ? 34   LEU C CD1   1 
ATOM   1620  C  CD2   . LEU C  3 34  ? -13.921 -9.695  25.559 1.00 71.52  ? 34   LEU C CD2   1 
ATOM   1621  N  N     . ARG C  3 35  ? -12.007 -11.843 20.898 1.00 77.79  ? 35   ARG C N     1 
ATOM   1622  C  CA    . ARG C  3 35  ? -12.245 -12.683 19.721 1.00 79.18  ? 35   ARG C CA    1 
ATOM   1623  C  C     . ARG C  3 35  ? -11.858 -14.118 20.011 1.00 79.57  ? 35   ARG C C     1 
ATOM   1624  O  O     . ARG C  3 35  ? -12.680 -15.016 19.880 1.00 79.73  ? 35   ARG C O     1 
ATOM   1625  C  CB    . ARG C  3 35  ? -11.449 -12.181 18.518 1.00 79.34  ? 35   ARG C CB    1 
ATOM   1626  C  CG    . ARG C  3 35  ? -11.657 -10.714 18.239 1.00 81.79  ? 35   ARG C CG    1 
ATOM   1627  C  CD    . ARG C  3 35  ? -11.218 -10.312 16.834 1.00 85.24  ? 35   ARG C CD    1 
ATOM   1628  N  NE    . ARG C  3 35  ? -11.569 -8.911  16.571 1.00 88.41  ? 35   ARG C NE    1 
ATOM   1629  C  CZ    . ARG C  3 35  ? -12.792 -8.474  16.247 1.00 89.47  ? 35   ARG C CZ    1 
ATOM   1630  N  NH1   . ARG C  3 35  ? -13.819 -9.315  16.131 1.00 89.29  ? 35   ARG C NH1   1 
ATOM   1631  N  NH2   . ARG C  3 35  ? -12.995 -7.178  16.034 1.00 91.12  ? 35   ARG C NH2   1 
ATOM   1632  N  N     . LYS C  3 36  ? -10.612 -14.323 20.427 1.00 80.02  ? 36   LYS C N     1 
ATOM   1633  C  CA    . LYS C  3 36  ? -10.109 -15.665 20.647 1.00 80.97  ? 36   LYS C CA    1 
ATOM   1634  C  C     . LYS C  3 36  ? -10.803 -16.358 21.837 1.00 80.49  ? 36   LYS C C     1 
ATOM   1635  O  O     . LYS C  3 36  ? -10.754 -17.579 21.982 1.00 80.82  ? 36   LYS C O     1 
ATOM   1636  C  CB    . LYS C  3 36  ? -8.591  -15.630 20.845 1.00 80.93  ? 36   LYS C CB    1 
ATOM   1637  C  CG    . LYS C  3 36  ? -8.132  -15.825 22.302 1.00 82.34  ? 36   LYS C CG    1 
ATOM   1638  C  CD    . LYS C  3 36  ? -6.674  -15.392 22.517 1.00 82.90  ? 36   LYS C CD    1 
ATOM   1639  C  CE    . LYS C  3 36  ? -5.706  -16.110 21.575 1.00 85.75  ? 36   LYS C CE    1 
ATOM   1640  N  NZ    . LYS C  3 36  ? -4.310  -15.500 21.675 1.00 87.24  ? 36   LYS C NZ    1 
ATOM   1641  N  N     . GLY C  3 37  ? -11.457 -15.578 22.680 1.00 80.06  ? 37   GLY C N     1 
ATOM   1642  C  CA    . GLY C  3 37  ? -12.034 -16.123 23.893 1.00 79.14  ? 37   GLY C CA    1 
ATOM   1643  C  C     . GLY C  3 37  ? -13.386 -16.747 23.667 1.00 78.69  ? 37   GLY C C     1 
ATOM   1644  O  O     . GLY C  3 37  ? -13.934 -17.375 24.590 1.00 78.95  ? 37   GLY C O     1 
ATOM   1645  N  N     . ASN C  3 38  ? -13.916 -16.576 22.447 1.00 77.75  ? 38   ASN C N     1 
ATOM   1646  C  CA    . ASN C  3 38  ? -15.222 -17.104 22.053 1.00 76.97  ? 38   ASN C CA    1 
ATOM   1647  C  C     . ASN C  3 38  ? -16.304 -16.636 22.984 1.00 76.17  ? 38   ASN C C     1 
ATOM   1648  O  O     . ASN C  3 38  ? -16.895 -17.429 23.716 1.00 76.47  ? 38   ASN C O     1 
ATOM   1649  C  CB    . ASN C  3 38  ? -15.219 -18.630 22.033 1.00 77.42  ? 38   ASN C CB    1 
ATOM   1650  C  CG    . ASN C  3 38  ? -14.365 -19.186 20.928 1.00 79.65  ? 38   ASN C CG    1 
ATOM   1651  O  OD1   . ASN C  3 38  ? -13.299 -19.769 21.188 1.00 80.79  ? 38   ASN C OD1   1 
ATOM   1652  N  ND2   . ASN C  3 38  ? -14.809 -18.993 19.668 1.00 80.57  ? 38   ASN C ND2   1 
ATOM   1653  N  N     . TYR C  3 39  ? -16.567 -15.344 22.973 1.00 74.83  ? 39   TYR C N     1 
ATOM   1654  C  CA    . TYR C  3 39  ? -17.546 -14.821 23.888 1.00 73.73  ? 39   TYR C CA    1 
ATOM   1655  C  C     . TYR C  3 39  ? -18.837 -14.443 23.177 1.00 74.20  ? 39   TYR C C     1 
ATOM   1656  O  O     . TYR C  3 39  ? -19.908 -14.526 23.770 1.00 74.51  ? 39   TYR C O     1 
ATOM   1657  C  CB    . TYR C  3 39  ? -16.960 -13.645 24.654 1.00 72.33  ? 39   TYR C CB    1 
ATOM   1658  C  CG    . TYR C  3 39  ? -15.802 -14.000 25.572 1.00 69.70  ? 39   TYR C CG    1 
ATOM   1659  C  CD1   . TYR C  3 39  ? -14.488 -13.716 25.211 1.00 67.25  ? 39   TYR C CD1   1 
ATOM   1660  C  CD2   . TYR C  3 39  ? -16.026 -14.585 26.810 1.00 67.20  ? 39   TYR C CD2   1 
ATOM   1661  C  CE1   . TYR C  3 39  ? -13.437 -14.014 26.053 1.00 66.01  ? 39   TYR C CE1   1 
ATOM   1662  C  CE2   . TYR C  3 39  ? -14.978 -14.894 27.649 1.00 65.89  ? 39   TYR C CE2   1 
ATOM   1663  C  CZ    . TYR C  3 39  ? -13.693 -14.605 27.261 1.00 66.59  ? 39   TYR C CZ    1 
ATOM   1664  O  OH    . TYR C  3 39  ? -12.659 -14.907 28.092 1.00 68.40  ? 39   TYR C OH    1 
ATOM   1665  N  N     . ALA C  3 40  ? -18.728 -14.017 21.920 1.00 74.63  ? 40   ALA C N     1 
ATOM   1666  C  CA    . ALA C  3 40  ? -19.884 -13.761 21.056 1.00 75.30  ? 40   ALA C CA    1 
ATOM   1667  C  C     . ALA C  3 40  ? -19.443 -13.789 19.599 1.00 76.09  ? 40   ALA C C     1 
ATOM   1668  O  O     . ALA C  3 40  ? -18.242 -13.820 19.321 1.00 76.08  ? 40   ALA C O     1 
ATOM   1669  C  CB    . ALA C  3 40  ? -20.535 -12.442 21.391 1.00 74.85  ? 40   ALA C CB    1 
ATOM   1670  N  N     . GLU C  3 41  ? -20.403 -13.811 18.671 1.00 77.33  ? 41   GLU C N     1 
ATOM   1671  C  CA    . GLU C  3 41  ? -20.069 -13.755 17.239 1.00 78.45  ? 41   GLU C CA    1 
ATOM   1672  C  C     . GLU C  3 41  ? -19.254 -12.505 16.929 1.00 78.42  ? 41   GLU C C     1 
ATOM   1673  O  O     . GLU C  3 41  ? -18.214 -12.587 16.284 1.00 78.70  ? 41   GLU C O     1 
ATOM   1674  C  CB    . GLU C  3 41  ? -21.323 -13.773 16.340 1.00 78.88  ? 41   GLU C CB    1 
ATOM   1675  C  CG    . GLU C  3 41  ? -22.030 -15.134 16.207 1.00 81.74  ? 41   GLU C CG    1 
ATOM   1676  C  CD    . GLU C  3 41  ? -21.062 -16.310 16.073 1.00 84.22  ? 41   GLU C CD    1 
ATOM   1677  O  OE1   . GLU C  3 41  ? -20.434 -16.465 15.001 1.00 85.28  ? 41   GLU C OE1   1 
ATOM   1678  O  OE2   . GLU C  3 41  ? -20.940 -17.084 17.050 1.00 85.18  ? 41   GLU C OE2   1 
ATOM   1679  N  N     . ARG C  3 42  ? -19.725 -11.359 17.417 1.00 78.23  ? 42   ARG C N     1 
ATOM   1680  C  CA    . ARG C  3 42  ? -19.149 -10.068 17.068 1.00 78.10  ? 42   ARG C CA    1 
ATOM   1681  C  C     . ARG C  3 42  ? -18.679 -9.272  18.288 1.00 77.19  ? 42   ARG C C     1 
ATOM   1682  O  O     . ARG C  3 42  ? -19.320 -9.302  19.349 1.00 77.30  ? 42   ARG C O     1 
ATOM   1683  C  CB    . ARG C  3 42  ? -20.200 -9.229  16.338 1.00 78.90  ? 42   ARG C CB    1 
ATOM   1684  C  CG    . ARG C  3 42  ? -20.736 -9.854  15.094 1.00 80.71  ? 42   ARG C CG    1 
ATOM   1685  C  CD    . ARG C  3 42  ? -21.598 -8.880  14.353 1.00 84.60  ? 42   ARG C CD    1 
ATOM   1686  N  NE    . ARG C  3 42  ? -21.582 -9.222  12.937 1.00 88.92  ? 42   ARG C NE    1 
ATOM   1687  C  CZ    . ARG C  3 42  ? -21.991 -8.423  11.956 1.00 91.09  ? 42   ARG C CZ    1 
ATOM   1688  N  NH1   . ARG C  3 42  ? -22.463 -7.205  12.229 1.00 91.49  ? 42   ARG C NH1   1 
ATOM   1689  N  NH2   . ARG C  3 42  ? -21.934 -8.855  10.698 1.00 92.33  ? 42   ARG C NH2   1 
ATOM   1690  N  N     . VAL C  3 43  ? -17.586 -8.531  18.121 1.00 75.68  ? 43   VAL C N     1 
ATOM   1691  C  CA    . VAL C  3 43  ? -17.126 -7.612  19.156 1.00 74.40  ? 43   VAL C CA    1 
ATOM   1692  C  C     . VAL C  3 43  ? -17.258 -6.167  18.705 1.00 73.29  ? 43   VAL C C     1 
ATOM   1693  O  O     . VAL C  3 43  ? -16.674 -5.762  17.705 1.00 73.50  ? 43   VAL C O     1 
ATOM   1694  C  CB    . VAL C  3 43  ? -15.668 -7.894  19.575 1.00 74.32  ? 43   VAL C CB    1 
ATOM   1695  C  CG1   . VAL C  3 43  ? -15.283 -7.032  20.754 1.00 74.27  ? 43   VAL C CG1   1 
ATOM   1696  C  CG2   . VAL C  3 43  ? -15.504 -9.351  19.944 1.00 74.80  ? 43   VAL C CG2   1 
ATOM   1697  N  N     . GLY C  3 44  ? -18.016 -5.387  19.463 1.00 72.17  ? 44   GLY C N     1 
ATOM   1698  C  CA    . GLY C  3 44  ? -18.153 -3.950  19.215 1.00 70.42  ? 44   GLY C CA    1 
ATOM   1699  C  C     . GLY C  3 44  ? -16.904 -3.162  19.539 1.00 69.13  ? 44   GLY C C     1 
ATOM   1700  O  O     . GLY C  3 44  ? -16.145 -3.541  20.416 1.00 69.13  ? 44   GLY C O     1 
ATOM   1701  N  N     . ALA C  3 45  ? -16.715 -2.055  18.822 1.00 68.58  ? 45   ALA C N     1 
ATOM   1702  C  CA    . ALA C  3 45  ? -15.499 -1.211  18.872 1.00 67.60  ? 45   ALA C CA    1 
ATOM   1703  C  C     . ALA C  3 45  ? -15.263 -0.548  20.231 1.00 66.79  ? 45   ALA C C     1 
ATOM   1704  O  O     . ALA C  3 45  ? -14.117 -0.379  20.656 1.00 66.44  ? 45   ALA C O     1 
ATOM   1705  C  CB    . ALA C  3 45  ? -15.554 -0.149  17.773 1.00 67.43  ? 45   ALA C CB    1 
ATOM   1706  N  N     . GLY C  3 46  ? -16.353 -0.168  20.888 1.00 65.86  ? 46   GLY C N     1 
ATOM   1707  C  CA    . GLY C  3 46  ? -16.292 0.391   22.219 1.00 65.56  ? 46   GLY C CA    1 
ATOM   1708  C  C     . GLY C  3 46  ? -15.947 -0.611  23.311 1.00 65.41  ? 46   GLY C C     1 
ATOM   1709  O  O     . GLY C  3 46  ? -15.414 -0.225  24.346 1.00 66.13  ? 46   GLY C O     1 
ATOM   1710  N  N     . ALA C  3 47  ? -16.234 -1.893  23.090 1.00 64.32  ? 47   ALA C N     1 
ATOM   1711  C  CA    . ALA C  3 47  ? -16.117 -2.895  24.149 1.00 63.20  ? 47   ALA C CA    1 
ATOM   1712  C  C     . ALA C  3 47  ? -14.700 -3.078  24.706 1.00 62.35  ? 47   ALA C C     1 
ATOM   1713  O  O     . ALA C  3 47  ? -14.527 -3.010  25.927 1.00 62.39  ? 47   ALA C O     1 
ATOM   1714  C  CB    . ALA C  3 47  ? -16.709 -4.230  23.711 1.00 63.44  ? 47   ALA C CB    1 
ATOM   1715  N  N     . PRO C  3 48  ? -13.684 -3.286  23.836 1.00 61.22  ? 48   PRO C N     1 
ATOM   1716  C  CA    . PRO C  3 48  ? -12.341 -3.403  24.419 1.00 60.65  ? 48   PRO C CA    1 
ATOM   1717  C  C     . PRO C  3 48  ? -11.851 -2.101  25.046 1.00 60.84  ? 48   PRO C C     1 
ATOM   1718  O  O     . PRO C  3 48  ? -10.959 -2.123  25.895 1.00 61.48  ? 48   PRO C O     1 
ATOM   1719  C  CB    . PRO C  3 48  ? -11.458 -3.771  23.230 1.00 60.35  ? 48   PRO C CB    1 
ATOM   1720  C  CG    . PRO C  3 48  ? -12.207 -3.338  22.035 1.00 60.46  ? 48   PRO C CG    1 
ATOM   1721  C  CD    . PRO C  3 48  ? -13.662 -3.426  22.370 1.00 60.84  ? 48   PRO C CD    1 
ATOM   1722  N  N     . VAL C  3 49  ? -12.419 -0.977  24.616 1.00 60.29  ? 49   VAL C N     1 
ATOM   1723  C  CA    . VAL C  3 49  ? -12.062 0.313   25.155 1.00 59.62  ? 49   VAL C CA    1 
ATOM   1724  C  C     . VAL C  3 49  ? -12.578 0.378   26.591 1.00 59.07  ? 49   VAL C C     1 
ATOM   1725  O  O     . VAL C  3 49  ? -11.814 0.610   27.521 1.00 59.53  ? 49   VAL C O     1 
ATOM   1726  C  CB    . VAL C  3 49  ? -12.622 1.481   24.254 1.00 60.40  ? 49   VAL C CB    1 
ATOM   1727  C  CG1   . VAL C  3 49  ? -12.606 2.827   24.991 1.00 60.16  ? 49   VAL C CG1   1 
ATOM   1728  C  CG2   . VAL C  3 49  ? -11.850 1.569   22.923 1.00 58.90  ? 49   VAL C CG2   1 
ATOM   1729  N  N     . TYR C  3 50  ? -13.870 0.142   26.766 1.00 57.85  ? 50   TYR C N     1 
ATOM   1730  C  CA    . TYR C  3 50  ? -14.497 0.158   28.077 1.00 57.15  ? 50   TYR C CA    1 
ATOM   1731  C  C     . TYR C  3 50  ? -13.877 -0.860  29.036 1.00 57.72  ? 50   TYR C C     1 
ATOM   1732  O  O     . TYR C  3 50  ? -13.603 -0.554  30.207 1.00 57.84  ? 50   TYR C O     1 
ATOM   1733  C  CB    . TYR C  3 50  ? -15.945 -0.182  27.902 1.00 56.43  ? 50   TYR C CB    1 
ATOM   1734  C  CG    . TYR C  3 50  ? -16.835 0.225   29.022 1.00 55.14  ? 50   TYR C CG    1 
ATOM   1735  C  CD1   . TYR C  3 50  ? -17.944 1.000   28.774 1.00 54.64  ? 50   TYR C CD1   1 
ATOM   1736  C  CD2   . TYR C  3 50  ? -16.602 -0.181  30.320 1.00 54.80  ? 50   TYR C CD2   1 
ATOM   1737  C  CE1   . TYR C  3 50  ? -18.801 1.377   29.780 1.00 54.64  ? 50   TYR C CE1   1 
ATOM   1738  C  CE2   . TYR C  3 50  ? -17.460 0.201   31.350 1.00 54.80  ? 50   TYR C CE2   1 
ATOM   1739  C  CZ    . TYR C  3 50  ? -18.559 0.979   31.063 1.00 55.22  ? 50   TYR C CZ    1 
ATOM   1740  O  OH    . TYR C  3 50  ? -19.432 1.376   32.052 1.00 57.12  ? 50   TYR C OH    1 
ATOM   1741  N  N     . LEU C  3 51  ? -13.652 -2.075  28.530 1.00 57.60  ? 51   LEU C N     1 
ATOM   1742  C  CA    . LEU C  3 51  ? -13.061 -3.138  29.327 1.00 56.96  ? 51   LEU C CA    1 
ATOM   1743  C  C     . LEU C  3 51  ? -11.634 -2.817  29.764 1.00 56.38  ? 51   LEU C C     1 
ATOM   1744  O  O     . LEU C  3 51  ? -11.308 -2.989  30.941 1.00 56.49  ? 51   LEU C O     1 
ATOM   1745  C  CB    . LEU C  3 51  ? -13.132 -4.477  28.590 1.00 57.06  ? 51   LEU C CB    1 
ATOM   1746  C  CG    . LEU C  3 51  ? -12.570 -5.727  29.295 1.00 57.37  ? 51   LEU C CG    1 
ATOM   1747  C  CD1   . LEU C  3 51  ? -13.129 -5.963  30.688 1.00 54.51  ? 51   LEU C CD1   1 
ATOM   1748  C  CD2   . LEU C  3 51  ? -12.814 -6.928  28.424 1.00 57.24  ? 51   LEU C CD2   1 
ATOM   1749  N  N     . ALA C  3 52  ? -10.791 -2.338  28.845 1.00 55.63  ? 52   ALA C N     1 
ATOM   1750  C  CA    . ALA C  3 52  ? -9.397  -1.980  29.197 1.00 54.66  ? 52   ALA C CA    1 
ATOM   1751  C  C     . ALA C  3 52  ? -9.331  -0.881  30.257 1.00 54.23  ? 52   ALA C C     1 
ATOM   1752  O  O     . ALA C  3 52  ? -8.405  -0.851  31.062 1.00 54.40  ? 52   ALA C O     1 
ATOM   1753  C  CB    . ALA C  3 52  ? -8.622  -1.583  27.988 1.00 54.66  ? 52   ALA C CB    1 
ATOM   1754  N  N     . ALA C  3 53  ? -10.342 -0.015  30.277 1.00 53.19  ? 53   ALA C N     1 
ATOM   1755  C  CA    . ALA C  3 53  ? -10.446 1.035   31.275 1.00 52.42  ? 53   ALA C CA    1 
ATOM   1756  C  C     . ALA C  3 53  ? -10.865 0.532   32.658 1.00 52.25  ? 53   ALA C C     1 
ATOM   1757  O  O     . ALA C  3 53  ? -10.315 0.959   33.672 1.00 52.79  ? 53   ALA C O     1 
ATOM   1758  C  CB    . ALA C  3 53  ? -11.398 2.113   30.794 1.00 52.09  ? 53   ALA C CB    1 
ATOM   1759  N  N     . VAL C  3 54  ? -11.861 -0.345  32.712 1.00 51.96  ? 54   VAL C N     1 
ATOM   1760  C  CA    . VAL C  3 54  ? -12.196 -1.026  33.966 1.00 51.75  ? 54   VAL C CA    1 
ATOM   1761  C  C     . VAL C  3 54  ? -10.978 -1.824  34.497 1.00 51.58  ? 54   VAL C C     1 
ATOM   1762  O  O     . VAL C  3 54  ? -10.650 -1.777  35.688 1.00 51.18  ? 54   VAL C O     1 
ATOM   1763  C  CB    . VAL C  3 54  ? -13.415 -1.948  33.784 1.00 51.87  ? 54   VAL C CB    1 
ATOM   1764  C  CG1   . VAL C  3 54  ? -13.701 -2.735  35.058 1.00 50.94  ? 54   VAL C CG1   1 
ATOM   1765  C  CG2   . VAL C  3 54  ? -14.638 -1.132  33.357 1.00 51.73  ? 54   VAL C CG2   1 
ATOM   1766  N  N     . LEU C  3 55  ? -10.291 -2.515  33.600 1.00 51.31  ? 55   LEU C N     1 
ATOM   1767  C  CA    . LEU C  3 55  ? -9.141  -3.291  34.004 1.00 52.39  ? 55   LEU C CA    1 
ATOM   1768  C  C     . LEU C  3 55  ? -8.085  -2.421  34.666 1.00 52.79  ? 55   LEU C C     1 
ATOM   1769  O  O     . LEU C  3 55  ? -7.602  -2.750  35.737 1.00 52.66  ? 55   LEU C O     1 
ATOM   1770  C  CB    . LEU C  3 55  ? -8.582  -4.077  32.821 1.00 52.46  ? 55   LEU C CB    1 
ATOM   1771  C  CG    . LEU C  3 55  ? -9.475  -5.253  32.370 1.00 53.27  ? 55   LEU C CG    1 
ATOM   1772  C  CD1   . LEU C  3 55  ? -8.840  -5.998  31.200 1.00 52.94  ? 55   LEU C CD1   1 
ATOM   1773  C  CD2   . LEU C  3 55  ? -9.821  -6.227  33.513 1.00 49.93  ? 55   LEU C CD2   1 
ATOM   1774  N  N     . GLU C  3 56  ? -7.786  -1.285  34.033 1.00 53.75  ? 56   GLU C N     1 
ATOM   1775  C  CA    . GLU C  3 56  ? -6.846  -0.262  34.516 1.00 53.52  ? 56   GLU C CA    1 
ATOM   1776  C  C     . GLU C  3 56  ? -7.314  0.474   35.768 1.00 52.67  ? 56   GLU C C     1 
ATOM   1777  O  O     . GLU C  3 56  ? -6.511  0.758   36.653 1.00 52.54  ? 56   GLU C O     1 
ATOM   1778  C  CB    . GLU C  3 56  ? -6.605  0.751   33.403 1.00 54.40  ? 56   GLU C CB    1 
ATOM   1779  C  CG    . GLU C  3 56  ? -5.558  1.817   33.692 1.00 56.27  ? 56   GLU C CG    1 
ATOM   1780  C  CD    . GLU C  3 56  ? -5.331  2.690   32.490 1.00 60.98  ? 56   GLU C CD    1 
ATOM   1781  O  OE1   . GLU C  3 56  ? -5.109  2.115   31.398 1.00 64.18  ? 56   GLU C OE1   1 
ATOM   1782  O  OE2   . GLU C  3 56  ? -5.389  3.942   32.615 1.00 64.08  ? 56   GLU C OE2   1 
ATOM   1783  N  N     . TYR C  3 57  ? -8.593  0.802   35.851 1.00 52.23  ? 57   TYR C N     1 
ATOM   1784  C  CA    . TYR C  3 57  ? -9.092  1.383   37.092 1.00 52.81  ? 57   TYR C CA    1 
ATOM   1785  C  C     . TYR C  3 57  ? -8.836  0.407   38.255 1.00 52.86  ? 57   TYR C C     1 
ATOM   1786  O  O     . TYR C  3 57  ? -8.242  0.793   39.248 1.00 53.59  ? 57   TYR C O     1 
ATOM   1787  C  CB    . TYR C  3 57  ? -10.569 1.785   36.982 1.00 53.26  ? 57   TYR C CB    1 
ATOM   1788  C  CG    . TYR C  3 57  ? -11.252 1.939   38.319 1.00 54.91  ? 57   TYR C CG    1 
ATOM   1789  C  CD1   . TYR C  3 57  ? -10.989 3.025   39.137 1.00 56.48  ? 57   TYR C CD1   1 
ATOM   1790  C  CD2   . TYR C  3 57  ? -12.167 0.984   38.768 1.00 56.78  ? 57   TYR C CD2   1 
ATOM   1791  C  CE1   . TYR C  3 57  ? -11.623 3.157   40.384 1.00 57.79  ? 57   TYR C CE1   1 
ATOM   1792  C  CE2   . TYR C  3 57  ? -12.800 1.100   39.999 1.00 56.00  ? 57   TYR C CE2   1 
ATOM   1793  C  CZ    . TYR C  3 57  ? -12.517 2.176   40.814 1.00 57.49  ? 57   TYR C CZ    1 
ATOM   1794  O  OH    . TYR C  3 57  ? -13.148 2.288   42.047 1.00 57.75  ? 57   TYR C OH    1 
ATOM   1795  N  N     . LEU C  3 58  ? -9.232  -0.863  38.102 1.00 52.23  ? 58   LEU C N     1 
ATOM   1796  C  CA    . LEU C  3 58  ? -9.078  -1.870  39.166 1.00 51.18  ? 58   LEU C CA    1 
ATOM   1797  C  C     . LEU C  3 58  ? -7.648  -2.079  39.597 1.00 50.09  ? 58   LEU C C     1 
ATOM   1798  O  O     . LEU C  3 58  ? -7.368  -2.133  40.802 1.00 49.88  ? 58   LEU C O     1 
ATOM   1799  C  CB    . LEU C  3 58  ? -9.704  -3.215  38.776 1.00 51.04  ? 58   LEU C CB    1 
ATOM   1800  C  CG    . LEU C  3 58  ? -11.233 -3.168  38.830 1.00 51.04  ? 58   LEU C CG    1 
ATOM   1801  C  CD1   . LEU C  3 58  ? -11.838 -4.460  38.311 1.00 48.06  ? 58   LEU C CD1   1 
ATOM   1802  C  CD2   . LEU C  3 58  ? -11.736 -2.837  40.234 1.00 49.20  ? 58   LEU C CD2   1 
ATOM   1803  N  N     . THR C  3 59  ? -6.744  -2.184  38.636 1.00 48.57  ? 59   THR C N     1 
ATOM   1804  C  CA    . THR C  3 59  ? -5.363  -2.369  39.009 1.00 48.30  ? 59   THR C CA    1 
ATOM   1805  C  C     . THR C  3 59  ? -4.725  -1.162  39.690 1.00 48.98  ? 59   THR C C     1 
ATOM   1806  O  O     . THR C  3 59  ? -3.864  -1.328  40.569 1.00 49.02  ? 59   THR C O     1 
ATOM   1807  C  CB    . THR C  3 59  ? -4.484  -2.953  37.887 1.00 48.58  ? 59   THR C CB    1 
ATOM   1808  O  OG1   . THR C  3 59  ? -3.344  -2.115  37.685 1.00 47.19  ? 59   THR C OG1   1 
ATOM   1809  C  CG2   . THR C  3 59  ? -5.262  -3.166  36.614 1.00 45.59  ? 59   THR C CG2   1 
ATOM   1810  N  N     . ALA C  3 60  ? -5.185  0.041   39.324 1.00 49.19  ? 60   ALA C N     1 
ATOM   1811  C  CA    . ALA C  3 60  ? -4.804  1.290   40.014 1.00 48.84  ? 60   ALA C CA    1 
ATOM   1812  C  C     . ALA C  3 60  ? -5.286  1.329   41.458 1.00 49.27  ? 60   ALA C C     1 
ATOM   1813  O  O     . ALA C  3 60  ? -4.545  1.746   42.361 1.00 49.54  ? 60   ALA C O     1 
ATOM   1814  C  CB    . ALA C  3 60  ? -5.343  2.470   39.278 1.00 48.98  ? 60   ALA C CB    1 
ATOM   1815  N  N     . GLU C  3 61  ? -6.528  0.900   41.677 1.00 49.21  ? 61   GLU C N     1 
ATOM   1816  C  CA    . GLU C  3 61  ? -7.079  0.834   43.015 1.00 49.73  ? 61   GLU C CA    1 
ATOM   1817  C  C     . GLU C  3 61  ? -6.249  -0.092  43.904 1.00 49.99  ? 61   GLU C C     1 
ATOM   1818  O  O     . GLU C  3 61  ? -5.894  0.266   45.022 1.00 50.23  ? 61   GLU C O     1 
ATOM   1819  C  CB    . GLU C  3 61  ? -8.520  0.383   42.955 1.00 49.62  ? 61   GLU C CB    1 
ATOM   1820  C  CG    . GLU C  3 61  ? -9.235  0.452   44.263 1.00 53.64  ? 61   GLU C CG    1 
ATOM   1821  C  CD    . GLU C  3 61  ? -9.484  1.909   44.773 1.00 63.16  ? 61   GLU C CD    1 
ATOM   1822  O  OE1   . GLU C  3 61  ? -9.675  2.890   43.957 1.00 62.36  ? 61   GLU C OE1   1 
ATOM   1823  O  OE2   . GLU C  3 61  ? -9.500  2.045   46.036 1.00 66.00  ? 61   GLU C OE2   1 
ATOM   1824  N  N     . ILE C  3 62  ? -5.887  -1.271  43.404 1.00 49.99  ? 62   ILE C N     1 
ATOM   1825  C  CA    . ILE C  3 62  ? -5.158  -2.205  44.257 1.00 49.79  ? 62   ILE C CA    1 
ATOM   1826  C  C     . ILE C  3 62  ? -3.713  -1.744  44.494 1.00 48.67  ? 62   ILE C C     1 
ATOM   1827  O  O     . ILE C  3 62  ? -3.218  -1.794  45.627 1.00 48.20  ? 62   ILE C O     1 
ATOM   1828  C  CB    . ILE C  3 62  ? -5.254  -3.656  43.732 1.00 50.24  ? 62   ILE C CB    1 
ATOM   1829  C  CG1   . ILE C  3 62  ? -4.590  -4.635  44.677 1.00 50.96  ? 62   ILE C CG1   1 
ATOM   1830  C  CG2   . ILE C  3 62  ? -4.563  -3.805  42.403 1.00 52.60  ? 62   ILE C CG2   1 
ATOM   1831  C  CD1   . ILE C  3 62  ? -5.243  -6.021  44.568 1.00 57.61  ? 62   ILE C CD1   1 
ATOM   1832  N  N     . LEU C  3 63  ? -3.053  -1.263  43.439 1.00 47.77  ? 63   LEU C N     1 
ATOM   1833  C  CA    . LEU C  3 63  ? -1.682  -0.760  43.584 1.00 47.14  ? 63   LEU C CA    1 
ATOM   1834  C  C     . LEU C  3 63  ? -1.594  0.469   44.511 1.00 47.47  ? 63   LEU C C     1 
ATOM   1835  O  O     . LEU C  3 63  ? -0.591  0.649   45.212 1.00 47.45  ? 63   LEU C O     1 
ATOM   1836  C  CB    . LEU C  3 63  ? -1.046  -0.468  42.238 1.00 46.32  ? 63   LEU C CB    1 
ATOM   1837  C  CG    . LEU C  3 63  ? -0.811  -1.642  41.284 1.00 46.30  ? 63   LEU C CG    1 
ATOM   1838  C  CD1   . LEU C  3 63  ? -0.485  -1.084  39.917 1.00 45.93  ? 63   LEU C CD1   1 
ATOM   1839  C  CD2   . LEU C  3 63  ? 0.248   -2.682  41.758 1.00 43.56  ? 63   LEU C CD2   1 
ATOM   1840  N  N     . GLU C  3 64  ? -2.643  1.282   44.543 1.00 46.93  ? 64   GLU C N     1 
ATOM   1841  C  CA    . GLU C  3 64  ? -2.658  2.417   45.424 1.00 48.17  ? 64   GLU C CA    1 
ATOM   1842  C  C     . GLU C  3 64  ? -2.538  1.928   46.841 1.00 48.02  ? 64   GLU C C     1 
ATOM   1843  O  O     . GLU C  3 64  ? -1.586  2.248   47.548 1.00 47.82  ? 64   GLU C O     1 
ATOM   1844  C  CB    . GLU C  3 64  ? -3.945  3.226   45.215 1.00 48.87  ? 64   GLU C CB    1 
ATOM   1845  C  CG    . GLU C  3 64  ? -4.216  4.328   46.212 1.00 52.42  ? 64   GLU C CG    1 
ATOM   1846  C  CD    . GLU C  3 64  ? -3.191  5.487   46.173 1.00 58.41  ? 64   GLU C CD    1 
ATOM   1847  O  OE1   . GLU C  3 64  ? -3.388  6.503   46.903 1.00 60.52  ? 64   GLU C OE1   1 
ATOM   1848  O  OE2   . GLU C  3 64  ? -2.190  5.377   45.427 1.00 58.98  ? 64   GLU C OE2   1 
ATOM   1849  N  N     . LEU C  3 65  ? -3.501  1.097   47.231 1.00 48.78  ? 65   LEU C N     1 
ATOM   1850  C  CA    . LEU C  3 65  ? -3.623  0.572   48.589 1.00 47.80  ? 65   LEU C CA    1 
ATOM   1851  C  C     . LEU C  3 65  ? -2.491  -0.368  48.959 1.00 48.48  ? 65   LEU C C     1 
ATOM   1852  O  O     . LEU C  3 65  ? -2.070  -0.403  50.116 1.00 48.95  ? 65   LEU C O     1 
ATOM   1853  C  CB    . LEU C  3 65  ? -4.929  -0.167  48.705 1.00 47.59  ? 65   LEU C CB    1 
ATOM   1854  C  CG    . LEU C  3 65  ? -6.209  0.620   48.532 1.00 46.65  ? 65   LEU C CG    1 
ATOM   1855  C  CD1   . LEU C  3 65  ? -7.312  -0.392  48.308 1.00 47.94  ? 65   LEU C CD1   1 
ATOM   1856  C  CD2   . LEU C  3 65  ? -6.482  1.446   49.788 1.00 44.44  ? 65   LEU C CD2   1 
ATOM   1857  N  N     . ALA C  3 66  ? -2.011  -1.144  47.994 1.00 48.70  ? 66   ALA C N     1 
ATOM   1858  C  CA    . ALA C  3 66  ? -0.870  -2.009  48.248 1.00 49.90  ? 66   ALA C CA    1 
ATOM   1859  C  C     . ALA C  3 66  ? 0.417   -1.218  48.531 1.00 50.22  ? 66   ALA C C     1 
ATOM   1860  O  O     . ALA C  3 66  ? 1.193   -1.576  49.424 1.00 50.35  ? 66   ALA C O     1 
ATOM   1861  C  CB    . ALA C  3 66  ? -0.667  -2.993  47.101 1.00 49.54  ? 66   ALA C CB    1 
ATOM   1862  N  N     . GLY C  3 67  ? 0.635   -0.145  47.773 1.00 50.80  ? 67   GLY C N     1 
ATOM   1863  C  CA    . GLY C  3 67  ? 1.732   0.786   48.043 1.00 50.97  ? 67   GLY C CA    1 
ATOM   1864  C  C     . GLY C  3 67  ? 1.626   1.414   49.427 1.00 51.49  ? 67   GLY C C     1 
ATOM   1865  O  O     . GLY C  3 67  ? 2.626   1.646   50.095 1.00 51.54  ? 67   GLY C O     1 
ATOM   1866  N  N     . ASN C  3 68  ? 0.420   1.698   49.877 1.00 51.61  ? 68   ASN C N     1 
ATOM   1867  C  CA    . ASN C  3 68  ? 0.305   2.247   51.185 1.00 52.99  ? 68   ASN C CA    1 
ATOM   1868  C  C     . ASN C  3 68  ? 0.743   1.285   52.225 1.00 53.68  ? 68   ASN C C     1 
ATOM   1869  O  O     . ASN C  3 68  ? 1.355   1.684   53.200 1.00 54.40  ? 68   ASN C O     1 
ATOM   1870  C  CB    . ASN C  3 68  ? -1.108  2.721   51.445 1.00 53.46  ? 68   ASN C CB    1 
ATOM   1871  C  CG    . ASN C  3 68  ? -1.445  3.930   50.619 1.00 55.59  ? 68   ASN C CG    1 
ATOM   1872  O  OD1   . ASN C  3 68  ? -0.577  4.476   49.929 1.00 58.83  ? 68   ASN C OD1   1 
ATOM   1873  N  ND2   . ASN C  3 68  ? -2.697  4.356   50.667 1.00 57.44  ? 68   ASN C ND2   1 
ATOM   1874  N  N     . ALA C  3 69  ? 0.450   0.001   52.004 1.00 54.82  ? 69   ALA C N     1 
ATOM   1875  C  CA    . ALA C  3 69  ? 0.777   -1.049  52.965 1.00 55.01  ? 69   ALA C CA    1 
ATOM   1876  C  C     . ALA C  3 69  ? 2.283   -1.235  52.979 1.00 55.79  ? 69   ALA C C     1 
ATOM   1877  O  O     . ALA C  3 69  ? 2.877   -1.399  54.037 1.00 55.49  ? 69   ALA C O     1 
ATOM   1878  C  CB    . ALA C  3 69  ? 0.076   -2.341  52.601 1.00 54.62  ? 69   ALA C CB    1 
ATOM   1879  N  N     . ALA C  3 70  ? 2.886   -1.201  51.790 1.00 56.77  ? 70   ALA C N     1 
ATOM   1880  C  CA    . ALA C  3 70  ? 4.322   -1.254  51.649 1.00 58.42  ? 70   ALA C CA    1 
ATOM   1881  C  C     . ALA C  3 70  ? 4.965   -0.103  52.398 1.00 60.12  ? 70   ALA C C     1 
ATOM   1882  O  O     . ALA C  3 70  ? 5.980   -0.294  53.043 1.00 60.76  ? 70   ALA C O     1 
ATOM   1883  C  CB    . ALA C  3 70  ? 4.711   -1.218  50.190 1.00 58.17  ? 70   ALA C CB    1 
ATOM   1884  N  N     . ARG C  3 71  ? 4.371   1.088   52.330 1.00 61.93  ? 71   ARG C N     1 
ATOM   1885  C  CA    . ARG C  3 71  ? 4.945   2.232   52.993 1.00 63.86  ? 71   ARG C CA    1 
ATOM   1886  C  C     . ARG C  3 71  ? 4.721   2.175   54.494 1.00 64.51  ? 71   ARG C C     1 
ATOM   1887  O  O     . ARG C  3 71  ? 5.652   2.438   55.259 1.00 64.75  ? 71   ARG C O     1 
ATOM   1888  C  CB    . ARG C  3 71  ? 4.431   3.546   52.410 1.00 64.51  ? 71   ARG C CB    1 
ATOM   1889  C  CG    . ARG C  3 71  ? 4.839   4.773   53.245 1.00 67.88  ? 71   ARG C CG    1 
ATOM   1890  C  CD    . ARG C  3 71  ? 4.341   6.063   52.673 1.00 74.71  ? 71   ARG C CD    1 
ATOM   1891  N  NE    . ARG C  3 71  ? 5.115   6.467   51.500 1.00 79.39  ? 71   ARG C NE    1 
ATOM   1892  C  CZ    . ARG C  3 71  ? 5.081   7.683   50.954 1.00 82.15  ? 71   ARG C CZ    1 
ATOM   1893  N  NH1   . ARG C  3 71  ? 4.301   8.642   51.466 1.00 81.55  ? 71   ARG C NH1   1 
ATOM   1894  N  NH2   . ARG C  3 71  ? 5.828   7.934   49.882 1.00 84.76  ? 71   ARG C NH2   1 
ATOM   1895  N  N     . ASP C  3 72  ? 3.504   1.841   54.914 1.00 65.47  ? 72   ASP C N     1 
ATOM   1896  C  CA    . ASP C  3 72  ? 3.206   1.610   56.327 1.00 67.08  ? 72   ASP C CA    1 
ATOM   1897  C  C     . ASP C  3 72  ? 4.214   0.656   56.969 1.00 67.75  ? 72   ASP C C     1 
ATOM   1898  O  O     . ASP C  3 72  ? 4.347   0.608   58.185 1.00 67.67  ? 72   ASP C O     1 
ATOM   1899  C  CB    . ASP C  3 72  ? 1.837   0.961   56.469 1.00 67.53  ? 72   ASP C CB    1 
ATOM   1900  C  CG    . ASP C  3 72  ? 0.714   1.895   56.173 1.00 69.99  ? 72   ASP C CG    1 
ATOM   1901  O  OD1   . ASP C  3 72  ? 0.902   3.118   56.303 1.00 73.00  ? 72   ASP C OD1   1 
ATOM   1902  O  OD2   . ASP C  3 72  ? -0.383  1.401   55.811 1.00 74.69  ? 72   ASP C OD2   1 
ATOM   1903  N  N     . ASN C  3 73  ? 4.883   -0.124  56.128 1.00 68.78  ? 73   ASN C N     1 
ATOM   1904  C  CA    . ASN C  3 73  ? 5.816   -1.160  56.540 1.00 70.26  ? 73   ASN C CA    1 
ATOM   1905  C  C     . ASN C  3 73  ? 7.268   -0.763  56.321 1.00 70.08  ? 73   ASN C C     1 
ATOM   1906  O  O     . ASN C  3 73  ? 8.159   -1.596  56.430 1.00 70.40  ? 73   ASN C O     1 
ATOM   1907  C  CB    . ASN C  3 73  ? 5.549   -2.433  55.730 1.00 71.10  ? 73   ASN C CB    1 
ATOM   1908  C  CG    . ASN C  3 73  ? 4.921   -3.541  56.558 1.00 73.99  ? 73   ASN C CG    1 
ATOM   1909  O  OD1   . ASN C  3 73  ? 5.626   -4.221  57.323 1.00 76.85  ? 73   ASN C OD1   1 
ATOM   1910  N  ND2   . ASN C  3 73  ? 3.593   -3.754  56.393 1.00 75.31  ? 73   ASN C ND2   1 
ATOM   1911  N  N     . LYS C  3 74  ? 7.500   0.495   55.982 1.00 69.95  ? 74   LYS C N     1 
ATOM   1912  C  CA    . LYS C  3 74  ? 8.850   0.979   55.693 1.00 70.18  ? 74   LYS C CA    1 
ATOM   1913  C  C     . LYS C  3 74  ? 9.556   0.175   54.592 1.00 69.36  ? 74   LYS C C     1 
ATOM   1914  O  O     . LYS C  3 74  ? 10.747  -0.124  54.681 1.00 69.69  ? 74   LYS C O     1 
ATOM   1915  C  CB    . LYS C  3 74  ? 9.669   1.033   56.986 1.00 70.70  ? 74   LYS C CB    1 
ATOM   1916  C  CG    . LYS C  3 74  ? 9.133   2.063   57.985 1.00 73.59  ? 74   LYS C CG    1 
ATOM   1917  C  CD    . LYS C  3 74  ? 9.017   1.493   59.397 1.00 77.82  ? 74   LYS C CD    1 
ATOM   1918  C  CE    . LYS C  3 74  ? 8.255   2.474   60.301 1.00 81.18  ? 74   LYS C CE    1 
ATOM   1919  N  NZ    . LYS C  3 74  ? 8.401   2.164   61.763 1.00 82.75  ? 74   LYS C NZ    1 
ATOM   1920  N  N     . LYS C  3 75  ? 8.813   -0.154  53.542 1.00 68.18  ? 75   LYS C N     1 
ATOM   1921  C  CA    . LYS C  3 75  ? 9.340   -0.957  52.438 1.00 67.11  ? 75   LYS C CA    1 
ATOM   1922  C  C     . LYS C  3 75  ? 9.125   -0.211  51.154 1.00 66.07  ? 75   LYS C C     1 
ATOM   1923  O  O     . LYS C  3 75  ? 8.213   0.609   51.061 1.00 66.55  ? 75   LYS C O     1 
ATOM   1924  C  CB    . LYS C  3 75  ? 8.608   -2.302  52.358 1.00 67.42  ? 75   LYS C CB    1 
ATOM   1925  C  CG    . LYS C  3 75  ? 8.828   -3.210  53.547 1.00 67.28  ? 75   LYS C CG    1 
ATOM   1926  C  CD    . LYS C  3 75  ? 10.211  -3.848  53.482 1.00 67.99  ? 75   LYS C CD    1 
ATOM   1927  C  CE    . LYS C  3 75  ? 10.348  -4.957  54.517 1.00 68.14  ? 75   LYS C CE    1 
ATOM   1928  N  NZ    . LYS C  3 75  ? 10.078  -4.445  55.897 1.00 69.64  ? 75   LYS C NZ    1 
ATOM   1929  N  N     . THR C  3 76  ? 9.942   -0.508  50.157 1.00 64.68  ? 76   THR C N     1 
ATOM   1930  C  CA    . THR C  3 76  ? 9.938   0.252   48.909 1.00 63.60  ? 76   THR C CA    1 
ATOM   1931  C  C     . THR C  3 76  ? 9.374   -0.581  47.783 1.00 62.48  ? 76   THR C C     1 
ATOM   1932  O  O     . THR C  3 76  ? 8.930   -0.046  46.769 1.00 61.86  ? 76   THR C O     1 
ATOM   1933  C  CB    . THR C  3 76  ? 11.393  0.767   48.566 1.00 64.23  ? 76   THR C CB    1 
ATOM   1934  O  OG1   . THR C  3 76  ? 11.504  2.149   48.937 1.00 64.07  ? 76   THR C OG1   1 
ATOM   1935  C  CG2   . THR C  3 76  ? 11.760  0.591   47.062 1.00 63.67  ? 76   THR C CG2   1 
ATOM   1936  N  N     . ARG C  3 77  ? 9.419   -1.903  47.966 1.00 61.38  ? 77   ARG C N     1 
ATOM   1937  C  CA    . ARG C  3 77  ? 8.912   -2.847  46.975 1.00 59.83  ? 77   ARG C CA    1 
ATOM   1938  C  C     . ARG C  3 77  ? 7.624   -3.496  47.443 1.00 57.83  ? 77   ARG C C     1 
ATOM   1939  O  O     . ARG C  3 77  ? 7.559   -4.002  48.555 1.00 58.18  ? 77   ARG C O     1 
ATOM   1940  C  CB    . ARG C  3 77  ? 9.945   -3.932  46.728 1.00 60.33  ? 77   ARG C CB    1 
ATOM   1941  C  CG    . ARG C  3 77  ? 9.647   -4.729  45.473 1.00 63.85  ? 77   ARG C CG    1 
ATOM   1942  C  CD    . ARG C  3 77  ? 10.725  -5.774  45.204 1.00 68.55  ? 77   ARG C CD    1 
ATOM   1943  N  NE    . ARG C  3 77  ? 11.965  -5.152  44.748 1.00 70.85  ? 77   ARG C NE    1 
ATOM   1944  C  CZ    . ARG C  3 77  ? 13.132  -5.253  45.381 1.00 72.96  ? 77   ARG C CZ    1 
ATOM   1945  N  NH1   . ARG C  3 77  ? 13.238  -5.964  46.496 1.00 72.85  ? 77   ARG C NH1   1 
ATOM   1946  N  NH2   . ARG C  3 77  ? 14.205  -4.652  44.883 1.00 75.65  ? 77   ARG C NH2   1 
ATOM   1947  N  N     . ILE C  3 78  ? 6.604   -3.496  46.594 1.00 55.57  ? 78   ILE C N     1 
ATOM   1948  C  CA    . ILE C  3 78  ? 5.379   -4.252  46.881 1.00 53.27  ? 78   ILE C CA    1 
ATOM   1949  C  C     . ILE C  3 78  ? 5.647   -5.756  46.764 1.00 52.81  ? 78   ILE C C     1 
ATOM   1950  O  O     . ILE C  3 78  ? 6.126   -6.239  45.718 1.00 53.16  ? 78   ILE C O     1 
ATOM   1951  C  CB    . ILE C  3 78  ? 4.235   -3.856  45.928 1.00 53.01  ? 78   ILE C CB    1 
ATOM   1952  C  CG1   . ILE C  3 78  ? 3.741   -2.428  46.233 1.00 51.33  ? 78   ILE C CG1   1 
ATOM   1953  C  CG2   . ILE C  3 78  ? 3.103   -4.862  45.994 1.00 51.89  ? 78   ILE C CG2   1 
ATOM   1954  C  CD1   . ILE C  3 78  ? 2.854   -1.824  45.169 1.00 45.83  ? 78   ILE C CD1   1 
ATOM   1955  N  N     . ILE C  3 79  ? 5.365   -6.480  47.844 1.00 51.29  ? 79   ILE C N     1 
ATOM   1956  C  CA    . ILE C  3 79  ? 5.403   -7.939  47.852 1.00 49.23  ? 79   ILE C CA    1 
ATOM   1957  C  C     . ILE C  3 79  ? 3.989   -8.490  48.055 1.00 49.53  ? 79   ILE C C     1 
ATOM   1958  O  O     . ILE C  3 79  ? 3.067   -7.715  48.381 1.00 50.43  ? 79   ILE C O     1 
ATOM   1959  C  CB    . ILE C  3 79  ? 6.380   -8.503  48.930 1.00 49.64  ? 79   ILE C CB    1 
ATOM   1960  C  CG1   . ILE C  3 79  ? 5.858   -8.287  50.365 1.00 48.21  ? 79   ILE C CG1   1 
ATOM   1961  C  CG2   . ILE C  3 79  ? 7.793   -7.961  48.693 1.00 48.73  ? 79   ILE C CG2   1 
ATOM   1962  C  CD1   . ILE C  3 79  ? 6.776   -8.848  51.457 1.00 45.50  ? 79   ILE C CD1   1 
ATOM   1963  N  N     . PRO C  3 80  ? 3.793   -9.820  47.841 1.00 48.71  ? 80   PRO C N     1 
ATOM   1964  C  CA    . PRO C  3 80  ? 2.467   -10.448 48.001 1.00 46.97  ? 80   PRO C CA    1 
ATOM   1965  C  C     . PRO C  3 80  ? 1.785   -10.171 49.333 1.00 46.24  ? 80   PRO C C     1 
ATOM   1966  O  O     . PRO C  3 80  ? 0.571   -10.039 49.366 1.00 46.64  ? 80   PRO C O     1 
ATOM   1967  C  CB    . PRO C  3 80  ? 2.785   -11.925 47.832 1.00 46.98  ? 80   PRO C CB    1 
ATOM   1968  C  CG    . PRO C  3 80  ? 3.935   -11.924 46.871 1.00 46.37  ? 80   PRO C CG    1 
ATOM   1969  C  CD    . PRO C  3 80  ? 4.787   -10.805 47.349 1.00 47.97  ? 80   PRO C CD    1 
ATOM   1970  N  N     . ARG C  3 81  ? 2.519   -10.052 50.431 1.00 45.53  ? 81   ARG C N     1 
ATOM   1971  C  CA    . ARG C  3 81  ? 1.834   -9.695  51.698 1.00 45.27  ? 81   ARG C CA    1 
ATOM   1972  C  C     . ARG C  3 81  ? 1.132   -8.311  51.637 1.00 45.16  ? 81   ARG C C     1 
ATOM   1973  O  O     . ARG C  3 81  ? 0.105   -8.076  52.306 1.00 44.96  ? 81   ARG C O     1 
ATOM   1974  C  CB    . ARG C  3 81  ? 2.757   -9.815  52.919 1.00 44.19  ? 81   ARG C CB    1 
ATOM   1975  C  CG    . ARG C  3 81  ? 2.369   -8.887  54.017 1.00 46.43  ? 81   ARG C CG    1 
ATOM   1976  C  CD    . ARG C  3 81  ? 2.139   -9.516  55.413 1.00 48.09  ? 81   ARG C CD    1 
ATOM   1977  N  NE    . ARG C  3 81  ? 0.928   -10.309 55.438 1.00 49.32  ? 81   ARG C NE    1 
ATOM   1978  C  CZ    . ARG C  3 81  ? 0.196   -10.611 56.511 1.00 47.65  ? 81   ARG C CZ    1 
ATOM   1979  N  NH1   . ARG C  3 81  ? 0.515   -10.184 57.706 1.00 41.76  ? 81   ARG C NH1   1 
ATOM   1980  N  NH2   . ARG C  3 81  ? -0.873  -11.390 56.364 1.00 46.87  ? 81   ARG C NH2   1 
ATOM   1981  N  N     . HIS C  3 82  ? 1.683   -7.402  50.834 1.00 44.78  ? 82   HIS C N     1 
ATOM   1982  C  CA    . HIS C  3 82  ? 1.121   -6.056  50.752 1.00 44.59  ? 82   HIS C CA    1 
ATOM   1983  C  C     . HIS C  3 82  ? -0.162  -6.078  49.960 1.00 44.73  ? 82   HIS C C     1 
ATOM   1984  O  O     . HIS C  3 82  ? -1.104  -5.359  50.308 1.00 44.47  ? 82   HIS C O     1 
ATOM   1985  C  CB    . HIS C  3 82  ? 2.090   -5.037  50.170 1.00 43.77  ? 82   HIS C CB    1 
ATOM   1986  C  CG    . HIS C  3 82  ? 3.362   -4.937  50.924 1.00 42.10  ? 82   HIS C CG    1 
ATOM   1987  N  ND1   . HIS C  3 82  ? 4.593   -4.894  50.303 1.00 42.27  ? 82   HIS C ND1   1 
ATOM   1988  C  CD2   . HIS C  3 82  ? 3.605   -4.908  52.253 1.00 41.39  ? 82   HIS C CD2   1 
ATOM   1989  C  CE1   . HIS C  3 82  ? 5.544   -4.849  51.216 1.00 41.89  ? 82   HIS C CE1   1 
ATOM   1990  N  NE2   . HIS C  3 82  ? 4.972   -4.851  52.410 1.00 43.12  ? 82   HIS C NE2   1 
ATOM   1991  N  N     . LEU C  3 83  ? -0.197  -6.902  48.908 1.00 44.75  ? 83   LEU C N     1 
ATOM   1992  C  CA    . LEU C  3 83  ? -1.439  -7.094  48.150 1.00 44.94  ? 83   LEU C CA    1 
ATOM   1993  C  C     . LEU C  3 83  ? -2.509  -7.700  49.047 1.00 45.18  ? 83   LEU C C     1 
ATOM   1994  O  O     . LEU C  3 83  ? -3.663  -7.320  48.979 1.00 45.12  ? 83   LEU C O     1 
ATOM   1995  C  CB    . LEU C  3 83  ? -1.213  -7.967  46.937 1.00 44.32  ? 83   LEU C CB    1 
ATOM   1996  C  CG    . LEU C  3 83  ? -0.196  -7.412  45.952 1.00 45.19  ? 83   LEU C CG    1 
ATOM   1997  C  CD1   . LEU C  3 83  ? 0.100   -8.439  44.865 1.00 45.25  ? 83   LEU C CD1   1 
ATOM   1998  C  CD2   . LEU C  3 83  ? -0.722  -6.133  45.325 1.00 47.15  ? 83   LEU C CD2   1 
ATOM   1999  N  N     . GLN C  3 84  ? -2.099  -8.609  49.927 1.00 45.58  ? 84   GLN C N     1 
ATOM   2000  C  CA    . GLN C  3 84  ? -3.052  -9.282  50.780 1.00 45.75  ? 84   GLN C CA    1 
ATOM   2001  C  C     . GLN C  3 84  ? -3.612  -8.321  51.817 1.00 45.68  ? 84   GLN C C     1 
ATOM   2002  O  O     . GLN C  3 84  ? -4.818  -8.252  51.992 1.00 45.38  ? 84   GLN C O     1 
ATOM   2003  C  CB    . GLN C  3 84  ? -2.430  -10.541 51.387 1.00 45.85  ? 84   GLN C CB    1 
ATOM   2004  C  CG    . GLN C  3 84  ? -3.224  -11.149 52.539 1.00 46.83  ? 84   GLN C CG    1 
ATOM   2005  C  CD    . GLN C  3 84  ? -4.449  -12.001 52.100 1.00 46.26  ? 84   GLN C CD    1 
ATOM   2006  O  OE1   . GLN C  3 84  ? -4.991  -11.856 50.986 1.00 45.62  ? 84   GLN C OE1   1 
ATOM   2007  N  NE2   . GLN C  3 84  ? -4.909  -12.849 53.010 1.00 41.64  ? 84   GLN C NE2   1 
ATOM   2008  N  N     . LEU C  3 85  ? -2.752  -7.543  52.469 1.00 46.33  ? 85   LEU C N     1 
ATOM   2009  C  CA    . LEU C  3 85  ? -3.239  -6.526  53.415 1.00 47.01  ? 85   LEU C CA    1 
ATOM   2010  C  C     . LEU C  3 85  ? -4.143  -5.506  52.723 1.00 47.42  ? 85   LEU C C     1 
ATOM   2011  O  O     . LEU C  3 85  ? -5.185  -5.142  53.263 1.00 48.00  ? 85   LEU C O     1 
ATOM   2012  C  CB    . LEU C  3 85  ? -2.083  -5.794  54.078 1.00 47.24  ? 85   LEU C CB    1 
ATOM   2013  C  CG    . LEU C  3 85  ? -1.175  -6.596  54.996 1.00 48.39  ? 85   LEU C CG    1 
ATOM   2014  C  CD1   . LEU C  3 85  ? 0.052   -5.769  55.280 1.00 46.29  ? 85   LEU C CD1   1 
ATOM   2015  C  CD2   . LEU C  3 85  ? -1.908  -6.964  56.297 1.00 47.50  ? 85   LEU C CD2   1 
ATOM   2016  N  N     . ALA C  3 86  ? -3.756  -5.065  51.526 1.00 47.00  ? 86   ALA C N     1 
ATOM   2017  C  CA    . ALA C  3 86  ? -4.582  -4.165  50.744 1.00 47.22  ? 86   ALA C CA    1 
ATOM   2018  C  C     . ALA C  3 86  ? -5.968  -4.727  50.437 1.00 47.49  ? 86   ALA C C     1 
ATOM   2019  O  O     . ALA C  3 86  ? -6.962  -4.084  50.680 1.00 48.23  ? 86   ALA C O     1 
ATOM   2020  C  CB    . ALA C  3 86  ? -3.874  -3.753  49.462 1.00 47.56  ? 86   ALA C CB    1 
ATOM   2021  N  N     . VAL C  3 87  ? -6.039  -5.928  49.895 1.00 48.07  ? 87   VAL C N     1 
ATOM   2022  C  CA    . VAL C  3 87  ? -7.331  -6.537  49.560 1.00 47.53  ? 87   VAL C CA    1 
ATOM   2023  C  C     . VAL C  3 87  ? -8.178  -6.801  50.800 1.00 47.70  ? 87   VAL C C     1 
ATOM   2024  O  O     . VAL C  3 87  ? -9.358  -6.498  50.826 1.00 47.41  ? 87   VAL C O     1 
ATOM   2025  C  CB    . VAL C  3 87  ? -7.125  -7.835  48.761 1.00 47.09  ? 87   VAL C CB    1 
ATOM   2026  C  CG1   . VAL C  3 87  ? -8.424  -8.555  48.573 1.00 46.85  ? 87   VAL C CG1   1 
ATOM   2027  C  CG2   . VAL C  3 87  ? -6.517  -7.507  47.419 1.00 46.93  ? 87   VAL C CG2   1 
ATOM   2028  N  N     . ARG C  3 88  ? -7.569  -7.363  51.835 1.00 48.10  ? 88   ARG C N     1 
ATOM   2029  C  CA    . ARG C  3 88  ? -8.357  -7.832  52.968 1.00 48.37  ? 88   ARG C CA    1 
ATOM   2030  C  C     . ARG C  3 88  ? -8.798  -6.687  53.836 1.00 49.00  ? 88   ARG C C     1 
ATOM   2031  O  O     . ARG C  3 88  ? -9.836  -6.759  54.466 1.00 49.59  ? 88   ARG C O     1 
ATOM   2032  C  CB    . ARG C  3 88  ? -7.613  -8.892  53.795 1.00 47.84  ? 88   ARG C CB    1 
ATOM   2033  C  CG    . ARG C  3 88  ? -7.246  -10.183 53.029 1.00 45.60  ? 88   ARG C CG    1 
ATOM   2034  C  CD    . ARG C  3 88  ? -8.401  -10.772 52.259 1.00 40.64  ? 88   ARG C CD    1 
ATOM   2035  N  NE    . ARG C  3 88  ? -7.965  -11.564 51.116 1.00 35.77  ? 88   ARG C NE    1 
ATOM   2036  C  CZ    . ARG C  3 88  ? -8.781  -12.001 50.155 1.00 36.24  ? 88   ARG C CZ    1 
ATOM   2037  N  NH1   . ARG C  3 88  ? -10.089 -11.716 50.179 1.00 36.20  ? 88   ARG C NH1   1 
ATOM   2038  N  NH2   . ARG C  3 88  ? -8.300  -12.720 49.159 1.00 34.44  ? 88   ARG C NH2   1 
ATOM   2039  N  N     . ASN C  3 89  ? -8.024  -5.613  53.845 1.00 50.21  ? 89   ASN C N     1 
ATOM   2040  C  CA    . ASN C  3 89  ? -8.388  -4.419  54.617 1.00 51.22  ? 89   ASN C CA    1 
ATOM   2041  C  C     . ASN C  3 89  ? -9.435  -3.512  53.957 1.00 51.85  ? 89   ASN C C     1 
ATOM   2042  O  O     . ASN C  3 89  ? -10.011 -2.672  54.635 1.00 52.05  ? 89   ASN C O     1 
ATOM   2043  C  CB    . ASN C  3 89  ? -7.141  -3.640  55.000 1.00 50.92  ? 89   ASN C CB    1 
ATOM   2044  C  CG    . ASN C  3 89  ? -6.438  -4.247  56.186 1.00 52.25  ? 89   ASN C CG    1 
ATOM   2045  O  OD1   . ASN C  3 89  ? -7.076  -4.591  57.177 1.00 53.73  ? 89   ASN C OD1   1 
ATOM   2046  N  ND2   . ASN C  3 89  ? -5.125  -4.401  56.093 1.00 53.56  ? 89   ASN C ND2   1 
ATOM   2047  N  N     . ASP C  3 90  ? -9.677  -3.702  52.653 1.00 52.70  ? 90   ASP C N     1 
ATOM   2048  C  CA    . ASP C  3 90  ? -10.691 -2.986  51.904 1.00 53.75  ? 90   ASP C CA    1 
ATOM   2049  C  C     . ASP C  3 90  ? -11.948 -3.803  51.688 1.00 54.48  ? 90   ASP C C     1 
ATOM   2050  O  O     . ASP C  3 90  ? -11.922 -4.802  50.987 1.00 55.62  ? 90   ASP C O     1 
ATOM   2051  C  CB    . ASP C  3 90  ? -10.167 -2.619  50.536 1.00 54.27  ? 90   ASP C CB    1 
ATOM   2052  C  CG    . ASP C  3 90  ? -11.096 -1.659  49.808 1.00 57.94  ? 90   ASP C CG    1 
ATOM   2053  O  OD1   . ASP C  3 90  ? -11.028 -0.440  50.104 1.00 60.52  ? 90   ASP C OD1   1 
ATOM   2054  O  OD2   . ASP C  3 90  ? -11.899 -2.110  48.958 1.00 61.69  ? 90   ASP C OD2   1 
ATOM   2055  N  N     . GLU C  3 91  ? -13.062 -3.348  52.240 1.00 55.29  ? 91   GLU C N     1 
ATOM   2056  C  CA    . GLU C  3 91  ? -14.324 -4.071  52.178 1.00 55.83  ? 91   GLU C CA    1 
ATOM   2057  C  C     . GLU C  3 91  ? -14.710 -4.545  50.801 1.00 55.33  ? 91   GLU C C     1 
ATOM   2058  O  O     . GLU C  3 91  ? -15.224 -5.655  50.659 1.00 56.01  ? 91   GLU C O     1 
ATOM   2059  C  CB    . GLU C  3 91  ? -15.451 -3.211  52.703 1.00 56.37  ? 91   GLU C CB    1 
ATOM   2060  C  CG    . GLU C  3 91  ? -15.979 -3.560  54.074 1.00 60.73  ? 91   GLU C CG    1 
ATOM   2061  C  CD    . GLU C  3 91  ? -17.335 -2.876  54.308 1.00 69.20  ? 91   GLU C CD    1 
ATOM   2062  O  OE1   . GLU C  3 91  ? -18.240 -3.069  53.446 1.00 70.27  ? 91   GLU C OE1   1 
ATOM   2063  O  OE2   . GLU C  3 91  ? -17.485 -2.130  55.326 1.00 71.82  ? 91   GLU C OE2   1 
ATOM   2064  N  N     . GLU C  3 92  ? -14.472 -3.731  49.787 1.00 54.61  ? 92   GLU C N     1 
ATOM   2065  C  CA    . GLU C  3 92  ? -14.963 -4.079  48.461 1.00 54.79  ? 92   GLU C CA    1 
ATOM   2066  C  C     . GLU C  3 92  ? -14.047 -4.971  47.650 1.00 53.67  ? 92   GLU C C     1 
ATOM   2067  O  O     . GLU C  3 92  ? -14.501 -5.883  46.945 1.00 53.37  ? 92   GLU C O     1 
ATOM   2068  C  CB    . GLU C  3 92  ? -15.383 -2.842  47.691 1.00 55.29  ? 92   GLU C CB    1 
ATOM   2069  C  CG    . GLU C  3 92  ? -16.709 -2.320  48.237 1.00 59.59  ? 92   GLU C CG    1 
ATOM   2070  C  CD    . GLU C  3 92  ? -17.211 -1.087  47.523 1.00 65.77  ? 92   GLU C CD    1 
ATOM   2071  O  OE1   . GLU C  3 92  ? -16.447 -0.524  46.686 1.00 66.30  ? 92   GLU C OE1   1 
ATOM   2072  O  OE2   . GLU C  3 92  ? -18.374 -0.685  47.810 1.00 68.98  ? 92   GLU C OE2   1 
ATOM   2073  N  N     . LEU C  3 93  ? -12.754 -4.719  47.752 1.00 52.73  ? 93   LEU C N     1 
ATOM   2074  C  CA    . LEU C  3 93  ? -11.816 -5.624  47.147 1.00 51.83  ? 93   LEU C CA    1 
ATOM   2075  C  C     . LEU C  3 93  ? -11.919 -6.996  47.823 1.00 51.46  ? 93   LEU C C     1 
ATOM   2076  O  O     . LEU C  3 93  ? -11.994 -8.015  47.140 1.00 50.96  ? 93   LEU C O     1 
ATOM   2077  C  CB    . LEU C  3 93  ? -10.420 -5.045  47.201 1.00 51.95  ? 93   LEU C CB    1 
ATOM   2078  C  CG    . LEU C  3 93  ? -10.151 -3.886  46.230 1.00 51.27  ? 93   LEU C CG    1 
ATOM   2079  C  CD1   . LEU C  3 93  ? -8.781  -3.377  46.556 1.00 51.51  ? 93   LEU C CD1   1 
ATOM   2080  C  CD2   . LEU C  3 93  ? -10.209 -4.295  44.764 1.00 47.41  ? 93   LEU C CD2   1 
ATOM   2081  N  N     . ASN C  3 94  ? -12.001 -7.013  49.154 1.00 50.81  ? 94   ASN C N     1 
ATOM   2082  C  CA    . ASN C  3 94  ? -12.239 -8.258  49.870 1.00 50.50  ? 94   ASN C CA    1 
ATOM   2083  C  C     . ASN C  3 94  ? -13.350 -9.116  49.308 1.00 50.65  ? 94   ASN C C     1 
ATOM   2084  O  O     . ASN C  3 94  ? -13.175 -10.306 49.133 1.00 51.46  ? 94   ASN C O     1 
ATOM   2085  C  CB    . ASN C  3 94  ? -12.510 -8.048  51.342 1.00 49.59  ? 94   ASN C CB    1 
ATOM   2086  C  CG    . ASN C  3 94  ? -12.452 -9.360  52.111 1.00 50.12  ? 94   ASN C CG    1 
ATOM   2087  O  OD1   . ASN C  3 94  ? -11.596 -10.219 51.845 1.00 51.22  ? 94   ASN C OD1   1 
ATOM   2088  N  ND2   . ASN C  3 94  ? -13.370 -9.539  53.040 1.00 48.47  ? 94   ASN C ND2   1 
ATOM   2089  N  N     . LYS C  3 95  ? -14.496 -8.508  49.048 1.00 51.03  ? 95   LYS C N     1 
ATOM   2090  C  CA    . LYS C  3 95  ? -15.655 -9.191  48.512 1.00 51.32  ? 95   LYS C CA    1 
ATOM   2091  C  C     . LYS C  3 95  ? -15.456 -9.599  47.057 1.00 50.81  ? 95   LYS C C     1 
ATOM   2092  O  O     . LYS C  3 95  ? -15.894 -10.646 46.635 1.00 51.23  ? 95   LYS C O     1 
ATOM   2093  C  CB    . LYS C  3 95  ? -16.847 -8.273  48.638 1.00 51.91  ? 95   LYS C CB    1 
ATOM   2094  C  CG    . LYS C  3 95  ? -18.061 -8.712  47.890 1.00 55.79  ? 95   LYS C CG    1 
ATOM   2095  C  CD    . LYS C  3 95  ? -19.246 -8.003  48.524 1.00 63.80  ? 95   LYS C CD    1 
ATOM   2096  C  CE    . LYS C  3 95  ? -20.502 -8.879  48.552 1.00 67.82  ? 95   LYS C CE    1 
ATOM   2097  N  NZ    . LYS C  3 95  ? -21.429 -8.350  49.606 1.00 69.87  ? 95   LYS C NZ    1 
ATOM   2098  N  N     . LEU C  3 96  ? -14.777 -8.774  46.288 1.00 50.26  ? 96   LEU C N     1 
ATOM   2099  C  CA    . LEU C  3 96  ? -14.584 -9.073  44.888 1.00 49.39  ? 96   LEU C CA    1 
ATOM   2100  C  C     . LEU C  3 96  ? -13.655 -10.266 44.743 1.00 49.08  ? 96   LEU C C     1 
ATOM   2101  O  O     . LEU C  3 96  ? -13.755 -11.029 43.788 1.00 50.00  ? 96   LEU C O     1 
ATOM   2102  C  CB    . LEU C  3 96  ? -14.012 -7.834  44.168 1.00 49.23  ? 96   LEU C CB    1 
ATOM   2103  C  CG    . LEU C  3 96  ? -13.471 -8.103  42.771 1.00 48.06  ? 96   LEU C CG    1 
ATOM   2104  C  CD1   . LEU C  3 96  ? -14.624 -8.374  41.824 1.00 47.90  ? 96   LEU C CD1   1 
ATOM   2105  C  CD2   . LEU C  3 96  ? -12.587 -7.013  42.284 1.00 46.44  ? 96   LEU C CD2   1 
ATOM   2106  N  N     . LEU C  3 97  ? -12.724 -10.387 45.676 1.00 48.76  ? 97   LEU C N     1 
ATOM   2107  C  CA    . LEU C  3 97  ? -11.768 -11.484 45.724 1.00 48.33  ? 97   LEU C CA    1 
ATOM   2108  C  C     . LEU C  3 97  ? -12.067 -12.305 46.976 1.00 48.92  ? 97   LEU C C     1 
ATOM   2109  O  O     . LEU C  3 97  ? -11.149 -12.774 47.691 1.00 49.19  ? 97   LEU C O     1 
ATOM   2110  C  CB    . LEU C  3 97  ? -10.347 -10.959 45.773 1.00 47.54  ? 97   LEU C CB    1 
ATOM   2111  C  CG    . LEU C  3 97  ? -9.917  -9.970  44.694 1.00 48.77  ? 97   LEU C CG    1 
ATOM   2112  C  CD1   . LEU C  3 97  ? -8.510  -9.497  44.929 1.00 46.98  ? 97   LEU C CD1   1 
ATOM   2113  C  CD2   . LEU C  3 97  ? -10.039 -10.588 43.298 1.00 50.74  ? 97   LEU C CD2   1 
ATOM   2114  N  N     . GLY C  3 98  ? -13.359 -12.455 47.261 1.00 48.53  ? 98   GLY C N     1 
ATOM   2115  C  CA    . GLY C  3 98  ? -13.784 -13.241 48.409 1.00 49.12  ? 98   GLY C CA    1 
ATOM   2116  C  C     . GLY C  3 98  ? -13.420 -14.718 48.286 1.00 49.59  ? 98   GLY C C     1 
ATOM   2117  O  O     . GLY C  3 98  ? -13.256 -15.385 49.277 1.00 49.86  ? 98   GLY C O     1 
ATOM   2118  N  N     . ARG C  3 99  ? -13.279 -15.225 47.068 1.00 49.71  ? 99   ARG C N     1 
ATOM   2119  C  CA    . ARG C  3 99  ? -13.012 -16.636 46.868 1.00 50.04  ? 99   ARG C CA    1 
ATOM   2120  C  C     . ARG C  3 99  ? -11.697 -16.882 46.106 1.00 48.95  ? 99   ARG C C     1 
ATOM   2121  O  O     . ARG C  3 99  ? -11.601 -17.789 45.267 1.00 48.29  ? 99   ARG C O     1 
ATOM   2122  C  CB    . ARG C  3 99  ? -14.218 -17.276 46.194 1.00 50.98  ? 99   ARG C CB    1 
ATOM   2123  C  CG    . ARG C  3 99  ? -15.382 -17.425 47.166 1.00 56.59  ? 99   ARG C CG    1 
ATOM   2124  C  CD    . ARG C  3 99  ? -16.728 -17.529 46.443 1.00 68.70  ? 99   ARG C CD    1 
ATOM   2125  N  NE    . ARG C  3 99  ? -17.580 -18.588 47.031 1.00 77.66  ? 99   ARG C NE    1 
ATOM   2126  C  CZ    . ARG C  3 99  ? -18.898 -18.743 46.796 1.00 81.36  ? 99   ARG C CZ    1 
ATOM   2127  N  NH1   . ARG C  3 99  ? -19.588 -17.890 45.984 1.00 82.35  ? 99   ARG C NH1   1 
ATOM   2128  N  NH2   . ARG C  3 99  ? -19.535 -19.765 47.389 1.00 82.12  ? 99   ARG C NH2   1 
ATOM   2129  N  N     . VAL C  3 100 ? -10.704 -16.036 46.414 1.00 47.41  ? 100  VAL C N     1 
ATOM   2130  C  CA    . VAL C  3 100 ? -9.394  -16.039 45.791 1.00 45.99  ? 100  VAL C CA    1 
ATOM   2131  C  C     . VAL C  3 100 ? -8.291  -16.112 46.870 1.00 46.38  ? 100  VAL C C     1 
ATOM   2132  O  O     . VAL C  3 100 ? -8.426  -15.586 47.966 1.00 45.18  ? 100  VAL C O     1 
ATOM   2133  C  CB    . VAL C  3 100 ? -9.184  -14.763 44.974 1.00 45.96  ? 100  VAL C CB    1 
ATOM   2134  C  CG1   . VAL C  3 100 ? -7.731  -14.598 44.580 1.00 46.32  ? 100  VAL C CG1   1 
ATOM   2135  C  CG2   . VAL C  3 100 ? -10.041 -14.750 43.757 1.00 44.33  ? 100  VAL C CG2   1 
ATOM   2136  N  N     . THR C  3 101 ? -7.205  -16.800 46.541 1.00 46.66  ? 101  THR C N     1 
ATOM   2137  C  CA    . THR C  3 101 ? -6.116  -16.991 47.445 1.00 46.62  ? 101  THR C CA    1 
ATOM   2138  C  C     . THR C  3 101 ? -4.909  -16.357 46.814 1.00 46.98  ? 101  THR C C     1 
ATOM   2139  O  O     . THR C  3 101 ? -4.540  -16.684 45.676 1.00 47.70  ? 101  THR C O     1 
ATOM   2140  C  CB    . THR C  3 101 ? -5.891  -18.503 47.702 1.00 47.50  ? 101  THR C CB    1 
ATOM   2141  O  OG1   . THR C  3 101 ? -7.056  -19.033 48.350 1.00 48.59  ? 101  THR C OG1   1 
ATOM   2142  C  CG2   . THR C  3 101 ? -4.658  -18.772 48.585 1.00 45.27  ? 101  THR C CG2   1 
ATOM   2143  N  N     . ILE C  3 102 ? -4.318  -15.425 47.545 1.00 46.74  ? 102  ILE C N     1 
ATOM   2144  C  CA    . ILE C  3 102 ? -3.122  -14.764 47.103 1.00 47.25  ? 102  ILE C CA    1 
ATOM   2145  C  C     . ILE C  3 102 ? -1.968  -15.520 47.713 1.00 47.97  ? 102  ILE C C     1 
ATOM   2146  O  O     . ILE C  3 102 ? -1.767  -15.497 48.944 1.00 48.14  ? 102  ILE C O     1 
ATOM   2147  C  CB    . ILE C  3 102 ? -3.122  -13.276 47.545 1.00 47.61  ? 102  ILE C CB    1 
ATOM   2148  C  CG1   . ILE C  3 102 ? -4.098  -12.470 46.689 1.00 46.63  ? 102  ILE C CG1   1 
ATOM   2149  C  CG2   . ILE C  3 102 ? -1.757  -12.665 47.414 1.00 46.92  ? 102  ILE C CG2   1 
ATOM   2150  C  CD1   . ILE C  3 102 ? -4.518  -11.220 47.353 1.00 47.76  ? 102  ILE C CD1   1 
ATOM   2151  N  N     . ALA C  3 103 ? -1.214  -16.219 46.872 1.00 48.24  ? 103  ALA C N     1 
ATOM   2152  C  CA    . ALA C  3 103 ? -0.087  -16.981 47.385 1.00 49.22  ? 103  ALA C CA    1 
ATOM   2153  C  C     . ALA C  3 103 ? 0.848   -16.072 48.180 1.00 50.30  ? 103  ALA C C     1 
ATOM   2154  O  O     . ALA C  3 103 ? 1.057   -14.904 47.824 1.00 51.60  ? 103  ALA C O     1 
ATOM   2155  C  CB    . ALA C  3 103 ? 0.644   -17.627 46.265 1.00 49.48  ? 103  ALA C CB    1 
ATOM   2156  N  N     . GLN C  3 104 ? 1.402   -16.593 49.263 1.00 50.42  ? 104  GLN C N     1 
ATOM   2157  C  CA    . GLN C  3 104 ? 2.360   -15.850 50.084 1.00 50.96  ? 104  GLN C CA    1 
ATOM   2158  C  C     . GLN C  3 104 ? 1.813   -14.527 50.667 1.00 50.29  ? 104  GLN C C     1 
ATOM   2159  O  O     . GLN C  3 104 ? 2.590   -13.648 51.022 1.00 51.17  ? 104  GLN C O     1 
ATOM   2160  C  CB    . GLN C  3 104 ? 3.705   -15.639 49.347 1.00 51.21  ? 104  GLN C CB    1 
ATOM   2161  C  CG    . GLN C  3 104 ? 4.645   -16.856 49.343 1.00 54.50  ? 104  GLN C CG    1 
ATOM   2162  C  CD    . GLN C  3 104 ? 5.011   -17.337 50.778 1.00 61.81  ? 104  GLN C CD    1 
ATOM   2163  O  OE1   . GLN C  3 104 ? 5.553   -16.560 51.591 1.00 66.13  ? 104  GLN C OE1   1 
ATOM   2164  N  NE2   . GLN C  3 104 ? 4.704   -18.609 51.091 1.00 59.34  ? 104  GLN C NE2   1 
ATOM   2165  N  N     . GLY C  3 105 ? 0.496   -14.403 50.791 1.00 48.80  ? 105  GLY C N     1 
ATOM   2166  C  CA    . GLY C  3 105 ? -0.083  -13.249 51.445 1.00 47.82  ? 105  GLY C CA    1 
ATOM   2167  C  C     . GLY C  3 105 ? -0.336  -13.353 52.946 1.00 47.52  ? 105  GLY C C     1 
ATOM   2168  O  O     . GLY C  3 105 ? -0.421  -12.315 53.662 1.00 47.33  ? 105  GLY C O     1 
ATOM   2169  N  N     . GLY C  3 106 ? -0.468  -14.588 53.439 1.00 46.86  ? 106  GLY C N     1 
ATOM   2170  C  CA    . GLY C  3 106 ? -0.823  -14.831 54.846 1.00 45.64  ? 106  GLY C CA    1 
ATOM   2171  C  C     . GLY C  3 106 ? -2.202  -14.302 55.170 1.00 44.96  ? 106  GLY C C     1 
ATOM   2172  O  O     . GLY C  3 106 ? -3.030  -14.125 54.291 1.00 44.76  ? 106  GLY C O     1 
ATOM   2173  N  N     . VAL C  3 107 ? -2.420  -13.993 56.433 1.00 45.69  ? 107  VAL C N     1 
ATOM   2174  C  CA    . VAL C  3 107 ? -3.710  -13.519 56.946 1.00 45.54  ? 107  VAL C CA    1 
ATOM   2175  C  C     . VAL C  3 107 ? -3.605  -12.190 57.720 1.00 46.52  ? 107  VAL C C     1 
ATOM   2176  O  O     . VAL C  3 107 ? -2.506  -11.752 58.057 1.00 46.40  ? 107  VAL C O     1 
ATOM   2177  C  CB    . VAL C  3 107 ? -4.338  -14.602 57.910 1.00 45.58  ? 107  VAL C CB    1 
ATOM   2178  C  CG1   . VAL C  3 107 ? -4.514  -15.951 57.195 1.00 43.23  ? 107  VAL C CG1   1 
ATOM   2179  C  CG2   . VAL C  3 107 ? -3.535  -14.743 59.199 1.00 43.14  ? 107  VAL C CG2   1 
ATOM   2180  N  N     . LEU C  3 108 ? -4.749  -11.569 58.022 1.00 47.91  ? 108  LEU C N     1 
ATOM   2181  C  CA    . LEU C  3 108 ? -4.789  -10.372 58.869 1.00 49.34  ? 108  LEU C CA    1 
ATOM   2182  C  C     . LEU C  3 108 ? -4.611  -10.749 60.329 1.00 50.45  ? 108  LEU C C     1 
ATOM   2183  O  O     . LEU C  3 108 ? -5.263  -11.669 60.805 1.00 50.76  ? 108  LEU C O     1 
ATOM   2184  C  CB    . LEU C  3 108 ? -6.123  -9.643  58.727 1.00 49.56  ? 108  LEU C CB    1 
ATOM   2185  C  CG    . LEU C  3 108 ? -6.461  -8.912  57.420 1.00 50.03  ? 108  LEU C CG    1 
ATOM   2186  C  CD1   . LEU C  3 108 ? -7.816  -8.218  57.539 1.00 46.76  ? 108  LEU C CD1   1 
ATOM   2187  C  CD2   . LEU C  3 108 ? -5.374  -7.928  57.045 1.00 48.69  ? 108  LEU C CD2   1 
ATOM   2188  N  N     . PRO C  3 109 ? -3.713  -10.053 61.053 1.00 51.87  ? 109  PRO C N     1 
ATOM   2189  C  CA    . PRO C  3 109 ? -3.645  -10.312 62.498 1.00 52.28  ? 109  PRO C CA    1 
ATOM   2190  C  C     . PRO C  3 109 ? -5.016  -10.125 63.064 1.00 53.03  ? 109  PRO C C     1 
ATOM   2191  O  O     . PRO C  3 109 ? -5.628  -9.111  62.814 1.00 53.71  ? 109  PRO C O     1 
ATOM   2192  C  CB    . PRO C  3 109 ? -2.716  -9.212  63.004 1.00 51.64  ? 109  PRO C CB    1 
ATOM   2193  C  CG    . PRO C  3 109 ? -1.779  -9.005  61.851 1.00 52.04  ? 109  PRO C CG    1 
ATOM   2194  C  CD    . PRO C  3 109 ? -2.711  -9.049  60.640 1.00 51.82  ? 109  PRO C CD    1 
ATOM   2195  N  N     . ASN C  3 110 ? -5.521  -11.131 63.757 1.00 54.17  ? 110  ASN C N     1 
ATOM   2196  C  CA    . ASN C  3 110 ? -6.817  -11.054 64.396 1.00 55.21  ? 110  ASN C CA    1 
ATOM   2197  C  C     . ASN C  3 110 ? -6.912  -12.192 65.406 1.00 55.99  ? 110  ASN C C     1 
ATOM   2198  O  O     . ASN C  3 110 ? -6.818  -13.384 65.044 1.00 56.32  ? 110  ASN C O     1 
ATOM   2199  C  CB    . ASN C  3 110 ? -7.940  -11.120 63.360 1.00 55.28  ? 110  ASN C CB    1 
ATOM   2200  C  CG    . ASN C  3 110 ? -9.329  -10.940 63.973 1.00 58.25  ? 110  ASN C CG    1 
ATOM   2201  O  OD1   . ASN C  3 110 ? -9.479  -10.504 65.127 1.00 62.08  ? 110  ASN C OD1   1 
ATOM   2202  N  ND2   . ASN C  3 110 ? -10.362 -11.272 63.195 1.00 59.13  ? 110  ASN C ND2   1 
ATOM   2203  N  N     . ILE C  3 111 ? -7.077  -11.801 66.670 1.00 56.43  ? 111  ILE C N     1 
ATOM   2204  C  CA    . ILE C  3 111 ? -7.208  -12.704 67.808 1.00 56.82  ? 111  ILE C CA    1 
ATOM   2205  C  C     . ILE C  3 111 ? -8.544  -12.430 68.491 1.00 58.11  ? 111  ILE C C     1 
ATOM   2206  O  O     . ILE C  3 111 ? -8.835  -11.296 68.840 1.00 59.00  ? 111  ILE C O     1 
ATOM   2207  C  CB    . ILE C  3 111 ? -6.080  -12.463 68.820 1.00 56.48  ? 111  ILE C CB    1 
ATOM   2208  C  CG1   . ILE C  3 111 ? -4.706  -12.529 68.129 1.00 55.17  ? 111  ILE C CG1   1 
ATOM   2209  C  CG2   . ILE C  3 111 ? -6.221  -13.397 70.036 1.00 55.61  ? 111  ILE C CG2   1 
ATOM   2210  C  CD1   . ILE C  3 111 ? -3.532  -12.586 69.080 1.00 52.49  ? 111  ILE C CD1   1 
ATOM   2211  N  N     . GLN C  3 112 ? -9.359  -13.460 68.667 1.00 59.55  ? 112  GLN C N     1 
ATOM   2212  C  CA    . GLN C  3 112 ? -10.663 -13.323 69.296 1.00 60.87  ? 112  GLN C CA    1 
ATOM   2213  C  C     . GLN C  3 112 ? -10.545 -12.894 70.742 1.00 62.16  ? 112  GLN C C     1 
ATOM   2214  O  O     . GLN C  3 112 ? -9.756  -13.473 71.494 1.00 62.62  ? 112  GLN C O     1 
ATOM   2215  C  CB    . GLN C  3 112 ? -11.394 -14.661 69.272 1.00 61.17  ? 112  GLN C CB    1 
ATOM   2216  C  CG    . GLN C  3 112 ? -11.718 -15.180 67.884 1.00 61.18  ? 112  GLN C CG    1 
ATOM   2217  C  CD    . GLN C  3 112 ? -12.709 -14.308 67.164 1.00 60.02  ? 112  GLN C CD    1 
ATOM   2218  O  OE1   . GLN C  3 112 ? -13.822 -14.065 67.649 1.00 56.91  ? 112  GLN C OE1   1 
ATOM   2219  N  NE2   . GLN C  3 112 ? -12.310 -13.824 65.990 1.00 60.27  ? 112  GLN C NE2   1 
ATOM   2220  N  N     . SER C  3 113 ? -11.352 -11.907 71.127 1.00 63.43  ? 113  SER C N     1 
ATOM   2221  C  CA    . SER C  3 113 ? -11.403 -11.372 72.497 1.00 64.65  ? 113  SER C CA    1 
ATOM   2222  C  C     . SER C  3 113 ? -11.226 -12.357 73.634 1.00 65.47  ? 113  SER C C     1 
ATOM   2223  O  O     . SER C  3 113 ? -10.350 -12.174 74.474 1.00 66.39  ? 113  SER C O     1 
ATOM   2224  C  CB    . SER C  3 113 ? -12.720 -10.654 72.730 1.00 64.41  ? 113  SER C CB    1 
ATOM   2225  O  OG    . SER C  3 113 ? -12.610 -9.387  72.167 1.00 64.85  ? 113  SER C OG    1 
ATOM   2226  N  N     . VAL C  3 114 ? -12.066 -13.382 73.674 1.00 66.21  ? 114  VAL C N     1 
ATOM   2227  C  CA    . VAL C  3 114 ? -12.089 -14.323 74.797 1.00 67.14  ? 114  VAL C CA    1 
ATOM   2228  C  C     . VAL C  3 114 ? -10.782 -15.075 74.972 1.00 68.17  ? 114  VAL C C     1 
ATOM   2229  O  O     . VAL C  3 114 ? -10.617 -15.790 75.951 1.00 68.85  ? 114  VAL C O     1 
ATOM   2230  C  CB    . VAL C  3 114 ? -13.241 -15.362 74.677 1.00 67.03  ? 114  VAL C CB    1 
ATOM   2231  C  CG1   . VAL C  3 114 ? -14.614 -14.673 74.445 1.00 67.02  ? 114  VAL C CG1   1 
ATOM   2232  C  CG2   . VAL C  3 114 ? -12.950 -16.375 73.565 1.00 66.47  ? 114  VAL C CG2   1 
ATOM   2233  N  N     . LEU C  3 115 ? -9.863  -14.932 74.021 1.00 69.55  ? 115  LEU C N     1 
ATOM   2234  C  CA    . LEU C  3 115 ? -8.599  -15.670 74.054 1.00 71.13  ? 115  LEU C CA    1 
ATOM   2235  C  C     . LEU C  3 115 ? -7.509  -14.896 74.762 1.00 72.77  ? 115  LEU C C     1 
ATOM   2236  O  O     . LEU C  3 115 ? -6.462  -15.449 75.082 1.00 73.14  ? 115  LEU C O     1 
ATOM   2237  C  CB    . LEU C  3 115 ? -8.131  -16.056 72.645 1.00 70.63  ? 115  LEU C CB    1 
ATOM   2238  C  CG    . LEU C  3 115 ? -9.055  -16.936 71.786 1.00 69.49  ? 115  LEU C CG    1 
ATOM   2239  C  CD1   . LEU C  3 115 ? -8.361  -17.332 70.491 1.00 66.38  ? 115  LEU C CD1   1 
ATOM   2240  C  CD2   . LEU C  3 115 ? -9.546  -18.160 72.549 1.00 67.48  ? 115  LEU C CD2   1 
ATOM   2241  N  N     . LEU C  3 116 ? -7.771  -13.617 75.003 1.00 74.88  ? 116  LEU C N     1 
ATOM   2242  C  CA    . LEU C  3 116 ? -6.844  -12.734 75.686 1.00 76.82  ? 116  LEU C CA    1 
ATOM   2243  C  C     . LEU C  3 116 ? -6.867  -12.987 77.185 1.00 78.88  ? 116  LEU C C     1 
ATOM   2244  O  O     . LEU C  3 116 ? -7.929  -13.273 77.753 1.00 79.25  ? 116  LEU C O     1 
ATOM   2245  C  CB    . LEU C  3 116 ? -7.195  -11.283 75.386 1.00 76.49  ? 116  LEU C CB    1 
ATOM   2246  C  CG    . LEU C  3 116 ? -7.133  -10.866 73.915 1.00 76.18  ? 116  LEU C CG    1 
ATOM   2247  C  CD1   . LEU C  3 116 ? -7.624  -9.433  73.784 1.00 75.80  ? 116  LEU C CD1   1 
ATOM   2248  C  CD2   . LEU C  3 116 ? -5.730  -11.030 73.320 1.00 73.25  ? 116  LEU C CD2   1 
ATOM   2249  N  N     . PRO C  3 117 ? -5.695  -12.880 77.834 1.00 80.91  ? 117  PRO C N     1 
ATOM   2250  C  CA    . PRO C  3 117 ? -5.539  -13.162 79.271 1.00 82.80  ? 117  PRO C CA    1 
ATOM   2251  C  C     . PRO C  3 117 ? -6.303  -12.240 80.247 1.00 84.91  ? 117  PRO C C     1 
ATOM   2252  O  O     . PRO C  3 117 ? -6.823  -11.183 79.850 1.00 85.00  ? 117  PRO C O     1 
ATOM   2253  C  CB    . PRO C  3 117 ? -4.024  -13.033 79.491 1.00 82.76  ? 117  PRO C CB    1 
ATOM   2254  C  CG    . PRO C  3 117 ? -3.549  -12.153 78.375 1.00 82.00  ? 117  PRO C CG    1 
ATOM   2255  C  CD    . PRO C  3 117 ? -4.418  -12.490 77.206 1.00 80.84  ? 117  PRO C CD    1 
ATOM   2256  N  N     . LYS C  3 118 ? -6.327  -12.667 81.520 1.00 87.37  ? 118  LYS C N     1 
ATOM   2257  C  CA    . LYS C  3 118 ? -6.953  -11.971 82.674 1.00 89.41  ? 118  LYS C CA    1 
ATOM   2258  C  C     . LYS C  3 118 ? -8.458  -11.729 82.489 1.00 90.55  ? 118  LYS C C     1 
ATOM   2259  O  O     . LYS C  3 118 ? -9.251  -12.687 82.442 1.00 90.64  ? 118  LYS C O     1 
ATOM   2260  C  CB    . LYS C  3 118 ? -6.242  -10.645 83.025 1.00 89.66  ? 118  LYS C CB    1 
ATOM   2261  C  CG    . LYS C  3 118 ? -4.754  -10.536 82.668 1.00 90.72  ? 118  LYS C CG    1 
ATOM   2262  C  CD    . LYS C  3 118 ? -4.384  -9.067  82.359 1.00 91.78  ? 118  LYS C CD    1 
ATOM   2263  C  CE    . LYS C  3 118 ? -5.120  -8.553  81.108 1.00 92.70  ? 118  LYS C CE    1 
ATOM   2264  N  NZ    . LYS C  3 118 ? -4.962  -7.088  80.837 1.00 92.17  ? 118  LYS C NZ    1 
ATOM   2265  N  N     . LYS C  3 119 ? -8.833  -10.444 82.411 1.00 91.95  ? 119  LYS C N     1 
ATOM   2266  C  CA    . LYS C  3 119 ? -10.207 -10.006 82.099 1.00 93.12  ? 119  LYS C CA    1 
ATOM   2267  C  C     . LYS C  3 119 ? -10.198 -8.568  81.593 1.00 93.10  ? 119  LYS C C     1 
ATOM   2268  O  O     . LYS C  3 119 ? -9.446  -7.742  82.108 1.00 93.44  ? 119  LYS C O     1 
ATOM   2269  C  CB    . LYS C  3 119 ? -11.151 -10.137 83.315 1.00 93.85  ? 119  LYS C CB    1 
ATOM   2270  C  CG    . LYS C  3 119 ? -10.962 -9.097  84.436 1.00 94.83  ? 119  LYS C CG    1 
ATOM   2271  C  CD    . LYS C  3 119 ? -9.984  -9.572  85.519 1.00 97.03  ? 119  LYS C CD    1 
ATOM   2272  C  CE    . LYS C  3 119 ? -10.055 -8.627  86.735 1.00 97.20  ? 119  LYS C CE    1 
ATOM   2273  N  NZ    . LYS C  3 119 ? -9.037  -8.960  87.780 1.00 98.70  ? 119  LYS C NZ    1 
ATOM   2274  N  N     . LYS D  4 28  ? 10.465  -20.521 20.219 1.00 105.06 ? 28   LYS D N     1 
ATOM   2275  C  CA    . LYS D  4 28  ? 10.723  -20.170 21.651 1.00 105.20 ? 28   LYS D CA    1 
ATOM   2276  C  C     . LYS D  4 28  ? 9.553   -19.322 22.168 1.00 105.10 ? 28   LYS D C     1 
ATOM   2277  O  O     . LYS D  4 28  ? 9.740   -18.179 22.617 1.00 105.07 ? 28   LYS D O     1 
ATOM   2278  C  CB    . LYS D  4 28  ? 12.067  -19.438 21.785 1.00 105.28 ? 28   LYS D CB    1 
ATOM   2279  C  CG    . LYS D  4 28  ? 13.269  -20.262 21.321 1.00 105.36 ? 28   LYS D CG    1 
ATOM   2280  C  CD    . LYS D  4 28  ? 13.401  -20.262 19.801 1.00 105.13 ? 28   LYS D CD    1 
ATOM   2281  C  CE    . LYS D  4 28  ? 13.567  -21.683 19.258 1.00 105.51 ? 28   LYS D CE    1 
ATOM   2282  N  NZ    . LYS D  4 28  ? 14.810  -22.360 19.736 1.00 105.78 ? 28   LYS D NZ    1 
ATOM   2283  N  N     . THR D  4 29  ? 8.364   -19.938 22.130 1.00 104.75 ? 29   THR D N     1 
ATOM   2284  C  CA    . THR D  4 29  ? 7.053   -19.260 22.077 1.00 104.42 ? 29   THR D CA    1 
ATOM   2285  C  C     . THR D  4 29  ? 6.854   -18.049 23.007 1.00 103.84 ? 29   THR D C     1 
ATOM   2286  O  O     . THR D  4 29  ? 7.400   -17.998 24.121 1.00 104.12 ? 29   THR D O     1 
ATOM   2287  C  CB    . THR D  4 29  ? 5.873   -20.291 22.209 1.00 104.64 ? 29   THR D CB    1 
ATOM   2288  O  OG1   . THR D  4 29  ? 4.761   -19.873 21.404 1.00 105.55 ? 29   THR D OG1   1 
ATOM   2289  C  CG2   . THR D  4 29  ? 5.421   -20.484 23.671 1.00 105.01 ? 29   THR D CG2   1 
ATOM   2290  N  N     . ARG D  4 30  ? 6.064   -17.084 22.531 1.00 102.75 ? 30   ARG D N     1 
ATOM   2291  C  CA    . ARG D  4 30  ? 5.824   -15.824 23.253 1.00 101.80 ? 30   ARG D CA    1 
ATOM   2292  C  C     . ARG D  4 30  ? 4.716   -15.930 24.325 1.00 100.07 ? 30   ARG D C     1 
ATOM   2293  O  O     . ARG D  4 30  ? 3.579   -16.300 24.023 1.00 99.86  ? 30   ARG D O     1 
ATOM   2294  C  CB    . ARG D  4 30  ? 5.516   -14.683 22.259 1.00 101.91 ? 30   ARG D CB    1 
ATOM   2295  C  CG    . ARG D  4 30  ? 4.175   -14.822 21.500 1.00 102.70 ? 30   ARG D CG    1 
ATOM   2296  C  CD    . ARG D  4 30  ? 3.822   -13.582 20.668 1.00 103.40 ? 30   ARG D CD    1 
ATOM   2297  N  NE    . ARG D  4 30  ? 4.120   -12.312 21.364 1.00 107.22 ? 30   ARG D NE    1 
ATOM   2298  C  CZ    . ARG D  4 30  ? 3.605   -11.124 21.026 1.00 108.83 ? 30   ARG D CZ    1 
ATOM   2299  N  NH1   . ARG D  4 30  ? 2.735   -11.016 20.007 1.00 109.41 ? 30   ARG D NH1   1 
ATOM   2300  N  NH2   . ARG D  4 30  ? 3.953   -10.033 21.720 1.00 110.15 ? 30   ARG D NH2   1 
ATOM   2301  N  N     . LYS D  4 31  ? 5.058   -15.613 25.572 1.00 98.04  ? 31   LYS D N     1 
ATOM   2302  C  CA    . LYS D  4 31  ? 4.048   -15.546 26.636 1.00 96.17  ? 31   LYS D CA    1 
ATOM   2303  C  C     . LYS D  4 31  ? 3.741   -14.101 27.074 1.00 94.16  ? 31   LYS D C     1 
ATOM   2304  O  O     . LYS D  4 31  ? 4.544   -13.448 27.755 1.00 93.89  ? 31   LYS D O     1 
ATOM   2305  C  CB    . LYS D  4 31  ? 4.415   -16.440 27.831 1.00 96.16  ? 31   LYS D CB    1 
ATOM   2306  C  CG    . LYS D  4 31  ? 5.874   -16.385 28.259 1.00 96.90  ? 31   LYS D CG    1 
ATOM   2307  C  CD    . LYS D  4 31  ? 6.157   -17.338 29.428 1.00 97.02  ? 31   LYS D CD    1 
ATOM   2308  C  CE    . LYS D  4 31  ? 7.651   -17.367 29.772 1.00 97.73  ? 31   LYS D CE    1 
ATOM   2309  N  NZ    . LYS D  4 31  ? 7.913   -18.012 31.097 1.00 97.87  ? 31   LYS D NZ    1 
ATOM   2310  N  N     . GLU D  4 32  ? 2.572   -13.619 26.657 1.00 91.49  ? 32   GLU D N     1 
ATOM   2311  C  CA    . GLU D  4 32  ? 2.093   -12.279 26.986 1.00 89.07  ? 32   GLU D CA    1 
ATOM   2312  C  C     . GLU D  4 32  ? 1.770   -12.108 28.465 1.00 86.90  ? 32   GLU D C     1 
ATOM   2313  O  O     . GLU D  4 32  ? 1.219   -13.021 29.086 1.00 86.97  ? 32   GLU D O     1 
ATOM   2314  C  CB    . GLU D  4 32  ? 0.804   -11.988 26.229 1.00 89.19  ? 32   GLU D CB    1 
ATOM   2315  C  CG    . GLU D  4 32  ? 0.925   -11.828 24.739 1.00 90.49  ? 32   GLU D CG    1 
ATOM   2316  C  CD    . GLU D  4 32  ? -0.339  -11.210 24.154 1.00 92.71  ? 32   GLU D CD    1 
ATOM   2317  O  OE1   . GLU D  4 32  ? -1.436  -11.410 24.751 1.00 92.79  ? 32   GLU D OE1   1 
ATOM   2318  O  OE2   . GLU D  4 32  ? -0.240  -10.515 23.106 1.00 93.32  ? 32   GLU D OE2   1 
ATOM   2319  N  N     . SER D  4 33  ? 2.083   -10.937 29.020 1.00 83.98  ? 33   SER D N     1 
ATOM   2320  C  CA    . SER D  4 33  ? 1.510   -10.543 30.308 1.00 81.08  ? 33   SER D CA    1 
ATOM   2321  C  C     . SER D  4 33  ? 1.109   -9.082  30.338 1.00 78.75  ? 33   SER D C     1 
ATOM   2322  O  O     . SER D  4 33  ? 1.391   -8.340  29.419 1.00 78.39  ? 33   SER D O     1 
ATOM   2323  C  CB    . SER D  4 33  ? 2.416   -10.921 31.500 1.00 81.36  ? 33   SER D CB    1 
ATOM   2324  O  OG    . SER D  4 33  ? 3.474   -10.012 31.726 1.00 80.47  ? 33   SER D OG    1 
ATOM   2325  N  N     . TYR D  4 34  ? 0.430   -8.688  31.403 1.00 76.25  ? 34   TYR D N     1 
ATOM   2326  C  CA    . TYR D  4 34  ? 0.047   -7.314  31.626 1.00 73.76  ? 34   TYR D CA    1 
ATOM   2327  C  C     . TYR D  4 34  ? 1.083   -6.507  32.389 1.00 72.54  ? 34   TYR D C     1 
ATOM   2328  O  O     . TYR D  4 34  ? 0.868   -5.321  32.653 1.00 72.58  ? 34   TYR D O     1 
ATOM   2329  C  CB    . TYR D  4 34  ? -1.235  -7.303  32.404 1.00 73.36  ? 34   TYR D CB    1 
ATOM   2330  C  CG    . TYR D  4 34  ? -2.415  -7.671  31.573 1.00 73.10  ? 34   TYR D CG    1 
ATOM   2331  C  CD1   . TYR D  4 34  ? -2.940  -8.961  31.599 1.00 71.83  ? 34   TYR D CD1   1 
ATOM   2332  C  CD2   . TYR D  4 34  ? -3.022  -6.725  30.759 1.00 73.18  ? 34   TYR D CD2   1 
ATOM   2333  C  CE1   . TYR D  4 34  ? -4.038  -9.298  30.846 1.00 70.75  ? 34   TYR D CE1   1 
ATOM   2334  C  CE2   . TYR D  4 34  ? -4.115  -7.057  29.986 1.00 73.91  ? 34   TYR D CE2   1 
ATOM   2335  C  CZ    . TYR D  4 34  ? -4.622  -8.346  30.041 1.00 72.37  ? 34   TYR D CZ    1 
ATOM   2336  O  OH    . TYR D  4 34  ? -5.724  -8.650  29.276 1.00 73.54  ? 34   TYR D OH    1 
ATOM   2337  N  N     . ALA D  4 35  ? 2.206   -7.146  32.707 1.00 71.05  ? 35   ALA D N     1 
ATOM   2338  C  CA    . ALA D  4 35  ? 3.273   -6.570  33.527 1.00 70.05  ? 35   ALA D CA    1 
ATOM   2339  C  C     . ALA D  4 35  ? 3.620   -5.119  33.227 1.00 69.45  ? 35   ALA D C     1 
ATOM   2340  O  O     . ALA D  4 35  ? 3.552   -4.280  34.115 1.00 69.45  ? 35   ALA D O     1 
ATOM   2341  C  CB    . ALA D  4 35  ? 4.541   -7.441  33.478 1.00 69.74  ? 35   ALA D CB    1 
ATOM   2342  N  N     . ILE D  4 36  ? 3.994   -4.817  31.990 1.00 68.56  ? 36   ILE D N     1 
ATOM   2343  C  CA    . ILE D  4 36  ? 4.468   -3.466  31.673 1.00 67.18  ? 36   ILE D CA    1 
ATOM   2344  C  C     . ILE D  4 36  ? 3.367   -2.440  31.881 1.00 66.28  ? 36   ILE D C     1 
ATOM   2345  O  O     . ILE D  4 36  ? 3.624   -1.324  32.309 1.00 65.64  ? 36   ILE D O     1 
ATOM   2346  C  CB    . ILE D  4 36  ? 5.056   -3.361  30.241 1.00 67.29  ? 36   ILE D CB    1 
ATOM   2347  C  CG1   . ILE D  4 36  ? 4.006   -3.714  29.184 1.00 66.89  ? 36   ILE D CG1   1 
ATOM   2348  C  CG2   . ILE D  4 36  ? 6.315   -4.238  30.115 1.00 67.54  ? 36   ILE D CG2   1 
ATOM   2349  C  CD1   . ILE D  4 36  ? 4.442   -3.407  27.781 1.00 66.85  ? 36   ILE D CD1   1 
ATOM   2350  N  N     . TYR D  4 37  ? 2.137   -2.842  31.594 1.00 65.56  ? 37   TYR D N     1 
ATOM   2351  C  CA    . TYR D  4 37  ? 0.980   -1.980  31.793 1.00 64.86  ? 37   TYR D CA    1 
ATOM   2352  C  C     . TYR D  4 37  ? 0.733   -1.787  33.262 1.00 63.38  ? 37   TYR D C     1 
ATOM   2353  O  O     . TYR D  4 37  ? 0.323   -0.698  33.685 1.00 63.26  ? 37   TYR D O     1 
ATOM   2354  C  CB    . TYR D  4 37  ? -0.244  -2.581  31.100 1.00 66.37  ? 37   TYR D CB    1 
ATOM   2355  C  CG    . TYR D  4 37  ? 0.086   -2.884  29.670 1.00 68.10  ? 37   TYR D CG    1 
ATOM   2356  C  CD1   . TYR D  4 37  ? 0.416   -4.175  29.262 1.00 69.88  ? 37   TYR D CD1   1 
ATOM   2357  C  CD2   . TYR D  4 37  ? 0.160   -1.855  28.739 1.00 68.77  ? 37   TYR D CD2   1 
ATOM   2358  C  CE1   . TYR D  4 37  ? 0.773   -4.431  27.930 1.00 71.47  ? 37   TYR D CE1   1 
ATOM   2359  C  CE2   . TYR D  4 37  ? 0.504   -2.089  27.434 1.00 69.53  ? 37   TYR D CE2   1 
ATOM   2360  C  CZ    . TYR D  4 37  ? 0.816   -3.366  27.030 1.00 70.95  ? 37   TYR D CZ    1 
ATOM   2361  O  OH    . TYR D  4 37  ? 1.162   -3.549  25.714 1.00 72.19  ? 37   TYR D OH    1 
ATOM   2362  N  N     . VAL D  4 38  ? 0.995   -2.846  34.038 1.00 61.33  ? 38   VAL D N     1 
ATOM   2363  C  CA    . VAL D  4 38  ? 0.808   -2.812  35.488 1.00 59.44  ? 38   VAL D CA    1 
ATOM   2364  C  C     . VAL D  4 38  ? 1.853   -1.879  36.079 1.00 58.83  ? 38   VAL D C     1 
ATOM   2365  O  O     . VAL D  4 38  ? 1.556   -1.092  36.961 1.00 57.74  ? 38   VAL D O     1 
ATOM   2366  C  CB    . VAL D  4 38  ? 0.853   -4.240  36.128 1.00 59.20  ? 38   VAL D CB    1 
ATOM   2367  C  CG1   . VAL D  4 38  ? 0.941   -4.159  37.640 1.00 57.94  ? 38   VAL D CG1   1 
ATOM   2368  C  CG2   . VAL D  4 38  ? -0.367  -5.046  35.715 1.00 57.06  ? 38   VAL D CG2   1 
ATOM   2369  N  N     . TYR D  4 39  ? 3.065   -1.956  35.550 1.00 59.10  ? 39   TYR D N     1 
ATOM   2370  C  CA    . TYR D  4 39  ? 4.170   -1.116  35.988 1.00 60.04  ? 39   TYR D CA    1 
ATOM   2371  C  C     . TYR D  4 39  ? 3.945   0.387   35.655 1.00 59.65  ? 39   TYR D C     1 
ATOM   2372  O  O     . TYR D  4 39  ? 4.121   1.255   36.523 1.00 59.21  ? 39   TYR D O     1 
ATOM   2373  C  CB    . TYR D  4 39  ? 5.475   -1.655  35.423 1.00 61.12  ? 39   TYR D CB    1 
ATOM   2374  C  CG    . TYR D  4 39  ? 6.711   -1.085  36.056 1.00 64.41  ? 39   TYR D CG    1 
ATOM   2375  C  CD1   . TYR D  4 39  ? 7.196   -1.573  37.280 1.00 67.23  ? 39   TYR D CD1   1 
ATOM   2376  C  CD2   . TYR D  4 39  ? 7.420   -0.057  35.429 1.00 67.95  ? 39   TYR D CD2   1 
ATOM   2377  C  CE1   . TYR D  4 39  ? 8.354   -1.028  37.877 1.00 67.15  ? 39   TYR D CE1   1 
ATOM   2378  C  CE2   . TYR D  4 39  ? 8.580   0.484   36.002 1.00 68.35  ? 39   TYR D CE2   1 
ATOM   2379  C  CZ    . TYR D  4 39  ? 9.043   -0.003  37.222 1.00 67.14  ? 39   TYR D CZ    1 
ATOM   2380  O  OH    . TYR D  4 39  ? 10.196  0.550   37.765 1.00 67.18  ? 39   TYR D OH    1 
ATOM   2381  N  N     . LYS D  4 40  ? 3.505   0.682   34.433 1.00 59.02  ? 40   LYS D N     1 
ATOM   2382  C  CA    . LYS D  4 40  ? 3.168   2.056   34.049 1.00 58.77  ? 40   LYS D CA    1 
ATOM   2383  C  C     . LYS D  4 40  ? 2.262   2.678   35.101 1.00 58.69  ? 40   LYS D C     1 
ATOM   2384  O  O     . LYS D  4 40  ? 2.592   3.704   35.686 1.00 60.06  ? 40   LYS D O     1 
ATOM   2385  C  CB    . LYS D  4 40  ? 2.492   2.104   32.679 1.00 58.62  ? 40   LYS D CB    1 
ATOM   2386  C  CG    . LYS D  4 40  ? 3.453   1.908   31.511 1.00 60.13  ? 40   LYS D CG    1 
ATOM   2387  C  CD    . LYS D  4 40  ? 2.723   1.660   30.197 1.00 63.45  ? 40   LYS D CD    1 
ATOM   2388  C  CE    . LYS D  4 40  ? 3.727   1.661   29.033 1.00 67.62  ? 40   LYS D CE    1 
ATOM   2389  N  NZ    . LYS D  4 40  ? 3.103   1.355   27.680 1.00 69.31  ? 40   LYS D NZ    1 
ATOM   2390  N  N     . VAL D  4 41  ? 1.137   2.022   35.349 1.00 57.64  ? 41   VAL D N     1 
ATOM   2391  C  CA    . VAL D  4 41  ? 0.108   2.452   36.285 1.00 55.99  ? 41   VAL D CA    1 
ATOM   2392  C  C     . VAL D  4 41  ? 0.681   2.573   37.687 1.00 55.94  ? 41   VAL D C     1 
ATOM   2393  O  O     . VAL D  4 41  ? 0.257   3.406   38.480 1.00 56.09  ? 41   VAL D O     1 
ATOM   2394  C  CB    . VAL D  4 41  ? -1.058  1.393   36.281 1.00 56.13  ? 41   VAL D CB    1 
ATOM   2395  C  CG1   . VAL D  4 41  ? -2.124  1.693   37.326 1.00 54.49  ? 41   VAL D CG1   1 
ATOM   2396  C  CG2   . VAL D  4 41  ? -1.661  1.238   34.882 1.00 54.27  ? 41   VAL D CG2   1 
ATOM   2397  N  N     . LEU D  4 42  ? 1.648   1.725   38.007 1.00 55.90  ? 42   LEU D N     1 
ATOM   2398  C  CA    . LEU D  4 42  ? 2.206   1.722   39.353 1.00 55.66  ? 42   LEU D CA    1 
ATOM   2399  C  C     . LEU D  4 42  ? 3.028   3.001   39.528 1.00 55.91  ? 42   LEU D C     1 
ATOM   2400  O  O     . LEU D  4 42  ? 3.051   3.612   40.616 1.00 55.99  ? 42   LEU D O     1 
ATOM   2401  C  CB    . LEU D  4 42  ? 3.054   0.457   39.586 1.00 55.39  ? 42   LEU D CB    1 
ATOM   2402  C  CG    . LEU D  4 42  ? 4.024   0.449   40.770 1.00 54.37  ? 42   LEU D CG    1 
ATOM   2403  C  CD1   . LEU D  4 42  ? 3.291   0.569   42.091 1.00 51.66  ? 42   LEU D CD1   1 
ATOM   2404  C  CD2   . LEU D  4 42  ? 4.879   -0.790  40.732 1.00 54.89  ? 42   LEU D CD2   1 
ATOM   2405  N  N     . LYS D  4 43  ? 3.699   3.397   38.445 1.00 55.74  ? 43   LYS D N     1 
ATOM   2406  C  CA    . LYS D  4 43  ? 4.532   4.595   38.466 1.00 55.96  ? 43   LYS D CA    1 
ATOM   2407  C  C     . LYS D  4 43  ? 3.652   5.807   38.604 1.00 55.57  ? 43   LYS D C     1 
ATOM   2408  O  O     . LYS D  4 43  ? 3.982   6.746   39.335 1.00 56.05  ? 43   LYS D O     1 
ATOM   2409  C  CB    . LYS D  4 43  ? 5.423   4.675   37.233 1.00 55.91  ? 43   LYS D CB    1 
ATOM   2410  C  CG    . LYS D  4 43  ? 6.578   3.674   37.327 1.00 57.55  ? 43   LYS D CG    1 
ATOM   2411  C  CD    . LYS D  4 43  ? 7.318   3.874   38.643 1.00 58.67  ? 43   LYS D CD    1 
ATOM   2412  C  CE    . LYS D  4 43  ? 7.719   2.581   39.291 1.00 59.98  ? 43   LYS D CE    1 
ATOM   2413  N  NZ    . LYS D  4 43  ? 8.905   2.766   40.197 1.00 59.77  ? 43   LYS D NZ    1 
ATOM   2414  N  N     . GLN D  4 44  ? 2.496   5.743   37.952 1.00 54.48  ? 44   GLN D N     1 
ATOM   2415  C  CA    . GLN D  4 44  ? 1.513   6.769   38.081 1.00 53.83  ? 44   GLN D CA    1 
ATOM   2416  C  C     . GLN D  4 44  ? 1.103   7.011   39.530 1.00 53.96  ? 44   GLN D C     1 
ATOM   2417  O  O     . GLN D  4 44  ? 1.061   8.147   39.944 1.00 54.29  ? 44   GLN D O     1 
ATOM   2418  C  CB    . GLN D  4 44  ? 0.304   6.459   37.222 1.00 53.64  ? 44   GLN D CB    1 
ATOM   2419  C  CG    . GLN D  4 44  ? 0.554   6.528   35.739 1.00 52.75  ? 44   GLN D CG    1 
ATOM   2420  C  CD    . GLN D  4 44  ? -0.727  6.424   34.963 1.00 54.94  ? 44   GLN D CD    1 
ATOM   2421  O  OE1   . GLN D  4 44  ? -1.614  5.626   35.311 1.00 58.47  ? 44   GLN D OE1   1 
ATOM   2422  N  NE2   . GLN D  4 44  ? -0.851  7.222   33.904 1.00 54.40  ? 44   GLN D NE2   1 
ATOM   2423  N  N     . VAL D  4 45  ? 0.831   5.961   40.305 1.00 54.37  ? 45   VAL D N     1 
ATOM   2424  C  CA    . VAL D  4 45  ? 0.245   6.124   41.650 1.00 54.71  ? 45   VAL D CA    1 
ATOM   2425  C  C     . VAL D  4 45  ? 1.264   6.115   42.795 1.00 55.30  ? 45   VAL D C     1 
ATOM   2426  O  O     . VAL D  4 45  ? 1.040   6.722   43.836 1.00 55.68  ? 45   VAL D O     1 
ATOM   2427  C  CB    . VAL D  4 45  ? -0.900  5.104   41.946 1.00 54.44  ? 45   VAL D CB    1 
ATOM   2428  C  CG1   . VAL D  4 45  ? -1.922  5.114   40.843 1.00 54.60  ? 45   VAL D CG1   1 
ATOM   2429  C  CG2   . VAL D  4 45  ? -0.354  3.690   42.118 1.00 55.84  ? 45   VAL D CG2   1 
ATOM   2430  N  N     . HIS D  4 46  ? 2.381   5.422   42.622 1.00 56.12  ? 46   HIS D N     1 
ATOM   2431  C  CA    . HIS D  4 46  ? 3.438   5.482   43.632 1.00 57.11  ? 46   HIS D CA    1 
ATOM   2432  C  C     . HIS D  4 46  ? 4.773   5.519   42.922 1.00 57.87  ? 46   HIS D C     1 
ATOM   2433  O  O     . HIS D  4 46  ? 5.363   4.468   42.671 1.00 57.85  ? 46   HIS D O     1 
ATOM   2434  C  CB    . HIS D  4 46  ? 3.409   4.290   44.567 1.00 56.29  ? 46   HIS D CB    1 
ATOM   2435  C  CG    . HIS D  4 46  ? 2.227   4.253   45.473 1.00 55.76  ? 46   HIS D CG    1 
ATOM   2436  N  ND1   . HIS D  4 46  ? 2.139   5.023   46.610 1.00 56.64  ? 46   HIS D ND1   1 
ATOM   2437  C  CD2   . HIS D  4 46  ? 1.107   3.497   45.444 1.00 55.26  ? 46   HIS D CD2   1 
ATOM   2438  C  CE1   . HIS D  4 46  ? 1.010   4.758   47.239 1.00 54.20  ? 46   HIS D CE1   1 
ATOM   2439  N  NE2   . HIS D  4 46  ? 0.366   3.835   46.550 1.00 56.02  ? 46   HIS D NE2   1 
ATOM   2440  N  N     . PRO D  4 47  ? 5.237   6.731   42.576 1.00 58.30  ? 47   PRO D N     1 
ATOM   2441  C  CA    . PRO D  4 47  ? 6.382   6.881   41.688 1.00 58.53  ? 47   PRO D CA    1 
ATOM   2442  C  C     . PRO D  4 47  ? 7.690   6.315   42.236 1.00 58.96  ? 47   PRO D C     1 
ATOM   2443  O  O     . PRO D  4 47  ? 8.552   5.981   41.436 1.00 59.52  ? 47   PRO D O     1 
ATOM   2444  C  CB    . PRO D  4 47  ? 6.466   8.394   41.474 1.00 58.33  ? 47   PRO D CB    1 
ATOM   2445  C  CG    . PRO D  4 47  ? 5.112   8.910   41.818 1.00 57.61  ? 47   PRO D CG    1 
ATOM   2446  C  CD    . PRO D  4 47  ? 4.682   8.038   42.960 1.00 58.31  ? 47   PRO D CD    1 
ATOM   2447  N  N     . ASP D  4 48  ? 7.832   6.165   43.553 1.00 59.16  ? 48   ASP D N     1 
ATOM   2448  C  CA    . ASP D  4 48  ? 9.100   5.650   44.113 1.00 59.94  ? 48   ASP D CA    1 
ATOM   2449  C  C     . ASP D  4 48  ? 9.052   4.191   44.594 1.00 59.70  ? 48   ASP D C     1 
ATOM   2450  O  O     . ASP D  4 48  ? 9.999   3.697   45.235 1.00 60.16  ? 48   ASP D O     1 
ATOM   2451  C  CB    . ASP D  4 48  ? 9.603   6.557   45.254 1.00 60.59  ? 48   ASP D CB    1 
ATOM   2452  C  CG    . ASP D  4 48  ? 10.028  7.957   44.767 1.00 63.30  ? 48   ASP D CG    1 
ATOM   2453  O  OD1   . ASP D  4 48  ? 10.711  8.045   43.699 1.00 65.10  ? 48   ASP D OD1   1 
ATOM   2454  O  OD2   . ASP D  4 48  ? 9.675   8.958   45.462 1.00 63.93  ? 48   ASP D OD2   1 
ATOM   2455  N  N     . THR D  4 49  ? 7.950   3.508   44.283 1.00 58.91  ? 49   THR D N     1 
ATOM   2456  C  CA    . THR D  4 49  ? 7.683   2.163   44.774 1.00 57.36  ? 49   THR D CA    1 
ATOM   2457  C  C     . THR D  4 49  ? 7.886   1.141   43.674 1.00 56.56  ? 49   THR D C     1 
ATOM   2458  O  O     . THR D  4 49  ? 7.417   1.340   42.545 1.00 55.92  ? 49   THR D O     1 
ATOM   2459  C  CB    . THR D  4 49  ? 6.259   2.091   45.329 1.00 57.48  ? 49   THR D CB    1 
ATOM   2460  O  OG1   . THR D  4 49  ? 6.068   3.189   46.225 1.00 59.19  ? 49   THR D OG1   1 
ATOM   2461  C  CG2   . THR D  4 49  ? 5.994   0.798   46.076 1.00 56.52  ? 49   THR D CG2   1 
ATOM   2462  N  N     . GLY D  4 50  ? 8.599   0.064   44.011 1.00 55.77  ? 50   GLY D N     1 
ATOM   2463  C  CA    . GLY D  4 50  ? 8.787   -1.064  43.101 1.00 55.90  ? 50   GLY D CA    1 
ATOM   2464  C  C     . GLY D  4 50  ? 7.763   -2.183  43.307 1.00 56.11  ? 50   GLY D C     1 
ATOM   2465  O  O     . GLY D  4 50  ? 6.908   -2.118  44.208 1.00 55.99  ? 50   GLY D O     1 
ATOM   2466  N  N     . ILE D  4 51  ? 7.852   -3.216  42.474 1.00 56.10  ? 51   ILE D N     1 
ATOM   2467  C  CA    . ILE D  4 51  ? 7.010   -4.407  42.630 1.00 56.11  ? 51   ILE D CA    1 
ATOM   2468  C  C     . ILE D  4 51  ? 7.843   -5.656  42.422 1.00 57.01  ? 51   ILE D C     1 
ATOM   2469  O  O     . ILE D  4 51  ? 8.555   -5.765  41.416 1.00 57.08  ? 51   ILE D O     1 
ATOM   2470  C  CB    . ILE D  4 51  ? 5.769   -4.386  41.678 1.00 56.06  ? 51   ILE D CB    1 
ATOM   2471  C  CG1   . ILE D  4 51  ? 4.743   -5.449  42.081 1.00 55.49  ? 51   ILE D CG1   1 
ATOM   2472  C  CG2   . ILE D  4 51  ? 6.174   -4.483  40.221 1.00 54.72  ? 51   ILE D CG2   1 
ATOM   2473  C  CD1   . ILE D  4 51  ? 3.378   -5.389  41.308 1.00 54.41  ? 51   ILE D CD1   1 
ATOM   2474  N  N     . SER D  4 52  ? 7.760   -6.589  43.382 1.00 57.34  ? 52   SER D N     1 
ATOM   2475  C  CA    . SER D  4 52  ? 8.487   -7.873  43.317 1.00 56.89  ? 52   SER D CA    1 
ATOM   2476  C  C     . SER D  4 52  ? 7.892   -8.690  42.203 1.00 56.30  ? 52   SER D C     1 
ATOM   2477  O  O     . SER D  4 52  ? 6.741   -8.468  41.851 1.00 56.03  ? 52   SER D O     1 
ATOM   2478  C  CB    . SER D  4 52  ? 8.333   -8.637  44.622 1.00 56.88  ? 52   SER D CB    1 
ATOM   2479  O  OG    . SER D  4 52  ? 7.213   -9.499  44.540 1.00 60.28  ? 52   SER D OG    1 
ATOM   2480  N  N     . SER D  4 53  ? 8.645   -9.637  41.643 1.00 56.58  ? 53   SER D N     1 
ATOM   2481  C  CA    . SER D  4 53  ? 8.095   -10.402 40.507 1.00 57.20  ? 53   SER D CA    1 
ATOM   2482  C  C     . SER D  4 53  ? 6.987   -11.377 40.909 1.00 56.44  ? 53   SER D C     1 
ATOM   2483  O  O     . SER D  4 53  ? 6.107   -11.669 40.084 1.00 56.43  ? 53   SER D O     1 
ATOM   2484  C  CB    . SER D  4 53  ? 9.168   -11.071 39.651 1.00 57.32  ? 53   SER D CB    1 
ATOM   2485  O  OG    . SER D  4 53  ? 9.937   -11.965 40.435 1.00 60.57  ? 53   SER D OG    1 
ATOM   2486  N  N     . LYS D  4 54  ? 6.989   -11.839 42.156 1.00 55.81  ? 54   LYS D N     1 
ATOM   2487  C  CA    . LYS D  4 54  ? 5.833   -12.598 42.642 1.00 56.99  ? 54   LYS D CA    1 
ATOM   2488  C  C     . LYS D  4 54  ? 4.584   -11.711 42.749 1.00 56.10  ? 54   LYS D C     1 
ATOM   2489  O  O     . LYS D  4 54  ? 3.495   -12.103 42.285 1.00 55.88  ? 54   LYS D O     1 
ATOM   2490  C  CB    . LYS D  4 54  ? 6.102   -13.290 43.975 1.00 58.63  ? 54   LYS D CB    1 
ATOM   2491  C  CG    . LYS D  4 54  ? 6.960   -14.549 43.898 1.00 61.53  ? 54   LYS D CG    1 
ATOM   2492  C  CD    . LYS D  4 54  ? 7.627   -14.804 45.284 1.00 67.18  ? 54   LYS D CD    1 
ATOM   2493  C  CE    . LYS D  4 54  ? 8.786   -15.856 45.227 1.00 67.21  ? 54   LYS D CE    1 
ATOM   2494  N  NZ    . LYS D  4 54  ? 9.851   -15.586 46.285 1.00 69.44  ? 54   LYS D NZ    1 
ATOM   2495  N  N     . ALA D  4 55  ? 4.742   -10.513 43.326 1.00 54.52  ? 55   ALA D N     1 
ATOM   2496  C  CA    . ALA D  4 55  ? 3.640   -9.556  43.363 1.00 52.82  ? 55   ALA D CA    1 
ATOM   2497  C  C     . ALA D  4 55  ? 3.152   -9.255  41.946 1.00 52.24  ? 55   ALA D C     1 
ATOM   2498  O  O     . ALA D  4 55  ? 1.956   -9.176  41.681 1.00 51.73  ? 55   ALA D O     1 
ATOM   2499  C  CB    . ALA D  4 55  ? 4.044   -8.330  44.068 1.00 52.63  ? 55   ALA D CB    1 
ATOM   2500  N  N     . MET D  4 56  ? 4.073   -9.163  41.004 1.00 52.07  ? 56   MET D N     1 
ATOM   2501  C  CA    . MET D  4 56  ? 3.665   -8.840  39.665 1.00 52.54  ? 56   MET D CA    1 
ATOM   2502  C  C     . MET D  4 56  ? 2.899   -10.001 39.076 1.00 52.38  ? 56   MET D C     1 
ATOM   2503  O  O     . MET D  4 56  ? 1.885   -9.817  38.405 1.00 52.54  ? 56   MET D O     1 
ATOM   2504  C  CB    . MET D  4 56  ? 4.854   -8.442  38.797 1.00 52.87  ? 56   MET D CB    1 
ATOM   2505  C  CG    . MET D  4 56  ? 4.486   -8.226  37.341 1.00 53.66  ? 56   MET D CG    1 
ATOM   2506  S  SD    . MET D  4 56  ? 3.366   -6.826  37.225 1.00 62.58  ? 56   MET D SD    1 
ATOM   2507  C  CE    . MET D  4 56  ? 4.536   -5.440  37.161 1.00 59.80  ? 56   MET D CE    1 
ATOM   2508  N  N     . SER D  4 57  ? 3.368   -11.206 39.358 1.00 52.61  ? 57   SER D N     1 
ATOM   2509  C  CA    . SER D  4 57  ? 2.649   -12.417 38.945 1.00 52.85  ? 57   SER D CA    1 
ATOM   2510  C  C     . SER D  4 57  ? 1.188   -12.478 39.449 1.00 52.31  ? 57   SER D C     1 
ATOM   2511  O  O     . SER D  4 57  ? 0.255   -12.667 38.664 1.00 52.26  ? 57   SER D O     1 
ATOM   2512  C  CB    . SER D  4 57  ? 3.405   -13.626 39.426 1.00 52.54  ? 57   SER D CB    1 
ATOM   2513  O  OG    . SER D  4 57  ? 2.784   -14.741 38.858 1.00 57.35  ? 57   SER D OG    1 
ATOM   2514  N  N     . ILE D  4 58  ? 0.997   -12.295 40.756 1.00 51.36  ? 58   ILE D N     1 
ATOM   2515  C  CA    . ILE D  4 58  ? -0.334  -12.097 41.303 1.00 51.23  ? 58   ILE D CA    1 
ATOM   2516  C  C     . ILE D  4 58  ? -1.161  -11.006 40.586 1.00 52.11  ? 58   ILE D C     1 
ATOM   2517  O  O     . ILE D  4 58  ? -2.359  -11.204 40.301 1.00 52.46  ? 58   ILE D O     1 
ATOM   2518  C  CB    . ILE D  4 58  ? -0.255  -11.762 42.785 1.00 51.16  ? 58   ILE D CB    1 
ATOM   2519  C  CG1   . ILE D  4 58  ? 0.283   -12.971 43.548 1.00 49.68  ? 58   ILE D CG1   1 
ATOM   2520  C  CG2   . ILE D  4 58  ? -1.627  -11.291 43.306 1.00 49.75  ? 58   ILE D CG2   1 
ATOM   2521  C  CD1   . ILE D  4 58  ? 0.811   -12.651 44.889 1.00 46.29  ? 58   ILE D CD1   1 
ATOM   2522  N  N     . MET D  4 59  ? -0.534  -9.859  40.306 1.00 52.04  ? 59   MET D N     1 
ATOM   2523  C  CA    . MET D  4 59  ? -1.221  -8.769  39.599 1.00 51.93  ? 59   MET D CA    1 
ATOM   2524  C  C     . MET D  4 59  ? -1.649  -9.191  38.210 1.00 51.66  ? 59   MET D C     1 
ATOM   2525  O  O     . MET D  4 59  ? -2.731  -8.834  37.747 1.00 51.32  ? 59   MET D O     1 
ATOM   2526  C  CB    . MET D  4 59  ? -0.333  -7.517  39.481 1.00 52.25  ? 59   MET D CB    1 
ATOM   2527  C  CG    . MET D  4 59  ? -0.272  -6.650  40.718 1.00 50.74  ? 59   MET D CG    1 
ATOM   2528  S  SD    . MET D  4 59  ? -1.878  -6.264  41.410 1.00 55.81  ? 59   MET D SD    1 
ATOM   2529  C  CE    . MET D  4 59  ? -2.730  -5.430  40.059 1.00 49.22  ? 59   MET D CE    1 
ATOM   2530  N  N     . ASN D  4 60  ? -0.795  -9.955  37.547 1.00 52.01  ? 60   ASN D N     1 
ATOM   2531  C  CA    . ASN D  4 60  ? -1.133  -10.453 36.224 1.00 52.90  ? 60   ASN D CA    1 
ATOM   2532  C  C     . ASN D  4 60  ? -2.295  -11.445 36.267 1.00 52.55  ? 60   ASN D C     1 
ATOM   2533  O  O     . ASN D  4 60  ? -3.128  -11.484 35.349 1.00 52.17  ? 60   ASN D O     1 
ATOM   2534  C  CB    . ASN D  4 60  ? 0.075   -11.078 35.540 1.00 53.44  ? 60   ASN D CB    1 
ATOM   2535  C  CG    . ASN D  4 60  ? -0.214  -11.435 34.103 1.00 56.13  ? 60   ASN D CG    1 
ATOM   2536  O  OD1   . ASN D  4 60  ? -0.830  -10.663 33.375 1.00 57.88  ? 60   ASN D OD1   1 
ATOM   2537  N  ND2   . ASN D  4 60  ? 0.191   -12.634 33.694 1.00 60.53  ? 60   ASN D ND2   1 
ATOM   2538  N  N     . SER D  4 61  ? -2.361  -12.222 37.350 1.00 52.14  ? 61   SER D N     1 
ATOM   2539  C  CA    . SER D  4 61  ? -3.444  -13.156 37.537 1.00 51.73  ? 61   SER D CA    1 
ATOM   2540  C  C     . SER D  4 61  ? -4.734  -12.422 37.805 1.00 51.92  ? 61   SER D C     1 
ATOM   2541  O  O     . SER D  4 61  ? -5.754  -12.743 37.197 1.00 52.50  ? 61   SER D O     1 
ATOM   2542  C  CB    . SER D  4 61  ? -3.148  -14.090 38.687 1.00 51.75  ? 61   SER D CB    1 
ATOM   2543  O  OG    . SER D  4 61  ? -2.217  -15.063 38.288 1.00 54.04  ? 61   SER D OG    1 
ATOM   2544  N  N     . PHE D  4 62  ? -4.693  -11.436 38.705 1.00 51.39  ? 62   PHE D N     1 
ATOM   2545  C  CA    . PHE D  4 62  ? -5.858  -10.585 38.980 1.00 51.04  ? 62   PHE D CA    1 
ATOM   2546  C  C     . PHE D  4 62  ? -6.479  -9.998  37.705 1.00 51.32  ? 62   PHE D C     1 
ATOM   2547  O  O     . PHE D  4 62  ? -7.705  -10.047 37.515 1.00 51.23  ? 62   PHE D O     1 
ATOM   2548  C  CB    . PHE D  4 62  ? -5.477  -9.483  39.964 1.00 50.48  ? 62   PHE D CB    1 
ATOM   2549  C  CG    . PHE D  4 62  ? -6.517  -8.425  40.145 1.00 50.04  ? 62   PHE D CG    1 
ATOM   2550  C  CD1   . PHE D  4 62  ? -7.706  -8.695  40.796 1.00 50.30  ? 62   PHE D CD1   1 
ATOM   2551  C  CD2   . PHE D  4 62  ? -6.289  -7.122  39.696 1.00 50.87  ? 62   PHE D CD2   1 
ATOM   2552  C  CE1   . PHE D  4 62  ? -8.662  -7.683  40.994 1.00 49.91  ? 62   PHE D CE1   1 
ATOM   2553  C  CE2   . PHE D  4 62  ? -7.234  -6.124  39.885 1.00 48.61  ? 62   PHE D CE2   1 
ATOM   2554  C  CZ    . PHE D  4 62  ? -8.420  -6.406  40.531 1.00 48.39  ? 62   PHE D CZ    1 
ATOM   2555  N  N     . VAL D  4 63  ? -5.630  -9.474  36.821 1.00 51.36  ? 63   VAL D N     1 
ATOM   2556  C  CA    . VAL D  4 63  ? -6.119  -8.818  35.607 1.00 51.27  ? 63   VAL D CA    1 
ATOM   2557  C  C     . VAL D  4 63  ? -6.822  -9.806  34.711 1.00 50.85  ? 63   VAL D C     1 
ATOM   2558  O  O     . VAL D  4 63  ? -7.911  -9.526  34.234 1.00 51.12  ? 63   VAL D O     1 
ATOM   2559  C  CB    . VAL D  4 63  ? -5.000  -8.039  34.818 1.00 51.70  ? 63   VAL D CB    1 
ATOM   2560  C  CG1   . VAL D  4 63  ? -5.604  -7.295  33.636 1.00 50.77  ? 63   VAL D CG1   1 
ATOM   2561  C  CG2   . VAL D  4 63  ? -4.264  -7.049  35.726 1.00 50.97  ? 63   VAL D CG2   1 
ATOM   2562  N  N     . ASN D  4 64  ? -6.196  -10.963 34.497 1.00 50.86  ? 64   ASN D N     1 
ATOM   2563  C  CA    . ASN D  4 64  ? -6.788  -12.047 33.697 1.00 50.44  ? 64   ASN D CA    1 
ATOM   2564  C  C     . ASN D  4 64  ? -8.104  -12.525 34.280 1.00 49.82  ? 64   ASN D C     1 
ATOM   2565  O  O     . ASN D  4 64  ? -9.083  -12.714 33.571 1.00 50.23  ? 64   ASN D O     1 
ATOM   2566  C  CB    . ASN D  4 64  ? -5.814  -13.211 33.595 1.00 50.11  ? 64   ASN D CB    1 
ATOM   2567  C  CG    . ASN D  4 64  ? -4.641  -12.893 32.697 1.00 52.52  ? 64   ASN D CG    1 
ATOM   2568  O  OD1   . ASN D  4 64  ? -4.831  -12.394 31.581 1.00 55.70  ? 64   ASN D OD1   1 
ATOM   2569  N  ND2   . ASN D  4 64  ? -3.417  -13.145 33.174 1.00 53.08  ? 64   ASN D ND2   1 
ATOM   2570  N  N     . ASP D  4 65  ? -8.114  -12.705 35.587 1.00 49.41  ? 65   ASP D N     1 
ATOM   2571  C  CA    . ASP D  4 65  ? -9.260  -13.233 36.277 1.00 49.00  ? 65   ASP D CA    1 
ATOM   2572  C  C     . ASP D  4 65  ? -10.442 -12.284 36.048 1.00 49.11  ? 65   ASP D C     1 
ATOM   2573  O  O     . ASP D  4 65  ? -11.477 -12.670 35.520 1.00 49.10  ? 65   ASP D O     1 
ATOM   2574  C  CB    . ASP D  4 65  ? -8.895  -13.440 37.752 1.00 48.68  ? 65   ASP D CB    1 
ATOM   2575  C  CG    . ASP D  4 65  ? -10.071 -13.866 38.597 1.00 50.70  ? 65   ASP D CG    1 
ATOM   2576  O  OD1   . ASP D  4 65  ? -11.091 -14.346 38.023 1.00 53.66  ? 65   ASP D OD1   1 
ATOM   2577  O  OD2   . ASP D  4 65  ? -9.980  -13.721 39.846 1.00 48.65  ? 65   ASP D OD2   1 
ATOM   2578  N  N     . VAL D  4 66  ? -10.261 -11.020 36.382 1.00 49.85  ? 66   VAL D N     1 
ATOM   2579  C  CA    . VAL D  4 66  ? -11.321 -10.021 36.199 1.00 49.84  ? 66   VAL D CA    1 
ATOM   2580  C  C     . VAL D  4 66  ? -11.752 -9.928  34.734 1.00 49.78  ? 66   VAL D C     1 
ATOM   2581  O  O     . VAL D  4 66  ? -12.943 -9.866  34.448 1.00 48.90  ? 66   VAL D O     1 
ATOM   2582  C  CB    . VAL D  4 66  ? -10.909 -8.629  36.785 1.00 49.72  ? 66   VAL D CB    1 
ATOM   2583  C  CG1   . VAL D  4 66  ? -12.005 -7.644  36.590 1.00 50.44  ? 66   VAL D CG1   1 
ATOM   2584  C  CG2   . VAL D  4 66  ? -10.657 -8.747  38.283 1.00 49.92  ? 66   VAL D CG2   1 
ATOM   2585  N  N     . PHE D  4 67  ? -10.784 -9.925  33.817 1.00 50.33  ? 67   PHE D N     1 
ATOM   2586  C  CA    . PHE D  4 67  ? -11.100 -9.979  32.409 1.00 51.50  ? 67   PHE D CA    1 
ATOM   2587  C  C     . PHE D  4 67  ? -12.040 -11.150 32.122 1.00 52.35  ? 67   PHE D C     1 
ATOM   2588  O  O     . PHE D  4 67  ? -13.080 -10.945 31.501 1.00 52.90  ? 67   PHE D O     1 
ATOM   2589  C  CB    . PHE D  4 67  ? -9.840  -10.075 31.556 1.00 52.26  ? 67   PHE D CB    1 
ATOM   2590  C  CG    . PHE D  4 67  ? -10.116 -10.261 30.073 1.00 54.22  ? 67   PHE D CG    1 
ATOM   2591  C  CD1   . PHE D  4 67  ? -10.090 -9.171  29.199 1.00 57.07  ? 67   PHE D CD1   1 
ATOM   2592  C  CD2   . PHE D  4 67  ? -10.390 -11.522 29.550 1.00 56.16  ? 67   PHE D CD2   1 
ATOM   2593  C  CE1   . PHE D  4 67  ? -10.344 -9.325  27.827 1.00 56.32  ? 67   PHE D CE1   1 
ATOM   2594  C  CE2   . PHE D  4 67  ? -10.652 -11.696 28.189 1.00 57.88  ? 67   PHE D CE2   1 
ATOM   2595  C  CZ    . PHE D  4 67  ? -10.631 -10.584 27.324 1.00 57.29  ? 67   PHE D CZ    1 
ATOM   2596  N  N     . GLU D  4 68  ? -11.693 -12.363 32.575 1.00 52.90  ? 68   GLU D N     1 
ATOM   2597  C  CA    . GLU D  4 68  ? -12.531 -13.546 32.337 1.00 53.98  ? 68   GLU D CA    1 
ATOM   2598  C  C     . GLU D  4 68  ? -13.915 -13.430 32.953 1.00 53.09  ? 68   GLU D C     1 
ATOM   2599  O  O     . GLU D  4 68  ? -14.908 -13.779 32.323 1.00 52.96  ? 68   GLU D O     1 
ATOM   2600  C  CB    . GLU D  4 68  ? -11.875 -14.787 32.890 1.00 54.81  ? 68   GLU D CB    1 
ATOM   2601  C  CG    . GLU D  4 68  ? -10.835 -15.426 31.989 1.00 61.36  ? 68   GLU D CG    1 
ATOM   2602  C  CD    . GLU D  4 68  ? -9.789  -16.226 32.809 1.00 68.01  ? 68   GLU D CD    1 
ATOM   2603  O  OE1   . GLU D  4 68  ? -10.166 -16.869 33.832 1.00 69.28  ? 68   GLU D OE1   1 
ATOM   2604  O  OE2   . GLU D  4 68  ? -8.587  -16.178 32.435 1.00 71.13  ? 68   GLU D OE2   1 
ATOM   2605  N  N     . ARG D  4 69  ? -13.991 -12.940 34.183 1.00 52.05  ? 69   ARG D N     1 
ATOM   2606  C  CA    . ARG D  4 69  ? -15.289 -12.763 34.797 1.00 51.57  ? 69   ARG D CA    1 
ATOM   2607  C  C     . ARG D  4 69  ? -16.184 -11.724 34.098 1.00 51.82  ? 69   ARG D C     1 
ATOM   2608  O  O     . ARG D  4 69  ? -17.400 -11.921 34.015 1.00 52.88  ? 69   ARG D O     1 
ATOM   2609  C  CB    . ARG D  4 69  ? -15.163 -12.425 36.269 1.00 51.27  ? 69   ARG D CB    1 
ATOM   2610  C  CG    . ARG D  4 69  ? -14.279 -13.328 37.074 1.00 51.03  ? 69   ARG D CG    1 
ATOM   2611  C  CD    . ARG D  4 69  ? -14.602 -13.055 38.526 1.00 51.51  ? 69   ARG D CD    1 
ATOM   2612  N  NE    . ARG D  4 69  ? -13.418 -13.037 39.363 1.00 49.07  ? 69   ARG D NE    1 
ATOM   2613  C  CZ    . ARG D  4 69  ? -13.414 -12.630 40.625 1.00 49.57  ? 69   ARG D CZ    1 
ATOM   2614  N  NH1   . ARG D  4 69  ? -14.527 -12.191 41.207 1.00 45.28  ? 69   ARG D NH1   1 
ATOM   2615  N  NH2   . ARG D  4 69  ? -12.278 -12.659 41.303 1.00 51.07  ? 69   ARG D NH2   1 
ATOM   2616  N  N     . ILE D  4 70  ? -15.616 -10.624 33.599 1.00 51.64  ? 70   ILE D N     1 
ATOM   2617  C  CA    . ILE D  4 70  ? -16.443 -9.605  32.915 1.00 51.21  ? 70   ILE D CA    1 
ATOM   2618  C  C     . ILE D  4 70  ? -16.870 -10.066 31.525 1.00 51.78  ? 70   ILE D C     1 
ATOM   2619  O  O     . ILE D  4 70  ? -18.064 -10.019 31.186 1.00 51.85  ? 70   ILE D O     1 
ATOM   2620  C  CB    . ILE D  4 70  ? -15.781 -8.195  32.884 1.00 51.20  ? 70   ILE D CB    1 
ATOM   2621  C  CG1   . ILE D  4 70  ? -15.815 -7.567  34.277 1.00 48.97  ? 70   ILE D CG1   1 
ATOM   2622  C  CG2   . ILE D  4 70  ? -16.471 -7.255  31.869 1.00 50.04  ? 70   ILE D CG2   1 
ATOM   2623  C  CD1   . ILE D  4 70  ? -14.726 -6.581  34.479 1.00 49.30  ? 70   ILE D CD1   1 
ATOM   2624  N  N     . ALA D  4 71  ? -15.908 -10.523 30.730 1.00 52.04  ? 71   ALA D N     1 
ATOM   2625  C  CA    . ALA D  4 71  ? -16.220 -11.066 29.411 1.00 53.12  ? 71   ALA D CA    1 
ATOM   2626  C  C     . ALA D  4 71  ? -17.263 -12.177 29.494 1.00 53.76  ? 71   ALA D C     1 
ATOM   2627  O  O     . ALA D  4 71  ? -18.191 -12.202 28.688 1.00 54.65  ? 71   ALA D O     1 
ATOM   2628  C  CB    . ALA D  4 71  ? -14.971 -11.571 28.746 1.00 53.35  ? 71   ALA D CB    1 
ATOM   2629  N  N     . GLY D  4 72  ? -17.111 -13.077 30.472 1.00 53.59  ? 72   GLY D N     1 
ATOM   2630  C  CA    . GLY D  4 72  ? -18.059 -14.148 30.704 1.00 53.68  ? 72   GLY D CA    1 
ATOM   2631  C  C     . GLY D  4 72  ? -19.460 -13.651 30.974 1.00 54.38  ? 72   GLY D C     1 
ATOM   2632  O  O     . GLY D  4 72  ? -20.370 -14.040 30.285 1.00 53.63  ? 72   GLY D O     1 
ATOM   2633  N  N     . GLU D  4 73  ? -19.640 -12.778 31.971 1.00 55.98  ? 73   GLU D N     1 
ATOM   2634  C  CA    . GLU D  4 73  ? -20.950 -12.152 32.190 1.00 57.78  ? 73   GLU D CA    1 
ATOM   2635  C  C     . GLU D  4 73  ? -21.436 -11.524 30.907 1.00 58.05  ? 73   GLU D C     1 
ATOM   2636  O  O     . GLU D  4 73  ? -22.594 -11.672 30.573 1.00 58.59  ? 73   GLU D O     1 
ATOM   2637  C  CB    . GLU D  4 73  ? -20.931 -11.052 33.251 1.00 58.22  ? 73   GLU D CB    1 
ATOM   2638  C  CG    . GLU D  4 73  ? -20.893 -11.478 34.680 1.00 62.86  ? 73   GLU D CG    1 
ATOM   2639  C  CD    . GLU D  4 73  ? -22.112 -12.299 35.113 1.00 69.25  ? 73   GLU D CD    1 
ATOM   2640  O  OE1   . GLU D  4 73  ? -23.057 -12.485 34.280 1.00 69.89  ? 73   GLU D OE1   1 
ATOM   2641  O  OE2   . GLU D  4 73  ? -22.102 -12.759 36.297 1.00 69.56  ? 73   GLU D OE2   1 
ATOM   2642  N  N     . ALA D  4 74  ? -20.553 -10.816 30.201 1.00 58.68  ? 74   ALA D N     1 
ATOM   2643  C  CA    . ALA D  4 74  ? -20.923 -10.150 28.957 1.00 59.76  ? 74   ALA D CA    1 
ATOM   2644  C  C     . ALA D  4 74  ? -21.458 -11.164 27.981 1.00 60.28  ? 74   ALA D C     1 
ATOM   2645  O  O     . ALA D  4 74  ? -22.506 -10.951 27.394 1.00 60.99  ? 74   ALA D O     1 
ATOM   2646  C  CB    . ALA D  4 74  ? -19.740 -9.408  28.346 1.00 59.49  ? 74   ALA D CB    1 
ATOM   2647  N  N     . SER D  4 75  ? -20.738 -12.269 27.829 1.00 60.77  ? 75   SER D N     1 
ATOM   2648  C  CA    . SER D  4 75  ? -21.121 -13.336 26.925 1.00 61.31  ? 75   SER D CA    1 
ATOM   2649  C  C     . SER D  4 75  ? -22.553 -13.809 27.217 1.00 61.89  ? 75   SER D C     1 
ATOM   2650  O  O     . SER D  4 75  ? -23.424 -13.834 26.336 1.00 61.81  ? 75   SER D O     1 
ATOM   2651  C  CB    . SER D  4 75  ? -20.136 -14.484 27.082 1.00 61.07  ? 75   SER D CB    1 
ATOM   2652  O  OG    . SER D  4 75  ? -20.433 -15.501 26.160 1.00 61.09  ? 75   SER D OG    1 
ATOM   2653  N  N     . ARG D  4 76  ? -22.787 -14.150 28.475 1.00 62.75  ? 76   ARG D N     1 
ATOM   2654  C  CA    . ARG D  4 76  ? -24.063 -14.650 28.923 1.00 63.81  ? 76   ARG D CA    1 
ATOM   2655  C  C     . ARG D  4 76  ? -25.152 -13.652 28.637 1.00 64.52  ? 76   ARG D C     1 
ATOM   2656  O  O     . ARG D  4 76  ? -26.192 -13.976 28.062 1.00 64.88  ? 76   ARG D O     1 
ATOM   2657  C  CB    . ARG D  4 76  ? -24.016 -14.901 30.425 1.00 64.07  ? 76   ARG D CB    1 
ATOM   2658  C  CG    . ARG D  4 76  ? -24.033 -16.348 30.814 1.00 63.52  ? 76   ARG D CG    1 
ATOM   2659  C  CD    . ARG D  4 76  ? -23.621 -16.495 32.254 1.00 63.12  ? 76   ARG D CD    1 
ATOM   2660  N  NE    . ARG D  4 76  ? -22.189 -16.768 32.340 1.00 62.95  ? 76   ARG D NE    1 
ATOM   2661  C  CZ    . ARG D  4 76  ? -21.350 -16.170 33.174 1.00 62.83  ? 76   ARG D CZ    1 
ATOM   2662  N  NH1   . ARG D  4 76  ? -21.785 -15.253 34.038 1.00 63.57  ? 76   ARG D NH1   1 
ATOM   2663  N  NH2   . ARG D  4 76  ? -20.073 -16.501 33.144 1.00 62.89  ? 76   ARG D NH2   1 
ATOM   2664  N  N     . LEU D  4 77  ? -24.908 -12.429 29.062 1.00 65.33  ? 77   LEU D N     1 
ATOM   2665  C  CA    . LEU D  4 77  ? -25.876 -11.363 28.916 1.00 66.32  ? 77   LEU D CA    1 
ATOM   2666  C  C     . LEU D  4 77  ? -26.360 -11.204 27.473 1.00 66.94  ? 77   LEU D C     1 
ATOM   2667  O  O     . LEU D  4 77  ? -27.569 -11.104 27.234 1.00 66.69  ? 77   LEU D O     1 
ATOM   2668  C  CB    . LEU D  4 77  ? -25.266 -10.072 29.445 1.00 66.25  ? 77   LEU D CB    1 
ATOM   2669  C  CG    . LEU D  4 77  ? -26.146 -8.861  29.703 1.00 66.74  ? 77   LEU D CG    1 
ATOM   2670  C  CD1   . LEU D  4 77  ? -27.181 -9.151  30.741 1.00 67.79  ? 77   LEU D CD1   1 
ATOM   2671  C  CD2   . LEU D  4 77  ? -25.227 -7.815  30.202 1.00 68.83  ? 77   LEU D CD2   1 
ATOM   2672  N  N     . ALA D  4 78  ? -25.426 -11.204 26.522 1.00 68.02  ? 78   ALA D N     1 
ATOM   2673  C  CA    . ALA D  4 78  ? -25.774 -11.134 25.102 1.00 69.70  ? 78   ALA D CA    1 
ATOM   2674  C  C     . ALA D  4 78  ? -26.683 -12.291 24.699 1.00 71.18  ? 78   ALA D C     1 
ATOM   2675  O  O     . ALA D  4 78  ? -27.769 -12.061 24.154 1.00 71.62  ? 78   ALA D O     1 
ATOM   2676  C  CB    . ALA D  4 78  ? -24.530 -11.099 24.237 1.00 69.44  ? 78   ALA D CB    1 
ATOM   2677  N  N     . HIS D  4 79  ? -26.249 -13.527 24.988 1.00 72.66  ? 79   HIS D N     1 
ATOM   2678  C  CA    . HIS D  4 79  ? -27.061 -14.715 24.721 1.00 73.65  ? 79   HIS D CA    1 
ATOM   2679  C  C     . HIS D  4 79  ? -28.473 -14.492 25.249 1.00 73.73  ? 79   HIS D C     1 
ATOM   2680  O  O     . HIS D  4 79  ? -29.426 -14.551 24.488 1.00 73.59  ? 79   HIS D O     1 
ATOM   2681  C  CB    . HIS D  4 79  ? -26.438 -15.989 25.320 1.00 74.11  ? 79   HIS D CB    1 
ATOM   2682  C  CG    . HIS D  4 79  ? -25.233 -16.497 24.573 1.00 77.46  ? 79   HIS D CG    1 
ATOM   2683  N  ND1   . HIS D  4 79  ? -25.300 -16.964 23.270 1.00 80.44  ? 79   HIS D ND1   1 
ATOM   2684  C  CD2   . HIS D  4 79  ? -23.935 -16.640 24.957 1.00 79.09  ? 79   HIS D CD2   1 
ATOM   2685  C  CE1   . HIS D  4 79  ? -24.094 -17.350 22.880 1.00 80.44  ? 79   HIS D CE1   1 
ATOM   2686  N  NE2   . HIS D  4 79  ? -23.247 -17.162 23.883 1.00 79.22  ? 79   HIS D NE2   1 
ATOM   2687  N  N     . TYR D  4 80  ? -28.603 -14.189 26.538 1.00 74.37  ? 80   TYR D N     1 
ATOM   2688  C  CA    . TYR D  4 80  ? -29.918 -13.982 27.147 1.00 75.29  ? 80   TYR D CA    1 
ATOM   2689  C  C     . TYR D  4 80  ? -30.812 -13.035 26.353 1.00 75.69  ? 80   TYR D C     1 
ATOM   2690  O  O     . TYR D  4 80  ? -32.037 -13.120 26.438 1.00 75.84  ? 80   TYR D O     1 
ATOM   2691  C  CB    . TYR D  4 80  ? -29.805 -13.447 28.573 1.00 75.36  ? 80   TYR D CB    1 
ATOM   2692  C  CG    . TYR D  4 80  ? -29.032 -14.310 29.538 1.00 76.67  ? 80   TYR D CG    1 
ATOM   2693  C  CD1   . TYR D  4 80  ? -28.518 -13.759 30.716 1.00 77.19  ? 80   TYR D CD1   1 
ATOM   2694  C  CD2   . TYR D  4 80  ? -28.812 -15.679 29.293 1.00 76.79  ? 80   TYR D CD2   1 
ATOM   2695  C  CE1   . TYR D  4 80  ? -27.806 -14.541 31.634 1.00 77.08  ? 80   TYR D CE1   1 
ATOM   2696  C  CE2   . TYR D  4 80  ? -28.092 -16.470 30.207 1.00 76.64  ? 80   TYR D CE2   1 
ATOM   2697  C  CZ    . TYR D  4 80  ? -27.593 -15.890 31.376 1.00 76.36  ? 80   TYR D CZ    1 
ATOM   2698  O  OH    . TYR D  4 80  ? -26.890 -16.643 32.298 1.00 75.95  ? 80   TYR D OH    1 
ATOM   2699  N  N     . ASN D  4 81  ? -30.199 -12.127 25.594 1.00 76.26  ? 81   ASN D N     1 
ATOM   2700  C  CA    . ASN D  4 81  ? -30.945 -11.109 24.849 1.00 76.40  ? 81   ASN D CA    1 
ATOM   2701  C  C     . ASN D  4 81  ? -30.906 -11.344 23.346 1.00 76.83  ? 81   ASN D C     1 
ATOM   2702  O  O     . ASN D  4 81  ? -31.287 -10.475 22.570 1.00 77.35  ? 81   ASN D O     1 
ATOM   2703  C  CB    . ASN D  4 81  ? -30.410 -9.718  25.176 1.00 75.99  ? 81   ASN D CB    1 
ATOM   2704  C  CG    . ASN D  4 81  ? -30.642 -9.335  26.618 1.00 75.76  ? 81   ASN D CG    1 
ATOM   2705  O  OD1   . ASN D  4 81  ? -31.672 -8.753  26.951 1.00 77.10  ? 81   ASN D OD1   1 
ATOM   2706  N  ND2   . ASN D  4 81  ? -29.693 -9.672  27.489 1.00 74.33  ? 81   ASN D ND2   1 
ATOM   2707  N  N     . LYS D  4 82  ? -30.437 -12.524 22.951 1.00 77.27  ? 82   LYS D N     1 
ATOM   2708  C  CA    . LYS D  4 82  ? -30.342 -12.935 21.548 1.00 77.62  ? 82   LYS D CA    1 
ATOM   2709  C  C     . LYS D  4 82  ? -29.525 -11.959 20.713 1.00 77.49  ? 82   LYS D C     1 
ATOM   2710  O  O     . LYS D  4 82  ? -29.945 -11.541 19.639 1.00 78.01  ? 82   LYS D O     1 
ATOM   2711  C  CB    . LYS D  4 82  ? -31.734 -13.148 20.958 1.00 77.84  ? 82   LYS D CB    1 
ATOM   2712  C  CG    . LYS D  4 82  ? -32.531 -14.199 21.697 1.00 79.31  ? 82   LYS D CG    1 
ATOM   2713  C  CD    . LYS D  4 82  ? -33.946 -13.727 21.963 1.00 81.90  ? 82   LYS D CD    1 
ATOM   2714  C  CE    . LYS D  4 82  ? -34.698 -14.735 22.849 1.00 84.18  ? 82   LYS D CE    1 
ATOM   2715  N  NZ    . LYS D  4 82  ? -35.166 -15.939 22.054 1.00 86.56  ? 82   LYS D NZ    1 
ATOM   2716  N  N     . ARG D  4 83  ? -28.355 -11.603 21.221 1.00 77.11  ? 83   ARG D N     1 
ATOM   2717  C  CA    . ARG D  4 83  ? -27.450 -10.696 20.535 1.00 76.91  ? 83   ARG D CA    1 
ATOM   2718  C  C     . ARG D  4 83  ? -26.150 -11.415 20.252 1.00 76.09  ? 83   ARG D C     1 
ATOM   2719  O  O     . ARG D  4 83  ? -25.681 -12.199 21.073 1.00 76.44  ? 83   ARG D O     1 
ATOM   2720  C  CB    . ARG D  4 83  ? -27.159 -9.480  21.412 1.00 77.46  ? 83   ARG D CB    1 
ATOM   2721  C  CG    . ARG D  4 83  ? -28.384 -8.680  21.794 1.00 79.68  ? 83   ARG D CG    1 
ATOM   2722  C  CD    . ARG D  4 83  ? -28.720 -7.659  20.734 1.00 83.25  ? 83   ARG D CD    1 
ATOM   2723  N  NE    . ARG D  4 83  ? -29.916 -6.912  21.100 1.00 86.92  ? 83   ARG D NE    1 
ATOM   2724  C  CZ    . ARG D  4 83  ? -31.149 -7.251  20.715 1.00 89.04  ? 83   ARG D CZ    1 
ATOM   2725  N  NH1   . ARG D  4 83  ? -31.348 -8.322  19.932 1.00 90.01  ? 83   ARG D NH1   1 
ATOM   2726  N  NH2   . ARG D  4 83  ? -32.187 -6.517  21.105 1.00 90.28  ? 83   ARG D NH2   1 
ATOM   2727  N  N     . SER D  4 84  ? -25.561 -11.134 19.099 1.00 74.75  ? 84   SER D N     1 
ATOM   2728  C  CA    . SER D  4 84  ? -24.372 -11.832 18.652 1.00 73.68  ? 84   SER D CA    1 
ATOM   2729  C  C     . SER D  4 84  ? -23.156 -10.915 18.756 1.00 72.95  ? 84   SER D C     1 
ATOM   2730  O  O     . SER D  4 84  ? -22.050 -11.241 18.293 1.00 72.49  ? 84   SER D O     1 
ATOM   2731  C  CB    . SER D  4 84  ? -24.587 -12.292 17.217 1.00 73.62  ? 84   SER D CB    1 
ATOM   2732  O  OG    . SER D  4 84  ? -25.180 -11.244 16.467 1.00 74.89  ? 84   SER D OG    1 
ATOM   2733  N  N     . THR D  4 85  ? -23.375 -9.764  19.384 1.00 71.95  ? 85   THR D N     1 
ATOM   2734  C  CA    . THR D  4 85  ? -22.341 -8.743  19.526 1.00 70.86  ? 85   THR D CA    1 
ATOM   2735  C  C     . THR D  4 85  ? -22.133 -8.395  20.998 1.00 69.24  ? 85   THR D C     1 
ATOM   2736  O  O     . THR D  4 85  ? -23.081 -8.020  21.696 1.00 69.03  ? 85   THR D O     1 
ATOM   2737  C  CB    . THR D  4 85  ? -22.725 -7.428  18.765 1.00 71.20  ? 85   THR D CB    1 
ATOM   2738  O  OG1   . THR D  4 85  ? -23.561 -7.735  17.644 1.00 72.96  ? 85   THR D OG1   1 
ATOM   2739  C  CG2   . THR D  4 85  ? -21.488 -6.671  18.281 1.00 71.00  ? 85   THR D CG2   1 
ATOM   2740  N  N     . ILE D  4 86  ? -20.898 -8.504  21.470 1.00 67.47  ? 86   ILE D N     1 
ATOM   2741  C  CA    . ILE D  4 86  ? -20.564 -7.880  22.748 1.00 66.47  ? 86   ILE D CA    1 
ATOM   2742  C  C     . ILE D  4 86  ? -20.186 -6.400  22.530 1.00 65.78  ? 86   ILE D C     1 
ATOM   2743  O  O     . ILE D  4 86  ? -19.201 -6.081  21.852 1.00 65.13  ? 86   ILE D O     1 
ATOM   2744  C  CB    . ILE D  4 86  ? -19.457 -8.635  23.505 1.00 66.15  ? 86   ILE D CB    1 
ATOM   2745  C  CG1   . ILE D  4 86  ? -19.998 -9.966  24.022 1.00 66.04  ? 86   ILE D CG1   1 
ATOM   2746  C  CG2   . ILE D  4 86  ? -18.929 -7.796  24.677 1.00 65.84  ? 86   ILE D CG2   1 
ATOM   2747  C  CD1   . ILE D  4 86  ? -18.904 -10.958 24.385 1.00 64.86  ? 86   ILE D CD1   1 
ATOM   2748  N  N     . THR D  4 87  ? -20.989 -5.512  23.104 1.00 64.98  ? 87   THR D N     1 
ATOM   2749  C  CA    . THR D  4 87  ? -20.713 -4.091  23.048 1.00 64.80  ? 87   THR D CA    1 
ATOM   2750  C  C     . THR D  4 87  ? -20.351 -3.517  24.421 1.00 64.66  ? 87   THR D C     1 
ATOM   2751  O  O     . THR D  4 87  ? -20.575 -4.152  25.456 1.00 65.02  ? 87   THR D O     1 
ATOM   2752  C  CB    . THR D  4 87  ? -21.924 -3.324  22.511 1.00 64.86  ? 87   THR D CB    1 
ATOM   2753  O  OG1   . THR D  4 87  ? -22.980 -3.323  23.496 1.00 64.78  ? 87   THR D OG1   1 
ATOM   2754  C  CG2   . THR D  4 87  ? -22.409 -3.943  21.203 1.00 64.84  ? 87   THR D CG2   1 
ATOM   2755  N  N     . SER D  4 88  ? -19.827 -2.295  24.420 1.00 64.50  ? 88   SER D N     1 
ATOM   2756  C  CA    . SER D  4 88  ? -19.525 -1.556  25.653 1.00 64.23  ? 88   SER D CA    1 
ATOM   2757  C  C     . SER D  4 88  ? -20.709 -1.519  26.612 1.00 63.36  ? 88   SER D C     1 
ATOM   2758  O  O     . SER D  4 88  ? -20.536 -1.410  27.816 1.00 63.32  ? 88   SER D O     1 
ATOM   2759  C  CB    . SER D  4 88  ? -19.035 -0.133  25.338 1.00 64.31  ? 88   SER D CB    1 
ATOM   2760  O  OG    . SER D  4 88  ? -20.125 0.779   25.351 1.00 65.41  ? 88   SER D OG    1 
ATOM   2761  N  N     . ARG D  4 89  ? -21.908 -1.645  26.075 1.00 63.11  ? 89   ARG D N     1 
ATOM   2762  C  CA    . ARG D  4 89  ? -23.112 -1.697  26.906 1.00 63.38  ? 89   ARG D CA    1 
ATOM   2763  C  C     . ARG D  4 89  ? -23.282 -3.039  27.666 1.00 62.87  ? 89   ARG D C     1 
ATOM   2764  O  O     . ARG D  4 89  ? -23.733 -3.055  28.822 1.00 62.61  ? 89   ARG D O     1 
ATOM   2765  C  CB    . ARG D  4 89  ? -24.343 -1.386  26.051 1.00 63.80  ? 89   ARG D CB    1 
ATOM   2766  C  CG    . ARG D  4 89  ? -25.595 -1.235  26.855 1.00 66.02  ? 89   ARG D CG    1 
ATOM   2767  C  CD    . ARG D  4 89  ? -26.779 -0.745  26.044 1.00 70.39  ? 89   ARG D CD    1 
ATOM   2768  N  NE    . ARG D  4 89  ? -27.891 -0.510  26.965 1.00 72.77  ? 89   ARG D NE    1 
ATOM   2769  C  CZ    . ARG D  4 89  ? -28.835 -1.400  27.245 1.00 73.88  ? 89   ARG D CZ    1 
ATOM   2770  N  NH1   . ARG D  4 89  ? -28.834 -2.595  26.642 1.00 74.25  ? 89   ARG D NH1   1 
ATOM   2771  N  NH2   . ARG D  4 89  ? -29.787 -1.088  28.120 1.00 74.53  ? 89   ARG D NH2   1 
ATOM   2772  N  N     . GLU D  4 90  ? -22.943 -4.157  27.014 1.00 62.02  ? 90   GLU D N     1 
ATOM   2773  C  CA    . GLU D  4 90  ? -22.843 -5.446  27.704 1.00 61.34  ? 90   GLU D CA    1 
ATOM   2774  C  C     . GLU D  4 90  ? -21.763 -5.402  28.783 1.00 60.10  ? 90   GLU D C     1 
ATOM   2775  O  O     . GLU D  4 90  ? -22.000 -5.842  29.915 1.00 59.48  ? 90   GLU D O     1 
ATOM   2776  C  CB    . GLU D  4 90  ? -22.539 -6.578  26.725 1.00 61.69  ? 90   GLU D CB    1 
ATOM   2777  C  CG    . GLU D  4 90  ? -23.761 -7.170  26.071 1.00 64.86  ? 90   GLU D CG    1 
ATOM   2778  C  CD    . GLU D  4 90  ? -24.481 -6.171  25.171 1.00 69.65  ? 90   GLU D CD    1 
ATOM   2779  O  OE1   . GLU D  4 90  ? -25.714 -6.014  25.324 1.00 70.76  ? 90   GLU D OE1   1 
ATOM   2780  O  OE2   . GLU D  4 90  ? -23.806 -5.533  24.322 1.00 71.84  ? 90   GLU D OE2   1 
ATOM   2781  N  N     . ILE D  4 91  ? -20.590 -4.873  28.435 1.00 58.53  ? 91   ILE D N     1 
ATOM   2782  C  CA    . ILE D  4 91  ? -19.511 -4.741  29.405 1.00 57.95  ? 91   ILE D CA    1 
ATOM   2783  C  C     . ILE D  4 91  ? -19.965 -3.957  30.636 1.00 58.22  ? 91   ILE D C     1 
ATOM   2784  O  O     . ILE D  4 91  ? -19.625 -4.303  31.762 1.00 58.47  ? 91   ILE D O     1 
ATOM   2785  C  CB    . ILE D  4 91  ? -18.290 -4.004  28.829 1.00 57.62  ? 91   ILE D CB    1 
ATOM   2786  C  CG1   . ILE D  4 91  ? -17.782 -4.644  27.516 1.00 57.57  ? 91   ILE D CG1   1 
ATOM   2787  C  CG2   . ILE D  4 91  ? -17.211 -3.839  29.901 1.00 56.72  ? 91   ILE D CG2   1 
ATOM   2788  C  CD1   . ILE D  4 91  ? -17.215 -6.073  27.585 1.00 55.69  ? 91   ILE D CD1   1 
ATOM   2789  N  N     . GLN D  4 92  ? -20.729 -2.896  30.412 1.00 58.24  ? 92   GLN D N     1 
ATOM   2790  C  CA    . GLN D  4 92  ? -21.177 -2.034  31.494 1.00 58.11  ? 92   GLN D CA    1 
ATOM   2791  C  C     . GLN D  4 92  ? -22.102 -2.761  32.472 1.00 57.50  ? 92   GLN D C     1 
ATOM   2792  O  O     . GLN D  4 92  ? -21.980 -2.600  33.680 1.00 57.89  ? 92   GLN D O     1 
ATOM   2793  C  CB    . GLN D  4 92  ? -21.852 -0.777  30.932 1.00 58.15  ? 92   GLN D CB    1 
ATOM   2794  C  CG    . GLN D  4 92  ? -22.315 0.184   32.012 1.00 60.25  ? 92   GLN D CG    1 
ATOM   2795  C  CD    . GLN D  4 92  ? -22.535 1.592   31.506 1.00 63.14  ? 92   GLN D CD    1 
ATOM   2796  O  OE1   . GLN D  4 92  ? -23.666 2.075   31.464 1.00 65.83  ? 92   GLN D OE1   1 
ATOM   2797  N  NE2   . GLN D  4 92  ? -21.459 2.262   31.126 1.00 62.38  ? 92   GLN D NE2   1 
ATOM   2798  N  N     . THR D  4 93  ? -23.025 -3.556  31.949 1.00 56.59  ? 93   THR D N     1 
ATOM   2799  C  CA    . THR D  4 93  ? -23.897 -4.349  32.797 1.00 55.82  ? 93   THR D CA    1 
ATOM   2800  C  C     . THR D  4 93  ? -23.112 -5.438  33.533 1.00 54.96  ? 93   THR D C     1 
ATOM   2801  O  O     . THR D  4 93  ? -23.344 -5.671  34.715 1.00 54.77  ? 93   THR D O     1 
ATOM   2802  C  CB    . THR D  4 93  ? -25.018 -4.975  31.980 1.00 55.85  ? 93   THR D CB    1 
ATOM   2803  O  OG1   . THR D  4 93  ? -25.702 -3.945  31.252 1.00 58.00  ? 93   THR D OG1   1 
ATOM   2804  C  CG2   . THR D  4 93  ? -25.998 -5.681  32.872 1.00 55.04  ? 93   THR D CG2   1 
ATOM   2805  N  N     . ALA D  4 94  ? -22.171 -6.079  32.847 1.00 53.97  ? 94   ALA D N     1 
ATOM   2806  C  CA    . ALA D  4 94  ? -21.319 -7.072  33.487 1.00 53.36  ? 94   ALA D CA    1 
ATOM   2807  C  C     . ALA D  4 94  ? -20.618 -6.443  34.657 1.00 53.74  ? 94   ALA D C     1 
ATOM   2808  O  O     . ALA D  4 94  ? -20.584 -7.025  35.726 1.00 54.36  ? 94   ALA D O     1 
ATOM   2809  C  CB    . ALA D  4 94  ? -20.315 -7.639  32.522 1.00 53.01  ? 94   ALA D CB    1 
ATOM   2810  N  N     . VAL D  4 95  ? -20.096 -5.233  34.463 1.00 53.95  ? 95   VAL D N     1 
ATOM   2811  C  CA    . VAL D  4 95  ? -19.371 -4.512  35.507 1.00 53.84  ? 95   VAL D CA    1 
ATOM   2812  C  C     . VAL D  4 95  ? -20.264 -4.261  36.723 1.00 54.35  ? 95   VAL D C     1 
ATOM   2813  O  O     . VAL D  4 95  ? -19.860 -4.462  37.867 1.00 53.67  ? 95   VAL D O     1 
ATOM   2814  C  CB    . VAL D  4 95  ? -18.750 -3.206  34.936 1.00 53.94  ? 95   VAL D CB    1 
ATOM   2815  C  CG1   . VAL D  4 95  ? -18.530 -2.149  36.027 1.00 54.51  ? 95   VAL D CG1   1 
ATOM   2816  C  CG2   . VAL D  4 95  ? -17.431 -3.514  34.203 1.00 52.33  ? 95   VAL D CG2   1 
ATOM   2817  N  N     . ARG D  4 96  ? -21.498 -3.858  36.453 1.00 55.41  ? 96   ARG D N     1 
ATOM   2818  C  CA    . ARG D  4 96  ? -22.500 -3.682  37.491 1.00 56.82  ? 96   ARG D CA    1 
ATOM   2819  C  C     . ARG D  4 96  ? -22.902 -4.990  38.152 1.00 55.90  ? 96   ARG D C     1 
ATOM   2820  O  O     . ARG D  4 96  ? -23.195 -4.998  39.339 1.00 56.31  ? 96   ARG D O     1 
ATOM   2821  C  CB    . ARG D  4 96  ? -23.733 -2.965  36.940 1.00 56.51  ? 96   ARG D CB    1 
ATOM   2822  C  CG    . ARG D  4 96  ? -23.591 -1.443  36.861 1.00 59.47  ? 96   ARG D CG    1 
ATOM   2823  C  CD    . ARG D  4 96  ? -24.819 -0.793  36.198 1.00 60.55  ? 96   ARG D CD    1 
ATOM   2824  N  NE    . ARG D  4 96  ? -24.708 0.667   36.219 1.00 70.26  ? 96   ARG D NE    1 
ATOM   2825  C  CZ    . ARG D  4 96  ? -25.077 1.483   35.223 1.00 73.63  ? 96   ARG D CZ    1 
ATOM   2826  N  NH1   . ARG D  4 96  ? -25.602 0.996   34.087 1.00 73.45  ? 96   ARG D NH1   1 
ATOM   2827  N  NH2   . ARG D  4 96  ? -24.911 2.801   35.364 1.00 74.54  ? 96   ARG D NH2   1 
ATOM   2828  N  N     . LEU D  4 97  ? -22.924 -6.090  37.397 1.00 55.60  ? 97   LEU D N     1 
ATOM   2829  C  CA    . LEU D  4 97  ? -23.252 -7.397  37.985 1.00 55.42  ? 97   LEU D CA    1 
ATOM   2830  C  C     . LEU D  4 97  ? -22.128 -7.905  38.884 1.00 55.98  ? 97   LEU D C     1 
ATOM   2831  O  O     . LEU D  4 97  ? -22.370 -8.394  39.974 1.00 56.20  ? 97   LEU D O     1 
ATOM   2832  C  CB    . LEU D  4 97  ? -23.600 -8.426  36.915 1.00 54.30  ? 97   LEU D CB    1 
ATOM   2833  C  CG    . LEU D  4 97  ? -24.976 -8.161  36.289 1.00 52.49  ? 97   LEU D CG    1 
ATOM   2834  C  CD1   . LEU D  4 97  ? -25.130 -8.819  34.950 1.00 48.66  ? 97   LEU D CD1   1 
ATOM   2835  C  CD2   . LEU D  4 97  ? -26.132 -8.502  37.221 1.00 50.94  ? 97   LEU D CD2   1 
ATOM   2836  N  N     . LEU D  4 98  ? -20.899 -7.705  38.437 1.00 56.66  ? 98   LEU D N     1 
ATOM   2837  C  CA    . LEU D  4 98  ? -19.734 -8.291  39.046 1.00 57.16  ? 98   LEU D CA    1 
ATOM   2838  C  C     . LEU D  4 98  ? -19.082 -7.507  40.187 1.00 56.98  ? 98   LEU D C     1 
ATOM   2839  O  O     . LEU D  4 98  ? -18.677 -8.100  41.178 1.00 57.85  ? 98   LEU D O     1 
ATOM   2840  C  CB    . LEU D  4 98  ? -18.710 -8.590  37.952 1.00 57.63  ? 98   LEU D CB    1 
ATOM   2841  C  CG    . LEU D  4 98  ? -17.549 -9.459  38.445 1.00 61.17  ? 98   LEU D CG    1 
ATOM   2842  C  CD1   . LEU D  4 98  ? -17.974 -10.960 38.507 1.00 63.41  ? 98   LEU D CD1   1 
ATOM   2843  C  CD2   . LEU D  4 98  ? -16.278 -9.264  37.616 1.00 62.04  ? 98   LEU D CD2   1 
ATOM   2844  N  N     . LEU D  4 99  ? -18.952 -6.194  40.059 1.00 56.94  ? 99   LEU D N     1 
ATOM   2845  C  CA    . LEU D  4 99  ? -18.223 -5.419  41.051 1.00 56.60  ? 99   LEU D CA    1 
ATOM   2846  C  C     . LEU D  4 99  ? -19.123 -4.948  42.169 1.00 57.27  ? 99   LEU D C     1 
ATOM   2847  O  O     . LEU D  4 99  ? -20.263 -4.592  41.929 1.00 58.03  ? 99   LEU D O     1 
ATOM   2848  C  CB    . LEU D  4 99  ? -17.534 -4.218  40.411 1.00 56.23  ? 99   LEU D CB    1 
ATOM   2849  C  CG    . LEU D  4 99  ? -16.506 -4.429  39.294 1.00 55.99  ? 99   LEU D CG    1 
ATOM   2850  C  CD1   . LEU D  4 99  ? -15.718 -3.168  39.094 1.00 55.42  ? 99   LEU D CD1   1 
ATOM   2851  C  CD2   . LEU D  4 99  ? -15.557 -5.585  39.558 1.00 55.68  ? 99   LEU D CD2   1 
ATOM   2852  N  N     . PRO D  4 100 ? -18.629 -4.957  43.413 1.00 58.04  ? 100  PRO D N     1 
ATOM   2853  C  CA    . PRO D  4 100 ? -19.483 -4.412  44.462 1.00 58.54  ? 100  PRO D CA    1 
ATOM   2854  C  C     . PRO D  4 100 ? -19.645 -2.882  44.408 1.00 59.74  ? 100  PRO D C     1 
ATOM   2855  O  O     . PRO D  4 100 ? -18.703 -2.154  44.029 1.00 59.65  ? 100  PRO D O     1 
ATOM   2856  C  CB    . PRO D  4 100 ? -18.777 -4.826  45.754 1.00 58.56  ? 100  PRO D CB    1 
ATOM   2857  C  CG    . PRO D  4 100 ? -17.365 -5.146  45.372 1.00 58.30  ? 100  PRO D CG    1 
ATOM   2858  C  CD    . PRO D  4 100 ? -17.343 -5.483  43.925 1.00 58.10  ? 100  PRO D CD    1 
ATOM   2859  N  N     . GLY D  4 101 ? -20.852 -2.434  44.785 1.00 60.58  ? 101  GLY D N     1 
ATOM   2860  C  CA    . GLY D  4 101 ? -21.179 -1.036  45.075 1.00 61.24  ? 101  GLY D CA    1 
ATOM   2861  C  C     . GLY D  4 101 ? -20.289 0.062   44.540 1.00 61.99  ? 101  GLY D C     1 
ATOM   2862  O  O     . GLY D  4 101 ? -20.445 0.501   43.401 1.00 62.41  ? 101  GLY D O     1 
ATOM   2863  N  N     . GLU D  4 102 ? -19.350 0.513   45.359 1.00 62.39  ? 102  GLU D N     1 
ATOM   2864  C  CA    . GLU D  4 102 ? -18.583 1.701   45.025 1.00 63.25  ? 102  GLU D CA    1 
ATOM   2865  C  C     . GLU D  4 102 ? -17.554 1.499   43.940 1.00 63.30  ? 102  GLU D C     1 
ATOM   2866  O  O     . GLU D  4 102 ? -17.194 2.450   43.262 1.00 64.11  ? 102  GLU D O     1 
ATOM   2867  C  CB    . GLU D  4 102 ? -17.890 2.256   46.255 1.00 63.54  ? 102  GLU D CB    1 
ATOM   2868  C  CG    . GLU D  4 102 ? -17.691 3.756   46.201 1.00 67.28  ? 102  GLU D CG    1 
ATOM   2869  C  CD    . GLU D  4 102 ? -19.024 4.511   46.109 1.00 72.34  ? 102  GLU D CD    1 
ATOM   2870  O  OE1   . GLU D  4 102 ? -20.030 4.040   46.704 1.00 71.64  ? 102  GLU D OE1   1 
ATOM   2871  O  OE2   . GLU D  4 102 ? -19.057 5.582   45.444 1.00 75.12  ? 102  GLU D OE2   1 
ATOM   2872  N  N     . LEU D  4 103 ? -17.038 0.278   43.803 1.00 63.34  ? 103  LEU D N     1 
ATOM   2873  C  CA    . LEU D  4 103 ? -16.079 -0.027  42.746 1.00 62.55  ? 103  LEU D CA    1 
ATOM   2874  C  C     . LEU D  4 103 ? -16.817 -0.072  41.408 1.00 62.61  ? 103  LEU D C     1 
ATOM   2875  O  O     . LEU D  4 103 ? -16.269 0.319   40.381 1.00 62.06  ? 103  LEU D O     1 
ATOM   2876  C  CB    . LEU D  4 103 ? -15.366 -1.362  43.006 1.00 62.57  ? 103  LEU D CB    1 
ATOM   2877  C  CG    . LEU D  4 103 ? -14.140 -1.542  43.911 1.00 60.81  ? 103  LEU D CG    1 
ATOM   2878  C  CD1   . LEU D  4 103 ? -13.810 -3.021  44.032 1.00 59.94  ? 103  LEU D CD1   1 
ATOM   2879  C  CD2   . LEU D  4 103 ? -12.944 -0.813  43.376 1.00 59.38  ? 103  LEU D CD2   1 
ATOM   2880  N  N     . ALA D  4 104 ? -18.064 -0.539  41.422 1.00 62.90  ? 104  ALA D N     1 
ATOM   2881  C  CA    . ALA D  4 104 ? -18.886 -0.548  40.210 1.00 63.62  ? 104  ALA D CA    1 
ATOM   2882  C  C     . ALA D  4 104 ? -19.126 0.881   39.692 1.00 64.52  ? 104  ALA D C     1 
ATOM   2883  O  O     . ALA D  4 104 ? -18.813 1.202   38.544 1.00 64.35  ? 104  ALA D O     1 
ATOM   2884  C  CB    . ALA D  4 104 ? -20.177 -1.260  40.466 1.00 63.12  ? 104  ALA D CB    1 
ATOM   2885  N  N     . LYS D  4 105 ? -19.647 1.738   40.567 1.00 65.87  ? 105  LYS D N     1 
ATOM   2886  C  CA    . LYS D  4 105 ? -19.818 3.175   40.304 1.00 67.11  ? 105  LYS D CA    1 
ATOM   2887  C  C     . LYS D  4 105 ? -18.598 3.834   39.639 1.00 66.22  ? 105  LYS D C     1 
ATOM   2888  O  O     . LYS D  4 105 ? -18.713 4.457   38.585 1.00 66.27  ? 105  LYS D O     1 
ATOM   2889  C  CB    . LYS D  4 105 ? -20.171 3.888   41.605 1.00 66.81  ? 105  LYS D CB    1 
ATOM   2890  C  CG    . LYS D  4 105 ? -20.513 5.338   41.429 1.00 69.82  ? 105  LYS D CG    1 
ATOM   2891  C  CD    . LYS D  4 105 ? -20.624 6.086   42.761 1.00 69.91  ? 105  LYS D CD    1 
ATOM   2892  C  CE    . LYS D  4 105 ? -21.960 5.810   43.495 1.00 73.51  ? 105  LYS D CE    1 
ATOM   2893  N  NZ    . LYS D  4 105 ? -21.980 6.474   44.852 1.00 72.78  ? 105  LYS D NZ    1 
ATOM   2894  N  N     . HIS D  4 106 ? -17.429 3.671   40.227 1.00 65.71  ? 106  HIS D N     1 
ATOM   2895  C  CA    . HIS D  4 106 ? -16.248 4.288   39.650 1.00 65.86  ? 106  HIS D CA    1 
ATOM   2896  C  C     . HIS D  4 106 ? -15.795 3.672   38.345 1.00 65.48  ? 106  HIS D C     1 
ATOM   2897  O  O     . HIS D  4 106 ? -15.210 4.361   37.513 1.00 65.80  ? 106  HIS D O     1 
ATOM   2898  C  CB    . HIS D  4 106 ? -15.097 4.270   40.635 1.00 66.30  ? 106  HIS D CB    1 
ATOM   2899  C  CG    . HIS D  4 106 ? -15.148 5.381   41.628 1.00 68.26  ? 106  HIS D CG    1 
ATOM   2900  N  ND1   . HIS D  4 106 ? -15.855 5.292   42.808 1.00 69.74  ? 106  HIS D ND1   1 
ATOM   2901  C  CD2   . HIS D  4 106 ? -14.599 6.616   41.607 1.00 69.59  ? 106  HIS D CD2   1 
ATOM   2902  C  CE1   . HIS D  4 106 ? -15.724 6.417   43.481 1.00 70.74  ? 106  HIS D CE1   1 
ATOM   2903  N  NE2   . HIS D  4 106 ? -14.965 7.237   42.774 1.00 71.81  ? 106  HIS D NE2   1 
ATOM   2904  N  N     . ALA D  4 107 ? -16.051 2.377   38.170 1.00 65.10  ? 107  ALA D N     1 
ATOM   2905  C  CA    . ALA D  4 107 ? -15.577 1.645   36.988 1.00 64.33  ? 107  ALA D CA    1 
ATOM   2906  C  C     . ALA D  4 107 ? -16.365 2.052   35.768 1.00 63.99  ? 107  ALA D C     1 
ATOM   2907  O  O     . ALA D  4 107 ? -15.797 2.243   34.700 1.00 63.13  ? 107  ALA D O     1 
ATOM   2908  C  CB    . ALA D  4 107 ? -15.666 0.141   37.211 1.00 64.10  ? 107  ALA D CB    1 
ATOM   2909  N  N     . VAL D  4 108 ? -17.677 2.181   35.963 1.00 64.59  ? 108  VAL D N     1 
ATOM   2910  C  CA    . VAL D  4 108 ? -18.637 2.675   34.967 1.00 65.29  ? 108  VAL D CA    1 
ATOM   2911  C  C     . VAL D  4 108 ? -18.315 4.088   34.476 1.00 65.88  ? 108  VAL D C     1 
ATOM   2912  O  O     . VAL D  4 108 ? -18.447 4.360   33.290 1.00 65.81  ? 108  VAL D O     1 
ATOM   2913  C  CB    . VAL D  4 108 ? -20.074 2.610   35.533 1.00 65.24  ? 108  VAL D CB    1 
ATOM   2914  C  CG1   . VAL D  4 108 ? -21.077 3.232   34.592 1.00 65.06  ? 108  VAL D CG1   1 
ATOM   2915  C  CG2   . VAL D  4 108 ? -20.453 1.165   35.814 1.00 65.99  ? 108  VAL D CG2   1 
ATOM   2916  N  N     . SER D  4 109 ? -17.887 4.979   35.375 1.00 66.79  ? 109  SER D N     1 
ATOM   2917  C  CA    . SER D  4 109 ? -17.317 6.267   34.954 1.00 67.87  ? 109  SER D CA    1 
ATOM   2918  C  C     . SER D  4 109 ? -16.065 6.080   34.106 1.00 68.19  ? 109  SER D C     1 
ATOM   2919  O  O     . SER D  4 109 ? -16.037 6.461   32.946 1.00 68.97  ? 109  SER D O     1 
ATOM   2920  C  CB    . SER D  4 109 ? -16.969 7.156   36.141 1.00 67.87  ? 109  SER D CB    1 
ATOM   2921  O  OG    . SER D  4 109 ? -18.122 7.464   36.890 1.00 70.45  ? 109  SER D OG    1 
ATOM   2922  N  N     . GLU D  4 110 ? -15.030 5.492   34.680 1.00 68.63  ? 110  GLU D N     1 
ATOM   2923  C  CA    . GLU D  4 110 ? -13.793 5.275   33.942 1.00 69.60  ? 110  GLU D CA    1 
ATOM   2924  C  C     . GLU D  4 110 ? -13.995 4.657   32.557 1.00 69.56  ? 110  GLU D C     1 
ATOM   2925  O  O     . GLU D  4 110 ? -13.289 5.008   31.611 1.00 69.97  ? 110  GLU D O     1 
ATOM   2926  C  CB    . GLU D  4 110 ? -12.830 4.438   34.775 1.00 69.81  ? 110  GLU D CB    1 
ATOM   2927  C  CG    . GLU D  4 110 ? -12.131 5.242   35.849 1.00 72.59  ? 110  GLU D CG    1 
ATOM   2928  C  CD    . GLU D  4 110 ? -10.783 5.735   35.387 1.00 76.66  ? 110  GLU D CD    1 
ATOM   2929  O  OE1   . GLU D  4 110 ? -10.568 6.973   35.324 1.00 77.53  ? 110  GLU D OE1   1 
ATOM   2930  O  OE2   . GLU D  4 110 ? -9.945  4.867   35.049 1.00 79.15  ? 110  GLU D OE2   1 
ATOM   2931  N  N     . GLY D  4 111 ? -14.968 3.758   32.436 1.00 69.50  ? 111  GLY D N     1 
ATOM   2932  C  CA    . GLY D  4 111 ? -15.239 3.083   31.168 1.00 69.08  ? 111  GLY D CA    1 
ATOM   2933  C  C     . GLY D  4 111 ? -15.968 3.971   30.181 1.00 68.90  ? 111  GLY D C     1 
ATOM   2934  O  O     . GLY D  4 111 ? -15.554 4.084   29.018 1.00 67.96  ? 111  GLY D O     1 
ATOM   2935  N  N     . THR D  4 112 ? -17.047 4.606   30.654 1.00 68.97  ? 112  THR D N     1 
ATOM   2936  C  CA    . THR D  4 112 ? -17.806 5.577   29.857 1.00 69.33  ? 112  THR D CA    1 
ATOM   2937  C  C     . THR D  4 112 ? -16.899 6.703   29.336 1.00 69.84  ? 112  THR D C     1 
ATOM   2938  O  O     . THR D  4 112 ? -16.924 7.040   28.144 1.00 69.84  ? 112  THR D O     1 
ATOM   2939  C  CB    . THR D  4 112 ? -18.942 6.230   30.661 1.00 69.21  ? 112  THR D CB    1 
ATOM   2940  O  OG1   . THR D  4 112 ? -19.786 5.227   31.241 1.00 68.93  ? 112  THR D OG1   1 
ATOM   2941  C  CG2   . THR D  4 112 ? -19.775 7.138   29.753 1.00 69.17  ? 112  THR D CG2   1 
ATOM   2942  N  N     . LYS D  4 113 ? -16.108 7.260   30.254 1.00 70.08  ? 113  LYS D N     1 
ATOM   2943  C  CA    . LYS D  4 113 ? -15.130 8.289   29.978 1.00 70.55  ? 113  LYS D CA    1 
ATOM   2944  C  C     . LYS D  4 113 ? -14.214 7.897   28.840 1.00 70.71  ? 113  LYS D C     1 
ATOM   2945  O  O     . LYS D  4 113 ? -13.962 8.694   27.953 1.00 71.26  ? 113  LYS D O     1 
ATOM   2946  C  CB    . LYS D  4 113 ? -14.310 8.566   31.245 1.00 70.59  ? 113  LYS D CB    1 
ATOM   2947  C  CG    . LYS D  4 113 ? -13.187 9.598   31.126 1.00 70.37  ? 113  LYS D CG    1 
ATOM   2948  C  CD    . LYS D  4 113 ? -12.611 9.880   32.516 1.00 71.81  ? 113  LYS D CD    1 
ATOM   2949  C  CE    . LYS D  4 113 ? -11.447 10.894  32.469 1.00 76.46  ? 113  LYS D CE    1 
ATOM   2950  N  NZ    . LYS D  4 113 ? -10.226 10.391  31.738 1.00 77.05  ? 113  LYS D NZ    1 
ATOM   2951  N  N     . ALA D  4 114 ? -13.707 6.673   28.860 1.00 71.29  ? 114  ALA D N     1 
ATOM   2952  C  CA    . ALA D  4 114 ? -12.719 6.269   27.874 1.00 71.42  ? 114  ALA D CA    1 
ATOM   2953  C  C     . ALA D  4 114 ? -13.392 6.034   26.543 1.00 71.69  ? 114  ALA D C     1 
ATOM   2954  O  O     . ALA D  4 114 ? -12.772 6.189   25.506 1.00 71.73  ? 114  ALA D O     1 
ATOM   2955  C  CB    . ALA D  4 114 ? -11.978 5.038   28.331 1.00 71.37  ? 114  ALA D CB    1 
ATOM   2956  N  N     . VAL D  4 115 ? -14.669 5.674   26.573 1.00 72.31  ? 115  VAL D N     1 
ATOM   2957  C  CA    . VAL D  4 115 ? -15.398 5.395   25.332 1.00 73.02  ? 115  VAL D CA    1 
ATOM   2958  C  C     . VAL D  4 115 ? -15.836 6.696   24.657 1.00 73.49  ? 115  VAL D C     1 
ATOM   2959  O  O     . VAL D  4 115 ? -15.580 6.891   23.471 1.00 73.61  ? 115  VAL D O     1 
ATOM   2960  C  CB    . VAL D  4 115 ? -16.575 4.391   25.540 1.00 72.91  ? 115  VAL D CB    1 
ATOM   2961  C  CG1   . VAL D  4 115 ? -17.496 4.365   24.339 1.00 72.03  ? 115  VAL D CG1   1 
ATOM   2962  C  CG2   . VAL D  4 115 ? -16.028 2.992   25.799 1.00 72.51  ? 115  VAL D CG2   1 
ATOM   2963  N  N     . THR D  4 116 ? -16.489 7.574   25.416 1.00 74.02  ? 116  THR D N     1 
ATOM   2964  C  CA    . THR D  4 116 ? -16.698 8.954   24.992 1.00 74.44  ? 116  THR D CA    1 
ATOM   2965  C  C     . THR D  4 116 ? -15.412 9.558   24.407 1.00 74.96  ? 116  THR D C     1 
ATOM   2966  O  O     . THR D  4 116 ? -15.384 9.971   23.243 1.00 75.34  ? 116  THR D O     1 
ATOM   2967  C  CB    . THR D  4 116 ? -17.185 9.836   26.136 1.00 74.15  ? 116  THR D CB    1 
ATOM   2968  O  OG1   . THR D  4 116 ? -18.342 9.254   26.752 1.00 74.65  ? 116  THR D OG1   1 
ATOM   2969  C  CG2   . THR D  4 116 ? -17.575 11.159  25.595 1.00 74.80  ? 116  THR D CG2   1 
ATOM   2970  N  N     . LYS D  4 117 ? -14.338 9.578   25.188 1.00 75.38  ? 117  LYS D N     1 
ATOM   2971  C  CA    . LYS D  4 117 ? -13.083 10.115  24.678 1.00 76.04  ? 117  LYS D CA    1 
ATOM   2972  C  C     . LYS D  4 117 ? -12.682 9.436   23.382 1.00 76.53  ? 117  LYS D C     1 
ATOM   2973  O  O     . LYS D  4 117 ? -12.152 10.075  22.490 1.00 77.09  ? 117  LYS D O     1 
ATOM   2974  C  CB    . LYS D  4 117 ? -11.953 10.050  25.718 1.00 75.86  ? 117  LYS D CB    1 
ATOM   2975  C  CG    . LYS D  4 117 ? -10.548 10.244  25.140 1.00 76.00  ? 117  LYS D CG    1 
ATOM   2976  C  CD    . LYS D  4 117 ? -9.616  10.945  26.118 1.00 77.58  ? 117  LYS D CD    1 
ATOM   2977  C  CE    . LYS D  4 117 ? -8.307  11.355  25.417 1.00 79.85  ? 117  LYS D CE    1 
ATOM   2978  N  NZ    . LYS D  4 117 ? -7.476  12.361  26.181 1.00 79.39  ? 117  LYS D NZ    1 
ATOM   2979  N  N     . TYR D  4 118 ? -12.958 8.145   23.273 1.00 77.55  ? 118  TYR D N     1 
ATOM   2980  C  CA    . TYR D  4 118 ? -12.492 7.364   22.134 1.00 78.36  ? 118  TYR D CA    1 
ATOM   2981  C  C     . TYR D  4 118 ? -13.332 7.650   20.886 1.00 79.55  ? 118  TYR D C     1 
ATOM   2982  O  O     . TYR D  4 118 ? -12.833 7.649   19.761 1.00 79.22  ? 118  TYR D O     1 
ATOM   2983  C  CB    . TYR D  4 118 ? -12.537 5.881   22.489 1.00 77.53  ? 118  TYR D CB    1 
ATOM   2984  C  CG    . TYR D  4 118 ? -12.175 4.966   21.355 1.00 76.48  ? 118  TYR D CG    1 
ATOM   2985  C  CD1   . TYR D  4 118 ? -10.843 4.699   21.058 1.00 74.53  ? 118  TYR D CD1   1 
ATOM   2986  C  CD2   . TYR D  4 118 ? -13.169 4.357   20.580 1.00 75.32  ? 118  TYR D CD2   1 
ATOM   2987  C  CE1   . TYR D  4 118 ? -10.502 3.852   20.017 1.00 75.08  ? 118  TYR D CE1   1 
ATOM   2988  C  CE2   . TYR D  4 118 ? -12.841 3.513   19.529 1.00 74.75  ? 118  TYR D CE2   1 
ATOM   2989  C  CZ    . TYR D  4 118 ? -11.508 3.268   19.253 1.00 75.58  ? 118  TYR D CZ    1 
ATOM   2990  O  OH    . TYR D  4 118 ? -11.165 2.431   18.221 1.00 76.66  ? 118  TYR D OH    1 
ATOM   2991  N  N     . THR D  4 119 ? -14.613 7.896   21.117 1.00 81.31  ? 119  THR D N     1 
ATOM   2992  C  CA    . THR D  4 119 ? -15.562 8.174   20.070 1.00 83.39  ? 119  THR D CA    1 
ATOM   2993  C  C     . THR D  4 119 ? -15.162 9.466   19.358 1.00 84.78  ? 119  THR D C     1 
ATOM   2994  O  O     . THR D  4 119 ? -15.160 9.527   18.127 1.00 85.17  ? 119  THR D O     1 
ATOM   2995  C  CB    . THR D  4 119 ? -16.988 8.281   20.670 1.00 83.53  ? 119  THR D CB    1 
ATOM   2996  O  OG1   . THR D  4 119 ? -17.305 7.054   21.339 1.00 83.39  ? 119  THR D OG1   1 
ATOM   2997  C  CG2   . THR D  4 119 ? -18.046 8.550   19.598 1.00 83.96  ? 119  THR D CG2   1 
ATOM   2998  N  N     . SER D  4 120 ? -14.794 10.481  20.140 1.00 86.49  ? 120  SER D N     1 
ATOM   2999  C  CA    . SER D  4 120 ? -14.430 11.801  19.611 1.00 87.98  ? 120  SER D CA    1 
ATOM   3000  C  C     . SER D  4 120 ? -13.048 11.851  18.952 1.00 89.06  ? 120  SER D C     1 
ATOM   3001  O  O     . SER D  4 120 ? -12.719 12.844  18.300 1.00 89.34  ? 120  SER D O     1 
ATOM   3002  C  CB    . SER D  4 120 ? -14.462 12.834  20.736 1.00 87.96  ? 120  SER D CB    1 
ATOM   3003  O  OG    . SER D  4 120 ? -13.223 12.804  21.449 1.00 88.12  ? 120  SER D OG    1 
ATOM   3004  N  N     . ALA D  4 121 ? -12.249 10.795  19.110 1.00 90.31  ? 121  ALA D N     1 
ATOM   3005  C  CA    . ALA D  4 121 ? -10.829 10.877  18.786 1.00 91.86  ? 121  ALA D CA    1 
ATOM   3006  C  C     . ALA D  4 121 ? -10.337 10.111  17.554 1.00 93.19  ? 121  ALA D C     1 
ATOM   3007  O  O     . ALA D  4 121 ? -9.222  9.575   17.567 1.00 93.72  ? 121  ALA D O     1 
ATOM   3008  C  CB    . ALA D  4 121 ? -9.993  10.515  20.003 1.00 91.82  ? 121  ALA D CB    1 
ATOM   3009  N  N     . LYS D  4 122 ? -11.142 10.050  16.492 1.00 94.62  ? 122  LYS D N     1 
ATOM   3010  C  CA    . LYS D  4 122 ? -10.629 9.566   15.195 1.00 95.87  ? 122  LYS D CA    1 
ATOM   3011  C  C     . LYS D  4 122 ? -11.164 10.374  14.000 1.00 96.12  ? 122  LYS D C     1 
ATOM   3012  O  O     . LYS D  4 122 ? -10.477 11.264  13.482 1.00 95.93  ? 122  LYS D O     1 
ATOM   3013  C  CB    . LYS D  4 122 ? -10.855 8.055   14.989 1.00 96.06  ? 122  LYS D CB    1 
ATOM   3014  C  CG    . LYS D  4 122 ? -10.204 7.532   13.684 1.00 96.86  ? 122  LYS D CG    1 
ATOM   3015  C  CD    . LYS D  4 122 ? -10.460 6.044   13.398 1.00 96.69  ? 122  LYS D CD    1 
ATOM   3016  C  CE    . LYS D  4 122 ? -9.669  5.613   12.154 1.00 97.31  ? 122  LYS D CE    1 
ATOM   3017  N  NZ    . LYS D  4 122 ? -9.756  4.150   11.856 1.00 98.43  ? 122  LYS D NZ    1 
ATOM   3018  O  OXT   . LYS D  4 122 ? -12.288 10.136  13.525 1.00 96.54  ? 122  LYS D OXT   1 
ATOM   3019  N  N     . PRO E  1 38  ? 14.200  -21.954 87.963 1.00 87.75  ? 38   PRO E N     1 
ATOM   3020  C  CA    . PRO E  1 38  ? 13.770  -22.374 86.615 1.00 87.52  ? 38   PRO E CA    1 
ATOM   3021  C  C     . PRO E  1 38  ? 12.480  -21.666 86.209 1.00 87.32  ? 38   PRO E C     1 
ATOM   3022  O  O     . PRO E  1 38  ? 11.469  -21.743 86.922 1.00 87.69  ? 38   PRO E O     1 
ATOM   3023  C  CB    . PRO E  1 38  ? 13.544  -23.896 86.761 1.00 87.35  ? 38   PRO E CB    1 
ATOM   3024  C  CG    . PRO E  1 38  ? 13.520  -24.178 88.268 1.00 87.63  ? 38   PRO E CG    1 
ATOM   3025  C  CD    . PRO E  1 38  ? 13.704  -22.869 89.018 1.00 87.59  ? 38   PRO E CD    1 
ATOM   3026  N  N     . HIS E  1 39  ? 12.518  -20.980 85.069 1.00 86.75  ? 39   HIS E N     1 
ATOM   3027  C  CA    . HIS E  1 39  ? 11.426  -20.080 84.669 1.00 85.86  ? 39   HIS E CA    1 
ATOM   3028  C  C     . HIS E  1 39  ? 10.346  -20.765 83.814 1.00 84.31  ? 39   HIS E C     1 
ATOM   3029  O  O     . HIS E  1 39  ? 10.656  -21.674 83.027 1.00 84.25  ? 39   HIS E O     1 
ATOM   3030  C  CB    . HIS E  1 39  ? 12.011  -18.872 83.937 1.00 86.61  ? 39   HIS E CB    1 
ATOM   3031  C  CG    . HIS E  1 39  ? 10.980  -17.940 83.391 1.00 88.36  ? 39   HIS E CG    1 
ATOM   3032  N  ND1   . HIS E  1 39  ? 10.458  -18.075 82.122 1.00 89.82  ? 39   HIS E ND1   1 
ATOM   3033  C  CD2   . HIS E  1 39  ? 10.371  -16.862 83.942 1.00 90.37  ? 39   HIS E CD2   1 
ATOM   3034  C  CE1   . HIS E  1 39  ? 9.576   -17.114 81.910 1.00 91.12  ? 39   HIS E CE1   1 
ATOM   3035  N  NE2   . HIS E  1 39  ? 9.506   -16.362 82.997 1.00 91.77  ? 39   HIS E NE2   1 
ATOM   3036  N  N     . ARG E  1 40  ? 9.091   -20.312 83.971 1.00 81.97  ? 40   ARG E N     1 
ATOM   3037  C  CA    . ARG E  1 40  ? 7.927   -20.911 83.282 1.00 79.42  ? 40   ARG E CA    1 
ATOM   3038  C  C     . ARG E  1 40  ? 6.829   -19.927 82.906 1.00 77.52  ? 40   ARG E C     1 
ATOM   3039  O  O     . ARG E  1 40  ? 6.209   -19.295 83.781 1.00 76.77  ? 40   ARG E O     1 
ATOM   3040  C  CB    . ARG E  1 40  ? 7.287   -22.019 84.125 1.00 79.44  ? 40   ARG E CB    1 
ATOM   3041  C  CG    . ARG E  1 40  ? 7.925   -23.360 83.939 1.00 79.63  ? 40   ARG E CG    1 
ATOM   3042  C  CD    . ARG E  1 40  ? 6.925   -24.502 84.053 1.00 79.61  ? 40   ARG E CD    1 
ATOM   3043  N  NE    . ARG E  1 40  ? 7.485   -25.689 83.408 1.00 80.64  ? 40   ARG E NE    1 
ATOM   3044  C  CZ    . ARG E  1 40  ? 6.917   -26.362 82.409 1.00 81.21  ? 40   ARG E CZ    1 
ATOM   3045  N  NH1   . ARG E  1 40  ? 5.731   -26.008 81.933 1.00 80.13  ? 40   ARG E NH1   1 
ATOM   3046  N  NH2   . ARG E  1 40  ? 7.529   -27.426 81.905 1.00 82.82  ? 40   ARG E NH2   1 
ATOM   3047  N  N     . TYR E  1 41  ? 6.566   -19.840 81.603 1.00 75.20  ? 41   TYR E N     1 
ATOM   3048  C  CA    . TYR E  1 41  ? 5.393   -19.126 81.120 1.00 73.04  ? 41   TYR E CA    1 
ATOM   3049  C  C     . TYR E  1 41  ? 4.148   -19.958 81.351 1.00 71.76  ? 41   TYR E C     1 
ATOM   3050  O  O     . TYR E  1 41  ? 4.146   -21.178 81.183 1.00 71.52  ? 41   TYR E O     1 
ATOM   3051  C  CB    . TYR E  1 41  ? 5.530   -18.761 79.643 1.00 72.97  ? 41   TYR E CB    1 
ATOM   3052  C  CG    . TYR E  1 41  ? 6.607   -17.749 79.378 1.00 72.30  ? 41   TYR E CG    1 
ATOM   3053  C  CD1   . TYR E  1 41  ? 7.744   -18.093 78.661 1.00 72.06  ? 41   TYR E CD1   1 
ATOM   3054  C  CD2   . TYR E  1 41  ? 6.503   -16.447 79.874 1.00 72.69  ? 41   TYR E CD2   1 
ATOM   3055  C  CE1   . TYR E  1 41  ? 8.750   -17.166 78.426 1.00 72.25  ? 41   TYR E CE1   1 
ATOM   3056  C  CE2   . TYR E  1 41  ? 7.501   -15.507 79.644 1.00 72.31  ? 41   TYR E CE2   1 
ATOM   3057  C  CZ    . TYR E  1 41  ? 8.620   -15.876 78.917 1.00 72.56  ? 41   TYR E CZ    1 
ATOM   3058  O  OH    . TYR E  1 41  ? 9.611   -14.951 78.680 1.00 73.39  ? 41   TYR E OH    1 
ATOM   3059  N  N     . ARG E  1 42  ? 3.083   -19.293 81.749 1.00 70.31  ? 42   ARG E N     1 
ATOM   3060  C  CA    . ARG E  1 42  ? 1.863   -20.000 82.038 1.00 69.79  ? 42   ARG E CA    1 
ATOM   3061  C  C     . ARG E  1 42  ? 1.201   -20.500 80.749 1.00 68.57  ? 42   ARG E C     1 
ATOM   3062  O  O     . ARG E  1 42  ? 1.335   -19.880 79.698 1.00 68.42  ? 42   ARG E O     1 
ATOM   3063  C  CB    . ARG E  1 42  ? 0.956   -19.097 82.846 1.00 69.83  ? 42   ARG E CB    1 
ATOM   3064  C  CG    . ARG E  1 42  ? 1.586   -18.737 84.176 1.00 72.90  ? 42   ARG E CG    1 
ATOM   3065  C  CD    . ARG E  1 42  ? 0.930   -17.538 84.766 1.00 77.82  ? 42   ARG E CD    1 
ATOM   3066  N  NE    . ARG E  1 42  ? -0.488  -17.555 84.421 1.00 82.71  ? 42   ARG E NE    1 
ATOM   3067  C  CZ    . ARG E  1 42  ? -1.430  -16.852 85.039 1.00 83.96  ? 42   ARG E CZ    1 
ATOM   3068  N  NH1   . ARG E  1 42  ? -1.119  -16.057 86.060 1.00 85.19  ? 42   ARG E NH1   1 
ATOM   3069  N  NH2   . ARG E  1 42  ? -2.687  -16.959 84.632 1.00 84.04  ? 42   ARG E NH2   1 
ATOM   3070  N  N     . PRO E  1 43  ? 0.501   -21.645 80.817 1.00 67.60  ? 43   PRO E N     1 
ATOM   3071  C  CA    . PRO E  1 43  ? -0.143  -22.160 79.615 1.00 66.81  ? 43   PRO E CA    1 
ATOM   3072  C  C     . PRO E  1 43  ? -1.092  -21.138 78.968 1.00 66.04  ? 43   PRO E C     1 
ATOM   3073  O  O     . PRO E  1 43  ? -2.016  -20.642 79.604 1.00 65.78  ? 43   PRO E O     1 
ATOM   3074  C  CB    . PRO E  1 43  ? -0.898  -23.388 80.129 1.00 66.87  ? 43   PRO E CB    1 
ATOM   3075  C  CG    . PRO E  1 43  ? -0.947  -23.246 81.598 1.00 66.43  ? 43   PRO E CG    1 
ATOM   3076  C  CD    . PRO E  1 43  ? 0.266   -22.521 81.977 1.00 67.39  ? 43   PRO E CD    1 
ATOM   3077  N  N     . GLY E  1 44  ? -0.845  -20.823 77.705 1.00 65.30  ? 44   GLY E N     1 
ATOM   3078  C  CA    . GLY E  1 44  ? -1.635  -19.814 77.023 1.00 64.52  ? 44   GLY E CA    1 
ATOM   3079  C  C     . GLY E  1 44  ? -0.742  -18.713 76.511 1.00 64.36  ? 44   GLY E C     1 
ATOM   3080  O  O     . GLY E  1 44  ? -1.030  -18.091 75.495 1.00 64.90  ? 44   GLY E O     1 
ATOM   3081  N  N     . THR E  1 45  ? 0.366   -18.486 77.204 1.00 63.81  ? 45   THR E N     1 
ATOM   3082  C  CA    . THR E  1 45  ? 1.200   -17.336 76.922 1.00 62.83  ? 45   THR E CA    1 
ATOM   3083  C  C     . THR E  1 45  ? 2.033   -17.565 75.680 1.00 62.02  ? 45   THR E C     1 
ATOM   3084  O  O     . THR E  1 45  ? 2.100   -16.681 74.815 1.00 62.25  ? 45   THR E O     1 
ATOM   3085  C  CB    . THR E  1 45  ? 2.076   -16.944 78.142 1.00 63.16  ? 45   THR E CB    1 
ATOM   3086  O  OG1   . THR E  1 45  ? 1.228   -16.745 79.281 1.00 64.75  ? 45   THR E OG1   1 
ATOM   3087  C  CG2   . THR E  1 45  ? 2.846   -15.670 77.877 1.00 61.53  ? 45   THR E CG2   1 
ATOM   3088  N  N     . VAL E  1 46  ? 2.666   -18.731 75.574 1.00 60.52  ? 46   VAL E N     1 
ATOM   3089  C  CA    . VAL E  1 46  ? 3.440   -19.014 74.366 1.00 59.17  ? 46   VAL E CA    1 
ATOM   3090  C  C     . VAL E  1 46  ? 2.485   -19.155 73.175 1.00 58.16  ? 46   VAL E C     1 
ATOM   3091  O  O     . VAL E  1 46  ? 2.812   -18.759 72.054 1.00 57.44  ? 46   VAL E O     1 
ATOM   3092  C  CB    . VAL E  1 46  ? 4.335   -20.248 74.519 1.00 59.02  ? 46   VAL E CB    1 
ATOM   3093  C  CG1   . VAL E  1 46  ? 5.319   -20.352 73.348 1.00 57.91  ? 46   VAL E CG1   1 
ATOM   3094  C  CG2   . VAL E  1 46  ? 5.097   -20.161 75.822 1.00 59.84  ? 46   VAL E CG2   1 
ATOM   3095  N  N     . ALA E  1 47  ? 1.298   -19.693 73.442 1.00 57.01  ? 47   ALA E N     1 
ATOM   3096  C  CA    . ALA E  1 47  ? 0.294   -19.895 72.411 1.00 56.73  ? 47   ALA E CA    1 
ATOM   3097  C  C     . ALA E  1 47  ? -0.077  -18.554 71.727 1.00 56.84  ? 47   ALA E C     1 
ATOM   3098  O  O     . ALA E  1 47  ? -0.021  -18.446 70.488 1.00 56.44  ? 47   ALA E O     1 
ATOM   3099  C  CB    . ALA E  1 47  ? -0.930  -20.621 72.991 1.00 56.02  ? 47   ALA E CB    1 
ATOM   3100  N  N     . LEU E  1 48  ? -0.399  -17.533 72.537 1.00 56.80  ? 48   LEU E N     1 
ATOM   3101  C  CA    . LEU E  1 48  ? -0.674  -16.165 72.039 1.00 56.55  ? 48   LEU E CA    1 
ATOM   3102  C  C     . LEU E  1 48  ? 0.523   -15.524 71.366 1.00 56.09  ? 48   LEU E C     1 
ATOM   3103  O  O     . LEU E  1 48  ? 0.376   -14.784 70.420 1.00 56.66  ? 48   LEU E O     1 
ATOM   3104  C  CB    . LEU E  1 48  ? -1.174  -15.256 73.154 1.00 56.51  ? 48   LEU E CB    1 
ATOM   3105  C  CG    . LEU E  1 48  ? -2.543  -15.582 73.746 1.00 58.12  ? 48   LEU E CG    1 
ATOM   3106  C  CD1   . LEU E  1 48  ? -2.786  -14.867 75.076 1.00 57.08  ? 48   LEU E CD1   1 
ATOM   3107  C  CD2   . LEU E  1 48  ? -3.666  -15.290 72.745 1.00 58.79  ? 48   LEU E CD2   1 
ATOM   3108  N  N     . ARG E  1 49  ? 1.709   -15.821 71.852 1.00 55.68  ? 49   ARG E N     1 
ATOM   3109  C  CA    . ARG E  1 49  ? 2.928   -15.318 71.262 1.00 55.97  ? 49   ARG E CA    1 
ATOM   3110  C  C     . ARG E  1 49  ? 3.068   -15.892 69.867 1.00 55.91  ? 49   ARG E C     1 
ATOM   3111  O  O     . ARG E  1 49  ? 3.435   -15.194 68.940 1.00 56.26  ? 49   ARG E O     1 
ATOM   3112  C  CB    . ARG E  1 49  ? 4.116   -15.765 72.125 1.00 56.43  ? 49   ARG E CB    1 
ATOM   3113  C  CG    . ARG E  1 49  ? 5.283   -14.828 72.148 1.00 58.04  ? 49   ARG E CG    1 
ATOM   3114  C  CD    . ARG E  1 49  ? 6.639   -15.546 72.156 1.00 63.12  ? 49   ARG E CD    1 
ATOM   3115  N  NE    . ARG E  1 49  ? 7.030   -16.183 73.431 1.00 66.32  ? 49   ARG E NE    1 
ATOM   3116  C  CZ    . ARG E  1 49  ? 6.640   -15.800 74.648 1.00 68.20  ? 49   ARG E CZ    1 
ATOM   3117  N  NH1   . ARG E  1 49  ? 5.839   -14.745 74.831 1.00 70.47  ? 49   ARG E NH1   1 
ATOM   3118  N  NH2   . ARG E  1 49  ? 7.074   -16.476 75.697 1.00 68.60  ? 49   ARG E NH2   1 
ATOM   3119  N  N     . GLU E  1 50  ? 2.755   -17.181 69.728 1.00 56.10  ? 50   GLU E N     1 
ATOM   3120  C  CA    . GLU E  1 50  ? 2.854   -17.896 68.451 1.00 55.70  ? 50   GLU E CA    1 
ATOM   3121  C  C     . GLU E  1 50  ? 1.773   -17.451 67.472 1.00 54.00  ? 50   GLU E C     1 
ATOM   3122  O  O     . GLU E  1 50  ? 2.039   -17.360 66.277 1.00 53.60  ? 50   GLU E O     1 
ATOM   3123  C  CB    . GLU E  1 50  ? 2.771   -19.407 68.673 1.00 55.63  ? 50   GLU E CB    1 
ATOM   3124  C  CG    . GLU E  1 50  ? 3.985   -20.073 69.301 1.00 56.46  ? 50   GLU E CG    1 
ATOM   3125  C  CD    . GLU E  1 50  ? 3.731   -21.554 69.632 1.00 59.14  ? 50   GLU E CD    1 
ATOM   3126  O  OE1   . GLU E  1 50  ? 4.442   -22.121 70.514 1.00 64.32  ? 50   GLU E OE1   1 
ATOM   3127  O  OE2   . GLU E  1 50  ? 2.809   -22.161 69.016 1.00 63.39  ? 50   GLU E OE2   1 
ATOM   3128  N  N     . ILE E  1 51  ? 0.564   -17.182 67.970 1.00 52.64  ? 51   ILE E N     1 
ATOM   3129  C  CA    . ILE E  1 51  ? -0.484  -16.603 67.126 1.00 51.50  ? 51   ILE E CA    1 
ATOM   3130  C  C     . ILE E  1 51  ? -0.013  -15.298 66.487 1.00 51.84  ? 51   ILE E C     1 
ATOM   3131  O  O     . ILE E  1 51  ? -0.126  -15.141 65.270 1.00 51.25  ? 51   ILE E O     1 
ATOM   3132  C  CB    . ILE E  1 51  ? -1.803  -16.329 67.866 1.00 51.52  ? 51   ILE E CB    1 
ATOM   3133  C  CG1   . ILE E  1 51  ? -2.327  -17.606 68.530 1.00 51.26  ? 51   ILE E CG1   1 
ATOM   3134  C  CG2   . ILE E  1 51  ? -2.831  -15.745 66.888 1.00 50.12  ? 51   ILE E CG2   1 
ATOM   3135  C  CD1   . ILE E  1 51  ? -3.703  -17.486 69.174 1.00 50.25  ? 51   ILE E CD1   1 
ATOM   3136  N  N     . ARG E  1 52  ? 0.514   -14.375 67.307 1.00 51.57  ? 52   ARG E N     1 
ATOM   3137  C  CA    . ARG E  1 52  ? 1.034   -13.096 66.814 1.00 51.59  ? 52   ARG E CA    1 
ATOM   3138  C  C     . ARG E  1 52  ? 2.150   -13.360 65.828 1.00 51.21  ? 52   ARG E C     1 
ATOM   3139  O  O     . ARG E  1 52  ? 2.233   -12.741 64.782 1.00 51.36  ? 52   ARG E O     1 
ATOM   3140  C  CB    . ARG E  1 52  ? 1.521   -12.216 67.963 1.00 51.22  ? 52   ARG E CB    1 
ATOM   3141  C  CG    . ARG E  1 52  ? 0.418   -11.885 69.002 1.00 53.08  ? 52   ARG E CG    1 
ATOM   3142  C  CD    . ARG E  1 52  ? 0.894   -10.985 70.140 1.00 53.58  ? 52   ARG E CD    1 
ATOM   3143  N  NE    . ARG E  1 52  ? 0.302   -11.338 71.444 1.00 59.51  ? 52   ARG E NE    1 
ATOM   3144  C  CZ    . ARG E  1 52  ? -0.890  -10.916 71.888 1.00 62.09  ? 52   ARG E CZ    1 
ATOM   3145  N  NH1   . ARG E  1 52  ? -1.651  -10.129 71.130 1.00 64.50  ? 52   ARG E NH1   1 
ATOM   3146  N  NH2   . ARG E  1 52  ? -1.330  -11.275 73.096 1.00 59.71  ? 52   ARG E NH2   1 
ATOM   3147  N  N     . ARG E  1 53  ? 2.993   -14.323 66.147 1.00 51.36  ? 53   ARG E N     1 
ATOM   3148  C  CA    . ARG E  1 53  ? 4.091   -14.657 65.290 1.00 51.66  ? 53   ARG E CA    1 
ATOM   3149  C  C     . ARG E  1 53  ? 3.649   -15.173 63.912 1.00 51.81  ? 53   ARG E C     1 
ATOM   3150  O  O     . ARG E  1 53  ? 4.113   -14.676 62.895 1.00 52.37  ? 53   ARG E O     1 
ATOM   3151  C  CB    . ARG E  1 53  ? 4.985   -15.666 65.987 1.00 51.85  ? 53   ARG E CB    1 
ATOM   3152  C  CG    . ARG E  1 53  ? 6.270   -15.876 65.252 1.00 55.23  ? 53   ARG E CG    1 
ATOM   3153  C  CD    . ARG E  1 53  ? 7.039   -17.064 65.746 1.00 60.07  ? 53   ARG E CD    1 
ATOM   3154  N  NE    . ARG E  1 53  ? 7.999   -17.433 64.713 1.00 64.73  ? 53   ARG E NE    1 
ATOM   3155  C  CZ    . ARG E  1 53  ? 8.831   -18.464 64.793 1.00 66.17  ? 53   ARG E CZ    1 
ATOM   3156  N  NH1   . ARG E  1 53  ? 8.827   -19.234 65.881 1.00 66.09  ? 53   ARG E NH1   1 
ATOM   3157  N  NH2   . ARG E  1 53  ? 9.665   -18.716 63.782 1.00 64.94  ? 53   ARG E NH2   1 
ATOM   3158  N  N     . TYR E  1 54  ? 2.750   -16.159 63.876 1.00 51.41  ? 54   TYR E N     1 
ATOM   3159  C  CA    . TYR E  1 54  ? 2.375   -16.781 62.610 1.00 50.96  ? 54   TYR E CA    1 
ATOM   3160  C  C     . TYR E  1 54  ? 1.361   -15.966 61.832 1.00 51.27  ? 54   TYR E C     1 
ATOM   3161  O  O     . TYR E  1 54  ? 1.258   -16.121 60.606 1.00 51.33  ? 54   TYR E O     1 
ATOM   3162  C  CB    . TYR E  1 54  ? 1.919   -18.237 62.813 1.00 50.50  ? 54   TYR E CB    1 
ATOM   3163  C  CG    . TYR E  1 54  ? 3.077   -19.089 63.266 1.00 48.89  ? 54   TYR E CG    1 
ATOM   3164  C  CD1   . TYR E  1 54  ? 3.115   -19.641 64.538 1.00 47.68  ? 54   TYR E CD1   1 
ATOM   3165  C  CD2   . TYR E  1 54  ? 4.161   -19.282 62.446 1.00 45.77  ? 54   TYR E CD2   1 
ATOM   3166  C  CE1   . TYR E  1 54  ? 4.180   -20.377 64.961 1.00 44.54  ? 54   TYR E CE1   1 
ATOM   3167  C  CE2   . TYR E  1 54  ? 5.233   -19.987 62.861 1.00 45.40  ? 54   TYR E CE2   1 
ATOM   3168  C  CZ    . TYR E  1 54  ? 5.244   -20.532 64.117 1.00 47.44  ? 54   TYR E CZ    1 
ATOM   3169  O  OH    . TYR E  1 54  ? 6.351   -21.268 64.503 1.00 51.27  ? 54   TYR E OH    1 
ATOM   3170  N  N     . GLN E  1 55  ? 0.628   -15.103 62.537 1.00 51.29  ? 55   GLN E N     1 
ATOM   3171  C  CA    . GLN E  1 55  ? -0.286  -14.178 61.876 1.00 51.73  ? 55   GLN E CA    1 
ATOM   3172  C  C     . GLN E  1 55  ? 0.449   -13.051 61.174 1.00 52.81  ? 55   GLN E C     1 
ATOM   3173  O  O     . GLN E  1 55  ? -0.084  -12.421 60.272 1.00 53.57  ? 55   GLN E O     1 
ATOM   3174  C  CB    . GLN E  1 55  ? -1.361  -13.670 62.816 1.00 50.74  ? 55   GLN E CB    1 
ATOM   3175  C  CG    . GLN E  1 55  ? -2.517  -14.621 62.842 1.00 50.18  ? 55   GLN E CG    1 
ATOM   3176  C  CD    . GLN E  1 55  ? -3.692  -14.161 63.657 1.00 49.95  ? 55   GLN E CD    1 
ATOM   3177  O  OE1   . GLN E  1 55  ? -3.691  -13.078 64.232 1.00 51.43  ? 55   GLN E OE1   1 
ATOM   3178  N  NE2   . GLN E  1 55  ? -4.720  -14.989 63.702 1.00 48.55  ? 55   GLN E NE2   1 
ATOM   3179  N  N     . LYS E  1 56  ? 1.701   -12.860 61.544 1.00 53.96  ? 56   LYS E N     1 
ATOM   3180  C  CA    . LYS E  1 56  ? 2.509   -11.777 61.048 1.00 55.88  ? 56   LYS E CA    1 
ATOM   3181  C  C     . LYS E  1 56  ? 3.299   -12.211 59.831 1.00 55.80  ? 56   LYS E C     1 
ATOM   3182  O  O     . LYS E  1 56  ? 3.661   -11.388 59.006 1.00 56.82  ? 56   LYS E O     1 
ATOM   3183  C  CB    . LYS E  1 56  ? 3.471   -11.358 62.169 1.00 56.84  ? 56   LYS E CB    1 
ATOM   3184  C  CG    . LYS E  1 56  ? 4.195   -10.048 62.003 1.00 61.26  ? 56   LYS E CG    1 
ATOM   3185  C  CD    . LYS E  1 56  ? 4.755   -9.614  63.362 1.00 66.39  ? 56   LYS E CD    1 
ATOM   3186  C  CE    . LYS E  1 56  ? 5.399   -8.195  63.300 1.00 71.47  ? 56   LYS E CE    1 
ATOM   3187  N  NZ    . LYS E  1 56  ? 5.632   -7.579  64.699 1.00 70.37  ? 56   LYS E NZ    1 
ATOM   3188  N  N     . SER E  1 57  ? 3.604   -13.496 59.724 1.00 55.43  ? 57   SER E N     1 
ATOM   3189  C  CA    . SER E  1 57  ? 4.448   -13.963 58.640 1.00 54.99  ? 57   SER E CA    1 
ATOM   3190  C  C     . SER E  1 57  ? 3.670   -14.679 57.538 1.00 54.60  ? 57   SER E C     1 
ATOM   3191  O  O     . SER E  1 57  ? 2.479   -14.974 57.690 1.00 54.63  ? 57   SER E O     1 
ATOM   3192  C  CB    . SER E  1 57  ? 5.513   -14.871 59.214 1.00 55.30  ? 57   SER E CB    1 
ATOM   3193  O  OG    . SER E  1 57  ? 4.901   -15.802 60.077 1.00 56.52  ? 57   SER E OG    1 
ATOM   3194  N  N     . THR E  1 58  ? 4.351   -14.973 56.430 1.00 54.29  ? 58   THR E N     1 
ATOM   3195  C  CA    . THR E  1 58  ? 3.705   -15.606 55.281 1.00 53.73  ? 58   THR E CA    1 
ATOM   3196  C  C     . THR E  1 58  ? 4.371   -16.900 54.777 1.00 54.33  ? 58   THR E C     1 
ATOM   3197  O  O     . THR E  1 58  ? 3.924   -17.455 53.760 1.00 54.21  ? 58   THR E O     1 
ATOM   3198  C  CB    . THR E  1 58  ? 3.647   -14.638 54.069 1.00 53.92  ? 58   THR E CB    1 
ATOM   3199  O  OG1   . THR E  1 58  ? 4.956   -14.511 53.525 1.00 52.74  ? 58   THR E OG1   1 
ATOM   3200  C  CG2   . THR E  1 58  ? 3.092   -13.249 54.449 1.00 52.70  ? 58   THR E CG2   1 
ATOM   3201  N  N     . GLU E  1 59  ? 5.425   -17.397 55.441 1.00 54.73  ? 59   GLU E N     1 
ATOM   3202  C  CA    . GLU E  1 59  ? 6.098   -18.612 54.923 1.00 54.90  ? 59   GLU E CA    1 
ATOM   3203  C  C     . GLU E  1 59  ? 5.206   -19.808 55.111 1.00 54.14  ? 59   GLU E C     1 
ATOM   3204  O  O     . GLU E  1 59  ? 4.341   -19.794 55.980 1.00 54.13  ? 59   GLU E O     1 
ATOM   3205  C  CB    . GLU E  1 59  ? 7.487   -18.850 55.507 1.00 55.27  ? 59   GLU E CB    1 
ATOM   3206  C  CG    . GLU E  1 59  ? 7.783   -18.157 56.834 1.00 60.05  ? 59   GLU E CG    1 
ATOM   3207  C  CD    . GLU E  1 59  ? 7.069   -18.799 57.996 1.00 65.68  ? 59   GLU E CD    1 
ATOM   3208  O  OE1   . GLU E  1 59  ? 6.664   -19.967 57.826 1.00 70.05  ? 59   GLU E OE1   1 
ATOM   3209  O  OE2   . GLU E  1 59  ? 6.909   -18.155 59.070 1.00 67.69  ? 59   GLU E OE2   1 
ATOM   3210  N  N     . LEU E  1 60  ? 5.361   -20.806 54.251 1.00 53.70  ? 60   LEU E N     1 
ATOM   3211  C  CA    . LEU E  1 60  ? 4.623   -22.055 54.424 1.00 53.90  ? 60   LEU E CA    1 
ATOM   3212  C  C     . LEU E  1 60  ? 5.018   -22.749 55.723 1.00 53.90  ? 60   LEU E C     1 
ATOM   3213  O  O     . LEU E  1 60  ? 6.174   -22.721 56.160 1.00 54.34  ? 60   LEU E O     1 
ATOM   3214  C  CB    . LEU E  1 60  ? 4.819   -22.987 53.235 1.00 53.77  ? 60   LEU E CB    1 
ATOM   3215  C  CG    . LEU E  1 60  ? 4.427   -22.357 51.893 1.00 54.17  ? 60   LEU E CG    1 
ATOM   3216  C  CD1   . LEU E  1 60  ? 4.986   -23.145 50.754 1.00 50.85  ? 60   LEU E CD1   1 
ATOM   3217  C  CD2   . LEU E  1 60  ? 2.890   -22.151 51.758 1.00 54.53  ? 60   LEU E CD2   1 
ATOM   3218  N  N     . LEU E  1 61  ? 4.034   -23.346 56.353 1.00 53.74  ? 61   LEU E N     1 
ATOM   3219  C  CA    . LEU E  1 61  ? 4.196   -23.832 57.697 1.00 53.65  ? 61   LEU E CA    1 
ATOM   3220  C  C     . LEU E  1 61  ? 4.418   -25.346 57.769 1.00 53.64  ? 61   LEU E C     1 
ATOM   3221  O  O     . LEU E  1 61  ? 4.782   -25.867 58.828 1.00 53.63  ? 61   LEU E O     1 
ATOM   3222  C  CB    . LEU E  1 61  ? 2.978   -23.410 58.513 1.00 53.68  ? 61   LEU E CB    1 
ATOM   3223  C  CG    . LEU E  1 61  ? 2.791   -21.899 58.614 1.00 53.51  ? 61   LEU E CG    1 
ATOM   3224  C  CD1   . LEU E  1 61  ? 1.513   -21.568 59.389 1.00 51.53  ? 61   LEU E CD1   1 
ATOM   3225  C  CD2   . LEU E  1 61  ? 4.046   -21.295 59.277 1.00 52.08  ? 61   LEU E CD2   1 
ATOM   3226  N  N     . ILE E  1 62  ? 4.183   -26.030 56.645 1.00 53.61  ? 62   ILE E N     1 
ATOM   3227  C  CA    . ILE E  1 62  ? 4.395   -27.462 56.495 1.00 53.48  ? 62   ILE E CA    1 
ATOM   3228  C  C     . ILE E  1 62  ? 5.719   -27.601 55.800 1.00 53.75  ? 62   ILE E C     1 
ATOM   3229  O  O     . ILE E  1 62  ? 5.963   -26.862 54.851 1.00 53.91  ? 62   ILE E O     1 
ATOM   3230  C  CB    . ILE E  1 62  ? 3.296   -28.117 55.599 1.00 53.50  ? 62   ILE E CB    1 
ATOM   3231  C  CG1   . ILE E  1 62  ? 1.933   -28.150 56.306 1.00 53.52  ? 62   ILE E CG1   1 
ATOM   3232  C  CG2   . ILE E  1 62  ? 3.679   -29.567 55.168 1.00 53.59  ? 62   ILE E CG2   1 
ATOM   3233  C  CD1   . ILE E  1 62  ? 0.763   -28.447 55.353 1.00 53.08  ? 62   ILE E CD1   1 
ATOM   3234  N  N     . ARG E  1 63  ? 6.561   -28.546 56.249 1.00 54.34  ? 63   ARG E N     1 
ATOM   3235  C  CA    . ARG E  1 63  ? 7.887   -28.787 55.638 1.00 54.57  ? 63   ARG E CA    1 
ATOM   3236  C  C     . ARG E  1 63  ? 7.700   -29.271 54.205 1.00 54.19  ? 63   ARG E C     1 
ATOM   3237  O  O     . ARG E  1 63  ? 6.752   -29.974 53.910 1.00 53.52  ? 63   ARG E O     1 
ATOM   3238  C  CB    . ARG E  1 63  ? 8.695   -29.810 56.427 1.00 55.34  ? 63   ARG E CB    1 
ATOM   3239  C  CG    . ARG E  1 63  ? 8.992   -29.515 57.884 1.00 57.91  ? 63   ARG E CG    1 
ATOM   3240  C  CD    . ARG E  1 63  ? 10.234  -28.650 58.046 1.00 64.18  ? 63   ARG E CD    1 
ATOM   3241  N  NE    . ARG E  1 63  ? 9.865   -27.277 58.410 1.00 68.85  ? 63   ARG E NE    1 
ATOM   3242  C  CZ    . ARG E  1 63  ? 10.009  -26.218 57.617 1.00 70.19  ? 63   ARG E CZ    1 
ATOM   3243  N  NH1   . ARG E  1 63  ? 10.546  -26.350 56.405 1.00 71.35  ? 63   ARG E NH1   1 
ATOM   3244  N  NH2   . ARG E  1 63  ? 9.631   -25.020 58.045 1.00 69.91  ? 63   ARG E NH2   1 
ATOM   3245  N  N     . LYS E  1 64  ? 8.596   -28.869 53.314 1.00 54.58  ? 64   LYS E N     1 
ATOM   3246  C  CA    . LYS E  1 64  ? 8.371   -29.040 51.881 1.00 55.37  ? 64   LYS E CA    1 
ATOM   3247  C  C     . LYS E  1 64  ? 8.339   -30.504 51.469 1.00 55.29  ? 64   LYS E C     1 
ATOM   3248  O  O     . LYS E  1 64  ? 7.367   -30.973 50.876 1.00 55.80  ? 64   LYS E O     1 
ATOM   3249  C  CB    . LYS E  1 64  ? 9.437   -28.303 51.065 1.00 55.63  ? 64   LYS E CB    1 
ATOM   3250  C  CG    . LYS E  1 64  ? 9.295   -26.819 51.050 1.00 59.33  ? 64   LYS E CG    1 
ATOM   3251  C  CD    . LYS E  1 64  ? 9.916   -26.237 49.777 1.00 67.18  ? 64   LYS E CD    1 
ATOM   3252  C  CE    . LYS E  1 64  ? 10.075  -24.690 49.826 1.00 69.01  ? 64   LYS E CE    1 
ATOM   3253  N  NZ    . LYS E  1 64  ? 8.987   -23.980 50.588 1.00 70.87  ? 64   LYS E NZ    1 
ATOM   3254  N  N     . LEU E  1 65  ? 9.414   -31.219 51.781 1.00 55.08  ? 65   LEU E N     1 
ATOM   3255  C  CA    . LEU E  1 65  ? 9.587   -32.586 51.321 1.00 54.44  ? 65   LEU E CA    1 
ATOM   3256  C  C     . LEU E  1 65  ? 8.514   -33.542 51.866 1.00 53.47  ? 65   LEU E C     1 
ATOM   3257  O  O     . LEU E  1 65  ? 7.938   -34.298 51.107 1.00 53.71  ? 65   LEU E O     1 
ATOM   3258  C  CB    . LEU E  1 65  ? 10.999  -33.073 51.631 1.00 54.59  ? 65   LEU E CB    1 
ATOM   3259  C  CG    . LEU E  1 65  ? 11.354  -34.504 51.219 1.00 54.60  ? 65   LEU E CG    1 
ATOM   3260  C  CD1   . LEU E  1 65  ? 11.388  -34.663 49.705 1.00 54.06  ? 65   LEU E CD1   1 
ATOM   3261  C  CD2   . LEU E  1 65  ? 12.693  -34.771 51.819 1.00 53.37  ? 65   LEU E CD2   1 
ATOM   3262  N  N     . PRO E  1 66  ? 8.223   -33.497 53.168 1.00 52.76  ? 66   PRO E N     1 
ATOM   3263  C  CA    . PRO E  1 66  ? 7.104   -34.329 53.602 1.00 52.74  ? 66   PRO E CA    1 
ATOM   3264  C  C     . PRO E  1 66  ? 5.846   -34.054 52.764 1.00 52.91  ? 66   PRO E C     1 
ATOM   3265  O  O     . PRO E  1 66  ? 5.097   -34.977 52.419 1.00 53.08  ? 66   PRO E O     1 
ATOM   3266  C  CB    . PRO E  1 66  ? 6.859   -33.878 55.038 1.00 52.82  ? 66   PRO E CB    1 
ATOM   3267  C  CG    . PRO E  1 66  ? 8.172   -33.288 55.491 1.00 53.21  ? 66   PRO E CG    1 
ATOM   3268  C  CD    . PRO E  1 66  ? 8.844   -32.749 54.274 1.00 52.69  ? 66   PRO E CD    1 
ATOM   3269  N  N     . PHE E  1 67  ? 5.623   -32.784 52.426 1.00 52.65  ? 67   PHE E N     1 
ATOM   3270  C  CA    . PHE E  1 67  ? 4.455   -32.429 51.643 1.00 51.45  ? 67   PHE E CA    1 
ATOM   3271  C  C     . PHE E  1 67  ? 4.520   -32.931 50.198 1.00 51.83  ? 67   PHE E C     1 
ATOM   3272  O  O     . PHE E  1 67  ? 3.509   -33.338 49.649 1.00 52.00  ? 67   PHE E O     1 
ATOM   3273  C  CB    . PHE E  1 67  ? 4.177   -30.928 51.681 1.00 49.89  ? 67   PHE E CB    1 
ATOM   3274  C  CG    . PHE E  1 67  ? 2.893   -30.559 50.995 1.00 46.05  ? 67   PHE E CG    1 
ATOM   3275  C  CD1   . PHE E  1 67  ? 1.702   -30.636 51.669 1.00 41.06  ? 67   PHE E CD1   1 
ATOM   3276  C  CD2   . PHE E  1 67  ? 2.885   -30.201 49.654 1.00 42.56  ? 67   PHE E CD2   1 
ATOM   3277  C  CE1   . PHE E  1 67  ? 0.539   -30.332 51.041 1.00 41.85  ? 67   PHE E CE1   1 
ATOM   3278  C  CE2   . PHE E  1 67  ? 1.713   -29.907 49.015 1.00 40.40  ? 67   PHE E CE2   1 
ATOM   3279  C  CZ    . PHE E  1 67  ? 0.538   -29.968 49.705 1.00 42.11  ? 67   PHE E CZ    1 
ATOM   3280  N  N     . GLN E  1 68  ? 5.694   -32.882 49.590 1.00 52.57  ? 68   GLN E N     1 
ATOM   3281  C  CA    . GLN E  1 68  ? 5.865   -33.328 48.221 1.00 54.04  ? 68   GLN E CA    1 
ATOM   3282  C  C     . GLN E  1 68  ? 5.581   -34.831 48.110 1.00 54.72  ? 68   GLN E C     1 
ATOM   3283  O  O     . GLN E  1 68  ? 4.983   -35.289 47.119 1.00 55.40  ? 68   GLN E O     1 
ATOM   3284  C  CB    . GLN E  1 68  ? 7.274   -33.029 47.744 1.00 54.03  ? 68   GLN E CB    1 
ATOM   3285  C  CG    . GLN E  1 68  ? 7.332   -32.815 46.260 1.00 59.08  ? 68   GLN E CG    1 
ATOM   3286  C  CD    . GLN E  1 68  ? 8.728   -32.486 45.718 1.00 66.95  ? 68   GLN E CD    1 
ATOM   3287  O  OE1   . GLN E  1 68  ? 9.769   -33.032 46.171 1.00 69.78  ? 68   GLN E OE1   1 
ATOM   3288  N  NE2   . GLN E  1 68  ? 8.750   -31.605 44.709 1.00 69.06  ? 68   GLN E NE2   1 
ATOM   3289  N  N     . ARG E  1 69  ? 5.992   -35.584 49.135 1.00 54.54  ? 69   ARG E N     1 
ATOM   3290  C  CA    . ARG E  1 69  ? 5.792   -37.033 49.192 1.00 54.23  ? 69   ARG E CA    1 
ATOM   3291  C  C     . ARG E  1 69  ? 4.327   -37.402 49.250 1.00 53.86  ? 69   ARG E C     1 
ATOM   3292  O  O     . ARG E  1 69  ? 3.882   -38.292 48.527 1.00 54.72  ? 69   ARG E O     1 
ATOM   3293  C  CB    . ARG E  1 69  ? 6.473   -37.614 50.422 1.00 54.61  ? 69   ARG E CB    1 
ATOM   3294  C  CG    . ARG E  1 69  ? 7.924   -37.938 50.243 1.00 54.01  ? 69   ARG E CG    1 
ATOM   3295  C  CD    . ARG E  1 69  ? 8.368   -38.800 51.407 1.00 54.25  ? 69   ARG E CD    1 
ATOM   3296  N  NE    . ARG E  1 69  ? 9.287   -38.119 52.305 1.00 54.45  ? 69   ARG E NE    1 
ATOM   3297  C  CZ    . ARG E  1 69  ? 9.047   -37.869 53.582 1.00 53.69  ? 69   ARG E CZ    1 
ATOM   3298  N  NH1   . ARG E  1 69  ? 7.919   -38.231 54.152 1.00 55.01  ? 69   ARG E NH1   1 
ATOM   3299  N  NH2   . ARG E  1 69  ? 9.957   -37.257 54.290 1.00 55.06  ? 69   ARG E NH2   1 
ATOM   3300  N  N     . LEU E  1 70  ? 3.596   -36.723 50.130 1.00 52.93  ? 70   LEU E N     1 
ATOM   3301  C  CA    . LEU E  1 70  ? 2.147   -36.884 50.255 1.00 52.03  ? 70   LEU E CA    1 
ATOM   3302  C  C     . LEU E  1 70  ? 1.445   -36.632 48.933 1.00 51.23  ? 70   LEU E C     1 
ATOM   3303  O  O     . LEU E  1 70  ? 0.519   -37.329 48.556 1.00 50.75  ? 70   LEU E O     1 
ATOM   3304  C  CB    . LEU E  1 70  ? 1.593   -35.946 51.326 1.00 51.70  ? 70   LEU E CB    1 
ATOM   3305  C  CG    . LEU E  1 70  ? 0.074   -35.985 51.558 1.00 52.75  ? 70   LEU E CG    1 
ATOM   3306  C  CD1   . LEU E  1 70  ? -0.476  -37.417 51.811 1.00 49.99  ? 70   LEU E CD1   1 
ATOM   3307  C  CD2   . LEU E  1 70  ? -0.315  -34.989 52.679 1.00 52.01  ? 70   LEU E CD2   1 
ATOM   3308  N  N     . VAL E  1 71  ? 1.898   -35.622 48.222 1.00 51.08  ? 71   VAL E N     1 
ATOM   3309  C  CA    . VAL E  1 71  ? 1.324   -35.333 46.921 1.00 50.77  ? 71   VAL E CA    1 
ATOM   3310  C  C     . VAL E  1 71  ? 1.558   -36.488 45.950 1.00 50.41  ? 71   VAL E C     1 
ATOM   3311  O  O     . VAL E  1 71  ? 0.624   -36.926 45.296 1.00 50.44  ? 71   VAL E O     1 
ATOM   3312  C  CB    . VAL E  1 71  ? 1.805   -33.957 46.408 1.00 50.49  ? 71   VAL E CB    1 
ATOM   3313  C  CG1   . VAL E  1 71  ? 1.500   -33.759 44.931 1.00 49.79  ? 71   VAL E CG1   1 
ATOM   3314  C  CG2   . VAL E  1 71  ? 1.141   -32.881 47.243 1.00 49.35  ? 71   VAL E CG2   1 
ATOM   3315  N  N     . ARG E  1 72  ? 2.786   -36.993 45.894 1.00 50.28  ? 72   ARG E N     1 
ATOM   3316  C  CA    . ARG E  1 72  ? 3.133   -38.136 45.032 1.00 50.50  ? 72   ARG E CA    1 
ATOM   3317  C  C     . ARG E  1 72  ? 2.435   -39.471 45.404 1.00 50.56  ? 72   ARG E C     1 
ATOM   3318  O  O     . ARG E  1 72  ? 1.940   -40.191 44.532 1.00 50.41  ? 72   ARG E O     1 
ATOM   3319  C  CB    . ARG E  1 72  ? 4.634   -38.294 44.988 1.00 50.34  ? 72   ARG E CB    1 
ATOM   3320  C  CG    . ARG E  1 72  ? 5.284   -37.126 44.269 1.00 53.18  ? 72   ARG E CG    1 
ATOM   3321  C  CD    . ARG E  1 72  ? 6.770   -37.220 44.328 1.00 58.06  ? 72   ARG E CD    1 
ATOM   3322  N  NE    . ARG E  1 72  ? 7.413   -35.944 44.046 1.00 62.98  ? 72   ARG E NE    1 
ATOM   3323  C  CZ    . ARG E  1 72  ? 7.696   -35.474 42.830 1.00 64.81  ? 72   ARG E CZ    1 
ATOM   3324  N  NH1   . ARG E  1 72  ? 7.369   -36.149 41.738 1.00 64.91  ? 72   ARG E NH1   1 
ATOM   3325  N  NH2   . ARG E  1 72  ? 8.296   -34.295 42.707 1.00 67.44  ? 72   ARG E NH2   1 
ATOM   3326  N  N     . GLU E  1 73  ? 2.377   -39.780 46.690 1.00 49.64  ? 73   GLU E N     1 
ATOM   3327  C  CA    . GLU E  1 73  ? 1.561   -40.860 47.122 1.00 50.25  ? 73   GLU E CA    1 
ATOM   3328  C  C     . GLU E  1 73  ? 0.139   -40.778 46.567 1.00 50.23  ? 73   GLU E C     1 
ATOM   3329  O  O     . GLU E  1 73  ? -0.345  -41.737 45.972 1.00 50.92  ? 73   GLU E O     1 
ATOM   3330  C  CB    . GLU E  1 73  ? 1.565   -40.961 48.641 1.00 50.00  ? 73   GLU E CB    1 
ATOM   3331  C  CG    . GLU E  1 73  ? 0.800   -42.174 49.158 1.00 49.90  ? 73   GLU E CG    1 
ATOM   3332  C  CD    . GLU E  1 73  ? 0.785   -42.257 50.689 1.00 51.92  ? 73   GLU E CD    1 
ATOM   3333  O  OE1   . GLU E  1 73  ? 1.864   -42.076 51.319 1.00 55.47  ? 73   GLU E OE1   1 
ATOM   3334  O  OE2   . GLU E  1 73  ? -0.306  -42.486 51.275 1.00 53.39  ? 73   GLU E OE2   1 
ATOM   3335  N  N     . ILE E  1 74  ? -0.524  -39.640 46.744 1.00 50.57  ? 74   ILE E N     1 
ATOM   3336  C  CA    . ILE E  1 74  ? -1.953  -39.502 46.411 1.00 49.91  ? 74   ILE E CA    1 
ATOM   3337  C  C     . ILE E  1 74  ? -2.101  -39.549 44.901 1.00 50.05  ? 74   ILE E C     1 
ATOM   3338  O  O     . ILE E  1 74  ? -2.979  -40.221 44.370 1.00 49.81  ? 74   ILE E O     1 
ATOM   3339  C  CB    . ILE E  1 74  ? -2.579  -38.201 47.029 1.00 49.75  ? 74   ILE E CB    1 
ATOM   3340  C  CG1   . ILE E  1 74  ? -2.755  -38.341 48.523 1.00 49.24  ? 74   ILE E CG1   1 
ATOM   3341  C  CG2   . ILE E  1 74  ? -3.968  -37.840 46.465 1.00 48.56  ? 74   ILE E CG2   1 
ATOM   3342  C  CD1   . ILE E  1 74  ? -3.005  -36.983 49.197 1.00 51.14  ? 74   ILE E CD1   1 
ATOM   3343  N  N     . ALA E  1 75  ? -1.224  -38.857 44.205 1.00 50.11  ? 75   ALA E N     1 
ATOM   3344  C  CA    . ALA E  1 75  ? -1.338  -38.800 42.761 1.00 51.19  ? 75   ALA E CA    1 
ATOM   3345  C  C     . ALA E  1 75  ? -1.126  -40.190 42.134 1.00 51.65  ? 75   ALA E C     1 
ATOM   3346  O  O     . ALA E  1 75  ? -1.839  -40.592 41.224 1.00 51.72  ? 75   ALA E O     1 
ATOM   3347  C  CB    . ALA E  1 75  ? -0.347  -37.743 42.187 1.00 50.37  ? 75   ALA E CB    1 
ATOM   3348  N  N     . GLN E  1 76  ? -0.137  -40.912 42.652 1.00 52.86  ? 76   GLN E N     1 
ATOM   3349  C  CA    . GLN E  1 76  ? 0.212   -42.252 42.190 1.00 53.63  ? 76   GLN E CA    1 
ATOM   3350  C  C     . GLN E  1 76  ? -0.961  -43.204 42.313 1.00 54.15  ? 76   GLN E C     1 
ATOM   3351  O  O     . GLN E  1 76  ? -1.217  -43.968 41.397 1.00 54.59  ? 76   GLN E O     1 
ATOM   3352  C  CB    . GLN E  1 76  ? 1.352   -42.782 43.023 1.00 53.60  ? 76   GLN E CB    1 
ATOM   3353  C  CG    . GLN E  1 76  ? 2.177   -43.851 42.370 1.00 53.96  ? 76   GLN E CG    1 
ATOM   3354  C  CD    . GLN E  1 76  ? 3.262   -44.324 43.303 1.00 54.16  ? 76   GLN E CD    1 
ATOM   3355  O  OE1   . GLN E  1 76  ? 3.059   -44.433 44.508 1.00 54.95  ? 76   GLN E OE1   1 
ATOM   3356  N  NE2   . GLN E  1 76  ? 4.424   -44.569 42.759 1.00 54.80  ? 76   GLN E NE2   1 
ATOM   3357  N  N     . ASP E  1 77  ? -1.663  -43.144 43.444 1.00 54.45  ? 77   ASP E N     1 
ATOM   3358  C  CA    . ASP E  1 77  ? -2.900  -43.842 43.605 1.00 55.30  ? 77   ASP E CA    1 
ATOM   3359  C  C     . ASP E  1 77  ? -3.985  -43.500 42.570 1.00 57.09  ? 77   ASP E C     1 
ATOM   3360  O  O     . ASP E  1 77  ? -4.950  -44.255 42.444 1.00 58.38  ? 77   ASP E O     1 
ATOM   3361  C  CB    . ASP E  1 77  ? -3.435  -43.670 45.010 1.00 54.77  ? 77   ASP E CB    1 
ATOM   3362  C  CG    . ASP E  1 77  ? -2.624  -44.420 46.043 1.00 55.49  ? 77   ASP E CG    1 
ATOM   3363  O  OD1   . ASP E  1 77  ? -1.814  -45.285 45.672 1.00 57.81  ? 77   ASP E OD1   1 
ATOM   3364  O  OD2   . ASP E  1 77  ? -2.799  -44.169 47.253 1.00 56.80  ? 77   ASP E OD2   1 
ATOM   3365  N  N     . PHE E  1 78  ? -3.850  -42.404 41.820 1.00 58.72  ? 78   PHE E N     1 
ATOM   3366  C  CA    . PHE E  1 78  ? -4.777  -42.131 40.703 1.00 60.23  ? 78   PHE E CA    1 
ATOM   3367  C  C     . PHE E  1 78  ? -4.168  -42.577 39.386 1.00 61.41  ? 78   PHE E C     1 
ATOM   3368  O  O     . PHE E  1 78  ? -4.861  -43.031 38.500 1.00 61.52  ? 78   PHE E O     1 
ATOM   3369  C  CB    . PHE E  1 78  ? -5.155  -40.640 40.595 1.00 59.90  ? 78   PHE E CB    1 
ATOM   3370  C  CG    . PHE E  1 78  ? -6.203  -40.203 41.581 1.00 61.60  ? 78   PHE E CG    1 
ATOM   3371  C  CD1   . PHE E  1 78  ? -5.899  -39.277 42.591 1.00 62.32  ? 78   PHE E CD1   1 
ATOM   3372  C  CD2   . PHE E  1 78  ? -7.495  -40.715 41.527 1.00 62.68  ? 78   PHE E CD2   1 
ATOM   3373  C  CE1   . PHE E  1 78  ? -6.869  -38.870 43.547 1.00 60.38  ? 78   PHE E CE1   1 
ATOM   3374  C  CE2   . PHE E  1 78  ? -8.480  -40.296 42.481 1.00 63.53  ? 78   PHE E CE2   1 
ATOM   3375  C  CZ    . PHE E  1 78  ? -8.152  -39.363 43.487 1.00 60.00  ? 78   PHE E CZ    1 
ATOM   3376  N  N     . LYS E  1 79  ? -2.867  -42.417 39.241 1.00 63.39  ? 79   LYS E N     1 
ATOM   3377  C  CA    . LYS E  1 79  ? -2.230  -42.687 37.968 1.00 65.45  ? 79   LYS E CA    1 
ATOM   3378  C  C     . LYS E  1 79  ? -0.736  -42.809 38.185 1.00 66.62  ? 79   LYS E C     1 
ATOM   3379  O  O     . LYS E  1 79  ? -0.099  -41.907 38.734 1.00 67.70  ? 79   LYS E O     1 
ATOM   3380  C  CB    . LYS E  1 79  ? -2.513  -41.549 37.003 1.00 65.58  ? 79   LYS E CB    1 
ATOM   3381  C  CG    . LYS E  1 79  ? -2.720  -41.986 35.572 1.00 67.71  ? 79   LYS E CG    1 
ATOM   3382  C  CD    . LYS E  1 79  ? -1.417  -42.203 34.847 1.00 69.64  ? 79   LYS E CD    1 
ATOM   3383  C  CE    . LYS E  1 79  ? -1.629  -43.036 33.608 1.00 69.88  ? 79   LYS E CE    1 
ATOM   3384  N  NZ    . LYS E  1 79  ? -0.341  -43.693 33.250 1.00 71.56  ? 79   LYS E NZ    1 
ATOM   3385  N  N     . THR E  1 80  ? -0.181  -43.934 37.769 1.00 67.64  ? 80   THR E N     1 
ATOM   3386  C  CA    . THR E  1 80  ? 1.245   -44.190 37.925 1.00 68.61  ? 80   THR E CA    1 
ATOM   3387  C  C     . THR E  1 80  ? 2.076   -43.456 36.878 1.00 69.02  ? 80   THR E C     1 
ATOM   3388  O  O     . THR E  1 80  ? 1.564   -43.082 35.814 1.00 68.61  ? 80   THR E O     1 
ATOM   3389  C  CB    . THR E  1 80  ? 1.549   -45.679 37.779 1.00 68.71  ? 80   THR E CB    1 
ATOM   3390  O  OG1   . THR E  1 80  ? 1.086   -46.124 36.490 1.00 69.30  ? 80   THR E OG1   1 
ATOM   3391  C  CG2   . THR E  1 80  ? 0.886   -46.473 38.906 1.00 68.31  ? 80   THR E CG2   1 
ATOM   3392  N  N     . ASP E  1 81  ? 3.361   -43.279 37.201 1.00 69.82  ? 81   ASP E N     1 
ATOM   3393  C  CA    . ASP E  1 81  ? 4.361   -42.673 36.307 1.00 71.00  ? 81   ASP E CA    1 
ATOM   3394  C  C     . ASP E  1 81  ? 4.140   -41.188 35.988 1.00 70.58  ? 81   ASP E C     1 
ATOM   3395  O  O     . ASP E  1 81  ? 4.427   -40.741 34.885 1.00 71.30  ? 81   ASP E O     1 
ATOM   3396  C  CB    . ASP E  1 81  ? 4.499   -43.508 35.027 1.00 71.63  ? 81   ASP E CB    1 
ATOM   3397  C  CG    . ASP E  1 81  ? 4.712   -44.987 35.330 1.00 75.53  ? 81   ASP E CG    1 
ATOM   3398  O  OD1   . ASP E  1 81  ? 3.761   -45.788 35.087 1.00 79.93  ? 81   ASP E OD1   1 
ATOM   3399  O  OD2   . ASP E  1 81  ? 5.813   -45.339 35.850 1.00 78.07  ? 81   ASP E OD2   1 
ATOM   3400  N  N     . LEU E  1 82  ? 3.627   -40.429 36.955 1.00 70.12  ? 82   LEU E N     1 
ATOM   3401  C  CA    . LEU E  1 82  ? 3.457   -38.983 36.800 1.00 68.82  ? 82   LEU E CA    1 
ATOM   3402  C  C     . LEU E  1 82  ? 4.657   -38.212 37.345 1.00 68.42  ? 82   LEU E C     1 
ATOM   3403  O  O     . LEU E  1 82  ? 5.289   -38.600 38.321 1.00 68.50  ? 82   LEU E O     1 
ATOM   3404  C  CB    . LEU E  1 82  ? 2.184   -38.498 37.492 1.00 68.52  ? 82   LEU E CB    1 
ATOM   3405  C  CG    . LEU E  1 82  ? 0.818   -38.894 36.934 1.00 67.73  ? 82   LEU E CG    1 
ATOM   3406  C  CD1   . LEU E  1 82  ? -0.261  -38.714 38.007 1.00 66.32  ? 82   LEU E CD1   1 
ATOM   3407  C  CD2   . LEU E  1 82  ? 0.488   -38.083 35.695 1.00 66.40  ? 82   LEU E CD2   1 
ATOM   3408  N  N     . ARG E  1 83  ? 4.958   -37.105 36.697 1.00 67.87  ? 83   ARG E N     1 
ATOM   3409  C  CA    . ARG E  1 83  ? 5.909   -36.153 37.220 1.00 67.40  ? 83   ARG E CA    1 
ATOM   3410  C  C     . ARG E  1 83  ? 5.200   -34.855 37.620 1.00 65.94  ? 83   ARG E C     1 
ATOM   3411  O  O     . ARG E  1 83  ? 4.081   -34.586 37.186 1.00 65.25  ? 83   ARG E O     1 
ATOM   3412  C  CB    . ARG E  1 83  ? 6.966   -35.875 36.164 1.00 68.03  ? 83   ARG E CB    1 
ATOM   3413  C  CG    . ARG E  1 83  ? 7.891   -37.016 35.989 1.00 70.53  ? 83   ARG E CG    1 
ATOM   3414  C  CD    . ARG E  1 83  ? 8.313   -37.148 34.557 1.00 75.62  ? 83   ARG E CD    1 
ATOM   3415  N  NE    . ARG E  1 83  ? 9.677   -37.663 34.487 1.00 80.37  ? 83   ARG E NE    1 
ATOM   3416  C  CZ    . ARG E  1 83  ? 10.750  -36.900 34.294 1.00 83.20  ? 83   ARG E CZ    1 
ATOM   3417  N  NH1   . ARG E  1 83  ? 10.615  -35.581 34.124 1.00 84.40  ? 83   ARG E NH1   1 
ATOM   3418  N  NH2   . ARG E  1 83  ? 11.957  -37.456 34.250 1.00 84.67  ? 83   ARG E NH2   1 
ATOM   3419  N  N     . PHE E  1 84  ? 5.874   -34.066 38.453 1.00 64.53  ? 84   PHE E N     1 
ATOM   3420  C  CA    . PHE E  1 84  ? 5.360   -32.790 38.915 1.00 63.23  ? 84   PHE E CA    1 
ATOM   3421  C  C     . PHE E  1 84  ? 6.368   -31.682 38.702 1.00 62.56  ? 84   PHE E C     1 
ATOM   3422  O  O     . PHE E  1 84  ? 7.536   -31.837 39.060 1.00 62.61  ? 84   PHE E O     1 
ATOM   3423  C  CB    . PHE E  1 84  ? 5.043   -32.869 40.392 1.00 62.78  ? 84   PHE E CB    1 
ATOM   3424  C  CG    . PHE E  1 84  ? 3.764   -33.566 40.699 1.00 63.20  ? 84   PHE E CG    1 
ATOM   3425  C  CD1   . PHE E  1 84  ? 3.705   -34.961 40.770 1.00 63.20  ? 84   PHE E CD1   1 
ATOM   3426  C  CD2   . PHE E  1 84  ? 2.607   -32.833 40.944 1.00 63.31  ? 84   PHE E CD2   1 
ATOM   3427  C  CE1   . PHE E  1 84  ? 2.505   -35.611 41.079 1.00 62.33  ? 84   PHE E CE1   1 
ATOM   3428  C  CE2   . PHE E  1 84  ? 1.396   -33.482 41.255 1.00 63.06  ? 84   PHE E CE2   1 
ATOM   3429  C  CZ    . PHE E  1 84  ? 1.352   -34.865 41.328 1.00 62.35  ? 84   PHE E CZ    1 
ATOM   3430  N  N     . GLN E  1 85  ? 5.928   -30.566 38.118 1.00 61.44  ? 85   GLN E N     1 
ATOM   3431  C  CA    . GLN E  1 85  ? 6.732   -29.362 38.129 1.00 60.57  ? 85   GLN E CA    1 
ATOM   3432  C  C     . GLN E  1 85  ? 6.780   -28.953 39.573 1.00 60.23  ? 85   GLN E C     1 
ATOM   3433  O  O     . GLN E  1 85  ? 5.803   -29.121 40.293 1.00 60.64  ? 85   GLN E O     1 
ATOM   3434  C  CB    . GLN E  1 85  ? 6.070   -28.260 37.330 1.00 60.84  ? 85   GLN E CB    1 
ATOM   3435  C  CG    . GLN E  1 85  ? 6.041   -28.469 35.824 1.00 61.93  ? 85   GLN E CG    1 
ATOM   3436  C  CD    . GLN E  1 85  ? 5.321   -27.342 35.118 1.00 64.24  ? 85   GLN E CD    1 
ATOM   3437  O  OE1   . GLN E  1 85  ? 4.698   -26.479 35.761 1.00 64.99  ? 85   GLN E OE1   1 
ATOM   3438  N  NE2   . GLN E  1 85  ? 5.401   -27.331 33.791 1.00 65.32  ? 85   GLN E NE2   1 
ATOM   3439  N  N     . SER E  1 86  ? 7.903   -28.434 40.030 1.00 59.69  ? 86   SER E N     1 
ATOM   3440  C  CA    . SER E  1 86  ? 7.978   -28.046 41.423 1.00 59.62  ? 86   SER E CA    1 
ATOM   3441  C  C     . SER E  1 86  ? 6.961   -26.963 41.738 1.00 59.07  ? 86   SER E C     1 
ATOM   3442  O  O     . SER E  1 86  ? 6.542   -26.837 42.876 1.00 59.54  ? 86   SER E O     1 
ATOM   3443  C  CB    . SER E  1 86  ? 9.366   -27.550 41.778 1.00 60.03  ? 86   SER E CB    1 
ATOM   3444  O  OG    . SER E  1 86  ? 9.793   -26.602 40.818 1.00 61.18  ? 86   SER E OG    1 
ATOM   3445  N  N     . SER E  1 87  ? 6.566   -26.175 40.745 1.00 58.27  ? 87   SER E N     1 
ATOM   3446  C  CA    . SER E  1 87  ? 5.589   -25.117 41.002 1.00 57.88  ? 87   SER E CA    1 
ATOM   3447  C  C     . SER E  1 87  ? 4.197   -25.697 41.168 1.00 57.10  ? 87   SER E C     1 
ATOM   3448  O  O     . SER E  1 87  ? 3.369   -25.103 41.857 1.00 57.63  ? 87   SER E O     1 
ATOM   3449  C  CB    . SER E  1 87  ? 5.607   -24.020 39.934 1.00 57.68  ? 87   SER E CB    1 
ATOM   3450  O  OG    . SER E  1 87  ? 5.331   -24.555 38.646 1.00 59.58  ? 87   SER E OG    1 
ATOM   3451  N  N     . ALA E  1 88  ? 3.944   -26.866 40.578 1.00 55.95  ? 88   ALA E N     1 
ATOM   3452  C  CA    . ALA E  1 88  ? 2.664   -27.555 40.793 1.00 54.46  ? 88   ALA E CA    1 
ATOM   3453  C  C     . ALA E  1 88  ? 2.533   -27.947 42.246 1.00 53.94  ? 88   ALA E C     1 
ATOM   3454  O  O     . ALA E  1 88  ? 1.491   -27.741 42.843 1.00 53.93  ? 88   ALA E O     1 
ATOM   3455  C  CB    . ALA E  1 88  ? 2.525   -28.731 39.906 1.00 53.80  ? 88   ALA E CB    1 
ATOM   3456  N  N     . VAL E  1 89  ? 3.608   -28.468 42.831 1.00 53.94  ? 89   VAL E N     1 
ATOM   3457  C  CA    . VAL E  1 89  ? 3.588   -28.889 44.236 1.00 53.41  ? 89   VAL E CA    1 
ATOM   3458  C  C     . VAL E  1 89  ? 3.453   -27.699 45.147 1.00 53.32  ? 89   VAL E C     1 
ATOM   3459  O  O     . VAL E  1 89  ? 2.632   -27.711 46.066 1.00 53.71  ? 89   VAL E O     1 
ATOM   3460  C  CB    . VAL E  1 89  ? 4.821   -29.728 44.657 1.00 53.36  ? 89   VAL E CB    1 
ATOM   3461  C  CG1   . VAL E  1 89  ? 4.693   -30.153 46.134 1.00 53.10  ? 89   VAL E CG1   1 
ATOM   3462  C  CG2   . VAL E  1 89  ? 4.941   -30.969 43.790 1.00 52.89  ? 89   VAL E CG2   1 
ATOM   3463  N  N     . MET E  1 90  ? 4.247   -26.665 44.886 1.00 53.50  ? 90   MET E N     1 
ATOM   3464  C  CA    . MET E  1 90  ? 4.132   -25.388 45.606 1.00 53.38  ? 90   MET E CA    1 
ATOM   3465  C  C     . MET E  1 90  ? 2.719   -24.766 45.502 1.00 51.42  ? 90   MET E C     1 
ATOM   3466  O  O     . MET E  1 90  ? 2.176   -24.287 46.499 1.00 50.63  ? 90   MET E O     1 
ATOM   3467  C  CB    . MET E  1 90  ? 5.207   -24.412 45.137 1.00 54.88  ? 90   MET E CB    1 
ATOM   3468  C  CG    . MET E  1 90  ? 6.657   -24.837 45.445 1.00 60.34  ? 90   MET E CG    1 
ATOM   3469  S  SD    . MET E  1 90  ? 6.914   -25.455 47.156 1.00 73.65  ? 90   MET E SD    1 
ATOM   3470  C  CE    . MET E  1 90  ? 6.689   -23.913 48.071 1.00 70.50  ? 90   MET E CE    1 
ATOM   3471  N  N     . ALA E  1 91  ? 2.119   -24.808 44.312 1.00 49.79  ? 91   ALA E N     1 
ATOM   3472  C  CA    . ALA E  1 91  ? 0.740   -24.336 44.138 1.00 48.83  ? 91   ALA E CA    1 
ATOM   3473  C  C     . ALA E  1 91  ? -0.231  -25.131 45.026 1.00 48.50  ? 91   ALA E C     1 
ATOM   3474  O  O     . ALA E  1 91  ? -1.087  -24.539 45.680 1.00 49.07  ? 91   ALA E O     1 
ATOM   3475  C  CB    . ALA E  1 91  ? 0.322   -24.379 42.679 1.00 47.55  ? 91   ALA E CB    1 
ATOM   3476  N  N     . LEU E  1 92  ? -0.059  -26.454 45.088 1.00 47.64  ? 92   LEU E N     1 
ATOM   3477  C  CA    . LEU E  1 92  ? -0.875  -27.310 45.955 1.00 47.03  ? 92   LEU E CA    1 
ATOM   3478  C  C     . LEU E  1 92  ? -0.666  -26.968 47.400 1.00 46.25  ? 92   LEU E C     1 
ATOM   3479  O  O     . LEU E  1 92  ? -1.616  -27.034 48.182 1.00 45.85  ? 92   LEU E O     1 
ATOM   3480  C  CB    . LEU E  1 92  ? -0.544  -28.799 45.759 1.00 46.94  ? 92   LEU E CB    1 
ATOM   3481  C  CG    . LEU E  1 92  ? -1.038  -29.404 44.448 1.00 47.25  ? 92   LEU E CG    1 
ATOM   3482  C  CD1   . LEU E  1 92  ? -0.281  -30.673 44.010 1.00 46.59  ? 92   LEU E CD1   1 
ATOM   3483  C  CD2   . LEU E  1 92  ? -2.528  -29.615 44.516 1.00 46.91  ? 92   LEU E CD2   1 
ATOM   3484  N  N     . GLN E  1 93  ? 0.568   -26.620 47.760 1.00 45.46  ? 93   GLN E N     1 
ATOM   3485  C  CA    . GLN E  1 93  ? 0.855   -26.309 49.157 1.00 45.72  ? 93   GLN E CA    1 
ATOM   3486  C  C     . GLN E  1 93  ? 0.245   -24.979 49.591 1.00 46.57  ? 93   GLN E C     1 
ATOM   3487  O  O     . GLN E  1 93  ? -0.269  -24.866 50.726 1.00 47.54  ? 93   GLN E O     1 
ATOM   3488  C  CB    . GLN E  1 93  ? 2.353   -26.386 49.499 1.00 44.74  ? 93   GLN E CB    1 
ATOM   3489  C  CG    . GLN E  1 93  ? 2.581   -26.758 50.967 1.00 44.98  ? 93   GLN E CG    1 
ATOM   3490  C  CD    . GLN E  1 93  ? 4.053   -26.807 51.379 1.00 46.02  ? 93   GLN E CD    1 
ATOM   3491  O  OE1   . GLN E  1 93  ? 4.920   -27.102 50.581 1.00 48.28  ? 93   GLN E OE1   1 
ATOM   3492  N  NE2   . GLN E  1 93  ? 4.329   -26.506 52.639 1.00 47.47  ? 93   GLN E NE2   1 
ATOM   3493  N  N     . GLU E  1 94  ? 0.306   -23.971 48.717 1.00 46.02  ? 94   GLU E N     1 
ATOM   3494  C  CA    . GLU E  1 94  ? -0.247  -22.678 49.040 1.00 45.33  ? 94   GLU E CA    1 
ATOM   3495  C  C     . GLU E  1 94  ? -1.748  -22.849 49.150 1.00 44.51  ? 94   GLU E C     1 
ATOM   3496  O  O     . GLU E  1 94  ? -2.393  -22.284 50.041 1.00 44.84  ? 94   GLU E O     1 
ATOM   3497  C  CB    . GLU E  1 94  ? 0.077   -21.640 47.953 1.00 46.64  ? 94   GLU E CB    1 
ATOM   3498  C  CG    . GLU E  1 94  ? 1.547   -21.119 47.894 1.00 48.49  ? 94   GLU E CG    1 
ATOM   3499  C  CD    . GLU E  1 94  ? 1.907   -20.114 49.012 1.00 52.97  ? 94   GLU E CD    1 
ATOM   3500  O  OE1   . GLU E  1 94  ? 1.019   -19.745 49.844 1.00 53.14  ? 94   GLU E OE1   1 
ATOM   3501  O  OE2   . GLU E  1 94  ? 3.104   -19.709 49.066 1.00 54.27  ? 94   GLU E OE2   1 
ATOM   3502  N  N     . ALA E  1 95  ? -2.322  -23.641 48.264 1.00 42.68  ? 95   ALA E N     1 
ATOM   3503  C  CA    . ALA E  1 95  ? -3.746  -23.834 48.324 1.00 41.79  ? 95   ALA E CA    1 
ATOM   3504  C  C     . ALA E  1 95  ? -4.182  -24.574 49.591 1.00 42.01  ? 95   ALA E C     1 
ATOM   3505  O  O     . ALA E  1 95  ? -5.138  -24.171 50.238 1.00 42.79  ? 95   ALA E O     1 
ATOM   3506  C  CB    . ALA E  1 95  ? -4.229  -24.500 47.098 1.00 40.98  ? 95   ALA E CB    1 
ATOM   3507  N  N     . SER E  1 96  ? -3.452  -25.611 49.974 1.00 42.39  ? 96   SER E N     1 
ATOM   3508  C  CA    . SER E  1 96  ? -3.813  -26.487 51.081 1.00 43.06  ? 96   SER E CA    1 
ATOM   3509  C  C     . SER E  1 96  ? -3.674  -25.811 52.415 1.00 43.44  ? 96   SER E C     1 
ATOM   3510  O  O     . SER E  1 96  ? -4.503  -26.002 53.309 1.00 43.00  ? 96   SER E O     1 
ATOM   3511  C  CB    . SER E  1 96  ? -2.890  -27.712 51.089 1.00 44.13  ? 96   SER E CB    1 
ATOM   3512  O  OG    . SER E  1 96  ? -3.063  -28.543 49.932 1.00 46.05  ? 96   SER E OG    1 
ATOM   3513  N  N     . GLU E  1 97  ? -2.583  -25.056 52.569 1.00 44.26  ? 97   GLU E N     1 
ATOM   3514  C  CA    . GLU E  1 97  ? -2.336  -24.263 53.775 1.00 44.03  ? 97   GLU E CA    1 
ATOM   3515  C  C     . GLU E  1 97  ? -3.321  -23.083 53.916 1.00 43.13  ? 97   GLU E C     1 
ATOM   3516  O  O     . GLU E  1 97  ? -3.778  -22.763 55.014 1.00 43.06  ? 97   GLU E O     1 
ATOM   3517  C  CB    . GLU E  1 97  ? -0.898  -23.797 53.820 1.00 44.25  ? 97   GLU E CB    1 
ATOM   3518  C  CG    . GLU E  1 97  ? 0.115   -24.920 53.863 1.00 49.31  ? 97   GLU E CG    1 
ATOM   3519  C  CD    . GLU E  1 97  ? 1.426   -24.564 54.634 1.00 54.25  ? 97   GLU E CD    1 
ATOM   3520  O  OE1   . GLU E  1 97  ? 1.486   -23.523 55.346 1.00 58.03  ? 97   GLU E OE1   1 
ATOM   3521  O  OE2   . GLU E  1 97  ? 2.410   -25.328 54.518 1.00 54.75  ? 97   GLU E OE2   1 
ATOM   3522  N  N     . ALA E  1 98  ? -3.686  -22.449 52.822 1.00 41.96  ? 98   ALA E N     1 
ATOM   3523  C  CA    . ALA E  1 98  ? -4.715  -21.421 52.954 1.00 42.15  ? 98   ALA E CA    1 
ATOM   3524  C  C     . ALA E  1 98  ? -6.022  -22.077 53.329 1.00 42.72  ? 98   ALA E C     1 
ATOM   3525  O  O     . ALA E  1 98  ? -6.786  -21.522 54.104 1.00 44.05  ? 98   ALA E O     1 
ATOM   3526  C  CB    . ALA E  1 98  ? -4.860  -20.586 51.700 1.00 40.09  ? 98   ALA E CB    1 
ATOM   3527  N  N     . TYR E  1 99  ? -6.283  -23.268 52.799 1.00 43.60  ? 99   TYR E N     1 
ATOM   3528  C  CA    . TYR E  1 99  ? -7.518  -23.961 53.120 1.00 43.49  ? 99   TYR E CA    1 
ATOM   3529  C  C     . TYR E  1 99  ? -7.574  -24.349 54.602 1.00 43.86  ? 99   TYR E C     1 
ATOM   3530  O  O     . TYR E  1 99  ? -8.586  -24.143 55.266 1.00 45.34  ? 99   TYR E O     1 
ATOM   3531  C  CB    . TYR E  1 99  ? -7.737  -25.153 52.199 1.00 43.64  ? 99   TYR E CB    1 
ATOM   3532  C  CG    . TYR E  1 99  ? -8.856  -26.041 52.649 1.00 43.90  ? 99   TYR E CG    1 
ATOM   3533  C  CD1   . TYR E  1 99  ? -10.175 -25.771 52.308 1.00 43.71  ? 99   TYR E CD1   1 
ATOM   3534  C  CD2   . TYR E  1 99  ? -8.597  -27.147 53.431 1.00 42.85  ? 99   TYR E CD2   1 
ATOM   3535  C  CE1   . TYR E  1 99  ? -11.192 -26.587 52.763 1.00 43.45  ? 99   TYR E CE1   1 
ATOM   3536  C  CE2   . TYR E  1 99  ? -9.590  -27.952 53.870 1.00 43.26  ? 99   TYR E CE2   1 
ATOM   3537  C  CZ    . TYR E  1 99  ? -10.876 -27.678 53.541 1.00 43.85  ? 99   TYR E CZ    1 
ATOM   3538  O  OH    . TYR E  1 99  ? -11.842 -28.521 54.022 1.00 46.53  ? 99   TYR E OH    1 
ATOM   3539  N  N     . LEU E  1 100 ? -6.488  -24.870 55.133 1.00 43.53  ? 100  LEU E N     1 
ATOM   3540  C  CA    . LEU E  1 100 ? -6.480  -25.332 56.502 1.00 43.16  ? 100  LEU E CA    1 
ATOM   3541  C  C     . LEU E  1 100 ? -6.508  -24.183 57.512 1.00 43.25  ? 100  LEU E C     1 
ATOM   3542  O  O     . LEU E  1 100 ? -7.216  -24.259 58.519 1.00 42.96  ? 100  LEU E O     1 
ATOM   3543  C  CB    . LEU E  1 100 ? -5.273  -26.269 56.732 1.00 43.99  ? 100  LEU E CB    1 
ATOM   3544  C  CG    . LEU E  1 100 ? -5.269  -27.682 56.080 1.00 44.19  ? 100  LEU E CG    1 
ATOM   3545  C  CD1   . LEU E  1 100 ? -4.026  -28.467 56.456 1.00 42.15  ? 100  LEU E CD1   1 
ATOM   3546  C  CD2   . LEU E  1 100 ? -6.544  -28.512 56.403 1.00 44.42  ? 100  LEU E CD2   1 
ATOM   3547  N  N     . VAL E  1 101 ? -5.730  -23.122 57.244 1.00 43.21  ? 101  VAL E N     1 
ATOM   3548  C  CA    . VAL E  1 101 ? -5.788  -21.872 58.039 1.00 42.62  ? 101  VAL E CA    1 
ATOM   3549  C  C     . VAL E  1 101 ? -7.220  -21.284 58.077 1.00 42.18  ? 101  VAL E C     1 
ATOM   3550  O  O     . VAL E  1 101 ? -7.728  -20.936 59.150 1.00 42.35  ? 101  VAL E O     1 
ATOM   3551  C  CB    . VAL E  1 101 ? -4.768  -20.805 57.554 1.00 43.10  ? 101  VAL E CB    1 
ATOM   3552  C  CG1   . VAL E  1 101 ? -4.997  -19.505 58.251 1.00 42.65  ? 101  VAL E CG1   1 
ATOM   3553  C  CG2   . VAL E  1 101 ? -3.304  -21.267 57.788 1.00 42.46  ? 101  VAL E CG2   1 
ATOM   3554  N  N     . ALA E  1 102 ? -7.892  -21.219 56.932 1.00 41.34  ? 102  ALA E N     1 
ATOM   3555  C  CA    . ALA E  1 102 ? -9.255  -20.712 56.920 1.00 41.42  ? 102  ALA E CA    1 
ATOM   3556  C  C     . ALA E  1 102 ? -10.209 -21.636 57.671 1.00 42.74  ? 102  ALA E C     1 
ATOM   3557  O  O     . ALA E  1 102 ? -11.109 -21.144 58.374 1.00 44.63  ? 102  ALA E O     1 
ATOM   3558  C  CB    . ALA E  1 102 ? -9.718  -20.478 55.549 1.00 39.85  ? 102  ALA E CB    1 
ATOM   3559  N  N     . LEU E  1 103 ? -10.031 -22.959 57.561 1.00 43.02  ? 103  LEU E N     1 
ATOM   3560  C  CA    . LEU E  1 103 ? -10.858 -23.899 58.324 1.00 42.91  ? 103  LEU E CA    1 
ATOM   3561  C  C     . LEU E  1 103 ? -10.637 -23.760 59.834 1.00 43.67  ? 103  LEU E C     1 
ATOM   3562  O  O     . LEU E  1 103 ? -11.579 -23.796 60.618 1.00 43.23  ? 103  LEU E O     1 
ATOM   3563  C  CB    . LEU E  1 103 ? -10.556 -25.308 57.887 1.00 42.91  ? 103  LEU E CB    1 
ATOM   3564  C  CG    . LEU E  1 103 ? -11.330 -26.416 58.578 1.00 43.54  ? 103  LEU E CG    1 
ATOM   3565  C  CD1   . LEU E  1 103 ? -12.803 -26.255 58.285 1.00 42.67  ? 103  LEU E CD1   1 
ATOM   3566  C  CD2   . LEU E  1 103 ? -10.809 -27.777 58.119 1.00 42.19  ? 103  LEU E CD2   1 
ATOM   3567  N  N     . PHE E  1 104 ? -9.389  -23.573 60.252 1.00 44.73  ? 104  PHE E N     1 
ATOM   3568  C  CA    . PHE E  1 104 ? -9.121  -23.361 61.663 1.00 45.87  ? 104  PHE E CA    1 
ATOM   3569  C  C     . PHE E  1 104 ? -9.787  -22.113 62.236 1.00 47.32  ? 104  PHE E C     1 
ATOM   3570  O  O     . PHE E  1 104 ? -10.271 -22.145 63.387 1.00 48.52  ? 104  PHE E O     1 
ATOM   3571  C  CB    . PHE E  1 104 ? -7.630  -23.392 61.956 1.00 45.55  ? 104  PHE E CB    1 
ATOM   3572  C  CG    . PHE E  1 104 ? -7.041  -24.786 62.002 1.00 46.31  ? 104  PHE E CG    1 
ATOM   3573  C  CD1   . PHE E  1 104 ? -5.942  -25.119 61.231 1.00 47.23  ? 104  PHE E CD1   1 
ATOM   3574  C  CD2   . PHE E  1 104 ? -7.587  -25.773 62.819 1.00 46.57  ? 104  PHE E CD2   1 
ATOM   3575  C  CE1   . PHE E  1 104 ? -5.378  -26.441 61.284 1.00 46.33  ? 104  PHE E CE1   1 
ATOM   3576  C  CE2   . PHE E  1 104 ? -7.027  -27.071 62.869 1.00 45.54  ? 104  PHE E CE2   1 
ATOM   3577  C  CZ    . PHE E  1 104 ? -5.923  -27.392 62.093 1.00 43.82  ? 104  PHE E CZ    1 
ATOM   3578  N  N     . GLU E  1 105 ? -9.844  -21.027 61.458 1.00 47.77  ? 105  GLU E N     1 
ATOM   3579  C  CA    . GLU E  1 105 ? -10.596 -19.842 61.885 1.00 48.50  ? 105  GLU E CA    1 
ATOM   3580  C  C     . GLU E  1 105 ? -12.073 -20.183 62.118 1.00 48.50  ? 105  GLU E C     1 
ATOM   3581  O  O     . GLU E  1 105 ? -12.621 -19.859 63.165 1.00 49.12  ? 105  GLU E O     1 
ATOM   3582  C  CB    . GLU E  1 105 ? -10.473 -18.686 60.871 1.00 48.81  ? 105  GLU E CB    1 
ATOM   3583  C  CG    . GLU E  1 105 ? -9.072  -18.158 60.634 1.00 50.96  ? 105  GLU E CG    1 
ATOM   3584  C  CD    . GLU E  1 105 ? -8.938  -17.443 59.308 1.00 56.05  ? 105  GLU E CD    1 
ATOM   3585  O  OE1   . GLU E  1 105 ? -9.997  -17.219 58.669 1.00 58.11  ? 105  GLU E OE1   1 
ATOM   3586  O  OE2   . GLU E  1 105 ? -7.780  -17.119 58.892 1.00 57.63  ? 105  GLU E OE2   1 
ATOM   3587  N  N     . ASP E  1 106 ? -12.713 -20.835 61.149 1.00 48.49  ? 106  ASP E N     1 
ATOM   3588  C  CA    . ASP E  1 106 ? -14.105 -21.293 61.306 1.00 48.73  ? 106  ASP E CA    1 
ATOM   3589  C  C     . ASP E  1 106 ? -14.255 -22.207 62.498 1.00 47.98  ? 106  ASP E C     1 
ATOM   3590  O  O     . ASP E  1 106 ? -15.251 -22.128 63.213 1.00 48.13  ? 106  ASP E O     1 
ATOM   3591  C  CB    . ASP E  1 106 ? -14.617 -22.004 60.045 1.00 49.00  ? 106  ASP E CB    1 
ATOM   3592  C  CG    . ASP E  1 106 ? -14.710 -21.066 58.826 1.00 52.80  ? 106  ASP E CG    1 
ATOM   3593  O  OD1   . ASP E  1 106 ? -14.403 -19.851 58.980 1.00 57.95  ? 106  ASP E OD1   1 
ATOM   3594  O  OD2   . ASP E  1 106 ? -15.094 -21.521 57.706 1.00 55.15  ? 106  ASP E OD2   1 
ATOM   3595  N  N     . THR E  1 107 ? -13.257 -23.064 62.709 1.00 47.62  ? 107  THR E N     1 
ATOM   3596  C  CA    . THR E  1 107 ? -13.306 -24.107 63.738 1.00 47.09  ? 107  THR E CA    1 
ATOM   3597  C  C     . THR E  1 107 ? -13.220 -23.392 65.068 1.00 47.16  ? 107  THR E C     1 
ATOM   3598  O  O     . THR E  1 107 ? -13.976 -23.692 65.992 1.00 46.77  ? 107  THR E O     1 
ATOM   3599  C  CB    . THR E  1 107 ? -12.108 -25.094 63.615 1.00 47.18  ? 107  THR E CB    1 
ATOM   3600  O  OG1   . THR E  1 107 ? -12.251 -25.903 62.445 1.00 46.44  ? 107  THR E OG1   1 
ATOM   3601  C  CG2   . THR E  1 107 ? -12.024 -25.992 64.811 1.00 45.59  ? 107  THR E CG2   1 
ATOM   3602  N  N     . ASN E  1 108 ? -12.294 -22.436 65.149 1.00 47.10  ? 108  ASN E N     1 
ATOM   3603  C  CA    . ASN E  1 108 ? -12.150 -21.618 66.344 1.00 47.22  ? 108  ASN E CA    1 
ATOM   3604  C  C     . ASN E  1 108 ? -13.448 -20.926 66.757 1.00 47.43  ? 108  ASN E C     1 
ATOM   3605  O  O     . ASN E  1 108 ? -13.805 -20.947 67.949 1.00 47.11  ? 108  ASN E O     1 
ATOM   3606  C  CB    . ASN E  1 108 ? -11.054 -20.593 66.170 1.00 47.10  ? 108  ASN E CB    1 
ATOM   3607  C  CG    . ASN E  1 108 ? -10.416 -20.217 67.482 1.00 47.67  ? 108  ASN E CG    1 
ATOM   3608  O  OD1   . ASN E  1 108 ? -10.531 -20.936 68.469 1.00 52.63  ? 108  ASN E OD1   1 
ATOM   3609  N  ND2   . ASN E  1 108 ? -9.715  -19.124 67.497 1.00 46.53  ? 108  ASN E ND2   1 
ATOM   3610  N  N     . LEU E  1 109 ? -14.163 -20.362 65.771 1.00 47.19  ? 109  LEU E N     1 
ATOM   3611  C  CA    . LEU E  1 109 ? -15.457 -19.739 66.009 1.00 47.68  ? 109  LEU E CA    1 
ATOM   3612  C  C     . LEU E  1 109 ? -16.481 -20.731 66.549 1.00 48.56  ? 109  LEU E C     1 
ATOM   3613  O  O     . LEU E  1 109 ? -17.280 -20.379 67.418 1.00 49.33  ? 109  LEU E O     1 
ATOM   3614  C  CB    . LEU E  1 109 ? -16.002 -19.089 64.742 1.00 47.16  ? 109  LEU E CB    1 
ATOM   3615  C  CG    . LEU E  1 109 ? -15.337 -17.811 64.230 1.00 46.77  ? 109  LEU E CG    1 
ATOM   3616  C  CD1   . LEU E  1 109 ? -15.970 -17.392 62.909 1.00 44.75  ? 109  LEU E CD1   1 
ATOM   3617  C  CD2   . LEU E  1 109 ? -15.412 -16.671 65.238 1.00 44.10  ? 109  LEU E CD2   1 
ATOM   3618  N  N     . CYS E  1 110 ? -16.463 -21.969 66.051 1.00 49.02  ? 110  CYS E N     1 
ATOM   3619  C  CA    . CYS E  1 110 ? -17.396 -22.991 66.550 1.00 49.26  ? 110  CYS E CA    1 
ATOM   3620  C  C     . CYS E  1 110 ? -17.111 -23.377 67.997 1.00 49.42  ? 110  CYS E C     1 
ATOM   3621  O  O     . CYS E  1 110 ? -18.042 -23.575 68.771 1.00 49.72  ? 110  CYS E O     1 
ATOM   3622  C  CB    . CYS E  1 110 ? -17.437 -24.235 65.659 1.00 48.95  ? 110  CYS E CB    1 
ATOM   3623  S  SG    . CYS E  1 110 ? -17.994 -23.945 63.937 1.00 50.42  ? 110  CYS E SG    1 
ATOM   3624  N  N     . ALA E  1 111 ? -15.838 -23.485 68.364 1.00 49.51  ? 111  ALA E N     1 
ATOM   3625  C  CA    . ALA E  1 111 ? -15.476 -23.758 69.743 1.00 49.84  ? 111  ALA E CA    1 
ATOM   3626  C  C     . ALA E  1 111 ? -15.964 -22.622 70.655 1.00 50.85  ? 111  ALA E C     1 
ATOM   3627  O  O     . ALA E  1 111 ? -16.586 -22.865 71.692 1.00 51.06  ? 111  ALA E O     1 
ATOM   3628  C  CB    . ALA E  1 111 ? -13.988 -23.925 69.858 1.00 49.72  ? 111  ALA E CB    1 
ATOM   3629  N  N     . ILE E  1 112 ? -15.696 -21.378 70.261 1.00 51.34  ? 112  ILE E N     1 
ATOM   3630  C  CA    . ILE E  1 112 ? -16.066 -20.234 71.079 1.00 51.34  ? 112  ILE E CA    1 
ATOM   3631  C  C     . ILE E  1 112 ? -17.582 -20.157 71.213 1.00 52.43  ? 112  ILE E C     1 
ATOM   3632  O  O     . ILE E  1 112 ? -18.093 -19.854 72.291 1.00 53.26  ? 112  ILE E O     1 
ATOM   3633  C  CB    . ILE E  1 112 ? -15.453 -18.933 70.538 1.00 51.11  ? 112  ILE E CB    1 
ATOM   3634  C  CG1   . ILE E  1 112 ? -13.948 -18.971 70.741 1.00 50.81  ? 112  ILE E CG1   1 
ATOM   3635  C  CG2   . ILE E  1 112 ? -16.009 -17.700 71.226 1.00 49.32  ? 112  ILE E CG2   1 
ATOM   3636  C  CD1   . ILE E  1 112 ? -13.222 -18.113 69.768 1.00 51.27  ? 112  ILE E CD1   1 
ATOM   3637  N  N     . HIS E  1 113 ? -18.306 -20.470 70.142 1.00 52.69  ? 113  HIS E N     1 
ATOM   3638  C  CA    . HIS E  1 113 ? -19.756 -20.501 70.214 1.00 53.25  ? 113  HIS E CA    1 
ATOM   3639  C  C     . HIS E  1 113 ? -20.210 -21.463 71.300 1.00 54.62  ? 113  HIS E C     1 
ATOM   3640  O  O     . HIS E  1 113 ? -21.296 -21.315 71.858 1.00 54.95  ? 113  HIS E O     1 
ATOM   3641  C  CB    . HIS E  1 113 ? -20.316 -20.965 68.893 1.00 53.06  ? 113  HIS E CB    1 
ATOM   3642  C  CG    . HIS E  1 113 ? -21.809 -20.903 68.809 1.00 53.02  ? 113  HIS E CG    1 
ATOM   3643  N  ND1   . HIS E  1 113 ? -22.500 -19.713 68.701 1.00 51.27  ? 113  HIS E ND1   1 
ATOM   3644  C  CD2   . HIS E  1 113 ? -22.740 -21.887 68.758 1.00 52.12  ? 113  HIS E CD2   1 
ATOM   3645  C  CE1   . HIS E  1 113 ? -23.795 -19.965 68.616 1.00 50.48  ? 113  HIS E CE1   1 
ATOM   3646  N  NE2   . HIS E  1 113 ? -23.967 -21.277 68.647 1.00 51.34  ? 113  HIS E NE2   1 
ATOM   3647  N  N     . ALA E  1 114 ? -19.370 -22.464 71.580 1.00 55.80  ? 114  ALA E N     1 
ATOM   3648  C  CA    . ALA E  1 114 ? -19.688 -23.512 72.540 1.00 56.62  ? 114  ALA E CA    1 
ATOM   3649  C  C     . ALA E  1 114 ? -19.208 -23.087 73.909 1.00 58.04  ? 114  ALA E C     1 
ATOM   3650  O  O     . ALA E  1 114 ? -19.330 -23.841 74.866 1.00 58.49  ? 114  ALA E O     1 
ATOM   3651  C  CB    . ALA E  1 114 ? -19.024 -24.774 72.154 1.00 56.03  ? 114  ALA E CB    1 
ATOM   3652  N  N     . LYS E  1 115 ? -18.648 -21.875 73.994 1.00 59.28  ? 115  LYS E N     1 
ATOM   3653  C  CA    . LYS E  1 115 ? -18.101 -21.337 75.253 1.00 59.98  ? 115  LYS E CA    1 
ATOM   3654  C  C     . LYS E  1 115 ? -16.844 -22.091 75.700 1.00 58.90  ? 115  LYS E C     1 
ATOM   3655  O  O     . LYS E  1 115 ? -16.566 -22.196 76.886 1.00 59.68  ? 115  LYS E O     1 
ATOM   3656  C  CB    . LYS E  1 115 ? -19.180 -21.330 76.341 1.00 59.65  ? 115  LYS E CB    1 
ATOM   3657  C  CG    . LYS E  1 115 ? -20.375 -20.444 75.982 1.00 61.92  ? 115  LYS E CG    1 
ATOM   3658  C  CD    . LYS E  1 115 ? -21.471 -20.513 77.035 1.00 62.82  ? 115  LYS E CD    1 
ATOM   3659  C  CE    . LYS E  1 115 ? -22.287 -19.223 77.039 1.00 67.87  ? 115  LYS E CE    1 
ATOM   3660  N  NZ    . LYS E  1 115 ? -23.063 -19.110 78.323 1.00 71.12  ? 115  LYS E NZ    1 
ATOM   3661  N  N     . ARG E  1 116 ? -16.092 -22.615 74.739 1.00 57.64  ? 116  ARG E N     1 
ATOM   3662  C  CA    . ARG E  1 116 ? -14.805 -23.236 75.005 1.00 56.15  ? 116  ARG E CA    1 
ATOM   3663  C  C     . ARG E  1 116 ? -13.733 -22.381 74.339 1.00 56.72  ? 116  ARG E C     1 
ATOM   3664  O  O     . ARG E  1 116 ? -14.045 -21.465 73.557 1.00 57.55  ? 116  ARG E O     1 
ATOM   3665  C  CB    . ARG E  1 116 ? -14.761 -24.647 74.409 1.00 56.08  ? 116  ARG E CB    1 
ATOM   3666  C  CG    . ARG E  1 116 ? -15.681 -25.653 75.089 1.00 54.65  ? 116  ARG E CG    1 
ATOM   3667  C  CD    . ARG E  1 116 ? -15.580 -27.026 74.473 1.00 54.26  ? 116  ARG E CD    1 
ATOM   3668  N  NE    . ARG E  1 116 ? -16.457 -27.212 73.314 1.00 51.74  ? 116  ARG E NE    1 
ATOM   3669  C  CZ    . ARG E  1 116 ? -16.058 -27.225 72.036 1.00 50.98  ? 116  ARG E CZ    1 
ATOM   3670  N  NH1   . ARG E  1 116 ? -14.780 -27.051 71.689 1.00 49.42  ? 116  ARG E NH1   1 
ATOM   3671  N  NH2   . ARG E  1 116 ? -16.953 -27.419 71.087 1.00 49.20  ? 116  ARG E NH2   1 
ATOM   3672  N  N     . VAL E  1 117 ? -12.470 -22.675 74.639 1.00 56.23  ? 117  VAL E N     1 
ATOM   3673  C  CA    . VAL E  1 117 ? -11.342 -22.062 73.949 1.00 55.11  ? 117  VAL E CA    1 
ATOM   3674  C  C     . VAL E  1 117 ? -10.514 -23.156 73.312 1.00 55.18  ? 117  VAL E C     1 
ATOM   3675  O  O     . VAL E  1 117 ? -9.516  -22.884 72.676 1.00 56.18  ? 117  VAL E O     1 
ATOM   3676  C  CB    . VAL E  1 117 ? -10.466 -21.174 74.895 1.00 55.11  ? 117  VAL E CB    1 
ATOM   3677  C  CG1   . VAL E  1 117 ? -11.268 -20.002 75.415 1.00 54.55  ? 117  VAL E CG1   1 
ATOM   3678  C  CG2   . VAL E  1 117 ? -9.886  -21.969 76.059 1.00 54.05  ? 117  VAL E CG2   1 
ATOM   3679  N  N     . THR E  1 118 ? -10.933 -24.404 73.485 1.00 55.09  ? 118  THR E N     1 
ATOM   3680  C  CA    . THR E  1 118 ? -10.223 -25.550 72.925 1.00 54.53  ? 118  THR E CA    1 
ATOM   3681  C  C     . THR E  1 118 ? -10.977 -26.064 71.719 1.00 53.92  ? 118  THR E C     1 
ATOM   3682  O  O     . THR E  1 118 ? -12.141 -26.476 71.840 1.00 53.90  ? 118  THR E O     1 
ATOM   3683  C  CB    . THR E  1 118 ? -10.129 -26.703 73.962 1.00 54.80  ? 118  THR E CB    1 
ATOM   3684  O  OG1   . THR E  1 118 ? -9.659  -26.179 75.215 1.00 56.26  ? 118  THR E OG1   1 
ATOM   3685  C  CG2   . THR E  1 118 ? -9.179  -27.799 73.482 1.00 54.03  ? 118  THR E CG2   1 
ATOM   3686  N  N     . ILE E  1 119 ? -10.328 -26.049 70.559 1.00 52.91  ? 119  ILE E N     1 
ATOM   3687  C  CA    . ILE E  1 119 ? -10.921 -26.659 69.381 1.00 52.14  ? 119  ILE E CA    1 
ATOM   3688  C  C     . ILE E  1 119 ? -10.919 -28.201 69.440 1.00 52.74  ? 119  ILE E C     1 
ATOM   3689  O  O     . ILE E  1 119 ? -9.932  -28.830 69.845 1.00 52.22  ? 119  ILE E O     1 
ATOM   3690  C  CB    . ILE E  1 119 ? -10.297 -26.155 68.043 1.00 51.41  ? 119  ILE E CB    1 
ATOM   3691  C  CG1   . ILE E  1 119 ? -8.814  -26.472 67.933 1.00 48.95  ? 119  ILE E CG1   1 
ATOM   3692  C  CG2   . ILE E  1 119 ? -10.528 -24.706 67.873 1.00 52.35  ? 119  ILE E CG2   1 
ATOM   3693  C  CD1   . ILE E  1 119 ? -8.325  -26.559 66.514 1.00 45.88  ? 119  ILE E CD1   1 
ATOM   3694  N  N     . MET E  1 120 ? -12.032 -28.795 69.012 1.00 53.50  ? 120  MET E N     1 
ATOM   3695  C  CA    . MET E  1 120 ? -12.209 -30.256 69.015 1.00 54.79  ? 120  MET E CA    1 
ATOM   3696  C  C     . MET E  1 120 ? -12.735 -30.762 67.671 1.00 54.22  ? 120  MET E C     1 
ATOM   3697  O  O     . MET E  1 120 ? -13.270 -29.984 66.865 1.00 54.85  ? 120  MET E O     1 
ATOM   3698  C  CB    . MET E  1 120 ? -13.149 -30.648 70.137 1.00 53.37  ? 120  MET E CB    1 
ATOM   3699  C  CG    . MET E  1 120 ? -12.759 -30.023 71.442 1.00 55.78  ? 120  MET E CG    1 
ATOM   3700  S  SD    . MET E  1 120 ? -13.702 -30.509 72.895 1.00 59.96  ? 120  MET E SD    1 
ATOM   3701  C  CE    . MET E  1 120 ? -15.377 -30.445 72.280 1.00 61.55  ? 120  MET E CE    1 
ATOM   3702  N  N     . PRO E  1 121 ? -12.589 -32.070 67.403 1.00 54.00  ? 121  PRO E N     1 
ATOM   3703  C  CA    . PRO E  1 121 ? -13.158 -32.576 66.152 1.00 53.27  ? 121  PRO E CA    1 
ATOM   3704  C  C     . PRO E  1 121 ? -14.632 -32.184 65.917 1.00 52.90  ? 121  PRO E C     1 
ATOM   3705  O  O     . PRO E  1 121 ? -15.015 -31.930 64.769 1.00 53.18  ? 121  PRO E O     1 
ATOM   3706  C  CB    . PRO E  1 121 ? -12.992 -34.085 66.293 1.00 53.32  ? 121  PRO E CB    1 
ATOM   3707  C  CG    . PRO E  1 121 ? -11.760 -34.228 67.141 1.00 52.77  ? 121  PRO E CG    1 
ATOM   3708  C  CD    . PRO E  1 121 ? -11.922 -33.144 68.166 1.00 53.77  ? 121  PRO E CD    1 
ATOM   3709  N  N     . LYS E  1 122 ? -15.449 -32.091 66.957 1.00 52.11  ? 122  LYS E N     1 
ATOM   3710  C  CA    . LYS E  1 122 ? -16.832 -31.718 66.709 1.00 52.41  ? 122  LYS E CA    1 
ATOM   3711  C  C     . LYS E  1 122 ? -16.937 -30.300 66.086 1.00 52.22  ? 122  LYS E C     1 
ATOM   3712  O  O     . LYS E  1 122 ? -17.810 -30.048 65.246 1.00 52.16  ? 122  LYS E O     1 
ATOM   3713  C  CB    . LYS E  1 122 ? -17.729 -31.906 67.951 1.00 52.71  ? 122  LYS E CB    1 
ATOM   3714  C  CG    . LYS E  1 122 ? -17.472 -30.956 69.116 1.00 54.84  ? 122  LYS E CG    1 
ATOM   3715  C  CD    . LYS E  1 122 ? -17.791 -31.593 70.460 1.00 59.03  ? 122  LYS E CD    1 
ATOM   3716  C  CE    . LYS E  1 122 ? -19.273 -31.467 70.827 1.00 62.88  ? 122  LYS E CE    1 
ATOM   3717  N  NZ    . LYS E  1 122 ? -19.642 -32.462 71.925 1.00 66.20  ? 122  LYS E NZ    1 
ATOM   3718  N  N     . ASP E  1 123 ? -16.022 -29.406 66.473 1.00 51.36  ? 123  ASP E N     1 
ATOM   3719  C  CA    . ASP E  1 123 ? -15.940 -28.054 65.901 1.00 50.16  ? 123  ASP E CA    1 
ATOM   3720  C  C     . ASP E  1 123 ? -15.595 -28.066 64.428 1.00 49.72  ? 123  ASP E C     1 
ATOM   3721  O  O     . ASP E  1 123 ? -16.236 -27.395 63.643 1.00 49.77  ? 123  ASP E O     1 
ATOM   3722  C  CB    . ASP E  1 123 ? -14.916 -27.207 66.652 1.00 49.71  ? 123  ASP E CB    1 
ATOM   3723  C  CG    . ASP E  1 123 ? -15.209 -27.128 68.126 1.00 50.01  ? 123  ASP E CG    1 
ATOM   3724  O  OD1   . ASP E  1 123 ? -16.401 -26.963 68.476 1.00 48.81  ? 123  ASP E OD1   1 
ATOM   3725  O  OD2   . ASP E  1 123 ? -14.252 -27.254 68.934 1.00 49.51  ? 123  ASP E OD2   1 
ATOM   3726  N  N     . ILE E  1 124 ? -14.573 -28.827 64.058 1.00 50.06  ? 124  ILE E N     1 
ATOM   3727  C  CA    . ILE E  1 124 ? -14.185 -28.978 62.654 1.00 49.96  ? 124  ILE E CA    1 
ATOM   3728  C  C     . ILE E  1 124 ? -15.333 -29.593 61.872 1.00 50.25  ? 124  ILE E C     1 
ATOM   3729  O  O     . ILE E  1 124 ? -15.678 -29.109 60.804 1.00 50.93  ? 124  ILE E O     1 
ATOM   3730  C  CB    . ILE E  1 124 ? -12.950 -29.881 62.477 1.00 49.25  ? 124  ILE E CB    1 
ATOM   3731  C  CG1   . ILE E  1 124 ? -11.738 -29.293 63.209 1.00 49.82  ? 124  ILE E CG1   1 
ATOM   3732  C  CG2   . ILE E  1 124 ? -12.682 -30.078 61.021 1.00 48.42  ? 124  ILE E CG2   1 
ATOM   3733  C  CD1   . ILE E  1 124 ? -10.387 -30.010 62.937 1.00 50.42  ? 124  ILE E CD1   1 
ATOM   3734  N  N     . GLN E  1 125 ? -15.929 -30.656 62.397 1.00 50.03  ? 125  GLN E N     1 
ATOM   3735  C  CA    . GLN E  1 125 ? -17.063 -31.252 61.702 1.00 50.05  ? 125  GLN E CA    1 
ATOM   3736  C  C     . GLN E  1 125 ? -18.207 -30.247 61.535 1.00 49.61  ? 125  GLN E C     1 
ATOM   3737  O  O     . GLN E  1 125 ? -18.864 -30.236 60.521 1.00 50.43  ? 125  GLN E O     1 
ATOM   3738  C  CB    . GLN E  1 125 ? -17.525 -32.556 62.388 1.00 50.29  ? 125  GLN E CB    1 
ATOM   3739  C  CG    . GLN E  1 125 ? -16.532 -33.724 62.208 1.00 49.41  ? 125  GLN E CG    1 
ATOM   3740  C  CD    . GLN E  1 125 ? -16.381 -34.587 63.457 1.00 50.54  ? 125  GLN E CD    1 
ATOM   3741  O  OE1   . GLN E  1 125 ? -17.248 -34.596 64.347 1.00 50.38  ? 125  GLN E OE1   1 
ATOM   3742  N  NE2   . GLN E  1 125 ? -15.263 -35.317 63.537 1.00 51.15  ? 125  GLN E NE2   1 
ATOM   3743  N  N     . LEU E  1 126 ? -18.438 -29.383 62.505 1.00 49.19  ? 126  LEU E N     1 
ATOM   3744  C  CA    . LEU E  1 126 ? -19.502 -28.400 62.360 1.00 48.86  ? 126  LEU E CA    1 
ATOM   3745  C  C     . LEU E  1 126 ? -19.174 -27.369 61.271 1.00 49.11  ? 126  LEU E C     1 
ATOM   3746  O  O     . LEU E  1 126 ? -20.011 -27.052 60.418 1.00 48.73  ? 126  LEU E O     1 
ATOM   3747  C  CB    . LEU E  1 126 ? -19.824 -27.741 63.704 1.00 48.13  ? 126  LEU E CB    1 
ATOM   3748  C  CG    . LEU E  1 126 ? -20.992 -26.767 63.617 1.00 48.41  ? 126  LEU E CG    1 
ATOM   3749  C  CD1   . LEU E  1 126 ? -22.264 -27.470 63.297 1.00 49.02  ? 126  LEU E CD1   1 
ATOM   3750  C  CD2   . LEU E  1 126 ? -21.150 -25.980 64.887 1.00 48.74  ? 126  LEU E CD2   1 
ATOM   3751  N  N     . ALA E  1 127 ? -17.948 -26.855 61.301 1.00 49.69  ? 127  ALA E N     1 
ATOM   3752  C  CA    . ALA E  1 127 ? -17.484 -25.906 60.296 1.00 50.48  ? 127  ALA E CA    1 
ATOM   3753  C  C     . ALA E  1 127 ? -17.672 -26.476 58.886 1.00 51.21  ? 127  ALA E C     1 
ATOM   3754  O  O     . ALA E  1 127 ? -18.194 -25.802 57.984 1.00 51.32  ? 127  ALA E O     1 
ATOM   3755  C  CB    . ALA E  1 127 ? -16.025 -25.563 60.536 1.00 50.42  ? 127  ALA E CB    1 
ATOM   3756  N  N     . ARG E  1 128 ? -17.249 -27.725 58.700 1.00 51.65  ? 128  ARG E N     1 
ATOM   3757  C  CA    . ARG E  1 128 ? -17.337 -28.363 57.393 1.00 51.78  ? 128  ARG E CA    1 
ATOM   3758  C  C     . ARG E  1 128 ? -18.762 -28.651 56.989 1.00 51.97  ? 128  ARG E C     1 
ATOM   3759  O  O     . ARG E  1 128 ? -19.094 -28.494 55.831 1.00 52.26  ? 128  ARG E O     1 
ATOM   3760  C  CB    . ARG E  1 128 ? -16.472 -29.597 57.333 1.00 51.33  ? 128  ARG E CB    1 
ATOM   3761  C  CG    . ARG E  1 128 ? -15.018 -29.282 57.579 1.00 52.20  ? 128  ARG E CG    1 
ATOM   3762  C  CD    . ARG E  1 128 ? -14.076 -30.162 56.758 1.00 54.80  ? 128  ARG E CD    1 
ATOM   3763  N  NE    . ARG E  1 128 ? -14.448 -31.560 56.849 1.00 56.92  ? 128  ARG E NE    1 
ATOM   3764  C  CZ    . ARG E  1 128 ? -14.621 -32.366 55.814 1.00 59.17  ? 128  ARG E CZ    1 
ATOM   3765  N  NH1   . ARG E  1 128 ? -14.417 -31.951 54.563 1.00 59.12  ? 128  ARG E NH1   1 
ATOM   3766  N  NH2   . ARG E  1 128 ? -14.984 -33.612 56.052 1.00 61.59  ? 128  ARG E NH2   1 
ATOM   3767  N  N     . ARG E  1 129 ? -19.611 -29.037 57.932 1.00 52.66  ? 129  ARG E N     1 
ATOM   3768  C  CA    . ARG E  1 129 ? -21.015 -29.240 57.616 1.00 54.52  ? 129  ARG E CA    1 
ATOM   3769  C  C     . ARG E  1 129 ? -21.663 -27.941 57.137 1.00 55.19  ? 129  ARG E C     1 
ATOM   3770  O  O     . ARG E  1 129 ? -22.273 -27.900 56.075 1.00 55.18  ? 129  ARG E O     1 
ATOM   3771  C  CB    . ARG E  1 129 ? -21.778 -29.832 58.796 1.00 54.54  ? 129  ARG E CB    1 
ATOM   3772  C  CG    . ARG E  1 129 ? -23.233 -30.196 58.471 1.00 57.40  ? 129  ARG E CG    1 
ATOM   3773  C  CD    . ARG E  1 129 ? -23.648 -31.486 59.211 1.00 63.41  ? 129  ARG E CD    1 
ATOM   3774  N  NE    . ARG E  1 129 ? -25.064 -31.821 59.028 1.00 68.98  ? 129  ARG E NE    1 
ATOM   3775  C  CZ    . ARG E  1 129 ? -25.812 -32.496 59.907 1.00 71.09  ? 129  ARG E CZ    1 
ATOM   3776  N  NH1   . ARG E  1 129 ? -25.296 -32.916 61.058 1.00 72.18  ? 129  ARG E NH1   1 
ATOM   3777  N  NH2   . ARG E  1 129 ? -27.095 -32.733 59.644 1.00 71.41  ? 129  ARG E NH2   1 
ATOM   3778  N  N     . ILE E  1 130 ? -21.473 -26.867 57.891 1.00 56.50  ? 130  ILE E N     1 
ATOM   3779  C  CA    . ILE E  1 130 ? -22.077 -25.597 57.534 1.00 57.69  ? 130  ILE E CA    1 
ATOM   3780  C  C     . ILE E  1 130 ? -21.501 -25.027 56.247 1.00 58.42  ? 130  ILE E C     1 
ATOM   3781  O  O     . ILE E  1 130 ? -22.231 -24.425 55.472 1.00 58.81  ? 130  ILE E O     1 
ATOM   3782  C  CB    . ILE E  1 130 ? -22.019 -24.594 58.684 1.00 58.10  ? 130  ILE E CB    1 
ATOM   3783  C  CG1   . ILE E  1 130 ? -22.791 -25.156 59.884 1.00 58.64  ? 130  ILE E CG1   1 
ATOM   3784  C  CG2   . ILE E  1 130 ? -22.594 -23.232 58.271 1.00 57.24  ? 130  ILE E CG2   1 
ATOM   3785  C  CD1   . ILE E  1 130 ? -22.580 -24.334 61.129 1.00 61.43  ? 130  ILE E CD1   1 
ATOM   3786  N  N     . ARG E  1 131 ? -20.212 -25.241 56.002 1.00 59.53  ? 131  ARG E N     1 
ATOM   3787  C  CA    . ARG E  1 131 ? -19.584 -24.806 54.743 1.00 60.29  ? 131  ARG E CA    1 
ATOM   3788  C  C     . ARG E  1 131 ? -20.095 -25.514 53.494 1.00 61.76  ? 131  ARG E C     1 
ATOM   3789  O  O     . ARG E  1 131 ? -19.765 -25.112 52.391 1.00 61.96  ? 131  ARG E O     1 
ATOM   3790  C  CB    . ARG E  1 131 ? -18.097 -25.049 54.779 1.00 59.47  ? 131  ARG E CB    1 
ATOM   3791  C  CG    . ARG E  1 131 ? -17.321 -24.086 55.538 1.00 57.30  ? 131  ARG E CG    1 
ATOM   3792  C  CD    . ARG E  1 131 ? -15.937 -24.636 55.626 1.00 53.39  ? 131  ARG E CD    1 
ATOM   3793  N  NE    . ARG E  1 131 ? -14.986 -23.620 56.009 1.00 51.96  ? 131  ARG E NE    1 
ATOM   3794  C  CZ    . ARG E  1 131 ? -13.759 -23.536 55.520 1.00 53.17  ? 131  ARG E CZ    1 
ATOM   3795  N  NH1   . ARG E  1 131 ? -13.338 -24.420 54.613 1.00 51.54  ? 131  ARG E NH1   1 
ATOM   3796  N  NH2   . ARG E  1 131 ? -12.948 -22.556 55.937 1.00 54.24  ? 131  ARG E NH2   1 
ATOM   3797  N  N     . GLY E  1 132 ? -20.856 -26.589 53.652 1.00 63.48  ? 132  GLY E N     1 
ATOM   3798  C  CA    . GLY E  1 132 ? -21.304 -27.320 52.481 1.00 66.10  ? 132  GLY E CA    1 
ATOM   3799  C  C     . GLY E  1 132 ? -20.304 -28.363 52.031 1.00 67.96  ? 132  GLY E C     1 
ATOM   3800  O  O     . GLY E  1 132 ? -20.591 -29.185 51.161 1.00 68.42  ? 132  GLY E O     1 
ATOM   3801  N  N     . GLU E  1 133 ? -19.116 -28.350 52.623 1.00 70.01  ? 133  GLU E N     1 
ATOM   3802  C  CA    . GLU E  1 133 ? -18.182 -29.454 52.416 1.00 71.80  ? 133  GLU E CA    1 
ATOM   3803  C  C     . GLU E  1 133 ? -18.895 -30.724 52.891 1.00 73.19  ? 133  GLU E C     1 
ATOM   3804  O  O     . GLU E  1 133 ? -18.416 -31.851 52.719 1.00 73.39  ? 133  GLU E O     1 
ATOM   3805  C  CB    . GLU E  1 133 ? -16.859 -29.184 53.122 1.00 71.36  ? 133  GLU E CB    1 
ATOM   3806  C  CG    . GLU E  1 133 ? -16.067 -28.083 52.432 1.00 71.57  ? 133  GLU E CG    1 
ATOM   3807  C  CD    . GLU E  1 133 ? -14.833 -27.621 53.218 1.00 73.51  ? 133  GLU E CD    1 
ATOM   3808  O  OE1   . GLU E  1 133 ? -14.035 -28.482 53.674 1.00 70.87  ? 133  GLU E OE1   1 
ATOM   3809  O  OE2   . GLU E  1 133 ? -14.660 -26.380 53.363 1.00 72.92  ? 133  GLU E OE2   1 
ATOM   3810  N  N     . ARG E  1 134 ? -20.070 -30.491 53.478 1.00 75.18  ? 134  ARG E N     1 
ATOM   3811  C  CA    . ARG E  1 134 ? -21.143 -31.483 53.607 1.00 77.20  ? 134  ARG E CA    1 
ATOM   3812  C  C     . ARG E  1 134 ? -22.528 -30.808 53.498 1.00 77.03  ? 134  ARG E C     1 
ATOM   3813  O  O     . ARG E  1 134 ? -23.281 -30.696 54.474 1.00 77.05  ? 134  ARG E O     1 
ATOM   3814  C  CB    . ARG E  1 134 ? -20.994 -32.290 54.900 1.00 77.79  ? 134  ARG E CB    1 
ATOM   3815  C  CG    . ARG E  1 134 ? -20.042 -33.475 54.753 1.00 81.31  ? 134  ARG E CG    1 
ATOM   3816  C  CD    . ARG E  1 134 ? -19.574 -33.926 56.104 1.00 86.32  ? 134  ARG E CD    1 
ATOM   3817  N  NE    . ARG E  1 134 ? -19.029 -32.794 56.847 1.00 89.71  ? 134  ARG E NE    1 
ATOM   3818  C  CZ    . ARG E  1 134 ? -18.939 -32.748 58.178 1.00 92.21  ? 134  ARG E CZ    1 
ATOM   3819  N  NH1   . ARG E  1 134 ? -19.368 -33.769 58.943 1.00 94.02  ? 134  ARG E NH1   1 
ATOM   3820  N  NH2   . ARG E  1 134 ? -18.414 -31.674 58.746 1.00 92.62  ? 134  ARG E NH2   1 
ATOM   3821  N  N     . LYS F  2 16  ? 14.364  -48.610 33.387 1.00 107.06 ? 16   LYS F N     1 
ATOM   3822  C  CA    . LYS F  2 16  ? 14.423  -48.128 34.801 1.00 107.06 ? 16   LYS F CA    1 
ATOM   3823  C  C     . LYS F  2 16  ? 14.628  -49.285 35.781 1.00 106.76 ? 16   LYS F C     1 
ATOM   3824  O  O     . LYS F  2 16  ? 14.165  -50.412 35.535 1.00 106.86 ? 16   LYS F O     1 
ATOM   3825  C  CB    . LYS F  2 16  ? 13.166  -47.321 35.167 1.00 107.12 ? 16   LYS F CB    1 
ATOM   3826  C  CG    . LYS F  2 16  ? 11.856  -48.118 35.150 1.00 107.44 ? 16   LYS F CG    1 
ATOM   3827  C  CD    . LYS F  2 16  ? 10.748  -47.360 35.893 1.00 107.32 ? 16   LYS F CD    1 
ATOM   3828  C  CE    . LYS F  2 16  ? 9.521   -48.275 36.093 1.00 107.18 ? 16   LYS F CE    1 
ATOM   3829  N  NZ    . LYS F  2 16  ? 8.530   -47.626 37.003 1.00 106.01 ? 16   LYS F NZ    1 
ATOM   3830  N  N     . ARG F  2 17  ? 15.325  -48.999 36.883 1.00 106.15 ? 17   ARG F N     1 
ATOM   3831  C  CA    . ARG F  2 17  ? 15.611  -50.010 37.908 1.00 105.46 ? 17   ARG F CA    1 
ATOM   3832  C  C     . ARG F  2 17  ? 15.267  -49.556 39.334 1.00 104.39 ? 17   ARG F C     1 
ATOM   3833  O  O     . ARG F  2 17  ? 16.035  -48.824 39.979 1.00 104.18 ? 17   ARG F O     1 
ATOM   3834  C  CB    . ARG F  2 17  ? 17.062  -50.493 37.808 1.00 105.55 ? 17   ARG F CB    1 
ATOM   3835  C  CG    . ARG F  2 17  ? 17.292  -51.498 36.680 1.00 106.28 ? 17   ARG F CG    1 
ATOM   3836  C  CD    . ARG F  2 17  ? 18.774  -51.837 36.516 1.00 106.44 ? 17   ARG F CD    1 
ATOM   3837  N  NE    . ARG F  2 17  ? 18.961  -53.227 36.097 1.00 108.72 ? 17   ARG F NE    1 
ATOM   3838  C  CZ    . ARG F  2 17  ? 20.133  -53.858 36.043 1.00 109.44 ? 17   ARG F CZ    1 
ATOM   3839  N  NH1   . ARG F  2 17  ? 21.257  -53.229 36.375 1.00 110.09 ? 17   ARG F NH1   1 
ATOM   3840  N  NH2   . ARG F  2 17  ? 20.180  -55.129 35.653 1.00 109.49 ? 17   ARG F NH2   1 
ATOM   3841  N  N     . HIS F  2 18  ? 14.090  -49.995 39.792 1.00 103.10 ? 18   HIS F N     1 
ATOM   3842  C  CA    . HIS F  2 18  ? 13.582  -49.783 41.160 1.00 101.58 ? 18   HIS F CA    1 
ATOM   3843  C  C     . HIS F  2 18  ? 13.193  -48.347 41.466 1.00 99.80  ? 18   HIS F C     1 
ATOM   3844  O  O     . HIS F  2 18  ? 13.842  -47.400 41.014 1.00 99.93  ? 18   HIS F O     1 
ATOM   3845  C  CB    . HIS F  2 18  ? 14.564  -50.308 42.228 1.00 102.03 ? 18   HIS F CB    1 
ATOM   3846  C  CG    . HIS F  2 18  ? 14.729  -51.797 42.213 1.00 103.49 ? 18   HIS F CG    1 
ATOM   3847  N  ND1   . HIS F  2 18  ? 13.986  -52.636 43.018 1.00 105.23 ? 18   HIS F ND1   1 
ATOM   3848  C  CD2   . HIS F  2 18  ? 15.546  -52.598 41.487 1.00 104.44 ? 18   HIS F CD2   1 
ATOM   3849  C  CE1   . HIS F  2 18  ? 14.335  -53.890 42.786 1.00 105.27 ? 18   HIS F CE1   1 
ATOM   3850  N  NE2   . HIS F  2 18  ? 15.284  -53.894 41.864 1.00 105.21 ? 18   HIS F NE2   1 
ATOM   3851  N  N     . ARG F  2 19  ? 12.128  -48.202 42.249 1.00 97.36  ? 19   ARG F N     1 
ATOM   3852  C  CA    . ARG F  2 19  ? 11.711  -46.911 42.778 1.00 94.82  ? 19   ARG F CA    1 
ATOM   3853  C  C     . ARG F  2 19  ? 10.909  -47.120 44.053 1.00 92.09  ? 19   ARG F C     1 
ATOM   3854  O  O     . ARG F  2 19  ? 9.886   -47.803 44.045 1.00 92.07  ? 19   ARG F O     1 
ATOM   3855  C  CB    . ARG F  2 19  ? 10.895  -46.134 41.735 1.00 95.57  ? 19   ARG F CB    1 
ATOM   3856  C  CG    . ARG F  2 19  ? 10.746  -44.640 42.030 1.00 97.41  ? 19   ARG F CG    1 
ATOM   3857  C  CD    . ARG F  2 19  ? 9.435   -44.376 42.749 1.00 101.40 ? 19   ARG F CD    1 
ATOM   3858  N  NE    . ARG F  2 19  ? 9.325   -43.011 43.254 1.00 103.59 ? 19   ARG F NE    1 
ATOM   3859  C  CZ    . ARG F  2 19  ? 8.220   -42.507 43.796 1.00 104.95 ? 19   ARG F CZ    1 
ATOM   3860  N  NH1   . ARG F  2 19  ? 7.128   -43.260 43.889 1.00 105.16 ? 19   ARG F NH1   1 
ATOM   3861  N  NH2   . ARG F  2 19  ? 8.201   -41.249 44.235 1.00 105.65 ? 19   ARG F NH2   1 
ATOM   3862  N  N     . LYS F  2 20  ? 11.386  -46.513 45.134 1.00 88.53  ? 20   LYS F N     1 
ATOM   3863  C  CA    . LYS F  2 20  ? 10.802  -46.626 46.476 1.00 85.01  ? 20   LYS F CA    1 
ATOM   3864  C  C     . LYS F  2 20  ? 9.257   -46.596 46.547 1.00 81.77  ? 20   LYS F C     1 
ATOM   3865  O  O     . LYS F  2 20  ? 8.589   -45.974 45.715 1.00 81.97  ? 20   LYS F O     1 
ATOM   3866  C  CB    . LYS F  2 20  ? 11.401  -45.525 47.364 1.00 85.60  ? 20   LYS F CB    1 
ATOM   3867  C  CG    . LYS F  2 20  ? 11.166  -45.691 48.863 1.00 87.25  ? 20   LYS F CG    1 
ATOM   3868  C  CD    . LYS F  2 20  ? 11.364  -47.138 49.357 1.00 88.14  ? 20   LYS F CD    1 
ATOM   3869  C  CE    . LYS F  2 20  ? 11.343  -47.139 50.875 1.00 89.47  ? 20   LYS F CE    1 
ATOM   3870  N  NZ    . LYS F  2 20  ? 11.305  -48.495 51.451 1.00 90.77  ? 20   LYS F NZ    1 
ATOM   3871  N  N     . VAL F  2 21  ? 8.709   -47.275 47.550 1.00 77.21  ? 21   VAL F N     1 
ATOM   3872  C  CA    . VAL F  2 21  ? 7.271   -47.410 47.718 1.00 72.75  ? 21   VAL F CA    1 
ATOM   3873  C  C     . VAL F  2 21  ? 6.783   -46.360 48.693 1.00 70.19  ? 21   VAL F C     1 
ATOM   3874  O  O     . VAL F  2 21  ? 7.282   -46.267 49.816 1.00 69.55  ? 21   VAL F O     1 
ATOM   3875  C  CB    . VAL F  2 21  ? 6.886   -48.846 48.192 1.00 72.45  ? 21   VAL F CB    1 
ATOM   3876  C  CG1   . VAL F  2 21  ? 5.505   -48.897 48.811 1.00 71.22  ? 21   VAL F CG1   1 
ATOM   3877  C  CG2   . VAL F  2 21  ? 6.951   -49.783 47.039 1.00 72.74  ? 21   VAL F CG2   1 
ATOM   3878  N  N     . LEU F  2 22  ? 5.790   -45.590 48.242 1.00 67.08  ? 22   LEU F N     1 
ATOM   3879  C  CA    . LEU F  2 22  ? 5.188   -44.509 49.018 1.00 63.45  ? 22   LEU F CA    1 
ATOM   3880  C  C     . LEU F  2 22  ? 4.062   -45.002 49.878 1.00 62.07  ? 22   LEU F C     1 
ATOM   3881  O  O     . LEU F  2 22  ? 3.063   -45.498 49.370 1.00 61.63  ? 22   LEU F O     1 
ATOM   3882  C  CB    . LEU F  2 22  ? 4.697   -43.396 48.096 1.00 62.73  ? 22   LEU F CB    1 
ATOM   3883  C  CG    . LEU F  2 22  ? 5.784   -42.833 47.176 1.00 60.87  ? 22   LEU F CG    1 
ATOM   3884  C  CD1   . LEU F  2 22  ? 5.216   -41.939 46.126 1.00 60.13  ? 22   LEU F CD1   1 
ATOM   3885  C  CD2   . LEU F  2 22  ? 6.819   -42.106 47.966 1.00 60.99  ? 22   LEU F CD2   1 
ATOM   3886  N  N     . ARG F  2 23  ? 4.241   -44.879 51.186 1.00 60.82  ? 23   ARG F N     1 
ATOM   3887  C  CA    . ARG F  2 23  ? 3.193   -45.221 52.143 1.00 60.02  ? 23   ARG F CA    1 
ATOM   3888  C  C     . ARG F  2 23  ? 3.252   -44.377 53.411 1.00 60.29  ? 23   ARG F C     1 
ATOM   3889  O  O     . ARG F  2 23  ? 4.332   -44.031 53.890 1.00 60.19  ? 23   ARG F O     1 
ATOM   3890  C  CB    . ARG F  2 23  ? 3.200   -46.717 52.496 1.00 60.08  ? 23   ARG F CB    1 
ATOM   3891  C  CG    . ARG F  2 23  ? 4.574   -47.338 52.652 1.00 59.95  ? 23   ARG F CG    1 
ATOM   3892  C  CD    . ARG F  2 23  ? 4.532   -48.864 52.612 1.00 58.23  ? 23   ARG F CD    1 
ATOM   3893  N  NE    . ARG F  2 23  ? 4.231   -49.376 53.945 1.00 55.49  ? 23   ARG F NE    1 
ATOM   3894  C  CZ    . ARG F  2 23  ? 5.139   -49.701 54.864 1.00 50.04  ? 23   ARG F CZ    1 
ATOM   3895  N  NH1   . ARG F  2 23  ? 6.437   -49.603 54.629 1.00 46.19  ? 23   ARG F NH1   1 
ATOM   3896  N  NH2   . ARG F  2 23  ? 4.722   -50.131 56.026 1.00 48.48  ? 23   ARG F NH2   1 
ATOM   3897  N  N     . ASP F  2 24  ? 2.064   -44.034 53.922 1.00 60.40  ? 24   ASP F N     1 
ATOM   3898  C  CA    . ASP F  2 24  ? 1.880   -43.315 55.192 1.00 59.87  ? 24   ASP F CA    1 
ATOM   3899  C  C     . ASP F  2 24  ? 2.527   -41.934 55.274 1.00 59.11  ? 24   ASP F C     1 
ATOM   3900  O  O     . ASP F  2 24  ? 2.843   -41.433 56.356 1.00 58.33  ? 24   ASP F O     1 
ATOM   3901  C  CB    . ASP F  2 24  ? 2.341   -44.177 56.362 1.00 60.24  ? 24   ASP F CB    1 
ATOM   3902  C  CG    . ASP F  2 24  ? 1.448   -44.010 57.560 1.00 62.97  ? 24   ASP F CG    1 
ATOM   3903  O  OD1   . ASP F  2 24  ? 0.219   -43.846 57.325 1.00 65.13  ? 24   ASP F OD1   1 
ATOM   3904  O  OD2   . ASP F  2 24  ? 1.959   -44.030 58.719 1.00 65.02  ? 24   ASP F OD2   1 
ATOM   3905  N  N     . ASN F  2 25  ? 2.712   -41.315 54.118 1.00 58.58  ? 25   ASN F N     1 
ATOM   3906  C  CA    . ASN F  2 25  ? 3.195   -39.959 54.062 1.00 58.09  ? 25   ASN F CA    1 
ATOM   3907  C  C     . ASN F  2 25  ? 2.327   -38.890 54.750 1.00 58.12  ? 25   ASN F C     1 
ATOM   3908  O  O     . ASN F  2 25  ? 2.813   -37.820 55.076 1.00 58.28  ? 25   ASN F O     1 
ATOM   3909  C  CB    . ASN F  2 25  ? 3.463   -39.618 52.637 1.00 57.67  ? 25   ASN F CB    1 
ATOM   3910  C  CG    . ASN F  2 25  ? 4.598   -40.421 52.098 1.00 58.44  ? 25   ASN F CG    1 
ATOM   3911  O  OD1   . ASN F  2 25  ? 5.760   -40.166 52.433 1.00 58.17  ? 25   ASN F OD1   1 
ATOM   3912  N  ND2   . ASN F  2 25  ? 4.285   -41.418 51.279 1.00 57.86  ? 25   ASN F ND2   1 
ATOM   3913  N  N     . ILE F  2 26  ? 1.068   -39.204 55.011 1.00 58.27  ? 26   ILE F N     1 
ATOM   3914  C  CA    . ILE F  2 26  ? 0.214   -38.327 55.754 1.00 58.50  ? 26   ILE F CA    1 
ATOM   3915  C  C     . ILE F  2 26  ? 0.842   -37.987 57.096 1.00 58.65  ? 26   ILE F C     1 
ATOM   3916  O  O     . ILE F  2 26  ? 0.572   -36.934 57.661 1.00 59.42  ? 26   ILE F O     1 
ATOM   3917  C  CB    . ILE F  2 26  ? -1.224  -38.906 55.941 1.00 58.84  ? 26   ILE F CB    1 
ATOM   3918  C  CG1   . ILE F  2 26  ? -2.183  -37.819 56.417 1.00 58.22  ? 26   ILE F CG1   1 
ATOM   3919  C  CG2   . ILE F  2 26  ? -1.258  -40.085 56.912 1.00 58.61  ? 26   ILE F CG2   1 
ATOM   3920  C  CD1   . ILE F  2 26  ? -2.317  -36.678 55.445 1.00 59.54  ? 26   ILE F CD1   1 
ATOM   3921  N  N     . GLN F  2 27  ? 1.699   -38.852 57.603 1.00 58.68  ? 27   GLN F N     1 
ATOM   3922  C  CA    . GLN F  2 27  ? 2.245   -38.628 58.947 1.00 58.58  ? 27   GLN F CA    1 
ATOM   3923  C  C     . GLN F  2 27  ? 3.406   -37.665 58.830 1.00 58.37  ? 27   GLN F C     1 
ATOM   3924  O  O     . GLN F  2 27  ? 3.985   -37.233 59.837 1.00 58.92  ? 27   GLN F O     1 
ATOM   3925  C  CB    . GLN F  2 27  ? 2.629   -39.947 59.644 1.00 58.36  ? 27   GLN F CB    1 
ATOM   3926  C  CG    . GLN F  2 27  ? 1.426   -40.865 59.944 1.00 58.78  ? 27   GLN F CG    1 
ATOM   3927  C  CD    . GLN F  2 27  ? 0.479   -40.274 60.986 1.00 60.69  ? 27   GLN F CD    1 
ATOM   3928  O  OE1   . GLN F  2 27  ? 0.922   -39.564 61.896 1.00 63.95  ? 27   GLN F OE1   1 
ATOM   3929  N  NE2   . GLN F  2 27  ? -0.830  -40.555 60.860 1.00 59.10  ? 27   GLN F NE2   1 
ATOM   3930  N  N     . GLY F  2 28  ? 3.732   -37.324 57.589 1.00 57.79  ? 28   GLY F N     1 
ATOM   3931  C  CA    . GLY F  2 28  ? 4.719   -36.295 57.308 1.00 58.27  ? 28   GLY F CA    1 
ATOM   3932  C  C     . GLY F  2 28  ? 4.162   -34.918 57.667 1.00 58.67  ? 28   GLY F C     1 
ATOM   3933  O  O     . GLY F  2 28  ? 4.916   -33.949 57.803 1.00 59.36  ? 28   GLY F O     1 
ATOM   3934  N  N     . ILE F  2 29  ? 2.839   -34.826 57.804 1.00 57.88  ? 29   ILE F N     1 
ATOM   3935  C  CA    . ILE F  2 29  ? 2.217   -33.645 58.355 1.00 57.32  ? 29   ILE F CA    1 
ATOM   3936  C  C     . ILE F  2 29  ? 2.216   -33.776 59.869 1.00 56.59  ? 29   ILE F C     1 
ATOM   3937  O  O     . ILE F  2 29  ? 1.283   -34.332 60.478 1.00 55.76  ? 29   ILE F O     1 
ATOM   3938  C  CB    . ILE F  2 29  ? 0.795   -33.457 57.831 1.00 57.72  ? 29   ILE F CB    1 
ATOM   3939  C  CG1   . ILE F  2 29  ? 0.720   -33.796 56.339 1.00 58.47  ? 29   ILE F CG1   1 
ATOM   3940  C  CG2   . ILE F  2 29  ? 0.358   -32.035 58.045 1.00 58.56  ? 29   ILE F CG2   1 
ATOM   3941  C  CD1   . ILE F  2 29  ? 1.645   -32.979 55.470 1.00 57.18  ? 29   ILE F CD1   1 
ATOM   3942  N  N     . THR F  2 30  ? 3.279   -33.254 60.467 1.00 56.09  ? 30   THR F N     1 
ATOM   3943  C  CA    . THR F  2 30  ? 3.521   -33.436 61.898 1.00 56.32  ? 30   THR F CA    1 
ATOM   3944  C  C     . THR F  2 30  ? 2.595   -32.640 62.807 1.00 56.21  ? 30   THR F C     1 
ATOM   3945  O  O     . THR F  2 30  ? 1.954   -31.689 62.391 1.00 56.40  ? 30   THR F O     1 
ATOM   3946  C  CB    . THR F  2 30  ? 4.986   -33.124 62.280 1.00 55.95  ? 30   THR F CB    1 
ATOM   3947  O  OG1   . THR F  2 30  ? 5.240   -31.737 62.051 1.00 56.73  ? 30   THR F OG1   1 
ATOM   3948  C  CG2   . THR F  2 30  ? 5.957   -33.950 61.452 1.00 54.94  ? 30   THR F CG2   1 
ATOM   3949  N  N     . LYS F  2 31  ? 2.539   -33.057 64.060 1.00 56.45  ? 31   LYS F N     1 
ATOM   3950  C  CA    . LYS F  2 31  ? 1.865   -32.326 65.113 1.00 56.87  ? 31   LYS F CA    1 
ATOM   3951  C  C     . LYS F  2 31  ? 2.313   -30.837 65.168 1.00 57.00  ? 31   LYS F C     1 
ATOM   3952  O  O     . LYS F  2 31  ? 1.473   -29.943 65.112 1.00 57.54  ? 31   LYS F O     1 
ATOM   3953  C  CB    . LYS F  2 31  ? 2.107   -33.039 66.438 1.00 57.03  ? 31   LYS F CB    1 
ATOM   3954  C  CG    . LYS F  2 31  ? 1.247   -32.580 67.551 1.00 59.90  ? 31   LYS F CG    1 
ATOM   3955  C  CD    . LYS F  2 31  ? 1.567   -33.291 68.840 1.00 62.22  ? 31   LYS F CD    1 
ATOM   3956  C  CE    . LYS F  2 31  ? 1.348   -32.323 70.017 1.00 65.12  ? 31   LYS F CE    1 
ATOM   3957  N  NZ    . LYS F  2 31  ? 0.681   -32.968 71.206 1.00 68.14  ? 31   LYS F NZ    1 
ATOM   3958  N  N     . PRO F  2 32  ? 3.629   -30.557 65.242 1.00 56.60  ? 32   PRO F N     1 
ATOM   3959  C  CA    . PRO F  2 32  ? 4.010   -29.139 65.223 1.00 56.16  ? 32   PRO F CA    1 
ATOM   3960  C  C     . PRO F  2 32  ? 3.570   -28.351 63.981 1.00 55.62  ? 32   PRO F C     1 
ATOM   3961  O  O     . PRO F  2 32  ? 3.159   -27.214 64.125 1.00 55.95  ? 32   PRO F O     1 
ATOM   3962  C  CB    . PRO F  2 32  ? 5.539   -29.180 65.295 1.00 56.14  ? 32   PRO F CB    1 
ATOM   3963  C  CG    . PRO F  2 32  ? 5.854   -30.518 65.880 1.00 57.25  ? 32   PRO F CG    1 
ATOM   3964  C  CD    . PRO F  2 32  ? 4.807   -31.435 65.354 1.00 56.56  ? 32   PRO F CD    1 
ATOM   3965  N  N     . ALA F  2 33  ? 3.665   -28.928 62.783 1.00 54.64  ? 33   ALA F N     1 
ATOM   3966  C  CA    . ALA F  2 33  ? 3.204   -28.244 61.578 1.00 53.60  ? 33   ALA F CA    1 
ATOM   3967  C  C     . ALA F  2 33  ? 1.710   -27.877 61.657 1.00 53.53  ? 33   ALA F C     1 
ATOM   3968  O  O     . ALA F  2 33  ? 1.308   -26.781 61.286 1.00 54.09  ? 33   ALA F O     1 
ATOM   3969  C  CB    . ALA F  2 33  ? 3.486   -29.068 60.350 1.00 52.80  ? 33   ALA F CB    1 
ATOM   3970  N  N     . ILE F  2 34  ? 0.887   -28.794 62.138 1.00 53.47  ? 34   ILE F N     1 
ATOM   3971  C  CA    . ILE F  2 34  ? -0.544  -28.553 62.250 1.00 52.70  ? 34   ILE F CA    1 
ATOM   3972  C  C     . ILE F  2 34  ? -0.784  -27.474 63.291 1.00 53.56  ? 34   ILE F C     1 
ATOM   3973  O  O     . ILE F  2 34  ? -1.648  -26.606 63.117 1.00 54.38  ? 34   ILE F O     1 
ATOM   3974  C  CB    . ILE F  2 34  ? -1.304  -29.862 62.619 1.00 52.73  ? 34   ILE F CB    1 
ATOM   3975  C  CG1   . ILE F  2 34  ? -1.187  -30.890 61.462 1.00 51.84  ? 34   ILE F CG1   1 
ATOM   3976  C  CG2   . ILE F  2 34  ? -2.752  -29.571 63.023 1.00 49.63  ? 34   ILE F CG2   1 
ATOM   3977  C  CD1   . ILE F  2 34  ? -1.525  -32.334 61.854 1.00 52.16  ? 34   ILE F CD1   1 
ATOM   3978  N  N     . ARG F  2 35  ? -0.010  -27.502 64.368 1.00 53.76  ? 35   ARG F N     1 
ATOM   3979  C  CA    . ARG F  2 35  ? -0.157  -26.501 65.414 1.00 53.74  ? 35   ARG F CA    1 
ATOM   3980  C  C     . ARG F  2 35  ? 0.142   -25.116 64.877 1.00 52.35  ? 35   ARG F C     1 
ATOM   3981  O  O     . ARG F  2 35  ? -0.600  -24.181 65.147 1.00 52.27  ? 35   ARG F O     1 
ATOM   3982  C  CB    . ARG F  2 35  ? 0.725   -26.805 66.609 1.00 54.33  ? 35   ARG F CB    1 
ATOM   3983  C  CG    . ARG F  2 35  ? 0.438   -25.864 67.765 1.00 59.84  ? 35   ARG F CG    1 
ATOM   3984  C  CD    . ARG F  2 35  ? 1.589   -25.789 68.784 1.00 67.12  ? 35   ARG F CD    1 
ATOM   3985  N  NE    . ARG F  2 35  ? 2.101   -27.124 69.071 1.00 70.97  ? 35   ARG F NE    1 
ATOM   3986  C  CZ    . ARG F  2 35  ? 1.379   -28.107 69.598 1.00 71.98  ? 35   ARG F CZ    1 
ATOM   3987  N  NH1   . ARG F  2 35  ? 0.101   -27.903 69.911 1.00 69.96  ? 35   ARG F NH1   1 
ATOM   3988  N  NH2   . ARG F  2 35  ? 1.952   -29.291 69.815 1.00 73.42  ? 35   ARG F NH2   1 
ATOM   3989  N  N     . ARG F  2 36  ? 1.197   -24.995 64.084 1.00 51.09  ? 36   ARG F N     1 
ATOM   3990  C  CA    . ARG F  2 36  ? 1.522   -23.720 63.460 1.00 50.49  ? 36   ARG F CA    1 
ATOM   3991  C  C     . ARG F  2 36  ? 0.377   -23.195 62.581 1.00 50.47  ? 36   ARG F C     1 
ATOM   3992  O  O     . ARG F  2 36  ? 0.002   -22.023 62.694 1.00 50.79  ? 36   ARG F O     1 
ATOM   3993  C  CB    . ARG F  2 36  ? 2.824   -23.782 62.670 1.00 49.75  ? 36   ARG F CB    1 
ATOM   3994  C  CG    . ARG F  2 36  ? 4.008   -23.924 63.541 1.00 48.73  ? 36   ARG F CG    1 
ATOM   3995  C  CD    . ARG F  2 36  ? 5.291   -23.763 62.773 1.00 50.90  ? 36   ARG F CD    1 
ATOM   3996  N  NE    . ARG F  2 36  ? 5.561   -24.764 61.732 1.00 52.89  ? 36   ARG F NE    1 
ATOM   3997  C  CZ    . ARG F  2 36  ? 6.211   -25.921 61.929 1.00 53.68  ? 36   ARG F CZ    1 
ATOM   3998  N  NH1   . ARG F  2 36  ? 6.631   -26.283 63.147 1.00 51.92  ? 36   ARG F NH1   1 
ATOM   3999  N  NH2   . ARG F  2 36  ? 6.439   -26.730 60.899 1.00 52.81  ? 36   ARG F NH2   1 
ATOM   4000  N  N     . LEU F  2 37  ? -0.182  -24.059 61.734 1.00 49.75  ? 37   LEU F N     1 
ATOM   4001  C  CA    . LEU F  2 37  ? -1.355  -23.700 60.934 1.00 49.38  ? 37   LEU F CA    1 
ATOM   4002  C  C     . LEU F  2 37  ? -2.526  -23.230 61.793 1.00 49.43  ? 37   LEU F C     1 
ATOM   4003  O  O     . LEU F  2 37  ? -3.226  -22.295 61.440 1.00 50.03  ? 37   LEU F O     1 
ATOM   4004  C  CB    . LEU F  2 37  ? -1.802  -24.854 60.048 1.00 48.98  ? 37   LEU F CB    1 
ATOM   4005  C  CG    . LEU F  2 37  ? -0.868  -25.303 58.921 1.00 48.38  ? 37   LEU F CG    1 
ATOM   4006  C  CD1   . LEU F  2 37  ? -1.228  -26.705 58.449 1.00 46.32  ? 37   LEU F CD1   1 
ATOM   4007  C  CD2   . LEU F  2 37  ? -0.895  -24.340 57.776 1.00 46.98  ? 37   LEU F CD2   1 
ATOM   4008  N  N     . ALA F  2 38  ? -2.741  -23.865 62.927 1.00 49.42  ? 38   ALA F N     1 
ATOM   4009  C  CA    . ALA F  2 38  ? -3.853  -23.471 63.776 1.00 48.68  ? 38   ALA F CA    1 
ATOM   4010  C  C     . ALA F  2 38  ? -3.576  -22.103 64.401 1.00 48.32  ? 38   ALA F C     1 
ATOM   4011  O  O     . ALA F  2 38  ? -4.499  -21.306 64.602 1.00 48.35  ? 38   ALA F O     1 
ATOM   4012  C  CB    . ALA F  2 38  ? -4.104  -24.513 64.832 1.00 48.19  ? 38   ALA F CB    1 
ATOM   4013  N  N     . ARG F  2 39  ? -2.304  -21.843 64.700 1.00 47.93  ? 39   ARG F N     1 
ATOM   4014  C  CA    . ARG F  2 39  ? -1.866  -20.545 65.213 1.00 47.32  ? 39   ARG F CA    1 
ATOM   4015  C  C     . ARG F  2 39  ? -2.149  -19.441 64.186 1.00 47.13  ? 39   ARG F C     1 
ATOM   4016  O  O     . ARG F  2 39  ? -2.715  -18.418 64.534 1.00 47.52  ? 39   ARG F O     1 
ATOM   4017  C  CB    . ARG F  2 39  ? -0.363  -20.555 65.500 1.00 47.33  ? 39   ARG F CB    1 
ATOM   4018  C  CG    . ARG F  2 39  ? 0.068   -21.414 66.633 1.00 46.29  ? 39   ARG F CG    1 
ATOM   4019  C  CD    . ARG F  2 39  ? -0.717  -21.175 67.898 1.00 47.22  ? 39   ARG F CD    1 
ATOM   4020  N  NE    . ARG F  2 39  ? -0.108  -21.972 68.953 1.00 51.14  ? 39   ARG F NE    1 
ATOM   4021  C  CZ    . ARG F  2 39  ? -0.752  -22.730 69.834 1.00 52.34  ? 39   ARG F CZ    1 
ATOM   4022  N  NH1   . ARG F  2 39  ? -2.082  -22.777 69.884 1.00 50.88  ? 39   ARG F NH1   1 
ATOM   4023  N  NH2   . ARG F  2 39  ? -0.035  -23.415 70.704 1.00 53.81  ? 39   ARG F NH2   1 
ATOM   4024  N  N     . ARG F  2 40  ? -1.771  -19.655 62.924 1.00 45.82  ? 40   ARG F N     1 
ATOM   4025  C  CA    . ARG F  2 40  ? -2.047  -18.671 61.900 1.00 44.90  ? 40   ARG F CA    1 
ATOM   4026  C  C     . ARG F  2 40  ? -3.546  -18.448 61.835 1.00 44.61  ? 40   ARG F C     1 
ATOM   4027  O  O     . ARG F  2 40  ? -3.995  -17.364 61.487 1.00 45.52  ? 40   ARG F O     1 
ATOM   4028  C  CB    . ARG F  2 40  ? -1.494  -19.113 60.542 1.00 44.72  ? 40   ARG F CB    1 
ATOM   4029  C  CG    . ARG F  2 40  ? -1.614  -18.100 59.393 1.00 42.60  ? 40   ARG F CG    1 
ATOM   4030  C  CD    . ARG F  2 40  ? -0.598  -18.404 58.261 1.00 39.14  ? 40   ARG F CD    1 
ATOM   4031  N  NE    . ARG F  2 40  ? 0.753   -18.060 58.671 1.00 40.69  ? 40   ARG F NE    1 
ATOM   4032  C  CZ    . ARG F  2 40  ? 1.860   -18.244 57.958 1.00 40.32  ? 40   ARG F CZ    1 
ATOM   4033  N  NH1   . ARG F  2 40  ? 1.835   -18.791 56.768 1.00 37.81  ? 40   ARG F NH1   1 
ATOM   4034  N  NH2   . ARG F  2 40  ? 3.026   -17.860 58.448 1.00 45.68  ? 40   ARG F NH2   1 
ATOM   4035  N  N     . GLY F  2 41  ? -4.311  -19.476 62.190 1.00 43.99  ? 41   GLY F N     1 
ATOM   4036  C  CA    . GLY F  2 41  ? -5.771  -19.436 62.140 1.00 43.15  ? 41   GLY F CA    1 
ATOM   4037  C  C     . GLY F  2 41  ? -6.339  -18.851 63.418 1.00 43.14  ? 41   GLY F C     1 
ATOM   4038  O  O     . GLY F  2 41  ? -7.548  -18.787 63.579 1.00 42.66  ? 41   GLY F O     1 
ATOM   4039  N  N     . GLY F  2 42  ? -5.462  -18.428 64.331 1.00 42.91  ? 42   GLY F N     1 
ATOM   4040  C  CA    . GLY F  2 42  ? -5.874  -17.787 65.558 1.00 43.38  ? 42   GLY F CA    1 
ATOM   4041  C  C     . GLY F  2 42  ? -6.235  -18.700 66.701 1.00 44.75  ? 42   GLY F C     1 
ATOM   4042  O  O     . GLY F  2 42  ? -6.899  -18.295 67.630 1.00 45.23  ? 42   GLY F O     1 
ATOM   4043  N  N     . VAL F  2 43  ? -5.773  -19.939 66.665 1.00 46.41  ? 43   VAL F N     1 
ATOM   4044  C  CA    . VAL F  2 43  ? -6.239  -20.934 67.617 1.00 47.03  ? 43   VAL F CA    1 
ATOM   4045  C  C     . VAL F  2 43  ? -5.310  -20.988 68.808 1.00 47.91  ? 43   VAL F C     1 
ATOM   4046  O  O     . VAL F  2 43  ? -4.113  -21.054 68.657 1.00 47.97  ? 43   VAL F O     1 
ATOM   4047  C  CB    . VAL F  2 43  ? -6.399  -22.329 66.969 1.00 46.75  ? 43   VAL F CB    1 
ATOM   4048  C  CG1   . VAL F  2 43  ? -6.887  -23.327 67.992 1.00 46.20  ? 43   VAL F CG1   1 
ATOM   4049  C  CG2   . VAL F  2 43  ? -7.386  -22.256 65.805 1.00 45.89  ? 43   VAL F CG2   1 
ATOM   4050  N  N     . LYS F  2 44  ? -5.891  -20.958 69.998 1.00 49.76  ? 44   LYS F N     1 
ATOM   4051  C  CA    . LYS F  2 44  ? -5.124  -20.881 71.228 1.00 51.22  ? 44   LYS F CA    1 
ATOM   4052  C  C     . LYS F  2 44  ? -4.925  -22.246 71.899 1.00 51.76  ? 44   LYS F C     1 
ATOM   4053  O  O     . LYS F  2 44  ? -3.829  -22.548 72.369 1.00 52.85  ? 44   LYS F O     1 
ATOM   4054  C  CB    . LYS F  2 44  ? -5.788  -19.899 72.192 1.00 50.98  ? 44   LYS F CB    1 
ATOM   4055  C  CG    . LYS F  2 44  ? -4.916  -19.544 73.383 1.00 53.68  ? 44   LYS F CG    1 
ATOM   4056  C  CD    . LYS F  2 44  ? -5.751  -18.967 74.516 1.00 58.21  ? 44   LYS F CD    1 
ATOM   4057  C  CE    . LYS F  2 44  ? -4.858  -18.438 75.620 1.00 59.67  ? 44   LYS F CE    1 
ATOM   4058  N  NZ    . LYS F  2 44  ? -5.713  -18.056 76.779 1.00 62.19  ? 44   LYS F NZ    1 
ATOM   4059  N  N     . ARG F  2 45  ? -5.973  -23.063 71.954 1.00 52.11  ? 45   ARG F N     1 
ATOM   4060  C  CA    . ARG F  2 45  ? -5.879  -24.358 72.596 1.00 52.59  ? 45   ARG F CA    1 
ATOM   4061  C  C     . ARG F  2 45  ? -6.376  -25.479 71.659 1.00 52.83  ? 45   ARG F C     1 
ATOM   4062  O  O     . ARG F  2 45  ? -7.484  -25.388 71.093 1.00 52.86  ? 45   ARG F O     1 
ATOM   4063  C  CB    . ARG F  2 45  ? -6.669  -24.329 73.904 1.00 52.84  ? 45   ARG F CB    1 
ATOM   4064  C  CG    . ARG F  2 45  ? -6.105  -25.198 74.994 1.00 53.41  ? 45   ARG F CG    1 
ATOM   4065  C  CD    . ARG F  2 45  ? -6.764  -24.901 76.337 1.00 56.44  ? 45   ARG F CD    1 
ATOM   4066  N  NE    . ARG F  2 45  ? -6.319  -25.858 77.349 1.00 58.58  ? 45   ARG F NE    1 
ATOM   4067  C  CZ    . ARG F  2 45  ? -6.895  -27.045 77.553 1.00 59.91  ? 45   ARG F CZ    1 
ATOM   4068  N  NH1   . ARG F  2 45  ? -7.951  -27.415 76.833 1.00 57.76  ? 45   ARG F NH1   1 
ATOM   4069  N  NH2   . ARG F  2 45  ? -6.406  -27.870 78.479 1.00 61.65  ? 45   ARG F NH2   1 
ATOM   4070  N  N     . ILE F  2 46  ? -5.552  -26.525 71.525 1.00 52.39  ? 46   ILE F N     1 
ATOM   4071  C  CA    . ILE F  2 46  ? -5.785  -27.648 70.607 1.00 52.41  ? 46   ILE F CA    1 
ATOM   4072  C  C     . ILE F  2 46  ? -5.904  -29.007 71.327 1.00 52.92  ? 46   ILE F C     1 
ATOM   4073  O  O     . ILE F  2 46  ? -4.959  -29.497 71.959 1.00 53.26  ? 46   ILE F O     1 
ATOM   4074  C  CB    . ILE F  2 46  ? -4.622  -27.739 69.593 1.00 52.40  ? 46   ILE F CB    1 
ATOM   4075  C  CG1   . ILE F  2 46  ? -4.328  -26.359 68.982 1.00 52.65  ? 46   ILE F CG1   1 
ATOM   4076  C  CG2   . ILE F  2 46  ? -4.904  -28.766 68.547 1.00 50.62  ? 46   ILE F CG2   1 
ATOM   4077  C  CD1   . ILE F  2 46  ? -3.102  -26.302 68.145 1.00 50.69  ? 46   ILE F CD1   1 
ATOM   4078  N  N     . SER F  2 47  ? -7.068  -29.623 71.225 1.00 53.25  ? 47   SER F N     1 
ATOM   4079  C  CA    . SER F  2 47  ? -7.300  -30.941 71.808 1.00 53.20  ? 47   SER F CA    1 
ATOM   4080  C  C     . SER F  2 47  ? -6.524  -32.020 71.076 1.00 52.62  ? 47   SER F C     1 
ATOM   4081  O  O     . SER F  2 47  ? -6.294  -31.902 69.864 1.00 52.73  ? 47   SER F O     1 
ATOM   4082  C  CB    . SER F  2 47  ? -8.778  -31.277 71.695 1.00 53.40  ? 47   SER F CB    1 
ATOM   4083  O  OG    . SER F  2 47  ? -8.905  -32.489 70.989 1.00 56.66  ? 47   SER F OG    1 
ATOM   4084  N  N     . GLY F  2 48  ? -6.185  -33.095 71.790 1.00 51.86  ? 48   GLY F N     1 
ATOM   4085  C  CA    . GLY F  2 48  ? -5.305  -34.146 71.255 1.00 51.20  ? 48   GLY F CA    1 
ATOM   4086  C  C     . GLY F  2 48  ? -5.751  -34.830 69.962 1.00 51.23  ? 48   GLY F C     1 
ATOM   4087  O  O     . GLY F  2 48  ? -4.919  -35.238 69.141 1.00 50.94  ? 48   GLY F O     1 
ATOM   4088  N  N     . LEU F  2 49  ? -7.058  -34.951 69.765 1.00 50.84  ? 49   LEU F N     1 
ATOM   4089  C  CA    . LEU F  2 49  ? -7.574  -35.612 68.577 1.00 51.22  ? 49   LEU F CA    1 
ATOM   4090  C  C     . LEU F  2 49  ? -7.596  -34.719 67.309 1.00 51.44  ? 49   LEU F C     1 
ATOM   4091  O  O     . LEU F  2 49  ? -7.977  -35.188 66.223 1.00 51.66  ? 49   LEU F O     1 
ATOM   4092  C  CB    . LEU F  2 49  ? -8.980  -36.147 68.866 1.00 51.12  ? 49   LEU F CB    1 
ATOM   4093  C  CG    . LEU F  2 49  ? -9.102  -37.206 69.977 1.00 52.18  ? 49   LEU F CG    1 
ATOM   4094  C  CD1   . LEU F  2 49  ? -10.568 -37.416 70.338 1.00 53.62  ? 49   LEU F CD1   1 
ATOM   4095  C  CD2   . LEU F  2 49  ? -8.453  -38.543 69.590 1.00 49.61  ? 49   LEU F CD2   1 
ATOM   4096  N  N     . ILE F  2 50  ? -7.217  -33.442 67.435 1.00 50.58  ? 50   ILE F N     1 
ATOM   4097  C  CA    . ILE F  2 50  ? -7.319  -32.538 66.294 1.00 50.40  ? 50   ILE F CA    1 
ATOM   4098  C  C     . ILE F  2 50  ? -6.406  -32.999 65.185 1.00 50.72  ? 50   ILE F C     1 
ATOM   4099  O  O     . ILE F  2 50  ? -6.720  -32.825 64.001 1.00 51.21  ? 50   ILE F O     1 
ATOM   4100  C  CB    . ILE F  2 50  ? -6.993  -31.029 66.664 1.00 50.32  ? 50   ILE F CB    1 
ATOM   4101  C  CG1   . ILE F  2 50  ? -8.202  -30.329 67.279 1.00 49.61  ? 50   ILE F CG1   1 
ATOM   4102  C  CG2   . ILE F  2 50  ? -6.428  -30.228 65.472 1.00 47.87  ? 50   ILE F CG2   1 
ATOM   4103  C  CD1   . ILE F  2 50  ? -9.446  -30.446 66.461 1.00 51.89  ? 50   ILE F CD1   1 
ATOM   4104  N  N     . TYR F  2 51  ? -5.270  -33.572 65.571 1.00 50.51  ? 51   TYR F N     1 
ATOM   4105  C  CA    . TYR F  2 51  ? -4.228  -33.852 64.613 1.00 51.08  ? 51   TYR F CA    1 
ATOM   4106  C  C     . TYR F  2 51  ? -4.635  -34.909 63.613 1.00 51.55  ? 51   TYR F C     1 
ATOM   4107  O  O     . TYR F  2 51  ? -4.358  -34.754 62.424 1.00 52.39  ? 51   TYR F O     1 
ATOM   4108  C  CB    . TYR F  2 51  ? -2.885  -34.138 65.290 1.00 51.30  ? 51   TYR F CB    1 
ATOM   4109  C  CG    . TYR F  2 51  ? -2.540  -33.084 66.298 1.00 51.43  ? 51   TYR F CG    1 
ATOM   4110  C  CD1   . TYR F  2 51  ? -2.683  -33.340 67.654 1.00 51.06  ? 51   TYR F CD1   1 
ATOM   4111  C  CD2   . TYR F  2 51  ? -2.132  -31.803 65.896 1.00 50.74  ? 51   TYR F CD2   1 
ATOM   4112  C  CE1   . TYR F  2 51  ? -2.425  -32.367 68.597 1.00 52.83  ? 51   TYR F CE1   1 
ATOM   4113  C  CE2   . TYR F  2 51  ? -1.859  -30.809 66.829 1.00 51.23  ? 51   TYR F CE2   1 
ATOM   4114  C  CZ    . TYR F  2 51  ? -2.007  -31.094 68.189 1.00 53.78  ? 51   TYR F CZ    1 
ATOM   4115  O  OH    . TYR F  2 51  ? -1.743  -30.131 69.175 1.00 54.24  ? 51   TYR F OH    1 
ATOM   4116  N  N     . GLU F  2 52  ? -5.320  -35.957 64.057 1.00 52.01  ? 52   GLU F N     1 
ATOM   4117  C  CA    . GLU F  2 52  ? -5.761  -36.996 63.104 1.00 52.52  ? 52   GLU F CA    1 
ATOM   4118  C  C     . GLU F  2 52  ? -6.925  -36.481 62.255 1.00 51.33  ? 52   GLU F C     1 
ATOM   4119  O  O     . GLU F  2 52  ? -6.971  -36.734 61.057 1.00 51.19  ? 52   GLU F O     1 
ATOM   4120  C  CB    . GLU F  2 52  ? -6.070  -38.363 63.779 1.00 52.79  ? 52   GLU F CB    1 
ATOM   4121  C  CG    . GLU F  2 52  ? -4.827  -39.270 64.029 1.00 56.60  ? 52   GLU F CG    1 
ATOM   4122  C  CD    . GLU F  2 52  ? -3.957  -39.537 62.773 1.00 63.55  ? 52   GLU F CD    1 
ATOM   4123  O  OE1   . GLU F  2 52  ? -4.503  -39.837 61.685 1.00 67.71  ? 52   GLU F OE1   1 
ATOM   4124  O  OE2   . GLU F  2 52  ? -2.708  -39.482 62.867 1.00 65.21  ? 52   GLU F OE2   1 
ATOM   4125  N  N     . GLU F  2 53  ? -7.829  -35.727 62.863 1.00 50.32  ? 53   GLU F N     1 
ATOM   4126  C  CA    . GLU F  2 53  ? -8.926  -35.128 62.116 1.00 50.47  ? 53   GLU F CA    1 
ATOM   4127  C  C     . GLU F  2 53  ? -8.412  -34.261 60.952 1.00 49.97  ? 53   GLU F C     1 
ATOM   4128  O  O     . GLU F  2 53  ? -8.876  -34.406 59.811 1.00 49.96  ? 53   GLU F O     1 
ATOM   4129  C  CB    . GLU F  2 53  ? -9.792  -34.297 63.050 1.00 50.95  ? 53   GLU F CB    1 
ATOM   4130  C  CG    . GLU F  2 53  ? -11.122 -33.866 62.482 1.00 53.94  ? 53   GLU F CG    1 
ATOM   4131  C  CD    . GLU F  2 53  ? -12.204 -34.956 62.563 1.00 59.56  ? 53   GLU F CD    1 
ATOM   4132  O  OE1   . GLU F  2 53  ? -11.938 -36.044 63.145 1.00 60.62  ? 53   GLU F OE1   1 
ATOM   4133  O  OE2   . GLU F  2 53  ? -13.335 -34.713 62.044 1.00 60.80  ? 53   GLU F OE2   1 
ATOM   4134  N  N     . THR F  2 54  ? -7.445  -33.388 61.250 1.00 48.59  ? 54   THR F N     1 
ATOM   4135  C  CA    . THR F  2 54  ? -6.857  -32.489 60.280 1.00 47.75  ? 54   THR F CA    1 
ATOM   4136  C  C     . THR F  2 54  ? -6.146  -33.232 59.155 1.00 47.85  ? 54   THR F C     1 
ATOM   4137  O  O     . THR F  2 54  ? -6.308  -32.880 57.993 1.00 48.49  ? 54   THR F O     1 
ATOM   4138  C  CB    . THR F  2 54  ? -5.835  -31.527 60.934 1.00 48.13  ? 54   THR F CB    1 
ATOM   4139  O  OG1   . THR F  2 54  ? -6.444  -30.807 62.006 1.00 46.68  ? 54   THR F OG1   1 
ATOM   4140  C  CG2   . THR F  2 54  ? -5.292  -30.541 59.924 1.00 46.82  ? 54   THR F CG2   1 
ATOM   4141  N  N     . ARG F  2 55  ? -5.333  -34.234 59.481 1.00 47.76  ? 55   ARG F N     1 
ATOM   4142  C  CA    . ARG F  2 55  ? -4.709  -35.075 58.446 1.00 46.64  ? 55   ARG F CA    1 
ATOM   4143  C  C     . ARG F  2 55  ? -5.810  -35.655 57.538 1.00 46.10  ? 55   ARG F C     1 
ATOM   4144  O  O     . ARG F  2 55  ? -5.693  -35.634 56.302 1.00 45.94  ? 55   ARG F O     1 
ATOM   4145  C  CB    . ARG F  2 55  ? -3.884  -36.190 59.084 1.00 46.81  ? 55   ARG F CB    1 
ATOM   4146  C  CG    . ARG F  2 55  ? -2.690  -35.685 59.865 1.00 47.57  ? 55   ARG F CG    1 
ATOM   4147  C  CD    . ARG F  2 55  ? -1.631  -36.759 60.144 1.00 47.49  ? 55   ARG F CD    1 
ATOM   4148  N  NE    . ARG F  2 55  ? -0.647  -36.242 61.088 1.00 48.19  ? 55   ARG F NE    1 
ATOM   4149  C  CZ    . ARG F  2 55  ? -0.710  -36.376 62.411 1.00 49.39  ? 55   ARG F CZ    1 
ATOM   4150  N  NH1   . ARG F  2 55  ? -1.699  -37.036 62.992 1.00 49.07  ? 55   ARG F NH1   1 
ATOM   4151  N  NH2   . ARG F  2 55  ? 0.224   -35.830 63.164 1.00 50.33  ? 55   ARG F NH2   1 
ATOM   4152  N  N     . GLY F  2 56  ? -6.894  -36.125 58.154 1.00 44.83  ? 56   GLY F N     1 
ATOM   4153  C  CA    . GLY F  2 56  ? -7.990  -36.708 57.416 1.00 44.34  ? 56   GLY F CA    1 
ATOM   4154  C  C     . GLY F  2 56  ? -8.559  -35.713 56.432 1.00 44.63  ? 56   GLY F C     1 
ATOM   4155  O  O     . GLY F  2 56  ? -8.532  -35.966 55.218 1.00 45.38  ? 56   GLY F O     1 
ATOM   4156  N  N     . VAL F  2 57  ? -9.041  -34.574 56.952 1.00 43.47  ? 57   VAL F N     1 
ATOM   4157  C  CA    . VAL F  2 57  ? -9.480  -33.412 56.147 1.00 42.32  ? 57   VAL F CA    1 
ATOM   4158  C  C     . VAL F  2 57  ? -8.514  -32.984 55.038 1.00 42.19  ? 57   VAL F C     1 
ATOM   4159  O  O     . VAL F  2 57  ? -8.936  -32.677 53.919 1.00 41.47  ? 57   VAL F O     1 
ATOM   4160  C  CB    . VAL F  2 57  ? -9.750  -32.178 57.038 1.00 42.31  ? 57   VAL F CB    1 
ATOM   4161  C  CG1   . VAL F  2 57  ? -9.846  -30.946 56.214 1.00 41.77  ? 57   VAL F CG1   1 
ATOM   4162  C  CG2   . VAL F  2 57  ? -11.014 -32.354 57.889 1.00 42.13  ? 57   VAL F CG2   1 
ATOM   4163  N  N     . LEU F  2 58  ? -7.223  -32.949 55.336 1.00 42.17  ? 58   LEU F N     1 
ATOM   4164  C  CA    . LEU F  2 58  ? -6.278  -32.538 54.330 1.00 43.21  ? 58   LEU F CA    1 
ATOM   4165  C  C     . LEU F  2 58  ? -6.172  -33.548 53.174 1.00 45.06  ? 58   LEU F C     1 
ATOM   4166  O  O     . LEU F  2 58  ? -6.111  -33.152 51.996 1.00 46.34  ? 58   LEU F O     1 
ATOM   4167  C  CB    . LEU F  2 58  ? -4.921  -32.246 54.951 1.00 42.74  ? 58   LEU F CB    1 
ATOM   4168  C  CG    . LEU F  2 58  ? -3.763  -32.046 53.958 1.00 42.85  ? 58   LEU F CG    1 
ATOM   4169  C  CD1   . LEU F  2 58  ? -4.004  -30.827 53.041 1.00 42.87  ? 58   LEU F CD1   1 
ATOM   4170  C  CD2   . LEU F  2 58  ? -2.460  -31.893 54.699 1.00 42.18  ? 58   LEU F CD2   1 
ATOM   4171  N  N     . LYS F  2 59  ? -6.180  -34.848 53.491 1.00 46.25  ? 59   LYS F N     1 
ATOM   4172  C  CA    . LYS F  2 59  ? -6.101  -35.894 52.475 1.00 46.80  ? 59   LYS F CA    1 
ATOM   4173  C  C     . LYS F  2 59  ? -7.299  -35.823 51.522 1.00 46.64  ? 59   LYS F C     1 
ATOM   4174  O  O     . LYS F  2 59  ? -7.154  -35.995 50.304 1.00 46.68  ? 59   LYS F O     1 
ATOM   4175  C  CB    . LYS F  2 59  ? -5.973  -37.239 53.170 1.00 47.88  ? 59   LYS F CB    1 
ATOM   4176  C  CG    . LYS F  2 59  ? -6.140  -38.477 52.301 1.00 53.00  ? 59   LYS F CG    1 
ATOM   4177  C  CD    . LYS F  2 59  ? -5.658  -39.731 53.046 1.00 59.95  ? 59   LYS F CD    1 
ATOM   4178  C  CE    . LYS F  2 59  ? -6.333  -41.038 52.498 1.00 64.57  ? 59   LYS F CE    1 
ATOM   4179  N  NZ    . LYS F  2 59  ? -7.851  -40.983 52.399 1.00 64.56  ? 59   LYS F NZ    1 
ATOM   4180  N  N     . VAL F  2 60  ? -8.478  -35.530 52.064 1.00 46.45  ? 60   VAL F N     1 
ATOM   4181  C  CA    . VAL F  2 60  ? -9.652  -35.289 51.217 1.00 46.16  ? 60   VAL F CA    1 
ATOM   4182  C  C     . VAL F  2 60  ? -9.450  -34.083 50.319 1.00 46.34  ? 60   VAL F C     1 
ATOM   4183  O  O     . VAL F  2 60  ? -9.776  -34.132 49.127 1.00 47.14  ? 60   VAL F O     1 
ATOM   4184  C  CB    . VAL F  2 60  ? -10.975 -35.088 52.017 1.00 46.32  ? 60   VAL F CB    1 
ATOM   4185  C  CG1   . VAL F  2 60  ? -12.079 -34.580 51.117 1.00 43.29  ? 60   VAL F CG1   1 
ATOM   4186  C  CG2   . VAL F  2 60  ? -11.405 -36.371 52.678 1.00 46.48  ? 60   VAL F CG2   1 
ATOM   4187  N  N     . PHE F  2 61  ? -8.927  -32.998 50.881 1.00 45.68  ? 61   PHE F N     1 
ATOM   4188  C  CA    . PHE F  2 61  ? -8.712  -31.813 50.082 1.00 45.27  ? 61   PHE F CA    1 
ATOM   4189  C  C     . PHE F  2 61  ? -7.765  -32.151 48.946 1.00 45.73  ? 61   PHE F C     1 
ATOM   4190  O  O     . PHE F  2 61  ? -8.066  -31.897 47.783 1.00 46.04  ? 61   PHE F O     1 
ATOM   4191  C  CB    . PHE F  2 61  ? -8.180  -30.663 50.937 1.00 44.91  ? 61   PHE F CB    1 
ATOM   4192  C  CG    . PHE F  2 61  ? -7.949  -29.395 50.179 1.00 44.92  ? 61   PHE F CG    1 
ATOM   4193  C  CD1   . PHE F  2 61  ? -9.001  -28.515 49.922 1.00 45.20  ? 61   PHE F CD1   1 
ATOM   4194  C  CD2   . PHE F  2 61  ? -6.683  -29.075 49.701 1.00 45.38  ? 61   PHE F CD2   1 
ATOM   4195  C  CE1   . PHE F  2 61  ? -8.783  -27.351 49.221 1.00 43.66  ? 61   PHE F CE1   1 
ATOM   4196  C  CE2   . PHE F  2 61  ? -6.468  -27.901 48.986 1.00 44.30  ? 61   PHE F CE2   1 
ATOM   4197  C  CZ    . PHE F  2 61  ? -7.513  -27.047 48.750 1.00 43.78  ? 61   PHE F CZ    1 
ATOM   4198  N  N     . LEU F  2 62  ? -6.638  -32.768 49.262 1.00 46.14  ? 62   LEU F N     1 
ATOM   4199  C  CA    . LEU F  2 62  ? -5.699  -33.109 48.210 1.00 46.66  ? 62   LEU F CA    1 
ATOM   4200  C  C     . LEU F  2 62  ? -6.196  -34.102 47.157 1.00 47.46  ? 62   LEU F C     1 
ATOM   4201  O  O     . LEU F  2 62  ? -5.892  -33.956 45.975 1.00 47.54  ? 62   LEU F O     1 
ATOM   4202  C  CB    . LEU F  2 62  ? -4.396  -33.555 48.814 1.00 46.95  ? 62   LEU F CB    1 
ATOM   4203  C  CG    . LEU F  2 62  ? -3.546  -32.402 49.334 1.00 46.88  ? 62   LEU F CG    1 
ATOM   4204  C  CD1   . LEU F  2 62  ? -2.317  -32.930 50.077 1.00 45.47  ? 62   LEU F CD1   1 
ATOM   4205  C  CD2   . LEU F  2 62  ? -3.144  -31.429 48.199 1.00 45.58  ? 62   LEU F CD2   1 
ATOM   4206  N  N     . GLU F  2 63  ? -6.951  -35.114 47.574 1.00 48.27  ? 63   GLU F N     1 
ATOM   4207  C  CA    . GLU F  2 63  ? -7.464  -36.097 46.630 1.00 49.03  ? 63   GLU F CA    1 
ATOM   4208  C  C     . GLU F  2 63  ? -8.289  -35.405 45.571 1.00 48.96  ? 63   GLU F C     1 
ATOM   4209  O  O     . GLU F  2 63  ? -8.113  -35.652 44.371 1.00 48.94  ? 63   GLU F O     1 
ATOM   4210  C  CB    . GLU F  2 63  ? -8.338  -37.121 47.333 1.00 49.78  ? 63   GLU F CB    1 
ATOM   4211  C  CG    . GLU F  2 63  ? -7.606  -38.308 47.888 1.00 53.11  ? 63   GLU F CG    1 
ATOM   4212  C  CD    . GLU F  2 63  ? -8.325  -38.950 49.082 1.00 58.97  ? 63   GLU F CD    1 
ATOM   4213  O  OE1   . GLU F  2 63  ? -9.525  -38.618 49.339 1.00 58.93  ? 63   GLU F OE1   1 
ATOM   4214  O  OE2   . GLU F  2 63  ? -7.659  -39.768 49.782 1.00 60.15  ? 63   GLU F OE2   1 
ATOM   4215  N  N     . ASN F  2 64  ? -9.201  -34.540 46.023 1.00 49.03  ? 64   ASN F N     1 
ATOM   4216  C  CA    . ASN F  2 64  ? -10.064 -33.799 45.119 1.00 49.05  ? 64   ASN F CA    1 
ATOM   4217  C  C     . ASN F  2 64  ? -9.299  -32.911 44.156 1.00 49.01  ? 64   ASN F C     1 
ATOM   4218  O  O     . ASN F  2 64  ? -9.585  -32.923 42.963 1.00 49.41  ? 64   ASN F O     1 
ATOM   4219  C  CB    . ASN F  2 64  ? -11.093 -33.002 45.893 1.00 49.38  ? 64   ASN F CB    1 
ATOM   4220  C  CG    . ASN F  2 64  ? -12.071 -33.886 46.628 1.00 51.29  ? 64   ASN F CG    1 
ATOM   4221  O  OD1   . ASN F  2 64  ? -12.130 -35.085 46.386 1.00 56.71  ? 64   ASN F OD1   1 
ATOM   4222  N  ND2   . ASN F  2 64  ? -12.850 -33.302 47.532 1.00 52.73  ? 64   ASN F ND2   1 
ATOM   4223  N  N     . VAL F  2 65  ? -8.306  -32.182 44.655 1.00 48.71  ? 65   VAL F N     1 
ATOM   4224  C  CA    . VAL F  2 65  ? -7.555  -31.278 43.794 1.00 49.20  ? 65   VAL F CA    1 
ATOM   4225  C  C     . VAL F  2 65  ? -6.666  -32.055 42.854 1.00 49.23  ? 65   VAL F C     1 
ATOM   4226  O  O     . VAL F  2 65  ? -6.602  -31.753 41.674 1.00 49.70  ? 65   VAL F O     1 
ATOM   4227  C  CB    . VAL F  2 65  ? -6.721  -30.154 44.571 1.00 49.16  ? 65   VAL F CB    1 
ATOM   4228  C  CG1   . VAL F  2 65  ? -6.155  -29.139 43.603 1.00 47.75  ? 65   VAL F CG1   1 
ATOM   4229  C  CG2   . VAL F  2 65  ? -7.598  -29.406 45.507 1.00 49.63  ? 65   VAL F CG2   1 
ATOM   4230  N  N     . ILE F  2 66  ? -5.967  -33.050 43.369 1.00 49.76  ? 66   ILE F N     1 
ATOM   4231  C  CA    . ILE F  2 66  ? -5.077  -33.827 42.528 1.00 50.11  ? 66   ILE F CA    1 
ATOM   4232  C  C     . ILE F  2 66  ? -5.828  -34.609 41.437 1.00 50.22  ? 66   ILE F C     1 
ATOM   4233  O  O     . ILE F  2 66  ? -5.380  -34.635 40.301 1.00 50.22  ? 66   ILE F O     1 
ATOM   4234  C  CB    . ILE F  2 66  ? -4.197  -34.723 43.371 1.00 50.53  ? 66   ILE F CB    1 
ATOM   4235  C  CG1   . ILE F  2 66  ? -3.133  -33.877 44.068 1.00 50.09  ? 66   ILE F CG1   1 
ATOM   4236  C  CG2   . ILE F  2 66  ? -3.540  -35.777 42.505 1.00 51.35  ? 66   ILE F CG2   1 
ATOM   4237  C  CD1   . ILE F  2 66  ? -2.779  -34.348 45.440 1.00 51.53  ? 66   ILE F CD1   1 
ATOM   4238  N  N     . ARG F  2 67  ? -6.965  -35.220 41.781 1.00 50.22  ? 67   ARG F N     1 
ATOM   4239  C  CA    . ARG F  2 67  ? -7.790  -35.924 40.815 1.00 50.61  ? 67   ARG F CA    1 
ATOM   4240  C  C     . ARG F  2 67  ? -8.121  -35.057 39.576 1.00 50.38  ? 67   ARG F C     1 
ATOM   4241  O  O     . ARG F  2 67  ? -7.839  -35.461 38.430 1.00 50.66  ? 67   ARG F O     1 
ATOM   4242  C  CB    . ARG F  2 67  ? -9.056  -36.446 41.495 1.00 50.68  ? 67   ARG F CB    1 
ATOM   4243  C  CG    . ARG F  2 67  ? -10.058 -37.171 40.558 1.00 51.92  ? 67   ARG F CG    1 
ATOM   4244  C  CD    . ARG F  2 67  ? -11.384 -37.446 41.248 1.00 52.78  ? 67   ARG F CD    1 
ATOM   4245  N  NE    . ARG F  2 67  ? -11.182 -38.265 42.442 1.00 61.43  ? 67   ARG F NE    1 
ATOM   4246  C  CZ    . ARG F  2 67  ? -11.526 -37.933 43.694 1.00 64.38  ? 67   ARG F CZ    1 
ATOM   4247  N  NH1   . ARG F  2 67  ? -12.138 -36.776 43.959 1.00 65.49  ? 67   ARG F NH1   1 
ATOM   4248  N  NH2   . ARG F  2 67  ? -11.273 -38.781 44.691 1.00 64.55  ? 67   ARG F NH2   1 
ATOM   4249  N  N     . ASP F  2 68  ? -8.688  -33.866 39.796 1.00 49.82  ? 68   ASP F N     1 
ATOM   4250  C  CA    . ASP F  2 68  ? -8.966  -32.921 38.689 1.00 48.88  ? 68   ASP F CA    1 
ATOM   4251  C  C     . ASP F  2 68  ? -7.718  -32.470 37.981 1.00 47.82  ? 68   ASP F C     1 
ATOM   4252  O  O     . ASP F  2 68  ? -7.709  -32.360 36.767 1.00 47.87  ? 68   ASP F O     1 
ATOM   4253  C  CB    . ASP F  2 68  ? -9.752  -31.700 39.160 1.00 49.09  ? 68   ASP F CB    1 
ATOM   4254  C  CG    . ASP F  2 68  ? -11.160 -32.054 39.603 1.00 51.89  ? 68   ASP F CG    1 
ATOM   4255  O  OD1   . ASP F  2 68  ? -11.567 -33.243 39.511 1.00 55.25  ? 68   ASP F OD1   1 
ATOM   4256  O  OD2   . ASP F  2 68  ? -11.875 -31.149 40.056 1.00 54.18  ? 68   ASP F OD2   1 
ATOM   4257  N  N     . ALA F  2 69  ? -6.653  -32.223 38.720 1.00 47.12  ? 69   ALA F N     1 
ATOM   4258  C  CA    . ALA F  2 69  ? -5.432  -31.746 38.091 1.00 47.49  ? 69   ALA F CA    1 
ATOM   4259  C  C     . ALA F  2 69  ? -4.876  -32.816 37.167 1.00 47.92  ? 69   ALA F C     1 
ATOM   4260  O  O     . ALA F  2 69  ? -4.679  -32.560 35.976 1.00 48.31  ? 69   ALA F O     1 
ATOM   4261  C  CB    . ALA F  2 69  ? -4.388  -31.280 39.137 1.00 47.04  ? 69   ALA F CB    1 
ATOM   4262  N  N     . VAL F  2 70  ? -4.653  -34.013 37.718 1.00 48.32  ? 70   VAL F N     1 
ATOM   4263  C  CA    . VAL F  2 70  ? -4.372  -35.226 36.928 1.00 48.85  ? 70   VAL F CA    1 
ATOM   4264  C  C     . VAL F  2 70  ? -5.336  -35.447 35.726 1.00 48.91  ? 70   VAL F C     1 
ATOM   4265  O  O     . VAL F  2 70  ? -4.878  -35.786 34.621 1.00 49.05  ? 70   VAL F O     1 
ATOM   4266  C  CB    . VAL F  2 70  ? -4.336  -36.514 37.805 1.00 48.37  ? 70   VAL F CB    1 
ATOM   4267  C  CG1   . VAL F  2 70  ? -4.124  -37.712 36.935 1.00 48.24  ? 70   VAL F CG1   1 
ATOM   4268  C  CG2   . VAL F  2 70  ? -3.229  -36.424 38.821 1.00 49.07  ? 70   VAL F CG2   1 
ATOM   4269  N  N     . THR F  2 71  ? -6.639  -35.274 35.927 1.00 47.94  ? 71   THR F N     1 
ATOM   4270  C  CA    . THR F  2 71  ? -7.515  -35.319 34.776 1.00 48.60  ? 71   THR F CA    1 
ATOM   4271  C  C     . THR F  2 71  ? -7.073  -34.320 33.662 1.00 50.77  ? 71   THR F C     1 
ATOM   4272  O  O     . THR F  2 71  ? -6.966  -34.706 32.472 1.00 51.69  ? 71   THR F O     1 
ATOM   4273  C  CB    . THR F  2 71  ? -8.975  -35.096 35.145 1.00 47.96  ? 71   THR F CB    1 
ATOM   4274  O  OG1   . THR F  2 71  ? -9.381  -36.064 36.124 1.00 45.44  ? 71   THR F OG1   1 
ATOM   4275  C  CG2   . THR F  2 71  ? -9.835  -35.209 33.914 1.00 44.97  ? 71   THR F CG2   1 
ATOM   4276  N  N     . TYR F  2 72  ? -6.795  -33.060 34.038 1.00 51.50  ? 72   TYR F N     1 
ATOM   4277  C  CA    . TYR F  2 72  ? -6.321  -32.052 33.071 1.00 51.98  ? 72   TYR F CA    1 
ATOM   4278  C  C     . TYR F  2 72  ? -5.032  -32.534 32.418 1.00 53.47  ? 72   TYR F C     1 
ATOM   4279  O  O     . TYR F  2 72  ? -4.884  -32.477 31.191 1.00 53.33  ? 72   TYR F O     1 
ATOM   4280  C  CB    . TYR F  2 72  ? -6.119  -30.671 33.723 1.00 51.19  ? 72   TYR F CB    1 
ATOM   4281  C  CG    . TYR F  2 72  ? -7.404  -29.899 33.989 1.00 48.93  ? 72   TYR F CG    1 
ATOM   4282  C  CD1   . TYR F  2 72  ? -7.804  -29.570 35.290 1.00 46.95  ? 72   TYR F CD1   1 
ATOM   4283  C  CD2   . TYR F  2 72  ? -8.202  -29.482 32.938 1.00 48.46  ? 72   TYR F CD2   1 
ATOM   4284  C  CE1   . TYR F  2 72  ? -8.974  -28.869 35.528 1.00 44.99  ? 72   TYR F CE1   1 
ATOM   4285  C  CE2   . TYR F  2 72  ? -9.356  -28.775 33.162 1.00 48.64  ? 72   TYR F CE2   1 
ATOM   4286  C  CZ    . TYR F  2 72  ? -9.738  -28.480 34.455 1.00 48.28  ? 72   TYR F CZ    1 
ATOM   4287  O  OH    . TYR F  2 72  ? -10.910 -27.796 34.620 1.00 49.69  ? 72   TYR F OH    1 
ATOM   4288  N  N     . THR F  2 73  ? -4.124  -33.065 33.238 1.00 55.15  ? 73   THR F N     1 
ATOM   4289  C  CA    . THR F  2 73  ? -2.877  -33.623 32.726 1.00 57.10  ? 73   THR F CA    1 
ATOM   4290  C  C     . THR F  2 73  ? -3.085  -34.650 31.639 1.00 57.94  ? 73   THR F C     1 
ATOM   4291  O  O     . THR F  2 73  ? -2.472  -34.538 30.596 1.00 58.14  ? 73   THR F O     1 
ATOM   4292  C  CB    . THR F  2 73  ? -2.054  -34.271 33.819 1.00 57.41  ? 73   THR F CB    1 
ATOM   4293  O  OG1   . THR F  2 73  ? -1.913  -33.348 34.907 1.00 59.61  ? 73   THR F OG1   1 
ATOM   4294  C  CG2   . THR F  2 73  ? -0.675  -34.645 33.295 1.00 57.27  ? 73   THR F CG2   1 
ATOM   4295  N  N     . GLU F  2 74  ? -3.950  -35.639 31.885 1.00 59.31  ? 74   GLU F N     1 
ATOM   4296  C  CA    . GLU F  2 74  ? -4.138  -36.754 30.958 1.00 60.85  ? 74   GLU F CA    1 
ATOM   4297  C  C     . GLU F  2 74  ? -4.794  -36.270 29.708 1.00 60.79  ? 74   GLU F C     1 
ATOM   4298  O  O     . GLU F  2 74  ? -4.471  -36.728 28.617 1.00 60.88  ? 74   GLU F O     1 
ATOM   4299  C  CB    . GLU F  2 74  ? -5.010  -37.859 31.550 1.00 60.39  ? 74   GLU F CB    1 
ATOM   4300  C  CG    . GLU F  2 74  ? -4.302  -38.779 32.545 1.00 62.48  ? 74   GLU F CG    1 
ATOM   4301  C  CD    . GLU F  2 74  ? -5.257  -39.363 33.615 1.00 64.44  ? 74   GLU F CD    1 
ATOM   4302  O  OE1   . GLU F  2 74  ? -6.501  -39.407 33.384 1.00 68.08  ? 74   GLU F OE1   1 
ATOM   4303  O  OE2   . GLU F  2 74  ? -4.760  -39.770 34.701 1.00 69.38  ? 74   GLU F OE2   1 
ATOM   4304  N  N     . HIS F  2 75  ? -5.730  -35.344 29.857 1.00 61.52  ? 75   HIS F N     1 
ATOM   4305  C  CA    . HIS F  2 75  ? -6.422  -34.824 28.680 1.00 61.99  ? 75   HIS F CA    1 
ATOM   4306  C  C     . HIS F  2 75  ? -5.455  -34.117 27.731 1.00 62.22  ? 75   HIS F C     1 
ATOM   4307  O  O     . HIS F  2 75  ? -5.601  -34.225 26.516 1.00 62.51  ? 75   HIS F O     1 
ATOM   4308  C  CB    . HIS F  2 75  ? -7.547  -33.893 29.064 1.00 61.88  ? 75   HIS F CB    1 
ATOM   4309  C  CG    . HIS F  2 75  ? -8.244  -33.307 27.888 1.00 62.02  ? 75   HIS F CG    1 
ATOM   4310  N  ND1   . HIS F  2 75  ? -9.444  -33.794 27.422 1.00 63.98  ? 75   HIS F ND1   1 
ATOM   4311  C  CD2   . HIS F  2 75  ? -7.912  -32.278 27.076 1.00 62.35  ? 75   HIS F CD2   1 
ATOM   4312  C  CE1   . HIS F  2 75  ? -9.823  -33.088 26.369 1.00 64.78  ? 75   HIS F CE1   1 
ATOM   4313  N  NE2   . HIS F  2 75  ? -8.915  -32.156 26.143 1.00 62.09  ? 75   HIS F NE2   1 
ATOM   4314  N  N     . ALA F  2 76  ? -4.469  -33.418 28.297 1.00 62.15  ? 76   ALA F N     1 
ATOM   4315  C  CA    . ALA F  2 76  ? -3.413  -32.761 27.529 1.00 62.11  ? 76   ALA F CA    1 
ATOM   4316  C  C     . ALA F  2 76  ? -2.442  -33.782 26.956 1.00 62.80  ? 76   ALA F C     1 
ATOM   4317  O  O     . ALA F  2 76  ? -1.605  -33.437 26.136 1.00 63.04  ? 76   ALA F O     1 
ATOM   4318  C  CB    . ALA F  2 76  ? -2.667  -31.796 28.397 1.00 61.60  ? 76   ALA F CB    1 
ATOM   4319  N  N     . LYS F  2 77  ? -2.547  -35.032 27.407 1.00 63.53  ? 77   LYS F N     1 
ATOM   4320  C  CA    . LYS F  2 77  ? -1.642  -36.120 26.990 1.00 64.44  ? 77   LYS F CA    1 
ATOM   4321  C  C     . LYS F  2 77  ? -0.199  -35.967 27.491 1.00 64.18  ? 77   LYS F C     1 
ATOM   4322  O  O     . LYS F  2 77  ? 0.746   -36.371 26.820 1.00 65.24  ? 77   LYS F O     1 
ATOM   4323  C  CB    . LYS F  2 77  ? -1.694  -36.346 25.464 1.00 64.34  ? 77   LYS F CB    1 
ATOM   4324  C  CG    . LYS F  2 77  ? -2.894  -37.165 25.049 1.00 66.48  ? 77   LYS F CG    1 
ATOM   4325  C  CD    . LYS F  2 77  ? -3.129  -37.186 23.560 1.00 68.84  ? 77   LYS F CD    1 
ATOM   4326  C  CE    . LYS F  2 77  ? -4.446  -37.891 23.276 1.00 71.70  ? 77   LYS F CE    1 
ATOM   4327  N  NZ    . LYS F  2 77  ? -4.949  -37.596 21.897 1.00 74.87  ? 77   LYS F NZ    1 
ATOM   4328  N  N     . ARG F  2 78  ? -0.038  -35.395 28.674 1.00 63.86  ? 78   ARG F N     1 
ATOM   4329  C  CA    . ARG F  2 78  ? 1.278   -35.180 29.257 1.00 63.40  ? 78   ARG F CA    1 
ATOM   4330  C  C     . ARG F  2 78  ? 1.478   -36.181 30.372 1.00 63.27  ? 78   ARG F C     1 
ATOM   4331  O  O     . ARG F  2 78  ? 0.530   -36.787 30.828 1.00 63.38  ? 78   ARG F O     1 
ATOM   4332  C  CB    . ARG F  2 78  ? 1.406   -33.752 29.819 1.00 63.62  ? 78   ARG F CB    1 
ATOM   4333  C  CG    . ARG F  2 78  ? 1.632   -32.674 28.782 1.00 62.55  ? 78   ARG F CG    1 
ATOM   4334  C  CD    . ARG F  2 78  ? 1.763   -31.293 29.413 1.00 62.91  ? 78   ARG F CD    1 
ATOM   4335  N  NE    . ARG F  2 78  ? 0.450   -30.684 29.662 1.00 61.35  ? 78   ARG F NE    1 
ATOM   4336  C  CZ    . ARG F  2 78  ? -0.137  -30.625 30.863 1.00 60.60  ? 78   ARG F CZ    1 
ATOM   4337  N  NH1   . ARG F  2 78  ? 0.466   -31.142 31.934 1.00 58.52  ? 78   ARG F NH1   1 
ATOM   4338  N  NH2   . ARG F  2 78  ? -1.329  -30.049 30.997 1.00 57.42  ? 78   ARG F NH2   1 
ATOM   4339  N  N     . LYS F  2 79  ? 2.722   -36.348 30.801 1.00 63.68  ? 79   LYS F N     1 
ATOM   4340  C  CA    . LYS F  2 79  ? 3.063   -37.196 31.939 1.00 64.14  ? 79   LYS F CA    1 
ATOM   4341  C  C     . LYS F  2 79  ? 3.433   -36.335 33.130 1.00 62.72  ? 79   LYS F C     1 
ATOM   4342  O  O     . LYS F  2 79  ? 3.746   -36.844 34.201 1.00 63.00  ? 79   LYS F O     1 
ATOM   4343  C  CB    . LYS F  2 79  ? 4.241   -38.106 31.597 1.00 64.33  ? 79   LYS F CB    1 
ATOM   4344  C  CG    . LYS F  2 79  ? 4.042   -38.934 30.329 1.00 66.57  ? 79   LYS F CG    1 
ATOM   4345  C  CD    . LYS F  2 79  ? 5.023   -40.122 30.285 1.00 67.33  ? 79   LYS F CD    1 
ATOM   4346  C  CE    . LYS F  2 79  ? 5.077   -40.766 28.876 1.00 69.14  ? 79   LYS F CE    1 
ATOM   4347  N  NZ    . LYS F  2 79  ? 5.795   -42.101 28.889 1.00 70.76  ? 79   LYS F NZ    1 
ATOM   4348  N  N     . THR F  2 80  ? 3.393   -35.024 32.934 1.00 61.72  ? 80   THR F N     1 
ATOM   4349  C  CA    . THR F  2 80  ? 3.898   -34.080 33.926 1.00 60.92  ? 80   THR F CA    1 
ATOM   4350  C  C     . THR F  2 80  ? 2.763   -33.174 34.357 1.00 59.73  ? 80   THR F C     1 
ATOM   4351  O  O     . THR F  2 80  ? 2.156   -32.498 33.524 1.00 59.91  ? 80   THR F O     1 
ATOM   4352  C  CB    . THR F  2 80  ? 5.051   -33.239 33.345 1.00 60.76  ? 80   THR F CB    1 
ATOM   4353  O  OG1   . THR F  2 80  ? 6.044   -34.124 32.799 1.00 62.51  ? 80   THR F OG1   1 
ATOM   4354  C  CG2   . THR F  2 80  ? 5.692   -32.381 34.425 1.00 61.28  ? 80   THR F CG2   1 
ATOM   4355  N  N     . VAL F  2 81  ? 2.465   -33.183 35.652 1.00 58.25  ? 81   VAL F N     1 
ATOM   4356  C  CA    . VAL F  2 81  ? 1.443   -32.310 36.200 1.00 56.81  ? 81   VAL F CA    1 
ATOM   4357  C  C     . VAL F  2 81  ? 2.039   -30.906 36.319 1.00 56.28  ? 81   VAL F C     1 
ATOM   4358  O  O     . VAL F  2 81  ? 3.012   -30.700 37.062 1.00 55.18  ? 81   VAL F O     1 
ATOM   4359  C  CB    . VAL F  2 81  ? 0.921   -32.807 37.562 1.00 56.94  ? 81   VAL F CB    1 
ATOM   4360  C  CG1   . VAL F  2 81  ? -0.179  -31.888 38.081 1.00 56.62  ? 81   VAL F CG1   1 
ATOM   4361  C  CG2   . VAL F  2 81  ? 0.401   -34.246 37.460 1.00 55.04  ? 81   VAL F CG2   1 
ATOM   4362  N  N     . THR F  2 82  ? 1.459   -29.965 35.563 1.00 55.85  ? 82   THR F N     1 
ATOM   4363  C  CA    . THR F  2 82  ? 1.907   -28.558 35.553 1.00 56.14  ? 82   THR F CA    1 
ATOM   4364  C  C     . THR F  2 82  ? 1.207   -27.697 36.598 1.00 55.80  ? 82   THR F C     1 
ATOM   4365  O  O     . THR F  2 82  ? 0.096   -28.013 37.058 1.00 55.80  ? 82   THR F O     1 
ATOM   4366  C  CB    . THR F  2 82  ? 1.738   -27.874 34.163 1.00 55.87  ? 82   THR F CB    1 
ATOM   4367  O  OG1   . THR F  2 82  ? 0.371   -27.931 33.752 1.00 55.71  ? 82   THR F OG1   1 
ATOM   4368  C  CG2   . THR F  2 82  ? 2.583   -28.556 33.114 1.00 56.57  ? 82   THR F CG2   1 
ATOM   4369  N  N     . ALA F  2 83  ? 1.862   -26.597 36.952 1.00 55.79  ? 83   ALA F N     1 
ATOM   4370  C  CA    . ALA F  2 83  ? 1.278   -25.566 37.820 1.00 55.43  ? 83   ALA F CA    1 
ATOM   4371  C  C     . ALA F  2 83  ? -0.074  -25.154 37.296 1.00 55.49  ? 83   ALA F C     1 
ATOM   4372  O  O     . ALA F  2 83  ? -1.004  -24.950 38.083 1.00 55.95  ? 83   ALA F O     1 
ATOM   4373  C  CB    . ALA F  2 83  ? 2.177   -24.354 37.882 1.00 55.71  ? 83   ALA F CB    1 
ATOM   4374  N  N     . MET F  2 84  ? -0.185  -25.028 35.970 1.00 55.14  ? 84   MET F N     1 
ATOM   4375  C  CA    . MET F  2 84  ? -1.448  -24.670 35.356 1.00 54.83  ? 84   MET F CA    1 
ATOM   4376  C  C     . MET F  2 84  ? -2.509  -25.740 35.568 1.00 54.12  ? 84   MET F C     1 
ATOM   4377  O  O     . MET F  2 84  ? -3.660  -25.402 35.809 1.00 54.52  ? 84   MET F O     1 
ATOM   4378  C  CB    . MET F  2 84  ? -1.289  -24.349 33.874 1.00 55.39  ? 84   MET F CB    1 
ATOM   4379  C  CG    . MET F  2 84  ? -0.678  -22.980 33.594 1.00 59.53  ? 84   MET F CG    1 
ATOM   4380  S  SD    . MET F  2 84  ? -1.278  -21.610 34.674 1.00 68.78  ? 84   MET F SD    1 
ATOM   4381  C  CE    . MET F  2 84  ? -2.931  -21.361 33.992 1.00 65.92  ? 84   MET F CE    1 
ATOM   4382  N  N     . ASP F  2 85  ? -2.144  -27.023 35.516 1.00 52.90  ? 85   ASP F N     1 
ATOM   4383  C  CA    . ASP F  2 85  ? -3.150  -28.065 35.757 1.00 52.04  ? 85   ASP F CA    1 
ATOM   4384  C  C     . ASP F  2 85  ? -3.756  -27.888 37.147 1.00 50.44  ? 85   ASP F C     1 
ATOM   4385  O  O     . ASP F  2 85  ? -4.958  -28.035 37.326 1.00 49.18  ? 85   ASP F O     1 
ATOM   4386  C  CB    . ASP F  2 85  ? -2.573  -29.491 35.632 1.00 52.97  ? 85   ASP F CB    1 
ATOM   4387  C  CG    . ASP F  2 85  ? -2.044  -29.823 34.233 1.00 54.56  ? 85   ASP F CG    1 
ATOM   4388  O  OD1   . ASP F  2 85  ? -2.669  -29.448 33.200 1.00 54.43  ? 85   ASP F OD1   1 
ATOM   4389  O  OD2   . ASP F  2 85  ? -0.987  -30.494 34.181 1.00 57.22  ? 85   ASP F OD2   1 
ATOM   4390  N  N     . VAL F  2 86  ? -2.899  -27.569 38.119 1.00 49.40  ? 86   VAL F N     1 
ATOM   4391  C  CA    . VAL F  2 86  ? -3.321  -27.363 39.510 1.00 48.67  ? 86   VAL F CA    1 
ATOM   4392  C  C     . VAL F  2 86  ? -4.169  -26.112 39.631 1.00 49.12  ? 86   VAL F C     1 
ATOM   4393  O  O     . VAL F  2 86  ? -5.205  -26.106 40.299 1.00 49.14  ? 86   VAL F O     1 
ATOM   4394  C  CB    . VAL F  2 86  ? -2.127  -27.252 40.447 1.00 48.26  ? 86   VAL F CB    1 
ATOM   4395  C  CG1   . VAL F  2 86  ? -2.565  -26.915 41.828 1.00 46.87  ? 86   VAL F CG1   1 
ATOM   4396  C  CG2   . VAL F  2 86  ? -1.336  -28.543 40.439 1.00 47.12  ? 86   VAL F CG2   1 
ATOM   4397  N  N     . VAL F  2 87  ? -3.745  -25.058 38.948 1.00 49.27  ? 87   VAL F N     1 
ATOM   4398  C  CA    . VAL F  2 87  ? -4.476  -23.801 38.988 1.00 49.21  ? 87   VAL F CA    1 
ATOM   4399  C  C     . VAL F  2 87  ? -5.863  -23.944 38.364 1.00 49.77  ? 87   VAL F C     1 
ATOM   4400  O  O     . VAL F  2 87  ? -6.801  -23.333 38.838 1.00 50.55  ? 87   VAL F O     1 
ATOM   4401  C  CB    . VAL F  2 87  ? -3.620  -22.621 38.410 1.00 49.48  ? 87   VAL F CB    1 
ATOM   4402  C  CG1   . VAL F  2 87  ? -4.461  -21.418 38.118 1.00 47.19  ? 87   VAL F CG1   1 
ATOM   4403  C  CG2   . VAL F  2 87  ? -2.488  -22.277 39.375 1.00 47.17  ? 87   VAL F CG2   1 
ATOM   4404  N  N     . TYR F  2 88  ? -6.004  -24.790 37.350 1.00 50.43  ? 88   TYR F N     1 
ATOM   4405  C  CA    . TYR F  2 88  ? -7.322  -25.062 36.759 1.00 50.87  ? 88   TYR F CA    1 
ATOM   4406  C  C     . TYR F  2 88  ? -8.191  -25.905 37.634 1.00 49.70  ? 88   TYR F C     1 
ATOM   4407  O  O     . TYR F  2 88  ? -9.405  -25.752 37.631 1.00 49.24  ? 88   TYR F O     1 
ATOM   4408  C  CB    . TYR F  2 88  ? -7.207  -25.744 35.400 1.00 52.50  ? 88   TYR F CB    1 
ATOM   4409  C  CG    . TYR F  2 88  ? -6.528  -24.900 34.361 1.00 55.32  ? 88   TYR F CG    1 
ATOM   4410  C  CD1   . TYR F  2 88  ? -5.702  -25.476 33.417 1.00 57.21  ? 88   TYR F CD1   1 
ATOM   4411  C  CD2   . TYR F  2 88  ? -6.703  -23.510 34.332 1.00 57.39  ? 88   TYR F CD2   1 
ATOM   4412  C  CE1   . TYR F  2 88  ? -5.073  -24.700 32.465 1.00 59.01  ? 88   TYR F CE1   1 
ATOM   4413  C  CE2   . TYR F  2 88  ? -6.079  -22.731 33.386 1.00 58.34  ? 88   TYR F CE2   1 
ATOM   4414  C  CZ    . TYR F  2 88  ? -5.267  -23.338 32.452 1.00 58.15  ? 88   TYR F CZ    1 
ATOM   4415  O  OH    . TYR F  2 88  ? -4.627  -22.585 31.499 1.00 60.08  ? 88   TYR F OH    1 
ATOM   4416  N  N     . ALA F  2 89  ? -7.558  -26.825 38.358 1.00 49.30  ? 89   ALA F N     1 
ATOM   4417  C  CA    . ALA F  2 89  ? -8.262  -27.745 39.234 1.00 48.22  ? 89   ALA F CA    1 
ATOM   4418  C  C     . ALA F  2 89  ? -8.822  -26.925 40.360 1.00 48.00  ? 89   ALA F C     1 
ATOM   4419  O  O     . ALA F  2 89  ? -9.965  -27.073 40.723 1.00 48.30  ? 89   ALA F O     1 
ATOM   4420  C  CB    . ALA F  2 89  ? -7.326  -28.803 39.753 1.00 47.41  ? 89   ALA F CB    1 
ATOM   4421  N  N     . LEU F  2 90  ? -8.004  -26.039 40.907 1.00 48.42  ? 90   LEU F N     1 
ATOM   4422  C  CA    . LEU F  2 90  ? -8.463  -25.167 41.953 1.00 48.89  ? 90   LEU F CA    1 
ATOM   4423  C  C     . LEU F  2 90  ? -9.590  -24.245 41.454 1.00 50.39  ? 90   LEU F C     1 
ATOM   4424  O  O     . LEU F  2 90  ? -10.625 -24.116 42.108 1.00 49.99  ? 90   LEU F O     1 
ATOM   4425  C  CB    . LEU F  2 90  ? -7.292  -24.393 42.534 1.00 48.25  ? 90   LEU F CB    1 
ATOM   4426  C  CG    . LEU F  2 90  ? -6.263  -25.182 43.365 1.00 46.25  ? 90   LEU F CG    1 
ATOM   4427  C  CD1   . LEU F  2 90  ? -4.920  -24.420 43.457 1.00 40.70  ? 90   LEU F CD1   1 
ATOM   4428  C  CD2   . LEU F  2 90  ? -6.789  -25.607 44.769 1.00 40.30  ? 90   LEU F CD2   1 
ATOM   4429  N  N     . LYS F  2 91  ? -9.420  -23.638 40.283 1.00 52.23  ? 91   LYS F N     1 
ATOM   4430  C  CA    . LYS F  2 91  ? -10.455 -22.742 39.794 1.00 54.68  ? 91   LYS F CA    1 
ATOM   4431  C  C     . LYS F  2 91  ? -11.802 -23.432 39.770 1.00 55.35  ? 91   LYS F C     1 
ATOM   4432  O  O     . LYS F  2 91  ? -12.804 -22.845 40.169 1.00 56.43  ? 91   LYS F O     1 
ATOM   4433  C  CB    . LYS F  2 91  ? -10.110 -22.156 38.435 1.00 55.22  ? 91   LYS F CB    1 
ATOM   4434  C  CG    . LYS F  2 91  ? -11.154 -21.178 37.904 1.00 59.52  ? 91   LYS F CG    1 
ATOM   4435  C  CD    . LYS F  2 91  ? -10.579 -20.298 36.796 1.00 62.71  ? 91   LYS F CD    1 
ATOM   4436  C  CE    . LYS F  2 91  ? -10.005 -18.990 37.377 1.00 67.37  ? 91   LYS F CE    1 
ATOM   4437  N  NZ    . LYS F  2 91  ? -9.685  -17.903 36.341 1.00 66.75  ? 91   LYS F NZ    1 
ATOM   4438  N  N     . ARG F  2 92  ? -11.809 -24.686 39.335 1.00 56.11  ? 92   ARG F N     1 
ATOM   4439  C  CA    . ARG F  2 92  ? -13.017 -25.504 39.200 1.00 57.04  ? 92   ARG F CA    1 
ATOM   4440  C  C     . ARG F  2 92  ? -13.726 -25.771 40.508 1.00 56.60  ? 92   ARG F C     1 
ATOM   4441  O  O     . ARG F  2 92  ? -14.908 -25.974 40.533 1.00 56.69  ? 92   ARG F O     1 
ATOM   4442  C  CB    . ARG F  2 92  ? -12.628 -26.879 38.674 1.00 57.82  ? 92   ARG F CB    1 
ATOM   4443  C  CG    . ARG F  2 92  ? -12.720 -27.068 37.198 1.00 60.52  ? 92   ARG F CG    1 
ATOM   4444  C  CD    . ARG F  2 92  ? -12.935 -28.573 36.940 1.00 63.12  ? 92   ARG F CD    1 
ATOM   4445  N  NE    . ARG F  2 92  ? -14.361 -28.865 36.995 1.00 64.23  ? 92   ARG F NE    1 
ATOM   4446  C  CZ    . ARG F  2 92  ? -14.979 -29.434 38.026 1.00 64.84  ? 92   ARG F CZ    1 
ATOM   4447  N  NH1   . ARG F  2 92  ? -14.311 -29.834 39.098 1.00 63.21  ? 92   ARG F NH1   1 
ATOM   4448  N  NH2   . ARG F  2 92  ? -16.285 -29.629 37.961 1.00 67.54  ? 92   ARG F NH2   1 
ATOM   4449  N  N     . GLN F  2 93  ? -12.971 -25.862 41.583 1.00 56.62  ? 93   GLN F N     1 
ATOM   4450  C  CA    . GLN F  2 93  ? -13.528 -26.102 42.888 1.00 56.50  ? 93   GLN F CA    1 
ATOM   4451  C  C     . GLN F  2 93  ? -13.824 -24.841 43.653 1.00 55.46  ? 93   GLN F C     1 
ATOM   4452  O  O     . GLN F  2 93  ? -14.149 -24.916 44.822 1.00 55.18  ? 93   GLN F O     1 
ATOM   4453  C  CB    . GLN F  2 93  ? -12.561 -26.960 43.667 1.00 57.57  ? 93   GLN F CB    1 
ATOM   4454  C  CG    . GLN F  2 93  ? -12.799 -28.421 43.343 1.00 63.08  ? 93   GLN F CG    1 
ATOM   4455  C  CD    . GLN F  2 93  ? -11.548 -29.225 43.360 1.00 67.69  ? 93   GLN F CD    1 
ATOM   4456  O  OE1   . GLN F  2 93  ? -10.772 -29.176 44.329 1.00 70.90  ? 93   GLN F OE1   1 
ATOM   4457  N  NE2   . GLN F  2 93  ? -11.327 -29.980 42.289 1.00 67.60  ? 93   GLN F NE2   1 
ATOM   4458  N  N     . GLY F  2 94  ? -13.708 -23.686 42.982 1.00 54.69  ? 94   GLY F N     1 
ATOM   4459  C  CA    . GLY F  2 94  ? -13.970 -22.381 43.576 1.00 52.70  ? 94   GLY F CA    1 
ATOM   4460  C  C     . GLY F  2 94  ? -12.962 -21.926 44.620 1.00 51.92  ? 94   GLY F C     1 
ATOM   4461  O  O     . GLY F  2 94  ? -13.336 -21.225 45.570 1.00 51.27  ? 94   GLY F O     1 
ATOM   4462  N  N     . ARG F  2 95  ? -11.697 -22.341 44.442 1.00 50.98  ? 95   ARG F N     1 
ATOM   4463  C  CA    . ARG F  2 95  ? -10.572 -22.020 45.329 1.00 49.39  ? 95   ARG F CA    1 
ATOM   4464  C  C     . ARG F  2 95  ? -9.433  -21.434 44.450 1.00 49.01  ? 95   ARG F C     1 
ATOM   4465  O  O     . ARG F  2 95  ? -8.235  -21.804 44.592 1.00 49.17  ? 95   ARG F O     1 
ATOM   4466  C  CB    . ARG F  2 95  ? -10.049 -23.263 46.083 1.00 49.35  ? 95   ARG F CB    1 
ATOM   4467  C  CG    . ARG F  2 95  ? -11.044 -24.209 46.796 1.00 51.36  ? 95   ARG F CG    1 
ATOM   4468  C  CD    . ARG F  2 95  ? -11.246 -24.014 48.324 1.00 54.78  ? 95   ARG F CD    1 
ATOM   4469  N  NE    . ARG F  2 95  ? -10.152 -23.261 48.974 1.00 58.30  ? 95   ARG F NE    1 
ATOM   4470  C  CZ    . ARG F  2 95  ? -10.238 -22.540 50.103 1.00 55.83  ? 95   ARG F CZ    1 
ATOM   4471  N  NH1   . ARG F  2 95  ? -11.370 -22.439 50.793 1.00 54.34  ? 95   ARG F NH1   1 
ATOM   4472  N  NH2   . ARG F  2 95  ? -9.156  -21.923 50.544 1.00 54.47  ? 95   ARG F NH2   1 
ATOM   4473  N  N     . THR F  2 96  ? -9.819  -20.552 43.526 1.00 47.62  ? 96   THR F N     1 
ATOM   4474  C  CA    . THR F  2 96  ? -8.918  -19.719 42.691 1.00 46.96  ? 96   THR F CA    1 
ATOM   4475  C  C     . THR F  2 96  ? -7.655  -19.256 43.380 1.00 45.50  ? 96   THR F C     1 
ATOM   4476  O  O     . THR F  2 96  ? -7.701  -18.706 44.472 1.00 45.36  ? 96   THR F O     1 
ATOM   4477  C  CB    . THR F  2 96  ? -9.672  -18.439 42.226 1.00 47.12  ? 96   THR F CB    1 
ATOM   4478  O  OG1   . THR F  2 96  ? -10.897 -18.828 41.592 1.00 49.65  ? 96   THR F OG1   1 
ATOM   4479  C  CG2   . THR F  2 96  ? -8.861  -17.627 41.273 1.00 46.53  ? 96   THR F CG2   1 
ATOM   4480  N  N     . LEU F  2 97  ? -6.530  -19.463 42.713 1.00 45.05  ? 97   LEU F N     1 
ATOM   4481  C  CA    . LEU F  2 97  ? -5.217  -19.194 43.280 1.00 44.61  ? 97   LEU F CA    1 
ATOM   4482  C  C     . LEU F  2 97  ? -4.454  -18.241 42.395 1.00 44.75  ? 97   LEU F C     1 
ATOM   4483  O  O     . LEU F  2 97  ? -4.358  -18.469 41.175 1.00 44.32  ? 97   LEU F O     1 
ATOM   4484  C  CB    . LEU F  2 97  ? -4.419  -20.488 43.439 1.00 43.92  ? 97   LEU F CB    1 
ATOM   4485  C  CG    . LEU F  2 97  ? -2.990  -20.401 43.991 1.00 44.21  ? 97   LEU F CG    1 
ATOM   4486  C  CD1   . LEU F  2 97  ? -2.890  -19.894 45.417 1.00 42.48  ? 97   LEU F CD1   1 
ATOM   4487  C  CD2   . LEU F  2 97  ? -2.319  -21.743 43.883 1.00 44.69  ? 97   LEU F CD2   1 
ATOM   4488  N  N     . TYR F  2 98  ? -3.928  -17.172 43.009 1.00 44.69  ? 98   TYR F N     1 
ATOM   4489  C  CA    . TYR F  2 98  ? -3.093  -16.221 42.285 1.00 45.61  ? 98   TYR F CA    1 
ATOM   4490  C  C     . TYR F  2 98  ? -1.640  -16.448 42.645 1.00 46.31  ? 98   TYR F C     1 
ATOM   4491  O  O     . TYR F  2 98  ? -1.326  -16.751 43.794 1.00 46.21  ? 98   TYR F O     1 
ATOM   4492  C  CB    . TYR F  2 98  ? -3.427  -14.776 42.638 1.00 45.74  ? 98   TYR F CB    1 
ATOM   4493  C  CG    . TYR F  2 98  ? -4.739  -14.199 42.156 1.00 44.19  ? 98   TYR F CG    1 
ATOM   4494  C  CD1   . TYR F  2 98  ? -5.526  -14.846 41.237 1.00 45.11  ? 98   TYR F CD1   1 
ATOM   4495  C  CD2   . TYR F  2 98  ? -5.145  -12.953 42.609 1.00 43.84  ? 98   TYR F CD2   1 
ATOM   4496  C  CE1   . TYR F  2 98  ? -6.708  -14.277 40.806 1.00 47.59  ? 98   TYR F CE1   1 
ATOM   4497  C  CE2   . TYR F  2 98  ? -6.301  -12.372 42.193 1.00 44.40  ? 98   TYR F CE2   1 
ATOM   4498  C  CZ    . TYR F  2 98  ? -7.083  -13.025 41.289 1.00 46.86  ? 98   TYR F CZ    1 
ATOM   4499  O  OH    . TYR F  2 98  ? -8.254  -12.437 40.896 1.00 45.90  ? 98   TYR F OH    1 
ATOM   4500  N  N     . GLY F  2 99  ? -0.760  -16.321 41.665 1.00 47.09  ? 99   GLY F N     1 
ATOM   4501  C  CA    . GLY F  2 99  ? 0.648   -16.354 41.944 1.00 49.52  ? 99   GLY F CA    1 
ATOM   4502  C  C     . GLY F  2 99  ? 1.434   -17.439 41.246 1.00 51.38  ? 99   GLY F C     1 
ATOM   4503  O  O     . GLY F  2 99  ? 2.622   -17.602 41.523 1.00 53.03  ? 99   GLY F O     1 
ATOM   4504  N  N     . PHE F  2 100 ? 0.803   -18.188 40.343 1.00 52.62  ? 100  PHE F N     1 
ATOM   4505  C  CA    . PHE F  2 100 ? 1.484   -19.304 39.651 1.00 52.99  ? 100  PHE F CA    1 
ATOM   4506  C  C     . PHE F  2 100 ? 1.215   -19.357 38.164 1.00 54.35  ? 100  PHE F C     1 
ATOM   4507  O  O     . PHE F  2 100 ? 1.354   -20.397 37.560 1.00 55.39  ? 100  PHE F O     1 
ATOM   4508  C  CB    . PHE F  2 100 ? 1.116   -20.656 40.295 1.00 51.73  ? 100  PHE F CB    1 
ATOM   4509  C  CG    . PHE F  2 100 ? 1.646   -20.816 41.683 1.00 49.87  ? 100  PHE F CG    1 
ATOM   4510  C  CD1   . PHE F  2 100 ? 0.902   -20.407 42.777 1.00 48.98  ? 100  PHE F CD1   1 
ATOM   4511  C  CD2   . PHE F  2 100 ? 2.901   -21.365 41.903 1.00 48.40  ? 100  PHE F CD2   1 
ATOM   4512  C  CE1   . PHE F  2 100 ? 1.406   -20.539 44.097 1.00 49.21  ? 100  PHE F CE1   1 
ATOM   4513  C  CE2   . PHE F  2 100 ? 3.410   -21.523 43.219 1.00 48.72  ? 100  PHE F CE2   1 
ATOM   4514  C  CZ    . PHE F  2 100 ? 2.664   -21.094 44.314 1.00 48.54  ? 100  PHE F CZ    1 
ATOM   4515  N  N     . GLY F  2 101 ? 0.843   -18.236 37.567 1.00 56.82  ? 101  GLY F N     1 
ATOM   4516  C  CA    . GLY F  2 101 ? 0.563   -18.176 36.126 1.00 59.49  ? 101  GLY F CA    1 
ATOM   4517  C  C     . GLY F  2 101 ? -0.943  -18.322 35.981 1.00 61.84  ? 101  GLY F C     1 
ATOM   4518  O  O     . GLY F  2 101 ? -1.489  -18.460 34.864 1.00 62.46  ? 101  GLY F O     1 
ATOM   4519  N  N     . GLY F  2 102 ? -1.637  -18.268 37.115 1.00 63.06  ? 102  GLY F N     1 
ATOM   4520  C  CA    . GLY F  2 102 ? -3.053  -18.564 37.079 1.00 65.03  ? 102  GLY F CA    1 
ATOM   4521  C  C     . GLY F  2 102 ? -3.960  -17.498 37.636 1.00 65.58  ? 102  GLY F C     1 
ATOM   4522  O  O     . GLY F  2 102 ? -4.001  -16.431 37.005 1.00 65.97  ? 102  GLY F O     1 
ATOM   4523  O  OXT   . GLY F  2 102 ? -4.656  -17.708 38.668 1.00 65.74  ? 102  GLY F OXT   1 
ATOM   4524  N  N     . ALA G  3 14  ? -33.432 -40.479 4.004  1.00 109.88 ? 14   ALA G N     1 
ATOM   4525  C  CA    . ALA G  3 14  ? -32.832 -39.839 5.214  1.00 109.75 ? 14   ALA G CA    1 
ATOM   4526  C  C     . ALA G  3 14  ? -33.137 -40.636 6.474  1.00 109.62 ? 14   ALA G C     1 
ATOM   4527  O  O     . ALA G  3 14  ? -34.240 -41.171 6.634  1.00 109.77 ? 14   ALA G O     1 
ATOM   4528  C  CB    . ALA G  3 14  ? -33.345 -38.409 5.373  1.00 109.84 ? 14   ALA G CB    1 
ATOM   4529  N  N     . LYS G  3 15  ? -32.148 -40.706 7.363  1.00 109.16 ? 15   LYS G N     1 
ATOM   4530  C  CA    . LYS G  3 15  ? -32.343 -41.246 8.708  1.00 108.53 ? 15   LYS G CA    1 
ATOM   4531  C  C     . LYS G  3 15  ? -31.787 -40.234 9.720  1.00 107.78 ? 15   LYS G C     1 
ATOM   4532  O  O     . LYS G  3 15  ? -30.679 -39.707 9.523  1.00 107.98 ? 15   LYS G O     1 
ATOM   4533  C  CB    . LYS G  3 15  ? -31.648 -42.613 8.851  1.00 108.69 ? 15   LYS G CB    1 
ATOM   4534  C  CG    . LYS G  3 15  ? -32.305 -43.540 9.879  1.00 109.09 ? 15   LYS G CG    1 
ATOM   4535  C  CD    . LYS G  3 15  ? -33.588 -44.178 9.320  1.00 109.53 ? 15   LYS G CD    1 
ATOM   4536  C  CE    . LYS G  3 15  ? -34.813 -43.818 10.177 1.00 109.74 ? 15   LYS G CE    1 
ATOM   4537  N  NZ    . LYS G  3 15  ? -34.755 -44.383 11.578 1.00 109.92 ? 15   LYS G NZ    1 
ATOM   4538  N  N     . THR G  3 16  ? -32.549 -39.953 10.784 1.00 106.44 ? 16   THR G N     1 
ATOM   4539  C  CA    . THR G  3 16  ? -32.109 -38.985 11.808 1.00 105.10 ? 16   THR G CA    1 
ATOM   4540  C  C     . THR G  3 16  ? -30.929 -39.496 12.635 1.00 103.92 ? 16   THR G C     1 
ATOM   4541  O  O     . THR G  3 16  ? -30.781 -40.703 12.846 1.00 103.73 ? 16   THR G O     1 
ATOM   4542  C  CB    . THR G  3 16  ? -33.237 -38.557 12.788 1.00 105.27 ? 16   THR G CB    1 
ATOM   4543  O  OG1   . THR G  3 16  ? -33.512 -39.620 13.716 1.00 105.35 ? 16   THR G OG1   1 
ATOM   4544  C  CG2   . THR G  3 16  ? -34.506 -38.144 12.038 1.00 105.40 ? 16   THR G CG2   1 
ATOM   4545  N  N     . ARG G  3 17  ? -30.106 -38.565 13.112 1.00 102.53 ? 17   ARG G N     1 
ATOM   4546  C  CA    . ARG G  3 17  ? -28.931 -38.910 13.910 1.00 101.27 ? 17   ARG G CA    1 
ATOM   4547  C  C     . ARG G  3 17  ? -29.266 -39.457 15.307 1.00 99.98  ? 17   ARG G C     1 
ATOM   4548  O  O     . ARG G  3 17  ? -28.494 -40.246 15.859 1.00 99.89  ? 17   ARG G O     1 
ATOM   4549  C  CB    . ARG G  3 17  ? -27.960 -37.731 13.987 1.00 101.29 ? 17   ARG G CB    1 
ATOM   4550  C  CG    . ARG G  3 17  ? -27.186 -37.493 12.695 1.00 101.64 ? 17   ARG G CG    1 
ATOM   4551  C  CD    . ARG G  3 17  ? -26.040 -36.505 12.891 1.00 101.43 ? 17   ARG G CD    1 
ATOM   4552  N  NE    . ARG G  3 17  ? -26.492 -35.118 12.994 1.00 102.16 ? 17   ARG G NE    1 
ATOM   4553  C  CZ    . ARG G  3 17  ? -25.749 -34.117 13.466 1.00 102.51 ? 17   ARG G CZ    1 
ATOM   4554  N  NH1   . ARG G  3 17  ? -24.507 -34.350 13.896 1.00 101.79 ? 17   ARG G NH1   1 
ATOM   4555  N  NH2   . ARG G  3 17  ? -26.254 -32.884 13.521 1.00 102.45 ? 17   ARG G NH2   1 
ATOM   4556  N  N     . SER G  3 18  ? -30.412 -39.058 15.863 1.00 98.33  ? 18   SER G N     1 
ATOM   4557  C  CA    . SER G  3 18  ? -30.882 -39.619 17.131 1.00 96.81  ? 18   SER G CA    1 
ATOM   4558  C  C     . SER G  3 18  ? -31.105 -41.118 17.001 1.00 96.04  ? 18   SER G C     1 
ATOM   4559  O  O     . SER G  3 18  ? -30.631 -41.893 17.834 1.00 96.22  ? 18   SER G O     1 
ATOM   4560  C  CB    . SER G  3 18  ? -32.165 -38.941 17.600 1.00 96.66  ? 18   SER G CB    1 
ATOM   4561  O  OG    . SER G  3 18  ? -31.956 -37.563 17.806 1.00 95.80  ? 18   SER G OG    1 
ATOM   4562  N  N     . SER G  3 19  ? -31.809 -41.519 15.943 1.00 94.94  ? 19   SER G N     1 
ATOM   4563  C  CA    . SER G  3 19  ? -32.080 -42.934 15.678 1.00 93.62  ? 19   SER G CA    1 
ATOM   4564  C  C     . SER G  3 19  ? -30.816 -43.725 15.331 1.00 92.48  ? 19   SER G C     1 
ATOM   4565  O  O     . SER G  3 19  ? -30.683 -44.867 15.757 1.00 92.30  ? 19   SER G O     1 
ATOM   4566  C  CB    . SER G  3 19  ? -33.155 -43.096 14.599 1.00 93.81  ? 19   SER G CB    1 
ATOM   4567  O  OG    . SER G  3 19  ? -32.803 -42.418 13.402 1.00 94.08  ? 19   SER G OG    1 
ATOM   4568  N  N     . ARG G  3 20  ? -29.895 -43.114 14.581 1.00 91.25  ? 20   ARG G N     1 
ATOM   4569  C  CA    . ARG G  3 20  ? -28.590 -43.727 14.268 1.00 90.36  ? 20   ARG G CA    1 
ATOM   4570  C  C     . ARG G  3 20  ? -27.780 -44.035 15.519 1.00 89.42  ? 20   ARG G C     1 
ATOM   4571  O  O     . ARG G  3 20  ? -27.089 -45.053 15.588 1.00 89.18  ? 20   ARG G O     1 
ATOM   4572  C  CB    . ARG G  3 20  ? -27.731 -42.802 13.412 1.00 90.55  ? 20   ARG G CB    1 
ATOM   4573  C  CG    . ARG G  3 20  ? -28.145 -42.637 11.987 1.00 91.95  ? 20   ARG G CG    1 
ATOM   4574  C  CD    . ARG G  3 20  ? -27.012 -41.997 11.212 1.00 95.49  ? 20   ARG G CD    1 
ATOM   4575  N  NE    . ARG G  3 20  ? -27.482 -41.330 10.001 1.00 98.97  ? 20   ARG G NE    1 
ATOM   4576  C  CZ    . ARG G  3 20  ? -27.861 -41.960 8.888  1.00 101.14 ? 20   ARG G CZ    1 
ATOM   4577  N  NH1   . ARG G  3 20  ? -27.838 -43.292 8.819  1.00 101.96 ? 20   ARG G NH1   1 
ATOM   4578  N  NH2   . ARG G  3 20  ? -28.272 -41.257 7.839  1.00 101.19 ? 20   ARG G NH2   1 
ATOM   4579  N  N     . ALA G  3 21  ? -27.848 -43.116 16.483 1.00 88.47  ? 21   ALA G N     1 
ATOM   4580  C  CA    . ALA G  3 21  ? -27.110 -43.211 17.738 1.00 87.30  ? 21   ALA G CA    1 
ATOM   4581  C  C     . ALA G  3 21  ? -27.892 -44.042 18.748 1.00 86.44  ? 21   ALA G C     1 
ATOM   4582  O  O     . ALA G  3 21  ? -27.349 -44.481 19.766 1.00 85.88  ? 21   ALA G O     1 
ATOM   4583  C  CB    . ALA G  3 21  ? -26.827 -41.823 18.278 1.00 87.46  ? 21   ALA G CB    1 
ATOM   4584  N  N     . GLY G  3 22  ? -29.173 -44.248 18.441 1.00 85.64  ? 22   GLY G N     1 
ATOM   4585  C  CA    . GLY G  3 22  ? -30.050 -45.125 19.210 1.00 84.66  ? 22   GLY G CA    1 
ATOM   4586  C  C     . GLY G  3 22  ? -30.573 -44.416 20.431 1.00 83.94  ? 22   GLY G C     1 
ATOM   4587  O  O     . GLY G  3 22  ? -30.531 -44.958 21.544 1.00 83.79  ? 22   GLY G O     1 
ATOM   4588  N  N     . LEU G  3 23  ? -31.076 -43.201 20.213 1.00 83.19  ? 23   LEU G N     1 
ATOM   4589  C  CA    . LEU G  3 23  ? -31.322 -42.273 21.300 1.00 82.48  ? 23   LEU G CA    1 
ATOM   4590  C  C     . LEU G  3 23  ? -32.599 -41.513 21.099 1.00 82.44  ? 23   LEU G C     1 
ATOM   4591  O  O     . LEU G  3 23  ? -32.924 -41.123 19.969 1.00 82.81  ? 23   LEU G O     1 
ATOM   4592  C  CB    . LEU G  3 23  ? -30.177 -41.263 21.395 1.00 82.31  ? 23   LEU G CB    1 
ATOM   4593  C  CG    . LEU G  3 23  ? -28.791 -41.727 21.853 1.00 82.22  ? 23   LEU G CG    1 
ATOM   4594  C  CD1   . LEU G  3 23  ? -27.797 -40.588 21.695 1.00 82.39  ? 23   LEU G CD1   1 
ATOM   4595  C  CD2   . LEU G  3 23  ? -28.813 -42.253 23.299 1.00 81.45  ? 23   LEU G CD2   1 
ATOM   4596  N  N     . GLN G  3 24  ? -33.303 -41.282 22.205 1.00 82.11  ? 24   GLN G N     1 
ATOM   4597  C  CA    . GLN G  3 24  ? -34.464 -40.403 22.225 1.00 82.10  ? 24   GLN G CA    1 
ATOM   4598  C  C     . GLN G  3 24  ? -34.078 -38.931 22.148 1.00 81.85  ? 24   GLN G C     1 
ATOM   4599  O  O     . GLN G  3 24  ? -34.758 -38.143 21.492 1.00 82.16  ? 24   GLN G O     1 
ATOM   4600  C  CB    . GLN G  3 24  ? -35.306 -40.647 23.473 1.00 82.44  ? 24   GLN G CB    1 
ATOM   4601  C  CG    . GLN G  3 24  ? -35.665 -42.128 23.708 1.00 84.14  ? 24   GLN G CG    1 
ATOM   4602  C  CD    . GLN G  3 24  ? -36.157 -42.827 22.444 1.00 85.52  ? 24   GLN G CD    1 
ATOM   4603  O  OE1   . GLN G  3 24  ? -37.065 -42.338 21.765 1.00 86.20  ? 24   GLN G OE1   1 
ATOM   4604  N  NE2   . GLN G  3 24  ? -35.558 -43.974 22.127 1.00 85.73  ? 24   GLN G NE2   1 
ATOM   4605  N  N     . PHE G  3 25  ? -32.982 -38.560 22.802 1.00 81.25  ? 25   PHE G N     1 
ATOM   4606  C  CA    . PHE G  3 25  ? -32.568 -37.157 22.842 1.00 80.62  ? 25   PHE G CA    1 
ATOM   4607  C  C     . PHE G  3 25  ? -32.005 -36.676 21.500 1.00 80.31  ? 25   PHE G C     1 
ATOM   4608  O  O     . PHE G  3 25  ? -31.337 -37.443 20.791 1.00 80.60  ? 25   PHE G O     1 
ATOM   4609  C  CB    . PHE G  3 25  ? -31.601 -36.897 24.011 1.00 80.63  ? 25   PHE G CB    1 
ATOM   4610  C  CG    . PHE G  3 25  ? -32.294 -36.502 25.300 1.00 79.81  ? 25   PHE G CG    1 
ATOM   4611  C  CD1   . PHE G  3 25  ? -33.300 -37.302 25.847 1.00 78.63  ? 25   PHE G CD1   1 
ATOM   4612  C  CD2   . PHE G  3 25  ? -31.940 -35.332 25.960 1.00 78.78  ? 25   PHE G CD2   1 
ATOM   4613  C  CE1   . PHE G  3 25  ? -33.944 -36.941 27.022 1.00 78.27  ? 25   PHE G CE1   1 
ATOM   4614  C  CE2   . PHE G  3 25  ? -32.577 -34.962 27.137 1.00 78.55  ? 25   PHE G CE2   1 
ATOM   4615  C  CZ    . PHE G  3 25  ? -33.581 -35.770 27.673 1.00 78.86  ? 25   PHE G CZ    1 
ATOM   4616  N  N     . PRO G  3 26  ? -32.271 -35.397 21.156 1.00 79.65  ? 26   PRO G N     1 
ATOM   4617  C  CA    . PRO G  3 26  ? -32.090 -34.878 19.806 1.00 78.72  ? 26   PRO G CA    1 
ATOM   4618  C  C     . PRO G  3 26  ? -30.674 -34.437 19.494 1.00 77.98  ? 26   PRO G C     1 
ATOM   4619  O  O     . PRO G  3 26  ? -30.291 -33.313 19.808 1.00 78.08  ? 26   PRO G O     1 
ATOM   4620  C  CB    . PRO G  3 26  ? -33.039 -33.686 19.773 1.00 78.95  ? 26   PRO G CB    1 
ATOM   4621  C  CG    . PRO G  3 26  ? -33.057 -33.186 21.185 1.00 79.29  ? 26   PRO G CG    1 
ATOM   4622  C  CD    . PRO G  3 26  ? -32.777 -34.359 22.081 1.00 79.64  ? 26   PRO G CD    1 
ATOM   4623  N  N     . VAL G  3 27  ? -29.920 -35.315 18.847 1.00 77.30  ? 27   VAL G N     1 
ATOM   4624  C  CA    . VAL G  3 27  ? -28.560 -35.017 18.400 1.00 76.51  ? 27   VAL G CA    1 
ATOM   4625  C  C     . VAL G  3 27  ? -28.485 -33.765 17.517 1.00 76.46  ? 27   VAL G C     1 
ATOM   4626  O  O     . VAL G  3 27  ? -27.558 -32.967 17.660 1.00 77.07  ? 27   VAL G O     1 
ATOM   4627  C  CB    . VAL G  3 27  ? -27.925 -36.234 17.693 1.00 76.29  ? 27   VAL G CB    1 
ATOM   4628  C  CG1   . VAL G  3 27  ? -26.524 -35.931 17.223 1.00 75.80  ? 27   VAL G CG1   1 
ATOM   4629  C  CG2   . VAL G  3 27  ? -27.890 -37.408 18.640 1.00 76.19  ? 27   VAL G CG2   1 
ATOM   4630  N  N     . GLY G  3 28  ? -29.453 -33.581 16.621 1.00 76.00  ? 28   GLY G N     1 
ATOM   4631  C  CA    . GLY G  3 28  ? -29.487 -32.384 15.781 1.00 75.39  ? 28   GLY G CA    1 
ATOM   4632  C  C     . GLY G  3 28  ? -29.526 -31.100 16.598 1.00 75.14  ? 28   GLY G C     1 
ATOM   4633  O  O     . GLY G  3 28  ? -28.705 -30.191 16.404 1.00 74.88  ? 28   GLY G O     1 
ATOM   4634  N  N     . ARG G  3 29  ? -30.486 -31.032 17.518 1.00 74.73  ? 29   ARG G N     1 
ATOM   4635  C  CA    . ARG G  3 29  ? -30.644 -29.874 18.393 1.00 74.42  ? 29   ARG G CA    1 
ATOM   4636  C  C     . ARG G  3 29  ? -29.396 -29.615 19.242 1.00 74.80  ? 29   ARG G C     1 
ATOM   4637  O  O     . ARG G  3 29  ? -28.894 -28.484 19.293 1.00 75.14  ? 29   ARG G O     1 
ATOM   4638  C  CB    . ARG G  3 29  ? -31.867 -30.051 19.277 1.00 73.76  ? 29   ARG G CB    1 
ATOM   4639  C  CG    . ARG G  3 29  ? -32.160 -28.876 20.139 1.00 72.71  ? 29   ARG G CG    1 
ATOM   4640  C  CD    . ARG G  3 29  ? -33.396 -29.144 20.941 1.00 71.70  ? 29   ARG G CD    1 
ATOM   4641  N  NE    . ARG G  3 29  ? -34.605 -28.898 20.164 1.00 72.75  ? 29   ARG G NE    1 
ATOM   4642  C  CZ    . ARG G  3 29  ? -35.835 -28.847 20.678 1.00 73.65  ? 29   ARG G CZ    1 
ATOM   4643  N  NH1   . ARG G  3 29  ? -36.035 -29.038 21.982 1.00 73.26  ? 29   ARG G NH1   1 
ATOM   4644  N  NH2   . ARG G  3 29  ? -36.873 -28.608 19.885 1.00 74.24  ? 29   ARG G NH2   1 
ATOM   4645  N  N     . VAL G  3 30  ? -28.896 -30.667 19.890 1.00 74.61  ? 30   VAL G N     1 
ATOM   4646  C  CA    . VAL G  3 30  ? -27.705 -30.570 20.726 1.00 74.32  ? 30   VAL G CA    1 
ATOM   4647  C  C     . VAL G  3 30  ? -26.556 -30.005 19.899 1.00 74.83  ? 30   VAL G C     1 
ATOM   4648  O  O     . VAL G  3 30  ? -25.824 -29.131 20.371 1.00 75.08  ? 30   VAL G O     1 
ATOM   4649  C  CB    . VAL G  3 30  ? -27.353 -31.938 21.393 1.00 74.12  ? 30   VAL G CB    1 
ATOM   4650  C  CG1   . VAL G  3 30  ? -25.969 -31.939 22.008 1.00 72.96  ? 30   VAL G CG1   1 
ATOM   4651  C  CG2   . VAL G  3 30  ? -28.380 -32.275 22.452 1.00 73.64  ? 30   VAL G CG2   1 
ATOM   4652  N  N     . HIS G  3 31  ? -26.426 -30.467 18.655 1.00 75.42  ? 31   HIS G N     1 
ATOM   4653  C  CA    . HIS G  3 31  ? -25.365 -29.982 17.757 1.00 75.96  ? 31   HIS G CA    1 
ATOM   4654  C  C     . HIS G  3 31  ? -25.497 -28.492 17.491 1.00 75.79  ? 31   HIS G C     1 
ATOM   4655  O  O     . HIS G  3 31  ? -24.528 -27.746 17.567 1.00 75.53  ? 31   HIS G O     1 
ATOM   4656  C  CB    . HIS G  3 31  ? -25.401 -30.714 16.417 1.00 76.16  ? 31   HIS G CB    1 
ATOM   4657  C  CG    . HIS G  3 31  ? -24.155 -30.541 15.604 1.00 77.80  ? 31   HIS G CG    1 
ATOM   4658  N  ND1   . HIS G  3 31  ? -23.431 -29.365 15.587 1.00 79.29  ? 31   HIS G ND1   1 
ATOM   4659  C  CD2   . HIS G  3 31  ? -23.505 -31.396 14.777 1.00 79.07  ? 31   HIS G CD2   1 
ATOM   4660  C  CE1   . HIS G  3 31  ? -22.385 -29.507 14.792 1.00 80.03  ? 31   HIS G CE1   1 
ATOM   4661  N  NE2   . HIS G  3 31  ? -22.405 -30.730 14.288 1.00 79.50  ? 31   HIS G NE2   1 
ATOM   4662  N  N     . ARG G  3 32  ? -26.709 -28.077 17.154 1.00 75.91  ? 32   ARG G N     1 
ATOM   4663  C  CA    . ARG G  3 32  ? -26.971 -26.702 16.823 1.00 76.08  ? 32   ARG G CA    1 
ATOM   4664  C  C     . ARG G  3 32  ? -26.632 -25.848 18.045 1.00 76.23  ? 32   ARG G C     1 
ATOM   4665  O  O     . ARG G  3 32  ? -25.848 -24.898 17.942 1.00 76.43  ? 32   ARG G O     1 
ATOM   4666  C  CB    . ARG G  3 32  ? -28.431 -26.548 16.406 1.00 76.07  ? 32   ARG G CB    1 
ATOM   4667  C  CG    . ARG G  3 32  ? -28.793 -25.202 15.814 1.00 75.97  ? 32   ARG G CG    1 
ATOM   4668  C  CD    . ARG G  3 32  ? -30.289 -24.988 15.985 1.00 77.63  ? 32   ARG G CD    1 
ATOM   4669  N  NE    . ARG G  3 32  ? -30.655 -24.824 17.395 1.00 77.92  ? 32   ARG G NE    1 
ATOM   4670  C  CZ    . ARG G  3 32  ? -31.825 -25.180 17.925 1.00 78.96  ? 32   ARG G CZ    1 
ATOM   4671  N  NH1   . ARG G  3 32  ? -32.773 -25.744 17.179 1.00 80.29  ? 32   ARG G NH1   1 
ATOM   4672  N  NH2   . ARG G  3 32  ? -32.044 -24.980 19.219 1.00 79.18  ? 32   ARG G NH2   1 
ATOM   4673  N  N     . LEU G  3 33  ? -27.184 -26.225 19.202 1.00 75.87  ? 33   LEU G N     1 
ATOM   4674  C  CA    . LEU G  3 33  ? -26.960 -25.487 20.436 1.00 75.25  ? 33   LEU G CA    1 
ATOM   4675  C  C     . LEU G  3 33  ? -25.481 -25.330 20.778 1.00 75.66  ? 33   LEU G C     1 
ATOM   4676  O  O     . LEU G  3 33  ? -25.079 -24.283 21.277 1.00 76.19  ? 33   LEU G O     1 
ATOM   4677  C  CB    . LEU G  3 33  ? -27.723 -26.107 21.598 1.00 74.49  ? 33   LEU G CB    1 
ATOM   4678  C  CG    . LEU G  3 33  ? -29.242 -25.931 21.602 1.00 73.39  ? 33   LEU G CG    1 
ATOM   4679  C  CD1   . LEU G  3 33  ? -29.863 -26.729 22.730 1.00 71.31  ? 33   LEU G CD1   1 
ATOM   4680  C  CD2   . LEU G  3 33  ? -29.666 -24.459 21.687 1.00 72.00  ? 33   LEU G CD2   1 
ATOM   4681  N  N     . LEU G  3 34  ? -24.666 -26.339 20.495 1.00 75.85  ? 34   LEU G N     1 
ATOM   4682  C  CA    . LEU G  3 34  ? -23.227 -26.195 20.722 1.00 76.40  ? 34   LEU G CA    1 
ATOM   4683  C  C     . LEU G  3 34  ? -22.612 -25.111 19.842 1.00 77.38  ? 34   LEU G C     1 
ATOM   4684  O  O     . LEU G  3 34  ? -21.814 -24.313 20.329 1.00 77.60  ? 34   LEU G O     1 
ATOM   4685  C  CB    . LEU G  3 34  ? -22.472 -27.519 20.538 1.00 75.98  ? 34   LEU G CB    1 
ATOM   4686  C  CG    . LEU G  3 34  ? -22.604 -28.578 21.639 1.00 74.94  ? 34   LEU G CG    1 
ATOM   4687  C  CD1   . LEU G  3 34  ? -22.313 -29.964 21.093 1.00 72.12  ? 34   LEU G CD1   1 
ATOM   4688  C  CD2   . LEU G  3 34  ? -21.746 -28.266 22.877 1.00 73.15  ? 34   LEU G CD2   1 
ATOM   4689  N  N     . ARG G  3 35  ? -22.985 -25.081 18.560 1.00 78.48  ? 35   ARG G N     1 
ATOM   4690  C  CA    . ARG G  3 35  ? -22.486 -24.072 17.602 1.00 79.66  ? 35   ARG G CA    1 
ATOM   4691  C  C     . ARG G  3 35  ? -22.868 -22.657 17.994 1.00 79.49  ? 35   ARG G C     1 
ATOM   4692  O  O     . ARG G  3 35  ? -22.035 -21.753 18.031 1.00 79.81  ? 35   ARG G O     1 
ATOM   4693  C  CB    . ARG G  3 35  ? -23.055 -24.313 16.214 1.00 80.21  ? 35   ARG G CB    1 
ATOM   4694  C  CG    . ARG G  3 35  ? -22.659 -25.614 15.589 1.00 82.77  ? 35   ARG G CG    1 
ATOM   4695  C  CD    . ARG G  3 35  ? -22.806 -25.508 14.095 1.00 86.31  ? 35   ARG G CD    1 
ATOM   4696  N  NE    . ARG G  3 35  ? -22.211 -26.661 13.427 1.00 90.44  ? 35   ARG G NE    1 
ATOM   4697  C  CZ    . ARG G  3 35  ? -20.899 -26.889 13.322 1.00 92.78  ? 35   ARG G CZ    1 
ATOM   4698  N  NH1   . ARG G  3 35  ? -20.006 -26.052 13.864 1.00 92.50  ? 35   ARG G NH1   1 
ATOM   4699  N  NH2   . ARG G  3 35  ? -20.481 -27.976 12.680 1.00 93.46  ? 35   ARG G NH2   1 
ATOM   4700  N  N     . LYS G  3 36  ? -24.145 -22.478 18.289 1.00 79.41  ? 36   LYS G N     1 
ATOM   4701  C  CA    . LYS G  3 36  ? -24.676 -21.168 18.597 1.00 79.30  ? 36   LYS G CA    1 
ATOM   4702  C  C     . LYS G  3 36  ? -24.419 -20.783 20.046 1.00 78.66  ? 36   LYS G C     1 
ATOM   4703  O  O     . LYS G  3 36  ? -24.739 -19.667 20.461 1.00 79.07  ? 36   LYS G O     1 
ATOM   4704  C  CB    . LYS G  3 36  ? -26.165 -21.105 18.229 1.00 80.12  ? 36   LYS G CB    1 
ATOM   4705  C  CG    . LYS G  3 36  ? -26.469 -21.866 16.925 1.00 80.86  ? 36   LYS G CG    1 
ATOM   4706  C  CD    . LYS G  3 36  ? -27.384 -21.114 15.964 1.00 83.33  ? 36   LYS G CD    1 
ATOM   4707  C  CE    . LYS G  3 36  ? -27.466 -21.867 14.608 1.00 84.61  ? 36   LYS G CE    1 
ATOM   4708  N  NZ    . LYS G  3 36  ? -28.419 -21.240 13.613 1.00 87.01  ? 36   LYS G NZ    1 
ATOM   4709  N  N     . GLY G  3 37  ? -23.808 -21.691 20.804 1.00 77.71  ? 37   GLY G N     1 
ATOM   4710  C  CA    . GLY G  3 37  ? -23.474 -21.421 22.199 1.00 76.56  ? 37   GLY G CA    1 
ATOM   4711  C  C     . GLY G  3 37  ? -22.111 -20.787 22.421 1.00 75.78  ? 37   GLY G C     1 
ATOM   4712  O  O     . GLY G  3 37  ? -21.762 -20.469 23.552 1.00 75.95  ? 37   GLY G O     1 
ATOM   4713  N  N     . ASN G  3 38  ? -21.338 -20.602 21.352 1.00 74.86  ? 38   ASN G N     1 
ATOM   4714  C  CA    . ASN G  3 38  ? -20.015 -19.971 21.435 1.00 74.12  ? 38   ASN G CA    1 
ATOM   4715  C  C     . ASN G  3 38  ? -19.067 -20.750 22.331 1.00 73.26  ? 38   ASN G C     1 
ATOM   4716  O  O     . ASN G  3 38  ? -18.359 -20.165 23.155 1.00 73.59  ? 38   ASN G O     1 
ATOM   4717  C  CB    . ASN G  3 38  ? -20.094 -18.512 21.953 1.00 74.32  ? 38   ASN G CB    1 
ATOM   4718  C  CG    . ASN G  3 38  ? -20.709 -17.540 20.948 1.00 73.97  ? 38   ASN G CG    1 
ATOM   4719  O  OD1   . ASN G  3 38  ? -21.763 -16.957 21.213 1.00 73.61  ? 38   ASN G OD1   1 
ATOM   4720  N  ND2   . ASN G  3 38  ? -20.043 -17.343 19.812 1.00 72.20  ? 38   ASN G ND2   1 
ATOM   4721  N  N     . TYR G  3 39  ? -19.043 -22.062 22.181 1.00 71.96  ? 39   TYR G N     1 
ATOM   4722  C  CA    . TYR G  3 39  ? -18.183 -22.873 23.032 1.00 71.17  ? 39   TYR G CA    1 
ATOM   4723  C  C     . TYR G  3 39  ? -16.786 -23.090 22.429 1.00 72.12  ? 39   TYR G C     1 
ATOM   4724  O  O     . TYR G  3 39  ? -15.788 -23.139 23.165 1.00 71.89  ? 39   TYR G O     1 
ATOM   4725  C  CB    . TYR G  3 39  ? -18.873 -24.185 23.409 1.00 69.50  ? 39   TYR G CB    1 
ATOM   4726  C  CG    . TYR G  3 39  ? -20.168 -24.012 24.178 1.00 66.53  ? 39   TYR G CG    1 
ATOM   4727  C  CD1   . TYR G  3 39  ? -21.390 -24.180 23.559 1.00 64.47  ? 39   TYR G CD1   1 
ATOM   4728  C  CD2   . TYR G  3 39  ? -20.162 -23.674 25.518 1.00 64.33  ? 39   TYR G CD2   1 
ATOM   4729  C  CE1   . TYR G  3 39  ? -22.572 -24.026 24.248 1.00 63.44  ? 39   TYR G CE1   1 
ATOM   4730  C  CE2   . TYR G  3 39  ? -21.335 -23.520 26.216 1.00 63.67  ? 39   TYR G CE2   1 
ATOM   4731  C  CZ    . TYR G  3 39  ? -22.538 -23.700 25.575 1.00 64.50  ? 39   TYR G CZ    1 
ATOM   4732  O  OH    . TYR G  3 39  ? -23.717 -23.553 26.272 1.00 65.01  ? 39   TYR G OH    1 
ATOM   4733  N  N     . ALA G  3 40  ? -16.725 -23.216 21.100 1.00 73.36  ? 40   ALA G N     1 
ATOM   4734  C  CA    . ALA G  3 40  ? -15.456 -23.186 20.345 1.00 74.80  ? 40   ALA G CA    1 
ATOM   4735  C  C     . ALA G  3 40  ? -15.735 -22.815 18.896 1.00 75.99  ? 40   ALA G C     1 
ATOM   4736  O  O     . ALA G  3 40  ? -16.891 -22.876 18.465 1.00 76.22  ? 40   ALA G O     1 
ATOM   4737  C  CB    . ALA G  3 40  ? -14.739 -24.519 20.422 1.00 74.34  ? 40   ALA G CB    1 
ATOM   4738  N  N     . GLU G  3 41  ? -14.696 -22.427 18.146 1.00 77.49  ? 41   GLU G N     1 
ATOM   4739  C  CA    . GLU G  3 41  ? -14.857 -22.145 16.709 1.00 79.16  ? 41   GLU G CA    1 
ATOM   4740  C  C     . GLU G  3 41  ? -15.504 -23.319 15.971 1.00 79.45  ? 41   GLU G C     1 
ATOM   4741  O  O     . GLU G  3 41  ? -16.313 -23.116 15.076 1.00 80.06  ? 41   GLU G O     1 
ATOM   4742  C  CB    . GLU G  3 41  ? -13.527 -21.791 16.030 1.00 79.54  ? 41   GLU G CB    1 
ATOM   4743  C  CG    . GLU G  3 41  ? -12.898 -20.440 16.428 1.00 83.16  ? 41   GLU G CG    1 
ATOM   4744  C  CD    . GLU G  3 41  ? -13.787 -19.216 16.138 1.00 87.95  ? 41   GLU G CD    1 
ATOM   4745  O  OE1   . GLU G  3 41  ? -14.131 -18.965 14.947 1.00 90.02  ? 41   GLU G OE1   1 
ATOM   4746  O  OE2   . GLU G  3 41  ? -14.130 -18.493 17.113 1.00 90.09  ? 41   GLU G OE2   1 
ATOM   4747  N  N     . ARG G  3 42  ? -15.161 -24.541 16.373 1.00 79.79  ? 42   ARG G N     1 
ATOM   4748  C  CA    . ARG G  3 42  ? -15.582 -25.759 15.671 1.00 79.77  ? 42   ARG G CA    1 
ATOM   4749  C  C     . ARG G  3 42  ? -16.161 -26.823 16.590 1.00 78.91  ? 42   ARG G C     1 
ATOM   4750  O  O     . ARG G  3 42  ? -15.861 -26.848 17.780 1.00 79.41  ? 42   ARG G O     1 
ATOM   4751  C  CB    . ARG G  3 42  ? -14.388 -26.370 14.957 1.00 80.25  ? 42   ARG G CB    1 
ATOM   4752  C  CG    . ARG G  3 42  ? -13.716 -25.431 14.010 1.00 83.05  ? 42   ARG G CG    1 
ATOM   4753  C  CD    . ARG G  3 42  ? -12.782 -26.204 13.121 1.00 89.00  ? 42   ARG G CD    1 
ATOM   4754  N  NE    . ARG G  3 42  ? -12.554 -25.468 11.884 1.00 94.06  ? 42   ARG G NE    1 
ATOM   4755  C  CZ    . ARG G  3 42  ? -12.004 -25.982 10.792 1.00 96.33  ? 42   ARG G CZ    1 
ATOM   4756  N  NH1   . ARG G  3 42  ? -11.615 -27.257 10.769 1.00 97.14  ? 42   ARG G NH1   1 
ATOM   4757  N  NH2   . ARG G  3 42  ? -11.836 -25.207 9.726  1.00 98.16  ? 42   ARG G NH2   1 
ATOM   4758  N  N     . VAL G  3 43  ? -16.954 -27.727 16.020 1.00 77.50  ? 43   VAL G N     1 
ATOM   4759  C  CA    . VAL G  3 43  ? -17.595 -28.785 16.778 1.00 76.09  ? 43   VAL G CA    1 
ATOM   4760  C  C     . VAL G  3 43  ? -17.511 -30.088 16.012 1.00 75.46  ? 43   VAL G C     1 
ATOM   4761  O  O     . VAL G  3 43  ? -18.101 -30.207 14.945 1.00 75.55  ? 43   VAL G O     1 
ATOM   4762  C  CB    . VAL G  3 43  ? -19.071 -28.456 17.022 1.00 76.08  ? 43   VAL G CB    1 
ATOM   4763  C  CG1   . VAL G  3 43  ? -19.771 -29.600 17.758 1.00 75.67  ? 43   VAL G CG1   1 
ATOM   4764  C  CG2   . VAL G  3 43  ? -19.207 -27.143 17.788 1.00 75.98  ? 43   VAL G CG2   1 
ATOM   4765  N  N     . GLY G  3 44  ? -16.782 -31.061 16.553 1.00 74.80  ? 44   GLY G N     1 
ATOM   4766  C  CA    . GLY G  3 44  ? -16.691 -32.404 15.958 1.00 73.98  ? 44   GLY G CA    1 
ATOM   4767  C  C     . GLY G  3 44  ? -18.035 -33.110 15.847 1.00 73.83  ? 44   GLY G C     1 
ATOM   4768  O  O     . GLY G  3 44  ? -18.989 -32.774 16.546 1.00 73.50  ? 44   GLY G O     1 
ATOM   4769  N  N     . ALA G  3 45  ? -18.105 -34.098 14.959 1.00 73.75  ? 45   ALA G N     1 
ATOM   4770  C  CA    . ALA G  3 45  ? -19.348 -34.800 14.654 1.00 73.17  ? 45   ALA G CA    1 
ATOM   4771  C  C     . ALA G  3 45  ? -19.867 -35.685 15.777 1.00 72.80  ? 45   ALA G C     1 
ATOM   4772  O  O     . ALA G  3 45  ? -21.081 -35.829 15.928 1.00 73.10  ? 45   ALA G O     1 
ATOM   4773  C  CB    . ALA G  3 45  ? -19.184 -35.614 13.393 1.00 73.40  ? 45   ALA G CB    1 
ATOM   4774  N  N     . GLY G  3 46  ? -18.963 -36.295 16.541 1.00 72.32  ? 46   GLY G N     1 
ATOM   4775  C  CA    . GLY G  3 46  ? -19.344 -37.228 17.612 1.00 71.86  ? 46   GLY G CA    1 
ATOM   4776  C  C     . GLY G  3 46  ? -19.828 -36.540 18.882 1.00 71.71  ? 46   GLY G C     1 
ATOM   4777  O  O     . GLY G  3 46  ? -20.685 -37.066 19.612 1.00 71.91  ? 46   GLY G O     1 
ATOM   4778  N  N     . ALA G  3 47  ? -19.282 -35.350 19.141 1.00 70.81  ? 47   ALA G N     1 
ATOM   4779  C  CA    . ALA G  3 47  ? -19.542 -34.617 20.378 1.00 69.23  ? 47   ALA G CA    1 
ATOM   4780  C  C     . ALA G  3 47  ? -21.025 -34.390 20.688 1.00 68.26  ? 47   ALA G C     1 
ATOM   4781  O  O     . ALA G  3 47  ? -21.445 -34.650 21.809 1.00 68.18  ? 47   ALA G O     1 
ATOM   4782  C  CB    . ALA G  3 47  ? -18.759 -33.306 20.400 1.00 69.34  ? 47   ALA G CB    1 
ATOM   4783  N  N     . PRO G  3 48  ? -21.831 -33.926 19.707 1.00 67.50  ? 48   PRO G N     1 
ATOM   4784  C  CA    . PRO G  3 48  ? -23.249 -33.788 20.044 1.00 66.85  ? 48   PRO G CA    1 
ATOM   4785  C  C     . PRO G  3 48  ? -23.904 -35.132 20.288 1.00 66.32  ? 48   PRO G C     1 
ATOM   4786  O  O     . PRO G  3 48  ? -24.902 -35.205 21.009 1.00 66.10  ? 48   PRO G O     1 
ATOM   4787  C  CB    . PRO G  3 48  ? -23.855 -33.123 18.806 1.00 66.71  ? 48   PRO G CB    1 
ATOM   4788  C  CG    . PRO G  3 48  ? -22.891 -33.321 17.728 1.00 66.68  ? 48   PRO G CG    1 
ATOM   4789  C  CD    . PRO G  3 48  ? -21.551 -33.505 18.323 1.00 67.54  ? 48   PRO G CD    1 
ATOM   4790  N  N     . VAL G  3 49  ? -23.338 -36.181 19.690 1.00 65.57  ? 49   VAL G N     1 
ATOM   4791  C  CA    . VAL G  3 49  ? -23.820 -37.537 19.919 1.00 65.03  ? 49   VAL G CA    1 
ATOM   4792  C  C     . VAL G  3 49  ? -23.536 -37.922 21.368 1.00 64.29  ? 49   VAL G C     1 
ATOM   4793  O  O     . VAL G  3 49  ? -24.463 -38.201 22.139 1.00 63.98  ? 49   VAL G O     1 
ATOM   4794  C  CB    . VAL G  3 49  ? -23.204 -38.574 18.918 1.00 65.24  ? 49   VAL G CB    1 
ATOM   4795  C  CG1   . VAL G  3 49  ? -23.610 -39.972 19.297 1.00 65.65  ? 49   VAL G CG1   1 
ATOM   4796  C  CG2   . VAL G  3 49  ? -23.660 -38.294 17.499 1.00 65.29  ? 49   VAL G CG2   1 
ATOM   4797  N  N     . TYR G  3 50  ? -22.258 -37.900 21.734 1.00 63.32  ? 50   TYR G N     1 
ATOM   4798  C  CA    . TYR G  3 50  ? -21.844 -38.169 23.103 1.00 62.89  ? 50   TYR G CA    1 
ATOM   4799  C  C     . TYR G  3 50  ? -22.668 -37.363 24.127 1.00 62.78  ? 50   TYR G C     1 
ATOM   4800  O  O     . TYR G  3 50  ? -23.168 -37.919 25.123 1.00 62.23  ? 50   TYR G O     1 
ATOM   4801  C  CB    . TYR G  3 50  ? -20.367 -37.833 23.243 1.00 62.86  ? 50   TYR G CB    1 
ATOM   4802  C  CG    . TYR G  3 50  ? -19.627 -38.525 24.367 1.00 62.81  ? 50   TYR G CG    1 
ATOM   4803  C  CD1   . TYR G  3 50  ? -18.556 -39.378 24.093 1.00 62.77  ? 50   TYR G CD1   1 
ATOM   4804  C  CD2   . TYR G  3 50  ? -19.959 -38.302 25.705 1.00 63.77  ? 50   TYR G CD2   1 
ATOM   4805  C  CE1   . TYR G  3 50  ? -17.838 -39.996 25.108 1.00 61.29  ? 50   TYR G CE1   1 
ATOM   4806  C  CE2   . TYR G  3 50  ? -19.237 -38.921 26.743 1.00 63.31  ? 50   TYR G CE2   1 
ATOM   4807  C  CZ    . TYR G  3 50  ? -18.178 -39.765 26.424 1.00 63.07  ? 50   TYR G CZ    1 
ATOM   4808  O  OH    . TYR G  3 50  ? -17.456 -40.380 27.428 1.00 64.32  ? 50   TYR G OH    1 
ATOM   4809  N  N     . LEU G  3 51  ? -22.818 -36.064 23.867 1.00 62.06  ? 51   LEU G N     1 
ATOM   4810  C  CA    . LEU G  3 51  ? -23.455 -35.196 24.828 1.00 62.08  ? 51   LEU G CA    1 
ATOM   4811  C  C     . LEU G  3 51  ? -24.932 -35.504 24.950 1.00 62.07  ? 51   LEU G C     1 
ATOM   4812  O  O     . LEU G  3 51  ? -25.471 -35.532 26.059 1.00 62.47  ? 51   LEU G O     1 
ATOM   4813  C  CB    . LEU G  3 51  ? -23.208 -33.705 24.535 1.00 61.98  ? 51   LEU G CB    1 
ATOM   4814  C  CG    . LEU G  3 51  ? -23.964 -32.736 25.473 1.00 61.98  ? 51   LEU G CG    1 
ATOM   4815  C  CD1   . LEU G  3 51  ? -23.645 -32.913 26.977 1.00 61.42  ? 51   LEU G CD1   1 
ATOM   4816  C  CD2   . LEU G  3 51  ? -23.778 -31.297 25.058 1.00 62.03  ? 51   LEU G CD2   1 
ATOM   4817  N  N     . ALA G  3 52  ? -25.588 -35.759 23.827 1.00 62.16  ? 52   ALA G N     1 
ATOM   4818  C  CA    . ALA G  3 52  ? -27.000 -36.136 23.873 1.00 61.81  ? 52   ALA G CA    1 
ATOM   4819  C  C     . ALA G  3 52  ? -27.166 -37.429 24.673 1.00 61.48  ? 52   ALA G C     1 
ATOM   4820  O  O     . ALA G  3 52  ? -28.092 -37.549 25.474 1.00 61.29  ? 52   ALA G O     1 
ATOM   4821  C  CB    . ALA G  3 52  ? -27.559 -36.273 22.486 1.00 61.88  ? 52   ALA G CB    1 
ATOM   4822  N  N     . ALA G  3 53  ? -26.252 -38.377 24.478 1.00 61.21  ? 53   ALA G N     1 
ATOM   4823  C  CA    . ALA G  3 53  ? -26.300 -39.643 25.218 1.00 61.23  ? 53   ALA G CA    1 
ATOM   4824  C  C     . ALA G  3 53  ? -26.270 -39.385 26.714 1.00 61.23  ? 53   ALA G C     1 
ATOM   4825  O  O     . ALA G  3 53  ? -27.137 -39.854 27.449 1.00 61.68  ? 53   ALA G O     1 
ATOM   4826  C  CB    . ALA G  3 53  ? -25.147 -40.546 24.818 1.00 60.94  ? 53   ALA G CB    1 
ATOM   4827  N  N     . VAL G  3 54  ? -25.267 -38.621 27.150 1.00 61.20  ? 54   VAL G N     1 
ATOM   4828  C  CA    . VAL G  3 54  ? -25.084 -38.267 28.560 1.00 60.29  ? 54   VAL G CA    1 
ATOM   4829  C  C     . VAL G  3 54  ? -26.326 -37.604 29.177 1.00 60.07  ? 54   VAL G C     1 
ATOM   4830  O  O     . VAL G  3 54  ? -26.724 -37.926 30.303 1.00 59.47  ? 54   VAL G O     1 
ATOM   4831  C  CB    . VAL G  3 54  ? -23.848 -37.375 28.721 1.00 60.21  ? 54   VAL G CB    1 
ATOM   4832  C  CG1   . VAL G  3 54  ? -23.771 -36.771 30.114 1.00 59.86  ? 54   VAL G CG1   1 
ATOM   4833  C  CG2   . VAL G  3 54  ? -22.578 -38.172 28.408 1.00 60.00  ? 54   VAL G CG2   1 
ATOM   4834  N  N     . LEU G  3 55  ? -26.943 -36.703 28.431 1.00 59.89  ? 55   LEU G N     1 
ATOM   4835  C  CA    . LEU G  3 55  ? -28.113 -36.004 28.919 1.00 60.68  ? 55   LEU G CA    1 
ATOM   4836  C  C     . LEU G  3 55  ? -29.299 -36.931 29.076 1.00 61.42  ? 55   LEU G C     1 
ATOM   4837  O  O     . LEU G  3 55  ? -30.035 -36.863 30.062 1.00 60.98  ? 55   LEU G O     1 
ATOM   4838  C  CB    . LEU G  3 55  ? -28.459 -34.861 27.982 1.00 60.71  ? 55   LEU G CB    1 
ATOM   4839  C  CG    . LEU G  3 55  ? -27.534 -33.642 27.980 1.00 60.78  ? 55   LEU G CG    1 
ATOM   4840  C  CD1   . LEU G  3 55  ? -27.921 -32.744 26.838 1.00 60.76  ? 55   LEU G CD1   1 
ATOM   4841  C  CD2   . LEU G  3 55  ? -27.619 -32.889 29.306 1.00 60.95  ? 55   LEU G CD2   1 
ATOM   4842  N  N     . GLU G  3 56  ? -29.469 -37.811 28.095 1.00 62.83  ? 56   GLU G N     1 
ATOM   4843  C  CA    . GLU G  3 56  ? -30.542 -38.805 28.115 1.00 63.40  ? 56   GLU G CA    1 
ATOM   4844  C  C     . GLU G  3 56  ? -30.371 -39.689 29.332 1.00 62.70  ? 56   GLU G C     1 
ATOM   4845  O  O     . GLU G  3 56  ? -31.294 -39.838 30.143 1.00 63.01  ? 56   GLU G O     1 
ATOM   4846  C  CB    . GLU G  3 56  ? -30.503 -39.652 26.850 1.00 63.94  ? 56   GLU G CB    1 
ATOM   4847  C  CG    . GLU G  3 56  ? -31.809 -40.379 26.570 1.00 66.83  ? 56   GLU G CG    1 
ATOM   4848  C  CD    . GLU G  3 56  ? -31.760 -41.168 25.266 1.00 70.53  ? 56   GLU G CD    1 
ATOM   4849  O  OE1   . GLU G  3 56  ? -31.562 -40.532 24.202 1.00 72.33  ? 56   GLU G OE1   1 
ATOM   4850  O  OE2   . GLU G  3 56  ? -31.925 -42.415 25.311 1.00 71.79  ? 56   GLU G OE2   1 
ATOM   4851  N  N     . TYR G  3 57  ? -29.181 -40.246 29.467 1.00 61.72  ? 57   TYR G N     1 
ATOM   4852  C  CA    . TYR G  3 57  ? -28.882 -41.092 30.598 1.00 61.98  ? 57   TYR G CA    1 
ATOM   4853  C  C     . TYR G  3 57  ? -29.284 -40.508 31.971 1.00 62.09  ? 57   TYR G C     1 
ATOM   4854  O  O     . TYR G  3 57  ? -30.016 -41.141 32.727 1.00 62.38  ? 57   TYR G O     1 
ATOM   4855  C  CB    . TYR G  3 57  ? -27.409 -41.489 30.593 1.00 62.26  ? 57   TYR G CB    1 
ATOM   4856  C  CG    . TYR G  3 57  ? -26.982 -41.999 31.939 1.00 63.36  ? 57   TYR G CG    1 
ATOM   4857  C  CD1   . TYR G  3 57  ? -27.487 -43.198 32.449 1.00 63.34  ? 57   TYR G CD1   1 
ATOM   4858  C  CD2   . TYR G  3 57  ? -26.095 -41.266 32.721 1.00 64.45  ? 57   TYR G CD2   1 
ATOM   4859  C  CE1   . TYR G  3 57  ? -27.104 -43.653 33.688 1.00 63.90  ? 57   TYR G CE1   1 
ATOM   4860  C  CE2   . TYR G  3 57  ? -25.704 -41.716 33.954 1.00 64.00  ? 57   TYR G CE2   1 
ATOM   4861  C  CZ    . TYR G  3 57  ? -26.216 -42.899 34.437 1.00 64.20  ? 57   TYR G CZ    1 
ATOM   4862  O  OH    . TYR G  3 57  ? -25.822 -43.320 35.685 1.00 65.93  ? 57   TYR G OH    1 
ATOM   4863  N  N     . LEU G  3 58  ? -28.805 -39.302 32.278 1.00 61.86  ? 58   LEU G N     1 
ATOM   4864  C  CA    . LEU G  3 58  ? -29.047 -38.667 33.557 1.00 61.35  ? 58   LEU G CA    1 
ATOM   4865  C  C     . LEU G  3 58  ? -30.527 -38.379 33.749 1.00 61.72  ? 58   LEU G C     1 
ATOM   4866  O  O     . LEU G  3 58  ? -31.044 -38.395 34.877 1.00 61.25  ? 58   LEU G O     1 
ATOM   4867  C  CB    . LEU G  3 58  ? -28.245 -37.362 33.649 1.00 61.43  ? 58   LEU G CB    1 
ATOM   4868  C  CG    . LEU G  3 58  ? -26.719 -37.483 33.696 1.00 60.72  ? 58   LEU G CG    1 
ATOM   4869  C  CD1   . LEU G  3 58  ? -26.071 -36.221 33.209 1.00 59.13  ? 58   LEU G CD1   1 
ATOM   4870  C  CD2   . LEU G  3 58  ? -26.218 -37.867 35.099 1.00 58.99  ? 58   LEU G CD2   1 
ATOM   4871  N  N     . THR G  3 59  ? -31.210 -38.104 32.644 1.00 61.97  ? 59   THR G N     1 
ATOM   4872  C  CA    . THR G  3 59  ? -32.644 -37.898 32.696 1.00 62.65  ? 59   THR G CA    1 
ATOM   4873  C  C     . THR G  3 59  ? -33.338 -39.212 33.074 1.00 63.00  ? 59   THR G C     1 
ATOM   4874  O  O     . THR G  3 59  ? -34.271 -39.230 33.888 1.00 62.55  ? 59   THR G O     1 
ATOM   4875  C  CB    . THR G  3 59  ? -33.174 -37.376 31.352 1.00 62.97  ? 59   THR G CB    1 
ATOM   4876  O  OG1   . THR G  3 59  ? -32.350 -36.292 30.917 1.00 63.31  ? 59   THR G OG1   1 
ATOM   4877  C  CG2   . THR G  3 59  ? -34.611 -36.892 31.470 1.00 61.68  ? 59   THR G CG2   1 
ATOM   4878  N  N     . ALA G  3 60  ? -32.869 -40.308 32.484 1.00 63.57  ? 60   ALA G N     1 
ATOM   4879  C  CA    . ALA G  3 60  ? -33.415 -41.631 32.799 1.00 64.07  ? 60   ALA G CA    1 
ATOM   4880  C  C     . ALA G  3 60  ? -33.142 -41.947 34.267 1.00 64.29  ? 60   ALA G C     1 
ATOM   4881  O  O     . ALA G  3 60  ? -34.017 -42.461 34.985 1.00 63.90  ? 60   ALA G O     1 
ATOM   4882  C  CB    . ALA G  3 60  ? -32.810 -42.692 31.889 1.00 63.81  ? 60   ALA G CB    1 
ATOM   4883  N  N     . GLU G  3 61  ? -31.937 -41.607 34.718 1.00 64.58  ? 61   GLU G N     1 
ATOM   4884  C  CA    . GLU G  3 61  ? -31.567 -41.891 36.091 1.00 65.45  ? 61   GLU G CA    1 
ATOM   4885  C  C     . GLU G  3 61  ? -32.509 -41.212 37.080 1.00 65.22  ? 61   GLU G C     1 
ATOM   4886  O  O     . GLU G  3 61  ? -32.962 -41.847 38.017 1.00 65.82  ? 61   GLU G O     1 
ATOM   4887  C  CB    . GLU G  3 61  ? -30.119 -41.521 36.357 1.00 65.95  ? 61   GLU G CB    1 
ATOM   4888  C  CG    . GLU G  3 61  ? -29.678 -41.691 37.807 1.00 69.68  ? 61   GLU G CG    1 
ATOM   4889  C  CD    . GLU G  3 61  ? -29.274 -43.131 38.180 1.00 75.35  ? 61   GLU G CD    1 
ATOM   4890  O  OE1   . GLU G  3 61  ? -29.414 -44.066 37.337 1.00 76.52  ? 61   GLU G OE1   1 
ATOM   4891  O  OE2   . GLU G  3 61  ? -28.819 -43.318 39.341 1.00 75.86  ? 61   GLU G OE2   1 
ATOM   4892  N  N     . ILE G  3 62  ? -32.833 -39.942 36.850 1.00 64.83  ? 62   ILE G N     1 
ATOM   4893  C  CA    . ILE G  3 62  ? -33.654 -39.188 37.780 1.00 63.98  ? 62   ILE G CA    1 
ATOM   4894  C  C     . ILE G  3 62  ? -35.084 -39.625 37.685 1.00 64.21  ? 62   ILE G C     1 
ATOM   4895  O  O     . ILE G  3 62  ? -35.730 -39.824 38.705 1.00 64.60  ? 62   ILE G O     1 
ATOM   4896  C  CB    . ILE G  3 62  ? -33.586 -37.676 37.518 1.00 64.39  ? 62   ILE G CB    1 
ATOM   4897  C  CG1   . ILE G  3 62  ? -32.180 -37.164 37.790 1.00 64.69  ? 62   ILE G CG1   1 
ATOM   4898  C  CG2   . ILE G  3 62  ? -34.601 -36.913 38.384 1.00 63.19  ? 62   ILE G CG2   1 
ATOM   4899  C  CD1   . ILE G  3 62  ? -32.114 -35.686 38.041 1.00 67.13  ? 62   ILE G CD1   1 
ATOM   4900  N  N     . LEU G  3 63  ? -35.588 -39.756 36.459 1.00 64.38  ? 63   LEU G N     1 
ATOM   4901  C  CA    . LEU G  3 63  ? -36.944 -40.246 36.226 1.00 64.16  ? 63   LEU G CA    1 
ATOM   4902  C  C     . LEU G  3 63  ? -37.149 -41.632 36.821 1.00 64.67  ? 63   LEU G C     1 
ATOM   4903  O  O     . LEU G  3 63  ? -38.174 -41.876 37.464 1.00 64.39  ? 63   LEU G O     1 
ATOM   4904  C  CB    . LEU G  3 63  ? -37.266 -40.252 34.743 1.00 63.95  ? 63   LEU G CB    1 
ATOM   4905  C  CG    . LEU G  3 63  ? -37.434 -38.866 34.130 1.00 63.55  ? 63   LEU G CG    1 
ATOM   4906  C  CD1   . LEU G  3 63  ? -37.623 -39.028 32.659 1.00 64.02  ? 63   LEU G CD1   1 
ATOM   4907  C  CD2   . LEU G  3 63  ? -38.590 -38.064 34.743 1.00 61.02  ? 63   LEU G CD2   1 
ATOM   4908  N  N     . GLU G  3 64  ? -36.168 -42.520 36.640 1.00 65.12  ? 64   GLU G N     1 
ATOM   4909  C  CA    . GLU G  3 64  ? -36.180 -43.809 37.316 1.00 66.40  ? 64   GLU G CA    1 
ATOM   4910  C  C     . GLU G  3 64  ? -36.544 -43.628 38.777 1.00 66.45  ? 64   GLU G C     1 
ATOM   4911  O  O     . GLU G  3 64  ? -37.603 -44.062 39.225 1.00 66.76  ? 64   GLU G O     1 
ATOM   4912  C  CB    . GLU G  3 64  ? -34.815 -44.469 37.210 1.00 67.05  ? 64   GLU G CB    1 
ATOM   4913  C  CG    . GLU G  3 64  ? -34.652 -45.780 37.996 1.00 70.96  ? 64   GLU G CG    1 
ATOM   4914  C  CD    . GLU G  3 64  ? -35.467 -46.952 37.439 1.00 76.49  ? 64   GLU G CD    1 
ATOM   4915  O  OE1   . GLU G  3 64  ? -35.675 -47.032 36.201 1.00 77.29  ? 64   GLU G OE1   1 
ATOM   4916  O  OE2   . GLU G  3 64  ? -35.893 -47.814 38.256 1.00 80.07  ? 64   GLU G OE2   1 
ATOM   4917  N  N     . LEU G  3 65  ? -35.673 -42.942 39.509 1.00 66.59  ? 65   LEU G N     1 
ATOM   4918  C  CA    . LEU G  3 65  ? -35.799 -42.833 40.957 1.00 65.94  ? 65   LEU G CA    1 
ATOM   4919  C  C     . LEU G  3 65  ? -37.009 -42.022 41.341 1.00 65.85  ? 65   LEU G C     1 
ATOM   4920  O  O     . LEU G  3 65  ? -37.615 -42.257 42.377 1.00 65.52  ? 65   LEU G O     1 
ATOM   4921  C  CB    . LEU G  3 65  ? -34.537 -42.216 41.550 1.00 65.79  ? 65   LEU G CB    1 
ATOM   4922  C  CG    . LEU G  3 65  ? -33.199 -42.912 41.301 1.00 65.24  ? 65   LEU G CG    1 
ATOM   4923  C  CD1   . LEU G  3 65  ? -32.091 -42.019 41.797 1.00 65.83  ? 65   LEU G CD1   1 
ATOM   4924  C  CD2   . LEU G  3 65  ? -33.109 -44.283 41.964 1.00 64.52  ? 65   LEU G CD2   1 
ATOM   4925  N  N     . ALA G  3 66  ? -37.354 -41.059 40.496 1.00 66.27  ? 66   ALA G N     1 
ATOM   4926  C  CA    . ALA G  3 66  ? -38.501 -40.198 40.758 1.00 66.84  ? 66   ALA G CA    1 
ATOM   4927  C  C     . ALA G  3 66  ? -39.787 -40.997 40.580 1.00 67.49  ? 66   ALA G C     1 
ATOM   4928  O  O     . ALA G  3 66  ? -40.739 -40.821 41.335 1.00 67.78  ? 66   ALA G O     1 
ATOM   4929  C  CB    . ALA G  3 66  ? -38.480 -38.974 39.862 1.00 66.04  ? 66   ALA G CB    1 
ATOM   4930  N  N     . GLY G  3 67  ? -39.801 -41.877 39.583 1.00 68.17  ? 67   GLY G N     1 
ATOM   4931  C  CA    . GLY G  3 67  ? -40.881 -42.841 39.418 1.00 69.16  ? 67   GLY G CA    1 
ATOM   4932  C  C     . GLY G  3 67  ? -41.103 -43.646 40.684 1.00 69.57  ? 67   GLY G C     1 
ATOM   4933  O  O     . GLY G  3 67  ? -42.205 -43.647 41.227 1.00 69.64  ? 67   GLY G O     1 
ATOM   4934  N  N     . ASN G  3 68  ? -40.060 -44.322 41.163 1.00 70.20  ? 68   ASN G N     1 
ATOM   4935  C  CA    . ASN G  3 68  ? -40.173 -45.120 42.387 1.00 71.09  ? 68   ASN G CA    1 
ATOM   4936  C  C     . ASN G  3 68  ? -40.826 -44.307 43.495 1.00 72.19  ? 68   ASN G C     1 
ATOM   4937  O  O     . ASN G  3 68  ? -41.844 -44.713 44.061 1.00 72.39  ? 68   ASN G O     1 
ATOM   4938  C  CB    . ASN G  3 68  ? -38.803 -45.641 42.828 1.00 70.58  ? 68   ASN G CB    1 
ATOM   4939  C  CG    . ASN G  3 68  ? -38.119 -46.441 41.741 1.00 70.59  ? 68   ASN G CG    1 
ATOM   4940  O  OD1   . ASN G  3 68  ? -38.765 -46.873 40.778 1.00 70.87  ? 68   ASN G OD1   1 
ATOM   4941  N  ND2   . ASN G  3 68  ? -36.805 -46.634 41.872 1.00 69.22  ? 68   ASN G ND2   1 
ATOM   4942  N  N     . ALA G  3 69  ? -40.260 -43.130 43.759 1.00 73.46  ? 69   ALA G N     1 
ATOM   4943  C  CA    . ALA G  3 69  ? -40.757 -42.223 44.793 1.00 74.05  ? 69   ALA G CA    1 
ATOM   4944  C  C     . ALA G  3 69  ? -42.235 -41.967 44.627 1.00 74.66  ? 69   ALA G C     1 
ATOM   4945  O  O     . ALA G  3 69  ? -42.936 -41.767 45.604 1.00 74.58  ? 69   ALA G O     1 
ATOM   4946  C  CB    . ALA G  3 69  ? -39.990 -40.921 44.767 1.00 73.93  ? 69   ALA G CB    1 
ATOM   4947  N  N     . ALA G  3 70  ? -42.702 -41.980 43.383 1.00 76.10  ? 70   ALA G N     1 
ATOM   4948  C  CA    . ALA G  3 70  ? -44.119 -41.779 43.090 1.00 77.65  ? 70   ALA G CA    1 
ATOM   4949  C  C     . ALA G  3 70  ? -44.895 -43.009 43.521 1.00 79.01  ? 70   ALA G C     1 
ATOM   4950  O  O     . ALA G  3 70  ? -45.871 -42.904 44.266 1.00 79.09  ? 70   ALA G O     1 
ATOM   4951  C  CB    . ALA G  3 70  ? -44.325 -41.500 41.621 1.00 77.06  ? 70   ALA G CB    1 
ATOM   4952  N  N     . ARG G  3 71  ? -44.433 -44.174 43.068 1.00 80.94  ? 71   ARG G N     1 
ATOM   4953  C  CA    . ARG G  3 71  ? -45.018 -45.453 43.457 1.00 82.83  ? 71   ARG G CA    1 
ATOM   4954  C  C     . ARG G  3 71  ? -45.047 -45.577 44.984 1.00 83.47  ? 71   ARG G C     1 
ATOM   4955  O  O     . ARG G  3 71  ? -46.112 -45.801 45.558 1.00 83.93  ? 71   ARG G O     1 
ATOM   4956  C  CB    . ARG G  3 71  ? -44.253 -46.615 42.814 1.00 83.18  ? 71   ARG G CB    1 
ATOM   4957  C  CG    . ARG G  3 71  ? -44.986 -47.940 42.827 1.00 85.34  ? 71   ARG G CG    1 
ATOM   4958  C  CD    . ARG G  3 71  ? -43.987 -49.099 42.798 1.00 89.86  ? 71   ARG G CD    1 
ATOM   4959  N  NE    . ARG G  3 71  ? -44.535 -50.299 43.444 1.00 92.40  ? 71   ARG G NE    1 
ATOM   4960  C  CZ    . ARG G  3 71  ? -43.808 -51.239 44.054 1.00 93.89  ? 71   ARG G CZ    1 
ATOM   4961  N  NH1   . ARG G  3 71  ? -42.481 -51.140 44.118 1.00 94.58  ? 71   ARG G NH1   1 
ATOM   4962  N  NH2   . ARG G  3 71  ? -44.409 -52.286 44.610 1.00 94.26  ? 71   ARG G NH2   1 
ATOM   4963  N  N     . ASP G  3 72  ? -43.897 -45.392 45.636 1.00 84.08  ? 72   ASP G N     1 
ATOM   4964  C  CA    . ASP G  3 72  ? -43.818 -45.437 47.097 1.00 84.91  ? 72   ASP G CA    1 
ATOM   4965  C  C     . ASP G  3 72  ? -44.924 -44.626 47.764 1.00 85.38  ? 72   ASP G C     1 
ATOM   4966  O  O     . ASP G  3 72  ? -45.452 -45.028 48.799 1.00 85.58  ? 72   ASP G O     1 
ATOM   4967  C  CB    . ASP G  3 72  ? -42.463 -44.927 47.593 1.00 85.12  ? 72   ASP G CB    1 
ATOM   4968  C  CG    . ASP G  3 72  ? -41.286 -45.674 46.982 1.00 86.66  ? 72   ASP G CG    1 
ATOM   4969  O  OD1   . ASP G  3 72  ? -41.316 -46.921 46.939 1.00 89.39  ? 72   ASP G OD1   1 
ATOM   4970  O  OD2   . ASP G  3 72  ? -40.312 -45.020 46.549 1.00 87.80  ? 72   ASP G OD2   1 
ATOM   4971  N  N     . ASN G  3 73  ? -45.280 -43.493 47.163 1.00 85.80  ? 73   ASN G N     1 
ATOM   4972  C  CA    . ASN G  3 73  ? -46.246 -42.577 47.759 1.00 86.24  ? 73   ASN G CA    1 
ATOM   4973  C  C     . ASN G  3 73  ? -47.701 -42.793 47.290 1.00 86.35  ? 73   ASN G C     1 
ATOM   4974  O  O     . ASN G  3 73  ? -48.585 -41.984 47.601 1.00 86.64  ? 73   ASN G O     1 
ATOM   4975  C  CB    . ASN G  3 73  ? -45.807 -41.120 47.534 1.00 86.62  ? 73   ASN G CB    1 
ATOM   4976  C  CG    . ASN G  3 73  ? -44.561 -40.731 48.354 1.00 87.69  ? 73   ASN G CG    1 
ATOM   4977  O  OD1   . ASN G  3 73  ? -44.661 -39.960 49.315 1.00 89.44  ? 73   ASN G OD1   1 
ATOM   4978  N  ND2   . ASN G  3 73  ? -43.391 -41.255 47.970 1.00 87.01  ? 73   ASN G ND2   1 
ATOM   4979  N  N     . LYS G  3 74  ? -47.948 -43.887 46.563 1.00 85.95  ? 74   LYS G N     1 
ATOM   4980  C  CA    . LYS G  3 74  ? -49.302 -44.262 46.112 1.00 85.78  ? 74   LYS G CA    1 
ATOM   4981  C  C     . LYS G  3 74  ? -49.785 -43.400 44.948 1.00 84.94  ? 74   LYS G C     1 
ATOM   4982  O  O     . LYS G  3 74  ? -50.949 -42.980 44.919 1.00 85.00  ? 74   LYS G O     1 
ATOM   4983  C  CB    . LYS G  3 74  ? -50.343 -44.186 47.259 1.00 86.57  ? 74   LYS G CB    1 
ATOM   4984  C  CG    . LYS G  3 74  ? -50.011 -44.941 48.556 1.00 87.74  ? 74   LYS G CG    1 
ATOM   4985  C  CD    . LYS G  3 74  ? -50.067 -46.469 48.380 1.00 89.12  ? 74   LYS G CD    1 
ATOM   4986  C  CE    . LYS G  3 74  ? -49.838 -47.166 49.725 1.00 88.98  ? 74   LYS G CE    1 
ATOM   4987  N  NZ    . LYS G  3 74  ? -48.902 -48.327 49.601 1.00 90.04  ? 74   LYS G NZ    1 
ATOM   4988  N  N     . LYS G  3 75  ? -48.904 -43.145 43.985 1.00 83.86  ? 75   LYS G N     1 
ATOM   4989  C  CA    . LYS G  3 75  ? -49.199 -42.192 42.905 1.00 82.70  ? 75   LYS G CA    1 
ATOM   4990  C  C     . LYS G  3 75  ? -48.564 -42.565 41.568 1.00 81.44  ? 75   LYS G C     1 
ATOM   4991  O  O     . LYS G  3 75  ? -47.541 -43.253 41.524 1.00 81.09  ? 75   LYS G O     1 
ATOM   4992  C  CB    . LYS G  3 75  ? -48.797 -40.770 43.336 1.00 83.04  ? 75   LYS G CB    1 
ATOM   4993  C  CG    . LYS G  3 75  ? -49.980 -39.922 43.835 1.00 84.13  ? 75   LYS G CG    1 
ATOM   4994  C  CD    . LYS G  3 75  ? -49.692 -39.423 45.293 1.00 86.81  ? 75   LYS G CD    1 
ATOM   4995  C  CE    . LYS G  3 75  ? -50.590 -38.220 45.640 1.00 89.23  ? 75   LYS G CE    1 
ATOM   4996  N  NZ    . LYS G  3 75  ? -50.058 -36.902 44.950 1.00 91.33  ? 75   LYS G NZ    1 
ATOM   4997  N  N     . THR G  3 76  ? -49.187 -42.110 40.483 1.00 80.31  ? 76   THR G N     1 
ATOM   4998  C  CA    . THR G  3 76  ? -48.760 -42.452 39.112 1.00 78.97  ? 76   THR G CA    1 
ATOM   4999  C  C     . THR G  3 76  ? -48.169 -41.267 38.349 1.00 77.91  ? 76   THR G C     1 
ATOM   5000  O  O     . THR G  3 76  ? -47.477 -41.441 37.346 1.00 77.84  ? 76   THR G O     1 
ATOM   5001  C  CB    . THR G  3 76  ? -49.938 -43.008 38.252 1.00 79.14  ? 76   THR G CB    1 
ATOM   5002  O  OG1   . THR G  3 76  ? -51.041 -42.081 38.273 1.00 78.51  ? 76   THR G OG1   1 
ATOM   5003  C  CG2   . THR G  3 76  ? -50.382 -44.397 38.744 1.00 79.12  ? 76   THR G CG2   1 
ATOM   5004  N  N     . ARG G  3 77  ? -48.477 -40.058 38.796 1.00 76.58  ? 77   ARG G N     1 
ATOM   5005  C  CA    . ARG G  3 77  ? -47.971 -38.870 38.120 1.00 75.22  ? 77   ARG G CA    1 
ATOM   5006  C  C     . ARG G  3 77  ? -46.859 -38.244 38.955 1.00 73.46  ? 77   ARG G C     1 
ATOM   5007  O  O     . ARG G  3 77  ? -47.058 -37.930 40.133 1.00 72.94  ? 77   ARG G O     1 
ATOM   5008  C  CB    . ARG G  3 77  ? -49.111 -37.881 37.881 1.00 75.74  ? 77   ARG G CB    1 
ATOM   5009  C  CG    . ARG G  3 77  ? -48.707 -36.579 37.220 1.00 76.84  ? 77   ARG G CG    1 
ATOM   5010  C  CD    . ARG G  3 77  ? -49.880 -35.633 37.220 1.00 78.15  ? 77   ARG G CD    1 
ATOM   5011  N  NE    . ARG G  3 77  ? -50.962 -36.163 36.396 1.00 79.64  ? 77   ARG G NE    1 
ATOM   5012  C  CZ    . ARG G  3 77  ? -52.252 -35.901 36.597 1.00 80.01  ? 77   ARG G CZ    1 
ATOM   5013  N  NH1   . ARG G  3 77  ? -52.645 -35.118 37.603 1.00 79.55  ? 77   ARG G NH1   1 
ATOM   5014  N  NH2   . ARG G  3 77  ? -53.155 -36.433 35.787 1.00 80.73  ? 77   ARG G NH2   1 
ATOM   5015  N  N     . ILE G  3 78  ? -45.686 -38.099 38.343 1.00 71.48  ? 78   ILE G N     1 
ATOM   5016  C  CA    . ILE G  3 78  ? -44.541 -37.477 39.006 1.00 69.53  ? 78   ILE G CA    1 
ATOM   5017  C  C     . ILE G  3 78  ? -44.767 -35.979 39.172 1.00 68.39  ? 78   ILE G C     1 
ATOM   5018  O  O     . ILE G  3 78  ? -45.125 -35.278 38.229 1.00 68.08  ? 78   ILE G O     1 
ATOM   5019  C  CB    . ILE G  3 78  ? -43.235 -37.731 38.248 1.00 69.26  ? 78   ILE G CB    1 
ATOM   5020  C  CG1   . ILE G  3 78  ? -42.759 -39.166 38.484 1.00 67.62  ? 78   ILE G CG1   1 
ATOM   5021  C  CG2   . ILE G  3 78  ? -42.160 -36.738 38.704 1.00 70.18  ? 78   ILE G CG2   1 
ATOM   5022  C  CD1   . ILE G  3 78  ? -41.684 -39.613 37.543 1.00 65.46  ? 78   ILE G CD1   1 
ATOM   5023  N  N     . ILE G  3 79  ? -44.592 -35.517 40.401 1.00 67.49  ? 79   ILE G N     1 
ATOM   5024  C  CA    . ILE G  3 79  ? -44.629 -34.095 40.726 1.00 66.84  ? 79   ILE G CA    1 
ATOM   5025  C  C     . ILE G  3 79  ? -43.243 -33.613 41.229 1.00 66.44  ? 79   ILE G C     1 
ATOM   5026  O  O     . ILE G  3 79  ? -42.332 -34.431 41.412 1.00 66.31  ? 79   ILE G O     1 
ATOM   5027  C  CB    . ILE G  3 79  ? -45.782 -33.766 41.714 1.00 66.66  ? 79   ILE G CB    1 
ATOM   5028  C  CG1   . ILE G  3 79  ? -45.600 -34.469 43.063 1.00 66.48  ? 79   ILE G CG1   1 
ATOM   5029  C  CG2   . ILE G  3 79  ? -47.104 -34.167 41.101 1.00 66.37  ? 79   ILE G CG2   1 
ATOM   5030  C  CD1   . ILE G  3 79  ? -46.593 -33.992 44.133 1.00 66.27  ? 79   ILE G CD1   1 
ATOM   5031  N  N     . PRO G  3 80  ? -43.062 -32.288 41.400 1.00 65.86  ? 80   PRO G N     1 
ATOM   5032  C  CA    . PRO G  3 80  ? -41.806 -31.751 41.950 1.00 65.06  ? 80   PRO G CA    1 
ATOM   5033  C  C     . PRO G  3 80  ? -41.337 -32.414 43.256 1.00 64.30  ? 80   PRO G C     1 
ATOM   5034  O  O     . PRO G  3 80  ? -40.133 -32.640 43.432 1.00 64.35  ? 80   PRO G O     1 
ATOM   5035  C  CB    . PRO G  3 80  ? -42.144 -30.279 42.190 1.00 64.95  ? 80   PRO G CB    1 
ATOM   5036  C  CG    . PRO G  3 80  ? -43.086 -29.972 41.090 1.00 65.48  ? 80   PRO G CG    1 
ATOM   5037  C  CD    . PRO G  3 80  ? -43.992 -31.198 41.046 1.00 65.88  ? 80   PRO G CD    1 
ATOM   5038  N  N     . ARG G  3 81  ? -42.270 -32.740 44.152 1.00 63.30  ? 81   ARG G N     1 
ATOM   5039  C  CA    . ARG G  3 81  ? -41.908 -33.402 45.399 1.00 61.83  ? 81   ARG G CA    1 
ATOM   5040  C  C     . ARG G  3 81  ? -41.172 -34.711 45.149 1.00 61.36  ? 81   ARG G C     1 
ATOM   5041  O  O     . ARG G  3 81  ? -40.194 -35.015 45.835 1.00 61.12  ? 81   ARG G O     1 
ATOM   5042  C  CB    . ARG G  3 81  ? -43.145 -33.645 46.252 1.00 61.81  ? 81   ARG G CB    1 
ATOM   5043  C  CG    . ARG G  3 81  ? -42.885 -34.453 47.504 1.00 61.90  ? 81   ARG G CG    1 
ATOM   5044  C  CD    . ARG G  3 81  ? -41.858 -33.801 48.407 1.00 59.90  ? 81   ARG G CD    1 
ATOM   5045  N  NE    . ARG G  3 81  ? -41.980 -34.259 49.787 1.00 59.21  ? 81   ARG G NE    1 
ATOM   5046  C  CZ    . ARG G  3 81  ? -41.197 -33.847 50.779 1.00 59.45  ? 81   ARG G CZ    1 
ATOM   5047  N  NH1   . ARG G  3 81  ? -40.229 -32.964 50.533 1.00 60.72  ? 81   ARG G NH1   1 
ATOM   5048  N  NH2   . ARG G  3 81  ? -41.383 -34.302 52.014 1.00 56.54  ? 81   ARG G NH2   1 
ATOM   5049  N  N     . HIS G  3 82  ? -41.629 -35.480 44.162 1.00 60.45  ? 82   HIS G N     1 
ATOM   5050  C  CA    . HIS G  3 82  ? -41.012 -36.773 43.896 1.00 59.78  ? 82   HIS G CA    1 
ATOM   5051  C  C     . HIS G  3 82  ? -39.619 -36.632 43.314 1.00 59.40  ? 82   HIS G C     1 
ATOM   5052  O  O     . HIS G  3 82  ? -38.748 -37.469 43.594 1.00 59.89  ? 82   HIS G O     1 
ATOM   5053  C  CB    . HIS G  3 82  ? -41.895 -37.689 43.036 1.00 59.77  ? 82   HIS G CB    1 
ATOM   5054  C  CG    . HIS G  3 82  ? -43.283 -37.853 43.570 1.00 60.35  ? 82   HIS G CG    1 
ATOM   5055  N  ND1   . HIS G  3 82  ? -44.406 -37.733 42.779 1.00 61.73  ? 82   HIS G ND1   1 
ATOM   5056  C  CD2   . HIS G  3 82  ? -43.734 -38.075 44.827 1.00 61.02  ? 82   HIS G CD2   1 
ATOM   5057  C  CE1   . HIS G  3 82  ? -45.486 -37.895 43.522 1.00 61.58  ? 82   HIS G CE1   1 
ATOM   5058  N  NE2   . HIS G  3 82  ? -45.107 -38.105 44.770 1.00 60.43  ? 82   HIS G NE2   1 
ATOM   5059  N  N     . LEU G  3 83  ? -39.391 -35.574 42.533 1.00 58.59  ? 83   LEU G N     1 
ATOM   5060  C  CA    . LEU G  3 83  ? -38.053 -35.296 41.993 1.00 57.29  ? 83   LEU G CA    1 
ATOM   5061  C  C     . LEU G  3 83  ? -37.098 -34.899 43.129 1.00 57.08  ? 83   LEU G C     1 
ATOM   5062  O  O     . LEU G  3 83  ? -35.952 -35.375 43.187 1.00 56.70  ? 83   LEU G O     1 
ATOM   5063  C  CB    . LEU G  3 83  ? -38.122 -34.222 40.917 1.00 57.18  ? 83   LEU G CB    1 
ATOM   5064  C  CG    . LEU G  3 83  ? -38.751 -34.542 39.553 1.00 56.20  ? 83   LEU G CG    1 
ATOM   5065  C  CD1   . LEU G  3 83  ? -39.109 -33.246 38.837 1.00 54.82  ? 83   LEU G CD1   1 
ATOM   5066  C  CD2   . LEU G  3 83  ? -37.824 -35.384 38.680 1.00 53.15  ? 83   LEU G CD2   1 
ATOM   5067  N  N     . GLN G  3 84  ? -37.599 -34.079 44.053 1.00 56.43  ? 84   GLN G N     1 
ATOM   5068  C  CA    . GLN G  3 84  ? -36.860 -33.710 45.261 1.00 56.61  ? 84   GLN G CA    1 
ATOM   5069  C  C     . GLN G  3 84  ? -36.441 -34.937 46.088 1.00 57.32  ? 84   GLN G C     1 
ATOM   5070  O  O     . GLN G  3 84  ? -35.240 -35.155 46.295 1.00 57.66  ? 84   GLN G O     1 
ATOM   5071  C  CB    . GLN G  3 84  ? -37.662 -32.708 46.097 1.00 56.17  ? 84   GLN G CB    1 
ATOM   5072  C  CG    . GLN G  3 84  ? -37.054 -32.304 47.414 1.00 55.50  ? 84   GLN G CG    1 
ATOM   5073  C  CD    . GLN G  3 84  ? -35.764 -31.464 47.282 1.00 55.78  ? 84   GLN G CD    1 
ATOM   5074  O  OE1   . GLN G  3 84  ? -35.073 -31.481 46.246 1.00 55.56  ? 84   GLN G OE1   1 
ATOM   5075  N  NE2   . GLN G  3 84  ? -35.414 -30.770 48.358 1.00 51.70  ? 84   GLN G NE2   1 
ATOM   5076  N  N     . LEU G  3 85  ? -37.406 -35.752 46.526 1.00 57.51  ? 85   LEU G N     1 
ATOM   5077  C  CA    . LEU G  3 85  ? -37.091 -36.985 47.259 1.00 57.12  ? 85   LEU G CA    1 
ATOM   5078  C  C     . LEU G  3 85  ? -36.101 -37.884 46.503 1.00 57.17  ? 85   LEU G C     1 
ATOM   5079  O  O     . LEU G  3 85  ? -35.190 -38.458 47.109 1.00 56.73  ? 85   LEU G O     1 
ATOM   5080  C  CB    . LEU G  3 85  ? -38.358 -37.785 47.555 1.00 57.47  ? 85   LEU G CB    1 
ATOM   5081  C  CG    . LEU G  3 85  ? -39.482 -37.246 48.445 1.00 56.93  ? 85   LEU G CG    1 
ATOM   5082  C  CD1   . LEU G  3 85  ? -40.588 -38.272 48.532 1.00 54.77  ? 85   LEU G CD1   1 
ATOM   5083  C  CD2   . LEU G  3 85  ? -39.002 -36.880 49.814 1.00 55.47  ? 85   LEU G CD2   1 
ATOM   5084  N  N     . ALA G  3 86  ? -36.270 -38.021 45.187 1.00 57.15  ? 86   ALA G N     1 
ATOM   5085  C  CA    . ALA G  3 86  ? -35.320 -38.843 44.410 1.00 57.37  ? 86   ALA G CA    1 
ATOM   5086  C  C     . ALA G  3 86  ? -33.916 -38.260 44.500 1.00 57.79  ? 86   ALA G C     1 
ATOM   5087  O  O     . ALA G  3 86  ? -32.957 -38.967 44.757 1.00 57.80  ? 86   ALA G O     1 
ATOM   5088  C  CB    . ALA G  3 86  ? -35.735 -38.957 42.970 1.00 56.90  ? 86   ALA G CB    1 
ATOM   5089  N  N     . VAL G  3 87  ? -33.808 -36.949 44.290 1.00 58.30  ? 87   VAL G N     1 
ATOM   5090  C  CA    . VAL G  3 87  ? -32.510 -36.283 44.311 1.00 57.74  ? 87   VAL G CA    1 
ATOM   5091  C  C     . VAL G  3 87  ? -31.846 -36.327 45.697 1.00 57.56  ? 87   VAL G C     1 
ATOM   5092  O  O     . VAL G  3 87  ? -30.717 -36.809 45.830 1.00 57.02  ? 87   VAL G O     1 
ATOM   5093  C  CB    . VAL G  3 87  ? -32.604 -34.854 43.704 1.00 57.56  ? 87   VAL G CB    1 
ATOM   5094  C  CG1   . VAL G  3 87  ? -31.389 -34.001 44.051 1.00 57.45  ? 87   VAL G CG1   1 
ATOM   5095  C  CG2   . VAL G  3 87  ? -32.749 -34.950 42.204 1.00 57.32  ? 87   VAL G CG2   1 
ATOM   5096  N  N     . ARG G  3 88  ? -32.530 -35.862 46.730 1.00 57.66  ? 88   ARG G N     1 
ATOM   5097  C  CA    . ARG G  3 88  ? -31.826 -35.746 48.006 1.00 58.78  ? 88   ARG G CA    1 
ATOM   5098  C  C     . ARG G  3 88  ? -31.592 -37.086 48.745 1.00 59.22  ? 88   ARG G C     1 
ATOM   5099  O  O     . ARG G  3 88  ? -30.779 -37.147 49.655 1.00 59.60  ? 88   ARG G O     1 
ATOM   5100  C  CB    . ARG G  3 88  ? -32.409 -34.642 48.917 1.00 58.42  ? 88   ARG G CB    1 
ATOM   5101  C  CG    . ARG G  3 88  ? -33.260 -33.593 48.216 1.00 57.95  ? 88   ARG G CG    1 
ATOM   5102  C  CD    . ARG G  3 88  ? -32.618 -32.223 47.851 1.00 56.01  ? 88   ARG G CD    1 
ATOM   5103  N  NE    . ARG G  3 88  ? -31.279 -32.245 47.267 1.00 55.49  ? 88   ARG G NE    1 
ATOM   5104  C  CZ    . ARG G  3 88  ? -30.787 -31.348 46.404 1.00 54.22  ? 88   ARG G CZ    1 
ATOM   5105  N  NH1   . ARG G  3 88  ? -31.518 -30.352 45.920 1.00 53.24  ? 88   ARG G NH1   1 
ATOM   5106  N  NH2   . ARG G  3 88  ? -29.540 -31.480 45.984 1.00 55.58  ? 88   ARG G NH2   1 
ATOM   5107  N  N     . ASN G  3 89  ? -32.269 -38.159 48.336 1.00 59.95  ? 89   ASN G N     1 
ATOM   5108  C  CA    . ASN G  3 89  ? -31.986 -39.517 48.875 1.00 60.09  ? 89   ASN G CA    1 
ATOM   5109  C  C     . ASN G  3 89  ? -30.959 -40.299 48.078 1.00 60.71  ? 89   ASN G C     1 
ATOM   5110  O  O     . ASN G  3 89  ? -30.630 -41.408 48.442 1.00 60.91  ? 89   ASN G O     1 
ATOM   5111  C  CB    . ASN G  3 89  ? -33.248 -40.368 48.983 1.00 59.52  ? 89   ASN G CB    1 
ATOM   5112  C  CG    . ASN G  3 89  ? -34.173 -39.901 50.069 1.00 59.56  ? 89   ASN G CG    1 
ATOM   5113  O  OD1   . ASN G  3 89  ? -33.789 -39.807 51.226 1.00 60.43  ? 89   ASN G OD1   1 
ATOM   5114  N  ND2   . ASN G  3 89  ? -35.404 -39.605 49.706 1.00 60.07  ? 89   ASN G ND2   1 
ATOM   5115  N  N     . ASP G  3 90  ? -30.479 -39.738 46.975 1.00 61.72  ? 90   ASP G N     1 
ATOM   5116  C  CA    . ASP G  3 90  ? -29.417 -40.353 46.209 1.00 62.57  ? 90   ASP G CA    1 
ATOM   5117  C  C     . ASP G  3 90  ? -28.150 -39.549 46.432 1.00 63.17  ? 90   ASP G C     1 
ATOM   5118  O  O     . ASP G  3 90  ? -28.073 -38.386 46.050 1.00 63.86  ? 90   ASP G O     1 
ATOM   5119  C  CB    . ASP G  3 90  ? -29.751 -40.384 44.726 1.00 62.49  ? 90   ASP G CB    1 
ATOM   5120  C  CG    . ASP G  3 90  ? -28.658 -41.059 43.913 1.00 65.48  ? 90   ASP G CG    1 
ATOM   5121  O  OD1   . ASP G  3 90  ? -28.581 -42.305 43.922 1.00 69.13  ? 90   ASP G OD1   1 
ATOM   5122  O  OD2   . ASP G  3 90  ? -27.854 -40.359 43.263 1.00 68.52  ? 90   ASP G OD2   1 
ATOM   5123  N  N     . GLU G  3 91  ? -27.158 -40.167 47.050 1.00 63.64  ? 91   GLU G N     1 
ATOM   5124  C  CA    . GLU G  3 91  ? -25.925 -39.488 47.392 1.00 64.51  ? 91   GLU G CA    1 
ATOM   5125  C  C     . GLU G  3 91  ? -25.251 -38.779 46.219 1.00 64.04  ? 91   GLU G C     1 
ATOM   5126  O  O     . GLU G  3 91  ? -24.661 -37.714 46.391 1.00 64.25  ? 91   GLU G O     1 
ATOM   5127  C  CB    . GLU G  3 91  ? -24.945 -40.465 48.012 1.00 64.89  ? 91   GLU G CB    1 
ATOM   5128  C  CG    . GLU G  3 91  ? -24.163 -39.833 49.125 1.00 69.03  ? 91   GLU G CG    1 
ATOM   5129  C  CD    . GLU G  3 91  ? -22.791 -40.439 49.280 1.00 74.64  ? 91   GLU G CD    1 
ATOM   5130  O  OE1   . GLU G  3 91  ? -22.055 -40.531 48.260 1.00 75.87  ? 91   GLU G OE1   1 
ATOM   5131  O  OE2   . GLU G  3 91  ? -22.453 -40.810 50.431 1.00 77.58  ? 91   GLU G OE2   1 
ATOM   5132  N  N     . GLU G  3 92  ? -25.340 -39.361 45.032 1.00 63.59  ? 92   GLU G N     1 
ATOM   5133  C  CA    . GLU G  3 92  ? -24.651 -38.782 43.889 1.00 63.34  ? 92   GLU G CA    1 
ATOM   5134  C  C     . GLU G  3 92  ? -25.437 -37.679 43.197 1.00 62.15  ? 92   GLU G C     1 
ATOM   5135  O  O     . GLU G  3 92  ? -24.930 -36.590 42.979 1.00 62.18  ? 92   GLU G O     1 
ATOM   5136  C  CB    . GLU G  3 92  ? -24.168 -39.862 42.926 1.00 63.56  ? 92   GLU G CB    1 
ATOM   5137  C  CG    . GLU G  3 92  ? -22.887 -40.490 43.456 1.00 66.39  ? 92   GLU G CG    1 
ATOM   5138  C  CD    . GLU G  3 92  ? -22.195 -41.440 42.493 1.00 71.14  ? 92   GLU G CD    1 
ATOM   5139  O  OE1   . GLU G  3 92  ? -22.616 -41.552 41.311 1.00 72.04  ? 92   GLU G OE1   1 
ATOM   5140  O  OE2   . GLU G  3 92  ? -21.201 -42.071 42.946 1.00 73.21  ? 92   GLU G OE2   1 
ATOM   5141  N  N     . LEU G  3 93  ? -26.691 -37.950 42.886 1.00 61.28  ? 93   LEU G N     1 
ATOM   5142  C  CA    . LEU G  3 93  ? -27.565 -36.917 42.354 1.00 60.29  ? 93   LEU G CA    1 
ATOM   5143  C  C     . LEU G  3 93  ? -27.635 -35.728 43.293 1.00 59.82  ? 93   LEU G C     1 
ATOM   5144  O  O     . LEU G  3 93  ? -27.702 -34.597 42.833 1.00 59.64  ? 93   LEU G O     1 
ATOM   5145  C  CB    . LEU G  3 93  ? -28.962 -37.466 42.111 1.00 60.13  ? 93   LEU G CB    1 
ATOM   5146  C  CG    . LEU G  3 93  ? -29.161 -38.344 40.880 1.00 59.38  ? 93   LEU G CG    1 
ATOM   5147  C  CD1   . LEU G  3 93  ? -30.594 -38.880 40.844 1.00 58.59  ? 93   LEU G CD1   1 
ATOM   5148  C  CD2   . LEU G  3 93  ? -28.820 -37.562 39.606 1.00 58.46  ? 93   LEU G CD2   1 
ATOM   5149  N  N     . ASN G  3 94  ? -27.609 -35.992 44.602 1.00 59.34  ? 94   ASN G N     1 
ATOM   5150  C  CA    . ASN G  3 94  ? -27.600 -34.933 45.590 1.00 58.88  ? 94   ASN G CA    1 
ATOM   5151  C  C     . ASN G  3 94  ? -26.363 -34.075 45.503 1.00 58.73  ? 94   ASN G C     1 
ATOM   5152  O  O     . ASN G  3 94  ? -26.433 -32.871 45.722 1.00 59.83  ? 94   ASN G O     1 
ATOM   5153  C  CB    . ASN G  3 94  ? -27.715 -35.468 47.010 1.00 58.96  ? 94   ASN G CB    1 
ATOM   5154  C  CG    . ASN G  3 94  ? -27.905 -34.357 48.038 1.00 58.08  ? 94   ASN G CG    1 
ATOM   5155  O  OD1   . ASN G  3 94  ? -28.847 -33.578 47.960 1.00 58.71  ? 94   ASN G OD1   1 
ATOM   5156  N  ND2   . ASN G  3 94  ? -27.004 -34.284 48.996 1.00 55.55  ? 94   ASN G ND2   1 
ATOM   5157  N  N     . LYS G  3 95  ? -25.229 -34.665 45.192 1.00 57.87  ? 95   LYS G N     1 
ATOM   5158  C  CA    . LYS G  3 95  ? -24.027 -33.869 45.158 1.00 57.64  ? 95   LYS G CA    1 
ATOM   5159  C  C     . LYS G  3 95  ? -23.988 -33.052 43.882 1.00 57.03  ? 95   LYS G C     1 
ATOM   5160  O  O     . LYS G  3 95  ? -23.604 -31.884 43.906 1.00 57.87  ? 95   LYS G O     1 
ATOM   5161  C  CB    . LYS G  3 95  ? -22.790 -34.728 45.291 1.00 57.82  ? 95   LYS G CB    1 
ATOM   5162  C  CG    . LYS G  3 95  ? -21.517 -33.938 45.329 1.00 61.58  ? 95   LYS G CG    1 
ATOM   5163  C  CD    . LYS G  3 95  ? -20.332 -34.891 45.290 1.00 68.47  ? 95   LYS G CD    1 
ATOM   5164  C  CE    . LYS G  3 95  ? -19.005 -34.148 45.218 1.00 72.57  ? 95   LYS G CE    1 
ATOM   5165  N  NZ    . LYS G  3 95  ? -17.901 -35.170 45.375 1.00 77.74  ? 95   LYS G NZ    1 
ATOM   5166  N  N     . LEU G  3 96  ? -24.404 -33.651 42.773 1.00 55.73  ? 96   LEU G N     1 
ATOM   5167  C  CA    . LEU G  3 96  ? -24.429 -32.949 41.506 1.00 54.51  ? 96   LEU G CA    1 
ATOM   5168  C  C     . LEU G  3 96  ? -25.373 -31.749 41.585 1.00 54.27  ? 96   LEU G C     1 
ATOM   5169  O  O     . LEU G  3 96  ? -25.123 -30.708 40.981 1.00 55.00  ? 96   LEU G O     1 
ATOM   5170  C  CB    . LEU G  3 96  ? -24.841 -33.895 40.370 1.00 53.86  ? 96   LEU G CB    1 
ATOM   5171  C  CG    . LEU G  3 96  ? -24.826 -33.313 38.948 1.00 53.76  ? 96   LEU G CG    1 
ATOM   5172  C  CD1   . LEU G  3 96  ? -23.423 -33.145 38.360 1.00 50.24  ? 96   LEU G CD1   1 
ATOM   5173  C  CD2   . LEU G  3 96  ? -25.699 -34.139 38.036 1.00 54.76  ? 96   LEU G CD2   1 
ATOM   5174  N  N     . LEU G  3 97  ? -26.455 -31.886 42.330 1.00 53.60  ? 97   LEU G N     1 
ATOM   5175  C  CA    . LEU G  3 97  ? -27.409 -30.803 42.459 1.00 53.56  ? 97   LEU G CA    1 
ATOM   5176  C  C     . LEU G  3 97  ? -27.325 -30.147 43.837 1.00 53.29  ? 97   LEU G C     1 
ATOM   5177  O  O     . LEU G  3 97  ? -28.300 -29.607 44.351 1.00 53.24  ? 97   LEU G O     1 
ATOM   5178  C  CB    . LEU G  3 97  ? -28.818 -31.328 42.185 1.00 53.54  ? 97   LEU G CB    1 
ATOM   5179  C  CG    . LEU G  3 97  ? -29.072 -31.972 40.819 1.00 54.17  ? 97   LEU G CG    1 
ATOM   5180  C  CD1   . LEU G  3 97  ? -30.574 -32.120 40.650 1.00 56.57  ? 97   LEU G CD1   1 
ATOM   5181  C  CD2   . LEU G  3 97  ? -28.496 -31.150 39.640 1.00 54.58  ? 97   LEU G CD2   1 
ATOM   5182  N  N     . GLY G  3 98  ? -26.150 -30.201 44.442 1.00 53.11  ? 98   GLY G N     1 
ATOM   5183  C  CA    . GLY G  3 98  ? -25.976 -29.676 45.782 1.00 53.08  ? 98   GLY G CA    1 
ATOM   5184  C  C     . GLY G  3 98  ? -26.220 -28.184 45.913 1.00 53.24  ? 98   GLY G C     1 
ATOM   5185  O  O     . GLY G  3 98  ? -26.495 -27.704 46.997 1.00 52.95  ? 98   GLY G O     1 
ATOM   5186  N  N     . ARG G  3 99  ? -26.106 -27.445 44.815 1.00 53.60  ? 99   ARG G N     1 
ATOM   5187  C  CA    . ARG G  3 99  ? -26.392 -26.025 44.852 1.00 54.11  ? 99   ARG G CA    1 
ATOM   5188  C  C     . ARG G  3 99  ? -27.639 -25.660 44.053 1.00 53.33  ? 99   ARG G C     1 
ATOM   5189  O  O     . ARG G  3 99  ? -27.791 -24.547 43.616 1.00 54.08  ? 99   ARG G O     1 
ATOM   5190  C  CB    . ARG G  3 99  ? -25.156 -25.218 44.435 1.00 55.01  ? 99   ARG G CB    1 
ATOM   5191  C  CG    . ARG G  3 99  ? -24.123 -25.111 45.556 1.00 57.94  ? 99   ARG G CG    1 
ATOM   5192  C  CD    . ARG G  3 99  ? -22.738 -24.935 44.993 1.00 67.06  ? 99   ARG G CD    1 
ATOM   5193  N  NE    . ARG G  3 99  ? -21.723 -25.108 46.043 1.00 76.69  ? 99   ARG G NE    1 
ATOM   5194  C  CZ    . ARG G  3 99  ? -20.411 -25.296 45.832 1.00 80.18  ? 99   ARG G CZ    1 
ATOM   5195  N  NH1   . ARG G  3 99  ? -19.917 -25.345 44.590 1.00 81.91  ? 99   ARG G NH1   1 
ATOM   5196  N  NH2   . ARG G  3 99  ? -19.586 -25.438 46.869 1.00 79.78  ? 99   ARG G NH2   1 
ATOM   5197  N  N     . VAL G  3 100 ? -28.535 -26.619 43.889 1.00 52.86  ? 100  VAL G N     1 
ATOM   5198  C  CA    . VAL G  3 100 ? -29.779 -26.431 43.162 1.00 52.03  ? 100  VAL G CA    1 
ATOM   5199  C  C     . VAL G  3 100 ? -30.997 -26.508 44.074 1.00 52.07  ? 100  VAL G C     1 
ATOM   5200  O  O     . VAL G  3 100 ? -31.000 -27.230 45.063 1.00 51.12  ? 100  VAL G O     1 
ATOM   5201  C  CB    . VAL G  3 100 ? -29.908 -27.423 42.006 1.00 51.57  ? 100  VAL G CB    1 
ATOM   5202  C  CG1   . VAL G  3 100 ? -31.317 -27.479 41.546 1.00 51.38  ? 100  VAL G CG1   1 
ATOM   5203  C  CG2   . VAL G  3 100 ? -29.015 -26.975 40.851 1.00 51.00  ? 100  VAL G CG2   1 
ATOM   5204  N  N     . THR G  3 101 ? -31.998 -25.695 43.748 1.00 52.79  ? 101  THR G N     1 
ATOM   5205  C  CA    . THR G  3 101 ? -33.250 -25.661 44.452 1.00 53.72  ? 101  THR G CA    1 
ATOM   5206  C  C     . THR G  3 101 ? -34.306 -26.081 43.463 1.00 54.71  ? 101  THR G C     1 
ATOM   5207  O  O     . THR G  3 101 ? -34.424 -25.501 42.382 1.00 55.75  ? 101  THR G O     1 
ATOM   5208  C  CB    . THR G  3 101 ? -33.574 -24.255 44.953 1.00 54.35  ? 101  THR G CB    1 
ATOM   5209  O  OG1   . THR G  3 101 ? -32.629 -23.862 45.969 1.00 54.88  ? 101  THR G OG1   1 
ATOM   5210  C  CG2   . THR G  3 101 ? -34.994 -24.204 45.523 1.00 53.54  ? 101  THR G CG2   1 
ATOM   5211  N  N     . ILE G  3 102 ? -35.053 -27.115 43.825 1.00 55.31  ? 102  ILE G N     1 
ATOM   5212  C  CA    . ILE G  3 102 ? -36.131 -27.636 43.009 1.00 55.20  ? 102  ILE G CA    1 
ATOM   5213  C  C     . ILE G  3 102 ? -37.359 -26.996 43.582 1.00 55.60  ? 102  ILE G C     1 
ATOM   5214  O  O     . ILE G  3 102 ? -37.757 -27.291 44.702 1.00 55.92  ? 102  ILE G O     1 
ATOM   5215  C  CB    . ILE G  3 102 ? -36.210 -29.189 43.112 1.00 55.50  ? 102  ILE G CB    1 
ATOM   5216  C  CG1   . ILE G  3 102 ? -34.999 -29.821 42.407 1.00 55.55  ? 102  ILE G CG1   1 
ATOM   5217  C  CG2   . ILE G  3 102 ? -37.524 -29.715 42.563 1.00 55.34  ? 102  ILE G CG2   1 
ATOM   5218  C  CD1   . ILE G  3 102 ? -34.888 -31.331 42.496 1.00 54.50  ? 102  ILE G CD1   1 
ATOM   5219  N  N     . ALA G  3 103 ? -37.943 -26.074 42.832 1.00 56.64  ? 103  ALA G N     1 
ATOM   5220  C  CA    . ALA G  3 103 ? -39.159 -25.390 43.269 1.00 57.55  ? 103  ALA G CA    1 
ATOM   5221  C  C     . ALA G  3 103 ? -40.268 -26.376 43.648 1.00 58.27  ? 103  ALA G C     1 
ATOM   5222  O  O     . ALA G  3 103 ? -40.475 -27.391 42.976 1.00 58.42  ? 103  ALA G O     1 
ATOM   5223  C  CB    . ALA G  3 103 ? -39.625 -24.476 42.210 1.00 57.55  ? 103  ALA G CB    1 
ATOM   5224  N  N     . GLN G  3 104 ? -40.964 -26.084 44.742 1.00 59.31  ? 104  GLN G N     1 
ATOM   5225  C  CA    . GLN G  3 104 ? -42.071 -26.935 45.230 1.00 60.30  ? 104  GLN G CA    1 
ATOM   5226  C  C     . GLN G  3 104 ? -41.580 -28.318 45.632 1.00 60.06  ? 104  GLN G C     1 
ATOM   5227  O  O     . GLN G  3 104 ? -42.327 -29.280 45.542 1.00 60.91  ? 104  GLN G O     1 
ATOM   5228  C  CB    . GLN G  3 104 ? -43.187 -27.085 44.176 1.00 60.57  ? 104  GLN G CB    1 
ATOM   5229  C  CG    . GLN G  3 104 ? -44.178 -25.945 44.110 1.00 63.99  ? 104  GLN G CG    1 
ATOM   5230  C  CD    . GLN G  3 104 ? -44.917 -25.742 45.432 1.00 70.64  ? 104  GLN G CD    1 
ATOM   5231  O  OE1   . GLN G  3 104 ? -45.713 -26.607 45.867 1.00 72.83  ? 104  GLN G OE1   1 
ATOM   5232  N  NE2   . GLN G  3 104 ? -44.656 -24.597 46.089 1.00 71.23  ? 104  GLN G NE2   1 
ATOM   5233  N  N     . GLY G  3 105 ? -40.330 -28.427 46.063 1.00 59.41  ? 105  GLY G N     1 
ATOM   5234  C  CA    . GLY G  3 105 ? -39.798 -29.720 46.420 1.00 58.65  ? 105  GLY G CA    1 
ATOM   5235  C  C     . GLY G  3 105 ? -39.864 -30.056 47.897 1.00 58.39  ? 105  GLY G C     1 
ATOM   5236  O  O     . GLY G  3 105 ? -39.860 -31.244 48.265 1.00 58.16  ? 105  GLY G O     1 
ATOM   5237  N  N     . GLY G  3 106 ? -39.899 -29.024 48.744 1.00 57.81  ? 106  GLY G N     1 
ATOM   5238  C  CA    . GLY G  3 106 ? -39.789 -29.196 50.192 1.00 57.55  ? 106  GLY G CA    1 
ATOM   5239  C  C     . GLY G  3 106 ? -38.468 -29.826 50.599 1.00 58.21  ? 106  GLY G C     1 
ATOM   5240  O  O     . GLY G  3 106 ? -37.510 -29.851 49.832 1.00 57.77  ? 106  GLY G O     1 
ATOM   5241  N  N     . VAL G  3 107 ? -38.430 -30.371 51.806 1.00 59.10  ? 107  VAL G N     1 
ATOM   5242  C  CA    . VAL G  3 107 ? -37.225 -30.965 52.353 1.00 59.55  ? 107  VAL G CA    1 
ATOM   5243  C  C     . VAL G  3 107 ? -37.449 -32.425 52.746 1.00 60.70  ? 107  VAL G C     1 
ATOM   5244  O  O     . VAL G  3 107 ? -38.581 -32.898 52.771 1.00 61.54  ? 107  VAL G O     1 
ATOM   5245  C  CB    . VAL G  3 107 ? -36.767 -30.194 53.603 1.00 59.40  ? 107  VAL G CB    1 
ATOM   5246  C  CG1   . VAL G  3 107 ? -36.502 -28.739 53.284 1.00 57.85  ? 107  VAL G CG1   1 
ATOM   5247  C  CG2   . VAL G  3 107 ? -37.777 -30.344 54.743 1.00 59.36  ? 107  VAL G CG2   1 
ATOM   5248  N  N     . LEU G  3 108 ? -36.370 -33.134 53.069 1.00 61.88  ? 108  LEU G N     1 
ATOM   5249  C  CA    . LEU G  3 108 ? -36.472 -34.480 53.646 1.00 62.67  ? 108  LEU G CA    1 
ATOM   5250  C  C     . LEU G  3 108 ? -36.961 -34.402 55.077 1.00 64.11  ? 108  LEU G C     1 
ATOM   5251  O  O     . LEU G  3 108 ? -36.549 -33.504 55.804 1.00 64.82  ? 108  LEU G O     1 
ATOM   5252  C  CB    . LEU G  3 108 ? -35.124 -35.186 53.635 1.00 61.51  ? 108  LEU G CB    1 
ATOM   5253  C  CG    . LEU G  3 108 ? -34.648 -35.517 52.234 1.00 59.99  ? 108  LEU G CG    1 
ATOM   5254  C  CD1   . LEU G  3 108 ? -33.457 -36.453 52.321 1.00 59.47  ? 108  LEU G CD1   1 
ATOM   5255  C  CD2   . LEU G  3 108 ? -35.774 -36.081 51.372 1.00 55.85  ? 108  LEU G CD2   1 
ATOM   5256  N  N     . PRO G  3 109 ? -37.868 -35.319 55.479 1.00 65.38  ? 109  PRO G N     1 
ATOM   5257  C  CA    . PRO G  3 109 ? -38.214 -35.421 56.893 1.00 65.89  ? 109  PRO G CA    1 
ATOM   5258  C  C     . PRO G  3 109 ? -36.980 -35.773 57.690 1.00 66.73  ? 109  PRO G C     1 
ATOM   5259  O  O     . PRO G  3 109 ? -36.348 -36.783 57.438 1.00 67.17  ? 109  PRO G O     1 
ATOM   5260  C  CB    . PRO G  3 109 ? -39.229 -36.560 56.921 1.00 65.35  ? 109  PRO G CB    1 
ATOM   5261  C  CG    . PRO G  3 109 ? -39.830 -36.523 55.559 1.00 65.59  ? 109  PRO G CG    1 
ATOM   5262  C  CD    . PRO G  3 109 ? -38.656 -36.267 54.668 1.00 65.25  ? 109  PRO G CD    1 
ATOM   5263  N  N     . ASN G  3 110 ? -36.619 -34.911 58.620 1.00 67.98  ? 110  ASN G N     1 
ATOM   5264  C  CA    . ASN G  3 110 ? -35.440 -35.128 59.410 1.00 69.62  ? 110  ASN G CA    1 
ATOM   5265  C  C     . ASN G  3 110 ? -35.514 -34.266 60.647 1.00 70.38  ? 110  ASN G C     1 
ATOM   5266  O  O     . ASN G  3 110 ? -35.620 -33.039 60.554 1.00 70.68  ? 110  ASN G O     1 
ATOM   5267  C  CB    . ASN G  3 110 ? -34.178 -34.817 58.594 1.00 69.91  ? 110  ASN G CB    1 
ATOM   5268  C  CG    . ASN G  3 110 ? -32.892 -35.075 59.368 1.00 71.43  ? 110  ASN G CG    1 
ATOM   5269  O  OD1   . ASN G  3 110 ? -32.866 -35.858 60.321 1.00 73.15  ? 110  ASN G OD1   1 
ATOM   5270  N  ND2   . ASN G  3 110 ? -31.813 -34.409 58.958 1.00 72.54  ? 110  ASN G ND2   1 
ATOM   5271  N  N     . ILE G  3 111 ? -35.487 -34.929 61.803 1.00 71.30  ? 111  ILE G N     1 
ATOM   5272  C  CA    . ILE G  3 111 ? -35.481 -34.255 63.093 1.00 71.93  ? 111  ILE G CA    1 
ATOM   5273  C  C     . ILE G  3 111 ? -34.254 -34.697 63.849 1.00 72.36  ? 111  ILE G C     1 
ATOM   5274  O  O     . ILE G  3 111 ? -33.967 -35.878 63.920 1.00 72.70  ? 111  ILE G O     1 
ATOM   5275  C  CB    . ILE G  3 111 ? -36.728 -34.587 63.929 1.00 71.93  ? 111  ILE G CB    1 
ATOM   5276  C  CG1   . ILE G  3 111 ? -38.002 -34.351 63.116 1.00 72.30  ? 111  ILE G CG1   1 
ATOM   5277  C  CG2   . ILE G  3 111 ? -36.751 -33.742 65.205 1.00 72.26  ? 111  ILE G CG2   1 
ATOM   5278  C  CD1   . ILE G  3 111 ? -39.280 -34.815 63.812 1.00 74.45  ? 111  ILE G CD1   1 
ATOM   5279  N  N     . GLN G  3 112 ? -33.527 -33.735 64.400 1.00 73.22  ? 112  GLN G N     1 
ATOM   5280  C  CA    . GLN G  3 112 ? -32.358 -34.010 65.213 1.00 73.83  ? 112  GLN G CA    1 
ATOM   5281  C  C     . GLN G  3 112 ? -32.789 -34.752 66.466 1.00 74.73  ? 112  GLN G C     1 
ATOM   5282  O  O     . GLN G  3 112 ? -33.737 -34.353 67.139 1.00 74.77  ? 112  GLN G O     1 
ATOM   5283  C  CB    . GLN G  3 112 ? -31.661 -32.702 65.575 1.00 73.70  ? 112  GLN G CB    1 
ATOM   5284  C  CG    . GLN G  3 112 ? -31.186 -31.909 64.363 1.00 73.21  ? 112  GLN G CG    1 
ATOM   5285  C  CD    . GLN G  3 112 ? -30.107 -32.625 63.578 1.00 71.69  ? 112  GLN G CD    1 
ATOM   5286  O  OE1   . GLN G  3 112 ? -29.152 -33.136 64.152 1.00 72.13  ? 112  GLN G OE1   1 
ATOM   5287  N  NE2   . GLN G  3 112 ? -30.248 -32.656 62.261 1.00 70.62  ? 112  GLN G NE2   1 
ATOM   5288  N  N     . SER G  3 113 ? -32.093 -35.836 66.776 1.00 75.98  ? 113  SER G N     1 
ATOM   5289  C  CA    . SER G  3 113 ? -32.550 -36.757 67.821 1.00 77.28  ? 113  SER G CA    1 
ATOM   5290  C  C     . SER G  3 113 ? -32.704 -36.096 69.195 1.00 77.85  ? 113  SER G C     1 
ATOM   5291  O  O     . SER G  3 113 ? -33.680 -36.347 69.908 1.00 77.69  ? 113  SER G O     1 
ATOM   5292  C  CB    . SER G  3 113 ? -31.649 -38.000 67.888 1.00 77.17  ? 113  SER G CB    1 
ATOM   5293  O  OG    . SER G  3 113 ? -30.353 -37.664 68.341 1.00 77.40  ? 113  SER G OG    1 
ATOM   5294  N  N     . VAL G  3 114 ? -31.762 -35.221 69.538 1.00 78.83  ? 114  VAL G N     1 
ATOM   5295  C  CA    . VAL G  3 114 ? -31.782 -34.524 70.829 1.00 79.77  ? 114  VAL G CA    1 
ATOM   5296  C  C     . VAL G  3 114 ? -33.083 -33.738 71.042 1.00 80.75  ? 114  VAL G C     1 
ATOM   5297  O  O     . VAL G  3 114 ? -33.422 -33.377 72.169 1.00 80.93  ? 114  VAL G O     1 
ATOM   5298  C  CB    . VAL G  3 114 ? -30.530 -33.615 71.005 1.00 79.67  ? 114  VAL G CB    1 
ATOM   5299  C  CG1   . VAL G  3 114 ? -30.605 -32.386 70.093 1.00 79.31  ? 114  VAL G CG1   1 
ATOM   5300  C  CG2   . VAL G  3 114 ? -30.328 -33.220 72.477 1.00 79.13  ? 114  VAL G CG2   1 
ATOM   5301  N  N     . LEU G  3 115 ? -33.811 -33.493 69.955 1.00 82.00  ? 115  LEU G N     1 
ATOM   5302  C  CA    . LEU G  3 115 ? -35.076 -32.766 70.014 1.00 83.05  ? 115  LEU G CA    1 
ATOM   5303  C  C     . LEU G  3 115 ? -36.263 -33.701 70.232 1.00 84.19  ? 115  LEU G C     1 
ATOM   5304  O  O     . LEU G  3 115 ? -37.368 -33.243 70.507 1.00 84.27  ? 115  LEU G O     1 
ATOM   5305  C  CB    . LEU G  3 115 ? -35.275 -31.919 68.750 1.00 82.89  ? 115  LEU G CB    1 
ATOM   5306  C  CG    . LEU G  3 115 ? -34.213 -30.848 68.435 1.00 83.24  ? 115  LEU G CG    1 
ATOM   5307  C  CD1   . LEU G  3 115 ? -34.404 -30.246 67.042 1.00 83.30  ? 115  LEU G CD1   1 
ATOM   5308  C  CD2   . LEU G  3 115 ? -34.190 -29.745 69.482 1.00 82.76  ? 115  LEU G CD2   1 
ATOM   5309  N  N     . LEU G  3 116 ? -36.036 -35.010 70.114 1.00 85.87  ? 116  LEU G N     1 
ATOM   5310  C  CA    . LEU G  3 116 ? -37.093 -36.001 70.348 1.00 87.23  ? 116  LEU G CA    1 
ATOM   5311  C  C     . LEU G  3 116 ? -37.430 -36.117 71.835 1.00 88.57  ? 116  LEU G C     1 
ATOM   5312  O  O     . LEU G  3 116 ? -36.527 -36.088 72.677 1.00 88.26  ? 116  LEU G O     1 
ATOM   5313  C  CB    . LEU G  3 116 ? -36.716 -37.368 69.773 1.00 86.97  ? 116  LEU G CB    1 
ATOM   5314  C  CG    . LEU G  3 116 ? -36.609 -37.498 68.249 1.00 86.54  ? 116  LEU G CG    1 
ATOM   5315  C  CD1   . LEU G  3 116 ? -36.098 -38.884 67.884 1.00 86.07  ? 116  LEU G CD1   1 
ATOM   5316  C  CD2   . LEU G  3 116 ? -37.941 -37.207 67.564 1.00 85.73  ? 116  LEU G CD2   1 
ATOM   5317  N  N     . PRO G  3 117 ? -38.737 -36.250 72.157 1.00 90.17  ? 117  PRO G N     1 
ATOM   5318  C  CA    . PRO G  3 117 ? -39.217 -36.274 73.542 1.00 91.32  ? 117  PRO G CA    1 
ATOM   5319  C  C     . PRO G  3 117 ? -38.554 -37.390 74.317 1.00 92.61  ? 117  PRO G C     1 
ATOM   5320  O  O     . PRO G  3 117 ? -38.321 -38.479 73.763 1.00 92.49  ? 117  PRO G O     1 
ATOM   5321  C  CB    . PRO G  3 117 ? -40.720 -36.563 73.401 1.00 91.22  ? 117  PRO G CB    1 
ATOM   5322  C  CG    . PRO G  3 117 ? -40.903 -37.094 72.024 1.00 90.92  ? 117  PRO G CG    1 
ATOM   5323  C  CD    . PRO G  3 117 ? -39.848 -36.413 71.201 1.00 90.41  ? 117  PRO G CD    1 
ATOM   5324  N  N     . LYS G  3 118 ? -38.247 -37.113 75.583 1.00 94.18  ? 118  LYS G N     1 
ATOM   5325  C  CA    . LYS G  3 118 ? -37.547 -38.088 76.415 1.00 96.01  ? 118  LYS G CA    1 
ATOM   5326  C  C     . LYS G  3 118 ? -38.492 -39.205 76.855 1.00 96.68  ? 118  LYS G C     1 
ATOM   5327  O  O     . LYS G  3 118 ? -39.450 -38.977 77.609 1.00 96.98  ? 118  LYS G O     1 
ATOM   5328  C  CB    . LYS G  3 118 ? -36.813 -37.412 77.577 1.00 96.02  ? 118  LYS G CB    1 
ATOM   5329  C  CG    . LYS G  3 118 ? -35.481 -36.810 77.117 1.00 96.87  ? 118  LYS G CG    1 
ATOM   5330  C  CD    . LYS G  3 118 ? -35.080 -35.573 77.966 1.00 96.85  ? 118  LYS G CD    1 
ATOM   5331  C  CE    . LYS G  3 118 ? -33.836 -34.901 77.376 1.00 97.00  ? 118  LYS G CE    1 
ATOM   5332  N  NZ    . LYS G  3 118 ? -33.454 -33.660 78.110 1.00 97.28  ? 118  LYS G NZ    1 
ATOM   5333  N  N     . LYS G  3 119 ? -38.212 -40.404 76.335 1.00 97.33  ? 119  LYS G N     1 
ATOM   5334  C  CA    . LYS G  3 119 ? -39.083 -41.573 76.474 1.00 97.85  ? 119  LYS G CA    1 
ATOM   5335  C  C     . LYS G  3 119 ? -38.942 -42.219 77.858 1.00 98.02  ? 119  LYS G C     1 
ATOM   5336  O  O     . LYS G  3 119 ? -39.921 -42.346 78.601 1.00 98.08  ? 119  LYS G O     1 
ATOM   5337  C  CB    . LYS G  3 119 ? -38.787 -42.599 75.360 1.00 97.97  ? 119  LYS G CB    1 
ATOM   5338  C  CG    . LYS G  3 119 ? -38.937 -42.046 73.930 1.00 98.06  ? 119  LYS G CG    1 
ATOM   5339  C  CD    . LYS G  3 119 ? -38.462 -43.034 72.867 1.00 97.81  ? 119  LYS G CD    1 
ATOM   5340  C  CE    . LYS G  3 119 ? -39.600 -43.936 72.395 1.00 97.99  ? 119  LYS G CE    1 
ATOM   5341  N  NZ    . LYS G  3 119 ? -39.209 -44.746 71.209 1.00 97.03  ? 119  LYS G NZ    1 
ATOM   5342  N  N     . LYS H  4 28  ? -46.314 -16.300 19.924 1.00 102.33 ? 28   LYS H N     1 
ATOM   5343  C  CA    . LYS H  4 28  ? -46.118 -16.951 18.591 1.00 102.28 ? 28   LYS H CA    1 
ATOM   5344  C  C     . LYS H  4 28  ? -44.707 -17.532 18.435 1.00 101.92 ? 28   LYS H C     1 
ATOM   5345  O  O     . LYS H  4 28  ? -44.567 -18.712 18.094 1.00 102.04 ? 28   LYS H O     1 
ATOM   5346  C  CB    . LYS H  4 28  ? -46.446 -15.974 17.445 1.00 102.20 ? 28   LYS H CB    1 
ATOM   5347  C  CG    . LYS H  4 28  ? -46.263 -16.546 16.029 1.00 102.43 ? 28   LYS H CG    1 
ATOM   5348  C  CD    . LYS H  4 28  ? -46.275 -15.446 14.954 1.00 102.86 ? 28   LYS H CD    1 
ATOM   5349  C  CE    . LYS H  4 28  ? -47.699 -14.946 14.623 1.00 103.88 ? 28   LYS H CE    1 
ATOM   5350  N  NZ    . LYS H  4 28  ? -47.722 -13.531 14.124 1.00 102.97 ? 28   LYS H NZ    1 
ATOM   5351  N  N     . THR H  4 29  ? -43.677 -16.716 18.690 1.00 101.47 ? 29   THR H N     1 
ATOM   5352  C  CA    . THR H  4 29  ? -42.288 -17.118 18.416 1.00 101.25 ? 29   THR H CA    1 
ATOM   5353  C  C     . THR H  4 29  ? -41.936 -18.458 19.072 1.00 100.71 ? 29   THR H C     1 
ATOM   5354  O  O     . THR H  4 29  ? -42.366 -18.750 20.195 1.00 100.52 ? 29   THR H O     1 
ATOM   5355  C  CB    . THR H  4 29  ? -41.243 -16.011 18.769 1.00 101.45 ? 29   THR H CB    1 
ATOM   5356  O  OG1   . THR H  4 29  ? -40.088 -16.152 17.927 1.00 102.01 ? 29   THR H OG1   1 
ATOM   5357  C  CG2   . THR H  4 29  ? -40.799 -16.084 20.239 1.00 101.84 ? 29   THR H CG2   1 
ATOM   5358  N  N     . ARG H  4 30  ? -41.172 -19.269 18.344 1.00 100.11 ? 30   ARG H N     1 
ATOM   5359  C  CA    . ARG H  4 30  ? -40.895 -20.647 18.746 1.00 99.62  ? 30   ARG H CA    1 
ATOM   5360  C  C     . ARG H  4 30  ? -40.208 -20.736 20.099 1.00 98.29  ? 30   ARG H C     1 
ATOM   5361  O  O     . ARG H  4 30  ? -39.229 -20.022 20.359 1.00 98.39  ? 30   ARG H O     1 
ATOM   5362  C  CB    . ARG H  4 30  ? -40.068 -21.377 17.682 1.00 99.75  ? 30   ARG H CB    1 
ATOM   5363  C  CG    . ARG H  4 30  ? -40.916 -22.268 16.772 1.00 100.54 ? 30   ARG H CG    1 
ATOM   5364  C  CD    . ARG H  4 30  ? -40.052 -22.995 15.744 1.00 101.10 ? 30   ARG H CD    1 
ATOM   5365  N  NE    . ARG H  4 30  ? -39.254 -24.085 16.327 1.00 103.62 ? 30   ARG H NE    1 
ATOM   5366  C  CZ    . ARG H  4 30  ? -39.424 -25.387 16.037 1.00 104.80 ? 30   ARG H CZ    1 
ATOM   5367  N  NH1   . ARG H  4 30  ? -40.371 -25.791 15.167 1.00 106.15 ? 30   ARG H NH1   1 
ATOM   5368  N  NH2   . ARG H  4 30  ? -38.639 -26.297 16.617 1.00 105.08 ? 30   ARG H NH2   1 
ATOM   5369  N  N     . LYS H  4 31  ? -40.752 -21.597 20.959 1.00 96.54  ? 31   LYS H N     1 
ATOM   5370  C  CA    . LYS H  4 31  ? -40.161 -21.865 22.265 1.00 94.90  ? 31   LYS H CA    1 
ATOM   5371  C  C     . LYS H  4 31  ? -39.791 -23.346 22.358 1.00 93.19  ? 31   LYS H C     1 
ATOM   5372  O  O     . LYS H  4 31  ? -40.654 -24.214 22.526 1.00 92.84  ? 31   LYS H O     1 
ATOM   5373  C  CB    . LYS H  4 31  ? -41.107 -21.451 23.405 1.00 95.25  ? 31   LYS H CB    1 
ATOM   5374  C  CG    . LYS H  4 31  ? -40.418 -20.727 24.579 1.00 95.80  ? 31   LYS H CG    1 
ATOM   5375  C  CD    . LYS H  4 31  ? -39.477 -21.644 25.387 1.00 97.26  ? 31   LYS H CD    1 
ATOM   5376  C  CE    . LYS H  4 31  ? -38.708 -20.877 26.484 1.00 96.80  ? 31   LYS H CE    1 
ATOM   5377  N  NZ    . LYS H  4 31  ? -37.535 -20.119 25.942 1.00 97.54  ? 31   LYS H NZ    1 
ATOM   5378  N  N     . GLU H  4 32  ? -38.500 -23.624 22.226 1.00 90.98  ? 32   GLU H N     1 
ATOM   5379  C  CA    . GLU H  4 32  ? -38.014 -24.993 22.280 1.00 88.95  ? 32   GLU H CA    1 
ATOM   5380  C  C     . GLU H  4 32  ? -37.878 -25.466 23.716 1.00 86.99  ? 32   GLU H C     1 
ATOM   5381  O  O     . GLU H  4 32  ? -37.560 -24.686 24.612 1.00 87.13  ? 32   GLU H O     1 
ATOM   5382  C  CB    . GLU H  4 32  ? -36.673 -25.112 21.572 1.00 89.27  ? 32   GLU H CB    1 
ATOM   5383  C  CG    . GLU H  4 32  ? -36.765 -25.116 20.053 1.00 90.46  ? 32   GLU H CG    1 
ATOM   5384  C  CD    . GLU H  4 32  ? -35.426 -25.443 19.414 1.00 93.15  ? 32   GLU H CD    1 
ATOM   5385  O  OE1   . GLU H  4 32  ? -35.414 -26.008 18.298 1.00 94.47  ? 32   GLU H OE1   1 
ATOM   5386  O  OE2   . GLU H  4 32  ? -34.376 -25.153 20.036 1.00 94.13  ? 32   GLU H OE2   1 
ATOM   5387  N  N     . SER H  4 33  ? -38.121 -26.754 23.919 1.00 84.55  ? 33   SER H N     1 
ATOM   5388  C  CA    . SER H  4 33  ? -38.028 -27.384 25.228 1.00 82.09  ? 33   SER H CA    1 
ATOM   5389  C  C     . SER H  4 33  ? -37.606 -28.825 25.041 1.00 80.68  ? 33   SER H C     1 
ATOM   5390  O  O     . SER H  4 33  ? -37.807 -29.399 23.974 1.00 80.71  ? 33   SER H O     1 
ATOM   5391  C  CB    . SER H  4 33  ? -39.384 -27.338 25.924 1.00 82.18  ? 33   SER H CB    1 
ATOM   5392  O  OG    . SER H  4 33  ? -39.421 -28.235 27.018 1.00 81.25  ? 33   SER H OG    1 
ATOM   5393  N  N     . TYR H  4 34  ? -37.030 -29.421 26.076 1.00 78.92  ? 34   TYR H N     1 
ATOM   5394  C  CA    . TYR H  4 34  ? -36.633 -30.824 26.005 1.00 76.97  ? 34   TYR H CA    1 
ATOM   5395  C  C     . TYR H  4 34  ? -37.776 -31.756 26.356 1.00 76.39  ? 34   TYR H C     1 
ATOM   5396  O  O     . TYR H  4 34  ? -37.587 -32.964 26.374 1.00 76.26  ? 34   TYR H O     1 
ATOM   5397  C  CB    . TYR H  4 34  ? -35.447 -31.095 26.920 1.00 76.08  ? 34   TYR H CB    1 
ATOM   5398  C  CG    . TYR H  4 34  ? -34.144 -30.588 26.378 1.00 74.41  ? 34   TYR H CG    1 
ATOM   5399  C  CD1   . TYR H  4 34  ? -33.656 -29.340 26.744 1.00 72.37  ? 34   TYR H CD1   1 
ATOM   5400  C  CD2   . TYR H  4 34  ? -33.392 -31.359 25.497 1.00 72.96  ? 34   TYR H CD2   1 
ATOM   5401  C  CE1   . TYR H  4 34  ? -32.456 -28.877 26.251 1.00 72.14  ? 34   TYR H CE1   1 
ATOM   5402  C  CE2   . TYR H  4 34  ? -32.199 -30.901 24.990 1.00 72.30  ? 34   TYR H CE2   1 
ATOM   5403  C  CZ    . TYR H  4 34  ? -31.738 -29.661 25.370 1.00 73.19  ? 34   TYR H CZ    1 
ATOM   5404  O  OH    . TYR H  4 34  ? -30.536 -29.210 24.878 1.00 75.34  ? 34   TYR H OH    1 
ATOM   5405  N  N     . ALA H  4 35  ? -38.961 -31.195 26.596 1.00 76.12  ? 35   ALA H N     1 
ATOM   5406  C  CA    . ALA H  4 35  ? -40.098 -31.941 27.149 1.00 76.07  ? 35   ALA H CA    1 
ATOM   5407  C  C     . ALA H  4 35  ? -40.482 -33.222 26.406 1.00 76.52  ? 35   ALA H C     1 
ATOM   5408  O  O     . ALA H  4 35  ? -40.586 -34.273 27.040 1.00 76.63  ? 35   ALA H O     1 
ATOM   5409  C  CB    . ALA H  4 35  ? -41.302 -31.043 27.326 1.00 75.67  ? 35   ALA H CB    1 
ATOM   5410  N  N     . ILE H  4 36  ? -40.674 -33.160 25.084 1.00 76.77  ? 36   ILE H N     1 
ATOM   5411  C  CA    . ILE H  4 36  ? -41.091 -34.362 24.336 1.00 77.09  ? 36   ILE H CA    1 
ATOM   5412  C  C     . ILE H  4 36  ? -40.143 -35.537 24.544 1.00 77.01  ? 36   ILE H C     1 
ATOM   5413  O  O     . ILE H  4 36  ? -40.589 -36.682 24.698 1.00 77.26  ? 36   ILE H O     1 
ATOM   5414  C  CB    . ILE H  4 36  ? -41.320 -34.135 22.804 1.00 76.89  ? 36   ILE H CB    1 
ATOM   5415  C  CG1   . ILE H  4 36  ? -40.070 -33.584 22.123 1.00 77.62  ? 36   ILE H CG1   1 
ATOM   5416  C  CG2   . ILE H  4 36  ? -42.532 -33.239 22.554 1.00 77.01  ? 36   ILE H CG2   1 
ATOM   5417  C  CD1   . ILE H  4 36  ? -40.098 -33.695 20.605 1.00 77.76  ? 36   ILE H CD1   1 
ATOM   5418  N  N     . TYR H  4 37  ? -38.846 -35.240 24.576 1.00 76.88  ? 37   TYR H N     1 
ATOM   5419  C  CA    . TYR H  4 37  ? -37.818 -36.259 24.675 1.00 76.54  ? 37   TYR H CA    1 
ATOM   5420  C  C     . TYR H  4 37  ? -37.678 -36.729 26.094 1.00 76.22  ? 37   TYR H C     1 
ATOM   5421  O  O     . TYR H  4 37  ? -37.175 -37.819 26.333 1.00 76.12  ? 37   TYR H O     1 
ATOM   5422  C  CB    . TYR H  4 37  ? -36.486 -35.707 24.223 1.00 77.03  ? 37   TYR H CB    1 
ATOM   5423  C  CG    . TYR H  4 37  ? -36.535 -34.940 22.928 1.00 77.91  ? 37   TYR H CG    1 
ATOM   5424  C  CD1   . TYR H  4 37  ? -36.661 -33.557 22.928 1.00 79.09  ? 37   TYR H CD1   1 
ATOM   5425  C  CD2   . TYR H  4 37  ? -36.429 -35.589 21.704 1.00 78.16  ? 37   TYR H CD2   1 
ATOM   5426  C  CE1   . TYR H  4 37  ? -36.691 -32.836 21.738 1.00 80.12  ? 37   TYR H CE1   1 
ATOM   5427  C  CE2   . TYR H  4 37  ? -36.447 -34.881 20.509 1.00 78.99  ? 37   TYR H CE2   1 
ATOM   5428  C  CZ    . TYR H  4 37  ? -36.578 -33.501 20.531 1.00 79.33  ? 37   TYR H CZ    1 
ATOM   5429  O  OH    . TYR H  4 37  ? -36.605 -32.773 19.354 1.00 79.21  ? 37   TYR H OH    1 
ATOM   5430  N  N     . VAL H  4 38  ? -38.095 -35.896 27.041 1.00 75.80  ? 38   VAL H N     1 
ATOM   5431  C  CA    . VAL H  4 38  ? -38.078 -36.296 28.439 1.00 75.68  ? 38   VAL H CA    1 
ATOM   5432  C  C     . VAL H  4 38  ? -39.213 -37.283 28.670 1.00 75.92  ? 38   VAL H C     1 
ATOM   5433  O  O     . VAL H  4 38  ? -39.043 -38.293 29.366 1.00 75.39  ? 38   VAL H O     1 
ATOM   5434  C  CB    . VAL H  4 38  ? -38.199 -35.089 29.382 1.00 75.75  ? 38   VAL H CB    1 
ATOM   5435  C  CG1   . VAL H  4 38  ? -38.655 -35.525 30.780 1.00 75.38  ? 38   VAL H CG1   1 
ATOM   5436  C  CG2   . VAL H  4 38  ? -36.868 -34.346 29.455 1.00 75.38  ? 38   VAL H CG2   1 
ATOM   5437  N  N     . TYR H  4 39  ? -40.353 -36.978 28.048 1.00 76.26  ? 39   TYR H N     1 
ATOM   5438  C  CA    . TYR H  4 39  ? -41.543 -37.803 28.093 1.00 76.60  ? 39   TYR H CA    1 
ATOM   5439  C  C     . TYR H  4 39  ? -41.287 -39.159 27.463 1.00 76.41  ? 39   TYR H C     1 
ATOM   5440  O  O     . TYR H  4 39  ? -41.667 -40.178 28.017 1.00 76.20  ? 39   TYR H O     1 
ATOM   5441  C  CB    . TYR H  4 39  ? -42.696 -37.103 27.387 1.00 77.79  ? 39   TYR H CB    1 
ATOM   5442  C  CG    . TYR H  4 39  ? -44.044 -37.679 27.757 1.00 79.29  ? 39   TYR H CG    1 
ATOM   5443  C  CD1   . TYR H  4 39  ? -44.707 -37.263 28.908 1.00 79.74  ? 39   TYR H CD1   1 
ATOM   5444  C  CD2   . TYR H  4 39  ? -44.652 -38.653 26.955 1.00 81.23  ? 39   TYR H CD2   1 
ATOM   5445  C  CE1   . TYR H  4 39  ? -45.944 -37.795 29.255 1.00 81.62  ? 39   TYR H CE1   1 
ATOM   5446  C  CE2   . TYR H  4 39  ? -45.887 -39.194 27.292 1.00 81.88  ? 39   TYR H CE2   1 
ATOM   5447  C  CZ    . TYR H  4 39  ? -46.531 -38.763 28.446 1.00 81.28  ? 39   TYR H CZ    1 
ATOM   5448  O  OH    . TYR H  4 39  ? -47.761 -39.299 28.785 1.00 81.12  ? 39   TYR H OH    1 
ATOM   5449  N  N     . LYS H  4 40  ? -40.617 -39.175 26.318 1.00 76.36  ? 40   LYS H N     1 
ATOM   5450  C  CA    . LYS H  4 40  ? -40.218 -40.427 25.708 1.00 76.16  ? 40   LYS H CA    1 
ATOM   5451  C  C     . LYS H  4 40  ? -39.455 -41.271 26.708 1.00 76.17  ? 40   LYS H C     1 
ATOM   5452  O  O     . LYS H  4 40  ? -39.832 -42.400 26.971 1.00 76.92  ? 40   LYS H O     1 
ATOM   5453  C  CB    . LYS H  4 40  ? -39.381 -40.186 24.461 1.00 76.06  ? 40   LYS H CB    1 
ATOM   5454  C  CG    . LYS H  4 40  ? -40.144 -39.502 23.354 1.00 77.03  ? 40   LYS H CG    1 
ATOM   5455  C  CD    . LYS H  4 40  ? -39.365 -39.570 22.052 1.00 80.19  ? 40   LYS H CD    1 
ATOM   5456  C  CE    . LYS H  4 40  ? -40.043 -38.739 20.960 1.00 81.44  ? 40   LYS H CE    1 
ATOM   5457  N  NZ    . LYS H  4 40  ? -39.048 -38.374 19.901 1.00 82.53  ? 40   LYS H NZ    1 
ATOM   5458  N  N     . VAL H  4 41  ? -38.400 -40.711 27.290 1.00 76.35  ? 41   VAL H N     1 
ATOM   5459  C  CA    . VAL H  4 41  ? -37.513 -41.448 28.202 1.00 75.84  ? 41   VAL H CA    1 
ATOM   5460  C  C     . VAL H  4 41  ? -38.275 -41.964 29.434 1.00 75.98  ? 41   VAL H C     1 
ATOM   5461  O  O     . VAL H  4 41  ? -38.030 -43.077 29.914 1.00 75.93  ? 41   VAL H O     1 
ATOM   5462  C  CB    . VAL H  4 41  ? -36.283 -40.588 28.622 1.00 75.74  ? 41   VAL H CB    1 
ATOM   5463  C  CG1   . VAL H  4 41  ? -35.312 -41.401 29.466 1.00 75.81  ? 41   VAL H CG1   1 
ATOM   5464  C  CG2   . VAL H  4 41  ? -35.553 -40.048 27.399 1.00 74.43  ? 41   VAL H CG2   1 
ATOM   5465  N  N     . LEU H  4 42  ? -39.211 -41.156 29.928 1.00 75.85  ? 42   LEU H N     1 
ATOM   5466  C  CA    . LEU H  4 42  ? -40.081 -41.562 31.019 1.00 75.71  ? 42   LEU H CA    1 
ATOM   5467  C  C     . LEU H  4 42  ? -40.869 -42.812 30.632 1.00 76.50  ? 42   LEU H C     1 
ATOM   5468  O  O     . LEU H  4 42  ? -41.067 -43.717 31.450 1.00 76.68  ? 42   LEU H O     1 
ATOM   5469  C  CB    . LEU H  4 42  ? -41.040 -40.429 31.362 1.00 75.06  ? 42   LEU H CB    1 
ATOM   5470  C  CG    . LEU H  4 42  ? -42.079 -40.717 32.431 1.00 74.28  ? 42   LEU H CG    1 
ATOM   5471  C  CD1   . LEU H  4 42  ? -41.413 -41.001 33.762 1.00 73.99  ? 42   LEU H CD1   1 
ATOM   5472  C  CD2   . LEU H  4 42  ? -43.032 -39.562 32.552 1.00 74.55  ? 42   LEU H CD2   1 
ATOM   5473  N  N     . LYS H  4 43  ? -41.304 -42.856 29.375 1.00 77.02  ? 43   LYS H N     1 
ATOM   5474  C  CA    . LYS H  4 43  ? -42.120 -43.954 28.877 1.00 77.53  ? 43   LYS H CA    1 
ATOM   5475  C  C     . LYS H  4 43  ? -41.317 -45.226 28.696 1.00 77.86  ? 43   LYS H C     1 
ATOM   5476  O  O     . LYS H  4 43  ? -41.838 -46.325 28.880 1.00 78.14  ? 43   LYS H O     1 
ATOM   5477  C  CB    . LYS H  4 43  ? -42.850 -43.553 27.596 1.00 77.55  ? 43   LYS H CB    1 
ATOM   5478  C  CG    . LYS H  4 43  ? -44.058 -42.641 27.866 1.00 78.01  ? 43   LYS H CG    1 
ATOM   5479  C  CD    . LYS H  4 43  ? -44.887 -43.175 29.036 1.00 78.62  ? 43   LYS H CD    1 
ATOM   5480  C  CE    . LYS H  4 43  ? -46.044 -42.259 29.356 1.00 80.13  ? 43   LYS H CE    1 
ATOM   5481  N  NZ    . LYS H  4 43  ? -46.556 -42.471 30.749 1.00 81.09  ? 43   LYS H NZ    1 
ATOM   5482  N  N     . GLN H  4 44  ? -40.039 -45.071 28.378 1.00 78.02  ? 44   GLN H N     1 
ATOM   5483  C  CA    . GLN H  4 44  ? -39.126 -46.196 28.358 1.00 78.51  ? 44   GLN H CA    1 
ATOM   5484  C  C     . GLN H  4 44  ? -38.801 -46.737 29.746 1.00 78.33  ? 44   GLN H C     1 
ATOM   5485  O  O     . GLN H  4 44  ? -38.350 -47.873 29.862 1.00 78.99  ? 44   GLN H O     1 
ATOM   5486  C  CB    . GLN H  4 44  ? -37.820 -45.792 27.702 1.00 78.91  ? 44   GLN H CB    1 
ATOM   5487  C  CG    . GLN H  4 44  ? -37.882 -45.631 26.210 1.00 81.58  ? 44   GLN H CG    1 
ATOM   5488  C  CD    . GLN H  4 44  ? -36.553 -45.987 25.581 1.00 85.29  ? 44   GLN H CD    1 
ATOM   5489  O  OE1   . GLN H  4 44  ? -35.505 -45.499 26.002 1.00 86.00  ? 44   GLN H OE1   1 
ATOM   5490  N  NE2   . GLN H  4 44  ? -36.586 -46.870 24.587 1.00 87.72  ? 44   GLN H NE2   1 
ATOM   5491  N  N     . VAL H  4 45  ? -39.021 -45.929 30.787 1.00 77.89  ? 45   VAL H N     1 
ATOM   5492  C  CA    . VAL H  4 45  ? -38.461 -46.173 32.131 1.00 77.22  ? 45   VAL H CA    1 
ATOM   5493  C  C     . VAL H  4 45  ? -39.543 -46.418 33.204 1.00 76.98  ? 45   VAL H C     1 
ATOM   5494  O  O     . VAL H  4 45  ? -39.330 -47.123 34.182 1.00 76.82  ? 45   VAL H O     1 
ATOM   5495  C  CB    . VAL H  4 45  ? -37.421 -45.022 32.502 1.00 77.41  ? 45   VAL H CB    1 
ATOM   5496  C  CG1   . VAL H  4 45  ? -37.744 -44.299 33.804 1.00 76.61  ? 45   VAL H CG1   1 
ATOM   5497  C  CG2   . VAL H  4 45  ? -35.978 -45.535 32.485 1.00 76.93  ? 45   VAL H CG2   1 
ATOM   5498  N  N     . HIS H  4 46  ? -40.701 -45.812 33.016 1.00 76.91  ? 46   HIS H N     1 
ATOM   5499  C  CA    . HIS H  4 46  ? -41.878 -46.140 33.789 1.00 77.25  ? 46   HIS H CA    1 
ATOM   5500  C  C     . HIS H  4 46  ? -43.026 -45.885 32.831 1.00 77.28  ? 46   HIS H C     1 
ATOM   5501  O  O     . HIS H  4 46  ? -43.547 -44.760 32.792 1.00 77.16  ? 46   HIS H O     1 
ATOM   5502  C  CB    . HIS H  4 46  ? -42.044 -45.224 34.997 1.00 77.43  ? 46   HIS H CB    1 
ATOM   5503  C  CG    . HIS H  4 46  ? -41.076 -45.473 36.110 1.00 78.52  ? 46   HIS H CG    1 
ATOM   5504  N  ND1   . HIS H  4 46  ? -41.338 -46.349 37.144 1.00 79.51  ? 46   HIS H ND1   1 
ATOM   5505  C  CD2   . HIS H  4 46  ? -39.875 -44.911 36.389 1.00 79.21  ? 46   HIS H CD2   1 
ATOM   5506  C  CE1   . HIS H  4 46  ? -40.325 -46.340 37.994 1.00 79.76  ? 46   HIS H CE1   1 
ATOM   5507  N  NE2   . HIS H  4 46  ? -39.421 -45.479 37.556 1.00 80.15  ? 46   HIS H NE2   1 
ATOM   5508  N  N     . PRO H  4 47  ? -43.421 -46.915 32.044 1.00 77.22  ? 47   PRO H N     1 
ATOM   5509  C  CA    . PRO H  4 47  ? -44.414 -46.707 30.985 1.00 77.03  ? 47   PRO H CA    1 
ATOM   5510  C  C     . PRO H  4 47  ? -45.772 -46.294 31.544 1.00 76.97  ? 47   PRO H C     1 
ATOM   5511  O  O     . PRO H  4 47  ? -46.507 -45.553 30.890 1.00 77.17  ? 47   PRO H O     1 
ATOM   5512  C  CB    . PRO H  4 47  ? -44.512 -48.080 30.305 1.00 76.88  ? 47   PRO H CB    1 
ATOM   5513  C  CG    . PRO H  4 47  ? -43.305 -48.841 30.751 1.00 76.94  ? 47   PRO H CG    1 
ATOM   5514  C  CD    . PRO H  4 47  ? -42.985 -48.322 32.115 1.00 77.25  ? 47   PRO H CD    1 
ATOM   5515  N  N     . ASP H  4 48  ? -46.094 -46.739 32.756 1.00 76.79  ? 48   ASP H N     1 
ATOM   5516  C  CA    . ASP H  4 48  ? -47.385 -46.409 33.333 1.00 76.64  ? 48   ASP H CA    1 
ATOM   5517  C  C     . ASP H  4 48  ? -47.396 -45.101 34.110 1.00 76.58  ? 48   ASP H C     1 
ATOM   5518  O  O     . ASP H  4 48  ? -48.452 -44.673 34.605 1.00 76.71  ? 48   ASP H O     1 
ATOM   5519  C  CB    . ASP H  4 48  ? -47.885 -47.562 34.194 1.00 76.78  ? 48   ASP H CB    1 
ATOM   5520  C  CG    . ASP H  4 48  ? -48.310 -48.767 33.360 1.00 78.03  ? 48   ASP H CG    1 
ATOM   5521  O  OD1   . ASP H  4 48  ? -49.208 -48.619 32.493 1.00 77.92  ? 48   ASP H OD1   1 
ATOM   5522  O  OD2   . ASP H  4 48  ? -47.742 -49.868 33.572 1.00 79.89  ? 48   ASP H OD2   1 
ATOM   5523  N  N     . THR H  4 49  ? -46.234 -44.447 34.208 1.00 76.38  ? 49   THR H N     1 
ATOM   5524  C  CA    . THR H  4 49  ? -46.105 -43.223 35.022 1.00 75.41  ? 49   THR H CA    1 
ATOM   5525  C  C     . THR H  4 49  ? -46.120 -41.971 34.160 1.00 74.72  ? 49   THR H C     1 
ATOM   5526  O  O     . THR H  4 49  ? -45.520 -41.945 33.080 1.00 74.65  ? 49   THR H O     1 
ATOM   5527  C  CB    . THR H  4 49  ? -44.831 -43.246 35.881 1.00 75.66  ? 49   THR H CB    1 
ATOM   5528  O  OG1   . THR H  4 49  ? -44.738 -44.498 36.567 1.00 75.50  ? 49   THR H OG1   1 
ATOM   5529  C  CG2   . THR H  4 49  ? -44.837 -42.126 36.920 1.00 76.14  ? 49   THR H CG2   1 
ATOM   5530  N  N     . GLY H  4 50  ? -46.823 -40.946 34.641 1.00 74.10  ? 50   GLY H N     1 
ATOM   5531  C  CA    . GLY H  4 50  ? -46.893 -39.637 33.970 1.00 73.39  ? 50   GLY H CA    1 
ATOM   5532  C  C     . GLY H  4 50  ? -46.168 -38.538 34.736 1.00 72.69  ? 50   GLY H C     1 
ATOM   5533  O  O     . GLY H  4 50  ? -45.530 -38.803 35.757 1.00 73.11  ? 50   GLY H O     1 
ATOM   5534  N  N     . ILE H  4 51  ? -46.274 -37.303 34.256 1.00 71.79  ? 51   ILE H N     1 
ATOM   5535  C  CA    . ILE H  4 51  ? -45.524 -36.187 34.835 1.00 70.75  ? 51   ILE H CA    1 
ATOM   5536  C  C     . ILE H  4 51  ? -46.305 -34.878 34.799 1.00 70.16  ? 51   ILE H C     1 
ATOM   5537  O  O     . ILE H  4 51  ? -46.826 -34.494 33.756 1.00 69.60  ? 51   ILE H O     1 
ATOM   5538  C  CB    . ILE H  4 51  ? -44.104 -36.045 34.151 1.00 71.12  ? 51   ILE H CB    1 
ATOM   5539  C  CG1   . ILE H  4 51  ? -43.237 -34.983 34.852 1.00 70.94  ? 51   ILE H CG1   1 
ATOM   5540  C  CG2   . ILE H  4 51  ? -44.212 -35.818 32.624 1.00 70.44  ? 51   ILE H CG2   1 
ATOM   5541  C  CD1   . ILE H  4 51  ? -41.737 -35.235 34.748 1.00 69.46  ? 51   ILE H CD1   1 
ATOM   5542  N  N     . SER H  4 52  ? -46.388 -34.199 35.944 1.00 69.77  ? 52   SER H N     1 
ATOM   5543  C  CA    . SER H  4 52  ? -47.050 -32.895 36.017 1.00 69.49  ? 52   SER H CA    1 
ATOM   5544  C  C     . SER H  4 52  ? -46.256 -31.840 35.232 1.00 69.40  ? 52   SER H C     1 
ATOM   5545  O  O     . SER H  4 52  ? -45.079 -32.053 34.899 1.00 68.99  ? 52   SER H O     1 
ATOM   5546  C  CB    . SER H  4 52  ? -47.224 -32.460 37.471 1.00 69.49  ? 52   SER H CB    1 
ATOM   5547  O  OG    . SER H  4 52  ? -45.997 -32.018 38.013 1.00 69.67  ? 52   SER H OG    1 
ATOM   5548  N  N     . SER H  4 53  ? -46.895 -30.715 34.923 1.00 69.24  ? 53   SER H N     1 
ATOM   5549  C  CA    . SER H  4 53  ? -46.228 -29.666 34.161 1.00 69.84  ? 53   SER H CA    1 
ATOM   5550  C  C     . SER H  4 53  ? -45.024 -29.143 34.899 1.00 69.53  ? 53   SER H C     1 
ATOM   5551  O  O     . SER H  4 53  ? -43.913 -29.063 34.332 1.00 69.82  ? 53   SER H O     1 
ATOM   5552  C  CB    . SER H  4 53  ? -47.167 -28.507 33.884 1.00 69.83  ? 53   SER H CB    1 
ATOM   5553  O  OG    . SER H  4 53  ? -47.592 -28.588 32.538 1.00 73.65  ? 53   SER H OG    1 
ATOM   5554  N  N     . LYS H  4 54  ? -45.252 -28.806 36.168 1.00 68.52  ? 54   LYS H N     1 
ATOM   5555  C  CA    . LYS H  4 54  ? -44.220 -28.269 37.012 1.00 67.95  ? 54   LYS H CA    1 
ATOM   5556  C  C     . LYS H  4 54  ? -43.008 -29.195 37.095 1.00 67.46  ? 54   LYS H C     1 
ATOM   5557  O  O     . LYS H  4 54  ? -41.860 -28.739 36.984 1.00 68.26  ? 54   LYS H O     1 
ATOM   5558  C  CB    . LYS H  4 54  ? -44.792 -27.920 38.379 1.00 68.32  ? 54   LYS H CB    1 
ATOM   5559  C  CG    . LYS H  4 54  ? -45.410 -26.537 38.381 1.00 69.19  ? 54   LYS H CG    1 
ATOM   5560  C  CD    . LYS H  4 54  ? -46.443 -26.358 39.493 1.00 72.14  ? 54   LYS H CD    1 
ATOM   5561  C  CE    . LYS H  4 54  ? -47.177 -25.004 39.353 1.00 71.97  ? 54   LYS H CE    1 
ATOM   5562  N  NZ    . LYS H  4 54  ? -48.594 -25.081 39.837 1.00 72.79  ? 54   LYS H NZ    1 
ATOM   5563  N  N     . ALA H  4 55  ? -43.240 -30.492 37.240 1.00 66.22  ? 55   ALA H N     1 
ATOM   5564  C  CA    . ALA H  4 55  ? -42.125 -31.417 37.272 1.00 65.42  ? 55   ALA H CA    1 
ATOM   5565  C  C     . ALA H  4 55  ? -41.415 -31.429 35.935 1.00 64.74  ? 55   ALA H C     1 
ATOM   5566  O  O     . ALA H  4 55  ? -40.212 -31.581 35.859 1.00 64.74  ? 55   ALA H O     1 
ATOM   5567  C  CB    . ALA H  4 55  ? -42.588 -32.805 37.646 1.00 65.63  ? 55   ALA H CB    1 
ATOM   5568  N  N     . MET H  4 56  ? -42.163 -31.255 34.865 1.00 64.46  ? 56   MET H N     1 
ATOM   5569  C  CA    . MET H  4 56  ? -41.557 -31.307 33.546 1.00 64.18  ? 56   MET H CA    1 
ATOM   5570  C  C     . MET H  4 56  ? -40.691 -30.052 33.359 1.00 63.76  ? 56   MET H C     1 
ATOM   5571  O  O     . MET H  4 56  ? -39.603 -30.077 32.753 1.00 62.90  ? 56   MET H O     1 
ATOM   5572  C  CB    . MET H  4 56  ? -42.641 -31.426 32.472 1.00 63.93  ? 56   MET H CB    1 
ATOM   5573  C  CG    . MET H  4 56  ? -42.127 -31.289 31.080 1.00 64.37  ? 56   MET H CG    1 
ATOM   5574  S  SD    . MET H  4 56  ? -40.978 -32.614 30.704 1.00 69.36  ? 56   MET H SD    1 
ATOM   5575  C  CE    . MET H  4 56  ? -42.104 -33.839 29.974 1.00 66.89  ? 56   MET H CE    1 
ATOM   5576  N  N     . SER H  4 57  ? -41.181 -28.952 33.910 1.00 63.39  ? 57   SER H N     1 
ATOM   5577  C  CA    . SER H  4 57  ? -40.440 -27.714 33.856 1.00 63.53  ? 57   SER H CA    1 
ATOM   5578  C  C     . SER H  4 57  ? -39.072 -27.859 34.560 1.00 62.72  ? 57   SER H C     1 
ATOM   5579  O  O     . SER H  4 57  ? -38.031 -27.453 34.017 1.00 62.63  ? 57   SER H O     1 
ATOM   5580  C  CB    . SER H  4 57  ? -41.266 -26.603 34.459 1.00 63.26  ? 57   SER H CB    1 
ATOM   5581  O  OG    . SER H  4 57  ? -40.813 -25.384 33.905 1.00 67.67  ? 57   SER H OG    1 
ATOM   5582  N  N     . ILE H  4 58  ? -39.087 -28.487 35.738 1.00 61.65  ? 58   ILE H N     1 
ATOM   5583  C  CA    . ILE H  4 58  ? -37.876 -28.835 36.476 1.00 60.59  ? 58   ILE H CA    1 
ATOM   5584  C  C     . ILE H  4 58  ? -36.915 -29.703 35.687 1.00 60.36  ? 58   ILE H C     1 
ATOM   5585  O  O     . ILE H  4 58  ? -35.731 -29.402 35.600 1.00 60.77  ? 58   ILE H O     1 
ATOM   5586  C  CB    . ILE H  4 58  ? -38.225 -29.496 37.799 1.00 60.26  ? 58   ILE H CB    1 
ATOM   5587  C  CG1   . ILE H  4 58  ? -38.897 -28.445 38.697 1.00 60.61  ? 58   ILE H CG1   1 
ATOM   5588  C  CG2   . ILE H  4 58  ? -36.964 -30.024 38.448 1.00 60.13  ? 58   ILE H CG2   1 
ATOM   5589  C  CD1   . ILE H  4 58  ? -39.776 -28.961 39.775 1.00 59.50  ? 58   ILE H CD1   1 
ATOM   5590  N  N     . MET H  4 59  ? -37.433 -30.769 35.092 1.00 60.13  ? 59   MET H N     1 
ATOM   5591  C  CA    . MET H  4 59  ? -36.636 -31.662 34.260 1.00 59.66  ? 59   MET H CA    1 
ATOM   5592  C  C     . MET H  4 59  ? -35.962 -30.942 33.100 1.00 59.50  ? 59   MET H C     1 
ATOM   5593  O  O     . MET H  4 59  ? -34.838 -31.264 32.720 1.00 60.16  ? 59   MET H O     1 
ATOM   5594  C  CB    . MET H  4 59  ? -37.501 -32.807 33.710 1.00 59.82  ? 59   MET H CB    1 
ATOM   5595  C  CG    . MET H  4 59  ? -37.860 -33.889 34.710 1.00 58.08  ? 59   MET H CG    1 
ATOM   5596  S  SD    . MET H  4 59  ? -36.432 -34.489 35.622 1.00 59.14  ? 59   MET H SD    1 
ATOM   5597  C  CE    . MET H  4 59  ? -35.376 -35.153 34.340 1.00 54.87  ? 59   MET H CE    1 
ATOM   5598  N  N     . ASN H  4 60  ? -36.665 -29.974 32.537 1.00 59.06  ? 60   ASN H N     1 
ATOM   5599  C  CA    . ASN H  4 60  ? -36.151 -29.187 31.434 1.00 58.59  ? 60   ASN H CA    1 
ATOM   5600  C  C     . ASN H  4 60  ? -35.036 -28.237 31.890 1.00 58.04  ? 60   ASN H C     1 
ATOM   5601  O  O     . ASN H  4 60  ? -34.001 -28.139 31.215 1.00 58.00  ? 60   ASN H O     1 
ATOM   5602  C  CB    . ASN H  4 60  ? -37.308 -28.442 30.749 1.00 58.80  ? 60   ASN H CB    1 
ATOM   5603  C  CG    . ASN H  4 60  ? -36.899 -27.798 29.436 1.00 59.72  ? 60   ASN H CG    1 
ATOM   5604  O  OD1   . ASN H  4 60  ? -36.257 -28.433 28.588 1.00 61.25  ? 60   ASN H OD1   1 
ATOM   5605  N  ND2   . ASN H  4 60  ? -37.263 -26.522 29.262 1.00 58.76  ? 60   ASN H ND2   1 
ATOM   5606  N  N     . SER H  4 61  ? -35.240 -27.546 33.022 1.00 57.33  ? 61   SER H N     1 
ATOM   5607  C  CA    . SER H  4 61  ? -34.151 -26.799 33.687 1.00 56.97  ? 61   SER H CA    1 
ATOM   5608  C  C     . SER H  4 61  ? -32.932 -27.695 33.903 1.00 57.10  ? 61   SER H C     1 
ATOM   5609  O  O     . SER H  4 61  ? -31.821 -27.390 33.414 1.00 56.97  ? 61   SER H O     1 
ATOM   5610  C  CB    . SER H  4 61  ? -34.597 -26.240 35.027 1.00 56.44  ? 61   SER H CB    1 
ATOM   5611  O  OG    . SER H  4 61  ? -35.744 -25.454 34.861 1.00 56.65  ? 61   SER H OG    1 
ATOM   5612  N  N     . PHE H  4 62  ? -33.148 -28.818 34.594 1.00 56.82  ? 62   PHE H N     1 
ATOM   5613  C  CA    . PHE H  4 62  ? -32.081 -29.800 34.792 1.00 56.96  ? 62   PHE H CA    1 
ATOM   5614  C  C     . PHE H  4 62  ? -31.319 -30.114 33.511 1.00 56.97  ? 62   PHE H C     1 
ATOM   5615  O  O     . PHE H  4 62  ? -30.090 -30.105 33.521 1.00 57.58  ? 62   PHE H O     1 
ATOM   5616  C  CB    . PHE H  4 62  ? -32.615 -31.074 35.422 1.00 57.26  ? 62   PHE H CB    1 
ATOM   5617  C  CG    . PHE H  4 62  ? -31.617 -32.195 35.467 1.00 57.36  ? 62   PHE H CG    1 
ATOM   5618  C  CD1   . PHE H  4 62  ? -30.601 -32.208 36.418 1.00 58.45  ? 62   PHE H CD1   1 
ATOM   5619  C  CD2   . PHE H  4 62  ? -31.718 -33.269 34.569 1.00 57.45  ? 62   PHE H CD2   1 
ATOM   5620  C  CE1   . PHE H  4 62  ? -29.676 -33.266 36.462 1.00 58.64  ? 62   PHE H CE1   1 
ATOM   5621  C  CE2   . PHE H  4 62  ? -30.817 -34.326 34.589 1.00 55.99  ? 62   PHE H CE2   1 
ATOM   5622  C  CZ    . PHE H  4 62  ? -29.795 -34.335 35.541 1.00 58.67  ? 62   PHE H CZ    1 
ATOM   5623  N  N     . VAL H  4 63  ? -32.028 -30.357 32.412 1.00 56.44  ? 63   VAL H N     1 
ATOM   5624  C  CA    . VAL H  4 63  ? -31.352 -30.685 31.159 1.00 56.58  ? 63   VAL H CA    1 
ATOM   5625  C  C     . VAL H  4 63  ? -30.546 -29.504 30.585 1.00 57.23  ? 63   VAL H C     1 
ATOM   5626  O  O     . VAL H  4 63  ? -29.381 -29.658 30.156 1.00 57.05  ? 63   VAL H O     1 
ATOM   5627  C  CB    . VAL H  4 63  ? -32.311 -31.270 30.103 1.00 56.39  ? 63   VAL H CB    1 
ATOM   5628  C  CG1   . VAL H  4 63  ? -31.569 -31.499 28.784 1.00 56.03  ? 63   VAL H CG1   1 
ATOM   5629  C  CG2   . VAL H  4 63  ? -32.873 -32.576 30.596 1.00 55.00  ? 63   VAL H CG2   1 
ATOM   5630  N  N     . ASN H  4 64  ? -31.157 -28.324 30.600 1.00 57.68  ? 64   ASN H N     1 
ATOM   5631  C  CA    . ASN H  4 64  ? -30.432 -27.104 30.273 1.00 58.17  ? 64   ASN H CA    1 
ATOM   5632  C  C     . ASN H  4 64  ? -29.219 -26.838 31.182 1.00 57.98  ? 64   ASN H C     1 
ATOM   5633  O  O     . ASN H  4 64  ? -28.116 -26.550 30.683 1.00 57.90  ? 64   ASN H O     1 
ATOM   5634  C  CB    . ASN H  4 64  ? -31.385 -25.920 30.261 1.00 58.50  ? 64   ASN H CB    1 
ATOM   5635  C  CG    . ASN H  4 64  ? -32.237 -25.885 29.014 1.00 60.05  ? 64   ASN H CG    1 
ATOM   5636  O  OD1   . ASN H  4 64  ? -31.723 -25.973 27.882 1.00 60.51  ? 64   ASN H OD1   1 
ATOM   5637  N  ND2   . ASN H  4 64  ? -33.552 -25.755 29.207 1.00 61.02  ? 64   ASN H ND2   1 
ATOM   5638  N  N     . ASP H  4 65  ? -29.417 -26.962 32.497 1.00 57.31  ? 65   ASP H N     1 
ATOM   5639  C  CA    . ASP H  4 65  ? -28.326 -26.784 33.435 1.00 57.07  ? 65   ASP H CA    1 
ATOM   5640  C  C     . ASP H  4 65  ? -27.165 -27.702 33.087 1.00 56.80  ? 65   ASP H C     1 
ATOM   5641  O  O     . ASP H  4 65  ? -26.062 -27.241 32.888 1.00 57.40  ? 65   ASP H O     1 
ATOM   5642  C  CB    . ASP H  4 65  ? -28.803 -26.991 34.876 1.00 57.60  ? 65   ASP H CB    1 
ATOM   5643  C  CG    . ASP H  4 65  ? -27.711 -26.712 35.919 1.00 58.39  ? 65   ASP H CG    1 
ATOM   5644  O  OD1   . ASP H  4 65  ? -26.736 -26.013 35.566 1.00 61.56  ? 65   ASP H OD1   1 
ATOM   5645  O  OD2   . ASP H  4 65  ? -27.827 -27.189 37.084 1.00 55.46  ? 65   ASP H OD2   1 
ATOM   5646  N  N     . VAL H  4 66  ? -27.404 -28.995 32.963 1.00 56.82  ? 66   VAL H N     1 
ATOM   5647  C  CA    . VAL H  4 66  ? -26.299 -29.947 32.728 1.00 56.91  ? 66   VAL H CA    1 
ATOM   5648  C  C     . VAL H  4 66  ? -25.590 -29.758 31.369 1.00 57.12  ? 66   VAL H C     1 
ATOM   5649  O  O     . VAL H  4 66  ? -24.367 -29.881 31.278 1.00 57.02  ? 66   VAL H O     1 
ATOM   5650  C  CB    . VAL H  4 66  ? -26.762 -31.422 32.917 1.00 57.05  ? 66   VAL H CB    1 
ATOM   5651  C  CG1   . VAL H  4 66  ? -25.593 -32.394 32.744 1.00 57.22  ? 66   VAL H CG1   1 
ATOM   5652  C  CG2   . VAL H  4 66  ? -27.389 -31.615 34.291 1.00 56.61  ? 66   VAL H CG2   1 
ATOM   5653  N  N     . PHE H  4 67  ? -26.355 -29.470 30.317 1.00 57.54  ? 67   PHE H N     1 
ATOM   5654  C  CA    . PHE H  4 67  ? -25.774 -29.118 29.029 1.00 57.88  ? 67   PHE H CA    1 
ATOM   5655  C  C     . PHE H  4 67  ? -24.741 -27.985 29.190 1.00 58.01  ? 67   PHE H C     1 
ATOM   5656  O  O     . PHE H  4 67  ? -23.581 -28.123 28.761 1.00 57.08  ? 67   PHE H O     1 
ATOM   5657  C  CB    . PHE H  4 67  ? -26.887 -28.704 28.068 1.00 58.49  ? 67   PHE H CB    1 
ATOM   5658  C  CG    . PHE H  4 67  ? -26.396 -28.189 26.736 1.00 59.60  ? 67   PHE H CG    1 
ATOM   5659  C  CD1   . PHE H  4 67  ? -26.239 -29.053 25.658 1.00 61.13  ? 67   PHE H CD1   1 
ATOM   5660  C  CD2   . PHE H  4 67  ? -26.124 -26.828 26.552 1.00 61.59  ? 67   PHE H CD2   1 
ATOM   5661  C  CE1   . PHE H  4 67  ? -25.789 -28.586 24.412 1.00 60.39  ? 67   PHE H CE1   1 
ATOM   5662  C  CE2   . PHE H  4 67  ? -25.676 -26.343 25.324 1.00 61.69  ? 67   PHE H CE2   1 
ATOM   5663  C  CZ    . PHE H  4 67  ? -25.506 -27.240 24.250 1.00 62.18  ? 67   PHE H CZ    1 
ATOM   5664  N  N     . GLU H  4 68  ? -25.187 -26.887 29.822 1.00 58.30  ? 68   GLU H N     1 
ATOM   5665  C  CA    . GLU H  4 68  ? -24.376 -25.695 30.085 1.00 59.52  ? 68   GLU H CA    1 
ATOM   5666  C  C     . GLU H  4 68  ? -23.115 -25.999 30.877 1.00 57.77  ? 68   GLU H C     1 
ATOM   5667  O  O     . GLU H  4 68  ? -22.005 -25.639 30.461 1.00 57.42  ? 68   GLU H O     1 
ATOM   5668  C  CB    . GLU H  4 68  ? -25.208 -24.602 30.757 1.00 58.88  ? 68   GLU H CB    1 
ATOM   5669  C  CG    . GLU H  4 68  ? -25.948 -23.729 29.728 1.00 63.71  ? 68   GLU H CG    1 
ATOM   5670  C  CD    . GLU H  4 68  ? -26.986 -22.718 30.314 1.00 65.29  ? 68   GLU H CD    1 
ATOM   5671  O  OE1   . GLU H  4 68  ? -27.316 -22.731 31.551 1.00 70.93  ? 68   GLU H OE1   1 
ATOM   5672  O  OE2   . GLU H  4 68  ? -27.479 -21.894 29.491 1.00 73.20  ? 68   GLU H OE2   1 
ATOM   5673  N  N     . ARG H  4 69  ? -23.276 -26.702 31.986 1.00 56.88  ? 69   ARG H N     1 
ATOM   5674  C  CA    . ARG H  4 69  ? -22.125 -27.178 32.738 1.00 56.94  ? 69   ARG H CA    1 
ATOM   5675  C  C     . ARG H  4 69  ? -21.126 -28.014 31.910 1.00 56.76  ? 69   ARG H C     1 
ATOM   5676  O  O     . ARG H  4 69  ? -19.932 -27.766 31.941 1.00 56.94  ? 69   ARG H O     1 
ATOM   5677  C  CB    . ARG H  4 69  ? -22.598 -27.958 33.940 1.00 56.80  ? 69   ARG H CB    1 
ATOM   5678  C  CG    . ARG H  4 69  ? -23.367 -27.124 34.916 1.00 58.71  ? 69   ARG H CG    1 
ATOM   5679  C  CD    . ARG H  4 69  ? -23.350 -27.801 36.257 1.00 60.78  ? 69   ARG H CD    1 
ATOM   5680  N  NE    . ARG H  4 69  ? -24.677 -28.017 36.811 1.00 59.96  ? 69   ARG H NE    1 
ATOM   5681  C  CZ    . ARG H  4 69  ? -24.880 -28.667 37.943 1.00 61.37  ? 69   ARG H CZ    1 
ATOM   5682  N  NH1   . ARG H  4 69  ? -23.852 -29.185 38.595 1.00 60.08  ? 69   ARG H NH1   1 
ATOM   5683  N  NH2   . ARG H  4 69  ? -26.107 -28.806 38.422 1.00 64.58  ? 69   ARG H NH2   1 
ATOM   5684  N  N     . ILE H  4 70  ? -21.607 -28.997 31.159 1.00 56.79  ? 70   ILE H N     1 
ATOM   5685  C  CA    . ILE H  4 70  ? -20.702 -29.833 30.373 1.00 56.57  ? 70   ILE H CA    1 
ATOM   5686  C  C     . ILE H  4 70  ? -20.097 -29.079 29.195 1.00 56.25  ? 70   ILE H C     1 
ATOM   5687  O  O     . ILE H  4 70  ? -18.889 -29.165 28.970 1.00 56.30  ? 70   ILE H O     1 
ATOM   5688  C  CB    . ILE H  4 70  ? -21.389 -31.135 29.893 1.00 57.21  ? 70   ILE H CB    1 
ATOM   5689  C  CG1   . ILE H  4 70  ? -21.836 -31.971 31.093 1.00 56.38  ? 70   ILE H CG1   1 
ATOM   5690  C  CG2   . ILE H  4 70  ? -20.464 -31.943 28.974 1.00 56.58  ? 70   ILE H CG2   1 
ATOM   5691  C  CD1   . ILE H  4 70  ? -22.672 -33.127 30.707 1.00 57.09  ? 70   ILE H CD1   1 
ATOM   5692  N  N     . ALA H  4 71  ? -20.922 -28.346 28.442 1.00 55.69  ? 71   ALA H N     1 
ATOM   5693  C  CA    . ALA H  4 71  ? -20.394 -27.530 27.337 1.00 55.22  ? 71   ALA H CA    1 
ATOM   5694  C  C     . ALA H  4 71  ? -19.404 -26.485 27.848 1.00 55.33  ? 71   ALA H C     1 
ATOM   5695  O  O     . ALA H  4 71  ? -18.310 -26.329 27.287 1.00 55.02  ? 71   ALA H O     1 
ATOM   5696  C  CB    . ALA H  4 71  ? -21.498 -26.875 26.587 1.00 54.94  ? 71   ALA H CB    1 
ATOM   5697  N  N     . GLY H  4 72  ? -19.781 -25.785 28.921 1.00 55.23  ? 72   GLY H N     1 
ATOM   5698  C  CA    . GLY H  4 72  ? -18.891 -24.819 29.537 1.00 55.44  ? 72   GLY H CA    1 
ATOM   5699  C  C     . GLY H  4 72  ? -17.525 -25.404 29.823 1.00 55.82  ? 72   GLY H C     1 
ATOM   5700  O  O     . GLY H  4 72  ? -16.517 -24.864 29.394 1.00 56.07  ? 72   GLY H O     1 
ATOM   5701  N  N     . GLU H  4 73  ? -17.487 -26.523 30.535 1.00 56.27  ? 73   GLU H N     1 
ATOM   5702  C  CA    . GLU H  4 73  ? -16.223 -27.175 30.850 1.00 57.23  ? 73   GLU H CA    1 
ATOM   5703  C  C     . GLU H  4 73  ? -15.466 -27.691 29.630 1.00 57.61  ? 73   GLU H C     1 
ATOM   5704  O  O     . GLU H  4 73  ? -14.239 -27.557 29.566 1.00 58.43  ? 73   GLU H O     1 
ATOM   5705  C  CB    . GLU H  4 73  ? -16.436 -28.304 31.838 1.00 57.61  ? 73   GLU H CB    1 
ATOM   5706  C  CG    . GLU H  4 73  ? -15.164 -28.977 32.244 1.00 60.23  ? 73   GLU H CG    1 
ATOM   5707  C  CD    . GLU H  4 73  ? -14.313 -28.110 33.152 1.00 65.53  ? 73   GLU H CD    1 
ATOM   5708  O  OE1   . GLU H  4 73  ? -13.156 -27.803 32.763 1.00 65.66  ? 73   GLU H OE1   1 
ATOM   5709  O  OE2   . GLU H  4 73  ? -14.803 -27.742 34.257 1.00 68.68  ? 73   GLU H OE2   1 
ATOM   5710  N  N     . ALA H  4 74  ? -16.171 -28.281 28.669 1.00 57.55  ? 74   ALA H N     1 
ATOM   5711  C  CA    . ALA H  4 74  ? -15.527 -28.712 27.433 1.00 58.11  ? 74   ALA H CA    1 
ATOM   5712  C  C     . ALA H  4 74  ? -14.879 -27.522 26.743 1.00 58.60  ? 74   ALA H C     1 
ATOM   5713  O  O     . ALA H  4 74  ? -13.770 -27.619 26.216 1.00 58.26  ? 74   ALA H O     1 
ATOM   5714  C  CB    . ALA H  4 74  ? -16.542 -29.350 26.506 1.00 58.33  ? 74   ALA H CB    1 
ATOM   5715  N  N     . SER H  4 75  ? -15.594 -26.397 26.752 1.00 59.23  ? 75   SER H N     1 
ATOM   5716  C  CA    . SER H  4 75  ? -15.121 -25.174 26.154 1.00 59.99  ? 75   SER H CA    1 
ATOM   5717  C  C     . SER H  4 75  ? -13.828 -24.741 26.797 1.00 60.56  ? 75   SER H C     1 
ATOM   5718  O  O     . SER H  4 75  ? -12.850 -24.470 26.095 1.00 61.24  ? 75   SER H O     1 
ATOM   5719  C  CB    . SER H  4 75  ? -16.162 -24.085 26.284 1.00 60.21  ? 75   SER H CB    1 
ATOM   5720  O  OG    . SER H  4 75  ? -15.598 -22.839 25.919 1.00 63.12  ? 75   SER H OG    1 
ATOM   5721  N  N     . ARG H  4 76  ? -13.798 -24.699 28.123 1.00 60.84  ? 76   ARG H N     1 
ATOM   5722  C  CA    . ARG H  4 76  ? -12.555 -24.405 28.798 1.00 61.88  ? 76   ARG H CA    1 
ATOM   5723  C  C     . ARG H  4 76  ? -11.400 -25.357 28.422 1.00 62.05  ? 76   ARG H C     1 
ATOM   5724  O  O     . ARG H  4 76  ? -10.296 -24.900 28.101 1.00 62.05  ? 76   ARG H O     1 
ATOM   5725  C  CB    . ARG H  4 76  ? -12.765 -24.354 30.311 1.00 62.38  ? 76   ARG H CB    1 
ATOM   5726  C  CG    . ARG H  4 76  ? -13.434 -23.080 30.786 1.00 62.83  ? 76   ARG H CG    1 
ATOM   5727  C  CD    . ARG H  4 76  ? -13.912 -23.184 32.232 1.00 62.38  ? 76   ARG H CD    1 
ATOM   5728  N  NE    . ARG H  4 76  ? -15.319 -22.788 32.303 1.00 62.92  ? 76   ARG H NE    1 
ATOM   5729  C  CZ    . ARG H  4 76  ? -16.285 -23.549 32.811 1.00 62.93  ? 76   ARG H CZ    1 
ATOM   5730  N  NH1   . ARG H  4 76  ? -15.984 -24.743 33.341 1.00 63.29  ? 76   ARG H NH1   1 
ATOM   5731  N  NH2   . ARG H  4 76  ? -17.542 -23.112 32.809 1.00 61.74  ? 76   ARG H NH2   1 
ATOM   5732  N  N     . LEU H  4 77  ? -11.643 -26.665 28.464 1.00 62.90  ? 77   LEU H N     1 
ATOM   5733  C  CA    . LEU H  4 77  ? -10.606 -27.659 28.117 1.00 64.05  ? 77   LEU H CA    1 
ATOM   5734  C  C     . LEU H  4 77  ? -9.987  -27.427 26.750 1.00 64.94  ? 77   LEU H C     1 
ATOM   5735  O  O     . LEU H  4 77  ? -8.768  -27.547 26.596 1.00 65.03  ? 77   LEU H O     1 
ATOM   5736  C  CB    . LEU H  4 77  ? -11.169 -29.074 28.127 1.00 64.01  ? 77   LEU H CB    1 
ATOM   5737  C  CG    . LEU H  4 77  ? -11.236 -29.838 29.437 1.00 64.17  ? 77   LEU H CG    1 
ATOM   5738  C  CD1   . LEU H  4 77  ? -12.334 -30.894 29.356 1.00 62.28  ? 77   LEU H CD1   1 
ATOM   5739  C  CD2   . LEU H  4 77  ? -9.877  -30.454 29.750 1.00 64.42  ? 77   LEU H CD2   1 
ATOM   5740  N  N     . ALA H  4 78  ? -10.828 -27.130 25.758 1.00 66.10  ? 78   ALA H N     1 
ATOM   5741  C  CA    . ALA H  4 78  ? -10.351 -26.821 24.421 1.00 67.58  ? 78   ALA H CA    1 
ATOM   5742  C  C     . ALA H  4 78  ? -9.419  -25.617 24.449 1.00 69.04  ? 78   ALA H C     1 
ATOM   5743  O  O     . ALA H  4 78  ? -8.303  -25.698 23.919 1.00 69.57  ? 78   ALA H O     1 
ATOM   5744  C  CB    . ALA H  4 78  ? -11.493 -26.568 23.508 1.00 67.58  ? 78   ALA H CB    1 
ATOM   5745  N  N     . HIS H  4 79  ? -9.851  -24.523 25.089 1.00 70.12  ? 79   HIS H N     1 
ATOM   5746  C  CA    . HIS H  4 79  ? -9.012  -23.329 25.219 1.00 71.67  ? 79   HIS H CA    1 
ATOM   5747  C  C     . HIS H  4 79  ? -7.682  -23.619 25.905 1.00 72.22  ? 79   HIS H C     1 
ATOM   5748  O  O     . HIS H  4 79  ? -6.632  -23.281 25.365 1.00 72.19  ? 79   HIS H O     1 
ATOM   5749  C  CB    . HIS H  4 79  ? -9.739  -22.174 25.925 1.00 72.17  ? 79   HIS H CB    1 
ATOM   5750  C  CG    . HIS H  4 79  ? -10.779 -21.498 25.076 1.00 75.96  ? 79   HIS H CG    1 
ATOM   5751  N  ND1   . HIS H  4 79  ? -10.517 -21.028 23.803 1.00 77.64  ? 79   HIS H ND1   1 
ATOM   5752  C  CD2   . HIS H  4 79  ? -12.086 -21.210 25.321 1.00 78.56  ? 79   HIS H CD2   1 
ATOM   5753  C  CE1   . HIS H  4 79  ? -11.616 -20.490 23.298 1.00 78.47  ? 79   HIS H CE1   1 
ATOM   5754  N  NE2   . HIS H  4 79  ? -12.581 -20.582 24.199 1.00 79.06  ? 79   HIS H NE2   1 
ATOM   5755  N  N     . TYR H  4 80  ? -7.715  -24.255 27.078 1.00 73.28  ? 80   TYR H N     1 
ATOM   5756  C  CA    . TYR H  4 80  ? -6.472  -24.629 27.783 1.00 74.62  ? 80   TYR H CA    1 
ATOM   5757  C  C     . TYR H  4 80  ? -5.457  -25.276 26.875 1.00 74.50  ? 80   TYR H C     1 
ATOM   5758  O  O     . TYR H  4 80  ? -4.268  -25.026 26.997 1.00 74.81  ? 80   TYR H O     1 
ATOM   5759  C  CB    . TYR H  4 80  ? -6.735  -25.578 28.957 1.00 75.22  ? 80   TYR H CB    1 
ATOM   5760  C  CG    . TYR H  4 80  ? -7.627  -24.969 30.004 1.00 77.77  ? 80   TYR H CG    1 
ATOM   5761  C  CD1   . TYR H  4 80  ? -7.747  -23.573 30.119 1.00 78.59  ? 80   TYR H CD1   1 
ATOM   5762  C  CD2   . TYR H  4 80  ? -8.355  -25.772 30.890 1.00 78.83  ? 80   TYR H CD2   1 
ATOM   5763  C  CE1   . TYR H  4 80  ? -8.572  -23.008 31.065 1.00 78.46  ? 80   TYR H CE1   1 
ATOM   5764  C  CE2   . TYR H  4 80  ? -9.189  -25.201 31.852 1.00 78.31  ? 80   TYR H CE2   1 
ATOM   5765  C  CZ    . TYR H  4 80  ? -9.283  -23.822 31.927 1.00 78.11  ? 80   TYR H CZ    1 
ATOM   5766  O  OH    . TYR H  4 80  ? -10.095 -23.236 32.865 1.00 79.74  ? 80   TYR H OH    1 
ATOM   5767  N  N     . ASN H  4 81  ? -5.943  -26.098 25.958 1.00 74.61  ? 81   ASN H N     1 
ATOM   5768  C  CA    . ASN H  4 81  ? -5.087  -26.875 25.108 1.00 74.82  ? 81   ASN H CA    1 
ATOM   5769  C  C     . ASN H  4 81  ? -4.948  -26.317 23.722 1.00 75.32  ? 81   ASN H C     1 
ATOM   5770  O  O     . ASN H  4 81  ? -4.480  -27.009 22.824 1.00 75.55  ? 81   ASN H O     1 
ATOM   5771  C  CB    . ASN H  4 81  ? -5.629  -28.284 25.030 1.00 74.79  ? 81   ASN H CB    1 
ATOM   5772  C  CG    . ASN H  4 81  ? -5.490  -29.005 26.327 1.00 74.03  ? 81   ASN H CG    1 
ATOM   5773  O  OD1   . ASN H  4 81  ? -4.370  -29.323 26.753 1.00 73.53  ? 81   ASN H OD1   1 
ATOM   5774  N  ND2   . ASN H  4 81  ? -6.620  -29.257 26.987 1.00 71.33  ? 81   ASN H ND2   1 
ATOM   5775  N  N     . LYS H  4 82  ? -5.364  -25.074 23.537 1.00 76.08  ? 82   LYS H N     1 
ATOM   5776  C  CA    . LYS H  4 82  ? -5.183  -24.408 22.259 1.00 77.10  ? 82   LYS H CA    1 
ATOM   5777  C  C     . LYS H  4 82  ? -5.714  -25.272 21.114 1.00 77.05  ? 82   LYS H C     1 
ATOM   5778  O  O     . LYS H  4 82  ? -4.994  -25.584 20.156 1.00 77.09  ? 82   LYS H O     1 
ATOM   5779  C  CB    . LYS H  4 82  ? -3.701  -24.082 22.044 1.00 77.12  ? 82   LYS H CB    1 
ATOM   5780  C  CG    . LYS H  4 82  ? -3.184  -22.963 22.944 1.00 78.64  ? 82   LYS H CG    1 
ATOM   5781  C  CD    . LYS H  4 82  ? -1.680  -22.787 22.789 1.00 78.44  ? 82   LYS H CD    1 
ATOM   5782  C  CE    . LYS H  4 82  ? -0.911  -23.538 23.880 1.00 80.36  ? 82   LYS H CE    1 
ATOM   5783  N  NZ    . LYS H  4 82  ? 0.553   -23.231 23.750 1.00 82.80  ? 82   LYS H NZ    1 
ATOM   5784  N  N     . ARG H  4 83  ? -6.972  -25.680 21.241 1.00 76.92  ? 83   ARG H N     1 
ATOM   5785  C  CA    . ARG H  4 83  ? -7.664  -26.353 20.168 1.00 76.96  ? 83   ARG H CA    1 
ATOM   5786  C  C     . ARG H  4 83  ? -8.862  -25.511 19.755 1.00 76.54  ? 83   ARG H C     1 
ATOM   5787  O  O     . ARG H  4 83  ? -9.385  -24.717 20.546 1.00 76.67  ? 83   ARG H O     1 
ATOM   5788  C  CB    . ARG H  4 83  ? -8.112  -27.748 20.599 1.00 77.41  ? 83   ARG H CB    1 
ATOM   5789  C  CG    . ARG H  4 83  ? -6.991  -28.658 21.050 1.00 79.98  ? 83   ARG H CG    1 
ATOM   5790  C  CD    . ARG H  4 83  ? -6.405  -29.465 19.906 1.00 84.66  ? 83   ARG H CD    1 
ATOM   5791  N  NE    . ARG H  4 83  ? -5.176  -30.154 20.320 1.00 89.36  ? 83   ARG H NE    1 
ATOM   5792  C  CZ    . ARG H  4 83  ? -3.976  -29.568 20.432 1.00 92.01  ? 83   ARG H CZ    1 
ATOM   5793  N  NH1   . ARG H  4 83  ? -3.820  -28.269 20.158 1.00 92.24  ? 83   ARG H NH1   1 
ATOM   5794  N  NH2   . ARG H  4 83  ? -2.920  -30.281 20.818 1.00 93.10  ? 83   ARG H NH2   1 
ATOM   5795  N  N     . SER H  4 84  ? -9.297  -25.698 18.512 1.00 75.94  ? 84   SER H N     1 
ATOM   5796  C  CA    . SER H  4 84  ? -10.400 -24.937 17.943 1.00 75.28  ? 84   SER H CA    1 
ATOM   5797  C  C     . SER H  4 84  ? -11.713 -25.713 17.987 1.00 74.63  ? 84   SER H C     1 
ATOM   5798  O  O     . SER H  4 84  ? -12.784 -25.151 17.713 1.00 74.50  ? 84   SER H O     1 
ATOM   5799  C  CB    . SER H  4 84  ? -10.057 -24.575 16.501 1.00 75.29  ? 84   SER H CB    1 
ATOM   5800  O  OG    . SER H  4 84  ? -8.694  -24.187 16.402 1.00 76.44  ? 84   SER H OG    1 
ATOM   5801  N  N     . THR H  4 85  ? -11.613 -27.000 18.334 1.00 73.60  ? 85   THR H N     1 
ATOM   5802  C  CA    . THR H  4 85  ? -12.721 -27.946 18.238 1.00 72.61  ? 85   THR H CA    1 
ATOM   5803  C  C     . THR H  4 85  ? -13.090 -28.493 19.604 1.00 71.70  ? 85   THR H C     1 
ATOM   5804  O  O     . THR H  4 85  ? -12.221 -28.885 20.386 1.00 71.19  ? 85   THR H O     1 
ATOM   5805  C  CB    . THR H  4 85  ? -12.370 -29.207 17.357 1.00 72.96  ? 85   THR H CB    1 
ATOM   5806  O  OG1   . THR H  4 85  ? -11.422 -28.879 16.332 1.00 73.17  ? 85   THR H OG1   1 
ATOM   5807  C  CG2   . THR H  4 85  ? -13.634 -29.813 16.730 1.00 72.83  ? 85   THR H CG2   1 
ATOM   5808  N  N     . ILE H  4 86  ? -14.391 -28.528 19.871 1.00 70.81  ? 86   ILE H N     1 
ATOM   5809  C  CA    . ILE H  4 86  ? -14.924 -29.326 20.947 1.00 69.99  ? 86   ILE H CA    1 
ATOM   5810  C  C     . ILE H  4 86  ? -15.297 -30.693 20.386 1.00 70.18  ? 86   ILE H C     1 
ATOM   5811  O  O     . ILE H  4 86  ? -16.243 -30.832 19.610 1.00 69.98  ? 86   ILE H O     1 
ATOM   5812  C  CB    . ILE H  4 86  ? -16.105 -28.648 21.588 1.00 69.79  ? 86   ILE H CB    1 
ATOM   5813  C  CG1   . ILE H  4 86  ? -15.593 -27.514 22.500 1.00 69.17  ? 86   ILE H CG1   1 
ATOM   5814  C  CG2   . ILE H  4 86  ? -16.953 -29.674 22.356 1.00 69.52  ? 86   ILE H CG2   1 
ATOM   5815  C  CD1   . ILE H  4 86  ? -16.682 -26.670 23.123 1.00 65.34  ? 86   ILE H CD1   1 
ATOM   5816  N  N     . THR H  4 87  ? -14.513 -31.695 20.770 1.00 70.17  ? 87   THR H N     1 
ATOM   5817  C  CA    . THR H  4 87  ? -14.707 -33.057 20.326 1.00 70.12  ? 87   THR H CA    1 
ATOM   5818  C  C     . THR H  4 87  ? -15.242 -33.863 21.499 1.00 70.44  ? 87   THR H C     1 
ATOM   5819  O  O     . THR H  4 87  ? -15.196 -33.396 22.635 1.00 70.81  ? 87   THR H O     1 
ATOM   5820  C  CB    . THR H  4 87  ? -13.379 -33.690 19.900 1.00 69.84  ? 87   THR H CB    1 
ATOM   5821  O  OG1   . THR H  4 87  ? -12.586 -33.942 21.064 1.00 70.41  ? 87   THR H OG1   1 
ATOM   5822  C  CG2   . THR H  4 87  ? -12.614 -32.788 18.968 1.00 69.82  ? 87   THR H CG2   1 
ATOM   5823  N  N     . SER H  4 88  ? -15.716 -35.079 21.213 1.00 70.40  ? 88   SER H N     1 
ATOM   5824  C  CA    . SER H  4 88  ? -16.232 -36.026 22.208 1.00 70.15  ? 88   SER H CA    1 
ATOM   5825  C  C     . SER H  4 88  ? -15.207 -36.309 23.290 1.00 69.47  ? 88   SER H C     1 
ATOM   5826  O  O     . SER H  4 88  ? -15.566 -36.630 24.420 1.00 69.69  ? 88   SER H O     1 
ATOM   5827  C  CB    . SER H  4 88  ? -16.633 -37.339 21.538 1.00 70.21  ? 88   SER H CB    1 
ATOM   5828  O  OG    . SER H  4 88  ? -15.493 -37.891 20.894 1.00 71.29  ? 88   SER H OG    1 
ATOM   5829  N  N     . ARG H  4 89  ? -13.933 -36.178 22.957 1.00 68.75  ? 89   ARG H N     1 
ATOM   5830  C  CA    . ARG H  4 89  ? -12.913 -36.296 23.980 1.00 68.40  ? 89   ARG H CA    1 
ATOM   5831  C  C     . ARG H  4 89  ? -13.064 -35.200 25.054 1.00 67.87  ? 89   ARG H C     1 
ATOM   5832  O  O     . ARG H  4 89  ? -13.019 -35.484 26.250 1.00 68.22  ? 89   ARG H O     1 
ATOM   5833  C  CB    . ARG H  4 89  ? -11.535 -36.260 23.352 1.00 68.79  ? 89   ARG H CB    1 
ATOM   5834  C  CG    . ARG H  4 89  ? -10.528 -36.994 24.154 1.00 69.90  ? 89   ARG H CG    1 
ATOM   5835  C  CD    . ARG H  4 89  ? -9.160  -36.882 23.563 1.00 72.66  ? 89   ARG H CD    1 
ATOM   5836  N  NE    . ARG H  4 89  ? -8.202  -37.369 24.547 1.00 75.82  ? 89   ARG H NE    1 
ATOM   5837  C  CZ    . ARG H  4 89  ? -7.308  -36.604 25.159 1.00 76.64  ? 89   ARG H CZ    1 
ATOM   5838  N  NH1   . ARG H  4 89  ? -7.232  -35.311 24.864 1.00 76.18  ? 89   ARG H NH1   1 
ATOM   5839  N  NH2   . ARG H  4 89  ? -6.485  -37.138 26.055 1.00 76.80  ? 89   ARG H NH2   1 
ATOM   5840  N  N     . GLU H  4 90  ? -13.270 -33.955 24.628 1.00 66.75  ? 90   GLU H N     1 
ATOM   5841  C  CA    . GLU H  4 90  ? -13.533 -32.871 25.573 1.00 65.55  ? 90   GLU H CA    1 
ATOM   5842  C  C     . GLU H  4 90  ? -14.811 -33.107 26.352 1.00 64.57  ? 90   GLU H C     1 
ATOM   5843  O  O     . GLU H  4 90  ? -14.847 -32.866 27.548 1.00 64.68  ? 90   GLU H O     1 
ATOM   5844  C  CB    . GLU H  4 90  ? -13.612 -31.515 24.871 1.00 65.52  ? 90   GLU H CB    1 
ATOM   5845  C  CG    . GLU H  4 90  ? -12.272 -30.889 24.587 1.00 66.66  ? 90   GLU H CG    1 
ATOM   5846  C  CD    . GLU H  4 90  ? -11.506 -31.617 23.509 1.00 69.76  ? 90   GLU H CD    1 
ATOM   5847  O  OE1   . GLU H  4 90  ? -12.145 -32.017 22.505 1.00 71.39  ? 90   GLU H OE1   1 
ATOM   5848  O  OE2   . GLU H  4 90  ? -10.274 -31.791 23.668 1.00 69.59  ? 90   GLU H OE2   1 
ATOM   5849  N  N     . ILE H  4 91  ? -15.860 -33.563 25.682 1.00 63.37  ? 91   ILE H N     1 
ATOM   5850  C  CA    . ILE H  4 91  ? -17.114 -33.839 26.367 1.00 62.63  ? 91   ILE H CA    1 
ATOM   5851  C  C     . ILE H  4 91  ? -16.884 -34.923 27.404 1.00 62.24  ? 91   ILE H C     1 
ATOM   5852  O  O     . ILE H  4 91  ? -17.412 -34.844 28.510 1.00 62.42  ? 91   ILE H O     1 
ATOM   5853  C  CB    . ILE H  4 91  ? -18.246 -34.259 25.391 1.00 62.93  ? 91   ILE H CB    1 
ATOM   5854  C  CG1   . ILE H  4 91  ? -18.454 -33.196 24.298 1.00 62.58  ? 91   ILE H CG1   1 
ATOM   5855  C  CG2   . ILE H  4 91  ? -19.562 -34.570 26.146 1.00 62.45  ? 91   ILE H CG2   1 
ATOM   5856  C  CD1   . ILE H  4 91  ? -19.182 -31.942 24.749 1.00 60.08  ? 91   ILE H CD1   1 
ATOM   5857  N  N     . GLN H  4 92  ? -16.067 -35.914 27.056 1.00 61.54  ? 92   GLN H N     1 
ATOM   5858  C  CA    . GLN H  4 92  ? -15.743 -37.000 27.981 1.00 60.41  ? 92   GLN H CA    1 
ATOM   5859  C  C     . GLN H  4 92  ? -15.006 -36.551 29.242 1.00 59.32  ? 92   GLN H C     1 
ATOM   5860  O  O     . GLN H  4 92  ? -15.440 -36.872 30.344 1.00 59.24  ? 92   GLN H O     1 
ATOM   5861  C  CB    . GLN H  4 92  ? -14.944 -38.087 27.286 1.00 60.47  ? 92   GLN H CB    1 
ATOM   5862  C  CG    . GLN H  4 92  ? -14.560 -39.198 28.237 1.00 61.45  ? 92   GLN H CG    1 
ATOM   5863  C  CD    . GLN H  4 92  ? -14.131 -40.434 27.517 1.00 61.11  ? 92   GLN H CD    1 
ATOM   5864  O  OE1   . GLN H  4 92  ? -12.936 -40.700 27.393 1.00 61.59  ? 92   GLN H OE1   1 
ATOM   5865  N  NE2   . GLN H  4 92  ? -15.097 -41.183 27.008 1.00 59.52  ? 92   GLN H NE2   1 
ATOM   5866  N  N     . THR H  4 93  ? -13.901 -35.828 29.077 1.00 57.86  ? 93   THR H N     1 
ATOM   5867  C  CA    . THR H  4 93  ? -13.192 -35.247 30.208 1.00 57.33  ? 93   THR H CA    1 
ATOM   5868  C  C     . THR H  4 93  ? -14.103 -34.316 31.041 1.00 57.34  ? 93   THR H C     1 
ATOM   5869  O  O     . THR H  4 93  ? -14.042 -34.314 32.267 1.00 57.22  ? 93   THR H O     1 
ATOM   5870  C  CB    . THR H  4 93  ? -12.005 -34.427 29.746 1.00 57.33  ? 93   THR H CB    1 
ATOM   5871  O  OG1   . THR H  4 93  ? -11.160 -35.213 28.914 1.00 57.15  ? 93   THR H OG1   1 
ATOM   5872  C  CG2   . THR H  4 93  ? -11.212 -33.945 30.917 1.00 57.86  ? 93   THR H CG2   1 
ATOM   5873  N  N     . ALA H  4 94  ? -14.943 -33.530 30.376 1.00 57.09  ? 94   ALA H N     1 
ATOM   5874  C  CA    . ALA H  4 94  ? -15.869 -32.651 31.075 1.00 57.59  ? 94   ALA H CA    1 
ATOM   5875  C  C     . ALA H  4 94  ? -16.794 -33.432 31.992 1.00 58.17  ? 94   ALA H C     1 
ATOM   5876  O  O     . ALA H  4 94  ? -17.067 -32.991 33.131 1.00 59.03  ? 94   ALA H O     1 
ATOM   5877  C  CB    . ALA H  4 94  ? -16.680 -31.814 30.096 1.00 57.36  ? 94   ALA H CB    1 
ATOM   5878  N  N     . VAL H  4 95  ? -17.283 -34.573 31.501 1.00 57.76  ? 95   VAL H N     1 
ATOM   5879  C  CA    . VAL H  4 95  ? -18.163 -35.439 32.271 1.00 57.32  ? 95   VAL H CA    1 
ATOM   5880  C  C     . VAL H  4 95  ? -17.414 -35.969 33.507 1.00 57.61  ? 95   VAL H C     1 
ATOM   5881  O  O     . VAL H  4 95  ? -17.968 -36.028 34.622 1.00 56.80  ? 95   VAL H O     1 
ATOM   5882  C  CB    . VAL H  4 95  ? -18.704 -36.596 31.380 1.00 57.36  ? 95   VAL H CB    1 
ATOM   5883  C  CG1   . VAL H  4 95  ? -19.127 -37.788 32.207 1.00 56.93  ? 95   VAL H CG1   1 
ATOM   5884  C  CG2   . VAL H  4 95  ? -19.881 -36.117 30.536 1.00 57.34  ? 95   VAL H CG2   1 
ATOM   5885  N  N     . ARG H  4 96  ? -16.147 -36.332 33.301 1.00 57.81  ? 96   ARG H N     1 
ATOM   5886  C  CA    . ARG H  4 96  ? -15.296 -36.826 34.390 1.00 58.99  ? 96   ARG H CA    1 
ATOM   5887  C  C     . ARG H  4 96  ? -14.997 -35.778 35.469 1.00 58.48  ? 96   ARG H C     1 
ATOM   5888  O  O     . ARG H  4 96  ? -14.762 -36.125 36.627 1.00 58.84  ? 96   ARG H O     1 
ATOM   5889  C  CB    . ARG H  4 96  ? -13.977 -37.384 33.857 1.00 58.91  ? 96   ARG H CB    1 
ATOM   5890  C  CG    . ARG H  4 96  ? -14.110 -38.717 33.189 1.00 62.80  ? 96   ARG H CG    1 
ATOM   5891  C  CD    . ARG H  4 96  ? -12.744 -39.368 33.005 1.00 69.79  ? 96   ARG H CD    1 
ATOM   5892  N  NE    . ARG H  4 96  ? -12.884 -40.779 32.632 1.00 75.07  ? 96   ARG H NE    1 
ATOM   5893  C  CZ    . ARG H  4 96  ? -12.550 -41.283 31.438 1.00 78.04  ? 96   ARG H CZ    1 
ATOM   5894  N  NH1   . ARG H  4 96  ? -12.037 -40.499 30.482 1.00 77.57  ? 96   ARG H NH1   1 
ATOM   5895  N  NH2   . ARG H  4 96  ? -12.718 -42.585 31.199 1.00 79.06  ? 96   ARG H NH2   1 
ATOM   5896  N  N     . LEU H  4 97  ? -14.970 -34.506 35.081 1.00 58.00  ? 97   LEU H N     1 
ATOM   5897  C  CA    . LEU H  4 97  ? -14.621 -33.448 36.018 1.00 57.28  ? 97   LEU H CA    1 
ATOM   5898  C  C     . LEU H  4 97  ? -15.870 -33.051 36.775 1.00 57.62  ? 97   LEU H C     1 
ATOM   5899  O  O     . LEU H  4 97  ? -15.810 -32.758 37.956 1.00 57.71  ? 97   LEU H O     1 
ATOM   5900  C  CB    . LEU H  4 97  ? -13.972 -32.252 35.299 1.00 56.61  ? 97   LEU H CB    1 
ATOM   5901  C  CG    . LEU H  4 97  ? -12.565 -32.438 34.690 1.00 54.65  ? 97   LEU H CG    1 
ATOM   5902  C  CD1   . LEU H  4 97  ? -12.253 -31.361 33.688 1.00 53.21  ? 97   LEU H CD1   1 
ATOM   5903  C  CD2   . LEU H  4 97  ? -11.477 -32.480 35.732 1.00 52.61  ? 97   LEU H CD2   1 
ATOM   5904  N  N     . LEU H  4 98  ? -17.008 -33.112 36.093 1.00 58.01  ? 98   LEU H N     1 
ATOM   5905  C  CA    . LEU H  4 98  ? -18.269 -32.647 36.630 1.00 58.26  ? 98   LEU H CA    1 
ATOM   5906  C  C     . LEU H  4 98  ? -19.114 -33.670 37.389 1.00 58.55  ? 98   LEU H C     1 
ATOM   5907  O  O     . LEU H  4 98  ? -19.750 -33.334 38.387 1.00 58.83  ? 98   LEU H O     1 
ATOM   5908  C  CB    . LEU H  4 98  ? -19.091 -32.043 35.502 1.00 58.29  ? 98   LEU H CB    1 
ATOM   5909  C  CG    . LEU H  4 98  ? -18.641 -30.642 35.107 1.00 58.27  ? 98   LEU H CG    1 
ATOM   5910  C  CD1   . LEU H  4 98  ? -19.090 -30.352 33.691 1.00 58.90  ? 98   LEU H CD1   1 
ATOM   5911  C  CD2   . LEU H  4 98  ? -19.183 -29.602 36.074 1.00 57.11  ? 98   LEU H CD2   1 
ATOM   5912  N  N     . LEU H  4 99  ? -19.152 -34.910 36.922 1.00 59.47  ? 99   LEU H N     1 
ATOM   5913  C  CA    . LEU H  4 99  ? -20.029 -35.911 37.542 1.00 59.98  ? 99   LEU H CA    1 
ATOM   5914  C  C     . LEU H  4 99  ? -19.318 -36.698 38.647 1.00 60.88  ? 99   LEU H C     1 
ATOM   5915  O  O     . LEU H  4 99  ? -18.130 -37.020 38.528 1.00 60.81  ? 99   LEU H O     1 
ATOM   5916  C  CB    . LEU H  4 99  ? -20.639 -36.846 36.495 1.00 59.51  ? 99   LEU H CB    1 
ATOM   5917  C  CG    . LEU H  4 99  ? -21.397 -36.252 35.286 1.00 59.62  ? 99   LEU H CG    1 
ATOM   5918  C  CD1   . LEU H  4 99  ? -22.365 -37.271 34.631 1.00 59.36  ? 99   LEU H CD1   1 
ATOM   5919  C  CD2   . LEU H  4 99  ? -22.169 -35.026 35.628 1.00 55.92  ? 99   LEU H CD2   1 
ATOM   5920  N  N     . PRO H  4 100 ? -20.041 -36.996 39.738 1.00 61.87  ? 100  PRO H N     1 
ATOM   5921  C  CA    . PRO H  4 100 ? -19.463 -37.830 40.771 1.00 62.78  ? 100  PRO H CA    1 
ATOM   5922  C  C     . PRO H  4 100 ? -19.219 -39.244 40.226 1.00 64.27  ? 100  PRO H C     1 
ATOM   5923  O  O     . PRO H  4 100 ? -19.944 -39.699 39.322 1.00 64.07  ? 100  PRO H O     1 
ATOM   5924  C  CB    . PRO H  4 100 ? -20.550 -37.870 41.853 1.00 62.54  ? 100  PRO H CB    1 
ATOM   5925  C  CG    . PRO H  4 100 ? -21.483 -36.766 41.547 1.00 62.39  ? 100  PRO H CG    1 
ATOM   5926  C  CD    . PRO H  4 100 ? -21.419 -36.586 40.065 1.00 62.13  ? 100  PRO H CD    1 
ATOM   5927  N  N     . GLY H  4 101 ? -18.207 -39.909 40.792 1.00 65.23  ? 101  GLY H N     1 
ATOM   5928  C  CA    . GLY H  4 101 ? -17.787 -41.262 40.428 1.00 66.79  ? 101  GLY H CA    1 
ATOM   5929  C  C     . GLY H  4 101 ? -18.729 -42.195 39.681 1.00 67.59  ? 101  GLY H C     1 
ATOM   5930  O  O     . GLY H  4 101 ? -18.571 -42.401 38.482 1.00 67.97  ? 101  GLY H O     1 
ATOM   5931  N  N     . GLU H  4 102 ? -19.691 -42.791 40.370 1.00 68.22  ? 102  GLU H N     1 
ATOM   5932  C  CA    . GLU H  4 102 ? -20.503 -43.801 39.714 1.00 69.61  ? 102  GLU H CA    1 
ATOM   5933  C  C     . GLU H  4 102 ? -21.337 -43.210 38.561 1.00 69.89  ? 102  GLU H C     1 
ATOM   5934  O  O     . GLU H  4 102 ? -21.429 -43.802 37.478 1.00 70.60  ? 102  GLU H O     1 
ATOM   5935  C  CB    . GLU H  4 102 ? -21.379 -44.542 40.724 1.00 70.11  ? 102  GLU H CB    1 
ATOM   5936  C  CG    . GLU H  4 102 ? -21.924 -45.888 40.221 1.00 73.27  ? 102  GLU H CG    1 
ATOM   5937  C  CD    . GLU H  4 102 ? -20.871 -47.011 40.193 1.00 76.44  ? 102  GLU H CD    1 
ATOM   5938  O  OE1   . GLU H  4 102 ? -21.230 -48.131 39.745 1.00 78.57  ? 102  GLU H OE1   1 
ATOM   5939  O  OE2   . GLU H  4 102 ? -19.704 -46.779 40.616 1.00 75.85  ? 102  GLU H OE2   1 
ATOM   5940  N  N     . LEU H  4 103 ? -21.917 -42.033 38.788 1.00 69.84  ? 103  LEU H N     1 
ATOM   5941  C  CA    . LEU H  4 103 ? -22.655 -41.306 37.763 1.00 69.46  ? 103  LEU H CA    1 
ATOM   5942  C  C     . LEU H  4 103 ? -21.742 -40.996 36.564 1.00 69.59  ? 103  LEU H C     1 
ATOM   5943  O  O     . LEU H  4 103 ? -22.166 -41.105 35.409 1.00 69.70  ? 103  LEU H O     1 
ATOM   5944  C  CB    . LEU H  4 103 ? -23.205 -40.017 38.368 1.00 69.39  ? 103  LEU H CB    1 
ATOM   5945  C  CG    . LEU H  4 103 ? -24.677 -39.590 38.278 1.00 69.52  ? 103  LEU H CG    1 
ATOM   5946  C  CD1   . LEU H  4 103 ? -25.671 -40.723 38.492 1.00 69.01  ? 103  LEU H CD1   1 
ATOM   5947  C  CD2   . LEU H  4 103 ? -24.960 -38.463 39.279 1.00 69.49  ? 103  LEU H CD2   1 
ATOM   5948  N  N     . ALA H  4 104 ? -20.487 -40.633 36.828 1.00 69.52  ? 104  ALA H N     1 
ATOM   5949  C  CA    . ALA H  4 104 ? -19.534 -40.389 35.744 1.00 69.98  ? 104  ALA H CA    1 
ATOM   5950  C  C     . ALA H  4 104 ? -19.333 -41.638 34.889 1.00 70.49  ? 104  ALA H C     1 
ATOM   5951  O  O     . ALA H  4 104 ? -19.456 -41.582 33.656 1.00 70.87  ? 104  ALA H O     1 
ATOM   5952  C  CB    . ALA H  4 104 ? -18.202 -39.896 36.280 1.00 69.87  ? 104  ALA H CB    1 
ATOM   5953  N  N     . LYS H  4 105 ? -19.054 -42.760 35.560 1.00 70.57  ? 105  LYS H N     1 
ATOM   5954  C  CA    . LYS H  4 105 ? -18.760 -44.037 34.922 1.00 70.41  ? 105  LYS H CA    1 
ATOM   5955  C  C     . LYS H  4 105 ? -19.840 -44.457 33.932 1.00 69.78  ? 105  LYS H C     1 
ATOM   5956  O  O     . LYS H  4 105 ? -19.547 -44.789 32.783 1.00 69.28  ? 105  LYS H O     1 
ATOM   5957  C  CB    . LYS H  4 105 ? -18.600 -45.111 35.995 1.00 70.96  ? 105  LYS H CB    1 
ATOM   5958  C  CG    . LYS H  4 105 ? -18.157 -46.469 35.458 1.00 73.20  ? 105  LYS H CG    1 
ATOM   5959  C  CD    . LYS H  4 105 ? -18.516 -47.573 36.431 1.00 77.32  ? 105  LYS H CD    1 
ATOM   5960  C  CE    . LYS H  4 105 ? -18.370 -48.925 35.735 1.00 80.32  ? 105  LYS H CE    1 
ATOM   5961  N  NZ    . LYS H  4 105 ? -18.584 -50.037 36.724 1.00 83.13  ? 105  LYS H NZ    1 
ATOM   5962  N  N     . HIS H  4 106 ? -21.087 -44.436 34.379 1.00 69.46  ? 106  HIS H N     1 
ATOM   5963  C  CA    . HIS H  4 106 ? -22.193 -44.807 33.510 1.00 69.86  ? 106  HIS H CA    1 
ATOM   5964  C  C     . HIS H  4 106 ? -22.372 -43.836 32.341 1.00 69.15  ? 106  HIS H C     1 
ATOM   5965  O  O     . HIS H  4 106 ? -22.610 -44.250 31.209 1.00 68.97  ? 106  HIS H O     1 
ATOM   5966  C  CB    . HIS H  4 106 ? -23.472 -44.968 34.325 1.00 70.21  ? 106  HIS H CB    1 
ATOM   5967  C  CG    . HIS H  4 106 ? -23.431 -46.141 35.259 1.00 73.08  ? 106  HIS H CG    1 
ATOM   5968  N  ND1   . HIS H  4 106 ? -24.141 -47.303 35.032 1.00 75.24  ? 106  HIS H ND1   1 
ATOM   5969  C  CD2   . HIS H  4 106 ? -22.723 -46.348 36.396 1.00 74.58  ? 106  HIS H CD2   1 
ATOM   5970  C  CE1   . HIS H  4 106 ? -23.888 -48.165 36.000 1.00 75.25  ? 106  HIS H CE1   1 
ATOM   5971  N  NE2   . HIS H  4 106 ? -23.031 -47.609 36.842 1.00 74.95  ? 106  HIS H NE2   1 
ATOM   5972  N  N     . ALA H  4 107 ? -22.205 -42.545 32.608 1.00 68.67  ? 107  ALA H N     1 
ATOM   5973  C  CA    . ALA H  4 107 ? -22.420 -41.526 31.579 1.00 67.99  ? 107  ALA H CA    1 
ATOM   5974  C  C     . ALA H  4 107 ? -21.416 -41.675 30.435 1.00 67.51  ? 107  ALA H C     1 
ATOM   5975  O  O     . ALA H  4 107 ? -21.787 -41.555 29.245 1.00 66.65  ? 107  ALA H O     1 
ATOM   5976  C  CB    . ALA H  4 107 ? -22.350 -40.146 32.184 1.00 67.71  ? 107  ALA H CB    1 
ATOM   5977  N  N     . VAL H  4 108 ? -20.163 -41.953 30.818 1.00 66.97  ? 108  VAL H N     1 
ATOM   5978  C  CA    . VAL H  4 108 ? -19.066 -42.172 29.887 1.00 67.02  ? 108  VAL H CA    1 
ATOM   5979  C  C     . VAL H  4 108 ? -19.378 -43.341 28.972 1.00 67.81  ? 108  VAL H C     1 
ATOM   5980  O  O     . VAL H  4 108 ? -19.252 -43.242 27.740 1.00 67.39  ? 108  VAL H O     1 
ATOM   5981  C  CB    . VAL H  4 108 ? -17.758 -42.432 30.634 1.00 66.48  ? 108  VAL H CB    1 
ATOM   5982  C  CG1   . VAL H  4 108 ? -16.704 -42.992 29.716 1.00 65.12  ? 108  VAL H CG1   1 
ATOM   5983  C  CG2   . VAL H  4 108 ? -17.261 -41.149 31.238 1.00 67.29  ? 108  VAL H CG2   1 
ATOM   5984  N  N     . SER H  4 109 ? -19.810 -44.443 29.577 1.00 68.73  ? 109  SER H N     1 
ATOM   5985  C  CA    . SER H  4 109 ? -20.131 -45.623 28.810 1.00 69.45  ? 109  SER H CA    1 
ATOM   5986  C  C     . SER H  4 109 ? -21.348 -45.363 27.929 1.00 69.97  ? 109  SER H C     1 
ATOM   5987  O  O     . SER H  4 109 ? -21.294 -45.638 26.736 1.00 70.27  ? 109  SER H O     1 
ATOM   5988  C  CB    . SER H  4 109 ? -20.318 -46.825 29.714 1.00 69.33  ? 109  SER H CB    1 
ATOM   5989  O  OG    . SER H  4 109 ? -21.580 -46.778 30.326 1.00 69.36  ? 109  SER H OG    1 
ATOM   5990  N  N     . GLU H  4 110 ? -22.416 -44.790 28.478 1.00 70.73  ? 110  GLU H N     1 
ATOM   5991  C  CA    . GLU H  4 110 ? -23.574 -44.447 27.635 1.00 72.00  ? 110  GLU H CA    1 
ATOM   5992  C  C     . GLU H  4 110 ? -23.169 -43.612 26.442 1.00 72.60  ? 110  GLU H C     1 
ATOM   5993  O  O     . GLU H  4 110 ? -23.694 -43.788 25.352 1.00 73.06  ? 110  GLU H O     1 
ATOM   5994  C  CB    . GLU H  4 110 ? -24.655 -43.684 28.390 1.00 71.87  ? 110  GLU H CB    1 
ATOM   5995  C  CG    . GLU H  4 110 ? -25.496 -44.513 29.331 1.00 74.75  ? 110  GLU H CG    1 
ATOM   5996  C  CD    . GLU H  4 110 ? -26.205 -45.684 28.671 1.00 78.26  ? 110  GLU H CD    1 
ATOM   5997  O  OE1   . GLU H  4 110 ? -26.483 -45.646 27.446 1.00 80.40  ? 110  GLU H OE1   1 
ATOM   5998  O  OE2   . GLU H  4 110 ? -26.492 -46.658 29.396 1.00 80.93  ? 110  GLU H OE2   1 
ATOM   5999  N  N     . GLY H  4 111 ? -22.233 -42.697 26.662 1.00 73.30  ? 111  GLY H N     1 
ATOM   6000  C  CA    . GLY H  4 111 ? -21.833 -41.764 25.641 1.00 73.85  ? 111  GLY H CA    1 
ATOM   6001  C  C     . GLY H  4 111 ? -20.911 -42.382 24.631 1.00 74.44  ? 111  GLY H C     1 
ATOM   6002  O  O     . GLY H  4 111 ? -21.073 -42.151 23.441 1.00 74.28  ? 111  GLY H O     1 
ATOM   6003  N  N     . THR H  4 112 ? -19.928 -43.143 25.107 1.00 75.43  ? 112  THR H N     1 
ATOM   6004  C  CA    . THR H  4 112 ? -19.036 -43.905 24.233 1.00 76.55  ? 112  THR H CA    1 
ATOM   6005  C  C     . THR H  4 112 ? -19.868 -44.866 23.371 1.00 77.73  ? 112  THR H C     1 
ATOM   6006  O  O     . THR H  4 112 ? -19.635 -44.991 22.167 1.00 77.80  ? 112  THR H O     1 
ATOM   6007  C  CB    . THR H  4 112 ? -17.982 -44.695 25.053 1.00 76.53  ? 112  THR H CB    1 
ATOM   6008  O  OG1   . THR H  4 112 ? -17.172 -43.782 25.804 1.00 76.60  ? 112  THR H OG1   1 
ATOM   6009  C  CG2   . THR H  4 112 ? -17.085 -45.523 24.156 1.00 75.71  ? 112  THR H CG2   1 
ATOM   6010  N  N     . LYS H  4 113 ? -20.858 -45.507 23.994 1.00 78.84  ? 113  LYS H N     1 
ATOM   6011  C  CA    . LYS H  4 113 ? -21.750 -46.422 23.307 1.00 80.33  ? 113  LYS H CA    1 
ATOM   6012  C  C     . LYS H  4 113 ? -22.483 -45.776 22.139 1.00 80.78  ? 113  LYS H C     1 
ATOM   6013  O  O     . LYS H  4 113 ? -22.580 -46.367 21.073 1.00 81.30  ? 113  LYS H O     1 
ATOM   6014  C  CB    . LYS H  4 113 ? -22.767 -47.015 24.284 1.00 80.59  ? 113  LYS H CB    1 
ATOM   6015  C  CG    . LYS H  4 113 ? -23.451 -48.299 23.790 1.00 80.98  ? 113  LYS H CG    1 
ATOM   6016  C  CD    . LYS H  4 113 ? -24.438 -48.833 24.825 1.00 81.43  ? 113  LYS H CD    1 
ATOM   6017  C  CE    . LYS H  4 113 ? -25.847 -48.303 24.578 1.00 83.34  ? 113  LYS H CE    1 
ATOM   6018  N  NZ    . LYS H  4 113 ? -26.780 -48.721 25.672 1.00 84.98  ? 113  LYS H NZ    1 
ATOM   6019  N  N     . ALA H  4 114 ? -23.006 -44.575 22.335 1.00 81.57  ? 114  ALA H N     1 
ATOM   6020  C  CA    . ALA H  4 114 ? -23.781 -43.911 21.290 1.00 82.33  ? 114  ALA H CA    1 
ATOM   6021  C  C     . ALA H  4 114 ? -22.918 -43.425 20.119 1.00 83.18  ? 114  ALA H C     1 
ATOM   6022  O  O     . ALA H  4 114 ? -23.401 -43.314 18.991 1.00 82.97  ? 114  ALA H O     1 
ATOM   6023  C  CB    . ALA H  4 114 ? -24.607 -42.772 21.875 1.00 82.02  ? 114  ALA H CB    1 
ATOM   6024  N  N     . VAL H  4 115 ? -21.647 -43.142 20.381 1.00 84.44  ? 115  VAL H N     1 
ATOM   6025  C  CA    . VAL H  4 115 ? -20.748 -42.672 19.324 1.00 85.94  ? 115  VAL H CA    1 
ATOM   6026  C  C     . VAL H  4 115 ? -20.298 -43.837 18.439 1.00 87.08  ? 115  VAL H C     1 
ATOM   6027  O  O     . VAL H  4 115 ? -20.104 -43.672 17.230 1.00 87.46  ? 115  VAL H O     1 
ATOM   6028  C  CB    . VAL H  4 115 ? -19.539 -41.874 19.895 1.00 85.90  ? 115  VAL H CB    1 
ATOM   6029  C  CG1   . VAL H  4 115 ? -18.438 -41.703 18.858 1.00 85.32  ? 115  VAL H CG1   1 
ATOM   6030  C  CG2   . VAL H  4 115 ? -20.001 -40.511 20.398 1.00 85.85  ? 115  VAL H CG2   1 
ATOM   6031  N  N     . THR H  4 116 ? -20.135 -45.009 19.047 1.00 88.27  ? 116  THR H N     1 
ATOM   6032  C  CA    . THR H  4 116 ? -19.847 -46.225 18.305 1.00 89.42  ? 116  THR H CA    1 
ATOM   6033  C  C     . THR H  4 116 ? -21.053 -46.557 17.411 1.00 90.22  ? 116  THR H C     1 
ATOM   6034  O  O     . THR H  4 116 ? -20.923 -46.573 16.184 1.00 90.30  ? 116  THR H O     1 
ATOM   6035  C  CB    . THR H  4 116 ? -19.469 -47.373 19.266 1.00 89.41  ? 116  THR H CB    1 
ATOM   6036  O  OG1   . THR H  4 116 ? -18.159 -47.126 19.788 1.00 89.93  ? 116  THR H OG1   1 
ATOM   6037  C  CG2   . THR H  4 116 ? -19.455 -48.714 18.562 1.00 90.01  ? 116  THR H CG2   1 
ATOM   6038  N  N     . LYS H  4 117 ? -22.220 -46.770 18.026 1.00 91.14  ? 117  LYS H N     1 
ATOM   6039  C  CA    . LYS H  4 117 ? -23.476 -47.027 17.307 1.00 92.33  ? 117  LYS H CA    1 
ATOM   6040  C  C     . LYS H  4 117 ? -23.696 -46.064 16.150 1.00 92.94  ? 117  LYS H C     1 
ATOM   6041  O  O     . LYS H  4 117 ? -24.174 -46.452 15.093 1.00 93.82  ? 117  LYS H O     1 
ATOM   6042  C  CB    . LYS H  4 117 ? -24.674 -46.953 18.260 1.00 92.05  ? 117  LYS H CB    1 
ATOM   6043  C  CG    . LYS H  4 117 ? -25.897 -47.751 17.807 1.00 92.75  ? 117  LYS H CG    1 
ATOM   6044  C  CD    . LYS H  4 117 ? -26.964 -47.817 18.911 1.00 93.12  ? 117  LYS H CD    1 
ATOM   6045  C  CE    . LYS H  4 117 ? -27.388 -49.268 19.243 1.00 94.49  ? 117  LYS H CE    1 
ATOM   6046  N  NZ    . LYS H  4 117 ? -28.197 -49.928 18.152 1.00 94.31  ? 117  LYS H NZ    1 
ATOM   6047  N  N     . TYR H  4 118 ? -23.342 -44.808 16.355 1.00 93.76  ? 118  TYR H N     1 
ATOM   6048  C  CA    . TYR H  4 118 ? -23.503 -43.788 15.337 1.00 94.55  ? 118  TYR H CA    1 
ATOM   6049  C  C     . TYR H  4 118 ? -22.497 -43.972 14.185 1.00 95.83  ? 118  TYR H C     1 
ATOM   6050  O  O     . TYR H  4 118 ? -22.856 -43.813 13.011 1.00 95.85  ? 118  TYR H O     1 
ATOM   6051  C  CB    . TYR H  4 118 ? -23.374 -42.411 15.995 1.00 93.70  ? 118  TYR H CB    1 
ATOM   6052  C  CG    . TYR H  4 118 ? -23.445 -41.235 15.062 1.00 92.26  ? 118  TYR H CG    1 
ATOM   6053  C  CD1   . TYR H  4 118 ? -24.669 -40.762 14.604 1.00 91.27  ? 118  TYR H CD1   1 
ATOM   6054  C  CD2   . TYR H  4 118 ? -22.283 -40.579 14.655 1.00 90.97  ? 118  TYR H CD2   1 
ATOM   6055  C  CE1   . TYR H  4 118 ? -24.732 -39.672 13.750 1.00 91.07  ? 118  TYR H CE1   1 
ATOM   6056  C  CE2   . TYR H  4 118 ? -22.335 -39.489 13.810 1.00 90.28  ? 118  TYR H CE2   1 
ATOM   6057  C  CZ    . TYR H  4 118 ? -23.560 -39.039 13.362 1.00 90.98  ? 118  TYR H CZ    1 
ATOM   6058  O  OH    . TYR H  4 118 ? -23.615 -37.960 12.515 1.00 91.58  ? 118  TYR H OH    1 
ATOM   6059  N  N     . THR H  4 119 ? -21.251 -44.308 14.528 1.00 97.33  ? 119  THR H N     1 
ATOM   6060  C  CA    . THR H  4 119 ? -20.208 -44.593 13.538 1.00 99.12  ? 119  THR H CA    1 
ATOM   6061  C  C     . THR H  4 119 ? -20.555 -45.832 12.701 1.00 100.58 ? 119  THR H C     1 
ATOM   6062  O  O     . THR H  4 119 ? -20.640 -45.763 11.469 1.00 100.83 ? 119  THR H O     1 
ATOM   6063  C  CB    . THR H  4 119 ? -18.823 -44.790 14.215 1.00 98.89  ? 119  THR H CB    1 
ATOM   6064  O  OG1   . THR H  4 119 ? -18.367 -43.539 14.727 1.00 98.48  ? 119  THR H OG1   1 
ATOM   6065  C  CG2   . THR H  4 119 ? -17.780 -45.318 13.226 1.00 99.06  ? 119  THR H CG2   1 
ATOM   6066  N  N     . SER H  4 120 ? -20.770 -46.955 13.383 1.00 102.25 ? 120  SER H N     1 
ATOM   6067  C  CA    . SER H  4 120 ? -20.978 -48.239 12.726 1.00 103.73 ? 120  SER H CA    1 
ATOM   6068  C  C     . SER H  4 120 ? -22.402 -48.390 12.196 1.00 104.86 ? 120  SER H C     1 
ATOM   6069  O  O     . SER H  4 120 ? -22.986 -49.477 12.251 1.00 105.22 ? 120  SER H O     1 
ATOM   6070  C  CB    . SER H  4 120 ? -20.626 -49.383 13.680 1.00 103.61 ? 120  SER H CB    1 
ATOM   6071  O  OG    . SER H  4 120 ? -19.343 -49.188 14.249 1.00 103.92 ? 120  SER H OG    1 
ATOM   6072  N  N     . ALA H  4 121 ? -22.960 -47.298 11.685 1.00 106.12 ? 121  ALA H N     1 
ATOM   6073  C  CA    . ALA H  4 121 ? -24.242 -47.357 11.000 1.00 107.59 ? 121  ALA H CA    1 
ATOM   6074  C  C     . ALA H  4 121 ? -24.219 -46.431 9.786  1.00 108.60 ? 121  ALA H C     1 
ATOM   6075  O  O     . ALA H  4 121 ? -23.855 -45.250 9.901  1.00 108.70 ? 121  ALA H O     1 
ATOM   6076  C  CB    . ALA H  4 121 ? -25.392 -47.006 11.952 1.00 107.38 ? 121  ALA H CB    1 
ATOM   6077  N  N     . LYS H  4 122 ? -24.586 -46.984 8.625  1.00 109.77 ? 122  LYS H N     1 
ATOM   6078  C  CA    . LYS H  4 122 ? -24.641 -46.213 7.373  1.00 110.76 ? 122  LYS H CA    1 
ATOM   6079  C  C     . LYS H  4 122 ? -25.748 -45.154 7.420  1.00 111.10 ? 122  LYS H C     1 
ATOM   6080  O  O     . LYS H  4 122 ? -25.495 -43.999 7.797  1.00 111.25 ? 122  LYS H O     1 
ATOM   6081  C  CB    . LYS H  4 122 ? -24.807 -47.129 6.144  1.00 110.96 ? 122  LYS H CB    1 
ATOM   6082  C  CG    . LYS H  4 122 ? -25.708 -48.345 6.365  1.00 111.92 ? 122  LYS H CG    1 
ATOM   6083  C  CD    . LYS H  4 122 ? -26.371 -48.811 5.069  1.00 113.49 ? 122  LYS H CD    1 
ATOM   6084  C  CE    . LYS H  4 122 ? -27.316 -49.991 5.338  1.00 114.00 ? 122  LYS H CE    1 
ATOM   6085  N  NZ    . LYS H  4 122 ? -28.333 -50.183 4.259  1.00 113.88 ? 122  LYS H NZ    1 
ATOM   6086  O  OXT   . LYS H  4 122 ? -26.919 -45.420 7.103  1.00 111.39 ? 122  LYS H OXT   1 
ATOM   6087  O  "O5'" . DA  I  5 1   ? 1.656   -0.489  95.052 1.00 162.24 ? -72  DA  I "O5'" 1 
ATOM   6088  C  "C5'" . DA  I  5 1   ? 2.715   -0.486  94.095 1.00 162.31 ? -72  DA  I "C5'" 1 
ATOM   6089  C  "C4'" . DA  I  5 1   ? 3.980   -1.141  94.650 1.00 162.24 ? -72  DA  I "C4'" 1 
ATOM   6090  O  "O4'" . DA  I  5 1   ? 3.712   -2.551  94.926 1.00 162.32 ? -72  DA  I "O4'" 1 
ATOM   6091  C  "C3'" . DA  I  5 1   ? 5.192   -1.076  93.711 1.00 161.92 ? -72  DA  I "C3'" 1 
ATOM   6092  O  "O3'" . DA  I  5 1   ? 6.373   -0.607  94.417 1.00 161.50 ? -72  DA  I "O3'" 1 
ATOM   6093  C  "C2'" . DA  I  5 1   ? 5.303   -2.507  93.188 1.00 162.19 ? -72  DA  I "C2'" 1 
ATOM   6094  C  "C1'" . DA  I  5 1   ? 4.676   -3.363  94.282 1.00 162.37 ? -72  DA  I "C1'" 1 
ATOM   6095  N  N9    . DA  I  5 1   ? 4.033   -4.547  93.711 1.00 162.46 ? -72  DA  I N9    1 
ATOM   6096  C  C8    . DA  I  5 1   ? 2.815   -4.604  93.086 1.00 162.55 ? -72  DA  I C8    1 
ATOM   6097  N  N7    . DA  I  5 1   ? 2.489   -5.802  92.656 1.00 162.65 ? -72  DA  I N7    1 
ATOM   6098  C  C5    . DA  I  5 1   ? 3.572   -6.586  93.017 1.00 162.47 ? -72  DA  I C5    1 
ATOM   6099  C  C6    . DA  I  5 1   ? 3.847   -7.960  92.846 1.00 162.38 ? -72  DA  I C6    1 
ATOM   6100  N  N6    . DA  I  5 1   ? 3.003   -8.802  92.242 1.00 162.36 ? -72  DA  I N6    1 
ATOM   6101  N  N1    . DA  I  5 1   ? 5.021   -8.434  93.322 1.00 162.41 ? -72  DA  I N1    1 
ATOM   6102  C  C2    . DA  I  5 1   ? 5.861   -7.584  93.935 1.00 162.45 ? -72  DA  I C2    1 
ATOM   6103  N  N3    . DA  I  5 1   ? 5.715   -6.273  94.149 1.00 162.45 ? -72  DA  I N3    1 
ATOM   6104  C  C4    . DA  I  5 1   ? 4.538   -5.829  93.665 1.00 162.45 ? -72  DA  I C4    1 
ATOM   6105  P  P     . DT  I  5 2   ? 7.901   -0.993  94.064 1.00 161.32 ? -71  DT  I P     1 
ATOM   6106  O  OP1   . DT  I  5 2   ? 8.783   0.027   94.683 1.00 161.21 ? -71  DT  I OP1   1 
ATOM   6107  O  OP2   . DT  I  5 2   ? 8.030   -1.266  92.609 1.00 161.21 ? -71  DT  I OP2   1 
ATOM   6108  O  "O5'" . DT  I  5 2   ? 8.078   -2.370  94.870 1.00 160.88 ? -71  DT  I "O5'" 1 
ATOM   6109  C  "C5'" . DT  I  5 2   ? 9.207   -2.615  95.707 1.00 159.75 ? -71  DT  I "C5'" 1 
ATOM   6110  C  "C4'" . DT  I  5 2   ? 10.178  -3.544  94.999 1.00 158.97 ? -71  DT  I "C4'" 1 
ATOM   6111  O  "O4'" . DT  I  5 2   ? 9.438   -4.623  94.372 1.00 159.13 ? -71  DT  I "O4'" 1 
ATOM   6112  C  "C3'" . DT  I  5 2   ? 11.014  -2.886  93.903 1.00 158.15 ? -71  DT  I "C3'" 1 
ATOM   6113  O  "O3'" . DT  I  5 2   ? 12.416  -3.026  94.216 1.00 156.76 ? -71  DT  I "O3'" 1 
ATOM   6114  C  "C2'" . DT  I  5 2   ? 10.513  -3.489  92.584 1.00 158.45 ? -71  DT  I "C2'" 1 
ATOM   6115  C  "C1'" . DT  I  5 2   ? 9.885   -4.809  93.037 1.00 159.15 ? -71  DT  I "C1'" 1 
ATOM   6116  N  N1    . DT  I  5 2   ? 8.739   -5.361  92.214 1.00 159.24 ? -71  DT  I N1    1 
ATOM   6117  C  C2    . DT  I  5 2   ? 8.574   -6.738  92.146 1.00 159.30 ? -71  DT  I C2    1 
ATOM   6118  O  O2    . DT  I  5 2   ? 9.304   -7.544  92.703 1.00 159.33 ? -71  DT  I O2    1 
ATOM   6119  N  N3    . DT  I  5 2   ? 7.509   -7.154  91.384 1.00 159.37 ? -71  DT  I N3    1 
ATOM   6120  C  C4    . DT  I  5 2   ? 6.602   -6.359  90.703 1.00 159.31 ? -71  DT  I C4    1 
ATOM   6121  O  O4    . DT  I  5 2   ? 5.683   -6.845  90.051 1.00 159.23 ? -71  DT  I O4    1 
ATOM   6122  C  C5    . DT  I  5 2   ? 6.825   -4.933  90.814 1.00 159.37 ? -71  DT  I C5    1 
ATOM   6123  C  C7    . DT  I  5 2   ? 5.913   -3.965  90.114 1.00 159.29 ? -71  DT  I C7    1 
ATOM   6124  C  C6    . DT  I  5 2   ? 7.864   -4.508  91.553 1.00 159.30 ? -71  DT  I C6    1 
ATOM   6125  P  P     . DC  I  5 3   ? 13.423  -4.159  93.680 1.00 155.89 ? -70  DC  I P     1 
ATOM   6126  O  OP1   . DC  I  5 3   ? 14.683  -3.982  94.436 1.00 156.07 ? -70  DC  I OP1   1 
ATOM   6127  O  OP2   . DC  I  5 3   ? 13.452  -4.065  92.201 1.00 155.99 ? -70  DC  I OP2   1 
ATOM   6128  O  "O5'" . DC  I  5 3   ? 12.775  -5.575  94.096 1.00 154.79 ? -70  DC  I "O5'" 1 
ATOM   6129  C  "C5'" . DC  I  5 3   ? 13.578  -6.716  94.490 1.00 152.42 ? -70  DC  I "C5'" 1 
ATOM   6130  C  "C4'" . DC  I  5 3   ? 13.642  -7.839  93.451 1.00 150.60 ? -70  DC  I "C4'" 1 
ATOM   6131  O  "O4'" . DC  I  5 3   ? 12.390  -7.975  92.711 1.00 150.54 ? -70  DC  I "O4'" 1 
ATOM   6132  C  "C3'" . DC  I  5 3   ? 14.737  -7.699  92.389 1.00 149.08 ? -70  DC  I "C3'" 1 
ATOM   6133  O  "O3'" . DC  I  5 3   ? 15.341  -8.976  92.138 1.00 146.25 ? -70  DC  I "O3'" 1 
ATOM   6134  C  "C2'" . DC  I  5 3   ? 13.959  -7.184  91.179 1.00 149.58 ? -70  DC  I "C2'" 1 
ATOM   6135  C  "C1'" . DC  I  5 3   ? 12.711  -8.052  91.328 1.00 150.36 ? -70  DC  I "C1'" 1 
ATOM   6136  N  N1    . DC  I  5 3   ? 11.523  -7.701  90.450 1.00 150.42 ? -70  DC  I N1    1 
ATOM   6137  C  C2    . DC  I  5 3   ? 10.627  -8.725  90.093 1.00 150.24 ? -70  DC  I C2    1 
ATOM   6138  O  O2    . DC  I  5 3   ? 10.825  -9.878  90.508 1.00 150.18 ? -70  DC  I O2    1 
ATOM   6139  N  N3    . DC  I  5 3   ? 9.561   -8.418  89.304 1.00 150.25 ? -70  DC  I N3    1 
ATOM   6140  C  C4    . DC  I  5 3   ? 9.375   -7.164  88.870 1.00 150.29 ? -70  DC  I C4    1 
ATOM   6141  N  N4    . DC  I  5 3   ? 8.310   -6.927  88.098 1.00 150.16 ? -70  DC  I N4    1 
ATOM   6142  C  C5    . DC  I  5 3   ? 10.274  -6.104  89.214 1.00 150.23 ? -70  DC  I C5    1 
ATOM   6143  C  C6    . DC  I  5 3   ? 11.321  -6.417  89.995 1.00 150.38 ? -70  DC  I C6    1 
ATOM   6144  P  P     . DA  I  5 4   ? 16.587  -9.137  91.136 1.00 144.30 ? -69  DA  I P     1 
ATOM   6145  O  OP1   . DA  I  5 4   ? 17.780  -8.645  91.857 1.00 144.26 ? -69  DA  I OP1   1 
ATOM   6146  O  OP2   . DA  I  5 4   ? 16.239  -8.547  89.821 1.00 144.18 ? -69  DA  I OP2   1 
ATOM   6147  O  "O5'" . DA  I  5 4   ? 16.746  -10.723 90.926 1.00 142.00 ? -69  DA  I "O5'" 1 
ATOM   6148  C  "C5'" . DA  I  5 4   ? 15.633  -11.624 90.840 1.00 137.99 ? -69  DA  I "C5'" 1 
ATOM   6149  C  "C4'" . DA  I  5 4   ? 15.316  -12.081 89.419 1.00 134.84 ? -69  DA  I "C4'" 1 
ATOM   6150  O  "O4'" . DA  I  5 4   ? 14.282  -11.243 88.848 1.00 134.28 ? -69  DA  I "O4'" 1 
ATOM   6151  C  "C3'" . DA  I  5 4   ? 16.436  -12.095 88.381 1.00 132.98 ? -69  DA  I "C3'" 1 
ATOM   6152  O  "O3'" . DA  I  5 4   ? 16.266  -13.283 87.623 1.00 130.35 ? -69  DA  I "O3'" 1 
ATOM   6153  C  "C2'" . DA  I  5 4   ? 16.145  -10.860 87.526 1.00 133.14 ? -69  DA  I "C2'" 1 
ATOM   6154  C  "C1'" . DA  I  5 4   ? 14.624  -10.946 87.509 1.00 133.63 ? -69  DA  I "C1'" 1 
ATOM   6155  N  N9    . DA  I  5 4   ? 13.859  -9.753  87.160 1.00 133.71 ? -69  DA  I N9    1 
ATOM   6156  C  C8    . DA  I  5 4   ? 14.217  -8.438  87.282 1.00 133.56 ? -69  DA  I C8    1 
ATOM   6157  N  N7    . DA  I  5 4   ? 13.282  -7.597  86.902 1.00 133.43 ? -69  DA  I N7    1 
ATOM   6158  C  C5    . DA  I  5 4   ? 12.231  -8.413  86.513 1.00 133.66 ? -69  DA  I C5    1 
ATOM   6159  C  C6    . DA  I  5 4   ? 10.937  -8.145  86.003 1.00 133.59 ? -69  DA  I C6    1 
ATOM   6160  N  N6    . DA  I  5 4   ? 10.464  -6.913  85.793 1.00 133.50 ? -69  DA  I N6    1 
ATOM   6161  N  N1    . DA  I  5 4   ? 10.136  -9.198  85.718 1.00 133.48 ? -69  DA  I N1    1 
ATOM   6162  C  C2    . DA  I  5 4   ? 10.605  -10.437 85.922 1.00 133.45 ? -69  DA  I C2    1 
ATOM   6163  N  N3    . DA  I  5 4   ? 11.795  -10.815 86.393 1.00 133.50 ? -69  DA  I N3    1 
ATOM   6164  C  C4    . DA  I  5 4   ? 12.571  -9.748  86.671 1.00 133.76 ? -69  DA  I C4    1 
ATOM   6165  P  P     . DA  I  5 5   ? 17.506  -14.083 87.002 1.00 128.33 ? -68  DA  I P     1 
ATOM   6166  O  OP1   . DA  I  5 5   ? 18.081  -14.899 88.104 1.00 128.63 ? -68  DA  I OP1   1 
ATOM   6167  O  OP2   . DA  I  5 5   ? 18.334  -13.108 86.245 1.00 128.45 ? -68  DA  I OP2   1 
ATOM   6168  O  "O5'" . DA  I  5 5   ? 16.845  -15.066 85.910 1.00 125.79 ? -68  DA  I "O5'" 1 
ATOM   6169  C  "C5'" . DA  I  5 5   ? 15.605  -15.762 86.145 1.00 121.58 ? -68  DA  I "C5'" 1 
ATOM   6170  C  "C4'" . DA  I  5 5   ? 14.708  -15.758 84.907 1.00 118.46 ? -68  DA  I "C4'" 1 
ATOM   6171  O  "O4'" . DA  I  5 5   ? 13.996  -14.504 84.772 1.00 117.24 ? -68  DA  I "O4'" 1 
ATOM   6172  C  "C3'" . DA  I  5 5   ? 15.385  -15.995 83.558 1.00 116.75 ? -68  DA  I "C3'" 1 
ATOM   6173  O  "O3'" . DA  I  5 5   ? 14.564  -16.854 82.803 1.00 114.87 ? -68  DA  I "O3'" 1 
ATOM   6174  C  "C2'" . DA  I  5 5   ? 15.447  -14.623 82.901 1.00 116.38 ? -68  DA  I "C2'" 1 
ATOM   6175  C  "C1'" . DA  I  5 5   ? 14.196  -13.981 83.479 1.00 117.06 ? -68  DA  I "C1'" 1 
ATOM   6176  N  N9    . DA  I  5 5   ? 14.321  -12.546 83.630 1.00 117.24 ? -68  DA  I N9    1 
ATOM   6177  C  C8    . DA  I  5 5   ? 15.378  -11.850 84.141 1.00 117.53 ? -68  DA  I C8    1 
ATOM   6178  N  N7    . DA  I  5 5   ? 15.191  -10.553 84.150 1.00 117.84 ? -68  DA  I N7    1 
ATOM   6179  C  C5    . DA  I  5 5   ? 13.925  -10.397 83.609 1.00 117.53 ? -68  DA  I C5    1 
ATOM   6180  C  C6    . DA  I  5 5   ? 13.128  -9.264  83.336 1.00 117.28 ? -68  DA  I C6    1 
ATOM   6181  N  N6    . DA  I  5 5   ? 13.510  -8.015  83.590 1.00 117.36 ? -68  DA  I N6    1 
ATOM   6182  N  N1    . DA  I  5 5   ? 11.909  -9.456  82.793 1.00 117.40 ? -68  DA  I N1    1 
ATOM   6183  C  C2    . DA  I  5 5   ? 11.509  -10.713 82.536 1.00 117.65 ? -68  DA  I C2    1 
ATOM   6184  N  N3    . DA  I  5 5   ? 12.165  -11.856 82.745 1.00 117.62 ? -68  DA  I N3    1 
ATOM   6185  C  C4    . DA  I  5 5   ? 13.375  -11.622 83.286 1.00 117.52 ? -68  DA  I C4    1 
ATOM   6186  P  P     . DT  I  5 6   ? 15.175  -17.822 81.686 1.00 113.26 ? -67  DT  I P     1 
ATOM   6187  O  OP1   . DT  I  5 6   ? 14.848  -19.202 82.119 1.00 112.88 ? -67  DT  I OP1   1 
ATOM   6188  O  OP2   . DT  I  5 6   ? 16.579  -17.421 81.411 1.00 112.66 ? -67  DT  I OP2   1 
ATOM   6189  O  "O5'" . DT  I  5 6   ? 14.328  -17.496 80.357 1.00 111.98 ? -67  DT  I "O5'" 1 
ATOM   6190  C  "C5'" . DT  I  5 6   ? 13.024  -16.884 80.380 1.00 109.03 ? -67  DT  I "C5'" 1 
ATOM   6191  C  "C4'" . DT  I  5 6   ? 12.849  -15.948 79.196 1.00 107.21 ? -67  DT  I "C4'" 1 
ATOM   6192  O  "O4'" . DT  I  5 6   ? 12.817  -14.580 79.682 1.00 107.20 ? -67  DT  I "O4'" 1 
ATOM   6193  C  "C3'" . DT  I  5 6   ? 13.967  -15.987 78.143 1.00 106.46 ? -67  DT  I "C3'" 1 
ATOM   6194  O  "O3'" . DT  I  5 6   ? 13.494  -15.644 76.849 1.00 104.90 ? -67  DT  I "O3'" 1 
ATOM   6195  C  "C2'" . DT  I  5 6   ? 14.858  -14.843 78.602 1.00 107.26 ? -67  DT  I "C2'" 1 
ATOM   6196  C  "C1'" . DT  I  5 6   ? 13.723  -13.856 78.861 1.00 107.84 ? -67  DT  I "C1'" 1 
ATOM   6197  N  N1    . DT  I  5 6   ? 14.106  -12.523 79.436 1.00 107.72 ? -67  DT  I N1    1 
ATOM   6198  C  C2    . DT  I  5 6   ? 13.186  -11.495 79.369 1.00 107.35 ? -67  DT  I C2    1 
ATOM   6199  O  O2    . DT  I  5 6   ? 12.077  -11.602 78.887 1.00 107.61 ? -67  DT  I O2    1 
ATOM   6200  N  N3    . DT  I  5 6   ? 13.608  -10.311 79.898 1.00 107.53 ? -67  DT  I N3    1 
ATOM   6201  C  C4    . DT  I  5 6   ? 14.837  -10.053 80.472 1.00 108.16 ? -67  DT  I C4    1 
ATOM   6202  O  O4    . DT  I  5 6   ? 15.093  -8.937  80.914 1.00 108.27 ? -67  DT  I O4    1 
ATOM   6203  C  C5    . DT  I  5 6   ? 15.765  -11.170 80.512 1.00 108.00 ? -67  DT  I C5    1 
ATOM   6204  C  C7    . DT  I  5 6   ? 17.137  -11.025 81.107 1.00 107.68 ? -67  DT  I C7    1 
ATOM   6205  C  C6    . DT  I  5 6   ? 15.361  -12.338 79.994 1.00 107.83 ? -67  DT  I C6    1 
ATOM   6206  P  P     . DA  I  5 7   ? 12.866  -16.666 75.787 1.00 103.52 ? -66  DA  I P     1 
ATOM   6207  O  OP1   . DA  I  5 7   ? 12.075  -17.697 76.494 1.00 102.87 ? -66  DA  I OP1   1 
ATOM   6208  O  OP2   . DA  I  5 7   ? 13.932  -17.071 74.840 1.00 103.41 ? -66  DA  I OP2   1 
ATOM   6209  O  "O5'" . DA  I  5 7   ? 11.863  -15.668 75.023 1.00 103.29 ? -66  DA  I "O5'" 1 
ATOM   6210  C  "C5'" . DA  I  5 7   ? 10.651  -15.258 75.669 1.00 101.92 ? -66  DA  I "C5'" 1 
ATOM   6211  C  "C4'" . DA  I  5 7   ? 10.009  -14.017 75.061 1.00 101.69 ? -66  DA  I "C4'" 1 
ATOM   6212  O  "O4'" . DA  I  5 7   ? 10.564  -12.799 75.616 1.00 102.07 ? -66  DA  I "O4'" 1 
ATOM   6213  C  "C3'" . DA  I  5 7   ? 10.092  -13.828 73.553 1.00 101.93 ? -66  DA  I "C3'" 1 
ATOM   6214  O  "O3'" . DA  I  5 7   ? 8.847   -13.199 73.187 1.00 102.00 ? -66  DA  I "O3'" 1 
ATOM   6215  C  "C2'" . DA  I  5 7   ? 11.331  -12.942 73.402 1.00 101.55 ? -66  DA  I "C2'" 1 
ATOM   6216  C  "C1'" . DA  I  5 7   ? 11.149  -12.009 74.597 1.00 101.42 ? -66  DA  I "C1'" 1 
ATOM   6217  N  N9    . DA  I  5 7   ? 12.369  -11.423 75.155 1.00 101.35 ? -66  DA  I N9    1 
ATOM   6218  C  C8    . DA  I  5 7   ? 13.563  -12.055 75.356 1.00 100.95 ? -66  DA  I C8    1 
ATOM   6219  N  N7    . DA  I  5 7   ? 14.480  -11.282 75.882 1.00 101.17 ? -66  DA  I N7    1 
ATOM   6220  C  C5    . DA  I  5 7   ? 13.853  -10.058 76.046 1.00 101.33 ? -66  DA  I C5    1 
ATOM   6221  C  C6    . DA  I  5 7   ? 14.288  -8.814  76.568 1.00 101.12 ? -66  DA  I C6    1 
ATOM   6222  N  N6    . DA  I  5 7   ? 15.524  -8.620  77.031 1.00 101.24 ? -66  DA  I N6    1 
ATOM   6223  N  N1    . DA  I  5 7   ? 13.411  -7.779  76.602 1.00 100.91 ? -66  DA  I N1    1 
ATOM   6224  C  C2    . DA  I  5 7   ? 12.173  -7.980  76.130 1.00 101.00 ? -66  DA  I C2    1 
ATOM   6225  N  N3    . DA  I  5 7   ? 11.641  -9.103  75.629 1.00 101.59 ? -66  DA  I N3    1 
ATOM   6226  C  C4    . DA  I  5 7   ? 12.540  -10.123 75.608 1.00 101.74 ? -66  DA  I C4    1 
ATOM   6227  P  P     . DT  I  5 8   ? 8.556   -12.545 71.762 1.00 100.94 ? -65  DT  I P     1 
ATOM   6228  O  OP1   . DT  I  5 8   ? 7.101   -12.369 71.626 1.00 101.03 ? -65  DT  I OP1   1 
ATOM   6229  O  OP2   . DT  I  5 8   ? 9.351   -13.264 70.739 1.00 100.97 ? -65  DT  I OP2   1 
ATOM   6230  O  "O5'" . DT  I  5 8   ? 9.130   -11.083 71.961 1.00 103.34 ? -65  DT  I "O5'" 1 
ATOM   6231  C  "C5'" . DT  I  5 8   ? 8.440   -10.205 72.840 1.00 107.10 ? -65  DT  I "C5'" 1 
ATOM   6232  C  "C4'" . DT  I  5 8   ? 8.811   -8.785  72.482 1.00 109.50 ? -65  DT  I "C4'" 1 
ATOM   6233  O  "O4'" . DT  I  5 8   ? 10.134  -8.488  72.998 1.00 109.90 ? -65  DT  I "O4'" 1 
ATOM   6234  C  "C3'" . DT  I  5 8   ? 8.884   -8.534  70.984 1.00 111.31 ? -65  DT  I "C3'" 1 
ATOM   6235  O  "O3'" . DT  I  5 8   ? 8.288   -7.265  70.764 1.00 115.13 ? -65  DT  I "O3'" 1 
ATOM   6236  C  "C2'" . DT  I  5 8   ? 10.385  -8.575  70.682 1.00 109.96 ? -65  DT  I "C2'" 1 
ATOM   6237  C  "C1'" . DT  I  5 8   ? 10.934  -7.965  71.963 1.00 108.93 ? -65  DT  I "C1'" 1 
ATOM   6238  N  N1    . DT  I  5 8   ? 12.360  -8.253  72.270 1.00 108.35 ? -65  DT  I N1    1 
ATOM   6239  C  C2    . DT  I  5 8   ? 13.138  -7.228  72.776 1.00 108.37 ? -65  DT  I C2    1 
ATOM   6240  O  O2    . DT  I  5 8   ? 12.714  -6.099  72.981 1.00 108.37 ? -65  DT  I O2    1 
ATOM   6241  N  N3    . DT  I  5 8   ? 14.445  -7.582  73.032 1.00 108.39 ? -65  DT  I N3    1 
ATOM   6242  C  C4    . DT  I  5 8   ? 15.028  -8.831  72.838 1.00 108.75 ? -65  DT  I C4    1 
ATOM   6243  O  O4    . DT  I  5 8   ? 16.209  -9.052  73.090 1.00 108.67 ? -65  DT  I O4    1 
ATOM   6244  C  C5    . DT  I  5 8   ? 14.155  -9.855  72.305 1.00 108.59 ? -65  DT  I C5    1 
ATOM   6245  C  C7    . DT  I  5 8   ? 14.675  -11.241 72.048 1.00 108.37 ? -65  DT  I C7    1 
ATOM   6246  C  C6    . DT  I  5 8   ? 12.878  -9.519  72.054 1.00 108.44 ? -65  DT  I C6    1 
ATOM   6247  P  P     . DC  I  5 9   ? 7.890   -6.700  69.319 1.00 117.90 ? -64  DC  I P     1 
ATOM   6248  O  OP1   . DC  I  5 9   ? 6.442   -6.363  69.359 1.00 117.50 ? -64  DC  I OP1   1 
ATOM   6249  O  OP2   . DC  I  5 9   ? 8.446   -7.579  68.255 1.00 117.05 ? -64  DC  I OP2   1 
ATOM   6250  O  "O5'" . DC  I  5 9   ? 8.717   -5.329  69.297 1.00 120.51 ? -64  DC  I "O5'" 1 
ATOM   6251  C  "C5'" . DC  I  5 9   ? 8.731   -4.429  70.416 1.00 123.79 ? -64  DC  I "C5'" 1 
ATOM   6252  C  "C4'" . DC  I  5 9   ? 9.926   -3.508  70.268 1.00 126.49 ? -64  DC  I "C4'" 1 
ATOM   6253  O  "O4'" . DC  I  5 9   ? 11.122  -4.203  70.723 1.00 126.78 ? -64  DC  I "O4'" 1 
ATOM   6254  C  "C3'" . DC  I  5 9   ? 10.173  -3.092  68.817 1.00 128.25 ? -64  DC  I "C3'" 1 
ATOM   6255  O  "O3'" . DC  I  5 9   ? 10.150  -1.653  68.657 1.00 131.49 ? -64  DC  I "O3'" 1 
ATOM   6256  C  "C2'" . DC  I  5 9   ? 11.517  -3.734  68.451 1.00 127.19 ? -64  DC  I "C2'" 1 
ATOM   6257  C  "C1'" . DC  I  5 9   ? 12.177  -3.977  69.808 1.00 126.09 ? -64  DC  I "C1'" 1 
ATOM   6258  N  N1    . DC  I  5 9   ? 13.146  -5.136  69.825 1.00 125.91 ? -64  DC  I N1    1 
ATOM   6259  C  C2    . DC  I  5 9   ? 14.418  -4.980  70.411 1.00 125.78 ? -64  DC  I C2    1 
ATOM   6260  O  O2    . DC  I  5 9   ? 14.744  -3.897  70.922 1.00 125.38 ? -64  DC  I O2    1 
ATOM   6261  N  N3    . DC  I  5 9   ? 15.276  -6.039  70.404 1.00 125.65 ? -64  DC  I N3    1 
ATOM   6262  C  C4    . DC  I  5 9   ? 14.921  -7.202  69.846 1.00 125.37 ? -64  DC  I C4    1 
ATOM   6263  N  N4    . DC  I  5 9   ? 15.816  -8.195  69.876 1.00 125.31 ? -64  DC  I N4    1 
ATOM   6264  C  C5    . DC  I  5 9   ? 13.637  -7.384  69.242 1.00 125.12 ? -64  DC  I C5    1 
ATOM   6265  C  C6    . DC  I  5 9   ? 12.799  -6.337  69.254 1.00 125.52 ? -64  DC  I C6    1 
ATOM   6266  P  P     . DC  I  5 10  ? 9.610   -0.952  67.308 1.00 133.56 ? -63  DC  I P     1 
ATOM   6267  O  OP1   . DC  I  5 10  ? 8.574   0.043   67.721 1.00 133.22 ? -63  DC  I OP1   1 
ATOM   6268  O  OP2   . DC  I  5 10  ? 9.289   -1.999  66.289 1.00 132.93 ? -63  DC  I OP2   1 
ATOM   6269  O  "O5'" . DC  I  5 10  ? 10.905  -0.163  66.769 1.00 134.80 ? -63  DC  I "O5'" 1 
ATOM   6270  C  "C5'" . DC  I  5 10  ? 12.108  -0.899  66.497 1.00 137.13 ? -63  DC  I "C5'" 1 
ATOM   6271  C  "C4'" . DC  I  5 10  ? 13.281  -0.050  66.949 1.00 139.33 ? -63  DC  I "C4'" 1 
ATOM   6272  O  "O4'" . DC  I  5 10  ? 14.143  -0.775  67.869 1.00 139.19 ? -63  DC  I "O4'" 1 
ATOM   6273  C  "C3'" . DC  I  5 10  ? 14.155  0.426   65.799 1.00 141.25 ? -63  DC  I "C3'" 1 
ATOM   6274  O  "O3'" . DC  I  5 10  ? 14.546  1.776   66.011 1.00 143.87 ? -63  DC  I "O3'" 1 
ATOM   6275  C  "C2'" . DC  I  5 10  ? 15.355  -0.521  65.829 1.00 140.40 ? -63  DC  I "C2'" 1 
ATOM   6276  C  "C1'" . DC  I  5 10  ? 15.421  -0.993  67.283 1.00 139.56 ? -63  DC  I "C1'" 1 
ATOM   6277  N  N1    . DC  I  5 10  ? 15.785  -2.446  67.363 1.00 139.48 ? -63  DC  I N1    1 
ATOM   6278  C  C2    . DC  I  5 10  ? 17.061  -2.834  67.830 1.00 139.40 ? -63  DC  I C2    1 
ATOM   6279  O  O2    . DC  I  5 10  ? 17.892  -1.985  68.192 1.00 139.04 ? -63  DC  I O2    1 
ATOM   6280  N  N3    . DC  I  5 10  ? 17.355  -4.161  67.879 1.00 139.39 ? -63  DC  I N3    1 
ATOM   6281  C  C4    . DC  I  5 10  ? 16.453  -5.067  67.484 1.00 139.44 ? -63  DC  I C4    1 
ATOM   6282  N  N4    . DC  I  5 10  ? 16.801  -6.357  67.553 1.00 139.49 ? -63  DC  I N4    1 
ATOM   6283  C  C5    . DC  I  5 10  ? 15.157  -4.695  67.001 1.00 139.23 ? -63  DC  I C5    1 
ATOM   6284  C  C6    . DC  I  5 10  ? 14.872  -3.388  66.957 1.00 139.15 ? -63  DC  I C6    1 
ATOM   6285  P  P     . DA  I  5 11  ? 15.073  2.678   64.796 1.00 145.31 ? -62  DA  I P     1 
ATOM   6286  O  OP1   . DA  I  5 11  ? 13.976  3.622   64.491 1.00 145.28 ? -62  DA  I OP1   1 
ATOM   6287  O  OP2   . DA  I  5 11  ? 15.609  1.823   63.705 1.00 145.31 ? -62  DA  I OP2   1 
ATOM   6288  O  "O5'" . DA  I  5 11  ? 16.312  3.450   65.467 1.00 146.99 ? -62  DA  I "O5'" 1 
ATOM   6289  C  "C5'" . DA  I  5 11  ? 17.190  2.788   66.399 1.00 149.83 ? -62  DA  I "C5'" 1 
ATOM   6290  C  "C4'" . DA  I  5 11  ? 18.580  2.496   65.840 1.00 151.89 ? -62  DA  I "C4'" 1 
ATOM   6291  O  "O4'" . DA  I  5 11  ? 18.899  1.090   66.014 1.00 152.51 ? -62  DA  I "O4'" 1 
ATOM   6292  C  "C3'" . DA  I  5 11  ? 18.807  2.815   64.365 1.00 153.36 ? -62  DA  I "C3'" 1 
ATOM   6293  O  "O3'" . DA  I  5 11  ? 19.998  3.575   64.200 1.00 155.03 ? -62  DA  I "O3'" 1 
ATOM   6294  C  "C2'" . DA  I  5 11  ? 18.927  1.453   63.690 1.00 153.48 ? -62  DA  I "C2'" 1 
ATOM   6295  C  "C1'" . DA  I  5 11  ? 19.427  0.555   64.814 1.00 153.31 ? -62  DA  I "C1'" 1 
ATOM   6296  N  N9    . DA  I  5 11  ? 19.006  -0.839  64.630 1.00 153.44 ? -62  DA  I N9    1 
ATOM   6297  C  C8    . DA  I  5 11  ? 17.777  -1.278  64.215 1.00 153.33 ? -62  DA  I C8    1 
ATOM   6298  N  N7    . DA  I  5 11  ? 17.666  -2.581  64.129 1.00 153.34 ? -62  DA  I N7    1 
ATOM   6299  C  C5    . DA  I  5 11  ? 18.917  -3.040  64.506 1.00 153.49 ? -62  DA  I C5    1 
ATOM   6300  C  C6    . DA  I  5 11  ? 19.461  -4.342  64.618 1.00 153.61 ? -62  DA  I C6    1 
ATOM   6301  N  N6    . DA  I  5 11  ? 18.761  -5.452  64.347 1.00 153.58 ? -62  DA  I N6    1 
ATOM   6302  N  N1    . DA  I  5 11  ? 20.752  -4.461  65.020 1.00 153.45 ? -62  DA  I N1    1 
ATOM   6303  C  C2    . DA  I  5 11  ? 21.452  -3.348  65.288 1.00 153.39 ? -62  DA  I C2    1 
ATOM   6304  N  N3    . DA  I  5 11  ? 21.048  -2.075  65.217 1.00 153.54 ? -62  DA  I N3    1 
ATOM   6305  C  C4    . DA  I  5 11  ? 19.761  -1.983  64.814 1.00 153.53 ? -62  DA  I C4    1 
ATOM   6306  P  P     . DC  I  5 12  ? 20.351  4.267   62.793 1.00 156.23 ? -61  DC  I P     1 
ATOM   6307  O  OP1   . DC  I  5 12  ? 20.952  5.585   63.114 1.00 156.47 ? -61  DC  I OP1   1 
ATOM   6308  O  OP2   . DC  I  5 12  ? 19.185  4.186   61.873 1.00 155.34 ? -61  DC  I OP2   1 
ATOM   6309  O  "O5'" . DC  I  5 12  ? 21.517  3.309   62.257 1.00 157.21 ? -61  DC  I "O5'" 1 
ATOM   6310  C  "C5'" . DC  I  5 12  ? 22.732  3.229   63.003 1.00 158.80 ? -61  DC  I "C5'" 1 
ATOM   6311  C  "C4'" . DC  I  5 12  ? 23.441  1.910   62.761 1.00 160.04 ? -61  DC  I "C4'" 1 
ATOM   6312  O  "O4'" . DC  I  5 12  ? 22.514  0.797   62.899 1.00 160.20 ? -61  DC  I "O4'" 1 
ATOM   6313  C  "C3'" . DC  I  5 12  ? 24.089  1.775   61.383 1.00 160.81 ? -61  DC  I "C3'" 1 
ATOM   6314  O  "O3'" . DC  I  5 12  ? 25.494  1.522   61.584 1.00 162.26 ? -61  DC  I "O3'" 1 
ATOM   6315  C  "C2'" . DC  I  5 12  ? 23.294  0.638   60.733 1.00 160.54 ? -61  DC  I "C2'" 1 
ATOM   6316  C  "C1'" . DC  I  5 12  ? 22.925  -0.181  61.966 1.00 160.04 ? -61  DC  I "C1'" 1 
ATOM   6317  N  N1    . DC  I  5 12  ? 21.874  -1.246  61.761 1.00 159.72 ? -61  DC  I N1    1 
ATOM   6318  C  C2    . DC  I  5 12  ? 22.218  -2.599  61.944 1.00 159.56 ? -61  DC  I C2    1 
ATOM   6319  O  O2    . DC  I  5 12  ? 23.373  -2.905  62.274 1.00 159.63 ? -61  DC  I O2    1 
ATOM   6320  N  N3    . DC  I  5 12  ? 21.266  -3.552  61.755 1.00 159.60 ? -61  DC  I N3    1 
ATOM   6321  C  C4    . DC  I  5 12  ? 20.022  -3.205  61.400 1.00 159.65 ? -61  DC  I C4    1 
ATOM   6322  N  N4    . DC  I  5 12  ? 19.125  -4.183  61.227 1.00 159.67 ? -61  DC  I N4    1 
ATOM   6323  C  C5    . DC  I  5 12  ? 19.649  -1.838  61.207 1.00 159.45 ? -61  DC  I C5    1 
ATOM   6324  C  C6    . DC  I  5 12  ? 20.595  -0.905  61.395 1.00 159.57 ? -61  DC  I C6    1 
ATOM   6325  P  P     . DC  I  5 13  ? 26.420  0.564   60.684 1.00 163.41 ? -60  DC  I P     1 
ATOM   6326  O  OP1   . DC  I  5 13  ? 27.822  0.876   61.047 1.00 163.52 ? -60  DC  I OP1   1 
ATOM   6327  O  OP2   . DC  I  5 13  ? 25.996  0.688   59.269 1.00 163.23 ? -60  DC  I OP2   1 
ATOM   6328  O  "O5'" . DC  I  5 13  ? 26.071  -0.913  61.210 1.00 164.34 ? -60  DC  I "O5'" 1 
ATOM   6329  C  "C5'" . DC  I  5 13  ? 27.080  -1.931  61.306 1.00 165.55 ? -60  DC  I "C5'" 1 
ATOM   6330  C  "C4'" . DC  I  5 13  ? 26.986  -2.921  60.153 1.00 166.42 ? -60  DC  I "C4'" 1 
ATOM   6331  O  "O4'" . DC  I  5 13  ? 25.625  -3.422  60.070 1.00 166.76 ? -60  DC  I "O4'" 1 
ATOM   6332  C  "C3'" . DC  I  5 13  ? 27.330  -2.357  58.767 1.00 166.78 ? -60  DC  I "C3'" 1 
ATOM   6333  O  "O3'" . DC  I  5 13  ? 28.246  -3.185  58.034 1.00 166.80 ? -60  DC  I "O3'" 1 
ATOM   6334  C  "C2'" . DC  I  5 13  ? 25.980  -2.295  58.055 1.00 166.97 ? -60  DC  I "C2'" 1 
ATOM   6335  C  "C1'" . DC  I  5 13  ? 25.247  -3.460  58.707 1.00 167.00 ? -60  DC  I "C1'" 1 
ATOM   6336  N  N1    . DC  I  5 13  ? 23.751  -3.404  58.562 1.00 167.14 ? -60  DC  I N1    1 
ATOM   6337  C  C2    . DC  I  5 13  ? 23.005  -4.596  58.627 1.00 167.20 ? -60  DC  I C2    1 
ATOM   6338  O  O2    . DC  I  5 13  ? 23.583  -5.676  58.810 1.00 167.13 ? -60  DC  I O2    1 
ATOM   6339  N  N3    . DC  I  5 13  ? 21.652  -4.530  58.487 1.00 167.26 ? -60  DC  I N3    1 
ATOM   6340  C  C4    . DC  I  5 13  ? 21.051  -3.351  58.288 1.00 166.97 ? -60  DC  I C4    1 
ATOM   6341  N  N4    . DC  I  5 13  ? 19.723  -3.347  58.160 1.00 166.98 ? -60  DC  I N4    1 
ATOM   6342  C  C5    . DC  I  5 13  ? 21.787  -2.127  58.217 1.00 167.05 ? -60  DC  I C5    1 
ATOM   6343  C  C6    . DC  I  5 13  ? 23.119  -2.202  58.355 1.00 167.13 ? -60  DC  I C6    1 
ATOM   6344  P  P     . DT  I  5 14  ? 29.158  -2.536  56.875 1.00 166.69 ? -59  DT  I P     1 
ATOM   6345  O  OP1   . DT  I  5 14  ? 30.297  -1.857  57.560 1.00 166.89 ? -59  DT  I OP1   1 
ATOM   6346  O  OP2   . DT  I  5 14  ? 28.273  -1.774  55.948 1.00 166.30 ? -59  DT  I OP2   1 
ATOM   6347  O  "O5'" . DT  I  5 14  ? 29.734  -3.801  56.051 1.00 166.53 ? -59  DT  I "O5'" 1 
ATOM   6348  C  "C5'" . DT  I  5 14  ? 30.228  -4.977  56.730 1.00 165.89 ? -59  DT  I "C5'" 1 
ATOM   6349  C  "C4'" . DT  I  5 14  ? 29.636  -6.226  56.088 1.00 165.36 ? -59  DT  I "C4'" 1 
ATOM   6350  O  "O4'" . DT  I  5 14  ? 28.185  -6.188  56.204 1.00 165.41 ? -59  DT  I "O4'" 1 
ATOM   6351  C  "C3'" . DT  I  5 14  ? 29.940  -6.395  54.599 1.00 164.89 ? -59  DT  I "C3'" 1 
ATOM   6352  O  "O3'" . DT  I  5 14  ? 30.202  -7.765  54.276 1.00 163.89 ? -59  DT  I "O3'" 1 
ATOM   6353  C  "C2'" . DT  I  5 14  ? 28.670  -5.886  53.918 1.00 165.17 ? -59  DT  I "C2'" 1 
ATOM   6354  C  "C1'" . DT  I  5 14  ? 27.598  -6.311  54.920 1.00 165.26 ? -59  DT  I "C1'" 1 
ATOM   6355  N  N1    . DT  I  5 14  ? 26.311  -5.523  54.834 1.00 165.36 ? -59  DT  I N1    1 
ATOM   6356  C  C2    . DT  I  5 14  ? 25.137  -6.112  55.286 1.00 165.43 ? -59  DT  I C2    1 
ATOM   6357  O  O2    . DT  I  5 14  ? 25.079  -7.238  55.764 1.00 165.30 ? -59  DT  I O2    1 
ATOM   6358  N  N3    . DT  I  5 14  ? 24.014  -5.323  55.157 1.00 165.41 ? -59  DT  I N3    1 
ATOM   6359  C  C4    . DT  I  5 14  ? 23.946  -4.037  54.633 1.00 165.29 ? -59  DT  I C4    1 
ATOM   6360  O  O4    . DT  I  5 14  ? 22.882  -3.429  54.569 1.00 165.23 ? -59  DT  I O4    1 
ATOM   6361  C  C5    . DT  I  5 14  ? 25.203  -3.476  54.176 1.00 165.28 ? -59  DT  I C5    1 
ATOM   6362  C  C7    . DT  I  5 14  ? 25.263  -2.091  53.587 1.00 165.22 ? -59  DT  I C7    1 
ATOM   6363  C  C6    . DT  I  5 14  ? 26.307  -4.236  54.296 1.00 165.28 ? -59  DT  I C6    1 
ATOM   6364  P  P     . DG  I  5 15  ? 30.770  -8.193  52.832 1.00 162.94 ? -58  DG  I P     1 
ATOM   6365  O  OP1   . DG  I  5 15  ? 32.051  -8.911  53.054 1.00 162.68 ? -58  DG  I OP1   1 
ATOM   6366  O  OP2   . DG  I  5 15  ? 30.747  -7.008  51.929 1.00 163.02 ? -58  DG  I OP2   1 
ATOM   6367  O  "O5'" . DG  I  5 15  ? 29.649  -9.209  52.283 1.00 161.85 ? -58  DG  I "O5'" 1 
ATOM   6368  C  "C5'" . DG  I  5 15  ? 29.319  -10.455 52.915 1.00 159.81 ? -58  DG  I "C5'" 1 
ATOM   6369  C  "C4'" . DG  I  5 15  ? 28.028  -11.035 52.337 1.00 158.53 ? -58  DG  I "C4'" 1 
ATOM   6370  O  "O4'" . DG  I  5 15  ? 26.937  -10.079 52.440 1.00 158.63 ? -58  DG  I "O4'" 1 
ATOM   6371  C  "C3'" . DG  I  5 15  ? 28.057  -11.478 50.874 1.00 157.45 ? -58  DG  I "C3'" 1 
ATOM   6372  O  "O3'" . DG  I  5 15  ? 27.339  -12.717 50.726 1.00 155.52 ? -58  DG  I "O3'" 1 
ATOM   6373  C  "C2'" . DG  I  5 15  ? 27.381  -10.321 50.128 1.00 157.75 ? -58  DG  I "C2'" 1 
ATOM   6374  C  "C1'" . DG  I  5 15  ? 26.377  -9.802  51.161 1.00 158.18 ? -58  DG  I "C1'" 1 
ATOM   6375  N  N9    . DG  I  5 15  ? 26.054  -8.365  51.082 1.00 158.23 ? -58  DG  I N9    1 
ATOM   6376  C  C8    . DG  I  5 15  ? 26.949  -7.318  51.015 1.00 158.06 ? -58  DG  I C8    1 
ATOM   6377  N  N7    . DG  I  5 15  ? 26.387  -6.142  50.960 1.00 158.01 ? -58  DG  I N7    1 
ATOM   6378  C  C5    . DG  I  5 15  ? 25.025  -6.412  50.996 1.00 158.02 ? -58  DG  I C5    1 
ATOM   6379  C  C6    . DG  I  5 15  ? 23.916  -5.523  50.966 1.00 157.91 ? -58  DG  I C6    1 
ATOM   6380  O  O6    . DG  I  5 15  ? 23.922  -4.287  50.904 1.00 157.93 ? -58  DG  I O6    1 
ATOM   6381  N  N1    . DG  I  5 15  ? 22.699  -6.197  51.022 1.00 157.97 ? -58  DG  I N1    1 
ATOM   6382  C  C2    . DG  I  5 15  ? 22.569  -7.564  51.096 1.00 158.00 ? -58  DG  I C2    1 
ATOM   6383  N  N2    . DG  I  5 15  ? 21.313  -8.029  51.139 1.00 158.03 ? -58  DG  I N2    1 
ATOM   6384  N  N3    . DG  I  5 15  ? 23.597  -8.411  51.124 1.00 158.10 ? -58  DG  I N3    1 
ATOM   6385  C  C4    . DG  I  5 15  ? 24.799  -7.774  51.073 1.00 158.14 ? -58  DG  I C4    1 
ATOM   6386  P  P     . DC  I  5 16  ? 27.571  -13.696 49.468 1.00 153.90 ? -57  DC  I P     1 
ATOM   6387  O  OP1   . DC  I  5 16  ? 27.692  -15.086 49.986 1.00 153.62 ? -57  DC  I OP1   1 
ATOM   6388  O  OP2   . DC  I  5 16  ? 28.651  -13.117 48.629 1.00 153.88 ? -57  DC  I OP2   1 
ATOM   6389  O  "O5'" . DC  I  5 16  ? 26.211  -13.565 48.611 1.00 152.16 ? -57  DC  I "O5'" 1 
ATOM   6390  C  "C5'" . DC  I  5 16  ? 24.911  -13.592 49.215 1.00 149.11 ? -57  DC  I "C5'" 1 
ATOM   6391  C  "C4'" . DC  I  5 16  ? 23.895  -12.823 48.380 1.00 146.87 ? -57  DC  I "C4'" 1 
ATOM   6392  O  "O4'" . DC  I  5 16  ? 24.017  -11.397 48.603 1.00 146.41 ? -57  DC  I "O4'" 1 
ATOM   6393  C  "C3'" . DC  I  5 16  ? 23.989  -13.022 46.866 1.00 145.42 ? -57  DC  I "C3'" 1 
ATOM   6394  O  "O3'" . DC  I  5 16  ? 22.770  -13.574 46.408 1.00 143.60 ? -57  DC  I "O3'" 1 
ATOM   6395  C  "C2'" . DC  I  5 16  ? 24.240  -11.629 46.290 1.00 145.35 ? -57  DC  I "C2'" 1 
ATOM   6396  C  "C1'" . DC  I  5 16  ? 23.658  -10.755 47.397 1.00 145.85 ? -57  DC  I "C1'" 1 
ATOM   6397  N  N1    . DC  I  5 16  ? 24.126  -9.327  47.447 1.00 145.90 ? -57  DC  I N1    1 
ATOM   6398  C  C2    . DC  I  5 16  ? 23.188  -8.322  47.745 1.00 145.97 ? -57  DC  I C2    1 
ATOM   6399  O  O2    . DC  I  5 16  ? 22.008  -8.638  47.955 1.00 145.99 ? -57  DC  I O2    1 
ATOM   6400  N  N3    . DC  I  5 16  ? 23.596  -7.025  47.796 1.00 145.85 ? -57  DC  I N3    1 
ATOM   6401  C  C4    . DC  I  5 16  ? 24.877  -6.719  47.564 1.00 145.80 ? -57  DC  I C4    1 
ATOM   6402  N  N4    . DC  I  5 16  ? 25.224  -5.429  47.628 1.00 145.82 ? -57  DC  I N4    1 
ATOM   6403  C  C5    . DC  I  5 16  ? 25.855  -7.722  47.260 1.00 145.75 ? -57  DC  I C5    1 
ATOM   6404  C  C6    . DC  I  5 16  ? 25.440  -8.998  47.214 1.00 145.86 ? -57  DC  I C6    1 
ATOM   6405  P  P     . DA  I  5 17  ? 22.710  -15.135 46.068 1.00 142.10 ? -56  DA  I P     1 
ATOM   6406  O  OP1   . DA  I  5 17  ? 23.382  -15.880 47.158 1.00 142.29 ? -56  DA  I OP1   1 
ATOM   6407  O  OP2   . DA  I  5 17  ? 23.168  -15.274 44.665 1.00 141.77 ? -56  DA  I OP2   1 
ATOM   6408  O  "O5'" . DA  I  5 17  ? 21.152  -15.498 46.136 1.00 140.76 ? -56  DA  I "O5'" 1 
ATOM   6409  C  "C5'" . DA  I  5 17  ? 20.328  -15.099 47.243 1.00 138.29 ? -56  DA  I "C5'" 1 
ATOM   6410  C  "C4'" . DA  I  5 17  ? 19.238  -14.130 46.792 1.00 136.44 ? -56  DA  I "C4'" 1 
ATOM   6411  O  "O4'" . DA  I  5 17  ? 19.835  -12.861 46.413 1.00 135.77 ? -56  DA  I "O4'" 1 
ATOM   6412  C  "C3'" . DA  I  5 17  ? 18.397  -14.573 45.595 1.00 135.20 ? -56  DA  I "C3'" 1 
ATOM   6413  O  "O3'" . DA  I  5 17  ? 17.021  -14.228 45.793 1.00 133.85 ? -56  DA  I "O3'" 1 
ATOM   6414  C  "C2'" . DA  I  5 17  ? 19.023  -13.822 44.419 1.00 135.20 ? -56  DA  I "C2'" 1 
ATOM   6415  C  "C1'" . DA  I  5 17  ? 19.462  -12.522 45.089 1.00 135.41 ? -56  DA  I "C1'" 1 
ATOM   6416  N  N9    . DA  I  5 17  ? 20.600  -11.836 44.471 1.00 135.46 ? -56  DA  I N9    1 
ATOM   6417  C  C8    . DA  I  5 17  ? 21.597  -12.383 43.698 1.00 135.62 ? -56  DA  I C8    1 
ATOM   6418  N  N7    . DA  I  5 17  ? 22.492  -11.515 43.284 1.00 135.58 ? -56  DA  I N7    1 
ATOM   6419  C  C5    . DA  I  5 17  ? 22.055  -10.317 43.827 1.00 135.34 ? -56  DA  I C5    1 
ATOM   6420  C  C6    . DA  I  5 17  ? 22.566  -9.005  43.763 1.00 135.33 ? -56  DA  I C6    1 
ATOM   6421  N  N6    . DA  I  5 17  ? 23.679  -8.707  43.089 1.00 135.48 ? -56  DA  I N6    1 
ATOM   6422  N  N1    . DA  I  5 17  ? 21.896  -8.014  44.407 1.00 135.32 ? -56  DA  I N1    1 
ATOM   6423  C  C2    . DA  I  5 17  ? 20.778  -8.329  45.079 1.00 135.37 ? -56  DA  I C2    1 
ATOM   6424  N  N3    . DA  I  5 17  ? 20.203  -9.529  45.213 1.00 135.54 ? -56  DA  I N3    1 
ATOM   6425  C  C4    . DA  I  5 17  ? 20.892  -10.491 44.559 1.00 135.42 ? -56  DA  I C4    1 
ATOM   6426  P  P     . DG  I  5 18  ? 15.847  -15.021 45.027 1.00 133.20 ? -55  DG  I P     1 
ATOM   6427  O  OP1   . DG  I  5 18  ? 14.943  -15.602 46.051 1.00 133.03 ? -55  DG  I OP1   1 
ATOM   6428  O  OP2   . DG  I  5 18  ? 16.480  -15.894 43.997 1.00 133.38 ? -55  DG  I OP2   1 
ATOM   6429  O  "O5'" . DG  I  5 18  ? 15.011  -13.886 44.264 1.00 131.37 ? -55  DG  I "O5'" 1 
ATOM   6430  C  "C5'" . DG  I  5 18  ? 14.829  -12.611 44.855 1.00 128.68 ? -55  DG  I "C5'" 1 
ATOM   6431  C  "C4'" . DG  I  5 18  ? 15.369  -11.523 43.947 1.00 126.49 ? -55  DG  I "C4'" 1 
ATOM   6432  O  "O4'" . DG  I  5 18  ? 16.730  -11.794 43.535 1.00 126.72 ? -55  DG  I "O4'" 1 
ATOM   6433  C  "C3'" . DG  I  5 18  ? 14.599  -11.320 42.648 1.00 125.11 ? -55  DG  I "C3'" 1 
ATOM   6434  O  "O3'" . DG  I  5 18  ? 13.881  -10.105 42.777 1.00 123.02 ? -55  DG  I "O3'" 1 
ATOM   6435  C  "C2'" . DG  I  5 18  ? 15.685  -11.234 41.567 1.00 125.70 ? -55  DG  I "C2'" 1 
ATOM   6436  C  "C1'" . DG  I  5 18  ? 16.931  -10.972 42.408 1.00 126.34 ? -55  DG  I "C1'" 1 
ATOM   6437  N  N9    . DG  I  5 18  ? 18.244  -11.181 41.765 1.00 126.42 ? -55  DG  I N9    1 
ATOM   6438  C  C8    . DG  I  5 18  ? 18.821  -12.331 41.246 1.00 126.38 ? -55  DG  I C8    1 
ATOM   6439  N  N7    . DG  I  5 18  ? 20.018  -12.150 40.738 1.00 126.12 ? -55  DG  I N7    1 
ATOM   6440  C  C5    . DG  I  5 18  ? 20.245  -10.789 40.937 1.00 126.42 ? -55  DG  I C5    1 
ATOM   6441  C  C6    . DG  I  5 18  ? 21.363  -9.978  40.606 1.00 126.40 ? -55  DG  I C6    1 
ATOM   6442  O  O6    . DG  I  5 18  ? 22.405  -10.338 40.050 1.00 126.29 ? -55  DG  I O6    1 
ATOM   6443  N  N1    . DG  I  5 18  ? 21.192  -8.633  40.976 1.00 126.43 ? -55  DG  I N1    1 
ATOM   6444  C  C2    . DG  I  5 18  ? 20.065  -8.127  41.605 1.00 126.40 ? -55  DG  I C2    1 
ATOM   6445  N  N2    . DG  I  5 18  ? 20.052  -6.815  41.901 1.00 126.27 ? -55  DG  I N2    1 
ATOM   6446  N  N3    . DG  I  5 18  ? 19.011  -8.877  41.920 1.00 126.24 ? -55  DG  I N3    1 
ATOM   6447  C  C4    . DG  I  5 18  ? 19.169  -10.184 41.562 1.00 126.26 ? -55  DG  I C4    1 
ATOM   6448  P  P     . DA  I  5 19  ? 12.430  -9.874  42.133 1.00 121.07 ? -54  DA  I P     1 
ATOM   6449  O  OP1   . DA  I  5 19  ? 11.422  -10.068 43.204 1.00 119.92 ? -54  DA  I OP1   1 
ATOM   6450  O  OP2   . DA  I  5 19  ? 12.343  -10.648 40.871 1.00 120.80 ? -54  DA  I OP2   1 
ATOM   6451  O  "O5'" . DA  I  5 19  ? 12.495  -8.326  41.725 1.00 121.53 ? -54  DA  I "O5'" 1 
ATOM   6452  C  "C5'" . DA  I  5 19  ? 13.112  -7.373  42.584 1.00 122.63 ? -54  DA  I "C5'" 1 
ATOM   6453  C  "C4'" . DA  I  5 19  ? 13.912  -6.323  41.831 1.00 123.70 ? -54  DA  I "C4'" 1 
ATOM   6454  O  "O4'" . DA  I  5 19  ? 15.223  -6.848  41.505 1.00 124.44 ? -54  DA  I "O4'" 1 
ATOM   6455  C  "C3'" . DA  I  5 19  ? 13.301  -5.828  40.521 1.00 124.63 ? -54  DA  I "C3'" 1 
ATOM   6456  O  "O3'" . DA  I  5 19  ? 13.302  -4.400  40.489 1.00 125.27 ? -54  DA  I "O3'" 1 
ATOM   6457  C  "C2'" . DA  I  5 19  ? 14.228  -6.419  39.460 1.00 125.24 ? -54  DA  I "C2'" 1 
ATOM   6458  C  "C1'" . DA  I  5 19  ? 15.553  -6.402  40.211 1.00 125.93 ? -54  DA  I "C1'" 1 
ATOM   6459  N  N9    . DA  I  5 19  ? 16.593  -7.248  39.628 1.00 126.26 ? -54  DA  I N9    1 
ATOM   6460  C  C8    . DA  I  5 19  ? 16.559  -8.597  39.398 1.00 126.44 ? -54  DA  I C8    1 
ATOM   6461  N  N7    . DA  I  5 19  ? 17.655  -9.073  38.855 1.00 126.52 ? -54  DA  I N7    1 
ATOM   6462  C  C5    . DA  I  5 19  ? 18.465  -7.957  38.713 1.00 126.57 ? -54  DA  I C5    1 
ATOM   6463  C  C6    . DA  I  5 19  ? 19.772  -7.773  38.198 1.00 126.65 ? -54  DA  I C6    1 
ATOM   6464  N  N6    . DA  I  5 19  ? 20.522  -8.766  37.703 1.00 126.54 ? -54  DA  I N6    1 
ATOM   6465  N  N1    . DA  I  5 19  ? 20.285  -6.518  38.209 1.00 126.68 ? -54  DA  I N1    1 
ATOM   6466  C  C2    . DA  I  5 19  ? 19.540  -5.514  38.700 1.00 126.53 ? -54  DA  I C2    1 
ATOM   6467  N  N3    . DA  I  5 19  ? 18.305  -5.562  39.205 1.00 126.37 ? -54  DA  I N3    1 
ATOM   6468  C  C4    . DA  I  5 19  ? 17.824  -6.821  39.186 1.00 126.43 ? -54  DA  I C4    1 
ATOM   6469  P  P     . DT  I  5 20  ? 12.282  -3.590  39.559 1.00 125.23 ? -53  DT  I P     1 
ATOM   6470  O  OP1   . DT  I  5 20  ? 11.051  -3.331  40.341 1.00 124.23 ? -53  DT  I OP1   1 
ATOM   6471  O  OP2   . DT  I  5 20  ? 12.161  -4.323  38.284 1.00 125.35 ? -53  DT  I OP2   1 
ATOM   6472  O  "O5'" . DT  I  5 20  ? 13.049  -2.208  39.249 1.00 127.17 ? -53  DT  I "O5'" 1 
ATOM   6473  C  "C5'" . DT  I  5 20  ? 14.389  -1.944  39.679 1.00 130.74 ? -53  DT  I "C5'" 1 
ATOM   6474  C  "C4'" . DT  I  5 20  ? 15.423  -1.910  38.551 1.00 134.10 ? -53  DT  I "C4'" 1 
ATOM   6475  O  "O4'" . DT  I  5 20  ? 16.000  -3.217  38.274 1.00 135.06 ? -53  DT  I "O4'" 1 
ATOM   6476  C  "C3'" . DT  I  5 20  ? 14.968  -1.362  37.193 1.00 136.14 ? -53  DT  I "C3'" 1 
ATOM   6477  O  "O3'" . DT  I  5 20  ? 15.532  -0.049  37.019 1.00 139.29 ? -53  DT  I "O3'" 1 
ATOM   6478  C  "C2'" . DT  I  5 20  ? 15.507  -2.370  36.170 1.00 135.97 ? -53  DT  I "C2'" 1 
ATOM   6479  C  "C1'" . DT  I  5 20  ? 16.553  -3.135  36.975 1.00 135.58 ? -53  DT  I "C1'" 1 
ATOM   6480  N  N1    . DT  I  5 20  ? 16.880  -4.501  36.420 1.00 135.66 ? -53  DT  I N1    1 
ATOM   6481  C  C2    . DT  I  5 20  ? 18.146  -4.739  35.907 1.00 135.68 ? -53  DT  I C2    1 
ATOM   6482  O  O2    . DT  I  5 20  ? 19.043  -3.911  35.876 1.00 135.81 ? -53  DT  I O2    1 
ATOM   6483  N  N3    . DT  I  5 20  ? 18.344  -6.011  35.424 1.00 135.92 ? -53  DT  I N3    1 
ATOM   6484  C  C4    . DT  I  5 20  ? 17.428  -7.050  35.396 1.00 135.73 ? -53  DT  I C4    1 
ATOM   6485  O  O4    . DT  I  5 20  ? 17.722  -8.149  34.938 1.00 135.74 ? -53  DT  I O4    1 
ATOM   6486  C  C5    . DT  I  5 20  ? 16.123  -6.743  35.940 1.00 135.75 ? -53  DT  I C5    1 
ATOM   6487  C  C7    . DT  I  5 20  ? 15.044  -7.789  35.966 1.00 135.62 ? -53  DT  I C7    1 
ATOM   6488  C  C6    . DT  I  5 20  ? 15.915  -5.502  36.416 1.00 135.70 ? -53  DT  I C6    1 
ATOM   6489  P  P     . DA  I  5 21  ? 15.359  0.848   35.691 1.00 141.20 ? -52  DA  I P     1 
ATOM   6490  O  OP1   . DA  I  5 21  ? 15.554  2.252   36.118 1.00 140.86 ? -52  DA  I OP1   1 
ATOM   6491  O  OP2   . DA  I  5 21  ? 14.116  0.471   34.975 1.00 140.70 ? -52  DA  I OP2   1 
ATOM   6492  O  "O5'" . DA  I  5 21  ? 16.588  0.366   34.779 1.00 143.80 ? -52  DA  I "O5'" 1 
ATOM   6493  C  "C5'" . DA  I  5 21  ? 17.935  0.383   35.272 1.00 147.61 ? -52  DA  I "C5'" 1 
ATOM   6494  C  "C4'" . DA  I  5 21  ? 18.926  0.142   34.144 1.00 150.76 ? -52  DA  I "C4'" 1 
ATOM   6495  O  "O4'" . DA  I  5 21  ? 19.194  -1.277  33.997 1.00 151.47 ? -52  DA  I "O4'" 1 
ATOM   6496  C  "C3'" . DA  I  5 21  ? 18.496  0.642   32.763 1.00 152.62 ? -52  DA  I "C3'" 1 
ATOM   6497  O  "O3'" . DA  I  5 21  ? 19.559  1.411   32.193 1.00 155.18 ? -52  DA  I "O3'" 1 
ATOM   6498  C  "C2'" . DA  I  5 21  ? 18.223  -0.646  31.984 1.00 152.49 ? -52  DA  I "C2'" 1 
ATOM   6499  C  "C1'" . DA  I  5 21  ? 19.237  -1.591  32.620 1.00 152.40 ? -52  DA  I "C1'" 1 
ATOM   6500  N  N9    . DA  I  5 21  ? 18.940  -3.013  32.444 1.00 152.64 ? -52  DA  I N9    1 
ATOM   6501  C  C8    . DA  I  5 21  ? 17.783  -3.661  32.798 1.00 152.75 ? -52  DA  I C8    1 
ATOM   6502  N  N7    . DA  I  5 21  ? 17.786  -4.946  32.528 1.00 152.91 ? -52  DA  I N7    1 
ATOM   6503  C  C5    . DA  I  5 21  ? 19.031  -5.166  31.954 1.00 152.85 ? -52  DA  I C5    1 
ATOM   6504  C  C6    . DA  I  5 21  ? 19.658  -6.331  31.440 1.00 152.73 ? -52  DA  I C6    1 
ATOM   6505  N  N6    . DA  I  5 21  ? 19.078  -7.539  31.429 1.00 152.46 ? -52  DA  I N6    1 
ATOM   6506  N  N1    . DA  I  5 21  ? 20.911  -6.202  30.933 1.00 152.81 ? -52  DA  I N1    1 
ATOM   6507  C  C2    . DA  I  5 21  ? 21.494  -4.990  30.933 1.00 152.71 ? -52  DA  I C2    1 
ATOM   6508  N  N3    . DA  I  5 21  ? 21.004  -3.830  31.393 1.00 152.64 ? -52  DA  I N3    1 
ATOM   6509  C  C4    . DA  I  5 21  ? 19.759  -3.982  31.894 1.00 152.70 ? -52  DA  I C4    1 
ATOM   6510  P  P     . DC  I  5 22  ? 19.334  2.468   31.006 1.00 157.07 ? -51  DC  I P     1 
ATOM   6511  O  OP1   . DC  I  5 22  ? 19.688  3.812   31.528 1.00 156.71 ? -51  DC  I OP1   1 
ATOM   6512  O  OP2   . DC  I  5 22  ? 17.994  2.259   30.392 1.00 156.81 ? -51  DC  I OP2   1 
ATOM   6513  O  "O5'" . DC  I  5 22  ? 20.455  2.016   29.941 1.00 159.24 ? -51  DC  I "O5'" 1 
ATOM   6514  C  "C5'" . DC  I  5 22  ? 20.612  0.627   29.597 1.00 162.49 ? -51  DC  I "C5'" 1 
ATOM   6515  C  "C4'" . DC  I  5 22  ? 21.365  0.424   28.280 1.00 164.98 ? -51  DC  I "C4'" 1 
ATOM   6516  O  "O4'" . DC  I  5 22  ? 21.536  -1.002  28.040 1.00 165.53 ? -51  DC  I "O4'" 1 
ATOM   6517  C  "C3'" . DC  I  5 22  ? 20.662  0.967   27.031 1.00 166.56 ? -51  DC  I "C3'" 1 
ATOM   6518  O  "O3'" . DC  I  5 22  ? 21.657  1.524   26.121 1.00 168.29 ? -51  DC  I "O3'" 1 
ATOM   6519  C  "C2'" . DC  I  5 22  ? 19.847  -0.236  26.528 1.00 166.50 ? -51  DC  I "C2'" 1 
ATOM   6520  C  "C1'" . DC  I  5 22  ? 20.656  -1.447  27.013 1.00 166.47 ? -51  DC  I "C1'" 1 
ATOM   6521  N  N1    . DC  I  5 22  ? 19.837  -2.621  27.510 1.00 166.79 ? -51  DC  I N1    1 
ATOM   6522  C  C2    . DC  I  5 22  ? 20.273  -3.938  27.242 1.00 167.12 ? -51  DC  I C2    1 
ATOM   6523  O  O2    . DC  I  5 22  ? 21.321  -4.129  26.604 1.00 167.19 ? -51  DC  I O2    1 
ATOM   6524  N  N3    . DC  I  5 22  ? 19.529  -4.989  27.694 1.00 167.06 ? -51  DC  I N3    1 
ATOM   6525  C  C4    . DC  I  5 22  ? 18.400  -4.768  28.381 1.00 166.94 ? -51  DC  I C4    1 
ATOM   6526  N  N4    . DC  I  5 22  ? 17.712  -5.837  28.802 1.00 166.81 ? -51  DC  I N4    1 
ATOM   6527  C  C5    . DC  I  5 22  ? 17.937  -3.441  28.664 1.00 166.91 ? -51  DC  I C5    1 
ATOM   6528  C  C6    . DC  I  5 22  ? 18.677  -2.412  28.217 1.00 166.75 ? -51  DC  I C6    1 
ATOM   6529  P  P     . DT  I  5 23  ? 21.985  1.022   24.628 1.00 169.72 ? -50  DT  I P     1 
ATOM   6530  O  OP1   . DT  I  5 23  ? 23.005  1.947   24.079 1.00 169.83 ? -50  DT  I OP1   1 
ATOM   6531  O  OP2   . DT  I  5 23  ? 20.705  0.853   23.894 1.00 169.68 ? -50  DT  I OP2   1 
ATOM   6532  O  "O5'" . DT  I  5 23  ? 22.651  -0.423  24.869 1.00 170.47 ? -50  DT  I "O5'" 1 
ATOM   6533  C  "C5'" . DT  I  5 23  ? 23.840  -0.860  24.202 1.00 171.61 ? -50  DT  I "C5'" 1 
ATOM   6534  C  "C4'" . DT  I  5 23  ? 23.504  -1.869  23.117 1.00 172.59 ? -50  DT  I "C4'" 1 
ATOM   6535  O  "O4'" . DT  I  5 23  ? 22.486  -2.793  23.596 1.00 172.81 ? -50  DT  I "O4'" 1 
ATOM   6536  C  "C3'" . DT  I  5 23  ? 22.967  -1.250  21.827 1.00 173.31 ? -50  DT  I "C3'" 1 
ATOM   6537  O  "O3'" . DT  I  5 23  ? 23.647  -1.806  20.692 1.00 174.54 ? -50  DT  I "O3'" 1 
ATOM   6538  C  "C2'" . DT  I  5 23  ? 21.476  -1.589  21.862 1.00 173.26 ? -50  DT  I "C2'" 1 
ATOM   6539  C  "C1'" . DT  I  5 23  ? 21.452  -2.906  22.632 1.00 172.95 ? -50  DT  I "C1'" 1 
ATOM   6540  N  N1    . DT  I  5 23  ? 20.119  -3.213  23.290 1.00 172.89 ? -50  DT  I N1    1 
ATOM   6541  C  C2    . DT  I  5 23  ? 19.831  -4.495  23.744 1.00 172.75 ? -50  DT  I C2    1 
ATOM   6542  O  O2    . DT  I  5 23  ? 20.596  -5.443  23.662 1.00 172.64 ? -50  DT  I O2    1 
ATOM   6543  N  N3    . DT  I  5 23  ? 18.586  -4.633  24.318 1.00 172.73 ? -50  DT  I N3    1 
ATOM   6544  C  C4    . DT  I  5 23  ? 17.616  -3.653  24.481 1.00 172.69 ? -50  DT  I C4    1 
ATOM   6545  O  O4    . DT  I  5 23  ? 16.534  -3.899  25.010 1.00 172.58 ? -50  DT  I O4    1 
ATOM   6546  C  C5    . DT  I  5 23  ? 17.975  -2.341  23.982 1.00 172.73 ? -50  DT  I C5    1 
ATOM   6547  C  C7    . DT  I  5 23  ? 17.031  -1.178  24.086 1.00 172.76 ? -50  DT  I C7    1 
ATOM   6548  C  C6    . DT  I  5 23  ? 19.185  -2.193  23.422 1.00 172.82 ? -50  DT  I C6    1 
ATOM   6549  P  P     . DA  I  5 24  ? 23.081  -1.738  19.186 1.00 175.41 ? -49  DA  I P     1 
ATOM   6550  O  OP1   . DA  I  5 24  ? 24.249  -1.774  18.274 1.00 175.60 ? -49  DA  I OP1   1 
ATOM   6551  O  OP2   . DA  I  5 24  ? 22.114  -0.619  19.068 1.00 175.25 ? -49  DA  I OP2   1 
ATOM   6552  O  "O5'" . DA  I  5 24  ? 22.287  -3.127  19.052 1.00 175.64 ? -49  DA  I "O5'" 1 
ATOM   6553  C  "C5'" . DA  I  5 24  ? 22.994  -4.375  19.019 1.00 175.75 ? -49  DA  I "C5'" 1 
ATOM   6554  C  "C4'" . DA  I  5 24  ? 22.071  -5.542  18.699 1.00 175.91 ? -49  DA  I "C4'" 1 
ATOM   6555  O  "O4'" . DA  I  5 24  ? 21.100  -5.709  19.768 1.00 176.01 ? -49  DA  I "O4'" 1 
ATOM   6556  C  "C3'" . DA  I  5 24  ? 21.273  -5.426  17.398 1.00 175.85 ? -49  DA  I "C3'" 1 
ATOM   6557  O  "O3'" . DA  I  5 24  ? 21.421  -6.637  16.650 1.00 175.84 ? -49  DA  I "O3'" 1 
ATOM   6558  C  "C2'" . DA  I  5 24  ? 19.833  -5.217  17.869 1.00 175.90 ? -49  DA  I "C2'" 1 
ATOM   6559  C  "C1'" . DA  I  5 24  ? 19.834  -5.968  19.197 1.00 176.03 ? -49  DA  I "C1'" 1 
ATOM   6560  N  N9    . DA  I  5 24  ? 18.780  -5.570  20.136 1.00 176.13 ? -49  DA  I N9    1 
ATOM   6561  C  C8    . DA  I  5 24  ? 18.365  -4.298  20.437 1.00 176.10 ? -49  DA  I C8    1 
ATOM   6562  N  N7    . DA  I  5 24  ? 17.393  -4.252  21.318 1.00 176.23 ? -49  DA  I N7    1 
ATOM   6563  C  C5    . DA  I  5 24  ? 17.148  -5.583  21.626 1.00 176.18 ? -49  DA  I C5    1 
ATOM   6564  C  C6    . DA  I  5 24  ? 16.232  -6.218  22.502 1.00 176.10 ? -49  DA  I C6    1 
ATOM   6565  N  N6    . DA  I  5 24  ? 15.348  -5.563  23.265 1.00 176.02 ? -49  DA  I N6    1 
ATOM   6566  N  N1    . DA  I  5 24  ? 16.255  -7.569  22.566 1.00 176.05 ? -49  DA  I N1    1 
ATOM   6567  C  C2    . DA  I  5 24  ? 17.132  -8.240  21.803 1.00 176.09 ? -49  DA  I C2    1 
ATOM   6568  N  N3    . DA  I  5 24  ? 18.039  -7.756  20.951 1.00 176.13 ? -49  DA  I N3    1 
ATOM   6569  C  C4    . DA  I  5 24  ? 17.998  -6.410  20.904 1.00 176.15 ? -49  DA  I C4    1 
ATOM   6570  P  P     . DC  I  5 25  ? 21.035  -6.750  15.095 1.00 175.64 ? -48  DC  I P     1 
ATOM   6571  O  OP1   . DC  I  5 25  ? 22.097  -7.547  14.433 1.00 175.51 ? -48  DC  I OP1   1 
ATOM   6572  O  OP2   . DC  I  5 25  ? 20.717  -5.390  14.592 1.00 175.64 ? -48  DC  I OP2   1 
ATOM   6573  O  "O5'" . DC  I  5 25  ? 19.674  -7.601  15.115 1.00 174.97 ? -48  DC  I "O5'" 1 
ATOM   6574  C  "C5'" . DC  I  5 25  ? 19.653  -8.948  15.597 1.00 173.90 ? -48  DC  I "C5'" 1 
ATOM   6575  C  "C4'" . DC  I  5 25  ? 18.249  -9.372  15.999 1.00 173.17 ? -48  DC  I "C4'" 1 
ATOM   6576  O  "O4'" . DC  I  5 25  ? 17.746  -8.535  17.075 1.00 173.29 ? -48  DC  I "O4'" 1 
ATOM   6577  C  "C3'" . DC  I  5 25  ? 17.188  -9.304  14.898 1.00 172.44 ? -48  DC  I "C3'" 1 
ATOM   6578  O  "O3'" . DC  I  5 25  ? 16.452  -10.525 14.861 1.00 171.07 ? -48  DC  I "O3'" 1 
ATOM   6579  C  "C2'" . DC  I  5 25  ? 16.289  -8.153  15.345 1.00 172.77 ? -48  DC  I "C2'" 1 
ATOM   6580  C  "C1'" . DC  I  5 25  ? 16.356  -8.399  16.846 1.00 173.25 ? -48  DC  I "C1'" 1 
ATOM   6581  N  N1    . DC  I  5 25  ? 15.715  -7.373  17.750 1.00 173.37 ? -48  DC  I N1    1 
ATOM   6582  C  C2    . DC  I  5 25  ? 14.658  -7.770  18.593 1.00 173.33 ? -48  DC  I C2    1 
ATOM   6583  O  O2    . DC  I  5 25  ? 14.266  -8.946  18.578 1.00 173.29 ? -48  DC  I O2    1 
ATOM   6584  N  N3    . DC  I  5 25  ? 14.083  -6.845  19.410 1.00 173.35 ? -48  DC  I N3    1 
ATOM   6585  C  C4    . DC  I  5 25  ? 14.520  -5.581  19.414 1.00 173.35 ? -48  DC  I C4    1 
ATOM   6586  N  N4    . DC  I  5 25  ? 13.920  -4.711  20.236 1.00 173.22 ? -48  DC  I N4    1 
ATOM   6587  C  C5    . DC  I  5 25  ? 15.592  -5.156  18.566 1.00 173.43 ? -48  DC  I C5    1 
ATOM   6588  C  C6    . DC  I  5 25  ? 16.155  -6.074  17.763 1.00 173.47 ? -48  DC  I C6    1 
ATOM   6589  P  P     . DC  I  5 26  ? 15.852  -11.049 13.472 1.00 169.89 ? -47  DC  I P     1 
ATOM   6590  O  OP1   . DC  I  5 26  ? 16.996  -11.574 12.694 1.00 170.01 ? -47  DC  I OP1   1 
ATOM   6591  O  OP2   . DC  I  5 26  ? 15.023  -9.971  12.885 1.00 169.73 ? -47  DC  I OP2   1 
ATOM   6592  O  "O5'" . DC  I  5 26  ? 14.909  -12.290 13.866 1.00 168.03 ? -47  DC  I "O5'" 1 
ATOM   6593  C  "C5'" . DC  I  5 26  ? 14.211  -12.361 15.105 1.00 165.23 ? -47  DC  I "C5'" 1 
ATOM   6594  C  "C4'" . DC  I  5 26  ? 12.795  -11.846 14.954 1.00 163.43 ? -47  DC  I "C4'" 1 
ATOM   6595  O  "O4'" . DC  I  5 26  ? 12.663  -10.639 15.737 1.00 163.00 ? -47  DC  I "O4'" 1 
ATOM   6596  C  "C3'" . DC  I  5 26  ? 12.364  -11.481 13.533 1.00 162.32 ? -47  DC  I "C3'" 1 
ATOM   6597  O  "O3'" . DC  I  5 26  ? 11.189  -12.179 13.193 1.00 161.18 ? -47  DC  I "O3'" 1 
ATOM   6598  C  "C2'" . DC  I  5 26  ? 12.123  -9.977  13.556 1.00 162.35 ? -47  DC  I "C2'" 1 
ATOM   6599  C  "C1'" . DC  I  5 26  ? 11.826  -9.749  15.032 1.00 162.48 ? -47  DC  I "C1'" 1 
ATOM   6600  N  N1    . DC  I  5 26  ? 12.072  -8.366  15.546 1.00 162.38 ? -47  DC  I N1    1 
ATOM   6601  C  C2    . DC  I  5 26  ? 11.580  -8.036  16.818 1.00 162.27 ? -47  DC  I C2    1 
ATOM   6602  O  O2    . DC  I  5 26  ? 10.965  -8.890  17.467 1.00 162.29 ? -47  DC  I O2    1 
ATOM   6603  N  N3    . DC  I  5 26  ? 11.792  -6.786  17.305 1.00 162.10 ? -47  DC  I N3    1 
ATOM   6604  C  C4    . DC  I  5 26  ? 12.465  -5.894  16.575 1.00 162.13 ? -47  DC  I C4    1 
ATOM   6605  N  N4    . DC  I  5 26  ? 12.645  -4.682  17.099 1.00 162.17 ? -47  DC  I N4    1 
ATOM   6606  C  C5    . DC  I  5 26  ? 12.977  -6.205  15.276 1.00 162.11 ? -47  DC  I C5    1 
ATOM   6607  C  C6    . DC  I  5 26  ? 12.761  -7.441  14.805 1.00 162.16 ? -47  DC  I C6    1 
ATOM   6608  P  P     . DA  I  5 27  ? 11.282  -13.462 12.241 1.00 160.11 ? -46  DA  I P     1 
ATOM   6609  O  OP1   . DA  I  5 27  ? 12.673  -13.980 12.297 1.00 160.22 ? -46  DA  I OP1   1 
ATOM   6610  O  OP2   . DA  I  5 27  ? 10.665  -13.095 10.944 1.00 159.82 ? -46  DA  I OP2   1 
ATOM   6611  O  "O5'" . DA  I  5 27  ? 10.331  -14.537 12.957 1.00 158.70 ? -46  DA  I "O5'" 1 
ATOM   6612  C  "C5'" . DA  I  5 27  ? 10.298  -14.676 14.386 1.00 155.79 ? -46  DA  I "C5'" 1 
ATOM   6613  C  "C4'" . DA  I  5 27  ? 8.939   -14.284 14.957 1.00 153.36 ? -46  DA  I "C4'" 1 
ATOM   6614  O  "O4'" . DA  I  5 27  ? 8.876   -12.858 15.217 1.00 152.78 ? -46  DA  I "O4'" 1 
ATOM   6615  C  "C3'" . DA  I  5 27  ? 7.720   -14.590 14.096 1.00 151.98 ? -46  DA  I "C3'" 1 
ATOM   6616  O  "O3'" . DA  I  5 27  ? 6.714   -14.999 14.994 1.00 150.40 ? -46  DA  I "O3'" 1 
ATOM   6617  C  "C2'" . DA  I  5 27  ? 7.406   -13.246 13.434 1.00 152.00 ? -46  DA  I "C2'" 1 
ATOM   6618  C  "C1'" . DA  I  5 27  ? 7.769   -12.273 14.550 1.00 152.33 ? -46  DA  I "C1'" 1 
ATOM   6619  N  N9    . DA  I  5 27  ? 8.183   -10.929 14.140 1.00 152.25 ? -46  DA  I N9    1 
ATOM   6620  C  C8    . DA  I  5 27  ? 8.619   -10.517 12.910 1.00 152.21 ? -46  DA  I C8    1 
ATOM   6621  N  N7    . DA  I  5 27  ? 8.936   -9.246  12.854 1.00 152.14 ? -46  DA  I N7    1 
ATOM   6622  C  C5    . DA  I  5 27  ? 8.696   -8.788  14.135 1.00 152.12 ? -46  DA  I C5    1 
ATOM   6623  C  C6    . DA  I  5 27  ? 8.841   -7.519  14.734 1.00 152.20 ? -46  DA  I C6    1 
ATOM   6624  N  N6    . DA  I  5 27  ? 9.269   -6.439  14.074 1.00 152.19 ? -46  DA  I N6    1 
ATOM   6625  N  N1    . DA  I  5 27  ? 8.508   -7.393  16.039 1.00 152.28 ? -46  DA  I N1    1 
ATOM   6626  C  C2    . DA  I  5 27  ? 8.067   -8.475  16.702 1.00 152.27 ? -46  DA  I C2    1 
ATOM   6627  N  N3    . DA  I  5 27  ? 7.896   -9.718  16.246 1.00 152.33 ? -46  DA  I N3    1 
ATOM   6628  C  C4    . DA  I  5 27  ? 8.232   -9.811  14.943 1.00 152.25 ? -46  DA  I C4    1 
ATOM   6629  P  P     . DA  I  5 28  ? 5.294   -15.587 14.543 1.00 149.38 ? -45  DA  I P     1 
ATOM   6630  O  OP1   . DA  I  5 28  ? 5.311   -17.032 14.870 1.00 149.80 ? -45  DA  I OP1   1 
ATOM   6631  O  OP2   . DA  I  5 28  ? 4.963   -15.139 13.169 1.00 149.53 ? -45  DA  I OP2   1 
ATOM   6632  O  "O5'" . DA  I  5 28  ? 4.304   -14.844 15.557 1.00 147.73 ? -45  DA  I "O5'" 1 
ATOM   6633  C  "C5'" . DA  I  5 28  ? 4.811   -14.131 16.703 1.00 144.78 ? -45  DA  I "C5'" 1 
ATOM   6634  C  "C4'" . DA  I  5 28  ? 4.149   -12.767 16.840 1.00 142.35 ? -45  DA  I "C4'" 1 
ATOM   6635  O  "O4'" . DA  I  5 28  ? 4.872   -11.768 16.071 1.00 141.79 ? -45  DA  I "O4'" 1 
ATOM   6636  C  "C3'" . DA  I  5 28  ? 2.703   -12.698 16.344 1.00 140.92 ? -45  DA  I "C3'" 1 
ATOM   6637  O  "O3'" . DA  I  5 28  ? 1.937   -11.987 17.282 1.00 138.48 ? -45  DA  I "O3'" 1 
ATOM   6638  C  "C2'" . DA  I  5 28  ? 2.787   -11.916 15.041 1.00 141.24 ? -45  DA  I "C2'" 1 
ATOM   6639  C  "C1'" . DA  I  5 28  ? 3.912   -10.963 15.417 1.00 141.67 ? -45  DA  I "C1'" 1 
ATOM   6640  N  N9    . DA  I  5 28  ? 4.501   -10.290 14.267 1.00 141.75 ? -45  DA  I N9    1 
ATOM   6641  C  C8    . DA  I  5 28  ? 4.639   -10.762 12.990 1.00 141.83 ? -45  DA  I C8    1 
ATOM   6642  N  N7    . DA  I  5 28  ? 5.205   -9.908  12.170 1.00 141.85 ? -45  DA  I N7    1 
ATOM   6643  C  C5    . DA  I  5 28  ? 5.450   -8.803  12.965 1.00 141.83 ? -45  DA  I C5    1 
ATOM   6644  C  C6    . DA  I  5 28  ? 6.031   -7.548  12.699 1.00 141.70 ? -45  DA  I C6    1 
ATOM   6645  N  N6    . DA  I  5 28  ? 6.495   -7.191  11.500 1.00 141.60 ? -45  DA  I N6    1 
ATOM   6646  N  N1    . DA  I  5 28  ? 6.121   -6.672  13.724 1.00 141.73 ? -45  DA  I N1    1 
ATOM   6647  C  C2    . DA  I  5 28  ? 5.657   -7.026  14.931 1.00 141.71 ? -45  DA  I C2    1 
ATOM   6648  N  N3    . DA  I  5 28  ? 5.092   -8.174  15.300 1.00 141.69 ? -45  DA  I N3    1 
ATOM   6649  C  C4    . DA  I  5 28  ? 5.017   -9.021  14.261 1.00 141.81 ? -45  DA  I C4    1 
ATOM   6650  P  P     . DA  I  5 29  ? 0.710   -12.752 17.935 1.00 136.43 ? -44  DA  I P     1 
ATOM   6651  O  OP1   . DA  I  5 29  ? 1.277   -13.790 18.827 1.00 136.32 ? -44  DA  I OP1   1 
ATOM   6652  O  OP2   . DA  I  5 29  ? -0.216  -13.112 16.835 1.00 136.68 ? -44  DA  I OP2   1 
ATOM   6653  O  "O5'" . DA  I  5 29  ? 0.034   -11.601 18.804 1.00 135.78 ? -44  DA  I "O5'" 1 
ATOM   6654  C  "C5'" . DA  I  5 29  ? -0.609  -10.548 18.122 1.00 134.16 ? -44  DA  I "C5'" 1 
ATOM   6655  C  "C4'" . DA  I  5 29  ? 0.121   -9.247  18.358 1.00 132.84 ? -44  DA  I "C4'" 1 
ATOM   6656  O  "O4'" . DA  I  5 29  ? 1.207   -9.098  17.411 1.00 132.46 ? -44  DA  I "O4'" 1 
ATOM   6657  C  "C3'" . DA  I  5 29  ? -0.813  -8.066  18.181 1.00 132.37 ? -44  DA  I "C3'" 1 
ATOM   6658  O  "O3'" . DA  I  5 29  ? -0.788  -7.286  19.348 1.00 131.70 ? -44  DA  I "O3'" 1 
ATOM   6659  C  "C2'" . DA  I  5 29  ? -0.266  -7.294  16.987 1.00 132.90 ? -44  DA  I "C2'" 1 
ATOM   6660  C  "C1'" . DA  I  5 29  ? 1.136   -7.843  16.766 1.00 133.16 ? -44  DA  I "C1'" 1 
ATOM   6661  N  N9    . DA  I  5 29  ? 1.395   -8.000  15.336 1.00 133.52 ? -44  DA  I N9    1 
ATOM   6662  C  C8    . DA  I  5 29  ? 0.993   -9.039  14.543 1.00 133.67 ? -44  DA  I C8    1 
ATOM   6663  N  N7    . DA  I  5 29  ? 1.352   -8.924  13.288 1.00 133.77 ? -44  DA  I N7    1 
ATOM   6664  C  C5    . DA  I  5 29  ? 2.025   -7.715  13.247 1.00 133.71 ? -44  DA  I C5    1 
ATOM   6665  C  C6    . DA  I  5 29  ? 2.655   -7.016  12.196 1.00 133.46 ? -44  DA  I C6    1 
ATOM   6666  N  N6    . DA  I  5 29  ? 2.690   -7.475  10.944 1.00 133.44 ? -44  DA  I N6    1 
ATOM   6667  N  N1    . DA  I  5 29  ? 3.239   -5.830  12.478 1.00 133.52 ? -44  DA  I N1    1 
ATOM   6668  C  C2    . DA  I  5 29  ? 3.192   -5.373  13.738 1.00 133.58 ? -44  DA  I C2    1 
ATOM   6669  N  N3    . DA  I  5 29  ? 2.634   -5.945  14.809 1.00 133.71 ? -44  DA  I N3    1 
ATOM   6670  C  C4    . DA  I  5 29  ? 2.060   -7.125  14.499 1.00 133.74 ? -44  DA  I C4    1 
ATOM   6671  P  P     . DA  I  5 30  ? -2.103  -6.506  19.798 1.00 131.54 ? -43  DA  I P     1 
ATOM   6672  O  OP1   . DA  I  5 30  ? -1.920  -6.181  21.231 1.00 131.85 ? -43  DA  I OP1   1 
ATOM   6673  O  OP2   . DA  I  5 30  ? -3.290  -7.259  19.324 1.00 131.45 ? -43  DA  I OP2   1 
ATOM   6674  O  "O5'" . DA  I  5 30  ? -2.069  -5.160  18.952 1.00 130.75 ? -43  DA  I "O5'" 1 
ATOM   6675  C  "C5'" . DA  I  5 30  ? -1.013  -4.234  19.102 1.00 130.06 ? -43  DA  I "C5'" 1 
ATOM   6676  C  "C4'" . DA  I  5 30  ? -1.127  -3.260  17.956 1.00 129.63 ? -43  DA  I "C4'" 1 
ATOM   6677  O  "O4'" . DA  I  5 30  ? -0.634  -3.911  16.761 1.00 129.14 ? -43  DA  I "O4'" 1 
ATOM   6678  C  "C3'" . DA  I  5 30  ? -2.574  -2.858  17.691 1.00 129.43 ? -43  DA  I "C3'" 1 
ATOM   6679  O  "O3'" . DA  I  5 30  ? -2.739  -1.483  18.033 1.00 130.10 ? -43  DA  I "O3'" 1 
ATOM   6680  C  "C2'" . DA  I  5 30  ? -2.804  -3.184  16.214 1.00 129.28 ? -43  DA  I "C2'" 1 
ATOM   6681  C  "C1'" . DA  I  5 30  ? -1.415  -3.508  15.660 1.00 128.95 ? -43  DA  I "C1'" 1 
ATOM   6682  N  N9    . DA  I  5 30  ? -1.393  -4.565  14.640 1.00 128.83 ? -43  DA  I N9    1 
ATOM   6683  C  C8    . DA  I  5 30  ? -2.042  -5.769  14.665 1.00 128.53 ? -43  DA  I C8    1 
ATOM   6684  N  N7    . DA  I  5 30  ? -1.833  -6.510  13.606 1.00 128.63 ? -43  DA  I N7    1 
ATOM   6685  C  C5    . DA  I  5 30  ? -0.991  -5.740  12.822 1.00 128.77 ? -43  DA  I C5    1 
ATOM   6686  C  C6    . DA  I  5 30  ? -0.395  -5.951  11.559 1.00 128.60 ? -43  DA  I C6    1 
ATOM   6687  N  N6    . DA  I  5 30  ? -0.568  -7.058  10.840 1.00 128.73 ? -43  DA  I N6    1 
ATOM   6688  N  N1    . DA  I  5 30  ? 0.396   -4.983  11.054 1.00 128.56 ? -43  DA  I N1    1 
ATOM   6689  C  C2    . DA  I  5 30  ? 0.579   -3.867  11.768 1.00 128.68 ? -43  DA  I C2    1 
ATOM   6690  N  N3    . DA  I  5 30  ? 0.074   -3.552  12.961 1.00 128.76 ? -43  DA  I N3    1 
ATOM   6691  C  C4    . DA  I  5 30  ? -0.707  -4.538  13.443 1.00 128.88 ? -43  DA  I C4    1 
ATOM   6692  P  P     . DG  I  5 31  ? -4.095  -0.665  17.792 1.00 130.81 ? -42  DG  I P     1 
ATOM   6693  O  OP1   . DG  I  5 31  ? -4.203  0.360   18.855 1.00 131.12 ? -42  DG  I OP1   1 
ATOM   6694  O  OP2   . DG  I  5 31  ? -5.209  -1.617  17.587 1.00 130.46 ? -42  DG  I OP2   1 
ATOM   6695  O  "O5'" . DG  I  5 31  ? -3.779  0.073   16.402 1.00 132.90 ? -42  DG  I "O5'" 1 
ATOM   6696  C  "C5'" . DG  I  5 31  ? -2.479  0.640   16.132 1.00 134.97 ? -42  DG  I "C5'" 1 
ATOM   6697  C  "C4'" . DG  I  5 31  ? -2.230  0.880   14.644 1.00 136.46 ? -42  DG  I "C4'" 1 
ATOM   6698  O  "O4'" . DG  I  5 31  ? -1.935  -0.364  13.950 1.00 136.90 ? -42  DG  I "O4'" 1 
ATOM   6699  C  "C3'" . DG  I  5 31  ? -3.407  1.519   13.910 1.00 137.06 ? -42  DG  I "C3'" 1 
ATOM   6700  O  "O3'" . DG  I  5 31  ? -3.002  2.785   13.437 1.00 137.73 ? -42  DG  I "O3'" 1 
ATOM   6701  C  "C2'" . DG  I  5 31  ? -3.745  0.570   12.755 1.00 137.08 ? -42  DG  I "C2'" 1 
ATOM   6702  C  "C1'" . DG  I  5 31  ? -2.498  -0.308  12.649 1.00 137.59 ? -42  DG  I "C1'" 1 
ATOM   6703  N  N9    . DG  I  5 31  ? -2.816  -1.667  12.227 1.00 137.73 ? -42  DG  I N9    1 
ATOM   6704  C  C8    . DG  I  5 31  ? -3.449  -2.627  12.977 1.00 137.88 ? -42  DG  I C8    1 
ATOM   6705  N  N7    . DG  I  5 31  ? -3.613  -3.762  12.362 1.00 138.10 ? -42  DG  I N7    1 
ATOM   6706  C  C5    . DG  I  5 31  ? -3.059  -3.540  11.109 1.00 138.10 ? -42  DG  I C5    1 
ATOM   6707  C  C6    . DG  I  5 31  ? -2.954  -4.415  10.000 1.00 137.94 ? -42  DG  I C6    1 
ATOM   6708  O  O6    . DG  I  5 31  ? -3.341  -5.588  9.924  1.00 137.82 ? -42  DG  I O6    1 
ATOM   6709  N  N1    . DG  I  5 31  ? -2.326  -3.807  8.909  1.00 138.07 ? -42  DG  I N1    1 
ATOM   6710  C  C2    . DG  I  5 31  ? -1.857  -2.506  8.896  1.00 138.16 ? -42  DG  I C2    1 
ATOM   6711  N  N2    . DG  I  5 31  ? -1.279  -2.088  7.756  1.00 138.03 ? -42  DG  I N2    1 
ATOM   6712  N  N3    . DG  I  5 31  ? -1.955  -1.673  9.933  1.00 138.07 ? -42  DG  I N3    1 
ATOM   6713  C  C4    . DG  I  5 31  ? -2.564  -2.253  11.005 1.00 138.05 ? -42  DG  I C4    1 
ATOM   6714  P  P     . DT  I  5 32  ? -4.098  3.887   13.086 1.00 138.69 ? -41  DT  I P     1 
ATOM   6715  O  OP1   . DT  I  5 32  ? -3.541  5.178   13.534 1.00 138.70 ? -41  DT  I OP1   1 
ATOM   6716  O  OP2   . DT  I  5 32  ? -5.417  3.462   13.602 1.00 138.74 ? -41  DT  I OP2   1 
ATOM   6717  O  "O5'" . DT  I  5 32  ? -4.174  3.815   11.485 1.00 140.65 ? -41  DT  I "O5'" 1 
ATOM   6718  C  "C5'" . DT  I  5 32  ? -3.004  3.898   10.654 1.00 143.05 ? -41  DT  I "C5'" 1 
ATOM   6719  C  "C4'" . DT  I  5 32  ? -3.243  3.371   9.239  1.00 144.88 ? -41  DT  I "C4'" 1 
ATOM   6720  O  "O4'" . DT  I  5 32  ? -3.277  1.921   9.242  1.00 144.98 ? -41  DT  I "O4'" 1 
ATOM   6721  C  "C3'" . DT  I  5 32  ? -4.545  3.819   8.573  1.00 146.22 ? -41  DT  I "C3'" 1 
ATOM   6722  O  "O3'" . DT  I  5 32  ? -4.282  4.788   7.557  1.00 148.63 ? -41  DT  I "O3'" 1 
ATOM   6723  C  "C2'" . DT  I  5 32  ? -5.149  2.555   7.956  1.00 145.72 ? -41  DT  I "C2'" 1 
ATOM   6724  C  "C1'" . DT  I  5 32  ? -4.101  1.475   8.182  1.00 145.26 ? -41  DT  I "C1'" 1 
ATOM   6725  N  N1    . DT  I  5 32  ? -4.711  0.166   8.555  1.00 145.29 ? -41  DT  I N1    1 
ATOM   6726  C  C2    . DT  I  5 32  ? -4.481  -0.951  7.772  1.00 145.38 ? -41  DT  I C2    1 
ATOM   6727  O  O2    . DT  I  5 32  ? -3.788  -0.950  6.769  1.00 145.56 ? -41  DT  I O2    1 
ATOM   6728  N  N3    . DT  I  5 32  ? -5.092  -2.099  8.215  1.00 145.36 ? -41  DT  I N3    1 
ATOM   6729  C  C4    . DT  I  5 32  ? -5.898  -2.241  9.335  1.00 145.36 ? -41  DT  I C4    1 
ATOM   6730  O  O4    . DT  I  5 32  ? -6.396  -3.322  9.638  1.00 145.33 ? -41  DT  I O4    1 
ATOM   6731  C  C5    . DT  I  5 32  ? -6.104  -1.032  10.107 1.00 145.43 ? -41  DT  I C5    1 
ATOM   6732  C  C7    . DT  I  5 32  ? -6.954  -1.031  11.347 1.00 145.37 ? -41  DT  I C7    1 
ATOM   6733  C  C6    . DT  I  5 32  ? -5.511  0.093   9.684  1.00 145.35 ? -41  DT  I C6    1 
ATOM   6734  P  P     . DG  I  5 33  ? -5.478  5.565   6.817  1.00 150.53 ? -40  DG  I P     1 
ATOM   6735  O  OP1   . DG  I  5 33  ? -4.887  6.773   6.197  1.00 150.39 ? -40  DG  I OP1   1 
ATOM   6736  O  OP2   . DG  I  5 33  ? -6.592  5.716   7.784  1.00 150.32 ? -40  DG  I OP2   1 
ATOM   6737  O  "O5'" . DG  I  5 33  ? -5.960  4.539   5.674  1.00 151.66 ? -40  DG  I "O5'" 1 
ATOM   6738  C  "C5'" . DG  I  5 33  ? -5.196  4.285   4.487  1.00 153.34 ? -40  DG  I "C5'" 1 
ATOM   6739  C  "C4'" . DG  I  5 33  ? -5.949  3.372   3.526  1.00 154.76 ? -40  DG  I "C4'" 1 
ATOM   6740  O  "O4'" . DG  I  5 33  ? -6.012  2.037   4.090  1.00 155.13 ? -40  DG  I "O4'" 1 
ATOM   6741  C  "C3'" . DG  I  5 33  ? -7.395  3.773   3.218  1.00 155.64 ? -40  DG  I "C3'" 1 
ATOM   6742  O  "O3'" . DG  I  5 33  ? -7.666  3.707   1.815  1.00 156.81 ? -40  DG  I "O3'" 1 
ATOM   6743  C  "C2'" . DG  I  5 33  ? -8.239  2.756   3.980  1.00 155.66 ? -40  DG  I "C2'" 1 
ATOM   6744  C  "C1'" . DG  I  5 33  ? -7.330  1.533   3.971  1.00 155.85 ? -40  DG  I "C1'" 1 
ATOM   6745  N  N9    . DG  I  5 33  ? -7.587  0.600   5.070  1.00 155.94 ? -40  DG  I N9    1 
ATOM   6746  C  C8    . DG  I  5 33  ? -7.695  0.905   6.406  1.00 155.89 ? -40  DG  I C8    1 
ATOM   6747  N  N7    . DG  I  5 33  ? -7.922  -0.128  7.164  1.00 155.80 ? -40  DG  I N7    1 
ATOM   6748  C  C5    . DG  I  5 33  ? -7.973  -1.193  6.279  1.00 155.90 ? -40  DG  I C5    1 
ATOM   6749  C  C6    . DG  I  5 33  ? -8.196  -2.575  6.520  1.00 156.09 ? -40  DG  I C6    1 
ATOM   6750  O  O6    . DG  I  5 33  ? -8.400  -3.141  7.601  1.00 156.02 ? -40  DG  I O6    1 
ATOM   6751  N  N1    . DG  I  5 33  ? -8.170  -3.332  5.349  1.00 156.02 ? -40  DG  I N1    1 
ATOM   6752  C  C2    . DG  I  5 33  ? -7.954  -2.811  4.096  1.00 155.96 ? -40  DG  I C2    1 
ATOM   6753  N  N2    . DG  I  5 33  ? -7.964  -3.692  3.088  1.00 155.99 ? -40  DG  I N2    1 
ATOM   6754  N  N3    . DG  I  5 33  ? -7.746  -1.518  3.854  1.00 156.09 ? -40  DG  I N3    1 
ATOM   6755  C  C4    . DG  I  5 33  ? -7.769  -0.764  4.985  1.00 155.91 ? -40  DG  I C4    1 
ATOM   6756  P  P     . DT  I  5 34  ? -8.796  4.637   1.149  1.00 157.74 ? -39  DT  I P     1 
ATOM   6757  O  OP1   . DT  I  5 34  ? -8.131  5.484   0.130  1.00 157.30 ? -39  DT  I OP1   1 
ATOM   6758  O  OP2   . DT  I  5 34  ? -9.565  5.296   2.236  1.00 157.99 ? -39  DT  I OP2   1 
ATOM   6759  O  "O5'" . DT  I  5 34  ? -9.783  3.581   0.443  1.00 157.72 ? -39  DT  I "O5'" 1 
ATOM   6760  C  "C5'" . DT  I  5 34  ? -9.341  2.765   -0.650 1.00 157.98 ? -39  DT  I "C5'" 1 
ATOM   6761  C  "C4'" . DT  I  5 34  ? -9.943  1.365   -0.601 1.00 158.05 ? -39  DT  I "C4'" 1 
ATOM   6762  O  "O4'" . DT  I  5 34  ? -9.747  0.784   0.718  1.00 158.12 ? -39  DT  I "O4'" 1 
ATOM   6763  C  "C3'" . DT  I  5 34  ? -11.446 1.288   -0.889 1.00 157.92 ? -39  DT  I "C3'" 1 
ATOM   6764  O  "O3'" . DT  I  5 34  ? -11.741 0.286   -1.870 1.00 157.57 ? -39  DT  I "O3'" 1 
ATOM   6765  C  "C2'" . DT  I  5 34  ? -12.054 0.926   0.463  1.00 158.15 ? -39  DT  I "C2'" 1 
ATOM   6766  C  "C1'" . DT  I  5 34  ? -10.927 0.075   1.048  1.00 158.56 ? -39  DT  I "C1'" 1 
ATOM   6767  N  N1    . DT  I  5 34  ? -11.027 -0.162  2.533  1.00 158.74 ? -39  DT  I N1    1 
ATOM   6768  C  C2    . DT  I  5 34  ? -10.884 -1.447  3.035  1.00 158.59 ? -39  DT  I C2    1 
ATOM   6769  O  O2    . DT  I  5 34  ? -10.667 -2.433  2.353  1.00 158.64 ? -39  DT  I O2    1 
ATOM   6770  N  N3    . DT  I  5 34  ? -10.998 -1.546  4.398  1.00 158.58 ? -39  DT  I N3    1 
ATOM   6771  C  C4    . DT  I  5 34  ? -11.241 -0.519  5.294  1.00 158.75 ? -39  DT  I C4    1 
ATOM   6772  O  O4    . DT  I  5 34  ? -11.323 -0.733  6.499  1.00 158.74 ? -39  DT  I O4    1 
ATOM   6773  C  C5    . DT  I  5 34  ? -11.387 0.799   4.710  1.00 158.85 ? -39  DT  I C5    1 
ATOM   6774  C  C7    . DT  I  5 34  ? -11.653 2.006   5.565  1.00 158.66 ? -39  DT  I C7    1 
ATOM   6775  C  C6    . DT  I  5 34  ? -11.276 0.909   3.378  1.00 158.94 ? -39  DT  I C6    1 
ATOM   6776  P  P     . DA  I  5 35  ? -13.034 0.419   -2.815 1.00 157.10 ? -38  DA  I P     1 
ATOM   6777  O  OP1   . DA  I  5 35  ? -12.583 1.107   -4.048 1.00 157.31 ? -38  DA  I OP1   1 
ATOM   6778  O  OP2   . DA  I  5 35  ? -14.148 0.989   -2.017 1.00 156.89 ? -38  DA  I OP2   1 
ATOM   6779  O  "O5'" . DA  I  5 35  ? -13.457 -1.082  -3.201 1.00 156.34 ? -38  DA  I "O5'" 1 
ATOM   6780  C  "C5'" . DA  I  5 35  ? -12.581 -2.198  -3.060 1.00 155.09 ? -38  DA  I "C5'" 1 
ATOM   6781  C  "C4'" . DA  I  5 35  ? -13.302 -3.363  -2.391 1.00 154.17 ? -38  DA  I "C4'" 1 
ATOM   6782  O  "O4'" . DA  I  5 35  ? -13.176 -3.254  -0.943 1.00 154.08 ? -38  DA  I "O4'" 1 
ATOM   6783  C  "C3'" . DA  I  5 35  ? -14.804 -3.489  -2.676 1.00 153.37 ? -38  DA  I "C3'" 1 
ATOM   6784  O  "O3'" . DA  I  5 35  ? -15.123 -4.857  -2.992 1.00 152.22 ? -38  DA  I "O3'" 1 
ATOM   6785  C  "C2'" . DA  I  5 35  ? -15.439 -3.005  -1.371 1.00 153.50 ? -38  DA  I "C2'" 1 
ATOM   6786  C  "C1'" . DA  I  5 35  ? -14.434 -3.586  -0.382 1.00 153.70 ? -38  DA  I "C1'" 1 
ATOM   6787  N  N9    . DA  I  5 35  ? -14.553 -3.101  0.996  1.00 153.62 ? -38  DA  I N9    1 
ATOM   6788  C  C8    . DA  I  5 35  ? -14.294 -1.847  1.480  1.00 153.61 ? -38  DA  I C8    1 
ATOM   6789  N  N7    . DA  I  5 35  ? -14.495 -1.721  2.772  1.00 153.43 ? -38  DA  I N7    1 
ATOM   6790  C  C5    . DA  I  5 35  ? -14.913 -2.983  3.164  1.00 153.52 ? -38  DA  I C5    1 
ATOM   6791  C  C6    . DA  I  5 35  ? -15.287 -3.525  4.414  1.00 153.59 ? -38  DA  I C6    1 
ATOM   6792  N  N6    . DA  I  5 35  ? -15.296 -2.818  5.544  1.00 153.72 ? -38  DA  I N6    1 
ATOM   6793  N  N1    . DA  I  5 35  ? -15.654 -4.827  4.467  1.00 153.64 ? -38  DA  I N1    1 
ATOM   6794  C  C2    . DA  I  5 35  ? -15.648 -5.543  3.334  1.00 153.63 ? -38  DA  I C2    1 
ATOM   6795  N  N3    . DA  I  5 35  ? -15.312 -5.145  2.104  1.00 153.61 ? -38  DA  I N3    1 
ATOM   6796  C  C4    . DA  I  5 35  ? -14.953 -3.846  2.084  1.00 153.57 ? -38  DA  I C4    1 
ATOM   6797  P  P     . DT  I  5 36  ? -16.630 -5.408  -3.164 1.00 151.25 ? -37  DT  I P     1 
ATOM   6798  O  OP1   . DT  I  5 36  ? -16.543 -6.663  -3.942 1.00 151.31 ? -37  DT  I OP1   1 
ATOM   6799  O  OP2   . DT  I  5 36  ? -17.508 -4.315  -3.644 1.00 151.49 ? -37  DT  I OP2   1 
ATOM   6800  O  "O5'" . DT  I  5 36  ? -17.092 -5.755  -1.664 1.00 150.46 ? -37  DT  I "O5'" 1 
ATOM   6801  C  "C5'" . DT  I  5 36  ? -16.726 -7.001  -1.076 1.00 149.28 ? -37  DT  I "C5'" 1 
ATOM   6802  C  "C4'" . DT  I  5 36  ? -17.771 -7.473  -0.077 1.00 148.30 ? -37  DT  I "C4'" 1 
ATOM   6803  O  "O4'" . DT  I  5 36  ? -17.660 -6.697  1.148  1.00 148.35 ? -37  DT  I "O4'" 1 
ATOM   6804  C  "C3'" . DT  I  5 36  ? -19.223 -7.370  -0.542 1.00 147.34 ? -37  DT  I "C3'" 1 
ATOM   6805  O  "O3'" . DT  I  5 36  ? -19.838 -8.652  -0.356 1.00 145.91 ? -37  DT  I "O3'" 1 
ATOM   6806  C  "C2'" . DT  I  5 36  ? -19.807 -6.262  0.337  1.00 147.74 ? -37  DT  I "C2'" 1 
ATOM   6807  C  "C1'" . DT  I  5 36  ? -18.950 -6.335  1.598  1.00 147.98 ? -37  DT  I "C1'" 1 
ATOM   6808  N  N1    . DT  I  5 36  ? -18.879 -5.035  2.362  1.00 147.86 ? -37  DT  I N1    1 
ATOM   6809  C  C2    . DT  I  5 36  ? -19.258 -4.975  3.698  1.00 147.68 ? -37  DT  I C2    1 
ATOM   6810  O  O2    . DT  I  5 36  ? -19.656 -5.921  4.355  1.00 147.72 ? -37  DT  I O2    1 
ATOM   6811  N  N3    . DT  I  5 36  ? -19.149 -3.732  4.266  1.00 147.46 ? -37  DT  I N3    1 
ATOM   6812  C  C4    . DT  I  5 36  ? -18.711 -2.570  3.654  1.00 147.68 ? -37  DT  I C4    1 
ATOM   6813  O  O4    . DT  I  5 36  ? -18.655 -1.512  4.267  1.00 147.77 ? -37  DT  I O4    1 
ATOM   6814  C  C5    . DT  I  5 36  ? -18.335 -2.695  2.262  1.00 147.83 ? -37  DT  I C5    1 
ATOM   6815  C  C7    . DT  I  5 36  ? -17.846 -1.512  1.475  1.00 147.78 ? -37  DT  I C7    1 
ATOM   6816  C  C6    . DT  I  5 36  ? -18.437 -3.904  1.695  1.00 147.83 ? -37  DT  I C6    1 
ATOM   6817  P  P     . DT  I  5 37  ? -21.423 -8.910  -0.212 1.00 144.85 ? -36  DT  I P     1 
ATOM   6818  O  OP1   . DT  I  5 37  ? -21.671 -10.279 -0.727 1.00 144.89 ? -36  DT  I OP1   1 
ATOM   6819  O  OP2   . DT  I  5 37  ? -22.186 -7.778  -0.788 1.00 144.97 ? -36  DT  I OP2   1 
ATOM   6820  O  "O5'" . DT  I  5 37  ? -21.647 -8.891  1.381  1.00 143.24 ? -36  DT  I "O5'" 1 
ATOM   6821  C  "C5'" . DT  I  5 37  ? -20.933 -9.807  2.229  1.00 140.36 ? -36  DT  I "C5'" 1 
ATOM   6822  C  "C4'" . DT  I  5 37  ? -21.399 -9.712  3.672  1.00 138.04 ? -36  DT  I "C4'" 1 
ATOM   6823  O  "O4'" . DT  I  5 37  ? -21.246 -8.355  4.159  1.00 138.16 ? -36  DT  I "O4'" 1 
ATOM   6824  C  "C3'" . DT  I  5 37  ? -22.858 -10.088 3.907  1.00 136.26 ? -36  DT  I "C3'" 1 
ATOM   6825  O  "O3'" . DT  I  5 37  ? -22.889 -10.954 5.023  1.00 133.00 ? -36  DT  I "O3'" 1 
ATOM   6826  C  "C2'" . DT  I  5 37  ? -23.570 -8.759  4.178  1.00 136.99 ? -36  DT  I "C2'" 1 
ATOM   6827  C  "C1'" . DT  I  5 37  ? -22.445 -7.921  4.776  1.00 138.35 ? -36  DT  I "C1'" 1 
ATOM   6828  N  N1    . DT  I  5 37  ? -22.563 -6.439  4.573  1.00 138.67 ? -36  DT  I N1    1 
ATOM   6829  C  C2    . DT  I  5 37  ? -22.624 -5.607  5.680  1.00 139.06 ? -36  DT  I C2    1 
ATOM   6830  O  O2    . DT  I  5 37  ? -22.604 -5.998  6.838  1.00 139.17 ? -36  DT  I O2    1 
ATOM   6831  N  N3    . DT  I  5 37  ? -22.722 -4.268  5.382  1.00 139.11 ? -36  DT  I N3    1 
ATOM   6832  C  C4    . DT  I  5 37  ? -22.755 -3.686  4.124  1.00 139.02 ? -36  DT  I C4    1 
ATOM   6833  O  O4    . DT  I  5 37  ? -22.844 -2.467  3.987  1.00 138.96 ? -36  DT  I O4    1 
ATOM   6834  C  C5    . DT  I  5 37  ? -22.682 -4.610  3.008  1.00 139.10 ? -36  DT  I C5    1 
ATOM   6835  C  C7    . DT  I  5 37  ? -22.712 -4.115  1.588  1.00 138.84 ? -36  DT  I C7    1 
ATOM   6836  C  C6    . DT  I  5 37  ? -22.590 -5.922  3.285  1.00 138.89 ? -36  DT  I C6    1 
ATOM   6837  P  P     . DT  I  5 38  ? -24.255 -11.651 5.489  1.00 130.92 ? -35  DT  I P     1 
ATOM   6838  O  OP1   . DT  I  5 38  ? -23.898 -12.979 6.062  1.00 130.32 ? -35  DT  I OP1   1 
ATOM   6839  O  OP2   . DT  I  5 38  ? -25.248 -11.557 4.390  1.00 131.18 ? -35  DT  I OP2   1 
ATOM   6840  O  "O5'" . DT  I  5 38  ? -24.797 -10.689 6.663  1.00 129.10 ? -35  DT  I "O5'" 1 
ATOM   6841  C  "C5'" . DT  I  5 38  ? -24.001 -10.380 7.808  1.00 125.82 ? -35  DT  I "C5'" 1 
ATOM   6842  C  "C4'" . DT  I  5 38  ? -24.714 -9.334  8.646  1.00 123.61 ? -35  DT  I "C4'" 1 
ATOM   6843  O  "O4'" . DT  I  5 38  ? -24.569 -8.027  8.029  1.00 123.12 ? -35  DT  I "O4'" 1 
ATOM   6844  C  "C3'" . DT  I  5 38  ? -26.221 -9.561  8.824  1.00 122.34 ? -35  DT  I "C3'" 1 
ATOM   6845  O  "O3'" . DT  I  5 38  ? -26.559 -9.579  10.209 1.00 120.45 ? -35  DT  I "O3'" 1 
ATOM   6846  C  "C2'" . DT  I  5 38  ? -26.869 -8.352  8.153  1.00 122.73 ? -35  DT  I "C2'" 1 
ATOM   6847  C  "C1'" . DT  I  5 38  ? -25.763 -7.310  8.294  1.00 123.28 ? -35  DT  I "C1'" 1 
ATOM   6848  N  N1    . DT  I  5 38  ? -25.902 -6.142  7.355  1.00 123.60 ? -35  DT  I N1    1 
ATOM   6849  C  C2    . DT  I  5 38  ? -25.808 -4.842  7.840  1.00 123.48 ? -35  DT  I C2    1 
ATOM   6850  O  O2    . DT  I  5 38  ? -25.613 -4.556  9.010  1.00 123.07 ? -35  DT  I O2    1 
ATOM   6851  N  N3    . DT  I  5 38  ? -25.957 -3.865  6.882  1.00 123.69 ? -35  DT  I N3    1 
ATOM   6852  C  C4    . DT  I  5 38  ? -26.185 -4.051  5.524  1.00 123.48 ? -35  DT  I C4    1 
ATOM   6853  O  O4    . DT  I  5 38  ? -26.304 -3.103  4.752  1.00 123.43 ? -35  DT  I O4    1 
ATOM   6854  C  C5    . DT  I  5 38  ? -26.273 -5.428  5.086  1.00 123.27 ? -35  DT  I C5    1 
ATOM   6855  C  C7    . DT  I  5 38  ? -26.515 -5.772  3.646  1.00 123.24 ? -35  DT  I C7    1 
ATOM   6856  C  C6    . DT  I  5 38  ? -26.131 -6.390  6.009  1.00 123.49 ? -35  DT  I C6    1 
ATOM   6857  P  P     . DG  I  5 39  ? -26.689 -10.925 11.073 1.00 117.55 ? -34  DG  I P     1 
ATOM   6858  O  OP1   . DG  I  5 39  ? -25.635 -11.890 10.670 1.00 116.80 ? -34  DG  I OP1   1 
ATOM   6859  O  OP2   . DG  I  5 39  ? -28.122 -11.316 11.094 1.00 117.34 ? -34  DG  I OP2   1 
ATOM   6860  O  "O5'" . DG  I  5 39  ? -26.313 -10.402 12.535 1.00 116.25 ? -34  DG  I "O5'" 1 
ATOM   6861  C  "C5'" . DG  I  5 39  ? -25.171 -9.580  12.727 1.00 114.80 ? -34  DG  I "C5'" 1 
ATOM   6862  C  "C4'" . DG  I  5 39  ? -25.544 -8.356  13.549 1.00 114.92 ? -34  DG  I "C4'" 1 
ATOM   6863  O  "O4'" . DG  I  5 39  ? -26.164 -7.344  12.709 1.00 115.61 ? -34  DG  I "O4'" 1 
ATOM   6864  C  "C3'" . DG  I  5 39  ? -26.530 -8.606  14.687 1.00 114.35 ? -34  DG  I "C3'" 1 
ATOM   6865  O  "O3'" . DG  I  5 39  ? -26.107 -7.872  15.835 1.00 111.60 ? -34  DG  I "O3'" 1 
ATOM   6866  C  "C2'" . DG  I  5 39  ? -27.885 -8.136  14.137 1.00 115.65 ? -34  DG  I "C2'" 1 
ATOM   6867  C  "C1'" . DG  I  5 39  ? -27.473 -7.034  13.168 1.00 117.59 ? -34  DG  I "C1'" 1 
ATOM   6868  N  N9    . DG  I  5 39  ? -28.280 -6.872  11.955 1.00 118.52 ? -34  DG  I N9    1 
ATOM   6869  C  C8    . DG  I  5 39  ? -28.962 -7.822  11.217 1.00 118.47 ? -34  DG  I C8    1 
ATOM   6870  N  N7    . DG  I  5 39  ? -29.560 -7.334  10.161 1.00 118.38 ? -34  DG  I N7    1 
ATOM   6871  C  C5    . DG  I  5 39  ? -29.242 -5.975  10.195 1.00 118.70 ? -34  DG  I C5    1 
ATOM   6872  C  C6    . DG  I  5 39  ? -29.596 -4.912  9.322  1.00 118.22 ? -34  DG  I C6    1 
ATOM   6873  O  O6    . DG  I  5 39  ? -30.286 -4.966  8.303  1.00 118.66 ? -34  DG  I O6    1 
ATOM   6874  N  N1    . DG  I  5 39  ? -29.077 -3.683  9.719  1.00 118.15 ? -34  DG  I N1    1 
ATOM   6875  C  C2    . DG  I  5 39  ? -28.295 -3.495  10.835 1.00 118.32 ? -34  DG  I C2    1 
ATOM   6876  N  N2    . DG  I  5 39  ? -27.877 -2.247  11.072 1.00 118.26 ? -34  DG  I N2    1 
ATOM   6877  N  N3    . DG  I  5 39  ? -27.949 -4.473  11.666 1.00 119.04 ? -34  DG  I N3    1 
ATOM   6878  C  C4    . DG  I  5 39  ? -28.456 -5.680  11.289 1.00 119.06 ? -34  DG  I C4    1 
ATOM   6879  P  P     . DG  I  5 40  ? -26.801 -8.105  17.256 1.00 110.67 ? -33  DG  I P     1 
ATOM   6880  O  OP1   . DG  I  5 40  ? -25.749 -7.995  18.283 1.00 111.48 ? -33  DG  I OP1   1 
ATOM   6881  O  OP2   . DG  I  5 40  ? -27.639 -9.329  17.203 1.00 110.40 ? -33  DG  I OP2   1 
ATOM   6882  O  "O5'" . DG  I  5 40  ? -27.757 -6.830  17.412 1.00 112.48 ? -33  DG  I "O5'" 1 
ATOM   6883  C  "C5'" . DG  I  5 40  ? -27.246 -5.499  17.257 1.00 114.26 ? -33  DG  I "C5'" 1 
ATOM   6884  C  "C4'" . DG  I  5 40  ? -28.337 -4.563  16.769 1.00 116.16 ? -33  DG  I "C4'" 1 
ATOM   6885  O  "O4'" . DG  I  5 40  ? -28.815 -5.025  15.479 1.00 116.93 ? -33  DG  I "O4'" 1 
ATOM   6886  C  "C3'" . DG  I  5 40  ? -29.567 -4.499  17.670 1.00 117.73 ? -33  DG  I "C3'" 1 
ATOM   6887  O  "O3'" . DG  I  5 40  ? -29.899 -3.137  17.910 1.00 119.73 ? -33  DG  I "O3'" 1 
ATOM   6888  C  "C2'" . DG  I  5 40  ? -30.649 -5.262  16.901 1.00 118.06 ? -33  DG  I "C2'" 1 
ATOM   6889  C  "C1'" . DG  I  5 40  ? -30.224 -4.925  15.478 1.00 118.79 ? -33  DG  I "C1'" 1 
ATOM   6890  N  N9    . DG  I  5 40  ? -30.827 -5.637  14.336 1.00 119.43 ? -33  DG  I N9    1 
ATOM   6891  C  C8    . DG  I  5 40  ? -31.126 -6.971  14.126 1.00 119.57 ? -33  DG  I C8    1 
ATOM   6892  N  N7    . DG  I  5 40  ? -31.671 -7.229  12.959 1.00 119.12 ? -33  DG  I N7    1 
ATOM   6893  C  C5    . DG  I  5 40  ? -31.735 -5.977  12.359 1.00 119.47 ? -33  DG  I C5    1 
ATOM   6894  C  C6    . DG  I  5 40  ? -32.228 -5.576  11.092 1.00 119.46 ? -33  DG  I C6    1 
ATOM   6895  O  O6    . DG  I  5 40  ? -32.713 -6.286  10.202 1.00 119.77 ? -33  DG  I O6    1 
ATOM   6896  N  N1    . DG  I  5 40  ? -32.104 -4.199  10.881 1.00 119.36 ? -33  DG  I N1    1 
ATOM   6897  C  C2    . DG  I  5 40  ? -31.568 -3.304  11.784 1.00 119.51 ? -33  DG  I C2    1 
ATOM   6898  N  N2    . DG  I  5 40  ? -31.526 -2.009  11.433 1.00 119.37 ? -33  DG  I N2    1 
ATOM   6899  N  N3    . DG  I  5 40  ? -31.110 -3.661  12.975 1.00 119.95 ? -33  DG  I N3    1 
ATOM   6900  C  C4    . DG  I  5 40  ? -31.224 -5.000  13.189 1.00 119.72 ? -33  DG  I C4    1 
ATOM   6901  P  P     . DA  I  5 41  ? -30.089 -2.604  19.423 1.00 122.43 ? -32  DA  I P     1 
ATOM   6902  O  OP1   . DA  I  5 41  ? -28.854 -2.891  20.208 1.00 122.01 ? -32  DA  I OP1   1 
ATOM   6903  O  OP2   . DA  I  5 41  ? -31.411 -3.111  19.889 1.00 122.51 ? -32  DA  I OP2   1 
ATOM   6904  O  "O5'" . DA  I  5 41  ? -30.190 -1.009  19.269 1.00 124.24 ? -32  DA  I "O5'" 1 
ATOM   6905  C  "C5'" . DA  I  5 41  ? -29.594 -0.291  18.174 1.00 126.57 ? -32  DA  I "C5'" 1 
ATOM   6906  C  "C4'" . DA  I  5 41  ? -30.604 0.660   17.546 1.00 128.59 ? -32  DA  I "C4'" 1 
ATOM   6907  O  "O4'" . DA  I  5 41  ? -31.145 0.059   16.339 1.00 129.41 ? -32  DA  I "O4'" 1 
ATOM   6908  C  "C3'" . DA  I  5 41  ? -31.790 1.026   18.447 1.00 129.68 ? -32  DA  I "C3'" 1 
ATOM   6909  O  "O3'" . DA  I  5 41  ? -31.832 2.456   18.685 1.00 130.74 ? -32  DA  I "O3'" 1 
ATOM   6910  C  "C2'" . DA  I  5 41  ? -33.020 0.396   17.781 1.00 129.73 ? -32  DA  I "C2'" 1 
ATOM   6911  C  "C1'" . DA  I  5 41  ? -32.562 0.000   16.377 1.00 130.07 ? -32  DA  I "C1'" 1 
ATOM   6912  N  N9    . DA  I  5 41  ? -32.976 -1.345  15.962 1.00 130.19 ? -32  DA  I N9    1 
ATOM   6913  C  C8    . DA  I  5 41  ? -32.903 -2.495  16.703 1.00 130.33 ? -32  DA  I C8    1 
ATOM   6914  N  N7    . DA  I  5 41  ? -33.339 -3.563  16.078 1.00 130.41 ? -32  DA  I N7    1 
ATOM   6915  C  C5    . DA  I  5 41  ? -33.724 -3.091  14.834 1.00 130.49 ? -32  DA  I C5    1 
ATOM   6916  C  C6    . DA  I  5 41  ? -34.273 -3.733  13.696 1.00 130.25 ? -32  DA  I C6    1 
ATOM   6917  N  N6    . DA  I  5 41  ? -34.533 -5.045  13.644 1.00 130.29 ? -32  DA  I N6    1 
ATOM   6918  N  N1    . DA  I  5 41  ? -34.546 -2.971  12.612 1.00 130.21 ? -32  DA  I N1    1 
ATOM   6919  C  C2    . DA  I  5 41  ? -34.283 -1.653  12.666 1.00 130.38 ? -32  DA  I C2    1 
ATOM   6920  N  N3    . DA  I  5 41  ? -33.766 -0.939  13.673 1.00 130.65 ? -32  DA  I N3    1 
ATOM   6921  C  C4    . DA  I  5 41  ? -33.503 -1.722  14.742 1.00 130.56 ? -32  DA  I C4    1 
ATOM   6922  P  P     . DA  I  5 42  ? -33.009 3.468   18.277 1.00 131.51 ? -31  DA  I P     1 
ATOM   6923  O  OP1   . DA  I  5 42  ? -32.615 4.801   18.784 1.00 131.71 ? -31  DA  I OP1   1 
ATOM   6924  O  OP2   . DA  I  5 42  ? -34.323 2.926   18.706 1.00 131.95 ? -31  DA  I OP2   1 
ATOM   6925  O  "O5'" . DA  I  5 42  ? -32.919 3.460   16.678 1.00 132.70 ? -31  DA  I "O5'" 1 
ATOM   6926  C  "C5'" . DA  I  5 42  ? -33.506 4.503   15.912 1.00 134.87 ? -31  DA  I "C5'" 1 
ATOM   6927  C  "C4'" . DA  I  5 42  ? -34.860 4.114   15.333 1.00 136.66 ? -31  DA  I "C4'" 1 
ATOM   6928  O  "O4'" . DA  I  5 42  ? -34.946 2.682   15.068 1.00 136.71 ? -31  DA  I "O4'" 1 
ATOM   6929  C  "C3'" . DA  I  5 42  ? -36.070 4.476   16.200 1.00 137.84 ? -31  DA  I "C3'" 1 
ATOM   6930  O  "O3'" . DA  I  5 42  ? -36.880 5.417   15.483 1.00 139.82 ? -31  DA  I "O3'" 1 
ATOM   6931  C  "C2'" . DA  I  5 42  ? -36.797 3.145   16.401 1.00 137.63 ? -31  DA  I "C2'" 1 
ATOM   6932  C  "C1'" . DA  I  5 42  ? -36.301 2.309   15.226 1.00 137.17 ? -31  DA  I "C1'" 1 
ATOM   6933  N  N9    . DA  I  5 42  ? -36.407 0.868   15.459 1.00 137.31 ? -31  DA  I N9    1 
ATOM   6934  C  C8    . DA  I  5 42  ? -36.104 0.200   16.614 1.00 137.28 ? -31  DA  I C8    1 
ATOM   6935  N  N7    . DA  I  5 42  ? -36.290 -1.097  16.552 1.00 137.48 ? -31  DA  I N7    1 
ATOM   6936  C  C5    . DA  I  5 42  ? -36.762 -1.303  15.265 1.00 137.43 ? -31  DA  I C5    1 
ATOM   6937  C  C6    . DA  I  5 42  ? -37.157 -2.468  14.567 1.00 136.97 ? -31  DA  I C6    1 
ATOM   6938  N  N6    . DA  I  5 42  ? -37.135 -3.690  15.098 1.00 137.14 ? -31  DA  I N6    1 
ATOM   6939  N  N1    . DA  I  5 42  ? -37.575 -2.333  13.292 1.00 137.08 ? -31  DA  I N1    1 
ATOM   6940  C  C2    . DA  I  5 42  ? -37.603 -1.105  12.756 1.00 137.32 ? -31  DA  I C2    1 
ATOM   6941  N  N3    . DA  I  5 42  ? -37.254 0.062   13.306 1.00 137.55 ? -31  DA  I N3    1 
ATOM   6942  C  C4    . DA  I  5 42  ? -36.840 -0.101  14.577 1.00 137.55 ? -31  DA  I C4    1 
ATOM   6943  P  P     . DA  I  5 43  ? -38.113 6.237   16.117 1.00 141.39 ? -30  DA  I P     1 
ATOM   6944  O  OP1   . DA  I  5 43  ? -37.669 7.651   16.183 1.00 141.16 ? -30  DA  I OP1   1 
ATOM   6945  O  OP2   . DA  I  5 43  ? -38.614 5.548   17.337 1.00 140.87 ? -30  DA  I OP2   1 
ATOM   6946  O  "O5'" . DA  I  5 43  ? -39.247 6.127   14.986 1.00 141.78 ? -30  DA  I "O5'" 1 
ATOM   6947  C  "C5'" . DA  I  5 43  ? -39.191 5.114   13.985 1.00 142.64 ? -30  DA  I "C5'" 1 
ATOM   6948  C  "C4'" . DA  I  5 43  ? -40.546 4.461   13.756 1.00 143.63 ? -30  DA  I "C4'" 1 
ATOM   6949  O  "O4'" . DA  I  5 43  ? -40.404 3.018   13.846 1.00 144.40 ? -30  DA  I "O4'" 1 
ATOM   6950  C  "C3'" . DA  I  5 43  ? -41.671 4.812   14.725 1.00 143.98 ? -30  DA  I "C3'" 1 
ATOM   6951  O  "O3'" . DA  I  5 43  ? -42.876 4.818   13.972 1.00 144.00 ? -30  DA  I "O3'" 1 
ATOM   6952  C  "C2'" . DA  I  5 43  ? -41.638 3.654   15.722 1.00 144.35 ? -30  DA  I "C2'" 1 
ATOM   6953  C  "C1'" . DA  I  5 43  ? -41.340 2.495   14.772 1.00 145.00 ? -30  DA  I "C1'" 1 
ATOM   6954  N  N9    . DA  I  5 43  ? -40.812 1.261   15.382 1.00 145.36 ? -30  DA  I N9    1 
ATOM   6955  C  C8    . DA  I  5 43  ? -39.967 1.147   16.459 1.00 145.32 ? -30  DA  I C8    1 
ATOM   6956  N  N7    . DA  I  5 43  ? -39.668 -0.093  16.776 1.00 145.28 ? -30  DA  I N7    1 
ATOM   6957  C  C5    . DA  I  5 43  ? -40.359 -0.858  15.846 1.00 145.41 ? -30  DA  I C5    1 
ATOM   6958  C  C6    . DA  I  5 43  ? -40.468 -2.259  15.633 1.00 145.39 ? -30  DA  I C6    1 
ATOM   6959  N  N6    . DA  I  5 43  ? -39.850 -3.180  16.382 1.00 145.22 ? -30  DA  I N6    1 
ATOM   6960  N  N1    . DA  I  5 43  ? -41.247 -2.686  14.610 1.00 145.34 ? -30  DA  I N1    1 
ATOM   6961  C  C2    . DA  I  5 43  ? -41.878 -1.778  13.850 1.00 145.17 ? -30  DA  I C2    1 
ATOM   6962  N  N3    . DA  I  5 43  ? -41.853 -0.446  13.955 1.00 145.17 ? -30  DA  I N3    1 
ATOM   6963  C  C4    . DA  I  5 43  ? -41.069 -0.039  14.977 1.00 145.36 ? -30  DA  I C4    1 
ATOM   6964  P  P     . DC  I  5 44  ? -44.185 5.631   14.412 1.00 143.82 ? -29  DC  I P     1 
ATOM   6965  O  OP1   . DC  I  5 44  ? -44.232 6.868   13.593 1.00 143.70 ? -29  DC  I OP1   1 
ATOM   6966  O  OP2   . DC  I  5 44  ? -44.203 5.733   15.891 1.00 143.67 ? -29  DC  I OP2   1 
ATOM   6967  O  "O5'" . DC  I  5 44  ? -45.383 4.641   13.985 1.00 143.73 ? -29  DC  I "O5'" 1 
ATOM   6968  C  "C5'" . DC  I  5 44  ? -45.389 3.889   12.753 1.00 143.23 ? -29  DC  I "C5'" 1 
ATOM   6969  C  "C4'" . DC  I  5 44  ? -46.033 2.516   12.917 1.00 143.11 ? -29  DC  I "C4'" 1 
ATOM   6970  O  "O4'" . DC  I  5 44  ? -45.089 1.613   13.559 1.00 143.17 ? -29  DC  I "O4'" 1 
ATOM   6971  C  "C3'" . DC  I  5 44  ? -47.312 2.469   13.763 1.00 143.32 ? -29  DC  I "C3'" 1 
ATOM   6972  O  "O3'" . DC  I  5 44  ? -48.360 1.737   13.097 1.00 143.80 ? -29  DC  I "O3'" 1 
ATOM   6973  C  "C2'" . DC  I  5 44  ? -46.852 1.768   15.040 1.00 143.25 ? -29  DC  I "C2'" 1 
ATOM   6974  C  "C1'" . DC  I  5 44  ? -45.818 0.810   14.467 1.00 142.94 ? -29  DC  I "C1'" 1 
ATOM   6975  N  N1    . DC  I  5 44  ? -44.957 0.145   15.520 1.00 142.85 ? -29  DC  I N1    1 
ATOM   6976  C  C2    . DC  I  5 44  ? -44.952 -1.265  15.636 1.00 142.87 ? -29  DC  I C2    1 
ATOM   6977  O  O2    . DC  I  5 44  ? -45.639 -1.955  14.867 1.00 142.89 ? -29  DC  I O2    1 
ATOM   6978  N  N3    . DC  I  5 44  ? -44.184 -1.850  16.597 1.00 142.47 ? -29  DC  I N3    1 
ATOM   6979  C  C4    . DC  I  5 44  ? -43.451 -1.096  17.422 1.00 142.53 ? -29  DC  I C4    1 
ATOM   6980  N  N4    . DC  I  5 44  ? -42.713 -1.721  18.346 1.00 142.60 ? -29  DC  I N4    1 
ATOM   6981  C  C5    . DC  I  5 44  ? -43.445 0.334   17.330 1.00 142.63 ? -29  DC  I C5    1 
ATOM   6982  C  C6    . DC  I  5 44  ? -44.202 0.904   16.378 1.00 142.56 ? -29  DC  I C6    1 
ATOM   6983  P  P     . DT  I  5 45  ? -49.751 1.314   13.806 1.00 144.36 ? -28  DT  I P     1 
ATOM   6984  O  OP1   . DT  I  5 45  ? -50.812 1.428   12.777 1.00 144.34 ? -28  DT  I OP1   1 
ATOM   6985  O  OP2   . DT  I  5 45  ? -49.927 2.051   15.083 1.00 144.34 ? -28  DT  I OP2   1 
ATOM   6986  O  "O5'" . DT  I  5 45  ? -49.500 -0.237  14.154 1.00 144.11 ? -28  DT  I "O5'" 1 
ATOM   6987  C  "C5'" . DT  I  5 45  ? -50.468 -1.245  13.847 1.00 143.61 ? -28  DT  I "C5'" 1 
ATOM   6988  C  "C4'" . DT  I  5 45  ? -50.548 -2.278  14.959 1.00 143.56 ? -28  DT  I "C4'" 1 
ATOM   6989  O  "O4'" . DT  I  5 45  ? -49.302 -2.348  15.708 1.00 143.57 ? -28  DT  I "O4'" 1 
ATOM   6990  C  "C3'" . DT  I  5 45  ? -51.636 -2.036  16.004 1.00 143.34 ? -28  DT  I "C3'" 1 
ATOM   6991  O  "O3'" . DT  I  5 45  ? -52.209 -3.280  16.332 1.00 143.30 ? -28  DT  I "O3'" 1 
ATOM   6992  C  "C2'" . DT  I  5 45  ? -50.862 -1.517  17.204 1.00 143.34 ? -28  DT  I "C2'" 1 
ATOM   6993  C  "C1'" . DT  I  5 45  ? -49.655 -2.442  17.074 1.00 143.41 ? -28  DT  I "C1'" 1 
ATOM   6994  N  N1    . DT  I  5 45  ? -48.495 -2.119  17.963 1.00 143.45 ? -28  DT  I N1    1 
ATOM   6995  C  C2    . DT  I  5 45  ? -47.838 -3.152  18.617 1.00 143.50 ? -28  DT  I C2    1 
ATOM   6996  O  O2    . DT  I  5 45  ? -48.134 -4.333  18.516 1.00 143.39 ? -28  DT  I O2    1 
ATOM   6997  N  N3    . DT  I  5 45  ? -46.795 -2.748  19.413 1.00 143.52 ? -28  DT  I N3    1 
ATOM   6998  C  C4    . DT  I  5 45  ? -46.351 -1.453  19.620 1.00 143.33 ? -28  DT  I C4    1 
ATOM   6999  O  O4    . DT  I  5 45  ? -45.397 -1.218  20.359 1.00 143.36 ? -28  DT  I O4    1 
ATOM   7000  C  C5    . DT  I  5 45  ? -47.083 -0.424  18.907 1.00 143.31 ? -28  DT  I C5    1 
ATOM   7001  C  C7    . DT  I  5 45  ? -46.713 1.027   19.034 1.00 143.40 ? -28  DT  I C7    1 
ATOM   7002  C  C6    . DT  I  5 45  ? -48.105 -0.802  18.125 1.00 143.19 ? -28  DT  I C6    1 
ATOM   7003  P  P     . DG  I  5 46  ? -53.579 -3.746  15.660 1.00 143.08 ? -27  DG  I P     1 
ATOM   7004  O  OP1   . DG  I  5 46  ? -53.689 -3.074  14.332 1.00 143.19 ? -27  DG  I OP1   1 
ATOM   7005  O  OP2   . DG  I  5 46  ? -54.645 -3.553  16.688 1.00 142.70 ? -27  DG  I OP2   1 
ATOM   7006  O  "O5'" . DG  I  5 46  ? -53.372 -5.335  15.429 1.00 142.29 ? -27  DG  I "O5'" 1 
ATOM   7007  C  "C5'" . DG  I  5 46  ? -52.082 -5.970  15.609 1.00 140.97 ? -27  DG  I "C5'" 1 
ATOM   7008  C  "C4'" . DG  I  5 46  ? -52.167 -7.159  16.576 1.00 140.20 ? -27  DG  I "C4'" 1 
ATOM   7009  O  "O4'" . DG  I  5 46  ? -51.250 -6.988  17.696 1.00 140.16 ? -27  DG  I "O4'" 1 
ATOM   7010  C  "C3'" . DG  I  5 46  ? -53.504 -7.444  17.257 1.00 139.45 ? -27  DG  I "C3'" 1 
ATOM   7011  O  "O3'" . DG  I  5 46  ? -53.521 -8.815  17.646 1.00 138.13 ? -27  DG  I "O3'" 1 
ATOM   7012  C  "C2'" . DG  I  5 46  ? -53.436 -6.530  18.479 1.00 139.57 ? -27  DG  I "C2'" 1 
ATOM   7013  C  "C1'" . DG  I  5 46  ? -51.979 -6.745  18.892 1.00 139.90 ? -27  DG  I "C1'" 1 
ATOM   7014  N  N9    . DG  I  5 46  ? -51.359 -5.615  19.586 1.00 139.98 ? -27  DG  I N9    1 
ATOM   7015  C  C8    . DG  I  5 46  ? -51.638 -4.276  19.430 1.00 139.87 ? -27  DG  I C8    1 
ATOM   7016  N  N7    . DG  I  5 46  ? -50.913 -3.499  20.186 1.00 139.84 ? -27  DG  I N7    1 
ATOM   7017  C  C5    . DG  I  5 46  ? -50.099 -4.376  20.893 1.00 139.93 ? -27  DG  I C5    1 
ATOM   7018  C  C6    . DG  I  5 46  ? -49.100 -4.116  21.865 1.00 139.83 ? -27  DG  I C6    1 
ATOM   7019  O  O6    . DG  I  5 46  ? -48.725 -3.023  22.310 1.00 139.63 ? -27  DG  I O6    1 
ATOM   7020  N  N1    . DG  I  5 46  ? -48.511 -5.291  22.334 1.00 139.98 ? -27  DG  I N1    1 
ATOM   7021  C  C2    . DG  I  5 46  ? -48.843 -6.559  21.909 1.00 139.85 ? -27  DG  I C2    1 
ATOM   7022  N  N2    . DG  I  5 46  ? -48.171 -7.569  22.474 1.00 139.89 ? -27  DG  I N2    1 
ATOM   7023  N  N3    . DG  I  5 46  ? -49.774 -6.818  20.997 1.00 139.73 ? -27  DG  I N3    1 
ATOM   7024  C  C4    . DG  I  5 46  ? -50.359 -5.684  20.531 1.00 139.97 ? -27  DG  I C4    1 
ATOM   7025  P  P     . DC  I  5 47  ? -54.868 -9.594  18.040 1.00 137.25 ? -26  DC  I P     1 
ATOM   7026  O  OP1   . DC  I  5 47  ? -55.170 -10.464 16.883 1.00 137.11 ? -26  DC  I OP1   1 
ATOM   7027  O  OP2   . DC  I  5 47  ? -55.886 -8.634  18.542 1.00 137.14 ? -26  DC  I OP2   1 
ATOM   7028  O  "O5'" . DC  I  5 47  ? -54.451 -10.510 19.298 1.00 136.18 ? -26  DC  I "O5'" 1 
ATOM   7029  C  "C5'" . DC  I  5 47  ? -53.094 -10.935 19.568 1.00 133.15 ? -26  DC  I "C5'" 1 
ATOM   7030  C  "C4'" . DC  I  5 47  ? -52.744 -10.817 21.047 1.00 130.79 ? -26  DC  I "C4'" 1 
ATOM   7031  O  "O4'" . DC  I  5 47  ? -52.477 -9.426  21.361 1.00 130.27 ? -26  DC  I "O4'" 1 
ATOM   7032  C  "C3'" . DC  I  5 47  ? -53.827 -11.283 22.025 1.00 129.80 ? -26  DC  I "C3'" 1 
ATOM   7033  O  "O3'" . DC  I  5 47  ? -53.297 -12.253 22.937 1.00 128.18 ? -26  DC  I "O3'" 1 
ATOM   7034  C  "C2'" . DC  I  5 47  ? -54.283 -10.009 22.744 1.00 130.00 ? -26  DC  I "C2'" 1 
ATOM   7035  C  "C1'" . DC  I  5 47  ? -53.055 -9.103  22.612 1.00 130.04 ? -26  DC  I "C1'" 1 
ATOM   7036  N  N1    . DC  I  5 47  ? -53.311 -7.611  22.660 1.00 129.80 ? -26  DC  I N1    1 
ATOM   7037  C  C2    . DC  I  5 47  ? -52.304 -6.739  23.117 1.00 129.73 ? -26  DC  I C2    1 
ATOM   7038  O  O2    . DC  I  5 47  ? -51.216 -7.203  23.483 1.00 129.70 ? -26  DC  I O2    1 
ATOM   7039  N  N3    . DC  I  5 47  ? -52.547 -5.399  23.151 1.00 129.49 ? -26  DC  I N3    1 
ATOM   7040  C  C4    . DC  I  5 47  ? -53.728 -4.919  22.756 1.00 129.64 ? -26  DC  I C4    1 
ATOM   7041  N  N4    . DC  I  5 47  ? -53.928 -3.598  22.809 1.00 129.64 ? -26  DC  I N4    1 
ATOM   7042  C  C5    . DC  I  5 47  ? -54.763 -5.783  22.289 1.00 130.07 ? -26  DC  I C5    1 
ATOM   7043  C  C6    . DC  I  5 47  ? -54.514 -7.101  22.258 1.00 129.98 ? -26  DC  I C6    1 
ATOM   7044  P  P     . DT  I  5 48  ? -53.501 -13.825 22.661 1.00 126.59 ? -25  DT  I P     1 
ATOM   7045  O  OP1   . DT  I  5 48  ? -52.560 -14.233 21.582 1.00 126.15 ? -25  DT  I OP1   1 
ATOM   7046  O  OP2   . DT  I  5 48  ? -54.962 -14.055 22.514 1.00 126.89 ? -25  DT  I OP2   1 
ATOM   7047  O  "O5'" . DT  I  5 48  ? -53.037 -14.534 24.021 1.00 124.45 ? -25  DT  I "O5'" 1 
ATOM   7048  C  "C5'" . DT  I  5 48  ? -52.977 -13.796 25.226 1.00 121.69 ? -25  DT  I "C5'" 1 
ATOM   7049  C  "C4'" . DT  I  5 48  ? -51.532 -13.445 25.565 1.00 119.41 ? -25  DT  I "C4'" 1 
ATOM   7050  O  "O4'" . DT  I  5 48  ? -51.305 -12.030 25.310 1.00 119.28 ? -25  DT  I "O4'" 1 
ATOM   7051  C  "C3'" . DT  I  5 48  ? -51.194 -13.661 27.035 1.00 117.51 ? -25  DT  I "C3'" 1 
ATOM   7052  O  "O3'" . DT  I  5 48  ? -49.827 -14.024 27.223 1.00 113.81 ? -25  DT  I "O3'" 1 
ATOM   7053  C  "C2'" . DT  I  5 48  ? -51.529 -12.314 27.667 1.00 118.51 ? -25  DT  I "C2'" 1 
ATOM   7054  C  "C1'" . DT  I  5 48  ? -51.275 -11.316 26.536 1.00 120.24 ? -25  DT  I "C1'" 1 
ATOM   7055  N  N1    . DT  I  5 48  ? -52.268 -10.174 26.553 1.00 120.80 ? -25  DT  I N1    1 
ATOM   7056  C  C2    . DT  I  5 48  ? -51.811 -8.902  26.838 1.00 121.13 ? -25  DT  I C2    1 
ATOM   7057  O  O2    . DT  I  5 48  ? -50.648 -8.627  27.064 1.00 121.65 ? -25  DT  I O2    1 
ATOM   7058  N  N3    . DT  I  5 48  ? -52.769 -7.927  26.846 1.00 121.24 ? -25  DT  I N3    1 
ATOM   7059  C  C4    . DT  I  5 48  ? -54.120 -8.079  26.614 1.00 121.17 ? -25  DT  I C4    1 
ATOM   7060  O  O4    . DT  I  5 48  ? -54.870 -7.104  26.655 1.00 121.27 ? -25  DT  I O4    1 
ATOM   7061  C  C5    . DT  I  5 48  ? -54.549 -9.436  26.328 1.00 121.24 ? -25  DT  I C5    1 
ATOM   7062  C  C7    . DT  I  5 48  ? -55.993 -9.757  26.053 1.00 121.17 ? -25  DT  I C7    1 
ATOM   7063  C  C6    . DT  I  5 48  ? -53.615 -10.401 26.314 1.00 121.02 ? -25  DT  I C6    1 
ATOM   7064  P  P     . DC  I  5 49  ? -49.353 -14.789 28.561 1.00 110.97 ? -24  DC  I P     1 
ATOM   7065  O  OP1   . DC  I  5 49  ? -47.957 -15.222 28.322 1.00 110.46 ? -24  DC  I OP1   1 
ATOM   7066  O  OP2   . DC  I  5 49  ? -50.390 -15.769 28.970 1.00 110.31 ? -24  DC  I OP2   1 
ATOM   7067  O  "O5'" . DC  I  5 49  ? -49.356 -13.677 29.702 1.00 109.04 ? -24  DC  I "O5'" 1 
ATOM   7068  C  "C5'" . DC  I  5 49  ? -48.557 -12.502 29.614 1.00 106.72 ? -24  DC  I "C5'" 1 
ATOM   7069  C  "C4'" . DC  I  5 49  ? -48.998 -11.563 30.716 1.00 105.04 ? -24  DC  I "C4'" 1 
ATOM   7070  O  "O4'" . DC  I  5 49  ? -50.131 -10.780 30.261 1.00 105.81 ? -24  DC  I "O4'" 1 
ATOM   7071  C  "C3'" . DC  I  5 49  ? -49.470 -12.263 32.001 1.00 103.19 ? -24  DC  I "C3'" 1 
ATOM   7072  O  "O3'" . DC  I  5 49  ? -49.222 -11.438 33.118 1.00 98.63  ? -24  DC  I "O3'" 1 
ATOM   7073  C  "C2'" . DC  I  5 49  ? -50.974 -12.331 31.813 1.00 104.65 ? -24  DC  I "C2'" 1 
ATOM   7074  C  "C1'" . DC  I  5 49  ? -51.116 -10.910 31.271 1.00 107.06 ? -24  DC  I "C1'" 1 
ATOM   7075  N  N1    . DC  I  5 49  ? -52.482 -10.525 30.805 1.00 108.25 ? -24  DC  I N1    1 
ATOM   7076  C  C2    . DC  I  5 49  ? -52.835 -9.160  30.809 1.00 108.66 ? -24  DC  I C2    1 
ATOM   7077  O  O2    . DC  I  5 49  ? -52.022 -8.302  31.186 1.00 108.36 ? -24  DC  I O2    1 
ATOM   7078  N  N3    . DC  I  5 49  ? -54.090 -8.827  30.403 1.00 109.33 ? -24  DC  I N3    1 
ATOM   7079  C  C4    . DC  I  5 49  ? -54.950 -9.778  30.004 1.00 108.56 ? -24  DC  I C4    1 
ATOM   7080  N  N4    . DC  I  5 49  ? -56.163 -9.381  29.611 1.00 108.60 ? -24  DC  I N4    1 
ATOM   7081  C  C5    . DC  I  5 49  ? -54.609 -11.168 29.997 1.00 108.29 ? -24  DC  I C5    1 
ATOM   7082  C  C6    . DC  I  5 49  ? -53.378 -11.493 30.407 1.00 108.20 ? -24  DC  I C6    1 
ATOM   7083  P  P     . DC  I  5 50  ? -47.799 -11.436 33.816 1.00 93.08  ? -23  DC  I P     1 
ATOM   7084  O  OP1   . DC  I  5 50  ? -46.763 -11.320 32.760 1.00 92.82  ? -23  DC  I OP1   1 
ATOM   7085  O  OP2   . DC  I  5 50  ? -47.826 -12.551 34.781 1.00 94.72  ? -23  DC  I OP2   1 
ATOM   7086  O  "O5'" . DC  I  5 50  ? -47.828 -10.092 34.668 1.00 93.16  ? -23  DC  I "O5'" 1 
ATOM   7087  C  "C5'" . DC  I  5 50  ? -47.333 -8.885  34.088 1.00 92.02  ? -23  DC  I "C5'" 1 
ATOM   7088  C  "C4'" . DC  I  5 50  ? -48.207 -7.718  34.497 1.00 91.52  ? -23  DC  I "C4'" 1 
ATOM   7089  O  "O4'" . DC  I  5 50  ? -49.477 -7.856  33.821 1.00 92.00  ? -23  DC  I "O4'" 1 
ATOM   7090  C  "C3'" . DC  I  5 50  ? -48.515 -7.663  35.989 1.00 90.95  ? -23  DC  I "C3'" 1 
ATOM   7091  O  "O3'" . DC  I  5 50  ? -48.121 -6.422  36.498 1.00 90.31  ? -23  DC  I "O3'" 1 
ATOM   7092  C  "C2'" . DC  I  5 50  ? -50.026 -7.818  36.102 1.00 91.71  ? -23  DC  I "C2'" 1 
ATOM   7093  C  "C1'" . DC  I  5 50  ? -50.507 -7.470  34.703 1.00 92.99  ? -23  DC  I "C1'" 1 
ATOM   7094  N  N1    . DC  I  5 50  ? -51.748 -8.185  34.306 1.00 93.67  ? -23  DC  I N1    1 
ATOM   7095  C  C2    . DC  I  5 50  ? -52.874 -7.447  33.888 1.00 94.07  ? -23  DC  I C2    1 
ATOM   7096  O  O2    . DC  I  5 50  ? -52.820 -6.206  33.855 1.00 94.43  ? -23  DC  I O2    1 
ATOM   7097  N  N3    . DC  I  5 50  ? -53.999 -8.121  33.529 1.00 93.58  ? -23  DC  I N3    1 
ATOM   7098  C  C4    . DC  I  5 50  ? -54.023 -9.454  33.590 1.00 94.13  ? -23  DC  I C4    1 
ATOM   7099  N  N4    . DC  I  5 50  ? -55.149 -10.080 33.226 1.00 94.26  ? -23  DC  I N4    1 
ATOM   7100  C  C5    . DC  I  5 50  ? -52.888 -10.218 34.017 1.00 94.66  ? -23  DC  I C5    1 
ATOM   7101  C  C6    . DC  I  5 50  ? -51.779 -9.552  34.359 1.00 93.77  ? -23  DC  I C6    1 
ATOM   7102  P  P     . DA  I  5 51  ? -47.906 -6.236  38.066 1.00 90.57  ? -22  DA  I P     1 
ATOM   7103  O  OP1   . DA  I  5 51  ? -46.525 -5.741  38.221 1.00 91.76  ? -22  DA  I OP1   1 
ATOM   7104  O  OP2   . DA  I  5 51  ? -48.336 -7.474  38.741 1.00 91.02  ? -22  DA  I OP2   1 
ATOM   7105  O  "O5'" . DA  I  5 51  ? -48.928 -5.086  38.523 1.00 94.11  ? -22  DA  I "O5'" 1 
ATOM   7106  C  "C5'" . DA  I  5 51  ? -49.146 -3.916  37.711 1.00 96.51  ? -22  DA  I "C5'" 1 
ATOM   7107  C  "C4'" . DA  I  5 51  ? -50.266 -3.003  38.205 1.00 98.16  ? -22  DA  I "C4'" 1 
ATOM   7108  O  "O4'" . DA  I  5 51  ? -51.541 -3.440  37.695 1.00 98.86  ? -22  DA  I "O4'" 1 
ATOM   7109  C  "C3'" . DA  I  5 51  ? -50.472 -2.856  39.703 1.00 99.90  ? -22  DA  I "C3'" 1 
ATOM   7110  O  "O3'" . DA  I  5 51  ? -50.822 -1.502  39.945 1.00 102.58 ? -22  DA  I "O3'" 1 
ATOM   7111  C  "C2'" . DA  I  5 51  ? -51.605 -3.826  40.023 1.00 99.96  ? -22  DA  I "C2'" 1 
ATOM   7112  C  "C1'" . DA  I  5 51  ? -52.408 -3.842  38.736 1.00 101.12 ? -22  DA  I "C1'" 1 
ATOM   7113  N  N9    . DA  I  5 51  ? -52.862 -5.161  38.320 1.00 101.76 ? -22  DA  I N9    1 
ATOM   7114  C  C8    . DA  I  5 51  ? -52.160 -6.328  38.411 1.00 102.09 ? -22  DA  I C8    1 
ATOM   7115  N  N7    . DA  I  5 51  ? -52.797 -7.366  37.933 1.00 102.38 ? -22  DA  I N7    1 
ATOM   7116  C  C5    . DA  I  5 51  ? -53.997 -6.848  37.484 1.00 102.45 ? -22  DA  I C5    1 
ATOM   7117  C  C6    . DA  I  5 51  ? -55.120 -7.449  36.873 1.00 102.35 ? -22  DA  I C6    1 
ATOM   7118  N  N6    . DA  I  5 51  ? -55.192 -8.758  36.601 1.00 101.83 ? -22  DA  I N6    1 
ATOM   7119  N  N1    . DA  I  5 51  ? -56.165 -6.645  36.552 1.00 102.29 ? -22  DA  I N1    1 
ATOM   7120  C  C2    . DA  I  5 51  ? -56.087 -5.331  36.826 1.00 102.27 ? -22  DA  I C2    1 
ATOM   7121  N  N3    . DA  I  5 51  ? -55.086 -4.657  37.404 1.00 102.37 ? -22  DA  I N3    1 
ATOM   7122  C  C4    . DA  I  5 51  ? -54.058 -5.481  37.711 1.00 102.53 ? -22  DA  I C4    1 
ATOM   7123  P  P     . DT  I  5 52  ? -51.442 -0.991  41.336 1.00 105.42 ? -21  DT  I P     1 
ATOM   7124  O  OP1   . DT  I  5 52  ? -51.026 0.420   41.480 1.00 104.61 ? -21  DT  I OP1   1 
ATOM   7125  O  OP2   . DT  I  5 52  ? -51.170 -1.955  42.430 1.00 104.21 ? -21  DT  I OP2   1 
ATOM   7126  O  "O5'" . DT  I  5 52  ? -53.025 -1.078  41.062 1.00 108.95 ? -21  DT  I "O5'" 1 
ATOM   7127  C  "C5'" . DT  I  5 52  ? -53.748 -0.369  40.035 1.00 111.35 ? -21  DT  I "C5'" 1 
ATOM   7128  C  "C4'" . DT  I  5 52  ? -55.228 -0.704  40.197 1.00 114.08 ? -21  DT  I "C4'" 1 
ATOM   7129  O  "O4'" . DT  I  5 52  ? -55.505 -2.038  39.679 1.00 114.54 ? -21  DT  I "O4'" 1 
ATOM   7130  C  "C3'" . DT  I  5 52  ? -55.759 -0.682  41.636 1.00 116.07 ? -21  DT  I "C3'" 1 
ATOM   7131  O  "O3'" . DT  I  5 52  ? -56.901 0.190   41.767 1.00 119.20 ? -21  DT  I "O3'" 1 
ATOM   7132  C  "C2'" . DT  I  5 52  ? -56.126 -2.137  41.935 1.00 115.54 ? -21  DT  I "C2'" 1 
ATOM   7133  C  "C1'" . DT  I  5 52  ? -56.438 -2.671  40.540 1.00 115.43 ? -21  DT  I "C1'" 1 
ATOM   7134  N  N1    . DT  I  5 52  ? -56.295 -4.156  40.421 1.00 115.79 ? -21  DT  I N1    1 
ATOM   7135  C  C2    . DT  I  5 52  ? -57.232 -4.885  39.702 1.00 116.04 ? -21  DT  I C2    1 
ATOM   7136  O  O2    . DT  I  5 52  ? -58.187 -4.387  39.135 1.00 116.36 ? -21  DT  I O2    1 
ATOM   7137  N  N3    . DT  I  5 52  ? -57.007 -6.243  39.654 1.00 115.87 ? -21  DT  I N3    1 
ATOM   7138  C  C4    . DT  I  5 52  ? -55.956 -6.935  40.245 1.00 116.11 ? -21  DT  I C4    1 
ATOM   7139  O  O4    . DT  I  5 52  ? -55.834 -8.158  40.140 1.00 116.23 ? -21  DT  I O4    1 
ATOM   7140  C  C5    . DT  I  5 52  ? -55.012 -6.118  40.986 1.00 116.21 ? -21  DT  I C5    1 
ATOM   7141  C  C7    . DT  I  5 52  ? -53.830 -6.746  41.672 1.00 115.97 ? -21  DT  I C7    1 
ATOM   7142  C  C6    . DT  I  5 52  ? -55.226 -4.790  41.035 1.00 116.09 ? -21  DT  I C6    1 
ATOM   7143  P  P     . DC  I  5 53  ? -57.565 0.612   43.181 1.00 121.02 ? -20  DC  I P     1 
ATOM   7144  O  OP1   . DC  I  5 53  ? -57.845 2.062   43.083 1.00 120.60 ? -20  DC  I OP1   1 
ATOM   7145  O  OP2   . DC  I  5 53  ? -56.754 0.124   44.328 1.00 121.11 ? -20  DC  I OP2   1 
ATOM   7146  O  "O5'" . DC  I  5 53  ? -58.939 -0.216  43.197 1.00 122.88 ? -20  DC  I "O5'" 1 
ATOM   7147  C  "C5'" . DC  I  5 53  ? -59.571 -0.716  42.005 1.00 125.64 ? -20  DC  I "C5'" 1 
ATOM   7148  C  "C4'" . DC  I  5 53  ? -60.674 -1.703  42.361 1.00 128.04 ? -20  DC  I "C4'" 1 
ATOM   7149  O  "O4'" . DC  I  5 53  ? -60.202 -3.061  42.177 1.00 128.40 ? -20  DC  I "O4'" 1 
ATOM   7150  C  "C3'" . DC  I  5 53  ? -61.191 -1.636  43.800 1.00 129.72 ? -20  DC  I "C3'" 1 
ATOM   7151  O  "O3'" . DC  I  5 53  ? -62.590 -1.919  43.835 1.00 131.70 ? -20  DC  I "O3'" 1 
ATOM   7152  C  "C2'" . DC  I  5 53  ? -60.385 -2.726  44.498 1.00 129.43 ? -20  DC  I "C2'" 1 
ATOM   7153  C  "C1'" . DC  I  5 53  ? -60.400 -3.770  43.388 1.00 129.41 ? -20  DC  I "C1'" 1 
ATOM   7154  N  N1    . DC  I  5 53  ? -59.372 -4.844  43.521 1.00 129.73 ? -20  DC  I N1    1 
ATOM   7155  C  C2    . DC  I  5 53  ? -59.592 -6.075  42.878 1.00 129.86 ? -20  DC  I C2    1 
ATOM   7156  O  O2    . DC  I  5 53  ? -60.624 -6.242  42.216 1.00 129.88 ? -20  DC  I O2    1 
ATOM   7157  N  N3    . DC  I  5 53  ? -58.657 -7.055  43.001 1.00 129.99 ? -20  DC  I N3    1 
ATOM   7158  C  C4    . DC  I  5 53  ? -57.551 -6.837  43.727 1.00 129.70 ? -20  DC  I C4    1 
ATOM   7159  N  N4    . DC  I  5 53  ? -56.662 -7.830  43.821 1.00 129.53 ? -20  DC  I N4    1 
ATOM   7160  C  C5    . DC  I  5 53  ? -57.309 -5.591  44.391 1.00 129.71 ? -20  DC  I C5    1 
ATOM   7161  C  C6    . DC  I  5 53  ? -58.237 -4.632  44.262 1.00 129.69 ? -20  DC  I C6    1 
ATOM   7162  P  P     . DA  I  5 54  ? -63.463 -1.677  45.163 1.00 133.37 ? -19  DA  I P     1 
ATOM   7163  O  OP1   . DA  I  5 54  ? -63.475 -0.213  45.413 1.00 132.75 ? -19  DA  I OP1   1 
ATOM   7164  O  OP2   . DA  I  5 54  ? -63.026 -2.608  46.236 1.00 133.10 ? -19  DA  I OP2   1 
ATOM   7165  O  "O5'" . DA  I  5 54  ? -64.916 -2.157  44.691 1.00 134.78 ? -19  DA  I "O5'" 1 
ATOM   7166  C  "C5'" . DA  I  5 54  ? -65.071 -3.087  43.611 1.00 136.69 ? -19  DA  I "C5'" 1 
ATOM   7167  C  "C4'" . DA  I  5 54  ? -66.007 -4.225  43.988 1.00 138.18 ? -19  DA  I "C4'" 1 
ATOM   7168  O  "O4'" . DA  I  5 54  ? -65.290 -5.486  43.983 1.00 138.37 ? -19  DA  I "O4'" 1 
ATOM   7169  C  "C3'" . DA  I  5 54  ? -66.684 -4.132  45.354 1.00 139.04 ? -19  DA  I "C3'" 1 
ATOM   7170  O  "O3'" . DA  I  5 54  ? -67.988 -4.700  45.228 1.00 140.19 ? -19  DA  I "O3'" 1 
ATOM   7171  C  "C2'" . DA  I  5 54  ? -65.748 -4.940  46.252 1.00 139.19 ? -19  DA  I "C2'" 1 
ATOM   7172  C  "C1'" . DA  I  5 54  ? -65.204 -6.004  45.299 1.00 139.43 ? -19  DA  I "C1'" 1 
ATOM   7173  N  N9    . DA  I  5 54  ? -63.806 -6.352  45.548 1.00 139.81 ? -19  DA  I N9    1 
ATOM   7174  C  C8    . DA  I  5 54  ? -62.859 -5.587  46.179 1.00 139.84 ? -19  DA  I C8    1 
ATOM   7175  N  N7    . DA  I  5 54  ? -61.679 -6.151  46.258 1.00 139.93 ? -19  DA  I N7    1 
ATOM   7176  C  C5    . DA  I  5 54  ? -61.865 -7.374  45.635 1.00 139.91 ? -19  DA  I C5    1 
ATOM   7177  C  C6    . DA  I  5 54  ? -60.992 -8.451  45.388 1.00 139.72 ? -19  DA  I C6    1 
ATOM   7178  N  N6    . DA  I  5 54  ? -59.713 -8.437  45.766 1.00 139.74 ? -19  DA  I N6    1 
ATOM   7179  N  N1    . DA  I  5 54  ? -61.483 -9.535  44.741 1.00 139.71 ? -19  DA  I N1    1 
ATOM   7180  C  C2    . DA  I  5 54  ? -62.770 -9.541  44.367 1.00 139.72 ? -19  DA  I C2    1 
ATOM   7181  N  N3    . DA  I  5 54  ? -63.688 -8.587  44.544 1.00 139.77 ? -19  DA  I N3    1 
ATOM   7182  C  C4    . DA  I  5 54  ? -63.168 -7.521  45.189 1.00 139.93 ? -19  DA  I C4    1 
ATOM   7183  P  P     . DA  I  5 55  ? -68.881 -5.223  46.456 1.00 141.01 ? -18  DA  I P     1 
ATOM   7184  O  OP1   . DA  I  5 55  ? -70.287 -5.057  46.016 1.00 141.20 ? -18  DA  I OP1   1 
ATOM   7185  O  OP2   . DA  I  5 55  ? -68.431 -4.581  47.717 1.00 140.76 ? -18  DA  I OP2   1 
ATOM   7186  O  "O5'" . DA  I  5 55  ? -68.544 -6.793  46.550 1.00 140.98 ? -18  DA  I "O5'" 1 
ATOM   7187  C  "C5'" . DA  I  5 55  ? -68.779 -7.711  45.466 1.00 141.57 ? -18  DA  I "C5'" 1 
ATOM   7188  C  "C4'" . DA  I  5 55  ? -68.317 -9.115  45.844 1.00 142.56 ? -18  DA  I "C4'" 1 
ATOM   7189  O  "O4'" . DA  I  5 55  ? -66.876 -9.108  46.063 1.00 143.02 ? -18  DA  I "O4'" 1 
ATOM   7190  C  "C3'" . DA  I  5 55  ? -68.938 -9.677  47.128 1.00 143.26 ? -18  DA  I "C3'" 1 
ATOM   7191  O  "O3'" . DA  I  5 55  ? -69.248 -11.081 47.036 1.00 143.86 ? -18  DA  I "O3'" 1 
ATOM   7192  C  "C2'" . DA  I  5 55  ? -67.860 -9.418  48.179 1.00 143.24 ? -18  DA  I "C2'" 1 
ATOM   7193  C  "C1'" . DA  I  5 55  ? -66.583 -9.595  47.365 1.00 142.96 ? -18  DA  I "C1'" 1 
ATOM   7194  N  N9    . DA  I  5 55  ? -65.437 -8.908  47.974 1.00 142.96 ? -18  DA  I N9    1 
ATOM   7195  C  C8    . DA  I  5 55  ? -65.426 -7.689  48.607 1.00 142.78 ? -18  DA  I C8    1 
ATOM   7196  N  N7    . DA  I  5 55  ? -64.253 -7.332  49.071 1.00 142.63 ? -18  DA  I N7    1 
ATOM   7197  C  C5    . DA  I  5 55  ? -63.433 -8.394  48.726 1.00 142.93 ? -18  DA  I C5    1 
ATOM   7198  C  C6    . DA  I  5 55  ? -62.058 -8.645  48.927 1.00 142.74 ? -18  DA  I C6    1 
ATOM   7199  N  N6    . DA  I  5 55  ? -61.240 -7.799  49.554 1.00 142.70 ? -18  DA  I N6    1 
ATOM   7200  N  N1    . DA  I  5 55  ? -61.550 -9.807  48.459 1.00 142.83 ? -18  DA  I N1    1 
ATOM   7201  C  C2    . DA  I  5 55  ? -62.362 -10.666 47.825 1.00 142.76 ? -18  DA  I C2    1 
ATOM   7202  N  N3    . DA  I  5 55  ? -63.666 -10.541 47.574 1.00 142.87 ? -18  DA  I N3    1 
ATOM   7203  C  C4    . DA  I  5 55  ? -64.146 -9.376  48.053 1.00 142.96 ? -18  DA  I C4    1 
ATOM   7204  P  P     . DA  I  5 56  ? -70.024 -11.846 48.227 1.00 144.67 ? -17  DA  I P     1 
ATOM   7205  O  OP1   . DA  I  5 56  ? -71.233 -12.467 47.647 1.00 145.42 ? -17  DA  I OP1   1 
ATOM   7206  O  OP2   . DA  I  5 56  ? -70.157 -10.951 49.401 1.00 144.12 ? -17  DA  I OP2   1 
ATOM   7207  O  "O5'" . DA  I  5 56  ? -69.032 -13.029 48.637 1.00 145.04 ? -17  DA  I "O5'" 1 
ATOM   7208  C  "C5'" . DA  I  5 56  ? -68.479 -13.913 47.655 1.00 145.55 ? -17  DA  I "C5'" 1 
ATOM   7209  C  "C4'" . DA  I  5 56  ? -67.220 -14.553 48.213 1.00 145.81 ? -17  DA  I "C4'" 1 
ATOM   7210  O  "O4'" . DA  I  5 56  ? -66.226 -13.519 48.457 1.00 146.02 ? -17  DA  I "O4'" 1 
ATOM   7211  C  "C3'" . DA  I  5 56  ? -67.435 -15.302 49.531 1.00 145.55 ? -17  DA  I "C3'" 1 
ATOM   7212  O  "O3'" . DA  I  5 56  ? -67.041 -16.680 49.380 1.00 144.34 ? -17  DA  I "O3'" 1 
ATOM   7213  C  "C2'" . DA  I  5 56  ? -66.615 -14.514 50.560 1.00 146.03 ? -17  DA  I "C2'" 1 
ATOM   7214  C  "C1'" . DA  I  5 56  ? -65.597 -13.763 49.701 1.00 146.71 ? -17  DA  I "C1'" 1 
ATOM   7215  N  N9    . DA  I  5 56  ? -65.133 -12.501 50.295 1.00 146.97 ? -17  DA  I N9    1 
ATOM   7216  C  C8    . DA  I  5 56  ? -65.883 -11.386 50.566 1.00 147.01 ? -17  DA  I C8    1 
ATOM   7217  N  N7    . DA  I  5 56  ? -65.209 -10.397 51.105 1.00 147.03 ? -17  DA  I N7    1 
ATOM   7218  C  C5    . DA  I  5 56  ? -63.920 -10.893 51.200 1.00 147.11 ? -17  DA  I C5    1 
ATOM   7219  C  C6    . DA  I  5 56  ? -62.720 -10.333 51.691 1.00 146.92 ? -17  DA  I C6    1 
ATOM   7220  N  N6    . DA  I  5 56  ? -62.640 -9.096  52.192 1.00 146.85 ? -17  DA  I N6    1 
ATOM   7221  N  N1    . DA  I  5 56  ? -61.601 -11.092 51.643 1.00 147.03 ? -17  DA  I N1    1 
ATOM   7222  C  C2    . DA  I  5 56  ? -61.679 -12.334 51.138 1.00 147.04 ? -17  DA  I C2    1 
ATOM   7223  N  N3    . DA  I  5 56  ? -62.748 -12.970 50.651 1.00 147.07 ? -17  DA  I N3    1 
ATOM   7224  C  C4    . DA  I  5 56  ? -63.850 -12.190 50.707 1.00 147.16 ? -17  DA  I C4    1 
ATOM   7225  P  P     . DA  I  5 57  ? -67.070 -17.770 50.568 1.00 143.63 ? -16  DA  I P     1 
ATOM   7226  O  OP1   . DA  I  5 57  ? -67.183 -19.105 49.922 1.00 143.63 ? -16  DA  I OP1   1 
ATOM   7227  O  OP2   . DA  I  5 57  ? -68.045 -17.371 51.612 1.00 143.31 ? -16  DA  I OP2   1 
ATOM   7228  O  "O5'" . DA  I  5 57  ? -65.608 -17.624 51.203 1.00 141.83 ? -16  DA  I "O5'" 1 
ATOM   7229  C  "C5'" . DA  I  5 57  ? -64.455 -17.841 50.379 1.00 138.82 ? -16  DA  I "C5'" 1 
ATOM   7230  C  "C4'" . DA  I  5 57  ? -63.166 -17.796 51.182 1.00 136.09 ? -16  DA  I "C4'" 1 
ATOM   7231  O  "O4'" . DA  I  5 57  ? -62.905 -16.440 51.630 1.00 135.66 ? -16  DA  I "O4'" 1 
ATOM   7232  C  "C3'" . DA  I  5 57  ? -63.131 -18.680 52.425 1.00 134.14 ? -16  DA  I "C3'" 1 
ATOM   7233  O  "O3'" . DA  I  5 57  ? -61.882 -19.345 52.405 1.00 131.50 ? -16  DA  I "O3'" 1 
ATOM   7234  C  "C2'" . DA  I  5 57  ? -63.250 -17.671 53.569 1.00 134.61 ? -16  DA  I "C2'" 1 
ATOM   7235  C  "C1'" . DA  I  5 57  ? -62.486 -16.496 52.972 1.00 135.59 ? -16  DA  I "C1'" 1 
ATOM   7236  N  N9    . DA  I  5 57  ? -62.732 -15.180 53.547 1.00 135.87 ? -16  DA  I N9    1 
ATOM   7237  C  C8    . DA  I  5 57  ? -63.936 -14.578 53.784 1.00 136.02 ? -16  DA  I C8    1 
ATOM   7238  N  N7    . DA  I  5 57  ? -63.825 -13.377 54.303 1.00 136.15 ? -16  DA  I N7    1 
ATOM   7239  C  C5    . DA  I  5 57  ? -62.458 -13.172 54.407 1.00 136.04 ? -16  DA  I C5    1 
ATOM   7240  C  C6    . DA  I  5 57  ? -61.670 -12.096 54.878 1.00 135.93 ? -16  DA  I C6    1 
ATOM   7241  N  N6    . DA  I  5 57  ? -62.180 -10.963 55.362 1.00 136.08 ? -16  DA  I N6    1 
ATOM   7242  N  N1    . DA  I  5 57  ? -60.325 -12.218 54.844 1.00 135.87 ? -16  DA  I N1    1 
ATOM   7243  C  C2    . DA  I  5 57  ? -59.797 -13.348 54.363 1.00 135.91 ? -16  DA  I C2    1 
ATOM   7244  N  N3    . DA  I  5 57  ? -60.431 -14.425 53.895 1.00 136.32 ? -16  DA  I N3    1 
ATOM   7245  C  C4    . DA  I  5 57  ? -61.770 -14.277 53.943 1.00 136.18 ? -16  DA  I C4    1 
ATOM   7246  P  P     . DG  I  5 58  ? -61.583 -20.690 53.219 1.00 129.55 ? -15  DG  I P     1 
ATOM   7247  O  OP1   . DG  I  5 58  ? -61.688 -21.815 52.254 1.00 128.99 ? -15  DG  I OP1   1 
ATOM   7248  O  OP2   . DG  I  5 58  ? -62.386 -20.693 54.472 1.00 129.34 ? -15  DG  I OP2   1 
ATOM   7249  O  "O5'" . DG  I  5 58  ? -60.031 -20.516 53.630 1.00 128.14 ? -15  DG  I "O5'" 1 
ATOM   7250  C  "C5'" . DG  I  5 58  ? -59.365 -19.238 53.623 1.00 124.80 ? -15  DG  I "C5'" 1 
ATOM   7251  C  "C4'" . DG  I  5 58  ? -58.796 -18.858 54.988 1.00 122.30 ? -15  DG  I "C4'" 1 
ATOM   7252  O  "O4'" . DG  I  5 58  ? -59.459 -17.653 55.462 1.00 122.10 ? -15  DG  I "O4'" 1 
ATOM   7253  C  "C3'" . DG  I  5 58  ? -58.944 -19.868 56.126 1.00 120.51 ? -15  DG  I "C3'" 1 
ATOM   7254  O  "O3'" . DG  I  5 58  ? -57.866 -19.700 57.027 1.00 117.60 ? -15  DG  I "O3'" 1 
ATOM   7255  C  "C2'" . DG  I  5 58  ? -60.221 -19.411 56.812 1.00 121.62 ? -15  DG  I "C2'" 1 
ATOM   7256  C  "C1'" . DG  I  5 58  ? -59.999 -17.903 56.745 1.00 123.23 ? -15  DG  I "C1'" 1 
ATOM   7257  N  N9    . DG  I  5 58  ? -61.209 -17.105 56.901 1.00 123.74 ? -15  DG  I N9    1 
ATOM   7258  C  C8    . DG  I  5 58  ? -62.520 -17.524 56.780 1.00 123.89 ? -15  DG  I C8    1 
ATOM   7259  N  N7    . DG  I  5 58  ? -63.393 -16.575 56.977 1.00 124.16 ? -15  DG  I N7    1 
ATOM   7260  C  C5    . DG  I  5 58  ? -62.603 -15.461 57.248 1.00 124.02 ? -15  DG  I C5    1 
ATOM   7261  C  C6    . DG  I  5 58  ? -62.986 -14.133 57.545 1.00 123.87 ? -15  DG  I C6    1 
ATOM   7262  O  O6    . DG  I  5 58  ? -64.138 -13.696 57.623 1.00 123.85 ? -15  DG  I O6    1 
ATOM   7263  N  N1    . DG  I  5 58  ? -61.887 -13.292 57.760 1.00 123.89 ? -15  DG  I N1    1 
ATOM   7264  C  C2    . DG  I  5 58  ? -60.569 -13.697 57.701 1.00 123.77 ? -15  DG  I C2    1 
ATOM   7265  N  N2    . DG  I  5 58  ? -59.645 -12.754 57.939 1.00 123.69 ? -15  DG  I N2    1 
ATOM   7266  N  N3    . DG  I  5 58  ? -60.193 -14.944 57.422 1.00 123.74 ? -15  DG  I N3    1 
ATOM   7267  C  C4    . DG  I  5 58  ? -61.258 -15.766 57.208 1.00 123.82 ? -15  DG  I C4    1 
ATOM   7268  P  P     . DG  I  5 59  ? -56.640 -20.726 57.113 1.00 114.39 ? -14  DG  I P     1 
ATOM   7269  O  OP1   . DG  I  5 59  ? -56.378 -21.291 55.765 1.00 114.42 ? -14  DG  I OP1   1 
ATOM   7270  O  OP2   . DG  I  5 59  ? -56.871 -21.616 58.279 1.00 114.05 ? -14  DG  I OP2   1 
ATOM   7271  O  "O5'" . DG  I  5 59  ? -55.437 -19.750 57.482 1.00 112.54 ? -14  DG  I "O5'" 1 
ATOM   7272  C  "C5'" . DG  I  5 59  ? -54.987 -18.770 56.557 1.00 110.20 ? -14  DG  I "C5'" 1 
ATOM   7273  C  "C4'" . DG  I  5 59  ? -54.284 -17.649 57.305 1.00 108.94 ? -14  DG  I "C4'" 1 
ATOM   7274  O  "O4'" . DG  I  5 59  ? -55.257 -16.806 57.966 1.00 109.81 ? -14  DG  I "O4'" 1 
ATOM   7275  C  "C3'" . DG  I  5 59  ? -53.303 -18.015 58.419 1.00 107.35 ? -14  DG  I "C3'" 1 
ATOM   7276  O  "O3'" . DG  I  5 59  ? -52.350 -16.937 58.477 1.00 103.40 ? -14  DG  I "O3'" 1 
ATOM   7277  C  "C2'" . DG  I  5 59  ? -54.215 -18.085 59.646 1.00 108.51 ? -14  DG  I "C2'" 1 
ATOM   7278  C  "C1'" . DG  I  5 59  ? -55.169 -16.923 59.379 1.00 111.02 ? -14  DG  I "C1'" 1 
ATOM   7279  N  N9    . DG  I  5 59  ? -56.563 -17.064 59.795 1.00 111.77 ? -14  DG  I N9    1 
ATOM   7280  C  C8    . DG  I  5 59  ? -57.331 -18.206 59.786 1.00 112.13 ? -14  DG  I C8    1 
ATOM   7281  N  N7    . DG  I  5 59  ? -58.560 -18.012 60.185 1.00 112.60 ? -14  DG  I N7    1 
ATOM   7282  C  C5    . DG  I  5 59  ? -58.619 -16.645 60.465 1.00 112.70 ? -14  DG  I C5    1 
ATOM   7283  C  C6    . DG  I  5 59  ? -59.696 -15.836 60.933 1.00 112.10 ? -14  DG  I C6    1 
ATOM   7284  O  O6    . DG  I  5 59  ? -60.854 -16.178 61.197 1.00 112.07 ? -14  DG  I O6    1 
ATOM   7285  N  N1    . DG  I  5 59  ? -59.336 -14.498 61.085 1.00 111.91 ? -14  DG  I N1    1 
ATOM   7286  C  C2    . DG  I  5 59  ? -58.084 -13.994 60.811 1.00 112.10 ? -14  DG  I C2    1 
ATOM   7287  N  N2    . DG  I  5 59  ? -57.908 -12.676 61.009 1.00 112.11 ? -14  DG  I N2    1 
ATOM   7288  N  N3    . DG  I  5 59  ? -57.070 -14.738 60.372 1.00 112.14 ? -14  DG  I N3    1 
ATOM   7289  C  C4    . DG  I  5 59  ? -57.398 -16.048 60.220 1.00 112.26 ? -14  DG  I C4    1 
ATOM   7290  P  P     . DC  I  5 60  ? -50.999 -16.905 59.332 1.00 98.39  ? -13  DC  I P     1 
ATOM   7291  O  OP1   . DC  I  5 60  ? -49.975 -16.428 58.375 1.00 98.56  ? -13  DC  I OP1   1 
ATOM   7292  O  OP2   . DC  I  5 60  ? -50.856 -18.157 60.107 1.00 98.54  ? -13  DC  I OP2   1 
ATOM   7293  O  "O5'" . DC  I  5 60  ? -51.263 -15.746 60.397 1.00 98.29  ? -13  DC  I "O5'" 1 
ATOM   7294  C  "C5'" . DC  I  5 60  ? -51.309 -14.386 59.950 1.00 97.04  ? -13  DC  I "C5'" 1 
ATOM   7295  C  "C4'" . DC  I  5 60  ? -51.820 -13.466 61.042 1.00 95.80  ? -13  DC  I "C4'" 1 
ATOM   7296  O  "O4'" . DC  I  5 60  ? -53.125 -13.911 61.469 1.00 96.29  ? -13  DC  I "O4'" 1 
ATOM   7297  C  "C3'" . DC  I  5 60  ? -50.987 -13.439 62.308 1.00 95.75  ? -13  DC  I "C3'" 1 
ATOM   7298  O  "O3'" . DC  I  5 60  ? -51.072 -12.146 62.817 1.00 95.22  ? -13  DC  I "O3'" 1 
ATOM   7299  C  "C2'" . DC  I  5 60  ? -51.690 -14.426 63.241 1.00 96.53  ? -13  DC  I "C2'" 1 
ATOM   7300  C  "C1'" . DC  I  5 60  ? -53.143 -14.176 62.859 1.00 97.26  ? -13  DC  I "C1'" 1 
ATOM   7301  N  N1    . DC  I  5 60  ? -54.113 -15.301 63.084 1.00 98.07  ? -13  DC  I N1    1 
ATOM   7302  C  C2    . DC  I  5 60  ? -55.426 -15.023 63.516 1.00 98.23  ? -13  DC  I C2    1 
ATOM   7303  O  O2    . DC  I  5 60  ? -55.771 -13.852 63.725 1.00 98.15  ? -13  DC  I O2    1 
ATOM   7304  N  N3    . DC  I  5 60  ? -56.293 -16.054 63.700 1.00 98.26  ? -13  DC  I N3    1 
ATOM   7305  C  C4    . DC  I  5 60  ? -55.902 -17.309 63.464 1.00 98.13  ? -13  DC  I C4    1 
ATOM   7306  N  N4    . DC  I  5 60  ? -56.780 -18.298 63.655 1.00 98.43  ? -13  DC  I N4    1 
ATOM   7307  C  C5    . DC  I  5 60  ? -54.580 -17.610 63.022 1.00 98.43  ? -13  DC  I C5    1 
ATOM   7308  C  C6    . DC  I  5 60  ? -53.730 -16.590 62.843 1.00 98.15  ? -13  DC  I C6    1 
ATOM   7309  P  P     . DA  I  5 61  ? -49.764 -11.376 63.272 1.00 94.26  ? -12  DA  I P     1 
ATOM   7310  O  OP1   . DA  I  5 61  ? -49.259 -10.674 62.072 1.00 94.07  ? -12  DA  I OP1   1 
ATOM   7311  O  OP2   . DA  I  5 61  ? -48.940 -12.321 64.053 1.00 95.42  ? -12  DA  I OP2   1 
ATOM   7312  O  "O5'" . DA  I  5 61  ? -50.276 -10.292 64.331 1.00 97.10  ? -12  DA  I "O5'" 1 
ATOM   7313  C  "C5'" . DA  I  5 61  ? -51.358 -9.392  64.056 1.00 99.59  ? -12  DA  I "C5'" 1 
ATOM   7314  C  "C4'" . DA  I  5 61  ? -52.142 -9.106  65.328 1.00 101.43 ? -12  DA  I "C4'" 1 
ATOM   7315  O  "O4'" . DA  I  5 61  ? -52.963 -10.253 65.640 1.00 101.39 ? -12  DA  I "O4'" 1 
ATOM   7316  C  "C3'" . DA  I  5 61  ? -51.325 -8.817  66.589 1.00 102.64 ? -12  DA  I "C3'" 1 
ATOM   7317  O  "O3'" . DA  I  5 61  ? -51.935 -7.711  67.225 1.00 105.30 ? -12  DA  I "O3'" 1 
ATOM   7318  C  "C2'" . DA  I  5 61  ? -51.410 -10.091 67.431 1.00 102.07 ? -12  DA  I "C2'" 1 
ATOM   7319  C  "C1'" . DA  I  5 61  ? -52.743 -10.673 66.972 1.00 102.69 ? -12  DA  I "C1'" 1 
ATOM   7320  N  N9    . DA  I  5 61  ? -52.865 -12.124 66.891 1.00 103.09 ? -12  DA  I N9    1 
ATOM   7321  C  C8    . DA  I  5 61  ? -51.911 -13.064 66.612 1.00 103.12 ? -12  DA  I C8    1 
ATOM   7322  N  N7    . DA  I  5 61  ? -52.379 -14.294 66.589 1.00 102.97 ? -12  DA  I N7    1 
ATOM   7323  C  C5    . DA  I  5 61  ? -53.728 -14.149 66.856 1.00 103.15 ? -12  DA  I C5    1 
ATOM   7324  C  C6    . DA  I  5 61  ? -54.798 -15.063 66.973 1.00 103.31 ? -12  DA  I C6    1 
ATOM   7325  N  N6    . DA  I  5 61  ? -54.666 -16.380 66.827 1.00 103.37 ? -12  DA  I N6    1 
ATOM   7326  N  N1    . DA  I  5 61  ? -56.029 -14.577 67.252 1.00 103.54 ? -12  DA  I N1    1 
ATOM   7327  C  C2    . DA  I  5 61  ? -56.187 -13.253 67.400 1.00 103.16 ? -12  DA  I C2    1 
ATOM   7328  N  N3    . DA  I  5 61  ? -55.260 -12.297 67.314 1.00 102.97 ? -12  DA  I N3    1 
ATOM   7329  C  C4    . DA  I  5 61  ? -54.045 -12.814 67.040 1.00 103.38 ? -12  DA  I C4    1 
ATOM   7330  P  P     . DT  I  5 62  ? -51.230 -6.877  68.397 1.00 107.23 ? -11  DT  I P     1 
ATOM   7331  O  OP1   . DT  I  5 62  ? -51.645 -5.458  68.249 1.00 106.55 ? -11  DT  I OP1   1 
ATOM   7332  O  OP2   . DT  I  5 62  ? -49.785 -7.216  68.480 1.00 107.15 ? -11  DT  I OP2   1 
ATOM   7333  O  "O5'" . DT  I  5 62  ? -51.954 -7.500  69.687 1.00 109.15 ? -11  DT  I "O5'" 1 
ATOM   7334  C  "C5'" . DT  I  5 62  ? -53.379 -7.627  69.739 1.00 111.01 ? -11  DT  I "C5'" 1 
ATOM   7335  C  "C4'" . DT  I  5 62  ? -53.797 -8.616  70.811 1.00 112.64 ? -11  DT  I "C4'" 1 
ATOM   7336  O  "O4'" . DT  I  5 62  ? -53.919 -9.935  70.239 1.00 112.77 ? -11  DT  I "O4'" 1 
ATOM   7337  C  "C3'" . DT  I  5 62  ? -52.821 -8.790  71.964 1.00 113.77 ? -11  DT  I "C3'" 1 
ATOM   7338  O  "O3'" . DT  I  5 62  ? -53.158 -7.830  72.957 1.00 115.99 ? -11  DT  I "O3'" 1 
ATOM   7339  C  "C2'" . DT  I  5 62  ? -53.089 -10.224 72.425 1.00 113.75 ? -11  DT  I "C2'" 1 
ATOM   7340  C  "C1'" . DT  I  5 62  ? -53.898 -10.859 71.297 1.00 113.73 ? -11  DT  I "C1'" 1 
ATOM   7341  N  N1    . DT  I  5 62  ? -53.311 -12.125 70.786 1.00 114.25 ? -11  DT  I N1    1 
ATOM   7342  C  C2    . DT  I  5 62  ? -54.132 -13.215 70.564 1.00 114.50 ? -11  DT  I C2    1 
ATOM   7343  O  O2    . DT  I  5 62  ? -55.333 -13.212 70.760 1.00 114.66 ? -11  DT  I O2    1 
ATOM   7344  N  N3    . DT  I  5 62  ? -53.491 -14.336 70.096 1.00 114.48 ? -11  DT  I N3    1 
ATOM   7345  C  C4    . DT  I  5 62  ? -52.139 -14.463 69.837 1.00 114.34 ? -11  DT  I C4    1 
ATOM   7346  O  O4    . DT  I  5 62  ? -51.667 -15.510 69.417 1.00 114.72 ? -11  DT  I O4    1 
ATOM   7347  C  C5    . DT  I  5 62  ? -51.333 -13.290 70.085 1.00 114.24 ? -11  DT  I C5    1 
ATOM   7348  C  C7    . DT  I  5 62  ? -49.856 -13.311 69.838 1.00 114.15 ? -11  DT  I C7    1 
ATOM   7349  C  C6    . DT  I  5 62  ? -51.948 -12.192 70.541 1.00 114.35 ? -11  DT  I C6    1 
ATOM   7350  P  P     . DG  I  5 63  ? -52.315 -7.587  74.301 1.00 118.30 ? -10  DG  I P     1 
ATOM   7351  O  OP1   . DG  I  5 63  ? -52.098 -6.125  74.360 1.00 118.10 ? -10  DG  I OP1   1 
ATOM   7352  O  OP2   . DG  I  5 63  ? -51.143 -8.492  74.353 1.00 118.58 ? -10  DG  I OP2   1 
ATOM   7353  O  "O5'" . DG  I  5 63  ? -53.301 -8.012  75.500 1.00 118.98 ? -10  DG  I "O5'" 1 
ATOM   7354  C  "C5'" . DG  I  5 63  ? -54.080 -9.222  75.469 1.00 120.39 ? -10  DG  I "C5'" 1 
ATOM   7355  C  "C4'" . DG  I  5 63  ? -54.181 -9.937  76.818 1.00 121.71 ? -10  DG  I "C4'" 1 
ATOM   7356  O  "O4'" . DG  I  5 63  ? -53.985 -11.368 76.658 1.00 121.94 ? -10  DG  I "O4'" 1 
ATOM   7357  C  "C3'" . DG  I  5 63  ? -53.196 -9.576  77.928 1.00 122.44 ? -10  DG  I "C3'" 1 
ATOM   7358  O  "O3'" . DG  I  5 63  ? -53.874 -9.842  79.182 1.00 123.40 ? -10  DG  I "O3'" 1 
ATOM   7359  C  "C2'" . DG  I  5 63  ? -51.998 -10.483 77.615 1.00 121.88 ? -10  DG  I "C2'" 1 
ATOM   7360  C  "C1'" . DG  I  5 63  ? -52.676 -11.740 77.073 1.00 121.72 ? -10  DG  I "C1'" 1 
ATOM   7361  N  N9    . DG  I  5 63  ? -52.015 -12.390 75.936 1.00 121.73 ? -10  DG  I N9    1 
ATOM   7362  C  C8    . DG  I  5 63  ? -51.213 -11.827 74.968 1.00 121.54 ? -10  DG  I C8    1 
ATOM   7363  N  N7    . DG  I  5 63  ? -50.786 -12.681 74.077 1.00 121.41 ? -10  DG  I N7    1 
ATOM   7364  C  C5    . DG  I  5 63  ? -51.341 -13.891 74.472 1.00 121.51 ? -10  DG  I C5    1 
ATOM   7365  C  C6    . DG  I  5 63  ? -51.238 -15.187 73.900 1.00 121.59 ? -10  DG  I C6    1 
ATOM   7366  O  O6    . DG  I  5 63  ? -50.618 -15.549 72.891 1.00 121.37 ? -10  DG  I O6    1 
ATOM   7367  N  N1    . DG  I  5 63  ? -51.961 -16.131 74.625 1.00 121.70 ? -10  DG  I N1    1 
ATOM   7368  C  C2    . DG  I  5 63  ? -52.692 -15.859 75.757 1.00 121.39 ? -10  DG  I C2    1 
ATOM   7369  N  N2    . DG  I  5 63  ? -53.319 -16.897 76.319 1.00 121.46 ? -10  DG  I N2    1 
ATOM   7370  N  N3    . DG  I  5 63  ? -52.799 -14.657 76.304 1.00 121.15 ? -10  DG  I N3    1 
ATOM   7371  C  C4    . DG  I  5 63  ? -52.102 -13.724 75.612 1.00 121.41 ? -10  DG  I C4    1 
ATOM   7372  P  P     . DT  I  5 64  ? -53.187 -10.152 80.607 1.00 123.96 ? -9   DT  I P     1 
ATOM   7373  O  OP1   . DT  I  5 64  ? -54.141 -9.723  81.656 1.00 123.91 ? -9   DT  I OP1   1 
ATOM   7374  O  OP2   . DT  I  5 64  ? -51.807 -9.609  80.637 1.00 123.86 ? -9   DT  I OP2   1 
ATOM   7375  O  "O5'" . DT  I  5 64  ? -53.128 -11.754 80.592 1.00 122.82 ? -9   DT  I "O5'" 1 
ATOM   7376  C  "C5'" . DT  I  5 64  ? -54.325 -12.522 80.402 1.00 121.66 ? -9   DT  I "C5'" 1 
ATOM   7377  C  "C4'" . DT  I  5 64  ? -54.136 -13.955 80.877 1.00 121.02 ? -9   DT  I "C4'" 1 
ATOM   7378  O  "O4'" . DT  I  5 64  ? -53.491 -14.739 79.834 1.00 120.83 ? -9   DT  I "O4'" 1 
ATOM   7379  C  "C3'" . DT  I  5 64  ? -53.287 -14.097 82.141 1.00 120.47 ? -9   DT  I "C3'" 1 
ATOM   7380  O  "O3'" . DT  I  5 64  ? -53.951 -14.931 83.108 1.00 119.21 ? -9   DT  I "O3'" 1 
ATOM   7381  C  "C2'" . DT  I  5 64  ? -51.954 -14.673 81.645 1.00 120.65 ? -9   DT  I "C2'" 1 
ATOM   7382  C  "C1'" . DT  I  5 64  ? -52.295 -15.331 80.312 1.00 120.35 ? -9   DT  I "C1'" 1 
ATOM   7383  N  N1    . DT  I  5 64  ? -51.205 -15.233 79.263 1.00 120.27 ? -9   DT  I N1    1 
ATOM   7384  C  C2    . DT  I  5 64  ? -50.891 -16.356 78.519 1.00 120.10 ? -9   DT  I C2    1 
ATOM   7385  O  O2    . DT  I  5 64  ? -51.451 -17.430 78.659 1.00 120.02 ? -9   DT  I O2    1 
ATOM   7386  N  N3    . DT  I  5 64  ? -49.889 -16.172 77.591 1.00 120.18 ? -9   DT  I N3    1 
ATOM   7387  C  C4    . DT  I  5 64  ? -49.174 -15.010 77.333 1.00 120.16 ? -9   DT  I C4    1 
ATOM   7388  O  O4    . DT  I  5 64  ? -48.294 -14.966 76.476 1.00 119.96 ? -9   DT  I O4    1 
ATOM   7389  C  C5    . DT  I  5 64  ? -49.546 -13.870 78.145 1.00 120.05 ? -9   DT  I C5    1 
ATOM   7390  C  C7    . DT  I  5 64  ? -48.858 -12.546 77.974 1.00 119.77 ? -9   DT  I C7    1 
ATOM   7391  C  C6    . DT  I  5 64  ? -50.526 -14.038 79.053 1.00 120.26 ? -9   DT  I C6    1 
ATOM   7392  P  P     . DT  I  5 65  ? -53.245 -15.347 84.492 1.00 118.35 ? -8   DT  I P     1 
ATOM   7393  O  OP1   . DT  I  5 65  ? -54.307 -15.596 85.495 1.00 118.49 ? -8   DT  I OP1   1 
ATOM   7394  O  OP2   . DT  I  5 65  ? -52.135 -14.407 84.781 1.00 117.91 ? -8   DT  I OP2   1 
ATOM   7395  O  "O5'" . DT  I  5 65  ? -52.579 -16.749 84.130 1.00 117.47 ? -8   DT  I "O5'" 1 
ATOM   7396  C  "C5'" . DT  I  5 65  ? -53.336 -17.780 83.502 1.00 116.34 ? -8   DT  I "C5'" 1 
ATOM   7397  C  "C4'" . DT  I  5 65  ? -52.393 -18.915 83.158 1.00 115.54 ? -8   DT  I "C4'" 1 
ATOM   7398  O  "O4'" . DT  I  5 65  ? -51.550 -18.531 82.037 1.00 115.30 ? -8   DT  I "O4'" 1 
ATOM   7399  C  "C3'" . DT  I  5 65  ? -51.455 -19.284 84.305 1.00 114.83 ? -8   DT  I "C3'" 1 
ATOM   7400  O  "O3'" . DT  I  5 65  ? -51.621 -20.660 84.621 1.00 113.66 ? -8   DT  I "O3'" 1 
ATOM   7401  C  "C2'" . DT  I  5 65  ? -50.048 -18.953 83.794 1.00 115.09 ? -8   DT  I "C2'" 1 
ATOM   7402  C  "C1'" . DT  I  5 65  ? -50.239 -18.992 82.281 1.00 114.77 ? -8   DT  I "C1'" 1 
ATOM   7403  N  N1    . DT  I  5 65  ? -49.285 -18.172 81.466 1.00 114.69 ? -8   DT  I N1    1 
ATOM   7404  C  C2    . DT  I  5 65  ? -48.732 -18.754 80.343 1.00 114.76 ? -8   DT  I C2    1 
ATOM   7405  O  O2    . DT  I  5 65  ? -48.971 -19.895 79.985 1.00 114.84 ? -8   DT  I O2    1 
ATOM   7406  N  N3    . DT  I  5 65  ? -47.876 -17.950 79.638 1.00 114.56 ? -8   DT  I N3    1 
ATOM   7407  C  C4    . DT  I  5 65  ? -47.515 -16.653 79.929 1.00 114.45 ? -8   DT  I C4    1 
ATOM   7408  O  O4    . DT  I  5 65  ? -46.732 -16.038 79.212 1.00 114.32 ? -8   DT  I O4    1 
ATOM   7409  C  C5    . DT  I  5 65  ? -48.127 -16.096 81.119 1.00 114.69 ? -8   DT  I C5    1 
ATOM   7410  C  C7    . DT  I  5 65  ? -47.819 -14.689 81.542 1.00 114.65 ? -8   DT  I C7    1 
ATOM   7411  C  C6    . DT  I  5 65  ? -48.973 -16.869 81.822 1.00 114.46 ? -8   DT  I C6    1 
ATOM   7412  P  P     . DC  I  5 66  ? -51.003 -21.264 85.968 1.00 112.97 ? -7   DC  I P     1 
ATOM   7413  O  OP1   . DC  I  5 66  ? -51.902 -22.351 86.434 1.00 112.70 ? -7   DC  I OP1   1 
ATOM   7414  O  OP2   . DC  I  5 66  ? -50.618 -20.132 86.854 1.00 111.94 ? -7   DC  I OP2   1 
ATOM   7415  O  "O5'" . DC  I  5 66  ? -49.647 -21.945 85.453 1.00 112.53 ? -7   DC  I "O5'" 1 
ATOM   7416  C  "C5'" . DC  I  5 66  ? -49.632 -23.074 84.561 1.00 110.18 ? -7   DC  I "C5'" 1 
ATOM   7417  C  "C4'" . DC  I  5 66  ? -48.234 -23.212 83.989 1.00 108.13 ? -7   DC  I "C4'" 1 
ATOM   7418  O  "O4'" . DC  I  5 66  ? -47.875 -21.952 83.359 1.00 107.88 ? -7   DC  I "O4'" 1 
ATOM   7419  C  "C3'" . DC  I  5 66  ? -47.156 -23.493 85.041 1.00 106.68 ? -7   DC  I "C3'" 1 
ATOM   7420  O  "O3'" . DC  I  5 66  ? -46.347 -24.583 84.649 1.00 104.52 ? -7   DC  I "O3'" 1 
ATOM   7421  C  "C2'" . DC  I  5 66  ? -46.318 -22.220 85.083 1.00 106.96 ? -7   DC  I "C2'" 1 
ATOM   7422  C  "C1'" . DC  I  5 66  ? -46.519 -21.685 83.667 1.00 108.20 ? -7   DC  I "C1'" 1 
ATOM   7423  N  N1    . DC  I  5 66  ? -46.203 -20.224 83.502 1.00 108.47 ? -7   DC  I N1    1 
ATOM   7424  C  C2    . DC  I  5 66  ? -45.860 -19.694 82.244 1.00 108.25 ? -7   DC  I C2    1 
ATOM   7425  O  O2    . DC  I  5 66  ? -45.824 -20.422 81.244 1.00 108.52 ? -7   DC  I O2    1 
ATOM   7426  N  N3    . DC  I  5 66  ? -45.577 -18.370 82.153 1.00 108.25 ? -7   DC  I N3    1 
ATOM   7427  C  C4    . DC  I  5 66  ? -45.618 -17.595 83.244 1.00 108.37 ? -7   DC  I C4    1 
ATOM   7428  N  N4    . DC  I  5 66  ? -45.330 -16.298 83.113 1.00 108.43 ? -7   DC  I N4    1 
ATOM   7429  C  C5    . DC  I  5 66  ? -45.958 -18.109 84.529 1.00 108.46 ? -7   DC  I C5    1 
ATOM   7430  C  C6    . DC  I  5 66  ? -46.239 -19.413 84.606 1.00 108.72 ? -7   DC  I C6    1 
ATOM   7431  P  P     . DA  I  5 67  ? -46.566 -26.033 85.286 1.00 103.39 ? -6   DA  I P     1 
ATOM   7432  O  OP1   . DA  I  5 67  ? -47.996 -26.102 85.652 1.00 104.01 ? -6   DA  I OP1   1 
ATOM   7433  O  OP2   . DA  I  5 67  ? -45.521 -26.257 86.318 1.00 103.65 ? -6   DA  I OP2   1 
ATOM   7434  O  "O5'" . DA  I  5 67  ? -46.281 -27.076 84.089 1.00 101.68 ? -6   DA  I "O5'" 1 
ATOM   7435  C  "C5'" . DA  I  5 67  ? -46.603 -26.787 82.705 1.00 97.67  ? -6   DA  I "C5'" 1 
ATOM   7436  C  "C4'" . DA  I  5 67  ? -45.433 -26.995 81.734 1.00 94.39  ? -6   DA  I "C4'" 1 
ATOM   7437  O  "O4'" . DA  I  5 67  ? -44.716 -25.752 81.525 1.00 93.24  ? -6   DA  I "O4'" 1 
ATOM   7438  C  "C3'" . DA  I  5 67  ? -44.370 -28.021 82.107 1.00 92.47  ? -6   DA  I "C3'" 1 
ATOM   7439  O  "O3'" . DA  I  5 67  ? -43.940 -28.663 80.928 1.00 90.77  ? -6   DA  I "O3'" 1 
ATOM   7440  C  "C2'" . DA  I  5 67  ? -43.252 -27.189 82.723 1.00 92.35  ? -6   DA  I "C2'" 1 
ATOM   7441  C  "C1'" . DA  I  5 67  ? -43.387 -25.848 82.004 1.00 93.29  ? -6   DA  I "C1'" 1 
ATOM   7442  N  N9    . DA  I  5 67  ? -43.133 -24.682 82.855 1.00 93.26  ? -6   DA  I N9    1 
ATOM   7443  C  C8    . DA  I  5 67  ? -43.331 -24.592 84.201 1.00 93.56  ? -6   DA  I C8    1 
ATOM   7444  N  N7    . DA  I  5 67  ? -43.023 -23.426 84.713 1.00 93.27  ? -6   DA  I N7    1 
ATOM   7445  C  C5    . DA  I  5 67  ? -42.594 -22.693 83.633 1.00 93.04  ? -6   DA  I C5    1 
ATOM   7446  C  C6    . DA  I  5 67  ? -42.128 -21.368 83.513 1.00 93.42  ? -6   DA  I C6    1 
ATOM   7447  N  N6    . DA  I  5 67  ? -42.017 -20.541 84.551 1.00 93.31  ? -6   DA  I N6    1 
ATOM   7448  N  N1    . DA  I  5 67  ? -41.766 -20.920 82.290 1.00 93.56  ? -6   DA  I N1    1 
ATOM   7449  C  C2    . DA  I  5 67  ? -41.875 -21.759 81.253 1.00 93.60  ? -6   DA  I C2    1 
ATOM   7450  N  N3    . DA  I  5 67  ? -42.301 -23.028 81.249 1.00 94.19  ? -6   DA  I N3    1 
ATOM   7451  C  C4    . DA  I  5 67  ? -42.650 -23.447 82.480 1.00 93.36  ? -6   DA  I C4    1 
ATOM   7452  P  P     . DG  I  5 68  ? -42.958 -29.934 80.948 1.00 90.45  ? -5   DG  I P     1 
ATOM   7453  O  OP1   . DG  I  5 68  ? -43.394 -30.839 79.864 1.00 91.40  ? -5   DG  I OP1   1 
ATOM   7454  O  OP2   . DG  I  5 68  ? -42.822 -30.489 82.301 1.00 91.11  ? -5   DG  I OP2   1 
ATOM   7455  O  "O5'" . DG  I  5 68  ? -41.540 -29.282 80.606 1.00 90.32  ? -5   DG  I "O5'" 1 
ATOM   7456  C  "C5'" . DG  I  5 68  ? -41.296 -28.580 79.385 1.00 89.21  ? -5   DG  I "C5'" 1 
ATOM   7457  C  "C4'" . DG  I  5 68  ? -40.025 -27.776 79.533 1.00 88.22  ? -5   DG  I "C4'" 1 
ATOM   7458  O  "O4'" . DG  I  5 68  ? -40.292 -26.651 80.411 1.00 88.77  ? -5   DG  I "O4'" 1 
ATOM   7459  C  "C3'" . DG  I  5 68  ? -38.885 -28.566 80.173 1.00 87.98  ? -5   DG  I "C3'" 1 
ATOM   7460  O  "O3'" . DG  I  5 68  ? -37.618 -28.312 79.592 1.00 86.26  ? -5   DG  I "O3'" 1 
ATOM   7461  C  "C2'" . DG  I  5 68  ? -38.832 -27.988 81.577 1.00 89.00  ? -5   DG  I "C2'" 1 
ATOM   7462  C  "C1'" . DG  I  5 68  ? -39.181 -26.544 81.266 1.00 90.63  ? -5   DG  I "C1'" 1 
ATOM   7463  N  N9    . DG  I  5 68  ? -39.420 -25.789 82.494 1.00 91.66  ? -5   DG  I N9    1 
ATOM   7464  C  C8    . DG  I  5 68  ? -39.852 -26.300 83.697 1.00 92.04  ? -5   DG  I C8    1 
ATOM   7465  N  N7    . DG  I  5 68  ? -39.947 -25.400 84.637 1.00 92.78  ? -5   DG  I N7    1 
ATOM   7466  C  C5    . DG  I  5 68  ? -39.535 -24.223 84.025 1.00 91.83  ? -5   DG  I C5    1 
ATOM   7467  C  C6    . DG  I  5 68  ? -39.421 -22.917 84.559 1.00 91.71  ? -5   DG  I C6    1 
ATOM   7468  O  O6    . DG  I  5 68  ? -39.678 -22.530 85.705 1.00 91.46  ? -5   DG  I O6    1 
ATOM   7469  N  N1    . DG  I  5 68  ? -38.972 -22.003 83.607 1.00 91.97  ? -5   DG  I N1    1 
ATOM   7470  C  C2    . DG  I  5 68  ? -38.661 -22.323 82.306 1.00 91.89  ? -5   DG  I C2    1 
ATOM   7471  N  N2    . DG  I  5 68  ? -38.238 -21.307 81.541 1.00 92.03  ? -5   DG  I N2    1 
ATOM   7472  N  N3    . DG  I  5 68  ? -38.758 -23.545 81.795 1.00 91.74  ? -5   DG  I N3    1 
ATOM   7473  C  C4    . DG  I  5 68  ? -39.202 -24.444 82.708 1.00 91.65  ? -5   DG  I C4    1 
ATOM   7474  P  P     . DC  I  5 69  ? -37.117 -28.895 78.191 1.00 84.81  ? -4   DC  I P     1 
ATOM   7475  O  OP1   . DC  I  5 69  ? -38.257 -28.915 77.229 1.00 85.08  ? -4   DC  I OP1   1 
ATOM   7476  O  OP2   . DC  I  5 69  ? -36.339 -30.141 78.413 1.00 83.83  ? -4   DC  I OP2   1 
ATOM   7477  O  "O5'" . DC  I  5 69  ? -36.136 -27.685 77.820 1.00 80.91  ? -4   DC  I "O5'" 1 
ATOM   7478  C  "C5'" . DC  I  5 69  ? -36.703 -26.621 77.097 1.00 77.34  ? -4   DC  I "C5'" 1 
ATOM   7479  C  "C4'" . DC  I  5 69  ? -35.969 -25.333 77.345 1.00 75.56  ? -4   DC  I "C4'" 1 
ATOM   7480  O  "O4'" . DC  I  5 69  ? -36.325 -24.853 78.654 1.00 76.36  ? -4   DC  I "O4'" 1 
ATOM   7481  C  "C3'" . DC  I  5 69  ? -34.457 -25.448 77.307 1.00 74.63  ? -4   DC  I "C3'" 1 
ATOM   7482  O  "O3'" . DC  I  5 69  ? -33.932 -24.473 76.400 1.00 71.74  ? -4   DC  I "O3'" 1 
ATOM   7483  C  "C2'" . DC  I  5 69  ? -34.025 -25.184 78.743 1.00 74.95  ? -4   DC  I "C2'" 1 
ATOM   7484  C  "C1'" . DC  I  5 69  ? -35.179 -24.368 79.305 1.00 76.33  ? -4   DC  I "C1'" 1 
ATOM   7485  N  N1    . DC  I  5 69  ? -35.376 -24.577 80.770 1.00 76.88  ? -4   DC  I N1    1 
ATOM   7486  C  C2    . DC  I  5 69  ? -35.380 -23.490 81.648 1.00 77.31  ? -4   DC  I C2    1 
ATOM   7487  O  O2    . DC  I  5 69  ? -35.230 -22.333 81.225 1.00 77.59  ? -4   DC  I O2    1 
ATOM   7488  N  N3    . DC  I  5 69  ? -35.555 -23.744 82.962 1.00 77.73  ? -4   DC  I N3    1 
ATOM   7489  C  C4    . DC  I  5 69  ? -35.715 -24.999 83.396 1.00 77.64  ? -4   DC  I C4    1 
ATOM   7490  N  N4    . DC  I  5 69  ? -35.898 -25.201 84.711 1.00 78.12  ? -4   DC  I N4    1 
ATOM   7491  C  C5    . DC  I  5 69  ? -35.703 -26.113 82.516 1.00 76.97  ? -4   DC  I C5    1 
ATOM   7492  C  C6    . DC  I  5 69  ? -35.534 -25.853 81.231 1.00 76.53  ? -4   DC  I C6    1 
ATOM   7493  P  P     . DT  I  5 70  ? -32.364 -24.419 76.084 1.00 67.39  ? -3   DT  I P     1 
ATOM   7494  O  OP1   . DT  I  5 70  ? -32.269 -24.164 74.634 1.00 68.42  ? -3   DT  I OP1   1 
ATOM   7495  O  OP2   . DT  I  5 70  ? -31.689 -25.585 76.685 1.00 66.61  ? -3   DT  I OP2   1 
ATOM   7496  O  "O5'" . DT  I  5 70  ? -31.882 -23.139 76.887 1.00 68.05  ? -3   DT  I "O5'" 1 
ATOM   7497  C  "C5'" . DT  I  5 70  ? -32.375 -21.849 76.578 1.00 70.70  ? -3   DT  I "C5'" 1 
ATOM   7498  C  "C4'" . DT  I  5 70  ? -31.818 -20.872 77.593 1.00 73.04  ? -3   DT  I "C4'" 1 
ATOM   7499  O  "O4'" . DT  I  5 70  ? -32.207 -21.291 78.920 1.00 74.94  ? -3   DT  I "O4'" 1 
ATOM   7500  C  "C3'" . DT  I  5 70  ? -30.301 -20.789 77.658 1.00 75.12  ? -3   DT  I "C3'" 1 
ATOM   7501  O  "O3'" . DT  I  5 70  ? -29.975 -19.452 77.869 1.00 76.64  ? -3   DT  I "O3'" 1 
ATOM   7502  C  "C2'" . DT  I  5 70  ? -29.880 -21.626 78.865 1.00 74.74  ? -3   DT  I "C2'" 1 
ATOM   7503  C  "C1'" . DT  I  5 70  ? -31.073 -21.372 79.767 1.00 75.83  ? -3   DT  I "C1'" 1 
ATOM   7504  N  N1    . DT  I  5 70  ? -31.349 -22.423 80.789 1.00 76.56  ? -3   DT  I N1    1 
ATOM   7505  C  C2    . DT  I  5 70  ? -31.671 -22.029 82.087 1.00 76.60  ? -3   DT  I C2    1 
ATOM   7506  O  O2    . DT  I  5 70  ? -31.729 -20.860 82.447 1.00 75.55  ? -3   DT  I O2    1 
ATOM   7507  N  N3    . DT  I  5 70  ? -31.916 -23.075 82.952 1.00 76.70  ? -3   DT  I N3    1 
ATOM   7508  C  C4    . DT  I  5 70  ? -31.870 -24.431 82.643 1.00 76.79  ? -3   DT  I C4    1 
ATOM   7509  O  O4    . DT  I  5 70  ? -32.105 -25.302 83.474 1.00 76.79  ? -3   DT  I O4    1 
ATOM   7510  C  C5    . DT  I  5 70  ? -31.530 -24.766 81.273 1.00 76.61  ? -3   DT  I C5    1 
ATOM   7511  C  C7    . DT  I  5 70  ? -31.458 -26.203 80.834 1.00 75.76  ? -3   DT  I C7    1 
ATOM   7512  C  C6    . DT  I  5 70  ? -31.291 -23.757 80.421 1.00 76.34  ? -3   DT  I C6    1 
ATOM   7513  P  P     . DG  I  5 71  ? -28.525 -18.918 77.495 1.00 76.32  ? -2   DG  I P     1 
ATOM   7514  O  OP1   . DG  I  5 71  ? -28.796 -17.648 76.764 1.00 76.62  ? -2   DG  I OP1   1 
ATOM   7515  O  OP2   . DG  I  5 71  ? -27.698 -20.026 76.976 1.00 74.01  ? -2   DG  I OP2   1 
ATOM   7516  O  "O5'" . DG  I  5 71  ? -27.939 -18.578 78.935 1.00 79.28  ? -2   DG  I "O5'" 1 
ATOM   7517  C  "C5'" . DG  I  5 71  ? -28.670 -17.713 79.830 1.00 83.11  ? -2   DG  I "C5'" 1 
ATOM   7518  C  "C4'" . DG  I  5 71  ? -28.008 -17.750 81.190 1.00 85.08  ? -2   DG  I "C4'" 1 
ATOM   7519  O  "O4'" . DG  I  5 71  ? -28.265 -19.029 81.817 1.00 85.24  ? -2   DG  I "O4'" 1 
ATOM   7520  C  "C3'" . DG  I  5 71  ? -26.496 -17.630 81.121 1.00 87.22  ? -2   DG  I "C3'" 1 
ATOM   7521  O  "O3'" . DG  I  5 71  ? -26.138 -16.848 82.222 1.00 90.84  ? -2   DG  I "O3'" 1 
ATOM   7522  C  "C2'" . DG  I  5 71  ? -26.003 -19.077 81.212 1.00 86.64  ? -2   DG  I "C2'" 1 
ATOM   7523  C  "C1'" . DG  I  5 71  ? -27.049 -19.669 82.145 1.00 86.81  ? -2   DG  I "C1'" 1 
ATOM   7524  N  N9    . DG  I  5 71  ? -27.306 -21.110 82.086 1.00 86.94  ? -2   DG  I N9    1 
ATOM   7525  C  C8    . DG  I  5 71  ? -27.106 -22.043 81.081 1.00 87.86  ? -2   DG  I C8    1 
ATOM   7526  N  N7    . DG  I  5 71  ? -27.469 -23.265 81.385 1.00 87.45  ? -2   DG  I N7    1 
ATOM   7527  C  C5    . DG  I  5 71  ? -27.957 -23.117 82.686 1.00 87.87  ? -2   DG  I C5    1 
ATOM   7528  C  C6    . DG  I  5 71  ? -28.500 -24.062 83.600 1.00 87.81  ? -2   DG  I C6    1 
ATOM   7529  O  O6    . DG  I  5 71  ? -28.687 -25.276 83.453 1.00 87.82  ? -2   DG  I O6    1 
ATOM   7530  N  N1    . DG  I  5 71  ? -28.840 -23.486 84.824 1.00 88.07  ? -2   DG  I N1    1 
ATOM   7531  C  C2    . DG  I  5 71  ? -28.695 -22.156 85.153 1.00 87.90  ? -2   DG  I C2    1 
ATOM   7532  N  N2    . DG  I  5 71  ? -29.093 -21.784 86.382 1.00 87.49  ? -2   DG  I N2    1 
ATOM   7533  N  N3    . DG  I  5 71  ? -28.199 -21.261 84.311 1.00 87.87  ? -2   DG  I N3    1 
ATOM   7534  C  C4    . DG  I  5 71  ? -27.855 -21.808 83.117 1.00 87.30  ? -2   DG  I C4    1 
ATOM   7535  P  P     . DA  I  5 72  ? -24.667 -16.242 82.441 1.00 94.18  ? -1   DA  I P     1 
ATOM   7536  O  OP1   . DA  I  5 72  ? -24.630 -14.888 81.822 1.00 92.63  ? -1   DA  I OP1   1 
ATOM   7537  O  OP2   . DA  I  5 72  ? -23.627 -17.270 82.145 1.00 91.92  ? -1   DA  I OP2   1 
ATOM   7538  O  "O5'" . DA  I  5 72  ? -24.701 -16.029 84.037 1.00 95.64  ? -1   DA  I "O5'" 1 
ATOM   7539  C  "C5'" . DA  I  5 72  ? -25.911 -16.164 84.808 1.00 96.71  ? -1   DA  I "C5'" 1 
ATOM   7540  C  "C4'" . DA  I  5 72  ? -25.600 -16.675 86.204 1.00 97.97  ? -1   DA  I "C4'" 1 
ATOM   7541  O  "O4'" . DA  I  5 72  ? -25.926 -18.085 86.301 1.00 98.58  ? -1   DA  I "O4'" 1 
ATOM   7542  C  "C3'" . DA  I  5 72  ? -24.137 -16.569 86.634 1.00 99.41  ? -1   DA  I "C3'" 1 
ATOM   7543  O  "O3'" . DA  I  5 72  ? -24.083 -16.213 88.027 1.00 101.55 ? -1   DA  I "O3'" 1 
ATOM   7544  C  "C2'" . DA  I  5 72  ? -23.561 -17.960 86.343 1.00 98.38  ? -1   DA  I "C2'" 1 
ATOM   7545  C  "C1'" . DA  I  5 72  ? -24.769 -18.840 86.638 1.00 98.09  ? -1   DA  I "C1'" 1 
ATOM   7546  N  N9    . DA  I  5 72  ? -24.809 -20.093 85.882 1.00 98.08  ? -1   DA  I N9    1 
ATOM   7547  C  C8    . DA  I  5 72  ? -24.476 -20.306 84.570 1.00 97.52  ? -1   DA  I C8    1 
ATOM   7548  N  N7    . DA  I  5 72  ? -24.634 -21.550 84.178 1.00 97.39  ? -1   DA  I N7    1 
ATOM   7549  C  C5    . DA  I  5 72  ? -25.105 -22.203 85.305 1.00 97.63  ? -1   DA  I C5    1 
ATOM   7550  C  C6    . DA  I  5 72  ? -25.474 -23.543 85.564 1.00 97.59  ? -1   DA  I C6    1 
ATOM   7551  N  N6    . DA  I  5 72  ? -25.418 -24.530 84.668 1.00 97.17  ? -1   DA  I N6    1 
ATOM   7552  N  N1    . DA  I  5 72  ? -25.902 -23.842 86.812 1.00 98.35  ? -1   DA  I N1    1 
ATOM   7553  C  C2    . DA  I  5 72  ? -25.962 -22.877 87.741 1.00 98.02  ? -1   DA  I C2    1 
ATOM   7554  N  N3    . DA  I  5 72  ? -25.647 -21.587 87.617 1.00 97.85  ? -1   DA  I N3    1 
ATOM   7555  C  C4    . DA  I  5 72  ? -25.222 -21.314 86.366 1.00 98.19  ? -1   DA  I C4    1 
ATOM   7556  P  P     . DA  I  5 73  ? -22.689 -15.914 88.759 1.00 101.68 ? 0    DA  I P     1 
ATOM   7557  O  OP1   . DA  I  5 73  ? -22.936 -14.805 89.697 1.00 102.70 ? 0    DA  I OP1   1 
ATOM   7558  O  OP2   . DA  I  5 73  ? -21.613 -15.788 87.748 1.00 101.38 ? 0    DA  I OP2   1 
ATOM   7559  O  "O5'" . DA  I  5 73  ? -22.445 -17.242 89.603 1.00 102.00 ? 0    DA  I "O5'" 1 
ATOM   7560  C  "C5'" . DA  I  5 73  ? -23.496 -17.796 90.374 1.00 103.07 ? 0    DA  I "C5'" 1 
ATOM   7561  C  "C4'" . DA  I  5 73  ? -22.950 -19.016 91.094 1.00 104.83 ? 0    DA  I "C4'" 1 
ATOM   7562  O  "O4'" . DA  I  5 73  ? -23.173 -20.201 90.285 1.00 104.94 ? 0    DA  I "O4'" 1 
ATOM   7563  C  "C3'" . DA  I  5 73  ? -21.455 -18.984 91.401 1.00 105.49 ? 0    DA  I "C3'" 1 
ATOM   7564  O  "O3'" . DA  I  5 73  ? -21.305 -19.327 92.777 1.00 106.43 ? 0    DA  I "O3'" 1 
ATOM   7565  C  "C2'" . DA  I  5 73  ? -20.843 -20.012 90.443 1.00 105.49 ? 0    DA  I "C2'" 1 
ATOM   7566  C  "C1'" . DA  I  5 73  ? -21.997 -20.982 90.217 1.00 105.57 ? 0    DA  I "C1'" 1 
ATOM   7567  N  N9    . DA  I  5 73  ? -22.008 -21.590 88.890 1.00 105.92 ? 0    DA  I N9    1 
ATOM   7568  C  C8    . DA  I  5 73  ? -21.732 -20.968 87.700 1.00 105.97 ? 0    DA  I C8    1 
ATOM   7569  N  N7    . DA  I  5 73  ? -21.825 -21.753 86.654 1.00 105.92 ? 0    DA  I N7    1 
ATOM   7570  C  C5    . DA  I  5 73  ? -22.199 -22.972 87.190 1.00 105.92 ? 0    DA  I C5    1 
ATOM   7571  C  C6    . DA  I  5 73  ? -22.464 -24.225 86.601 1.00 105.88 ? 0    DA  I C6    1 
ATOM   7572  N  N6    . DA  I  5 73  ? -22.383 -24.425 85.286 1.00 105.94 ? 0    DA  I N6    1 
ATOM   7573  N  N1    . DA  I  5 73  ? -22.820 -25.257 87.409 1.00 106.15 ? 0    DA  I N1    1 
ATOM   7574  C  C2    . DA  I  5 73  ? -22.900 -25.039 88.733 1.00 106.15 ? 0    DA  I C2    1 
ATOM   7575  N  N3    . DA  I  5 73  ? -22.669 -23.901 89.403 1.00 106.41 ? 0    DA  I N3    1 
ATOM   7576  C  C4    . DA  I  5 73  ? -22.322 -22.894 88.569 1.00 106.24 ? 0    DA  I C4    1 
ATOM   7577  P  P     . DT  I  5 74  ? -19.886 -19.617 93.465 1.00 107.11 ? 1    DT  I P     1 
ATOM   7578  O  OP1   . DT  I  5 74  ? -20.081 -19.284 94.900 1.00 106.95 ? 1    DT  I OP1   1 
ATOM   7579  O  OP2   . DT  I  5 74  ? -18.772 -19.019 92.675 1.00 106.37 ? 1    DT  I OP2   1 
ATOM   7580  O  "O5'" . DT  I  5 74  ? -19.745 -21.194 93.296 1.00 105.97 ? 1    DT  I "O5'" 1 
ATOM   7581  C  "C5'" . DT  I  5 74  ? -20.692 -22.045 93.897 1.00 106.13 ? 1    DT  I "C5'" 1 
ATOM   7582  C  "C4'" . DT  I  5 74  ? -20.170 -23.454 93.786 1.00 106.11 ? 1    DT  I "C4'" 1 
ATOM   7583  O  "O4'" . DT  I  5 74  ? -20.358 -23.905 92.425 1.00 106.68 ? 1    DT  I "O4'" 1 
ATOM   7584  C  "C3'" . DT  I  5 74  ? -18.680 -23.569 94.073 1.00 106.41 ? 1    DT  I "C3'" 1 
ATOM   7585  O  "O3'" . DT  I  5 74  ? -18.506 -24.686 94.913 1.00 107.64 ? 1    DT  I "O3'" 1 
ATOM   7586  C  "C2'" . DT  I  5 74  ? -18.026 -23.781 92.707 1.00 106.19 ? 1    DT  I "C2'" 1 
ATOM   7587  C  "C1'" . DT  I  5 74  ? -19.153 -24.483 91.954 1.00 105.43 ? 1    DT  I "C1'" 1 
ATOM   7588  N  N1    . DT  I  5 74  ? -19.112 -24.355 90.463 1.00 104.50 ? 1    DT  I N1    1 
ATOM   7589  C  C2    . DT  I  5 74  ? -19.466 -25.452 89.711 1.00 103.77 ? 1    DT  I C2    1 
ATOM   7590  O  O2    . DT  I  5 74  ? -19.802 -26.510 90.201 1.00 104.17 ? 1    DT  I O2    1 
ATOM   7591  N  N3    . DT  I  5 74  ? -19.407 -25.270 88.358 1.00 103.60 ? 1    DT  I N3    1 
ATOM   7592  C  C4    . DT  I  5 74  ? -19.039 -24.111 87.696 1.00 104.57 ? 1    DT  I C4    1 
ATOM   7593  O  O4    . DT  I  5 74  ? -19.023 -24.057 86.467 1.00 104.79 ? 1    DT  I O4    1 
ATOM   7594  C  C5    . DT  I  5 74  ? -18.679 -22.990 88.547 1.00 104.30 ? 1    DT  I C5    1 
ATOM   7595  C  C7    . DT  I  5 74  ? -18.252 -21.671 87.963 1.00 104.26 ? 1    DT  I C7    1 
ATOM   7596  C  C6    . DT  I  5 74  ? -18.737 -23.163 89.874 1.00 103.97 ? 1    DT  I C6    1 
ATOM   7597  P  P     . DC  I  5 75  ? -17.097 -24.961 95.618 1.00 108.22 ? 2    DC  I P     1 
ATOM   7598  O  OP1   . DC  I  5 75  ? -17.404 -25.490 96.972 1.00 108.17 ? 2    DC  I OP1   1 
ATOM   7599  O  OP2   . DC  I  5 75  ? -16.229 -23.764 95.443 1.00 107.38 ? 2    DC  I OP2   1 
ATOM   7600  O  "O5'" . DC  I  5 75  ? -16.498 -26.147 94.731 1.00 108.33 ? 2    DC  I "O5'" 1 
ATOM   7601  C  "C5'" . DC  I  5 75  ? -17.212 -27.369 94.554 1.00 108.59 ? 2    DC  I "C5'" 1 
ATOM   7602  C  "C4'" . DC  I  5 75  ? -16.552 -28.168 93.449 1.00 109.07 ? 2    DC  I "C4'" 1 
ATOM   7603  O  "O4'" . DC  I  5 75  ? -16.843 -27.571 92.160 1.00 108.73 ? 2    DC  I "O4'" 1 
ATOM   7604  C  "C3'" . DC  I  5 75  ? -15.027 -28.225 93.538 1.00 109.21 ? 2    DC  I "C3'" 1 
ATOM   7605  O  "O3'" . DC  I  5 75  ? -14.645 -29.570 93.499 1.00 110.57 ? 2    DC  I "O3'" 1 
ATOM   7606  C  "C2'" . DC  I  5 75  ? -14.523 -27.497 92.298 1.00 108.61 ? 2    DC  I "C2'" 1 
ATOM   7607  C  "C1'" . DC  I  5 75  ? -15.694 -27.775 91.360 1.00 108.34 ? 2    DC  I "C1'" 1 
ATOM   7608  N  N1    . DC  I  5 75  ? -15.760 -26.936 90.119 1.00 108.09 ? 2    DC  I N1    1 
ATOM   7609  C  C2    . DC  I  5 75  ? -16.013 -27.550 88.878 1.00 107.65 ? 2    DC  I C2    1 
ATOM   7610  O  O2    . DC  I  5 75  ? -16.180 -28.776 88.805 1.00 107.77 ? 2    DC  I O2    1 
ATOM   7611  N  N3    . DC  I  5 75  ? -16.067 -26.771 87.773 1.00 107.34 ? 2    DC  I N3    1 
ATOM   7612  C  C4    . DC  I  5 75  ? -15.883 -25.455 87.870 1.00 107.46 ? 2    DC  I C4    1 
ATOM   7613  N  N4    . DC  I  5 75  ? -15.945 -24.739 86.750 1.00 107.99 ? 2    DC  I N4    1 
ATOM   7614  C  C5    . DC  I  5 75  ? -15.626 -24.810 89.112 1.00 107.49 ? 2    DC  I C5    1 
ATOM   7615  C  C6    . DC  I  5 75  ? -15.575 -25.583 90.202 1.00 107.89 ? 2    DC  I C6    1 
ATOM   7616  P  P     . DA  I  5 76  ? -13.720 -30.145 94.659 1.00 111.18 ? 3    DA  I P     1 
ATOM   7617  O  OP1   . DA  I  5 76  ? -14.511 -30.086 95.914 1.00 111.77 ? 3    DA  I OP1   1 
ATOM   7618  O  OP2   . DA  I  5 76  ? -12.396 -29.472 94.552 1.00 110.56 ? 3    DA  I OP2   1 
ATOM   7619  O  "O5'" . DA  I  5 76  ? -13.563 -31.687 94.251 1.00 111.78 ? 3    DA  I "O5'" 1 
ATOM   7620  C  "C5'" . DA  I  5 76  ? -14.694 -32.452 93.803 1.00 112.43 ? 3    DA  I "C5'" 1 
ATOM   7621  C  "C4'" . DA  I  5 76  ? -14.344 -33.344 92.607 1.00 113.18 ? 3    DA  I "C4'" 1 
ATOM   7622  O  "O4'" . DA  I  5 76  ? -14.337 -32.585 91.365 1.00 113.36 ? 3    DA  I "O4'" 1 
ATOM   7623  C  "C3'" . DA  I  5 76  ? -13.000 -34.076 92.640 1.00 112.81 ? 3    DA  I "C3'" 1 
ATOM   7624  O  "O3'" . DA  I  5 76  ? -13.193 -35.371 92.047 1.00 112.45 ? 3    DA  I "O3'" 1 
ATOM   7625  C  "C2'" . DA  I  5 76  ? -12.087 -33.165 91.814 1.00 112.98 ? 3    DA  I "C2'" 1 
ATOM   7626  C  "C1'" . DA  I  5 76  ? -13.066 -32.675 90.747 1.00 113.81 ? 3    DA  I "C1'" 1 
ATOM   7627  N  N9    . DA  I  5 76  ? -12.775 -31.356 90.207 1.00 114.05 ? 3    DA  I N9    1 
ATOM   7628  C  C8    . DA  I  5 76  ? -12.211 -30.294 90.859 1.00 114.45 ? 3    DA  I C8    1 
ATOM   7629  N  N7    . DA  I  5 76  ? -12.081 -29.223 90.112 1.00 114.72 ? 3    DA  I N7    1 
ATOM   7630  C  C5    . DA  I  5 76  ? -12.598 -29.611 88.888 1.00 114.43 ? 3    DA  I C5    1 
ATOM   7631  C  C6    . DA  I  5 76  ? -12.752 -28.932 87.665 1.00 114.13 ? 3    DA  I C6    1 
ATOM   7632  N  N6    . DA  I  5 76  ? -12.378 -27.666 87.481 1.00 114.21 ? 3    DA  I N6    1 
ATOM   7633  N  N1    . DA  I  5 76  ? -13.307 -29.607 86.637 1.00 114.28 ? 3    DA  I N1    1 
ATOM   7634  C  C2    . DA  I  5 76  ? -13.681 -30.881 86.817 1.00 114.32 ? 3    DA  I C2    1 
ATOM   7635  N  N3    . DA  I  5 76  ? -13.590 -31.623 87.920 1.00 114.57 ? 3    DA  I N3    1 
ATOM   7636  C  C4    . DA  I  5 76  ? -13.034 -30.923 88.928 1.00 114.42 ? 3    DA  I C4    1 
ATOM   7637  P  P     . DG  I  5 77  ? -12.025 -36.476 91.910 1.00 112.60 ? 4    DG  I P     1 
ATOM   7638  O  OP1   . DG  I  5 77  ? -12.596 -37.787 92.336 1.00 112.15 ? 4    DG  I OP1   1 
ATOM   7639  O  OP2   . DG  I  5 77  ? -10.751 -35.934 92.456 1.00 111.68 ? 4    DG  I OP2   1 
ATOM   7640  O  "O5'" . DG  I  5 77  ? -11.778 -36.610 90.332 1.00 111.77 ? 4    DG  I "O5'" 1 
ATOM   7641  C  "C5'" . DG  I  5 77  ? -12.830 -36.397 89.383 1.00 109.21 ? 4    DG  I "C5'" 1 
ATOM   7642  C  "C4'" . DG  I  5 77  ? -12.160 -36.046 88.067 1.00 106.89 ? 4    DG  I "C4'" 1 
ATOM   7643  O  "O4'" . DG  I  5 77  ? -11.806 -34.639 88.018 1.00 105.08 ? 4    DG  I "O4'" 1 
ATOM   7644  C  "C3'" . DG  I  5 77  ? -10.859 -36.795 87.827 1.00 106.03 ? 4    DG  I "C3'" 1 
ATOM   7645  O  "O3'" . DG  I  5 77  ? -10.882 -37.138 86.461 1.00 106.40 ? 4    DG  I "O3'" 1 
ATOM   7646  C  "C2'" . DG  I  5 77  ? -9.772  -35.771 88.191 1.00 105.20 ? 4    DG  I "C2'" 1 
ATOM   7647  C  "C1'" . DG  I  5 77  ? -10.442 -34.510 87.660 1.00 104.38 ? 4    DG  I "C1'" 1 
ATOM   7648  N  N9    . DG  I  5 77  ? -9.979  -33.185 88.092 1.00 104.12 ? 4    DG  I N9    1 
ATOM   7649  C  C8    . DG  I  5 77  ? -9.467  -32.746 89.294 1.00 103.98 ? 4    DG  I C8    1 
ATOM   7650  N  N7    . DG  I  5 77  ? -9.186  -31.464 89.311 1.00 104.01 ? 4    DG  I N7    1 
ATOM   7651  C  C5    . DG  I  5 77  ? -9.539  -31.021 88.035 1.00 104.23 ? 4    DG  I C5    1 
ATOM   7652  C  C6    . DG  I  5 77  ? -9.476  -29.736 87.420 1.00 103.73 ? 4    DG  I C6    1 
ATOM   7653  O  O6    . DG  I  5 77  ? -9.084  -28.661 87.877 1.00 103.87 ? 4    DG  I O6    1 
ATOM   7654  N  N1    . DG  I  5 77  ? -9.940  -29.750 86.112 1.00 103.91 ? 4    DG  I N1    1 
ATOM   7655  C  C2    . DG  I  5 77  ? -10.412 -30.861 85.452 1.00 103.97 ? 4    DG  I C2    1 
ATOM   7656  N  N2    . DG  I  5 77  ? -10.818 -30.688 84.188 1.00 103.96 ? 4    DG  I N2    1 
ATOM   7657  N  N3    . DG  I  5 77  ? -10.482 -32.063 86.000 1.00 104.03 ? 4    DG  I N3    1 
ATOM   7658  C  C4    . DG  I  5 77  ? -10.031 -32.072 87.285 1.00 104.41 ? 4    DG  I C4    1 
ATOM   7659  P  P     . DC  I  5 78  ? -10.212 -38.487 85.932 1.00 105.98 ? 5    DC  I P     1 
ATOM   7660  O  OP1   . DC  I  5 78  ? -11.304 -39.489 85.894 1.00 105.86 ? 5    DC  I OP1   1 
ATOM   7661  O  OP2   . DC  I  5 78  ? -8.969  -38.718 86.708 1.00 105.76 ? 5    DC  I OP2   1 
ATOM   7662  O  "O5'" . DC  I  5 78  ? -9.768  -38.147 84.422 1.00 105.71 ? 5    DC  I "O5'" 1 
ATOM   7663  C  "C5'" . DC  I  5 78  ? -10.401 -37.108 83.652 1.00 104.62 ? 5    DC  I "C5'" 1 
ATOM   7664  C  "C4'" . DC  I  5 78  ? -9.387  -36.120 83.084 1.00 103.94 ? 5    DC  I "C4'" 1 
ATOM   7665  O  "O4'" . DC  I  5 78  ? -9.064  -35.098 84.066 1.00 103.74 ? 5    DC  I "O4'" 1 
ATOM   7666  C  "C3'" . DC  I  5 78  ? -8.036  -36.693 82.631 1.00 102.99 ? 5    DC  I "C3'" 1 
ATOM   7667  O  "O3'" . DC  I  5 78  ? -7.751  -36.204 81.337 1.00 101.03 ? 5    DC  I "O3'" 1 
ATOM   7668  C  "C2'" . DC  I  5 78  ? -7.018  -36.086 83.590 1.00 103.92 ? 5    DC  I "C2'" 1 
ATOM   7669  C  "C1'" . DC  I  5 78  ? -7.706  -34.755 83.868 1.00 105.07 ? 5    DC  I "C1'" 1 
ATOM   7670  N  N1    . DC  I  5 78  ? -7.227  -34.014 85.052 1.00 106.12 ? 5    DC  I N1    1 
ATOM   7671  C  C2    . DC  I  5 78  ? -7.227  -32.606 85.018 1.00 107.10 ? 5    DC  I C2    1 
ATOM   7672  O  O2    . DC  I  5 78  ? -7.627  -32.016 83.994 1.00 107.18 ? 5    DC  I O2    1 
ATOM   7673  N  N3    . DC  I  5 78  ? -6.784  -31.931 86.121 1.00 106.86 ? 5    DC  I N3    1 
ATOM   7674  C  C4    . DC  I  5 78  ? -6.369  -32.604 87.201 1.00 106.42 ? 5    DC  I C4    1 
ATOM   7675  N  N4    . DC  I  5 78  ? -5.952  -31.905 88.260 1.00 106.56 ? 5    DC  I N4    1 
ATOM   7676  C  C5    . DC  I  5 78  ? -6.367  -34.034 87.248 1.00 106.84 ? 5    DC  I C5    1 
ATOM   7677  C  C6    . DC  I  5 78  ? -6.800  -34.689 86.164 1.00 106.57 ? 5    DC  I C6    1 
ATOM   7678  P  P     . DT  I  5 79  ? -7.676  -37.147 80.045 1.00 99.30  ? 6    DT  I P     1 
ATOM   7679  O  OP1   . DT  I  5 79  ? -8.686  -38.232 80.184 1.00 99.47  ? 6    DT  I OP1   1 
ATOM   7680  O  OP2   . DT  I  5 79  ? -6.222  -37.431 79.836 1.00 96.83  ? 6    DT  I OP2   1 
ATOM   7681  O  "O5'" . DT  I  5 79  ? -8.250  -36.215 78.868 1.00 94.67  ? 6    DT  I "O5'" 1 
ATOM   7682  C  "C5'" . DT  I  5 79  ? -8.867  -34.962 79.125 1.00 88.74  ? 6    DT  I "C5'" 1 
ATOM   7683  C  "C4'" . DT  I  5 79  ? -7.974  -33.842 78.609 1.00 84.53  ? 6    DT  I "C4'" 1 
ATOM   7684  O  "O4'" . DT  I  5 79  ? -7.303  -33.178 79.715 1.00 83.90  ? 6    DT  I "O4'" 1 
ATOM   7685  C  "C3'" . DT  I  5 79  ? -6.846  -34.229 77.651 1.00 81.75  ? 6    DT  I "C3'" 1 
ATOM   7686  O  "O3'" . DT  I  5 79  ? -6.535  -33.121 76.881 1.00 76.85  ? 6    DT  I "O3'" 1 
ATOM   7687  C  "C2'" . DT  I  5 79  ? -5.659  -34.341 78.585 1.00 82.62  ? 6    DT  I "C2'" 1 
ATOM   7688  C  "C1'" . DT  I  5 79  ? -5.928  -33.087 79.397 1.00 85.05  ? 6    DT  I "C1'" 1 
ATOM   7689  N  N1    . DT  I  5 79  ? -5.152  -33.025 80.643 1.00 86.87  ? 6    DT  I N1    1 
ATOM   7690  C  C2    . DT  I  5 79  ? -5.005  -31.820 81.300 1.00 86.51  ? 6    DT  I C2    1 
ATOM   7691  O  O2    . DT  I  5 79  ? -5.481  -30.778 80.915 1.00 86.45  ? 6    DT  I O2    1 
ATOM   7692  N  N3    . DT  I  5 79  ? -4.261  -31.887 82.443 1.00 86.63  ? 6    DT  I N3    1 
ATOM   7693  C  C4    . DT  I  5 79  ? -3.673  -33.014 82.994 1.00 87.07  ? 6    DT  I C4    1 
ATOM   7694  O  O4    . DT  I  5 79  ? -3.024  -32.941 84.040 1.00 87.50  ? 6    DT  I O4    1 
ATOM   7695  C  C5    . DT  I  5 79  ? -3.876  -34.254 82.261 1.00 87.18  ? 6    DT  I C5    1 
ATOM   7696  C  C7    . DT  I  5 79  ? -3.305  -35.567 82.720 1.00 86.35  ? 6    DT  I C7    1 
ATOM   7697  C  C6    . DT  I  5 79  ? -4.594  -34.194 81.137 1.00 87.20  ? 6    DT  I C6    1 
ATOM   7698  P  P     . DG  I  5 80  ? -6.887  -32.876 75.359 1.00 70.59  ? 7    DG  I P     1 
ATOM   7699  O  OP1   . DG  I  5 80  ? -8.282  -32.372 75.310 1.00 70.33  ? 7    DG  I OP1   1 
ATOM   7700  O  OP2   . DG  I  5 80  ? -6.367  -33.977 74.531 1.00 71.76  ? 7    DG  I OP2   1 
ATOM   7701  O  "O5'" . DG  I  5 80  ? -5.877  -31.653 75.117 1.00 71.38  ? 7    DG  I "O5'" 1 
ATOM   7702  C  "C5'" . DG  I  5 80  ? -6.164  -30.384 75.733 1.00 69.33  ? 7    DG  I "C5'" 1 
ATOM   7703  C  "C4'" . DG  I  5 80  ? -4.941  -29.556 76.042 1.00 67.21  ? 7    DG  I "C4'" 1 
ATOM   7704  O  "O4'" . DG  I  5 80  ? -4.323  -30.056 77.244 1.00 69.53  ? 7    DG  I "O4'" 1 
ATOM   7705  C  "C3'" . DG  I  5 80  ? -3.853  -29.482 74.982 1.00 65.48  ? 7    DG  I "C3'" 1 
ATOM   7706  O  "O3'" . DG  I  5 80  ? -3.463  -28.122 74.953 1.00 60.37  ? 7    DG  I "O3'" 1 
ATOM   7707  C  "C2'" . DG  I  5 80  ? -2.748  -30.406 75.493 1.00 67.31  ? 7    DG  I "C2'" 1 
ATOM   7708  C  "C1'" . DG  I  5 80  ? -2.943  -30.301 77.005 1.00 73.60  ? 7    DG  I "C1'" 1 
ATOM   7709  N  N9    . DG  I  5 80  ? -2.587  -31.446 77.852 1.00 74.15  ? 7    DG  I N9    1 
ATOM   7710  C  C8    . DG  I  5 80  ? -2.749  -32.790 77.637 1.00 75.61  ? 7    DG  I C8    1 
ATOM   7711  N  N7    . DG  I  5 80  ? -2.326  -33.551 78.618 1.00 77.64  ? 7    DG  I N7    1 
ATOM   7712  C  C5    . DG  I  5 80  ? -1.872  -32.609 79.552 1.00 76.91  ? 7    DG  I C5    1 
ATOM   7713  C  C6    . DG  I  5 80  ? -1.293  -32.773 80.839 1.00 75.87  ? 7    DG  I C6    1 
ATOM   7714  O  O6    . DG  I  5 80  ? -1.061  -33.821 81.449 1.00 75.64  ? 7    DG  I O6    1 
ATOM   7715  N  N1    . DG  I  5 80  ? -0.961  -31.561 81.434 1.00 75.76  ? 7    DG  I N1    1 
ATOM   7716  C  C2    . DG  I  5 80  ? -1.162  -30.325 80.870 1.00 75.93  ? 7    DG  I C2    1 
ATOM   7717  N  N2    . DG  I  5 80  ? -0.790  -29.255 81.591 1.00 75.57  ? 7    DG  I N2    1 
ATOM   7718  N  N3    . DG  I  5 80  ? -1.699  -30.159 79.675 1.00 76.01  ? 7    DG  I N3    1 
ATOM   7719  C  C4    . DG  I  5 80  ? -2.027  -31.329 79.084 1.00 75.20  ? 7    DG  I C4    1 
ATOM   7720  P  P     . DA  I  5 81  ? -2.432  -27.522 73.902 1.00 56.67  ? 8    DA  I P     1 
ATOM   7721  O  OP1   . DA  I  5 81  ? -3.280  -26.746 72.972 1.00 58.52  ? 8    DA  I OP1   1 
ATOM   7722  O  OP2   . DA  I  5 81  ? -1.451  -28.471 73.371 1.00 54.72  ? 8    DA  I OP2   1 
ATOM   7723  O  "O5'" . DA  I  5 81  ? -1.569  -26.549 74.813 1.00 58.06  ? 8    DA  I "O5'" 1 
ATOM   7724  C  "C5'" . DA  I  5 81  ? -2.158  -25.931 75.971 1.00 59.87  ? 8    DA  I "C5'" 1 
ATOM   7725  C  "C4'" . DA  I  5 81  ? -1.077  -25.194 76.737 1.00 61.37  ? 8    DA  I "C4'" 1 
ATOM   7726  O  "O4'" . DA  I  5 81  ? -0.481  -26.094 77.707 1.00 62.35  ? 8    DA  I "O4'" 1 
ATOM   7727  C  "C3'" . DA  I  5 81  ? 0.082   -24.691 75.876 1.00 63.01  ? 8    DA  I "C3'" 1 
ATOM   7728  O  "O3'" . DA  I  5 81  ? 0.581   -23.489 76.460 1.00 63.89  ? 8    DA  I "O3'" 1 
ATOM   7729  C  "C2'" . DA  I  5 81  ? 1.105   -25.818 75.932 1.00 62.25  ? 8    DA  I "C2'" 1 
ATOM   7730  C  "C1'" . DA  I  5 81  ? 0.830   -26.443 77.294 1.00 66.10  ? 8    DA  I "C1'" 1 
ATOM   7731  N  N9    . DA  I  5 81  ? 0.908   -27.907 77.310 1.00 68.08  ? 8    DA  I N9    1 
ATOM   7732  C  C8    . DA  I  5 81  ? 0.581   -28.786 76.319 1.00 68.42  ? 8    DA  I C8    1 
ATOM   7733  N  N7    . DA  I  5 81  ? 0.750   -30.037 76.629 1.00 68.28  ? 8    DA  I N7    1 
ATOM   7734  C  C5    . DA  I  5 81  ? 1.229   -29.984 77.918 1.00 69.42  ? 8    DA  I C5    1 
ATOM   7735  C  C6    . DA  I  5 81  ? 1.625   -30.983 78.835 1.00 68.82  ? 8    DA  I C6    1 
ATOM   7736  N  N6    . DA  I  5 81  ? 1.591   -32.288 78.590 1.00 68.08  ? 8    DA  I N6    1 
ATOM   7737  N  N1    . DA  I  5 81  ? 2.061   -30.571 80.039 1.00 68.92  ? 8    DA  I N1    1 
ATOM   7738  C  C2    . DA  I  5 81  ? 2.110   -29.264 80.339 1.00 68.48  ? 8    DA  I C2    1 
ATOM   7739  N  N3    . DA  I  5 81  ? 1.771   -28.237 79.565 1.00 69.49  ? 8    DA  I N3    1 
ATOM   7740  C  C4    . DA  I  5 81  ? 1.335   -28.674 78.357 1.00 69.37  ? 8    DA  I C4    1 
ATOM   7741  P  P     . DA  I  5 82  ? 1.785   -22.652 75.830 1.00 62.48  ? 9    DA  I P     1 
ATOM   7742  O  OP1   . DA  I  5 82  ? 1.388   -21.271 76.135 1.00 65.02  ? 9    DA  I OP1   1 
ATOM   7743  O  OP2   . DA  I  5 82  ? 2.043   -23.098 74.452 1.00 63.18  ? 9    DA  I OP2   1 
ATOM   7744  O  "O5'" . DA  I  5 82  ? 3.088   -23.000 76.683 1.00 65.24  ? 9    DA  I "O5'" 1 
ATOM   7745  C  "C5'" . DA  I  5 82  ? 3.038   -22.980 78.117 1.00 66.55  ? 9    DA  I "C5'" 1 
ATOM   7746  C  "C4'" . DA  I  5 82  ? 4.291   -23.578 78.756 1.00 68.82  ? 9    DA  I "C4'" 1 
ATOM   7747  O  "O4'" . DA  I  5 82  ? 4.174   -25.016 78.799 1.00 69.64  ? 9    DA  I "O4'" 1 
ATOM   7748  C  "C3'" . DA  I  5 82  ? 5.633   -23.281 78.088 1.00 69.39  ? 9    DA  I "C3'" 1 
ATOM   7749  O  "O3'" . DA  I  5 82  ? 6.530   -22.837 79.079 1.00 70.84  ? 9    DA  I "O3'" 1 
ATOM   7750  C  "C2'" . DA  I  5 82  ? 6.095   -24.612 77.512 1.00 69.86  ? 9    DA  I "C2'" 1 
ATOM   7751  C  "C1'" . DA  I  5 82  ? 5.406   -25.598 78.432 1.00 73.20  ? 9    DA  I "C1'" 1 
ATOM   7752  N  N9    . DA  I  5 82  ? 5.103   -26.891 77.837 1.00 74.60  ? 9    DA  I N9    1 
ATOM   7753  C  C8    . DA  I  5 82  ? 4.655   -27.141 76.574 1.00 75.67  ? 9    DA  I C8    1 
ATOM   7754  N  N7    . DA  I  5 82  ? 4.458   -28.415 76.317 1.00 76.90  ? 9    DA  I N7    1 
ATOM   7755  C  C5    . DA  I  5 82  ? 4.796   -29.052 77.502 1.00 77.13  ? 9    DA  I C5    1 
ATOM   7756  C  C6    . DA  I  5 82  ? 4.803   -30.410 77.903 1.00 76.23  ? 9    DA  I C6    1 
ATOM   7757  N  N6    . DA  I  5 82  ? 4.449   -31.427 77.114 1.00 75.62  ? 9    DA  I N6    1 
ATOM   7758  N  N1    . DA  I  5 82  ? 5.188   -30.691 79.163 1.00 75.82  ? 9    DA  I N1    1 
ATOM   7759  C  C2    . DA  I  5 82  ? 5.554   -29.696 79.971 1.00 75.64  ? 9    DA  I C2    1 
ATOM   7760  N  N3    . DA  I  5 82  ? 5.587   -28.391 79.712 1.00 76.49  ? 9    DA  I N3    1 
ATOM   7761  C  C4    . DA  I  5 82  ? 5.194   -28.123 78.450 1.00 76.49  ? 9    DA  I C4    1 
ATOM   7762  P  P     . DC  I  5 83  ? 7.984   -22.240 78.739 1.00 72.45  ? 10   DC  I P     1 
ATOM   7763  O  OP1   . DC  I  5 83  ? 8.197   -21.252 79.839 1.00 72.25  ? 10   DC  I OP1   1 
ATOM   7764  O  OP2   . DC  I  5 83  ? 8.105   -21.911 77.299 1.00 71.38  ? 10   DC  I OP2   1 
ATOM   7765  O  "O5'" . DC  I  5 83  ? 9.007   -23.450 78.885 1.00 74.20  ? 10   DC  I "O5'" 1 
ATOM   7766  C  "C5'" . DC  I  5 83  ? 8.904   -24.360 79.980 1.00 76.63  ? 10   DC  I "C5'" 1 
ATOM   7767  C  "C4'" . DC  I  5 83  ? 9.900   -25.485 79.789 1.00 78.86  ? 10   DC  I "C4'" 1 
ATOM   7768  O  "O4'" . DC  I  5 83  ? 9.232   -26.621 79.213 1.00 78.84  ? 10   DC  I "O4'" 1 
ATOM   7769  C  "C3'" . DC  I  5 83  ? 11.095  -25.210 78.881 1.00 80.94  ? 10   DC  I "C3'" 1 
ATOM   7770  O  "O3'" . DC  I  5 83  ? 12.203  -25.780 79.529 1.00 85.43  ? 10   DC  I "O3'" 1 
ATOM   7771  C  "C2'" . DC  I  5 83  ? 10.770  -25.990 77.615 1.00 80.59  ? 10   DC  I "C2'" 1 
ATOM   7772  C  "C1'" . DC  I  5 83  ? 10.069  -27.190 78.231 1.00 80.91  ? 10   DC  I "C1'" 1 
ATOM   7773  N  N1    . DC  I  5 83  ? 9.177   -27.977 77.324 1.00 82.29  ? 10   DC  I N1    1 
ATOM   7774  C  C2    . DC  I  5 83  ? 8.751   -29.261 77.729 1.00 82.63  ? 10   DC  I C2    1 
ATOM   7775  O  O2    . DC  I  5 83  ? 9.122   -29.725 78.807 1.00 82.30  ? 10   DC  I O2    1 
ATOM   7776  N  N3    . DC  I  5 83  ? 7.929   -29.971 76.921 1.00 83.46  ? 10   DC  I N3    1 
ATOM   7777  C  C4    . DC  I  5 83  ? 7.547   -29.445 75.754 1.00 82.48  ? 10   DC  I C4    1 
ATOM   7778  N  N4    . DC  I  5 83  ? 6.745   -30.187 74.994 1.00 82.31  ? 10   DC  I N4    1 
ATOM   7779  C  C5    . DC  I  5 83  ? 7.955   -28.144 75.323 1.00 82.04  ? 10   DC  I C5    1 
ATOM   7780  C  C6    . DC  I  5 83  ? 8.757   -27.447 76.131 1.00 81.57  ? 10   DC  I C6    1 
ATOM   7781  P  P     . DA  I  5 84  ? 13.719  -25.368 79.247 1.00 89.59  ? 11   DA  I P     1 
ATOM   7782  O  OP1   . DA  I  5 84  ? 13.906  -24.090 79.976 1.00 89.04  ? 11   DA  I OP1   1 
ATOM   7783  O  OP2   . DA  I  5 84  ? 14.048  -25.500 77.802 1.00 88.44  ? 11   DA  I OP2   1 
ATOM   7784  O  "O5'" . DA  I  5 84  ? 14.538  -26.522 80.002 1.00 93.13  ? 11   DA  I "O5'" 1 
ATOM   7785  C  "C5'" . DA  I  5 84  ? 13.863  -27.477 80.833 1.00 98.64  ? 11   DA  I "C5'" 1 
ATOM   7786  C  "C4'" . DA  I  5 84  ? 14.396  -28.876 80.569 1.00 103.15 ? 11   DA  I "C4'" 1 
ATOM   7787  O  "O4'" . DA  I  5 84  ? 13.459  -29.611 79.738 1.00 104.80 ? 11   DA  I "O4'" 1 
ATOM   7788  C  "C3'" . DA  I  5 84  ? 15.756  -28.929 79.869 1.00 105.73 ? 11   DA  I "C3'" 1 
ATOM   7789  O  "O3'" . DA  I  5 84  ? 16.606  -29.901 80.496 1.00 109.04 ? 11   DA  I "O3'" 1 
ATOM   7790  C  "C2'" . DA  I  5 84  ? 15.421  -29.321 78.434 1.00 106.56 ? 11   DA  I "C2'" 1 
ATOM   7791  C  "C1'" . DA  I  5 84  ? 14.088  -30.061 78.546 1.00 107.47 ? 11   DA  I "C1'" 1 
ATOM   7792  N  N9    . DA  I  5 84  ? 13.240  -29.814 77.368 1.00 108.13 ? 11   DA  I N9    1 
ATOM   7793  C  C8    . DA  I  5 84  ? 12.995  -28.606 76.769 1.00 108.43 ? 11   DA  I C8    1 
ATOM   7794  N  N7    . DA  I  5 84  ? 12.213  -28.667 75.720 1.00 108.64 ? 11   DA  I N7    1 
ATOM   7795  C  C5    . DA  I  5 84  ? 11.915  -30.015 75.620 1.00 108.95 ? 11   DA  I C5    1 
ATOM   7796  C  C6    . DA  I  5 84  ? 11.122  -30.747 74.706 1.00 108.52 ? 11   DA  I C6    1 
ATOM   7797  N  N6    . DA  I  5 84  ? 10.465  -30.174 73.696 1.00 108.20 ? 11   DA  I N6    1 
ATOM   7798  N  N1    . DA  I  5 84  ? 11.030  -32.087 74.876 1.00 108.48 ? 11   DA  I N1    1 
ATOM   7799  C  C2    . DA  I  5 84  ? 11.688  -32.663 75.896 1.00 108.49 ? 11   DA  I C2    1 
ATOM   7800  N  N3    . DA  I  5 84  ? 12.466  -32.081 76.815 1.00 109.02 ? 11   DA  I N3    1 
ATOM   7801  C  C4    . DA  I  5 84  ? 12.543  -30.743 76.623 1.00 108.88 ? 11   DA  I C4    1 
ATOM   7802  P  P     . DT  I  5 85  ? 18.163  -30.073 80.117 1.00 110.58 ? 12   DT  I P     1 
ATOM   7803  O  OP1   . DT  I  5 85  ? 18.912  -30.284 81.378 1.00 110.27 ? 12   DT  I OP1   1 
ATOM   7804  O  OP2   . DT  I  5 85  ? 18.582  -28.980 79.207 1.00 110.68 ? 12   DT  I OP2   1 
ATOM   7805  O  "O5'" . DT  I  5 85  ? 18.146  -31.425 79.257 1.00 112.34 ? 12   DT  I "O5'" 1 
ATOM   7806  C  "C5'" . DT  I  5 85  ? 17.247  -32.510 79.536 1.00 115.23 ? 12   DT  I "C5'" 1 
ATOM   7807  C  "C4'" . DT  I  5 85  ? 17.189  -33.476 78.365 1.00 117.40 ? 12   DT  I "C4'" 1 
ATOM   7808  O  "O4'" . DT  I  5 85  ? 16.104  -33.100 77.474 1.00 118.25 ? 12   DT  I "O4'" 1 
ATOM   7809  C  "C3'" . DT  I  5 85  ? 18.452  -33.507 77.501 1.00 118.92 ? 12   DT  I "C3'" 1 
ATOM   7810  O  "O3'" . DT  I  5 85  ? 18.815  -34.847 77.193 1.00 120.09 ? 12   DT  I "O3'" 1 
ATOM   7811  C  "C2'" . DT  I  5 85  ? 18.055  -32.737 76.242 1.00 118.85 ? 12   DT  I "C2'" 1 
ATOM   7812  C  "C1'" . DT  I  5 85  ? 16.582  -33.109 76.141 1.00 119.17 ? 12   DT  I "C1'" 1 
ATOM   7813  N  N1    . DT  I  5 85  ? 15.771  -32.180 75.294 1.00 119.42 ? 12   DT  I N1    1 
ATOM   7814  C  C2    . DT  I  5 85  ? 14.834  -32.700 74.417 1.00 119.62 ? 12   DT  I C2    1 
ATOM   7815  O  O2    . DT  I  5 85  ? 14.612  -33.893 74.287 1.00 119.62 ? 12   DT  I O2    1 
ATOM   7816  N  N3    . DT  I  5 85  ? 14.150  -31.753 73.691 1.00 119.66 ? 12   DT  I N3    1 
ATOM   7817  C  C4    . DT  I  5 85  ? 14.313  -30.379 73.750 1.00 119.72 ? 12   DT  I C4    1 
ATOM   7818  O  O4    . DT  I  5 85  ? 13.640  -29.631 73.053 1.00 119.82 ? 12   DT  I O4    1 
ATOM   7819  C  C5    . DT  I  5 85  ? 15.309  -29.900 74.688 1.00 119.75 ? 12   DT  I C5    1 
ATOM   7820  C  C7    . DT  I  5 85  ? 15.596  -28.435 74.857 1.00 119.43 ? 12   DT  I C7    1 
ATOM   7821  C  C6    . DT  I  5 85  ? 15.979  -30.816 75.398 1.00 119.65 ? 12   DT  I C6    1 
ATOM   7822  P  P     . DG  I  5 86  ? 20.324  -35.221 76.801 1.00 120.91 ? 13   DG  I P     1 
ATOM   7823  O  OP1   . DG  I  5 86  ? 21.041  -35.425 78.084 1.00 120.94 ? 13   DG  I OP1   1 
ATOM   7824  O  OP2   . DG  I  5 86  ? 20.869  -34.247 75.812 1.00 120.62 ? 13   DG  I OP2   1 
ATOM   7825  O  "O5'" . DG  I  5 86  ? 20.133  -36.635 76.055 1.00 120.14 ? 13   DG  I "O5'" 1 
ATOM   7826  C  "C5'" . DG  I  5 86  ? 18.836  -37.193 75.765 1.00 118.70 ? 13   DG  I "C5'" 1 
ATOM   7827  C  "C4'" . DG  I  5 86  ? 18.692  -37.638 74.312 1.00 117.79 ? 13   DG  I "C4'" 1 
ATOM   7828  O  "O4'" . DG  I  5 86  ? 17.859  -36.703 73.571 1.00 118.51 ? 13   DG  I "O4'" 1 
ATOM   7829  C  "C3'" . DG  I  5 86  ? 19.978  -37.774 73.498 1.00 116.58 ? 13   DG  I "C3'" 1 
ATOM   7830  O  "O3'" . DG  I  5 86  ? 19.864  -38.972 72.714 1.00 113.55 ? 13   DG  I "O3'" 1 
ATOM   7831  C  "C2'" . DG  I  5 86  ? 20.032  -36.464 72.696 1.00 117.44 ? 13   DG  I "C2'" 1 
ATOM   7832  C  "C1'" . DG  I  5 86  ? 18.550  -36.182 72.446 1.00 118.98 ? 13   DG  I "C1'" 1 
ATOM   7833  N  N9    . DG  I  5 86  ? 18.168  -34.771 72.320 1.00 119.33 ? 13   DG  I N9    1 
ATOM   7834  C  C8    . DG  I  5 86  ? 18.682  -33.703 73.018 1.00 119.63 ? 13   DG  I C8    1 
ATOM   7835  N  N7    . DG  I  5 86  ? 18.143  -32.554 72.713 1.00 119.71 ? 13   DG  I N7    1 
ATOM   7836  C  C5    . DG  I  5 86  ? 17.198  -32.873 71.746 1.00 119.74 ? 13   DG  I C5    1 
ATOM   7837  C  C6    . DG  I  5 86  ? 16.300  -32.031 71.035 1.00 119.43 ? 13   DG  I C6    1 
ATOM   7838  O  O6    . DG  I  5 86  ? 16.160  -30.805 71.130 1.00 119.23 ? 13   DG  I O6    1 
ATOM   7839  N  N1    . DG  I  5 86  ? 15.509  -32.750 70.139 1.00 119.44 ? 13   DG  I N1    1 
ATOM   7840  C  C2    . DG  I  5 86  ? 15.585  -34.115 69.956 1.00 119.53 ? 13   DG  I C2    1 
ATOM   7841  N  N2    . DG  I  5 86  ? 14.748  -34.639 69.055 1.00 119.50 ? 13   DG  I N2    1 
ATOM   7842  N  N3    . DG  I  5 86  ? 16.417  -34.917 70.614 1.00 119.80 ? 13   DG  I N3    1 
ATOM   7843  C  C4    . DG  I  5 86  ? 17.198  -34.234 71.495 1.00 119.80 ? 13   DG  I C4    1 
ATOM   7844  P  P     . DC  I  5 87  ? 20.805  -39.314 71.459 1.00 111.63 ? 14   DC  I P     1 
ATOM   7845  O  OP1   . DC  I  5 87  ? 20.826  -40.794 71.344 1.00 111.23 ? 14   DC  I OP1   1 
ATOM   7846  O  OP2   . DC  I  5 87  ? 22.064  -38.528 71.544 1.00 110.64 ? 14   DC  I OP2   1 
ATOM   7847  O  "O5'" . DC  I  5 87  ? 19.987  -38.705 70.221 1.00 109.55 ? 14   DC  I "O5'" 1 
ATOM   7848  C  "C5'" . DC  I  5 87  ? 19.104  -39.489 69.419 1.00 106.02 ? 14   DC  I "C5'" 1 
ATOM   7849  C  "C4'" . DC  I  5 87  ? 18.868  -38.794 68.090 1.00 103.14 ? 14   DC  I "C4'" 1 
ATOM   7850  O  "O4'" . DC  I  5 87  ? 18.502  -37.425 68.362 1.00 101.38 ? 14   DC  I "O4'" 1 
ATOM   7851  C  "C3'" . DC  I  5 87  ? 20.073  -38.751 67.144 1.00 101.89 ? 14   DC  I "C3'" 1 
ATOM   7852  O  "O3'" . DC  I  5 87  ? 19.698  -39.073 65.794 1.00 99.43  ? 14   DC  I "O3'" 1 
ATOM   7853  C  "C2'" . DC  I  5 87  ? 20.543  -37.304 67.252 1.00 102.32 ? 14   DC  I "C2'" 1 
ATOM   7854  C  "C1'" . DC  I  5 87  ? 19.205  -36.608 67.466 1.00 102.56 ? 14   DC  I "C1'" 1 
ATOM   7855  N  N1    . DC  I  5 87  ? 19.250  -35.248 68.061 1.00 103.45 ? 14   DC  I N1    1 
ATOM   7856  C  C2    . DC  I  5 87  ? 18.551  -34.213 67.411 1.00 103.76 ? 14   DC  I C2    1 
ATOM   7857  O  O2    . DC  I  5 87  ? 17.931  -34.458 66.361 1.00 103.78 ? 14   DC  I O2    1 
ATOM   7858  N  N3    . DC  I  5 87  ? 18.583  -32.966 67.958 1.00 103.59 ? 14   DC  I N3    1 
ATOM   7859  C  C4    . DC  I  5 87  ? 19.263  -32.743 69.091 1.00 103.14 ? 14   DC  I C4    1 
ATOM   7860  N  N4    . DC  I  5 87  ? 19.259  -31.504 69.583 1.00 102.94 ? 14   DC  I N4    1 
ATOM   7861  C  C5    . DC  I  5 87  ? 19.978  -33.784 69.767 1.00 103.54 ? 14   DC  I C5    1 
ATOM   7862  C  C6    . DC  I  5 87  ? 19.942  -35.011 69.225 1.00 103.52 ? 14   DC  I C6    1 
ATOM   7863  P  P     . DC  I  5 88  ? 19.481  -40.585 65.308 1.00 97.39  ? 15   DC  I P     1 
ATOM   7864  O  OP1   . DC  I  5 88  ? 19.131  -41.363 66.523 1.00 96.91  ? 15   DC  I OP1   1 
ATOM   7865  O  OP2   . DC  I  5 88  ? 20.631  -40.949 64.448 1.00 95.74  ? 15   DC  I OP2   1 
ATOM   7866  O  "O5'" . DC  I  5 88  ? 18.171  -40.531 64.369 1.00 97.57  ? 15   DC  I "O5'" 1 
ATOM   7867  C  "C5'" . DC  I  5 88  ? 16.838  -40.308 64.927 1.00 96.91  ? 15   DC  I "C5'" 1 
ATOM   7868  C  "C4'" . DC  I  5 88  ? 15.957  -39.414 64.052 1.00 96.28  ? 15   DC  I "C4'" 1 
ATOM   7869  O  "O4'" . DC  I  5 88  ? 16.498  -38.063 64.026 1.00 96.62  ? 15   DC  I "O4'" 1 
ATOM   7870  C  "C3'" . DC  I  5 88  ? 15.819  -39.854 62.594 1.00 95.34  ? 15   DC  I "C3'" 1 
ATOM   7871  O  "O3'" . DC  I  5 88  ? 14.504  -39.620 62.092 1.00 92.94  ? 15   DC  I "O3'" 1 
ATOM   7872  C  "C2'" . DC  I  5 88  ? 16.835  -38.986 61.870 1.00 95.97  ? 15   DC  I "C2'" 1 
ATOM   7873  C  "C1'" . DC  I  5 88  ? 16.766  -37.704 62.687 1.00 98.10  ? 15   DC  I "C1'" 1 
ATOM   7874  N  N1    . DC  I  5 88  ? 18.031  -36.928 62.586 1.00 99.33  ? 15   DC  I N1    1 
ATOM   7875  C  C2    . DC  I  5 88  ? 18.001  -35.527 62.568 1.00 99.93  ? 15   DC  I C2    1 
ATOM   7876  O  O2    . DC  I  5 88  ? 16.919  -34.931 62.661 1.00 99.86  ? 15   DC  I O2    1 
ATOM   7877  N  N3    . DC  I  5 88  ? 19.180  -34.859 62.457 1.00 100.39 ? 15   DC  I N3    1 
ATOM   7878  C  C4    . DC  I  5 88  ? 20.333  -35.527 62.358 1.00 99.85  ? 15   DC  I C4    1 
ATOM   7879  N  N4    . DC  I  5 88  ? 21.457  -34.822 62.252 1.00 99.87  ? 15   DC  I N4    1 
ATOM   7880  C  C5    . DC  I  5 88  ? 20.389  -36.947 62.366 1.00 100.11 ? 15   DC  I C5    1 
ATOM   7881  C  C6    . DC  I  5 88  ? 19.222  -37.594 62.479 1.00 100.09 ? 15   DC  I C6    1 
ATOM   7882  P  P     . DT  I  5 89  ? 14.035  -40.114 60.626 1.00 92.06  ? 16   DT  I P     1 
ATOM   7883  O  OP1   . DT  I  5 89  ? 12.812  -40.920 60.840 1.00 91.30  ? 16   DT  I OP1   1 
ATOM   7884  O  OP2   . DT  I  5 89  ? 15.162  -40.628 59.810 1.00 90.46  ? 16   DT  I OP2   1 
ATOM   7885  O  "O5'" . DT  I  5 89  ? 13.643  -38.753 59.877 1.00 90.99  ? 16   DT  I "O5'" 1 
ATOM   7886  C  "C5'" . DT  I  5 89  ? 13.081  -37.638 60.555 1.00 87.09  ? 16   DT  I "C5'" 1 
ATOM   7887  C  "C4'" . DT  I  5 89  ? 13.315  -36.416 59.697 1.00 84.83  ? 16   DT  I "C4'" 1 
ATOM   7888  O  "O4'" . DT  I  5 89  ? 14.669  -35.951 59.850 1.00 84.99  ? 16   DT  I "O4'" 1 
ATOM   7889  C  "C3'" . DT  I  5 89  ? 13.117  -36.649 58.205 1.00 83.59  ? 16   DT  I "C3'" 1 
ATOM   7890  O  "O3'" . DT  I  5 89  ? 12.113  -35.749 57.811 1.00 79.45  ? 16   DT  I "O3'" 1 
ATOM   7891  C  "C2'" . DT  I  5 89  ? 14.476  -36.350 57.567 1.00 84.50  ? 16   DT  I "C2'" 1 
ATOM   7892  C  "C1'" . DT  I  5 89  ? 15.120  -35.458 58.606 1.00 87.18  ? 16   DT  I "C1'" 1 
ATOM   7893  N  N1    . DT  I  5 89  ? 16.619  -35.474 58.587 1.00 88.86  ? 16   DT  I N1    1 
ATOM   7894  C  C2    . DT  I  5 89  ? 17.315  -34.289 58.369 1.00 89.34  ? 16   DT  I C2    1 
ATOM   7895  O  O2    . DT  I  5 89  ? 16.800  -33.202 58.177 1.00 89.29  ? 16   DT  I O2    1 
ATOM   7896  N  N3    . DT  I  5 89  ? 18.680  -34.414 58.376 1.00 89.97  ? 16   DT  I N3    1 
ATOM   7897  C  C4    . DT  I  5 89  ? 19.426  -35.563 58.585 1.00 89.52  ? 16   DT  I C4    1 
ATOM   7898  O  O4    . DT  I  5 89  ? 20.660  -35.520 58.571 1.00 89.09  ? 16   DT  I O4    1 
ATOM   7899  C  C5    . DT  I  5 89  ? 18.642  -36.770 58.813 1.00 89.32  ? 16   DT  I C5    1 
ATOM   7900  C  C7    . DT  I  5 89  ? 19.298  -38.097 59.045 1.00 88.35  ? 16   DT  I C7    1 
ATOM   7901  C  C6    . DT  I  5 89  ? 17.300  -36.666 58.802 1.00 89.14  ? 16   DT  I C6    1 
ATOM   7902  P  P     . DT  I  5 90  ? 11.580  -35.578 56.314 1.00 77.50  ? 17   DT  I P     1 
ATOM   7903  O  OP1   . DT  I  5 90  ? 10.132  -35.858 56.481 1.00 77.52  ? 17   DT  I OP1   1 
ATOM   7904  O  OP2   . DT  I  5 90  ? 12.422  -36.293 55.314 1.00 74.90  ? 17   DT  I OP2   1 
ATOM   7905  O  "O5'" . DT  I  5 90  ? 11.751  -34.013 56.003 1.00 77.41  ? 17   DT  I "O5'" 1 
ATOM   7906  C  "C5'" . DT  I  5 90  ? 11.882  -33.080 57.085 1.00 77.35  ? 17   DT  I "C5'" 1 
ATOM   7907  C  "C4'" . DT  I  5 90  ? 12.755  -31.906 56.704 1.00 77.32  ? 17   DT  I "C4'" 1 
ATOM   7908  O  "O4'" . DT  I  5 90  ? 14.154  -32.260 56.828 1.00 79.23  ? 17   DT  I "O4'" 1 
ATOM   7909  C  "C3'" . DT  I  5 90  ? 12.550  -31.406 55.282 1.00 76.48  ? 17   DT  I "C3'" 1 
ATOM   7910  O  "O3'" . DT  I  5 90  ? 12.296  -30.032 55.357 1.00 73.41  ? 17   DT  I "O3'" 1 
ATOM   7911  C  "C2'" . DT  I  5 90  ? 13.857  -31.738 54.561 1.00 77.93  ? 17   DT  I "C2'" 1 
ATOM   7912  C  "C1'" . DT  I  5 90  ? 14.868  -31.813 55.692 1.00 81.64  ? 17   DT  I "C1'" 1 
ATOM   7913  N  N1    . DT  I  5 90  ? 16.035  -32.745 55.448 1.00 83.46  ? 17   DT  I N1    1 
ATOM   7914  C  C2    . DT  I  5 90  ? 17.320  -32.233 55.513 1.00 84.51  ? 17   DT  I C2    1 
ATOM   7915  O  O2    . DT  I  5 90  ? 17.576  -31.061 55.750 1.00 85.47  ? 17   DT  I O2    1 
ATOM   7916  N  N3    . DT  I  5 90  ? 18.313  -33.149 55.279 1.00 84.28  ? 17   DT  I N3    1 
ATOM   7917  C  C4    . DT  I  5 90  ? 18.174  -34.496 55.008 1.00 84.07  ? 17   DT  I C4    1 
ATOM   7918  O  O4    . DT  I  5 90  ? 19.150  -35.222 54.824 1.00 84.49  ? 17   DT  I O4    1 
ATOM   7919  C  C5    . DT  I  5 90  ? 16.813  -34.979 54.953 1.00 84.85  ? 17   DT  I C5    1 
ATOM   7920  C  C7    . DT  I  5 90  ? 16.533  -36.432 54.657 1.00 83.83  ? 17   DT  I C7    1 
ATOM   7921  C  C6    . DT  I  5 90  ? 15.824  -34.088 55.168 1.00 84.00  ? 17   DT  I C6    1 
ATOM   7922  P  P     . DT  I  5 91  ? 12.175  -29.132 54.051 1.00 73.18  ? 18   DT  I P     1 
ATOM   7923  O  OP1   . DT  I  5 91  ? 11.077  -28.238 54.458 1.00 76.86  ? 18   DT  I OP1   1 
ATOM   7924  O  OP2   . DT  I  5 91  ? 12.107  -29.892 52.773 1.00 70.67  ? 18   DT  I OP2   1 
ATOM   7925  O  "O5'" . DT  I  5 91  ? 13.545  -28.304 53.951 1.00 76.95  ? 18   DT  I "O5'" 1 
ATOM   7926  C  "C5'" . DT  I  5 91  ? 14.169  -27.612 55.033 1.00 81.92  ? 18   DT  I "C5'" 1 
ATOM   7927  C  "C4'" . DT  I  5 91  ? 15.544  -27.125 54.602 1.00 87.44  ? 18   DT  I "C4'" 1 
ATOM   7928  O  "O4'" . DT  I  5 91  ? 16.449  -28.252 54.458 1.00 89.87  ? 18   DT  I "O4'" 1 
ATOM   7929  C  "C3'" . DT  I  5 91  ? 15.616  -26.376 53.267 1.00 90.45  ? 18   DT  I "C3'" 1 
ATOM   7930  O  "O3'" . DT  I  5 91  ? 16.531  -25.272 53.367 1.00 92.39  ? 18   DT  I "O3'" 1 
ATOM   7931  C  "C2'" . DT  I  5 91  ? 16.138  -27.428 52.289 1.00 91.33  ? 18   DT  I "C2'" 1 
ATOM   7932  C  "C1'" . DT  I  5 91  ? 17.104  -28.177 53.198 1.00 93.88  ? 18   DT  I "C1'" 1 
ATOM   7933  N  N1    . DT  I  5 91  ? 17.435  -29.575 52.779 1.00 95.53  ? 18   DT  I N1    1 
ATOM   7934  C  C2    . DT  I  5 91  ? 18.707  -30.096 52.985 1.00 96.98  ? 18   DT  I C2    1 
ATOM   7935  O  O2    . DT  I  5 91  ? 19.628  -29.474 53.488 1.00 97.44  ? 18   DT  I O2    1 
ATOM   7936  N  N3    . DT  I  5 91  ? 18.875  -31.402 52.575 1.00 97.30  ? 18   DT  I N3    1 
ATOM   7937  C  C4    . DT  I  5 91  ? 17.916  -32.220 52.000 1.00 96.43  ? 18   DT  I C4    1 
ATOM   7938  O  O4    . DT  I  5 91  ? 18.152  -33.372 51.666 1.00 96.75  ? 18   DT  I O4    1 
ATOM   7939  C  C5    . DT  I  5 91  ? 16.615  -31.625 51.819 1.00 96.77  ? 18   DT  I C5    1 
ATOM   7940  C  C7    . DT  I  5 91  ? 15.498  -32.412 51.205 1.00 96.38  ? 18   DT  I C7    1 
ATOM   7941  C  C6    . DT  I  5 91  ? 16.441  -30.355 52.213 1.00 96.50  ? 18   DT  I C6    1 
ATOM   7942  P  P     . DT  I  5 92  ? 16.652  -24.157 52.221 1.00 93.76  ? 19   DT  I P     1 
ATOM   7943  O  OP1   . DT  I  5 92  ? 16.651  -22.865 52.943 1.00 94.32  ? 19   DT  I OP1   1 
ATOM   7944  O  OP2   . DT  I  5 92  ? 15.686  -24.411 51.128 1.00 92.62  ? 19   DT  I OP2   1 
ATOM   7945  O  "O5'" . DT  I  5 92  ? 18.089  -24.385 51.558 1.00 98.67  ? 19   DT  I "O5'" 1 
ATOM   7946  C  "C5'" . DT  I  5 92  ? 19.225  -24.661 52.367 1.00 106.00 ? 19   DT  I "C5'" 1 
ATOM   7947  C  "C4'" . DT  I  5 92  ? 20.373  -25.154 51.506 1.00 111.52 ? 19   DT  I "C4'" 1 
ATOM   7948  O  "O4'" . DT  I  5 92  ? 20.279  -26.590 51.302 1.00 113.47 ? 19   DT  I "O4'" 1 
ATOM   7949  C  "C3'" . DT  I  5 92  ? 20.424  -24.517 50.119 1.00 114.90 ? 19   DT  I "C3'" 1 
ATOM   7950  O  "O3'" . DT  I  5 92  ? 21.757  -24.100 49.878 1.00 118.93 ? 19   DT  I "O3'" 1 
ATOM   7951  C  "C2'" . DT  I  5 92  ? 19.998  -25.632 49.166 1.00 115.19 ? 19   DT  I "C2'" 1 
ATOM   7952  C  "C1'" . DT  I  5 92  ? 20.481  -26.861 49.928 1.00 116.14 ? 19   DT  I "C1'" 1 
ATOM   7953  N  N1    . DT  I  5 92  ? 19.756  -28.109 49.575 1.00 117.00 ? 19   DT  I N1    1 
ATOM   7954  C  C2    . DT  I  5 92  ? 20.459  -29.296 49.475 1.00 117.44 ? 19   DT  I C2    1 
ATOM   7955  O  O2    . DT  I  5 92  ? 21.657  -29.395 49.661 1.00 117.75 ? 19   DT  I O2    1 
ATOM   7956  N  N3    . DT  I  5 92  ? 19.695  -30.384 49.143 1.00 117.70 ? 19   DT  I N3    1 
ATOM   7957  C  C4    . DT  I  5 92  ? 18.328  -30.403 48.908 1.00 117.57 ? 19   DT  I C4    1 
ATOM   7958  O  O4    . DT  I  5 92  ? 17.733  -31.436 48.610 1.00 117.67 ? 19   DT  I O4    1 
ATOM   7959  C  C5    . DT  I  5 92  ? 17.654  -29.129 49.027 1.00 117.55 ? 19   DT  I C5    1 
ATOM   7960  C  C7    . DT  I  5 92  ? 16.174  -29.020 48.794 1.00 117.35 ? 19   DT  I C7    1 
ATOM   7961  C  C6    . DT  I  5 92  ? 18.390  -28.058 49.353 1.00 117.42 ? 19   DT  I C6    1 
ATOM   7962  P  P     . DG  I  5 93  ? 22.098  -23.067 48.707 1.00 122.03 ? 20   DG  I P     1 
ATOM   7963  O  OP1   . DG  I  5 93  ? 22.960  -22.031 49.317 1.00 121.99 ? 20   DG  I OP1   1 
ATOM   7964  O  OP2   . DG  I  5 93  ? 20.855  -22.703 47.976 1.00 121.58 ? 20   DG  I OP2   1 
ATOM   7965  O  "O5'" . DG  I  5 93  ? 22.995  -23.949 47.725 1.00 125.36 ? 20   DG  I "O5'" 1 
ATOM   7966  C  "C5'" . DG  I  5 93  ? 24.209  -24.555 48.180 1.00 130.40 ? 20   DG  I "C5'" 1 
ATOM   7967  C  "C4'" . DG  I  5 93  ? 24.791  -25.453 47.095 1.00 134.01 ? 20   DG  I "C4'" 1 
ATOM   7968  O  "O4'" . DG  I  5 93  ? 24.068  -26.716 47.082 1.00 135.12 ? 20   DG  I "O4'" 1 
ATOM   7969  C  "C3'" . DG  I  5 93  ? 24.719  -24.914 45.665 1.00 135.73 ? 20   DG  I "C3'" 1 
ATOM   7970  O  "O3'" . DG  I  5 93  ? 25.859  -25.364 44.938 1.00 138.16 ? 20   DG  I "O3'" 1 
ATOM   7971  C  "C2'" . DG  I  5 93  ? 23.422  -25.538 45.158 1.00 136.12 ? 20   DG  I "C2'" 1 
ATOM   7972  C  "C1'" . DG  I  5 93  ? 23.502  -26.920 45.802 1.00 136.60 ? 20   DG  I "C1'" 1 
ATOM   7973  N  N9    . DG  I  5 93  ? 22.213  -27.607 45.922 1.00 136.98 ? 20   DG  I N9    1 
ATOM   7974  C  C8    . DG  I  5 93  ? 20.970  -27.040 46.108 1.00 137.17 ? 20   DG  I C8    1 
ATOM   7975  N  N7    . DG  I  5 93  ? 20.001  -27.909 46.170 1.00 137.17 ? 20   DG  I N7    1 
ATOM   7976  C  C5    . DG  I  5 93  ? 20.640  -29.134 46.011 1.00 137.23 ? 20   DG  I C5    1 
ATOM   7977  C  C6    . DG  I  5 93  ? 20.108  -30.449 45.988 1.00 137.30 ? 20   DG  I C6    1 
ATOM   7978  O  O6    . DG  I  5 93  ? 18.921  -30.790 46.109 1.00 137.08 ? 20   DG  I O6    1 
ATOM   7979  N  N1    . DG  I  5 93  ? 21.099  -31.421 45.804 1.00 137.26 ? 20   DG  I N1    1 
ATOM   7980  C  C2    . DG  I  5 93  ? 22.443  -31.153 45.655 1.00 137.14 ? 20   DG  I C2    1 
ATOM   7981  N  N2    . DG  I  5 93  ? 23.250  -32.210 45.482 1.00 137.09 ? 20   DG  I N2    1 
ATOM   7982  N  N3    . DG  I  5 93  ? 22.953  -29.925 45.677 1.00 137.20 ? 20   DG  I N3    1 
ATOM   7983  C  C4    . DG  I  5 93  ? 22.001  -28.967 45.857 1.00 137.11 ? 20   DG  I C4    1 
ATOM   7984  P  P     . DA  I  5 94  ? 26.085  -25.087 43.367 1.00 140.59 ? 21   DA  I P     1 
ATOM   7985  O  OP1   . DA  I  5 94  ? 26.604  -23.703 43.267 1.00 140.40 ? 21   DA  I OP1   1 
ATOM   7986  O  OP2   . DA  I  5 94  ? 24.886  -25.458 42.581 1.00 140.33 ? 21   DA  I OP2   1 
ATOM   7987  O  "O5'" . DA  I  5 94  ? 27.222  -26.157 42.967 1.00 142.11 ? 21   DA  I "O5'" 1 
ATOM   7988  C  "C5'" . DA  I  5 94  ? 27.459  -27.355 43.741 1.00 144.66 ? 21   DA  I "C5'" 1 
ATOM   7989  C  "C4'" . DA  I  5 94  ? 27.180  -28.659 42.995 1.00 146.63 ? 21   DA  I "C4'" 1 
ATOM   7990  O  "O4'" . DA  I  5 94  ? 25.858  -29.159 43.351 1.00 147.40 ? 21   DA  I "O4'" 1 
ATOM   7991  C  "C3'" . DA  I  5 94  ? 27.209  -28.607 41.463 1.00 147.94 ? 21   DA  I "C3'" 1 
ATOM   7992  O  "O3'" . DA  I  5 94  ? 28.078  -29.632 40.928 1.00 148.83 ? 21   DA  I "O3'" 1 
ATOM   7993  C  "C2'" . DA  I  5 94  ? 25.741  -28.828 41.073 1.00 148.31 ? 21   DA  I "C2'" 1 
ATOM   7994  C  "C1'" . DA  I  5 94  ? 25.302  -29.770 42.191 1.00 148.43 ? 21   DA  I "C1'" 1 
ATOM   7995  N  N9    . DA  I  5 94  ? 23.847  -29.946 42.308 1.00 148.60 ? 21   DA  I N9    1 
ATOM   7996  C  C8    . DA  I  5 94  ? 22.920  -28.970 42.568 1.00 148.71 ? 21   DA  I C8    1 
ATOM   7997  N  N7    . DA  I  5 94  ? 21.681  -29.402 42.621 1.00 148.72 ? 21   DA  I N7    1 
ATOM   7998  C  C5    . DA  I  5 94  ? 21.798  -30.758 42.371 1.00 148.66 ? 21   DA  I C5    1 
ATOM   7999  C  C6    . DA  I  5 94  ? 20.836  -31.786 42.292 1.00 148.62 ? 21   DA  I C6    1 
ATOM   8000  N  N6    . DA  I  5 94  ? 19.532  -31.553 42.467 1.00 148.50 ? 21   DA  I N6    1 
ATOM   8001  N  N1    . DA  I  5 94  ? 21.265  -33.046 42.029 1.00 148.60 ? 21   DA  I N1    1 
ATOM   8002  C  C2    . DA  I  5 94  ? 22.582  -33.252 41.858 1.00 148.62 ? 21   DA  I C2    1 
ATOM   8003  N  N3    . DA  I  5 94  ? 23.581  -32.362 41.913 1.00 148.51 ? 21   DA  I N3    1 
ATOM   8004  C  C4    . DA  I  5 94  ? 23.123  -31.118 42.175 1.00 148.56 ? 21   DA  I C4    1 
ATOM   8005  P  P     . DT  I  5 95  ? 28.245  -29.866 39.332 1.00 149.40 ? 22   DT  I P     1 
ATOM   8006  O  OP1   . DT  I  5 95  ? 29.581  -30.482 39.127 1.00 149.48 ? 22   DT  I OP1   1 
ATOM   8007  O  OP2   . DT  I  5 95  ? 27.913  -28.603 38.630 1.00 149.21 ? 22   DT  I OP2   1 
ATOM   8008  O  "O5'" . DT  I  5 95  ? 27.088  -30.929 38.969 1.00 149.83 ? 22   DT  I "O5'" 1 
ATOM   8009  C  "C5'" . DT  I  5 95  ? 27.341  -32.348 39.080 1.00 150.91 ? 22   DT  I "C5'" 1 
ATOM   8010  C  "C4'" . DT  I  5 95  ? 26.313  -33.150 38.295 1.00 151.73 ? 22   DT  I "C4'" 1 
ATOM   8011  O  "O4'" . DT  I  5 95  ? 24.960  -32.778 38.682 1.00 152.35 ? 22   DT  I "O4'" 1 
ATOM   8012  C  "C3'" . DT  I  5 95  ? 26.375  -33.028 36.768 1.00 151.92 ? 22   DT  I "C3'" 1 
ATOM   8013  O  "O3'" . DT  I  5 95  ? 26.459  -34.338 36.197 1.00 151.22 ? 22   DT  I "O3'" 1 
ATOM   8014  C  "C2'" . DT  I  5 95  ? 25.059  -32.341 36.394 1.00 152.27 ? 22   DT  I "C2'" 1 
ATOM   8015  C  "C1'" . DT  I  5 95  ? 24.150  -32.825 37.522 1.00 153.07 ? 22   DT  I "C1'" 1 
ATOM   8016  N  N1    . DT  I  5 95  ? 22.917  -32.000 37.737 1.00 153.53 ? 22   DT  I N1    1 
ATOM   8017  C  C2    . DT  I  5 95  ? 21.700  -32.621 38.015 1.00 153.66 ? 22   DT  I C2    1 
ATOM   8018  O  O2    . DT  I  5 95  ? 21.538  -33.834 38.103 1.00 153.57 ? 22   DT  I O2    1 
ATOM   8019  N  N3    . DT  I  5 95  ? 20.652  -31.742 38.189 1.00 153.61 ? 22   DT  I N3    1 
ATOM   8020  C  C4    . DT  I  5 95  ? 20.696  -30.350 38.117 1.00 153.60 ? 22   DT  I C4    1 
ATOM   8021  O  O4    . DT  I  5 95  ? 19.692  -29.661 38.292 1.00 153.60 ? 22   DT  I O4    1 
ATOM   8022  C  C5    . DT  I  5 95  ? 21.994  -29.772 37.824 1.00 153.55 ? 22   DT  I C5    1 
ATOM   8023  C  C7    . DT  I  5 95  ? 22.184  -28.283 37.716 1.00 153.31 ? 22   DT  I C7    1 
ATOM   8024  C  C6    . DT  I  5 95  ? 23.024  -30.616 37.653 1.00 153.50 ? 22   DT  I C6    1 
ATOM   8025  P  P     . DG  I  5 96  ? 27.005  -34.606 34.711 1.00 150.39 ? 23   DG  I P     1 
ATOM   8026  O  OP1   . DG  I  5 96  ? 28.466  -34.325 34.737 1.00 150.52 ? 23   DG  I OP1   1 
ATOM   8027  O  OP2   . DG  I  5 96  ? 26.137  -33.894 33.733 1.00 150.24 ? 23   DG  I OP2   1 
ATOM   8028  O  "O5'" . DG  I  5 96  ? 26.766  -36.199 34.576 1.00 148.86 ? 23   DG  I "O5'" 1 
ATOM   8029  C  "C5'" . DG  I  5 96  ? 26.414  -36.831 33.333 1.00 146.21 ? 23   DG  I "C5'" 1 
ATOM   8030  C  "C4'" . DG  I  5 96  ? 25.071  -37.547 33.434 1.00 144.19 ? 23   DG  I "C4'" 1 
ATOM   8031  O  "O4'" . DG  I  5 96  ? 24.071  -36.688 34.056 1.00 143.34 ? 23   DG  I "O4'" 1 
ATOM   8032  C  "C3'" . DG  I  5 96  ? 24.459  -37.973 32.100 1.00 143.25 ? 23   DG  I "C3'" 1 
ATOM   8033  O  "O3'" . DG  I  5 96  ? 23.751  -39.220 32.306 1.00 142.26 ? 23   DG  I "O3'" 1 
ATOM   8034  C  "C2'" . DG  I  5 96  ? 23.578  -36.763 31.766 1.00 142.79 ? 23   DG  I "C2'" 1 
ATOM   8035  C  "C1'" . DG  I  5 96  ? 23.004  -36.462 33.147 1.00 141.74 ? 23   DG  I "C1'" 1 
ATOM   8036  N  N9    . DG  I  5 96  ? 22.453  -35.123 33.363 1.00 141.19 ? 23   DG  I N9    1 
ATOM   8037  C  C8    . DG  I  5 96  ? 22.964  -33.897 32.997 1.00 140.78 ? 23   DG  I C8    1 
ATOM   8038  N  N7    . DG  I  5 96  ? 22.219  -32.892 33.361 1.00 140.68 ? 23   DG  I N7    1 
ATOM   8039  C  C5    . DG  I  5 96  ? 21.145  -33.491 34.018 1.00 141.24 ? 23   DG  I C5    1 
ATOM   8040  C  C6    . DG  I  5 96  ? 19.992  -32.928 34.640 1.00 141.14 ? 23   DG  I C6    1 
ATOM   8041  O  O6    . DG  I  5 96  ? 19.685  -31.733 34.742 1.00 141.01 ? 23   DG  I O6    1 
ATOM   8042  N  N1    . DG  I  5 96  ? 19.146  -33.898 35.186 1.00 140.86 ? 23   DG  I N1    1 
ATOM   8043  C  C2    . DG  I  5 96  ? 19.381  -35.250 35.137 1.00 140.88 ? 23   DG  I C2    1 
ATOM   8044  N  N2    . DG  I  5 96  ? 18.469  -36.037 35.708 1.00 141.04 ? 23   DG  I N2    1 
ATOM   8045  N  N3    . DG  I  5 96  ? 20.445  -35.797 34.562 1.00 141.29 ? 23   DG  I N3    1 
ATOM   8046  C  C4    . DG  I  5 96  ? 21.279  -34.864 34.025 1.00 141.39 ? 23   DG  I C4    1 
ATOM   8047  P  P     . DG  I  5 97  ? 22.441  -39.697 31.462 1.00 141.43 ? 24   DG  I P     1 
ATOM   8048  O  OP1   . DG  I  5 97  ? 22.255  -41.143 31.736 1.00 141.43 ? 24   DG  I OP1   1 
ATOM   8049  O  OP2   . DG  I  5 97  ? 22.563  -39.235 30.042 1.00 141.26 ? 24   DG  I OP2   1 
ATOM   8050  O  "O5'" . DG  I  5 97  ? 21.241  -38.869 32.175 1.00 141.04 ? 24   DG  I "O5'" 1 
ATOM   8051  C  "C5'" . DG  I  5 97  ? 20.101  -39.579 32.704 1.00 140.01 ? 24   DG  I "C5'" 1 
ATOM   8052  C  "C4'" . DG  I  5 97  ? 18.791  -39.054 32.115 1.00 138.89 ? 24   DG  I "C4'" 1 
ATOM   8053  O  "O4'" . DG  I  5 97  ? 18.786  -37.606 32.095 1.00 139.13 ? 24   DG  I "O4'" 1 
ATOM   8054  C  "C3'" . DG  I  5 97  ? 18.470  -39.454 30.676 1.00 137.88 ? 24   DG  I "C3'" 1 
ATOM   8055  O  "O3'" . DG  I  5 97  ? 17.065  -39.495 30.574 1.00 135.58 ? 24   DG  I "O3'" 1 
ATOM   8056  C  "C2'" . DG  I  5 97  ? 19.011  -38.295 29.839 1.00 138.51 ? 24   DG  I "C2'" 1 
ATOM   8057  C  "C1'" . DG  I  5 97  ? 18.590  -37.155 30.761 1.00 139.75 ? 24   DG  I "C1'" 1 
ATOM   8058  N  N9    . DG  I  5 97  ? 19.341  -35.914 30.665 1.00 140.08 ? 24   DG  I N9    1 
ATOM   8059  C  C8    . DG  I  5 97  ? 20.614  -35.688 30.191 1.00 140.23 ? 24   DG  I C8    1 
ATOM   8060  N  N7    . DG  I  5 97  ? 20.977  -34.433 30.277 1.00 140.44 ? 24   DG  I N7    1 
ATOM   8061  C  C5    . DG  I  5 97  ? 19.875  -33.793 30.849 1.00 140.47 ? 24   DG  I C5    1 
ATOM   8062  C  C6    . DG  I  5 97  ? 19.657  -32.426 31.195 1.00 140.34 ? 24   DG  I C6    1 
ATOM   8063  O  O6    . DG  I  5 97  ? 20.433  -31.464 31.059 1.00 140.19 ? 24   DG  I O6    1 
ATOM   8064  N  N1    . DG  I  5 97  ? 18.388  -32.223 31.757 1.00 140.21 ? 24   DG  I N1    1 
ATOM   8065  C  C2    . DG  I  5 97  ? 17.448  -33.216 31.961 1.00 140.22 ? 24   DG  I C2    1 
ATOM   8066  N  N2    . DG  I  5 97  ? 16.281  -32.851 32.512 1.00 140.24 ? 24   DG  I N2    1 
ATOM   8067  N  N3    . DG  I  5 97  ? 17.640  -34.490 31.645 1.00 140.11 ? 24   DG  I N3    1 
ATOM   8068  C  C4    . DG  I  5 97  ? 18.866  -34.702 31.097 1.00 140.30 ? 24   DG  I C4    1 
ATOM   8069  P  P     . DA  I  5 98  ? 16.383  -40.712 29.800 1.00 134.09 ? 25   DA  I P     1 
ATOM   8070  O  OP1   . DA  I  5 98  ? 16.874  -41.969 30.424 1.00 133.07 ? 25   DA  I OP1   1 
ATOM   8071  O  OP2   . DA  I  5 98  ? 16.534  -40.434 28.346 1.00 133.36 ? 25   DA  I OP2   1 
ATOM   8072  O  "O5'" . DA  I  5 98  ? 14.830  -40.586 30.163 1.00 132.36 ? 25   DA  I "O5'" 1 
ATOM   8073  C  "C5'" . DA  I  5 98  ? 14.391  -40.432 31.514 1.00 129.99 ? 25   DA  I "C5'" 1 
ATOM   8074  C  "C4'" . DA  I  5 98  ? 13.274  -39.404 31.574 1.00 128.17 ? 25   DA  I "C4'" 1 
ATOM   8075  O  "O4'" . DA  I  5 98  ? 13.796  -38.084 31.270 1.00 128.38 ? 25   DA  I "O4'" 1 
ATOM   8076  C  "C3'" . DA  I  5 98  ? 12.129  -39.634 30.596 1.00 127.01 ? 25   DA  I "C3'" 1 
ATOM   8077  O  "O3'" . DA  I  5 98  ? 10.899  -39.343 31.260 1.00 124.62 ? 25   DA  I "O3'" 1 
ATOM   8078  C  "C2'" . DA  I  5 98  ? 12.418  -38.685 29.424 1.00 127.60 ? 25   DA  I "C2'" 1 
ATOM   8079  C  "C1'" . DA  I  5 98  ? 13.207  -37.560 30.089 1.00 128.89 ? 25   DA  I "C1'" 1 
ATOM   8080  N  N9    . DA  I  5 98  ? 14.263  -36.962 29.262 1.00 129.32 ? 25   DA  I N9    1 
ATOM   8081  C  C8    . DA  I  5 98  ? 15.095  -37.576 28.358 1.00 129.48 ? 25   DA  I C8    1 
ATOM   8082  N  N7    . DA  I  5 98  ? 15.950  -36.763 27.773 1.00 129.27 ? 25   DA  I N7    1 
ATOM   8083  C  C5    . DA  I  5 98  ? 15.662  -35.528 28.331 1.00 129.34 ? 25   DA  I C5    1 
ATOM   8084  C  C6    . DA  I  5 98  ? 16.206  -34.234 28.147 1.00 129.47 ? 25   DA  I C6    1 
ATOM   8085  N  N6    . DA  I  5 98  ? 17.202  -33.965 27.297 1.00 129.59 ? 25   DA  I N6    1 
ATOM   8086  N  N1    . DA  I  5 98  ? 15.686  -33.211 28.869 1.00 129.62 ? 25   DA  I N1    1 
ATOM   8087  C  C2    . DA  I  5 98  ? 14.685  -33.462 29.724 1.00 129.44 ? 25   DA  I C2    1 
ATOM   8088  N  N3    . DA  I  5 98  ? 14.093  -34.632 29.978 1.00 129.56 ? 25   DA  I N3    1 
ATOM   8089  C  C4    . DA  I  5 98  ? 14.628  -35.632 29.249 1.00 129.47 ? 25   DA  I C4    1 
ATOM   8090  P  P     . DG  I  5 99  ? 9.472   -39.626 30.578 1.00 122.51 ? 26   DG  I P     1 
ATOM   8091  O  OP1   . DG  I  5 99  ? 8.546   -40.016 31.668 1.00 123.13 ? 26   DG  I OP1   1 
ATOM   8092  O  OP2   . DG  I  5 99  ? 9.661   -40.519 29.410 1.00 122.67 ? 26   DG  I OP2   1 
ATOM   8093  O  "O5'" . DG  I  5 99  ? 9.028   -38.207 29.987 1.00 119.78 ? 26   DG  I "O5'" 1 
ATOM   8094  C  "C5'" . DG  I  5 99  ? 8.893   -37.063 30.816 1.00 116.24 ? 26   DG  I "C5'" 1 
ATOM   8095  C  "C4'" . DG  I  5 99  ? 8.749   -35.824 29.956 1.00 113.76 ? 26   DG  I "C4'" 1 
ATOM   8096  O  "O4'" . DG  I  5 99  ? 9.968   -35.597 29.204 1.00 114.00 ? 26   DG  I "O4'" 1 
ATOM   8097  C  "C3'" . DG  I  5 99  ? 7.624   -35.882 28.932 1.00 112.06 ? 26   DG  I "C3'" 1 
ATOM   8098  O  "O3'" . DG  I  5 99  ? 6.950   -34.646 29.000 1.00 109.03 ? 26   DG  I "O3'" 1 
ATOM   8099  C  "C2'" . DG  I  5 99  ? 8.362   -36.033 27.601 1.00 113.22 ? 26   DG  I "C2'" 1 
ATOM   8100  C  "C1'" . DG  I  5 99  ? 9.628   -35.228 27.886 1.00 115.30 ? 26   DG  I "C1'" 1 
ATOM   8101  N  N9    . DG  I  5 99  ? 10.796  -35.460 27.026 1.00 115.72 ? 26   DG  I N9    1 
ATOM   8102  C  C8    . DG  I  5 99  ? 11.114  -36.572 26.274 1.00 116.04 ? 26   DG  I C8    1 
ATOM   8103  N  N7    . DG  I  5 99  ? 12.241  -36.466 25.617 1.00 116.03 ? 26   DG  I N7    1 
ATOM   8104  C  C5    . DG  I  5 99  ? 12.707  -35.200 25.957 1.00 116.32 ? 26   DG  I C5    1 
ATOM   8105  C  C6    . DG  I  5 99  ? 13.893  -34.508 25.563 1.00 116.43 ? 26   DG  I C6    1 
ATOM   8106  O  O6    . DG  I  5 99  ? 14.795  -34.897 24.801 1.00 116.19 ? 26   DG  I O6    1 
ATOM   8107  N  N1    . DG  I  5 99  ? 13.985  -33.233 26.139 1.00 116.34 ? 26   DG  I N1    1 
ATOM   8108  C  C2    . DG  I  5 99  ? 13.043  -32.693 26.997 1.00 116.36 ? 26   DG  I C2    1 
ATOM   8109  N  N2    . DG  I  5 99  ? 13.287  -31.456 27.462 1.00 116.07 ? 26   DG  I N2    1 
ATOM   8110  N  N3    . DG  I  5 99  ? 11.935  -33.334 27.376 1.00 116.66 ? 26   DG  I N3    1 
ATOM   8111  C  C4    . DG  I  5 99  ? 11.828  -34.574 26.822 1.00 116.10 ? 26   DG  I C4    1 
ATOM   8112  P  P     . DC  I  5 100 ? 5.368   -34.502 29.168 1.00 104.39 ? 27   DC  I P     1 
ATOM   8113  O  OP1   . DC  I  5 100 ? 5.028   -34.860 30.552 1.00 104.53 ? 27   DC  I OP1   1 
ATOM   8114  O  OP2   . DC  I  5 100 ? 4.661   -35.135 28.035 1.00 104.94 ? 27   DC  I OP2   1 
ATOM   8115  O  "O5'" . DC  I  5 100 ? 5.225   -32.933 28.963 1.00 107.45 ? 27   DC  I "O5'" 1 
ATOM   8116  C  "C5'" . DC  I  5 100 ? 6.041   -32.042 29.723 1.00 110.71 ? 27   DC  I "C5'" 1 
ATOM   8117  C  "C4'" . DC  I  5 100 ? 6.773   -31.052 28.831 1.00 112.68 ? 27   DC  I "C4'" 1 
ATOM   8118  O  "O4'" . DC  I  5 100 ? 7.757   -31.726 28.005 1.00 113.07 ? 27   DC  I "O4'" 1 
ATOM   8119  C  "C3'" . DC  I  5 100 ? 5.879   -30.234 27.903 1.00 113.67 ? 27   DC  I "C3'" 1 
ATOM   8120  O  "O3'" . DC  I  5 100 ? 6.042   -28.868 28.278 1.00 115.84 ? 27   DC  I "O3'" 1 
ATOM   8121  C  "C2'" . DC  I  5 100 ? 6.392   -30.551 26.497 1.00 113.04 ? 27   DC  I "C2'" 1 
ATOM   8122  C  "C1'" . DC  I  5 100 ? 7.804   -31.081 26.747 1.00 113.26 ? 27   DC  I "C1'" 1 
ATOM   8123  N  N1    . DC  I  5 100 ? 8.357   -32.076 25.749 1.00 113.33 ? 27   DC  I N1    1 
ATOM   8124  C  C2    . DC  I  5 100 ? 9.638   -31.878 25.186 1.00 113.60 ? 27   DC  I C2    1 
ATOM   8125  O  O2    . DC  I  5 100 ? 10.313  -30.882 25.487 1.00 113.68 ? 27   DC  I O2    1 
ATOM   8126  N  N3    . DC  I  5 100 ? 10.120  -32.791 24.302 1.00 113.53 ? 27   DC  I N3    1 
ATOM   8127  C  C4    . DC  I  5 100 ? 9.394   -33.862 23.975 1.00 113.38 ? 27   DC  I C4    1 
ATOM   8128  N  N4    . DC  I  5 100 ? 9.919   -34.723 23.094 1.00 113.19 ? 27   DC  I N4    1 
ATOM   8129  C  C5    . DC  I  5 100 ? 8.096   -34.086 24.534 1.00 113.31 ? 27   DC  I C5    1 
ATOM   8130  C  C6    . DC  I  5 100 ? 7.627   -33.183 25.407 1.00 113.03 ? 27   DC  I C6    1 
ATOM   8131  P  P     . DA  I  5 101 ? 4.963   -27.703 28.024 1.00 116.47 ? 28   DA  I P     1 
ATOM   8132  O  OP1   . DA  I  5 101 ? 5.077   -26.790 29.186 1.00 115.43 ? 28   DA  I OP1   1 
ATOM   8133  O  OP2   . DA  I  5 101 ? 3.657   -28.284 27.626 1.00 116.76 ? 28   DA  I OP2   1 
ATOM   8134  O  "O5'" . DA  I  5 101 ? 5.570   -26.990 26.719 1.00 120.13 ? 28   DA  I "O5'" 1 
ATOM   8135  C  "C5'" . DA  I  5 101 ? 6.987   -26.740 26.610 1.00 124.37 ? 28   DA  I "C5'" 1 
ATOM   8136  C  "C4'" . DA  I  5 101 ? 7.463   -26.753 25.164 1.00 127.36 ? 28   DA  I "C4'" 1 
ATOM   8137  O  "O4'" . DA  I  5 101 ? 7.652   -28.111 24.695 1.00 127.87 ? 28   DA  I "O4'" 1 
ATOM   8138  C  "C3'" . DA  I  5 101 ? 6.546   -26.089 24.138 1.00 129.88 ? 28   DA  I "C3'" 1 
ATOM   8139  O  "O3'" . DA  I  5 101 ? 7.355   -25.296 23.258 1.00 134.50 ? 28   DA  I "O3'" 1 
ATOM   8140  C  "C2'" . DA  I  5 101 ? 5.904   -27.278 23.419 1.00 128.90 ? 28   DA  I "C2'" 1 
ATOM   8141  C  "C1'" . DA  I  5 101 ? 7.127   -28.184 23.379 1.00 128.38 ? 28   DA  I "C1'" 1 
ATOM   8142  N  N9    . DA  I  5 101 ? 6.939   -29.585 22.989 1.00 128.41 ? 28   DA  I N9    1 
ATOM   8143  C  C8    . DA  I  5 101 ? 5.880   -30.425 23.238 1.00 128.49 ? 28   DA  I C8    1 
ATOM   8144  N  N7    . DA  I  5 101 ? 6.036   -31.641 22.758 1.00 128.45 ? 28   DA  I N7    1 
ATOM   8145  C  C5    . DA  I  5 101 ? 7.287   -31.591 22.147 1.00 128.63 ? 28   DA  I C5    1 
ATOM   8146  C  C6    . DA  I  5 101 ? 8.055   -32.546 21.437 1.00 128.55 ? 28   DA  I C6    1 
ATOM   8147  N  N6    . DA  I  5 101 ? 7.644   -33.801 21.225 1.00 128.49 ? 28   DA  I N6    1 
ATOM   8148  N  N1    . DA  I  5 101 ? 9.264   -32.171 20.957 1.00 128.29 ? 28   DA  I N1    1 
ATOM   8149  C  C2    . DA  I  5 101 ? 9.682   -30.916 21.167 1.00 128.19 ? 28   DA  I C2    1 
ATOM   8150  N  N3    . DA  I  5 101 ? 9.054   -29.934 21.814 1.00 128.09 ? 28   DA  I N3    1 
ATOM   8151  C  C4    . DA  I  5 101 ? 7.854   -30.334 22.282 1.00 128.26 ? 28   DA  I C4    1 
ATOM   8152  P  P     . DG  I  5 102 ? 7.020   -23.751 22.940 1.00 137.65 ? 29   DG  I P     1 
ATOM   8153  O  OP1   . DG  I  5 102 ? 7.460   -22.919 24.090 1.00 137.82 ? 29   DG  I OP1   1 
ATOM   8154  O  OP2   . DG  I  5 102 ? 5.615   -23.687 22.466 1.00 137.52 ? 29   DG  I OP2   1 
ATOM   8155  O  "O5'" . DG  I  5 102 ? 7.954   -23.424 21.676 1.00 139.97 ? 29   DG  I "O5'" 1 
ATOM   8156  C  "C5'" . DG  I  5 102 ? 9.369   -23.724 21.667 1.00 143.07 ? 29   DG  I "C5'" 1 
ATOM   8157  C  "C4'" . DG  I  5 102 ? 9.868   -24.071 20.263 1.00 145.10 ? 29   DG  I "C4'" 1 
ATOM   8158  O  "O4'" . DG  I  5 102 ? 9.785   -25.502 20.022 1.00 145.42 ? 29   DG  I "O4'" 1 
ATOM   8159  C  "C3'" . DG  I  5 102 ? 9.151   -23.412 19.087 1.00 146.53 ? 29   DG  I "C3'" 1 
ATOM   8160  O  "O3'" . DG  I  5 102 ? 10.108  -23.035 18.099 1.00 148.71 ? 29   DG  I "O3'" 1 
ATOM   8161  C  "C2'" . DG  I  5 102 ? 8.208   -24.501 18.579 1.00 146.13 ? 29   DG  I "C2'" 1 
ATOM   8162  C  "C1'" . DG  I  5 102 ? 9.039   -25.755 18.847 1.00 145.85 ? 29   DG  I "C1'" 1 
ATOM   8163  N  N9    . DG  I  5 102 ? 8.252   -26.957 19.093 1.00 145.81 ? 29   DG  I N9    1 
ATOM   8164  C  C8    . DG  I  5 102 ? 7.181   -27.090 19.946 1.00 145.99 ? 29   DG  I C8    1 
ATOM   8165  N  N7    . DG  I  5 102 ? 6.672   -28.289 19.960 1.00 146.04 ? 29   DG  I N7    1 
ATOM   8166  C  C5    . DG  I  5 102 ? 7.465   -29.000 19.067 1.00 146.01 ? 29   DG  I C5    1 
ATOM   8167  C  C6    . DG  I  5 102 ? 7.398   -30.360 18.667 1.00 146.15 ? 29   DG  I C6    1 
ATOM   8168  O  O6    . DG  I  5 102 ? 6.596   -31.231 19.040 1.00 146.05 ? 29   DG  I O6    1 
ATOM   8169  N  N1    . DG  I  5 102 ? 8.391   -30.683 17.736 1.00 146.16 ? 29   DG  I N1    1 
ATOM   8170  C  C2    . DG  I  5 102 ? 9.331   -29.797 17.252 1.00 146.02 ? 29   DG  I C2    1 
ATOM   8171  N  N2    . DG  I  5 102 ? 10.205  -30.290 16.361 1.00 145.96 ? 29   DG  I N2    1 
ATOM   8172  N  N3    . DG  I  5 102 ? 9.403   -28.520 17.619 1.00 145.79 ? 29   DG  I N3    1 
ATOM   8173  C  C4    . DG  I  5 102 ? 8.444   -28.192 18.525 1.00 145.73 ? 29   DG  I C4    1 
ATOM   8174  P  P     . DT  I  5 103 ? 9.823   -21.802 17.116 1.00 150.14 ? 30   DT  I P     1 
ATOM   8175  O  OP1   . DT  I  5 103 ? 11.073  -21.001 17.074 1.00 150.52 ? 30   DT  I OP1   1 
ATOM   8176  O  OP2   . DT  I  5 103 ? 8.548   -21.148 17.520 1.00 150.08 ? 30   DT  I OP2   1 
ATOM   8177  O  "O5'" . DT  I  5 103 ? 9.599   -22.519 15.697 1.00 150.67 ? 30   DT  I "O5'" 1 
ATOM   8178  C  "C5'" . DT  I  5 103 ? 10.714  -23.059 14.987 1.00 152.38 ? 30   DT  I "C5'" 1 
ATOM   8179  C  "C4'" . DT  I  5 103 ? 10.317  -24.302 14.215 1.00 153.84 ? 30   DT  I "C4'" 1 
ATOM   8180  O  "O4'" . DT  I  5 103 ? 9.503   -25.164 15.051 1.00 154.37 ? 30   DT  I "O4'" 1 
ATOM   8181  C  "C3'" . DT  I  5 103 ? 9.466   -24.045 12.972 1.00 155.01 ? 30   DT  I "C3'" 1 
ATOM   8182  O  "O3'" . DT  I  5 103 ? 10.245  -24.238 11.779 1.00 156.58 ? 30   DT  I "O3'" 1 
ATOM   8183  C  "C2'" . DT  I  5 103 ? 8.308   -25.047 13.078 1.00 154.86 ? 30   DT  I "C2'" 1 
ATOM   8184  C  "C1'" . DT  I  5 103 ? 8.797   -26.003 14.160 1.00 154.52 ? 30   DT  I "C1'" 1 
ATOM   8185  N  N1    . DT  I  5 103 ? 7.717   -26.833 14.850 1.00 154.68 ? 30   DT  I N1    1 
ATOM   8186  C  C2    . DT  I  5 103 ? 7.555   -28.161 14.466 1.00 154.44 ? 30   DT  I C2    1 
ATOM   8187  O  O2    . DT  I  5 103 ? 8.228   -28.699 13.605 1.00 154.42 ? 30   DT  I O2    1 
ATOM   8188  N  N3    . DT  I  5 103 ? 6.563   -28.856 15.125 1.00 154.28 ? 30   DT  I N3    1 
ATOM   8189  C  C4    . DT  I  5 103 ? 5.727   -28.368 16.118 1.00 154.47 ? 30   DT  I C4    1 
ATOM   8190  O  O4    . DT  I  5 103 ? 4.874   -29.078 16.643 1.00 154.44 ? 30   DT  I O4    1 
ATOM   8191  C  C5    . DT  I  5 103 ? 5.935   -26.977 16.485 1.00 154.61 ? 30   DT  I C5    1 
ATOM   8192  C  C7    . DT  I  5 103 ? 5.082   -26.337 17.549 1.00 154.37 ? 30   DT  I C7    1 
ATOM   8193  C  C6    . DT  I  5 103 ? 6.904   -26.287 15.841 1.00 154.77 ? 30   DT  I C6    1 
ATOM   8194  P  P     . DT  I  5 104 ? 9.676   -23.875 10.314 1.00 157.71 ? 31   DT  I P     1 
ATOM   8195  O  OP1   . DT  I  5 104 ? 10.829  -23.548 9.443  1.00 157.86 ? 31   DT  I OP1   1 
ATOM   8196  O  OP2   . DT  I  5 104 ? 8.564   -22.901 10.440 1.00 157.63 ? 31   DT  I OP2   1 
ATOM   8197  O  "O5'" . DT  I  5 104 ? 9.065   -25.271 9.838  1.00 158.14 ? 31   DT  I "O5'" 1 
ATOM   8198  C  "C5'" . DT  I  5 104 ? 9.940   -26.309 9.389  1.00 159.11 ? 31   DT  I "C5'" 1 
ATOM   8199  C  "C4'" . DT  I  5 104 ? 9.121   -27.477 8.868  1.00 159.86 ? 31   DT  I "C4'" 1 
ATOM   8200  O  "O4'" . DT  I  5 104 ? 8.265   -27.981 9.933  1.00 160.09 ? 31   DT  I "O4'" 1 
ATOM   8201  C  "C3'" . DT  I  5 104 ? 8.199   -27.145 7.695  1.00 160.23 ? 31   DT  I "C3'" 1 
ATOM   8202  O  "O3'" . DT  I  5 104 ? 8.274   -28.204 6.739  1.00 160.67 ? 31   DT  I "O3'" 1 
ATOM   8203  C  "C2'" . DT  I  5 104 ? 6.822   -27.063 8.357  1.00 160.32 ? 31   DT  I "C2'" 1 
ATOM   8204  C  "C1'" . DT  I  5 104 ? 6.960   -28.160 9.413  1.00 160.34 ? 31   DT  I "C1'" 1 
ATOM   8205  N  N1    . DT  I  5 104 ? 5.943   -28.163 10.534 1.00 160.35 ? 31   DT  I N1    1 
ATOM   8206  C  C2    . DT  I  5 104 ? 5.431   -29.369 11.000 1.00 160.19 ? 31   DT  I C2    1 
ATOM   8207  O  O2    . DT  I  5 104 ? 5.739   -30.465 10.565 1.00 160.15 ? 31   DT  I O2    1 
ATOM   8208  N  N3    . DT  I  5 104 ? 4.521   -29.251 12.022 1.00 160.21 ? 31   DT  I N3    1 
ATOM   8209  C  C4    . DT  I  5 104 ? 4.076   -28.083 12.616 1.00 160.26 ? 31   DT  I C4    1 
ATOM   8210  O  O4    . DT  I  5 104 ? 3.255   -28.104 13.528 1.00 160.38 ? 31   DT  I O4    1 
ATOM   8211  C  C5    . DT  I  5 104 ? 4.645   -26.859 12.088 1.00 160.21 ? 31   DT  I C5    1 
ATOM   8212  C  C7    . DT  I  5 104 ? 4.253   -25.518 12.640 1.00 160.16 ? 31   DT  I C7    1 
ATOM   8213  C  C6    . DT  I  5 104 ? 5.538   -26.959 11.091 1.00 160.28 ? 31   DT  I C6    1 
ATOM   8214  P  P     . DT  I  5 105 ? 7.662   -28.043 5.267  1.00 161.00 ? 32   DT  I P     1 
ATOM   8215  O  OP1   . DT  I  5 105 ? 8.411   -26.940 4.620  1.00 161.27 ? 32   DT  I OP1   1 
ATOM   8216  O  OP2   . DT  I  5 105 ? 6.186   -27.960 5.370  1.00 160.73 ? 32   DT  I OP2   1 
ATOM   8217  O  "O5'" . DT  I  5 105 ? 8.017   -29.431 4.535  1.00 160.75 ? 32   DT  I "O5'" 1 
ATOM   8218  C  "C5'" . DT  I  5 105 ? 8.166   -30.662 5.256  1.00 160.88 ? 32   DT  I "C5'" 1 
ATOM   8219  C  "C4'" . DT  I  5 105 ? 6.835   -31.320 5.599  1.00 160.86 ? 32   DT  I "C4'" 1 
ATOM   8220  O  "O4'" . DT  I  5 105 ? 6.191   -30.663 6.725  1.00 161.59 ? 32   DT  I "O4'" 1 
ATOM   8221  C  "C3'" . DT  I  5 105 ? 5.780   -31.351 4.490  1.00 160.39 ? 32   DT  I "C3'" 1 
ATOM   8222  O  "O3'" . DT  I  5 105 ? 5.698   -32.682 3.975  1.00 158.60 ? 32   DT  I "O3'" 1 
ATOM   8223  C  "C2'" . DT  I  5 105 ? 4.484   -30.904 5.184  1.00 161.31 ? 32   DT  I "C2'" 1 
ATOM   8224  C  "C1'" . DT  I  5 105 ? 4.832   -31.057 6.664  1.00 162.27 ? 32   DT  I "C1'" 1 
ATOM   8225  N  N1    . DT  I  5 105 ? 3.946   -30.290 7.642  1.00 162.68 ? 32   DT  I N1    1 
ATOM   8226  C  C2    . DT  I  5 105 ? 3.202   -30.997 8.583  1.00 162.93 ? 32   DT  I C2    1 
ATOM   8227  O  O2    . DT  I  5 105 ? 3.210   -32.215 8.689  1.00 162.97 ? 32   DT  I O2    1 
ATOM   8228  N  N3    . DT  I  5 105 ? 2.431   -30.215 9.418  1.00 163.09 ? 32   DT  I N3    1 
ATOM   8229  C  C4    . DT  I  5 105 ? 2.322   -28.831 9.415  1.00 162.86 ? 32   DT  I C4    1 
ATOM   8230  O  O4    . DT  I  5 105 ? 1.595   -28.238 10.212 1.00 162.84 ? 32   DT  I O4    1 
ATOM   8231  C  C5    . DT  I  5 105 ? 3.118   -28.151 8.412  1.00 162.90 ? 32   DT  I C5    1 
ATOM   8232  C  C7    . DT  I  5 105 ? 3.092   -26.650 8.296  1.00 162.77 ? 32   DT  I C7    1 
ATOM   8233  C  C6    . DT  I  5 105 ? 3.875   -28.903 7.589  1.00 162.76 ? 32   DT  I C6    1 
ATOM   8234  P  P     . DC  I  5 106 ? 4.591   -33.148 2.909  1.00 157.18 ? 33   DC  I P     1 
ATOM   8235  O  OP1   . DC  I  5 106 ? 5.106   -34.404 2.311  1.00 156.66 ? 33   DC  I OP1   1 
ATOM   8236  O  OP2   . DC  I  5 106 ? 4.254   -31.991 2.045  1.00 156.87 ? 33   DC  I OP2   1 
ATOM   8237  O  "O5'" . DC  I  5 106 ? 3.293   -33.471 3.800  1.00 155.72 ? 33   DC  I "O5'" 1 
ATOM   8238  C  "C5'" . DC  I  5 106 ? 2.803   -34.814 3.953  1.00 153.18 ? 33   DC  I "C5'" 1 
ATOM   8239  C  "C4'" . DC  I  5 106 ? 1.337   -34.837 4.366  1.00 151.03 ? 33   DC  I "C4'" 1 
ATOM   8240  O  "O4'" . DC  I  5 106 ? 1.080   -33.777 5.330  1.00 150.66 ? 33   DC  I "O4'" 1 
ATOM   8241  C  "C3'" . DC  I  5 106 ? 0.315   -34.654 3.239  1.00 149.34 ? 33   DC  I "C3'" 1 
ATOM   8242  O  "O3'" . DC  I  5 106 ? -0.790  -35.559 3.383  1.00 146.64 ? 33   DC  I "O3'" 1 
ATOM   8243  C  "C2'" . DC  I  5 106 ? -0.134  -33.207 3.425  1.00 149.67 ? 33   DC  I "C2'" 1 
ATOM   8244  C  "C1'" . DC  I  5 106 ? -0.118  -33.125 4.952  1.00 150.03 ? 33   DC  I "C1'" 1 
ATOM   8245  N  N1    . DC  I  5 106 ? -0.142  -31.742 5.536  1.00 149.94 ? 33   DC  I N1    1 
ATOM   8246  C  C2    . DC  I  5 106 ? -1.054  -31.433 6.565  1.00 149.76 ? 33   DC  I C2    1 
ATOM   8247  O  O2    . DC  I  5 106 ? -1.836  -32.298 6.983  1.00 149.68 ? 33   DC  I O2    1 
ATOM   8248  N  N3    . DC  I  5 106 ? -1.058  -30.175 7.080  1.00 149.70 ? 33   DC  I N3    1 
ATOM   8249  C  C4    . DC  I  5 106 ? -0.204  -29.253 6.613  1.00 149.80 ? 33   DC  I C4    1 
ATOM   8250  N  N4    . DC  I  5 106 ? -0.243  -28.031 7.151  1.00 149.58 ? 33   DC  I N4    1 
ATOM   8251  C  C5    . DC  I  5 106 ? 0.731   -29.546 5.571  1.00 149.94 ? 33   DC  I C5    1 
ATOM   8252  C  C6    . DC  I  5 106 ? 0.728   -30.789 5.069  1.00 150.09 ? 33   DC  I C6    1 
ATOM   8253  P  P     . DC  I  5 107 ? -1.314  -36.377 2.107  1.00 144.36 ? 34   DC  I P     1 
ATOM   8254  O  OP1   . DC  I  5 107 ? -0.205  -37.261 1.671  1.00 144.08 ? 34   DC  I OP1   1 
ATOM   8255  O  OP2   . DC  I  5 107 ? -1.916  -35.403 1.166  1.00 143.84 ? 34   DC  I OP2   1 
ATOM   8256  O  "O5'" . DC  I  5 107 ? -2.510  -37.307 2.624  1.00 143.19 ? 34   DC  I "O5'" 1 
ATOM   8257  C  "C5'" . DC  I  5 107 ? -2.577  -37.816 3.956  1.00 141.07 ? 34   DC  I "C5'" 1 
ATOM   8258  C  "C4'" . DC  I  5 107 ? -3.807  -37.276 4.671  1.00 139.42 ? 34   DC  I "C4'" 1 
ATOM   8259  O  "O4'" . DC  I  5 107 ? -3.569  -35.897 5.047  1.00 139.53 ? 34   DC  I "O4'" 1 
ATOM   8260  C  "C3'" . DC  I  5 107 ? -5.115  -37.268 3.869  1.00 138.25 ? 34   DC  I "C3'" 1 
ATOM   8261  O  "O3'" . DC  I  5 107 ? -6.176  -37.764 4.671  1.00 136.67 ? 34   DC  I "O3'" 1 
ATOM   8262  C  "C2'" . DC  I  5 107 ? -5.347  -35.792 3.557  1.00 138.52 ? 34   DC  I "C2'" 1 
ATOM   8263  C  "C1'" . DC  I  5 107 ? -4.780  -35.199 4.839  1.00 139.32 ? 34   DC  I "C1'" 1 
ATOM   8264  N  N1    . DC  I  5 107 ? -4.518  -33.731 4.833  1.00 139.39 ? 34   DC  I N1    1 
ATOM   8265  C  C2    . DC  I  5 107 ? -5.159  -32.925 5.790  1.00 139.58 ? 34   DC  I C2    1 
ATOM   8266  O  O2    . DC  I  5 107 ? -5.930  -33.438 6.612  1.00 139.49 ? 34   DC  I O2    1 
ATOM   8267  N  N3    . DC  I  5 107 ? -4.919  -31.587 5.788  1.00 139.82 ? 34   DC  I N3    1 
ATOM   8268  C  C4    . DC  I  5 107 ? -4.080  -31.060 4.890  1.00 139.66 ? 34   DC  I C4    1 
ATOM   8269  N  N4    . DC  I  5 107 ? -3.878  -29.743 4.933  1.00 139.43 ? 34   DC  I N4    1 
ATOM   8270  C  C5    . DC  I  5 107 ? -3.414  -31.863 3.910  1.00 139.59 ? 34   DC  I C5    1 
ATOM   8271  C  C6    . DC  I  5 107 ? -3.660  -33.181 3.920  1.00 139.44 ? 34   DC  I C6    1 
ATOM   8272  P  P     . DA  I  5 108 ? -6.552  -39.320 4.673  1.00 135.54 ? 35   DA  I P     1 
ATOM   8273  O  OP1   . DA  I  5 108 ? -5.329  -40.082 5.038  1.00 135.13 ? 35   DA  I OP1   1 
ATOM   8274  O  OP2   . DA  I  5 108 ? -7.262  -39.588 3.401  1.00 135.31 ? 35   DA  I OP2   1 
ATOM   8275  O  "O5'" . DA  I  5 108 ? -7.635  -39.457 5.857  1.00 133.66 ? 35   DA  I "O5'" 1 
ATOM   8276  C  "C5'" . DA  I  5 108 ? -7.232  -39.414 7.236  1.00 130.31 ? 35   DA  I "C5'" 1 
ATOM   8277  C  "C4'" . DA  I  5 108 ? -8.110  -38.500 8.084  1.00 127.61 ? 35   DA  I "C4'" 1 
ATOM   8278  O  "O4'" . DA  I  5 108 ? -8.022  -37.113 7.668  1.00 127.06 ? 35   DA  I "O4'" 1 
ATOM   8279  C  "C3'" . DA  I  5 108 ? -9.601  -38.784 8.082  1.00 126.27 ? 35   DA  I "C3'" 1 
ATOM   8280  O  "O3'" . DA  I  5 108 ? -10.048 -38.434 9.378  1.00 124.45 ? 35   DA  I "O3'" 1 
ATOM   8281  C  "C2'" . DA  I  5 108 ? -10.142 -37.833 7.015  1.00 126.15 ? 35   DA  I "C2'" 1 
ATOM   8282  C  "C1'" . DA  I  5 108 ? -9.300  -36.608 7.335  1.00 126.78 ? 35   DA  I "C1'" 1 
ATOM   8283  N  N9    . DA  I  5 108 ? -9.082  -35.682 6.238  1.00 127.03 ? 35   DA  I N9    1 
ATOM   8284  C  C8    . DA  I  5 108 ? -8.916  -35.990 4.916  1.00 127.41 ? 35   DA  I C8    1 
ATOM   8285  N  N7    . DA  I  5 108 ? -8.713  -34.945 4.150  1.00 127.48 ? 35   DA  I N7    1 
ATOM   8286  C  C5    . DA  I  5 108 ? -8.741  -33.875 5.029  1.00 127.16 ? 35   DA  I C5    1 
ATOM   8287  C  C6    . DA  I  5 108 ? -8.587  -32.481 4.847  1.00 127.12 ? 35   DA  I C6    1 
ATOM   8288  N  N6    . DA  I  5 108 ? -8.371  -31.910 3.657  1.00 127.10 ? 35   DA  I N6    1 
ATOM   8289  N  N1    . DA  I  5 108 ? -8.669  -31.688 5.938  1.00 127.06 ? 35   DA  I N1    1 
ATOM   8290  C  C2    . DA  I  5 108 ? -8.880  -32.253 7.132  1.00 127.08 ? 35   DA  I C2    1 
ATOM   8291  N  N3    . DA  I  5 108 ? -9.043  -33.545 7.426  1.00 127.37 ? 35   DA  I N3    1 
ATOM   8292  C  C4    . DA  I  5 108 ? -8.962  -34.313 6.323  1.00 127.13 ? 35   DA  I C4    1 
ATOM   8293  P  P     . DA  I  5 109 ? -11.536 -38.747 9.882  1.00 122.52 ? 36   DA  I P     1 
ATOM   8294  O  OP1   . DA  I  5 109 ? -11.388 -39.570 11.109 1.00 122.13 ? 36   DA  I OP1   1 
ATOM   8295  O  OP2   . DA  I  5 109 ? -12.359 -39.230 8.743  1.00 121.88 ? 36   DA  I OP2   1 
ATOM   8296  O  "O5'" . DA  I  5 109 ? -12.086 -37.293 10.266 1.00 121.10 ? 36   DA  I "O5'" 1 
ATOM   8297  C  "C5'" . DA  I  5 109 ? -11.258 -36.314 10.918 1.00 118.96 ? 36   DA  I "C5'" 1 
ATOM   8298  C  "C4'" . DA  I  5 109 ? -11.917 -34.946 10.854 1.00 117.21 ? 36   DA  I "C4'" 1 
ATOM   8299  O  "O4'" . DA  I  5 109 ? -11.454 -34.278 9.652  1.00 116.81 ? 36   DA  I "O4'" 1 
ATOM   8300  C  "C3'" . DA  I  5 109 ? -13.452 -34.953 10.804 1.00 116.20 ? 36   DA  I "C3'" 1 
ATOM   8301  O  "O3'" . DA  I  5 109 ? -14.019 -33.971 11.677 1.00 114.56 ? 36   DA  I "O3'" 1 
ATOM   8302  C  "C2'" . DA  I  5 109 ? -13.745 -34.648 9.341  1.00 116.82 ? 36   DA  I "C2'" 1 
ATOM   8303  C  "C1'" . DA  I  5 109 ? -12.585 -33.718 9.019  1.00 117.45 ? 36   DA  I "C1'" 1 
ATOM   8304  N  N9    . DA  I  5 109 ? -12.375 -33.565 7.587  1.00 117.68 ? 36   DA  I N9    1 
ATOM   8305  C  C8    . DA  I  5 109 ? -12.482 -34.535 6.630  1.00 117.53 ? 36   DA  I C8    1 
ATOM   8306  N  N7    . DA  I  5 109 ? -12.247 -34.095 5.420  1.00 117.94 ? 36   DA  I N7    1 
ATOM   8307  C  C5    . DA  I  5 109 ? -11.972 -32.745 5.592  1.00 118.04 ? 36   DA  I C5    1 
ATOM   8308  C  C6    . DA  I  5 109 ? -11.639 -31.699 4.699  1.00 117.72 ? 36   DA  I C6    1 
ATOM   8309  N  N6    . DA  I  5 109 ? -11.525 -31.865 3.379  1.00 117.82 ? 36   DA  I N6    1 
ATOM   8310  N  N1    . DA  I  5 109 ? -11.426 -30.465 5.204  1.00 117.61 ? 36   DA  I N1    1 
ATOM   8311  C  C2    . DA  I  5 109 ? -11.537 -30.279 6.522  1.00 117.64 ? 36   DA  I C2    1 
ATOM   8312  N  N3    . DA  I  5 109 ? -11.843 -31.181 7.457  1.00 118.02 ? 36   DA  I N3    1 
ATOM   8313  C  C4    . DA  I  5 109 ? -12.051 -32.402 6.927  1.00 117.99 ? 36   DA  I C4    1 
ATOM   8314  P  P     . DA  I  5 110 ? -15.602 -33.771 11.929 1.00 113.76 ? 37   DA  I P     1 
ATOM   8315  O  OP1   . DA  I  5 110 ? -15.954 -34.441 13.201 1.00 113.35 ? 37   DA  I OP1   1 
ATOM   8316  O  OP2   . DA  I  5 110 ? -16.408 -34.123 10.735 1.00 112.77 ? 37   DA  I OP2   1 
ATOM   8317  O  "O5'" . DA  I  5 110 ? -15.657 -32.177 12.124 1.00 113.44 ? 37   DA  I "O5'" 1 
ATOM   8318  C  "C5'" . DA  I  5 110 ? -14.459 -31.385 12.185 1.00 113.52 ? 37   DA  I "C5'" 1 
ATOM   8319  C  "C4'" . DA  I  5 110 ? -14.665 -29.955 11.688 1.00 114.06 ? 37   DA  I "C4'" 1 
ATOM   8320  O  "O4'" . DA  I  5 110 ? -14.169 -29.805 10.327 1.00 115.29 ? 37   DA  I "O4'" 1 
ATOM   8321  C  "C3'" . DA  I  5 110 ? -16.104 -29.460 11.646 1.00 113.67 ? 37   DA  I "C3'" 1 
ATOM   8322  O  "O3'" . DA  I  5 110 ? -16.153 -28.070 11.913 1.00 113.01 ? 37   DA  I "O3'" 1 
ATOM   8323  C  "C2'" . DA  I  5 110 ? -16.514 -29.738 10.207 1.00 114.47 ? 37   DA  I "C2'" 1 
ATOM   8324  C  "C1'" . DA  I  5 110 ? -15.224 -29.469 9.442  1.00 116.24 ? 37   DA  I "C1'" 1 
ATOM   8325  N  N9    . DA  I  5 110 ? -15.133 -30.271 8.221  1.00 116.51 ? 37   DA  I N9    1 
ATOM   8326  C  C8    . DA  I  5 110 ? -15.361 -31.617 8.099  1.00 116.93 ? 37   DA  I C8    1 
ATOM   8327  N  N7    . DA  I  5 110 ? -15.218 -32.081 6.882  1.00 117.18 ? 37   DA  I N7    1 
ATOM   8328  C  C5    . DA  I  5 110 ? -14.873 -30.960 6.148  1.00 117.23 ? 37   DA  I C5    1 
ATOM   8329  C  C6    . DA  I  5 110 ? -14.578 -30.771 4.776  1.00 117.19 ? 37   DA  I C6    1 
ATOM   8330  N  N6    . DA  I  5 110 ? -14.593 -31.766 3.885  1.00 116.95 ? 37   DA  I N6    1 
ATOM   8331  N  N1    . DA  I  5 110 ? -14.261 -29.520 4.355  1.00 117.08 ? 37   DA  I N1    1 
ATOM   8332  C  C2    . DA  I  5 110 ? -14.250 -28.525 5.255  1.00 117.29 ? 37   DA  I C2    1 
ATOM   8333  N  N3    . DA  I  5 110 ? -14.509 -28.583 6.570  1.00 117.57 ? 37   DA  I N3    1 
ATOM   8334  C  C4    . DA  I  5 110 ? -14.818 -29.836 6.958  1.00 116.94 ? 37   DA  I C4    1 
ATOM   8335  P  P     . DT  I  5 111 ? -17.576 -27.377 12.141 1.00 111.93 ? 38   DT  I P     1 
ATOM   8336  O  OP1   . DT  I  5 111 ? -17.678 -27.047 13.571 1.00 112.11 ? 38   DT  I OP1   1 
ATOM   8337  O  OP2   . DT  I  5 111 ? -18.597 -28.238 11.521 1.00 110.88 ? 38   DT  I OP2   1 
ATOM   8338  O  "O5'" . DT  I  5 111 ? -17.529 -26.004 11.322 1.00 113.82 ? 38   DT  I "O5'" 1 
ATOM   8339  C  "C5'" . DT  I  5 111 ? -16.298 -25.338 11.007 1.00 116.49 ? 38   DT  I "C5'" 1 
ATOM   8340  C  "C4'" . DT  I  5 111 ? -16.403 -24.590 9.681  1.00 118.64 ? 38   DT  I "C4'" 1 
ATOM   8341  O  "O4'" . DT  I  5 111 ? -16.191 -25.484 8.549  1.00 119.15 ? 38   DT  I "O4'" 1 
ATOM   8342  C  "C3'" . DT  I  5 111 ? -17.726 -23.871 9.415  1.00 119.63 ? 38   DT  I "C3'" 1 
ATOM   8343  O  "O3'" . DT  I  5 111 ? -17.408 -22.572 8.925  1.00 122.09 ? 38   DT  I "O3'" 1 
ATOM   8344  C  "C2'" . DT  I  5 111 ? -18.425 -24.761 8.383  1.00 119.18 ? 38   DT  I "C2'" 1 
ATOM   8345  C  "C1'" . DT  I  5 111 ? -17.226 -25.290 7.595  1.00 119.15 ? 38   DT  I "C1'" 1 
ATOM   8346  N  N1    . DT  I  5 111 ? -17.434 -26.568 6.810  1.00 118.98 ? 38   DT  I N1    1 
ATOM   8347  C  C2    . DT  I  5 111 ? -17.194 -26.568 5.441  1.00 119.11 ? 38   DT  I C2    1 
ATOM   8348  O  O2    . DT  I  5 111 ? -16.829 -25.595 4.800  1.00 118.99 ? 38   DT  I O2    1 
ATOM   8349  N  N3    . DT  I  5 111 ? -17.404 -27.775 4.819  1.00 119.10 ? 38   DT  I N3    1 
ATOM   8350  C  C4    . DT  I  5 111 ? -17.813 -28.958 5.407  1.00 118.93 ? 38   DT  I C4    1 
ATOM   8351  O  O4    . DT  I  5 111 ? -17.967 -29.983 4.750  1.00 118.75 ? 38   DT  I O4    1 
ATOM   8352  C  C5    . DT  I  5 111 ? -18.044 -28.895 6.835  1.00 118.98 ? 38   DT  I C5    1 
ATOM   8353  C  C7    . DT  I  5 111 ? -18.499 -30.120 7.576  1.00 119.16 ? 38   DT  I C7    1 
ATOM   8354  C  C6    . DT  I  5 111 ? -17.846 -27.722 7.459  1.00 118.68 ? 38   DT  I C6    1 
ATOM   8355  P  P     . DA  I  5 112 ? -18.513 -21.451 8.631  1.00 124.33 ? 39   DA  I P     1 
ATOM   8356  O  OP1   . DA  I  5 112 ? -17.815 -20.148 8.611  1.00 123.90 ? 39   DA  I OP1   1 
ATOM   8357  O  OP2   . DA  I  5 112 ? -19.705 -21.660 9.493  1.00 122.91 ? 39   DA  I OP2   1 
ATOM   8358  O  "O5'" . DA  I  5 112 ? -18.911 -21.820 7.127  1.00 127.52 ? 39   DA  I "O5'" 1 
ATOM   8359  C  "C5'" . DA  I  5 112 ? -18.080 -21.460 6.015  1.00 131.26 ? 39   DA  I "C5'" 1 
ATOM   8360  C  "C4'" . DA  I  5 112 ? -18.829 -21.688 4.708  1.00 134.16 ? 39   DA  I "C4'" 1 
ATOM   8361  O  "O4'" . DA  I  5 112 ? -18.819 -23.104 4.401  1.00 134.94 ? 39   DA  I "O4'" 1 
ATOM   8362  C  "C3'" . DA  I  5 112 ? -20.306 -21.274 4.691  1.00 135.77 ? 39   DA  I "C3'" 1 
ATOM   8363  O  "O3'" . DA  I  5 112 ? -20.589 -20.529 3.505  1.00 138.44 ? 39   DA  I "O3'" 1 
ATOM   8364  C  "C2'" . DA  I  5 112 ? -21.065 -22.599 4.711  1.00 135.61 ? 39   DA  I "C2'" 1 
ATOM   8365  C  "C1'" . DA  I  5 112 ? -20.095 -23.436 3.886  1.00 136.34 ? 39   DA  I "C1'" 1 
ATOM   8366  N  N9    . DA  I  5 112 ? -20.269 -24.884 3.956  1.00 136.57 ? 39   DA  I N9    1 
ATOM   8367  C  C8    . DA  I  5 112 ? -20.458 -25.644 5.077  1.00 136.93 ? 39   DA  I C8    1 
ATOM   8368  N  N7    . DA  I  5 112 ? -20.577 -26.927 4.835  1.00 136.93 ? 39   DA  I N7    1 
ATOM   8369  C  C5    . DA  I  5 112 ? -20.451 -27.018 3.460  1.00 136.97 ? 39   DA  I C5    1 
ATOM   8370  C  C6    . DA  I  5 112 ? -20.485 -28.118 2.570  1.00 137.04 ? 39   DA  I C6    1 
ATOM   8371  N  N6    . DA  I  5 112 ? -20.664 -29.378 2.980  1.00 136.79 ? 39   DA  I N6    1 
ATOM   8372  N  N1    . DA  I  5 112 ? -20.329 -27.871 1.246  1.00 136.98 ? 39   DA  I N1    1 
ATOM   8373  C  C2    . DA  I  5 112 ? -20.153 -26.600 0.845  1.00 136.96 ? 39   DA  I C2    1 
ATOM   8374  N  N3    . DA  I  5 112 ? -20.101 -25.487 1.587  1.00 136.72 ? 39   DA  I N3    1 
ATOM   8375  C  C4    . DA  I  5 112 ? -20.259 -25.765 2.898  1.00 136.69 ? 39   DA  I C4    1 
ATOM   8376  P  P     . DC  I  5 113 ? -21.406 -19.148 3.571  1.00 140.42 ? 40   DC  I P     1 
ATOM   8377  O  OP1   . DC  I  5 113 ? -20.796 -18.223 2.585  1.00 140.34 ? 40   DC  I OP1   1 
ATOM   8378  O  OP2   . DC  I  5 113 ? -21.503 -18.733 4.990  1.00 140.47 ? 40   DC  I OP2   1 
ATOM   8379  O  "O5'" . DC  I  5 113 ? -22.881 -19.566 3.097  1.00 141.43 ? 40   DC  I "O5'" 1 
ATOM   8380  C  "C5'" . DC  I  5 113 ? -23.265 -19.429 1.739  1.00 143.24 ? 40   DC  I "C5'" 1 
ATOM   8381  C  "C4'" . DC  I  5 113 ? -23.134 -20.732 0.973  1.00 144.77 ? 40   DC  I "C4'" 1 
ATOM   8382  O  "O4'" . DC  I  5 113 ? -22.985 -21.869 1.850  1.00 145.22 ? 40   DC  I "O4'" 1 
ATOM   8383  C  "C3'" . DC  I  5 113 ? -24.375 -21.074 0.173  1.00 145.78 ? 40   DC  I "C3'" 1 
ATOM   8384  O  "O3'" . DC  I  5 113 ? -24.257 -20.475 -1.099 1.00 147.34 ? 40   DC  I "O3'" 1 
ATOM   8385  C  "C2'" . DC  I  5 113 ? -24.348 -22.593 0.069  1.00 145.44 ? 40   DC  I "C2'" 1 
ATOM   8386  C  "C1'" . DC  I  5 113 ? -23.285 -23.013 1.076  1.00 145.42 ? 40   DC  I "C1'" 1 
ATOM   8387  N  N1    . DC  I  5 113 ? -23.732 -24.159 1.939  1.00 145.47 ? 40   DC  I N1    1 
ATOM   8388  C  C2    . DC  I  5 113 ? -23.584 -25.480 1.465  1.00 145.60 ? 40   DC  I C2    1 
ATOM   8389  O  O2    . DC  I  5 113 ? -23.088 -25.693 0.352  1.00 145.76 ? 40   DC  I O2    1 
ATOM   8390  N  N3    . DC  I  5 113 ? -23.989 -26.514 2.242  1.00 145.42 ? 40   DC  I N3    1 
ATOM   8391  C  C4    . DC  I  5 113 ? -24.522 -26.272 3.438  1.00 145.31 ? 40   DC  I C4    1 
ATOM   8392  N  N4    . DC  I  5 113 ? -24.899 -27.332 4.156  1.00 145.41 ? 40   DC  I N4    1 
ATOM   8393  C  C5    . DC  I  5 113 ? -24.685 -24.942 3.942  1.00 145.36 ? 40   DC  I C5    1 
ATOM   8394  C  C6    . DC  I  5 113 ? -24.285 -23.924 3.169  1.00 145.06 ? 40   DC  I C6    1 
ATOM   8395  P  P     . DA  I  5 114 ? -25.539 -19.843 -1.816 1.00 148.44 ? 41   DA  I P     1 
ATOM   8396  O  OP1   . DA  I  5 114 ? -25.027 -19.121 -3.001 1.00 148.38 ? 41   DA  I OP1   1 
ATOM   8397  O  OP2   . DA  I  5 114 ? -26.373 -19.131 -0.818 1.00 147.71 ? 41   DA  I OP2   1 
ATOM   8398  O  "O5'" . DA  I  5 114 ? -26.351 -21.136 -2.290 1.00 149.65 ? 41   DA  I "O5'" 1 
ATOM   8399  C  "C5'" . DA  I  5 114 ? -25.745 -22.121 -3.135 1.00 151.76 ? 41   DA  I "C5'" 1 
ATOM   8400  C  "C4'" . DA  I  5 114 ? -26.514 -23.432 -3.072 1.00 153.27 ? 41   DA  I "C4'" 1 
ATOM   8401  O  "O4'" . DA  I  5 114 ? -26.231 -24.127 -1.824 1.00 153.50 ? 41   DA  I "O4'" 1 
ATOM   8402  C  "C3'" . DA  I  5 114 ? -28.036 -23.268 -3.145 1.00 154.18 ? 41   DA  I "C3'" 1 
ATOM   8403  O  "O3'" . DA  I  5 114 ? -28.608 -24.128 -4.136 1.00 155.27 ? 41   DA  I "O3'" 1 
ATOM   8404  C  "C2'" . DA  I  5 114 ? -28.491 -23.655 -1.743 1.00 154.07 ? 41   DA  I "C2'" 1 
ATOM   8405  C  "C1'" . DA  I  5 114 ? -27.447 -24.712 -1.416 1.00 154.03 ? 41   DA  I "C1'" 1 
ATOM   8406  N  N9    . DA  I  5 114 ? -27.485 -25.072 -0.003 1.00 154.06 ? 41   DA  I N9    1 
ATOM   8407  C  C8    . DA  I  5 114 ? -27.427 -24.235 1.078  1.00 154.05 ? 41   DA  I C8    1 
ATOM   8408  N  N7    . DA  I  5 114 ? -27.516 -24.856 2.228  1.00 153.94 ? 41   DA  I N7    1 
ATOM   8409  C  C5    . DA  I  5 114 ? -27.651 -26.188 1.873  1.00 154.19 ? 41   DA  I C5    1 
ATOM   8410  C  C6    . DA  I  5 114 ? -27.792 -27.372 2.629  1.00 154.23 ? 41   DA  I C6    1 
ATOM   8411  N  N6    . DA  I  5 114 ? -27.818 -27.376 3.964  1.00 154.06 ? 41   DA  I N6    1 
ATOM   8412  N  N1    . DA  I  5 114 ? -27.905 -28.548 1.964  1.00 154.24 ? 41   DA  I N1    1 
ATOM   8413  C  C2    . DA  I  5 114 ? -27.882 -28.547 0.624  1.00 154.13 ? 41   DA  I C2    1 
ATOM   8414  N  N3    . DA  I  5 114 ? -27.752 -27.497 -0.192 1.00 154.22 ? 41   DA  I N3    1 
ATOM   8415  C  C4    . DA  I  5 114 ? -27.642 -26.342 0.499  1.00 154.16 ? 41   DA  I C4    1 
ATOM   8416  P  P     . DC  I  5 115 ? -30.109 -23.907 -4.674 1.00 155.97 ? 42   DC  I P     1 
ATOM   8417  O  OP1   . DC  I  5 115 ? -30.077 -22.755 -5.609 1.00 155.84 ? 42   DC  I OP1   1 
ATOM   8418  O  OP2   . DC  I  5 115 ? -31.054 -23.885 -3.525 1.00 155.33 ? 42   DC  I OP2   1 
ATOM   8419  O  "O5'" . DC  I  5 115 ? -30.386 -25.249 -5.521 1.00 155.58 ? 42   DC  I "O5'" 1 
ATOM   8420  C  "C5'" . DC  I  5 115 ? -29.865 -26.531 -5.128 1.00 154.42 ? 42   DC  I "C5'" 1 
ATOM   8421  C  "C4'" . DC  I  5 115 ? -30.775 -27.296 -4.170 1.00 153.54 ? 42   DC  I "C4'" 1 
ATOM   8422  O  "O4'" . DC  I  5 115 ? -30.390 -27.016 -2.797 1.00 153.52 ? 42   DC  I "O4'" 1 
ATOM   8423  C  "C3'" . DC  I  5 115 ? -32.286 -27.014 -4.237 1.00 152.60 ? 42   DC  I "C3'" 1 
ATOM   8424  O  "O3'" . DC  I  5 115 ? -32.973 -28.099 -4.930 1.00 150.74 ? 42   DC  I "O3'" 1 
ATOM   8425  C  "C2'" . DC  I  5 115 ? -32.696 -26.781 -2.772 1.00 152.94 ? 42   DC  I "C2'" 1 
ATOM   8426  C  "C1'" . DC  I  5 115 ? -31.509 -27.376 -2.015 1.00 153.32 ? 42   DC  I "C1'" 1 
ATOM   8427  N  N1    . DC  I  5 115 ? -31.347 -26.951 -0.573 1.00 153.37 ? 42   DC  I N1    1 
ATOM   8428  C  C2    . DC  I  5 115 ? -31.229 -27.935 0.435  1.00 153.33 ? 42   DC  I C2    1 
ATOM   8429  O  O2    . DC  I  5 115 ? -31.249 -29.142 0.145  1.00 153.17 ? 42   DC  I O2    1 
ATOM   8430  N  N3    . DC  I  5 115 ? -31.087 -27.532 1.726  1.00 153.22 ? 42   DC  I N3    1 
ATOM   8431  C  C4    . DC  I  5 115 ? -31.064 -26.228 2.026  1.00 153.17 ? 42   DC  I C4    1 
ATOM   8432  N  N4    . DC  I  5 115 ? -30.921 -25.893 3.309  1.00 153.16 ? 42   DC  I N4    1 
ATOM   8433  C  C5    . DC  I  5 115 ? -31.182 -25.213 1.026  1.00 153.15 ? 42   DC  I C5    1 
ATOM   8434  C  C6    . DC  I  5 115 ? -31.321 -25.616 -0.245 1.00 153.35 ? 42   DC  I C6    1 
ATOM   8435  P  P     . DT  I  5 116 ? -34.075 -29.102 -4.319 1.00 149.19 ? 43   DT  I P     1 
ATOM   8436  O  OP1   . DT  I  5 116 ? -34.487 -30.013 -5.413 1.00 148.94 ? 43   DT  I OP1   1 
ATOM   8437  O  OP2   . DT  I  5 116 ? -35.112 -28.316 -3.606 1.00 148.82 ? 43   DT  I OP2   1 
ATOM   8438  O  "O5'" . DT  I  5 116 ? -33.235 -29.935 -3.238 1.00 148.68 ? 43   DT  I "O5'" 1 
ATOM   8439  C  "C5'" . DT  I  5 116 ? -33.207 -31.364 -3.233 1.00 147.56 ? 43   DT  I "C5'" 1 
ATOM   8440  C  "C4'" . DT  I  5 116 ? -34.088 -31.914 -2.124 1.00 146.56 ? 43   DT  I "C4'" 1 
ATOM   8441  O  "O4'" . DT  I  5 116 ? -33.823 -31.210 -0.878 1.00 146.55 ? 43   DT  I "O4'" 1 
ATOM   8442  C  "C3'" . DT  I  5 116 ? -35.593 -31.802 -2.381 1.00 145.73 ? 43   DT  I "C3'" 1 
ATOM   8443  O  "O3'" . DT  I  5 116 ? -36.170 -33.105 -2.207 1.00 145.10 ? 43   DT  I "O3'" 1 
ATOM   8444  C  "C2'" . DT  I  5 116 ? -36.054 -30.751 -1.370 1.00 145.63 ? 43   DT  I "C2'" 1 
ATOM   8445  C  "C1'" . DT  I  5 116 ? -35.060 -30.983 -0.236 1.00 146.02 ? 43   DT  I "C1'" 1 
ATOM   8446  N  N1    . DT  I  5 116 ? -34.937 -29.856 0.747  1.00 145.94 ? 43   DT  I N1    1 
ATOM   8447  C  C2    . DT  I  5 116 ? -34.738 -30.136 2.089  1.00 145.80 ? 43   DT  I C2    1 
ATOM   8448  O  O2    . DT  I  5 116 ? -34.644 -31.260 2.552  1.00 145.64 ? 43   DT  I O2    1 
ATOM   8449  N  N3    . DT  I  5 116 ? -34.647 -29.027 2.894  1.00 145.79 ? 43   DT  I N3    1 
ATOM   8450  C  C4    . DT  I  5 116 ? -34.732 -27.702 2.504  1.00 145.81 ? 43   DT  I C4    1 
ATOM   8451  O  O4    . DT  I  5 116 ? -34.633 -26.787 3.310  1.00 145.86 ? 43   DT  I O4    1 
ATOM   8452  C  C5    . DT  I  5 116 ? -34.942 -27.478 1.094  1.00 145.82 ? 43   DT  I C5    1 
ATOM   8453  C  C7    . DT  I  5 116 ? -35.051 -26.086 0.542  1.00 145.84 ? 43   DT  I C7    1 
ATOM   8454  C  C6    . DT  I  5 116 ? -35.031 -28.550 0.296  1.00 145.97 ? 43   DT  I C6    1 
ATOM   8455  P  P     . DT  I  5 117 ? -37.636 -33.418 -1.625 1.00 144.81 ? 44   DT  I P     1 
ATOM   8456  O  OP1   . DT  I  5 117 ? -37.997 -34.782 -2.082 1.00 144.68 ? 44   DT  I OP1   1 
ATOM   8457  O  OP2   . DT  I  5 117 ? -38.549 -32.281 -1.896 1.00 144.99 ? 44   DT  I OP2   1 
ATOM   8458  O  "O5'" . DT  I  5 117 ? -37.398 -33.462 -0.046 1.00 143.93 ? 44   DT  I "O5'" 1 
ATOM   8459  C  "C5'" . DT  I  5 117 ? -36.660 -34.536 0.535  1.00 142.46 ? 44   DT  I "C5'" 1 
ATOM   8460  C  "C4'" . DT  I  5 117 ? -36.944 -34.635 2.025  1.00 140.80 ? 44   DT  I "C4'" 1 
ATOM   8461  O  "O4'" . DT  I  5 117 ? -36.714 -33.350 2.659  1.00 140.26 ? 44   DT  I "O4'" 1 
ATOM   8462  C  "C3'" . DT  I  5 117 ? -38.370 -35.036 2.390  1.00 139.85 ? 44   DT  I "C3'" 1 
ATOM   8463  O  "O3'" . DT  I  5 117 ? -38.284 -35.958 3.471  1.00 138.66 ? 44   DT  I "O3'" 1 
ATOM   8464  C  "C2'" . DT  I  5 117 ? -39.018 -33.704 2.775  1.00 139.63 ? 44   DT  I "C2'" 1 
ATOM   8465  C  "C1'" . DT  I  5 117 ? -37.844 -32.985 3.427  1.00 139.72 ? 44   DT  I "C1'" 1 
ATOM   8466  N  N1    . DT  I  5 117 ? -37.919 -31.485 3.482  1.00 139.60 ? 44   DT  I N1    1 
ATOM   8467  C  C2    . DT  I  5 117 ? -37.673 -30.842 4.685  1.00 139.36 ? 44   DT  I C2    1 
ATOM   8468  O  O2    . DT  I  5 117 ? -37.405 -31.412 5.727  1.00 139.24 ? 44   DT  I O2    1 
ATOM   8469  N  N3    . DT  I  5 117 ? -37.753 -29.474 4.633  1.00 139.22 ? 44   DT  I N3    1 
ATOM   8470  C  C4    . DT  I  5 117 ? -38.041 -28.699 3.526  1.00 139.49 ? 44   DT  I C4    1 
ATOM   8471  O  O4    . DT  I  5 117 ? -38.086 -27.477 3.596  1.00 139.64 ? 44   DT  I O4    1 
ATOM   8472  C  C5    . DT  I  5 117 ? -38.284 -29.425 2.300  1.00 139.51 ? 44   DT  I C5    1 
ATOM   8473  C  C7    . DT  I  5 117 ? -38.612 -28.691 1.031  1.00 139.49 ? 44   DT  I C7    1 
ATOM   8474  C  C6    . DT  I  5 117 ? -38.210 -30.765 2.334  1.00 139.53 ? 44   DT  I C6    1 
ATOM   8475  P  P     . DT  I  5 118 ? -39.553 -36.654 4.164  1.00 138.33 ? 45   DT  I P     1 
ATOM   8476  O  OP1   . DT  I  5 118 ? -39.242 -38.097 4.281  1.00 138.22 ? 45   DT  I OP1   1 
ATOM   8477  O  OP2   . DT  I  5 118 ? -40.814 -36.216 3.522  1.00 138.54 ? 45   DT  I OP2   1 
ATOM   8478  O  "O5'" . DT  I  5 118 ? -39.541 -36.009 5.625  1.00 137.45 ? 45   DT  I "O5'" 1 
ATOM   8479  C  "C5'" . DT  I  5 118 ? -38.441 -36.206 6.525  1.00 135.55 ? 45   DT  I "C5'" 1 
ATOM   8480  C  "C4'" . DT  I  5 118 ? -38.633 -35.331 7.748  1.00 133.88 ? 45   DT  I "C4'" 1 
ATOM   8481  O  "O4'" . DT  I  5 118 ? -38.304 -33.957 7.414  1.00 133.88 ? 45   DT  I "O4'" 1 
ATOM   8482  C  "C3'" . DT  I  5 118 ? -40.075 -35.258 8.237  1.00 132.45 ? 45   DT  I "C3'" 1 
ATOM   8483  O  "O3'" . DT  I  5 118 ? -40.510 -36.381 9.036  1.00 129.99 ? 45   DT  I "O3'" 1 
ATOM   8484  C  "C2'" . DT  I  5 118 ? -40.074 -33.937 8.983  1.00 133.21 ? 45   DT  I "C2'" 1 
ATOM   8485  C  "C1'" . DT  I  5 118 ? -39.131 -33.079 8.154  1.00 134.53 ? 45   DT  I "C1'" 1 
ATOM   8486  N  N1    . DT  I  5 118 ? -39.860 -32.102 7.263  1.00 135.06 ? 45   DT  I N1    1 
ATOM   8487  C  C2    . DT  I  5 118 ? -39.916 -30.775 7.652  1.00 135.37 ? 45   DT  I C2    1 
ATOM   8488  O  O2    . DT  I  5 118 ? -39.406 -30.359 8.675  1.00 135.58 ? 45   DT  I O2    1 
ATOM   8489  N  N3    . DT  I  5 118 ? -40.595 -29.938 6.799  1.00 135.38 ? 45   DT  I N3    1 
ATOM   8490  C  C4    . DT  I  5 118 ? -41.217 -30.292 5.611  1.00 135.41 ? 45   DT  I C4    1 
ATOM   8491  O  O4    . DT  I  5 118 ? -41.801 -29.469 4.914  1.00 135.27 ? 45   DT  I O4    1 
ATOM   8492  C  C5    . DT  I  5 118 ? -41.127 -31.694 5.255  1.00 135.70 ? 45   DT  I C5    1 
ATOM   8493  C  C7    . DT  I  5 118 ? -41.765 -32.201 3.992  1.00 135.58 ? 45   DT  I C7    1 
ATOM   8494  C  C6    . DT  I  5 118 ? -40.466 -32.520 6.085  1.00 135.57 ? 45   DT  I C6    1 
ATOM   8495  P  P     . DT  I  5 119 ? -39.744 -37.073 10.269 1.00 127.84 ? 46   DT  I P     1 
ATOM   8496  O  OP1   . DT  I  5 119 ? -38.370 -37.451 9.862  1.00 127.57 ? 46   DT  I OP1   1 
ATOM   8497  O  OP2   . DT  I  5 119 ? -40.650 -38.119 10.779 1.00 127.72 ? 46   DT  I OP2   1 
ATOM   8498  O  "O5'" . DT  I  5 119 ? -39.738 -35.948 11.405 1.00 127.75 ? 46   DT  I "O5'" 1 
ATOM   8499  C  "C5'" . DT  I  5 119 ? -38.570 -35.164 11.687 1.00 126.80 ? 46   DT  I "C5'" 1 
ATOM   8500  C  "C4'" . DT  I  5 119 ? -38.896 -34.054 12.667 1.00 125.35 ? 46   DT  I "C4'" 1 
ATOM   8501  O  "O4'" . DT  I  5 119 ? -39.452 -32.877 12.017 1.00 125.77 ? 46   DT  I "O4'" 1 
ATOM   8502  C  "C3'" . DT  I  5 119 ? -39.865 -34.464 13.759 1.00 124.54 ? 46   DT  I "C3'" 1 
ATOM   8503  O  "O3'" . DT  I  5 119 ? -39.148 -34.110 14.923 1.00 123.45 ? 46   DT  I "O3'" 1 
ATOM   8504  C  "C2'" . DT  I  5 119 ? -41.141 -33.652 13.473 1.00 125.67 ? 46   DT  I "C2'" 1 
ATOM   8505  C  "C1'" . DT  I  5 119 ? -40.655 -32.461 12.644 1.00 126.61 ? 46   DT  I "C1'" 1 
ATOM   8506  N  N1    . DT  I  5 119 ? -41.559 -31.940 11.537 1.00 126.91 ? 46   DT  I N1    1 
ATOM   8507  C  C2    . DT  I  5 119 ? -41.678 -30.572 11.323 1.00 127.31 ? 46   DT  I C2    1 
ATOM   8508  O  O2    . DT  I  5 119 ? -41.127 -29.707 11.986 1.00 127.48 ? 46   DT  I O2    1 
ATOM   8509  N  N3    . DT  I  5 119 ? -42.498 -30.223 10.277 1.00 127.87 ? 46   DT  I N3    1 
ATOM   8510  C  C4    . DT  I  5 119 ? -43.200 -31.067 9.426  1.00 127.57 ? 46   DT  I C4    1 
ATOM   8511  O  O4    . DT  I  5 119 ? -43.905 -30.615 8.521  1.00 127.44 ? 46   DT  I O4    1 
ATOM   8512  C  C5    . DT  I  5 119 ? -43.031 -32.485 9.695  1.00 127.54 ? 46   DT  I C5    1 
ATOM   8513  C  C7    . DT  I  5 119 ? -43.722 -33.539 8.869  1.00 127.35 ? 46   DT  I C7    1 
ATOM   8514  C  C6    . DT  I  5 119 ? -42.235 -32.836 10.719 1.00 127.32 ? 46   DT  I C6    1 
ATOM   8515  P  P     . DG  I  5 120 ? -39.636 -34.306 16.435 1.00 122.52 ? 47   DG  I P     1 
ATOM   8516  O  OP1   . DG  I  5 120 ? -38.499 -34.862 17.219 1.00 120.88 ? 47   DG  I OP1   1 
ATOM   8517  O  OP2   . DG  I  5 120 ? -40.984 -34.933 16.443 1.00 122.47 ? 47   DG  I OP2   1 
ATOM   8518  O  "O5'" . DG  I  5 120 ? -39.821 -32.796 16.891 1.00 121.22 ? 47   DG  I "O5'" 1 
ATOM   8519  C  "C5'" . DG  I  5 120 ? -38.737 -31.876 16.800 1.00 119.56 ? 47   DG  I "C5'" 1 
ATOM   8520  C  "C4'" . DG  I  5 120 ? -39.310 -30.497 17.057 1.00 118.20 ? 47   DG  I "C4'" 1 
ATOM   8521  O  "O4'" . DG  I  5 120 ? -40.352 -30.245 16.072 1.00 118.71 ? 47   DG  I "O4'" 1 
ATOM   8522  C  "C3'" . DG  I  5 120 ? -39.964 -30.378 18.426 1.00 117.44 ? 47   DG  I "C3'" 1 
ATOM   8523  O  "O3'" . DG  I  5 120 ? -39.645 -29.116 19.007 1.00 115.75 ? 47   DG  I "O3'" 1 
ATOM   8524  C  "C2'" . DG  I  5 120 ? -41.464 -30.566 18.153 1.00 118.15 ? 47   DG  I "C2'" 1 
ATOM   8525  C  "C1'" . DG  I  5 120 ? -41.622 -30.133 16.694 1.00 119.18 ? 47   DG  I "C1'" 1 
ATOM   8526  N  N9    . DG  I  5 120 ? -42.619 -30.878 15.910 1.00 119.41 ? 47   DG  I N9    1 
ATOM   8527  C  C8    . DG  I  5 120 ? -42.997 -32.201 16.016 1.00 119.33 ? 47   DG  I C8    1 
ATOM   8528  N  N7    . DG  I  5 120 ? -43.920 -32.560 15.162 1.00 119.25 ? 47   DG  I N7    1 
ATOM   8529  C  C5    . DG  I  5 120 ? -44.171 -31.398 14.445 1.00 119.43 ? 47   DG  I C5    1 
ATOM   8530  C  C6    . DG  I  5 120 ? -45.069 -31.153 13.381 1.00 119.21 ? 47   DG  I C6    1 
ATOM   8531  O  O6    . DG  I  5 120 ? -45.849 -31.949 12.855 1.00 119.44 ? 47   DG  I O6    1 
ATOM   8532  N  N1    . DG  I  5 120 ? -45.018 -29.833 12.930 1.00 119.49 ? 47   DG  I N1    1 
ATOM   8533  C  C2    . DG  I  5 120 ? -44.187 -28.856 13.444 1.00 119.58 ? 47   DG  I C2    1 
ATOM   8534  N  N2    . DG  I  5 120 ? -44.258 -27.632 12.899 1.00 119.38 ? 47   DG  I N2    1 
ATOM   8535  N  N3    . DG  I  5 120 ? -43.339 -29.074 14.441 1.00 120.09 ? 47   DG  I N3    1 
ATOM   8536  C  C4    . DG  I  5 120 ? -43.383 -30.359 14.891 1.00 119.70 ? 47   DG  I C4    1 
ATOM   8537  P  P     . DG  I  5 121 ? -40.135 -28.750 20.487 1.00 113.96 ? 48   DG  I P     1 
ATOM   8538  O  OP1   . DG  I  5 121 ? -38.985 -28.128 21.181 1.00 114.24 ? 48   DG  I OP1   1 
ATOM   8539  O  OP2   . DG  I  5 121 ? -40.829 -29.914 21.072 1.00 113.67 ? 48   DG  I OP2   1 
ATOM   8540  O  "O5'" . DG  I  5 121 ? -41.263 -27.644 20.262 1.00 116.72 ? 48   DG  I "O5'" 1 
ATOM   8541  C  "C5'" . DG  I  5 121 ? -40.994 -26.466 19.521 1.00 121.04 ? 48   DG  I "C5'" 1 
ATOM   8542  C  "C4'" . DG  I  5 121 ? -42.303 -25.815 19.115 1.00 124.58 ? 48   DG  I "C4'" 1 
ATOM   8543  O  "O4'" . DG  I  5 121 ? -43.052 -26.673 18.218 1.00 125.76 ? 48   DG  I "O4'" 1 
ATOM   8544  C  "C3'" . DG  I  5 121 ? -43.247 -25.493 20.268 1.00 126.20 ? 48   DG  I "C3'" 1 
ATOM   8545  O  "O3'" . DG  I  5 121 ? -43.477 -24.102 20.178 1.00 128.01 ? 48   DG  I "O3'" 1 
ATOM   8546  C  "C2'" . DG  I  5 121 ? -44.495 -26.349 20.013 1.00 126.70 ? 48   DG  I "C2'" 1 
ATOM   8547  C  "C1'" . DG  I  5 121 ? -44.424 -26.508 18.502 1.00 128.00 ? 48   DG  I "C1'" 1 
ATOM   8548  N  N9    . DG  I  5 121 ? -45.132 -27.625 17.875 1.00 128.70 ? 48   DG  I N9    1 
ATOM   8549  C  C8    . DG  I  5 121 ? -45.286 -28.932 18.291 1.00 128.95 ? 48   DG  I C8    1 
ATOM   8550  N  N7    . DG  I  5 121 ? -45.973 -29.668 17.452 1.00 128.92 ? 48   DG  I N7    1 
ATOM   8551  C  C5    . DG  I  5 121 ? -46.288 -28.795 16.409 1.00 129.19 ? 48   DG  I C5    1 
ATOM   8552  C  C6    . DG  I  5 121 ? -47.019 -28.989 15.200 1.00 129.29 ? 48   DG  I C6    1 
ATOM   8553  O  O6    . DG  I  5 121 ? -47.560 -30.028 14.782 1.00 129.20 ? 48   DG  I O6    1 
ATOM   8554  N  N1    . DG  I  5 121 ? -47.091 -27.817 14.425 1.00 129.25 ? 48   DG  I N1    1 
ATOM   8555  C  C2    . DG  I  5 121 ? -46.534 -26.599 14.769 1.00 129.01 ? 48   DG  I C2    1 
ATOM   8556  N  N2    . DG  I  5 121 ? -46.692 -25.571 13.917 1.00 128.89 ? 48   DG  I N2    1 
ATOM   8557  N  N3    . DG  I  5 121 ? -45.856 -26.411 15.892 1.00 129.48 ? 48   DG  I N3    1 
ATOM   8558  C  C4    . DG  I  5 121 ? -45.772 -27.538 16.658 1.00 129.31 ? 48   DG  I C4    1 
ATOM   8559  P  P     . DT  I  5 122 ? -44.463 -23.327 21.159 1.00 129.29 ? 49   DT  I P     1 
ATOM   8560  O  OP1   . DT  I  5 122 ? -43.842 -22.004 21.416 1.00 129.40 ? 49   DT  I OP1   1 
ATOM   8561  O  OP2   . DT  I  5 122 ? -44.887 -24.214 22.272 1.00 128.19 ? 49   DT  I OP2   1 
ATOM   8562  O  "O5'" . DT  I  5 122 ? -45.746 -23.163 20.224 1.00 131.62 ? 49   DT  I "O5'" 1 
ATOM   8563  C  "C5'" . DT  I  5 122 ? -45.774 -22.342 19.062 1.00 134.77 ? 49   DT  I "C5'" 1 
ATOM   8564  C  "C4'" . DT  I  5 122 ? -47.173 -22.450 18.483 1.00 137.41 ? 49   DT  I "C4'" 1 
ATOM   8565  O  "O4'" . DT  I  5 122 ? -47.416 -23.838 18.143 1.00 137.68 ? 49   DT  I "O4'" 1 
ATOM   8566  C  "C3'" . DT  I  5 122 ? -48.293 -22.016 19.432 1.00 139.08 ? 49   DT  I "C3'" 1 
ATOM   8567  O  "O3'" . DT  I  5 122 ? -48.954 -20.877 18.860 1.00 142.81 ? 49   DT  I "O3'" 1 
ATOM   8568  C  "C2'" . DT  I  5 122 ? -49.211 -23.235 19.577 1.00 138.07 ? 49   DT  I "C2'" 1 
ATOM   8569  C  "C1'" . DT  I  5 122 ? -48.734 -24.202 18.496 1.00 137.64 ? 49   DT  I "C1'" 1 
ATOM   8570  N  N1    . DT  I  5 122 ? -48.743 -25.652 18.910 1.00 137.52 ? 49   DT  I N1    1 
ATOM   8571  C  C2    . DT  I  5 122 ? -49.009 -26.626 17.959 1.00 137.52 ? 49   DT  I C2    1 
ATOM   8572  O  O2    . DT  I  5 122 ? -49.237 -26.391 16.784 1.00 137.67 ? 49   DT  I O2    1 
ATOM   8573  N  N3    . DT  I  5 122 ? -49.002 -27.915 18.431 1.00 137.43 ? 49   DT  I N3    1 
ATOM   8574  C  C4    . DT  I  5 122 ? -48.762 -28.329 19.731 1.00 137.40 ? 49   DT  I C4    1 
ATOM   8575  O  O4    . DT  I  5 122 ? -48.787 -29.523 20.022 1.00 137.00 ? 49   DT  I O4    1 
ATOM   8576  C  C5    . DT  I  5 122 ? -48.486 -27.261 20.686 1.00 137.69 ? 49   DT  I C5    1 
ATOM   8577  C  C7    . DT  I  5 122 ? -48.203 -27.547 22.142 1.00 137.79 ? 49   DT  I C7    1 
ATOM   8578  C  C6    . DT  I  5 122 ? -48.491 -25.996 20.233 1.00 137.45 ? 49   DT  I C6    1 
ATOM   8579  P  P     . DA  I  5 123 ? -50.089 -19.999 19.600 1.00 145.30 ? 50   DA  I P     1 
ATOM   8580  O  OP1   . DA  I  5 123 ? -49.496 -18.679 19.933 1.00 145.19 ? 50   DA  I OP1   1 
ATOM   8581  O  OP2   . DA  I  5 123 ? -50.751 -20.792 20.664 1.00 144.12 ? 50   DA  I OP2   1 
ATOM   8582  O  "O5'" . DA  I  5 123 ? -51.132 -19.785 18.395 1.00 147.22 ? 50   DA  I "O5'" 1 
ATOM   8583  C  "C5'" . DA  I  5 123 ? -51.304 -20.767 17.364 1.00 149.88 ? 50   DA  I "C5'" 1 
ATOM   8584  C  "C4'" . DA  I  5 123 ? -52.609 -21.541 17.499 1.00 152.01 ? 50   DA  I "C4'" 1 
ATOM   8585  O  "O4'" . DA  I  5 123 ? -52.307 -22.956 17.649 1.00 152.22 ? 50   DA  I "O4'" 1 
ATOM   8586  C  "C3'" . DA  I  5 123 ? -53.518 -21.192 18.683 1.00 153.57 ? 50   DA  I "C3'" 1 
ATOM   8587  O  "O3'" . DA  I  5 123 ? -54.853 -20.990 18.204 1.00 156.55 ? 50   DA  I "O3'" 1 
ATOM   8588  C  "C2'" . DA  I  5 123 ? -53.412 -22.419 19.593 1.00 152.81 ? 50   DA  I "C2'" 1 
ATOM   8589  C  "C1'" . DA  I  5 123 ? -53.277 -23.490 18.523 1.00 152.08 ? 50   DA  I "C1'" 1 
ATOM   8590  N  N9    . DA  I  5 123 ? -52.872 -24.825 18.958 1.00 151.92 ? 50   DA  I N9    1 
ATOM   8591  C  C8    . DA  I  5 123 ? -52.408 -25.225 20.186 1.00 151.81 ? 50   DA  I C8    1 
ATOM   8592  N  N7    . DA  I  5 123 ? -52.133 -26.508 20.253 1.00 151.88 ? 50   DA  I N7    1 
ATOM   8593  C  C5    . DA  I  5 123 ? -52.434 -26.979 18.980 1.00 152.01 ? 50   DA  I C5    1 
ATOM   8594  C  C6    . DA  I  5 123 ? -52.369 -28.264 18.389 1.00 151.88 ? 50   DA  I C6    1 
ATOM   8595  N  N6    . DA  I  5 123 ? -51.951 -29.345 19.050 1.00 151.85 ? 50   DA  I N6    1 
ATOM   8596  N  N1    . DA  I  5 123 ? -52.752 -28.397 17.095 1.00 151.89 ? 50   DA  I N1    1 
ATOM   8597  C  C2    . DA  I  5 123 ? -53.179 -27.308 16.430 1.00 151.85 ? 50   DA  I C2    1 
ATOM   8598  N  N3    . DA  I  5 123 ? -53.285 -26.052 16.876 1.00 151.69 ? 50   DA  I N3    1 
ATOM   8599  C  C4    . DA  I  5 123 ? -52.896 -25.954 18.169 1.00 151.95 ? 50   DA  I C4    1 
ATOM   8600  P  P     . DG  I  5 124 ? -55.961 -20.170 19.039 1.00 158.88 ? 51   DG  I P     1 
ATOM   8601  O  OP1   . DG  I  5 124 ? -55.754 -18.719 18.731 1.00 158.83 ? 51   DG  I OP1   1 
ATOM   8602  O  OP2   . DG  I  5 124 ? -55.960 -20.642 20.458 1.00 158.51 ? 51   DG  I OP2   1 
ATOM   8603  O  "O5'" . DG  I  5 124 ? -57.371 -20.646 18.400 1.00 159.67 ? 51   DG  I "O5'" 1 
ATOM   8604  C  "C5'" . DG  I  5 124 ? -57.444 -21.129 17.052 1.00 161.32 ? 51   DG  I "C5'" 1 
ATOM   8605  C  "C4'" . DG  I  5 124 ? -58.172 -22.462 16.985 1.00 162.40 ? 51   DG  I "C4'" 1 
ATOM   8606  O  "O4'" . DG  I  5 124 ? -57.254 -23.533 17.334 1.00 162.33 ? 51   DG  I "O4'" 1 
ATOM   8607  C  "C3'" . DG  I  5 124 ? -59.365 -22.580 17.935 1.00 163.22 ? 51   DG  I "C3'" 1 
ATOM   8608  O  "O3'" . DG  I  5 124 ? -60.572 -22.807 17.188 1.00 164.37 ? 51   DG  I "O3'" 1 
ATOM   8609  C  "C2'" . DG  I  5 124 ? -59.001 -23.737 18.870 1.00 162.94 ? 51   DG  I "C2'" 1 
ATOM   8610  C  "C1'" . DG  I  5 124 ? -57.963 -24.508 18.063 1.00 162.50 ? 51   DG  I "C1'" 1 
ATOM   8611  N  N9    . DG  I  5 124 ? -57.021 -25.241 18.901 1.00 162.43 ? 51   DG  I N9    1 
ATOM   8612  C  C8    . DG  I  5 124 ? -56.289 -24.737 19.952 1.00 162.52 ? 51   DG  I C8    1 
ATOM   8613  N  N7    . DG  I  5 124 ? -55.524 -25.622 20.530 1.00 162.58 ? 51   DG  I N7    1 
ATOM   8614  C  C5    . DG  I  5 124 ? -55.761 -26.792 19.817 1.00 162.52 ? 51   DG  I C5    1 
ATOM   8615  C  C6    . DG  I  5 124 ? -55.213 -28.093 19.990 1.00 162.54 ? 51   DG  I C6    1 
ATOM   8616  O  O6    . DG  I  5 124 ? -54.382 -28.464 20.837 1.00 162.31 ? 51   DG  I O6    1 
ATOM   8617  N  N1    . DG  I  5 124 ? -55.722 -29.002 19.050 1.00 162.65 ? 51   DG  I N1    1 
ATOM   8618  C  C2    . DG  I  5 124 ? -56.647 -28.689 18.070 1.00 162.51 ? 51   DG  I C2    1 
ATOM   8619  N  N2    . DG  I  5 124 ? -57.027 -29.688 17.256 1.00 162.39 ? 51   DG  I N2    1 
ATOM   8620  N  N3    . DG  I  5 124 ? -57.165 -27.473 17.903 1.00 162.38 ? 51   DG  I N3    1 
ATOM   8621  C  C4    . DG  I  5 124 ? -56.682 -26.575 18.807 1.00 162.45 ? 51   DG  I C4    1 
ATOM   8622  P  P     . DT  I  5 125 ? -62.025 -22.743 17.881 1.00 165.23 ? 52   DT  I P     1 
ATOM   8623  O  OP1   . DT  I  5 125 ? -63.011 -22.369 16.835 1.00 165.16 ? 52   DT  I OP1   1 
ATOM   8624  O  OP2   . DT  I  5 125 ? -61.921 -21.931 19.120 1.00 165.36 ? 52   DT  I OP2   1 
ATOM   8625  O  "O5'" . DT  I  5 125 ? -62.292 -24.264 18.318 1.00 164.97 ? 52   DT  I "O5'" 1 
ATOM   8626  C  "C5'" . DT  I  5 125 ? -61.938 -25.366 17.465 1.00 164.52 ? 52   DT  I "C5'" 1 
ATOM   8627  C  "C4'" . DT  I  5 125 ? -61.832 -26.661 18.254 1.00 163.98 ? 52   DT  I "C4'" 1 
ATOM   8628  O  "O4'" . DT  I  5 125 ? -60.483 -26.896 18.724 1.00 164.02 ? 52   DT  I "O4'" 1 
ATOM   8629  C  "C3'" . DT  I  5 125 ? -62.663 -26.704 19.527 1.00 163.41 ? 52   DT  I "C3'" 1 
ATOM   8630  O  "O3'" . DT  I  5 125 ? -64.002 -27.082 19.199 1.00 162.64 ? 52   DT  I "O3'" 1 
ATOM   8631  C  "C2'" . DT  I  5 125 ? -61.937 -27.751 20.372 1.00 163.68 ? 52   DT  I "C2'" 1 
ATOM   8632  C  "C1'" . DT  I  5 125 ? -60.573 -27.922 19.699 1.00 164.03 ? 52   DT  I "C1'" 1 
ATOM   8633  N  N1    . DT  I  5 125 ? -59.418 -27.870 20.687 1.00 164.24 ? 52   DT  I N1    1 
ATOM   8634  C  C2    . DT  I  5 125 ? -58.667 -29.020 20.926 1.00 164.20 ? 52   DT  I C2    1 
ATOM   8635  O  O2    . DT  I  5 125 ? -58.862 -30.099 20.376 1.00 164.09 ? 52   DT  I O2    1 
ATOM   8636  N  N3    . DT  I  5 125 ? -57.652 -28.861 21.849 1.00 164.14 ? 52   DT  I N3    1 
ATOM   8637  C  C4    . DT  I  5 125 ? -57.316 -27.705 22.549 1.00 164.13 ? 52   DT  I C4    1 
ATOM   8638  O  O4    . DT  I  5 125 ? -56.378 -27.686 23.347 1.00 164.01 ? 52   DT  I O4    1 
ATOM   8639  C  C5    . DT  I  5 125 ? -58.138 -26.540 22.260 1.00 164.20 ? 52   DT  I C5    1 
ATOM   8640  C  C7    . DT  I  5 125 ? -57.890 -25.219 22.943 1.00 164.02 ? 52   DT  I C7    1 
ATOM   8641  C  C6    . DT  I  5 125 ? -59.132 -26.681 21.360 1.00 164.27 ? 52   DT  I C6    1 
ATOM   8642  P  P     . DA  I  5 126 ? -65.156 -27.260 20.307 1.00 161.88 ? 53   DA  I P     1 
ATOM   8643  O  OP1   . DA  I  5 126 ? -66.461 -27.139 19.614 1.00 161.90 ? 53   DA  I OP1   1 
ATOM   8644  O  OP2   . DA  I  5 126 ? -64.859 -26.365 21.456 1.00 161.65 ? 53   DA  I OP2   1 
ATOM   8645  O  "O5'" . DA  I  5 126 ? -64.972 -28.789 20.766 1.00 161.02 ? 53   DA  I "O5'" 1 
ATOM   8646  C  "C5'" . DA  I  5 126 ? -64.735 -29.837 19.807 1.00 159.18 ? 53   DA  I "C5'" 1 
ATOM   8647  C  "C4'" . DA  I  5 126 ? -64.171 -31.075 20.489 1.00 157.77 ? 53   DA  I "C4'" 1 
ATOM   8648  O  "O4'" . DA  I  5 126 ? -62.813 -30.839 20.958 1.00 157.24 ? 53   DA  I "O4'" 1 
ATOM   8649  C  "C3'" . DA  I  5 126 ? -64.997 -31.533 21.690 1.00 156.96 ? 53   DA  I "C3'" 1 
ATOM   8650  O  "O3'" . DA  I  5 126 ? -65.367 -32.910 21.461 1.00 155.90 ? 53   DA  I "O3'" 1 
ATOM   8651  C  "C2'" . DA  I  5 126 ? -64.073 -31.280 22.884 1.00 156.90 ? 53   DA  I "C2'" 1 
ATOM   8652  C  "C1'" . DA  I  5 126 ? -62.684 -31.384 22.256 1.00 157.06 ? 53   DA  I "C1'" 1 
ATOM   8653  N  N9    . DA  I  5 126 ? -61.694 -30.627 23.018 1.00 157.13 ? 53   DA  I N9    1 
ATOM   8654  C  C8    . DA  I  5 126 ? -61.702 -29.276 23.236 1.00 157.10 ? 53   DA  I C8    1 
ATOM   8655  N  N7    . DA  I  5 126 ? -60.700 -28.845 23.965 1.00 157.34 ? 53   DA  I N7    1 
ATOM   8656  C  C5    . DA  I  5 126 ? -59.983 -29.996 24.263 1.00 157.43 ? 53   DA  I C5    1 
ATOM   8657  C  C6    . DA  I  5 126 ? -58.802 -30.217 25.013 1.00 157.16 ? 53   DA  I C6    1 
ATOM   8658  N  N6    . DA  I  5 126 ? -58.125 -29.234 25.616 1.00 157.02 ? 53   DA  I N6    1 
ATOM   8659  N  N1    . DA  I  5 126 ? -58.345 -31.489 25.118 1.00 157.09 ? 53   DA  I N1    1 
ATOM   8660  C  C2    . DA  I  5 126 ? -59.026 -32.471 24.508 1.00 157.11 ? 53   DA  I C2    1 
ATOM   8661  N  N3    . DA  I  5 126 ? -60.145 -32.387 23.779 1.00 157.20 ? 53   DA  I N3    1 
ATOM   8662  C  C4    . DA  I  5 126 ? -60.583 -31.111 23.688 1.00 157.37 ? 53   DA  I C4    1 
ATOM   8663  P  P     . DT  I  5 127 ? -65.391 -34.069 22.578 1.00 154.72 ? 54   DT  I P     1 
ATOM   8664  O  OP1   . DT  I  5 127 ? -66.002 -35.273 21.955 1.00 154.42 ? 54   DT  I OP1   1 
ATOM   8665  O  OP2   . DT  I  5 127 ? -65.976 -33.514 23.833 1.00 154.58 ? 54   DT  I OP2   1 
ATOM   8666  O  "O5'" . DT  I  5 127 ? -63.819 -34.318 22.817 1.00 152.75 ? 54   DT  I "O5'" 1 
ATOM   8667  C  "C5'" . DT  I  5 127 ? -63.114 -35.462 22.322 1.00 149.42 ? 54   DT  I "C5'" 1 
ATOM   8668  C  "C4'" . DT  I  5 127 ? -62.513 -36.212 23.496 1.00 146.79 ? 54   DT  I "C4'" 1 
ATOM   8669  O  "O4'" . DT  I  5 127 ? -61.595 -35.334 24.197 1.00 146.24 ? 54   DT  I "O4'" 1 
ATOM   8670  C  "C3'" . DT  I  5 127 ? -63.547 -36.681 24.521 1.00 145.33 ? 54   DT  I "C3'" 1 
ATOM   8671  O  "O3'" . DT  I  5 127 ? -63.350 -38.089 24.746 1.00 142.76 ? 54   DT  I "O3'" 1 
ATOM   8672  C  "C2'" . DT  I  5 127 ? -63.311 -35.785 25.746 1.00 145.51 ? 54   DT  I "C2'" 1 
ATOM   8673  C  "C1'" . DT  I  5 127 ? -61.849 -35.379 25.589 1.00 145.88 ? 54   DT  I "C1'" 1 
ATOM   8674  N  N1    . DT  I  5 127 ? -61.467 -34.056 26.225 1.00 145.92 ? 54   DT  I N1    1 
ATOM   8675  C  C2    . DT  I  5 127 ? -60.246 -33.936 26.877 1.00 145.80 ? 54   DT  I C2    1 
ATOM   8676  O  O2    . DT  I  5 127 ? -59.431 -34.837 26.982 1.00 145.65 ? 54   DT  I O2    1 
ATOM   8677  N  N3    . DT  I  5 127 ? -59.999 -32.695 27.416 1.00 145.72 ? 54   DT  I N3    1 
ATOM   8678  C  C4    . DT  I  5 127 ? -60.819 -31.580 27.375 1.00 145.71 ? 54   DT  I C4    1 
ATOM   8679  O  O4    . DT  I  5 127 ? -60.476 -30.524 27.897 1.00 145.63 ? 54   DT  I O4    1 
ATOM   8680  C  C5    . DT  I  5 127 ? -62.082 -31.764 26.684 1.00 145.91 ? 54   DT  I C5    1 
ATOM   8681  C  C7    . DT  I  5 127 ? -63.077 -30.640 26.562 1.00 145.75 ? 54   DT  I C7    1 
ATOM   8682  C  C6    . DT  I  5 127 ? -62.336 -32.974 26.152 1.00 146.08 ? 54   DT  I C6    1 
ATOM   8683  P  P     . DC  I  5 128 ? -63.874 -38.876 26.045 1.00 140.93 ? 55   DC  I P     1 
ATOM   8684  O  OP1   . DC  I  5 128 ? -64.024 -40.304 25.666 1.00 140.72 ? 55   DC  I OP1   1 
ATOM   8685  O  OP2   . DC  I  5 128 ? -65.025 -38.146 26.633 1.00 141.06 ? 55   DC  I OP2   1 
ATOM   8686  O  "O5'" . DC  I  5 128 ? -62.618 -38.745 27.033 1.00 139.15 ? 55   DC  I "O5'" 1 
ATOM   8687  C  "C5'" . DC  I  5 128 ? -61.283 -38.981 26.540 1.00 136.20 ? 55   DC  I "C5'" 1 
ATOM   8688  C  "C4'" . DC  I  5 128 ? -60.216 -38.847 27.619 1.00 133.63 ? 55   DC  I "C4'" 1 
ATOM   8689  O  "O4'" . DC  I  5 128 ? -60.044 -37.452 27.982 1.00 133.47 ? 55   DC  I "O4'" 1 
ATOM   8690  C  "C3'" . DC  I  5 128 ? -60.510 -39.607 28.909 1.00 131.92 ? 55   DC  I "C3'" 1 
ATOM   8691  O  "O3'" . DC  I  5 128 ? -59.377 -40.387 29.265 1.00 128.72 ? 55   DC  I "O3'" 1 
ATOM   8692  C  "C2'" . DC  I  5 128 ? -60.820 -38.527 29.945 1.00 132.60 ? 55   DC  I "C2'" 1 
ATOM   8693  C  "C1'" . DC  I  5 128 ? -60.083 -37.307 29.392 1.00 133.71 ? 55   DC  I "C1'" 1 
ATOM   8694  N  N1    . DC  I  5 128 ? -60.689 -35.965 29.757 1.00 133.97 ? 55   DC  I N1    1 
ATOM   8695  C  C2    . DC  I  5 128 ? -60.055 -35.138 30.707 1.00 134.05 ? 55   DC  I C2    1 
ATOM   8696  O  O2    . DC  I  5 128 ? -59.005 -35.504 31.248 1.00 134.21 ? 55   DC  I O2    1 
ATOM   8697  N  N3    . DC  I  5 128 ? -60.612 -33.938 31.017 1.00 134.17 ? 55   DC  I N3    1 
ATOM   8698  C  C4    . DC  I  5 128 ? -61.750 -33.555 30.426 1.00 134.23 ? 55   DC  I C4    1 
ATOM   8699  N  N4    . DC  I  5 128 ? -62.260 -32.367 30.765 1.00 134.07 ? 55   DC  I N4    1 
ATOM   8700  C  C5    . DC  I  5 128 ? -62.416 -34.375 29.463 1.00 134.23 ? 55   DC  I C5    1 
ATOM   8701  C  C6    . DC  I  5 128 ? -61.857 -35.557 29.167 1.00 133.97 ? 55   DC  I C6    1 
ATOM   8702  P  P     . DT  I  5 129 ? -59.510 -41.608 30.297 1.00 126.26 ? 56   DT  I P     1 
ATOM   8703  O  OP1   . DT  I  5 129 ? -58.473 -42.605 29.917 1.00 125.62 ? 56   DT  I OP1   1 
ATOM   8704  O  OP2   . DT  I  5 129 ? -60.939 -41.991 30.403 1.00 125.89 ? 56   DT  I OP2   1 
ATOM   8705  O  "O5'" . DT  I  5 129 ? -59.128 -40.947 31.707 1.00 124.31 ? 56   DT  I "O5'" 1 
ATOM   8706  C  "C5'" . DT  I  5 129 ? -57.762 -40.871 32.111 1.00 120.12 ? 56   DT  I "C5'" 1 
ATOM   8707  C  "C4'" . DT  I  5 129 ? -57.629 -40.175 33.447 1.00 116.87 ? 56   DT  I "C4'" 1 
ATOM   8708  O  "O4'" . DT  I  5 129 ? -58.238 -38.867 33.359 1.00 117.13 ? 56   DT  I "O4'" 1 
ATOM   8709  C  "C3'" . DT  I  5 129 ? -58.292 -40.885 34.625 1.00 114.55 ? 56   DT  I "C3'" 1 
ATOM   8710  O  "O3'" . DT  I  5 129 ? -57.358 -40.961 35.684 1.00 110.10 ? 56   DT  I "O3'" 1 
ATOM   8711  C  "C2'" . DT  I  5 129 ? -59.460 -39.971 34.985 1.00 116.01 ? 56   DT  I "C2'" 1 
ATOM   8712  C  "C1'" . DT  I  5 129 ? -58.881 -38.620 34.585 1.00 118.04 ? 56   DT  I "C1'" 1 
ATOM   8713  N  N1    . DT  I  5 129 ? -59.858 -37.521 34.361 1.00 118.84 ? 56   DT  I N1    1 
ATOM   8714  C  C2    . DT  I  5 129 ? -59.647 -36.311 34.994 1.00 119.51 ? 56   DT  I C2    1 
ATOM   8715  O  O2    . DT  I  5 129 ? -58.708 -36.088 35.742 1.00 119.47 ? 56   DT  I O2    1 
ATOM   8716  N  N3    . DT  I  5 129 ? -60.596 -35.354 34.723 1.00 119.89 ? 56   DT  I N3    1 
ATOM   8717  C  C4    . DT  I  5 129 ? -61.700 -35.478 33.895 1.00 119.03 ? 56   DT  I C4    1 
ATOM   8718  O  O4    . DT  I  5 129 ? -62.484 -34.555 33.732 1.00 118.88 ? 56   DT  I O4    1 
ATOM   8719  C  C5    . DT  I  5 129 ? -61.860 -36.765 33.259 1.00 119.35 ? 56   DT  I C5    1 
ATOM   8720  C  C7    . DT  I  5 129 ? -63.021 -37.022 32.343 1.00 119.28 ? 56   DT  I C7    1 
ATOM   8721  C  C6    . DT  I  5 129 ? -60.943 -37.712 33.514 1.00 119.44 ? 56   DT  I C6    1 
ATOM   8722  P  P     . DG  I  5 130 ? -56.167 -42.033 35.665 1.00 106.82 ? 57   DG  I P     1 
ATOM   8723  O  OP1   . DG  I  5 130 ? -55.528 -42.064 34.328 1.00 105.87 ? 57   DG  I OP1   1 
ATOM   8724  O  OP2   . DG  I  5 130 ? -56.673 -43.278 36.290 1.00 106.57 ? 57   DG  I OP2   1 
ATOM   8725  O  "O5'" . DG  I  5 130 ? -55.137 -41.378 36.688 1.00 105.97 ? 57   DG  I "O5'" 1 
ATOM   8726  C  "C5'" . DG  I  5 130 ? -54.235 -40.361 36.260 1.00 103.17 ? 57   DG  I "C5'" 1 
ATOM   8727  C  "C4'" . DG  I  5 130 ? -53.947 -39.392 37.390 1.00 100.86 ? 57   DG  I "C4'" 1 
ATOM   8728  O  "O4'" . DG  I  5 130 ? -55.090 -38.531 37.580 1.00 99.68  ? 57   DG  I "O4'" 1 
ATOM   8729  C  "C3'" . DG  I  5 130 ? -53.616 -39.976 38.756 1.00 99.85  ? 57   DG  I "C3'" 1 
ATOM   8730  O  "O3'" . DG  I  5 130 ? -52.548 -39.186 39.264 1.00 99.12  ? 57   DG  I "O3'" 1 
ATOM   8731  C  "C2'" . DG  I  5 130 ? -54.922 -39.837 39.547 1.00 100.41 ? 57   DG  I "C2'" 1 
ATOM   8732  C  "C1'" . DG  I  5 130 ? -55.638 -38.665 38.877 1.00 101.00 ? 57   DG  I "C1'" 1 
ATOM   8733  N  N9    . DG  I  5 130 ? -57.065 -38.809 38.592 1.00 101.61 ? 57   DG  I N9    1 
ATOM   8734  C  C8    . DG  I  5 130 ? -57.729 -39.948 38.199 1.00 101.46 ? 57   DG  I C8    1 
ATOM   8735  N  N7    . DG  I  5 130 ? -59.000 -39.758 37.983 1.00 101.54 ? 57   DG  I N7    1 
ATOM   8736  C  C5    . DG  I  5 130 ? -59.199 -38.406 38.225 1.00 101.40 ? 57   DG  I C5    1 
ATOM   8737  C  C6    . DG  I  5 130 ? -60.381 -37.620 38.153 1.00 101.69 ? 57   DG  I C6    1 
ATOM   8738  O  O6    . DG  I  5 130 ? -61.528 -37.966 37.842 1.00 101.56 ? 57   DG  I O6    1 
ATOM   8739  N  N1    . DG  I  5 130 ? -60.149 -36.286 38.482 1.00 101.78 ? 57   DG  I N1    1 
ATOM   8740  C  C2    . DG  I  5 130 ? -58.923 -35.778 38.842 1.00 101.44 ? 57   DG  I C2    1 
ATOM   8741  N  N2    . DG  I  5 130 ? -58.890 -34.470 39.124 1.00 101.52 ? 57   DG  I N2    1 
ATOM   8742  N  N3    . DG  I  5 130 ? -57.811 -36.502 38.917 1.00 101.16 ? 57   DG  I N3    1 
ATOM   8743  C  C4    . DG  I  5 130 ? -58.016 -37.806 38.598 1.00 101.40 ? 57   DG  I C4    1 
ATOM   8744  P  P     . DC  I  5 131 ? -51.857 -39.399 40.697 1.00 99.42  ? 58   DC  I P     1 
ATOM   8745  O  OP1   . DC  I  5 131 ? -50.488 -38.853 40.581 1.00 99.89  ? 58   DC  I OP1   1 
ATOM   8746  O  OP2   . DC  I  5 131 ? -51.998 -40.820 41.091 1.00 100.13 ? 58   DC  I OP2   1 
ATOM   8747  O  "O5'" . DC  I  5 131 ? -52.717 -38.487 41.702 1.00 98.55  ? 58   DC  I "O5'" 1 
ATOM   8748  C  "C5'" . DC  I  5 131 ? -53.060 -37.154 41.330 1.00 99.46  ? 58   DC  I "C5'" 1 
ATOM   8749  C  "C4'" . DC  I  5 131 ? -53.888 -36.423 42.378 1.00 101.62 ? 58   DC  I "C4'" 1 
ATOM   8750  O  "O4'" . DC  I  5 131 ? -55.298 -36.471 42.041 1.00 103.09 ? 58   DC  I "O4'" 1 
ATOM   8751  C  "C3'" . DC  I  5 131 ? -53.833 -36.906 43.822 1.00 103.09 ? 58   DC  I "C3'" 1 
ATOM   8752  O  "O3'" . DC  I  5 131 ? -54.086 -35.770 44.654 1.00 103.92 ? 58   DC  I "O3'" 1 
ATOM   8753  C  "C2'" . DC  I  5 131 ? -55.009 -37.878 43.879 1.00 103.98 ? 58   DC  I "C2'" 1 
ATOM   8754  C  "C1'" . DC  I  5 131 ? -56.035 -37.067 43.093 1.00 104.61 ? 58   DC  I "C1'" 1 
ATOM   8755  N  N1    . DC  I  5 131 ? -57.191 -37.821 42.489 1.00 106.02 ? 58   DC  I N1    1 
ATOM   8756  C  C2    . DC  I  5 131 ? -58.353 -37.111 42.100 1.00 106.39 ? 58   DC  I C2    1 
ATOM   8757  O  O2    . DC  I  5 131 ? -58.426 -35.887 42.256 1.00 106.45 ? 58   DC  I O2    1 
ATOM   8758  N  N3    . DC  I  5 131 ? -59.395 -37.785 41.548 1.00 106.64 ? 58   DC  I N3    1 
ATOM   8759  C  C4    . DC  I  5 131 ? -59.316 -39.106 41.373 1.00 105.96 ? 58   DC  I C4    1 
ATOM   8760  N  N4    . DC  I  5 131 ? -60.380 -39.697 40.819 1.00 106.16 ? 58   DC  I N4    1 
ATOM   8761  C  C5    . DC  I  5 131 ? -58.152 -39.858 41.751 1.00 106.11 ? 58   DC  I C5    1 
ATOM   8762  C  C6    . DC  I  5 131 ? -57.125 -39.183 42.299 1.00 106.11 ? 58   DC  I C6    1 
ATOM   8763  P  P     . DA  I  5 132 ? -52.954 -35.075 45.555 1.00 103.06 ? 59   DA  I P     1 
ATOM   8764  O  OP1   . DA  I  5 132 ? -51.713 -34.987 44.748 1.00 101.72 ? 59   DA  I OP1   1 
ATOM   8765  O  OP2   . DA  I  5 132 ? -52.978 -35.782 46.863 1.00 102.61 ? 59   DA  I OP2   1 
ATOM   8766  O  "O5'" . DA  I  5 132 ? -53.507 -33.583 45.804 1.00 103.89 ? 59   DA  I "O5'" 1 
ATOM   8767  C  "C5'" . DA  I  5 132 ? -54.166 -32.812 44.795 1.00 105.55 ? 59   DA  I "C5'" 1 
ATOM   8768  C  "C4'" . DA  I  5 132 ? -55.362 -32.040 45.353 1.00 108.34 ? 59   DA  I "C4'" 1 
ATOM   8769  O  "O4'" . DA  I  5 132 ? -56.594 -32.820 45.299 1.00 108.69 ? 59   DA  I "O4'" 1 
ATOM   8770  C  "C3'" . DA  I  5 132 ? -55.303 -31.528 46.795 1.00 109.99 ? 59   DA  I "C3'" 1 
ATOM   8771  O  "O3'" . DA  I  5 132 ? -56.031 -30.286 46.847 1.00 111.90 ? 59   DA  I "O3'" 1 
ATOM   8772  C  "C2'" . DA  I  5 132 ? -55.996 -32.643 47.589 1.00 109.76 ? 59   DA  I "C2'" 1 
ATOM   8773  C  "C1'" . DA  I  5 132 ? -57.048 -33.160 46.602 1.00 109.12 ? 59   DA  I "C1'" 1 
ATOM   8774  N  N9    . DA  I  5 132 ? -57.205 -34.606 46.529 1.00 109.13 ? 59   DA  I N9    1 
ATOM   8775  C  C8    . DA  I  5 132 ? -56.351 -35.575 46.991 1.00 109.08 ? 59   DA  I C8    1 
ATOM   8776  N  N7    . DA  I  5 132 ? -56.754 -36.796 46.745 1.00 109.24 ? 59   DA  I N7    1 
ATOM   8777  C  C5    . DA  I  5 132 ? -57.953 -36.610 46.063 1.00 109.45 ? 59   DA  I C5    1 
ATOM   8778  C  C6    . DA  I  5 132 ? -58.892 -37.507 45.512 1.00 108.99 ? 59   DA  I C6    1 
ATOM   8779  N  N6    . DA  I  5 132 ? -58.743 -38.832 45.579 1.00 109.40 ? 59   DA  I N6    1 
ATOM   8780  N  N1    . DA  I  5 132 ? -59.982 -37.002 44.892 1.00 108.97 ? 59   DA  I N1    1 
ATOM   8781  C  C2    . DA  I  5 132 ? -60.141 -35.676 44.824 1.00 108.94 ? 59   DA  I C2    1 
ATOM   8782  N  N3    . DA  I  5 132 ? -59.327 -34.735 45.301 1.00 109.79 ? 59   DA  I N3    1 
ATOM   8783  C  C4    . DA  I  5 132 ? -58.243 -35.268 45.913 1.00 109.54 ? 59   DA  I C4    1 
ATOM   8784  P  P     . DG  I  5 133 ? -56.012 -29.264 48.085 1.00 113.17 ? 60   DG  I P     1 
ATOM   8785  O  OP1   . DG  I  5 133 ? -55.710 -27.918 47.535 1.00 112.78 ? 60   DG  I OP1   1 
ATOM   8786  O  OP2   . DG  I  5 133 ? -55.226 -29.815 49.223 1.00 111.63 ? 60   DG  I OP2   1 
ATOM   8787  O  "O5'" . DG  I  5 133 ? -57.559 -29.291 48.489 1.00 115.37 ? 60   DG  I "O5'" 1 
ATOM   8788  C  "C5'" . DG  I  5 133 ? -57.936 -30.167 49.525 1.00 118.47 ? 60   DG  I "C5'" 1 
ATOM   8789  C  "C4'" . DG  I  5 133 ? -59.356 -30.684 49.382 1.00 120.72 ? 60   DG  I "C4'" 1 
ATOM   8790  O  "O4'" . DG  I  5 133 ? -59.369 -32.050 48.856 1.00 121.15 ? 60   DG  I "O4'" 1 
ATOM   8791  C  "C3'" . DG  I  5 133 ? -59.979 -30.755 50.766 1.00 122.23 ? 60   DG  I "C3'" 1 
ATOM   8792  O  "O3'" . DG  I  5 133 ? -61.333 -30.328 50.711 1.00 124.81 ? 60   DG  I "O3'" 1 
ATOM   8793  C  "C2'" . DG  I  5 133 ? -59.814 -32.219 51.193 1.00 121.60 ? 60   DG  I "C2'" 1 
ATOM   8794  C  "C1'" . DG  I  5 133 ? -59.797 -32.970 49.858 1.00 120.61 ? 60   DG  I "C1'" 1 
ATOM   8795  N  N9    . DG  I  5 133 ? -59.023 -34.234 49.875 1.00 120.28 ? 60   DG  I N9    1 
ATOM   8796  C  C8    . DG  I  5 133 ? -57.771 -34.536 50.389 1.00 120.00 ? 60   DG  I C8    1 
ATOM   8797  N  N7    . DG  I  5 133 ? -57.396 -35.788 50.245 1.00 119.44 ? 60   DG  I N7    1 
ATOM   8798  C  C5    . DG  I  5 133 ? -58.480 -36.349 49.591 1.00 120.12 ? 60   DG  I C5    1 
ATOM   8799  C  C6    . DG  I  5 133 ? -58.692 -37.676 49.153 1.00 120.22 ? 60   DG  I C6    1 
ATOM   8800  O  O6    . DG  I  5 133 ? -57.904 -38.625 49.268 1.00 120.50 ? 60   DG  I O6    1 
ATOM   8801  N  N1    . DG  I  5 133 ? -59.938 -37.838 48.533 1.00 119.83 ? 60   DG  I N1    1 
ATOM   8802  C  C2    . DG  I  5 133 ? -60.874 -36.829 48.360 1.00 119.94 ? 60   DG  I C2    1 
ATOM   8803  N  N2    . DG  I  5 133 ? -62.033 -37.122 47.749 1.00 119.91 ? 60   DG  I N2    1 
ATOM   8804  N  N3    . DG  I  5 133 ? -60.687 -35.584 48.766 1.00 120.33 ? 60   DG  I N3    1 
ATOM   8805  C  C4    . DG  I  5 133 ? -59.478 -35.418 49.365 1.00 120.34 ? 60   DG  I C4    1 
ATOM   8806  P  P     . DG  I  5 134 ? -61.979 -29.585 51.985 1.00 127.02 ? 61   DG  I P     1 
ATOM   8807  O  OP1   . DG  I  5 134 ? -62.303 -28.194 51.562 1.00 126.93 ? 61   DG  I OP1   1 
ATOM   8808  O  OP2   . DG  I  5 134 ? -61.100 -29.802 53.169 1.00 126.81 ? 61   DG  I OP2   1 
ATOM   8809  O  "O5'" . DG  I  5 134 ? -63.338 -30.413 52.235 1.00 127.38 ? 61   DG  I "O5'" 1 
ATOM   8810  C  "C5'" . DG  I  5 134 ? -64.180 -30.812 51.140 1.00 128.75 ? 61   DG  I "C5'" 1 
ATOM   8811  C  "C4'" . DG  I  5 134 ? -64.848 -32.151 51.411 1.00 129.78 ? 61   DG  I "C4'" 1 
ATOM   8812  O  "O4'" . DG  I  5 134 ? -63.992 -33.244 50.983 1.00 129.99 ? 61   DG  I "O4'" 1 
ATOM   8813  C  "C3'" . DG  I  5 134 ? -65.164 -32.413 52.879 1.00 130.15 ? 61   DG  I "C3'" 1 
ATOM   8814  O  "O3'" . DG  I  5 134 ? -66.569 -32.366 53.060 1.00 131.31 ? 61   DG  I "O3'" 1 
ATOM   8815  C  "C2'" . DG  I  5 134 ? -64.598 -33.800 53.178 1.00 129.96 ? 61   DG  I "C2'" 1 
ATOM   8816  C  "C1'" . DG  I  5 134 ? -64.251 -34.362 51.806 1.00 129.92 ? 61   DG  I "C1'" 1 
ATOM   8817  N  N9    . DG  I  5 134 ? -63.062 -35.208 51.866 1.00 129.91 ? 61   DG  I N9    1 
ATOM   8818  C  C8    . DG  I  5 134 ? -61.796 -34.816 52.240 1.00 129.98 ? 61   DG  I C8    1 
ATOM   8819  N  N7    . DG  I  5 134 ? -60.914 -35.772 52.219 1.00 129.83 ? 61   DG  I N7    1 
ATOM   8820  C  C5    . DG  I  5 134 ? -61.645 -36.878 51.806 1.00 129.76 ? 61   DG  I C5    1 
ATOM   8821  C  C6    . DG  I  5 134 ? -61.220 -38.211 51.596 1.00 129.80 ? 61   DG  I C6    1 
ATOM   8822  O  O6    . DG  I  5 134 ? -60.081 -38.678 51.745 1.00 129.92 ? 61   DG  I O6    1 
ATOM   8823  N  N1    . DG  I  5 134 ? -62.268 -39.035 51.179 1.00 129.81 ? 61   DG  I N1    1 
ATOM   8824  C  C2    . DG  I  5 134 ? -63.566 -38.621 50.988 1.00 129.83 ? 61   DG  I C2    1 
ATOM   8825  N  N2    . DG  I  5 134 ? -64.433 -39.560 50.586 1.00 129.75 ? 61   DG  I N2    1 
ATOM   8826  N  N3    . DG  I  5 134 ? -63.979 -37.370 51.181 1.00 130.16 ? 61   DG  I N3    1 
ATOM   8827  C  C4    . DG  I  5 134 ? -62.969 -36.552 51.589 1.00 129.90 ? 61   DG  I C4    1 
ATOM   8828  P  P     . DT  I  5 135 ? -67.209 -32.539 54.519 1.00 132.54 ? 62   DT  I P     1 
ATOM   8829  O  OP1   . DT  I  5 135 ? -68.565 -31.938 54.523 1.00 132.36 ? 62   DT  I OP1   1 
ATOM   8830  O  OP2   . DT  I  5 135 ? -66.206 -32.128 55.532 1.00 133.11 ? 62   DT  I OP2   1 
ATOM   8831  O  "O5'" . DT  I  5 135 ? -67.347 -34.121 54.636 1.00 132.50 ? 62   DT  I "O5'" 1 
ATOM   8832  C  "C5'" . DT  I  5 135 ? -68.053 -34.905 53.691 1.00 132.68 ? 62   DT  I "C5'" 1 
ATOM   8833  C  "C4'" . DT  I  5 135 ? -68.018 -36.304 54.260 1.00 133.22 ? 62   DT  I "C4'" 1 
ATOM   8834  O  "O4'" . DT  I  5 135 ? -66.760 -36.935 53.928 1.00 133.15 ? 62   DT  I "O4'" 1 
ATOM   8835  C  "C3'" . DT  I  5 135 ? -68.091 -36.267 55.784 1.00 133.57 ? 62   DT  I "C3'" 1 
ATOM   8836  O  "O3'" . DT  I  5 135 ? -69.407 -36.672 56.197 1.00 133.92 ? 62   DT  I "O3'" 1 
ATOM   8837  C  "C2'" . DT  I  5 135 ? -66.917 -37.125 56.274 1.00 133.51 ? 62   DT  I "C2'" 1 
ATOM   8838  C  "C1'" . DT  I  5 135 ? -66.377 -37.772 55.002 1.00 133.35 ? 62   DT  I "C1'" 1 
ATOM   8839  N  N1    . DT  I  5 135 ? -64.881 -37.952 55.009 1.00 133.13 ? 62   DT  I N1    1 
ATOM   8840  C  C2    . DT  I  5 135 ? -64.331 -39.181 54.678 1.00 132.84 ? 62   DT  I C2    1 
ATOM   8841  O  O2    . DT  I  5 135 ? -64.976 -40.163 54.366 1.00 132.82 ? 62   DT  I O2    1 
ATOM   8842  N  N3    . DT  I  5 135 ? -62.960 -39.229 54.722 1.00 133.00 ? 62   DT  I N3    1 
ATOM   8843  C  C4    . DT  I  5 135 ? -62.096 -38.197 55.054 1.00 133.43 ? 62   DT  I C4    1 
ATOM   8844  O  O4    . DT  I  5 135 ? -60.877 -38.351 55.058 1.00 133.41 ? 62   DT  I O4    1 
ATOM   8845  C  C5    . DT  I  5 135 ? -62.731 -36.938 55.390 1.00 133.29 ? 62   DT  I C5    1 
ATOM   8846  C  C7    . DT  I  5 135 ? -61.906 -35.740 55.769 1.00 133.10 ? 62   DT  I C7    1 
ATOM   8847  C  C6    . DT  I  5 135 ? -64.072 -36.879 55.351 1.00 133.21 ? 62   DT  I C6    1 
ATOM   8848  P  P     . DG  I  5 136 ? -69.700 -37.848 57.241 1.00 134.25 ? 63   DG  I P     1 
ATOM   8849  O  OP1   . DG  I  5 136 ? -71.172 -37.990 57.312 1.00 134.16 ? 63   DG  I OP1   1 
ATOM   8850  O  OP2   . DG  I  5 136 ? -68.931 -37.569 58.479 1.00 134.81 ? 63   DG  I OP2   1 
ATOM   8851  O  "O5'" . DG  I  5 136 ? -69.076 -39.145 56.528 1.00 134.54 ? 63   DG  I "O5'" 1 
ATOM   8852  C  "C5'" . DG  I  5 136 ? -69.622 -40.457 56.765 1.00 134.94 ? 63   DG  I "C5'" 1 
ATOM   8853  C  "C4'" . DG  I  5 136 ? -68.881 -41.167 57.892 1.00 135.06 ? 63   DG  I "C4'" 1 
ATOM   8854  O  "O4'" . DG  I  5 136 ? -67.453 -40.996 57.711 1.00 135.36 ? 63   DG  I "O4'" 1 
ATOM   8855  C  "C3'" . DG  I  5 136 ? -69.222 -40.673 59.298 1.00 135.16 ? 63   DG  I "C3'" 1 
ATOM   8856  O  "O3'" . DG  I  5 136 ? -69.957 -41.708 60.021 1.00 135.51 ? 63   DG  I "O3'" 1 
ATOM   8857  C  "C2'" . DG  I  5 136 ? -67.889 -40.175 59.890 1.00 134.79 ? 63   DG  I "C2'" 1 
ATOM   8858  C  "C1'" . DG  I  5 136 ? -66.844 -40.821 58.975 1.00 134.88 ? 63   DG  I "C1'" 1 
ATOM   8859  N  N9    . DG  I  5 136 ? -65.557 -40.133 58.790 1.00 134.89 ? 63   DG  I N9    1 
ATOM   8860  C  C8    . DG  I  5 136 ? -65.228 -38.807 58.991 1.00 134.72 ? 63   DG  I C8    1 
ATOM   8861  N  N7    . DG  I  5 136 ? -63.976 -38.535 58.729 1.00 134.59 ? 63   DG  I N7    1 
ATOM   8862  C  C5    . DG  I  5 136 ? -63.441 -39.760 58.325 1.00 134.73 ? 63   DG  I C5    1 
ATOM   8863  C  C6    . DG  I  5 136 ? -62.127 -40.117 57.910 1.00 134.58 ? 63   DG  I C6    1 
ATOM   8864  O  O6    . DG  I  5 136 ? -61.135 -39.387 57.811 1.00 134.84 ? 63   DG  I O6    1 
ATOM   8865  N  N1    . DG  I  5 136 ? -62.001 -41.469 57.589 1.00 134.45 ? 63   DG  I N1    1 
ATOM   8866  C  C2    . DG  I  5 136 ? -63.024 -42.383 57.656 1.00 134.58 ? 63   DG  I C2    1 
ATOM   8867  N  N2    . DG  I  5 136 ? -62.728 -43.644 57.309 1.00 134.61 ? 63   DG  I N2    1 
ATOM   8868  N  N3    . DG  I  5 136 ? -64.260 -42.072 58.041 1.00 134.93 ? 63   DG  I N3    1 
ATOM   8869  C  C4    . DG  I  5 136 ? -64.399 -40.750 58.359 1.00 134.95 ? 63   DG  I C4    1 
ATOM   8870  P  P     . DG  I  5 137 ? -69.266 -42.842 61.005 1.00 135.84 ? 64   DG  I P     1 
ATOM   8871  O  OP1   . DG  I  5 137 ? -70.254 -43.942 61.169 1.00 135.53 ? 64   DG  I OP1   1 
ATOM   8872  O  OP2   . DG  I  5 137 ? -68.692 -42.174 62.246 1.00 135.55 ? 64   DG  I OP2   1 
ATOM   8873  O  "O5'" . DG  I  5 137 ? -68.049 -43.382 60.070 1.00 134.75 ? 64   DG  I "O5'" 1 
ATOM   8874  C  "C5'" . DG  I  5 137 ? -67.950 -44.775 59.727 1.00 133.60 ? 64   DG  I "C5'" 1 
ATOM   8875  C  "C4'" . DG  I  5 137 ? -66.851 -45.378 60.587 1.00 132.66 ? 64   DG  I "C4'" 1 
ATOM   8876  O  "O4'" . DG  I  5 137 ? -65.649 -44.558 60.496 1.00 132.35 ? 64   DG  I "O4'" 1 
ATOM   8877  C  "C3'" . DG  I  5 137 ? -67.212 -45.455 62.064 1.00 132.06 ? 64   DG  I "C3'" 1 
ATOM   8878  O  "O3'" . DG  I  5 137 ? -66.784 -46.713 62.557 1.00 131.43 ? 64   DG  I "O3'" 1 
ATOM   8879  C  "C2'" . DG  I  5 137 ? -66.477 -44.257 62.673 1.00 131.95 ? 64   DG  I "C2'" 1 
ATOM   8880  C  "C1'" . DG  I  5 137 ? -65.238 -44.145 61.788 1.00 131.45 ? 64   DG  I "C1'" 1 
ATOM   8881  N  N9    . DG  I  5 137 ? -64.634 -42.804 61.747 1.00 131.19 ? 64   DG  I N9    1 
ATOM   8882  C  C8    . DG  I  5 137 ? -65.229 -41.598 62.074 1.00 131.30 ? 64   DG  I C8    1 
ATOM   8883  N  N7    . DG  I  5 137 ? -64.450 -40.556 61.947 1.00 131.05 ? 64   DG  I N7    1 
ATOM   8884  C  C5    . DG  I  5 137 ? -63.250 -41.108 61.510 1.00 131.19 ? 64   DG  I C5    1 
ATOM   8885  C  C6    . DG  I  5 137 ? -62.020 -40.472 61.200 1.00 131.26 ? 64   DG  I C6    1 
ATOM   8886  O  O6    . DG  I  5 137 ? -61.763 -39.260 61.253 1.00 131.21 ? 64   DG  I O6    1 
ATOM   8887  N  N1    . DG  I  5 137 ? -61.043 -41.384 60.786 1.00 131.14 ? 64   DG  I N1    1 
ATOM   8888  C  C2    . DG  I  5 137 ? -61.234 -42.747 60.689 1.00 131.00 ? 64   DG  I C2    1 
ATOM   8889  N  N2    . DG  I  5 137 ? -60.185 -43.471 60.277 1.00 130.83 ? 64   DG  I N2    1 
ATOM   8890  N  N3    . DG  I  5 137 ? -62.381 -43.356 60.980 1.00 131.01 ? 64   DG  I N3    1 
ATOM   8891  C  C4    . DG  I  5 137 ? -63.345 -42.483 61.380 1.00 130.96 ? 64   DG  I C4    1 
ATOM   8892  P  P     . DA  I  5 138 ? -66.603 -47.040 64.118 1.00 130.90 ? 65   DA  I P     1 
ATOM   8893  O  OP1   . DA  I  5 138 ? -67.513 -48.161 64.449 1.00 131.34 ? 65   DA  I OP1   1 
ATOM   8894  O  OP2   . DA  I  5 138 ? -66.657 -45.797 64.925 1.00 130.34 ? 65   DA  I OP2   1 
ATOM   8895  O  "O5'" . DA  I  5 138 ? -65.101 -47.594 64.145 1.00 129.52 ? 65   DA  I "O5'" 1 
ATOM   8896  C  "C5'" . DA  I  5 138 ? -64.685 -48.609 63.233 1.00 127.70 ? 65   DA  I "C5'" 1 
ATOM   8897  C  "C4'" . DA  I  5 138 ? -63.172 -48.675 63.204 1.00 126.49 ? 65   DA  I "C4'" 1 
ATOM   8898  O  "O4'" . DA  I  5 138 ? -62.634 -47.379 62.826 1.00 126.49 ? 65   DA  I "O4'" 1 
ATOM   8899  C  "C3'" . DA  I  5 138 ? -62.537 -49.049 64.541 1.00 125.88 ? 65   DA  I "C3'" 1 
ATOM   8900  O  "O3'" . DA  I  5 138 ? -61.553 -50.080 64.305 1.00 124.88 ? 65   DA  I "O3'" 1 
ATOM   8901  C  "C2'" . DA  I  5 138 ? -61.999 -47.716 65.075 1.00 126.03 ? 65   DA  I "C2'" 1 
ATOM   8902  C  "C1'" . DA  I  5 138 ? -61.694 -46.937 63.796 1.00 126.12 ? 65   DA  I "C1'" 1 
ATOM   8903  N  N9    . DA  I  5 138 ? -61.784 -45.478 63.951 1.00 126.15 ? 65   DA  I N9    1 
ATOM   8904  C  C8    . DA  I  5 138 ? -62.925 -44.740 64.139 1.00 126.13 ? 65   DA  I C8    1 
ATOM   8905  N  N7    . DA  I  5 138 ? -62.734 -43.447 64.250 1.00 125.94 ? 65   DA  I N7    1 
ATOM   8906  C  C5    . DA  I  5 138 ? -61.363 -43.317 64.129 1.00 126.08 ? 65   DA  I C5    1 
ATOM   8907  C  C6    . DA  I  5 138 ? -60.519 -42.187 64.158 1.00 125.77 ? 65   DA  I C6    1 
ATOM   8908  N  N6    . DA  I  5 138 ? -60.974 -40.943 64.327 1.00 125.61 ? 65   DA  I N6    1 
ATOM   8909  N  N1    . DA  I  5 138 ? -59.191 -42.393 64.009 1.00 125.79 ? 65   DA  I N1    1 
ATOM   8910  C  C2    . DA  I  5 138 ? -58.742 -43.648 63.834 1.00 125.86 ? 65   DA  I C2    1 
ATOM   8911  N  N3    . DA  I  5 138 ? -59.437 -44.790 63.794 1.00 125.90 ? 65   DA  I N3    1 
ATOM   8912  C  C4    . DA  I  5 138 ? -60.756 -44.557 63.946 1.00 126.13 ? 65   DA  I C4    1 
ATOM   8913  P  P     . DT  I  5 139 ? -60.195 -50.272 65.144 1.00 123.94 ? 66   DT  I P     1 
ATOM   8914  O  OP1   . DT  I  5 139 ? -59.469 -51.457 64.626 1.00 123.18 ? 66   DT  I OP1   1 
ATOM   8915  O  OP2   . DT  I  5 139 ? -60.520 -50.182 66.589 1.00 123.49 ? 66   DT  I OP2   1 
ATOM   8916  O  "O5'" . DT  I  5 139 ? -59.396 -48.952 64.710 1.00 123.47 ? 66   DT  I "O5'" 1 
ATOM   8917  C  "C5'" . DT  I  5 139 ? -58.112 -48.993 64.090 1.00 121.55 ? 66   DT  I "C5'" 1 
ATOM   8918  C  "C4'" . DT  I  5 139 ? -57.131 -48.154 64.892 1.00 119.50 ? 66   DT  I "C4'" 1 
ATOM   8919  O  "O4'" . DT  I  5 139 ? -57.687 -46.830 65.117 1.00 118.75 ? 66   DT  I "O4'" 1 
ATOM   8920  C  "C3'" . DT  I  5 139 ? -56.749 -48.704 66.268 1.00 118.49 ? 66   DT  I "C3'" 1 
ATOM   8921  O  "O3'" . DT  I  5 139 ? -55.324 -48.806 66.218 1.00 118.19 ? 66   DT  I "O3'" 1 
ATOM   8922  C  "C2'" . DT  I  5 139 ? -57.297 -47.671 67.267 1.00 117.51 ? 66   DT  I "C2'" 1 
ATOM   8923  C  "C1'" . DT  I  5 139 ? -57.332 -46.402 66.419 1.00 117.38 ? 66   DT  I "C1'" 1 
ATOM   8924  N  N1    . DT  I  5 139 ? -58.288 -45.303 66.823 1.00 117.04 ? 66   DT  I N1    1 
ATOM   8925  C  C2    . DT  I  5 139 ? -57.832 -43.997 66.797 1.00 116.66 ? 66   DT  I C2    1 
ATOM   8926  O  O2    . DT  I  5 139 ? -56.702 -43.681 66.475 1.00 116.41 ? 66   DT  I O2    1 
ATOM   8927  N  N3    . DT  I  5 139 ? -58.754 -43.046 67.160 1.00 116.63 ? 66   DT  I N3    1 
ATOM   8928  C  C4    . DT  I  5 139 ? -60.065 -43.260 67.541 1.00 116.77 ? 66   DT  I C4    1 
ATOM   8929  O  O4    . DT  I  5 139 ? -60.800 -42.325 67.848 1.00 116.48 ? 66   DT  I O4    1 
ATOM   8930  C  C5    . DT  I  5 139 ? -60.486 -44.646 67.546 1.00 116.65 ? 66   DT  I C5    1 
ATOM   8931  C  C7    . DT  I  5 139 ? -61.884 -45.012 67.942 1.00 116.85 ? 66   DT  I C7    1 
ATOM   8932  C  C6    . DT  I  5 139 ? -59.595 -45.588 67.188 1.00 116.91 ? 66   DT  I C6    1 
ATOM   8933  P  P     . DA  I  5 140 ? -54.327 -49.190 67.420 1.00 117.52 ? 67   DA  I P     1 
ATOM   8934  O  OP1   . DA  I  5 140 ? -53.914 -50.602 67.216 1.00 116.91 ? 67   DA  I OP1   1 
ATOM   8935  O  OP2   . DA  I  5 140 ? -54.910 -48.765 68.716 1.00 116.72 ? 67   DA  I OP2   1 
ATOM   8936  O  "O5'" . DA  I  5 140 ? -53.092 -48.207 67.094 1.00 116.15 ? 67   DA  I "O5'" 1 
ATOM   8937  C  "C5'" . DA  I  5 140 ? -53.307 -47.018 66.290 1.00 114.01 ? 67   DA  I "C5'" 1 
ATOM   8938  C  "C4'" . DA  I  5 140 ? -52.461 -45.804 66.693 1.00 112.30 ? 67   DA  I "C4'" 1 
ATOM   8939  O  "O4'" . DA  I  5 140 ? -53.295 -44.645 67.020 1.00 111.66 ? 67   DA  I "O4'" 1 
ATOM   8940  C  "C3'" . DA  I  5 140 ? -51.461 -45.927 67.837 1.00 111.42 ? 67   DA  I "C3'" 1 
ATOM   8941  O  "O3'" . DA  I  5 140 ? -50.288 -45.236 67.384 1.00 110.90 ? 67   DA  I "O3'" 1 
ATOM   8942  C  "C2'" . DA  I  5 140 ? -52.175 -45.251 69.020 1.00 110.79 ? 67   DA  I "C2'" 1 
ATOM   8943  C  "C1'" . DA  I  5 140 ? -53.065 -44.202 68.353 1.00 109.71 ? 67   DA  I "C1'" 1 
ATOM   8944  N  N9    . DA  I  5 140 ? -54.394 -43.990 68.934 1.00 109.23 ? 67   DA  I N9    1 
ATOM   8945  C  C8    . DA  I  5 140 ? -55.347 -44.939 69.183 1.00 109.02 ? 67   DA  I C8    1 
ATOM   8946  N  N7    . DA  I  5 140 ? -56.468 -44.469 69.679 1.00 108.63 ? 67   DA  I N7    1 
ATOM   8947  C  C5    . DA  I  5 140 ? -56.246 -43.112 69.755 1.00 108.90 ? 67   DA  I C5    1 
ATOM   8948  C  C6    . DA  I  5 140 ? -57.051 -42.044 70.202 1.00 109.17 ? 67   DA  I C6    1 
ATOM   8949  N  N6    . DA  I  5 140 ? -58.291 -42.207 70.668 1.00 109.16 ? 67   DA  I N6    1 
ATOM   8950  N  N1    . DA  I  5 140 ? -56.535 -40.795 70.145 1.00 109.21 ? 67   DA  I N1    1 
ATOM   8951  C  C2    . DA  I  5 140 ? -55.290 -40.632 69.675 1.00 108.82 ? 67   DA  I C2    1 
ATOM   8952  N  N3    . DA  I  5 140 ? -54.440 -41.560 69.228 1.00 108.71 ? 67   DA  I N3    1 
ATOM   8953  C  C4    . DA  I  5 140 ? -54.977 -42.793 69.294 1.00 109.02 ? 67   DA  I C4    1 
ATOM   8954  P  P     . DT  I  5 141 ? -48.996 -44.953 68.289 1.00 109.78 ? 68   DT  I P     1 
ATOM   8955  O  OP1   . DT  I  5 141 ? -47.874 -44.678 67.355 1.00 109.83 ? 68   DT  I OP1   1 
ATOM   8956  O  OP2   . DT  I  5 141 ? -48.899 -46.032 69.308 1.00 109.18 ? 68   DT  I OP2   1 
ATOM   8957  O  "O5'" . DT  I  5 141 ? -49.355 -43.572 69.016 1.00 107.96 ? 68   DT  I "O5'" 1 
ATOM   8958  C  "C5'" . DT  I  5 141 ? -49.512 -42.377 68.250 1.00 106.06 ? 68   DT  I "C5'" 1 
ATOM   8959  C  "C4'" . DT  I  5 141 ? -49.716 -41.195 69.180 1.00 104.54 ? 68   DT  I "C4'" 1 
ATOM   8960  O  "O4'" . DT  I  5 141 ? -51.051 -41.229 69.750 1.00 104.93 ? 68   DT  I "O4'" 1 
ATOM   8961  C  "C3'" . DT  I  5 141 ? -48.757 -41.113 70.369 1.00 102.98 ? 68   DT  I "C3'" 1 
ATOM   8962  O  "O3'" . DT  I  5 141 ? -48.229 -39.793 70.371 1.00 100.42 ? 68   DT  I "O3'" 1 
ATOM   8963  C  "C2'" . DT  I  5 141 ? -49.622 -41.413 71.599 1.00 103.20 ? 68   DT  I "C2'" 1 
ATOM   8964  C  "C1'" . DT  I  5 141 ? -50.982 -40.906 71.132 1.00 104.24 ? 68   DT  I "C1'" 1 
ATOM   8965  N  N1    . DT  I  5 141 ? -52.207 -41.472 71.810 1.00 104.24 ? 68   DT  I N1    1 
ATOM   8966  C  C2    . DT  I  5 141 ? -53.182 -40.599 72.276 1.00 104.53 ? 68   DT  I C2    1 
ATOM   8967  O  O2    . DT  I  5 141 ? -53.126 -39.379 72.194 1.00 104.16 ? 68   DT  I O2    1 
ATOM   8968  N  N3    . DT  I  5 141 ? -54.263 -41.213 72.859 1.00 104.64 ? 68   DT  I N3    1 
ATOM   8969  C  C4    . DT  I  5 141 ? -54.471 -42.569 73.021 1.00 104.62 ? 68   DT  I C4    1 
ATOM   8970  O  O4    . DT  I  5 141 ? -55.494 -42.986 73.562 1.00 104.81 ? 68   DT  I O4    1 
ATOM   8971  C  C5    . DT  I  5 141 ? -53.421 -43.426 72.510 1.00 104.02 ? 68   DT  I C5    1 
ATOM   8972  C  C7    . DT  I  5 141 ? -53.520 -44.919 72.612 1.00 103.99 ? 68   DT  I C7    1 
ATOM   8973  C  C6    . DT  I  5 141 ? -52.361 -42.844 71.935 1.00 103.99 ? 68   DT  I C6    1 
ATOM   8974  P  P     . DT  I  5 142 ? -47.108 -39.290 71.398 1.00 97.99  ? 69   DT  I P     1 
ATOM   8975  O  OP1   . DT  I  5 142 ? -46.279 -38.299 70.675 1.00 97.91  ? 69   DT  I OP1   1 
ATOM   8976  O  OP2   . DT  I  5 142 ? -46.472 -40.471 72.035 1.00 97.26  ? 69   DT  I OP2   1 
ATOM   8977  O  "O5'" . DT  I  5 142 ? -47.993 -38.494 72.467 1.00 95.79  ? 69   DT  I "O5'" 1 
ATOM   8978  C  "C5'" . DT  I  5 142 ? -48.666 -37.326 72.041 1.00 93.61  ? 69   DT  I "C5'" 1 
ATOM   8979  C  "C4'" . DT  I  5 142 ? -49.473 -36.756 73.179 1.00 93.06  ? 69   DT  I "C4'" 1 
ATOM   8980  O  "O4'" . DT  I  5 142 ? -50.505 -37.694 73.541 1.00 93.35  ? 69   DT  I "O4'" 1 
ATOM   8981  C  "C3'" . DT  I  5 142 ? -48.678 -36.523 74.452 1.00 92.93  ? 69   DT  I "C3'" 1 
ATOM   8982  O  "O3'" . DT  I  5 142 ? -49.036 -35.236 74.892 1.00 92.47  ? 69   DT  I "O3'" 1 
ATOM   8983  C  "C2'" . DT  I  5 142 ? -49.120 -37.635 75.413 1.00 92.48  ? 69   DT  I "C2'" 1 
ATOM   8984  C  "C1'" . DT  I  5 142 ? -50.558 -37.825 74.951 1.00 92.68  ? 69   DT  I "C1'" 1 
ATOM   8985  N  N1    . DT  I  5 142 ? -51.237 -39.134 75.225 1.00 92.01  ? 69   DT  I N1    1 
ATOM   8986  C  C2    . DT  I  5 142 ? -52.579 -39.114 75.574 1.00 92.30  ? 69   DT  I C2    1 
ATOM   8987  O  O2    . DT  I  5 142 ? -53.245 -38.092 75.704 1.00 92.05  ? 69   DT  I O2    1 
ATOM   8988  N  N3    . DT  I  5 142 ? -53.132 -40.353 75.786 1.00 92.26  ? 69   DT  I N3    1 
ATOM   8989  C  C4    . DT  I  5 142 ? -52.501 -41.574 75.680 1.00 92.37  ? 69   DT  I C4    1 
ATOM   8990  O  O4    . DT  I  5 142 ? -53.116 -42.616 75.894 1.00 92.68  ? 69   DT  I O4    1 
ATOM   8991  C  C5    . DT  I  5 142 ? -51.098 -41.521 75.309 1.00 92.15  ? 69   DT  I C5    1 
ATOM   8992  C  C7    . DT  I  5 142 ? -50.283 -42.776 75.157 1.00 92.29  ? 69   DT  I C7    1 
ATOM   8993  C  C6    . DT  I  5 142 ? -50.545 -40.320 75.094 1.00 91.48  ? 69   DT  I C6    1 
ATOM   8994  P  P     . DG  I  5 143 ? -48.134 -34.503 75.975 1.00 91.74  ? 70   DG  I P     1 
ATOM   8995  O  OP1   . DG  I  5 143 ? -48.007 -33.086 75.543 1.00 91.70  ? 70   DG  I OP1   1 
ATOM   8996  O  OP2   . DG  I  5 143 ? -46.957 -35.357 76.252 1.00 90.74  ? 70   DG  I OP2   1 
ATOM   8997  O  "O5'" . DG  I  5 143 ? -49.098 -34.510 77.232 1.00 93.43  ? 70   DG  I "O5'" 1 
ATOM   8998  C  "C5'" . DG  I  5 143 ? -50.395 -33.923 77.059 1.00 96.78  ? 70   DG  I "C5'" 1 
ATOM   8999  C  "C4'" . DG  I  5 143 ? -51.308 -34.282 78.219 1.00 98.81  ? 70   DG  I "C4'" 1 
ATOM   9000  O  "O4'" . DG  I  5 143 ? -51.709 -35.678 78.130 1.00 98.57  ? 70   DG  I "O4'" 1 
ATOM   9001  C  "C3'" . DG  I  5 143 ? -50.661 -34.128 79.589 1.00 100.30 ? 70   DG  I "C3'" 1 
ATOM   9002  O  "O3'" . DG  I  5 143 ? -51.672 -33.638 80.426 1.00 103.57 ? 70   DG  I "O3'" 1 
ATOM   9003  C  "C2'" . DG  I  5 143 ? -50.241 -35.554 79.951 1.00 99.49  ? 70   DG  I "C2'" 1 
ATOM   9004  C  "C1'" . DG  I  5 143 ? -51.440 -36.294 79.373 1.00 99.03  ? 70   DG  I "C1'" 1 
ATOM   9005  N  N9    . DG  I  5 143 ? -51.291 -37.730 79.169 1.00 98.98  ? 70   DG  I N9    1 
ATOM   9006  C  C8    . DG  I  5 143 ? -50.164 -38.452 78.843 1.00 99.05  ? 70   DG  I C8    1 
ATOM   9007  N  N7    . DG  I  5 143 ? -50.388 -39.738 78.739 1.00 99.29  ? 70   DG  I N7    1 
ATOM   9008  C  C5    . DG  I  5 143 ? -51.752 -39.875 79.014 1.00 99.35  ? 70   DG  I C5    1 
ATOM   9009  C  C6    . DG  I  5 143 ? -52.591 -41.029 79.055 1.00 99.13  ? 70   DG  I C6    1 
ATOM   9010  O  O6    . DG  I  5 143 ? -52.281 -42.212 78.845 1.00 99.03  ? 70   DG  I O6    1 
ATOM   9011  N  N1    . DG  I  5 143 ? -53.918 -40.712 79.374 1.00 99.11  ? 70   DG  I N1    1 
ATOM   9012  C  C2    . DG  I  5 143 ? -54.382 -39.436 79.636 1.00 99.31  ? 70   DG  I C2    1 
ATOM   9013  N  N2    . DG  I  5 143 ? -55.685 -39.310 79.932 1.00 99.03  ? 70   DG  I N2    1 
ATOM   9014  N  N3    . DG  I  5 143 ? -53.612 -38.349 79.599 1.00 99.46  ? 70   DG  I N3    1 
ATOM   9015  C  C4    . DG  I  5 143 ? -52.318 -38.641 79.278 1.00 99.29  ? 70   DG  I C4    1 
ATOM   9016  P  P     . DA  I  5 144 ? -51.323 -32.901 81.797 1.00 106.45 ? 71   DA  I P     1 
ATOM   9017  O  OP1   . DA  I  5 144 ? -51.370 -31.449 81.489 1.00 106.72 ? 71   DA  I OP1   1 
ATOM   9018  O  OP2   . DA  I  5 144 ? -50.138 -33.532 82.432 1.00 104.93 ? 71   DA  I OP2   1 
ATOM   9019  O  "O5'" . DA  I  5 144 ? -52.576 -33.280 82.717 1.00 107.62 ? 71   DA  I "O5'" 1 
ATOM   9020  C  "C5'" . DA  I  5 144 ? -53.926 -33.224 82.245 1.00 108.91 ? 71   DA  I "C5'" 1 
ATOM   9021  C  "C4'" . DA  I  5 144 ? -54.705 -34.234 83.061 1.00 109.83 ? 71   DA  I "C4'" 1 
ATOM   9022  O  "O4'" . DA  I  5 144 ? -54.445 -35.545 82.510 1.00 109.50 ? 71   DA  I "O4'" 1 
ATOM   9023  C  "C3'" . DA  I  5 144 ? -54.237 -34.270 84.515 1.00 111.01 ? 71   DA  I "C3'" 1 
ATOM   9024  O  "O3'" . DA  I  5 144 ? -55.310 -34.023 85.426 1.00 113.48 ? 71   DA  I "O3'" 1 
ATOM   9025  C  "C2'" . DA  I  5 144 ? -53.618 -35.651 84.709 1.00 110.24 ? 71   DA  I "C2'" 1 
ATOM   9026  C  "C1'" . DA  I  5 144 ? -54.199 -36.454 83.557 1.00 109.23 ? 71   DA  I "C1'" 1 
ATOM   9027  N  N9    . DA  I  5 144 ? -53.262 -37.473 83.107 1.00 108.93 ? 71   DA  I N9    1 
ATOM   9028  C  C8    . DA  I  5 144 ? -51.993 -37.288 82.637 1.00 108.79 ? 71   DA  I C8    1 
ATOM   9029  N  N7    . DA  I  5 144 ? -51.374 -38.404 82.320 1.00 108.72 ? 71   DA  I N7    1 
ATOM   9030  C  C5    . DA  I  5 144 ? -52.302 -39.389 82.607 1.00 108.70 ? 71   DA  I C5    1 
ATOM   9031  C  C6    . DA  I  5 144 ? -52.273 -40.799 82.497 1.00 108.61 ? 71   DA  I C6    1 
ATOM   9032  N  N6    . DA  I  5 144 ? -51.222 -41.479 82.040 1.00 108.71 ? 71   DA  I N6    1 
ATOM   9033  N  N1    . DA  I  5 144 ? -53.371 -41.489 82.880 1.00 108.86 ? 71   DA  I N1    1 
ATOM   9034  C  C2    . DA  I  5 144 ? -54.433 -40.808 83.338 1.00 109.28 ? 71   DA  I C2    1 
ATOM   9035  N  N3    . DA  I  5 144 ? -54.576 -39.484 83.487 1.00 109.25 ? 71   DA  I N3    1 
ATOM   9036  C  C4    . DA  I  5 144 ? -53.469 -38.828 83.099 1.00 108.83 ? 71   DA  I C4    1 
ATOM   9037  P  P     . DT  I  5 145 ? -55.033 -33.625 86.968 1.00 115.74 ? 72   DT  I P     1 
ATOM   9038  O  OP1   . DT  I  5 145 ? -56.067 -32.629 87.341 1.00 115.22 ? 72   DT  I OP1   1 
ATOM   9039  O  OP2   . DT  I  5 145 ? -53.600 -33.272 87.178 1.00 115.10 ? 72   DT  I OP2   1 
ATOM   9040  O  "O5'" . DT  I  5 145 ? -55.310 -35.010 87.742 1.00 115.40 ? 72   DT  I "O5'" 1 
ATOM   9041  C  "C5'" . DT  I  5 145 ? -56.492 -35.764 87.458 1.00 115.06 ? 72   DT  I "C5'" 1 
ATOM   9042  C  "C4'" . DT  I  5 145 ? -56.312 -37.223 87.832 1.00 114.82 ? 72   DT  I "C4'" 1 
ATOM   9043  O  "O4'" . DT  I  5 145 ? -55.389 -37.864 86.910 1.00 114.69 ? 72   DT  I "O4'" 1 
ATOM   9044  C  "C3'" . DT  I  5 145 ? -55.745 -37.448 89.236 1.00 115.02 ? 72   DT  I "C3'" 1 
ATOM   9045  O  "O3'" . DT  I  5 145 ? -56.631 -38.280 89.983 1.00 115.06 ? 72   DT  I "O3'" 1 
ATOM   9046  C  "C2'" . DT  I  5 145 ? -54.402 -38.133 88.989 1.00 114.53 ? 72   DT  I "C2'" 1 
ATOM   9047  C  "C1'" . DT  I  5 145 ? -54.698 -38.831 87.666 1.00 113.89 ? 72   DT  I "C1'" 1 
ATOM   9048  N  N1    . DT  I  5 145 ? -53.486 -39.373 86.970 1.00 113.45 ? 72   DT  I N1    1 
ATOM   9049  C  C2    . DT  I  5 145 ? -53.428 -40.732 86.729 1.00 113.24 ? 72   DT  I C2    1 
ATOM   9050  O  O2    . DT  I  5 145 ? -54.315 -41.517 87.027 1.00 113.39 ? 72   DT  I O2    1 
ATOM   9051  N  N3    . DT  I  5 145 ? -52.283 -41.150 86.109 1.00 113.06 ? 72   DT  I N3    1 
ATOM   9052  C  C4    . DT  I  5 145 ? -51.212 -40.374 85.719 1.00 113.09 ? 72   DT  I C4    1 
ATOM   9053  O  O4    . DT  I  5 145 ? -50.238 -40.875 85.172 1.00 113.34 ? 72   DT  I O4    1 
ATOM   9054  C  C5    . DT  I  5 145 ? -51.327 -38.963 86.004 1.00 112.87 ? 72   DT  I C5    1 
ATOM   9055  C  C7    . DT  I  5 145 ? -50.228 -38.015 85.634 1.00 112.93 ? 72   DT  I C7    1 
ATOM   9056  C  C6    . DT  I  5 145 ? -52.444 -38.536 86.611 1.00 113.25 ? 72   DT  I C6    1 
ATOM   9057  O  "O5'" . DA  J  6 1   ? -49.806 -51.679 82.985 1.00 136.31 ? -72  DA  J "O5'" 1 
ATOM   9058  C  "C5'" . DA  J  6 1   ? -50.623 -50.457 83.052 1.00 136.79 ? -72  DA  J "C5'" 1 
ATOM   9059  C  "C4'" . DA  J  6 1   ? -51.561 -50.528 84.256 1.00 136.94 ? -72  DA  J "C4'" 1 
ATOM   9060  O  "O4'" . DA  J  6 1   ? -50.939 -49.897 85.410 1.00 136.54 ? -72  DA  J "O4'" 1 
ATOM   9061  C  "C3'" . DA  J  6 1   ? -52.917 -49.852 84.052 1.00 136.92 ? -72  DA  J "C3'" 1 
ATOM   9062  O  "O3'" . DA  J  6 1   ? -53.948 -50.830 84.112 1.00 137.71 ? -72  DA  J "O3'" 1 
ATOM   9063  C  "C2'" . DA  J  6 1   ? -53.064 -48.836 85.185 1.00 136.20 ? -72  DA  J "C2'" 1 
ATOM   9064  C  "C1'" . DA  J  6 1   ? -51.675 -48.753 85.807 1.00 135.49 ? -72  DA  J "C1'" 1 
ATOM   9065  N  N9    . DA  J  6 1   ? -50.924 -47.542 85.467 1.00 135.18 ? -72  DA  J N9    1 
ATOM   9066  C  C8    . DA  J  6 1   ? -49.671 -47.484 84.919 1.00 134.95 ? -72  DA  J C8    1 
ATOM   9067  N  N7    . DA  J  6 1   ? -49.225 -46.264 84.735 1.00 135.12 ? -72  DA  J N7    1 
ATOM   9068  C  C5    . DA  J  6 1   ? -50.257 -45.462 85.199 1.00 135.22 ? -72  DA  J C5    1 
ATOM   9069  C  C6    . DA  J  6 1   ? -50.412 -44.059 85.280 1.00 135.05 ? -72  DA  J C6    1 
ATOM   9070  N  N6    . DA  J  6 1   ? -49.474 -43.198 84.872 1.00 134.73 ? -72  DA  J N6    1 
ATOM   9071  N  N1    . DA  J  6 1   ? -51.569 -43.579 85.792 1.00 134.81 ? -72  DA  J N1    1 
ATOM   9072  C  C2    . DA  J  6 1   ? -52.510 -44.443 86.199 1.00 134.79 ? -72  DA  J C2    1 
ATOM   9073  N  N3    . DA  J  6 1   ? -52.477 -45.776 86.174 1.00 134.76 ? -72  DA  J N3    1 
ATOM   9074  C  C4    . DA  J  6 1   ? -51.316 -46.232 85.658 1.00 135.10 ? -72  DA  J C4    1 
ATOM   9075  P  P     . DT  J  6 2   ? -55.442 -50.519 83.605 1.00 138.61 ? -71  DT  J P     1 
ATOM   9076  O  OP1   . DT  J  6 2   ? -56.167 -51.814 83.639 1.00 138.43 ? -71  DT  J OP1   1 
ATOM   9077  O  OP2   . DT  J  6 2   ? -55.378 -49.748 82.339 1.00 138.39 ? -71  DT  J OP2   1 
ATOM   9078  O  "O5'" . DT  J  6 2   ? -56.012 -49.543 84.740 1.00 137.58 ? -71  DT  J "O5'" 1 
ATOM   9079  C  "C5'" . DT  J  6 2   ? -57.379 -49.600 85.114 1.00 136.77 ? -71  DT  J "C5'" 1 
ATOM   9080  C  "C4'" . DT  J  6 2   ? -58.113 -48.389 84.577 1.00 135.90 ? -71  DT  J "C4'" 1 
ATOM   9081  O  "O4'" . DT  J  6 2   ? -57.240 -47.231 84.618 1.00 135.66 ? -71  DT  J "O4'" 1 
ATOM   9082  C  "C3'" . DT  J  6 2   ? -58.627 -48.511 83.143 1.00 135.35 ? -71  DT  J "C3'" 1 
ATOM   9083  O  "O3'" . DT  J  6 2   ? -60.050 -48.229 83.032 1.00 134.86 ? -71  DT  J "O3'" 1 
ATOM   9084  C  "C2'" . DT  J  6 2   ? -57.746 -47.556 82.330 1.00 135.49 ? -71  DT  J "C2'" 1 
ATOM   9085  C  "C1'" . DT  J  6 2   ? -57.269 -46.547 83.378 1.00 135.29 ? -71  DT  J "C1'" 1 
ATOM   9086  N  N1    . DT  J  6 2   ? -55.914 -45.894 83.160 1.00 135.21 ? -71  DT  J N1    1 
ATOM   9087  C  C2    . DT  J  6 2   ? -55.787 -44.530 83.377 1.00 135.20 ? -71  DT  J C2    1 
ATOM   9088  O  O2    . DT  J  6 2   ? -56.705 -43.801 83.720 1.00 135.11 ? -71  DT  J O2    1 
ATOM   9089  N  N3    . DT  J  6 2   ? -54.523 -44.030 83.169 1.00 134.96 ? -71  DT  J N3    1 
ATOM   9090  C  C4    . DT  J  6 2   ? -53.395 -44.728 82.782 1.00 134.81 ? -71  DT  J C4    1 
ATOM   9091  O  O4    . DT  J  6 2   ? -52.310 -44.180 82.624 1.00 134.79 ? -71  DT  J O4    1 
ATOM   9092  C  C5    . DT  J  6 2   ? -53.582 -46.140 82.578 1.00 135.08 ? -71  DT  J C5    1 
ATOM   9093  C  C7    . DT  J  6 2   ? -52.415 -46.985 82.150 1.00 135.23 ? -71  DT  J C7    1 
ATOM   9094  C  C6    . DT  J  6 2   ? -54.813 -46.650 82.777 1.00 135.25 ? -71  DT  J C6    1 
ATOM   9095  P  P     . DC  J  6 3   ? -60.901 -47.134 83.871 1.00 134.55 ? -70  DC  J P     1 
ATOM   9096  O  OP1   . DC  J  6 3   ? -60.473 -47.120 85.293 1.00 134.23 ? -70  DC  J OP1   1 
ATOM   9097  O  OP2   . DC  J  6 3   ? -62.329 -47.371 83.554 1.00 134.73 ? -70  DC  J OP2   1 
ATOM   9098  O  "O5'" . DC  J  6 3   ? -60.516 -45.734 83.188 1.00 133.75 ? -70  DC  J "O5'" 1 
ATOM   9099  C  "C5'" . DC  J  6 3   ? -61.071 -44.504 83.677 1.00 131.70 ? -70  DC  J "C5'" 1 
ATOM   9100  C  "C4'" . DC  J  6 3   ? -60.805 -43.356 82.715 1.00 130.25 ? -70  DC  J "C4'" 1 
ATOM   9101  O  "O4'" . DC  J  6 3   ? -59.396 -43.270 82.363 1.00 129.95 ? -70  DC  J "O4'" 1 
ATOM   9102  C  "C3'" . DC  J  6 3   ? -61.531 -43.455 81.381 1.00 129.52 ? -70  DC  J "C3'" 1 
ATOM   9103  O  "O3'" . DC  J  6 3   ? -61.983 -42.164 81.061 1.00 128.87 ? -70  DC  J "O3'" 1 
ATOM   9104  C  "C2'" . DC  J  6 3   ? -60.450 -43.895 80.401 1.00 129.31 ? -70  DC  J "C2'" 1 
ATOM   9105  C  "C1'" . DC  J  6 3   ? -59.309 -43.061 80.966 1.00 128.80 ? -70  DC  J "C1'" 1 
ATOM   9106  N  N1    . DC  J  6 3   ? -57.942 -43.410 80.498 1.00 128.28 ? -70  DC  J N1    1 
ATOM   9107  C  C2    . DC  J  6 3   ? -56.925 -42.448 80.611 1.00 127.87 ? -70  DC  J C2    1 
ATOM   9108  O  O2    . DC  J  6 3   ? -57.180 -41.330 81.087 1.00 127.67 ? -70  DC  J O2    1 
ATOM   9109  N  N3    . DC  J  6 3   ? -55.680 -42.777 80.188 1.00 127.74 ? -70  DC  J N3    1 
ATOM   9110  C  C4    . DC  J  6 3   ? -55.439 -43.993 79.680 1.00 128.01 ? -70  DC  J C4    1 
ATOM   9111  N  N4    . DC  J  6 3   ? -54.197 -44.264 79.278 1.00 128.16 ? -70  DC  J N4    1 
ATOM   9112  C  C5    . DC  J  6 3   ? -56.457 -44.988 79.557 1.00 128.07 ? -70  DC  J C5    1 
ATOM   9113  C  C6    . DC  J  6 3   ? -57.684 -44.653 79.977 1.00 128.45 ? -70  DC  J C6    1 
ATOM   9114  P  P     . DA  J  6 4   ? -63.556 -41.941 81.001 1.00 128.51 ? -69  DA  J P     1 
ATOM   9115  O  OP1   . DA  J  6 4   ? -64.043 -42.036 82.399 1.00 128.27 ? -69  DA  J OP1   1 
ATOM   9116  O  OP2   . DA  J  6 4   ? -64.060 -42.850 79.939 1.00 128.41 ? -69  DA  J OP2   1 
ATOM   9117  O  "O5'" . DA  J  6 4   ? -63.760 -40.437 80.476 1.00 126.70 ? -69  DA  J "O5'" 1 
ATOM   9118  C  "C5'" . DA  J  6 4   ? -62.908 -39.363 80.890 1.00 123.57 ? -69  DA  J "C5'" 1 
ATOM   9119  C  "C4'" . DA  J  6 4   ? -62.136 -38.766 79.721 1.00 120.95 ? -69  DA  J "C4'" 1 
ATOM   9120  O  "O4'" . DA  J  6 4   ? -60.904 -39.501 79.503 1.00 119.32 ? -69  DA  J "O4'" 1 
ATOM   9121  C  "C3'" . DA  J  6 4   ? -62.840 -38.716 78.360 1.00 120.17 ? -69  DA  J "C3'" 1 
ATOM   9122  O  "O3'" . DA  J  6 4   ? -62.572 -37.462 77.759 1.00 120.54 ? -69  DA  J "O3'" 1 
ATOM   9123  C  "C2'" . DA  J  6 4   ? -62.131 -39.813 77.572 1.00 119.34 ? -69  DA  J "C2'" 1 
ATOM   9124  C  "C1'" . DA  J  6 4   ? -60.726 -39.541 78.103 1.00 117.69 ? -69  DA  J "C1'" 1 
ATOM   9125  N  N9    . DA  J  6 4   ? -59.668 -40.484 77.744 1.00 117.09 ? -69  DA  J N9    1 
ATOM   9126  C  C8    . DA  J  6 4   ? -59.742 -41.844 77.631 1.00 116.79 ? -69  DA  J C8    1 
ATOM   9127  N  N7    . DA  J  6 4   ? -58.606 -42.407 77.299 1.00 116.71 ? -69  DA  J N7    1 
ATOM   9128  C  C5    . DA  J  6 4   ? -57.733 -41.339 77.177 1.00 116.30 ? -69  DA  J C5    1 
ATOM   9129  C  C6    . DA  J  6 4   ? -56.372 -41.254 76.841 1.00 116.21 ? -69  DA  J C6    1 
ATOM   9130  N  N6    . DA  J  6 4   ? -55.627 -42.317 76.557 1.00 116.61 ? -69  DA  J N6    1 
ATOM   9131  N  N1    . DA  J  6 4   ? -55.798 -40.038 76.811 1.00 116.39 ? -69  DA  J N1    1 
ATOM   9132  C  C2    . DA  J  6 4   ? -56.540 -38.964 77.100 1.00 116.46 ? -69  DA  J C2    1 
ATOM   9133  N  N3    . DA  J  6 4   ? -57.826 -38.914 77.429 1.00 116.43 ? -69  DA  J N3    1 
ATOM   9134  C  C4    . DA  J  6 4   ? -58.368 -40.147 77.451 1.00 116.62 ? -69  DA  J C4    1 
ATOM   9135  P  P     . DA  J  6 5   ? -63.574 -36.223 77.921 1.00 121.36 ? -68  DA  J P     1 
ATOM   9136  O  OP1   . DA  J  6 5   ? -63.594 -35.807 79.351 1.00 121.16 ? -68  DA  J OP1   1 
ATOM   9137  O  OP2   . DA  J  6 5   ? -64.819 -36.618 77.216 1.00 121.46 ? -68  DA  J OP2   1 
ATOM   9138  O  "O5'" . DA  J  6 5   ? -62.877 -35.062 77.061 1.00 119.49 ? -68  DA  J "O5'" 1 
ATOM   9139  C  "C5'" . DA  J  6 5   ? -61.641 -34.460 77.489 1.00 116.96 ? -68  DA  J "C5'" 1 
ATOM   9140  C  "C4'" . DA  J  6 5   ? -60.521 -34.540 76.446 1.00 114.56 ? -68  DA  J "C4'" 1 
ATOM   9141  O  "O4'" . DA  J  6 5   ? -60.004 -35.892 76.295 1.00 113.60 ? -68  DA  J "O4'" 1 
ATOM   9142  C  "C3'" . DA  J  6 5   ? -60.865 -34.036 75.040 1.00 112.92 ? -68  DA  J "C3'" 1 
ATOM   9143  O  "O3'" . DA  J  6 5   ? -60.023 -32.915 74.774 1.00 111.89 ? -68  DA  J "O3'" 1 
ATOM   9144  C  "C2'" . DA  J  6 5   ? -60.579 -35.228 74.121 1.00 112.42 ? -68  DA  J "C2'" 1 
ATOM   9145  C  "C1'" . DA  J  6 5   ? -59.582 -36.039 74.954 1.00 112.07 ? -68  DA  J "C1'" 1 
ATOM   9146  N  N9    . DA  J  6 5   ? -59.468 -37.475 74.675 1.00 111.46 ? -68  DA  J N9    1 
ATOM   9147  C  C8    . DA  J  6 5   ? -60.444 -38.429 74.752 1.00 111.37 ? -68  DA  J C8    1 
ATOM   9148  N  N7    . DA  J  6 5   ? -60.037 -39.643 74.459 1.00 111.32 ? -68  DA  J N7    1 
ATOM   9149  C  C5    . DA  J  6 5   ? -58.696 -39.475 74.165 1.00 111.14 ? -68  DA  J C5    1 
ATOM   9150  C  C6    . DA  J  6 5   ? -57.678 -40.373 73.776 1.00 111.18 ? -68  DA  J C6    1 
ATOM   9151  N  N6    . DA  J  6 5   ? -57.861 -41.678 73.604 1.00 111.21 ? -68  DA  J N6    1 
ATOM   9152  N  N1    . DA  J  6 5   ? -56.442 -39.877 73.562 1.00 111.52 ? -68  DA  J N1    1 
ATOM   9153  C  C2    . DA  J  6 5   ? -56.231 -38.562 73.724 1.00 111.27 ? -68  DA  J C2    1 
ATOM   9154  N  N3    . DA  J  6 5   ? -57.106 -37.622 74.087 1.00 110.76 ? -68  DA  J N3    1 
ATOM   9155  C  C4    . DA  J  6 5   ? -58.329 -38.146 74.296 1.00 111.15 ? -68  DA  J C4    1 
ATOM   9156  P  P     . DT  J  6 6   ? -60.384 -31.761 73.710 1.00 111.10 ? -67  DT  J P     1 
ATOM   9157  O  OP1   . DT  J  6 6   ? -59.978 -30.454 74.292 1.00 109.45 ? -67  DT  J OP1   1 
ATOM   9158  O  OP2   . DT  J  6 6   ? -61.775 -31.980 73.245 1.00 110.31 ? -67  DT  J OP2   1 
ATOM   9159  O  "O5'" . DT  J  6 6   ? -59.407 -32.094 72.474 1.00 109.75 ? -67  DT  J "O5'" 1 
ATOM   9160  C  "C5'" . DT  J  6 6   ? -57.996 -32.320 72.659 1.00 106.93 ? -67  DT  J "C5'" 1 
ATOM   9161  C  "C4'" . DT  J  6 6   ? -57.385 -33.088 71.492 1.00 104.97 ? -67  DT  J "C4'" 1 
ATOM   9162  O  "O4'" . DT  J  6 6   ? -57.536 -34.532 71.653 1.00 104.11 ? -67  DT  J "O4'" 1 
ATOM   9163  C  "C3'" . DT  J  6 6   ? -57.947 -32.758 70.107 1.00 103.84 ? -67  DT  J "C3'" 1 
ATOM   9164  O  "O3'" . DT  J  6 6   ? -56.878 -32.821 69.176 1.00 102.90 ? -67  DT  J "O3'" 1 
ATOM   9165  C  "C2'" . DT  J  6 6   ? -58.880 -33.938 69.866 1.00 103.94 ? -67  DT  J "C2'" 1 
ATOM   9166  C  "C1'" . DT  J  6 6   ? -57.987 -35.053 70.411 1.00 103.95 ? -67  DT  J "C1'" 1 
ATOM   9167  N  N1    . DT  J  6 6   ? -58.602 -36.439 70.554 1.00 103.78 ? -67  DT  J N1    1 
ATOM   9168  C  C2    . DT  J  6 6   ? -57.774 -37.556 70.491 1.00 103.77 ? -67  DT  J C2    1 
ATOM   9169  O  O2    . DT  J  6 6   ? -56.567 -37.514 70.326 1.00 103.57 ? -67  DT  J O2    1 
ATOM   9170  N  N3    . DT  J  6 6   ? -58.415 -38.766 70.630 1.00 104.10 ? -67  DT  J N3    1 
ATOM   9171  C  C4    . DT  J  6 6   ? -59.772 -38.983 70.818 1.00 104.30 ? -67  DT  J C4    1 
ATOM   9172  O  O4    . DT  J  6 6   ? -60.226 -40.122 70.929 1.00 104.24 ? -67  DT  J O4    1 
ATOM   9173  C  C5    . DT  J  6 6   ? -60.590 -37.783 70.869 1.00 104.12 ? -67  DT  J C5    1 
ATOM   9174  C  C7    . DT  J  6 6   ? -62.078 -37.879 71.071 1.00 103.91 ? -67  DT  J C7    1 
ATOM   9175  C  C6    . DT  J  6 6   ? -59.973 -36.591 70.737 1.00 103.74 ? -67  DT  J C6    1 
ATOM   9176  P  P     . DA  J  6 7   ? -56.466 -31.682 68.130 1.00 100.64 ? -66  DA  J P     1 
ATOM   9177  O  OP1   . DA  J  6 7   ? -55.943 -30.504 68.867 1.00 99.75  ? -66  DA  J OP1   1 
ATOM   9178  O  OP2   . DA  J  6 7   ? -57.540 -31.552 67.123 1.00 100.25 ? -66  DA  J OP2   1 
ATOM   9179  O  "O5'" . DA  J  6 7   ? -55.237 -32.421 67.429 1.00 99.57  ? -66  DA  J "O5'" 1 
ATOM   9180  C  "C5'" . DA  J  6 7   ? -54.241 -33.013 68.256 1.00 98.43  ? -66  DA  J "C5'" 1 
ATOM   9181  C  "C4'" . DA  J  6 7   ? -53.696 -34.289 67.642 1.00 98.00  ? -66  DA  J "C4'" 1 
ATOM   9182  O  "O4'" . DA  J  6 7   ? -54.560 -35.424 67.922 1.00 97.52  ? -66  DA  J "O4'" 1 
ATOM   9183  C  "C3'" . DA  J  6 7   ? -53.530 -34.224 66.130 1.00 98.06  ? -66  DA  J "C3'" 1 
ATOM   9184  O  "O3'" . DA  J  6 7   ? -52.195 -34.640 65.821 1.00 98.28  ? -66  DA  J "O3'" 1 
ATOM   9185  C  "C2'" . DA  J  6 7   ? -54.625 -35.157 65.598 1.00 97.95  ? -66  DA  J "C2'" 1 
ATOM   9186  C  "C1'" . DA  J  6 7   ? -54.792 -36.159 66.736 1.00 97.48  ? -66  DA  J "C1'" 1 
ATOM   9187  N  N9    . DA  J  6 7   ? -56.127 -36.761 66.832 1.00 97.81  ? -66  DA  J N9    1 
ATOM   9188  C  C8    . DA  J  6 7   ? -57.312 -36.084 66.989 1.00 97.65  ? -66  DA  J C8    1 
ATOM   9189  N  N7    . DA  J  6 7   ? -58.367 -36.863 67.053 1.00 97.66  ? -66  DA  J N7    1 
ATOM   9190  C  C5    . DA  J  6 7   ? -57.849 -38.144 66.938 1.00 97.54  ? -66  DA  J C5    1 
ATOM   9191  C  C6    . DA  J  6 7   ? -58.457 -39.422 66.943 1.00 97.46  ? -66  DA  J C6    1 
ATOM   9192  N  N6    . DA  J  6 7   ? -59.775 -39.612 67.070 1.00 97.31  ? -66  DA  J N6    1 
ATOM   9193  N  N1    . DA  J  6 7   ? -57.653 -40.504 66.810 1.00 97.76  ? -66  DA  J N1    1 
ATOM   9194  C  C2    . DA  J  6 7   ? -56.328 -40.322 66.676 1.00 97.47  ? -66  DA  J C2    1 
ATOM   9195  N  N3    . DA  J  6 7   ? -55.646 -39.172 66.664 1.00 97.15  ? -66  DA  J N3    1 
ATOM   9196  C  C4    . DA  J  6 7   ? -56.466 -38.105 66.799 1.00 97.55  ? -66  DA  J C4    1 
ATOM   9197  P  P     . DT  J  6 8   ? -51.642 -34.775 64.317 1.00 97.96  ? -65  DT  J P     1 
ATOM   9198  O  OP1   . DT  J  6 8   ? -50.172 -34.792 64.457 1.00 97.79  ? -65  DT  J OP1   1 
ATOM   9199  O  OP2   . DT  J  6 8   ? -52.332 -33.794 63.445 1.00 96.49  ? -65  DT  J OP2   1 
ATOM   9200  O  "O5'" . DT  J  6 8   ? -52.060 -36.260 63.885 1.00 98.45  ? -65  DT  J "O5'" 1 
ATOM   9201  C  "C5'" . DT  J  6 8   ? -51.524 -37.371 64.633 1.00 98.64  ? -65  DT  J "C5'" 1 
ATOM   9202  C  "C4'" . DT  J  6 8   ? -51.888 -38.693 63.984 1.00 99.41  ? -65  DT  J "C4'" 1 
ATOM   9203  O  "O4'" . DT  J  6 8   ? -53.283 -38.972 64.247 1.00 99.84  ? -65  DT  J "O4'" 1 
ATOM   9204  C  "C3'" . DT  J  6 8   ? -51.751 -38.749 62.465 1.00 99.89  ? -65  DT  J "C3'" 1 
ATOM   9205  O  "O3'" . DT  J  6 8   ? -51.228 -40.021 62.145 1.00 100.65 ? -65  DT  J "O3'" 1 
ATOM   9206  C  "C2'" . DT  J  6 8   ? -53.185 -38.562 61.964 1.00 99.50  ? -65  DT  J "C2'" 1 
ATOM   9207  C  "C1'" . DT  J  6 8   ? -53.941 -39.323 63.045 1.00 98.95  ? -65  DT  J "C1'" 1 
ATOM   9208  N  N1    . DT  J  6 8   ? -55.419 -39.047 63.200 1.00 98.63  ? -65  DT  J N1    1 
ATOM   9209  C  C2    . DT  J  6 8   ? -56.272 -40.128 63.325 1.00 98.19  ? -65  DT  J C2    1 
ATOM   9210  O  O2    . DT  J  6 8   ? -55.893 -41.287 63.301 1.00 98.31  ? -65  DT  J O2    1 
ATOM   9211  N  N3    . DT  J  6 8   ? -57.598 -39.807 63.476 1.00 97.96  ? -65  DT  J N3    1 
ATOM   9212  C  C4    . DT  J  6 8   ? -58.151 -38.540 63.523 1.00 98.66  ? -65  DT  J C4    1 
ATOM   9213  O  O4    . DT  J  6 8   ? -59.360 -38.361 63.658 1.00 98.69  ? -65  DT  J O4    1 
ATOM   9214  C  C5    . DT  J  6 8   ? -57.206 -37.448 63.398 1.00 98.71  ? -65  DT  J C5    1 
ATOM   9215  C  C7    . DT  J  6 8   ? -57.689 -36.025 63.435 1.00 98.43  ? -65  DT  J C7    1 
ATOM   9216  C  C6    . DT  J  6 8   ? -55.903 -37.749 63.247 1.00 98.54  ? -65  DT  J C6    1 
ATOM   9217  P  P     . DC  J  6 9   ? -50.552 -40.342 60.727 1.00 101.78 ? -64  DC  J P     1 
ATOM   9218  O  OP1   . DC  J  6 9   ? -49.130 -40.660 61.006 1.00 100.75 ? -64  DC  J OP1   1 
ATOM   9219  O  OP2   . DC  J  6 9   ? -50.968 -39.314 59.734 1.00 100.44 ? -64  DC  J OP2   1 
ATOM   9220  O  "O5'" . DC  J  6 9   ? -51.238 -41.727 60.306 1.00 102.13 ? -64  DC  J "O5'" 1 
ATOM   9221  C  "C5'" . DC  J  6 9   ? -51.531 -42.745 61.279 1.00 101.98 ? -64  DC  J "C5'" 1 
ATOM   9222  C  "C4'" . DC  J  6 9   ? -52.637 -43.630 60.732 1.00 102.10 ? -64  DC  J "C4'" 1 
ATOM   9223  O  "O4'" . DC  J  6 9   ? -53.948 -43.091 61.064 1.00 101.59 ? -64  DC  J "O4'" 1 
ATOM   9224  C  "C3'" . DC  J  6 9   ? -52.586 -43.756 59.212 1.00 102.22 ? -64  DC  J "C3'" 1 
ATOM   9225  O  "O3'" . DC  J  6 9   ? -52.645 -45.130 58.865 1.00 103.45 ? -64  DC  J "O3'" 1 
ATOM   9226  C  "C2'" . DC  J  6 9   ? -53.788 -42.953 58.714 1.00 101.63 ? -64  DC  J "C2'" 1 
ATOM   9227  C  "C1'" . DC  J  6 9   ? -54.742 -43.065 59.898 1.00 100.84 ? -64  DC  J "C1'" 1 
ATOM   9228  N  N1    . DC  J  6 9   ? -55.707 -41.947 60.002 1.00 100.43 ? -64  DC  J N1    1 
ATOM   9229  C  C2    . DC  J  6 9   ? -57.059 -42.240 60.224 1.00 100.89 ? -64  DC  J C2    1 
ATOM   9230  O  O2    . DC  J  6 9   ? -57.408 -43.427 60.328 1.00 101.60 ? -64  DC  J O2    1 
ATOM   9231  N  N3    . DC  J  6 9   ? -57.949 -41.213 60.315 1.00 100.52 ? -64  DC  J N3    1 
ATOM   9232  C  C4    . DC  J  6 9   ? -57.528 -39.951 60.194 1.00 100.16 ? -64  DC  J C4    1 
ATOM   9233  N  N4    . DC  J  6 9   ? -58.434 -38.977 60.292 1.00 100.34 ? -64  DC  J N4    1 
ATOM   9234  C  C5    . DC  J  6 9   ? -56.155 -39.635 59.962 1.00 100.58 ? -64  DC  J C5    1 
ATOM   9235  C  C6    . DC  J  6 9   ? -55.287 -40.652 59.873 1.00 100.46 ? -64  DC  J C6    1 
ATOM   9236  P  P     . DC  J  6 10  ? -52.333 -45.604 57.370 1.00 104.55 ? -63  DC  J P     1 
ATOM   9237  O  OP1   . DC  J  6 10  ? -51.480 -46.819 57.432 1.00 103.95 ? -63  DC  J OP1   1 
ATOM   9238  O  OP2   . DC  J  6 10  ? -51.889 -44.430 56.572 1.00 104.34 ? -63  DC  J OP2   1 
ATOM   9239  O  "O5'" . DC  J  6 10  ? -53.808 -45.998 56.882 1.00 105.19 ? -63  DC  J "O5'" 1 
ATOM   9240  C  "C5'" . DC  J  6 10  ? -54.653 -46.858 57.663 1.00 105.81 ? -63  DC  J "C5'" 1 
ATOM   9241  C  "C4'" . DC  J  6 10  ? -56.050 -46.876 57.067 1.00 106.88 ? -63  DC  J "C4'" 1 
ATOM   9242  O  "O4'" . DC  J  6 10  ? -56.799 -45.709 57.509 1.00 107.03 ? -63  DC  J "O4'" 1 
ATOM   9243  C  "C3'" . DC  J  6 10  ? -56.086 -46.876 55.534 1.00 107.45 ? -63  DC  J "C3'" 1 
ATOM   9244  O  "O3'" . DC  J  6 10  ? -56.945 -47.917 55.093 1.00 108.04 ? -63  DC  J "O3'" 1 
ATOM   9245  C  "C2'" . DC  J  6 10  ? -56.675 -45.517 55.165 1.00 107.01 ? -63  DC  J "C2'" 1 
ATOM   9246  C  "C1'" . DC  J  6 10  ? -57.510 -45.194 56.403 1.00 106.87 ? -63  DC  J "C1'" 1 
ATOM   9247  N  N1    . DC  J  6 10  ? -57.758 -43.729 56.613 1.00 107.21 ? -63  DC  J N1    1 
ATOM   9248  C  C2    . DC  J  6 10  ? -59.036 -43.300 57.020 1.00 107.15 ? -63  DC  J C2    1 
ATOM   9249  O  O2    . DC  J  6 10  ? -59.928 -44.140 57.208 1.00 107.32 ? -63  DC  J O2    1 
ATOM   9250  N  N3    . DC  J  6 10  ? -59.261 -41.969 57.198 1.00 106.61 ? -63  DC  J N3    1 
ATOM   9251  C  C4    . DC  J  6 10  ? -58.275 -41.092 56.989 1.00 106.37 ? -63  DC  J C4    1 
ATOM   9252  N  N4    . DC  J  6 10  ? -58.550 -39.803 57.183 1.00 106.45 ? -63  DC  J N4    1 
ATOM   9253  C  C5    . DC  J  6 10  ? -56.966 -41.500 56.572 1.00 106.73 ? -63  DC  J C5    1 
ATOM   9254  C  C6    . DC  J  6 10  ? -56.753 -42.813 56.399 1.00 106.78 ? -63  DC  J C6    1 
ATOM   9255  P  P     . DA  J  6 11  ? -56.653 -48.824 53.800 1.00 107.91 ? -62  DA  J P     1 
ATOM   9256  O  OP1   . DA  J  6 11  ? -55.964 -50.058 54.261 1.00 107.60 ? -62  DA  J OP1   1 
ATOM   9257  O  OP2   . DA  J  6 11  ? -56.063 -47.999 52.711 1.00 107.52 ? -62  DA  J OP2   1 
ATOM   9258  O  "O5'" . DA  J  6 11  ? -58.151 -49.201 53.369 1.00 106.28 ? -62  DA  J "O5'" 1 
ATOM   9259  C  "C5'" . DA  J  6 11  ? -59.210 -49.220 54.335 1.00 103.94 ? -62  DA  J "C5'" 1 
ATOM   9260  C  "C4'" . DA  J  6 11  ? -60.503 -48.750 53.701 1.00 102.85 ? -62  DA  J "C4'" 1 
ATOM   9261  O  "O4'" . DA  J  6 11  ? -60.748 -47.378 54.090 1.00 101.69 ? -62  DA  J "O4'" 1 
ATOM   9262  C  "C3'" . DA  J  6 11  ? -60.516 -48.809 52.170 1.00 102.43 ? -62  DA  J "C3'" 1 
ATOM   9263  O  "O3'" . DA  J  6 11  ? -61.652 -49.578 51.707 1.00 102.11 ? -62  DA  J "O3'" 1 
ATOM   9264  C  "C2'" . DA  J  6 11  ? -60.519 -47.340 51.736 1.00 101.93 ? -62  DA  J "C2'" 1 
ATOM   9265  C  "C1'" . DA  J  6 11  ? -61.101 -46.623 52.950 1.00 102.15 ? -62  DA  J "C1'" 1 
ATOM   9266  N  N9    . DA  J  6 11  ? -60.583 -45.273 53.171 1.00 102.56 ? -62  DA  J N9    1 
ATOM   9267  C  C8    . DA  J  6 11  ? -59.281 -44.844 53.078 1.00 102.22 ? -62  DA  J C8    1 
ATOM   9268  N  N7    . DA  J  6 11  ? -59.123 -43.568 53.343 1.00 101.80 ? -62  DA  J N7    1 
ATOM   9269  C  C5    . DA  J  6 11  ? -60.403 -43.130 53.642 1.00 102.14 ? -62  DA  J C5    1 
ATOM   9270  C  C6    . DA  J  6 11  ? -60.925 -41.866 54.010 1.00 102.51 ? -62  DA  J C6    1 
ATOM   9271  N  N6    . DA  J  6 11  ? -60.165 -40.772 54.144 1.00 102.54 ? -62  DA  J N6    1 
ATOM   9272  N  N1    . DA  J  6 11  ? -62.261 -41.767 54.231 1.00 102.25 ? -62  DA  J N1    1 
ATOM   9273  C  C2    . DA  J  6 11  ? -63.020 -42.864 54.090 1.00 101.84 ? -62  DA  J C2    1 
ATOM   9274  N  N3    . DA  J  6 11  ? -62.648 -44.099 53.747 1.00 101.52 ? -62  DA  J N3    1 
ATOM   9275  C  C4    . DA  J  6 11  ? -61.319 -44.167 53.537 1.00 102.21 ? -62  DA  J C4    1 
ATOM   9276  P  P     . DC  J  6 12  ? -61.981 -49.801 50.144 1.00 101.63 ? -61  DC  J P     1 
ATOM   9277  O  OP1   . DC  J  6 12  ? -62.837 -51.001 49.984 1.00 102.80 ? -61  DC  J OP1   1 
ATOM   9278  O  OP2   . DC  J  6 12  ? -60.713 -49.719 49.372 1.00 100.98 ? -61  DC  J OP2   1 
ATOM   9279  O  "O5'" . DC  J  6 12  ? -62.939 -48.556 49.864 1.00 101.58 ? -61  DC  J "O5'" 1 
ATOM   9280  C  "C5'" . DC  J  6 12  ? -63.890 -48.219 50.875 1.00 102.36 ? -61  DC  J "C5'" 1 
ATOM   9281  C  "C4'" . DC  J  6 12  ? -64.661 -46.969 50.507 1.00 103.99 ? -61  DC  J "C4'" 1 
ATOM   9282  O  "O4'" . DC  J  6 12  ? -63.958 -45.790 50.977 1.00 104.72 ? -61  DC  J "O4'" 1 
ATOM   9283  C  "C3'" . DC  J  6 12  ? -64.860 -46.761 49.009 1.00 104.67 ? -61  DC  J "C3'" 1 
ATOM   9284  O  "O3'" . DC  J  6 12  ? -66.201 -46.357 48.803 1.00 105.58 ? -61  DC  J "O3'" 1 
ATOM   9285  C  "C2'" . DC  J  6 12  ? -63.855 -45.662 48.662 1.00 104.57 ? -61  DC  J "C2'" 1 
ATOM   9286  C  "C1'" . DC  J  6 12  ? -63.948 -44.832 49.935 1.00 104.56 ? -61  DC  J "C1'" 1 
ATOM   9287  N  N1    . DC  J  6 12  ? -62.837 -43.848 50.154 1.00 104.58 ? -61  DC  J N1    1 
ATOM   9288  C  C2    . DC  J  6 12  ? -63.125 -42.572 50.692 1.00 104.72 ? -61  DC  J C2    1 
ATOM   9289  O  O2    . DC  J  6 12  ? -64.288 -42.256 50.988 1.00 104.73 ? -61  DC  J O2    1 
ATOM   9290  N  N3    . DC  J  6 12  ? -62.103 -41.694 50.882 1.00 104.45 ? -61  DC  J N3    1 
ATOM   9291  C  C4    . DC  J  6 12  ? -60.851 -42.038 50.567 1.00 104.07 ? -61  DC  J C4    1 
ATOM   9292  N  N4    . DC  J  6 12  ? -59.893 -41.135 50.782 1.00 104.06 ? -61  DC  J N4    1 
ATOM   9293  C  C5    . DC  J  6 12  ? -60.535 -43.324 50.020 1.00 104.42 ? -61  DC  J C5    1 
ATOM   9294  C  C6    . DC  J  6 12  ? -61.547 -44.189 49.833 1.00 104.39 ? -61  DC  J C6    1 
ATOM   9295  P  P     . DC  J  6 13  ? -66.731 -45.969 47.346 1.00 106.63 ? -60  DC  J P     1 
ATOM   9296  O  OP1   . DC  J  6 13  ? -68.126 -46.466 47.297 1.00 107.22 ? -60  DC  J OP1   1 
ATOM   9297  O  OP2   . DC  J  6 13  ? -65.740 -46.372 46.310 1.00 104.81 ? -60  DC  J OP2   1 
ATOM   9298  O  "O5'" . DC  J  6 13  ? -66.785 -44.374 47.414 1.00 107.34 ? -60  DC  J "O5'" 1 
ATOM   9299  C  "C5'" . DC  J  6 13  ? -67.679 -43.745 48.327 1.00 110.56 ? -60  DC  J "C5'" 1 
ATOM   9300  C  "C4'" . DC  J  6 13  ? -67.841 -42.280 47.962 1.00 113.29 ? -60  DC  J "C4'" 1 
ATOM   9301  O  "O4'" . DC  J  6 13  ? -66.621 -41.572 48.318 1.00 113.23 ? -60  DC  J "O4'" 1 
ATOM   9302  C  "C3'" . DC  J  6 13  ? -68.085 -42.017 46.475 1.00 114.71 ? -60  DC  J "C3'" 1 
ATOM   9303  O  "O3'" . DC  J  6 13  ? -69.080 -41.008 46.274 1.00 117.38 ? -60  DC  J "O3'" 1 
ATOM   9304  C  "C2'" . DC  J  6 13  ? -66.729 -41.542 45.960 1.00 114.28 ? -60  DC  J "C2'" 1 
ATOM   9305  C  "C1'" . DC  J  6 13  ? -66.146 -40.857 47.193 1.00 113.33 ? -60  DC  J "C1'" 1 
ATOM   9306  N  N1    . DC  J  6 13  ? -64.657 -40.867 47.192 1.00 113.06 ? -60  DC  J N1    1 
ATOM   9307  C  C2    . DC  J  6 13  ? -63.916 -39.702 47.492 1.00 112.89 ? -60  DC  J C2    1 
ATOM   9308  O  O2    . DC  J  6 13  ? -64.477 -38.638 47.782 1.00 112.99 ? -60  DC  J O2    1 
ATOM   9309  N  N3    . DC  J  6 13  ? -62.562 -39.768 47.470 1.00 112.98 ? -60  DC  J N3    1 
ATOM   9310  C  C4    . DC  J  6 13  ? -61.949 -40.917 47.163 1.00 113.16 ? -60  DC  J C4    1 
ATOM   9311  N  N4    . DC  J  6 13  ? -60.611 -40.929 47.154 1.00 112.71 ? -60  DC  J N4    1 
ATOM   9312  C  C5    . DC  J  6 13  ? -62.682 -42.107 46.850 1.00 113.20 ? -60  DC  J C5    1 
ATOM   9313  C  C6    . DC  J  6 13  ? -64.018 -42.036 46.877 1.00 112.88 ? -60  DC  J C6    1 
ATOM   9314  P  P     . DT  J  6 14  ? -69.802 -40.879 44.841 1.00 119.66 ? -59  DT  J P     1 
ATOM   9315  O  OP1   . DT  J  6 14  ? -71.267 -40.768 45.089 1.00 119.60 ? -59  DT  J OP1   1 
ATOM   9316  O  OP2   . DT  J  6 14  ? -69.264 -41.953 43.960 1.00 118.33 ? -59  DT  J OP2   1 
ATOM   9317  O  "O5'" . DT  J  6 14  ? -69.283 -39.481 44.250 1.00 120.53 ? -59  DT  J "O5'" 1 
ATOM   9318  C  "C5'" . DT  J  6 14  ? -69.187 -38.282 45.017 1.00 121.93 ? -59  DT  J "C5'" 1 
ATOM   9319  C  "C4'" . DT  J  6 14  ? -68.181 -37.347 44.359 1.00 123.82 ? -59  DT  J "C4'" 1 
ATOM   9320  O  "O4'" . DT  J  6 14  ? -66.819 -37.799 44.584 1.00 124.35 ? -59  DT  J "O4'" 1 
ATOM   9321  C  "C3'" . DT  J  6 14  ? -68.295 -37.203 42.838 1.00 124.69 ? -59  DT  J "C3'" 1 
ATOM   9322  O  "O3'" . DT  J  6 14  ? -68.261 -35.825 42.518 1.00 125.35 ? -59  DT  J "O3'" 1 
ATOM   9323  C  "C2'" . DT  J  6 14  ? -67.072 -37.921 42.267 1.00 124.72 ? -59  DT  J "C2'" 1 
ATOM   9324  C  "C1'" . DT  J  6 14  ? -66.096 -37.564 43.382 1.00 125.18 ? -59  DT  J "C1'" 1 
ATOM   9325  N  N1    . DT  J  6 14  ? -64.807 -38.327 43.406 1.00 125.45 ? -59  DT  J N1    1 
ATOM   9326  C  C2    . DT  J  6 14  ? -63.621 -37.632 43.620 1.00 125.24 ? -59  DT  J C2    1 
ATOM   9327  O  O2    . DT  J  6 14  ? -63.547 -36.425 43.784 1.00 125.47 ? -59  DT  J O2    1 
ATOM   9328  N  N3    . DT  J  6 14  ? -62.496 -38.409 43.628 1.00 124.76 ? -59  DT  J N3    1 
ATOM   9329  C  C4    . DT  J  6 14  ? -62.436 -39.779 43.453 1.00 125.33 ? -59  DT  J C4    1 
ATOM   9330  O  O4    . DT  J  6 14  ? -61.356 -40.363 43.487 1.00 125.21 ? -59  DT  J O4    1 
ATOM   9331  C  C5    . DT  J  6 14  ? -63.713 -40.449 43.236 1.00 125.62 ? -59  DT  J C5    1 
ATOM   9332  C  C7    . DT  J  6 14  ? -63.796 -41.938 43.035 1.00 125.33 ? -59  DT  J C7    1 
ATOM   9333  C  C6    . DT  J  6 14  ? -64.825 -39.699 43.223 1.00 125.40 ? -59  DT  J C6    1 
ATOM   9334  P  P     . DG  J  6 15  ? -69.507 -35.215 41.716 1.00 125.98 ? -58  DG  J P     1 
ATOM   9335  O  OP1   . DG  J  6 15  ? -70.660 -35.151 42.664 1.00 125.47 ? -58  DG  J OP1   1 
ATOM   9336  O  OP2   . DG  J  6 15  ? -69.601 -35.978 40.435 1.00 125.26 ? -58  DG  J OP2   1 
ATOM   9337  O  "O5'" . DG  J  6 15  ? -69.029 -33.723 41.364 1.00 126.25 ? -58  DG  J "O5'" 1 
ATOM   9338  C  "C5'" . DG  J  6 15  ? -68.556 -32.831 42.382 1.00 126.08 ? -58  DG  J "C5'" 1 
ATOM   9339  C  "C4'" . DG  J  6 15  ? -67.423 -31.971 41.849 1.00 125.57 ? -58  DG  J "C4'" 1 
ATOM   9340  O  "O4'" . DG  J  6 15  ? -66.192 -32.736 41.820 1.00 125.12 ? -58  DG  J "O4'" 1 
ATOM   9341  C  "C3'" . DG  J  6 15  ? -67.664 -31.433 40.438 1.00 125.69 ? -58  DG  J "C3'" 1 
ATOM   9342  O  "O3'" . DG  J  6 15  ? -67.641 -29.973 40.488 1.00 126.05 ? -58  DG  J "O3'" 1 
ATOM   9343  C  "C2'" . DG  J  6 15  ? -66.646 -32.170 39.546 1.00 125.18 ? -58  DG  J "C2'" 1 
ATOM   9344  C  "C1'" . DG  J  6 15  ? -65.625 -32.769 40.522 1.00 124.87 ? -58  DG  J "C1'" 1 
ATOM   9345  N  N9    . DG  J  6 15  ? -65.189 -34.156 40.287 1.00 124.75 ? -58  DG  J N9    1 
ATOM   9346  C  C8    . DG  J  6 15  ? -65.919 -35.187 39.739 1.00 124.70 ? -58  DG  J C8    1 
ATOM   9347  N  N7    . DG  J  6 15  ? -65.269 -36.319 39.673 1.00 124.61 ? -58  DG  J N7    1 
ATOM   9348  C  C5    . DG  J  6 15  ? -64.027 -36.029 40.216 1.00 124.40 ? -58  DG  J C5    1 
ATOM   9349  C  C6    . DG  J  6 15  ? -62.898 -36.864 40.410 1.00 124.47 ? -58  DG  J C6    1 
ATOM   9350  O  O6    . DG  J  6 15  ? -62.778 -38.062 40.132 1.00 124.72 ? -58  DG  J O6    1 
ATOM   9351  N  N1    . DG  J  6 15  ? -61.826 -36.197 40.997 1.00 124.47 ? -58  DG  J N1    1 
ATOM   9352  C  C2    . DG  J  6 15  ? -61.847 -34.871 41.353 1.00 124.73 ? -58  DG  J C2    1 
ATOM   9353  N  N2    . DG  J  6 15  ? -60.723 -34.393 41.906 1.00 124.58 ? -58  DG  J N2    1 
ATOM   9354  N  N3    . DG  J  6 15  ? -62.901 -34.072 41.177 1.00 124.86 ? -58  DG  J N3    1 
ATOM   9355  C  C4    . DG  J  6 15  ? -63.960 -34.709 40.604 1.00 124.53 ? -58  DG  J C4    1 
ATOM   9356  P  P     . DC  J  6 16  ? -66.550 -28.988 39.831 1.00 126.03 ? -57  DC  J P     1 
ATOM   9357  O  OP1   . DC  J  6 16  ? -66.867 -27.627 40.324 1.00 125.87 ? -57  DC  J OP1   1 
ATOM   9358  O  OP2   . DC  J  6 16  ? -66.495 -29.274 38.369 1.00 124.91 ? -57  DC  J OP2   1 
ATOM   9359  O  "O5'" . DC  J  6 16  ? -65.167 -29.432 40.527 1.00 126.31 ? -57  DC  J "O5'" 1 
ATOM   9360  C  "C5'" . DC  J  6 16  ? -64.016 -28.565 40.609 1.00 125.33 ? -57  DC  J "C5'" 1 
ATOM   9361  C  "C4'" . DC  J  6 16  ? -62.933 -28.943 39.602 1.00 124.39 ? -57  DC  J "C4'" 1 
ATOM   9362  O  "O4'" . DC  J  6 16  ? -62.892 -30.374 39.362 1.00 123.85 ? -57  DC  J "O4'" 1 
ATOM   9363  C  "C3'" . DC  J  6 16  ? -63.107 -28.291 38.229 1.00 124.19 ? -57  DC  J "C3'" 1 
ATOM   9364  O  "O3'" . DC  J  6 16  ? -61.941 -27.528 37.937 1.00 124.75 ? -57  DC  J "O3'" 1 
ATOM   9365  C  "C2'" . DC  J  6 16  ? -63.276 -29.463 37.261 1.00 123.54 ? -57  DC  J "C2'" 1 
ATOM   9366  C  "C1'" . DC  J  6 16  ? -62.519 -30.553 38.013 1.00 123.42 ? -57  DC  J "C1'" 1 
ATOM   9367  N  N1    . DC  J  6 16  ? -62.763 -31.986 37.605 1.00 123.34 ? -57  DC  J N1    1 
ATOM   9368  C  C2    . DC  J  6 16  ? -61.743 -32.936 37.815 1.00 123.50 ? -57  DC  J C2    1 
ATOM   9369  O  O2    . DC  J  6 16  ? -60.675 -32.581 38.330 1.00 123.24 ? -57  DC  J O2    1 
ATOM   9370  N  N3    . DC  J  6 16  ? -61.945 -34.233 37.446 1.00 123.48 ? -57  DC  J N3    1 
ATOM   9371  C  C4    . DC  J  6 16  ? -63.106 -34.597 36.897 1.00 123.28 ? -57  DC  J C4    1 
ATOM   9372  N  N4    . DC  J  6 16  ? -63.251 -35.881 36.562 1.00 123.01 ? -57  DC  J N4    1 
ATOM   9373  C  C5    . DC  J  6 16  ? -64.159 -33.653 36.672 1.00 123.39 ? -57  DC  J C5    1 
ATOM   9374  C  C6    . DC  J  6 16  ? -63.949 -32.376 37.037 1.00 123.37 ? -57  DC  J C6    1 
ATOM   9375  P  P     . DA  J  6 17  ? -61.801 -25.987 38.393 1.00 125.37 ? -56  DA  J P     1 
ATOM   9376  O  OP1   . DA  J  6 17  ? -62.409 -25.758 39.740 1.00 124.75 ? -56  DA  J OP1   1 
ATOM   9377  O  OP2   . DA  J  6 17  ? -62.244 -25.193 37.215 1.00 125.03 ? -56  DA  J OP2   1 
ATOM   9378  O  "O5'" . DA  J  6 17  ? -60.217 -25.814 38.562 1.00 125.26 ? -56  DA  J "O5'" 1 
ATOM   9379  C  "C5'" . DA  J  6 17  ? -59.543 -26.419 39.678 1.00 125.49 ? -56  DA  J "C5'" 1 
ATOM   9380  C  "C4'" . DA  J  6 17  ? -58.332 -27.237 39.240 1.00 125.38 ? -56  DA  J "C4'" 1 
ATOM   9381  O  "O4'" . DA  J  6 17  ? -58.715 -28.433 38.503 1.00 125.24 ? -56  DA  J "O4'" 1 
ATOM   9382  C  "C3'" . DA  J  6 17  ? -57.330 -26.518 38.339 1.00 125.40 ? -56  DA  J "C3'" 1 
ATOM   9383  O  "O3'" . DA  J  6 17  ? -56.040 -27.045 38.652 1.00 125.41 ? -56  DA  J "O3'" 1 
ATOM   9384  C  "C2'" . DA  J  6 17  ? -57.779 -26.931 36.939 1.00 125.36 ? -56  DA  J "C2'" 1 
ATOM   9385  C  "C1'" . DA  J  6 17  ? -58.142 -28.393 37.203 1.00 125.30 ? -56  DA  J "C1'" 1 
ATOM   9386  N  N9    . DA  J  6 17  ? -59.110 -28.990 36.290 1.00 125.20 ? -56  DA  J N9    1 
ATOM   9387  C  C8    . DA  J  6 17  ? -60.097 -28.361 35.578 1.00 125.26 ? -56  DA  J C8    1 
ATOM   9388  N  N7    . DA  J  6 17  ? -60.820 -29.175 34.852 1.00 125.50 ? -56  DA  J N7    1 
ATOM   9389  C  C5    . DA  J  6 17  ? -60.274 -30.422 35.111 1.00 125.39 ? -56  DA  J C5    1 
ATOM   9390  C  C6    . DA  J  6 17  ? -60.593 -31.719 34.653 1.00 125.24 ? -56  DA  J C6    1 
ATOM   9391  N  N6    . DA  J  6 17  ? -61.589 -31.960 33.793 1.00 125.11 ? -56  DA  J N6    1 
ATOM   9392  N  N1    . DA  J  6 17  ? -59.843 -32.755 35.106 1.00 125.31 ? -56  DA  J N1    1 
ATOM   9393  C  C2    . DA  J  6 17  ? -58.841 -32.513 35.967 1.00 125.39 ? -56  DA  J C2    1 
ATOM   9394  N  N3    . DA  J  6 17  ? -58.454 -31.337 36.473 1.00 125.45 ? -56  DA  J N3    1 
ATOM   9395  C  C4    . DA  J  6 17  ? -59.217 -30.327 36.000 1.00 125.38 ? -56  DA  J C4    1 
ATOM   9396  P  P     . DG  J  6 18  ? -54.665 -26.382 38.164 1.00 124.63 ? -55  DG  J P     1 
ATOM   9397  O  OP1   . DG  J  6 18  ? -53.871 -26.158 39.393 1.00 124.06 ? -55  DG  J OP1   1 
ATOM   9398  O  OP2   . DG  J  6 18  ? -54.985 -25.249 37.255 1.00 125.21 ? -55  DG  J OP2   1 
ATOM   9399  O  "O5'" . DG  J  6 18  ? -53.961 -27.519 37.286 1.00 123.41 ? -55  DG  J "O5'" 1 
ATOM   9400  C  "C5'" . DG  J  6 18  ? -53.883 -28.867 37.740 1.00 122.93 ? -55  DG  J "C5'" 1 
ATOM   9401  C  "C4'" . DG  J  6 18  ? -54.031 -29.792 36.546 1.00 123.04 ? -55  DG  J "C4'" 1 
ATOM   9402  O  "O4'" . DG  J  6 18  ? -55.353 -29.629 35.960 1.00 123.88 ? -55  DG  J "O4'" 1 
ATOM   9403  C  "C3'" . DG  J  6 18  ? -53.017 -29.560 35.421 1.00 122.67 ? -55  DG  J "C3'" 1 
ATOM   9404  O  "O3'" . DG  J  6 18  ? -52.360 -30.783 35.095 1.00 121.91 ? -55  DG  J "O3'" 1 
ATOM   9405  C  "C2'" . DG  J  6 18  ? -53.881 -29.057 34.256 1.00 123.46 ? -55  DG  J "C2'" 1 
ATOM   9406  C  "C1'" . DG  J  6 18  ? -55.212 -29.750 34.557 1.00 124.27 ? -55  DG  J "C1'" 1 
ATOM   9407  N  N9    . DG  J  6 18  ? -56.399 -29.347 33.759 1.00 124.48 ? -55  DG  J N9    1 
ATOM   9408  C  C8    . DG  J  6 18  ? -56.917 -28.111 33.385 1.00 124.66 ? -55  DG  J C8    1 
ATOM   9409  N  N7    . DG  J  6 18  ? -58.000 -28.165 32.636 1.00 124.02 ? -55  DG  J N7    1 
ATOM   9410  C  C5    . DG  J  6 18  ? -58.205 -29.536 32.508 1.00 124.46 ? -55  DG  J C5    1 
ATOM   9411  C  C6    . DG  J  6 18  ? -59.209 -30.267 31.828 1.00 124.57 ? -55  DG  J C6    1 
ATOM   9412  O  O6    . DG  J  6 18  ? -60.148 -29.810 31.169 1.00 124.63 ? -55  DG  J O6    1 
ATOM   9413  N  N1    . DG  J  6 18  ? -59.044 -31.657 31.946 1.00 124.55 ? -55  DG  J N1    1 
ATOM   9414  C  C2    . DG  J  6 18  ? -58.027 -32.272 32.653 1.00 124.41 ? -55  DG  J C2    1 
ATOM   9415  N  N2    . DG  J  6 18  ? -57.988 -33.609 32.695 1.00 124.25 ? -55  DG  J N2    1 
ATOM   9416  N  N3    . DG  J  6 18  ? -57.088 -31.605 33.299 1.00 124.61 ? -55  DG  J N3    1 
ATOM   9417  C  C4    . DG  J  6 18  ? -57.241 -30.259 33.185 1.00 124.52 ? -55  DG  J C4    1 
ATOM   9418  P  P     . DA  J  6 19  ? -50.773 -30.822 34.875 1.00 121.16 ? -54  DA  J P     1 
ATOM   9419  O  OP1   . DA  J  6 19  ? -50.146 -31.009 36.206 1.00 120.24 ? -54  DA  J OP1   1 
ATOM   9420  O  OP2   . DA  J  6 19  ? -50.415 -29.673 34.017 1.00 121.44 ? -54  DA  J OP2   1 
ATOM   9421  O  "O5'" . DA  J  6 19  ? -50.528 -32.110 33.958 1.00 121.96 ? -54  DA  J "O5'" 1 
ATOM   9422  C  "C5'" . DA  J  6 19  ? -50.894 -33.401 34.410 1.00 123.06 ? -54  DA  J "C5'" 1 
ATOM   9423  C  "C4'" . DA  J  6 19  ? -51.841 -34.083 33.437 1.00 124.17 ? -54  DA  J "C4'" 1 
ATOM   9424  O  "O4'" . DA  J  6 19  ? -53.009 -33.270 33.183 1.00 124.36 ? -54  DA  J "O4'" 1 
ATOM   9425  C  "C3'" . DA  J  6 19  ? -51.238 -34.383 32.074 1.00 125.31 ? -54  DA  J "C3'" 1 
ATOM   9426  O  "O3'" . DA  J  6 19  ? -51.063 -35.779 31.962 1.00 128.08 ? -54  DA  J "O3'" 1 
ATOM   9427  C  "C2'" . DA  J  6 19  ? -52.270 -33.876 31.066 1.00 125.01 ? -54  DA  J "C2'" 1 
ATOM   9428  C  "C1'" . DA  J  6 19  ? -53.509 -33.626 31.914 1.00 124.40 ? -54  DA  J "C1'" 1 
ATOM   9429  N  N9    . DA  J  6 19  ? -54.335 -32.534 31.403 1.00 124.30 ? -54  DA  J N9    1 
ATOM   9430  C  C8    . DA  J  6 19  ? -54.128 -31.203 31.628 1.00 124.30 ? -54  DA  J C8    1 
ATOM   9431  N  N7    . DA  J  6 19  ? -55.006 -30.415 31.053 1.00 124.53 ? -54  DA  J N7    1 
ATOM   9432  C  C5    . DA  J  6 19  ? -55.850 -31.292 30.395 1.00 124.33 ? -54  DA  J C5    1 
ATOM   9433  C  C6    . DA  J  6 19  ? -56.991 -31.071 29.602 1.00 124.14 ? -54  DA  J C6    1 
ATOM   9434  N  N6    . DA  J  6 19  ? -57.469 -29.850 29.341 1.00 124.15 ? -54  DA  J N6    1 
ATOM   9435  N  N1    . DA  J  6 19  ? -57.615 -32.157 29.096 1.00 124.34 ? -54  DA  J N1    1 
ATOM   9436  C  C2    . DA  J  6 19  ? -57.120 -33.376 29.370 1.00 124.26 ? -54  DA  J C2    1 
ATOM   9437  N  N3    . DA  J  6 19  ? -56.054 -33.706 30.102 1.00 123.80 ? -54  DA  J N3    1 
ATOM   9438  C  C4    . DA  J  6 19  ? -55.455 -32.608 30.598 1.00 124.15 ? -54  DA  J C4    1 
ATOM   9439  P  P     . DT  J  6 20  ? -50.082 -36.379 30.848 1.00 130.29 ? -53  DT  J P     1 
ATOM   9440  O  OP1   . DT  J  6 20  ? -49.560 -37.693 31.300 1.00 130.69 ? -53  DT  J OP1   1 
ATOM   9441  O  OP2   . DT  J  6 20  ? -49.096 -35.324 30.509 1.00 129.91 ? -53  DT  J OP2   1 
ATOM   9442  O  "O5'" . DT  J  6 20  ? -51.061 -36.642 29.598 1.00 132.38 ? -53  DT  J "O5'" 1 
ATOM   9443  C  "C5'" . DT  J  6 20  ? -52.194 -37.491 29.742 1.00 135.11 ? -53  DT  J "C5'" 1 
ATOM   9444  C  "C4'" . DT  J  6 20  ? -53.131 -37.349 28.560 1.00 137.72 ? -53  DT  J "C4'" 1 
ATOM   9445  O  "O4'" . DT  J  6 20  ? -53.795 -36.059 28.580 1.00 138.22 ? -53  DT  J "O4'" 1 
ATOM   9446  C  "C3'" . DT  J  6 20  ? -52.456 -37.458 27.196 1.00 139.38 ? -53  DT  J "C3'" 1 
ATOM   9447  O  "O3'" . DT  J  6 20  ? -53.047 -38.533 26.461 1.00 142.10 ? -53  DT  J "O3'" 1 
ATOM   9448  C  "C2'" . DT  J  6 20  ? -52.730 -36.096 26.554 1.00 139.10 ? -53  DT  J "C2'" 1 
ATOM   9449  C  "C1'" . DT  J  6 20  ? -54.041 -35.718 27.233 1.00 139.17 ? -53  DT  J "C1'" 1 
ATOM   9450  N  N1    . DT  J  6 20  ? -54.444 -34.274 27.105 1.00 139.40 ? -53  DT  J N1    1 
ATOM   9451  C  C2    . DT  J  6 20  ? -55.587 -33.922 26.385 1.00 139.88 ? -53  DT  J C2    1 
ATOM   9452  O  O2    . DT  J  6 20  ? -56.336 -34.714 25.821 1.00 139.83 ? -53  DT  J O2    1 
ATOM   9453  N  N3    . DT  J  6 20  ? -55.842 -32.568 26.339 1.00 140.09 ? -53  DT  J N3    1 
ATOM   9454  C  C4    . DT  J  6 20  ? -55.096 -31.551 26.921 1.00 139.72 ? -53  DT  J C4    1 
ATOM   9455  O  O4    . DT  J  6 20  ? -55.426 -30.370 26.815 1.00 139.69 ? -53  DT  J O4    1 
ATOM   9456  C  C5    . DT  J  6 20  ? -53.922 -31.985 27.654 1.00 139.67 ? -53  DT  J C5    1 
ATOM   9457  C  C7    . DT  J  6 20  ? -53.021 -30.988 28.332 1.00 139.50 ? -53  DT  J C7    1 
ATOM   9458  C  C6    . DT  J  6 20  ? -53.659 -33.302 27.707 1.00 139.47 ? -53  DT  J C6    1 
ATOM   9459  P  P     . DA  J  6 21  ? -52.159 -39.653 25.728 1.00 143.72 ? -52  DA  J P     1 
ATOM   9460  O  OP1   . DA  J  6 21  ? -52.258 -40.915 26.506 1.00 143.32 ? -52  DA  J OP1   1 
ATOM   9461  O  OP2   . DA  J  6 21  ? -50.832 -39.079 25.411 1.00 143.09 ? -52  DA  J OP2   1 
ATOM   9462  O  "O5'" . DA  J  6 21  ? -52.929 -39.840 24.329 1.00 146.89 ? -52  DA  J "O5'" 1 
ATOM   9463  C  "C5'" . DA  J  6 21  ? -54.316 -40.211 24.289 1.00 150.59 ? -52  DA  J "C5'" 1 
ATOM   9464  C  "C4'" . DA  J  6 21  ? -55.077 -39.401 23.250 1.00 153.08 ? -52  DA  J "C4'" 1 
ATOM   9465  O  "O4'" . DA  J  6 21  ? -55.232 -38.023 23.691 1.00 153.56 ? -52  DA  J "O4'" 1 
ATOM   9466  C  "C3'" . DA  J  6 21  ? -54.451 -39.357 21.851 1.00 154.47 ? -52  DA  J "C3'" 1 
ATOM   9467  O  "O3'" . DA  J  6 21  ? -55.338 -40.000 20.903 1.00 156.40 ? -52  DA  J "O3'" 1 
ATOM   9468  C  "C2'" . DA  J  6 21  ? -54.220 -37.857 21.625 1.00 154.60 ? -52  DA  J "C2'" 1 
ATOM   9469  C  "C1'" . DA  J  6 21  ? -55.288 -37.232 22.520 1.00 154.57 ? -52  DA  J "C1'" 1 
ATOM   9470  N  N9    . DA  J  6 21  ? -55.063 -35.810 22.813 1.00 154.83 ? -52  DA  J N9    1 
ATOM   9471  C  C8    . DA  J  6 21  ? -53.970 -35.268 23.436 1.00 154.78 ? -52  DA  J C8    1 
ATOM   9472  N  N7    . DA  J  6 21  ? -54.015 -33.962 23.566 1.00 154.82 ? -52  DA  J N7    1 
ATOM   9473  C  C5    . DA  J  6 21  ? -55.223 -33.613 22.983 1.00 154.92 ? -52  DA  J C5    1 
ATOM   9474  C  C6    . DA  J  6 21  ? -55.860 -32.366 22.801 1.00 154.70 ? -52  DA  J C6    1 
ATOM   9475  N  N6    . DA  J  6 21  ? -55.319 -31.216 23.218 1.00 154.77 ? -52  DA  J N6    1 
ATOM   9476  N  N1    . DA  J  6 21  ? -57.063 -32.349 22.175 1.00 154.66 ? -52  DA  J N1    1 
ATOM   9477  C  C2    . DA  J  6 21  ? -57.595 -33.511 21.762 1.00 154.68 ? -52  DA  J C2    1 
ATOM   9478  N  N3    . DA  J  6 21  ? -57.089 -34.744 21.884 1.00 155.00 ? -52  DA  J N3    1 
ATOM   9479  C  C4    . DA  J  6 21  ? -55.888 -34.735 22.509 1.00 155.01 ? -52  DA  J C4    1 
ATOM   9480  P  P     . DC  J  6 22  ? -55.585 -39.534 19.374 1.00 157.95 ? -51  DC  J P     1 
ATOM   9481  O  OP1   . DC  J  6 22  ? -56.283 -40.653 18.692 1.00 157.94 ? -51  DC  J OP1   1 
ATOM   9482  O  OP2   . DC  J  6 22  ? -54.306 -39.028 18.807 1.00 157.29 ? -51  DC  J OP2   1 
ATOM   9483  O  "O5'" . DC  J  6 22  ? -56.606 -38.294 19.533 1.00 159.48 ? -51  DC  J "O5'" 1 
ATOM   9484  C  "C5'" . DC  J  6 22  ? -57.827 -38.189 18.778 1.00 161.99 ? -51  DC  J "C5'" 1 
ATOM   9485  C  "C4'" . DC  J  6 22  ? -57.741 -37.107 17.705 1.00 163.87 ? -51  DC  J "C4'" 1 
ATOM   9486  O  "O4'" . DC  J  6 22  ? -57.159 -35.884 18.248 1.00 163.98 ? -51  DC  J "O4'" 1 
ATOM   9487  C  "C3'" . DC  J  6 22  ? -56.876 -37.464 16.495 1.00 165.26 ? -51  DC  J "C3'" 1 
ATOM   9488  O  "O3'" . DC  J  6 22  ? -57.481 -36.974 15.289 1.00 167.43 ? -51  DC  J "O3'" 1 
ATOM   9489  C  "C2'" . DC  J  6 22  ? -55.558 -36.756 16.815 1.00 164.80 ? -51  DC  J "C2'" 1 
ATOM   9490  C  "C1'" . DC  J  6 22  ? -56.124 -35.457 17.378 1.00 164.22 ? -51  DC  J "C1'" 1 
ATOM   9491  N  N1    . DC  J  6 22  ? -55.148 -34.576 18.108 1.00 164.14 ? -51  DC  J N1    1 
ATOM   9492  C  C2    . DC  J  6 22  ? -55.391 -33.187 18.188 1.00 164.23 ? -51  DC  J C2    1 
ATOM   9493  O  O2    . DC  J  6 22  ? -56.405 -32.697 17.662 1.00 164.33 ? -51  DC  J O2    1 
ATOM   9494  N  N3    . DC  J  6 22  ? -54.500 -32.401 18.853 1.00 164.10 ? -51  DC  J N3    1 
ATOM   9495  C  C4    . DC  J  6 22  ? -53.415 -32.946 19.416 1.00 164.10 ? -51  DC  J C4    1 
ATOM   9496  N  N4    . DC  J  6 22  ? -52.577 -32.126 20.058 1.00 164.18 ? -51  DC  J N4    1 
ATOM   9497  C  C5    . DC  J  6 22  ? -53.145 -34.353 19.347 1.00 164.00 ? -51  DC  J C5    1 
ATOM   9498  C  C6    . DC  J  6 22  ? -54.028 -35.119 18.689 1.00 163.95 ? -51  DC  J C6    1 
ATOM   9499  P  P     . DT  J  6 23  ? -56.742 -37.128 13.867 1.00 169.31 ? -50  DT  J P     1 
ATOM   9500  O  OP1   . DT  J  6 23  ? -56.614 -38.580 13.604 1.00 169.36 ? -50  DT  J OP1   1 
ATOM   9501  O  OP2   . DT  J  6 23  ? -55.522 -36.281 13.856 1.00 169.04 ? -50  DT  J OP2   1 
ATOM   9502  O  "O5'" . DT  J  6 23  ? -57.769 -36.497 12.799 1.00 170.53 ? -50  DT  J "O5'" 1 
ATOM   9503  C  "C5'" . DT  J  6 23  ? -58.607 -35.362 13.117 1.00 172.14 ? -50  DT  J "C5'" 1 
ATOM   9504  C  "C4'" . DT  J  6 23  ? -57.902 -34.008 12.958 1.00 173.39 ? -50  DT  J "C4'" 1 
ATOM   9505  O  "O4'" . DT  J  6 23  ? -57.043 -33.743 14.100 1.00 173.60 ? -50  DT  J "O4'" 1 
ATOM   9506  C  "C3'" . DT  J  6 23  ? -56.965 -33.805 11.756 1.00 174.11 ? -50  DT  J "C3'" 1 
ATOM   9507  O  "O3'" . DT  J  6 23  ? -57.683 -33.477 10.536 1.00 174.90 ? -50  DT  J "O3'" 1 
ATOM   9508  C  "C2'" . DT  J  6 23  ? -56.046 -32.669 12.248 1.00 173.99 ? -50  DT  J "C2'" 1 
ATOM   9509  C  "C1'" . DT  J  6 23  ? -56.305 -32.582 13.758 1.00 173.66 ? -50  DT  J "C1'" 1 
ATOM   9510  N  N1    . DT  J  6 23  ? -55.034 -32.415 14.560 1.00 173.54 ? -50  DT  J N1    1 
ATOM   9511  C  C2    . DT  J  6 23  ? -54.785 -31.187 15.161 1.00 173.56 ? -50  DT  J C2    1 
ATOM   9512  O  O2    . DT  J  6 23  ? -55.543 -30.230 15.092 1.00 173.38 ? -50  DT  J O2    1 
ATOM   9513  N  N3    . DT  J  6 23  ? -53.601 -31.113 15.863 1.00 173.58 ? -50  DT  J N3    1 
ATOM   9514  C  C4    . DT  J  6 23  ? -52.658 -32.119 16.020 1.00 173.52 ? -50  DT  J C4    1 
ATOM   9515  O  O4    . DT  J  6 23  ? -51.629 -31.943 16.671 1.00 173.32 ? -50  DT  J O4    1 
ATOM   9516  C  C5    . DT  J  6 23  ? -52.971 -33.373 15.364 1.00 173.56 ? -50  DT  J C5    1 
ATOM   9517  C  C7    . DT  J  6 23  ? -52.026 -34.540 15.461 1.00 173.55 ? -50  DT  J C7    1 
ATOM   9518  C  C6    . DT  J  6 23  ? -54.125 -33.459 14.674 1.00 173.53 ? -50  DT  J C6    1 
ATOM   9519  P  P     . DA  J  6 24  ? -57.060 -32.596 9.332  1.00 175.54 ? -49  DA  J P     1 
ATOM   9520  O  OP1   . DA  J  6 24  ? -58.074 -32.510 8.250  1.00 175.63 ? -49  DA  J OP1   1 
ATOM   9521  O  OP2   . DA  J  6 24  ? -55.701 -33.101 9.006  1.00 175.45 ? -49  DA  J OP2   1 
ATOM   9522  O  "O5'" . DA  J  6 24  ? -56.880 -31.158 10.021 1.00 175.51 ? -49  DA  J "O5'" 1 
ATOM   9523  C  "C5'" . DA  J  6 24  ? -57.472 -29.954 9.501  1.00 175.55 ? -49  DA  J "C5'" 1 
ATOM   9524  C  "C4'" . DA  J  6 24  ? -56.412 -28.863 9.493  1.00 175.52 ? -49  DA  J "C4'" 1 
ATOM   9525  O  "O4'" . DA  J  6 24  ? -55.604 -28.948 10.703 1.00 175.60 ? -49  DA  J "O4'" 1 
ATOM   9526  C  "C3'" . DA  J  6 24  ? -55.441 -28.951 8.313  1.00 175.35 ? -49  DA  J "C3'" 1 
ATOM   9527  O  "O3'" . DA  J  6 24  ? -55.276 -27.649 7.703  1.00 174.44 ? -49  DA  J "O3'" 1 
ATOM   9528  C  "C2'" . DA  J  6 24  ? -54.177 -29.525 8.958  1.00 175.55 ? -49  DA  J "C2'" 1 
ATOM   9529  C  "C1'" . DA  J  6 24  ? -54.242 -28.887 10.337 1.00 175.97 ? -49  DA  J "C1'" 1 
ATOM   9530  N  N9    . DA  J  6 24  ? -53.381 -29.555 11.308 1.00 176.13 ? -49  DA  J N9    1 
ATOM   9531  C  C8    . DA  J  6 24  ? -53.225 -30.902 11.495 1.00 176.25 ? -49  DA  J C8    1 
ATOM   9532  N  N7    . DA  J  6 24  ? -52.368 -31.215 12.437 1.00 176.28 ? -49  DA  J N7    1 
ATOM   9533  C  C5    . DA  J  6 24  ? -51.922 -29.987 12.896 1.00 176.31 ? -49  DA  J C5    1 
ATOM   9534  C  C6    . DA  J  6 24  ? -50.995 -29.623 13.899 1.00 176.31 ? -49  DA  J C6    1 
ATOM   9535  N  N6    . DA  J  6 24  ? -50.327 -30.514 14.641 1.00 176.20 ? -49  DA  J N6    1 
ATOM   9536  N  N1    . DA  J  6 24  ? -50.778 -28.301 14.105 1.00 176.30 ? -49  DA  J N1    1 
ATOM   9537  C  C2    . DA  J  6 24  ? -51.447 -27.404 13.360 1.00 176.27 ? -49  DA  J C2    1 
ATOM   9538  N  N3    . DA  J  6 24  ? -52.340 -27.627 12.391 1.00 176.25 ? -49  DA  J N3    1 
ATOM   9539  C  C4    . DA  J  6 24  ? -52.534 -28.949 12.207 1.00 176.25 ? -49  DA  J C4    1 
ATOM   9540  P  P     . DC  J  6 25  ? -53.864 -27.090 7.113  1.00 173.36 ? -48  DC  J P     1 
ATOM   9541  O  OP1   . DC  J  6 25  ? -54.156 -25.929 6.236  1.00 173.70 ? -48  DC  J OP1   1 
ATOM   9542  O  OP2   . DC  J  6 25  ? -53.052 -28.207 6.543  1.00 173.29 ? -48  DC  J OP2   1 
ATOM   9543  O  "O5'" . DC  J  6 25  ? -53.124 -26.586 8.465  1.00 172.25 ? -48  DC  J "O5'" 1 
ATOM   9544  C  "C5'" . DC  J  6 25  ? -53.243 -25.232 8.910  1.00 170.80 ? -48  DC  J "C5'" 1 
ATOM   9545  C  "C4'" . DC  J  6 25  ? -51.850 -24.623 8.945  1.00 170.02 ? -48  DC  J "C4'" 1 
ATOM   9546  O  "O4'" . DC  J  6 25  ? -51.010 -25.307 9.913  1.00 169.87 ? -48  DC  J "O4'" 1 
ATOM   9547  C  "C3'" . DC  J  6 25  ? -51.077 -24.692 7.632  1.00 169.60 ? -48  DC  J "C3'" 1 
ATOM   9548  O  "O3'" . DC  J  6 25  ? -50.259 -23.557 7.582  1.00 169.49 ? -48  DC  J "O3'" 1 
ATOM   9549  C  "C2'" . DC  J  6 25  ? -50.208 -25.940 7.768  1.00 169.30 ? -48  DC  J "C2'" 1 
ATOM   9550  C  "C1'" . DC  J  6 25  ? -49.885 -25.900 9.265  1.00 169.11 ? -48  DC  J "C1'" 1 
ATOM   9551  N  N1    . DC  J  6 25  ? -49.598 -27.232 9.911  1.00 168.80 ? -48  DC  J N1    1 
ATOM   9552  C  C2    . DC  J  6 25  ? -48.934 -27.263 11.153 1.00 168.57 ? -48  DC  J C2    1 
ATOM   9553  O  O2    . DC  J  6 25  ? -48.585 -26.202 11.693 1.00 168.34 ? -48  DC  J O2    1 
ATOM   9554  N  N3    . DC  J  6 25  ? -48.680 -28.468 11.731 1.00 168.53 ? -48  DC  J N3    1 
ATOM   9555  C  C4    . DC  J  6 25  ? -49.065 -29.600 11.127 1.00 168.59 ? -48  DC  J C4    1 
ATOM   9556  N  N4    . DC  J  6 25  ? -48.794 -30.755 11.741 1.00 168.63 ? -48  DC  J N4    1 
ATOM   9557  C  C5    . DC  J  6 25  ? -49.747 -29.598 9.868  1.00 168.37 ? -48  DC  J C5    1 
ATOM   9558  C  C6    . DC  J  6 25  ? -49.990 -28.404 9.307  1.00 168.65 ? -48  DC  J C6    1 
ATOM   9559  P  P     . DC  J  6 26  ? -50.273 -22.592 6.307  1.00 169.17 ? -47  DC  J P     1 
ATOM   9560  O  OP1   . DC  J  6 26  ? -51.485 -21.734 6.405  1.00 169.08 ? -47  DC  J OP1   1 
ATOM   9561  O  OP2   . DC  J  6 26  ? -50.055 -23.424 5.095  1.00 169.00 ? -47  DC  J OP2   1 
ATOM   9562  O  "O5'" . DC  J  6 26  ? -48.954 -21.697 6.577  1.00 168.55 ? -47  DC  J "O5'" 1 
ATOM   9563  C  "C5'" . DC  J  6 26  ? -48.613 -21.293 7.922  1.00 166.99 ? -47  DC  J "C5'" 1 
ATOM   9564  C  "C4'" . DC  J  6 26  ? -47.362 -21.986 8.444  1.00 165.98 ? -47  DC  J "C4'" 1 
ATOM   9565  O  "O4'" . DC  J  6 26  ? -47.601 -23.389 8.750  1.00 165.92 ? -47  DC  J "O4'" 1 
ATOM   9566  C  "C3'" . DC  J  6 26  ? -46.157 -21.972 7.501  1.00 165.33 ? -47  DC  J "C3'" 1 
ATOM   9567  O  "O3'" . DC  J  6 26  ? -45.080 -21.214 8.069  1.00 164.35 ? -47  DC  J "O3'" 1 
ATOM   9568  C  "C2'" . DC  J  6 26  ? -45.795 -23.446 7.347  1.00 165.50 ? -47  DC  J "C2'" 1 
ATOM   9569  C  "C1'" . DC  J  6 26  ? -46.314 -23.965 8.683  1.00 165.87 ? -47  DC  J "C1'" 1 
ATOM   9570  N  N1    . DC  J  6 26  ? -46.326 -25.462 8.866  1.00 165.94 ? -47  DC  J N1    1 
ATOM   9571  C  C2    . DC  J  6 26  ? -45.998 -26.011 10.123 1.00 166.05 ? -47  DC  J C2    1 
ATOM   9572  O  O2    . DC  J  6 26  ? -45.717 -25.266 11.076 1.00 166.07 ? -47  DC  J O2    1 
ATOM   9573  N  N3    . DC  J  6 26  ? -46.004 -27.365 10.269 1.00 165.87 ? -47  DC  J N3    1 
ATOM   9574  C  C4    . DC  J  6 26  ? -46.312 -28.156 9.233  1.00 165.78 ? -47  DC  J C4    1 
ATOM   9575  N  N4    . DC  J  6 26  ? -46.308 -29.478 9.426  1.00 165.68 ? -47  DC  J N4    1 
ATOM   9576  C  C5    . DC  J  6 26  ? -46.643 -27.619 7.951  1.00 165.90 ? -47  DC  J C5    1 
ATOM   9577  C  C6    . DC  J  6 26  ? -46.632 -26.286 7.814  1.00 165.91 ? -47  DC  J C6    1 
ATOM   9578  P  P     . DA  J  6 27  ? -44.462 -19.989 7.234  1.00 163.21 ? -46  DA  J P     1 
ATOM   9579  O  OP1   . DA  J  6 27  ? -45.607 -19.234 6.666  1.00 163.25 ? -46  DA  J OP1   1 
ATOM   9580  O  OP2   . DA  J  6 27  ? -43.425 -20.542 6.327  1.00 162.81 ? -46  DA  J OP2   1 
ATOM   9581  O  "O5'" . DA  J  6 27  ? -43.732 -19.017 8.292  1.00 161.69 ? -46  DA  J "O5'" 1 
ATOM   9582  C  "C5'" . DA  J  6 27  ? -43.829 -19.165 9.712  1.00 158.64 ? -46  DA  J "C5'" 1 
ATOM   9583  C  "C4'" . DA  J  6 27  ? -42.609 -19.885 10.267 1.00 156.33 ? -46  DA  J "C4'" 1 
ATOM   9584  O  "O4'" . DA  J  6 27  ? -42.780 -21.311 10.082 1.00 155.33 ? -46  DA  J "O4'" 1 
ATOM   9585  C  "C3'" . DA  J  6 27  ? -41.257 -19.546 9.636  1.00 155.63 ? -46  DA  J "C3'" 1 
ATOM   9586  O  "O3'" . DA  J  6 27  ? -40.291 -19.571 10.675 1.00 155.15 ? -46  DA  J "O3'" 1 
ATOM   9587  C  "C2'" . DA  J  6 27  ? -41.041 -20.694 8.653  1.00 155.24 ? -46  DA  J "C2'" 1 
ATOM   9588  C  "C1'" . DA  J  6 27  ? -41.623 -21.836 9.470  1.00 154.81 ? -46  DA  J "C1'" 1 
ATOM   9589  N  N9    . DA  J  6 27  ? -42.029 -23.025 8.735  1.00 154.61 ? -46  DA  J N9    1 
ATOM   9590  C  C8    . DA  J  6 27  ? -42.256 -23.172 7.395  1.00 154.54 ? -46  DA  J C8    1 
ATOM   9591  N  N7    . DA  J  6 27  ? -42.623 -24.385 7.053  1.00 154.60 ? -46  DA  J N7    1 
ATOM   9592  C  C5    . DA  J  6 27  ? -42.645 -25.081 8.252  1.00 154.72 ? -46  DA  J C5    1 
ATOM   9593  C  C6    . DA  J  6 27  ? -42.951 -26.423 8.590  1.00 154.68 ? -46  DA  J C6    1 
ATOM   9594  N  N6    . DA  J  6 27  ? -43.321 -27.358 7.707  1.00 154.52 ? -46  DA  J N6    1 
ATOM   9595  N  N1    . DA  J  6 27  ? -42.862 -26.776 9.893  1.00 154.71 ? -46  DA  J N1    1 
ATOM   9596  C  C2    . DA  J  6 27  ? -42.493 -25.855 10.798 1.00 154.71 ? -46  DA  J C2    1 
ATOM   9597  N  N3    . DA  J  6 27  ? -42.182 -24.574 10.601 1.00 154.70 ? -46  DA  J N3    1 
ATOM   9598  C  C4    . DA  J  6 27  ? -42.279 -24.250 9.298  1.00 154.71 ? -46  DA  J C4    1 
ATOM   9599  P  P     . DA  J  6 28  ? -38.783 -19.021 10.566 1.00 154.41 ? -45  DA  J P     1 
ATOM   9600  O  OP1   . DA  J  6 28  ? -38.834 -17.541 10.638 1.00 154.17 ? -45  DA  J OP1   1 
ATOM   9601  O  OP2   . DA  J  6 28  ? -38.096 -19.691 9.434  1.00 154.05 ? -45  DA  J OP2   1 
ATOM   9602  O  "O5'" . DA  J  6 28  ? -38.176 -19.572 11.947 1.00 152.87 ? -45  DA  J "O5'" 1 
ATOM   9603  C  "C5'" . DA  J  6 28  ? -38.903 -20.534 12.734 1.00 150.09 ? -45  DA  J "C5'" 1 
ATOM   9604  C  "C4'" . DA  J  6 28  ? -38.433 -21.940 12.418 1.00 148.31 ? -45  DA  J "C4'" 1 
ATOM   9605  O  "O4'" . DA  J  6 28  ? -39.158 -22.511 11.296 1.00 147.70 ? -45  DA  J "O4'" 1 
ATOM   9606  C  "C3'" . DA  J  6 28  ? -36.953 -22.016 12.033 1.00 147.36 ? -45  DA  J "C3'" 1 
ATOM   9607  O  "O3'" . DA  J  6 28  ? -36.316 -22.997 12.806 1.00 145.73 ? -45  DA  J "O3'" 1 
ATOM   9608  C  "C2'" . DA  J  6 28  ? -36.971 -22.458 10.580 1.00 147.60 ? -45  DA  J "C2'" 1 
ATOM   9609  C  "C1'" . DA  J  6 28  ? -38.204 -23.337 10.667 1.00 147.81 ? -45  DA  J "C1'" 1 
ATOM   9610  N  N9    . DA  J  6 28  ? -38.618 -23.872 9.382  1.00 147.79 ? -45  DA  J N9    1 
ATOM   9611  C  C8    . DA  J  6 28  ? -38.665 -23.227 8.181  1.00 147.94 ? -45  DA  J C8    1 
ATOM   9612  N  N7    . DA  J  6 28  ? -39.061 -23.993 7.196  1.00 148.05 ? -45  DA  J N7    1 
ATOM   9613  C  C5    . DA  J  6 28  ? -39.273 -25.224 7.792  1.00 147.92 ? -45  DA  J C5    1 
ATOM   9614  C  C6    . DA  J  6 28  ? -39.703 -26.473 7.289  1.00 148.00 ? -45  DA  J C6    1 
ATOM   9615  N  N6    . DA  J  6 28  ? -40.005 -26.689 6.004  1.00 147.93 ? -45  DA  J N6    1 
ATOM   9616  N  N1    . DA  J  6 28  ? -39.805 -27.501 8.162  1.00 147.95 ? -45  DA  J N1    1 
ATOM   9617  C  C2    . DA  J  6 28  ? -39.499 -27.291 9.450  1.00 147.89 ? -45  DA  J C2    1 
ATOM   9618  N  N3    . DA  J  6 28  ? -39.088 -26.166 10.033 1.00 147.85 ? -45  DA  J N3    1 
ATOM   9619  C  C4    . DA  J  6 28  ? -38.996 -25.166 9.142  1.00 147.74 ? -45  DA  J C4    1 
ATOM   9620  P  P     . DA  J  6 29  ? -35.752 -22.641 14.252 1.00 144.23 ? -44  DA  J P     1 
ATOM   9621  O  OP1   . DA  J  6 29  ? -36.465 -23.514 15.213 1.00 144.31 ? -44  DA  J OP1   1 
ATOM   9622  O  OP2   . DA  J  6 29  ? -35.808 -21.170 14.426 1.00 144.15 ? -44  DA  J OP2   1 
ATOM   9623  O  "O5'" . DA  J  6 29  ? -34.210 -23.089 14.147 1.00 143.34 ? -44  DA  J "O5'" 1 
ATOM   9624  C  "C5'" . DA  J  6 29  ? -33.783 -24.106 13.224 1.00 141.16 ? -44  DA  J "C5'" 1 
ATOM   9625  C  "C4'" . DA  J  6 29  ? -34.217 -25.495 13.686 1.00 139.34 ? -44  DA  J "C4'" 1 
ATOM   9626  O  "O4'" . DA  J  6 29  ? -35.384 -25.938 12.941 1.00 138.53 ? -44  DA  J "O4'" 1 
ATOM   9627  C  "C3'" . DA  J  6 29  ? -33.172 -26.594 13.542 1.00 138.34 ? -44  DA  J "C3'" 1 
ATOM   9628  O  "O3'" . DA  J  6 29  ? -33.266 -27.483 14.652 1.00 137.21 ? -44  DA  J "O3'" 1 
ATOM   9629  C  "C2'" . DA  J  6 29  ? -33.559 -27.255 12.223 1.00 138.64 ? -44  DA  J "C2'" 1 
ATOM   9630  C  "C1'" . DA  J  6 29  ? -35.049 -26.993 12.062 1.00 138.23 ? -44  DA  J "C1'" 1 
ATOM   9631  N  N9    . DA  J  6 29  ? -35.375 -26.595 10.692 1.00 138.15 ? -44  DA  J N9    1 
ATOM   9632  C  C8    . DA  J  6 29  ? -35.255 -25.348 10.143 1.00 137.92 ? -44  DA  J C8    1 
ATOM   9633  N  N7    . DA  J  6 29  ? -35.623 -25.274 8.888  1.00 137.73 ? -44  DA  J N7    1 
ATOM   9634  C  C5    . DA  J  6 29  ? -36.000 -26.569 8.585  1.00 137.88 ? -44  DA  J C5    1 
ATOM   9635  C  C6    . DA  J  6 29  ? -36.487 -27.160 7.405  1.00 137.91 ? -44  DA  J C6    1 
ATOM   9636  N  N6    . DA  J  6 29  ? -36.674 -26.476 6.274  1.00 137.98 ? -44  DA  J N6    1 
ATOM   9637  N  N1    . DA  J  6 29  ? -36.773 -28.481 7.428  1.00 137.97 ? -44  DA  J N1    1 
ATOM   9638  C  C2    . DA  J  6 29  ? -36.582 -29.162 8.566  1.00 138.04 ? -44  DA  J C2    1 
ATOM   9639  N  N3    . DA  J  6 29  ? -36.132 -28.717 9.742  1.00 138.09 ? -44  DA  J N3    1 
ATOM   9640  C  C4    . DA  J  6 29  ? -35.855 -27.400 9.683  1.00 138.10 ? -44  DA  J C4    1 
ATOM   9641  P  P     . DA  J  6 30  ? -32.667 -28.968 14.636 1.00 137.25 ? -43  DA  J P     1 
ATOM   9642  O  OP1   . DA  J  6 30  ? -32.779 -29.470 16.020 1.00 137.55 ? -43  DA  J OP1   1 
ATOM   9643  O  OP2   . DA  J  6 30  ? -31.344 -28.967 13.967 1.00 137.24 ? -43  DA  J OP2   1 
ATOM   9644  O  "O5'" . DA  J  6 30  ? -33.719 -29.768 13.724 1.00 136.84 ? -43  DA  J "O5'" 1 
ATOM   9645  C  "C5'" . DA  J  6 30  ? -33.814 -31.189 13.785 1.00 135.57 ? -43  DA  J "C5'" 1 
ATOM   9646  C  "C4'" . DA  J  6 30  ? -33.406 -31.792 12.453 1.00 134.47 ? -43  DA  J "C4'" 1 
ATOM   9647  O  "O4'" . DA  J  6 30  ? -33.787 -30.891 11.377 1.00 134.48 ? -43  DA  J "O4'" 1 
ATOM   9648  C  "C3'" . DA  J  6 30  ? -31.908 -32.042 12.299 1.00 133.41 ? -43  DA  J "C3'" 1 
ATOM   9649  O  "O3'" . DA  J  6 30  ? -31.710 -33.369 11.821 1.00 132.31 ? -43  DA  J "O3'" 1 
ATOM   9650  C  "C2'" . DA  J  6 30  ? -31.495 -31.000 11.266 1.00 133.88 ? -43  DA  J "C2'" 1 
ATOM   9651  C  "C1'" . DA  J  6 30  ? -32.758 -30.942 10.416 1.00 134.92 ? -43  DA  J "C1'" 1 
ATOM   9652  N  N9    . DA  J  6 30  ? -32.842 -29.804 9.496  1.00 135.22 ? -43  DA  J N9    1 
ATOM   9653  C  C8    . DA  J  6 30  ? -32.466 -28.514 9.743  1.00 135.17 ? -43  DA  J C8    1 
ATOM   9654  N  N7    . DA  J  6 30  ? -32.645 -27.693 8.739  1.00 135.45 ? -43  DA  J N7    1 
ATOM   9655  C  C5    . DA  J  6 30  ? -33.171 -28.500 7.745  1.00 135.48 ? -43  DA  J C5    1 
ATOM   9656  C  C6    . DA  J  6 30  ? -33.576 -28.231 6.418  1.00 135.15 ? -43  DA  J C6    1 
ATOM   9657  N  N6    . DA  J  6 30  ? -33.509 -27.017 5.864  1.00 135.00 ? -43  DA  J N6    1 
ATOM   9658  N  N1    . DA  J  6 30  ? -34.057 -29.260 5.685  1.00 135.27 ? -43  DA  J N1    1 
ATOM   9659  C  C2    . DA  J  6 30  ? -34.126 -30.479 6.244  1.00 135.35 ? -43  DA  J C2    1 
ATOM   9660  N  N3    . DA  J  6 30  ? -33.777 -30.854 7.479  1.00 135.42 ? -43  DA  J N3    1 
ATOM   9661  C  C4    . DA  J  6 30  ? -33.299 -29.809 8.190  1.00 135.59 ? -43  DA  J C4    1 
ATOM   9662  P  P     . DG  J  6 31  ? -30.261 -34.073 11.788 1.00 132.10 ? -42  DG  J P     1 
ATOM   9663  O  OP1   . DG  J  6 31  ? -30.227 -35.021 12.952 1.00 132.42 ? -42  DG  J OP1   1 
ATOM   9664  O  OP2   . DG  J  6 31  ? -29.149 -33.011 11.566 1.00 132.34 ? -42  DG  J OP2   1 
ATOM   9665  O  "O5'" . DG  J  6 31  ? -30.259 -34.922 10.406 1.00 132.97 ? -42  DG  J "O5'" 1 
ATOM   9666  C  "C5'" . DG  J  6 31  ? -31.492 -35.328 9.747  1.00 133.55 ? -42  DG  J "C5'" 1 
ATOM   9667  C  "C4'" . DG  J  6 31  ? -31.420 -35.134 8.236  1.00 133.85 ? -42  DG  J "C4'" 1 
ATOM   9668  O  "O4'" . DG  J  6 31  ? -31.636 -33.735 7.906  1.00 133.84 ? -42  DG  J "O4'" 1 
ATOM   9669  C  "C3'" . DG  J  6 31  ? -30.101 -35.534 7.572  1.00 134.24 ? -42  DG  J "C3'" 1 
ATOM   9670  O  "O3'" . DG  J  6 31  ? -30.329 -36.389 6.455  1.00 135.02 ? -42  DG  J "O3'" 1 
ATOM   9671  C  "C2'" . DG  J  6 31  ? -29.492 -34.206 7.127  1.00 134.27 ? -42  DG  J "C2'" 1 
ATOM   9672  C  "C1'" . DG  J  6 31  ? -30.746 -33.381 6.865  1.00 134.34 ? -42  DG  J "C1'" 1 
ATOM   9673  N  N9    . DG  J  6 31  ? -30.535 -31.933 6.852  1.00 134.19 ? -42  DG  J N9    1 
ATOM   9674  C  C8    . DG  J  6 31  ? -30.168 -31.137 7.908  1.00 134.15 ? -42  DG  J C8    1 
ATOM   9675  N  N7    . DG  J  6 31  ? -30.057 -29.878 7.601  1.00 134.05 ? -42  DG  J N7    1 
ATOM   9676  C  C5    . DG  J  6 31  ? -30.369 -29.832 6.249  1.00 134.32 ? -42  DG  J C5    1 
ATOM   9677  C  C6    . DG  J  6 31  ? -30.416 -28.730 5.354  1.00 134.43 ? -42  DG  J C6    1 
ATOM   9678  O  O6    . DG  J  6 31  ? -30.183 -27.538 5.595  1.00 134.38 ? -42  DG  J O6    1 
ATOM   9679  N  N1    . DG  J  6 31  ? -30.773 -29.108 4.060  1.00 134.44 ? -42  DG  J N1    1 
ATOM   9680  C  C2    . DG  J  6 31  ? -31.056 -30.398 3.676  1.00 134.48 ? -42  DG  J C2    1 
ATOM   9681  N  N2    . DG  J  6 31  ? -31.380 -30.574 2.386  1.00 134.52 ? -42  DG  J N2    1 
ATOM   9682  N  N3    . DG  J  6 31  ? -31.013 -31.442 4.503  1.00 134.54 ? -42  DG  J N3    1 
ATOM   9683  C  C4    . DG  J  6 31  ? -30.666 -31.089 5.771  1.00 134.32 ? -42  DG  J C4    1 
ATOM   9684  P  P     . DT  J  6 32  ? -29.382 -37.657 6.219  1.00 135.51 ? -41  DT  J P     1 
ATOM   9685  O  OP1   . DT  J  6 32  ? -30.032 -38.806 6.889  1.00 135.32 ? -41  DT  J OP1   1 
ATOM   9686  O  OP2   . DT  J  6 32  ? -28.004 -37.257 6.582  1.00 135.35 ? -41  DT  J OP2   1 
ATOM   9687  O  "O5'" . DT  J  6 32  ? -29.391 -37.909 4.634  1.00 137.46 ? -41  DT  J "O5'" 1 
ATOM   9688  C  "C5'" . DT  J  6 32  ? -30.366 -37.318 3.769  1.00 139.45 ? -41  DT  J "C5'" 1 
ATOM   9689  C  "C4'" . DT  J  6 32  ? -29.769 -36.611 2.557  1.00 140.97 ? -41  DT  J "C4'" 1 
ATOM   9690  O  "O4'" . DT  J  6 32  ? -29.710 -35.187 2.826  1.00 141.17 ? -41  DT  J "O4'" 1 
ATOM   9691  C  "C3'" . DT  J  6 32  ? -28.370 -37.039 2.092  1.00 141.98 ? -41  DT  J "C3'" 1 
ATOM   9692  O  "O3'" . DT  J  6 32  ? -28.465 -37.445 0.704  1.00 143.41 ? -41  DT  J "O3'" 1 
ATOM   9693  C  "C2'" . DT  J  6 32  ? -27.519 -35.794 2.357  1.00 141.98 ? -41  DT  J "C2'" 1 
ATOM   9694  C  "C1'" . DT  J  6 32  ? -28.552 -34.680 2.207  1.00 142.21 ? -41  DT  J "C1'" 1 
ATOM   9695  N  N1    . DT  J  6 32  ? -28.212 -33.369 2.850  1.00 142.49 ? -41  DT  J N1    1 
ATOM   9696  C  C2    . DT  J  6 32  ? -28.551 -32.188 2.205  1.00 142.58 ? -41  DT  J C2    1 
ATOM   9697  O  O2    . DT  J  6 32  ? -29.117 -32.119 1.127  1.00 142.83 ? -41  DT  J O2    1 
ATOM   9698  N  N3    . DT  J  6 32  ? -28.197 -31.052 2.880  1.00 142.49 ? -41  DT  J N3    1 
ATOM   9699  C  C4    . DT  J  6 32  ? -27.561 -30.967 4.105  1.00 142.66 ? -41  DT  J C4    1 
ATOM   9700  O  O4    . DT  J  6 32  ? -27.295 -29.881 4.609  1.00 142.64 ? -41  DT  J O4    1 
ATOM   9701  C  C5    . DT  J  6 32  ? -27.230 -32.230 4.731  1.00 142.84 ? -41  DT  J C5    1 
ATOM   9702  C  C7    . DT  J  6 32  ? -26.532 -32.268 6.063  1.00 142.63 ? -41  DT  J C7    1 
ATOM   9703  C  C6    . DT  J  6 32  ? -27.571 -33.355 4.081  1.00 142.75 ? -41  DT  J C6    1 
ATOM   9704  P  P     . DG  J  6 33  ? -27.269 -37.486 -0.385 1.00 144.98 ? -40  DG  J P     1 
ATOM   9705  O  OP1   . DG  J  6 33  ? -27.311 -38.850 -0.973 1.00 144.96 ? -40  DG  J OP1   1 
ATOM   9706  O  OP2   . DG  J  6 33  ? -26.000 -36.969 0.177  1.00 144.74 ? -40  DG  J OP2   1 
ATOM   9707  O  "O5'" . DG  J  6 33  ? -27.771 -36.425 -1.485 1.00 146.14 ? -40  DG  J "O5'" 1 
ATOM   9708  C  "C5'" . DG  J  6 33  ? -27.173 -36.361 -2.791 1.00 147.73 ? -40  DG  J "C5'" 1 
ATOM   9709  C  "C4'" . DG  J  6 33  ? -26.241 -35.163 -2.926 1.00 148.97 ? -40  DG  J "C4'" 1 
ATOM   9710  O  "O4'" . DG  J  6 33  ? -26.434 -34.234 -1.823 1.00 149.61 ? -40  DG  J "O4'" 1 
ATOM   9711  C  "C3'" . DG  J  6 33  ? -24.751 -35.521 -2.929 1.00 149.48 ? -40  DG  J "C3'" 1 
ATOM   9712  O  "O3'" . DG  J  6 33  ? -24.212 -35.483 -4.277 1.00 149.50 ? -40  DG  J "O3'" 1 
ATOM   9713  C  "C2'" . DG  J  6 33  ? -24.109 -34.539 -1.940 1.00 149.83 ? -40  DG  J "C2'" 1 
ATOM   9714  C  "C1'" . DG  J  6 33  ? -25.220 -33.538 -1.621 1.00 150.23 ? -40  DG  J "C1'" 1 
ATOM   9715  N  N9    . DG  J  6 33  ? -25.108 -33.033 -0.250 1.00 150.36 ? -40  DG  J N9    1 
ATOM   9716  C  C8    . DG  J  6 33  ? -25.084 -33.794 0.895  1.00 150.44 ? -40  DG  J C8    1 
ATOM   9717  N  N7    . DG  J  6 33  ? -24.956 -33.102 1.989  1.00 150.43 ? -40  DG  J N7    1 
ATOM   9718  C  C5    . DG  J  6 33  ? -24.881 -31.789 1.546  1.00 150.47 ? -40  DG  J C5    1 
ATOM   9719  C  C6    . DG  J  6 33  ? -24.735 -30.592 2.289  1.00 150.47 ? -40  DG  J C6    1 
ATOM   9720  O  O6    . DG  J  6 33  ? -24.641 -30.465 3.517  1.00 150.41 ? -40  DG  J O6    1 
ATOM   9721  N  N1    . DG  J  6 33  ? -24.701 -29.464 1.472  1.00 150.39 ? -40  DG  J N1    1 
ATOM   9722  C  C2    . DG  J  6 33  ? -24.792 -29.497 0.104  1.00 150.34 ? -40  DG  J C2    1 
ATOM   9723  N  N2    . DG  J  6 33  ? -24.741 -28.307 -0.504 1.00 150.49 ? -40  DG  J N2    1 
ATOM   9724  N  N3    . DG  J  6 33  ? -24.930 -30.612 -0.610 1.00 150.36 ? -40  DG  J N3    1 
ATOM   9725  C  C4    . DG  J  6 33  ? -24.967 -31.724 0.171  1.00 150.40 ? -40  DG  J C4    1 
ATOM   9726  P  P     . DT  J  6 34  ? -23.056 -34.493 -4.811 1.00 149.66 ? -39  DT  J P     1 
ATOM   9727  O  OP1   . DT  J  6 34  ? -22.857 -34.809 -6.242 1.00 149.61 ? -39  DT  J OP1   1 
ATOM   9728  O  OP2   . DT  J  6 34  ? -21.889 -34.577 -3.903 1.00 149.41 ? -39  DT  J OP2   1 
ATOM   9729  O  "O5'" . DT  J  6 34  ? -23.712 -33.030 -4.680 1.00 149.40 ? -39  DT  J "O5'" 1 
ATOM   9730  C  "C5'" . DT  J  6 34  ? -23.586 -32.043 -5.708 1.00 149.00 ? -39  DT  J "C5'" 1 
ATOM   9731  C  "C4'" . DT  J  6 34  ? -22.421 -31.100 -5.445 1.00 148.81 ? -39  DT  J "C4'" 1 
ATOM   9732  O  "O4'" . DT  J  6 34  ? -22.356 -30.793 -4.029 1.00 148.93 ? -39  DT  J "O4'" 1 
ATOM   9733  C  "C3'" . DT  J  6 34  ? -21.048 -31.649 -5.843 1.00 148.50 ? -39  DT  J "C3'" 1 
ATOM   9734  O  "O3'" . DT  J  6 34  ? -20.423 -30.770 -6.802 1.00 147.92 ? -39  DT  J "O3'" 1 
ATOM   9735  C  "C2'" . DT  J  6 34  ? -20.302 -31.803 -4.519 1.00 148.71 ? -39  DT  J "C2'" 1 
ATOM   9736  C  "C1'" . DT  J  6 34  ? -20.999 -30.770 -3.639 1.00 149.31 ? -39  DT  J "C1'" 1 
ATOM   9737  N  N1    . DT  J  6 34  ? -20.875 -31.015 -2.155 1.00 149.53 ? -39  DT  J N1    1 
ATOM   9738  C  C2    . DT  J  6 34  ? -20.833 -29.935 -1.285 1.00 149.50 ? -39  DT  J C2    1 
ATOM   9739  O  O2    . DT  J  6 34  ? -20.896 -28.769 -1.638 1.00 149.55 ? -39  DT  J O2    1 
ATOM   9740  N  N3    . DT  J  6 34  ? -20.714 -30.274 0.040  1.00 149.48 ? -39  DT  J N3    1 
ATOM   9741  C  C4    . DT  J  6 34  ? -20.632 -31.550 0.577  1.00 149.55 ? -39  DT  J C4    1 
ATOM   9742  O  O4    . DT  J  6 34  ? -20.528 -31.733 1.785  1.00 149.45 ? -39  DT  J O4    1 
ATOM   9743  C  C5    . DT  J  6 34  ? -20.678 -32.637 -0.379 1.00 149.70 ? -39  DT  J C5    1 
ATOM   9744  C  C7    . DT  J  6 34  ? -20.599 -34.072 0.072  1.00 149.47 ? -39  DT  J C7    1 
ATOM   9745  C  C6    . DT  J  6 34  ? -20.795 -32.318 -1.678 1.00 149.82 ? -39  DT  J C6    1 
ATOM   9746  P  P     . DA  J  6 35  ? -19.104 -29.877 -6.583 1.00 147.39 ? -38  DA  J P     1 
ATOM   9747  O  OP1   . DA  J  6 35  ? -18.642 -29.507 -7.940 1.00 147.51 ? -38  DA  J OP1   1 
ATOM   9748  O  OP2   . DA  J  6 35  ? -18.157 -30.575 -5.680 1.00 146.95 ? -38  DA  J OP2   1 
ATOM   9749  O  "O5'" . DA  J  6 35  ? -19.663 -28.567 -5.838 1.00 147.26 ? -38  DA  J "O5'" 1 
ATOM   9750  C  "C5'" . DA  J  6 35  ? -19.261 -27.247 -6.241 1.00 147.54 ? -38  DA  J "C5'" 1 
ATOM   9751  C  "C4'" . DA  J  6 35  ? -18.353 -26.564 -5.221 1.00 147.88 ? -38  DA  J "C4'" 1 
ATOM   9752  O  "O4'" . DA  J  6 35  ? -18.578 -27.117 -3.893 1.00 147.95 ? -38  DA  J "O4'" 1 
ATOM   9753  C  "C3'" . DA  J  6 35  ? -16.844 -26.680 -5.482 1.00 147.93 ? -38  DA  J "C3'" 1 
ATOM   9754  O  "O3'" . DA  J  6 35  ? -16.208 -25.387 -5.354 1.00 147.53 ? -38  DA  J "O3'" 1 
ATOM   9755  C  "C2'" . DA  J  6 35  ? -16.385 -27.675 -4.413 1.00 147.93 ? -38  DA  J "C2'" 1 
ATOM   9756  C  "C1'" . DA  J  6 35  ? -17.318 -27.286 -3.274 1.00 148.03 ? -38  DA  J "C1'" 1 
ATOM   9757  N  N9    . DA  J  6 35  ? -17.386 -28.244 -2.168 1.00 148.20 ? -38  DA  J N9    1 
ATOM   9758  C  C8    . DA  J  6 35  ? -17.583 -29.600 -2.233 1.00 148.25 ? -38  DA  J C8    1 
ATOM   9759  N  N7    . DA  J  6 35  ? -17.591 -30.197 -1.062 1.00 148.11 ? -38  DA  J N7    1 
ATOM   9760  C  C5    . DA  J  6 35  ? -17.380 -29.161 -0.167 1.00 148.15 ? -38  DA  J C5    1 
ATOM   9761  C  C6    . DA  J  6 35  ? -17.277 -29.121 1.238  1.00 148.00 ? -38  DA  J C6    1 
ATOM   9762  N  N6    . DA  J  6 35  ? -17.381 -30.208 2.001  1.00 148.14 ? -38  DA  J N6    1 
ATOM   9763  N  N1    . DA  J  6 35  ? -17.064 -27.924 1.831  1.00 148.14 ? -38  DA  J N1    1 
ATOM   9764  C  C2    . DA  J  6 35  ? -16.958 -26.828 1.064  1.00 148.07 ? -38  DA  J C2    1 
ATOM   9765  N  N3    . DA  J  6 35  ? -17.039 -26.742 -0.264 1.00 148.15 ? -38  DA  J N3    1 
ATOM   9766  C  C4    . DA  J  6 35  ? -17.251 -27.950 -0.827 1.00 148.27 ? -38  DA  J C4    1 
ATOM   9767  P  P     . DT  J  6 36  ? -14.609 -25.178 -5.287 1.00 147.47 ? -37  DT  J P     1 
ATOM   9768  O  OP1   . DT  J  6 36  ? -14.328 -23.807 -5.777 1.00 147.44 ? -37  DT  J OP1   1 
ATOM   9769  O  OP2   . DT  J  6 36  ? -13.931 -26.320 -5.940 1.00 147.35 ? -37  DT  J OP2   1 
ATOM   9770  O  "O5'" . DT  J  6 36  ? -14.285 -25.235 -3.715 1.00 146.92 ? -37  DT  J "O5'" 1 
ATOM   9771  C  "C5'" . DT  J  6 36  ? -14.897 -24.287 -2.826 1.00 146.20 ? -37  DT  J "C5'" 1 
ATOM   9772  C  "C4'" . DT  J  6 36  ? -14.224 -24.188 -1.461 1.00 145.43 ? -37  DT  J "C4'" 1 
ATOM   9773  O  "O4'" . DT  J  6 36  ? -14.552 -25.347 -0.645 1.00 145.37 ? -37  DT  J "O4'" 1 
ATOM   9774  C  "C3'" . DT  J  6 36  ? -12.700 -24.055 -1.457 1.00 144.79 ? -37  DT  J "C3'" 1 
ATOM   9775  O  "O3'" . DT  J  6 36  ? -12.355 -22.877 -0.712 1.00 143.64 ? -37  DT  J "O3'" 1 
ATOM   9776  C  "C2'" . DT  J  6 36  ? -12.217 -25.347 -0.781 1.00 145.11 ? -37  DT  J "C2'" 1 
ATOM   9777  C  "C1'" . DT  J  6 36  ? -13.410 -25.736 0.096  1.00 145.07 ? -37  DT  J "C1'" 1 
ATOM   9778  N  N1    . DT  J  6 36  ? -13.527 -27.202 0.447  1.00 144.81 ? -37  DT  J N1    1 
ATOM   9779  C  C2    . DT  J  6 36  ? -13.891 -27.583 1.733  1.00 144.89 ? -37  DT  J C2    1 
ATOM   9780  O  O2    . DT  J  6 36  ? -14.140 -26.809 2.644  1.00 144.74 ? -37  DT  J O2    1 
ATOM   9781  N  N3    . DT  J  6 36  ? -13.970 -28.941 1.925  1.00 144.91 ? -37  DT  J N3    1 
ATOM   9782  C  C4    . DT  J  6 36  ? -13.723 -29.941 0.999  1.00 144.95 ? -37  DT  J C4    1 
ATOM   9783  O  O4    . DT  J  6 36  ? -13.823 -31.130 1.293  1.00 144.85 ? -37  DT  J O4    1 
ATOM   9784  C  C5    . DT  J  6 36  ? -13.346 -29.479 -0.321 1.00 144.84 ? -37  DT  J C5    1 
ATOM   9785  C  C7    . DT  J  6 36  ? -13.050 -30.453 -1.426 1.00 144.95 ? -37  DT  J C7    1 
ATOM   9786  C  C6    . DT  J  6 36  ? -13.270 -28.155 -0.525 1.00 144.74 ? -37  DT  J C6    1 
ATOM   9787  P  P     . DT  J  6 37  ? -10.879 -22.234 -0.699 1.00 143.04 ? -36  DT  J P     1 
ATOM   9788  O  OP1   . DT  J  6 37  ? -10.972 -20.831 -1.175 1.00 143.24 ? -36  DT  J OP1   1 
ATOM   9789  O  OP2   . DT  J  6 37  ? -9.933  -23.171 -1.347 1.00 143.10 ? -36  DT  J OP2   1 
ATOM   9790  O  "O5'" . DT  J  6 37  ? -10.544 -22.183 0.870  1.00 142.03 ? -36  DT  J "O5'" 1 
ATOM   9791  C  "C5'" . DT  J  6 37  ? -11.552 -21.773 1.802  1.00 140.17 ? -36  DT  J "C5'" 1 
ATOM   9792  C  "C4'" . DT  J  6 37  ? -11.351 -22.431 3.163  1.00 138.57 ? -36  DT  J "C4'" 1 
ATOM   9793  O  "O4'" . DT  J  6 37  ? -11.697 -23.844 3.120  1.00 138.29 ? -36  DT  J "O4'" 1 
ATOM   9794  C  "C3'" . DT  J  6 37  ? -9.922  -22.331 3.690  1.00 137.34 ? -36  DT  J "C3'" 1 
ATOM   9795  O  "O3'" . DT  J  6 37  ? -9.934  -21.650 4.937  1.00 135.03 ? -36  DT  J "O3'" 1 
ATOM   9796  C  "C2'" . DT  J  6 37  ? -9.440  -23.778 3.811  1.00 137.73 ? -36  DT  J "C2'" 1 
ATOM   9797  C  "C1'" . DT  J  6 37  ? -10.746 -24.569 3.876  1.00 138.20 ? -36  DT  J "C1'" 1 
ATOM   9798  N  N1    . DT  J  6 37  ? -10.618 -25.960 3.328  1.00 138.31 ? -36  DT  J N1    1 
ATOM   9799  C  C2    . DT  J  6 37  ? -11.078 -27.023 4.081  1.00 138.30 ? -36  DT  J C2    1 
ATOM   9800  O  O2    . DT  J  6 37  ? -11.594 -26.904 5.177  1.00 138.41 ? -36  DT  J O2    1 
ATOM   9801  N  N3    . DT  J  6 37  ? -10.910 -28.254 3.501  1.00 138.39 ? -36  DT  J N3    1 
ATOM   9802  C  C4    . DT  J  6 37  ? -10.341 -28.531 2.270  1.00 138.48 ? -36  DT  J C4    1 
ATOM   9803  O  O4    . DT  J  6 37  ? -10.247 -29.684 1.854  1.00 138.47 ? -36  DT  J O4    1 
ATOM   9804  C  C5    . DT  J  6 37  ? -9.874  -27.377 1.526  1.00 138.62 ? -36  DT  J C5    1 
ATOM   9805  C  C7    . DT  J  6 37  ? -9.232  -27.532 0.173  1.00 138.47 ? -36  DT  J C7    1 
ATOM   9806  C  C6    . DT  J  6 37  ? -10.033 -26.166 2.087  1.00 138.50 ? -36  DT  J C6    1 
ATOM   9807  P  P     . DT  J  6 38  ? -8.566  -21.170 5.620  1.00 133.72 ? -35  DT  J P     1 
ATOM   9808  O  OP1   . DT  J  6 38  ? -8.891  -19.945 6.384  1.00 133.44 ? -35  DT  J OP1   1 
ATOM   9809  O  OP2   . DT  J  6 38  ? -7.482  -21.153 4.608  1.00 133.64 ? -35  DT  J OP2   1 
ATOM   9810  O  "O5'" . DT  J  6 38  ? -8.251  -22.361 6.643  1.00 133.61 ? -35  DT  J "O5'" 1 
ATOM   9811  C  "C5'" . DT  J  6 38  ? -9.308  -22.891 7.468  1.00 132.43 ? -35  DT  J "C5'" 1 
ATOM   9812  C  "C4'" . DT  J  6 38  ? -8.853  -23.994 8.418  1.00 131.04 ? -35  DT  J "C4'" 1 
ATOM   9813  O  "O4'" . DT  J  6 38  ? -9.054  -25.294 7.802  1.00 131.13 ? -35  DT  J "O4'" 1 
ATOM   9814  C  "C3'" . DT  J  6 38  ? -7.394  -23.946 8.887  1.00 130.05 ? -35  DT  J "C3'" 1 
ATOM   9815  O  "O3'" . DT  J  6 38  ? -7.301  -24.317 10.263 1.00 127.72 ? -35  DT  J "O3'" 1 
ATOM   9816  C  "C2'" . DT  J  6 38  ? -6.731  -25.011 8.025  1.00 131.01 ? -35  DT  J "C2'" 1 
ATOM   9817  C  "C1'" . DT  J  6 38  ? -7.859  -26.040 7.929  1.00 132.28 ? -35  DT  J "C1'" 1 
ATOM   9818  N  N1    . DT  J  6 38  ? -7.767  -26.982 6.767  1.00 132.86 ? -35  DT  J N1    1 
ATOM   9819  C  C2    . DT  J  6 38  ? -8.341  -28.240 6.854  1.00 133.02 ? -35  DT  J C2    1 
ATOM   9820  O  O2    . DT  J  6 38  ? -8.933  -28.660 7.835  1.00 132.93 ? -35  DT  J O2    1 
ATOM   9821  N  N3    . DT  J  6 38  ? -8.193  -29.007 5.726  1.00 133.18 ? -35  DT  J N3    1 
ATOM   9822  C  C4    . DT  J  6 38  ? -7.547  -28.657 4.552  1.00 132.89 ? -35  DT  J C4    1 
ATOM   9823  O  O4    . DT  J  6 38  ? -7.480  -29.439 3.609  1.00 132.99 ? -35  DT  J O4    1 
ATOM   9824  C  C5    . DT  J  6 38  ? -6.971  -27.328 4.529  1.00 132.85 ? -35  DT  J C5    1 
ATOM   9825  C  C7    . DT  J  6 38  ? -6.239  -26.801 3.331  1.00 132.87 ? -35  DT  J C7    1 
ATOM   9826  C  C6    . DT  J  6 38  ? -7.111  -26.569 5.620  1.00 132.84 ? -35  DT  J C6    1 
ATOM   9827  P  P     . DG  J  6 39  ? -7.621  -23.331 11.491 1.00 124.94 ? -34  DG  J P     1 
ATOM   9828  O  OP1   . DG  J  6 39  ? -8.731  -22.402 11.155 1.00 124.54 ? -34  DG  J OP1   1 
ATOM   9829  O  OP2   . DG  J  6 39  ? -6.311  -22.808 11.942 1.00 124.72 ? -34  DG  J OP2   1 
ATOM   9830  O  "O5'" . DG  J  6 39  ? -8.186  -24.317 12.617 1.00 123.29 ? -34  DG  J "O5'" 1 
ATOM   9831  C  "C5'" . DG  J  6 39  ? -9.196  -25.267 12.305 1.00 121.15 ? -34  DG  J "C5'" 1 
ATOM   9832  C  "C4'" . DG  J  6 39  ? -8.900  -26.638 12.902 1.00 120.81 ? -34  DG  J "C4'" 1 
ATOM   9833  O  "O4'" . DG  J  6 39  ? -8.187  -27.486 11.967 1.00 120.84 ? -34  DG  J "O4'" 1 
ATOM   9834  C  "C3'" . DG  J  6 39  ? -8.037  -26.692 14.159 1.00 120.21 ? -34  DG  J "C3'" 1 
ATOM   9835  O  "O3'" . DG  J  6 39  ? -8.380  -27.883 14.867 1.00 117.10 ? -34  DG  J "O3'" 1 
ATOM   9836  C  "C2'" . DG  J  6 39  ? -6.620  -26.778 13.596 1.00 121.62 ? -34  DG  J "C2'" 1 
ATOM   9837  C  "C1'" . DG  J  6 39  ? -6.886  -27.751 12.459 1.00 123.46 ? -34  DG  J "C1'" 1 
ATOM   9838  N  N9    . DG  J  6 39  ? -6.025  -27.592 11.307 1.00 124.38 ? -34  DG  J N9    1 
ATOM   9839  C  C8    . DG  J  6 39  ? -5.272  -26.506 10.920 1.00 124.79 ? -34  DG  J C8    1 
ATOM   9840  N  N7    . DG  J  6 39  ? -4.625  -26.706 9.803  1.00 125.06 ? -34  DG  J N7    1 
ATOM   9841  C  C5    . DG  J  6 39  ? -4.983  -28.002 9.438  1.00 124.99 ? -34  DG  J C5    1 
ATOM   9842  C  C6    . DG  J  6 39  ? -4.603  -28.784 8.324  1.00 124.54 ? -34  DG  J C6    1 
ATOM   9843  O  O6    . DG  J  6 39  ? -3.842  -28.464 7.405  1.00 124.50 ? -34  DG  J O6    1 
ATOM   9844  N  N1    . DG  J  6 39  ? -5.193  -30.053 8.344  1.00 124.63 ? -34  DG  J N1    1 
ATOM   9845  C  C2    . DG  J  6 39  ? -6.054  -30.508 9.321  1.00 124.59 ? -34  DG  J C2    1 
ATOM   9846  N  N2    . DG  J  6 39  ? -6.530  -31.750 9.186  1.00 124.71 ? -34  DG  J N2    1 
ATOM   9847  N  N3    . DG  J  6 39  ? -6.423  -29.790 10.368 1.00 124.83 ? -34  DG  J N3    1 
ATOM   9848  C  C4    . DG  J  6 39  ? -5.847  -28.557 10.356 1.00 125.03 ? -34  DG  J C4    1 
ATOM   9849  P  P     . DG  J  6 40  ? -7.900  -28.138 16.363 1.00 113.97 ? -33  DG  J P     1 
ATOM   9850  O  OP1   . DG  J  6 40  ? -9.064  -28.725 17.048 1.00 114.61 ? -33  DG  J OP1   1 
ATOM   9851  O  OP2   . DG  J  6 40  ? -7.241  -26.919 16.886 1.00 114.08 ? -33  DG  J OP2   1 
ATOM   9852  O  "O5'" . DG  J  6 40  ? -6.796  -29.276 16.205 1.00 114.50 ? -33  DG  J "O5'" 1 
ATOM   9853  C  "C5'" . DG  J  6 40  ? -7.154  -30.565 15.721 1.00 115.50 ? -33  DG  J "C5'" 1 
ATOM   9854  C  "C4'" . DG  J  6 40  ? -5.894  -31.334 15.379 1.00 116.91 ? -33  DG  J "C4'" 1 
ATOM   9855  O  "O4'" . DG  J  6 40  ? -5.193  -30.615 14.334 1.00 117.28 ? -33  DG  J "O4'" 1 
ATOM   9856  C  "C3'" . DG  J  6 40  ? -4.886  -31.503 16.523 1.00 117.83 ? -33  DG  J "C3'" 1 
ATOM   9857  O  "O3'" . DG  J  6 40  ? -4.382  -32.840 16.517 1.00 119.15 ? -33  DG  J "O3'" 1 
ATOM   9858  C  "C2'" . DG  J  6 40  ? -3.780  -30.491 16.212 1.00 117.88 ? -33  DG  J "C2'" 1 
ATOM   9859  C  "C1'" . DG  J  6 40  ? -3.825  -30.570 14.689 1.00 117.88 ? -33  DG  J "C1'" 1 
ATOM   9860  N  N9    . DG  J  6 40  ? -3.174  -29.539 13.887 1.00 117.95 ? -33  DG  J N9    1 
ATOM   9861  C  C8    . DG  J  6 40  ? -2.704  -28.270 14.174 1.00 118.01 ? -33  DG  J C8    1 
ATOM   9862  N  N7    . DG  J  6 40  ? -2.180  -27.664 13.136 1.00 117.83 ? -33  DG  J N7    1 
ATOM   9863  C  C5    . DG  J  6 40  ? -2.330  -28.603 12.114 1.00 118.07 ? -33  DG  J C5    1 
ATOM   9864  C  C6    . DG  J  6 40  ? -1.963  -28.572 10.749 1.00 118.02 ? -33  DG  J C6    1 
ATOM   9865  O  O6    . DG  J  6 40  ? -1.408  -27.655 10.140 1.00 117.98 ? -33  DG  J O6    1 
ATOM   9866  N  N1    . DG  J  6 40  ? -2.300  -29.756 10.078 1.00 118.18 ? -33  DG  J N1    1 
ATOM   9867  C  C2    . DG  J  6 40  ? -2.924  -30.846 10.650 1.00 117.92 ? -33  DG  J C2    1 
ATOM   9868  N  N2    . DG  J  6 40  ? -3.179  -31.906 9.878  1.00 117.83 ? -33  DG  J N2    1 
ATOM   9869  N  N3    . DG  J  6 40  ? -3.267  -30.892 11.921 1.00 117.88 ? -33  DG  J N3    1 
ATOM   9870  C  C4    . DG  J  6 40  ? -2.940  -29.747 12.570 1.00 117.88 ? -33  DG  J C4    1 
ATOM   9871  P  P     . DA  J  6 41  ? -4.659  -33.838 17.739 1.00 119.44 ? -32  DA  J P     1 
ATOM   9872  O  OP1   . DA  J  6 41  ? -6.125  -34.046 17.854 1.00 119.27 ? -32  DA  J OP1   1 
ATOM   9873  O  OP2   . DA  J  6 41  ? -3.897  -33.329 18.902 1.00 119.87 ? -32  DA  J OP2   1 
ATOM   9874  O  "O5'" . DA  J  6 41  ? -3.964  -35.189 17.235 1.00 121.60 ? -32  DA  J "O5'" 1 
ATOM   9875  C  "C5'" . DA  J  6 41  ? -4.547  -35.958 16.175 1.00 125.19 ? -32  DA  J "C5'" 1 
ATOM   9876  C  "C4'" . DA  J  6 41  ? -3.492  -36.734 15.402 1.00 127.95 ? -32  DA  J "C4'" 1 
ATOM   9877  O  "O4'" . DA  J  6 41  ? -2.931  -35.900 14.354 1.00 128.62 ? -32  DA  J "O4'" 1 
ATOM   9878  C  "C3'" . DA  J  6 41  ? -2.323  -37.246 16.245 1.00 129.87 ? -32  DA  J "C3'" 1 
ATOM   9879  O  "O3'" . DA  J  6 41  ? -2.173  -38.674 16.011 1.00 132.25 ? -32  DA  J "O3'" 1 
ATOM   9880  C  "C2'" . DA  J  6 41  ? -1.152  -36.330 15.867 1.00 129.64 ? -32  DA  J "C2'" 1 
ATOM   9881  C  "C1'" . DA  J  6 41  ? -1.528  -35.768 14.495 1.00 129.22 ? -32  DA  J "C1'" 1 
ATOM   9882  N  N9    . DA  J  6 41  ? -1.169  -34.357 14.294 1.00 129.33 ? -32  DA  J N9    1 
ATOM   9883  C  C8    . DA  J  6 41  ? -1.107  -33.373 15.247 1.00 129.37 ? -32  DA  J C8    1 
ATOM   9884  N  N7    . DA  J  6 41  ? -0.763  -32.193 14.785 1.00 129.51 ? -32  DA  J N7    1 
ATOM   9885  C  C5    . DA  J  6 41  ? -0.587  -32.406 13.427 1.00 129.68 ? -32  DA  J C5    1 
ATOM   9886  C  C6    . DA  J  6 41  ? -0.209  -31.548 12.363 1.00 129.46 ? -32  DA  J C6    1 
ATOM   9887  N  N6    . DA  J  6 41  ? 0.061   -30.249 12.527 1.00 129.15 ? -32  DA  J N6    1 
ATOM   9888  N  N1    . DA  J  6 41  ? -0.125  -32.077 11.117 1.00 129.25 ? -32  DA  J N1    1 
ATOM   9889  C  C2    . DA  J  6 41  ? -0.397  -33.381 10.950 1.00 129.30 ? -32  DA  J C2    1 
ATOM   9890  N  N3    . DA  J  6 41  ? -0.755  -34.285 11.870 1.00 129.55 ? -32  DA  J N3    1 
ATOM   9891  C  C4    . DA  J  6 41  ? -0.833  -33.736 13.104 1.00 129.61 ? -32  DA  J C4    1 
ATOM   9892  P  P     . DA  J  6 42  ? -0.848  -39.466 15.555 1.00 133.40 ? -31  DA  J P     1 
ATOM   9893  O  OP1   . DA  J  6 42  ? -1.219  -40.901 15.521 1.00 133.12 ? -31  DA  J OP1   1 
ATOM   9894  O  OP2   . DA  J  6 42  ? 0.295   -39.032 16.397 1.00 133.22 ? -31  DA  J OP2   1 
ATOM   9895  O  "O5'" . DA  J  6 42  ? -0.634  -38.945 14.046 1.00 134.95 ? -31  DA  J "O5'" 1 
ATOM   9896  C  "C5'" . DA  J  6 42  ? -0.037  -39.772 13.032 1.00 136.39 ? -31  DA  J "C5'" 1 
ATOM   9897  C  "C4'" . DA  J  6 42  ? 1.366   -39.303 12.692 1.00 137.21 ? -31  DA  J "C4'" 1 
ATOM   9898  O  "O4'" . DA  J  6 42  ? 1.362   -37.862 12.582 1.00 137.30 ? -31  DA  J "O4'" 1 
ATOM   9899  C  "C3'" . DA  J  6 42  ? 2.413   -39.635 13.751 1.00