data_3REK
# 
_entry.id   3REK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3REK         
NDB   NA1065       
RCSB  RCSB064833   
WWPDB D_1000064833 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1KX3 .                       unspecified 
PDB 1KX4 .                       unspecified 
PDB 1KX5 .                       unspecified 
PDB 2NZD 'Molrep starting model' unspecified 
PDB 3REH .                       unspecified 
PDB 3REI .                       unspecified 
PDB 3REJ .                       unspecified 
PDB 3REL .                       unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3REK 
_pdbx_database_status.recvd_initial_deposition_date   2011-04-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wu, B.'      1 
'Davey, C.A.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.' 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            39 
_citation.page_first                8200 
_citation.page_last                 8212 
_citation.year                      2011 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21724603 
_citation.pdbx_database_id_DOI      10.1093/nar/gkr491 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wu, B.'        1 
primary 'Davey, G.E.'   2 
primary 'Nazarov, A.A.' 3 
primary 'Dyson, P.J.'   4 
primary 'Davey, C.A.'   5 
# 
_cell.entry_id           3REK 
_cell.length_a           105.001 
_cell.length_b           109.436 
_cell.length_c           176.357 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3REK 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone H3.2'       15303.930 2  ? ? ? ? 
2 polymer     man 'Histone H4'         11263.231 2  ? ? ? ? 
3 polymer     man 'Histone H2A type1'  13978.241 2  ? ? ? ? 
4 polymer     man 'Histone H2B 1.1'    13524.752 2  ? ? ? ? 
5 polymer     syn 'DNA (146-MER)'      45054.840 2  ? ? ? ? 
6 non-polymer syn 'MANGANESE (II) ION' 54.938    2  ? ? ? ? 
7 non-polymer syn 'PLATINUM (II) ION'  195.078   40 ? ? ? ? 
8 non-polymer syn 'SULFATE ION'        96.063    3  ? ? ? ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        H2B1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
C,G ? 
4 'polypeptide(L)'        no no 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DC)(DT)(DT)(DG)(DC)(DG)
(DG)(DA)(DT)(DC)(DG)(DT)(DA)(DG)(DA)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DG)(DT)(DC)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DG)(DC)(DT)(DA)(DT)(DC)(DA)(DA)(DA)(DG)(DG)(DG)(DA)
(DA)(DA)(DC)(DT)(DT)(DC)(DA)(DA)(DC)(DT)(DG)(DA)(DA)(DT)(DT)(DC)(DA)(DG)(DT)(DT)
(DG)(DA)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DC)(DT)(DT)(DT)(DG)(DA)(DT)(DA)(DG)(DC)(DG)
(DC)(DA)(DG)(DT)(DT)(DT)(DG)(DA)(DC)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DT)(DC)(DT)
(DA)(DC)(DG)(DA)(DT)(DC)(DC)(DG)(DC)(DA)(DA)(DG)(DG)(DG)(DA)(DT)(DA)(DT)(DT)(DT)
(DG)(DG)(DA)(DG)(DA)(DT)
;
;ATCTCCAAATATCCCTTGCGGATCGTAGAAAAAGTGTGTCAAACTGCGCTATCAAAGGGAAACTTCAACTGAATTCAGTT
GAAGTTTCCCTTTGATAGCGCAGTTTGACACACTTTTTCTACGATCCGCAAGGGATATTTGGAGAT
;
I,J ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   THR n 
1 4   LYS n 
1 5   GLN n 
1 6   THR n 
1 7   ALA n 
1 8   ARG n 
1 9   LYS n 
1 10  SER n 
1 11  THR n 
1 12  GLY n 
1 13  GLY n 
1 14  LYS n 
1 15  ALA n 
1 16  PRO n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  LEU n 
1 21  ALA n 
1 22  THR n 
1 23  LYS n 
1 24  ALA n 
1 25  ALA n 
1 26  ARG n 
1 27  LYS n 
1 28  SER n 
1 29  ALA n 
1 30  PRO n 
1 31  ALA n 
1 32  THR n 
1 33  GLY n 
1 34  GLY n 
1 35  VAL n 
1 36  LYS n 
1 37  LYS n 
1 38  PRO n 
1 39  HIS n 
1 40  ARG n 
1 41  TYR n 
1 42  ARG n 
1 43  PRO n 
1 44  GLY n 
1 45  THR n 
1 46  VAL n 
1 47  ALA n 
1 48  LEU n 
1 49  ARG n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  ARG n 
1 54  TYR n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  GLU n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  GLN n 
1 69  ARG n 
1 70  LEU n 
1 71  VAL n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  ALA n 
1 76  GLN n 
1 77  ASP n 
1 78  PHE n 
1 79  LYS n 
1 80  THR n 
1 81  ASP n 
1 82  LEU n 
1 83  ARG n 
1 84  PHE n 
1 85  GLN n 
1 86  SER n 
1 87  SER n 
1 88  ALA n 
1 89  VAL n 
1 90  MET n 
1 91  ALA n 
1 92  LEU n 
1 93  GLN n 
1 94  GLU n 
1 95  ALA n 
1 96  SER n 
1 97  GLU n 
1 98  ALA n 
1 99  TYR n 
1 100 LEU n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 PHE n 
1 105 GLU n 
1 106 ASP n 
1 107 THR n 
1 108 ASN n 
1 109 LEU n 
1 110 CYS n 
1 111 ALA n 
1 112 ILE n 
1 113 HIS n 
1 114 ALA n 
1 115 LYS n 
1 116 ARG n 
1 117 VAL n 
1 118 THR n 
1 119 ILE n 
1 120 MET n 
1 121 PRO n 
1 122 LYS n 
1 123 ASP n 
1 124 ILE n 
1 125 GLN n 
1 126 LEU n 
1 127 ALA n 
1 128 ARG n 
1 129 ARG n 
1 130 ILE n 
1 131 ARG n 
1 132 GLY n 
1 133 GLU n 
1 134 ARG n 
1 135 ALA n 
2 1   SER n 
2 2   GLY n 
2 3   ARG n 
2 4   GLY n 
2 5   LYS n 
2 6   GLY n 
2 7   GLY n 
2 8   LYS n 
2 9   GLY n 
2 10  LEU n 
2 11  GLY n 
2 12  LYS n 
2 13  GLY n 
2 14  GLY n 
2 15  ALA n 
2 16  LYS n 
2 17  ARG n 
2 18  HIS n 
2 19  ARG n 
2 20  LYS n 
2 21  VAL n 
2 22  LEU n 
2 23  ARG n 
2 24  ASP n 
2 25  ASN n 
2 26  ILE n 
2 27  GLN n 
2 28  GLY n 
2 29  ILE n 
2 30  THR n 
2 31  LYS n 
2 32  PRO n 
2 33  ALA n 
2 34  ILE n 
2 35  ARG n 
2 36  ARG n 
2 37  LEU n 
2 38  ALA n 
2 39  ARG n 
2 40  ARG n 
2 41  GLY n 
2 42  GLY n 
2 43  VAL n 
2 44  LYS n 
2 45  ARG n 
2 46  ILE n 
2 47  SER n 
2 48  GLY n 
2 49  LEU n 
2 50  ILE n 
2 51  TYR n 
2 52  GLU n 
2 53  GLU n 
2 54  THR n 
2 55  ARG n 
2 56  GLY n 
2 57  VAL n 
2 58  LEU n 
2 59  LYS n 
2 60  VAL n 
2 61  PHE n 
2 62  LEU n 
2 63  GLU n 
2 64  ASN n 
2 65  VAL n 
2 66  ILE n 
2 67  ARG n 
2 68  ASP n 
2 69  ALA n 
2 70  VAL n 
2 71  THR n 
2 72  TYR n 
2 73  THR n 
2 74  GLU n 
2 75  HIS n 
2 76  ALA n 
2 77  LYS n 
2 78  ARG n 
2 79  LYS n 
2 80  THR n 
2 81  VAL n 
2 82  THR n 
2 83  ALA n 
2 84  MET n 
2 85  ASP n 
2 86  VAL n 
2 87  VAL n 
2 88  TYR n 
2 89  ALA n 
2 90  LEU n 
2 91  LYS n 
2 92  ARG n 
2 93  GLN n 
2 94  GLY n 
2 95  ARG n 
2 96  THR n 
2 97  LEU n 
2 98  TYR n 
2 99  GLY n 
2 100 PHE n 
2 101 GLY n 
2 102 GLY n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLN n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  THR n 
3 11  ARG n 
3 12  ALA n 
3 13  LYS n 
3 14  ALA n 
3 15  LYS n 
3 16  THR n 
3 17  ARG n 
3 18  SER n 
3 19  SER n 
3 20  ARG n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  GLN n 
3 25  PHE n 
3 26  PRO n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  VAL n 
3 31  HIS n 
3 32  ARG n 
3 33  LEU n 
3 34  LEU n 
3 35  ARG n 
3 36  LYS n 
3 37  GLY n 
3 38  ASN n 
3 39  TYR n 
3 40  ALA n 
3 41  GLU n 
3 42  ARG n 
3 43  VAL n 
3 44  GLY n 
3 45  ALA n 
3 46  GLY n 
3 47  ALA n 
3 48  PRO n 
3 49  VAL n 
3 50  TYR n 
3 51  LEU n 
3 52  ALA n 
3 53  ALA n 
3 54  VAL n 
3 55  LEU n 
3 56  GLU n 
3 57  TYR n 
3 58  LEU n 
3 59  THR n 
3 60  ALA n 
3 61  GLU n 
3 62  ILE n 
3 63  LEU n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  GLY n 
3 68  ASN n 
3 69  ALA n 
3 70  ALA n 
3 71  ARG n 
3 72  ASP n 
3 73  ASN n 
3 74  LYS n 
3 75  LYS n 
3 76  THR n 
3 77  ARG n 
3 78  ILE n 
3 79  ILE n 
3 80  PRO n 
3 81  ARG n 
3 82  HIS n 
3 83  LEU n 
3 84  GLN n 
3 85  LEU n 
3 86  ALA n 
3 87  VAL n 
3 88  ARG n 
3 89  ASN n 
3 90  ASP n 
3 91  GLU n 
3 92  GLU n 
3 93  LEU n 
3 94  ASN n 
3 95  LYS n 
3 96  LEU n 
3 97  LEU n 
3 98  GLY n 
3 99  ARG n 
3 100 VAL n 
3 101 THR n 
3 102 ILE n 
3 103 ALA n 
3 104 GLN n 
3 105 GLY n 
3 106 GLY n 
3 107 VAL n 
3 108 LEU n 
3 109 PRO n 
3 110 ASN n 
3 111 ILE n 
3 112 GLN n 
3 113 SER n 
3 114 VAL n 
3 115 LEU n 
3 116 LEU n 
3 117 PRO n 
3 118 LYS n 
3 119 LYS n 
3 120 THR n 
3 121 GLU n 
3 122 SER n 
3 123 SER n 
3 124 LYS n 
3 125 SER n 
3 126 ALA n 
3 127 LYS n 
3 128 SER n 
3 129 LYS n 
4 1   ALA n 
4 2   LYS n 
4 3   SER n 
4 4   ALA n 
4 5   PRO n 
4 6   ALA n 
4 7   PRO n 
4 8   LYS n 
4 9   LYS n 
4 10  GLY n 
4 11  SER n 
4 12  LYS n 
4 13  LYS n 
4 14  ALA n 
4 15  VAL n 
4 16  THR n 
4 17  LYS n 
4 18  THR n 
4 19  GLN n 
4 20  LYS n 
4 21  LYS n 
4 22  ASP n 
4 23  GLY n 
4 24  LYS n 
4 25  LYS n 
4 26  ARG n 
4 27  ARG n 
4 28  LYS n 
4 29  THR n 
4 30  ARG n 
4 31  LYS n 
4 32  GLU n 
4 33  SER n 
4 34  TYR n 
4 35  ALA n 
4 36  ILE n 
4 37  TYR n 
4 38  VAL n 
4 39  TYR n 
4 40  LYS n 
4 41  VAL n 
4 42  LEU n 
4 43  LYS n 
4 44  GLN n 
4 45  VAL n 
4 46  HIS n 
4 47  PRO n 
4 48  ASP n 
4 49  THR n 
4 50  GLY n 
4 51  ILE n 
4 52  SER n 
4 53  SER n 
4 54  LYS n 
4 55  ALA n 
4 56  MET n 
4 57  SER n 
4 58  ILE n 
4 59  MET n 
4 60  ASN n 
4 61  SER n 
4 62  PHE n 
4 63  VAL n 
4 64  ASN n 
4 65  ASP n 
4 66  VAL n 
4 67  PHE n 
4 68  GLU n 
4 69  ARG n 
4 70  ILE n 
4 71  ALA n 
4 72  GLY n 
4 73  GLU n 
4 74  ALA n 
4 75  SER n 
4 76  ARG n 
4 77  LEU n 
4 78  ALA n 
4 79  HIS n 
4 80  TYR n 
4 81  ASN n 
4 82  LYS n 
4 83  ARG n 
4 84  SER n 
4 85  THR n 
4 86  ILE n 
4 87  THR n 
4 88  SER n 
4 89  ARG n 
4 90  GLU n 
4 91  ILE n 
4 92  GLN n 
4 93  THR n 
4 94  ALA n 
4 95  VAL n 
4 96  ARG n 
4 97  LEU n 
4 98  LEU n 
4 99  LEU n 
4 100 PRO n 
4 101 GLY n 
4 102 GLU n 
4 103 LEU n 
4 104 ALA n 
4 105 LYS n 
4 106 HIS n 
4 107 ALA n 
4 108 VAL n 
4 109 SER n 
4 110 GLU n 
4 111 GLY n 
4 112 THR n 
4 113 LYS n 
4 114 ALA n 
4 115 VAL n 
4 116 THR n 
4 117 LYS n 
4 118 TYR n 
4 119 THR n 
4 120 SER n 
4 121 ALA n 
4 122 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DT  n 
5 5   DC  n 
5 6   DC  n 
5 7   DA  n 
5 8   DA  n 
5 9   DA  n 
5 10  DT  n 
5 11  DA  n 
5 12  DT  n 
5 13  DC  n 
5 14  DC  n 
5 15  DC  n 
5 16  DT  n 
5 17  DT  n 
5 18  DG  n 
5 19  DC  n 
5 20  DG  n 
5 21  DG  n 
5 22  DA  n 
5 23  DT  n 
5 24  DC  n 
5 25  DG  n 
5 26  DT  n 
5 27  DA  n 
5 28  DG  n 
5 29  DA  n 
5 30  DA  n 
5 31  DA  n 
5 32  DA  n 
5 33  DA  n 
5 34  DG  n 
5 35  DT  n 
5 36  DG  n 
5 37  DT  n 
5 38  DG  n 
5 39  DT  n 
5 40  DC  n 
5 41  DA  n 
5 42  DA  n 
5 43  DA  n 
5 44  DC  n 
5 45  DT  n 
5 46  DG  n 
5 47  DC  n 
5 48  DG  n 
5 49  DC  n 
5 50  DT  n 
5 51  DA  n 
5 52  DT  n 
5 53  DC  n 
5 54  DA  n 
5 55  DA  n 
5 56  DA  n 
5 57  DG  n 
5 58  DG  n 
5 59  DG  n 
5 60  DA  n 
5 61  DA  n 
5 62  DA  n 
5 63  DC  n 
5 64  DT  n 
5 65  DT  n 
5 66  DC  n 
5 67  DA  n 
5 68  DA  n 
5 69  DC  n 
5 70  DT  n 
5 71  DG  n 
5 72  DA  n 
5 73  DA  n 
5 74  DT  n 
5 75  DT  n 
5 76  DC  n 
5 77  DA  n 
5 78  DG  n 
5 79  DT  n 
5 80  DT  n 
5 81  DG  n 
5 82  DA  n 
5 83  DA  n 
5 84  DG  n 
5 85  DT  n 
5 86  DT  n 
5 87  DT  n 
5 88  DC  n 
5 89  DC  n 
5 90  DC  n 
5 91  DT  n 
5 92  DT  n 
5 93  DT  n 
5 94  DG  n 
5 95  DA  n 
5 96  DT  n 
5 97  DA  n 
5 98  DG  n 
5 99  DC  n 
5 100 DG  n 
5 101 DC  n 
5 102 DA  n 
5 103 DG  n 
5 104 DT  n 
5 105 DT  n 
5 106 DT  n 
5 107 DG  n 
5 108 DA  n 
5 109 DC  n 
5 110 DA  n 
5 111 DC  n 
5 112 DA  n 
5 113 DC  n 
5 114 DT  n 
5 115 DT  n 
5 116 DT  n 
5 117 DT  n 
5 118 DT  n 
5 119 DC  n 
5 120 DT  n 
5 121 DA  n 
5 122 DC  n 
5 123 DG  n 
5 124 DA  n 
5 125 DT  n 
5 126 DC  n 
5 127 DC  n 
5 128 DG  n 
5 129 DC  n 
5 130 DA  n 
5 131 DA  n 
5 132 DG  n 
5 133 DG  n 
5 134 DG  n 
5 135 DA  n 
5 136 DT  n 
5 137 DA  n 
5 138 DT  n 
5 139 DT  n 
5 140 DT  n 
5 141 DG  n 
5 142 DG  n 
5 143 DA  n 
5 144 DG  n 
5 145 DA  n 
5 146 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              5 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP H32_XENLA   P84233 1 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2 ? 
2 UNP H4_XENLA    P62799 2 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2 ? 
3 UNP H2A1_XENLA  P06897 3 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
2 ? 
4 UNP H2B11_XENLA P02281 4 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
5 ? 
5 PDB 3REK        3REK   5 
;ATCTCCAAATATCCCTTGCGGATCGTAGAAAAAGTGTGTCAAACTGCGCTATCAAAGGGAAACTTCAACTGAATTCAGTT
GAAGTTTCCCTTTGATAGCGCAGTTTGACACACTTTTTCTACGATCCGCAAGGGATATTTGGAGAT
;
? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3REK A 1 ? 135 ? P84233 2   ? 136 ? 1   135 
2  2 3REK B 1 ? 102 ? P62799 2   ? 103 ? 1   102 
3  3 3REK C 1 ? 129 ? P06897 2   ? 130 ? 1   129 
4  4 3REK D 1 ? 122 ? P02281 5   ? 126 ? 1   122 
5  1 3REK E 1 ? 135 ? P84233 2   ? 136 ? 1   135 
6  2 3REK F 1 ? 102 ? P62799 2   ? 103 ? 1   102 
7  3 3REK G 1 ? 129 ? P06897 2   ? 130 ? 1   129 
8  4 3REK H 1 ? 122 ? P02281 5   ? 126 ? 1   122 
9  5 3REK I 1 ? 146 ? 3REK   -72 ? 73  ? -72 73  
10 5 3REK J 1 ? 146 ? 3REK   -73 ? 72  ? -73 72  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3REK ALA A 102 ? UNP P84233 GLY 103 VARIANT 102 1 
3 3REK ARG C 99  ? UNP P06897 GLY 100 VARIANT 99  2 
3 3REK SER C 123 ? UNP P06897 ALA 124 VARIANT 123 3 
4 3REK THR D 29  ? UNP P02281 SER 33  VARIANT 29  4 
5 3REK ALA E 102 ? UNP P84233 GLY 103 VARIANT 102 5 
7 3REK ARG G 99  ? UNP P06897 GLY 100 VARIANT 99  6 
7 3REK SER G 123 ? UNP P06897 ALA 124 VARIANT 123 7 
8 3REK THR H 29  ? UNP P02281 SER 33  VARIANT 29  8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
PT  non-polymer         . 'PLATINUM (II) ION'                  ? 'Pt 2'            195.078 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                        ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3REK 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.56 
_exptl_crystal.density_percent_sol   51.87 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.07 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.07 
# 
_reflns.entry_id                     3REK 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             57 
_reflns.d_resolution_high            2.60 
_reflns.number_obs                   57610 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         93.5 
_reflns.pdbx_Rmerge_I_obs            0.061 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        18.4 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 3REK 
_refine.ls_number_reflns_obs                     57610 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             57 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    93.08 
_refine.ls_R_factor_obs                          0.26046 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.25999 
_refine.ls_R_factor_R_free                       0.28120 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.1 
_refine.ls_number_reflns_R_free                  1210 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.913 
_refine.correlation_coeff_Fo_to_Fc_free          0.905 
_refine.B_iso_mean                               90.860 
_refine.aniso_B[1][1]                            2.58 
_refine.aniso_B[2][2]                            -3.93 
_refine.aniso_B[3][3]                            1.35 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1KX4 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.344 
_refine.overall_SU_ML                            0.274 
_refine.overall_SU_B                             12.601 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6015 
_refine_hist.pdbx_number_atoms_nucleic_acid   5980 
_refine_hist.pdbx_number_atoms_ligand         57 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               12052 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        57 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.010  0.021  ? 12814 ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.433  2.548  ? 18561 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       5.098  5.000  ? 749   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       34.277 21.269 ? 268   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       18.520 15.000 ? 1163  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       18.983 15.000 ? 85    ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.077  0.200  ? 2111  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.004  0.020  ? 7537  ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_refined                0.211  0.200  ? 4996  ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              0.309  0.200  ? 8022  ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        0.175  0.200  ? 354   ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       0.193  0.200  ? 37    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     0.193  0.200  ? 5     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  0.808  1.500  ? 3812  ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 1.380  2.000  ? 6046  ? 'X-RAY DIFFRACTION' 
r_scbond_it                  1.215  3.000  ? 12127 ? 'X-RAY DIFFRACTION' 
r_scangle_it                 2.159  4.500  ? 12515 ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.600 
_refine_ls_shell.d_res_low                        2.668 
_refine_ls_shell.number_reflns_R_work             2925 
_refine_ls_shell.R_factor_R_work                  0.305 
_refine_ls_shell.percent_reflns_obs               64.78 
_refine_ls_shell.R_factor_R_free                  0.284 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             60 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3REK 
_struct.title                     
;2.6 Angstrom Crystal Structure of the Nucleosome Core Particle Assembled with a 146 bp Alpha-Satellite DNA (NCP146b) Derivatized with Oxaliplatin
;
_struct.pdbx_descriptor           'Histone H3.2, Histone H4, Histone H2A type1, Histone H2B 1.1/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3REK 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
_struct_keywords.text            'nucleosome, STRUCTURAL PROTEIN-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 4 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 3 ? 
H  N N 4 ? 
I  N N 5 ? 
J  N N 5 ? 
K  N N 6 ? 
L  N N 7 ? 
M  N N 7 ? 
N  N N 7 ? 
O  N N 8 ? 
P  N N 6 ? 
Q  N N 8 ? 
R  N N 7 ? 
S  N N 7 ? 
T  N N 8 ? 
U  N N 7 ? 
V  N N 7 ? 
W  N N 7 ? 
X  N N 7 ? 
Y  N N 7 ? 
Z  N N 7 ? 
AA N N 7 ? 
BA N N 7 ? 
CA N N 7 ? 
DA N N 7 ? 
EA N N 7 ? 
FA N N 7 ? 
GA N N 7 ? 
HA N N 7 ? 
IA N N 7 ? 
JA N N 7 ? 
KA N N 7 ? 
LA N N 7 ? 
MA N N 7 ? 
NA N N 7 ? 
OA N N 7 ? 
PA N N 7 ? 
QA N N 7 ? 
RA N N 7 ? 
SA N N 7 ? 
TA N N 7 ? 
UA N N 7 ? 
VA N N 7 ? 
WA N N 7 ? 
XA N N 7 ? 
YA N N 7 ? 
ZA N N 7 ? 
AB N N 7 ? 
BB N N 7 ? 
CB N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 44  ? SER A 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  2  ARG A 63  ? ASP A 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  3  GLN A 85  ? ALA A 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  4  MET A 120 ? ARG A 131 ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  5  ASP B 24  ? ILE B 29  ? ASP B 24  ILE B 29  5 ? 6  
HELX_P HELX_P6  6  THR B 30  ? GLY B 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  7  LEU B 49  ? ALA B 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  8  THR B 82  ? GLN B 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  9  THR C 16  ? ALA C 21  ? THR C 16  ALA C 21  1 ? 6  
HELX_P HELX_P10 10 PRO C 26  ? LYS C 36  ? PRO C 26  LYS C 36  1 ? 11 
HELX_P HELX_P11 11 ALA C 45  ? ASN C 73  ? ALA C 45  ASN C 73  1 ? 29 
HELX_P HELX_P12 12 ILE C 79  ? ASP C 90  ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P13 13 ASP C 90  ? LEU C 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 14 GLN C 112 ? LEU C 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 15 TYR D 34  ? HIS D 46  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 16 SER D 52  ? ASN D 81  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 17 THR D 87  ? LEU D 99  ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 18 PRO D 100 ? ALA D 121 ? PRO D 100 ALA D 121 1 ? 22 
HELX_P HELX_P19 19 GLY E 44  ? SER E 57  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 20 ARG E 63  ? ASP E 77  ? ARG E 63  ASP E 77  1 ? 15 
HELX_P HELX_P21 21 GLN E 85  ? ALA E 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 22 MET E 120 ? ARG E 131 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P23 23 ASN F 25  ? ILE F 29  ? ASN F 25  ILE F 29  5 ? 5  
HELX_P HELX_P24 24 THR F 30  ? GLY F 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 25 LEU F 49  ? ALA F 76  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P26 26 THR F 82  ? GLN F 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 27 THR G 16  ? GLY G 22  ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P28 28 PRO G 26  ? LYS G 36  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P29 29 GLY G 46  ? ASN G 73  ? GLY G 46  ASN G 73  1 ? 28 
HELX_P HELX_P30 30 ILE G 79  ? ASP G 90  ? ILE G 79  ASP G 90  1 ? 12 
HELX_P HELX_P31 31 ASP G 90  ? LEU G 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 32 GLN G 112 ? LEU G 116 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 33 TYR H 34  ? HIS H 46  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 34 SER H 52  ? ASN H 81  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 35 THR H 87  ? LEU H 99  ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 36 PRO H 100 ? SER H 120 ? PRO H 100 SER H 120 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? I DG  94  N7  ? ? ? 1_555 GA PT .   PT ? ? I DG  21  I PT 86   1_555 ? ? ? ? ? ? ?               1.864 ? 
metalc2   metalc ? ? J DG  38  N7  ? ? ? 1_555 CB PT .   PT ? ? J DG  -36 J PT 89   1_555 ? ? ? ? ? ? ?               1.892 ? 
metalc3   metalc ? ? J DG  57  N7  ? ? ? 1_555 UA PT .   PT ? ? J DG  -17 J PT 81   1_555 ? ? ? ? ? ? ?               1.899 ? 
metalc4   metalc ? ? I DG  59  N7  ? ? ? 1_555 X  PT .   PT ? ? I DG  -14 I PT 77   1_555 ? ? ? ? ? ? ?               1.981 ? 
metalc5   metalc ? ? A ASP 77  OD1 ? ? ? 1_555 K  MN .   MN ? ? A ASP 77  A MN 1001 1_555 ? ? ? ? ? ? ?               1.994 ? 
metalc6   metalc ? ? J DG  34  N7  ? ? ? 1_555 BB PT .   PT ? ? J DG  -40 J PT 88   1_555 ? ? ? ? ? ? ?               2.031 ? 
metalc7   metalc ? ? J DG  81  N7  ? ? ? 1_555 PA PT .   PT ? ? J DG  7   J PT 76   1_555 ? ? ? ? ? ? ?               2.034 ? 
metalc8   metalc ? ? I DG  46  N7  ? ? ? 1_555 HA PT .   PT ? ? I DG  -27 I PT 87   1_555 ? ? ? ? ? ? ?               2.066 ? 
metalc9   metalc ? ? J DG  20  N9  ? ? ? 1_555 RA PT .   PT ? ? J DG  -54 J PT 78   1_555 ? ? ? ? ? ? ?               2.142 ? 
metalc10  metalc ? ? J DG  142 O6  ? ? ? 1_555 QA PT .   PT ? ? J DG  68  J PT 77   1_555 ? ? ? ? ? ? ?               2.159 ? 
metalc11  metalc ? ? I DG  144 N7  ? ? ? 1_555 V  PT .   PT ? ? I DG  71  I PT 75   1_555 ? ? ? ? ? ? ?               2.195 ? 
metalc12  metalc ? ? J DG  98  N7  ? ? ? 1_555 SA PT .   PT ? ? J DG  24  J PT 79   1_555 ? ? ? ? ? ? ?               2.275 ? 
metalc13  metalc ? ? J DG  142 N7  ? ? ? 1_555 QA PT .   PT ? ? J DG  68  J PT 77   1_555 ? ? ? ? ? ? ?               2.300 ? 
metalc14  metalc ? ? I DG  142 N7  ? ? ? 1_555 CA PT .   PT ? ? I DG  69  I PT 82   1_555 ? ? ? ? ? ? ?               2.304 ? 
metalc15  metalc ? ? I DG  107 N7  ? ? ? 1_555 DA PT .   PT ? ? I DG  34  I PT 83   1_555 ? ? ? ? ? ? ?               2.311 ? 
metalc16  metalc ? ? J DG  21  N7  ? ? ? 1_555 RA PT .   PT ? ? J DG  -53 J PT 78   1_555 ? ? ? ? ? ? ?               2.335 ? 
metalc17  metalc ? ? I DA  95  N6  ? ? ? 1_555 GA PT .   PT ? ? I DA  22  I PT 86   1_555 ? ? ? ? ? ? ?               2.378 ? 
metalc18  metalc ? ? I DG  98  N7  ? ? ? 1_555 AA PT .   PT ? ? I DG  25  I PT 80   1_555 ? ? ? ? ? ? ?               2.384 ? 
metalc19  metalc ? ? B MET 84  SD  ? ? ? 1_555 N  PT .   PT ? ? B MET 84  B PT 104  1_555 ? ? ? ? ? ? ?               2.386 ? 
metalc20  metalc ? ? J DG  46  N7  ? ? ? 1_555 YA PT .   PT ? ? J DG  -28 J PT 85   1_555 ? ? ? ? ? ? ?               2.386 ? 
metalc21  metalc ? ? J DG  59  N7  ? ? ? 1_555 WA PT .   PT ? ? J DG  -15 J PT 83   1_555 ? ? ? ? ? ? ?               2.389 ? 
metalc22  metalc ? ? A MET 120 SD  ? ? ? 1_555 L  PT .   PT ? ? A MET 120 A PT 136  1_555 ? ? ? ? ? ? ?               2.393 ? 
metalc23  metalc ? ? I DG  141 N7  ? ? ? 1_555 CA PT .   PT ? ? I DG  68  I PT 82   1_555 ? ? ? ? ? ? ?               2.414 ? 
metalc24  metalc ? ? J DG  132 N7  ? ? ? 1_555 ZA PT .   PT ? ? J DG  58  J PT 86   1_555 ? ? ? ? ? ? ?               2.461 ? 
metalc25  metalc ? ? I DG  58  N7  ? ? ? 1_555 EA PT .   PT ? ? I DG  -15 I PT 84   1_555 ? ? ? ? ? ? ?               2.484 ? 
metalc26  metalc ? ? I DG  18  O6  ? ? ? 1_555 BA PT .   PT ? ? I DG  -55 I PT 81   1_555 ? ? ? ? ? ? ?               2.486 ? 
metalc27  metalc ? ? I DA  1   N9  ? ? ? 1_555 U  PT .   PT ? ? I DA  -72 I PT 74   1_555 ? ? ? ? ? ? ?               2.521 ? 
metalc28  metalc ? ? D VAL 45  O   ? ? ? 1_555 P  MN .   MN ? ? D VAL 45  D MN 1007 1_555 ? ? ? ? ? ? ?               2.522 ? 
metalc29  metalc ? ? J DG  28  N7  ? ? ? 1_555 OA PT .   PT ? ? J DG  -46 J PT 75   1_555 ? ? ? ? ? ? ?               2.536 ? 
metalc30  metalc ? ? I DG  71  N7  ? ? ? 1_555 FA PT .   PT ? ? I DG  -2  I PT 85   1_555 ? ? ? ? ? ? ?               2.582 ? 
metalc31  metalc ? ? J DG  144 O6  ? ? ? 1_555 XA PT .   PT ? ? J DG  70  J PT 84   1_555 ? ? ? ? ? ? ?               2.628 ? 
metalc32  metalc ? ? J DG  58  N7  ? ? ? 1_555 TA PT .   PT ? ? J DG  -16 J PT 80   1_555 ? ? ? ? ? ? ?               2.638 ? 
metalc33  metalc ? ? J DT  35  O4  ? ? ? 1_555 BB PT .   PT ? ? J DT  -39 J PT 88   1_555 ? ? ? ? ? ? ?               2.678 ? 
metalc34  metalc ? ? I DG  107 O6  ? ? ? 1_555 DA PT .   PT ? ? I DG  34  I PT 83   1_555 ? ? ? ? ? ? ?               2.678 ? 
metalc35  metalc ? ? I DG  98  O6  ? ? ? 1_555 KA PT .   PT ? ? I DG  25  I PT 90   1_555 ? ? ? ? ? ? ?               2.732 ? 
metalc36  metalc ? ? J DA  72  OP1 ? ? ? 1_555 R  PT .   PT ? ? J DA  -2  E PT 136  1_555 ? ? ? ? ? ? ?               2.755 ? 
metalc37  metalc ? ? J DC  99  N4  ? ? ? 1_555 SA PT .   PT ? ? J DC  25  J PT 79   1_555 ? ? ? ? ? ? ?               2.758 ? 
metalc38  metalc ? ? I DA  27  N7  ? ? ? 1_555 Y  PT .   PT ? ? I DA  -46 I PT 78   1_555 ? ? ? ? ? ? ?               2.771 ? 
hydrog1   hydrog ? ? I DA  1   N1  ? ? ? 1_555 J  DT 146 N3 ? ? I DA  -72 J DT 72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? I DA  1   N6  ? ? ? 1_555 J  DT 146 O4 ? ? I DA  -72 J DT 72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? I DT  2   N3  ? ? ? 1_555 J  DA 145 N1 ? ? I DT  -71 J DA 71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? I DT  2   O4  ? ? ? 1_555 J  DA 145 N6 ? ? I DT  -71 J DA 71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? I DC  3   N4  ? ? ? 1_555 J  DG 144 O6 ? ? I DC  -70 J DG 70   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog6   hydrog ? ? I DT  4   N3  ? ? ? 1_555 J  DA 143 N1 ? ? I DT  -69 J DA 69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? I DT  4   O4  ? ? ? 1_555 J  DA 143 N6 ? ? I DT  -69 J DA 69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? I DC  5   N3  ? ? ? 1_555 J  DG 142 N1 ? ? I DC  -68 J DG 68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? I DC  5   N4  ? ? ? 1_555 J  DG 142 O6 ? ? I DC  -68 J DG 68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? I DC  5   O2  ? ? ? 1_555 J  DG 142 N2 ? ? I DC  -68 J DG 68   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? I DC  6   N3  ? ? ? 1_555 J  DG 141 N1 ? ? I DC  -67 J DG 67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? I DC  6   N4  ? ? ? 1_555 J  DG 141 O6 ? ? I DC  -67 J DG 67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? I DC  6   O2  ? ? ? 1_555 J  DG 141 N2 ? ? I DC  -67 J DG 67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? I DA  7   N1  ? ? ? 1_555 J  DT 140 N3 ? ? I DA  -66 J DT 66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? I DA  7   N6  ? ? ? 1_555 J  DT 140 O4 ? ? I DA  -66 J DT 66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? I DA  8   N1  ? ? ? 1_555 J  DT 139 N3 ? ? I DA  -65 J DT 65   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog17  hydrog ? ? I DA  9   N1  ? ? ? 1_555 J  DT 138 N3 ? ? I DA  -64 J DT 64   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog18  hydrog ? ? I DT  10  N3  ? ? ? 1_555 J  DA 137 N1 ? ? I DT  -63 J DA 63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? I DT  10  O4  ? ? ? 1_555 J  DA 137 N6 ? ? I DT  -63 J DA 63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? I DA  11  N1  ? ? ? 1_555 J  DT 136 N3 ? ? I DA  -62 J DT 62   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog21  hydrog ? ? I DT  12  N3  ? ? ? 1_555 J  DA 135 N1 ? ? I DT  -61 J DA 61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? I DT  12  O4  ? ? ? 1_555 J  DA 135 N6 ? ? I DT  -61 J DA 61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? I DC  13  O2  ? ? ? 1_555 J  DG 134 N2 ? ? I DC  -60 J DG 60   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog24  hydrog ? ? I DC  14  O2  ? ? ? 1_555 J  DG 133 N2 ? ? I DC  -59 J DG 59   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog25  hydrog ? ? I DC  15  O2  ? ? ? 1_555 J  DG 132 N2 ? ? I DC  -58 J DG 58   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog26  hydrog ? ? I DT  16  N3  ? ? ? 1_555 J  DA 130 N1 ? ? I DT  -57 J DA 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? I DT  16  O4  ? ? ? 1_555 J  DA 130 N6 ? ? I DT  -57 J DA 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? I DT  16  N3  ? ? ? 1_555 J  DA 131 N1 ? ? I DT  -57 J DA 57   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog29  hydrog ? ? I DT  17  N3  ? ? ? 1_555 J  DA 130 N1 ? ? I DT  -56 J DA 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? I DT  17  O4  ? ? ? 1_555 J  DA 130 N6 ? ? I DT  -56 J DA 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? I DG  18  N2  ? ? ? 1_555 J  DC 129 O2 ? ? I DG  -55 J DC 55   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog32  hydrog ? ? I DC  19  N3  ? ? ? 1_555 J  DG 128 N1 ? ? I DC  -54 J DG 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? I DC  19  N4  ? ? ? 1_555 J  DG 128 O6 ? ? I DC  -54 J DG 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? I DC  19  O2  ? ? ? 1_555 J  DG 128 N2 ? ? I DC  -54 J DG 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? I DG  20  N1  ? ? ? 1_555 J  DC 127 N3 ? ? I DG  -53 J DC 53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? I DG  20  N2  ? ? ? 1_555 J  DC 127 O2 ? ? I DG  -53 J DC 53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? I DG  20  O6  ? ? ? 1_555 J  DC 127 N4 ? ? I DG  -53 J DC 53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? I DG  21  N1  ? ? ? 1_555 J  DC 126 N3 ? ? I DG  -52 J DC 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? I DG  21  N2  ? ? ? 1_555 J  DC 126 O2 ? ? I DG  -52 J DC 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? I DG  21  O6  ? ? ? 1_555 J  DC 126 N4 ? ? I DG  -52 J DC 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? I DA  22  N1  ? ? ? 1_555 J  DT 125 N3 ? ? I DA  -51 J DT 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? I DA  22  N6  ? ? ? 1_555 J  DT 125 O4 ? ? I DA  -51 J DT 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? I DT  23  N3  ? ? ? 1_555 J  DA 124 N1 ? ? I DT  -50 J DA 50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? I DT  23  O4  ? ? ? 1_555 J  DA 124 N6 ? ? I DT  -50 J DA 50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? I DC  24  N3  ? ? ? 1_555 J  DG 123 N1 ? ? I DC  -49 J DG 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? I DC  24  N4  ? ? ? 1_555 J  DG 123 O6 ? ? I DC  -49 J DG 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? I DC  24  O2  ? ? ? 1_555 J  DG 123 N2 ? ? I DC  -49 J DG 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? I DG  25  N1  ? ? ? 1_555 J  DC 122 N3 ? ? I DG  -48 J DC 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? I DG  25  N2  ? ? ? 1_555 J  DC 122 O2 ? ? I DG  -48 J DC 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? I DG  25  O6  ? ? ? 1_555 J  DC 122 N4 ? ? I DG  -48 J DC 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? I DT  26  N3  ? ? ? 1_555 J  DA 121 N1 ? ? I DT  -47 J DA 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? I DT  26  O4  ? ? ? 1_555 J  DA 121 N6 ? ? I DT  -47 J DA 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? I DA  27  N1  ? ? ? 1_555 J  DT 120 N3 ? ? I DA  -46 J DT 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? I DA  27  N6  ? ? ? 1_555 J  DT 120 O4 ? ? I DA  -46 J DT 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? I DG  28  N1  ? ? ? 1_555 J  DC 119 N3 ? ? I DG  -45 J DC 45   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog56  hydrog ? ? I DA  29  N1  ? ? ? 1_555 J  DT 118 N3 ? ? I DA  -44 J DT 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? I DA  29  N6  ? ? ? 1_555 J  DT 118 O4 ? ? I DA  -44 J DT 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? I DA  30  N1  ? ? ? 1_555 J  DT 117 N3 ? ? I DA  -43 J DT 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? I DA  30  N6  ? ? ? 1_555 J  DT 117 O4 ? ? I DA  -43 J DT 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? I DA  31  N1  ? ? ? 1_555 J  DT 116 N3 ? ? I DA  -42 J DT 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? I DA  31  N6  ? ? ? 1_555 J  DT 116 O4 ? ? I DA  -42 J DT 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? I DA  32  N1  ? ? ? 1_555 J  DT 115 N3 ? ? I DA  -41 J DT 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? I DA  32  N6  ? ? ? 1_555 J  DT 115 O4 ? ? I DA  -41 J DT 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? I DA  33  N1  ? ? ? 1_555 J  DT 114 N3 ? ? I DA  -40 J DT 40   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog65  hydrog ? ? I DG  34  N1  ? ? ? 1_555 J  DC 113 N3 ? ? I DG  -39 J DC 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? I DG  34  N2  ? ? ? 1_555 J  DC 113 O2 ? ? I DG  -39 J DC 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? I DG  34  O6  ? ? ? 1_555 J  DC 113 N4 ? ? I DG  -39 J DC 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? I DT  35  N3  ? ? ? 1_555 J  DA 112 N1 ? ? I DT  -38 J DA 38   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog69  hydrog ? ? I DG  36  N1  ? ? ? 1_555 J  DC 111 N3 ? ? I DG  -37 J DC 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? I DG  36  N2  ? ? ? 1_555 J  DC 111 O2 ? ? I DG  -37 J DC 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? I DG  36  O6  ? ? ? 1_555 J  DC 111 N4 ? ? I DG  -37 J DC 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? I DT  37  N3  ? ? ? 1_555 J  DA 110 N1 ? ? I DT  -36 J DA 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? I DT  37  O4  ? ? ? 1_555 J  DA 110 N6 ? ? I DT  -36 J DA 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? I DG  38  N1  ? ? ? 1_555 J  DC 109 N3 ? ? I DG  -35 J DC 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? I DG  38  N2  ? ? ? 1_555 J  DC 109 O2 ? ? I DG  -35 J DC 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? I DG  38  O6  ? ? ? 1_555 J  DC 109 N4 ? ? I DG  -35 J DC 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? I DT  39  N3  ? ? ? 1_555 J  DA 108 N1 ? ? I DT  -34 J DA 34   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog78  hydrog ? ? I DC  40  N3  ? ? ? 1_555 J  DG 107 N1 ? ? I DC  -33 J DG 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? I DC  40  N4  ? ? ? 1_555 J  DG 107 O6 ? ? I DC  -33 J DG 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? I DC  40  O2  ? ? ? 1_555 J  DG 107 N2 ? ? I DC  -33 J DG 33   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? I DA  41  N6  ? ? ? 1_555 J  DT 105 O4 ? ? I DA  -32 J DT 31   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog82  hydrog ? ? I DA  41  N1  ? ? ? 1_555 J  DT 106 N3 ? ? I DA  -32 J DT 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? I DA  41  N6  ? ? ? 1_555 J  DT 106 O4 ? ? I DA  -32 J DT 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? I DA  42  N1  ? ? ? 1_555 J  DT 105 N3 ? ? I DA  -31 J DT 31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? I DA  42  N6  ? ? ? 1_555 J  DT 105 O4 ? ? I DA  -31 J DT 31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? I DA  43  N6  ? ? ? 1_555 J  DG 103 O6 ? ? I DA  -30 J DG 29   1_555 ? ? ? ? ? ? 'DA-DG MISPAIR' ?     ? 
hydrog87  hydrog ? ? I DA  43  N1  ? ? ? 1_555 J  DT 104 N3 ? ? I DA  -30 J DT 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? I DA  43  N6  ? ? ? 1_555 J  DT 104 O4 ? ? I DA  -30 J DT 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? I DC  44  O2  ? ? ? 1_555 J  DG 103 N2 ? ? I DC  -29 J DG 29   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog90  hydrog ? ? I DT  45  N3  ? ? ? 1_555 J  DA 102 N1 ? ? I DT  -28 J DA 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? I DT  45  O4  ? ? ? 1_555 J  DA 102 N6 ? ? I DT  -28 J DA 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? I DG  46  N1  ? ? ? 1_555 J  DC 101 N3 ? ? I DG  -27 J DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? I DG  46  N2  ? ? ? 1_555 J  DC 101 O2 ? ? I DG  -27 J DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? I DG  46  O6  ? ? ? 1_555 J  DC 101 N4 ? ? I DG  -27 J DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? I DC  47  O2  ? ? ? 1_555 J  DG 100 N2 ? ? I DC  -26 J DG 26   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog96  hydrog ? ? I DG  48  N1  ? ? ? 1_555 J  DC 99  N3 ? ? I DG  -25 J DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? I DG  48  N2  ? ? ? 1_555 J  DC 99  O2 ? ? I DG  -25 J DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? I DG  48  O6  ? ? ? 1_555 J  DC 99  N4 ? ? I DG  -25 J DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? I DC  49  O2  ? ? ? 1_555 J  DG 98  N2 ? ? I DC  -24 J DG 24   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog100 hydrog ? ? I DT  50  N3  ? ? ? 1_555 J  DA 97  N1 ? ? I DT  -23 J DA 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? I DT  50  O4  ? ? ? 1_555 J  DA 97  N6 ? ? I DT  -23 J DA 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? I DA  51  N1  ? ? ? 1_555 J  DT 96  N3 ? ? I DA  -22 J DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? I DA  51  N6  ? ? ? 1_555 J  DT 96  O4 ? ? I DA  -22 J DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? I DT  52  N3  ? ? ? 1_555 J  DA 95  N1 ? ? I DT  -21 J DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? I DT  52  O4  ? ? ? 1_555 J  DA 95  N6 ? ? I DT  -21 J DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? I DC  53  N3  ? ? ? 1_555 J  DG 94  N1 ? ? I DC  -20 J DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? I DC  53  N4  ? ? ? 1_555 J  DG 94  O6 ? ? I DC  -20 J DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? I DC  53  O2  ? ? ? 1_555 J  DG 94  N2 ? ? I DC  -20 J DG 20   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? I DA  54  N1  ? ? ? 1_555 J  DT 93  N3 ? ? I DA  -19 J DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? I DA  54  N6  ? ? ? 1_555 J  DT 93  O4 ? ? I DA  -19 J DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? I DA  55  N1  ? ? ? 1_555 J  DT 92  N3 ? ? I DA  -18 J DT 18   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog112 hydrog ? ? I DA  56  N1  ? ? ? 1_555 J  DT 91  N3 ? ? I DA  -17 J DT 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? I DA  56  N6  ? ? ? 1_555 J  DT 91  O4 ? ? I DA  -17 J DT 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? I DG  57  N1  ? ? ? 1_555 J  DC 90  N3 ? ? I DG  -16 J DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? I DG  57  N2  ? ? ? 1_555 J  DC 90  O2 ? ? I DG  -16 J DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? I DG  57  O6  ? ? ? 1_555 J  DC 90  N4 ? ? I DG  -16 J DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? I DG  58  N1  ? ? ? 1_555 J  DC 89  N3 ? ? I DG  -15 J DC 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? I DG  58  N2  ? ? ? 1_555 J  DC 89  O2 ? ? I DG  -15 J DC 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? I DG  58  O6  ? ? ? 1_555 J  DC 89  N4 ? ? I DG  -15 J DC 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? I DG  59  N1  ? ? ? 1_555 J  DC 88  N3 ? ? I DG  -14 J DC 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? I DG  59  N2  ? ? ? 1_555 J  DC 88  O2 ? ? I DG  -14 J DC 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? I DG  59  O6  ? ? ? 1_555 J  DC 88  N4 ? ? I DG  -14 J DC 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? I DA  60  N1  ? ? ? 1_555 J  DT 87  N3 ? ? I DA  -13 J DT 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? I DA  60  N6  ? ? ? 1_555 J  DT 87  O4 ? ? I DA  -13 J DT 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? I DA  61  N1  ? ? ? 1_555 J  DT 86  N3 ? ? I DA  -12 J DT 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? I DA  61  N6  ? ? ? 1_555 J  DT 86  O4 ? ? I DA  -12 J DT 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? I DA  62  N1  ? ? ? 1_555 J  DT 85  N3 ? ? I DA  -11 J DT 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? I DA  62  N6  ? ? ? 1_555 J  DT 85  O4 ? ? I DA  -11 J DT 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? I DC  63  N3  ? ? ? 1_555 J  DG 84  N1 ? ? I DC  -10 J DG 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? I DC  63  N4  ? ? ? 1_555 J  DG 84  O6 ? ? I DC  -10 J DG 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? I DC  63  O2  ? ? ? 1_555 J  DG 84  N2 ? ? I DC  -10 J DG 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? I DT  64  N3  ? ? ? 1_555 J  DA 83  N1 ? ? I DT  -9  J DA 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? I DT  64  O4  ? ? ? 1_555 J  DA 83  N6 ? ? I DT  -9  J DA 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? I DT  65  N3  ? ? ? 1_555 J  DA 82  N1 ? ? I DT  -8  J DA 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? I DT  65  O4  ? ? ? 1_555 J  DA 82  N6 ? ? I DT  -8  J DA 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? I DC  66  N3  ? ? ? 1_555 J  DG 81  N1 ? ? I DC  -7  J DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? I DC  66  N4  ? ? ? 1_555 J  DG 81  O6 ? ? I DC  -7  J DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? I DC  66  O2  ? ? ? 1_555 J  DG 81  N2 ? ? I DC  -7  J DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? I DA  67  N1  ? ? ? 1_555 J  DT 80  N3 ? ? I DA  -6  J DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? I DA  67  N6  ? ? ? 1_555 J  DT 80  O4 ? ? I DA  -6  J DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? I DA  68  N1  ? ? ? 1_555 J  DT 79  N3 ? ? I DA  -5  J DT 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? I DA  68  N6  ? ? ? 1_555 J  DT 79  O4 ? ? I DA  -5  J DT 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? I DC  69  N3  ? ? ? 1_555 J  DG 78  N1 ? ? I DC  -4  J DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? I DC  69  N4  ? ? ? 1_555 J  DG 78  O6 ? ? I DC  -4  J DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? I DC  69  O2  ? ? ? 1_555 J  DG 78  N2 ? ? I DC  -4  J DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? I DT  70  N3  ? ? ? 1_555 J  DA 77  N1 ? ? I DT  -3  J DA 3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? I DT  70  O4  ? ? ? 1_555 J  DA 77  N6 ? ? I DT  -3  J DA 3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? I DG  71  N1  ? ? ? 1_555 J  DC 76  N3 ? ? I DG  -2  J DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? I DG  71  N2  ? ? ? 1_555 J  DC 76  O2 ? ? I DG  -2  J DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? I DG  71  O6  ? ? ? 1_555 J  DC 76  N4 ? ? I DG  -2  J DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? I DA  72  N1  ? ? ? 1_555 J  DT 75  N3 ? ? I DA  -1  J DT 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? I DA  72  N6  ? ? ? 1_555 J  DT 75  O4 ? ? I DA  -1  J DT 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? I DA  73  N1  ? ? ? 1_555 J  DT 74  N3 ? ? I DA  0   J DT 0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? I DA  73  N6  ? ? ? 1_555 J  DT 74  O4 ? ? I DA  0   J DT 0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? I DT  74  N3  ? ? ? 1_555 J  DA 73  N1 ? ? I DT  1   J DA -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? I DT  74  O4  ? ? ? 1_555 J  DA 73  N6 ? ? I DT  1   J DA -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? I DT  75  N3  ? ? ? 1_555 J  DA 72  N1 ? ? I DT  2   J DA -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? I DT  75  O4  ? ? ? 1_555 J  DA 72  N6 ? ? I DT  2   J DA -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? I DC  76  N3  ? ? ? 1_555 J  DG 71  N1 ? ? I DC  3   J DG -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? I DC  76  N4  ? ? ? 1_555 J  DG 71  O6 ? ? I DC  3   J DG -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? I DC  76  O2  ? ? ? 1_555 J  DG 71  N2 ? ? I DC  3   J DG -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? I DA  77  N1  ? ? ? 1_555 J  DT 70  N3 ? ? I DA  4   J DT -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? I DA  77  N6  ? ? ? 1_555 J  DT 70  O4 ? ? I DA  4   J DT -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? I DG  78  N1  ? ? ? 1_555 J  DC 69  N3 ? ? I DG  5   J DC -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? I DG  78  N2  ? ? ? 1_555 J  DC 69  O2 ? ? I DG  5   J DC -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? I DG  78  O6  ? ? ? 1_555 J  DC 69  N4 ? ? I DG  5   J DC -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? I DT  79  N3  ? ? ? 1_555 J  DA 68  N1 ? ? I DT  6   J DA -6   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog168 hydrog ? ? I DT  80  N3  ? ? ? 1_555 J  DA 67  N1 ? ? I DT  7   J DA -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? I DT  80  O4  ? ? ? 1_555 J  DA 67  N6 ? ? I DT  7   J DA -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? I DG  81  N1  ? ? ? 1_555 J  DC 66  N3 ? ? I DG  8   J DC -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? I DG  81  N2  ? ? ? 1_555 J  DC 66  O2 ? ? I DG  8   J DC -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? I DG  81  O6  ? ? ? 1_555 J  DC 66  N4 ? ? I DG  8   J DC -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? I DA  82  N1  ? ? ? 1_555 J  DT 65  N3 ? ? I DA  9   J DT -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? I DA  82  N6  ? ? ? 1_555 J  DT 65  O4 ? ? I DA  9   J DT -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? I DA  83  N1  ? ? ? 1_555 J  DT 64  N3 ? ? I DA  10  J DT -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? I DA  83  N6  ? ? ? 1_555 J  DT 64  O4 ? ? I DA  10  J DT -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? I DG  84  N1  ? ? ? 1_555 J  DC 63  N3 ? ? I DG  11  J DC -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? I DG  84  N2  ? ? ? 1_555 J  DC 63  O2 ? ? I DG  11  J DC -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? I DG  84  O6  ? ? ? 1_555 J  DC 63  N4 ? ? I DG  11  J DC -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? I DT  85  N3  ? ? ? 1_555 J  DA 62  N1 ? ? I DT  12  J DA -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? I DT  85  O4  ? ? ? 1_555 J  DA 62  N6 ? ? I DT  12  J DA -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? I DT  86  O4  ? ? ? 1_555 J  DA 60  N6 ? ? I DT  13  J DA -14  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog183 hydrog ? ? I DT  86  N3  ? ? ? 1_555 J  DA 61  N1 ? ? I DT  13  J DA -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? I DT  86  O4  ? ? ? 1_555 J  DA 61  N6 ? ? I DT  13  J DA -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? I DT  87  N3  ? ? ? 1_555 J  DA 60  N1 ? ? I DT  14  J DA -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? I DT  87  O4  ? ? ? 1_555 J  DA 60  N6 ? ? I DT  14  J DA -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? I DC  88  N3  ? ? ? 1_555 J  DG 59  N1 ? ? I DC  15  J DG -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? I DC  88  N4  ? ? ? 1_555 J  DG 59  O6 ? ? I DC  15  J DG -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? I DC  88  O2  ? ? ? 1_555 J  DG 59  N2 ? ? I DC  15  J DG -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? I DC  89  N4  ? ? ? 1_555 J  DG 57  O6 ? ? I DC  16  J DG -17  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog191 hydrog ? ? I DC  89  N3  ? ? ? 1_555 J  DG 58  N1 ? ? I DC  16  J DG -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? I DC  89  N4  ? ? ? 1_555 J  DG 58  O6 ? ? I DC  16  J DG -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? I DC  89  O2  ? ? ? 1_555 J  DG 58  N2 ? ? I DC  16  J DG -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? I DC  90  O2  ? ? ? 1_555 J  DG 57  N2 ? ? I DC  17  J DG -17  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog195 hydrog ? ? I DT  91  N3  ? ? ? 1_555 J  DA 56  N1 ? ? I DT  18  J DA -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ? ? I DT  91  O4  ? ? ? 1_555 J  DA 56  N6 ? ? I DT  18  J DA -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ? ? I DT  92  N3  ? ? ? 1_555 J  DA 55  N1 ? ? I DT  19  J DA -19  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog198 hydrog ? ? I DT  93  N3  ? ? ? 1_555 J  DA 54  N1 ? ? I DT  20  J DA -20  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog199 hydrog ? ? I DG  94  N1  ? ? ? 1_555 J  DC 53  N3 ? ? I DG  21  J DC -21  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog200 hydrog ? ? I DA  95  N1  ? ? ? 1_555 J  DT 52  N3 ? ? I DA  22  J DT -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? I DA  95  N6  ? ? ? 1_555 J  DT 52  O4 ? ? I DA  22  J DT -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? I DT  96  N3  ? ? ? 1_555 J  DA 51  N1 ? ? I DT  23  J DA -23  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog203 hydrog ? ? I DA  97  N1  ? ? ? 1_555 J  DT 50  N3 ? ? I DA  24  J DT -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? I DA  97  N6  ? ? ? 1_555 J  DT 50  O4 ? ? I DA  24  J DT -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? I DG  98  N1  ? ? ? 1_555 J  DC 49  N3 ? ? I DG  25  J DC -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog206 hydrog ? ? I DG  98  N2  ? ? ? 1_555 J  DC 49  O2 ? ? I DG  25  J DC -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? I DG  98  O6  ? ? ? 1_555 J  DC 49  N4 ? ? I DG  25  J DC -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? I DC  99  O2  ? ? ? 1_555 J  DG 48  N2 ? ? I DC  26  J DG -26  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog209 hydrog ? ? I DG  100 N1  ? ? ? 1_555 J  DC 47  N3 ? ? I DG  27  J DC -27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? I DG  100 N2  ? ? ? 1_555 J  DC 47  O2 ? ? I DG  27  J DC -27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ? ? I DG  100 O6  ? ? ? 1_555 J  DC 47  N4 ? ? I DG  27  J DC -27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? I DC  101 O2  ? ? ? 1_555 J  DG 46  N2 ? ? I DC  28  J DG -28  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog213 hydrog ? ? I DA  102 N1  ? ? ? 1_555 J  DT 45  N3 ? ? I DA  29  J DT -29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? I DA  102 N6  ? ? ? 1_555 J  DT 45  O4 ? ? I DA  29  J DT -29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog215 hydrog ? ? I DG  103 N1  ? ? ? 1_555 J  DC 44  N3 ? ? I DG  30  J DC -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? I DG  103 N2  ? ? ? 1_555 J  DC 44  O2 ? ? I DG  30  J DC -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? I DG  103 O6  ? ? ? 1_555 J  DC 44  N4 ? ? I DG  30  J DC -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? I DT  104 N3  ? ? ? 1_555 J  DA 43  N1 ? ? I DT  31  J DA -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? I DT  104 O4  ? ? ? 1_555 J  DA 43  N6 ? ? I DT  31  J DA -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? I DT  105 N3  ? ? ? 1_555 J  DA 42  N1 ? ? I DT  32  J DA -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? I DT  105 O4  ? ? ? 1_555 J  DA 42  N6 ? ? I DT  32  J DA -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? I DT  106 N3  ? ? ? 1_555 J  DA 41  N1 ? ? I DT  33  J DA -33  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog223 hydrog ? ? I DG  107 N1  ? ? ? 1_555 J  DC 40  N3 ? ? I DG  34  J DC -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? I DG  107 N2  ? ? ? 1_555 J  DC 40  O2 ? ? I DG  34  J DC -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? I DG  107 O6  ? ? ? 1_555 J  DC 40  N4 ? ? I DG  34  J DC -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? I DA  108 N1  ? ? ? 1_555 J  DT 39  N3 ? ? I DA  35  J DT -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? I DA  108 N6  ? ? ? 1_555 J  DT 39  O4 ? ? I DA  35  J DT -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ? ? I DC  109 N4  ? ? ? 1_555 J  DT 37  O4 ? ? I DC  36  J DT -37  1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ?     ? 
hydrog229 hydrog ? ? I DC  109 N3  ? ? ? 1_555 J  DG 38  N1 ? ? I DC  36  J DG -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? I DC  109 N4  ? ? ? 1_555 J  DG 38  O6 ? ? I DC  36  J DG -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? I DC  109 O2  ? ? ? 1_555 J  DG 38  N2 ? ? I DC  36  J DG -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? I DA  110 N1  ? ? ? 1_555 J  DT 37  N3 ? ? I DA  37  J DT -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? I DA  110 N6  ? ? ? 1_555 J  DT 37  O4 ? ? I DA  37  J DT -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? I DC  111 N3  ? ? ? 1_555 J  DG 36  N1 ? ? I DC  38  J DG -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? I DC  111 N4  ? ? ? 1_555 J  DG 36  O6 ? ? I DC  38  J DG -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? I DC  111 O2  ? ? ? 1_555 J  DG 36  N2 ? ? I DC  38  J DG -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? I DA  112 N1  ? ? ? 1_555 J  DT 35  N3 ? ? I DA  39  J DT -39  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog238 hydrog ? ? I DC  113 N3  ? ? ? 1_555 J  DG 34  N1 ? ? I DC  40  J DG -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? I DC  113 N4  ? ? ? 1_555 J  DG 34  O6 ? ? I DC  40  J DG -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? I DC  113 O2  ? ? ? 1_555 J  DG 34  N2 ? ? I DC  40  J DG -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? I DT  114 N3  ? ? ? 1_555 J  DA 33  N1 ? ? I DT  41  J DA -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ? ? I DT  114 O4  ? ? ? 1_555 J  DA 33  N6 ? ? I DT  41  J DA -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? I DT  115 N3  ? ? ? 1_555 J  DA 32  N1 ? ? I DT  42  J DA -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? I DT  115 O4  ? ? ? 1_555 J  DA 32  N6 ? ? I DT  42  J DA -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? I DT  116 N3  ? ? ? 1_555 J  DA 31  N1 ? ? I DT  43  J DA -43  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog246 hydrog ? ? I DT  117 N3  ? ? ? 1_555 J  DA 30  N1 ? ? I DT  44  J DA -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? I DT  117 O4  ? ? ? 1_555 J  DA 30  N6 ? ? I DT  44  J DA -44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? I DT  118 N3  ? ? ? 1_555 J  DA 29  N1 ? ? I DT  45  J DA -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? I DT  118 O4  ? ? ? 1_555 J  DA 29  N6 ? ? I DT  45  J DA -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? I DC  119 O2  ? ? ? 1_555 J  DG 28  N2 ? ? I DC  46  J DG -46  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog251 hydrog ? ? I DT  120 N3  ? ? ? 1_555 J  DA 27  N1 ? ? I DT  47  J DA -47  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog252 hydrog ? ? I DA  121 N1  ? ? ? 1_555 J  DT 26  N3 ? ? I DA  48  J DT -48  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog253 hydrog ? ? I DC  122 N4  ? ? ? 1_555 J  DG 25  O6 ? ? I DC  49  J DG -49  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog254 hydrog ? ? I DG  123 N1  ? ? ? 1_555 J  DC 24  N3 ? ? I DG  50  J DC -50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog255 hydrog ? ? I DG  123 N2  ? ? ? 1_555 J  DC 24  O2 ? ? I DG  50  J DC -50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog256 hydrog ? ? I DG  123 O6  ? ? ? 1_555 J  DC 24  N4 ? ? I DG  50  J DC -50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog257 hydrog ? ? I DC  126 N3  ? ? ? 1_555 J  DG 21  N1 ? ? I DC  53  J DG -53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog258 hydrog ? ? I DC  126 N4  ? ? ? 1_555 J  DG 21  O6 ? ? I DC  53  J DG -53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog259 hydrog ? ? I DC  126 O2  ? ? ? 1_555 J  DG 21  N2 ? ? I DC  53  J DG -53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog260 hydrog ? ? I DC  127 O2  ? ? ? 1_555 J  DG 20  N2 ? ? I DC  54  J DG -54  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog261 hydrog ? ? I DG  128 N2  ? ? ? 1_555 J  DC 19  O2 ? ? I DG  55  J DC -55  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog262 hydrog ? ? I DC  129 O2  ? ? ? 1_555 J  DG 18  N2 ? ? I DC  56  J DG -56  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog263 hydrog ? ? I DA  130 N1  ? ? ? 1_555 J  DT 17  N3 ? ? I DA  57  J DT -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? I DA  130 N6  ? ? ? 1_555 J  DT 17  O4 ? ? I DA  57  J DT -57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ? ? I DG  132 O6  ? ? ? 1_555 J  DC 14  N4 ? ? I DG  59  J DC -60  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog266 hydrog ? ? I DG  132 N1  ? ? ? 1_555 J  DC 15  N3 ? ? I DG  59  J DC -59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog267 hydrog ? ? I DG  132 N2  ? ? ? 1_555 J  DC 15  O2 ? ? I DG  59  J DC -59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog268 hydrog ? ? I DG  132 O6  ? ? ? 1_555 J  DC 15  N4 ? ? I DG  59  J DC -59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog269 hydrog ? ? I DG  133 N1  ? ? ? 1_555 J  DC 14  N3 ? ? I DG  60  J DC -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog270 hydrog ? ? I DG  133 N2  ? ? ? 1_555 J  DC 14  O2 ? ? I DG  60  J DC -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? I DG  133 O6  ? ? ? 1_555 J  DC 14  N4 ? ? I DG  60  J DC -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? I DG  134 N1  ? ? ? 1_555 J  DC 13  N3 ? ? I DG  61  J DC -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? I DG  134 N2  ? ? ? 1_555 J  DC 13  O2 ? ? I DG  61  J DC -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog274 hydrog ? ? I DG  134 O6  ? ? ? 1_555 J  DC 13  N4 ? ? I DG  61  J DC -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog275 hydrog ? ? I DA  135 N1  ? ? ? 1_555 J  DT 12  N3 ? ? I DA  62  J DT -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog276 hydrog ? ? I DA  135 N6  ? ? ? 1_555 J  DT 12  O4 ? ? I DA  62  J DT -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog277 hydrog ? ? I DT  136 N3  ? ? ? 1_555 J  DA 11  N1 ? ? I DT  63  J DA -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog278 hydrog ? ? I DT  136 O4  ? ? ? 1_555 J  DA 11  N6 ? ? I DT  63  J DA -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog279 hydrog ? ? I DA  137 N1  ? ? ? 1_555 J  DT 10  N3 ? ? I DA  64  J DT -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog280 hydrog ? ? I DA  137 N6  ? ? ? 1_555 J  DT 10  O4 ? ? I DA  64  J DT -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog281 hydrog ? ? I DT  138 N3  ? ? ? 1_555 J  DA 9   N1 ? ? I DT  65  J DA -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog282 hydrog ? ? I DT  138 O4  ? ? ? 1_555 J  DA 9   N6 ? ? I DT  65  J DA -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog283 hydrog ? ? I DT  139 N3  ? ? ? 1_555 J  DA 8   N1 ? ? I DT  66  J DA -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ? ? I DT  139 O4  ? ? ? 1_555 J  DA 8   N6 ? ? I DT  66  J DA -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog285 hydrog ? ? I DT  140 N3  ? ? ? 1_555 J  DA 7   N1 ? ? I DT  67  J DA -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ? ? I DT  140 O4  ? ? ? 1_555 J  DA 7   N6 ? ? I DT  67  J DA -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog287 hydrog ? ? I DG  141 N1  ? ? ? 1_555 J  DC 6   N3 ? ? I DG  68  J DC -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog288 hydrog ? ? I DG  141 N2  ? ? ? 1_555 J  DC 6   O2 ? ? I DG  68  J DC -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog289 hydrog ? ? I DG  141 O6  ? ? ? 1_555 J  DC 6   N4 ? ? I DG  68  J DC -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog290 hydrog ? ? I DG  142 N1  ? ? ? 1_555 J  DC 5   N3 ? ? I DG  69  J DC -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog291 hydrog ? ? I DG  142 N2  ? ? ? 1_555 J  DC 5   O2 ? ? I DG  69  J DC -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog292 hydrog ? ? I DG  142 O6  ? ? ? 1_555 J  DC 5   N4 ? ? I DG  69  J DC -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog293 hydrog ? ? I DA  143 N1  ? ? ? 1_555 J  DT 4   N3 ? ? I DA  70  J DT -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog294 hydrog ? ? I DA  143 N6  ? ? ? 1_555 J  DT 4   O4 ? ? I DA  70  J DT -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog295 hydrog ? ? I DG  144 N1  ? ? ? 1_555 J  DC 3   N3 ? ? I DG  71  J DC -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog296 hydrog ? ? I DG  144 N2  ? ? ? 1_555 J  DC 3   O2 ? ? I DG  71  J DC -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog297 hydrog ? ? I DG  144 O6  ? ? ? 1_555 J  DC 3   N4 ? ? I DG  71  J DC -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog298 hydrog ? ? I DA  145 N1  ? ? ? 1_555 J  DT 2   N3 ? ? I DA  72  J DT -72  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog299 hydrog ? ? I DT  146 N3  ? ? ? 1_555 J  DA 1   N1 ? ? I DT  73  J DA -73  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog300 hydrog ? ? I DT  146 O4  ? ? ? 1_555 J  DA 1   N6 ? ? I DT  73  J DA -73  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 83  ? PHE A 84  ? ARG A 83  PHE A 84  
A 2 THR B 80  ? VAL B 81  ? THR B 80  VAL B 81  
B 1 THR A 118 ? ILE A 119 ? THR A 118 ILE A 119 
B 2 ARG B 45  ? ILE B 46  ? ARG B 45  ILE B 46  
C 1 THR B 96  ? TYR B 98  ? THR B 96  TYR B 98  
C 2 VAL G 100 ? ILE G 102 ? VAL G 100 ILE G 102 
D 1 ARG C 42  ? VAL C 43  ? ARG C 42  VAL C 43  
D 2 THR D 85  ? ILE D 86  ? THR D 85  ILE D 86  
E 1 ARG C 77  ? ILE C 78  ? ARG C 77  ILE C 78  
E 2 GLY D 50  ? ILE D 51  ? GLY D 50  ILE D 51  
F 1 VAL C 100 ? ILE C 102 ? VAL C 100 ILE C 102 
F 2 THR F 96  ? TYR F 98  ? THR F 96  TYR F 98  
G 1 ARG E 83  ? PHE E 84  ? ARG E 83  PHE E 84  
G 2 THR F 80  ? VAL F 81  ? THR F 80  VAL F 81  
H 1 THR E 118 ? ILE E 119 ? THR E 118 ILE E 119 
H 2 ARG F 45  ? ILE F 46  ? ARG F 45  ILE F 46  
I 1 ARG G 42  ? VAL G 43  ? ARG G 42  VAL G 43  
I 2 THR H 85  ? ILE H 86  ? THR H 85  ILE H 86  
J 1 ARG G 77  ? ILE G 78  ? ARG G 77  ILE G 78  
J 2 GLY H 50  ? ILE H 51  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 83  ? N ARG A 83  O VAL B 81  ? O VAL B 81  
B 1 2 N ILE A 119 ? N ILE A 119 O ARG B 45  ? O ARG B 45  
C 1 2 N TYR B 98  ? N TYR B 98  O THR G 101 ? O THR G 101 
D 1 2 N ARG C 42  ? N ARG C 42  O ILE D 86  ? O ILE D 86  
E 1 2 N ILE C 78  ? N ILE C 78  O GLY D 50  ? O GLY D 50  
F 1 2 N THR C 101 ? N THR C 101 O TYR F 98  ? O TYR F 98  
G 1 2 N ARG E 83  ? N ARG E 83  O VAL F 81  ? O VAL F 81  
H 1 2 N ILE E 119 ? N ILE E 119 O ARG F 45  ? O ARG F 45  
I 1 2 N ARG G 42  ? N ARG G 42  O ILE H 86  ? O ILE H 86  
J 1 2 N ILE G 78  ? N ILE G 78  O GLY H 50  ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN A 1001'  
AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN D 1007'  
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 D 1101' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 C 1102' 
AC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 G 1103' 
AC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT I 74'    
AC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 73'    
AC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 74'    
AC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 75'    
BC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 76'    
BC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 75'    
BC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT B 103'   
BC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT I 76'    
BC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 77'    
BC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 78'    
BC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 77'    
BC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 79'    
BC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT F 103'   
CC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT I 80'    
CC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 78'    
CC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT I 81'    
CC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 79'    
CC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 80'    
CC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT I 82'    
CC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 81'    
CC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT I 83'    
CC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 82'    
DC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT E 136'   
DC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 84'    
DC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 83'    
DC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 84'    
DC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 85'    
DC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT A 136'   
DC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 85'    
DC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT I 86'    
DC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 86'    
EC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 87'    
EC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT I 87'    
EC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 88'    
EC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT I 89'    
EC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 88'    
EC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 89'    
EC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE PT I 90'    
EC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE PT B 104'   
EC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT I 101'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 ASP A  77  ? ASP A 77  . ? 1_555 ? 
2  AC1 2 VAL H  45  ? VAL H 45  . ? 3_545 ? 
3  AC2 1 VAL D  45  ? VAL D 45  . ? 1_555 ? 
4  AC3 5 ARG C  71  ? ARG C 71  . ? 1_555 ? 
5  AC3 5 HIS D  46  ? HIS D 46  . ? 1_555 ? 
6  AC3 5 PRO D  47  ? PRO D 47  . ? 1_555 ? 
7  AC3 5 ASP D  48  ? ASP D 48  . ? 1_555 ? 
8  AC3 5 THR D  49  ? THR D 49  . ? 1_555 ? 
9  AC4 5 ALA C  45  ? ALA C 45  . ? 1_555 ? 
10 AC4 5 GLY C  46  ? GLY C 46  . ? 1_555 ? 
11 AC4 5 ALA C  47  ? ALA C 47  . ? 1_555 ? 
12 AC4 5 THR D  87  ? THR D 87  . ? 1_555 ? 
13 AC4 5 SER D  88  ? SER D 88  . ? 1_555 ? 
14 AC5 7 GLY G  44  ? GLY G 44  . ? 1_555 ? 
15 AC5 7 ALA G  45  ? ALA G 45  . ? 1_555 ? 
16 AC5 7 GLY G  46  ? GLY G 46  . ? 1_555 ? 
17 AC5 7 ALA G  47  ? ALA G 47  . ? 1_555 ? 
18 AC5 7 THR H  87  ? THR H 87  . ? 1_555 ? 
19 AC5 7 SER H  88  ? SER H 88  . ? 1_555 ? 
20 AC5 7 DC  I  111 ? DC  I 38  . ? 1_555 ? 
21 AC6 2 DA  I  1   ? DA  I -72 . ? 1_555 ? 
22 AC6 2 DT  I  146 ? DT  I 73  . ? 4_446 ? 
23 AC7 1 DG  J  71  ? DG  J -3  . ? 1_555 ? 
24 AC8 1 DA  J  1   ? DA  J -73 . ? 1_555 ? 
25 AC9 1 DG  J  28  ? DG  J -46 . ? 1_555 ? 
26 BC1 1 DG  J  81  ? DG  J 7   . ? 1_555 ? 
27 BC2 1 DG  I  144 ? DG  I 71  . ? 1_555 ? 
28 BC3 2 MET B  84  ? MET B 84  . ? 1_555 ? 
29 BC3 2 TYR B  88  ? TYR B 88  . ? 1_555 ? 
30 BC4 2 DG  I  20  ? DG  I -53 . ? 1_555 ? 
31 BC4 2 DC  I  19  ? DC  I -54 . ? 1_555 ? 
32 BC5 1 DG  I  59  ? DG  I -14 . ? 1_555 ? 
33 BC6 1 DA  I  27  ? DA  I -46 . ? 1_555 ? 
34 BC7 2 DG  J  141 ? DG  J 67  . ? 1_555 ? 
35 BC7 2 DG  J  142 ? DG  J 68  . ? 1_555 ? 
36 BC8 1 DG  I  57  ? DG  I -16 . ? 1_555 ? 
37 BC9 2 MET F  84  ? MET F 84  . ? 1_555 ? 
38 BC9 2 TYR F  88  ? TYR F 88  . ? 1_555 ? 
39 CC1 2 DG  I  98  ? DG  I 25  . ? 1_555 ? 
40 CC1 2 PT  KA .   ? PT  I 90  . ? 1_555 ? 
41 CC2 2 DG  J  20  ? DG  J -54 . ? 1_555 ? 
42 CC2 2 DG  J  21  ? DG  J -53 . ? 1_555 ? 
43 CC3 2 DT  I  17  ? DT  I -56 . ? 1_555 ? 
44 CC3 2 DG  I  18  ? DG  I -55 . ? 1_555 ? 
45 CC4 2 DG  J  98  ? DG  J 24  . ? 1_555 ? 
46 CC4 2 DC  J  99  ? DC  J 25  . ? 1_555 ? 
47 CC5 2 DG  J  58  ? DG  J -16 . ? 1_555 ? 
48 CC5 2 DG  J  57  ? DG  J -17 . ? 1_555 ? 
49 CC6 2 DG  I  141 ? DG  I 68  . ? 1_555 ? 
50 CC6 2 DG  I  142 ? DG  I 69  . ? 1_555 ? 
51 CC7 1 DG  J  57  ? DG  J -17 . ? 1_555 ? 
52 CC8 2 DT  I  106 ? DT  I 33  . ? 1_555 ? 
53 CC8 2 DG  I  107 ? DG  I 34  . ? 1_555 ? 
54 CC9 2 DA  J  77  ? DA  J 3   . ? 1_555 ? 
55 CC9 2 DG  J  78  ? DG  J 4   . ? 1_555 ? 
56 DC1 2 MET E  120 ? MET E 120 . ? 1_555 ? 
57 DC1 2 DA  J  72  ? DA  J -2  . ? 1_555 ? 
58 DC2 1 DG  I  58  ? DG  I -15 . ? 1_555 ? 
59 DC3 1 DG  J  59  ? DG  J -15 . ? 1_555 ? 
60 DC4 1 DG  J  144 ? DG  J 70  . ? 1_555 ? 
61 DC5 1 DG  J  46  ? DG  J -28 . ? 1_555 ? 
62 DC6 2 MET A  120 ? MET A 120 . ? 1_555 ? 
63 DC6 2 DG  I  71  ? DG  I -2  . ? 1_555 ? 
64 DC7 1 DG  I  71  ? DG  I -2  . ? 1_555 ? 
65 DC8 2 DG  I  94  ? DG  I 21  . ? 1_555 ? 
66 DC8 2 DA  I  95  ? DA  I 22  . ? 1_555 ? 
67 DC9 2 DG  J  132 ? DG  J 58  . ? 1_555 ? 
68 DC9 2 DG  J  133 ? DG  J 59  . ? 1_555 ? 
69 EC1 2 DG  J  20  ? DG  J -54 . ? 1_555 ? 
70 EC1 2 DC  J  19  ? DC  J -55 . ? 1_555 ? 
71 EC2 2 DG  I  46  ? DG  I -27 . ? 1_555 ? 
72 EC2 2 DT  I  45  ? DT  I -28 . ? 1_555 ? 
73 EC3 1 DG  I  78  ? DG  I 5   . ? 1_555 ? 
74 EC4 2 DA  I  27  ? DA  I -46 . ? 1_555 ? 
75 EC4 2 DG  I  28  ? DG  I -45 . ? 1_555 ? 
76 EC5 2 DT  J  35  ? DT  J -39 . ? 1_555 ? 
77 EC5 2 DG  J  34  ? DG  J -40 . ? 1_555 ? 
78 EC6 2 DG  J  38  ? DG  J -36 . ? 1_555 ? 
79 EC6 2 DT  J  37  ? DT  J -37 . ? 1_555 ? 
80 EC7 3 DG  I  98  ? DG  I 25  . ? 1_555 ? 
81 EC7 3 PT  AA .   ? PT  I 80  . ? 1_555 ? 
82 EC7 3 DC  J  49  ? DC  J -25 . ? 1_555 ? 
83 EC8 3 MET B  84  ? MET B 84  . ? 1_555 ? 
84 EC8 3 GLY B  101 ? GLY B 101 . ? 1_555 ? 
85 EC8 3 GLY B  102 ? GLY B 102 . ? 1_555 ? 
86 EC9 2 DT  I  37  ? DT  I -36 . ? 1_555 ? 
87 EC9 2 DG  I  38  ? DG  I -35 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3REK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3REK 
_atom_sites.fract_transf_matrix[1][1]   0.009524 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009138 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005670 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
PT 
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . PRO A  1 38  ? 10.219  -21.460 88.110  1.00 78.66  ? 38   PRO A N     1 
ATOM   2     C  CA    . PRO A  1 38  ? 10.383  -21.258 86.667  1.00 78.28  ? 38   PRO A CA    1 
ATOM   3     C  C     . PRO A  1 38  ? 9.117   -20.712 85.990  1.00 77.95  ? 38   PRO A C     1 
ATOM   4     O  O     . PRO A  1 38  ? 8.006   -21.213 86.230  1.00 78.25  ? 38   PRO A O     1 
ATOM   5     C  CB    . PRO A  1 38  ? 10.709  -22.666 86.138  1.00 78.26  ? 38   PRO A CB    1 
ATOM   6     C  CG    . PRO A  1 38  ? 10.628  -23.597 87.336  1.00 78.43  ? 38   PRO A CG    1 
ATOM   7     C  CD    . PRO A  1 38  ? 10.770  -22.753 88.551  1.00 78.53  ? 38   PRO A CD    1 
ATOM   8     N  N     . HIS A  1 39  ? 9.307   -19.704 85.139  1.00 77.11  ? 39   HIS A N     1 
ATOM   9     C  CA    . HIS A  1 39  ? 8.220   -18.993 84.458  1.00 76.41  ? 39   HIS A CA    1 
ATOM   10    C  C     . HIS A  1 39  ? 7.377   -19.861 83.516  1.00 75.44  ? 39   HIS A C     1 
ATOM   11    O  O     . HIS A  1 39  ? 7.879   -20.756 82.834  1.00 75.07  ? 39   HIS A O     1 
ATOM   12    C  CB    . HIS A  1 39  ? 8.774   -17.785 83.699  1.00 76.73  ? 39   HIS A CB    1 
ATOM   13    C  CG    . HIS A  1 39  ? 7.724   -16.972 83.013  1.00 78.20  ? 39   HIS A CG    1 
ATOM   14    N  ND1   . HIS A  1 39  ? 7.410   -17.135 81.680  1.00 79.79  ? 39   HIS A ND1   1 
ATOM   15    C  CD2   . HIS A  1 39  ? 6.900   -16.003 83.480  1.00 79.53  ? 39   HIS A CD2   1 
ATOM   16    C  CE1   . HIS A  1 39  ? 6.446   -16.293 81.352  1.00 80.27  ? 39   HIS A CE1   1 
ATOM   17    N  NE2   . HIS A  1 39  ? 6.118   -15.594 82.425  1.00 80.77  ? 39   HIS A NE2   1 
ATOM   18    N  N     . ARG A  1 40  ? 6.087   -19.549 83.473  1.00 74.24  ? 40   ARG A N     1 
ATOM   19    C  CA    . ARG A  1 40  ? 5.129   -20.353 82.748  1.00 73.05  ? 40   ARG A CA    1 
ATOM   20    C  C     . ARG A  1 40  ? 4.019   -19.466 82.194  1.00 71.92  ? 40   ARG A C     1 
ATOM   21    O  O     . ARG A  1 40  ? 3.358   -18.775 82.964  1.00 72.04  ? 40   ARG A O     1 
ATOM   22    C  CB    . ARG A  1 40  ? 4.540   -21.373 83.722  1.00 73.15  ? 40   ARG A CB    1 
ATOM   23    C  CG    . ARG A  1 40  ? 3.970   -22.590 83.069  1.00 73.23  ? 40   ARG A CG    1 
ATOM   24    C  CD    . ARG A  1 40  ? 4.281   -23.819 83.888  1.00 72.28  ? 40   ARG A CD    1 
ATOM   25    N  NE    . ARG A  1 40  ? 4.907   -24.822 83.037  1.00 72.08  ? 40   ARG A NE    1 
ATOM   26    C  CZ    . ARG A  1 40  ? 4.246   -25.595 82.190  1.00 71.35  ? 40   ARG A CZ    1 
ATOM   27    N  NH1   . ARG A  1 40  ? 2.932   -25.492 82.098  1.00 72.63  ? 40   ARG A NH1   1 
ATOM   28    N  NH2   . ARG A  1 40  ? 4.901   -26.467 81.444  1.00 71.50  ? 40   ARG A NH2   1 
ATOM   29    N  N     . TYR A  1 41  ? 3.800   -19.476 80.880  1.00 70.34  ? 41   TYR A N     1 
ATOM   30    C  CA    . TYR A  1 41  ? 2.639   -18.762 80.338  1.00 69.59  ? 41   TYR A CA    1 
ATOM   31    C  C     . TYR A  1 41  ? 1.346   -19.552 80.568  1.00 68.97  ? 41   TYR A C     1 
ATOM   32    O  O     . TYR A  1 41  ? 1.335   -20.769 80.463  1.00 69.28  ? 41   TYR A O     1 
ATOM   33    C  CB    . TYR A  1 41  ? 2.813   -18.425 78.855  1.00 69.45  ? 41   TYR A CB    1 
ATOM   34    C  CG    . TYR A  1 41  ? 3.911   -17.432 78.573  1.00 68.85  ? 41   TYR A CG    1 
ATOM   35    C  CD1   . TYR A  1 41  ? 5.119   -17.850 78.009  1.00 68.99  ? 41   TYR A CD1   1 
ATOM   36    C  CD2   . TYR A  1 41  ? 3.752   -16.080 78.872  1.00 67.84  ? 41   TYR A CD2   1 
ATOM   37    C  CE1   . TYR A  1 41  ? 6.149   -16.949 77.747  1.00 69.45  ? 41   TYR A CE1   1 
ATOM   38    C  CE2   . TYR A  1 41  ? 4.767   -15.163 78.615  1.00 68.31  ? 41   TYR A CE2   1 
ATOM   39    C  CZ    . TYR A  1 41  ? 5.969   -15.607 78.051  1.00 69.90  ? 41   TYR A CZ    1 
ATOM   40    O  OH    . TYR A  1 41  ? 6.997   -14.719 77.799  1.00 70.34  ? 41   TYR A OH    1 
ATOM   41    N  N     . ARG A  1 42  ? 0.262   -18.865 80.898  1.00 68.19  ? 42   ARG A N     1 
ATOM   42    C  CA    . ARG A  1 42  ? -1.035  -19.525 81.063  1.00 67.58  ? 42   ARG A CA    1 
ATOM   43    C  C     . ARG A  1 42  ? -1.538  -20.084 79.734  1.00 66.70  ? 42   ARG A C     1 
ATOM   44    O  O     . ARG A  1 42  ? -1.233  -19.534 78.670  1.00 66.82  ? 42   ARG A O     1 
ATOM   45    C  CB    . ARG A  1 42  ? -2.058  -18.559 81.648  1.00 67.84  ? 42   ARG A CB    1 
ATOM   46    C  CG    . ARG A  1 42  ? -1.668  -18.012 83.018  1.00 69.59  ? 42   ARG A CG    1 
ATOM   47    C  CD    . ARG A  1 42  ? -2.621  -16.920 83.476  1.00 72.52  ? 42   ARG A CD    1 
ATOM   48    N  NE    . ARG A  1 42  ? -3.990  -17.426 83.554  1.00 75.24  ? 42   ARG A NE    1 
ATOM   49    C  CZ    . ARG A  1 42  ? -5.035  -16.747 84.015  1.00 76.53  ? 42   ARG A CZ    1 
ATOM   50    N  NH1   . ARG A  1 42  ? -4.893  -15.497 84.464  1.00 76.90  ? 42   ARG A NH1   1 
ATOM   51    N  NH2   . ARG A  1 42  ? -6.232  -17.332 84.028  1.00 76.26  ? 42   ARG A NH2   1 
ATOM   52    N  N     . PRO A  1 43  ? -2.276  -21.202 79.780  1.00 65.86  ? 43   PRO A N     1 
ATOM   53    C  CA    . PRO A  1 43  ? -2.776  -21.788 78.536  1.00 65.09  ? 43   PRO A CA    1 
ATOM   54    C  C     . PRO A  1 43  ? -3.584  -20.814 77.678  1.00 64.08  ? 43   PRO A C     1 
ATOM   55    O  O     . PRO A  1 43  ? -4.575  -20.245 78.128  1.00 64.06  ? 43   PRO A O     1 
ATOM   56    C  CB    . PRO A  1 43  ? -3.634  -22.958 79.025  1.00 65.15  ? 43   PRO A CB    1 
ATOM   57    C  CG    . PRO A  1 43  ? -3.012  -23.331 80.345  1.00 65.05  ? 43   PRO A CG    1 
ATOM   58    C  CD    . PRO A  1 43  ? -2.620  -22.031 80.953  1.00 65.91  ? 43   PRO A CD    1 
ATOM   59    N  N     . GLY A  1 44  ? -3.140  -20.626 76.442  1.00 62.96  ? 44   GLY A N     1 
ATOM   60    C  CA    . GLY A  1 44  ? -3.870  -19.792 75.509  1.00 61.51  ? 44   GLY A CA    1 
ATOM   61    C  C     . GLY A  1 44  ? -3.088  -18.570 75.129  1.00 60.40  ? 44   GLY A C     1 
ATOM   62    O  O     . GLY A  1 44  ? -3.292  -18.009 74.058  1.00 60.82  ? 44   GLY A O     1 
ATOM   63    N  N     . THR A  1 45  ? -2.194  -18.153 76.016  1.00 59.02  ? 45   THR A N     1 
ATOM   64    C  CA    . THR A  1 45  ? -1.390  -16.977 75.776  1.00 57.42  ? 45   THR A CA    1 
ATOM   65    C  C     . THR A  1 45  ? -0.458  -17.197 74.601  1.00 56.58  ? 45   THR A C     1 
ATOM   66    O  O     . THR A  1 45  ? -0.361  -16.332 73.731  1.00 57.19  ? 45   THR A O     1 
ATOM   67    C  CB    . THR A  1 45  ? -0.590  -16.599 77.011  1.00 57.47  ? 45   THR A CB    1 
ATOM   68    O  OG1   . THR A  1 45  ? -1.491  -16.447 78.111  1.00 57.51  ? 45   THR A OG1   1 
ATOM   69    C  CG2   . THR A  1 45  ? 0.163   -15.298 76.788  1.00 56.54  ? 45   THR A CG2   1 
ATOM   70    N  N     . VAL A  1 46  ? 0.210   -18.347 74.558  1.00 55.07  ? 46   VAL A N     1 
ATOM   71    C  CA    . VAL A  1 46  ? 1.131   -18.643 73.457  1.00 53.72  ? 46   VAL A CA    1 
ATOM   72    C  C     . VAL A  1 46  ? 0.349   -18.936 72.165  1.00 53.21  ? 46   VAL A C     1 
ATOM   73    O  O     . VAL A  1 46  ? 0.822   -18.711 71.037  1.00 52.43  ? 46   VAL A O     1 
ATOM   74    C  CB    . VAL A  1 46  ? 2.105   -19.780 73.832  1.00 53.68  ? 46   VAL A CB    1 
ATOM   75    C  CG1   . VAL A  1 46  ? 3.150   -20.028 72.734  1.00 51.45  ? 46   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A  1 46  ? 2.783   -19.454 75.145  1.00 52.60  ? 46   VAL A CG2   1 
ATOM   77    N  N     . ALA A  1 47  ? -0.873  -19.412 72.345  1.00 52.76  ? 47   ALA A N     1 
ATOM   78    C  CA    . ALA A  1 47  ? -1.686  -19.768 71.209  1.00 52.31  ? 47   ALA A CA    1 
ATOM   79    C  C     . ALA A  1 47  ? -2.079  -18.491 70.504  1.00 52.02  ? 47   ALA A C     1 
ATOM   80    O  O     . ALA A  1 47  ? -1.951  -18.406 69.289  1.00 52.17  ? 47   ALA A O     1 
ATOM   81    C  CB    . ALA A  1 47  ? -2.888  -20.571 71.625  1.00 52.50  ? 47   ALA A CB    1 
ATOM   82    N  N     . LEU A  1 48  ? -2.501  -17.492 71.276  1.00 51.79  ? 48   LEU A N     1 
ATOM   83    C  CA    . LEU A  1 48  ? -2.775  -16.153 70.756  1.00 51.60  ? 48   LEU A CA    1 
ATOM   84    C  C     . LEU A  1 48  ? -1.572  -15.510 70.088  1.00 51.62  ? 48   LEU A C     1 
ATOM   85    O  O     . LEU A  1 48  ? -1.694  -14.911 69.031  1.00 51.88  ? 48   LEU A O     1 
ATOM   86    C  CB    . LEU A  1 48  ? -3.273  -15.255 71.864  1.00 51.55  ? 48   LEU A CB    1 
ATOM   87    C  CG    . LEU A  1 48  ? -4.759  -14.930 71.998  1.00 51.99  ? 48   LEU A CG    1 
ATOM   88    C  CD1   . LEU A  1 48  ? -5.657  -15.766 71.114  1.00 51.26  ? 48   LEU A CD1   1 
ATOM   89    C  CD2   . LEU A  1 48  ? -5.153  -15.056 73.450  1.00 50.78  ? 48   LEU A CD2   1 
ATOM   90    N  N     . ARG A  1 49  ? -0.393  -15.650 70.660  1.00 51.53  ? 49   ARG A N     1 
ATOM   91    C  CA    . ARG A  1 49  ? 0.726   -15.001 70.021  1.00 52.24  ? 49   ARG A CA    1 
ATOM   92    C  C     . ARG A  1 49  ? 1.175   -15.747 68.757  1.00 52.31  ? 49   ARG A C     1 
ATOM   93    O  O     . ARG A  1 49  ? 1.668   -15.141 67.796  1.00 53.41  ? 49   ARG A O     1 
ATOM   94    C  CB    . ARG A  1 49  ? 1.833   -14.712 71.030  1.00 52.48  ? 49   ARG A CB    1 
ATOM   95    C  CG    . ARG A  1 49  ? 3.148   -15.383 70.835  1.00 55.74  ? 49   ARG A CG    1 
ATOM   96    C  CD    . ARG A  1 49  ? 4.005   -15.069 72.072  1.00 60.07  ? 49   ARG A CD    1 
ATOM   97    N  NE    . ARG A  1 49  ? 5.001   -16.112 72.314  1.00 62.50  ? 49   ARG A NE    1 
ATOM   98    C  CZ    . ARG A  1 49  ? 5.326   -16.572 73.517  1.00 63.00  ? 49   ARG A CZ    1 
ATOM   99    N  NH1   . ARG A  1 49  ? 4.734   -16.094 74.613  1.00 62.61  ? 49   ARG A NH1   1 
ATOM   100   N  NH2   . ARG A  1 49  ? 6.236   -17.529 73.616  1.00 63.81  ? 49   ARG A NH2   1 
ATOM   101   N  N     . GLU A  1 50  ? 0.953   -17.056 68.734  1.00 51.85  ? 50   GLU A N     1 
ATOM   102   C  CA    . GLU A  1 50  ? 1.167   -17.837 67.525  1.00 50.96  ? 50   GLU A CA    1 
ATOM   103   C  C     . GLU A  1 50  ? 0.216   -17.409 66.412  1.00 48.96  ? 50   GLU A C     1 
ATOM   104   O  O     . GLU A  1 50  ? 0.615   -17.377 65.267  1.00 48.86  ? 50   GLU A O     1 
ATOM   105   C  CB    . GLU A  1 50  ? 1.022   -19.338 67.818  1.00 51.43  ? 50   GLU A CB    1 
ATOM   106   C  CG    . GLU A  1 50  ? 2.283   -20.028 68.299  1.00 51.57  ? 50   GLU A CG    1 
ATOM   107   C  CD    . GLU A  1 50  ? 2.011   -21.454 68.772  1.00 54.00  ? 50   GLU A CD    1 
ATOM   108   O  OE1   . GLU A  1 50  ? 0.887   -21.970 68.554  1.00 60.25  ? 50   GLU A OE1   1 
ATOM   109   O  OE2   . GLU A  1 50  ? 2.922   -22.071 69.374  1.00 57.76  ? 50   GLU A OE2   1 
ATOM   110   N  N     . ILE A  1 51  ? -1.030  -17.090 66.747  1.00 47.29  ? 51   ILE A N     1 
ATOM   111   C  CA    . ILE A  1 51  ? -1.954  -16.548 65.769  1.00 46.35  ? 51   ILE A CA    1 
ATOM   112   C  C     . ILE A  1 51  ? -1.472  -15.221 65.156  1.00 46.85  ? 51   ILE A C     1 
ATOM   113   O  O     . ILE A  1 51  ? -1.578  -15.026 63.948  1.00 46.41  ? 51   ILE A O     1 
ATOM   114   C  CB    . ILE A  1 51  ? -3.372  -16.343 66.336  1.00 46.20  ? 51   ILE A CB    1 
ATOM   115   C  CG1   . ILE A  1 51  ? -3.973  -17.680 66.757  1.00 46.33  ? 51   ILE A CG1   1 
ATOM   116   C  CG2   . ILE A  1 51  ? -4.276  -15.665 65.292  1.00 44.96  ? 51   ILE A CG2   1 
ATOM   117   C  CD1   . ILE A  1 51  ? -5.378  -17.607 67.364  1.00 45.38  ? 51   ILE A CD1   1 
ATOM   118   N  N     . ARG A  1 52  ? -0.978  -14.295 65.975  1.00 47.22  ? 52   ARG A N     1 
ATOM   119   C  CA    . ARG A  1 52  ? -0.455  -13.033 65.434  1.00 47.72  ? 52   ARG A CA    1 
ATOM   120   C  C     . ARG A  1 52  ? 0.710   -13.334 64.543  1.00 47.52  ? 52   ARG A C     1 
ATOM   121   O  O     . ARG A  1 52  ? 0.836   -12.753 63.465  1.00 47.90  ? 52   ARG A O     1 
ATOM   122   C  CB    . ARG A  1 52  ? 0.000   -12.078 66.532  1.00 47.91  ? 52   ARG A CB    1 
ATOM   123   C  CG    . ARG A  1 52  ? -1.102  -11.789 67.483  1.00 50.47  ? 52   ARG A CG    1 
ATOM   124   C  CD    . ARG A  1 52  ? -0.913  -10.597 68.381  1.00 52.71  ? 52   ARG A CD    1 
ATOM   125   N  NE    . ARG A  1 52  ? -2.202  -10.423 69.053  1.00 56.69  ? 52   ARG A NE    1 
ATOM   126   C  CZ    . ARG A  1 52  ? -2.523  -10.992 70.216  1.00 57.62  ? 52   ARG A CZ    1 
ATOM   127   N  NH1   . ARG A  1 52  ? -1.626  -11.733 70.873  1.00 58.15  ? 52   ARG A NH1   1 
ATOM   128   N  NH2   . ARG A  1 52  ? -3.731  -10.802 70.733  1.00 57.73  ? 52   ARG A NH2   1 
ATOM   129   N  N     . ARG A  1 53  ? 1.574   -14.232 64.999  1.00 47.09  ? 53   ARG A N     1 
ATOM   130   C  CA    . ARG A  1 53  ? 2.775   -14.516 64.251  1.00 47.32  ? 53   ARG A CA    1 
ATOM   131   C  C     . ARG A  1 53  ? 2.418   -15.073 62.875  1.00 47.43  ? 53   ARG A C     1 
ATOM   132   O  O     . ARG A  1 53  ? 2.917   -14.579 61.865  1.00 48.15  ? 53   ARG A O     1 
ATOM   133   C  CB    . ARG A  1 53  ? 3.672   -15.479 65.008  1.00 47.58  ? 53   ARG A CB    1 
ATOM   134   C  CG    . ARG A  1 53  ? 4.751   -16.017 64.129  1.00 49.70  ? 53   ARG A CG    1 
ATOM   135   C  CD    . ARG A  1 53  ? 5.679   -16.990 64.820  1.00 52.76  ? 53   ARG A CD    1 
ATOM   136   N  NE    . ARG A  1 53  ? 6.637   -17.495 63.833  1.00 55.69  ? 53   ARG A NE    1 
ATOM   137   C  CZ    . ARG A  1 53  ? 7.463   -18.517 64.045  1.00 58.02  ? 53   ARG A CZ    1 
ATOM   138   N  NH1   . ARG A  1 53  ? 7.469   -19.138 65.219  1.00 59.41  ? 53   ARG A NH1   1 
ATOM   139   N  NH2   . ARG A  1 53  ? 8.294   -18.909 63.091  1.00 58.14  ? 53   ARG A NH2   1 
ATOM   140   N  N     . TYR A  1 54  ? 1.544   -16.086 62.829  1.00 46.54  ? 54   TYR A N     1 
ATOM   141   C  CA    . TYR A  1 54  ? 1.234   -16.739 61.570  1.00 45.63  ? 54   TYR A CA    1 
ATOM   142   C  C     . TYR A  1 54  ? 0.291   -15.947 60.683  1.00 45.47  ? 54   TYR A C     1 
ATOM   143   O  O     . TYR A  1 54  ? 0.298   -16.128 59.458  1.00 45.34  ? 54   TYR A O     1 
ATOM   144   C  CB    . TYR A  1 54  ? 0.781   -18.191 61.772  1.00 45.38  ? 54   TYR A CB    1 
ATOM   145   C  CG    . TYR A  1 54  ? 1.910   -19.029 62.273  1.00 45.14  ? 54   TYR A CG    1 
ATOM   146   C  CD1   . TYR A  1 54  ? 1.865   -19.627 63.532  1.00 45.73  ? 54   TYR A CD1   1 
ATOM   147   C  CD2   . TYR A  1 54  ? 3.058   -19.192 61.509  1.00 43.83  ? 54   TYR A CD2   1 
ATOM   148   C  CE1   . TYR A  1 54  ? 2.939   -20.367 64.003  1.00 43.77  ? 54   TYR A CE1   1 
ATOM   149   C  CE2   . TYR A  1 54  ? 4.120   -19.917 61.976  1.00 42.21  ? 54   TYR A CE2   1 
ATOM   150   C  CZ    . TYR A  1 54  ? 4.058   -20.489 63.212  1.00 44.34  ? 54   TYR A CZ    1 
ATOM   151   O  OH    . TYR A  1 54  ? 5.131   -21.224 63.645  1.00 48.65  ? 54   TYR A OH    1 
ATOM   152   N  N     . GLN A  1 55  ? -0.496  -15.064 61.287  1.00 45.53  ? 55   GLN A N     1 
ATOM   153   C  CA    . GLN A  1 55  ? -1.274  -14.093 60.523  1.00 46.11  ? 55   GLN A CA    1 
ATOM   154   C  C     . GLN A  1 55  ? -0.463  -12.991 59.863  1.00 46.88  ? 55   GLN A C     1 
ATOM   155   O  O     . GLN A  1 55  ? -0.909  -12.446 58.871  1.00 47.75  ? 55   GLN A O     1 
ATOM   156   C  CB    . GLN A  1 55  ? -2.427  -13.534 61.337  1.00 45.75  ? 55   GLN A CB    1 
ATOM   157   C  CG    . GLN A  1 55  ? -3.408  -14.616 61.749  1.00 46.09  ? 55   GLN A CG    1 
ATOM   158   C  CD    . GLN A  1 55  ? -4.773  -14.111 62.042  1.00 45.02  ? 55   GLN A CD    1 
ATOM   159   O  OE1   . GLN A  1 55  ? -4.956  -12.991 62.492  1.00 47.82  ? 55   GLN A OE1   1 
ATOM   160   N  NE2   . GLN A  1 55  ? -5.750  -14.942 61.816  1.00 45.84  ? 55   GLN A NE2   1 
ATOM   161   N  N     . LYS A  1 56  ? 0.727   -12.672 60.374  1.00 48.33  ? 56   LYS A N     1 
ATOM   162   C  CA    . LYS A  1 56  ? 1.600   -11.669 59.730  1.00 50.03  ? 56   LYS A CA    1 
ATOM   163   C  C     . LYS A  1 56  ? 2.393   -12.249 58.578  1.00 50.08  ? 56   LYS A C     1 
ATOM   164   O  O     . LYS A  1 56  ? 2.747   -11.537 57.670  1.00 50.88  ? 56   LYS A O     1 
ATOM   165   C  CB    . LYS A  1 56  ? 2.641   -11.093 60.698  1.00 50.97  ? 56   LYS A CB    1 
ATOM   166   C  CG    . LYS A  1 56  ? 2.163   -10.148 61.796  1.00 52.60  ? 56   LYS A CG    1 
ATOM   167   C  CD    . LYS A  1 56  ? 3.373   -9.725  62.671  1.00 51.87  ? 56   LYS A CD    1 
ATOM   168   C  CE    . LYS A  1 56  ? 2.946   -9.030  64.012  1.00 55.56  ? 56   LYS A CE    1 
ATOM   169   N  NZ    . LYS A  1 56  ? 2.892   -9.962  65.229  1.00 58.21  ? 56   LYS A NZ    1 
ATOM   170   N  N     . SER A  1 57  ? 2.746   -13.522 58.634  1.00 50.26  ? 57   SER A N     1 
ATOM   171   C  CA    . SER A  1 57  ? 3.642   -14.075 57.634  1.00 50.55  ? 57   SER A CA    1 
ATOM   172   C  C     . SER A  1 57  ? 2.870   -14.758 56.508  1.00 50.10  ? 57   SER A C     1 
ATOM   173   O  O     . SER A  1 57  ? 1.665   -14.966 56.607  1.00 50.51  ? 57   SER A O     1 
ATOM   174   C  CB    . SER A  1 57  ? 4.615   -15.047 58.284  1.00 50.55  ? 57   SER A CB    1 
ATOM   175   O  OG    . SER A  1 57  ? 3.890   -16.123 58.866  1.00 54.07  ? 57   SER A OG    1 
ATOM   176   N  N     . THR A  1 58  ? 3.593   -15.106 55.446  1.00 49.88  ? 58   THR A N     1 
ATOM   177   C  CA    . THR A  1 58  ? 3.041   -15.703 54.241  1.00 48.62  ? 58   THR A CA    1 
ATOM   178   C  C     . THR A  1 58  ? 3.818   -16.963 53.808  1.00 48.54  ? 58   THR A C     1 
ATOM   179   O  O     . THR A  1 58  ? 3.569   -17.504 52.738  1.00 48.16  ? 58   THR A O     1 
ATOM   180   C  CB    . THR A  1 58  ? 3.105   -14.685 53.062  1.00 48.98  ? 58   THR A CB    1 
ATOM   181   O  OG1   . THR A  1 58  ? 4.473   -14.446 52.712  1.00 48.45  ? 58   THR A OG1   1 
ATOM   182   C  CG2   . THR A  1 58  ? 2.451   -13.373 53.430  1.00 47.14  ? 58   THR A CG2   1 
ATOM   183   N  N     . GLU A  1 59  ? 4.770   -17.430 54.614  1.00 48.70  ? 59   GLU A N     1 
ATOM   184   C  CA    . GLU A  1 59  ? 5.516   -18.654 54.248  1.00 49.57  ? 59   GLU A CA    1 
ATOM   185   C  C     . GLU A  1 59  ? 4.680   -19.919 54.410  1.00 48.62  ? 59   GLU A C     1 
ATOM   186   O  O     . GLU A  1 59  ? 3.797   -19.982 55.293  1.00 48.12  ? 59   GLU A O     1 
ATOM   187   C  CB    . GLU A  1 59  ? 6.808   -18.802 55.031  1.00 49.37  ? 59   GLU A CB    1 
ATOM   188   C  CG    . GLU A  1 59  ? 6.820   -17.994 56.292  1.00 55.59  ? 59   GLU A CG    1 
ATOM   189   C  CD    . GLU A  1 59  ? 6.208   -18.712 57.462  1.00 59.72  ? 59   GLU A CD    1 
ATOM   190   O  OE1   . GLU A  1 59  ? 6.248   -19.955 57.429  1.00 62.21  ? 59   GLU A OE1   1 
ATOM   191   O  OE2   . GLU A  1 59  ? 5.724   -18.036 58.415  1.00 60.71  ? 59   GLU A OE2   1 
ATOM   192   N  N     . LEU A  1 60  ? 4.955   -20.894 53.536  1.00 47.39  ? 60   LEU A N     1 
ATOM   193   C  CA    . LEU A  1 60  ? 4.333   -22.215 53.595  1.00 47.26  ? 60   LEU A CA    1 
ATOM   194   C  C     . LEU A  1 60  ? 4.642   -22.840 54.930  1.00 46.92  ? 60   LEU A C     1 
ATOM   195   O  O     . LEU A  1 60  ? 5.758   -22.710 55.456  1.00 46.54  ? 60   LEU A O     1 
ATOM   196   C  CB    . LEU A  1 60  ? 4.806   -23.118 52.448  1.00 47.31  ? 60   LEU A CB    1 
ATOM   197   C  CG    . LEU A  1 60  ? 4.483   -22.591 51.036  1.00 48.45  ? 60   LEU A CG    1 
ATOM   198   C  CD1   . LEU A  1 60  ? 5.173   -23.395 49.977  1.00 49.90  ? 60   LEU A CD1   1 
ATOM   199   C  CD2   . LEU A  1 60  ? 2.997   -22.540 50.767  1.00 49.43  ? 60   LEU A CD2   1 
ATOM   200   N  N     . LEU A  1 61  ? 3.635   -23.504 55.480  1.00 46.90  ? 61   LEU A N     1 
ATOM   201   C  CA    . LEU A  1 61  ? 3.658   -23.952 56.870  1.00 46.62  ? 61   LEU A CA    1 
ATOM   202   C  C     . LEU A  1 61  ? 3.823   -25.451 56.994  1.00 46.86  ? 61   LEU A C     1 
ATOM   203   O  O     . LEU A  1 61  ? 4.122   -25.949 58.073  1.00 46.96  ? 61   LEU A O     1 
ATOM   204   C  CB    . LEU A  1 61  ? 2.388   -23.512 57.598  1.00 46.32  ? 61   LEU A CB    1 
ATOM   205   C  CG    . LEU A  1 61  ? 2.122   -22.009 57.702  1.00 45.33  ? 61   LEU A CG    1 
ATOM   206   C  CD1   . LEU A  1 61  ? 0.813   -21.770 58.363  1.00 43.20  ? 61   LEU A CD1   1 
ATOM   207   C  CD2   . LEU A  1 61  ? 3.210   -21.307 58.457  1.00 45.53  ? 61   LEU A CD2   1 
ATOM   208   N  N     . ILE A  1 62  ? 3.606   -26.161 55.890  1.00 47.21  ? 62   ILE A N     1 
ATOM   209   C  CA    . ILE A  1 62  ? 3.869   -27.596 55.802  1.00 47.32  ? 62   ILE A CA    1 
ATOM   210   C  C     . ILE A  1 62  ? 5.277   -27.803 55.260  1.00 47.65  ? 62   ILE A C     1 
ATOM   211   O  O     . ILE A  1 62  ? 5.705   -27.100 54.351  1.00 48.00  ? 62   ILE A O     1 
ATOM   212   C  CB    . ILE A  1 62  ? 2.874   -28.269 54.851  1.00 47.13  ? 62   ILE A CB    1 
ATOM   213   C  CG1   . ILE A  1 62  ? 1.516   -28.393 55.507  1.00 47.05  ? 62   ILE A CG1   1 
ATOM   214   C  CG2   . ILE A  1 62  ? 3.351   -29.653 54.411  1.00 46.48  ? 62   ILE A CG2   1 
ATOM   215   C  CD1   . ILE A  1 62  ? 0.425   -28.618 54.472  1.00 49.81  ? 62   ILE A CD1   1 
ATOM   216   N  N     . ARG A  1 63  ? 5.996   -28.766 55.801  1.00 47.94  ? 63   ARG A N     1 
ATOM   217   C  CA    . ARG A  1 63  ? 7.355   -28.993 55.358  1.00 49.14  ? 63   ARG A CA    1 
ATOM   218   C  C     . ARG A  1 63  ? 7.401   -29.402 53.897  1.00 49.40  ? 63   ARG A C     1 
ATOM   219   O  O     . ARG A  1 63  ? 6.479   -30.019 53.376  1.00 49.99  ? 63   ARG A O     1 
ATOM   220   C  CB    . ARG A  1 63  ? 8.012   -30.036 56.236  1.00 50.09  ? 63   ARG A CB    1 
ATOM   221   C  CG    . ARG A  1 63  ? 8.683   -29.449 57.470  1.00 52.84  ? 63   ARG A CG    1 
ATOM   222   C  CD    . ARG A  1 63  ? 8.426   -30.302 58.723  1.00 60.52  ? 63   ARG A CD    1 
ATOM   223   N  NE    . ARG A  1 63  ? 8.275   -31.754 58.478  1.00 66.41  ? 63   ARG A NE    1 
ATOM   224   C  CZ    . ARG A  1 63  ? 7.215   -32.482 58.856  1.00 67.86  ? 63   ARG A CZ    1 
ATOM   225   N  NH1   . ARG A  1 63  ? 6.196   -31.906 59.509  1.00 66.91  ? 63   ARG A NH1   1 
ATOM   226   N  NH2   . ARG A  1 63  ? 7.170   -33.784 58.573  1.00 67.33  ? 63   ARG A NH2   1 
ATOM   227   N  N     . LYS A  1 64  ? 8.482   -29.065 53.228  1.00 49.48  ? 64   LYS A N     1 
ATOM   228   C  CA    . LYS A  1 64  ? 8.482   -29.121 51.788  1.00 50.09  ? 64   LYS A CA    1 
ATOM   229   C  C     . LYS A  1 64  ? 8.627   -30.532 51.189  1.00 49.67  ? 64   LYS A C     1 
ATOM   230   O  O     . LYS A  1 64  ? 7.882   -30.889 50.305  1.00 49.94  ? 64   LYS A O     1 
ATOM   231   C  CB    . LYS A  1 64  ? 9.506   -28.120 51.249  1.00 50.66  ? 64   LYS A CB    1 
ATOM   232   C  CG    . LYS A  1 64  ? 9.469   -27.900 49.763  1.00 54.53  ? 64   LYS A CG    1 
ATOM   233   C  CD    . LYS A  1 64  ? 10.824  -27.392 49.275  1.00 59.93  ? 64   LYS A CD    1 
ATOM   234   C  CE    . LYS A  1 64  ? 10.946  -27.511 47.744  1.00 62.17  ? 64   LYS A CE    1 
ATOM   235   N  NZ    . LYS A  1 64  ? 12.317  -27.102 47.294  1.00 63.37  ? 64   LYS A NZ    1 
ATOM   236   N  N     . LEU A  1 65  ? 9.572   -31.335 51.670  1.00 49.99  ? 65   LEU A N     1 
ATOM   237   C  CA    . LEU A  1 65  ? 9.769   -32.697 51.147  1.00 49.34  ? 65   LEU A CA    1 
ATOM   238   C  C     . LEU A  1 65  ? 8.632   -33.674 51.499  1.00 48.54  ? 65   LEU A C     1 
ATOM   239   O  O     . LEU A  1 65  ? 8.171   -34.403 50.623  1.00 48.44  ? 65   LEU A O     1 
ATOM   240   C  CB    . LEU A  1 65  ? 11.144  -33.260 51.544  1.00 49.50  ? 65   LEU A CB    1 
ATOM   241   C  CG    . LEU A  1 65  ? 11.540  -34.685 51.104  1.00 50.32  ? 65   LEU A CG    1 
ATOM   242   C  CD1   . LEU A  1 65  ? 11.517  -34.871 49.599  1.00 51.07  ? 65   LEU A CD1   1 
ATOM   243   C  CD2   . LEU A  1 65  ? 12.910  -35.094 51.636  1.00 50.07  ? 65   LEU A CD2   1 
ATOM   244   N  N     . PRO A  1 66  ? 8.194   -33.719 52.776  1.00 47.89  ? 66   PRO A N     1 
ATOM   245   C  CA    . PRO A  1 66  ? 7.013   -34.509 53.084  1.00 47.19  ? 66   PRO A CA    1 
ATOM   246   C  C     . PRO A  1 66  ? 5.881   -34.228 52.117  1.00 46.86  ? 66   PRO A C     1 
ATOM   247   O  O     . PRO A  1 66  ? 5.338   -35.167 51.556  1.00 47.87  ? 66   PRO A O     1 
ATOM   248   C  CB    . PRO A  1 66  ? 6.631   -34.029 54.474  1.00 47.28  ? 66   PRO A CB    1 
ATOM   249   C  CG    . PRO A  1 66  ? 7.920   -33.720 55.091  1.00 47.96  ? 66   PRO A CG    1 
ATOM   250   C  CD    . PRO A  1 66  ? 8.756   -33.110 53.994  1.00 48.01  ? 66   PRO A CD    1 
ATOM   251   N  N     . PHE A  1 67  ? 5.554   -32.951 51.894  1.00 46.08  ? 67   PHE A N     1 
ATOM   252   C  CA    . PHE A  1 67  ? 4.464   -32.569 51.002  1.00 44.49  ? 67   PHE A CA    1 
ATOM   253   C  C     . PHE A  1 67  ? 4.659   -33.125 49.611  1.00 45.97  ? 67   PHE A C     1 
ATOM   254   O  O     . PHE A  1 67  ? 3.696   -33.548 48.961  1.00 47.62  ? 67   PHE A O     1 
ATOM   255   C  CB    . PHE A  1 67  ? 4.264   -31.036 50.892  1.00 42.28  ? 67   PHE A CB    1 
ATOM   256   C  CG    . PHE A  1 67  ? 3.105   -30.667 50.016  1.00 36.37  ? 67   PHE A CG    1 
ATOM   257   C  CD1   . PHE A  1 67  ? 1.831   -30.693 50.504  1.00 32.07  ? 67   PHE A CD1   1 
ATOM   258   C  CD2   . PHE A  1 67  ? 3.290   -30.400 48.682  1.00 32.17  ? 67   PHE A CD2   1 
ATOM   259   C  CE1   . PHE A  1 67  ? 0.759   -30.414 49.676  1.00 32.36  ? 67   PHE A CE1   1 
ATOM   260   C  CE2   . PHE A  1 67  ? 2.232   -30.143 47.846  1.00 29.57  ? 67   PHE A CE2   1 
ATOM   261   C  CZ    . PHE A  1 67  ? 0.959   -30.128 48.344  1.00 30.34  ? 67   PHE A CZ    1 
ATOM   262   N  N     . GLN A  1 68  ? 5.888   -33.096 49.136  1.00 46.69  ? 68   GLN A N     1 
ATOM   263   C  CA    . GLN A  1 68  ? 6.197   -33.544 47.802  1.00 48.43  ? 68   GLN A CA    1 
ATOM   264   C  C     . GLN A  1 68  ? 6.050   -35.058 47.636  1.00 48.51  ? 68   GLN A C     1 
ATOM   265   O  O     . GLN A  1 68  ? 5.579   -35.528 46.604  1.00 49.20  ? 68   GLN A O     1 
ATOM   266   C  CB    . GLN A  1 68  ? 7.607   -33.110 47.445  1.00 49.05  ? 68   GLN A CB    1 
ATOM   267   C  CG    . GLN A  1 68  ? 8.026   -33.586 46.097  1.00 53.90  ? 68   GLN A CG    1 
ATOM   268   C  CD    . GLN A  1 68  ? 8.812   -32.540 45.380  1.00 61.62  ? 68   GLN A CD    1 
ATOM   269   O  OE1   . GLN A  1 68  ? 9.497   -31.715 46.012  1.00 64.50  ? 68   GLN A OE1   1 
ATOM   270   N  NE2   . GLN A  1 68  ? 8.727   -32.547 44.048  1.00 63.40  ? 68   GLN A NE2   1 
ATOM   271   N  N     . ARG A  1 69  ? 6.444   -35.816 48.654  1.00 48.53  ? 69   ARG A N     1 
ATOM   272   C  CA    . ARG A  1 69  ? 6.241   -37.258 48.668  1.00 48.46  ? 69   ARG A CA    1 
ATOM   273   C  C     . ARG A  1 69  ? 4.757   -37.610 48.580  1.00 48.32  ? 69   ARG A C     1 
ATOM   274   O  O     . ARG A  1 69  ? 4.369   -38.512 47.825  1.00 48.56  ? 69   ARG A O     1 
ATOM   275   C  CB    . ARG A  1 69  ? 6.788   -37.836 49.948  1.00 49.10  ? 69   ARG A CB    1 
ATOM   276   C  CG    . ARG A  1 69  ? 8.293   -37.917 50.019  1.00 50.45  ? 69   ARG A CG    1 
ATOM   277   C  CD    . ARG A  1 69  ? 8.607   -38.829 51.165  1.00 51.03  ? 69   ARG A CD    1 
ATOM   278   N  NE    . ARG A  1 69  ? 9.532   -38.225 52.101  1.00 53.45  ? 69   ARG A NE    1 
ATOM   279   C  CZ    . ARG A  1 69  ? 9.216   -37.893 53.348  1.00 53.82  ? 69   ARG A CZ    1 
ATOM   280   N  NH1   . ARG A  1 69  ? 7.993   -38.104 53.802  1.00 52.86  ? 69   ARG A NH1   1 
ATOM   281   N  NH2   . ARG A  1 69  ? 10.139  -37.371 54.143  1.00 53.97  ? 69   ARG A NH2   1 
ATOM   282   N  N     . LEU A  1 70  ? 3.936   -36.874 49.329  1.00 46.92  ? 70   LEU A N     1 
ATOM   283   C  CA    . LEU A  1 70  ? 2.504   -37.068 49.309  1.00 46.55  ? 70   LEU A CA    1 
ATOM   284   C  C     . LEU A  1 70  ? 1.893   -36.870 47.921  1.00 46.10  ? 70   LEU A C     1 
ATOM   285   O  O     . LEU A  1 70  ? 1.040   -37.634 47.497  1.00 46.69  ? 70   LEU A O     1 
ATOM   286   C  CB    . LEU A  1 70  ? 1.834   -36.165 50.337  1.00 46.64  ? 70   LEU A CB    1 
ATOM   287   C  CG    . LEU A  1 70  ? 0.306   -36.233 50.380  1.00 46.96  ? 70   LEU A CG    1 
ATOM   288   C  CD1   . LEU A  1 70  ? -0.155  -37.651 50.599  1.00 47.16  ? 70   LEU A CD1   1 
ATOM   289   C  CD2   . LEU A  1 70  ? -0.261  -35.300 51.456  1.00 46.14  ? 70   LEU A CD2   1 
ATOM   290   N  N     . VAL A  1 71  ? 2.349   -35.854 47.205  1.00 45.54  ? 71   VAL A N     1 
ATOM   291   C  CA    . VAL A  1 71  ? 1.832   -35.557 45.873  1.00 44.02  ? 71   VAL A CA    1 
ATOM   292   C  C     . VAL A  1 71  ? 2.234   -36.671 44.915  1.00 44.70  ? 71   VAL A C     1 
ATOM   293   O  O     . VAL A  1 71  ? 1.429   -37.113 44.087  1.00 44.26  ? 71   VAL A O     1 
ATOM   294   C  CB    . VAL A  1 71  ? 2.337   -34.158 45.407  1.00 43.38  ? 71   VAL A CB    1 
ATOM   295   C  CG1   . VAL A  1 71  ? 2.318   -33.998 43.925  1.00 40.65  ? 71   VAL A CG1   1 
ATOM   296   C  CG2   . VAL A  1 71  ? 1.522   -33.092 46.052  1.00 42.33  ? 71   VAL A CG2   1 
ATOM   297   N  N     . ARG A  1 72  ? 3.477   -37.138 45.045  1.00 45.09  ? 72   ARG A N     1 
ATOM   298   C  CA    . ARG A  1 72  ? 3.996   -38.182 44.155  1.00 46.22  ? 72   ARG A CA    1 
ATOM   299   C  C     . ARG A  1 72  ? 3.280   -39.516 44.393  1.00 45.94  ? 72   ARG A C     1 
ATOM   300   O  O     . ARG A  1 72  ? 2.903   -40.194 43.450  1.00 46.46  ? 72   ARG A O     1 
ATOM   301   C  CB    . ARG A  1 72  ? 5.515   -38.333 44.311  1.00 46.68  ? 72   ARG A CB    1 
ATOM   302   C  CG    . ARG A  1 72  ? 6.279   -37.166 43.740  1.00 48.57  ? 72   ARG A CG    1 
ATOM   303   C  CD    . ARG A  1 72  ? 7.738   -37.295 44.049  1.00 54.31  ? 72   ARG A CD    1 
ATOM   304   N  NE    . ARG A  1 72  ? 8.511   -36.134 43.604  1.00 59.46  ? 72   ARG A NE    1 
ATOM   305   C  CZ    . ARG A  1 72  ? 8.745   -35.822 42.328  1.00 61.69  ? 72   ARG A CZ    1 
ATOM   306   N  NH1   . ARG A  1 72  ? 8.249   -36.561 41.347  1.00 63.04  ? 72   ARG A NH1   1 
ATOM   307   N  NH2   . ARG A  1 72  ? 9.481   -34.760 42.031  1.00 62.99  ? 72   ARG A NH2   1 
ATOM   308   N  N     . GLU A  1 73  ? 3.062   -39.851 45.655  1.00 44.94  ? 73   GLU A N     1 
ATOM   309   C  CA    . GLU A  1 73  ? 2.286   -40.992 45.995  1.00 44.93  ? 73   GLU A CA    1 
ATOM   310   C  C     . GLU A  1 73  ? 0.900   -40.949 45.349  1.00 44.94  ? 73   GLU A C     1 
ATOM   311   O  O     . GLU A  1 73  ? 0.406   -41.953 44.835  1.00 45.75  ? 73   GLU A O     1 
ATOM   312   C  CB    . GLU A  1 73  ? 2.191   -41.120 47.520  1.00 44.96  ? 73   GLU A CB    1 
ATOM   313   C  CG    . GLU A  1 73  ? 1.319   -42.273 47.979  1.00 45.81  ? 73   GLU A CG    1 
ATOM   314   C  CD    . GLU A  1 73  ? 1.085   -42.261 49.464  1.00 48.73  ? 73   GLU A CD    1 
ATOM   315   O  OE1   . GLU A  1 73  ? 2.074   -42.043 50.212  1.00 50.73  ? 73   GLU A OE1   1 
ATOM   316   O  OE2   . GLU A  1 73  ? -0.088  -42.469 49.890  1.00 49.97  ? 73   GLU A OE2   1 
ATOM   317   N  N     . ILE A  1 74  ? 0.269   -39.788 45.382  1.00 45.07  ? 74   ILE A N     1 
ATOM   318   C  CA    . ILE A  1 74  ? -1.104  -39.667 44.931  1.00 44.81  ? 74   ILE A CA    1 
ATOM   319   C  C     . ILE A  1 74  ? -1.130  -39.707 43.425  1.00 45.30  ? 74   ILE A C     1 
ATOM   320   O  O     . ILE A  1 74  ? -1.957  -40.396 42.835  1.00 45.02  ? 74   ILE A O     1 
ATOM   321   C  CB    . ILE A  1 74  ? -1.771  -38.408 45.513  1.00 44.49  ? 74   ILE A CB    1 
ATOM   322   C  CG1   . ILE A  1 74  ? -2.055  -38.622 46.999  1.00 42.30  ? 74   ILE A CG1   1 
ATOM   323   C  CG2   . ILE A  1 74  ? -3.053  -38.037 44.753  1.00 43.67  ? 74   ILE A CG2   1 
ATOM   324   C  CD1   . ILE A  1 74  ? -2.248  -37.330 47.765  1.00 40.90  ? 74   ILE A CD1   1 
ATOM   325   N  N     . ALA A  1 75  ? -0.206  -38.986 42.801  1.00 46.42  ? 75   ALA A N     1 
ATOM   326   C  CA    . ALA A  1 75  ? -0.130  -38.989 41.342  1.00 47.89  ? 75   ALA A CA    1 
ATOM   327   C  C     . ALA A  1 75  ? -0.023  -40.424 40.871  1.00 48.80  ? 75   ALA A C     1 
ATOM   328   O  O     . ALA A  1 75  ? -0.752  -40.834 39.968  1.00 49.31  ? 75   ALA A O     1 
ATOM   329   C  CB    . ALA A  1 75  ? 1.054   -38.195 40.851  1.00 47.51  ? 75   ALA A CB    1 
ATOM   330   N  N     . GLN A  1 76  ? 0.860   -41.174 41.536  1.00 49.61  ? 76   GLN A N     1 
ATOM   331   C  CA    . GLN A  1 76  ? 1.242   -42.515 41.146  1.00 50.67  ? 76   GLN A CA    1 
ATOM   332   C  C     . GLN A  1 76  ? 0.064   -43.450 41.126  1.00 51.61  ? 76   GLN A C     1 
ATOM   333   O  O     . GLN A  1 76  ? -0.077  -44.213 40.189  1.00 52.61  ? 76   GLN A O     1 
ATOM   334   C  CB    . GLN A  1 76  ? 2.306   -43.064 42.075  1.00 50.63  ? 76   GLN A CB    1 
ATOM   335   C  CG    . GLN A  1 76  ? 3.064   -44.195 41.472  1.00 50.91  ? 76   GLN A CG    1 
ATOM   336   C  CD    . GLN A  1 76  ? 4.218   -44.600 42.335  1.00 53.18  ? 76   GLN A CD    1 
ATOM   337   O  OE1   . GLN A  1 76  ? 4.109   -44.654 43.558  1.00 53.84  ? 76   GLN A OE1   1 
ATOM   338   N  NE2   . GLN A  1 76  ? 5.348   -44.876 41.705  1.00 54.89  ? 76   GLN A NE2   1 
ATOM   339   N  N     . ASP A  1 77  ? -0.787  -43.389 42.146  1.00 52.23  ? 77   ASP A N     1 
ATOM   340   C  CA    . ASP A  1 77  ? -2.052  -44.084 42.084  1.00 53.20  ? 77   ASP A CA    1 
ATOM   341   C  C     . ASP A  1 77  ? -2.929  -43.732 40.873  1.00 54.12  ? 77   ASP A C     1 
ATOM   342   O  O     . ASP A  1 77  ? -3.896  -44.435 40.629  1.00 55.11  ? 77   ASP A O     1 
ATOM   343   C  CB    . ASP A  1 77  ? -2.824  -43.951 43.393  1.00 52.82  ? 77   ASP A CB    1 
ATOM   344   C  CG    . ASP A  1 77  ? -2.023  -44.441 44.602  1.00 54.46  ? 77   ASP A CG    1 
ATOM   345   O  OD1   . ASP A  1 77  ? -1.121  -45.307 44.470  1.00 57.84  ? 77   ASP A OD1   1 
ATOM   346   O  OD2   . ASP A  1 77  ? -2.309  -43.966 45.716  1.00 56.69  ? 77   ASP A OD2   1 
ATOM   347   N  N     . PHE A  1 78  ? -2.607  -42.686 40.110  1.00 55.28  ? 78   PHE A N     1 
ATOM   348   C  CA    . PHE A  1 78  ? -3.378  -42.366 38.896  1.00 56.80  ? 78   PHE A CA    1 
ATOM   349   C  C     . PHE A  1 78  ? -2.645  -42.721 37.608  1.00 57.76  ? 78   PHE A C     1 
ATOM   350   O  O     . PHE A  1 78  ? -3.274  -42.971 36.570  1.00 57.84  ? 78   PHE A O     1 
ATOM   351   C  CB    . PHE A  1 78  ? -3.756  -40.885 38.814  1.00 56.63  ? 78   PHE A CB    1 
ATOM   352   C  CG    . PHE A  1 78  ? -4.773  -40.454 39.806  1.00 57.25  ? 78   PHE A CG    1 
ATOM   353   C  CD1   . PHE A  1 78  ? -4.473  -39.446 40.732  1.00 58.25  ? 78   PHE A CD1   1 
ATOM   354   C  CD2   . PHE A  1 78  ? -6.039  -41.018 39.820  1.00 57.40  ? 78   PHE A CD2   1 
ATOM   355   C  CE1   . PHE A  1 78  ? -5.413  -39.025 41.682  1.00 57.81  ? 78   PHE A CE1   1 
ATOM   356   C  CE2   . PHE A  1 78  ? -7.002  -40.594 40.761  1.00 59.34  ? 78   PHE A CE2   1 
ATOM   357   C  CZ    . PHE A  1 78  ? -6.682  -39.593 41.697  1.00 58.30  ? 78   PHE A CZ    1 
ATOM   358   N  N     . LYS A  1 79  ? -1.321  -42.679 37.668  1.00 58.63  ? 79   LYS A N     1 
ATOM   359   C  CA    . LYS A  1 79  ? -0.481  -42.960 36.525  1.00 60.22  ? 79   LYS A CA    1 
ATOM   360   C  C     . LYS A  1 79  ? 0.933   -43.076 37.058  1.00 61.14  ? 79   LYS A C     1 
ATOM   361   O  O     . LYS A  1 79  ? 1.365   -42.256 37.878  1.00 61.90  ? 79   LYS A O     1 
ATOM   362   C  CB    . LYS A  1 79  ? -0.582  -41.836 35.492  1.00 60.40  ? 79   LYS A CB    1 
ATOM   363   C  CG    . LYS A  1 79  ? 0.389   -41.935 34.323  1.00 61.19  ? 79   LYS A CG    1 
ATOM   364   C  CD    . LYS A  1 79  ? -0.277  -42.437 33.049  1.00 63.90  ? 79   LYS A CD    1 
ATOM   365   C  CE    . LYS A  1 79  ? 0.757   -42.802 31.959  1.00 65.14  ? 79   LYS A CE    1 
ATOM   366   N  NZ    . LYS A  1 79  ? 1.557   -44.065 32.252  1.00 67.65  ? 79   LYS A NZ    1 
ATOM   367   N  N     . THR A  1 80  ? 1.641   -44.109 36.614  1.00 61.97  ? 80   THR A N     1 
ATOM   368   C  CA    . THR A  1 80  ? 3.017   -44.362 37.048  1.00 62.29  ? 80   THR A CA    1 
ATOM   369   C  C     . THR A  1 80  ? 3.897   -43.596 36.103  1.00 62.57  ? 80   THR A C     1 
ATOM   370   O  O     . THR A  1 80  ? 3.454   -43.211 35.020  1.00 62.72  ? 80   THR A O     1 
ATOM   371   C  CB    . THR A  1 80  ? 3.381   -45.852 36.919  1.00 62.61  ? 80   THR A CB    1 
ATOM   372   O  OG1   . THR A  1 80  ? 3.258   -46.258 35.542  1.00 62.32  ? 80   THR A OG1   1 
ATOM   373   C  CG2   . THR A  1 80  ? 2.467   -46.722 37.797  1.00 62.39  ? 80   THR A CG2   1 
ATOM   374   N  N     . ASP A  1 81  ? 5.148   -43.383 36.488  1.00 63.19  ? 81   ASP A N     1 
ATOM   375   C  CA    . ASP A  1 81  ? 6.079   -42.649 35.630  1.00 63.94  ? 81   ASP A CA    1 
ATOM   376   C  C     . ASP A  1 81  ? 5.801   -41.152 35.423  1.00 63.02  ? 81   ASP A C     1 
ATOM   377   O  O     . ASP A  1 81  ? 6.161   -40.594 34.375  1.00 63.32  ? 81   ASP A O     1 
ATOM   378   C  CB    . ASP A  1 81  ? 6.169   -43.321 34.259  1.00 65.13  ? 81   ASP A CB    1 
ATOM   379   C  CG    . ASP A  1 81  ? 7.450   -44.095 34.092  1.00 69.13  ? 81   ASP A CG    1 
ATOM   380   O  OD1   . ASP A  1 81  ? 7.806   -44.849 35.051  1.00 73.21  ? 81   ASP A OD1   1 
ATOM   381   O  OD2   . ASP A  1 81  ? 8.096   -43.923 33.015  1.00 72.50  ? 81   ASP A OD2   1 
ATOM   382   N  N     . LEU A  1 82  ? 5.166   -40.496 36.394  1.00 61.61  ? 82   LEU A N     1 
ATOM   383   C  CA    . LEU A  1 82  ? 4.951   -39.073 36.252  1.00 59.88  ? 82   LEU A CA    1 
ATOM   384   C  C     . LEU A  1 82  ? 6.139   -38.388 36.850  1.00 59.72  ? 82   LEU A C     1 
ATOM   385   O  O     . LEU A  1 82  ? 6.717   -38.858 37.830  1.00 60.35  ? 82   LEU A O     1 
ATOM   386   C  CB    . LEU A  1 82  ? 3.654   -38.607 36.895  1.00 59.03  ? 82   LEU A CB    1 
ATOM   387   C  CG    . LEU A  1 82  ? 2.383   -39.099 36.194  1.00 57.74  ? 82   LEU A CG    1 
ATOM   388   C  CD1   . LEU A  1 82  ? 1.165   -38.678 36.961  1.00 56.62  ? 82   LEU A CD1   1 
ATOM   389   C  CD2   . LEU A  1 82  ? 2.268   -38.668 34.745  1.00 55.63  ? 82   LEU A CD2   1 
ATOM   390   N  N     . ARG A  1 83  ? 6.542   -37.304 36.214  1.00 59.05  ? 83   ARG A N     1 
ATOM   391   C  CA    . ARG A  1 83  ? 7.478   -36.377 36.820  1.00 58.30  ? 83   ARG A CA    1 
ATOM   392   C  C     . ARG A  1 83  ? 6.772   -35.031 37.056  1.00 57.11  ? 83   ARG A C     1 
ATOM   393   O  O     . ARG A  1 83  ? 5.757   -34.728 36.406  1.00 57.40  ? 83   ARG A O     1 
ATOM   394   C  CB    . ARG A  1 83  ? 8.694   -36.232 35.926  1.00 58.47  ? 83   ARG A CB    1 
ATOM   395   C  CG    . ARG A  1 83  ? 9.254   -37.562 35.536  1.00 60.04  ? 83   ARG A CG    1 
ATOM   396   C  CD    . ARG A  1 83  ? 10.299  -37.415 34.462  1.00 65.08  ? 83   ARG A CD    1 
ATOM   397   N  NE    . ARG A  1 83  ? 11.645  -37.606 34.988  1.00 69.54  ? 83   ARG A NE    1 
ATOM   398   C  CZ    . ARG A  1 83  ? 12.743  -37.118 34.417  1.00 72.24  ? 83   ARG A CZ    1 
ATOM   399   N  NH1   . ARG A  1 83  ? 12.639  -36.386 33.312  1.00 71.88  ? 83   ARG A NH1   1 
ATOM   400   N  NH2   . ARG A  1 83  ? 13.943  -37.348 34.960  1.00 73.71  ? 83   ARG A NH2   1 
ATOM   401   N  N     . PHE A  1 84  ? 7.295   -34.250 37.996  1.00 55.19  ? 84   PHE A N     1 
ATOM   402   C  CA    . PHE A  1 84  ? 6.743   -32.934 38.334  1.00 53.36  ? 84   PHE A CA    1 
ATOM   403   C  C     . PHE A  1 84  ? 7.748   -31.797 38.156  1.00 52.55  ? 84   PHE A C     1 
ATOM   404   O  O     . PHE A  1 84  ? 8.882   -31.890 38.630  1.00 51.77  ? 84   PHE A O     1 
ATOM   405   C  CB    . PHE A  1 84  ? 6.278   -32.938 39.790  1.00 52.98  ? 84   PHE A CB    1 
ATOM   406   C  CG    . PHE A  1 84  ? 5.019   -33.724 40.027  1.00 52.36  ? 84   PHE A CG    1 
ATOM   407   C  CD1   . PHE A  1 84  ? 5.067   -35.109 40.223  1.00 51.32  ? 84   PHE A CD1   1 
ATOM   408   C  CD2   . PHE A  1 84  ? 3.782   -33.077 40.072  1.00 51.87  ? 84   PHE A CD2   1 
ATOM   409   C  CE1   . PHE A  1 84  ? 3.907   -35.836 40.455  1.00 50.23  ? 84   PHE A CE1   1 
ATOM   410   C  CE2   . PHE A  1 84  ? 2.603   -33.792 40.303  1.00 52.24  ? 84   PHE A CE2   1 
ATOM   411   C  CZ    . PHE A  1 84  ? 2.666   -35.180 40.493  1.00 52.03  ? 84   PHE A CZ    1 
ATOM   412   N  N     . GLN A  1 85  ? 7.334   -30.713 37.495  1.00 51.82  ? 85   GLN A N     1 
ATOM   413   C  CA    . GLN A  1 85  ? 8.084   -29.453 37.610  1.00 50.98  ? 85   GLN A CA    1 
ATOM   414   C  C     . GLN A  1 85  ? 8.018   -29.055 39.067  1.00 50.67  ? 85   GLN A C     1 
ATOM   415   O  O     . GLN A  1 85  ? 6.994   -29.251 39.719  1.00 50.60  ? 85   GLN A O     1 
ATOM   416   C  CB    . GLN A  1 85  ? 7.468   -28.357 36.768  1.00 50.61  ? 85   GLN A CB    1 
ATOM   417   C  CG    . GLN A  1 85  ? 7.606   -28.551 35.293  1.00 51.28  ? 85   GLN A CG    1 
ATOM   418   C  CD    . GLN A  1 85  ? 6.924   -27.457 34.490  1.00 52.64  ? 85   GLN A CD    1 
ATOM   419   O  OE1   . GLN A  1 85  ? 6.074   -26.720 35.001  1.00 53.03  ? 85   GLN A OE1   1 
ATOM   420   N  NE2   . GLN A  1 85  ? 7.279   -27.360 33.214  1.00 54.29  ? 85   GLN A NE2   1 
ATOM   421   N  N     . SER A  1 86  ? 9.104   -28.530 39.606  1.00 50.64  ? 86   SER A N     1 
ATOM   422   C  CA    . SER A  1 86  ? 9.107   -28.201 41.027  1.00 51.30  ? 86   SER A CA    1 
ATOM   423   C  C     . SER A  1 86  ? 8.070   -27.123 41.309  1.00 51.13  ? 86   SER A C     1 
ATOM   424   O  O     . SER A  1 86  ? 7.498   -27.093 42.385  1.00 52.02  ? 86   SER A O     1 
ATOM   425   C  CB    . SER A  1 86  ? 10.458  -27.700 41.455  1.00 51.17  ? 86   SER A CB    1 
ATOM   426   O  OG    . SER A  1 86  ? 10.842  -26.709 40.525  1.00 53.38  ? 86   SER A OG    1 
ATOM   427   N  N     . SER A  1 87  ? 7.814   -26.257 40.339  1.00 50.10  ? 87   SER A N     1 
ATOM   428   C  CA    . SER A  1 87  ? 6.793   -25.260 40.524  1.00 50.11  ? 87   SER A CA    1 
ATOM   429   C  C     . SER A  1 87  ? 5.363   -25.831 40.446  1.00 49.70  ? 87   SER A C     1 
ATOM   430   O  O     . SER A  1 87  ? 4.424   -25.206 40.968  1.00 49.38  ? 87   SER A O     1 
ATOM   431   C  CB    . SER A  1 87  ? 6.972   -24.092 39.542  1.00 49.86  ? 87   SER A CB    1 
ATOM   432   O  OG    . SER A  1 87  ? 6.538   -24.448 38.245  1.00 51.17  ? 87   SER A OG    1 
ATOM   433   N  N     . ALA A  1 88  ? 5.194   -26.983 39.790  1.00 48.81  ? 88   ALA A N     1 
ATOM   434   C  CA    . ALA A  1 88  ? 3.895   -27.652 39.794  1.00 48.63  ? 88   ALA A CA    1 
ATOM   435   C  C     . ALA A  1 88  ? 3.582   -28.056 41.207  1.00 48.65  ? 88   ALA A C     1 
ATOM   436   O  O     . ALA A  1 88  ? 2.428   -27.984 41.636  1.00 48.80  ? 88   ALA A O     1 
ATOM   437   C  CB    . ALA A  1 88  ? 3.876   -28.862 38.902  1.00 48.39  ? 88   ALA A CB    1 
ATOM   438   N  N     . VAL A  1 89  ? 4.617   -28.461 41.935  1.00 48.76  ? 89   VAL A N     1 
ATOM   439   C  CA    . VAL A  1 89  ? 4.473   -28.900 43.317  1.00 48.75  ? 89   VAL A CA    1 
ATOM   440   C  C     . VAL A  1 89  ? 4.274   -27.692 44.220  1.00 48.69  ? 89   VAL A C     1 
ATOM   441   O  O     . VAL A  1 89  ? 3.419   -27.698 45.111  1.00 49.25  ? 89   VAL A O     1 
ATOM   442   C  CB    . VAL A  1 89  ? 5.688   -29.767 43.779  1.00 48.92  ? 89   VAL A CB    1 
ATOM   443   C  CG1   . VAL A  1 89  ? 5.628   -30.073 45.280  1.00 48.74  ? 89   VAL A CG1   1 
ATOM   444   C  CG2   . VAL A  1 89  ? 5.743   -31.057 42.998  1.00 47.90  ? 89   VAL A CG2   1 
ATOM   445   N  N     . MET A  1 90  ? 5.049   -26.645 43.978  1.00 49.09  ? 90   MET A N     1 
ATOM   446   C  CA    . MET A  1 90  ? 4.906   -25.420 44.758  1.00 49.28  ? 90   MET A CA    1 
ATOM   447   C  C     . MET A  1 90  ? 3.510   -24.832 44.594  1.00 47.22  ? 90   MET A C     1 
ATOM   448   O  O     . MET A  1 90  ? 2.897   -24.404 45.560  1.00 46.52  ? 90   MET A O     1 
ATOM   449   C  CB    . MET A  1 90  ? 6.018   -24.423 44.448  1.00 50.28  ? 90   MET A CB    1 
ATOM   450   C  CG    . MET A  1 90  ? 6.621   -23.809 45.718  1.00 57.56  ? 90   MET A CG    1 
ATOM   451   S  SD    . MET A  1 90  ? 6.910   -24.992 47.100  1.00 71.79  ? 90   MET A SD    1 
ATOM   452   C  CE    . MET A  1 90  ? 8.117   -26.086 46.307  1.00 69.51  ? 90   MET A CE    1 
ATOM   453   N  N     . ALA A  1 91  ? 2.986   -24.903 43.381  1.00 46.02  ? 91   ALA A N     1 
ATOM   454   C  CA    . ALA A  1 91  ? 1.622   -24.486 43.112  1.00 45.80  ? 91   ALA A CA    1 
ATOM   455   C  C     . ALA A  1 91  ? 0.626   -25.289 43.934  1.00 46.03  ? 91   ALA A C     1 
ATOM   456   O  O     . ALA A  1 91  ? -0.293  -24.714 44.550  1.00 47.06  ? 91   ALA A O     1 
ATOM   457   C  CB    . ALA A  1 91  ? 1.304   -24.585 41.640  1.00 45.12  ? 91   ALA A CB    1 
ATOM   458   N  N     . LEU A  1 92  ? 0.823   -26.606 43.979  1.00 45.14  ? 92   LEU A N     1 
ATOM   459   C  CA    . LEU A  1 92  ? -0.085  -27.485 44.698  1.00 44.35  ? 92   LEU A CA    1 
ATOM   460   C  C     . LEU A  1 92  ? -0.042  -27.146 46.164  1.00 43.48  ? 92   LEU A C     1 
ATOM   461   O  O     . LEU A  1 92  ? -1.078  -27.053 46.822  1.00 43.60  ? 92   LEU A O     1 
ATOM   462   C  CB    . LEU A  1 92  ? 0.279   -28.968 44.477  1.00 44.28  ? 92   LEU A CB    1 
ATOM   463   C  CG    . LEU A  1 92  ? -0.298  -29.549 43.192  1.00 44.38  ? 92   LEU A CG    1 
ATOM   464   C  CD1   . LEU A  1 92  ? 0.446   -30.796 42.728  1.00 43.24  ? 92   LEU A CD1   1 
ATOM   465   C  CD2   . LEU A  1 92  ? -1.792  -29.797 43.368  1.00 43.42  ? 92   LEU A CD2   1 
ATOM   466   N  N     . GLN A  1 93  ? 1.162   -26.953 46.676  1.00 42.47  ? 93   GLN A N     1 
ATOM   467   C  CA    . GLN A  1 93  ? 1.292   -26.563 48.060  1.00 41.68  ? 93   GLN A CA    1 
ATOM   468   C  C     . GLN A  1 93  ? 0.625   -25.215 48.349  1.00 41.83  ? 93   GLN A C     1 
ATOM   469   O  O     . GLN A  1 93  ? -0.038  -25.079 49.366  1.00 41.75  ? 93   GLN A O     1 
ATOM   470   C  CB    . GLN A  1 93  ? 2.756   -26.601 48.521  1.00 40.98  ? 93   GLN A CB    1 
ATOM   471   C  CG    . GLN A  1 93  ? 2.869   -26.911 50.021  1.00 39.54  ? 93   GLN A CG    1 
ATOM   472   C  CD    . GLN A  1 93  ? 4.281   -26.968 50.488  1.00 39.96  ? 93   GLN A CD    1 
ATOM   473   O  OE1   . GLN A  1 93  ? 5.203   -26.990 49.679  1.00 41.41  ? 93   GLN A OE1   1 
ATOM   474   N  NE2   . GLN A  1 93  ? 4.478   -26.981 51.807  1.00 38.38  ? 93   GLN A NE2   1 
ATOM   475   N  N     . GLU A  1 94  ? 0.780   -24.227 47.464  1.00 41.90  ? 94   GLU A N     1 
ATOM   476   C  CA    . GLU A  1 94  ? 0.164   -22.917 47.715  1.00 41.91  ? 94   GLU A CA    1 
ATOM   477   C  C     . GLU A  1 94  ? -1.355  -23.074 47.771  1.00 41.26  ? 94   GLU A C     1 
ATOM   478   O  O     . GLU A  1 94  ? -1.982  -22.647 48.729  1.00 40.89  ? 94   GLU A O     1 
ATOM   479   C  CB    . GLU A  1 94  ? 0.543   -21.891 46.646  1.00 42.55  ? 94   GLU A CB    1 
ATOM   480   C  CG    . GLU A  1 94  ? 1.981   -21.389 46.669  1.00 44.72  ? 94   GLU A CG    1 
ATOM   481   C  CD    . GLU A  1 94  ? 2.303   -20.485 47.851  1.00 50.17  ? 94   GLU A CD    1 
ATOM   482   O  OE1   . GLU A  1 94  ? 3.506   -20.391 48.192  1.00 54.11  ? 94   GLU A OE1   1 
ATOM   483   O  OE2   . GLU A  1 94  ? 1.385   -19.863 48.439  1.00 52.02  ? 94   GLU A OE2   1 
ATOM   484   N  N     . ALA A  1 95  ? -1.930  -23.749 46.771  1.00 40.64  ? 95   ALA A N     1 
ATOM   485   C  CA    . ALA A  1 95  ? -3.360  -24.057 46.773  1.00 40.16  ? 95   ALA A CA    1 
ATOM   486   C  C     . ALA A  1 95  ? -3.833  -24.815 48.015  1.00 40.45  ? 95   ALA A C     1 
ATOM   487   O  O     . ALA A  1 95  ? -4.918  -24.505 48.517  1.00 41.30  ? 95   ALA A O     1 
ATOM   488   C  CB    . ALA A  1 95  ? -3.787  -24.787 45.513  1.00 39.06  ? 95   ALA A CB    1 
ATOM   489   N  N     . SER A  1 96  ? -3.030  -25.762 48.517  1.00 39.87  ? 96   SER A N     1 
ATOM   490   C  CA    . SER A  1 96  ? -3.435  -26.644 49.621  1.00 40.30  ? 96   SER A CA    1 
ATOM   491   C  C     . SER A  1 96  ? -3.437  -25.933 50.953  1.00 40.73  ? 96   SER A C     1 
ATOM   492   O  O     . SER A  1 96  ? -4.403  -26.014 51.721  1.00 41.24  ? 96   SER A O     1 
ATOM   493   C  CB    . SER A  1 96  ? -2.551  -27.919 49.697  1.00 40.12  ? 96   SER A CB    1 
ATOM   494   O  OG    . SER A  1 96  ? -2.711  -28.723 48.532  1.00 39.33  ? 96   SER A OG    1 
ATOM   495   N  N     . GLU A  1 97  ? -2.345  -25.239 51.236  1.00 41.14  ? 97   GLU A N     1 
ATOM   496   C  CA    . GLU A  1 97  ? -2.304  -24.340 52.381  1.00 41.60  ? 97   GLU A CA    1 
ATOM   497   C  C     . GLU A  1 97  ? -3.390  -23.254 52.303  1.00 41.19  ? 97   GLU A C     1 
ATOM   498   O  O     . GLU A  1 97  ? -4.071  -22.996 53.283  1.00 41.57  ? 97   GLU A O     1 
ATOM   499   C  CB    . GLU A  1 97  ? -0.906  -23.776 52.574  1.00 41.65  ? 97   GLU A CB    1 
ATOM   500   C  CG    . GLU A  1 97  ? 0.147   -24.869 52.691  1.00 44.84  ? 97   GLU A CG    1 
ATOM   501   C  CD    . GLU A  1 97  ? 1.305   -24.496 53.605  1.00 50.93  ? 97   GLU A CD    1 
ATOM   502   O  OE1   . GLU A  1 97  ? 1.148   -23.572 54.441  1.00 54.60  ? 97   GLU A OE1   1 
ATOM   503   O  OE2   . GLU A  1 97  ? 2.384   -25.137 53.515  1.00 53.42  ? 97   GLU A OE2   1 
ATOM   504   N  N     . ALA A  1 98  ? -3.617  -22.648 51.147  1.00 40.66  ? 98   ALA A N     1 
ATOM   505   C  CA    . ALA A  1 98  ? -4.754  -21.690 51.084  1.00 40.60  ? 98   ALA A CA    1 
ATOM   506   C  C     . ALA A  1 98  ? -6.099  -22.348 51.455  1.00 39.78  ? 98   ALA A C     1 
ATOM   507   O  O     . ALA A  1 98  ? -6.855  -21.803 52.254  1.00 39.93  ? 98   ALA A O     1 
ATOM   508   C  CB    . ALA A  1 98  ? -4.837  -20.950 49.737  1.00 39.32  ? 98   ALA A CB    1 
ATOM   509   N  N     . TYR A  1 99  ? -6.359  -23.532 50.914  1.00 39.62  ? 99   TYR A N     1 
ATOM   510   C  CA    . TYR A  1 99  ? -7.610  -24.230 51.161  1.00 39.85  ? 99   TYR A CA    1 
ATOM   511   C  C     . TYR A  1 99  ? -7.776  -24.554 52.646  1.00 39.85  ? 99   TYR A C     1 
ATOM   512   O  O     . TYR A  1 99  ? -8.789  -24.230 53.252  1.00 39.57  ? 99   TYR A O     1 
ATOM   513   C  CB    . TYR A  1 99  ? -7.718  -25.472 50.273  1.00 40.88  ? 99   TYR A CB    1 
ATOM   514   C  CG    . TYR A  1 99  ? -8.817  -26.415 50.674  1.00 42.82  ? 99   TYR A CG    1 
ATOM   515   C  CD1   . TYR A  1 99  ? -10.133 -26.248 50.208  1.00 42.51  ? 99   TYR A CD1   1 
ATOM   516   C  CD2   . TYR A  1 99  ? -8.557  -27.459 51.546  1.00 43.35  ? 99   TYR A CD2   1 
ATOM   517   C  CE1   . TYR A  1 99  ? -11.132 -27.099 50.599  1.00 39.67  ? 99   TYR A CE1   1 
ATOM   518   C  CE2   . TYR A  1 99  ? -9.559  -28.308 51.937  1.00 43.46  ? 99   TYR A CE2   1 
ATOM   519   C  CZ    . TYR A  1 99  ? -10.834 -28.123 51.469  1.00 42.74  ? 99   TYR A CZ    1 
ATOM   520   O  OH    . TYR A  1 99  ? -11.802 -29.015 51.903  1.00 45.47  ? 99   TYR A OH    1 
ATOM   521   N  N     . LEU A  1 100 ? -6.754  -25.144 53.246  1.00 40.38  ? 100  LEU A N     1 
ATOM   522   C  CA    . LEU A  1 100 ? -6.837  -25.561 54.621  1.00 40.23  ? 100  LEU A CA    1 
ATOM   523   C  C     . LEU A  1 100 ? -6.980  -24.377 55.537  1.00 40.48  ? 100  LEU A C     1 
ATOM   524   O  O     . LEU A  1 100 ? -7.821  -24.413 56.439  1.00 41.65  ? 100  LEU A O     1 
ATOM   525   C  CB    . LEU A  1 100 ? -5.635  -26.423 55.001  1.00 40.71  ? 100  LEU A CB    1 
ATOM   526   C  CG    . LEU A  1 100 ? -5.582  -27.837 54.389  1.00 42.11  ? 100  LEU A CG    1 
ATOM   527   C  CD1   . LEU A  1 100 ? -4.503  -28.633 55.066  1.00 39.71  ? 100  LEU A CD1   1 
ATOM   528   C  CD2   . LEU A  1 100 ? -6.929  -28.592 54.512  1.00 41.99  ? 100  LEU A CD2   1 
ATOM   529   N  N     . VAL A  1 101 ? -6.192  -23.317 55.313  1.00 40.15  ? 101  VAL A N     1 
ATOM   530   C  CA    . VAL A  1 101 ? -6.323  -22.066 56.099  1.00 38.94  ? 101  VAL A CA    1 
ATOM   531   C  C     . VAL A  1 101 ? -7.763  -21.547 56.028  1.00 38.57  ? 101  VAL A C     1 
ATOM   532   O  O     . VAL A  1 101 ? -8.384  -21.306 57.043  1.00 38.51  ? 101  VAL A O     1 
ATOM   533   C  CB    . VAL A  1 101 ? -5.299  -20.953 55.697  1.00 38.90  ? 101  VAL A CB    1 
ATOM   534   C  CG1   . VAL A  1 101 ? -5.692  -19.647 56.312  1.00 37.89  ? 101  VAL A CG1   1 
ATOM   535   C  CG2   . VAL A  1 101 ? -3.851  -21.292 56.151  1.00 37.09  ? 101  VAL A CG2   1 
ATOM   536   N  N     . ALA A  1 102 ? -8.321  -21.431 54.833  1.00 38.57  ? 102  ALA A N     1 
ATOM   537   C  CA    . ALA A  1 102 ? -9.695  -20.948 54.718  1.00 39.14  ? 102  ALA A CA    1 
ATOM   538   C  C     . ALA A  1 102 ? -10.676 -21.877 55.447  1.00 40.22  ? 102  ALA A C     1 
ATOM   539   O  O     . ALA A  1 102 ? -11.567 -21.408 56.135  1.00 41.09  ? 102  ALA A O     1 
ATOM   540   C  CB    . ALA A  1 102 ? -10.088 -20.733 53.281  1.00 37.22  ? 102  ALA A CB    1 
ATOM   541   N  N     . LEU A  1 103 ? -10.478 -23.188 55.333  1.00 41.50  ? 103  LEU A N     1 
ATOM   542   C  CA    . LEU A  1 103 ? -11.298 -24.162 56.038  1.00 41.89  ? 103  LEU A CA    1 
ATOM   543   C  C     . LEU A  1 103 ? -11.244 -24.017 57.561  1.00 42.62  ? 103  LEU A C     1 
ATOM   544   O  O     . LEU A  1 103 ? -12.274 -24.123 58.225  1.00 42.40  ? 103  LEU A O     1 
ATOM   545   C  CB    . LEU A  1 103 ? -10.878 -25.582 55.652  1.00 42.46  ? 103  LEU A CB    1 
ATOM   546   C  CG    . LEU A  1 103 ? -11.788 -26.680 56.239  1.00 43.10  ? 103  LEU A CG    1 
ATOM   547   C  CD1   . LEU A  1 103 ? -13.187 -26.544 55.641  1.00 41.92  ? 103  LEU A CD1   1 
ATOM   548   C  CD2   . LEU A  1 103 ? -11.184 -28.071 56.033  1.00 41.24  ? 103  LEU A CD2   1 
ATOM   549   N  N     . PHE A  1 104 ? -10.058 -23.789 58.123  1.00 43.34  ? 104  PHE A N     1 
ATOM   550   C  CA    . PHE A  1 104 ? -9.974  -23.496 59.558  1.00 44.35  ? 104  PHE A CA    1 
ATOM   551   C  C     . PHE A  1 104 ? -10.704 -22.216 59.985  1.00 45.76  ? 104  PHE A C     1 
ATOM   552   O  O     . PHE A  1 104 ? -11.210 -22.127 61.117  1.00 46.00  ? 104  PHE A O     1 
ATOM   553   C  CB    . PHE A  1 104 ? -8.535  -23.495 60.052  1.00 43.53  ? 104  PHE A CB    1 
ATOM   554   C  CG    . PHE A  1 104 ? -7.908  -24.884 60.111  1.00 43.35  ? 104  PHE A CG    1 
ATOM   555   C  CD1   . PHE A  1 104 ? -6.771  -25.181 59.372  1.00 41.52  ? 104  PHE A CD1   1 
ATOM   556   C  CD2   . PHE A  1 104 ? -8.465  -25.893 60.916  1.00 42.37  ? 104  PHE A CD2   1 
ATOM   557   C  CE1   . PHE A  1 104 ? -6.177  -26.461 59.440  1.00 43.22  ? 104  PHE A CE1   1 
ATOM   558   C  CE2   . PHE A  1 104 ? -7.896  -27.165 60.983  1.00 42.42  ? 104  PHE A CE2   1 
ATOM   559   C  CZ    . PHE A  1 104 ? -6.737  -27.457 60.238  1.00 41.66  ? 104  PHE A CZ    1 
ATOM   560   N  N     . GLU A  1 105 ? -10.785 -21.223 59.102  1.00 46.81  ? 105  GLU A N     1 
ATOM   561   C  CA    . GLU A  1 105 ? -11.513 -20.009 59.471  1.00 48.16  ? 105  GLU A CA    1 
ATOM   562   C  C     . GLU A  1 105 ? -12.977 -20.376 59.625  1.00 48.39  ? 105  GLU A C     1 
ATOM   563   O  O     . GLU A  1 105 ? -13.600 -20.006 60.624  1.00 48.71  ? 105  GLU A O     1 
ATOM   564   C  CB    . GLU A  1 105 ? -11.382 -18.917 58.407  1.00 48.80  ? 105  GLU A CB    1 
ATOM   565   C  CG    . GLU A  1 105 ? -10.066 -18.200 58.367  1.00 52.22  ? 105  GLU A CG    1 
ATOM   566   C  CD    . GLU A  1 105 ? -9.744  -17.659 56.967  1.00 57.84  ? 105  GLU A CD    1 
ATOM   567   O  OE1   . GLU A  1 105 ? -10.681 -17.610 56.108  1.00 60.11  ? 105  GLU A OE1   1 
ATOM   568   O  OE2   . GLU A  1 105 ? -8.556  -17.299 56.731  1.00 57.84  ? 105  GLU A OE2   1 
ATOM   569   N  N     . ASP A  1 106 ? -13.518 -21.088 58.628  1.00 48.12  ? 106  ASP A N     1 
ATOM   570   C  CA    . ASP A  1 106 ? -14.878 -21.612 58.681  1.00 48.73  ? 106  ASP A CA    1 
ATOM   571   C  C     . ASP A  1 106 ? -15.110 -22.568 59.847  1.00 48.66  ? 106  ASP A C     1 
ATOM   572   O  O     . ASP A  1 106 ? -16.141 -22.495 60.517  1.00 48.55  ? 106  ASP A O     1 
ATOM   573   C  CB    . ASP A  1 106 ? -15.264 -22.275 57.362  1.00 48.75  ? 106  ASP A CB    1 
ATOM   574   C  CG    . ASP A  1 106 ? -15.336 -21.278 56.206  1.00 51.61  ? 106  ASP A CG    1 
ATOM   575   O  OD1   . ASP A  1 106 ? -15.194 -20.060 56.453  1.00 54.74  ? 106  ASP A OD1   1 
ATOM   576   O  OD2   . ASP A  1 106 ? -15.524 -21.704 55.039  1.00 54.43  ? 106  ASP A OD2   1 
ATOM   577   N  N     . THR A  1 107 ? -14.153 -23.454 60.098  1.00 48.69  ? 107  THR A N     1 
ATOM   578   C  CA    . THR A  1 107 ? -14.262 -24.379 61.221  1.00 49.02  ? 107  THR A CA    1 
ATOM   579   C  C     . THR A  1 107 ? -14.342 -23.590 62.535  1.00 49.17  ? 107  THR A C     1 
ATOM   580   O  O     . THR A  1 107 ? -15.138 -23.912 63.409  1.00 49.20  ? 107  THR A O     1 
ATOM   581   C  CB    . THR A  1 107 ? -13.054 -25.349 61.277  1.00 49.32  ? 107  THR A CB    1 
ATOM   582   O  OG1   . THR A  1 107 ? -12.923 -26.051 60.038  1.00 49.19  ? 107  THR A OG1   1 
ATOM   583   C  CG2   . THR A  1 107 ? -13.216 -26.345 62.383  1.00 48.73  ? 107  THR A CG2   1 
ATOM   584   N  N     . ASN A  1 108 ? -13.522 -22.555 62.681  1.00 49.27  ? 108  ASN A N     1 
ATOM   585   C  CA    . ASN A  1 108 ? -13.555 -21.760 63.917  1.00 49.68  ? 108  ASN A CA    1 
ATOM   586   C  C     . ASN A  1 108 ? -14.904 -21.082 64.135  1.00 49.40  ? 108  ASN A C     1 
ATOM   587   O  O     . ASN A  1 108 ? -15.432 -21.041 65.245  1.00 48.50  ? 108  ASN A O     1 
ATOM   588   C  CB    . ASN A  1 108 ? -12.456 -20.728 63.928  1.00 49.55  ? 108  ASN A CB    1 
ATOM   589   C  CG    . ASN A  1 108 ? -11.909 -20.490 65.299  1.00 51.64  ? 108  ASN A CG    1 
ATOM   590   O  OD1   . ASN A  1 108 ? -11.155 -19.542 65.510  1.00 55.29  ? 108  ASN A OD1   1 
ATOM   591   N  ND2   . ASN A  1 108 ? -12.269 -21.345 66.250  1.00 51.39  ? 108  ASN A ND2   1 
ATOM   592   N  N     . LEU A  1 109 ? -15.471 -20.582 63.044  1.00 49.62  ? 109  LEU A N     1 
ATOM   593   C  CA    . LEU A  1 109 ? -16.772 -19.959 63.099  1.00 49.56  ? 109  LEU A CA    1 
ATOM   594   C  C     . LEU A  1 109 ? -17.802 -20.962 63.554  1.00 49.94  ? 109  LEU A C     1 
ATOM   595   O  O     . LEU A  1 109 ? -18.742 -20.607 64.242  1.00 50.04  ? 109  LEU A O     1 
ATOM   596   C  CB    . LEU A  1 109 ? -17.148 -19.401 61.736  1.00 49.72  ? 109  LEU A CB    1 
ATOM   597   C  CG    . LEU A  1 109 ? -16.413 -18.157 61.217  1.00 48.99  ? 109  LEU A CG    1 
ATOM   598   C  CD1   . LEU A  1 109 ? -17.125 -17.672 59.970  1.00 45.38  ? 109  LEU A CD1   1 
ATOM   599   C  CD2   . LEU A  1 109 ? -16.345 -17.065 62.288  1.00 47.03  ? 109  LEU A CD2   1 
ATOM   600   N  N     . CYS A  1 110 ? -17.606 -22.231 63.190  1.00 50.64  ? 110  CYS A N     1 
ATOM   601   C  CA    . CYS A  1 110 ? -18.528 -23.292 63.607  1.00 50.40  ? 110  CYS A CA    1 
ATOM   602   C  C     . CYS A  1 110 ? -18.332 -23.639 65.083  1.00 50.51  ? 110  CYS A C     1 
ATOM   603   O  O     . CYS A  1 110 ? -19.293 -23.837 65.809  1.00 50.47  ? 110  CYS A O     1 
ATOM   604   C  CB    . CYS A  1 110 ? -18.405 -24.509 62.693  1.00 50.13  ? 110  CYS A CB    1 
ATOM   605   S  SG    . CYS A  1 110 ? -18.961 -24.173 60.962  1.00 50.99  ? 110  CYS A SG    1 
ATOM   606   N  N     . ALA A  1 111 ? -17.089 -23.668 65.544  1.00 50.87  ? 111  ALA A N     1 
ATOM   607   C  CA    . ALA A  1 111 ? -16.839 -23.910 66.957  1.00 51.17  ? 111  ALA A CA    1 
ATOM   608   C  C     . ALA A  1 111 ? -17.453 -22.785 67.816  1.00 51.90  ? 111  ALA A C     1 
ATOM   609   O  O     . ALA A  1 111 ? -18.235 -23.041 68.747  1.00 52.29  ? 111  ALA A O     1 
ATOM   610   C  CB    . ALA A  1 111 ? -15.379 -24.049 67.201  1.00 50.80  ? 111  ALA A CB    1 
ATOM   611   N  N     . ILE A  1 112 ? -17.128 -21.541 67.472  1.00 52.04  ? 112  ILE A N     1 
ATOM   612   C  CA    . ILE A  1 112 ? -17.694 -20.373 68.146  1.00 51.78  ? 112  ILE A CA    1 
ATOM   613   C  C     . ILE A  1 112 ? -19.233 -20.370 68.114  1.00 52.09  ? 112  ILE A C     1 
ATOM   614   O  O     . ILE A  1 112 ? -19.847 -20.024 69.097  1.00 52.04  ? 112  ILE A O     1 
ATOM   615   C  CB    . ILE A  1 112 ? -17.110 -19.056 67.563  1.00 51.53  ? 112  ILE A CB    1 
ATOM   616   C  CG1   . ILE A  1 112 ? -15.626 -18.927 67.911  1.00 50.97  ? 112  ILE A CG1   1 
ATOM   617   C  CG2   . ILE A  1 112 ? -17.887 -17.848 68.035  1.00 50.68  ? 112  ILE A CG2   1 
ATOM   618   C  CD1   . ILE A  1 112 ? -14.854 -18.070 66.927  1.00 49.74  ? 112  ILE A CD1   1 
ATOM   619   N  N     . HIS A  1 113 ? -19.847 -20.760 66.997  1.00 52.70  ? 113  HIS A N     1 
ATOM   620   C  CA    . HIS A  1 113 ? -21.310 -20.815 66.888  1.00 53.69  ? 113  HIS A CA    1 
ATOM   621   C  C     . HIS A  1 113 ? -21.904 -21.717 67.959  1.00 54.89  ? 113  HIS A C     1 
ATOM   622   O  O     . HIS A  1 113 ? -23.051 -21.538 68.370  1.00 55.70  ? 113  HIS A O     1 
ATOM   623   C  CB    . HIS A  1 113 ? -21.702 -21.377 65.541  1.00 53.42  ? 113  HIS A CB    1 
ATOM   624   C  CG    . HIS A  1 113 ? -23.172 -21.344 65.257  1.00 53.83  ? 113  HIS A CG    1 
ATOM   625   N  ND1   . HIS A  1 113 ? -23.865 -20.171 65.040  1.00 54.37  ? 113  HIS A ND1   1 
ATOM   626   C  CD2   . HIS A  1 113 ? -24.069 -22.343 65.088  1.00 53.49  ? 113  HIS A CD2   1 
ATOM   627   C  CE1   . HIS A  1 113 ? -25.126 -20.447 64.762  1.00 53.38  ? 113  HIS A CE1   1 
ATOM   628   N  NE2   . HIS A  1 113 ? -25.275 -21.759 64.778  1.00 53.24  ? 113  HIS A NE2   1 
ATOM   629   N  N     . ALA A  1 114 ? -21.111 -22.683 68.414  1.00 55.58  ? 114  ALA A N     1 
ATOM   630   C  CA    . ALA A  1 114 ? -21.569 -23.645 69.395  1.00 55.99  ? 114  ALA A CA    1 
ATOM   631   C  C     . ALA A  1 114 ? -21.030 -23.319 70.772  1.00 56.64  ? 114  ALA A C     1 
ATOM   632   O  O     . ALA A  1 114 ? -20.881 -24.219 71.605  1.00 57.14  ? 114  ALA A O     1 
ATOM   633   C  CB    . ALA A  1 114 ? -21.139 -25.036 68.985  1.00 56.07  ? 114  ALA A CB    1 
ATOM   634   N  N     . LYS A  1 115 ? -20.729 -22.039 71.009  1.00 56.91  ? 115  LYS A N     1 
ATOM   635   C  CA    . LYS A  1 115 ? -20.223 -21.559 72.304  1.00 57.17  ? 115  LYS A CA    1 
ATOM   636   C  C     . LYS A  1 115 ? -18.936 -22.248 72.739  1.00 56.83  ? 115  LYS A C     1 
ATOM   637   O  O     . LYS A  1 115 ? -18.639 -22.324 73.926  1.00 57.17  ? 115  LYS A O     1 
ATOM   638   C  CB    . LYS A  1 115 ? -21.278 -21.687 73.401  1.00 57.36  ? 115  LYS A CB    1 
ATOM   639   C  CG    . LYS A  1 115 ? -22.568 -20.927 73.104  1.00 60.41  ? 115  LYS A CG    1 
ATOM   640   C  CD    . LYS A  1 115 ? -23.820 -21.758 73.474  1.00 65.72  ? 115  LYS A CD    1 
ATOM   641   C  CE    . LYS A  1 115 ? -23.771 -23.215 72.890  1.00 67.01  ? 115  LYS A CE    1 
ATOM   642   N  NZ    . LYS A  1 115 ? -25.125 -23.825 72.656  1.00 66.88  ? 115  LYS A NZ    1 
ATOM   643   N  N     . ARG A  1 116 ? -18.160 -22.743 71.783  1.00 56.45  ? 116  ARG A N     1 
ATOM   644   C  CA    . ARG A  1 116 ? -16.877 -23.335 72.120  1.00 56.06  ? 116  ARG A CA    1 
ATOM   645   C  C     . ARG A  1 116 ? -15.719 -22.496 71.606  1.00 55.79  ? 116  ARG A C     1 
ATOM   646   O  O     . ARG A  1 116 ? -15.899 -21.582 70.815  1.00 56.19  ? 116  ARG A O     1 
ATOM   647   C  CB    . ARG A  1 116 ? -16.772 -24.759 71.575  1.00 56.33  ? 116  ARG A CB    1 
ATOM   648   C  CG    . ARG A  1 116 ? -17.590 -25.783 72.315  1.00 55.58  ? 116  ARG A CG    1 
ATOM   649   C  CD    . ARG A  1 116 ? -17.405 -27.169 71.709  1.00 55.72  ? 116  ARG A CD    1 
ATOM   650   N  NE    . ARG A  1 116 ? -18.196 -27.389 70.495  1.00 54.61  ? 116  ARG A NE    1 
ATOM   651   C  CZ    . ARG A  1 116 ? -17.692 -27.392 69.262  1.00 54.64  ? 116  ARG A CZ    1 
ATOM   652   N  NH1   . ARG A  1 116 ? -16.402 -27.185 69.075  1.00 53.45  ? 116  ARG A NH1   1 
ATOM   653   N  NH2   . ARG A  1 116 ? -18.477 -27.616 68.208  1.00 55.70  ? 116  ARG A NH2   1 
ATOM   654   N  N     . VAL A  1 117 ? -14.526 -22.830 72.051  1.00 55.15  ? 117  VAL A N     1 
ATOM   655   C  CA    . VAL A  1 117 ? -13.322 -22.146 71.632  1.00 55.08  ? 117  VAL A CA    1 
ATOM   656   C  C     . VAL A  1 117 ? -12.388 -23.189 71.002  1.00 55.22  ? 117  VAL A C     1 
ATOM   657   O  O     . VAL A  1 117 ? -11.277 -22.885 70.566  1.00 55.56  ? 117  VAL A O     1 
ATOM   658   C  CB    . VAL A  1 117 ? -12.667 -21.468 72.873  1.00 54.86  ? 117  VAL A CB    1 
ATOM   659   C  CG1   . VAL A  1 117 ? -11.190 -21.241 72.677  1.00 55.59  ? 117  VAL A CG1   1 
ATOM   660   C  CG2   . VAL A  1 117 ? -13.369 -20.156 73.186  1.00 54.69  ? 117  VAL A CG2   1 
ATOM   661   N  N     . THR A  1 118 ? -12.848 -24.435 70.966  1.00 55.02  ? 118  THR A N     1 
ATOM   662   C  CA    . THR A  1 118 ? -12.005 -25.550 70.581  1.00 54.09  ? 118  THR A CA    1 
ATOM   663   C  C     . THR A  1 118 ? -12.561 -26.153 69.305  1.00 53.89  ? 118  THR A C     1 
ATOM   664   O  O     . THR A  1 118 ? -13.698 -26.617 69.289  1.00 53.79  ? 118  THR A O     1 
ATOM   665   C  CB    . THR A  1 118 ? -12.025 -26.633 71.679  1.00 54.22  ? 118  THR A CB    1 
ATOM   666   O  OG1   . THR A  1 118 ? -11.760 -26.037 72.964  1.00 53.63  ? 118  THR A OG1   1 
ATOM   667   C  CG2   . THR A  1 118 ? -11.019 -27.743 71.369  1.00 53.55  ? 118  THR A CG2   1 
ATOM   668   N  N     . ILE A  1 119 ? -11.772 -26.146 68.234  1.00 53.37  ? 119  ILE A N     1 
ATOM   669   C  CA    . ILE A  1 119 ? -12.208 -26.806 66.999  1.00 52.80  ? 119  ILE A CA    1 
ATOM   670   C  C     . ILE A  1 119 ? -12.175 -28.328 67.114  1.00 52.61  ? 119  ILE A C     1 
ATOM   671   O  O     . ILE A  1 119 ? -11.280 -28.916 67.732  1.00 51.94  ? 119  ILE A O     1 
ATOM   672   C  CB    . ILE A  1 119 ? -11.448 -26.328 65.738  1.00 52.42  ? 119  ILE A CB    1 
ATOM   673   C  CG1   . ILE A  1 119 ? -9.973  -26.688 65.823  1.00 51.02  ? 119  ILE A CG1   1 
ATOM   674   C  CG2   . ILE A  1 119 ? -11.642 -24.842 65.562  1.00 52.78  ? 119  ILE A CG2   1 
ATOM   675   C  CD1   . ILE A  1 119 ? -9.298  -26.734 64.507  1.00 50.43  ? 119  ILE A CD1   1 
ATOM   676   N  N     . MET A  1 120 ? -13.173 -28.939 66.494  1.00 52.93  ? 120  MET A N     1 
ATOM   677   C  CA    . MET A  1 120 ? -13.455 -30.365 66.618  1.00 53.86  ? 120  MET A CA    1 
ATOM   678   C  C     . MET A  1 120 ? -13.866 -30.890 65.254  1.00 52.53  ? 120  MET A C     1 
ATOM   679   O  O     . MET A  1 120 ? -14.406 -30.139 64.438  1.00 52.96  ? 120  MET A O     1 
ATOM   680   C  CB    . MET A  1 120 ? -14.582 -30.599 67.641  1.00 53.02  ? 120  MET A CB    1 
ATOM   681   C  CG    . MET A  1 120 ? -14.151 -30.392 69.082  1.00 54.77  ? 120  MET A CG    1 
ATOM   682   S  SD    . MET A  1 120 ? -15.513 -30.529 70.272  1.00 58.26  ? 120  MET A SD    1 
ATOM   683   C  CE    . MET A  1 120 ? -15.505 -32.301 70.644  1.00 56.59  ? 120  MET A CE    1 
ATOM   684   N  N     . PRO A  1 121 ? -13.617 -32.179 64.997  1.00 51.98  ? 121  PRO A N     1 
ATOM   685   C  CA    . PRO A  1 121 ? -14.051 -32.787 63.742  1.00 51.31  ? 121  PRO A CA    1 
ATOM   686   C  C     . PRO A  1 121 ? -15.471 -32.397 63.282  1.00 51.15  ? 121  PRO A C     1 
ATOM   687   O  O     . PRO A  1 121 ? -15.678 -32.152 62.085  1.00 51.31  ? 121  PRO A O     1 
ATOM   688   C  CB    . PRO A  1 121 ? -13.954 -34.285 64.040  1.00 51.32  ? 121  PRO A CB    1 
ATOM   689   C  CG    . PRO A  1 121 ? -12.798 -34.380 65.009  1.00 51.64  ? 121  PRO A CG    1 
ATOM   690   C  CD    . PRO A  1 121 ? -12.881 -33.135 65.859  1.00 51.98  ? 121  PRO A CD    1 
ATOM   691   N  N     . LYS A  1 122 ? -16.442 -32.331 64.186  1.00 50.31  ? 122  LYS A N     1 
ATOM   692   C  CA    . LYS A  1 122 ? -17.787 -32.000 63.735  1.00 50.64  ? 122  LYS A CA    1 
ATOM   693   C  C     . LYS A  1 122 ? -17.897 -30.550 63.236  1.00 50.25  ? 122  LYS A C     1 
ATOM   694   O  O     . LYS A  1 122 ? -18.820 -30.213 62.467  1.00 49.95  ? 122  LYS A O     1 
ATOM   695   C  CB    . LYS A  1 122 ? -18.861 -32.303 64.782  1.00 50.67  ? 122  LYS A CB    1 
ATOM   696   C  CG    . LYS A  1 122 ? -18.647 -31.616 66.095  1.00 53.12  ? 122  LYS A CG    1 
ATOM   697   C  CD    . LYS A  1 122 ? -19.936 -31.494 66.836  1.00 57.34  ? 122  LYS A CD    1 
ATOM   698   C  CE    . LYS A  1 122 ? -19.698 -31.542 68.335  1.00 61.04  ? 122  LYS A CE    1 
ATOM   699   N  NZ    . LYS A  1 122 ? -19.134 -32.864 68.721  1.00 64.57  ? 122  LYS A NZ    1 
ATOM   700   N  N     . ASP A  1 123 ? -16.962 -29.702 63.673  1.00 49.51  ? 123  ASP A N     1 
ATOM   701   C  CA    . ASP A  1 123 ? -16.905 -28.332 63.171  1.00 48.69  ? 123  ASP A CA    1 
ATOM   702   C  C     . ASP A  1 123 ? -16.498 -28.345 61.693  1.00 48.48  ? 123  ASP A C     1 
ATOM   703   O  O     . ASP A  1 123 ? -17.183 -27.756 60.860  1.00 48.34  ? 123  ASP A O     1 
ATOM   704   C  CB    . ASP A  1 123 ? -15.958 -27.474 64.004  1.00 48.42  ? 123  ASP A CB    1 
ATOM   705   C  CG    . ASP A  1 123 ? -16.419 -27.304 65.455  1.00 47.44  ? 123  ASP A CG    1 
ATOM   706   O  OD1   . ASP A  1 123 ? -17.624 -27.035 65.697  1.00 44.73  ? 123  ASP A OD1   1 
ATOM   707   O  OD2   . ASP A  1 123 ? -15.552 -27.416 66.349  1.00 44.48  ? 123  ASP A OD2   1 
ATOM   708   N  N     . ILE A  1 124 ? -15.417 -29.059 61.375  1.00 48.25  ? 124  ILE A N     1 
ATOM   709   C  CA    . ILE A  1 124 ? -14.926 -29.171 59.999  1.00 48.21  ? 124  ILE A CA    1 
ATOM   710   C  C     . ILE A  1 124 ? -15.973 -29.810 59.118  1.00 48.89  ? 124  ILE A C     1 
ATOM   711   O  O     . ILE A  1 124 ? -16.189 -29.397 57.996  1.00 48.99  ? 124  ILE A O     1 
ATOM   712   C  CB    . ILE A  1 124 ? -13.680 -30.062 59.910  1.00 48.15  ? 124  ILE A CB    1 
ATOM   713   C  CG1   . ILE A  1 124 ? -12.517 -29.500 60.757  1.00 47.76  ? 124  ILE A CG1   1 
ATOM   714   C  CG2   . ILE A  1 124 ? -13.289 -30.270 58.458  1.00 47.41  ? 124  ILE A CG2   1 
ATOM   715   C  CD1   . ILE A  1 124 ? -11.120 -30.092 60.399  1.00 47.83  ? 124  ILE A CD1   1 
ATOM   716   N  N     . GLN A  1 125 ? -16.623 -30.837 59.650  1.00 49.68  ? 125  GLN A N     1 
ATOM   717   C  CA    . GLN A  1 125 ? -17.668 -31.542 58.941  1.00 49.75  ? 125  GLN A CA    1 
ATOM   718   C  C     . GLN A  1 125 ? -18.797 -30.584 58.627  1.00 49.53  ? 125  GLN A C     1 
ATOM   719   O  O     . GLN A  1 125 ? -19.314 -30.563 57.522  1.00 49.98  ? 125  GLN A O     1 
ATOM   720   C  CB    . GLN A  1 125 ? -18.135 -32.764 59.763  1.00 49.73  ? 125  GLN A CB    1 
ATOM   721   C  CG    . GLN A  1 125 ? -17.309 -34.045 59.502  1.00 50.58  ? 125  GLN A CG    1 
ATOM   722   C  CD    . GLN A  1 125 ? -17.099 -34.905 60.763  1.00 53.61  ? 125  GLN A CD    1 
ATOM   723   O  OE1   . GLN A  1 125 ? -18.000 -35.040 61.611  1.00 52.23  ? 125  GLN A OE1   1 
ATOM   724   N  NE2   . GLN A  1 125 ? -15.892 -35.485 60.893  1.00 51.75  ? 125  GLN A NE2   1 
ATOM   725   N  N     . LEU A  1 126 ? -19.174 -29.758 59.586  1.00 49.91  ? 126  LEU A N     1 
ATOM   726   C  CA    . LEU A  1 126 ? -20.249 -28.822 59.325  1.00 49.95  ? 126  LEU A CA    1 
ATOM   727   C  C     . LEU A  1 126 ? -19.839 -27.845 58.222  1.00 50.50  ? 126  LEU A C     1 
ATOM   728   O  O     . LEU A  1 126 ? -20.590 -27.640 57.259  1.00 51.11  ? 126  LEU A O     1 
ATOM   729   C  CB    . LEU A  1 126 ? -20.666 -28.099 60.590  1.00 49.50  ? 126  LEU A CB    1 
ATOM   730   C  CG    . LEU A  1 126 ? -21.817 -27.108 60.370  1.00 51.01  ? 126  LEU A CG    1 
ATOM   731   C  CD1   . LEU A  1 126 ? -23.148 -27.770 60.006  1.00 49.24  ? 126  LEU A CD1   1 
ATOM   732   C  CD2   . LEU A  1 126 ? -21.968 -26.246 61.597  1.00 51.23  ? 126  LEU A CD2   1 
ATOM   733   N  N     . ALA A  1 127 ? -18.640 -27.270 58.348  1.00 50.44  ? 127  ALA A N     1 
ATOM   734   C  CA    . ALA A  1 127 ? -18.105 -26.348 57.342  1.00 50.37  ? 127  ALA A CA    1 
ATOM   735   C  C     . ALA A  1 127 ? -18.133 -26.964 55.948  1.00 50.74  ? 127  ALA A C     1 
ATOM   736   O  O     . ALA A  1 127 ? -18.568 -26.323 54.990  1.00 50.41  ? 127  ALA A O     1 
ATOM   737   C  CB    . ALA A  1 127 ? -16.685 -25.906 57.702  1.00 49.89  ? 127  ALA A CB    1 
ATOM   738   N  N     . ARG A  1 128 ? -17.690 -28.213 55.844  1.00 51.07  ? 128  ARG A N     1 
ATOM   739   C  CA    . ARG A  1 128 ? -17.554 -28.845 54.553  1.00 51.89  ? 128  ARG A CA    1 
ATOM   740   C  C     . ARG A  1 128 ? -18.899 -29.142 53.960  1.00 52.74  ? 128  ARG A C     1 
ATOM   741   O  O     . ARG A  1 128 ? -19.074 -29.079 52.737  1.00 52.10  ? 128  ARG A O     1 
ATOM   742   C  CB    . ARG A  1 128 ? -16.695 -30.098 54.634  1.00 51.80  ? 128  ARG A CB    1 
ATOM   743   C  CG    . ARG A  1 128 ? -15.214 -29.774 54.816  1.00 52.48  ? 128  ARG A CG    1 
ATOM   744   C  CD    . ARG A  1 128 ? -14.319 -30.973 54.626  1.00 53.49  ? 128  ARG A CD    1 
ATOM   745   N  NE    . ARG A  1 128 ? -14.218 -31.360 53.221  1.00 54.86  ? 128  ARG A NE    1 
ATOM   746   C  CZ    . ARG A  1 128 ? -14.430 -32.592 52.763  1.00 54.75  ? 128  ARG A CZ    1 
ATOM   747   N  NH1   . ARG A  1 128 ? -14.736 -33.575 53.602  1.00 54.69  ? 128  ARG A NH1   1 
ATOM   748   N  NH2   . ARG A  1 128 ? -14.310 -32.846 51.467  1.00 53.58  ? 128  ARG A NH2   1 
ATOM   749   N  N     . ARG A  1 129 ? -19.854 -29.451 54.830  1.00 54.39  ? 129  ARG A N     1 
ATOM   750   C  CA    . ARG A  1 129 ? -21.196 -29.779 54.381  1.00 56.51  ? 129  ARG A CA    1 
ATOM   751   C  C     . ARG A  1 129 ? -21.827 -28.546 53.760  1.00 57.14  ? 129  ARG A C     1 
ATOM   752   O  O     . ARG A  1 129 ? -22.255 -28.570 52.623  1.00 57.28  ? 129  ARG A O     1 
ATOM   753   C  CB    . ARG A  1 129 ? -22.029 -30.329 55.535  1.00 57.21  ? 129  ARG A CB    1 
ATOM   754   C  CG    . ARG A  1 129 ? -23.366 -30.933 55.120  1.00 60.58  ? 129  ARG A CG    1 
ATOM   755   C  CD    . ARG A  1 129 ? -23.942 -31.801 56.244  1.00 68.97  ? 129  ARG A CD    1 
ATOM   756   N  NE    . ARG A  1 129 ? -23.922 -33.228 55.918  1.00 74.57  ? 129  ARG A NE    1 
ATOM   757   C  CZ    . ARG A  1 129 ? -23.139 -34.140 56.497  1.00 78.70  ? 129  ARG A CZ    1 
ATOM   758   N  NH1   . ARG A  1 129 ? -22.299 -33.799 57.485  1.00 80.24  ? 129  ARG A NH1   1 
ATOM   759   N  NH2   . ARG A  1 129 ? -23.204 -35.411 56.085  1.00 79.77  ? 129  ARG A NH2   1 
ATOM   760   N  N     . ILE A  1 130 ? -21.822 -27.449 54.501  1.00 58.52  ? 130  ILE A N     1 
ATOM   761   C  CA    . ILE A  1 130 ? -22.386 -26.194 54.039  1.00 59.52  ? 130  ILE A CA    1 
ATOM   762   C  C     . ILE A  1 130 ? -21.669 -25.627 52.816  1.00 60.44  ? 130  ILE A C     1 
ATOM   763   O  O     . ILE A  1 130 ? -22.307 -25.017 51.976  1.00 60.77  ? 130  ILE A O     1 
ATOM   764   C  CB    . ILE A  1 130 ? -22.472 -25.190 55.196  1.00 59.60  ? 130  ILE A CB    1 
ATOM   765   C  CG1   . ILE A  1 130 ? -23.404 -25.769 56.270  1.00 60.19  ? 130  ILE A CG1   1 
ATOM   766   C  CG2   . ILE A  1 130 ? -22.959 -23.836 54.716  1.00 58.24  ? 130  ILE A CG2   1 
ATOM   767   C  CD1   . ILE A  1 130 ? -23.434 -24.994 57.561  1.00 62.82  ? 130  ILE A CD1   1 
ATOM   768   N  N     . ARG A  1 131 ? -20.366 -25.858 52.699  1.00 61.85  ? 131  ARG A N     1 
ATOM   769   C  CA    . ARG A  1 131 ? -19.617 -25.465 51.498  1.00 63.33  ? 131  ARG A CA    1 
ATOM   770   C  C     . ARG A  1 131 ? -20.005 -26.227 50.225  1.00 65.33  ? 131  ARG A C     1 
ATOM   771   O  O     . ARG A  1 131 ? -19.606 -25.836 49.130  1.00 65.39  ? 131  ARG A O     1 
ATOM   772   C  CB    . ARG A  1 131 ? -18.123 -25.652 51.719  1.00 62.43  ? 131  ARG A CB    1 
ATOM   773   C  CG    . ARG A  1 131 ? -17.397 -24.445 52.191  1.00 60.55  ? 131  ARG A CG    1 
ATOM   774   C  CD    . ARG A  1 131 ? -16.263 -24.899 53.085  1.00 59.78  ? 131  ARG A CD    1 
ATOM   775   N  NE    . ARG A  1 131 ? -15.235 -23.891 53.331  1.00 58.79  ? 131  ARG A NE    1 
ATOM   776   C  CZ    . ARG A  1 131 ? -14.024 -23.912 52.787  1.00 58.64  ? 131  ARG A CZ    1 
ATOM   777   N  NH1   . ARG A  1 131 ? -13.685 -24.886 51.965  1.00 58.87  ? 131  ARG A NH1   1 
ATOM   778   N  NH2   . ARG A  1 131 ? -13.143 -22.971 53.077  1.00 59.66  ? 131  ARG A NH2   1 
ATOM   779   N  N     . GLY A  1 132 ? -20.754 -27.319 50.358  1.00 67.75  ? 132  GLY A N     1 
ATOM   780   C  CA    . GLY A  1 132 ? -21.058 -28.169 49.209  1.00 71.07  ? 132  GLY A CA    1 
ATOM   781   C  C     . GLY A  1 132 ? -19.890 -29.067 48.827  1.00 73.89  ? 132  GLY A C     1 
ATOM   782   O  O     . GLY A  1 132 ? -19.834 -29.579 47.712  1.00 74.49  ? 132  GLY A O     1 
ATOM   783   N  N     . GLU A  1 133 ? -18.948 -29.253 49.752  1.00 76.55  ? 133  GLU A N     1 
ATOM   784   C  CA    . GLU A  1 133 ? -17.851 -30.213 49.580  1.00 79.06  ? 133  GLU A CA    1 
ATOM   785   C  C     . GLU A  1 133 ? -18.310 -31.600 50.044  1.00 81.29  ? 133  GLU A C     1 
ATOM   786   O  O     . GLU A  1 133 ? -18.943 -31.749 51.100  1.00 81.72  ? 133  GLU A O     1 
ATOM   787   C  CB    . GLU A  1 133 ? -16.611 -29.789 50.370  1.00 78.35  ? 133  GLU A CB    1 
ATOM   788   C  CG    . GLU A  1 133 ? -15.968 -28.518 49.864  1.00 77.73  ? 133  GLU A CG    1 
ATOM   789   C  CD    . GLU A  1 133 ? -14.725 -28.118 50.643  1.00 75.59  ? 133  GLU A CD    1 
ATOM   790   O  OE1   . GLU A  1 133 ? -14.230 -28.931 51.454  1.00 74.09  ? 133  GLU A OE1   1 
ATOM   791   O  OE2   . GLU A  1 133 ? -14.245 -26.980 50.433  1.00 74.39  ? 133  GLU A OE2   1 
ATOM   792   N  N     . ARG A  1 134 ? -17.995 -32.615 49.250  1.00 83.59  ? 134  ARG A N     1 
ATOM   793   C  CA    . ARG A  1 134 ? -18.484 -33.961 49.519  1.00 85.76  ? 134  ARG A CA    1 
ATOM   794   C  C     . ARG A  1 134 ? -17.353 -34.952 49.315  1.00 86.61  ? 134  ARG A C     1 
ATOM   795   O  O     . ARG A  1 134 ? -16.285 -34.584 48.806  1.00 87.18  ? 134  ARG A O     1 
ATOM   796   C  CB    . ARG A  1 134 ? -19.700 -34.270 48.640  1.00 86.09  ? 134  ARG A CB    1 
ATOM   797   C  CG    . ARG A  1 134 ? -20.947 -33.446 49.021  1.00 88.54  ? 134  ARG A CG    1 
ATOM   798   C  CD    . ARG A  1 134 ? -21.494 -32.668 47.814  1.00 92.11  ? 134  ARG A CD    1 
ATOM   799   N  NE    . ARG A  1 134 ? -22.834 -32.115 48.044  1.00 94.48  ? 134  ARG A NE    1 
ATOM   800   C  CZ    . ARG A  1 134 ? -23.709 -31.814 47.079  1.00 95.89  ? 134  ARG A CZ    1 
ATOM   801   N  NH1   . ARG A  1 134 ? -23.405 -32.017 45.793  1.00 96.01  ? 134  ARG A NH1   1 
ATOM   802   N  NH2   . ARG A  1 134 ? -24.903 -31.317 47.399  1.00 95.91  ? 134  ARG A NH2   1 
ATOM   803   N  N     . ALA A  1 135 ? -17.580 -36.198 49.730  1.00 87.56  ? 135  ALA A N     1 
ATOM   804   C  CA    . ALA A  1 135 ? -16.501 -37.199 49.846  1.00 88.52  ? 135  ALA A CA    1 
ATOM   805   C  C     . ALA A  1 135 ? -15.436 -36.783 50.893  1.00 88.80  ? 135  ALA A C     1 
ATOM   806   O  O     . ALA A  1 135 ? -14.433 -37.480 51.090  1.00 89.01  ? 135  ALA A O     1 
ATOM   807   C  CB    . ALA A  1 135 ? -15.851 -37.502 48.465  1.00 88.47  ? 135  ALA A CB    1 
ATOM   808   O  OXT   . ALA A  1 135 ? -15.556 -35.750 51.579  1.00 88.86  ? 135  ALA A OXT   1 
ATOM   809   N  N     . LYS B  2 20  ? 11.189  -47.286 44.287  1.00 59.31  ? 20   LYS B N     1 
ATOM   810   C  CA    . LYS B  2 20  ? 10.759  -47.746 45.655  1.00 59.10  ? 20   LYS B CA    1 
ATOM   811   C  C     . LYS B  2 20  ? 9.301   -47.372 46.065  1.00 58.42  ? 20   LYS B C     1 
ATOM   812   O  O     . LYS B  2 20  ? 8.764   -46.323 45.676  1.00 58.74  ? 20   LYS B O     1 
ATOM   813   C  CB    . LYS B  2 20  ? 11.777  -47.316 46.716  1.00 58.81  ? 20   LYS B CB    1 
ATOM   814   C  CG    . LYS B  2 20  ? 11.139  -47.076 48.077  1.00 61.50  ? 20   LYS B CG    1 
ATOM   815   C  CD    . LYS B  2 20  ? 12.014  -47.470 49.261  1.00 62.95  ? 20   LYS B CD    1 
ATOM   816   C  CE    . LYS B  2 20  ? 11.317  -47.071 50.566  1.00 64.11  ? 20   LYS B CE    1 
ATOM   817   N  NZ    . LYS B  2 20  ? 11.871  -47.766 51.762  1.00 65.62  ? 20   LYS B NZ    1 
ATOM   818   N  N     . VAL B  2 21  ? 8.669   -48.233 46.856  1.00 57.07  ? 21   VAL B N     1 
ATOM   819   C  CA    . VAL B  2 21  ? 7.237   -48.093 47.133  1.00 56.01  ? 21   VAL B CA    1 
ATOM   820   C  C     . VAL B  2 21  ? 6.888   -46.897 48.052  1.00 55.48  ? 21   VAL B C     1 
ATOM   821   O  O     . VAL B  2 21  ? 7.408   -46.772 49.167  1.00 55.53  ? 21   VAL B O     1 
ATOM   822   C  CB    . VAL B  2 21  ? 6.630   -49.429 47.630  1.00 55.35  ? 21   VAL B CB    1 
ATOM   823   C  CG1   . VAL B  2 21  ? 7.434   -50.009 48.796  1.00 56.34  ? 21   VAL B CG1   1 
ATOM   824   C  CG2   . VAL B  2 21  ? 5.185   -49.262 48.023  1.00 56.22  ? 21   VAL B CG2   1 
ATOM   825   N  N     . LEU B  2 22  ? 6.006   -46.023 47.557  1.00 54.60  ? 22   LEU B N     1 
ATOM   826   C  CA    . LEU B  2 22  ? 5.490   -44.882 48.316  1.00 53.05  ? 22   LEU B CA    1 
ATOM   827   C  C     . LEU B  2 22  ? 4.276   -45.265 49.132  1.00 52.30  ? 22   LEU B C     1 
ATOM   828   O  O     . LEU B  2 22  ? 3.296   -45.714 48.585  1.00 52.24  ? 22   LEU B O     1 
ATOM   829   C  CB    . LEU B  2 22  ? 5.115   -43.742 47.366  1.00 53.17  ? 22   LEU B CB    1 
ATOM   830   C  CG    . LEU B  2 22  ? 6.274   -43.148 46.557  1.00 53.00  ? 22   LEU B CG    1 
ATOM   831   C  CD1   . LEU B  2 22  ? 5.771   -42.114 45.570  1.00 50.81  ? 22   LEU B CD1   1 
ATOM   832   C  CD2   . LEU B  2 22  ? 7.358   -42.589 47.477  1.00 51.76  ? 22   LEU B CD2   1 
ATOM   833   N  N     . ARG B  2 23  ? 4.351   -45.076 50.443  1.00 52.00  ? 23   ARG B N     1 
ATOM   834   C  CA    . ARG B  2 23  ? 3.291   -45.472 51.367  1.00 52.07  ? 23   ARG B CA    1 
ATOM   835   C  C     . ARG B  2 23  ? 3.138   -44.487 52.500  1.00 52.57  ? 23   ARG B C     1 
ATOM   836   O  O     . ARG B  2 23  ? 4.121   -43.944 53.003  1.00 52.83  ? 23   ARG B O     1 
ATOM   837   C  CB    . ARG B  2 23  ? 3.621   -46.784 52.056  1.00 51.47  ? 23   ARG B CB    1 
ATOM   838   C  CG    . ARG B  2 23  ? 3.824   -47.964 51.151  1.00 51.32  ? 23   ARG B CG    1 
ATOM   839   C  CD    . ARG B  2 23  ? 4.630   -49.015 51.889  1.00 45.75  ? 23   ARG B CD    1 
ATOM   840   N  NE    . ARG B  2 23  ? 3.914   -49.400 53.090  1.00 41.51  ? 23   ARG B NE    1 
ATOM   841   C  CZ    . ARG B  2 23  ? 4.507   -49.870 54.183  1.00 40.58  ? 23   ARG B CZ    1 
ATOM   842   N  NH1   . ARG B  2 23  ? 5.834   -50.022 54.222  1.00 36.35  ? 23   ARG B NH1   1 
ATOM   843   N  NH2   . ARG B  2 23  ? 3.759   -50.188 55.230  1.00 38.12  ? 23   ARG B NH2   1 
ATOM   844   N  N     . ASP B  2 24  ? 1.901   -44.320 52.944  1.00 52.74  ? 24   ASP B N     1 
ATOM   845   C  CA    . ASP B  2 24  ? 1.610   -43.597 54.160  1.00 53.65  ? 24   ASP B CA    1 
ATOM   846   C  C     . ASP B  2 24  ? 2.142   -42.166 54.295  1.00 53.70  ? 24   ASP B C     1 
ATOM   847   O  O     . ASP B  2 24  ? 2.326   -41.680 55.418  1.00 53.69  ? 24   ASP B O     1 
ATOM   848   C  CB    . ASP B  2 24  ? 2.058   -44.394 55.359  1.00 53.54  ? 24   ASP B CB    1 
ATOM   849   C  CG    . ASP B  2 24  ? 1.115   -44.228 56.499  1.00 57.01  ? 24   ASP B CG    1 
ATOM   850   O  OD1   . ASP B  2 24  ? -0.108  -44.078 56.219  1.00 60.65  ? 24   ASP B OD1   1 
ATOM   851   O  OD2   . ASP B  2 24  ? 1.574   -44.225 57.660  1.00 60.22  ? 24   ASP B OD2   1 
ATOM   852   N  N     . ASN B  2 25  ? 2.366   -41.484 53.170  1.00 53.39  ? 25   ASN B N     1 
ATOM   853   C  CA    . ASN B  2 25  ? 2.956   -40.152 53.217  1.00 52.79  ? 25   ASN B CA    1 
ATOM   854   C  C     . ASN B  2 25  ? 2.086   -39.019 53.814  1.00 52.75  ? 25   ASN B C     1 
ATOM   855   O  O     . ASN B  2 25  ? 2.609   -37.975 54.180  1.00 52.85  ? 25   ASN B O     1 
ATOM   856   C  CB    . ASN B  2 25  ? 3.500   -39.794 51.857  1.00 52.82  ? 25   ASN B CB    1 
ATOM   857   C  CG    . ASN B  2 25  ? 4.695   -40.643 51.483  1.00 53.45  ? 25   ASN B CG    1 
ATOM   858   O  OD1   . ASN B  2 25  ? 5.742   -40.568 52.136  1.00 54.25  ? 25   ASN B OD1   1 
ATOM   859   N  ND2   . ASN B  2 25  ? 4.549   -41.465 50.431  1.00 52.16  ? 25   ASN B ND2   1 
ATOM   860   N  N     . ILE B  2 26  ? 0.782   -39.250 53.955  1.00 52.78  ? 26   ILE B N     1 
ATOM   861   C  CA    . ILE B  2 26  ? -0.101  -38.318 54.616  1.00 52.98  ? 26   ILE B CA    1 
ATOM   862   C  C     . ILE B  2 26  ? 0.356   -38.027 56.056  1.00 53.89  ? 26   ILE B C     1 
ATOM   863   O  O     . ILE B  2 26  ? -0.103  -37.062 56.682  1.00 53.77  ? 26   ILE B O     1 
ATOM   864   C  CB    . ILE B  2 26  ? -1.601  -38.766 54.562  1.00 53.07  ? 26   ILE B CB    1 
ATOM   865   C  CG1   . ILE B  2 26  ? -2.525  -37.593 54.904  1.00 54.08  ? 26   ILE B CG1   1 
ATOM   866   C  CG2   . ILE B  2 26  ? -1.926  -39.913 55.551  1.00 51.19  ? 26   ILE B CG2   1 
ATOM   867   C  CD1   . ILE B  2 26  ? -2.403  -36.364 53.990  1.00 55.28  ? 26   ILE B CD1   1 
ATOM   868   N  N     . GLN B  2 27  ? 1.262   -38.852 56.574  1.00 54.31  ? 27   GLN B N     1 
ATOM   869   C  CA    . GLN B  2 27  ? 1.773   -38.662 57.940  1.00 55.26  ? 27   GLN B CA    1 
ATOM   870   C  C     . GLN B  2 27  ? 2.908   -37.640 57.965  1.00 55.45  ? 27   GLN B C     1 
ATOM   871   O  O     . GLN B  2 27  ? 3.304   -37.162 59.033  1.00 56.09  ? 27   GLN B O     1 
ATOM   872   C  CB    . GLN B  2 27  ? 2.221   -39.982 58.582  1.00 54.93  ? 27   GLN B CB    1 
ATOM   873   C  CG    . GLN B  2 27  ? 1.097   -40.998 58.793  1.00 57.35  ? 27   GLN B CG    1 
ATOM   874   C  CD    . GLN B  2 27  ? -0.039  -40.472 59.656  1.00 59.23  ? 27   GLN B CD    1 
ATOM   875   O  OE1   . GLN B  2 27  ? 0.192   -39.921 60.728  1.00 61.03  ? 27   GLN B OE1   1 
ATOM   876   N  NE2   . GLN B  2 27  ? -1.276  -40.643 59.190  1.00 59.76  ? 27   GLN B NE2   1 
ATOM   877   N  N     . GLY B  2 28  ? 3.438   -37.310 56.796  1.00 54.90  ? 28   GLY B N     1 
ATOM   878   C  CA    . GLY B  2 28  ? 4.386   -36.214 56.706  1.00 54.86  ? 28   GLY B CA    1 
ATOM   879   C  C     . GLY B  2 28  ? 3.698   -34.871 56.924  1.00 54.58  ? 28   GLY B C     1 
ATOM   880   O  O     . GLY B  2 28  ? 4.362   -33.873 57.158  1.00 55.36  ? 28   GLY B O     1 
ATOM   881   N  N     . ILE B  2 29  ? 2.370   -34.843 56.822  1.00 53.90  ? 29   ILE B N     1 
ATOM   882   C  CA    . ILE B  2 29  ? 1.580   -33.668 57.169  1.00 53.25  ? 29   ILE B CA    1 
ATOM   883   C  C     . ILE B  2 29  ? 1.400   -33.699 58.672  1.00 52.79  ? 29   ILE B C     1 
ATOM   884   O  O     . ILE B  2 29  ? 0.396   -34.187 59.173  1.00 52.74  ? 29   ILE B O     1 
ATOM   885   C  CB    . ILE B  2 29  ? 0.204   -33.681 56.465  1.00 53.24  ? 29   ILE B CB    1 
ATOM   886   C  CG1   . ILE B  2 29  ? 0.372   -33.915 54.958  1.00 54.08  ? 29   ILE B CG1   1 
ATOM   887   C  CG2   . ILE B  2 29  ? -0.570  -32.401 56.724  1.00 54.30  ? 29   ILE B CG2   1 
ATOM   888   C  CD1   . ILE B  2 29  ? 1.154   -32.859 54.227  1.00 52.50  ? 29   ILE B CD1   1 
ATOM   889   N  N     . THR B  2 30  ? 2.386   -33.183 59.393  1.00 52.60  ? 30   THR B N     1 
ATOM   890   C  CA    . THR B  2 30  ? 2.455   -33.393 60.836  1.00 52.81  ? 30   THR B CA    1 
ATOM   891   C  C     . THR B  2 30  ? 1.506   -32.589 61.704  1.00 52.78  ? 30   THR B C     1 
ATOM   892   O  O     . THR B  2 30  ? 0.921   -31.606 61.266  1.00 53.87  ? 30   THR B O     1 
ATOM   893   C  CB    . THR B  2 30  ? 3.860   -33.189 61.350  1.00 52.64  ? 30   THR B CB    1 
ATOM   894   O  OG1   . THR B  2 30  ? 4.294   -31.871 61.009  1.00 53.01  ? 30   THR B OG1   1 
ATOM   895   C  CG2   . THR B  2 30  ? 4.758   -34.199 60.710  1.00 52.08  ? 30   THR B CG2   1 
ATOM   896   N  N     . LYS B  2 31  ? 1.369   -33.018 62.950  1.00 52.47  ? 31   LYS B N     1 
ATOM   897   C  CA    . LYS B  2 31  ? 0.588   -32.307 63.944  1.00 52.55  ? 31   LYS B CA    1 
ATOM   898   C  C     . LYS B  2 31  ? 1.011   -30.817 64.094  1.00 52.35  ? 31   LYS B C     1 
ATOM   899   O  O     . LYS B  2 31  ? 0.155   -29.929 64.000  1.00 52.32  ? 31   LYS B O     1 
ATOM   900   C  CB    . LYS B  2 31  ? 0.664   -33.041 65.280  1.00 52.12  ? 31   LYS B CB    1 
ATOM   901   C  CG    . LYS B  2 31  ? 0.007   -32.328 66.400  1.00 53.84  ? 31   LYS B CG    1 
ATOM   902   C  CD    . LYS B  2 31  ? 0.364   -32.942 67.712  1.00 56.75  ? 31   LYS B CD    1 
ATOM   903   C  CE    . LYS B  2 31  ? -0.636  -32.483 68.761  1.00 61.18  ? 31   LYS B CE    1 
ATOM   904   N  NZ    . LYS B  2 31  ? -0.245  -32.937 70.136  1.00 65.17  ? 31   LYS B NZ    1 
ATOM   905   N  N     . PRO B  2 32  ? 2.308   -30.544 64.351  1.00 51.75  ? 32   PRO B N     1 
ATOM   906   C  CA    . PRO B  2 32  ? 2.711   -29.134 64.397  1.00 51.50  ? 32   PRO B CA    1 
ATOM   907   C  C     . PRO B  2 32  ? 2.383   -28.357 63.122  1.00 51.27  ? 32   PRO B C     1 
ATOM   908   O  O     . PRO B  2 32  ? 2.052   -27.177 63.217  1.00 51.54  ? 32   PRO B O     1 
ATOM   909   C  CB    . PRO B  2 32  ? 4.234   -29.172 64.648  1.00 50.95  ? 32   PRO B CB    1 
ATOM   910   C  CG    . PRO B  2 32  ? 4.646   -30.600 64.386  1.00 52.52  ? 32   PRO B CG    1 
ATOM   911   C  CD    . PRO B  2 32  ? 3.428   -31.453 64.651  1.00 51.91  ? 32   PRO B CD    1 
ATOM   912   N  N     . ALA B  2 33  ? 2.472   -28.993 61.951  1.00 50.97  ? 33   ALA B N     1 
ATOM   913   C  CA    . ALA B  2 33  ? 2.174   -28.292 60.698  1.00 50.44  ? 33   ALA B CA    1 
ATOM   914   C  C     . ALA B  2 33  ? 0.684   -28.019 60.570  1.00 50.66  ? 33   ALA B C     1 
ATOM   915   O  O     . ALA B  2 33  ? 0.305   -26.996 60.030  1.00 51.84  ? 33   ALA B O     1 
ATOM   916   C  CB    . ALA B  2 33  ? 2.680   -29.026 59.507  1.00 49.14  ? 33   ALA B CB    1 
ATOM   917   N  N     . ILE B  2 34  ? -0.158  -28.925 61.052  1.00 50.45  ? 34   ILE B N     1 
ATOM   918   C  CA    . ILE B  2 34  ? -1.602  -28.675 61.097  1.00 50.14  ? 34   ILE B CA    1 
ATOM   919   C  C     . ILE B  2 34  ? -1.942  -27.563 62.122  1.00 50.20  ? 34   ILE B C     1 
ATOM   920   O  O     . ILE B  2 34  ? -2.796  -26.729 61.876  1.00 50.10  ? 34   ILE B O     1 
ATOM   921   C  CB    . ILE B  2 34  ? -2.398  -29.989 61.367  1.00 49.68  ? 34   ILE B CB    1 
ATOM   922   C  CG1   . ILE B  2 34  ? -2.280  -30.956 60.178  1.00 49.83  ? 34   ILE B CG1   1 
ATOM   923   C  CG2   . ILE B  2 34  ? -3.859  -29.708 61.619  1.00 48.52  ? 34   ILE B CG2   1 
ATOM   924   C  CD1   . ILE B  2 34  ? -2.333  -32.465 60.551  1.00 45.77  ? 34   ILE B CD1   1 
ATOM   925   N  N     . ARG B  2 35  ? -1.272  -27.575 63.268  1.00 50.66  ? 35   ARG B N     1 
ATOM   926   C  CA    . ARG B  2 35  ? -1.384  -26.524 64.289  1.00 51.27  ? 35   ARG B CA    1 
ATOM   927   C  C     . ARG B  2 35  ? -1.065  -25.126 63.684  1.00 50.68  ? 35   ARG B C     1 
ATOM   928   O  O     . ARG B  2 35  ? -1.873  -24.196 63.782  1.00 50.91  ? 35   ARG B O     1 
ATOM   929   C  CB    . ARG B  2 35  ? -0.451  -26.874 65.445  1.00 51.39  ? 35   ARG B CB    1 
ATOM   930   C  CG    . ARG B  2 35  ? -0.402  -25.932 66.636  1.00 55.33  ? 35   ARG B CG    1 
ATOM   931   C  CD    . ARG B  2 35  ? 0.292   -26.644 67.823  1.00 61.28  ? 35   ARG B CD    1 
ATOM   932   N  NE    . ARG B  2 35  ? -0.680  -27.532 68.482  1.00 66.95  ? 35   ARG B NE    1 
ATOM   933   C  CZ    . ARG B  2 35  ? -1.203  -27.308 69.693  1.00 69.93  ? 35   ARG B CZ    1 
ATOM   934   N  NH1   . ARG B  2 35  ? -0.808  -26.259 70.425  1.00 70.98  ? 35   ARG B NH1   1 
ATOM   935   N  NH2   . ARG B  2 35  ? -2.101  -28.147 70.193  1.00 71.19  ? 35   ARG B NH2   1 
ATOM   936   N  N     . ARG B  2 36  ? 0.074   -25.016 63.008  1.00 49.27  ? 36   ARG B N     1 
ATOM   937   C  CA    . ARG B  2 36  ? 0.458   -23.799 62.334  1.00 47.78  ? 36   ARG B CA    1 
ATOM   938   C  C     . ARG B  2 36  ? -0.596  -23.263 61.348  1.00 47.50  ? 36   ARG B C     1 
ATOM   939   O  O     . ARG B  2 36  ? -0.872  -22.071 61.340  1.00 48.25  ? 36   ARG B O     1 
ATOM   940   C  CB    . ARG B  2 36  ? 1.811   -23.963 61.659  1.00 47.67  ? 36   ARG B CB    1 
ATOM   941   C  CG    . ARG B  2 36  ? 2.985   -24.064 62.630  1.00 47.38  ? 36   ARG B CG    1 
ATOM   942   C  CD    . ARG B  2 36  ? 4.318   -23.855 61.905  1.00 48.66  ? 36   ARG B CD    1 
ATOM   943   N  NE    . ARG B  2 36  ? 4.609   -24.885 60.886  1.00 48.43  ? 36   ARG B NE    1 
ATOM   944   C  CZ    . ARG B  2 36  ? 5.238   -26.036 61.140  1.00 47.11  ? 36   ARG B CZ    1 
ATOM   945   N  NH1   . ARG B  2 36  ? 5.659   -26.331 62.370  1.00 44.93  ? 36   ARG B NH1   1 
ATOM   946   N  NH2   . ARG B  2 36  ? 5.472   -26.888 60.157  1.00 47.09  ? 36   ARG B NH2   1 
ATOM   947   N  N     . LEU B  2 37  ? -1.192  -24.115 60.530  1.00 46.46  ? 37   LEU B N     1 
ATOM   948   C  CA    . LEU B  2 37  ? -2.231  -23.670 59.597  1.00 45.51  ? 37   LEU B CA    1 
ATOM   949   C  C     . LEU B  2 37  ? -3.487  -23.214 60.327  1.00 45.82  ? 37   LEU B C     1 
ATOM   950   O  O     . LEU B  2 37  ? -4.220  -22.347 59.847  1.00 46.50  ? 37   LEU B O     1 
ATOM   951   C  CB    . LEU B  2 37  ? -2.608  -24.793 58.625  1.00 44.83  ? 37   LEU B CB    1 
ATOM   952   C  CG    . LEU B  2 37  ? -1.547  -25.258 57.634  1.00 42.96  ? 37   LEU B CG    1 
ATOM   953   C  CD1   . LEU B  2 37  ? -1.822  -26.731 57.269  1.00 43.05  ? 37   LEU B CD1   1 
ATOM   954   C  CD2   . LEU B  2 37  ? -1.500  -24.395 56.394  1.00 39.02  ? 37   LEU B CD2   1 
ATOM   955   N  N     . ALA B  2 38  ? -3.760  -23.797 61.486  1.00 45.33  ? 38   ALA B N     1 
ATOM   956   C  CA    . ALA B  2 38  ? -4.963  -23.415 62.216  1.00 44.91  ? 38   ALA B CA    1 
ATOM   957   C  C     . ALA B  2 38  ? -4.748  -22.027 62.818  1.00 44.59  ? 38   ALA B C     1 
ATOM   958   O  O     . ALA B  2 38  ? -5.687  -21.262 62.975  1.00 44.24  ? 38   ALA B O     1 
ATOM   959   C  CB    . ALA B  2 38  ? -5.275  -24.428 63.306  1.00 44.16  ? 38   ALA B CB    1 
ATOM   960   N  N     . ARG B  2 39  ? -3.497  -21.748 63.182  1.00 43.87  ? 39   ARG B N     1 
ATOM   961   C  CA    . ARG B  2 39  ? -3.105  -20.472 63.713  1.00 43.50  ? 39   ARG B CA    1 
ATOM   962   C  C     . ARG B  2 39  ? -3.322  -19.413 62.632  1.00 43.19  ? 39   ARG B C     1 
ATOM   963   O  O     . ARG B  2 39  ? -4.046  -18.435 62.849  1.00 42.54  ? 39   ARG B O     1 
ATOM   964   C  CB    . ARG B  2 39  ? -1.642  -20.510 64.163  1.00 43.50  ? 39   ARG B CB    1 
ATOM   965   C  CG    . ARG B  2 39  ? -1.379  -21.414 65.367  1.00 45.31  ? 39   ARG B CG    1 
ATOM   966   C  CD    . ARG B  2 39  ? -2.206  -21.048 66.600  1.00 48.66  ? 39   ARG B CD    1 
ATOM   967   N  NE    . ARG B  2 39  ? -1.806  -21.885 67.718  1.00 51.78  ? 39   ARG B NE    1 
ATOM   968   C  CZ    . ARG B  2 39  ? -2.621  -22.672 68.429  1.00 55.64  ? 39   ARG B CZ    1 
ATOM   969   N  NH1   . ARG B  2 39  ? -3.935  -22.718 68.183  1.00 54.20  ? 39   ARG B NH1   1 
ATOM   970   N  NH2   . ARG B  2 39  ? -2.110  -23.406 69.422  1.00 56.80  ? 39   ARG B NH2   1 
ATOM   971   N  N     . ARG B  2 40  ? -2.742  -19.633 61.449  1.00 42.12  ? 40   ARG B N     1 
ATOM   972   C  CA    . ARG B  2 40  ? -2.974  -18.710 60.375  1.00 41.39  ? 40   ARG B CA    1 
ATOM   973   C  C     . ARG B  2 40  ? -4.476  -18.497 60.187  1.00 41.65  ? 40   ARG B C     1 
ATOM   974   O  O     . ARG B  2 40  ? -4.896  -17.412 59.825  1.00 42.37  ? 40   ARG B O     1 
ATOM   975   C  CB    . ARG B  2 40  ? -2.293  -19.114 59.074  1.00 40.49  ? 40   ARG B CB    1 
ATOM   976   C  CG    . ARG B  2 40  ? -2.384  -18.026 57.993  1.00 37.29  ? 40   ARG B CG    1 
ATOM   977   C  CD    . ARG B  2 40  ? -1.380  -18.231 56.874  1.00 35.54  ? 40   ARG B CD    1 
ATOM   978   N  NE    . ARG B  2 40  ? -0.031  -18.022 57.363  1.00 34.80  ? 40   ARG B NE    1 
ATOM   979   C  CZ    . ARG B  2 40  ? 1.075   -18.400 56.750  1.00 35.16  ? 40   ARG B CZ    1 
ATOM   980   N  NH1   . ARG B  2 40  ? 1.019   -19.037 55.606  1.00 37.70  ? 40   ARG B NH1   1 
ATOM   981   N  NH2   . ARG B  2 40  ? 2.257   -18.136 57.298  1.00 39.30  ? 40   ARG B NH2   1 
ATOM   982   N  N     . GLY B  2 41  ? -5.277  -19.512 60.478  1.00 41.32  ? 41   GLY B N     1 
ATOM   983   C  CA    . GLY B  2 41  ? -6.727  -19.396 60.341  1.00 41.36  ? 41   GLY B CA    1 
ATOM   984   C  C     . GLY B  2 41  ? -7.418  -18.914 61.592  1.00 41.65  ? 41   GLY B C     1 
ATOM   985   O  O     . GLY B  2 41  ? -8.629  -18.931 61.651  1.00 41.97  ? 41   GLY B O     1 
ATOM   986   N  N     . GLY B  2 42  ? -6.650  -18.487 62.594  1.00 42.42  ? 42   GLY B N     1 
ATOM   987   C  CA    . GLY B  2 42  ? -7.180  -17.893 63.833  1.00 43.18  ? 42   GLY B CA    1 
ATOM   988   C  C     . GLY B  2 42  ? -7.638  -18.828 64.935  1.00 44.55  ? 42   GLY B C     1 
ATOM   989   O  O     . GLY B  2 42  ? -8.341  -18.431 65.849  1.00 44.90  ? 42   GLY B O     1 
ATOM   990   N  N     . VAL B  2 43  ? -7.241  -20.085 64.861  1.00 45.90  ? 43   VAL B N     1 
ATOM   991   C  CA    . VAL B  2 43  ? -7.740  -21.074 65.783  1.00 46.25  ? 43   VAL B CA    1 
ATOM   992   C  C     . VAL B  2 43  ? -6.889  -21.072 67.042  1.00 46.65  ? 43   VAL B C     1 
ATOM   993   O  O     . VAL B  2 43  ? -5.662  -21.217 66.991  1.00 46.01  ? 43   VAL B O     1 
ATOM   994   C  CB    . VAL B  2 43  ? -7.821  -22.482 65.117  1.00 46.70  ? 43   VAL B CB    1 
ATOM   995   C  CG1   . VAL B  2 43  ? -8.269  -23.528 66.108  1.00 45.66  ? 43   VAL B CG1   1 
ATOM   996   C  CG2   . VAL B  2 43  ? -8.762  -22.449 63.910  1.00 46.98  ? 43   VAL B CG2   1 
ATOM   997   N  N     . LYS B  2 44  ? -7.562  -20.867 68.172  1.00 47.61  ? 44   LYS B N     1 
ATOM   998   C  CA    . LYS B  2 44  ? -6.892  -20.820 69.460  1.00 48.82  ? 44   LYS B CA    1 
ATOM   999   C  C     . LYS B  2 44  ? -6.707  -22.203 70.116  1.00 49.30  ? 44   LYS B C     1 
ATOM   1000  O  O     . LYS B  2 44  ? -5.604  -22.542 70.560  1.00 50.48  ? 44   LYS B O     1 
ATOM   1001  C  CB    . LYS B  2 44  ? -7.613  -19.868 70.383  1.00 48.81  ? 44   LYS B CB    1 
ATOM   1002  C  CG    . LYS B  2 44  ? -6.890  -19.635 71.701  1.00 51.10  ? 44   LYS B CG    1 
ATOM   1003  C  CD    . LYS B  2 44  ? -7.836  -18.942 72.688  1.00 52.08  ? 44   LYS B CD    1 
ATOM   1004  C  CE    . LYS B  2 44  ? -7.089  -18.389 73.861  1.00 51.84  ? 44   LYS B CE    1 
ATOM   1005  N  NZ    . LYS B  2 44  ? -8.032  -17.518 74.615  1.00 56.10  ? 44   LYS B NZ    1 
ATOM   1006  N  N     . ARG B  2 45  ? -7.759  -23.009 70.138  1.00 49.13  ? 45   ARG B N     1 
ATOM   1007  C  CA    . ARG B  2 45  ? -7.692  -24.303 70.766  1.00 49.55  ? 45   ARG B CA    1 
ATOM   1008  C  C     . ARG B  2 45  ? -8.050  -25.416 69.774  1.00 49.44  ? 45   ARG B C     1 
ATOM   1009  O  O     . ARG B  2 45  ? -9.021  -25.289 69.043  1.00 49.52  ? 45   ARG B O     1 
ATOM   1010  C  CB    . ARG B  2 45  ? -8.618  -24.317 71.978  1.00 49.75  ? 45   ARG B CB    1 
ATOM   1011  C  CG    . ARG B  2 45  ? -8.124  -25.132 73.132  1.00 51.58  ? 45   ARG B CG    1 
ATOM   1012  C  CD    . ARG B  2 45  ? -9.024  -24.915 74.313  1.00 57.39  ? 45   ARG B CD    1 
ATOM   1013  N  NE    . ARG B  2 45  ? -8.691  -25.759 75.466  1.00 62.39  ? 45   ARG B NE    1 
ATOM   1014  C  CZ    . ARG B  2 45  ? -9.177  -26.985 75.673  1.00 64.27  ? 45   ARG B CZ    1 
ATOM   1015  N  NH1   . ARG B  2 45  ? -10.003 -27.546 74.790  1.00 65.32  ? 45   ARG B NH1   1 
ATOM   1016  N  NH2   . ARG B  2 45  ? -8.825  -27.665 76.760  1.00 64.33  ? 45   ARG B NH2   1 
ATOM   1017  N  N     . ILE B  2 46  ? -7.274  -26.504 69.775  1.00 49.35  ? 46   ILE B N     1 
ATOM   1018  C  CA    . ILE B  2 46  ? -7.439  -27.623 68.830  1.00 49.68  ? 46   ILE B CA    1 
ATOM   1019  C  C     . ILE B  2 46  ? -7.648  -28.984 69.501  1.00 50.18  ? 46   ILE B C     1 
ATOM   1020  O  O     . ILE B  2 46  ? -6.800  -29.473 70.228  1.00 50.93  ? 46   ILE B O     1 
ATOM   1021  C  CB    . ILE B  2 46  ? -6.199  -27.761 67.932  1.00 49.12  ? 46   ILE B CB    1 
ATOM   1022  C  CG1   . ILE B  2 46  ? -5.965  -26.473 67.142  1.00 49.46  ? 46   ILE B CG1   1 
ATOM   1023  C  CG2   . ILE B  2 46  ? -6.350  -28.942 67.009  1.00 48.16  ? 46   ILE B CG2   1 
ATOM   1024  C  CD1   . ILE B  2 46  ? -4.664  -26.438 66.387  1.00 47.80  ? 46   ILE B CD1   1 
ATOM   1025  N  N     . SER B  2 47  ? -8.763  -29.626 69.237  1.00 51.03  ? 47   SER B N     1 
ATOM   1026  C  CA    . SER B  2 47  ? -8.981  -30.965 69.785  1.00 51.24  ? 47   SER B CA    1 
ATOM   1027  C  C     . SER B  2 47  ? -8.029  -32.017 69.177  1.00 50.98  ? 47   SER B C     1 
ATOM   1028  O  O     . SER B  2 47  ? -7.682  -31.942 67.994  1.00 51.62  ? 47   SER B O     1 
ATOM   1029  C  CB    . SER B  2 47  ? -10.428 -31.370 69.562  1.00 50.93  ? 47   SER B CB    1 
ATOM   1030  O  OG    . SER B  2 47  ? -10.452 -32.696 69.090  1.00 54.24  ? 47   SER B OG    1 
ATOM   1031  N  N     . GLY B  2 48  ? -7.629  -33.008 69.972  1.00 50.73  ? 48   GLY B N     1 
ATOM   1032  C  CA    . GLY B  2 48  ? -6.706  -34.055 69.512  1.00 50.19  ? 48   GLY B CA    1 
ATOM   1033  C  C     . GLY B  2 48  ? -7.200  -34.847 68.302  1.00 50.18  ? 48   GLY B C     1 
ATOM   1034  O  O     . GLY B  2 48  ? -6.407  -35.440 67.552  1.00 49.97  ? 48   GLY B O     1 
ATOM   1035  N  N     . LEU B  2 49  ? -8.505  -34.840 68.087  1.00 49.54  ? 49   LEU B N     1 
ATOM   1036  C  CA    . LEU B  2 49  ? -9.050  -35.514 66.934  1.00 50.47  ? 49   LEU B CA    1 
ATOM   1037  C  C     . LEU B  2 49  ? -8.927  -34.775 65.578  1.00 50.15  ? 49   LEU B C     1 
ATOM   1038  O  O     . LEU B  2 49  ? -9.230  -35.357 64.527  1.00 50.33  ? 49   LEU B O     1 
ATOM   1039  C  CB    . LEU B  2 49  ? -10.511 -35.868 67.227  1.00 51.19  ? 49   LEU B CB    1 
ATOM   1040  C  CG    . LEU B  2 49  ? -10.703 -36.862 68.388  1.00 53.28  ? 49   LEU B CG    1 
ATOM   1041  C  CD1   . LEU B  2 49  ? -12.145 -36.804 68.913  1.00 55.61  ? 49   LEU B CD1   1 
ATOM   1042  C  CD2   . LEU B  2 49  ? -10.315 -38.288 67.965  1.00 51.02  ? 49   LEU B CD2   1 
ATOM   1043  N  N     . ILE B  2 50  ? -8.512  -33.505 65.609  1.00 49.24  ? 50   ILE B N     1 
ATOM   1044  C  CA    . ILE B  2 50  ? -8.452  -32.656 64.419  1.00 48.40  ? 50   ILE B CA    1 
ATOM   1045  C  C     . ILE B  2 50  ? -7.387  -33.107 63.448  1.00 48.44  ? 50   ILE B C     1 
ATOM   1046  O  O     . ILE B  2 50  ? -7.557  -32.993 62.241  1.00 48.75  ? 50   ILE B O     1 
ATOM   1047  C  CB    . ILE B  2 50  ? -8.205  -31.125 64.784  1.00 48.49  ? 50   ILE B CB    1 
ATOM   1048  C  CG1   . ILE B  2 50  ? -9.450  -30.469 65.374  1.00 47.38  ? 50   ILE B CG1   1 
ATOM   1049  C  CG2   . ILE B  2 50  ? -7.770  -30.300 63.580  1.00 46.71  ? 50   ILE B CG2   1 
ATOM   1050  C  CD1   . ILE B  2 50  ? -10.547 -30.211 64.346  1.00 47.40  ? 50   ILE B CD1   1 
ATOM   1051  N  N     . TYR B  2 51  ? -6.270  -33.597 63.957  1.00 48.79  ? 51   TYR B N     1 
ATOM   1052  C  CA    . TYR B  2 51  ? -5.163  -33.925 63.070  1.00 49.86  ? 51   TYR B CA    1 
ATOM   1053  C  C     . TYR B  2 51  ? -5.502  -34.977 62.032  1.00 50.60  ? 51   TYR B C     1 
ATOM   1054  O  O     . TYR B  2 51  ? -5.078  -34.844 60.876  1.00 51.53  ? 51   TYR B O     1 
ATOM   1055  C  CB    . TYR B  2 51  ? -3.890  -34.217 63.851  1.00 49.94  ? 51   TYR B CB    1 
ATOM   1056  C  CG    . TYR B  2 51  ? -3.675  -33.130 64.864  1.00 51.03  ? 51   TYR B CG    1 
ATOM   1057  C  CD1   . TYR B  2 51  ? -3.515  -31.800 64.450  1.00 51.18  ? 51   TYR B CD1   1 
ATOM   1058  C  CD2   . TYR B  2 51  ? -3.707  -33.395 66.234  1.00 51.24  ? 51   TYR B CD2   1 
ATOM   1059  C  CE1   . TYR B  2 51  ? -3.373  -30.767 65.363  1.00 50.18  ? 51   TYR B CE1   1 
ATOM   1060  C  CE2   . TYR B  2 51  ? -3.549  -32.359 67.165  1.00 51.16  ? 51   TYR B CE2   1 
ATOM   1061  C  CZ    . TYR B  2 51  ? -3.383  -31.049 66.706  1.00 51.59  ? 51   TYR B CZ    1 
ATOM   1062  O  OH    . TYR B  2 51  ? -3.238  -30.002 67.583  1.00 53.65  ? 51   TYR B OH    1 
ATOM   1063  N  N     . GLU B  2 52  ? -6.292  -35.989 62.398  1.00 50.87  ? 52   GLU B N     1 
ATOM   1064  C  CA    . GLU B  2 52  ? -6.613  -37.021 61.418  1.00 51.79  ? 52   GLU B CA    1 
ATOM   1065  C  C     . GLU B  2 52  ? -7.750  -36.592 60.496  1.00 51.07  ? 52   GLU B C     1 
ATOM   1066  O  O     . GLU B  2 52  ? -7.761  -36.941 59.321  1.00 51.12  ? 52   GLU B O     1 
ATOM   1067  C  CB    . GLU B  2 52  ? -6.815  -38.424 62.038  1.00 52.10  ? 52   GLU B CB    1 
ATOM   1068  C  CG    . GLU B  2 52  ? -5.478  -39.172 62.296  1.00 54.90  ? 52   GLU B CG    1 
ATOM   1069  C  CD    . GLU B  2 52  ? -4.907  -39.838 61.051  1.00 60.42  ? 52   GLU B CD    1 
ATOM   1070  O  OE1   . GLU B  2 52  ? -5.711  -40.413 60.274  1.00 64.12  ? 52   GLU B OE1   1 
ATOM   1071  O  OE2   . GLU B  2 52  ? -3.661  -39.798 60.838  1.00 62.05  ? 52   GLU B OE2   1 
ATOM   1072  N  N     . GLU B  2 53  ? -8.675  -35.801 61.008  1.00 50.59  ? 53   GLU B N     1 
ATOM   1073  C  CA    . GLU B  2 53  ? -9.718  -35.236 60.151  1.00 50.93  ? 53   GLU B CA    1 
ATOM   1074  C  C     . GLU B  2 53  ? -9.084  -34.368 59.048  1.00 50.54  ? 53   GLU B C     1 
ATOM   1075  O  O     . GLU B  2 53  ? -9.475  -34.451 57.866  1.00 50.77  ? 53   GLU B O     1 
ATOM   1076  C  CB    . GLU B  2 53  ? -10.704 -34.413 60.977  1.00 50.29  ? 53   GLU B CB    1 
ATOM   1077  C  CG    . GLU B  2 53  ? -11.943 -34.037 60.226  1.00 52.25  ? 53   GLU B CG    1 
ATOM   1078  C  CD    . GLU B  2 53  ? -12.947 -35.197 60.066  1.00 56.51  ? 53   GLU B CD    1 
ATOM   1079  O  OE1   . GLU B  2 53  ? -12.889 -36.171 60.844  1.00 57.67  ? 53   GLU B OE1   1 
ATOM   1080  O  OE2   . GLU B  2 53  ? -13.825 -35.126 59.164  1.00 58.53  ? 53   GLU B OE2   1 
ATOM   1081  N  N     . THR B  2 54  ? -8.090  -33.567 59.437  1.00 49.51  ? 54   THR B N     1 
ATOM   1082  C  CA    . THR B  2 54  ? -7.406  -32.679 58.501  1.00 49.01  ? 54   THR B CA    1 
ATOM   1083  C  C     . THR B  2 54  ? -6.691  -33.471 57.428  1.00 48.68  ? 54   THR B C     1 
ATOM   1084  O  O     . THR B  2 54  ? -6.887  -33.209 56.243  1.00 49.36  ? 54   THR B O     1 
ATOM   1085  C  CB    . THR B  2 54  ? -6.443  -31.686 59.197  1.00 49.14  ? 54   THR B CB    1 
ATOM   1086  O  OG1   . THR B  2 54  ? -7.170  -30.864 60.113  1.00 46.41  ? 54   THR B OG1   1 
ATOM   1087  C  CG2   . THR B  2 54  ? -5.795  -30.784 58.177  1.00 49.37  ? 54   THR B CG2   1 
ATOM   1088  N  N     . ARG B  2 55  ? -5.901  -34.463 57.829  1.00 48.33  ? 55   ARG B N     1 
ATOM   1089  C  CA    . ARG B  2 55  ? -5.240  -35.361 56.860  1.00 47.41  ? 55   ARG B CA    1 
ATOM   1090  C  C     . ARG B  2 55  ? -6.227  -35.924 55.840  1.00 47.18  ? 55   ARG B C     1 
ATOM   1091  O  O     . ARG B  2 55  ? -5.957  -35.925 54.626  1.00 46.55  ? 55   ARG B O     1 
ATOM   1092  C  CB    . ARG B  2 55  ? -4.504  -36.469 57.586  1.00 47.37  ? 55   ARG B CB    1 
ATOM   1093  C  CG    . ARG B  2 55  ? -3.329  -35.929 58.372  1.00 48.51  ? 55   ARG B CG    1 
ATOM   1094  C  CD    . ARG B  2 55  ? -2.413  -36.981 58.918  1.00 49.00  ? 55   ARG B CD    1 
ATOM   1095  N  NE    . ARG B  2 55  ? -1.472  -36.357 59.834  1.00 51.06  ? 55   ARG B NE    1 
ATOM   1096  C  CZ    . ARG B  2 55  ? -1.618  -36.316 61.156  1.00 52.86  ? 55   ARG B CZ    1 
ATOM   1097  N  NH1   . ARG B  2 55  ? -2.660  -36.882 61.734  1.00 54.28  ? 55   ARG B NH1   1 
ATOM   1098  N  NH2   . ARG B  2 55  ? -0.714  -35.708 61.908  1.00 54.05  ? 55   ARG B NH2   1 
ATOM   1099  N  N     . GLY B  2 56  ? -7.395  -36.343 56.344  1.00 46.70  ? 56   GLY B N     1 
ATOM   1100  C  CA    . GLY B  2 56  ? -8.447  -36.919 55.528  1.00 45.70  ? 56   GLY B CA    1 
ATOM   1101  C  C     . GLY B  2 56  ? -8.791  -35.955 54.432  1.00 45.92  ? 56   GLY B C     1 
ATOM   1102  O  O     . GLY B  2 56  ? -8.603  -36.255 53.251  1.00 46.43  ? 56   GLY B O     1 
ATOM   1103  N  N     . VAL B  2 57  ? -9.242  -34.769 54.858  1.00 45.66  ? 57   VAL B N     1 
ATOM   1104  C  CA    . VAL B  2 57  ? -9.615  -33.644 54.012  1.00 44.74  ? 57   VAL B CA    1 
ATOM   1105  C  C     . VAL B  2 57  ? -8.523  -33.200 53.043  1.00 44.06  ? 57   VAL B C     1 
ATOM   1106  O  O     . VAL B  2 57  ? -8.796  -32.999 51.861  1.00 43.75  ? 57   VAL B O     1 
ATOM   1107  C  CB    . VAL B  2 57  ? -9.998  -32.474 54.898  1.00 45.40  ? 57   VAL B CB    1 
ATOM   1108  C  CG1   . VAL B  2 57  ? -10.098 -31.172 54.095  1.00 45.42  ? 57   VAL B CG1   1 
ATOM   1109  C  CG2   . VAL B  2 57  ? -11.287 -32.792 55.641  1.00 45.90  ? 57   VAL B CG2   1 
ATOM   1110  N  N     . LEU B  2 58  ? -7.291  -33.047 53.525  1.00 43.28  ? 58   LEU B N     1 
ATOM   1111  C  CA    . LEU B  2 58  ? -6.190  -32.697 52.624  1.00 42.99  ? 58   LEU B CA    1 
ATOM   1112  C  C     . LEU B  2 58  ? -6.030  -33.711 51.488  1.00 43.31  ? 58   LEU B C     1 
ATOM   1113  O  O     . LEU B  2 58  ? -5.939  -33.340 50.335  1.00 43.67  ? 58   LEU B O     1 
ATOM   1114  C  CB    . LEU B  2 58  ? -4.885  -32.521 53.390  1.00 42.59  ? 58   LEU B CB    1 
ATOM   1115  C  CG    . LEU B  2 58  ? -3.640  -32.248 52.548  1.00 42.90  ? 58   LEU B CG    1 
ATOM   1116  C  CD1   . LEU B  2 58  ? -3.789  -31.004 51.702  1.00 45.54  ? 58   LEU B CD1   1 
ATOM   1117  C  CD2   . LEU B  2 58  ? -2.456  -32.094 53.436  1.00 43.41  ? 58   LEU B CD2   1 
ATOM   1118  N  N     . LYS B  2 59  ? -6.020  -34.997 51.835  1.00 44.13  ? 59   LYS B N     1 
ATOM   1119  C  CA    . LYS B  2 59  ? -5.940  -36.116 50.900  1.00 43.58  ? 59   LYS B CA    1 
ATOM   1120  C  C     . LYS B  2 59  ? -7.050  -36.033 49.843  1.00 43.25  ? 59   LYS B C     1 
ATOM   1121  O  O     . LYS B  2 59  ? -6.797  -36.122 48.638  1.00 42.91  ? 59   LYS B O     1 
ATOM   1122  C  CB    . LYS B  2 59  ? -6.078  -37.391 51.733  1.00 44.42  ? 59   LYS B CB    1 
ATOM   1123  C  CG    . LYS B  2 59  ? -5.868  -38.703 51.019  1.00 47.57  ? 59   LYS B CG    1 
ATOM   1124  C  CD    . LYS B  2 59  ? -4.438  -39.214 51.290  1.00 52.87  ? 59   LYS B CD    1 
ATOM   1125  C  CE    . LYS B  2 59  ? -4.100  -40.315 50.282  1.00 54.37  ? 59   LYS B CE    1 
ATOM   1126  N  NZ    . LYS B  2 59  ? -4.818  -41.585 50.680  1.00 59.35  ? 59   LYS B NZ    1 
ATOM   1127  N  N     . VAL B  2 60  ? -8.293  -35.834 50.281  1.00 42.39  ? 60   VAL B N     1 
ATOM   1128  C  CA    . VAL B  2 60  ? -9.368  -35.680 49.313  1.00 41.88  ? 60   VAL B CA    1 
ATOM   1129  C  C     . VAL B  2 60  ? -9.125  -34.461 48.436  1.00 42.14  ? 60   VAL B C     1 
ATOM   1130  O  O     . VAL B  2 60  ? -9.405  -34.500 47.220  1.00 42.87  ? 60   VAL B O     1 
ATOM   1131  C  CB    . VAL B  2 60  ? -10.748 -35.561 49.978  1.00 41.86  ? 60   VAL B CB    1 
ATOM   1132  C  CG1   . VAL B  2 60  ? -11.774 -35.078 48.976  1.00 40.12  ? 60   VAL B CG1   1 
ATOM   1133  C  CG2   . VAL B  2 60  ? -11.154 -36.894 50.561  1.00 41.96  ? 60   VAL B CG2   1 
ATOM   1134  N  N     . PHE B  2 61  ? -8.622  -33.376 49.042  1.00 41.08  ? 61   PHE B N     1 
ATOM   1135  C  CA    . PHE B  2 61  ? -8.413  -32.172 48.280  1.00 40.23  ? 61   PHE B CA    1 
ATOM   1136  C  C     . PHE B  2 61  ? -7.377  -32.449 47.195  1.00 40.62  ? 61   PHE B C     1 
ATOM   1137  O  O     . PHE B  2 61  ? -7.624  -32.193 46.022  1.00 40.91  ? 61   PHE B O     1 
ATOM   1138  C  CB    . PHE B  2 61  ? -8.048  -30.964 49.171  1.00 39.81  ? 61   PHE B CB    1 
ATOM   1139  C  CG    . PHE B  2 61  ? -7.593  -29.766 48.393  1.00 38.08  ? 61   PHE B CG    1 
ATOM   1140  C  CD1   . PHE B  2 61  ? -8.508  -28.816 47.951  1.00 39.65  ? 61   PHE B CD1   1 
ATOM   1141  C  CD2   . PHE B  2 61  ? -6.255  -29.607 48.058  1.00 35.89  ? 61   PHE B CD2   1 
ATOM   1142  C  CE1   . PHE B  2 61  ? -8.099  -27.688 47.207  1.00 37.31  ? 61   PHE B CE1   1 
ATOM   1143  C  CE2   . PHE B  2 61  ? -5.840  -28.524 47.305  1.00 37.28  ? 61   PHE B CE2   1 
ATOM   1144  C  CZ    . PHE B  2 61  ? -6.779  -27.548 46.881  1.00 38.63  ? 61   PHE B CZ    1 
ATOM   1145  N  N     . LEU B  2 62  ? -6.229  -32.976 47.592  1.00 41.21  ? 62   LEU B N     1 
ATOM   1146  C  CA    . LEU B  2 62  ? -5.170  -33.337 46.651  1.00 42.75  ? 62   LEU B CA    1 
ATOM   1147  C  C     . LEU B  2 62  ? -5.536  -34.395 45.586  1.00 43.27  ? 62   LEU B C     1 
ATOM   1148  O  O     . LEU B  2 62  ? -5.046  -34.328 44.469  1.00 43.23  ? 62   LEU B O     1 
ATOM   1149  C  CB    . LEU B  2 62  ? -3.929  -33.799 47.413  1.00 42.50  ? 62   LEU B CB    1 
ATOM   1150  C  CG    . LEU B  2 62  ? -3.120  -32.671 48.033  1.00 43.02  ? 62   LEU B CG    1 
ATOM   1151  C  CD1   . LEU B  2 62  ? -2.068  -33.281 48.900  1.00 43.78  ? 62   LEU B CD1   1 
ATOM   1152  C  CD2   . LEU B  2 62  ? -2.488  -31.799 46.947  1.00 41.40  ? 62   LEU B CD2   1 
ATOM   1153  N  N     . GLU B  2 63  ? -6.376  -35.371 45.929  1.00 43.99  ? 63   GLU B N     1 
ATOM   1154  C  CA    . GLU B  2 63  ? -6.746  -36.395 44.970  1.00 44.83  ? 63   GLU B CA    1 
ATOM   1155  C  C     . GLU B  2 63  ? -7.473  -35.724 43.843  1.00 45.02  ? 63   GLU B C     1 
ATOM   1156  O  O     . GLU B  2 63  ? -7.152  -35.959 42.674  1.00 45.68  ? 63   GLU B O     1 
ATOM   1157  C  CB    . GLU B  2 63  ? -7.635  -37.477 45.595  1.00 45.29  ? 63   GLU B CB    1 
ATOM   1158  C  CG    . GLU B  2 63  ? -6.914  -38.697 46.161  1.00 47.83  ? 63   GLU B CG    1 
ATOM   1159  C  CD    . GLU B  2 63  ? -7.626  -39.242 47.395  1.00 53.98  ? 63   GLU B CD    1 
ATOM   1160  O  OE1   . GLU B  2 63  ? -8.885  -39.270 47.398  1.00 55.69  ? 63   GLU B OE1   1 
ATOM   1161  O  OE2   . GLU B  2 63  ? -6.936  -39.630 48.383  1.00 57.13  ? 63   GLU B OE2   1 
ATOM   1162  N  N     . ASN B  2 64  ? -8.457  -34.894 44.187  1.00 44.96  ? 64   ASN B N     1 
ATOM   1163  C  CA    . ASN B  2 64  ? -9.234  -34.172 43.189  1.00 45.14  ? 64   ASN B CA    1 
ATOM   1164  C  C     . ASN B  2 64  ? -8.424  -33.274 42.269  1.00 44.75  ? 64   ASN B C     1 
ATOM   1165  O  O     . ASN B  2 64  ? -8.604  -33.343 41.050  1.00 45.51  ? 64   ASN B O     1 
ATOM   1166  C  CB    . ASN B  2 64  ? -10.358 -33.398 43.843  1.00 45.78  ? 64   ASN B CB    1 
ATOM   1167  C  CG    . ASN B  2 64  ? -11.404 -34.308 44.402  1.00 48.63  ? 64   ASN B CG    1 
ATOM   1168  O  OD1   . ASN B  2 64  ? -11.642 -35.385 43.861  1.00 55.14  ? 64   ASN B OD1   1 
ATOM   1169  N  ND2   . ASN B  2 64  ? -12.040 -33.901 45.477  1.00 51.65  ? 64   ASN B ND2   1 
ATOM   1170  N  N     . VAL B  2 65  ? -7.526  -32.454 42.820  1.00 43.80  ? 65   VAL B N     1 
ATOM   1171  C  CA    . VAL B  2 65  ? -6.734  -31.556 41.981  1.00 43.02  ? 65   VAL B CA    1 
ATOM   1172  C  C     . VAL B  2 65  ? -5.756  -32.346 41.149  1.00 42.63  ? 65   VAL B C     1 
ATOM   1173  O  O     . VAL B  2 65  ? -5.669  -32.145 39.930  1.00 42.19  ? 65   VAL B O     1 
ATOM   1174  C  CB    . VAL B  2 65  ? -5.996  -30.437 42.780  1.00 43.18  ? 65   VAL B CB    1 
ATOM   1175  C  CG1   . VAL B  2 65  ? -5.198  -29.537 41.843  1.00 40.98  ? 65   VAL B CG1   1 
ATOM   1176  C  CG2   . VAL B  2 65  ? -7.000  -29.593 43.530  1.00 43.97  ? 65   VAL B CG2   1 
ATOM   1177  N  N     . ILE B  2 66  ? -5.028  -33.250 41.798  1.00 42.86  ? 66   ILE B N     1 
ATOM   1178  C  CA    . ILE B  2 66  ? -4.049  -34.074 41.082  1.00 43.30  ? 66   ILE B CA    1 
ATOM   1179  C  C     . ILE B  2 66  ? -4.664  -34.946 39.978  1.00 43.11  ? 66   ILE B C     1 
ATOM   1180  O  O     . ILE B  2 66  ? -4.107  -35.030 38.889  1.00 43.33  ? 66   ILE B O     1 
ATOM   1181  C  CB    . ILE B  2 66  ? -3.174  -34.881 41.996  1.00 43.26  ? 66   ILE B CB    1 
ATOM   1182  C  CG1   . ILE B  2 66  ? -2.529  -33.952 43.027  1.00 42.89  ? 66   ILE B CG1   1 
ATOM   1183  C  CG2   . ILE B  2 66  ? -2.091  -35.563 41.170  1.00 43.67  ? 66   ILE B CG2   1 
ATOM   1184  C  CD1   . ILE B  2 66  ? -1.553  -34.659 44.018  1.00 42.03  ? 66   ILE B CD1   1 
ATOM   1185  N  N     . ARG B  2 67  ? -5.831  -35.520 40.221  1.00 43.18  ? 67   ARG B N     1 
ATOM   1186  C  CA    . ARG B  2 67  ? -6.486  -36.287 39.174  1.00 44.52  ? 67   ARG B CA    1 
ATOM   1187  C  C     . ARG B  2 67  ? -6.652  -35.488 37.902  1.00 44.71  ? 67   ARG B C     1 
ATOM   1188  O  O     . ARG B  2 67  ? -6.316  -35.968 36.813  1.00 44.54  ? 67   ARG B O     1 
ATOM   1189  C  CB    . ARG B  2 67  ? -7.831  -36.833 39.624  1.00 45.04  ? 67   ARG B CB    1 
ATOM   1190  C  CG    . ARG B  2 67  ? -8.598  -37.498 38.490  1.00 47.68  ? 67   ARG B CG    1 
ATOM   1191  C  CD    . ARG B  2 67  ? -10.049 -37.704 38.837  1.00 51.99  ? 67   ARG B CD    1 
ATOM   1192  N  NE    . ARG B  2 67  ? -10.091 -38.547 40.021  1.00 57.31  ? 67   ARG B NE    1 
ATOM   1193  C  CZ    . ARG B  2 67  ? -10.585 -38.180 41.195  1.00 59.51  ? 67   ARG B CZ    1 
ATOM   1194  N  NH1   . ARG B  2 67  ? -11.145 -36.977 41.350  1.00 60.29  ? 67   ARG B NH1   1 
ATOM   1195  N  NH2   . ARG B  2 67  ? -10.535 -39.038 42.207  1.00 60.77  ? 67   ARG B NH2   1 
ATOM   1196  N  N     . ASP B  2 68  ? -7.164  -34.261 38.056  1.00 45.70  ? 68   ASP B N     1 
ATOM   1197  C  CA    . ASP B  2 68  ? -7.315  -33.310 36.943  1.00 45.70  ? 68   ASP B CA    1 
ATOM   1198  C  C     . ASP B  2 68  ? -5.999  -32.841 36.355  1.00 45.06  ? 68   ASP B C     1 
ATOM   1199  O  O     . ASP B  2 68  ? -5.870  -32.755 35.130  1.00 44.84  ? 68   ASP B O     1 
ATOM   1200  C  CB    . ASP B  2 68  ? -8.232  -32.150 37.322  1.00 46.21  ? 68   ASP B CB    1 
ATOM   1201  C  CG    . ASP B  2 68  ? -9.659  -32.618 37.617  1.00 49.31  ? 68   ASP B CG    1 
ATOM   1202  O  OD1   . ASP B  2 68  ? -9.886  -33.855 37.610  1.00 50.02  ? 68   ASP B OD1   1 
ATOM   1203  O  OD2   . ASP B  2 68  ? -10.552 -31.764 37.855  1.00 51.37  ? 68   ASP B OD2   1 
ATOM   1204  N  N     . ALA B  2 69  ? -5.003  -32.570 37.188  1.00 44.60  ? 69   ALA B N     1 
ATOM   1205  C  CA    . ALA B  2 69  ? -3.745  -32.111 36.601  1.00 44.73  ? 69   ALA B CA    1 
ATOM   1206  C  C     . ALA B  2 69  ? -3.211  -33.227 35.726  1.00 45.06  ? 69   ALA B C     1 
ATOM   1207  O  O     . ALA B  2 69  ? -2.887  -33.010 34.557  1.00 45.61  ? 69   ALA B O     1 
ATOM   1208  C  CB    . ALA B  2 69  ? -2.711  -31.662 37.666  1.00 44.19  ? 69   ALA B CB    1 
ATOM   1209  N  N     . VAL B  2 70  ? -3.172  -34.438 36.272  1.00 45.16  ? 70   VAL B N     1 
ATOM   1210  C  CA    . VAL B  2 70  ? -2.655  -35.582 35.524  1.00 45.32  ? 70   VAL B CA    1 
ATOM   1211  C  C     . VAL B  2 70  ? -3.405  -35.835 34.207  1.00 45.37  ? 70   VAL B C     1 
ATOM   1212  O  O     . VAL B  2 70  ? -2.777  -36.082 33.188  1.00 45.61  ? 70   VAL B O     1 
ATOM   1213  C  CB    . VAL B  2 70  ? -2.590  -36.821 36.393  1.00 46.10  ? 70   VAL B CB    1 
ATOM   1214  C  CG1   . VAL B  2 70  ? -2.338  -38.016 35.528  1.00 46.29  ? 70   VAL B CG1   1 
ATOM   1215  C  CG2   . VAL B  2 70  ? -1.484  -36.637 37.487  1.00 43.75  ? 70   VAL B CG2   1 
ATOM   1216  N  N     . THR B  2 71  ? -4.726  -35.707 34.207  1.00 44.97  ? 71   THR B N     1 
ATOM   1217  C  CA    . THR B  2 71  ? -5.467  -35.730 32.960  1.00 44.75  ? 71   THR B CA    1 
ATOM   1218  C  C     . THR B  2 71  ? -4.997  -34.682 31.939  1.00 46.40  ? 71   THR B C     1 
ATOM   1219  O  O     . THR B  2 71  ? -4.841  -35.021 30.754  1.00 47.23  ? 71   THR B O     1 
ATOM   1220  C  CB    . THR B  2 71  ? -6.941  -35.529 33.206  1.00 44.72  ? 71   THR B CB    1 
ATOM   1221  O  OG1   . THR B  2 71  ? -7.402  -36.520 34.117  1.00 42.65  ? 71   THR B OG1   1 
ATOM   1222  C  CG2   . THR B  2 71  ? -7.726  -35.622 31.918  1.00 42.35  ? 71   THR B CG2   1 
ATOM   1223  N  N     . TYR B  2 72  ? -4.793  -33.422 32.366  1.00 46.86  ? 72   TYR B N     1 
ATOM   1224  C  CA    . TYR B  2 72  ? -4.151  -32.410 31.489  1.00 47.48  ? 72   TYR B CA    1 
ATOM   1225  C  C     . TYR B  2 72  ? -2.783  -32.869 30.974  1.00 48.37  ? 72   TYR B C     1 
ATOM   1226  O  O     . TYR B  2 72  ? -2.467  -32.661 29.815  1.00 48.22  ? 72   TYR B O     1 
ATOM   1227  C  CB    . TYR B  2 72  ? -4.029  -31.015 32.151  1.00 47.25  ? 72   TYR B CB    1 
ATOM   1228  C  CG    . TYR B  2 72  ? -5.355  -30.317 32.292  1.00 46.64  ? 72   TYR B CG    1 
ATOM   1229  C  CD1   . TYR B  2 72  ? -5.948  -30.141 33.542  1.00 45.02  ? 72   TYR B CD1   1 
ATOM   1230  C  CD2   . TYR B  2 72  ? -6.030  -29.850 31.169  1.00 46.60  ? 72   TYR B CD2   1 
ATOM   1231  C  CE1   . TYR B  2 72  ? -7.179  -29.535 33.656  1.00 45.99  ? 72   TYR B CE1   1 
ATOM   1232  C  CE2   . TYR B  2 72  ? -7.249  -29.224 31.278  1.00 46.51  ? 72   TYR B CE2   1 
ATOM   1233  C  CZ    . TYR B  2 72  ? -7.823  -29.082 32.514  1.00 46.87  ? 72   TYR B CZ    1 
ATOM   1234  O  OH    . TYR B  2 72  ? -9.037  -28.471 32.593  1.00 47.21  ? 72   TYR B OH    1 
ATOM   1235  N  N     . THR B  2 73  ? -1.982  -33.502 31.826  1.00 49.67  ? 73   THR B N     1 
ATOM   1236  C  CA    . THR B  2 73  ? -0.691  -34.033 31.389  1.00 51.42  ? 73   THR B CA    1 
ATOM   1237  C  C     . THR B  2 73  ? -0.837  -35.125 30.329  1.00 52.77  ? 73   THR B C     1 
ATOM   1238  O  O     . THR B  2 73  ? -0.127  -35.123 29.316  1.00 52.82  ? 73   THR B O     1 
ATOM   1239  C  CB    . THR B  2 73  ? 0.101   -34.634 32.552  1.00 51.72  ? 73   THR B CB    1 
ATOM   1240  O  OG1   . THR B  2 73  ? -0.059  -33.829 33.734  1.00 52.93  ? 73   THR B OG1   1 
ATOM   1241  C  CG2   . THR B  2 73  ? 1.573   -34.747 32.184  1.00 51.01  ? 73   THR B CG2   1 
ATOM   1242  N  N     . GLU B  2 74  ? -1.737  -36.074 30.574  1.00 54.06  ? 74   GLU B N     1 
ATOM   1243  C  CA    . GLU B  2 74  ? -1.920  -37.186 29.656  1.00 55.74  ? 74   GLU B CA    1 
ATOM   1244  C  C     . GLU B  2 74  ? -2.425  -36.658 28.342  1.00 56.16  ? 74   GLU B C     1 
ATOM   1245  O  O     . GLU B  2 74  ? -1.920  -37.023 27.281  1.00 56.36  ? 74   GLU B O     1 
ATOM   1246  C  CB    . GLU B  2 74  ? -2.912  -38.204 30.212  1.00 56.49  ? 74   GLU B CB    1 
ATOM   1247  C  CG    . GLU B  2 74  ? -2.328  -39.061 31.323  1.00 59.57  ? 74   GLU B CG    1 
ATOM   1248  C  CD    . GLU B  2 74  ? -3.391  -39.777 32.139  1.00 64.80  ? 74   GLU B CD    1 
ATOM   1249  O  OE1   . GLU B  2 74  ? -4.556  -39.293 32.246  1.00 65.32  ? 74   GLU B OE1   1 
ATOM   1250  O  OE2   . GLU B  2 74  ? -3.040  -40.843 32.690  1.00 69.40  ? 74   GLU B OE2   1 
ATOM   1251  N  N     . HIS B  2 75  ? -3.401  -35.759 28.401  1.00 56.59  ? 75   HIS B N     1 
ATOM   1252  C  CA    . HIS B  2 75  ? -3.908  -35.215 27.164  1.00 56.99  ? 75   HIS B CA    1 
ATOM   1253  C  C     . HIS B  2 75  ? -2.808  -34.614 26.288  1.00 57.23  ? 75   HIS B C     1 
ATOM   1254  O  O     . HIS B  2 75  ? -2.823  -34.770 25.069  1.00 57.89  ? 75   HIS B O     1 
ATOM   1255  C  CB    . HIS B  2 75  ? -5.015  -34.211 27.381  1.00 56.95  ? 75   HIS B CB    1 
ATOM   1256  C  CG    . HIS B  2 75  ? -5.564  -33.710 26.098  1.00 57.15  ? 75   HIS B CG    1 
ATOM   1257  N  ND1   . HIS B  2 75  ? -5.070  -32.584 25.474  1.00 58.26  ? 75   HIS B ND1   1 
ATOM   1258  C  CD2   . HIS B  2 75  ? -6.492  -34.231 25.266  1.00 57.01  ? 75   HIS B CD2   1 
ATOM   1259  C  CE1   . HIS B  2 75  ? -5.710  -32.405 24.332  1.00 58.60  ? 75   HIS B CE1   1 
ATOM   1260  N  NE2   . HIS B  2 75  ? -6.578  -33.392 24.183  1.00 59.34  ? 75   HIS B NE2   1 
ATOM   1261  N  N     . ALA B  2 76  ? -1.852  -33.935 26.909  1.00 57.05  ? 76   ALA B N     1 
ATOM   1262  C  CA    . ALA B  2 76  ? -0.750  -33.324 26.172  1.00 57.05  ? 76   ALA B CA    1 
ATOM   1263  C  C     . ALA B  2 76  ? 0.315   -34.336 25.701  1.00 57.31  ? 76   ALA B C     1 
ATOM   1264  O  O     . ALA B  2 76  ? 1.310   -33.952 25.070  1.00 57.32  ? 76   ALA B O     1 
ATOM   1265  C  CB    . ALA B  2 76  ? -0.118  -32.247 27.019  1.00 57.06  ? 76   ALA B CB    1 
ATOM   1266  N  N     . LYS B  2 77  ? 0.106   -35.617 26.015  1.00 57.35  ? 77   LYS B N     1 
ATOM   1267  C  CA    . LYS B  2 77  ? 1.090   -36.679 25.754  1.00 57.59  ? 77   LYS B CA    1 
ATOM   1268  C  C     . LYS B  2 77  ? 2.430   -36.400 26.443  1.00 56.98  ? 77   LYS B C     1 
ATOM   1269  O  O     . LYS B  2 77  ? 3.490   -36.608 25.867  1.00 57.29  ? 77   LYS B O     1 
ATOM   1270  C  CB    . LYS B  2 77  ? 1.284   -36.916 24.244  1.00 57.50  ? 77   LYS B CB    1 
ATOM   1271  C  CG    . LYS B  2 77  ? 0.031   -37.373 23.506  1.00 58.65  ? 77   LYS B CG    1 
ATOM   1272  C  CD    . LYS B  2 77  ? 0.311   -37.740 22.053  1.00 58.95  ? 77   LYS B CD    1 
ATOM   1273  C  CE    . LYS B  2 77  ? -0.978  -37.869 21.223  1.00 61.12  ? 77   LYS B CE    1 
ATOM   1274  N  NZ    . LYS B  2 77  ? -1.298  -36.601 20.436  1.00 64.95  ? 77   LYS B NZ    1 
ATOM   1275  N  N     . ARG B  2 78  ? 2.375   -35.917 27.675  1.00 56.58  ? 78   ARG B N     1 
ATOM   1276  C  CA    . ARG B  2 78  ? 3.577   -35.557 28.418  1.00 55.96  ? 78   ARG B CA    1 
ATOM   1277  C  C     . ARG B  2 78  ? 3.682   -36.505 29.595  1.00 55.89  ? 78   ARG B C     1 
ATOM   1278  O  O     . ARG B  2 78  ? 2.691   -37.108 29.994  1.00 55.38  ? 78   ARG B O     1 
ATOM   1279  C  CB    . ARG B  2 78  ? 3.521   -34.090 28.918  1.00 56.10  ? 78   ARG B CB    1 
ATOM   1280  C  CG    . ARG B  2 78  ? 3.984   -33.018 27.916  1.00 56.02  ? 78   ARG B CG    1 
ATOM   1281  C  CD    . ARG B  2 78  ? 4.083   -31.614 28.525  1.00 55.37  ? 78   ARG B CD    1 
ATOM   1282  N  NE    . ARG B  2 78  ? 2.764   -30.991 28.644  1.00 57.05  ? 78   ARG B NE    1 
ATOM   1283  C  CZ    . ARG B  2 78  ? 2.045   -30.914 29.773  1.00 55.86  ? 78   ARG B CZ    1 
ATOM   1284  N  NH1   . ARG B  2 78  ? 2.512   -31.399 30.924  1.00 56.49  ? 78   ARG B NH1   1 
ATOM   1285  N  NH2   . ARG B  2 78  ? 0.856   -30.337 29.761  1.00 52.20  ? 78   ARG B NH2   1 
ATOM   1286  N  N     . LYS B  2 79  ? 4.874   -36.624 30.161  1.00 56.07  ? 79   LYS B N     1 
ATOM   1287  C  CA    . LYS B  2 79  ? 5.060   -37.452 31.337  1.00 57.32  ? 79   LYS B CA    1 
ATOM   1288  C  C     . LYS B  2 79  ? 5.326   -36.563 32.550  1.00 56.73  ? 79   LYS B C     1 
ATOM   1289  O  O     . LYS B  2 79  ? 5.366   -37.040 33.696  1.00 57.26  ? 79   LYS B O     1 
ATOM   1290  C  CB    . LYS B  2 79  ? 6.201   -38.463 31.117  1.00 57.03  ? 79   LYS B CB    1 
ATOM   1291  C  CG    . LYS B  2 79  ? 6.122   -39.201 29.770  1.00 59.23  ? 79   LYS B CG    1 
ATOM   1292  C  CD    . LYS B  2 79  ? 7.312   -40.154 29.545  1.00 60.15  ? 79   LYS B CD    1 
ATOM   1293  C  CE    . LYS B  2 79  ? 6.894   -41.619 29.772  1.00 65.55  ? 79   LYS B CE    1 
ATOM   1294  N  NZ    . LYS B  2 79  ? 8.035   -42.466 30.263  1.00 68.70  ? 79   LYS B NZ    1 
ATOM   1295  N  N     . THR B  2 80  ? 5.503   -35.269 32.288  1.00 55.92  ? 80   THR B N     1 
ATOM   1296  C  CA    . THR B  2 80  ? 5.858   -34.303 33.330  1.00 55.06  ? 80   THR B CA    1 
ATOM   1297  C  C     . THR B  2 80  ? 4.677   -33.404 33.615  1.00 53.86  ? 80   THR B C     1 
ATOM   1298  O  O     . THR B  2 80  ? 4.207   -32.706 32.719  1.00 54.37  ? 80   THR B O     1 
ATOM   1299  C  CB    . THR B  2 80  ? 7.038   -33.406 32.890  1.00 55.59  ? 80   THR B CB    1 
ATOM   1300  O  OG1   . THR B  2 80  ? 8.102   -34.213 32.355  1.00 55.42  ? 80   THR B OG1   1 
ATOM   1301  C  CG2   . THR B  2 80  ? 7.557   -32.559 34.063  1.00 55.53  ? 80   THR B CG2   1 
ATOM   1302  N  N     . VAL B  2 81  ? 4.193   -33.427 34.848  1.00 52.22  ? 81   VAL B N     1 
ATOM   1303  C  CA    . VAL B  2 81  ? 3.126   -32.523 35.266  1.00 50.91  ? 81   VAL B CA    1 
ATOM   1304  C  C     . VAL B  2 81  ? 3.698   -31.122 35.435  1.00 50.14  ? 81   VAL B C     1 
ATOM   1305  O  O     . VAL B  2 81  ? 4.693   -30.924 36.140  1.00 49.98  ? 81   VAL B O     1 
ATOM   1306  C  CB    . VAL B  2 81  ? 2.458   -32.983 36.577  1.00 51.16  ? 81   VAL B CB    1 
ATOM   1307  C  CG1   . VAL B  2 81  ? 1.348   -31.992 37.018  1.00 49.20  ? 81   VAL B CG1   1 
ATOM   1308  C  CG2   . VAL B  2 81  ? 1.910   -34.428 36.414  1.00 51.21  ? 81   VAL B CG2   1 
ATOM   1309  N  N     . THR B  2 82  ? 3.074   -30.154 34.774  1.00 48.86  ? 82   THR B N     1 
ATOM   1310  C  CA    . THR B  2 82  ? 3.565   -28.783 34.785  1.00 47.65  ? 82   THR B CA    1 
ATOM   1311  C  C     . THR B  2 82  ? 2.728   -27.919 35.707  1.00 47.06  ? 82   THR B C     1 
ATOM   1312  O  O     . THR B  2 82  ? 1.620   -28.297 36.110  1.00 47.19  ? 82   THR B O     1 
ATOM   1313  C  CB    . THR B  2 82  ? 3.502   -28.167 33.372  1.00 47.39  ? 82   THR B CB    1 
ATOM   1314  O  OG1   . THR B  2 82  ? 2.136   -28.166 32.915  1.00 48.38  ? 82   THR B OG1   1 
ATOM   1315  C  CG2   . THR B  2 82  ? 4.319   -28.968 32.415  1.00 46.54  ? 82   THR B CG2   1 
ATOM   1316  N  N     . ALA B  2 83  ? 3.247   -26.731 35.997  1.00 46.84  ? 83   ALA B N     1 
ATOM   1317  C  CA    . ALA B  2 83  ? 2.535   -25.705 36.761  1.00 45.81  ? 83   ALA B CA    1 
ATOM   1318  C  C     . ALA B  2 83  ? 1.225   -25.396 36.092  1.00 45.46  ? 83   ALA B C     1 
ATOM   1319  O  O     . ALA B  2 83  ? 0.200   -25.197 36.745  1.00 45.03  ? 83   ALA B O     1 
ATOM   1320  C  CB    . ALA B  2 83  ? 3.372   -24.479 36.854  1.00 45.47  ? 83   ALA B CB    1 
ATOM   1321  N  N     . MET B  2 84  ? 1.247   -25.403 34.772  1.00 45.84  ? 84   MET B N     1 
ATOM   1322  C  CA    . MET B  2 84  ? 0.043   -25.102 34.026  1.00 46.75  ? 84   MET B CA    1 
ATOM   1323  C  C     . MET B  2 84  ? -1.057  -26.166 34.181  1.00 46.17  ? 84   MET B C     1 
ATOM   1324  O  O     . MET B  2 84  ? -2.237  -25.805 34.290  1.00 46.16  ? 84   MET B O     1 
ATOM   1325  C  CB    . MET B  2 84  ? 0.352   -24.804 32.552  1.00 47.32  ? 84   MET B CB    1 
ATOM   1326  C  CG    . MET B  2 84  ? 1.104   -23.475 32.322  1.00 50.56  ? 84   MET B CG    1 
ATOM   1327  S  SD    . MET B  2 84  ? 0.458   -22.019 33.251  1.00 59.34  ? 84   MET B SD    1 
ATOM   1328  C  CE    . MET B  2 84  ? -1.234  -21.843 32.604  1.00 58.08  ? 84   MET B CE    1 
ATOM   1329  N  N     . ASP B  2 85  ? -0.685  -27.452 34.207  1.00 44.93  ? 85   ASP B N     1 
ATOM   1330  C  CA    . ASP B  2 85  ? -1.688  -28.503 34.406  1.00 43.84  ? 85   ASP B CA    1 
ATOM   1331  C  C     . ASP B  2 85  ? -2.352  -28.292 35.737  1.00 42.41  ? 85   ASP B C     1 
ATOM   1332  O  O     . ASP B  2 85  ? -3.567  -28.382 35.837  1.00 42.10  ? 85   ASP B O     1 
ATOM   1333  C  CB    . ASP B  2 85  ? -1.095  -29.919 34.357  1.00 44.56  ? 85   ASP B CB    1 
ATOM   1334  C  CG    . ASP B  2 85  ? -0.333  -30.215 33.065  1.00 47.34  ? 85   ASP B CG    1 
ATOM   1335  O  OD1   . ASP B  2 85  ? -0.820  -29.871 31.954  1.00 48.43  ? 85   ASP B OD1   1 
ATOM   1336  O  OD2   . ASP B  2 85  ? 0.768   -30.820 33.177  1.00 50.81  ? 85   ASP B OD2   1 
ATOM   1337  N  N     . VAL B  2 86  ? -1.555  -27.997 36.761  1.00 41.36  ? 86   VAL B N     1 
ATOM   1338  C  CA    . VAL B  2 86  ? -2.094  -27.682 38.095  1.00 40.72  ? 86   VAL B CA    1 
ATOM   1339  C  C     . VAL B  2 86  ? -2.950  -26.397 38.106  1.00 41.61  ? 86   VAL B C     1 
ATOM   1340  O  O     . VAL B  2 86  ? -4.040  -26.385 38.707  1.00 41.78  ? 86   VAL B O     1 
ATOM   1341  C  CB    . VAL B  2 86  ? -0.979  -27.501 39.106  1.00 40.64  ? 86   VAL B CB    1 
ATOM   1342  C  CG1   . VAL B  2 86  ? -1.541  -27.172 40.449  1.00 38.59  ? 86   VAL B CG1   1 
ATOM   1343  C  CG2   . VAL B  2 86  ? -0.057  -28.751 39.143  1.00 40.12  ? 86   VAL B CG2   1 
ATOM   1344  N  N     . VAL B  2 87  ? -2.466  -25.327 37.447  1.00 41.30  ? 87   VAL B N     1 
ATOM   1345  C  CA    . VAL B  2 87  ? -3.192  -24.062 37.421  1.00 41.33  ? 87   VAL B CA    1 
ATOM   1346  C  C     . VAL B  2 87  ? -4.538  -24.253 36.728  1.00 42.32  ? 87   VAL B C     1 
ATOM   1347  O  O     . VAL B  2 87  ? -5.548  -23.732 37.204  1.00 42.17  ? 87   VAL B O     1 
ATOM   1348  C  CB    . VAL B  2 87  ? -2.328  -22.890 36.800  1.00 41.85  ? 87   VAL B CB    1 
ATOM   1349  C  CG1   . VAL B  2 87  ? -3.157  -21.746 36.316  1.00 38.17  ? 87   VAL B CG1   1 
ATOM   1350  C  CG2   . VAL B  2 87  ? -1.247  -22.396 37.813  1.00 40.84  ? 87   VAL B CG2   1 
ATOM   1351  N  N     . TYR B  2 88  ? -4.538  -25.014 35.630  1.00 43.64  ? 88   TYR B N     1 
ATOM   1352  C  CA    . TYR B  2 88  ? -5.745  -25.385 34.893  1.00 44.77  ? 88   TYR B CA    1 
ATOM   1353  C  C     . TYR B  2 88  ? -6.646  -26.286 35.712  1.00 44.64  ? 88   TYR B C     1 
ATOM   1354  O  O     . TYR B  2 88  ? -7.871  -26.137 35.692  1.00 45.02  ? 88   TYR B O     1 
ATOM   1355  C  CB    . TYR B  2 88  ? -5.416  -26.102 33.582  1.00 46.48  ? 88   TYR B CB    1 
ATOM   1356  C  CG    . TYR B  2 88  ? -4.659  -25.302 32.550  1.00 49.15  ? 88   TYR B CG    1 
ATOM   1357  C  CD1   . TYR B  2 88  ? -3.700  -25.907 31.758  1.00 52.51  ? 88   TYR B CD1   1 
ATOM   1358  C  CD2   . TYR B  2 88  ? -4.904  -23.942 32.353  1.00 52.90  ? 88   TYR B CD2   1 
ATOM   1359  C  CE1   . TYR B  2 88  ? -2.981  -25.181 30.794  1.00 53.35  ? 88   TYR B CE1   1 
ATOM   1360  C  CE2   . TYR B  2 88  ? -4.187  -23.204 31.392  1.00 53.32  ? 88   TYR B CE2   1 
ATOM   1361  C  CZ    . TYR B  2 88  ? -3.231  -23.837 30.617  1.00 52.99  ? 88   TYR B CZ    1 
ATOM   1362  O  OH    . TYR B  2 88  ? -2.521  -23.133 29.647  1.00 54.44  ? 88   TYR B OH    1 
ATOM   1363  N  N     . ALA B  2 89  ? -6.043  -27.223 36.441  1.00 44.47  ? 89   ALA B N     1 
ATOM   1364  C  CA    . ALA B  2 89  ? -6.804  -28.125 37.309  1.00 43.99  ? 89   ALA B CA    1 
ATOM   1365  C  C     . ALA B  2 89  ? -7.501  -27.326 38.393  1.00 44.21  ? 89   ALA B C     1 
ATOM   1366  O  O     . ALA B  2 89  ? -8.709  -27.473 38.587  1.00 44.96  ? 89   ALA B O     1 
ATOM   1367  C  CB    . ALA B  2 89  ? -5.915  -29.215 37.905  1.00 42.67  ? 89   ALA B CB    1 
ATOM   1368  N  N     . LEU B  2 90  ? -6.764  -26.452 39.078  1.00 44.57  ? 90   LEU B N     1 
ATOM   1369  C  CA    . LEU B  2 90  ? -7.382  -25.595 40.088  1.00 45.28  ? 90   LEU B CA    1 
ATOM   1370  C  C     . LEU B  2 90  ? -8.486  -24.709 39.505  1.00 46.60  ? 90   LEU B C     1 
ATOM   1371  O  O     . LEU B  2 90  ? -9.541  -24.555 40.120  1.00 46.61  ? 90   LEU B O     1 
ATOM   1372  C  CB    . LEU B  2 90  ? -6.334  -24.761 40.808  1.00 44.75  ? 90   LEU B CB    1 
ATOM   1373  C  CG    . LEU B  2 90  ? -5.392  -25.535 41.733  1.00 43.19  ? 90   LEU B CG    1 
ATOM   1374  C  CD1   . LEU B  2 90  ? -4.098  -24.745 41.927  1.00 40.73  ? 90   LEU B CD1   1 
ATOM   1375  C  CD2   . LEU B  2 90  ? -6.109  -25.853 43.042  1.00 37.45  ? 90   LEU B CD2   1 
ATOM   1376  N  N     . LYS B  2 91  ? -8.270  -24.162 38.312  1.00 47.93  ? 91   LYS B N     1 
ATOM   1377  C  CA    . LYS B  2 91  ? -9.292  -23.323 37.704  1.00 50.24  ? 91   LYS B CA    1 
ATOM   1378  C  C     . LYS B  2 91  ? -10.595 -24.085 37.555  1.00 50.60  ? 91   LYS B C     1 
ATOM   1379  O  O     . LYS B  2 91  ? -11.658 -23.587 37.929  1.00 50.35  ? 91   LYS B O     1 
ATOM   1380  C  CB    . LYS B  2 91  ? -8.857  -22.734 36.361  1.00 50.54  ? 91   LYS B CB    1 
ATOM   1381  C  CG    . LYS B  2 91  ? -9.767  -21.590 35.926  1.00 54.78  ? 91   LYS B CG    1 
ATOM   1382  C  CD    . LYS B  2 91  ? -9.047  -20.570 35.041  1.00 61.85  ? 91   LYS B CD    1 
ATOM   1383  C  CE    . LYS B  2 91  ? -9.068  -21.003 33.557  1.00 66.82  ? 91   LYS B CE    1 
ATOM   1384  N  NZ    . LYS B  2 91  ? -8.058  -20.249 32.721  1.00 70.09  ? 91   LYS B NZ    1 
ATOM   1385  N  N     . ARG B  2 92  ? -10.491 -25.306 37.033  1.00 51.75  ? 92   ARG B N     1 
ATOM   1386  C  CA    . ARG B  2 92  ? -11.639 -26.199 36.883  1.00 52.61  ? 92   ARG B CA    1 
ATOM   1387  C  C     . ARG B  2 92  ? -12.428 -26.393 38.165  1.00 52.01  ? 92   ARG B C     1 
ATOM   1388  O  O     . ARG B  2 92  ? -13.642 -26.460 38.108  1.00 51.94  ? 92   ARG B O     1 
ATOM   1389  C  CB    . ARG B  2 92  ? -11.199 -27.562 36.360  1.00 53.35  ? 92   ARG B CB    1 
ATOM   1390  C  CG    . ARG B  2 92  ? -11.185 -27.649 34.845  1.00 56.47  ? 92   ARG B CG    1 
ATOM   1391  C  CD    . ARG B  2 92  ? -11.597 -29.045 34.411  1.00 60.63  ? 92   ARG B CD    1 
ATOM   1392  N  NE    . ARG B  2 92  ? -12.965 -29.314 34.851  1.00 64.78  ? 92   ARG B NE    1 
ATOM   1393  C  CZ    . ARG B  2 92  ? -13.291 -30.105 35.874  1.00 66.41  ? 92   ARG B CZ    1 
ATOM   1394  N  NH1   . ARG B  2 92  ? -12.334 -30.744 36.552  1.00 67.36  ? 92   ARG B NH1   1 
ATOM   1395  N  NH2   . ARG B  2 92  ? -14.576 -30.265 36.212  1.00 65.17  ? 92   ARG B NH2   1 
ATOM   1396  N  N     . GLN B  2 93  ? -11.749 -26.497 39.307  1.00 51.38  ? 93   GLN B N     1 
ATOM   1397  C  CA    . GLN B  2 93  ? -12.449 -26.679 40.568  1.00 51.21  ? 93   GLN B CA    1 
ATOM   1398  C  C     . GLN B  2 93  ? -12.880 -25.359 41.173  1.00 50.64  ? 93   GLN B C     1 
ATOM   1399  O  O     . GLN B  2 93  ? -13.214 -25.330 42.346  1.00 51.36  ? 93   GLN B O     1 
ATOM   1400  C  CB    . GLN B  2 93  ? -11.597 -27.409 41.616  1.00 52.07  ? 93   GLN B CB    1 
ATOM   1401  C  CG    . GLN B  2 93  ? -10.655 -28.528 41.122  1.00 54.72  ? 93   GLN B CG    1 
ATOM   1402  C  CD    . GLN B  2 93  ? -11.309 -29.878 41.026  1.00 57.53  ? 93   GLN B CD    1 
ATOM   1403  O  OE1   . GLN B  2 93  ? -12.130 -30.252 41.871  1.00 61.00  ? 93   GLN B OE1   1 
ATOM   1404  N  NE2   . GLN B  2 93  ? -10.935 -30.638 40.004  1.00 57.94  ? 93   GLN B NE2   1 
ATOM   1405  N  N     . GLY B  2 94  ? -12.870 -24.269 40.396  1.00 49.97  ? 94   GLY B N     1 
ATOM   1406  C  CA    . GLY B  2 94  ? -13.209 -22.933 40.910  1.00 48.29  ? 94   GLY B CA    1 
ATOM   1407  C  C     . GLY B  2 94  ? -12.261 -22.456 42.009  1.00 47.76  ? 94   GLY B C     1 
ATOM   1408  O  O     . GLY B  2 94  ? -12.690 -21.876 42.998  1.00 48.05  ? 94   GLY B O     1 
ATOM   1409  N  N     . ARG B  2 95  ? -10.968 -22.715 41.851  1.00 46.69  ? 95   ARG B N     1 
ATOM   1410  C  CA    . ARG B  2 95  ? -9.989  -22.317 42.847  1.00 45.66  ? 95   ARG B CA    1 
ATOM   1411  C  C     . ARG B  2 95  ? -8.774  -21.744 42.171  1.00 44.93  ? 95   ARG B C     1 
ATOM   1412  O  O     . ARG B  2 95  ? -7.641  -22.127 42.482  1.00 44.94  ? 95   ARG B O     1 
ATOM   1413  C  CB    . ARG B  2 95  ? -9.602  -23.485 43.752  1.00 45.69  ? 95   ARG B CB    1 
ATOM   1414  C  CG    . ARG B  2 95  ? -10.749 -23.978 44.601  1.00 48.21  ? 95   ARG B CG    1 
ATOM   1415  C  CD    . ARG B  2 95  ? -10.276 -24.717 45.803  1.00 51.74  ? 95   ARG B CD    1 
ATOM   1416  N  NE    . ARG B  2 95  ? -9.668  -23.781 46.748  1.00 58.17  ? 95   ARG B NE    1 
ATOM   1417  C  CZ    . ARG B  2 95  ? -10.325 -23.151 47.727  1.00 60.36  ? 95   ARG B CZ    1 
ATOM   1418  N  NH1   . ARG B  2 95  ? -11.639 -23.360 47.899  1.00 61.42  ? 95   ARG B NH1   1 
ATOM   1419  N  NH2   . ARG B  2 95  ? -9.664  -22.318 48.539  1.00 57.72  ? 95   ARG B NH2   1 
ATOM   1420  N  N     . THR B  2 96  ? -9.033  -20.826 41.242  1.00 43.95  ? 96   THR B N     1 
ATOM   1421  C  CA    . THR B  2 96  ? -8.024  -20.081 40.495  1.00 43.02  ? 96   THR B CA    1 
ATOM   1422  C  C     . THR B  2 96  ? -6.843  -19.681 41.355  1.00 41.73  ? 96   THR B C     1 
ATOM   1423  O  O     . THR B  2 96  ? -7.014  -19.184 42.448  1.00 41.76  ? 96   THR B O     1 
ATOM   1424  C  CB    . THR B  2 96  ? -8.657  -18.814 39.879  1.00 43.20  ? 96   THR B CB    1 
ATOM   1425  O  OG1   . THR B  2 96  ? -9.714  -19.203 39.007  1.00 45.30  ? 96   THR B OG1   1 
ATOM   1426  C  CG2   . THR B  2 96  ? -7.664  -18.039 39.063  1.00 42.74  ? 96   THR B CG2   1 
ATOM   1427  N  N     . LEU B  2 97  ? -5.644  -19.899 40.847  1.00 40.49  ? 97   LEU B N     1 
ATOM   1428  C  CA    . LEU B  2 97  ? -4.451  -19.542 41.562  1.00 39.70  ? 97   LEU B CA    1 
ATOM   1429  C  C     . LEU B  2 97  ? -3.626  -18.537 40.757  1.00 39.85  ? 97   LEU B C     1 
ATOM   1430  O  O     . LEU B  2 97  ? -3.408  -18.702 39.557  1.00 39.17  ? 97   LEU B O     1 
ATOM   1431  C  CB    . LEU B  2 97  ? -3.632  -20.795 41.853  1.00 39.18  ? 97   LEU B CB    1 
ATOM   1432  C  CG    . LEU B  2 97  ? -2.294  -20.586 42.550  1.00 38.71  ? 97   LEU B CG    1 
ATOM   1433  C  CD1   . LEU B  2 97  ? -2.573  -20.237 43.938  1.00 37.86  ? 97   LEU B CD1   1 
ATOM   1434  C  CD2   . LEU B  2 97  ? -1.451  -21.812 42.500  1.00 41.14  ? 97   LEU B CD2   1 
ATOM   1435  N  N     . TYR B  2 98  ? -3.156  -17.501 41.433  1.00 39.95  ? 98   TYR B N     1 
ATOM   1436  C  CA    . TYR B  2 98  ? -2.327  -16.510 40.776  1.00 41.15  ? 98   TYR B CA    1 
ATOM   1437  C  C     . TYR B  2 98  ? -0.884  -16.711 41.224  1.00 41.69  ? 98   TYR B C     1 
ATOM   1438  O  O     . TYR B  2 98  ? -0.623  -16.875 42.414  1.00 40.77  ? 98   TYR B O     1 
ATOM   1439  C  CB    . TYR B  2 98  ? -2.772  -15.084 41.161  1.00 40.74  ? 98   TYR B CB    1 
ATOM   1440  C  CG    . TYR B  2 98  ? -4.052  -14.531 40.545  1.00 39.89  ? 98   TYR B CG    1 
ATOM   1441  C  CD1   . TYR B  2 98  ? -4.878  -15.300 39.720  1.00 39.07  ? 98   TYR B CD1   1 
ATOM   1442  C  CD2   . TYR B  2 98  ? -4.442  -13.212 40.827  1.00 38.20  ? 98   TYR B CD2   1 
ATOM   1443  C  CE1   . TYR B  2 98  ? -6.062  -14.758 39.186  1.00 40.61  ? 98   TYR B CE1   1 
ATOM   1444  C  CE2   . TYR B  2 98  ? -5.597  -12.659 40.305  1.00 37.40  ? 98   TYR B CE2   1 
ATOM   1445  C  CZ    . TYR B  2 98  ? -6.409  -13.417 39.488  1.00 40.65  ? 98   TYR B CZ    1 
ATOM   1446  O  OH    . TYR B  2 98  ? -7.547  -12.842 38.981  1.00 37.58  ? 98   TYR B OH    1 
ATOM   1447  N  N     . GLY B  2 99  ? 0.039   -16.679 40.272  1.00 42.86  ? 99   GLY B N     1 
ATOM   1448  C  CA    . GLY B  2 99  ? 1.453   -16.749 40.588  1.00 45.23  ? 99   GLY B CA    1 
ATOM   1449  C  C     . GLY B  2 99  ? 2.266   -17.814 39.881  1.00 47.23  ? 99   GLY B C     1 
ATOM   1450  O  O     . GLY B  2 99  ? 3.475   -17.874 40.081  1.00 48.74  ? 99   GLY B O     1 
ATOM   1451  N  N     . PHE B  2 100 ? 1.637   -18.653 39.055  1.00 48.30  ? 100  PHE B N     1 
ATOM   1452  C  CA    . PHE B  2 100 ? 2.340   -19.757 38.412  1.00 48.72  ? 100  PHE B CA    1 
ATOM   1453  C  C     . PHE B  2 100 ? 2.062   -19.912 36.898  1.00 50.97  ? 100  PHE B C     1 
ATOM   1454  O  O     . PHE B  2 100 ? 2.226   -21.020 36.319  1.00 51.70  ? 100  PHE B O     1 
ATOM   1455  C  CB    . PHE B  2 100 ? 2.021   -21.061 39.155  1.00 47.41  ? 100  PHE B CB    1 
ATOM   1456  C  CG    . PHE B  2 100 ? 2.540   -21.102 40.561  1.00 45.41  ? 100  PHE B CG    1 
ATOM   1457  C  CD1   . PHE B  2 100 ? 1.737   -20.752 41.618  1.00 44.10  ? 100  PHE B CD1   1 
ATOM   1458  C  CD2   . PHE B  2 100 ? 3.853   -21.485 40.828  1.00 41.60  ? 100  PHE B CD2   1 
ATOM   1459  C  CE1   . PHE B  2 100 ? 2.232   -20.803 42.919  1.00 43.64  ? 100  PHE B CE1   1 
ATOM   1460  C  CE2   . PHE B  2 100 ? 4.346   -21.522 42.117  1.00 38.69  ? 100  PHE B CE2   1 
ATOM   1461  C  CZ    . PHE B  2 100 ? 3.535   -21.192 43.161  1.00 41.62  ? 100  PHE B CZ    1 
ATOM   1462  N  N     . GLY B  2 101 ? 1.675   -18.824 36.243  1.00 52.21  ? 101  GLY B N     1 
ATOM   1463  C  CA    . GLY B  2 101 ? 1.356   -18.878 34.818  1.00 54.69  ? 101  GLY B CA    1 
ATOM   1464  C  C     . GLY B  2 101 ? -0.147  -18.799 34.648  1.00 56.89  ? 101  GLY B C     1 
ATOM   1465  O  O     . GLY B  2 101 ? -0.891  -18.688 35.638  1.00 57.08  ? 101  GLY B O     1 
ATOM   1466  N  N     . GLY B  2 102 ? -0.606  -18.827 33.398  1.00 58.87  ? 102  GLY B N     1 
ATOM   1467  C  CA    . GLY B  2 102 ? -2.031  -18.568 33.091  1.00 60.96  ? 102  GLY B CA    1 
ATOM   1468  C  C     . GLY B  2 102 ? -2.439  -17.096 33.229  1.00 62.71  ? 102  GLY B C     1 
ATOM   1469  O  O     . GLY B  2 102 ? -3.653  -16.800 33.317  1.00 63.75  ? 102  GLY B O     1 
ATOM   1470  O  OXT   . GLY B  2 102 ? -1.600  -16.148 33.268  1.00 63.19  ? 102  GLY B OXT   1 
ATOM   1471  N  N     . THR C  3 16  ? -27.454 -41.714 7.317   1.00 83.75  ? 16   THR C N     1 
ATOM   1472  C  CA    . THR C  3 16  ? -27.007 -40.824 8.434   1.00 83.68  ? 16   THR C CA    1 
ATOM   1473  C  C     . THR C  3 16  ? -25.790 -41.373 9.164   1.00 83.36  ? 16   THR C C     1 
ATOM   1474  O  O     . THR C  3 16  ? -25.636 -42.594 9.334   1.00 83.69  ? 16   THR C O     1 
ATOM   1475  C  CB    . THR C  3 16  ? -28.089 -40.623 9.512   1.00 83.76  ? 16   THR C CB    1 
ATOM   1476  O  OG1   . THR C  3 16  ? -28.219 -41.826 10.285  1.00 84.38  ? 16   THR C OG1   1 
ATOM   1477  C  CG2   . THR C  3 16  ? -29.436 -40.231 8.898   1.00 83.79  ? 16   THR C CG2   1 
ATOM   1478  N  N     . ARG C  3 17  ? -24.955 -40.449 9.628   1.00 82.76  ? 17   ARG C N     1 
ATOM   1479  C  CA    . ARG C  3 17  ? -23.783 -40.777 10.413  1.00 81.95  ? 17   ARG C CA    1 
ATOM   1480  C  C     . ARG C  3 17  ? -24.164 -41.454 11.723  1.00 81.72  ? 17   ARG C C     1 
ATOM   1481  O  O     . ARG C  3 17  ? -23.394 -42.251 12.256  1.00 81.66  ? 17   ARG C O     1 
ATOM   1482  C  CB    . ARG C  3 17  ? -22.981 -39.512 10.684  1.00 82.03  ? 17   ARG C CB    1 
ATOM   1483  C  CG    . ARG C  3 17  ? -22.368 -38.898 9.440   1.00 81.60  ? 17   ARG C CG    1 
ATOM   1484  C  CD    . ARG C  3 17  ? -21.474 -37.733 9.780   1.00 80.93  ? 17   ARG C CD    1 
ATOM   1485  N  NE    . ARG C  3 17  ? -22.227 -36.482 9.876   1.00 81.40  ? 17   ARG C NE    1 
ATOM   1486  C  CZ    . ARG C  3 17  ? -21.691 -35.290 10.134  1.00 80.93  ? 17   ARG C CZ    1 
ATOM   1487  N  NH1   . ARG C  3 17  ? -20.384 -35.166 10.334  1.00 80.30  ? 17   ARG C NH1   1 
ATOM   1488  N  NH2   . ARG C  3 17  ? -22.467 -34.220 10.195  1.00 80.94  ? 17   ARG C NH2   1 
ATOM   1489  N  N     . SER C  3 18  ? -25.356 -41.147 12.229  1.00 81.43  ? 18   SER C N     1 
ATOM   1490  C  CA    . SER C  3 18  ? -25.858 -41.764 13.459  1.00 81.56  ? 18   SER C CA    1 
ATOM   1491  C  C     . SER C  3 18  ? -25.967 -43.282 13.361  1.00 81.81  ? 18   SER C C     1 
ATOM   1492  O  O     . SER C  3 18  ? -25.646 -43.999 14.320  1.00 82.10  ? 18   SER C O     1 
ATOM   1493  C  CB    . SER C  3 18  ? -27.223 -41.196 13.825  1.00 81.24  ? 18   SER C CB    1 
ATOM   1494  O  OG    . SER C  3 18  ? -27.111 -39.832 14.162  1.00 81.48  ? 18   SER C OG    1 
ATOM   1495  N  N     . SER C  3 19  ? -26.435 -43.760 12.207  1.00 81.72  ? 19   SER C N     1 
ATOM   1496  C  CA    . SER C  3 19  ? -26.623 -45.186 11.978  1.00 81.56  ? 19   SER C CA    1 
ATOM   1497  C  C     . SER C  3 19  ? -25.267 -45.871 11.815  1.00 81.27  ? 19   SER C C     1 
ATOM   1498  O  O     . SER C  3 19  ? -25.018 -46.909 12.435  1.00 81.19  ? 19   SER C O     1 
ATOM   1499  C  CB    . SER C  3 19  ? -27.540 -45.431 10.772  1.00 81.72  ? 19   SER C CB    1 
ATOM   1500  O  OG    . SER C  3 19  ? -27.133 -44.658 9.648   1.00 82.86  ? 19   SER C OG    1 
ATOM   1501  N  N     . ARG C  3 20  ? -24.383 -45.275 11.012  1.00 80.84  ? 20   ARG C N     1 
ATOM   1502  C  CA    . ARG C  3 20  ? -23.004 -45.770 10.880  1.00 80.51  ? 20   ARG C CA    1 
ATOM   1503  C  C     . ARG C  3 20  ? -22.345 -45.952 12.245  1.00 79.88  ? 20   ARG C C     1 
ATOM   1504  O  O     . ARG C  3 20  ? -21.350 -46.677 12.369  1.00 80.13  ? 20   ARG C O     1 
ATOM   1505  C  CB    . ARG C  3 20  ? -22.146 -44.815 10.044  1.00 80.68  ? 20   ARG C CB    1 
ATOM   1506  C  CG    . ARG C  3 20  ? -22.605 -44.628 8.612   1.00 82.25  ? 20   ARG C CG    1 
ATOM   1507  C  CD    . ARG C  3 20  ? -21.559 -43.881 7.803   1.00 84.85  ? 20   ARG C CD    1 
ATOM   1508  N  NE    . ARG C  3 20  ? -22.062 -43.467 6.491   1.00 87.39  ? 20   ARG C NE    1 
ATOM   1509  C  CZ    . ARG C  3 20  ? -21.882 -44.146 5.354   1.00 88.94  ? 20   ARG C CZ    1 
ATOM   1510  N  NH1   . ARG C  3 20  ? -21.208 -45.297 5.345   1.00 88.38  ? 20   ARG C NH1   1 
ATOM   1511  N  NH2   . ARG C  3 20  ? -22.374 -43.669 4.215   1.00 89.15  ? 20   ARG C NH2   1 
ATOM   1512  N  N     . ALA C  3 21  ? -22.905 -45.291 13.260  1.00 78.78  ? 21   ALA C N     1 
ATOM   1513  C  CA    . ALA C  3 21  ? -22.343 -45.305 14.604  1.00 77.80  ? 21   ALA C CA    1 
ATOM   1514  C  C     . ALA C  3 21  ? -23.259 -45.972 15.622  1.00 76.92  ? 21   ALA C C     1 
ATOM   1515  O  O     . ALA C  3 21  ? -22.888 -46.153 16.780  1.00 76.67  ? 21   ALA C O     1 
ATOM   1516  C  CB    . ALA C  3 21  ? -21.998 -43.897 15.038  1.00 78.04  ? 21   ALA C CB    1 
ATOM   1517  N  N     . GLY C  3 22  ? -24.456 -46.338 15.187  1.00 76.23  ? 22   GLY C N     1 
ATOM   1518  C  CA    . GLY C  3 22  ? -25.388 -47.071 16.037  1.00 75.38  ? 22   GLY C CA    1 
ATOM   1519  C  C     . GLY C  3 22  ? -25.916 -46.248 17.186  1.00 74.63  ? 22   GLY C C     1 
ATOM   1520  O  O     . GLY C  3 22  ? -26.128 -46.757 18.285  1.00 74.44  ? 22   GLY C O     1 
ATOM   1521  N  N     . LEU C  3 23  ? -26.145 -44.970 16.920  1.00 74.37  ? 23   LEU C N     1 
ATOM   1522  C  CA    . LEU C  3 23  ? -26.641 -44.060 17.940  1.00 74.00  ? 23   LEU C CA    1 
ATOM   1523  C  C     . LEU C  3 23  ? -28.020 -43.523 17.592  1.00 73.86  ? 23   LEU C C     1 
ATOM   1524  O  O     . LEU C  3 23  ? -28.314 -43.242 16.429  1.00 73.68  ? 23   LEU C O     1 
ATOM   1525  C  CB    . LEU C  3 23  ? -25.670 -42.891 18.121  1.00 73.72  ? 23   LEU C CB    1 
ATOM   1526  C  CG    . LEU C  3 23  ? -24.256 -43.250 18.579  1.00 73.70  ? 23   LEU C CG    1 
ATOM   1527  C  CD1   . LEU C  3 23  ? -23.294 -42.108 18.311  1.00 73.47  ? 23   LEU C CD1   1 
ATOM   1528  C  CD2   . LEU C  3 23  ? -24.253 -43.643 20.050  1.00 72.36  ? 23   LEU C CD2   1 
ATOM   1529  N  N     . GLN C  3 24  ? -28.845 -43.378 18.624  1.00 73.76  ? 24   GLN C N     1 
ATOM   1530  C  CA    . GLN C  3 24  ? -30.072 -42.585 18.571  1.00 73.63  ? 24   GLN C CA    1 
ATOM   1531  C  C     . GLN C  3 24  ? -29.834 -41.073 18.395  1.00 73.46  ? 24   GLN C C     1 
ATOM   1532  O  O     . GLN C  3 24  ? -30.557 -40.422 17.646  1.00 73.88  ? 24   GLN C O     1 
ATOM   1533  C  CB    . GLN C  3 24  ? -30.914 -42.852 19.818  1.00 73.81  ? 24   GLN C CB    1 
ATOM   1534  C  CG    . GLN C  3 24  ? -31.405 -44.303 19.935  1.00 74.80  ? 24   GLN C CG    1 
ATOM   1535  C  CD    . GLN C  3 24  ? -32.078 -44.798 18.655  1.00 76.00  ? 24   GLN C CD    1 
ATOM   1536  O  OE1   . GLN C  3 24  ? -33.272 -44.581 18.434  1.00 76.28  ? 24   GLN C OE1   1 
ATOM   1537  N  NE2   . GLN C  3 24  ? -31.304 -45.458 17.803  1.00 76.09  ? 24   GLN C NE2   1 
ATOM   1538  N  N     . PHE C  3 25  ? -28.820 -40.523 19.065  1.00 72.99  ? 25   PHE C N     1 
ATOM   1539  C  CA    . PHE C  3 25  ? -28.519 -39.083 18.990  1.00 72.25  ? 25   PHE C CA    1 
ATOM   1540  C  C     . PHE C  3 25  ? -27.901 -38.644 17.654  1.00 72.05  ? 25   PHE C C     1 
ATOM   1541  O  O     . PHE C  3 25  ? -27.078 -39.367 17.086  1.00 72.48  ? 25   PHE C O     1 
ATOM   1542  C  CB    . PHE C  3 25  ? -27.668 -38.647 20.193  1.00 72.00  ? 25   PHE C CB    1 
ATOM   1543  C  CG    . PHE C  3 25  ? -28.496 -38.288 21.403  1.00 71.56  ? 25   PHE C CG    1 
ATOM   1544  C  CD1   . PHE C  3 25  ? -29.357 -39.224 21.979  1.00 69.86  ? 25   PHE C CD1   1 
ATOM   1545  C  CD2   . PHE C  3 25  ? -28.451 -37.006 21.940  1.00 69.78  ? 25   PHE C CD2   1 
ATOM   1546  C  CE1   . PHE C  3 25  ? -30.141 -38.884 23.073  1.00 69.46  ? 25   PHE C CE1   1 
ATOM   1547  C  CE2   . PHE C  3 25  ? -29.236 -36.670 23.035  1.00 68.84  ? 25   PHE C CE2   1 
ATOM   1548  C  CZ    . PHE C  3 25  ? -30.080 -37.606 23.599  1.00 69.07  ? 25   PHE C CZ    1 
ATOM   1549  N  N     . PRO C  3 26  ? -28.293 -37.447 17.158  1.00 71.53  ? 26   PRO C N     1 
ATOM   1550  C  CA    . PRO C  3 26  ? -28.001 -36.992 15.805  1.00 70.75  ? 26   PRO C CA    1 
ATOM   1551  C  C     . PRO C  3 26  ? -26.574 -36.517 15.677  1.00 70.46  ? 26   PRO C C     1 
ATOM   1552  O  O     . PRO C  3 26  ? -26.233 -35.447 16.177  1.00 70.65  ? 26   PRO C O     1 
ATOM   1553  C  CB    . PRO C  3 26  ? -28.926 -35.790 15.649  1.00 70.98  ? 26   PRO C CB    1 
ATOM   1554  C  CG    . PRO C  3 26  ? -29.011 -35.229 17.010  1.00 70.60  ? 26   PRO C CG    1 
ATOM   1555  C  CD    . PRO C  3 26  ? -29.040 -36.420 17.917  1.00 71.50  ? 26   PRO C CD    1 
ATOM   1556  N  N     . VAL C  3 27  ? -25.759 -37.293 14.979  1.00 69.96  ? 27   VAL C N     1 
ATOM   1557  C  CA    . VAL C  3 27  ? -24.353 -36.974 14.800  1.00 69.26  ? 27   VAL C CA    1 
ATOM   1558  C  C     . VAL C  3 27  ? -24.147 -35.763 13.900  1.00 69.03  ? 27   VAL C C     1 
ATOM   1559  O  O     . VAL C  3 27  ? -23.108 -35.110 13.971  1.00 69.27  ? 27   VAL C O     1 
ATOM   1560  C  CB    . VAL C  3 27  ? -23.568 -38.217 14.306  1.00 69.28  ? 27   VAL C CB    1 
ATOM   1561  C  CG1   . VAL C  3 27  ? -22.145 -37.873 13.913  1.00 68.30  ? 27   VAL C CG1   1 
ATOM   1562  C  CG2   . VAL C  3 27  ? -23.574 -39.291 15.397  1.00 69.10  ? 27   VAL C CG2   1 
ATOM   1563  N  N     . GLY C  3 28  ? -25.140 -35.445 13.074  1.00 68.74  ? 28   GLY C N     1 
ATOM   1564  C  CA    . GLY C  3 28  ? -25.039 -34.298 12.156  1.00 68.33  ? 28   GLY C CA    1 
ATOM   1565  C  C     . GLY C  3 28  ? -25.281 -32.989 12.881  1.00 67.95  ? 28   GLY C C     1 
ATOM   1566  O  O     . GLY C  3 28  ? -24.513 -32.039 12.754  1.00 67.91  ? 28   GLY C O     1 
ATOM   1567  N  N     . ARG C  3 29  ? -26.353 -32.959 13.660  1.00 67.76  ? 29   ARG C N     1 
ATOM   1568  C  CA    . ARG C  3 29  ? -26.677 -31.821 14.490  1.00 67.69  ? 29   ARG C CA    1 
ATOM   1569  C  C     . ARG C  3 29  ? -25.554 -31.472 15.474  1.00 67.94  ? 29   ARG C C     1 
ATOM   1570  O  O     . ARG C  3 29  ? -25.084 -30.325 15.501  1.00 68.40  ? 29   ARG C O     1 
ATOM   1571  C  CB    . ARG C  3 29  ? -27.956 -32.096 15.250  1.00 67.56  ? 29   ARG C CB    1 
ATOM   1572  C  CG    . ARG C  3 29  ? -28.515 -30.881 15.904  1.00 67.16  ? 29   ARG C CG    1 
ATOM   1573  C  CD    . ARG C  3 29  ? -29.961 -30.791 15.510  1.00 68.43  ? 29   ARG C CD    1 
ATOM   1574  N  NE    . ARG C  3 29  ? -30.858 -31.062 16.616  1.00 67.23  ? 29   ARG C NE    1 
ATOM   1575  C  CZ    . ARG C  3 29  ? -32.158 -31.260 16.463  1.00 67.88  ? 29   ARG C CZ    1 
ATOM   1576  N  NH1   . ARG C  3 29  ? -32.685 -31.243 15.246  1.00 67.81  ? 29   ARG C NH1   1 
ATOM   1577  N  NH2   . ARG C  3 29  ? -32.928 -31.467 17.522  1.00 67.13  ? 29   ARG C NH2   1 
ATOM   1578  N  N     . VAL C  3 30  ? -25.131 -32.449 16.279  1.00 67.57  ? 30   VAL C N     1 
ATOM   1579  C  CA    . VAL C  3 30  ? -24.019 -32.252 17.206  1.00 67.18  ? 30   VAL C CA    1 
ATOM   1580  C  C     . VAL C  3 30  ? -22.822 -31.674 16.461  1.00 67.53  ? 30   VAL C C     1 
ATOM   1581  O  O     . VAL C  3 30  ? -22.138 -30.791 16.967  1.00 67.59  ? 30   VAL C O     1 
ATOM   1582  C  CB    . VAL C  3 30  ? -23.636 -33.555 17.934  1.00 67.09  ? 30   VAL C CB    1 
ATOM   1583  C  CG1   . VAL C  3 30  ? -22.284 -33.417 18.635  1.00 66.36  ? 30   VAL C CG1   1 
ATOM   1584  C  CG2   . VAL C  3 30  ? -24.736 -33.961 18.920  1.00 66.03  ? 30   VAL C CG2   1 
ATOM   1585  N  N     . HIS C  3 31  ? -22.607 -32.144 15.239  1.00 68.05  ? 31   HIS C N     1 
ATOM   1586  C  CA    . HIS C  3 31  ? -21.525 -31.646 14.401  1.00 68.74  ? 31   HIS C CA    1 
ATOM   1587  C  C     . HIS C  3 31  ? -21.742 -30.202 13.940  1.00 69.11  ? 31   HIS C C     1 
ATOM   1588  O  O     . HIS C  3 31  ? -20.812 -29.378 14.008  1.00 68.85  ? 31   HIS C O     1 
ATOM   1589  C  CB    . HIS C  3 31  ? -21.333 -32.557 13.198  1.00 68.81  ? 31   HIS C CB    1 
ATOM   1590  C  CG    . HIS C  3 31  ? -20.166 -32.187 12.349  1.00 70.02  ? 31   HIS C CG    1 
ATOM   1591  N  ND1   . HIS C  3 31  ? -18.942 -31.846 12.879  1.00 71.61  ? 31   HIS C ND1   1 
ATOM   1592  C  CD2   . HIS C  3 31  ? -20.029 -32.115 11.005  1.00 71.80  ? 31   HIS C CD2   1 
ATOM   1593  C  CE1   . HIS C  3 31  ? -18.102 -31.571 11.898  1.00 72.25  ? 31   HIS C CE1   1 
ATOM   1594  N  NE2   . HIS C  3 31  ? -18.735 -31.731 10.751  1.00 72.12  ? 31   HIS C NE2   1 
ATOM   1595  N  N     . ARG C  3 32  ? -22.958 -29.897 13.472  1.00 69.32  ? 32   ARG C N     1 
ATOM   1596  C  CA    . ARG C  3 32  ? -23.297 -28.521 13.122  1.00 69.79  ? 32   ARG C CA    1 
ATOM   1597  C  C     . ARG C  3 32  ? -23.075 -27.626 14.346  1.00 70.27  ? 32   ARG C C     1 
ATOM   1598  O  O     . ARG C  3 32  ? -22.340 -26.643 14.270  1.00 70.08  ? 32   ARG C O     1 
ATOM   1599  C  CB    . ARG C  3 32  ? -24.743 -28.411 12.622  1.00 69.70  ? 32   ARG C CB    1 
ATOM   1600  C  CG    . ARG C  3 32  ? -25.224 -26.973 12.359  1.00 68.83  ? 32   ARG C CG    1 
ATOM   1601  C  CD    . ARG C  3 32  ? -26.743 -26.926 12.259  1.00 67.64  ? 32   ARG C CD    1 
ATOM   1602  N  NE    . ARG C  3 32  ? -27.373 -26.680 13.552  1.00 67.51  ? 32   ARG C NE    1 
ATOM   1603  C  CZ    . ARG C  3 32  ? -28.546 -27.189 13.953  1.00 67.30  ? 32   ARG C CZ    1 
ATOM   1604  N  NH1   . ARG C  3 32  ? -29.249 -28.010 13.179  1.00 66.51  ? 32   ARG C NH1   1 
ATOM   1605  N  NH2   . ARG C  3 32  ? -29.011 -26.886 15.155  1.00 66.25  ? 32   ARG C NH2   1 
ATOM   1606  N  N     . LEU C  3 33  ? -23.689 -28.009 15.470  1.00 70.90  ? 33   LEU C N     1 
ATOM   1607  C  CA    . LEU C  3 33  ? -23.646 -27.250 16.714  1.00 71.74  ? 33   LEU C CA    1 
ATOM   1608  C  C     . LEU C  3 33  ? -22.241 -27.029 17.274  1.00 72.56  ? 33   LEU C C     1 
ATOM   1609  O  O     . LEU C  3 33  ? -21.995 -26.042 17.951  1.00 72.86  ? 33   LEU C O     1 
ATOM   1610  C  CB    . LEU C  3 33  ? -24.528 -27.908 17.771  1.00 71.61  ? 33   LEU C CB    1 
ATOM   1611  C  CG    . LEU C  3 33  ? -26.040 -27.689 17.743  1.00 71.63  ? 33   LEU C CG    1 
ATOM   1612  C  CD1   . LEU C  3 33  ? -26.663 -28.476 18.887  1.00 72.57  ? 33   LEU C CD1   1 
ATOM   1613  C  CD2   . LEU C  3 33  ? -26.413 -26.220 17.872  1.00 71.66  ? 33   LEU C CD2   1 
ATOM   1614  N  N     . LEU C  3 34  ? -21.321 -27.940 16.992  1.00 73.61  ? 34   LEU C N     1 
ATOM   1615  C  CA    . LEU C  3 34  ? -19.932 -27.726 17.355  1.00 74.67  ? 34   LEU C CA    1 
ATOM   1616  C  C     . LEU C  3 34  ? -19.240 -26.737 16.418  1.00 75.66  ? 34   LEU C C     1 
ATOM   1617  O  O     . LEU C  3 34  ? -18.212 -26.172 16.781  1.00 76.45  ? 34   LEU C O     1 
ATOM   1618  C  CB    . LEU C  3 34  ? -19.160 -29.044 17.355  1.00 74.69  ? 34   LEU C CB    1 
ATOM   1619  C  CG    . LEU C  3 34  ? -19.357 -30.075 18.468  1.00 74.63  ? 34   LEU C CG    1 
ATOM   1620  C  CD1   . LEU C  3 34  ? -18.734 -31.396 18.061  1.00 74.17  ? 34   LEU C CD1   1 
ATOM   1621  C  CD2   . LEU C  3 34  ? -18.774 -29.598 19.782  1.00 74.51  ? 34   LEU C CD2   1 
ATOM   1622  N  N     . ARG C  3 35  ? -19.775 -26.527 15.216  1.00 76.40  ? 35   ARG C N     1 
ATOM   1623  C  CA    . ARG C  3 35  ? -19.153 -25.571 14.279  1.00 77.22  ? 35   ARG C CA    1 
ATOM   1624  C  C     . ARG C  3 35  ? -19.630 -24.148 14.532  1.00 76.41  ? 35   ARG C C     1 
ATOM   1625  O  O     . ARG C  3 35  ? -18.871 -23.195 14.348  1.00 76.42  ? 35   ARG C O     1 
ATOM   1626  C  CB    . ARG C  3 35  ? -19.379 -25.975 12.814  1.00 76.98  ? 35   ARG C CB    1 
ATOM   1627  C  CG    . ARG C  3 35  ? -18.665 -27.263 12.429  1.00 78.73  ? 35   ARG C CG    1 
ATOM   1628  C  CD    . ARG C  3 35  ? -18.727 -27.577 10.938  1.00 79.90  ? 35   ARG C CD    1 
ATOM   1629  N  NE    . ARG C  3 35  ? -17.864 -28.720 10.607  1.00 86.88  ? 35   ARG C NE    1 
ATOM   1630  C  CZ    . ARG C  3 35  ? -17.610 -29.180 9.374   1.00 90.01  ? 35   ARG C CZ    1 
ATOM   1631  N  NH1   . ARG C  3 35  ? -18.139 -28.604 8.293   1.00 91.21  ? 35   ARG C NH1   1 
ATOM   1632  N  NH2   . ARG C  3 35  ? -16.806 -30.231 9.217   1.00 91.17  ? 35   ARG C NH2   1 
ATOM   1633  N  N     . LYS C  3 36  ? -20.881 -24.028 14.976  1.00 75.85  ? 36   LYS C N     1 
ATOM   1634  C  CA    . LYS C  3 36  ? -21.525 -22.742 15.247  1.00 75.64  ? 36   LYS C CA    1 
ATOM   1635  C  C     . LYS C  3 36  ? -21.222 -22.160 16.624  1.00 74.90  ? 36   LYS C C     1 
ATOM   1636  O  O     . LYS C  3 36  ? -21.597 -21.022 16.904  1.00 75.36  ? 36   LYS C O     1 
ATOM   1637  C  CB    . LYS C  3 36  ? -23.045 -22.872 15.136  1.00 75.54  ? 36   LYS C CB    1 
ATOM   1638  C  CG    . LYS C  3 36  ? -23.576 -22.952 13.713  1.00 76.91  ? 36   LYS C CG    1 
ATOM   1639  C  CD    . LYS C  3 36  ? -25.112 -22.883 13.713  1.00 76.87  ? 36   LYS C CD    1 
ATOM   1640  C  CE    . LYS C  3 36  ? -25.667 -22.694 12.300  1.00 79.06  ? 36   LYS C CE    1 
ATOM   1641  N  NZ    . LYS C  3 36  ? -27.160 -22.756 12.300  1.00 80.05  ? 36   LYS C NZ    1 
ATOM   1642  N  N     . GLY C  3 37  ? -20.584 -22.940 17.494  1.00 73.94  ? 37   GLY C N     1 
ATOM   1643  C  CA    . GLY C  3 37  ? -20.336 -22.506 18.867  1.00 72.02  ? 37   GLY C CA    1 
ATOM   1644  C  C     . GLY C  3 37  ? -18.953 -21.926 19.079  1.00 70.81  ? 37   GLY C C     1 
ATOM   1645  O  O     . GLY C  3 37  ? -18.581 -21.610 20.210  1.00 70.30  ? 37   GLY C O     1 
ATOM   1646  N  N     . ASN C  3 38  ? -18.191 -21.796 17.995  1.00 69.81  ? 38   ASN C N     1 
ATOM   1647  C  CA    . ASN C  3 38  ? -16.842 -21.239 18.063  1.00 69.22  ? 38   ASN C CA    1 
ATOM   1648  C  C     . ASN C  3 38  ? -15.974 -21.895 19.117  1.00 67.97  ? 38   ASN C C     1 
ATOM   1649  O  O     . ASN C  3 38  ? -15.334 -21.220 19.925  1.00 68.41  ? 38   ASN C O     1 
ATOM   1650  C  CB    . ASN C  3 38  ? -16.896 -19.737 18.360  1.00 69.89  ? 38   ASN C CB    1 
ATOM   1651  C  CG    . ASN C  3 38  ? -17.337 -18.941 17.176  1.00 71.15  ? 38   ASN C CG    1 
ATOM   1652  O  OD1   . ASN C  3 38  ? -16.599 -18.809 16.182  1.00 72.64  ? 38   ASN C OD1   1 
ATOM   1653  N  ND2   . ASN C  3 38  ? -18.555 -18.399 17.258  1.00 71.44  ? 38   ASN C ND2   1 
ATOM   1654  N  N     . TYR C  3 39  ? -15.949 -23.212 19.132  1.00 66.26  ? 39   TYR C N     1 
ATOM   1655  C  CA    . TYR C  3 39  ? -15.144 -23.882 20.120  1.00 64.22  ? 39   TYR C CA    1 
ATOM   1656  C  C     . TYR C  3 39  ? -13.735 -24.004 19.589  1.00 64.48  ? 39   TYR C C     1 
ATOM   1657  O  O     . TYR C  3 39  ? -12.787 -23.872 20.331  1.00 64.88  ? 39   TYR C O     1 
ATOM   1658  C  CB    . TYR C  3 39  ? -15.764 -25.210 20.473  1.00 62.47  ? 39   TYR C CB    1 
ATOM   1659  C  CG    . TYR C  3 39  ? -17.159 -25.082 21.012  1.00 59.42  ? 39   TYR C CG    1 
ATOM   1660  C  CD1   . TYR C  3 39  ? -18.257 -25.341 20.214  1.00 57.77  ? 39   TYR C CD1   1 
ATOM   1661  C  CD2   . TYR C  3 39  ? -17.380 -24.702 22.319  1.00 57.49  ? 39   TYR C CD2   1 
ATOM   1662  C  CE1   . TYR C  3 39  ? -19.553 -25.235 20.716  1.00 57.09  ? 39   TYR C CE1   1 
ATOM   1663  C  CE2   . TYR C  3 39  ? -18.661 -24.590 22.829  1.00 57.11  ? 39   TYR C CE2   1 
ATOM   1664  C  CZ    . TYR C  3 39  ? -19.741 -24.860 22.021  1.00 57.90  ? 39   TYR C CZ    1 
ATOM   1665  O  OH    . TYR C  3 39  ? -21.011 -24.743 22.527  1.00 58.86  ? 39   TYR C OH    1 
ATOM   1666  N  N     . ALA C  3 40  ? -13.604 -24.212 18.289  1.00 65.23  ? 40   ALA C N     1 
ATOM   1667  C  CA    . ALA C  3 40  ? -12.314 -24.159 17.610  1.00 66.08  ? 40   ALA C CA    1 
ATOM   1668  C  C     . ALA C  3 40  ? -12.483 -23.932 16.118  1.00 66.99  ? 40   ALA C C     1 
ATOM   1669  O  O     . ALA C  3 40  ? -13.564 -24.144 15.539  1.00 66.66  ? 40   ALA C O     1 
ATOM   1670  C  CB    . ALA C  3 40  ? -11.523 -25.430 17.841  1.00 66.05  ? 40   ALA C CB    1 
ATOM   1671  N  N     . GLU C  3 41  ? -11.387 -23.521 15.502  1.00 68.13  ? 41   GLU C N     1 
ATOM   1672  C  CA    . GLU C  3 41  ? -11.336 -23.279 14.071  1.00 69.98  ? 41   GLU C CA    1 
ATOM   1673  C  C     . GLU C  3 41  ? -11.859 -24.466 13.247  1.00 69.79  ? 41   GLU C C     1 
ATOM   1674  O  O     . GLU C  3 41  ? -12.555 -24.272 12.269  1.00 69.84  ? 41   GLU C O     1 
ATOM   1675  C  CB    . GLU C  3 41  ? -9.896  -22.943 13.694  1.00 70.60  ? 41   GLU C CB    1 
ATOM   1676  C  CG    . GLU C  3 41  ? -9.704  -22.173 12.416  1.00 74.50  ? 41   GLU C CG    1 
ATOM   1677  C  CD    . GLU C  3 41  ? -8.215  -22.024 12.100  1.00 80.44  ? 41   GLU C CD    1 
ATOM   1678  O  OE1   . GLU C  3 41  ? -7.544  -21.155 12.732  1.00 82.16  ? 41   GLU C OE1   1 
ATOM   1679  O  OE2   . GLU C  3 41  ? -7.714  -22.799 11.236  1.00 81.71  ? 41   GLU C OE2   1 
ATOM   1680  N  N     . ARG C  3 42  ? -11.531 -25.692 13.656  1.00 70.28  ? 42   ARG C N     1 
ATOM   1681  C  CA    . ARG C  3 42  ? -11.941 -26.907 12.923  1.00 70.09  ? 42   ARG C CA    1 
ATOM   1682  C  C     . ARG C  3 42  ? -12.463 -28.013 13.835  1.00 69.58  ? 42   ARG C C     1 
ATOM   1683  O  O     . ARG C  3 42  ? -12.087 -28.104 14.999  1.00 69.85  ? 42   ARG C O     1 
ATOM   1684  C  CB    . ARG C  3 42  ? -10.783 -27.450 12.090  1.00 70.24  ? 42   ARG C CB    1 
ATOM   1685  C  CG    . ARG C  3 42  ? -9.792  -26.380 11.658  1.00 72.47  ? 42   ARG C CG    1 
ATOM   1686  C  CD    . ARG C  3 42  ? -8.482  -26.978 11.229  1.00 75.88  ? 42   ARG C CD    1 
ATOM   1687  N  NE    . ARG C  3 42  ? -8.365  -27.007 9.776   1.00 79.03  ? 42   ARG C NE    1 
ATOM   1688  C  CZ    . ARG C  3 42  ? -7.757  -27.975 9.099   1.00 81.29  ? 42   ARG C CZ    1 
ATOM   1689  N  NH1   . ARG C  3 42  ? -7.230  -29.017 9.746   1.00 81.10  ? 42   ARG C NH1   1 
ATOM   1690  N  NH2   . ARG C  3 42  ? -7.693  -27.910 7.772   1.00 81.74  ? 42   ARG C NH2   1 
ATOM   1691  N  N     . VAL C  3 43  ? -13.336 -28.853 13.295  1.00 69.16  ? 43   VAL C N     1 
ATOM   1692  C  CA    . VAL C  3 43  ? -13.887 -29.978 14.032  1.00 68.69  ? 43   VAL C CA    1 
ATOM   1693  C  C     . VAL C  3 43  ? -13.577 -31.269 13.308  1.00 68.47  ? 43   VAL C C     1 
ATOM   1694  O  O     . VAL C  3 43  ? -13.980 -31.456 12.163  1.00 68.69  ? 43   VAL C O     1 
ATOM   1695  C  CB    . VAL C  3 43  ? -15.409 -29.851 14.209  1.00 68.67  ? 43   VAL C CB    1 
ATOM   1696  C  CG1   . VAL C  3 43  ? -15.994 -31.122 14.804  1.00 67.79  ? 43   VAL C CG1   1 
ATOM   1697  C  CG2   . VAL C  3 43  ? -15.737 -28.660 15.097  1.00 68.87  ? 43   VAL C CG2   1 
ATOM   1698  N  N     . GLY C  3 44  ? -12.853 -32.156 13.980  1.00 68.10  ? 44   GLY C N     1 
ATOM   1699  C  CA    . GLY C  3 44  ? -12.568 -33.493 13.452  1.00 67.51  ? 44   GLY C CA    1 
ATOM   1700  C  C     . GLY C  3 44  ? -13.828 -34.314 13.252  1.00 66.98  ? 44   GLY C C     1 
ATOM   1701  O  O     . GLY C  3 44  ? -14.868 -33.999 13.821  1.00 66.93  ? 44   GLY C O     1 
ATOM   1702  N  N     . ALA C  3 45  ? -13.724 -35.367 12.438  1.00 66.66  ? 45   ALA C N     1 
ATOM   1703  C  CA    . ALA C  3 45  ? -14.862 -36.224 12.091  1.00 65.61  ? 45   ALA C CA    1 
ATOM   1704  C  C     . ALA C  3 45  ? -15.340 -37.073 13.256  1.00 64.98  ? 45   ALA C C     1 
ATOM   1705  O  O     . ALA C  3 45  ? -16.545 -37.283 13.397  1.00 64.99  ? 45   ALA C O     1 
ATOM   1706  C  CB    . ALA C  3 45  ? -14.518 -37.109 10.913  1.00 65.68  ? 45   ALA C CB    1 
ATOM   1707  N  N     . GLY C  3 46  ? -14.407 -37.560 14.081  1.00 63.99  ? 46   GLY C N     1 
ATOM   1708  C  CA    . GLY C  3 46  ? -14.751 -38.417 15.223  1.00 63.03  ? 46   GLY C CA    1 
ATOM   1709  C  C     . GLY C  3 46  ? -15.519 -37.712 16.345  1.00 62.57  ? 46   GLY C C     1 
ATOM   1710  O  O     . GLY C  3 46  ? -16.423 -38.305 16.965  1.00 62.06  ? 46   GLY C O     1 
ATOM   1711  N  N     . ALA C  3 47  ? -15.163 -36.442 16.585  1.00 61.40  ? 47   ALA C N     1 
ATOM   1712  C  CA    . ALA C  3 47  ? -15.672 -35.644 17.708  1.00 60.02  ? 47   ALA C CA    1 
ATOM   1713  C  C     . ALA C  3 47  ? -17.202 -35.580 17.880  1.00 59.11  ? 47   ALA C C     1 
ATOM   1714  O  O     . ALA C  3 47  ? -17.707 -35.780 18.992  1.00 58.92  ? 47   ALA C O     1 
ATOM   1715  C  CB    . ALA C  3 47  ? -15.061 -34.238 17.683  1.00 60.24  ? 47   ALA C CB    1 
ATOM   1716  N  N     . PRO C  3 48  ? -17.956 -35.318 16.801  1.00 58.25  ? 48   PRO C N     1 
ATOM   1717  C  CA    . PRO C  3 48  ? -19.415 -35.331 17.044  1.00 57.50  ? 48   PRO C CA    1 
ATOM   1718  C  C     . PRO C  3 48  ? -19.969 -36.711 17.398  1.00 56.76  ? 48   PRO C C     1 
ATOM   1719  O  O     . PRO C  3 48  ? -20.903 -36.806 18.204  1.00 56.32  ? 48   PRO C O     1 
ATOM   1720  C  CB    . PRO C  3 48  ? -20.010 -34.822 15.727  1.00 57.40  ? 48   PRO C CB    1 
ATOM   1721  C  CG    . PRO C  3 48  ? -18.946 -35.036 14.696  1.00 58.13  ? 48   PRO C CG    1 
ATOM   1722  C  CD    . PRO C  3 48  ? -17.616 -34.993 15.401  1.00 58.23  ? 48   PRO C CD    1 
ATOM   1723  N  N     . VAL C  3 49  ? -19.394 -37.764 16.807  1.00 55.92  ? 49   VAL C N     1 
ATOM   1724  C  CA    . VAL C  3 49  ? -19.783 -39.142 17.140  1.00 55.27  ? 49   VAL C CA    1 
ATOM   1725  C  C     . VAL C  3 49  ? -19.583 -39.403 18.631  1.00 55.10  ? 49   VAL C C     1 
ATOM   1726  O  O     . VAL C  3 49  ? -20.527 -39.784 19.350  1.00 55.02  ? 49   VAL C O     1 
ATOM   1727  C  CB    . VAL C  3 49  ? -18.998 -40.196 16.311  1.00 55.48  ? 49   VAL C CB    1 
ATOM   1728  C  CG1   . VAL C  3 49  ? -19.244 -41.595 16.828  1.00 53.83  ? 49   VAL C CG1   1 
ATOM   1729  C  CG2   . VAL C  3 49  ? -19.346 -40.098 14.826  1.00 55.18  ? 49   VAL C CG2   1 
ATOM   1730  N  N     . TYR C  3 50  ? -18.356 -39.172 19.088  1.00 54.65  ? 50   TYR C N     1 
ATOM   1731  C  CA    . TYR C  3 50  ? -17.989 -39.394 20.475  1.00 54.62  ? 50   TYR C CA    1 
ATOM   1732  C  C     . TYR C  3 50  ? -18.866 -38.569 21.389  1.00 55.26  ? 50   TYR C C     1 
ATOM   1733  O  O     . TYR C  3 50  ? -19.356 -39.070 22.408  1.00 55.80  ? 50   TYR C O     1 
ATOM   1734  C  CB    . TYR C  3 50  ? -16.541 -39.020 20.685  1.00 54.20  ? 50   TYR C CB    1 
ATOM   1735  C  CG    . TYR C  3 50  ? -15.901 -39.625 21.895  1.00 53.89  ? 50   TYR C CG    1 
ATOM   1736  C  CD1   . TYR C  3 50  ? -14.681 -40.271 21.791  1.00 52.93  ? 50   TYR C CD1   1 
ATOM   1737  C  CD2   . TYR C  3 50  ? -16.501 -39.540 23.159  1.00 54.93  ? 50   TYR C CD2   1 
ATOM   1738  C  CE1   . TYR C  3 50  ? -14.065 -40.824 22.908  1.00 52.69  ? 50   TYR C CE1   1 
ATOM   1739  C  CE2   . TYR C  3 50  ? -15.890 -40.088 24.289  1.00 53.77  ? 50   TYR C CE2   1 
ATOM   1740  C  CZ    . TYR C  3 50  ? -14.672 -40.725 24.145  1.00 54.00  ? 50   TYR C CZ    1 
ATOM   1741  O  OH    . TYR C  3 50  ? -14.043 -41.259 25.242  1.00 55.12  ? 50   TYR C OH    1 
ATOM   1742  N  N     . LEU C  3 51  ? -19.102 -37.315 21.018  1.00 55.47  ? 51   LEU C N     1 
ATOM   1743  C  CA    . LEU C  3 51  ? -19.932 -36.471 21.852  1.00 55.98  ? 51   LEU C CA    1 
ATOM   1744  C  C     . LEU C  3 51  ? -21.383 -36.927 21.838  1.00 55.72  ? 51   LEU C C     1 
ATOM   1745  O  O     . LEU C  3 51  ? -21.984 -37.088 22.897  1.00 55.96  ? 51   LEU C O     1 
ATOM   1746  C  CB    . LEU C  3 51  ? -19.783 -34.980 21.498  1.00 56.46  ? 51   LEU C CB    1 
ATOM   1747  C  CG    . LEU C  3 51  ? -20.608 -34.018 22.351  1.00 57.62  ? 51   LEU C CG    1 
ATOM   1748  C  CD1   . LEU C  3 51  ? -20.448 -34.336 23.830  1.00 59.64  ? 51   LEU C CD1   1 
ATOM   1749  C  CD2   . LEU C  3 51  ? -20.170 -32.605 22.080  1.00 59.38  ? 51   LEU C CD2   1 
ATOM   1750  N  N     . ALA C  3 52  ? -21.938 -37.175 20.657  1.00 55.66  ? 52   ALA C N     1 
ATOM   1751  C  CA    . ALA C  3 52  ? -23.323 -37.642 20.585  1.00 55.73  ? 52   ALA C CA    1 
ATOM   1752  C  C     . ALA C  3 52  ? -23.523 -38.876 21.462  1.00 56.13  ? 52   ALA C C     1 
ATOM   1753  O  O     . ALA C  3 52  ? -24.526 -38.982 22.190  1.00 56.14  ? 52   ALA C O     1 
ATOM   1754  C  CB    . ALA C  3 52  ? -23.713 -37.927 19.174  1.00 55.67  ? 52   ALA C CB    1 
ATOM   1755  N  N     . ALA C  3 53  ? -22.543 -39.787 21.402  1.00 56.44  ? 53   ALA C N     1 
ATOM   1756  C  CA    . ALA C  3 53  ? -22.551 -41.044 22.162  1.00 56.08  ? 53   ALA C CA    1 
ATOM   1757  C  C     . ALA C  3 53  ? -22.603 -40.793 23.653  1.00 56.25  ? 53   ALA C C     1 
ATOM   1758  O  O     . ALA C  3 53  ? -23.405 -41.406 24.368  1.00 56.66  ? 53   ALA C O     1 
ATOM   1759  C  CB    . ALA C  3 53  ? -21.326 -41.869 21.816  1.00 56.06  ? 53   ALA C CB    1 
ATOM   1760  N  N     . VAL C  3 54  ? -21.749 -39.881 24.120  1.00 56.16  ? 54   VAL C N     1 
ATOM   1761  C  CA    . VAL C  3 54  ? -21.692 -39.529 25.544  1.00 55.64  ? 54   VAL C CA    1 
ATOM   1762  C  C     . VAL C  3 54  ? -23.020 -38.923 25.976  1.00 55.64  ? 54   VAL C C     1 
ATOM   1763  O  O     . VAL C  3 54  ? -23.520 -39.209 27.056  1.00 55.06  ? 54   VAL C O     1 
ATOM   1764  C  CB    . VAL C  3 54  ? -20.554 -38.545 25.824  1.00 55.50  ? 54   VAL C CB    1 
ATOM   1765  C  CG1   . VAL C  3 54  ? -20.687 -37.950 27.222  1.00 56.31  ? 54   VAL C CG1   1 
ATOM   1766  C  CG2   . VAL C  3 54  ? -19.200 -39.201 25.611  1.00 53.92  ? 54   VAL C CG2   1 
ATOM   1767  N  N     . LEU C  3 55  ? -23.593 -38.097 25.107  1.00 56.25  ? 55   LEU C N     1 
ATOM   1768  C  CA    . LEU C  3 55  ? -24.853 -37.429 25.412  1.00 57.06  ? 55   LEU C CA    1 
ATOM   1769  C  C     . LEU C  3 55  ? -25.948 -38.442 25.484  1.00 57.19  ? 55   LEU C C     1 
ATOM   1770  O  O     . LEU C  3 55  ? -26.791 -38.371 26.365  1.00 57.00  ? 55   LEU C O     1 
ATOM   1771  C  CB    . LEU C  3 55  ? -25.194 -36.355 24.374  1.00 57.43  ? 55   LEU C CB    1 
ATOM   1772  C  CG    . LEU C  3 55  ? -24.344 -35.082 24.373  1.00 57.22  ? 55   LEU C CG    1 
ATOM   1773  C  CD1   . LEU C  3 55  ? -24.722 -34.215 23.191  1.00 58.80  ? 55   LEU C CD1   1 
ATOM   1774  C  CD2   . LEU C  3 55  ? -24.506 -34.315 25.673  1.00 56.81  ? 55   LEU C CD2   1 
ATOM   1775  N  N     . GLU C  3 56  ? -25.908 -39.404 24.565  1.00 58.09  ? 56   GLU C N     1 
ATOM   1776  C  CA    . GLU C  3 56  ? -26.838 -40.533 24.587  1.00 58.50  ? 56   GLU C CA    1 
ATOM   1777  C  C     . GLU C  3 56  ? -26.735 -41.353 25.872  1.00 58.63  ? 56   GLU C C     1 
ATOM   1778  O  O     . GLU C  3 56  ? -27.751 -41.624 26.539  1.00 58.00  ? 56   GLU C O     1 
ATOM   1779  C  CB    . GLU C  3 56  ? -26.588 -41.435 23.395  1.00 58.79  ? 56   GLU C CB    1 
ATOM   1780  C  CG    . GLU C  3 56  ? -27.644 -42.511 23.258  1.00 59.24  ? 56   GLU C CG    1 
ATOM   1781  C  CD    . GLU C  3 56  ? -27.757 -43.028 21.852  1.00 61.39  ? 56   GLU C CD    1 
ATOM   1782  O  OE1   . GLU C  3 56  ? -27.473 -42.257 20.888  1.00 61.52  ? 56   GLU C OE1   1 
ATOM   1783  O  OE2   . GLU C  3 56  ? -28.139 -44.211 21.725  1.00 62.03  ? 56   GLU C OE2   1 
ATOM   1784  N  N     . TYR C  3 57  ? -25.511 -41.743 26.224  1.00 58.99  ? 57   TYR C N     1 
ATOM   1785  C  CA    . TYR C  3 57  ? -25.338 -42.581 27.394  1.00 59.84  ? 57   TYR C CA    1 
ATOM   1786  C  C     . TYR C  3 57  ? -25.886 -41.894 28.611  1.00 59.87  ? 57   TYR C C     1 
ATOM   1787  O  O     . TYR C  3 57  ? -26.621 -42.512 29.380  1.00 60.31  ? 57   TYR C O     1 
ATOM   1788  C  CB    . TYR C  3 57  ? -23.884 -42.973 27.623  1.00 60.98  ? 57   TYR C CB    1 
ATOM   1789  C  CG    . TYR C  3 57  ? -23.620 -43.393 29.059  1.00 62.83  ? 57   TYR C CG    1 
ATOM   1790  C  CD1   . TYR C  3 57  ? -24.249 -44.524 29.614  1.00 62.64  ? 57   TYR C CD1   1 
ATOM   1791  C  CD2   . TYR C  3 57  ? -22.744 -42.650 29.869  1.00 63.96  ? 57   TYR C CD2   1 
ATOM   1792  C  CE1   . TYR C  3 57  ? -24.012 -44.899 30.939  1.00 63.88  ? 57   TYR C CE1   1 
ATOM   1793  C  CE2   . TYR C  3 57  ? -22.494 -43.019 31.189  1.00 64.39  ? 57   TYR C CE2   1 
ATOM   1794  C  CZ    . TYR C  3 57  ? -23.130 -44.138 31.724  1.00 64.50  ? 57   TYR C CZ    1 
ATOM   1795  O  OH    . TYR C  3 57  ? -22.863 -44.493 33.033  1.00 64.23  ? 57   TYR C OH    1 
ATOM   1796  N  N     . LEU C  3 58  ? -25.559 -40.606 28.764  1.00 59.56  ? 58   LEU C N     1 
ATOM   1797  C  CA    . LEU C  3 58  ? -26.011 -39.842 29.925  1.00 59.25  ? 58   LEU C CA    1 
ATOM   1798  C  C     . LEU C  3 58  ? -27.508 -39.649 30.002  1.00 59.04  ? 58   LEU C C     1 
ATOM   1799  O  O     . LEU C  3 58  ? -28.064 -39.703 31.091  1.00 58.75  ? 58   LEU C O     1 
ATOM   1800  C  CB    . LEU C  3 58  ? -25.293 -38.497 30.049  1.00 59.31  ? 58   LEU C CB    1 
ATOM   1801  C  CG    . LEU C  3 58  ? -23.837 -38.566 30.506  1.00 58.79  ? 58   LEU C CG    1 
ATOM   1802  C  CD1   . LEU C  3 58  ? -23.178 -37.218 30.287  1.00 59.56  ? 58   LEU C CD1   1 
ATOM   1803  C  CD2   . LEU C  3 58  ? -23.722 -39.003 31.966  1.00 58.59  ? 58   LEU C CD2   1 
ATOM   1804  N  N     . THR C  3 59  ? -28.175 -39.415 28.882  1.00 59.18  ? 59   THR C N     1 
ATOM   1805  C  CA    . THR C  3 59  ? -29.631 -39.306 28.977  1.00 60.28  ? 59   THR C CA    1 
ATOM   1806  C  C     . THR C  3 59  ? -30.271 -40.694 29.196  1.00 60.68  ? 59   THR C C     1 
ATOM   1807  O  O     . THR C  3 59  ? -31.275 -40.822 29.908  1.00 60.09  ? 59   THR C O     1 
ATOM   1808  C  CB    . THR C  3 59  ? -30.285 -38.547 27.804  1.00 60.56  ? 59   THR C CB    1 
ATOM   1809  O  OG1   . THR C  3 59  ? -31.269 -39.381 27.171  1.00 62.67  ? 59   THR C OG1   1 
ATOM   1810  C  CG2   . THR C  3 59  ? -29.255 -38.065 26.800  1.00 58.82  ? 59   THR C CG2   1 
ATOM   1811  N  N     . ALA C  3 60  ? -29.658 -41.726 28.621  1.00 61.50  ? 60   ALA C N     1 
ATOM   1812  C  CA    . ALA C  3 60  ? -30.018 -43.117 28.958  1.00 62.50  ? 60   ALA C CA    1 
ATOM   1813  C  C     . ALA C  3 60  ? -29.939 -43.357 30.459  1.00 63.01  ? 60   ALA C C     1 
ATOM   1814  O  O     . ALA C  3 60  ? -30.872 -43.896 31.072  1.00 62.95  ? 60   ALA C O     1 
ATOM   1815  C  CB    . ALA C  3 60  ? -29.124 -44.106 28.216  1.00 62.39  ? 60   ALA C CB    1 
ATOM   1816  N  N     . GLU C  3 61  ? -28.824 -42.939 31.052  1.00 63.85  ? 61   GLU C N     1 
ATOM   1817  C  CA    . GLU C  3 61  ? -28.604 -43.151 32.474  1.00 64.92  ? 61   GLU C CA    1 
ATOM   1818  C  C     . GLU C  3 61  ? -29.677 -42.510 33.333  1.00 64.77  ? 61   GLU C C     1 
ATOM   1819  O  O     . GLU C  3 61  ? -30.183 -43.147 34.236  1.00 65.21  ? 61   GLU C O     1 
ATOM   1820  C  CB    . GLU C  3 61  ? -27.238 -42.636 32.889  1.00 65.31  ? 61   GLU C CB    1 
ATOM   1821  C  CG    . GLU C  3 61  ? -26.908 -42.928 34.333  1.00 68.56  ? 61   GLU C CG    1 
ATOM   1822  C  CD    . GLU C  3 61  ? -26.442 -44.358 34.528  1.00 73.71  ? 61   GLU C CD    1 
ATOM   1823  O  OE1   . GLU C  3 61  ? -25.812 -44.894 33.569  1.00 76.31  ? 61   GLU C OE1   1 
ATOM   1824  O  OE2   . GLU C  3 61  ? -26.705 -44.932 35.623  1.00 73.67  ? 61   GLU C OE2   1 
ATOM   1825  N  N     . ILE C  3 62  ? -30.020 -41.255 33.050  1.00 65.20  ? 62   ILE C N     1 
ATOM   1826  C  CA    . ILE C  3 62  ? -31.023 -40.535 33.834  1.00 65.60  ? 62   ILE C CA    1 
ATOM   1827  C  C     . ILE C  3 62  ? -32.350 -41.248 33.717  1.00 65.44  ? 62   ILE C C     1 
ATOM   1828  O  O     . ILE C  3 62  ? -32.905 -41.686 34.707  1.00 65.30  ? 62   ILE C O     1 
ATOM   1829  C  CB    . ILE C  3 62  ? -31.242 -39.084 33.331  1.00 66.04  ? 62   ILE C CB    1 
ATOM   1830  C  CG1   . ILE C  3 62  ? -29.919 -38.383 33.047  1.00 66.65  ? 62   ILE C CG1   1 
ATOM   1831  C  CG2   . ILE C  3 62  ? -32.103 -38.287 34.319  1.00 65.53  ? 62   ILE C CG2   1 
ATOM   1832  C  CD1   . ILE C  3 62  ? -29.360 -37.647 34.229  1.00 69.02  ? 62   ILE C CD1   1 
ATOM   1833  N  N     . LEU C  3 63  ? -32.843 -41.351 32.487  1.00 65.97  ? 63   LEU C N     1 
ATOM   1834  C  CA    . LEU C  3 63  ? -34.119 -42.019 32.173  1.00 66.57  ? 63   LEU C CA    1 
ATOM   1835  C  C     . LEU C  3 63  ? -34.287 -43.388 32.842  1.00 67.11  ? 63   LEU C C     1 
ATOM   1836  O  O     . LEU C  3 63  ? -35.388 -43.715 33.327  1.00 66.76  ? 63   LEU C O     1 
ATOM   1837  C  CB    . LEU C  3 63  ? -34.306 -42.118 30.650  1.00 66.12  ? 63   LEU C CB    1 
ATOM   1838  C  CG    . LEU C  3 63  ? -34.274 -40.733 29.974  1.00 65.30  ? 63   LEU C CG    1 
ATOM   1839  C  CD1   . LEU C  3 63  ? -34.227 -40.806 28.453  1.00 63.62  ? 63   LEU C CD1   1 
ATOM   1840  C  CD2   . LEU C  3 63  ? -35.432 -39.866 30.445  1.00 63.49  ? 63   LEU C CD2   1 
ATOM   1841  N  N     . GLU C  3 64  ? -33.194 -44.158 32.884  1.00 67.73  ? 64   GLU C N     1 
ATOM   1842  C  CA    . GLU C  3 64  ? -33.172 -45.457 33.564  1.00 69.12  ? 64   GLU C CA    1 
ATOM   1843  C  C     . GLU C  3 64  ? -33.607 -45.343 35.009  1.00 69.26  ? 64   GLU C C     1 
ATOM   1844  O  O     . GLU C  3 64  ? -34.524 -46.041 35.418  1.00 69.41  ? 64   GLU C O     1 
ATOM   1845  C  CB    . GLU C  3 64  ? -31.778 -46.100 33.502  1.00 70.04  ? 64   GLU C CB    1 
ATOM   1846  C  CG    . GLU C  3 64  ? -31.721 -47.567 33.942  1.00 72.05  ? 64   GLU C CG    1 
ATOM   1847  C  CD    . GLU C  3 64  ? -31.973 -48.532 32.782  1.00 76.59  ? 64   GLU C CD    1 
ATOM   1848  O  OE1   . GLU C  3 64  ? -33.085 -49.124 32.717  1.00 77.34  ? 64   GLU C OE1   1 
ATOM   1849  O  OE2   . GLU C  3 64  ? -31.062 -48.678 31.921  1.00 78.18  ? 64   GLU C OE2   1 
ATOM   1850  N  N     . LEU C  3 65  ? -32.944 -44.475 35.781  1.00 69.62  ? 65   LEU C N     1 
ATOM   1851  C  CA    . LEU C  3 65  ? -33.280 -44.286 37.197  1.00 69.81  ? 65   LEU C CA    1 
ATOM   1852  C  C     . LEU C  3 65  ? -34.588 -43.507 37.383  1.00 70.06  ? 65   LEU C C     1 
ATOM   1853  O  O     . LEU C  3 65  ? -35.324 -43.728 38.343  1.00 69.72  ? 65   LEU C O     1 
ATOM   1854  C  CB    . LEU C  3 65  ? -32.139 -43.584 37.939  1.00 69.82  ? 65   LEU C CB    1 
ATOM   1855  C  CG    . LEU C  3 65  ? -30.757 -44.241 38.093  1.00 70.86  ? 65   LEU C CG    1 
ATOM   1856  C  CD1   . LEU C  3 65  ? -29.712 -43.222 38.564  1.00 70.27  ? 65   LEU C CD1   1 
ATOM   1857  C  CD2   . LEU C  3 65  ? -30.785 -45.450 39.048  1.00 70.59  ? 65   LEU C CD2   1 
ATOM   1858  N  N     . ALA C  3 66  ? -34.865 -42.585 36.466  1.00 70.79  ? 66   ALA C N     1 
ATOM   1859  C  CA    . ALA C  3 66  ? -36.093 -41.800 36.514  1.00 71.75  ? 66   ALA C CA    1 
ATOM   1860  C  C     . ALA C  3 66  ? -37.299 -42.715 36.366  1.00 72.32  ? 66   ALA C C     1 
ATOM   1861  O  O     . ALA C  3 66  ? -38.231 -42.660 37.181  1.00 72.15  ? 66   ALA C O     1 
ATOM   1862  C  CB    . ALA C  3 66  ? -36.093 -40.728 35.429  1.00 71.58  ? 66   ALA C CB    1 
ATOM   1863  N  N     . GLY C  3 67  ? -37.257 -43.560 35.330  1.00 73.15  ? 67   GLY C N     1 
ATOM   1864  C  CA    . GLY C  3 67  ? -38.288 -44.570 35.075  1.00 74.20  ? 67   GLY C CA    1 
ATOM   1865  C  C     . GLY C  3 67  ? -38.637 -45.405 36.299  1.00 74.85  ? 67   GLY C C     1 
ATOM   1866  O  O     . GLY C  3 67  ? -39.802 -45.531 36.652  1.00 74.77  ? 67   GLY C O     1 
ATOM   1867  N  N     . ASN C  3 68  ? -37.625 -45.971 36.949  1.00 75.70  ? 68   ASN C N     1 
ATOM   1868  C  CA    . ASN C  3 68  ? -37.844 -46.753 38.158  1.00 76.91  ? 68   ASN C CA    1 
ATOM   1869  C  C     . ASN C  3 68  ? -38.514 -45.940 39.233  1.00 77.83  ? 68   ASN C C     1 
ATOM   1870  O  O     . ASN C  3 68  ? -39.283 -46.477 40.022  1.00 78.05  ? 68   ASN C O     1 
ATOM   1871  C  CB    . ASN C  3 68  ? -36.534 -47.311 38.711  1.00 76.90  ? 68   ASN C CB    1 
ATOM   1872  C  CG    . ASN C  3 68  ? -35.698 -48.001 37.657  1.00 77.20  ? 68   ASN C CG    1 
ATOM   1873  O  OD1   . ASN C  3 68  ? -36.158 -48.267 36.533  1.00 77.11  ? 68   ASN C OD1   1 
ATOM   1874  N  ND2   . ASN C  3 68  ? -34.443 -48.285 38.009  1.00 77.86  ? 68   ASN C ND2   1 
ATOM   1875  N  N     . ALA C  3 69  ? -38.212 -44.644 39.272  1.00 79.15  ? 69   ALA C N     1 
ATOM   1876  C  CA    . ALA C  3 69  ? -38.819 -43.768 40.260  1.00 80.34  ? 69   ALA C CA    1 
ATOM   1877  C  C     . ALA C  3 69  ? -40.273 -43.471 39.882  1.00 81.20  ? 69   ALA C C     1 
ATOM   1878  O  O     . ALA C  3 69  ? -41.105 -43.215 40.754  1.00 81.25  ? 69   ALA C O     1 
ATOM   1879  C  CB    . ALA C  3 69  ? -38.006 -42.497 40.440  1.00 80.30  ? 69   ALA C CB    1 
ATOM   1880  N  N     . ALA C  3 70  ? -40.576 -43.523 38.586  1.00 82.45  ? 70   ALA C N     1 
ATOM   1881  C  CA    . ALA C  3 70  ? -41.965 -43.488 38.127  1.00 83.84  ? 70   ALA C CA    1 
ATOM   1882  C  C     . ALA C  3 70  ? -42.666 -44.767 38.581  1.00 84.90  ? 70   ALA C C     1 
ATOM   1883  O  O     . ALA C  3 70  ? -43.727 -44.708 39.213  1.00 84.93  ? 70   ALA C O     1 
ATOM   1884  C  CB    . ALA C  3 70  ? -42.035 -43.335 36.607  1.00 83.58  ? 70   ALA C CB    1 
ATOM   1885  N  N     . ARG C  3 71  ? -42.052 -45.912 38.278  1.00 86.19  ? 71   ARG C N     1 
ATOM   1886  C  CA    . ARG C  3 71  ? -42.540 -47.208 38.753  1.00 87.97  ? 71   ARG C CA    1 
ATOM   1887  C  C     . ARG C  3 71  ? -42.782 -47.143 40.256  1.00 88.19  ? 71   ARG C C     1 
ATOM   1888  O  O     . ARG C  3 71  ? -43.928 -47.205 40.683  1.00 88.09  ? 71   ARG C O     1 
ATOM   1889  C  CB    . ARG C  3 71  ? -41.568 -48.358 38.415  1.00 87.80  ? 71   ARG C CB    1 
ATOM   1890  C  CG    . ARG C  3 71  ? -41.416 -48.711 36.912  1.00 89.39  ? 71   ARG C CG    1 
ATOM   1891  C  CD    . ARG C  3 71  ? -40.073 -49.420 36.676  1.00 89.94  ? 71   ARG C CD    1 
ATOM   1892  N  NE    . ARG C  3 71  ? -39.922 -50.039 35.353  1.00 94.78  ? 71   ARG C NE    1 
ATOM   1893  C  CZ    . ARG C  3 71  ? -38.934 -50.882 35.030  1.00 95.97  ? 71   ARG C CZ    1 
ATOM   1894  N  NH1   . ARG C  3 71  ? -38.005 -51.214 35.925  1.00 96.43  ? 71   ARG C NH1   1 
ATOM   1895  N  NH2   . ARG C  3 71  ? -38.868 -51.406 33.813  1.00 95.85  ? 71   ARG C NH2   1 
ATOM   1896  N  N     . ASP C  3 72  ? -41.713 -46.981 41.046  1.00 88.96  ? 72   ASP C N     1 
ATOM   1897  C  CA    . ASP C  3 72  ? -41.806 -46.995 42.521  1.00 89.76  ? 72   ASP C CA    1 
ATOM   1898  C  C     . ASP C  3 72  ? -42.928 -46.103 43.022  1.00 89.95  ? 72   ASP C C     1 
ATOM   1899  O  O     . ASP C  3 72  ? -43.515 -46.364 44.065  1.00 90.00  ? 72   ASP C O     1 
ATOM   1900  C  CB    . ASP C  3 72  ? -40.495 -46.547 43.188  1.00 90.10  ? 72   ASP C CB    1 
ATOM   1901  C  CG    . ASP C  3 72  ? -39.302 -47.441 42.842  1.00 91.38  ? 72   ASP C CG    1 
ATOM   1902  O  OD1   . ASP C  3 72  ? -39.498 -48.579 42.346  1.00 92.74  ? 72   ASP C OD1   1 
ATOM   1903  O  OD2   . ASP C  3 72  ? -38.153 -46.990 43.073  1.00 92.46  ? 72   ASP C OD2   1 
ATOM   1904  N  N     . ASN C  3 73  ? -43.206 -45.046 42.265  1.00 90.41  ? 73   ASN C N     1 
ATOM   1905  C  CA    . ASN C  3 73  ? -44.270 -44.104 42.581  1.00 90.75  ? 73   ASN C CA    1 
ATOM   1906  C  C     . ASN C  3 73  ? -45.579 -44.462 41.889  1.00 90.49  ? 73   ASN C C     1 
ATOM   1907  O  O     . ASN C  3 73  ? -46.548 -43.704 41.956  1.00 90.64  ? 73   ASN C O     1 
ATOM   1908  C  CB    . ASN C  3 73  ? -43.844 -42.677 42.209  1.00 91.21  ? 73   ASN C CB    1 
ATOM   1909  C  CG    . ASN C  3 73  ? -42.861 -42.081 43.209  1.00 92.27  ? 73   ASN C CG    1 
ATOM   1910  O  OD1   . ASN C  3 73  ? -43.239 -41.242 44.034  1.00 93.00  ? 73   ASN C OD1   1 
ATOM   1911  N  ND2   . ASN C  3 73  ? -41.596 -42.525 43.155  1.00 92.62  ? 73   ASN C ND2   1 
ATOM   1912  N  N     . LYS C  3 74  ? -45.593 -45.622 41.231  1.00 90.09  ? 74   LYS C N     1 
ATOM   1913  C  CA    . LYS C  3 74  ? -46.772 -46.146 40.525  1.00 89.52  ? 74   LYS C CA    1 
ATOM   1914  C  C     . LYS C  3 74  ? -47.239 -45.208 39.411  1.00 88.79  ? 74   LYS C C     1 
ATOM   1915  O  O     . LYS C  3 74  ? -48.346 -44.670 39.467  1.00 88.76  ? 74   LYS C O     1 
ATOM   1916  C  CB    . LYS C  3 74  ? -47.910 -46.463 41.506  1.00 89.74  ? 74   LYS C CB    1 
ATOM   1917  C  CG    . LYS C  3 74  ? -47.764 -47.793 42.246  1.00 90.48  ? 74   LYS C CG    1 
ATOM   1918  C  CD    . LYS C  3 74  ? -48.755 -47.863 43.402  1.00 91.07  ? 74   LYS C CD    1 
ATOM   1919  C  CE    . LYS C  3 74  ? -48.928 -49.290 43.894  1.00 91.65  ? 74   LYS C CE    1 
ATOM   1920  N  NZ    . LYS C  3 74  ? -50.076 -49.372 44.846  1.00 92.16  ? 74   LYS C NZ    1 
ATOM   1921  N  N     . LYS C  3 75  ? -46.376 -45.012 38.413  1.00 87.76  ? 75   LYS C N     1 
ATOM   1922  C  CA    . LYS C  3 75  ? -46.662 -44.133 37.279  1.00 86.76  ? 75   LYS C CA    1 
ATOM   1923  C  C     . LYS C  3 75  ? -45.997 -44.631 36.007  1.00 85.98  ? 75   LYS C C     1 
ATOM   1924  O  O     . LYS C  3 75  ? -44.969 -45.317 36.046  1.00 86.05  ? 75   LYS C O     1 
ATOM   1925  C  CB    . LYS C  3 75  ? -46.183 -42.701 37.546  1.00 87.11  ? 75   LYS C CB    1 
ATOM   1926  C  CG    . LYS C  3 75  ? -46.829 -41.986 38.717  1.00 87.07  ? 75   LYS C CG    1 
ATOM   1927  C  CD    . LYS C  3 75  ? -48.236 -41.536 38.406  1.00 87.54  ? 75   LYS C CD    1 
ATOM   1928  C  CE    . LYS C  3 75  ? -48.692 -40.523 39.439  1.00 88.49  ? 75   LYS C CE    1 
ATOM   1929  N  NZ    . LYS C  3 75  ? -48.439 -41.034 40.819  1.00 88.74  ? 75   LYS C NZ    1 
ATOM   1930  N  N     . THR C  3 76  ? -46.580 -44.263 34.874  1.00 84.86  ? 76   THR C N     1 
ATOM   1931  C  CA    . THR C  3 76  ? -46.068 -44.699 33.583  1.00 84.01  ? 76   THR C CA    1 
ATOM   1932  C  C     . THR C  3 76  ? -45.466 -43.500 32.851  1.00 82.95  ? 76   THR C C     1 
ATOM   1933  O  O     . THR C  3 76  ? -44.914 -43.634 31.748  1.00 82.96  ? 76   THR C O     1 
ATOM   1934  C  CB    . THR C  3 76  ? -47.179 -45.379 32.717  1.00 84.34  ? 76   THR C CB    1 
ATOM   1935  O  OG1   . THR C  3 76  ? -47.671 -44.463 31.722  1.00 85.03  ? 76   THR C OG1   1 
ATOM   1936  C  CG2   . THR C  3 76  ? -48.351 -45.864 33.600  1.00 84.33  ? 76   THR C CG2   1 
ATOM   1937  N  N     . ARG C  3 77  ? -45.600 -42.325 33.469  1.00 81.35  ? 77   ARG C N     1 
ATOM   1938  C  CA    . ARG C  3 77  ? -44.996 -41.101 32.953  1.00 79.72  ? 77   ARG C CA    1 
ATOM   1939  C  C     . ARG C  3 77  ? -44.000 -40.490 33.917  1.00 78.00  ? 77   ARG C C     1 
ATOM   1940  O  O     . ARG C  3 77  ? -44.287 -40.296 35.103  1.00 77.52  ? 77   ARG C O     1 
ATOM   1941  C  CB    . ARG C  3 77  ? -46.059 -40.073 32.588  1.00 80.07  ? 77   ARG C CB    1 
ATOM   1942  C  CG    . ARG C  3 77  ? -46.149 -39.850 31.097  1.00 81.44  ? 77   ARG C CG    1 
ATOM   1943  C  CD    . ARG C  3 77  ? -47.584 -39.671 30.685  1.00 84.00  ? 77   ARG C CD    1 
ATOM   1944  N  NE    . ARG C  3 77  ? -48.227 -38.554 31.372  1.00 85.31  ? 77   ARG C NE    1 
ATOM   1945  C  CZ    . ARG C  3 77  ? -49.495 -38.196 31.180  1.00 87.14  ? 77   ARG C CZ    1 
ATOM   1946  N  NH1   . ARG C  3 77  ? -50.260 -38.866 30.313  1.00 87.21  ? 77   ARG C NH1   1 
ATOM   1947  N  NH2   . ARG C  3 77  ? -50.002 -37.165 31.850  1.00 87.19  ? 77   ARG C NH2   1 
ATOM   1948  N  N     . ILE C  3 78  ? -42.821 -40.187 33.387  1.00 76.04  ? 78   ILE C N     1 
ATOM   1949  C  CA    . ILE C  3 78  ? -41.818 -39.466 34.140  1.00 73.97  ? 78   ILE C CA    1 
ATOM   1950  C  C     . ILE C  3 78  ? -42.179 -37.983 34.207  1.00 72.97  ? 78   ILE C C     1 
ATOM   1951  O  O     . ILE C  3 78  ? -42.381 -37.323 33.179  1.00 72.52  ? 78   ILE C O     1 
ATOM   1952  C  CB    . ILE C  3 78  ? -40.431 -39.647 33.528  1.00 73.85  ? 78   ILE C CB    1 
ATOM   1953  C  CG1   . ILE C  3 78  ? -40.061 -41.135 33.493  1.00 72.58  ? 78   ILE C CG1   1 
ATOM   1954  C  CG2   . ILE C  3 78  ? -39.391 -38.841 34.325  1.00 74.20  ? 78   ILE C CG2   1 
ATOM   1955  C  CD1   . ILE C  3 78  ? -38.901 -41.465 32.591  1.00 69.82  ? 78   ILE C CD1   1 
ATOM   1956  N  N     . ILE C  3 79  ? -42.288 -37.482 35.432  1.00 71.64  ? 79   ILE C N     1 
ATOM   1957  C  CA    . ILE C  3 79  ? -42.429 -36.055 35.675  1.00 70.32  ? 79   ILE C CA    1 
ATOM   1958  C  C     . ILE C  3 79  ? -41.183 -35.506 36.383  1.00 69.91  ? 79   ILE C C     1 
ATOM   1959  O  O     . ILE C  3 79  ? -40.415 -36.274 36.986  1.00 70.05  ? 79   ILE C O     1 
ATOM   1960  C  CB    . ILE C  3 79  ? -43.718 -35.715 36.461  1.00 70.23  ? 79   ILE C CB    1 
ATOM   1961  C  CG1   . ILE C  3 79  ? -43.726 -36.401 37.833  1.00 69.79  ? 79   ILE C CG1   1 
ATOM   1962  C  CG2   . ILE C  3 79  ? -44.948 -36.033 35.611  1.00 69.15  ? 79   ILE C CG2   1 
ATOM   1963  C  CD1   . ILE C  3 79  ? -44.837 -35.913 38.783  1.00 69.73  ? 79   ILE C CD1   1 
ATOM   1964  N  N     . PRO C  3 80  ? -40.966 -34.180 36.299  1.00 69.29  ? 80   PRO C N     1 
ATOM   1965  C  CA    . PRO C  3 80  ? -39.799 -33.556 36.911  1.00 68.57  ? 80   PRO C CA    1 
ATOM   1966  C  C     . PRO C  3 80  ? -39.447 -34.098 38.297  1.00 67.83  ? 80   PRO C C     1 
ATOM   1967  O  O     . PRO C  3 80  ? -38.258 -34.271 38.587  1.00 68.29  ? 80   PRO C O     1 
ATOM   1968  C  CB    . PRO C  3 80  ? -40.202 -32.082 36.979  1.00 68.68  ? 80   PRO C CB    1 
ATOM   1969  C  CG    . PRO C  3 80  ? -41.020 -31.895 35.744  1.00 68.74  ? 80   PRO C CG    1 
ATOM   1970  C  CD    . PRO C  3 80  ? -41.803 -33.179 35.599  1.00 69.45  ? 80   PRO C CD    1 
ATOM   1971  N  N     . ARG C  3 81  ? -40.448 -34.389 39.129  1.00 66.48  ? 81   ARG C N     1 
ATOM   1972  C  CA    . ARG C  3 81  ? -40.184 -34.932 40.465  1.00 65.61  ? 81   ARG C CA    1 
ATOM   1973  C  C     . ARG C  3 81  ? -39.424 -36.251 40.437  1.00 65.21  ? 81   ARG C C     1 
ATOM   1974  O  O     . ARG C  3 81  ? -38.654 -36.551 41.360  1.00 65.61  ? 81   ARG C O     1 
ATOM   1975  C  CB    . ARG C  3 81  ? -41.474 -35.115 41.257  1.00 65.27  ? 81   ARG C CB    1 
ATOM   1976  C  CG    . ARG C  3 81  ? -41.392 -36.266 42.236  1.00 65.59  ? 81   ARG C CG    1 
ATOM   1977  C  CD    . ARG C  3 81  ? -41.378 -35.871 43.697  1.00 65.72  ? 81   ARG C CD    1 
ATOM   1978  N  NE    . ARG C  3 81  ? -40.194 -35.141 44.131  1.00 67.00  ? 81   ARG C NE    1 
ATOM   1979  C  CZ    . ARG C  3 81  ? -39.813 -35.018 45.409  1.00 66.84  ? 81   ARG C CZ    1 
ATOM   1980  N  NH1   . ARG C  3 81  ? -40.494 -35.601 46.397  1.00 64.80  ? 81   ARG C NH1   1 
ATOM   1981  N  NH2   . ARG C  3 81  ? -38.731 -34.312 45.701  1.00 66.16  ? 81   ARG C NH2   1 
ATOM   1982  N  N     . HIS C  3 82  ? -39.653 -37.057 39.404  1.00 64.36  ? 82   HIS C N     1 
ATOM   1983  C  CA    . HIS C  3 82  ? -38.968 -38.341 39.298  1.00 63.53  ? 82   HIS C CA    1 
ATOM   1984  C  C     . HIS C  3 82  ? -37.529 -38.132 38.874  1.00 63.08  ? 82   HIS C C     1 
ATOM   1985  O  O     . HIS C  3 82  ? -36.631 -38.865 39.309  1.00 62.94  ? 82   HIS C O     1 
ATOM   1986  C  CB    . HIS C  3 82  ? -39.669 -39.267 38.309  1.00 63.61  ? 82   HIS C CB    1 
ATOM   1987  C  CG    . HIS C  3 82  ? -41.125 -39.454 38.591  1.00 63.11  ? 82   HIS C CG    1 
ATOM   1988  N  ND1   . HIS C  3 82  ? -42.079 -39.456 37.596  1.00 61.63  ? 82   HIS C ND1   1 
ATOM   1989  C  CD2   . HIS C  3 82  ? -41.790 -39.623 39.757  1.00 62.06  ? 82   HIS C CD2   1 
ATOM   1990  C  CE1   . HIS C  3 82  ? -43.268 -39.640 38.137  1.00 61.65  ? 82   HIS C CE1   1 
ATOM   1991  N  NE2   . HIS C  3 82  ? -43.123 -39.730 39.446  1.00 62.08  ? 82   HIS C NE2   1 
ATOM   1992  N  N     . LEU C  3 83  ? -37.321 -37.136 38.011  1.00 61.98  ? 83   LEU C N     1 
ATOM   1993  C  CA    . LEU C  3 83  ? -35.978 -36.744 37.628  1.00 60.93  ? 83   LEU C CA    1 
ATOM   1994  C  C     . LEU C  3 83  ? -35.209 -36.257 38.877  1.00 60.92  ? 83   LEU C C     1 
ATOM   1995  O  O     . LEU C  3 83  ? -34.033 -36.591 39.069  1.00 60.63  ? 83   LEU C O     1 
ATOM   1996  C  CB    . LEU C  3 83  ? -36.020 -35.708 36.504  1.00 60.25  ? 83   LEU C CB    1 
ATOM   1997  C  CG    . LEU C  3 83  ? -36.473 -36.235 35.133  1.00 58.14  ? 83   LEU C CG    1 
ATOM   1998  C  CD1   . LEU C  3 83  ? -36.606 -35.140 34.101  1.00 56.62  ? 83   LEU C CD1   1 
ATOM   1999  C  CD2   . LEU C  3 83  ? -35.540 -37.293 34.594  1.00 56.18  ? 83   LEU C CD2   1 
ATOM   2000  N  N     . GLN C  3 84  ? -35.897 -35.534 39.753  1.00 60.43  ? 84   GLN C N     1 
ATOM   2001  C  CA    . GLN C  3 84  ? -35.281 -35.065 40.987  1.00 60.79  ? 84   GLN C CA    1 
ATOM   2002  C  C     . GLN C  3 84  ? -34.873 -36.239 41.881  1.00 61.03  ? 84   GLN C C     1 
ATOM   2003  O  O     . GLN C  3 84  ? -33.729 -36.307 42.339  1.00 61.06  ? 84   GLN C O     1 
ATOM   2004  C  CB    . GLN C  3 84  ? -36.198 -34.063 41.713  1.00 60.43  ? 84   GLN C CB    1 
ATOM   2005  C  CG    . GLN C  3 84  ? -35.723 -33.588 43.094  1.00 60.73  ? 84   GLN C CG    1 
ATOM   2006  C  CD    . GLN C  3 84  ? -34.450 -32.714 43.085  1.00 60.49  ? 84   GLN C CD    1 
ATOM   2007  O  OE1   . GLN C  3 84  ? -33.656 -32.722 42.142  1.00 60.33  ? 84   GLN C OE1   1 
ATOM   2008  N  NE2   . GLN C  3 84  ? -34.250 -31.987 44.163  1.00 60.30  ? 84   GLN C NE2   1 
ATOM   2009  N  N     . LEU C  3 85  ? -35.798 -37.172 42.105  1.00 61.50  ? 85   LEU C N     1 
ATOM   2010  C  CA    . LEU C  3 85  ? -35.495 -38.382 42.860  1.00 61.27  ? 85   LEU C CA    1 
ATOM   2011  C  C     . LEU C  3 85  ? -34.381 -39.181 42.192  1.00 61.18  ? 85   LEU C C     1 
ATOM   2012  O  O     . LEU C  3 85  ? -33.423 -39.592 42.859  1.00 61.68  ? 85   LEU C O     1 
ATOM   2013  C  CB    . LEU C  3 85  ? -36.734 -39.241 43.031  1.00 61.50  ? 85   LEU C CB    1 
ATOM   2014  C  CG    . LEU C  3 85  ? -37.855 -38.728 43.941  1.00 62.39  ? 85   LEU C CG    1 
ATOM   2015  C  CD1   . LEU C  3 85  ? -39.124 -39.552 43.704  1.00 61.61  ? 85   LEU C CD1   1 
ATOM   2016  C  CD2   . LEU C  3 85  ? -37.453 -38.757 45.426  1.00 62.57  ? 85   LEU C CD2   1 
ATOM   2017  N  N     . ALA C  3 86  ? -34.465 -39.377 40.883  1.00 60.55  ? 86   ALA C N     1 
ATOM   2018  C  CA    . ALA C  3 86  ? -33.414 -40.124 40.211  1.00 60.90  ? 86   ALA C CA    1 
ATOM   2019  C  C     . ALA C  3 86  ? -32.057 -39.496 40.515  1.00 61.00  ? 86   ALA C C     1 
ATOM   2020  O  O     . ALA C  3 86  ? -31.134 -40.186 40.948  1.00 61.45  ? 86   ALA C O     1 
ATOM   2021  C  CB    . ALA C  3 86  ? -33.647 -40.195 38.705  1.00 61.01  ? 86   ALA C CB    1 
ATOM   2022  N  N     . VAL C  3 87  ? -31.961 -38.180 40.319  1.00 60.92  ? 87   VAL C N     1 
ATOM   2023  C  CA    . VAL C  3 87  ? -30.693 -37.449 40.401  1.00 60.05  ? 87   VAL C CA    1 
ATOM   2024  C  C     . VAL C  3 87  ? -30.154 -37.433 41.827  1.00 59.87  ? 87   VAL C C     1 
ATOM   2025  O  O     . VAL C  3 87  ? -29.029 -37.872 42.056  1.00 60.18  ? 87   VAL C O     1 
ATOM   2026  C  CB    . VAL C  3 87  ? -30.822 -36.013 39.797  1.00 59.92  ? 87   VAL C CB    1 
ATOM   2027  C  CG1   . VAL C  3 87  ? -29.635 -35.136 40.155  1.00 60.67  ? 87   VAL C CG1   1 
ATOM   2028  C  CG2   . VAL C  3 87  ? -30.985 -36.082 38.277  1.00 58.65  ? 87   VAL C CG2   1 
ATOM   2029  N  N     . ARG C  3 88  ? -30.954 -36.966 42.779  1.00 59.44  ? 88   ARG C N     1 
ATOM   2030  C  CA    . ARG C  3 88  ? -30.495 -36.845 44.171  1.00 59.68  ? 88   ARG C CA    1 
ATOM   2031  C  C     . ARG C  3 88  ? -30.308 -38.180 44.928  1.00 60.14  ? 88   ARG C C     1 
ATOM   2032  O  O     . ARG C  3 88  ? -29.588 -38.239 45.924  1.00 60.75  ? 88   ARG C O     1 
ATOM   2033  C  CB    . ARG C  3 88  ? -31.412 -35.906 44.981  1.00 59.40  ? 88   ARG C CB    1 
ATOM   2034  C  CG    . ARG C  3 88  ? -31.687 -34.528 44.368  1.00 58.15  ? 88   ARG C CG    1 
ATOM   2035  C  CD    . ARG C  3 88  ? -30.393 -33.768 44.039  1.00 57.55  ? 88   ARG C CD    1 
ATOM   2036  N  NE    . ARG C  3 88  ? -30.594 -32.752 43.008  1.00 53.72  ? 88   ARG C NE    1 
ATOM   2037  C  CZ    . ARG C  3 88  ? -29.623 -32.184 42.306  1.00 52.62  ? 88   ARG C CZ    1 
ATOM   2038  N  NH1   . ARG C  3 88  ? -28.363 -32.547 42.518  1.00 54.46  ? 88   ARG C NH1   1 
ATOM   2039  N  NH2   . ARG C  3 88  ? -29.910 -31.261 41.386  1.00 48.24  ? 88   ARG C NH2   1 
ATOM   2040  N  N     . ASN C  3 89  ? -30.956 -39.251 44.480  1.00 60.63  ? 89   ASN C N     1 
ATOM   2041  C  CA    . ASN C  3 89  ? -30.706 -40.567 45.080  1.00 60.77  ? 89   ASN C CA    1 
ATOM   2042  C  C     . ASN C  3 89  ? -29.508 -41.292 44.476  1.00 61.21  ? 89   ASN C C     1 
ATOM   2043  O  O     . ASN C  3 89  ? -29.085 -42.300 45.012  1.00 61.45  ? 89   ASN C O     1 
ATOM   2044  C  CB    . ASN C  3 89  ? -31.944 -41.450 45.022  1.00 60.43  ? 89   ASN C CB    1 
ATOM   2045  C  CG    . ASN C  3 89  ? -33.006 -41.020 46.001  1.00 60.30  ? 89   ASN C CG    1 
ATOM   2046  O  OD1   . ASN C  3 89  ? -32.801 -41.050 47.215  1.00 60.23  ? 89   ASN C OD1   1 
ATOM   2047  N  ND2   . ASN C  3 89  ? -34.153 -40.616 45.481  1.00 59.80  ? 89   ASN C ND2   1 
ATOM   2048  N  N     . ASP C  3 90  ? -28.974 -40.782 43.368  1.00 61.90  ? 90   ASP C N     1 
ATOM   2049  C  CA    . ASP C  3 90  ? -27.771 -41.325 42.763  1.00 62.83  ? 90   ASP C CA    1 
ATOM   2050  C  C     . ASP C  3 90  ? -26.564 -40.428 43.011  1.00 63.59  ? 90   ASP C C     1 
ATOM   2051  O  O     . ASP C  3 90  ? -26.494 -39.290 42.527  1.00 64.19  ? 90   ASP C O     1 
ATOM   2052  C  CB    . ASP C  3 90  ? -27.946 -41.523 41.262  1.00 63.09  ? 90   ASP C CB    1 
ATOM   2053  C  CG    . ASP C  3 90  ? -26.702 -42.113 40.605  1.00 64.94  ? 90   ASP C CG    1 
ATOM   2054  O  OD1   . ASP C  3 90  ? -26.383 -41.778 39.446  1.00 67.20  ? 90   ASP C OD1   1 
ATOM   2055  O  OD2   . ASP C  3 90  ? -26.011 -42.915 41.254  1.00 69.01  ? 90   ASP C OD2   1 
ATOM   2056  N  N     . GLU C  3 91  ? -25.596 -40.966 43.738  1.00 64.19  ? 91   GLU C N     1 
ATOM   2057  C  CA    . GLU C  3 91  ? -24.413 -40.225 44.155  1.00 64.52  ? 91   GLU C CA    1 
ATOM   2058  C  C     . GLU C  3 91  ? -23.709 -39.520 42.996  1.00 63.91  ? 91   GLU C C     1 
ATOM   2059  O  O     . GLU C  3 91  ? -23.348 -38.361 43.111  1.00 64.56  ? 91   GLU C O     1 
ATOM   2060  C  CB    . GLU C  3 91  ? -23.447 -41.162 44.888  1.00 64.93  ? 91   GLU C CB    1 
ATOM   2061  C  CG    . GLU C  3 91  ? -22.317 -40.482 45.648  1.00 68.32  ? 91   GLU C CG    1 
ATOM   2062  C  CD    . GLU C  3 91  ? -21.036 -41.332 45.685  1.00 73.70  ? 91   GLU C CD    1 
ATOM   2063  O  OE1   . GLU C  3 91  ? -20.731 -42.048 44.687  1.00 75.23  ? 91   GLU C OE1   1 
ATOM   2064  O  OE2   . GLU C  3 91  ? -20.325 -41.284 46.723  1.00 75.71  ? 91   GLU C OE2   1 
ATOM   2065  N  N     . GLU C  3 92  ? -23.525 -40.194 41.874  1.00 63.52  ? 92   GLU C N     1 
ATOM   2066  C  CA    . GLU C  3 92  ? -22.719 -39.601 40.816  1.00 62.96  ? 92   GLU C CA    1 
ATOM   2067  C  C     . GLU C  3 92  ? -23.459 -38.533 40.025  1.00 62.46  ? 92   GLU C C     1 
ATOM   2068  O  O     . GLU C  3 92  ? -22.861 -37.531 39.634  1.00 62.76  ? 92   GLU C O     1 
ATOM   2069  C  CB    . GLU C  3 92  ? -22.116 -40.664 39.913  1.00 62.78  ? 92   GLU C CB    1 
ATOM   2070  C  CG    . GLU C  3 92  ? -21.016 -41.460 40.613  1.00 64.79  ? 92   GLU C CG    1 
ATOM   2071  C  CD    . GLU C  3 92  ? -20.203 -42.321 39.666  1.00 68.36  ? 92   GLU C CD    1 
ATOM   2072  O  OE1   . GLU C  3 92  ? -20.753 -42.763 38.631  1.00 70.32  ? 92   GLU C OE1   1 
ATOM   2073  O  OE2   . GLU C  3 92  ? -19.005 -42.562 39.945  1.00 70.82  ? 92   GLU C OE2   1 
ATOM   2074  N  N     . LEU C  3 93  ? -24.751 -38.746 39.795  1.00 61.43  ? 93   LEU C N     1 
ATOM   2075  C  CA    . LEU C  3 93  ? -25.563 -37.781 39.080  1.00 60.59  ? 93   LEU C CA    1 
ATOM   2076  C  C     . LEU C  3 93  ? -25.819 -36.559 39.962  1.00 60.28  ? 93   LEU C C     1 
ATOM   2077  O  O     . LEU C  3 93  ? -25.888 -35.428 39.468  1.00 59.68  ? 93   LEU C O     1 
ATOM   2078  C  CB    . LEU C  3 93  ? -26.883 -38.405 38.617  1.00 60.55  ? 93   LEU C CB    1 
ATOM   2079  C  CG    . LEU C  3 93  ? -26.866 -39.326 37.386  1.00 60.37  ? 93   LEU C CG    1 
ATOM   2080  C  CD1   . LEU C  3 93  ? -28.216 -39.997 37.225  1.00 60.18  ? 93   LEU C CD1   1 
ATOM   2081  C  CD2   . LEU C  3 93  ? -26.450 -38.618 36.087  1.00 60.19  ? 93   LEU C CD2   1 
ATOM   2082  N  N     . ASN C  3 94  ? -25.950 -36.798 41.266  1.00 59.60  ? 94   ASN C N     1 
ATOM   2083  C  CA    . ASN C  3 94  ? -26.077 -35.721 42.219  1.00 59.25  ? 94   ASN C CA    1 
ATOM   2084  C  C     . ASN C  3 94  ? -24.853 -34.815 42.216  1.00 59.22  ? 94   ASN C C     1 
ATOM   2085  O  O     . ASN C  3 94  ? -24.982 -33.598 42.385  1.00 59.54  ? 94   ASN C O     1 
ATOM   2086  C  CB    . ASN C  3 94  ? -26.321 -36.262 43.621  1.00 59.66  ? 94   ASN C CB    1 
ATOM   2087  C  CG    . ASN C  3 94  ? -26.544 -35.159 44.635  1.00 59.57  ? 94   ASN C CG    1 
ATOM   2088  O  OD1   . ASN C  3 94  ? -27.357 -34.258 44.417  1.00 60.27  ? 94   ASN C OD1   1 
ATOM   2089  N  ND2   . ASN C  3 94  ? -25.817 -35.214 45.736  1.00 58.00  ? 94   ASN C ND2   1 
ATOM   2090  N  N     . LYS C  3 95  ? -23.676 -35.400 42.014  1.00 58.80  ? 95   LYS C N     1 
ATOM   2091  C  CA    . LYS C  3 95  ? -22.453 -34.629 41.895  1.00 58.84  ? 95   LYS C CA    1 
ATOM   2092  C  C     . LYS C  3 95  ? -22.452 -33.849 40.583  1.00 58.61  ? 95   LYS C C     1 
ATOM   2093  O  O     . LYS C  3 95  ? -22.228 -32.629 40.570  1.00 59.32  ? 95   LYS C O     1 
ATOM   2094  C  CB    . LYS C  3 95  ? -21.240 -35.540 41.967  1.00 59.27  ? 95   LYS C CB    1 
ATOM   2095  C  CG    . LYS C  3 95  ? -19.989 -34.887 42.568  1.00 61.61  ? 95   LYS C CG    1 
ATOM   2096  C  CD    . LYS C  3 95  ? -18.833 -35.891 42.693  1.00 65.87  ? 95   LYS C CD    1 
ATOM   2097  C  CE    . LYS C  3 95  ? -19.148 -37.029 43.691  1.00 67.89  ? 95   LYS C CE    1 
ATOM   2098  N  NZ    . LYS C  3 95  ? -18.422 -38.324 43.416  1.00 68.32  ? 95   LYS C NZ    1 
ATOM   2099  N  N     . LEU C  3 96  ? -22.739 -34.540 39.485  1.00 57.84  ? 96   LEU C N     1 
ATOM   2100  C  CA    . LEU C  3 96  ? -22.783 -33.914 38.160  1.00 56.99  ? 96   LEU C CA    1 
ATOM   2101  C  C     . LEU C  3 96  ? -23.785 -32.736 38.062  1.00 57.31  ? 96   LEU C C     1 
ATOM   2102  O  O     . LEU C  3 96  ? -23.566 -31.773 37.311  1.00 57.66  ? 96   LEU C O     1 
ATOM   2103  C  CB    . LEU C  3 96  ? -23.084 -34.979 37.103  1.00 56.44  ? 96   LEU C CB    1 
ATOM   2104  C  CG    . LEU C  3 96  ? -23.217 -34.536 35.654  1.00 56.44  ? 96   LEU C CG    1 
ATOM   2105  C  CD1   . LEU C  3 96  ? -21.928 -33.897 35.179  1.00 56.40  ? 96   LEU C CD1   1 
ATOM   2106  C  CD2   . LEU C  3 96  ? -23.645 -35.659 34.728  1.00 56.14  ? 96   LEU C CD2   1 
ATOM   2107  N  N     . LEU C  3 97  ? -24.883 -32.817 38.804  1.00 56.87  ? 97   LEU C N     1 
ATOM   2108  C  CA    . LEU C  3 97  ? -25.870 -31.751 38.799  1.00 56.75  ? 97   LEU C CA    1 
ATOM   2109  C  C     . LEU C  3 97  ? -25.877 -31.082 40.173  1.00 57.34  ? 97   LEU C C     1 
ATOM   2110  O  O     . LEU C  3 97  ? -26.941 -30.719 40.710  1.00 56.55  ? 97   LEU C O     1 
ATOM   2111  C  CB    . LEU C  3 97  ? -27.258 -32.286 38.433  1.00 56.59  ? 97   LEU C CB    1 
ATOM   2112  C  CG    . LEU C  3 97  ? -27.357 -33.052 37.110  1.00 56.05  ? 97   LEU C CG    1 
ATOM   2113  C  CD1   . LEU C  3 97  ? -28.794 -33.413 36.773  1.00 53.69  ? 97   LEU C CD1   1 
ATOM   2114  C  CD2   . LEU C  3 97  ? -26.695 -32.289 35.970  1.00 56.21  ? 97   LEU C CD2   1 
ATOM   2115  N  N     . GLY C  3 98  ? -24.672 -30.932 40.737  1.00 57.45  ? 98   GLY C N     1 
ATOM   2116  C  CA    . GLY C  3 98  ? -24.511 -30.315 42.047  1.00 57.74  ? 98   GLY C CA    1 
ATOM   2117  C  C     . GLY C  3 98  ? -25.057 -28.902 42.112  1.00 57.94  ? 98   GLY C C     1 
ATOM   2118  O  O     . GLY C  3 98  ? -25.583 -28.491 43.135  1.00 58.03  ? 98   GLY C O     1 
ATOM   2119  N  N     . ARG C  3 99  ? -24.947 -28.176 41.003  1.00 58.38  ? 99   ARG C N     1 
ATOM   2120  C  CA    . ARG C  3 99  ? -25.236 -26.738 40.950  1.00 58.92  ? 99   ARG C CA    1 
ATOM   2121  C  C     . ARG C  3 99  ? -26.420 -26.425 40.020  1.00 58.47  ? 99   ARG C C     1 
ATOM   2122  O  O     . ARG C  3 99  ? -26.461 -25.377 39.356  1.00 58.73  ? 99   ARG C O     1 
ATOM   2123  C  CB    . ARG C  3 99  ? -23.983 -25.991 40.464  1.00 59.07  ? 99   ARG C CB    1 
ATOM   2124  C  CG    . ARG C  3 99  ? -22.787 -26.094 41.383  1.00 62.02  ? 99   ARG C CG    1 
ATOM   2125  C  CD    . ARG C  3 99  ? -23.120 -25.549 42.776  1.00 69.60  ? 99   ARG C CD    1 
ATOM   2126  N  NE    . ARG C  3 99  ? -21.940 -25.391 43.628  1.00 74.65  ? 99   ARG C NE    1 
ATOM   2127  C  CZ    . ARG C  3 99  ? -21.945 -24.786 44.819  1.00 77.84  ? 99   ARG C CZ    1 
ATOM   2128  N  NH1   . ARG C  3 99  ? -23.076 -24.260 45.306  1.00 78.67  ? 99   ARG C NH1   1 
ATOM   2129  N  NH2   . ARG C  3 99  ? -20.817 -24.707 45.527  1.00 77.36  ? 99   ARG C NH2   1 
ATOM   2130  N  N     . VAL C  3 100 ? -27.354 -27.370 39.953  1.00 57.73  ? 100  VAL C N     1 
ATOM   2131  C  CA    . VAL C  3 100 ? -28.491 -27.317 39.046  1.00 56.81  ? 100  VAL C CA    1 
ATOM   2132  C  C     . VAL C  3 100 ? -29.725 -27.472 39.879  1.00 55.89  ? 100  VAL C C     1 
ATOM   2133  O  O     . VAL C  3 100 ? -29.739 -28.194 40.848  1.00 54.90  ? 100  VAL C O     1 
ATOM   2134  C  CB    . VAL C  3 100 ? -28.460 -28.446 38.004  1.00 56.81  ? 100  VAL C CB    1 
ATOM   2135  C  CG1   . VAL C  3 100 ? -29.712 -28.431 37.199  1.00 57.60  ? 100  VAL C CG1   1 
ATOM   2136  C  CG2   . VAL C  3 100 ? -27.272 -28.289 37.062  1.00 57.36  ? 100  VAL C CG2   1 
ATOM   2137  N  N     . THR C  3 101 ? -30.751 -26.726 39.542  1.00 56.41  ? 101  THR C N     1 
ATOM   2138  C  CA    . THR C  3 101 ? -32.018 -26.943 40.181  1.00 57.29  ? 101  THR C CA    1 
ATOM   2139  C  C     . THR C  3 101 ? -32.977 -27.398 39.094  1.00 57.50  ? 101  THR C C     1 
ATOM   2140  O  O     . THR C  3 101 ? -33.074 -26.804 38.007  1.00 56.76  ? 101  THR C O     1 
ATOM   2141  C  CB    . THR C  3 101 ? -32.569 -25.702 40.909  1.00 57.49  ? 101  THR C CB    1 
ATOM   2142  O  OG1   . THR C  3 101 ? -33.405 -24.988 40.011  1.00 59.66  ? 101  THR C OG1   1 
ATOM   2143  C  CG2   . THR C  3 101 ? -31.459 -24.771 41.410  1.00 56.93  ? 101  THR C CG2   1 
ATOM   2144  N  N     . ILE C  3 102 ? -33.646 -28.498 39.396  1.00 58.44  ? 102  ILE C N     1 
ATOM   2145  C  CA    . ILE C  3 102 ? -34.638 -29.074 38.519  1.00 59.08  ? 102  ILE C CA    1 
ATOM   2146  C  C     . ILE C  3 102 ? -35.936 -28.439 38.944  1.00 59.52  ? 102  ILE C C     1 
ATOM   2147  O  O     . ILE C  3 102 ? -36.342 -28.577 40.098  1.00 59.44  ? 102  ILE C O     1 
ATOM   2148  C  CB    . ILE C  3 102 ? -34.653 -30.608 38.677  1.00 58.93  ? 102  ILE C CB    1 
ATOM   2149  C  CG1   . ILE C  3 102 ? -33.348 -31.183 38.119  1.00 59.57  ? 102  ILE C CG1   1 
ATOM   2150  C  CG2   . ILE C  3 102 ? -35.835 -31.212 37.971  1.00 58.61  ? 102  ILE C CG2   1 
ATOM   2151  C  CD1   . ILE C  3 102 ? -33.029 -32.582 38.584  1.00 60.47  ? 102  ILE C CD1   1 
ATOM   2152  N  N     . ALA C  3 103 ? -36.562 -27.694 38.038  1.00 60.54  ? 103  ALA C N     1 
ATOM   2153  C  CA    . ALA C  3 103 ? -37.796 -27.000 38.396  1.00 62.06  ? 103  ALA C CA    1 
ATOM   2154  C  C     . ALA C  3 103 ? -38.811 -28.058 38.767  1.00 62.97  ? 103  ALA C C     1 
ATOM   2155  O  O     . ALA C  3 103 ? -38.807 -29.140 38.175  1.00 63.59  ? 103  ALA C O     1 
ATOM   2156  C  CB    . ALA C  3 103 ? -38.316 -26.130 37.245  1.00 61.72  ? 103  ALA C CB    1 
ATOM   2157  N  N     . GLN C  3 104 ? -39.657 -27.756 39.751  1.00 63.73  ? 104  GLN C N     1 
ATOM   2158  C  CA    . GLN C  3 104 ? -40.759 -28.637 40.120  1.00 64.47  ? 104  GLN C CA    1 
ATOM   2159  C  C     . GLN C  3 104 ? -40.258 -29.994 40.629  1.00 64.66  ? 104  GLN C C     1 
ATOM   2160  O  O     . GLN C  3 104 ? -40.927 -31.013 40.451  1.00 65.19  ? 104  GLN C O     1 
ATOM   2161  C  CB    . GLN C  3 104 ? -41.732 -28.817 38.933  1.00 64.76  ? 104  GLN C CB    1 
ATOM   2162  C  CG    . GLN C  3 104 ? -42.794 -27.715 38.789  1.00 67.12  ? 104  GLN C CG    1 
ATOM   2163  C  CD    . GLN C  3 104 ? -43.349 -27.247 40.148  1.00 71.07  ? 104  GLN C CD    1 
ATOM   2164  O  OE1   . GLN C  3 104 ? -44.166 -27.932 40.781  1.00 71.60  ? 104  GLN C OE1   1 
ATOM   2165  N  NE2   . GLN C  3 104 ? -42.887 -26.078 40.603  1.00 72.55  ? 104  GLN C NE2   1 
ATOM   2166  N  N     . GLY C  3 105 ? -39.085 -30.015 41.259  1.00 64.14  ? 105  GLY C N     1 
ATOM   2167  C  CA    . GLY C  3 105 ? -38.506 -31.271 41.698  1.00 63.32  ? 105  GLY C CA    1 
ATOM   2168  C  C     . GLY C  3 105 ? -38.702 -31.577 43.168  1.00 63.06  ? 105  GLY C C     1 
ATOM   2169  O  O     . GLY C  3 105 ? -38.694 -32.750 43.572  1.00 63.05  ? 105  GLY C O     1 
ATOM   2170  N  N     . GLY C  3 106 ? -38.876 -30.531 43.972  1.00 62.46  ? 106  GLY C N     1 
ATOM   2171  C  CA    . GLY C  3 106 ? -38.973 -30.670 45.420  1.00 62.10  ? 106  GLY C CA    1 
ATOM   2172  C  C     . GLY C  3 106 ? -37.668 -31.168 45.999  1.00 62.38  ? 106  GLY C C     1 
ATOM   2173  O  O     . GLY C  3 106 ? -36.621 -31.075 45.360  1.00 62.11  ? 106  GLY C O     1 
ATOM   2174  N  N     . VAL C  3 107 ? -37.730 -31.717 47.208  1.00 63.19  ? 107  VAL C N     1 
ATOM   2175  C  CA    . VAL C  3 107 ? -36.547 -32.276 47.852  1.00 64.15  ? 107  VAL C CA    1 
ATOM   2176  C  C     . VAL C  3 107 ? -36.700 -33.747 48.199  1.00 64.69  ? 107  VAL C C     1 
ATOM   2177  O  O     . VAL C  3 107 ? -37.807 -34.266 48.224  1.00 64.61  ? 107  VAL C O     1 
ATOM   2178  C  CB    . VAL C  3 107 ? -36.198 -31.511 49.151  1.00 64.43  ? 107  VAL C CB    1 
ATOM   2179  C  CG1   . VAL C  3 107 ? -35.915 -30.031 48.855  1.00 64.02  ? 107  VAL C CG1   1 
ATOM   2180  C  CG2   . VAL C  3 107 ? -37.309 -31.662 50.181  1.00 64.55  ? 107  VAL C CG2   1 
ATOM   2181  N  N     . LEU C  3 108 ? -35.578 -34.411 48.477  1.00 65.61  ? 108  LEU C N     1 
ATOM   2182  C  CA    . LEU C  3 108 ? -35.596 -35.745 49.067  1.00 66.26  ? 108  LEU C CA    1 
ATOM   2183  C  C     . LEU C  3 108 ? -36.186 -35.652 50.457  1.00 66.90  ? 108  LEU C C     1 
ATOM   2184  O  O     . LEU C  3 108 ? -35.813 -34.765 51.209  1.00 67.47  ? 108  LEU C O     1 
ATOM   2185  C  CB    . LEU C  3 108 ? -34.180 -36.301 49.188  1.00 66.00  ? 108  LEU C CB    1 
ATOM   2186  C  CG    . LEU C  3 108 ? -33.502 -36.874 47.948  1.00 66.52  ? 108  LEU C CG    1 
ATOM   2187  C  CD1   . LEU C  3 108 ? -32.186 -37.582 48.313  1.00 67.30  ? 108  LEU C CD1   1 
ATOM   2188  C  CD2   . LEU C  3 108 ? -34.420 -37.817 47.211  1.00 67.58  ? 108  LEU C CD2   1 
ATOM   2189  N  N     . PRO C  3 109 ? -37.128 -36.544 50.805  1.00 67.85  ? 109  PRO C N     1 
ATOM   2190  C  CA    . PRO C  3 109 ? -37.580 -36.556 52.199  1.00 68.26  ? 109  PRO C CA    1 
ATOM   2191  C  C     . PRO C  3 109 ? -36.406 -36.853 53.117  1.00 68.77  ? 109  PRO C C     1 
ATOM   2192  O  O     . PRO C  3 109 ? -35.755 -37.882 52.955  1.00 69.29  ? 109  PRO C O     1 
ATOM   2193  C  CB    . PRO C  3 109 ? -38.596 -37.704 52.229  1.00 68.03  ? 109  PRO C CB    1 
ATOM   2194  C  CG    . PRO C  3 109 ? -39.082 -37.798 50.811  1.00 67.86  ? 109  PRO C CG    1 
ATOM   2195  C  CD    . PRO C  3 109 ? -37.853 -37.541 49.992  1.00 67.90  ? 109  PRO C CD    1 
ATOM   2196  N  N     . ASN C  3 110 ? -36.131 -35.939 54.047  1.00 69.25  ? 110  ASN C N     1 
ATOM   2197  C  CA    . ASN C  3 110 ? -34.995 -36.050 54.955  1.00 69.67  ? 110  ASN C CA    1 
ATOM   2198  C  C     . ASN C  3 110 ? -35.284 -35.255 56.223  1.00 69.86  ? 110  ASN C C     1 
ATOM   2199  O  O     . ASN C  3 110 ? -35.450 -34.042 56.160  1.00 69.71  ? 110  ASN C O     1 
ATOM   2200  C  CB    . ASN C  3 110 ? -33.722 -35.529 54.272  1.00 69.68  ? 110  ASN C CB    1 
ATOM   2201  C  CG    . ASN C  3 110 ? -32.441 -35.936 55.008  1.00 71.02  ? 110  ASN C CG    1 
ATOM   2202  O  OD1   . ASN C  3 110 ? -32.381 -36.995 55.633  1.00 74.81  ? 110  ASN C OD1   1 
ATOM   2203  N  ND2   . ASN C  3 110 ? -31.408 -35.107 54.915  1.00 70.62  ? 110  ASN C ND2   1 
ATOM   2204  N  N     . ILE C  3 111 ? -35.382 -35.939 57.364  1.00 70.49  ? 111  ILE C N     1 
ATOM   2205  C  CA    . ILE C  3 111 ? -35.597 -35.271 58.665  1.00 70.76  ? 111  ILE C CA    1 
ATOM   2206  C  C     . ILE C  3 111 ? -34.502 -35.670 59.642  1.00 70.86  ? 111  ILE C C     1 
ATOM   2207  O  O     . ILE C  3 111 ? -34.223 -36.851 59.824  1.00 70.83  ? 111  ILE C O     1 
ATOM   2208  C  CB    . ILE C  3 111 ? -36.971 -35.599 59.323  1.00 70.82  ? 111  ILE C CB    1 
ATOM   2209  C  CG1   . ILE C  3 111 ? -38.124 -35.596 58.313  1.00 71.62  ? 111  ILE C CG1   1 
ATOM   2210  C  CG2   . ILE C  3 111 ? -37.254 -34.638 60.474  1.00 70.61  ? 111  ILE C CG2   1 
ATOM   2211  C  CD1   . ILE C  3 111 ? -38.436 -36.988 57.726  1.00 74.38  ? 111  ILE C CD1   1 
ATOM   2212  N  N     . GLN C  3 112 ? -33.897 -34.677 60.277  1.00 71.47  ? 112  GLN C N     1 
ATOM   2213  C  CA    . GLN C  3 112 ? -32.759 -34.908 61.161  1.00 72.57  ? 112  GLN C CA    1 
ATOM   2214  C  C     . GLN C  3 112 ? -33.144 -35.679 62.423  1.00 73.34  ? 112  GLN C C     1 
ATOM   2215  O  O     . GLN C  3 112 ? -34.152 -35.383 63.066  1.00 73.58  ? 112  GLN C O     1 
ATOM   2216  C  CB    . GLN C  3 112 ? -32.082 -33.580 61.517  1.00 72.24  ? 112  GLN C CB    1 
ATOM   2217  C  CG    . GLN C  3 112 ? -31.594 -32.793 60.301  1.00 72.45  ? 112  GLN C CG    1 
ATOM   2218  C  CD    . GLN C  3 112 ? -30.627 -33.579 59.435  1.00 72.97  ? 112  GLN C CD    1 
ATOM   2219  O  OE1   . GLN C  3 112 ? -29.617 -34.064 59.924  1.00 75.02  ? 112  GLN C OE1   1 
ATOM   2220  N  NE2   . GLN C  3 112 ? -30.933 -33.706 58.144  1.00 72.56  ? 112  GLN C NE2   1 
ATOM   2221  N  N     . SER C  3 113 ? -32.325 -36.666 62.766  1.00 74.31  ? 113  SER C N     1 
ATOM   2222  C  CA    . SER C  3 113 ? -32.589 -37.553 63.896  1.00 75.46  ? 113  SER C CA    1 
ATOM   2223  C  C     . SER C  3 113 ? -33.152 -36.820 65.108  1.00 75.98  ? 113  SER C C     1 
ATOM   2224  O  O     . SER C  3 113 ? -34.268 -37.112 65.553  1.00 75.93  ? 113  SER C O     1 
ATOM   2225  C  CB    . SER C  3 113 ? -31.315 -38.309 64.292  1.00 75.47  ? 113  SER C CB    1 
ATOM   2226  O  OG    . SER C  3 113 ? -30.804 -39.057 63.195  1.00 76.87  ? 113  SER C OG    1 
ATOM   2227  N  N     . VAL C  3 114 ? -32.384 -35.858 65.616  1.00 76.58  ? 114  VAL C N     1 
ATOM   2228  C  CA    . VAL C  3 114 ? -32.724 -35.148 66.856  1.00 77.29  ? 114  VAL C CA    1 
ATOM   2229  C  C     . VAL C  3 114 ? -34.043 -34.371 66.825  1.00 77.73  ? 114  VAL C C     1 
ATOM   2230  O  O     . VAL C  3 114 ? -34.500 -33.897 67.862  1.00 77.74  ? 114  VAL C O     1 
ATOM   2231  C  CB    . VAL C  3 114 ? -31.587 -34.196 67.312  1.00 77.17  ? 114  VAL C CB    1 
ATOM   2232  C  CG1   . VAL C  3 114 ? -30.408 -34.996 67.862  1.00 77.59  ? 114  VAL C CG1   1 
ATOM   2233  C  CG2   . VAL C  3 114 ? -31.153 -33.283 66.169  1.00 77.18  ? 114  VAL C CG2   1 
ATOM   2234  N  N     . LEU C  3 115 ? -34.644 -34.231 65.644  1.00 78.42  ? 115  LEU C N     1 
ATOM   2235  C  CA    . LEU C  3 115 ? -35.950 -33.580 65.526  1.00 78.95  ? 115  LEU C CA    1 
ATOM   2236  C  C     . LEU C  3 115 ? -37.112 -34.550 65.732  1.00 79.93  ? 115  LEU C C     1 
ATOM   2237  O  O     . LEU C  3 115 ? -38.240 -34.121 65.952  1.00 79.90  ? 115  LEU C O     1 
ATOM   2238  C  CB    . LEU C  3 115 ? -36.099 -32.863 64.179  1.00 78.61  ? 115  LEU C CB    1 
ATOM   2239  C  CG    . LEU C  3 115 ? -35.147 -31.738 63.766  1.00 77.32  ? 115  LEU C CG    1 
ATOM   2240  C  CD1   . LEU C  3 115 ? -35.697 -31.101 62.508  1.00 75.48  ? 115  LEU C CD1   1 
ATOM   2241  C  CD2   . LEU C  3 115 ? -34.948 -30.698 64.864  1.00 75.20  ? 115  LEU C CD2   1 
ATOM   2242  N  N     . LEU C  3 116 ? -36.827 -35.849 65.645  1.00 81.49  ? 116  LEU C N     1 
ATOM   2243  C  CA    . LEU C  3 116 ? -37.816 -36.903 65.876  1.00 83.12  ? 116  LEU C CA    1 
ATOM   2244  C  C     . LEU C  3 116 ? -38.007 -37.159 67.369  1.00 84.44  ? 116  LEU C C     1 
ATOM   2245  O  O     . LEU C  3 116 ? -37.051 -37.052 68.133  1.00 84.47  ? 116  LEU C O     1 
ATOM   2246  C  CB    . LEU C  3 116 ? -37.374 -38.201 65.195  1.00 83.07  ? 116  LEU C CB    1 
ATOM   2247  C  CG    . LEU C  3 116 ? -37.127 -38.223 63.683  1.00 83.05  ? 116  LEU C CG    1 
ATOM   2248  C  CD1   . LEU C  3 116 ? -36.312 -39.438 63.323  1.00 83.67  ? 116  LEU C CD1   1 
ATOM   2249  C  CD2   . LEU C  3 116 ? -38.431 -38.228 62.918  1.00 83.13  ? 116  LEU C CD2   1 
ATOM   2250  N  N     . PRO C  3 117 ? -39.240 -37.507 67.793  1.00 86.13  ? 117  PRO C N     1 
ATOM   2251  C  CA    . PRO C  3 117 ? -39.488 -37.786 69.224  1.00 87.36  ? 117  PRO C CA    1 
ATOM   2252  C  C     . PRO C  3 117 ? -38.945 -39.153 69.651  1.00 88.66  ? 117  PRO C C     1 
ATOM   2253  O  O     . PRO C  3 117 ? -38.802 -40.049 68.808  1.00 88.98  ? 117  PRO C O     1 
ATOM   2254  C  CB    . PRO C  3 117 ? -41.013 -37.771 69.326  1.00 87.18  ? 117  PRO C CB    1 
ATOM   2255  C  CG    . PRO C  3 117 ? -41.477 -38.196 67.966  1.00 86.78  ? 117  PRO C CG    1 
ATOM   2256  C  CD    . PRO C  3 117 ? -40.465 -37.659 66.979  1.00 86.15  ? 117  PRO C CD    1 
ATOM   2257  N  N     . LYS C  3 118 ? -38.641 -39.306 70.941  1.00 90.27  ? 118  LYS C N     1 
ATOM   2258  C  CA    . LYS C  3 118 ? -38.160 -40.594 71.476  1.00 91.15  ? 118  LYS C CA    1 
ATOM   2259  C  C     . LYS C  3 118 ? -39.289 -41.622 71.595  1.00 91.43  ? 118  LYS C C     1 
ATOM   2260  O  O     . LYS C  3 118 ? -39.209 -42.715 70.992  1.00 91.94  ? 118  LYS C O     1 
ATOM   2261  C  CB    . LYS C  3 118 ? -37.467 -40.413 72.840  1.00 91.65  ? 118  LYS C CB    1 
ATOM   2262  C  CG    . LYS C  3 118 ? -36.723 -41.669 73.389  1.00 91.64  ? 118  LYS C CG    1 
ATOM   2263  C  CD    . LYS C  3 118 ? -35.448 -42.003 72.591  1.00 94.17  ? 118  LYS C CD    1 
ATOM   2264  C  CE    . LYS C  3 118 ? -35.720 -43.074 71.521  1.00 95.23  ? 118  LYS C CE    1 
ATOM   2265  N  NZ    . LYS C  3 118 ? -34.771 -43.030 70.361  1.00 95.87  ? 118  LYS C NZ    1 
ATOM   2266  N  N     . LYS D  4 24  ? -48.119 -19.562 5.551   1.00 129.71 ? 24   LYS D N     1 
ATOM   2267  C  CA    . LYS D  4 24  ? -47.037 -19.436 4.521   1.00 129.70 ? 24   LYS D CA    1 
ATOM   2268  C  C     . LYS D  4 24  ? -46.507 -18.000 4.410   1.00 129.47 ? 24   LYS D C     1 
ATOM   2269  O  O     . LYS D  4 24  ? -47.019 -17.090 5.077   1.00 129.49 ? 24   LYS D O     1 
ATOM   2270  C  CB    . LYS D  4 24  ? -47.531 -19.941 3.150   1.00 129.89 ? 24   LYS D CB    1 
ATOM   2271  C  CG    . LYS D  4 24  ? -47.714 -21.470 3.038   1.00 130.32 ? 24   LYS D CG    1 
ATOM   2272  C  CD    . LYS D  4 24  ? -46.415 -22.252 3.310   1.00 131.24 ? 24   LYS D CD    1 
ATOM   2273  C  CE    . LYS D  4 24  ? -45.325 -21.954 2.276   1.00 131.49 ? 24   LYS D CE    1 
ATOM   2274  N  NZ    . LYS D  4 24  ? -43.956 -22.307 2.766   1.00 131.59 ? 24   LYS D NZ    1 
ATOM   2275  N  N     . LYS D  4 25  ? -45.476 -17.818 3.575   1.00 129.08 ? 25   LYS D N     1 
ATOM   2276  C  CA    . LYS D  4 25  ? -44.821 -16.518 3.328   1.00 128.70 ? 25   LYS D CA    1 
ATOM   2277  C  C     . LYS D  4 25  ? -44.128 -15.954 4.583   1.00 128.20 ? 25   LYS D C     1 
ATOM   2278  O  O     . LYS D  4 25  ? -42.913 -15.729 4.578   1.00 128.35 ? 25   LYS D O     1 
ATOM   2279  C  CB    . LYS D  4 25  ? -45.795 -15.507 2.680   1.00 128.88 ? 25   LYS D CB    1 
ATOM   2280  C  CG    . LYS D  4 25  ? -45.158 -14.366 1.858   1.00 129.20 ? 25   LYS D CG    1 
ATOM   2281  C  CD    . LYS D  4 25  ? -44.213 -14.865 0.759   1.00 129.92 ? 25   LYS D CD    1 
ATOM   2282  C  CE    . LYS D  4 25  ? -42.756 -14.757 1.206   1.00 130.45 ? 25   LYS D CE    1 
ATOM   2283  N  NZ    . LYS D  4 25  ? -41.934 -15.907 0.731   1.00 131.01 ? 25   LYS D NZ    1 
ATOM   2284  N  N     . ARG D  4 26  ? -44.903 -15.728 5.644   1.00 127.39 ? 26   ARG D N     1 
ATOM   2285  C  CA    . ARG D  4 26  ? -44.356 -15.447 6.970   1.00 126.57 ? 26   ARG D CA    1 
ATOM   2286  C  C     . ARG D  4 26  ? -44.357 -16.739 7.797   1.00 125.73 ? 26   ARG D C     1 
ATOM   2287  O  O     . ARG D  4 26  ? -45.425 -17.239 8.180   1.00 125.60 ? 26   ARG D O     1 
ATOM   2288  C  CB    . ARG D  4 26  ? -45.168 -14.350 7.667   1.00 126.75 ? 26   ARG D CB    1 
ATOM   2289  C  CG    . ARG D  4 26  ? -44.796 -14.119 9.130   1.00 127.40 ? 26   ARG D CG    1 
ATOM   2290  C  CD    . ARG D  4 26  ? -45.287 -12.768 9.633   1.00 128.73 ? 26   ARG D CD    1 
ATOM   2291  N  NE    . ARG D  4 26  ? -44.660 -11.661 8.908   1.00 129.77 ? 26   ARG D NE    1 
ATOM   2292  C  CZ    . ARG D  4 26  ? -44.485 -10.435 9.399   1.00 130.70 ? 26   ARG D CZ    1 
ATOM   2293  N  NH1   . ARG D  4 26  ? -44.876 -10.140 10.633  1.00 131.28 ? 26   ARG D NH1   1 
ATOM   2294  N  NH2   . ARG D  4 26  ? -43.903 -9.500  8.655   1.00 131.38 ? 26   ARG D NH2   1 
ATOM   2295  N  N     . ARG D  4 27  ? -43.157 -17.270 8.059   1.00 124.61 ? 27   ARG D N     1 
ATOM   2296  C  CA    . ARG D  4 27  ? -42.988 -18.536 8.789   1.00 123.37 ? 27   ARG D CA    1 
ATOM   2297  C  C     . ARG D  4 27  ? -42.758 -18.332 10.289  1.00 122.24 ? 27   ARG D C     1 
ATOM   2298  O  O     . ARG D  4 27  ? -41.909 -17.533 10.690  1.00 122.17 ? 27   ARG D O     1 
ATOM   2299  C  CB    . ARG D  4 27  ? -41.852 -19.373 8.169   1.00 123.54 ? 27   ARG D CB    1 
ATOM   2300  C  CG    . ARG D  4 27  ? -41.457 -20.654 8.940   1.00 123.97 ? 27   ARG D CG    1 
ATOM   2301  C  CD    . ARG D  4 27  ? -42.647 -21.590 9.221   1.00 124.97 ? 27   ARG D CD    1 
ATOM   2302  N  NE    . ARG D  4 27  ? -43.324 -22.031 7.999   1.00 125.46 ? 27   ARG D NE    1 
ATOM   2303  C  CZ    . ARG D  4 27  ? -43.330 -23.283 7.546   1.00 125.75 ? 27   ARG D CZ    1 
ATOM   2304  N  NH1   . ARG D  4 27  ? -42.704 -24.247 8.216   1.00 126.18 ? 27   ARG D NH1   1 
ATOM   2305  N  NH2   . ARG D  4 27  ? -43.972 -23.574 6.422   1.00 125.61 ? 27   ARG D NH2   1 
ATOM   2306  N  N     . LYS D  4 28  ? -43.512 -19.082 11.096  1.00 120.84 ? 28   LYS D N     1 
ATOM   2307  C  CA    . LYS D  4 28  ? -43.452 -19.028 12.564  1.00 119.44 ? 28   LYS D CA    1 
ATOM   2308  C  C     . LYS D  4 28  ? -42.148 -19.625 13.128  1.00 118.21 ? 28   LYS D C     1 
ATOM   2309  O  O     . LYS D  4 28  ? -42.162 -20.670 13.790  1.00 118.07 ? 28   LYS D O     1 
ATOM   2310  C  CB    . LYS D  4 28  ? -44.688 -19.729 13.160  1.00 119.57 ? 28   LYS D CB    1 
ATOM   2311  C  CG    . LYS D  4 28  ? -45.055 -19.313 14.591  1.00 119.94 ? 28   LYS D CG    1 
ATOM   2312  C  CD    . LYS D  4 28  ? -44.488 -20.396 15.645  1.00 120.07 ? 28   LYS D CD    1 
ATOM   2313  C  CE    . LYS D  4 28  ? -44.853 -19.763 17.073  1.00 120.38 ? 28   LYS D CE    1 
ATOM   2314  N  NZ    . LYS D  4 28  ? -44.260 -20.663 18.139  1.00 120.31 ? 28   LYS D NZ    1 
ATOM   2315  N  N     . THR D  4 29  ? -41.029 -18.947 12.853  1.00 116.61 ? 29   THR D N     1 
ATOM   2316  C  CA    . THR D  4 29  ? -39.691 -19.352 13.313  1.00 114.90 ? 29   THR D CA    1 
ATOM   2317  C  C     . THR D  4 29  ? -39.483 -20.875 13.198  1.00 113.50 ? 29   THR D C     1 
ATOM   2318  O  O     . THR D  4 29  ? -39.967 -21.497 12.246  1.00 113.64 ? 29   THR D O     1 
ATOM   2319  C  CB    . THR D  4 29  ? -39.400 -18.830 14.754  1.00 115.12 ? 29   THR D CB    1 
ATOM   2320  O  OG1   . THR D  4 29  ? -39.919 -17.500 14.904  1.00 115.01 ? 29   THR D OG1   1 
ATOM   2321  C  CG2   . THR D  4 29  ? -37.894 -18.808 15.034  1.00 115.25 ? 29   THR D CG2   1 
ATOM   2322  N  N     . ARG D  4 30  ? -38.766 -21.462 14.156  1.00 111.45 ? 30   ARG D N     1 
ATOM   2323  C  CA    . ARG D  4 30  ? -38.519 -22.903 14.206  1.00 109.36 ? 30   ARG D CA    1 
ATOM   2324  C  C     . ARG D  4 30  ? -37.610 -23.247 15.382  1.00 107.67 ? 30   ARG D C     1 
ATOM   2325  O  O     . ARG D  4 30  ? -36.386 -23.106 15.292  1.00 107.53 ? 30   ARG D O     1 
ATOM   2326  C  CB    . ARG D  4 30  ? -37.910 -23.418 12.893  1.00 109.55 ? 30   ARG D CB    1 
ATOM   2327  C  CG    . ARG D  4 30  ? -37.606 -24.906 12.888  1.00 109.92 ? 30   ARG D CG    1 
ATOM   2328  C  CD    . ARG D  4 30  ? -37.410 -25.425 11.483  1.00 110.71 ? 30   ARG D CD    1 
ATOM   2329  N  NE    . ARG D  4 30  ? -36.368 -26.450 11.439  1.00 111.62 ? 30   ARG D NE    1 
ATOM   2330  C  CZ    . ARG D  4 30  ? -36.186 -27.309 10.437  1.00 112.00 ? 30   ARG D CZ    1 
ATOM   2331  N  NH1   . ARG D  4 30  ? -36.984 -27.294 9.375   1.00 112.05 ? 30   ARG D NH1   1 
ATOM   2332  N  NH2   . ARG D  4 30  ? -35.202 -28.195 10.501  1.00 112.16 ? 30   ARG D NH2   1 
ATOM   2333  N  N     . LYS D  4 31  ? -38.221 -23.681 16.486  1.00 105.39 ? 31   LYS D N     1 
ATOM   2334  C  CA    . LYS D  4 31  ? -37.479 -24.202 17.643  1.00 103.04 ? 31   LYS D CA    1 
ATOM   2335  C  C     . LYS D  4 31  ? -36.902 -25.587 17.334  1.00 101.11 ? 31   LYS D C     1 
ATOM   2336  O  O     . LYS D  4 31  ? -37.340 -26.273 16.410  1.00 101.35 ? 31   LYS D O     1 
ATOM   2337  C  CB    . LYS D  4 31  ? -38.360 -24.239 18.906  1.00 103.26 ? 31   LYS D CB    1 
ATOM   2338  C  CG    . LYS D  4 31  ? -39.726 -24.897 18.720  1.00 103.17 ? 31   LYS D CG    1 
ATOM   2339  C  CD    . LYS D  4 31  ? -40.436 -25.152 20.051  1.00 103.27 ? 31   LYS D CD    1 
ATOM   2340  C  CE    . LYS D  4 31  ? -41.620 -26.119 19.823  1.00 103.37 ? 31   LYS D CE    1 
ATOM   2341  N  NZ    . LYS D  4 31  ? -42.314 -26.491 21.086  1.00 102.77 ? 31   LYS D NZ    1 
ATOM   2342  N  N     . GLU D  4 32  ? -35.920 -26.003 18.114  1.00 98.36  ? 32   GLU D N     1 
ATOM   2343  C  CA    . GLU D  4 32  ? -35.181 -27.209 17.796  1.00 95.50  ? 32   GLU D CA    1 
ATOM   2344  C  C     . GLU D  4 32  ? -34.652 -27.770 19.099  1.00 93.43  ? 32   GLU D C     1 
ATOM   2345  O  O     . GLU D  4 32  ? -33.998 -27.055 19.857  1.00 93.44  ? 32   GLU D O     1 
ATOM   2346  C  CB    . GLU D  4 32  ? -34.041 -26.825 16.873  1.00 95.60  ? 32   GLU D CB    1 
ATOM   2347  C  CG    . GLU D  4 32  ? -33.263 -27.955 16.289  1.00 95.68  ? 32   GLU D CG    1 
ATOM   2348  C  CD    . GLU D  4 32  ? -31.954 -27.466 15.711  1.00 96.73  ? 32   GLU D CD    1 
ATOM   2349  O  OE1   . GLU D  4 32  ? -31.246 -26.719 16.420  1.00 96.97  ? 32   GLU D OE1   1 
ATOM   2350  O  OE2   . GLU D  4 32  ? -31.635 -27.809 14.549  1.00 97.52  ? 32   GLU D OE2   1 
ATOM   2351  N  N     . SER D  4 33  ? -34.962 -29.030 19.378  1.00 90.55  ? 33   SER D N     1 
ATOM   2352  C  CA    . SER D  4 33  ? -34.609 -29.625 20.657  1.00 87.98  ? 33   SER D CA    1 
ATOM   2353  C  C     . SER D  4 33  ? -34.139 -31.061 20.475  1.00 86.41  ? 33   SER D C     1 
ATOM   2354  O  O     . SER D  4 33  ? -33.909 -31.503 19.353  1.00 85.97  ? 33   SER D O     1 
ATOM   2355  C  CB    . SER D  4 33  ? -35.784 -29.536 21.638  1.00 87.98  ? 33   SER D CB    1 
ATOM   2356  O  OG    . SER D  4 33  ? -36.813 -30.450 21.312  1.00 87.20  ? 33   SER D OG    1 
ATOM   2357  N  N     . TYR D  4 34  ? -33.973 -31.785 21.576  1.00 84.21  ? 34   TYR D N     1 
ATOM   2358  C  CA    . TYR D  4 34  ? -33.537 -33.168 21.490  1.00 82.35  ? 34   TYR D CA    1 
ATOM   2359  C  C     . TYR D  4 34  ? -34.684 -34.109 21.741  1.00 81.67  ? 34   TYR D C     1 
ATOM   2360  O  O     . TYR D  4 34  ? -34.499 -35.317 21.710  1.00 81.72  ? 34   TYR D O     1 
ATOM   2361  C  CB    . TYR D  4 34  ? -32.410 -33.457 22.485  1.00 81.37  ? 34   TYR D CB    1 
ATOM   2362  C  CG    . TYR D  4 34  ? -31.112 -32.798 22.123  1.00 79.62  ? 34   TYR D CG    1 
ATOM   2363  C  CD1   . TYR D  4 34  ? -30.794 -31.549 22.627  1.00 78.35  ? 34   TYR D CD1   1 
ATOM   2364  C  CD2   . TYR D  4 34  ? -30.200 -33.421 21.274  1.00 78.05  ? 34   TYR D CD2   1 
ATOM   2365  C  CE1   . TYR D  4 34  ? -29.608 -30.932 22.300  1.00 77.77  ? 34   TYR D CE1   1 
ATOM   2366  C  CE2   . TYR D  4 34  ? -29.008 -32.807 20.938  1.00 77.27  ? 34   TYR D CE2   1 
ATOM   2367  C  CZ    . TYR D  4 34  ? -28.723 -31.560 21.460  1.00 77.66  ? 34   TYR D CZ    1 
ATOM   2368  O  OH    . TYR D  4 34  ? -27.558 -30.917 21.151  1.00 78.14  ? 34   TYR D OH    1 
ATOM   2369  N  N     . ALA D  4 35  ? -35.869 -33.550 21.964  1.00 81.00  ? 35   ALA D N     1 
ATOM   2370  C  CA    . ALA D  4 35  ? -37.038 -34.313 22.415  1.00 80.32  ? 35   ALA D CA    1 
ATOM   2371  C  C     . ALA D  4 35  ? -37.288 -35.661 21.718  1.00 79.86  ? 35   ALA D C     1 
ATOM   2372  O  O     . ALA D  4 35  ? -37.684 -36.620 22.383  1.00 79.74  ? 35   ALA D O     1 
ATOM   2373  C  CB    . ALA D  4 35  ? -38.283 -33.451 22.376  1.00 80.34  ? 35   ALA D CB    1 
ATOM   2374  N  N     . ILE D  4 36  ? -37.054 -35.745 20.407  1.00 78.89  ? 36   ILE D N     1 
ATOM   2375  C  CA    . ILE D  4 36  ? -37.272 -37.015 19.710  1.00 78.46  ? 36   ILE D CA    1 
ATOM   2376  C  C     . ILE D  4 36  ? -36.245 -38.117 20.074  1.00 78.26  ? 36   ILE D C     1 
ATOM   2377  O  O     . ILE D  4 36  ? -36.635 -39.249 20.421  1.00 78.14  ? 36   ILE D O     1 
ATOM   2378  C  CB    . ILE D  4 36  ? -37.484 -36.865 18.160  1.00 78.31  ? 36   ILE D CB    1 
ATOM   2379  C  CG1   . ILE D  4 36  ? -36.291 -36.194 17.483  1.00 78.51  ? 36   ILE D CG1   1 
ATOM   2380  C  CG2   . ILE D  4 36  ? -38.801 -36.136 17.864  1.00 77.73  ? 36   ILE D CG2   1 
ATOM   2381  C  CD1   . ILE D  4 36  ? -36.302 -36.334 15.970  1.00 78.70  ? 36   ILE D CD1   1 
ATOM   2382  N  N     . TYR D  4 37  ? -34.951 -37.779 20.020  1.00 77.53  ? 37   TYR D N     1 
ATOM   2383  C  CA    . TYR D  4 37  ? -33.885 -38.712 20.398  1.00 76.49  ? 37   TYR D CA    1 
ATOM   2384  C  C     . TYR D  4 37  ? -33.990 -39.139 21.849  1.00 75.91  ? 37   TYR D C     1 
ATOM   2385  O  O     . TYR D  4 37  ? -33.629 -40.264 22.197  1.00 75.83  ? 37   TYR D O     1 
ATOM   2386  C  CB    . TYR D  4 37  ? -32.519 -38.093 20.175  1.00 76.51  ? 37   TYR D CB    1 
ATOM   2387  C  CG    . TYR D  4 37  ? -32.441 -37.238 18.951  1.00 76.77  ? 37   TYR D CG    1 
ATOM   2388  C  CD1   . TYR D  4 37  ? -32.462 -35.851 19.057  1.00 77.43  ? 37   TYR D CD1   1 
ATOM   2389  C  CD2   . TYR D  4 37  ? -32.347 -37.808 17.683  1.00 76.02  ? 37   TYR D CD2   1 
ATOM   2390  C  CE1   . TYR D  4 37  ? -32.390 -35.049 17.929  1.00 77.69  ? 37   TYR D CE1   1 
ATOM   2391  C  CE2   . TYR D  4 37  ? -32.265 -37.020 16.553  1.00 76.52  ? 37   TYR D CE2   1 
ATOM   2392  C  CZ    . TYR D  4 37  ? -32.295 -35.638 16.677  1.00 77.35  ? 37   TYR D CZ    1 
ATOM   2393  O  OH    . TYR D  4 37  ? -32.219 -34.837 15.558  1.00 76.97  ? 37   TYR D OH    1 
ATOM   2394  N  N     . VAL D  4 38  ? -34.469 -38.233 22.693  1.00 75.21  ? 38   VAL D N     1 
ATOM   2395  C  CA    . VAL D  4 38  ? -34.658 -38.530 24.099  1.00 75.02  ? 38   VAL D CA    1 
ATOM   2396  C  C     . VAL D  4 38  ? -35.759 -39.560 24.229  1.00 75.01  ? 38   VAL D C     1 
ATOM   2397  O  O     . VAL D  4 38  ? -35.590 -40.570 24.908  1.00 74.82  ? 38   VAL D O     1 
ATOM   2398  C  CB    . VAL D  4 38  ? -35.013 -37.276 24.897  1.00 74.92  ? 38   VAL D CB    1 
ATOM   2399  C  CG1   . VAL D  4 38  ? -35.270 -37.621 26.366  1.00 73.94  ? 38   VAL D CG1   1 
ATOM   2400  C  CG2   . VAL D  4 38  ? -33.894 -36.254 24.769  1.00 75.21  ? 38   VAL D CG2   1 
ATOM   2401  N  N     . TYR D  4 39  ? -36.870 -39.307 23.545  1.00 75.38  ? 39   TYR D N     1 
ATOM   2402  C  CA    . TYR D  4 39  ? -38.001 -40.223 23.533  1.00 75.53  ? 39   TYR D CA    1 
ATOM   2403  C  C     . TYR D  4 39  ? -37.588 -41.598 23.010  1.00 75.07  ? 39   TYR D C     1 
ATOM   2404  O  O     . TYR D  4 39  ? -37.932 -42.612 23.612  1.00 74.89  ? 39   TYR D O     1 
ATOM   2405  C  CB    . TYR D  4 39  ? -39.190 -39.640 22.754  1.00 76.25  ? 39   TYR D CB    1 
ATOM   2406  C  CG    . TYR D  4 39  ? -40.473 -40.358 23.078  1.00 77.43  ? 39   TYR D CG    1 
ATOM   2407  C  CD1   . TYR D  4 39  ? -41.077 -40.213 24.330  1.00 77.93  ? 39   TYR D CD1   1 
ATOM   2408  C  CD2   . TYR D  4 39  ? -41.070 -41.216 22.145  1.00 78.96  ? 39   TYR D CD2   1 
ATOM   2409  C  CE1   . TYR D  4 39  ? -42.250 -40.903 24.644  1.00 79.11  ? 39   TYR D CE1   1 
ATOM   2410  C  CE2   . TYR D  4 39  ? -42.246 -41.905 22.446  1.00 78.54  ? 39   TYR D CE2   1 
ATOM   2411  C  CZ    . TYR D  4 39  ? -42.828 -41.749 23.695  1.00 78.52  ? 39   TYR D CZ    1 
ATOM   2412  O  OH    . TYR D  4 39  ? -43.985 -42.437 23.998  1.00 78.16  ? 39   TYR D OH    1 
ATOM   2413  N  N     . LYS D  4 40  ? -36.818 -41.629 21.928  1.00 74.74  ? 40   LYS D N     1 
ATOM   2414  C  CA    . LYS D  4 40  ? -36.232 -42.882 21.447  1.00 75.17  ? 40   LYS D CA    1 
ATOM   2415  C  C     . LYS D  4 40  ? -35.430 -43.630 22.524  1.00 75.33  ? 40   LYS D C     1 
ATOM   2416  O  O     . LYS D  4 40  ? -35.627 -44.830 22.736  1.00 75.88  ? 40   LYS D O     1 
ATOM   2417  C  CB    . LYS D  4 40  ? -35.351 -42.643 20.227  1.00 75.15  ? 40   LYS D CB    1 
ATOM   2418  C  CG    . LYS D  4 40  ? -36.119 -42.424 18.953  1.00 75.80  ? 40   LYS D CG    1 
ATOM   2419  C  CD    . LYS D  4 40  ? -35.212 -41.914 17.854  1.00 77.44  ? 40   LYS D CD    1 
ATOM   2420  C  CE    . LYS D  4 40  ? -36.007 -41.691 16.572  1.00 79.24  ? 40   LYS D CE    1 
ATOM   2421  N  NZ    . LYS D  4 40  ? -35.123 -41.296 15.438  1.00 79.82  ? 40   LYS D NZ    1 
ATOM   2422  N  N     . VAL D  4 41  ? -34.531 -42.923 23.201  1.00 75.17  ? 41   VAL D N     1 
ATOM   2423  C  CA    . VAL D  4 41  ? -33.724 -43.529 24.247  1.00 74.73  ? 41   VAL D CA    1 
ATOM   2424  C  C     . VAL D  4 41  ? -34.619 -43.984 25.408  1.00 75.25  ? 41   VAL D C     1 
ATOM   2425  O  O     . VAL D  4 41  ? -34.382 -45.039 26.004  1.00 75.39  ? 41   VAL D O     1 
ATOM   2426  C  CB    . VAL D  4 41  ? -32.562 -42.587 24.703  1.00 74.48  ? 41   VAL D CB    1 
ATOM   2427  C  CG1   . VAL D  4 41  ? -31.918 -43.074 25.983  1.00 73.05  ? 41   VAL D CG1   1 
ATOM   2428  C  CG2   . VAL D  4 41  ? -31.508 -42.460 23.606  1.00 73.20  ? 41   VAL D CG2   1 
ATOM   2429  N  N     . LEU D  4 42  ? -35.664 -43.219 25.716  1.00 75.75  ? 42   LEU D N     1 
ATOM   2430  C  CA    . LEU D  4 42  ? -36.597 -43.638 26.765  1.00 76.32  ? 42   LEU D CA    1 
ATOM   2431  C  C     . LEU D  4 42  ? -37.217 -44.986 26.395  1.00 77.27  ? 42   LEU D C     1 
ATOM   2432  O  O     . LEU D  4 42  ? -37.457 -45.827 27.264  1.00 77.53  ? 42   LEU D O     1 
ATOM   2433  C  CB    . LEU D  4 42  ? -37.683 -42.583 27.029  1.00 75.83  ? 42   LEU D CB    1 
ATOM   2434  C  CG    . LEU D  4 42  ? -38.842 -42.982 27.967  1.00 75.59  ? 42   LEU D CG    1 
ATOM   2435  C  CD1   . LEU D  4 42  ? -38.386 -43.412 29.354  1.00 74.29  ? 42   LEU D CD1   1 
ATOM   2436  C  CD2   . LEU D  4 42  ? -39.894 -41.881 28.091  1.00 76.21  ? 42   LEU D CD2   1 
ATOM   2437  N  N     . LYS D  4 43  ? -37.463 -45.190 25.101  1.00 78.21  ? 43   LYS D N     1 
ATOM   2438  C  CA    . LYS D  4 43  ? -37.989 -46.458 24.623  1.00 79.01  ? 43   LYS D CA    1 
ATOM   2439  C  C     . LYS D  4 43  ? -36.991 -47.578 24.897  1.00 79.59  ? 43   LYS D C     1 
ATOM   2440  O  O     . LYS D  4 43  ? -37.283 -48.501 25.666  1.00 79.64  ? 43   LYS D O     1 
ATOM   2441  C  CB    . LYS D  4 43  ? -38.381 -46.373 23.142  1.00 79.13  ? 43   LYS D CB    1 
ATOM   2442  C  CG    . LYS D  4 43  ? -39.660 -45.572 22.901  1.00 79.62  ? 43   LYS D CG    1 
ATOM   2443  C  CD    . LYS D  4 43  ? -40.611 -45.744 24.087  1.00 81.38  ? 43   LYS D CD    1 
ATOM   2444  C  CE    . LYS D  4 43  ? -41.951 -45.072 23.866  1.00 82.70  ? 43   LYS D CE    1 
ATOM   2445  N  NZ    . LYS D  4 43  ? -42.675 -44.935 25.175  1.00 82.85  ? 43   LYS D NZ    1 
ATOM   2446  N  N     . GLN D  4 44  ? -35.805 -47.468 24.304  1.00 80.03  ? 44   GLN D N     1 
ATOM   2447  C  CA    . GLN D  4 44  ? -34.728 -48.420 24.547  1.00 81.08  ? 44   GLN D CA    1 
ATOM   2448  C  C     . GLN D  4 44  ? -34.578 -48.910 26.001  1.00 80.82  ? 44   GLN D C     1 
ATOM   2449  O  O     . GLN D  4 44  ? -34.123 -50.036 26.211  1.00 81.22  ? 44   GLN D O     1 
ATOM   2450  C  CB    . GLN D  4 44  ? -33.393 -47.857 24.059  1.00 81.07  ? 44   GLN D CB    1 
ATOM   2451  C  CG    . GLN D  4 44  ? -33.285 -47.687 22.551  1.00 82.24  ? 44   GLN D CG    1 
ATOM   2452  C  CD    . GLN D  4 44  ? -31.899 -47.217 22.109  1.00 83.19  ? 44   GLN D CD    1 
ATOM   2453  O  OE1   . GLN D  4 44  ? -31.086 -46.755 22.919  1.00 86.87  ? 44   GLN D OE1   1 
ATOM   2454  N  NE2   . GLN D  4 44  ? -31.627 -47.330 20.817  1.00 85.75  ? 44   GLN D NE2   1 
ATOM   2455  N  N     . VAL D  4 45  ? -34.947 -48.096 26.995  1.00 80.67  ? 45   VAL D N     1 
ATOM   2456  C  CA    . VAL D  4 45  ? -34.751 -48.494 28.409  1.00 80.73  ? 45   VAL D CA    1 
ATOM   2457  C  C     . VAL D  4 45  ? -36.023 -48.655 29.245  1.00 80.78  ? 45   VAL D C     1 
ATOM   2458  O  O     . VAL D  4 45  ? -36.029 -49.394 30.235  1.00 80.81  ? 45   VAL D O     1 
ATOM   2459  C  CB    . VAL D  4 45  ? -33.742 -47.570 29.188  1.00 80.91  ? 45   VAL D CB    1 
ATOM   2460  C  CG1   . VAL D  4 45  ? -32.309 -47.718 28.647  1.00 81.17  ? 45   VAL D CG1   1 
ATOM   2461  C  CG2   . VAL D  4 45  ? -34.199 -46.114 29.188  1.00 80.18  ? 45   VAL D CG2   1 
ATOM   2462  N  N     . HIS D  4 46  ? -37.085 -47.952 28.875  1.00 80.93  ? 46   HIS D N     1 
ATOM   2463  C  CA    . HIS D  4 46  ? -38.354 -48.101 29.577  1.00 81.68  ? 46   HIS D CA    1 
ATOM   2464  C  C     . HIS D  4 46  ? -39.526 -48.084 28.597  1.00 82.15  ? 46   HIS D C     1 
ATOM   2465  O  O     . HIS D  4 46  ? -40.290 -47.109 28.558  1.00 81.96  ? 46   HIS D O     1 
ATOM   2466  C  CB    . HIS D  4 46  ? -38.522 -47.027 30.650  1.00 81.69  ? 46   HIS D CB    1 
ATOM   2467  C  CG    . HIS D  4 46  ? -37.833 -47.346 31.940  1.00 82.33  ? 46   HIS D CG    1 
ATOM   2468  N  ND1   . HIS D  4 46  ? -36.602 -46.823 32.276  1.00 82.59  ? 46   HIS D ND1   1 
ATOM   2469  C  CD2   . HIS D  4 46  ? -38.207 -48.126 32.983  1.00 83.21  ? 46   HIS D CD2   1 
ATOM   2470  C  CE1   . HIS D  4 46  ? -36.246 -47.274 33.466  1.00 83.50  ? 46   HIS D CE1   1 
ATOM   2471  N  NE2   . HIS D  4 46  ? -37.202 -48.067 33.917  1.00 83.37  ? 46   HIS D NE2   1 
ATOM   2472  N  N     . PRO D  4 47  ? -39.696 -49.195 27.840  1.00 82.51  ? 47   PRO D N     1 
ATOM   2473  C  CA    . PRO D  4 47  ? -40.612 -49.269 26.698  1.00 82.70  ? 47   PRO D CA    1 
ATOM   2474  C  C     . PRO D  4 47  ? -42.058 -48.968 27.097  1.00 82.87  ? 47   PRO D C     1 
ATOM   2475  O  O     . PRO D  4 47  ? -42.825 -48.436 26.296  1.00 82.80  ? 47   PRO D O     1 
ATOM   2476  C  CB    . PRO D  4 47  ? -40.487 -50.735 26.248  1.00 82.79  ? 47   PRO D CB    1 
ATOM   2477  C  CG    . PRO D  4 47  ? -39.149 -51.178 26.766  1.00 82.65  ? 47   PRO D CG    1 
ATOM   2478  C  CD    . PRO D  4 47  ? -39.031 -50.493 28.083  1.00 82.48  ? 47   PRO D CD    1 
ATOM   2479  N  N     . ASP D  4 48  ? -42.413 -49.297 28.333  1.00 83.11  ? 48   ASP D N     1 
ATOM   2480  C  CA    . ASP D  4 48  ? -43.768 -49.099 28.811  1.00 83.64  ? 48   ASP D CA    1 
ATOM   2481  C  C     . ASP D  4 48  ? -43.923 -47.786 29.576  1.00 83.27  ? 48   ASP D C     1 
ATOM   2482  O  O     . ASP D  4 48  ? -44.994 -47.507 30.135  1.00 83.27  ? 48   ASP D O     1 
ATOM   2483  C  CB    . ASP D  4 48  ? -44.212 -50.300 29.669  1.00 84.34  ? 48   ASP D CB    1 
ATOM   2484  C  CG    . ASP D  4 48  ? -44.541 -51.543 28.820  1.00 86.60  ? 48   ASP D CG    1 
ATOM   2485  O  OD1   . ASP D  4 48  ? -43.598 -52.202 28.298  1.00 89.09  ? 48   ASP D OD1   1 
ATOM   2486  O  OD2   . ASP D  4 48  ? -45.749 -51.862 28.677  1.00 88.63  ? 48   ASP D OD2   1 
ATOM   2487  N  N     . THR D  4 49  ? -42.864 -46.974 29.585  1.00 82.63  ? 49   THR D N     1 
ATOM   2488  C  CA    . THR D  4 49  ? -42.863 -45.723 30.350  1.00 81.87  ? 49   THR D CA    1 
ATOM   2489  C  C     . THR D  4 49  ? -42.833 -44.495 29.438  1.00 81.22  ? 49   THR D C     1 
ATOM   2490  O  O     . THR D  4 49  ? -42.088 -44.467 28.459  1.00 81.00  ? 49   THR D O     1 
ATOM   2491  C  CB    . THR D  4 49  ? -41.676 -45.670 31.356  1.00 82.18  ? 49   THR D CB    1 
ATOM   2492  O  OG1   . THR D  4 49  ? -41.400 -46.983 31.860  1.00 82.11  ? 49   THR D OG1   1 
ATOM   2493  C  CG2   . THR D  4 49  ? -41.980 -44.734 32.531  1.00 81.71  ? 49   THR D CG2   1 
ATOM   2494  N  N     . GLY D  4 50  ? -43.652 -43.494 29.764  1.00 80.63  ? 50   GLY D N     1 
ATOM   2495  C  CA    . GLY D  4 50  ? -43.697 -42.224 29.017  1.00 80.67  ? 50   GLY D CA    1 
ATOM   2496  C  C     . GLY D  4 50  ? -43.010 -41.036 29.699  1.00 80.47  ? 50   GLY D C     1 
ATOM   2497  O  O     . GLY D  4 50  ? -42.242 -41.216 30.653  1.00 80.67  ? 50   GLY D O     1 
ATOM   2498  N  N     . ILE D  4 51  ? -43.285 -39.820 29.215  1.00 79.87  ? 51   ILE D N     1 
ATOM   2499  C  CA    . ILE D  4 51  ? -42.642 -38.606 29.744  1.00 79.26  ? 51   ILE D CA    1 
ATOM   2500  C  C     . ILE D  4 51  ? -43.496 -37.351 29.578  1.00 78.89  ? 51   ILE D C     1 
ATOM   2501  O  O     . ILE D  4 51  ? -43.919 -37.030 28.466  1.00 78.90  ? 51   ILE D O     1 
ATOM   2502  C  CB    . ILE D  4 51  ? -41.220 -38.381 29.121  1.00 79.39  ? 51   ILE D CB    1 
ATOM   2503  C  CG1   . ILE D  4 51  ? -40.537 -37.157 29.747  1.00 79.51  ? 51   ILE D CG1   1 
ATOM   2504  C  CG2   . ILE D  4 51  ? -41.275 -38.282 27.591  1.00 78.20  ? 51   ILE D CG2   1 
ATOM   2505  C  CD1   . ILE D  4 51  ? -39.019 -37.201 29.708  1.00 80.55  ? 51   ILE D CD1   1 
ATOM   2506  N  N     . SER D  4 52  ? -43.738 -36.638 30.677  1.00 78.32  ? 52   SER D N     1 
ATOM   2507  C  CA    . SER D  4 52  ? -44.493 -35.375 30.620  1.00 77.83  ? 52   SER D CA    1 
ATOM   2508  C  C     . SER D  4 52  ? -43.677 -34.281 29.927  1.00 77.40  ? 52   SER D C     1 
ATOM   2509  O  O     . SER D  4 52  ? -42.456 -34.348 29.902  1.00 77.58  ? 52   SER D O     1 
ATOM   2510  C  CB    . SER D  4 52  ? -44.932 -34.930 32.018  1.00 77.71  ? 52   SER D CB    1 
ATOM   2511  O  OG    . SER D  4 52  ? -44.027 -33.996 32.573  1.00 78.19  ? 52   SER D OG    1 
ATOM   2512  N  N     . SER D  4 53  ? -44.344 -33.283 29.356  1.00 77.18  ? 53   SER D N     1 
ATOM   2513  C  CA    . SER D  4 53  ? -43.648 -32.243 28.581  1.00 77.33  ? 53   SER D CA    1 
ATOM   2514  C  C     . SER D  4 53  ? -42.658 -31.397 29.407  1.00 76.67  ? 53   SER D C     1 
ATOM   2515  O  O     . SER D  4 53  ? -41.588 -31.034 28.919  1.00 76.50  ? 53   SER D O     1 
ATOM   2516  C  CB    . SER D  4 53  ? -44.655 -31.336 27.875  1.00 77.68  ? 53   SER D CB    1 
ATOM   2517  O  OG    . SER D  4 53  ? -45.473 -30.670 28.826  1.00 78.96  ? 53   SER D OG    1 
ATOM   2518  N  N     . LYS D  4 54  ? -43.017 -31.085 30.648  1.00 76.15  ? 54   LYS D N     1 
ATOM   2519  C  CA    . LYS D  4 54  ? -42.088 -30.391 31.539  1.00 75.98  ? 54   LYS D CA    1 
ATOM   2520  C  C     . LYS D  4 54  ? -40.805 -31.195 31.813  1.00 75.14  ? 54   LYS D C     1 
ATOM   2521  O  O     . LYS D  4 54  ? -39.708 -30.628 31.837  1.00 75.33  ? 54   LYS D O     1 
ATOM   2522  C  CB    . LYS D  4 54  ? -42.763 -30.007 32.857  1.00 76.28  ? 54   LYS D CB    1 
ATOM   2523  C  CG    . LYS D  4 54  ? -43.759 -28.851 32.747  1.00 78.14  ? 54   LYS D CG    1 
ATOM   2524  C  CD    . LYS D  4 54  ? -44.030 -28.266 34.127  1.00 81.79  ? 54   LYS D CD    1 
ATOM   2525  C  CE    . LYS D  4 54  ? -45.358 -27.519 34.210  1.00 83.13  ? 54   LYS D CE    1 
ATOM   2526  N  NZ    . LYS D  4 54  ? -45.582 -27.097 35.640  1.00 84.14  ? 54   LYS D NZ    1 
ATOM   2527  N  N     . ALA D  4 55  ? -40.940 -32.505 32.022  1.00 73.75  ? 55   ALA D N     1 
ATOM   2528  C  CA    . ALA D  4 55  ? -39.777 -33.367 32.245  1.00 72.40  ? 55   ALA D CA    1 
ATOM   2529  C  C     . ALA D  4 55  ? -38.949 -33.486 30.978  1.00 71.50  ? 55   ALA D C     1 
ATOM   2530  O  O     . ALA D  4 55  ? -37.736 -33.693 31.033  1.00 71.59  ? 55   ALA D O     1 
ATOM   2531  C  CB    . ALA D  4 55  ? -40.197 -34.733 32.744  1.00 72.37  ? 55   ALA D CB    1 
ATOM   2532  N  N     . MET D  4 56  ? -39.606 -33.333 29.837  1.00 70.42  ? 56   MET D N     1 
ATOM   2533  C  CA    . MET D  4 56  ? -38.922 -33.328 28.556  1.00 69.72  ? 56   MET D CA    1 
ATOM   2534  C  C     . MET D  4 56  ? -38.092 -32.057 28.428  1.00 68.77  ? 56   MET D C     1 
ATOM   2535  O  O     . MET D  4 56  ? -36.964 -32.064 27.922  1.00 68.70  ? 56   MET D O     1 
ATOM   2536  C  CB    . MET D  4 56  ? -39.938 -33.415 27.419  1.00 69.50  ? 56   MET D CB    1 
ATOM   2537  C  CG    . MET D  4 56  ? -39.313 -33.468 26.043  1.00 71.70  ? 56   MET D CG    1 
ATOM   2538  S  SD    . MET D  4 56  ? -38.277 -34.934 25.783  1.00 77.53  ? 56   MET D SD    1 
ATOM   2539  C  CE    . MET D  4 56  ? -36.636 -34.255 25.964  1.00 77.67  ? 56   MET D CE    1 
ATOM   2540  N  N     . SER D  4 57  ? -38.662 -30.956 28.891  1.00 67.71  ? 57   SER D N     1 
ATOM   2541  C  CA    . SER D  4 57  ? -37.979 -29.689 28.840  1.00 66.88  ? 57   SER D CA    1 
ATOM   2542  C  C     . SER D  4 57  ? -36.665 -29.806 29.620  1.00 65.33  ? 57   SER D C     1 
ATOM   2543  O  O     . SER D  4 57  ? -35.592 -29.537 29.088  1.00 65.01  ? 57   SER D O     1 
ATOM   2544  C  CB    . SER D  4 57  ? -38.886 -28.612 29.419  1.00 67.21  ? 57   SER D CB    1 
ATOM   2545  O  OG    . SER D  4 57  ? -38.346 -27.326 29.167  1.00 70.74  ? 57   SER D OG    1 
ATOM   2546  N  N     . ILE D  4 58  ? -36.779 -30.264 30.865  1.00 63.80  ? 58   ILE D N     1 
ATOM   2547  C  CA    . ILE D  4 58  ? -35.658 -30.577 31.741  1.00 62.59  ? 58   ILE D CA    1 
ATOM   2548  C  C     . ILE D  4 58  ? -34.566 -31.447 31.099  1.00 62.98  ? 58   ILE D C     1 
ATOM   2549  O  O     . ILE D  4 58  ? -33.372 -31.172 31.267  1.00 63.01  ? 58   ILE D O     1 
ATOM   2550  C  CB    . ILE D  4 58  ? -36.186 -31.230 33.019  1.00 62.28  ? 58   ILE D CB    1 
ATOM   2551  C  CG1   . ILE D  4 58  ? -37.082 -30.224 33.751  1.00 60.96  ? 58   ILE D CG1   1 
ATOM   2552  C  CG2   . ILE D  4 58  ? -35.041 -31.775 33.886  1.00 61.17  ? 58   ILE D CG2   1 
ATOM   2553  C  CD1   . ILE D  4 58  ? -37.700 -30.741 34.993  1.00 59.66  ? 58   ILE D CD1   1 
ATOM   2554  N  N     . MET D  4 59  ? -34.969 -32.480 30.358  1.00 62.90  ? 59   MET D N     1 
ATOM   2555  C  CA    . MET D  4 59  ? -34.015 -33.333 29.659  1.00 63.01  ? 59   MET D CA    1 
ATOM   2556  C  C     . MET D  4 59  ? -33.349 -32.582 28.533  1.00 62.63  ? 59   MET D C     1 
ATOM   2557  O  O     . MET D  4 59  ? -32.139 -32.737 28.294  1.00 62.80  ? 59   MET D O     1 
ATOM   2558  C  CB    . MET D  4 59  ? -34.676 -34.587 29.088  1.00 63.38  ? 59   MET D CB    1 
ATOM   2559  C  CG    . MET D  4 59  ? -35.167 -35.584 30.122  1.00 64.07  ? 59   MET D CG    1 
ATOM   2560  S  SD    . MET D  4 59  ? -33.880 -36.216 31.191  1.00 65.21  ? 59   MET D SD    1 
ATOM   2561  C  CE    . MET D  4 59  ? -32.672 -36.769 29.992  1.00 66.18  ? 59   MET D CE    1 
ATOM   2562  N  N     . ASN D  4 60  ? -34.129 -31.774 27.831  1.00 62.25  ? 60   ASN D N     1 
ATOM   2563  C  CA    . ASN D  4 60  ? -33.533 -30.929 26.806  1.00 62.50  ? 60   ASN D CA    1 
ATOM   2564  C  C     . ASN D  4 60  ? -32.492 -29.966 27.382  1.00 61.53  ? 60   ASN D C     1 
ATOM   2565  O  O     . ASN D  4 60  ? -31.434 -29.762 26.778  1.00 61.34  ? 60   ASN D O     1 
ATOM   2566  C  CB    . ASN D  4 60  ? -34.569 -30.160 26.009  1.00 62.91  ? 60   ASN D CB    1 
ATOM   2567  C  CG    . ASN D  4 60  ? -34.010 -29.672 24.699  1.00 65.70  ? 60   ASN D CG    1 
ATOM   2568  O  OD1   . ASN D  4 60  ? -33.501 -30.468 23.901  1.00 68.99  ? 60   ASN D OD1   1 
ATOM   2569  N  ND2   . ASN D  4 60  ? -34.071 -28.361 24.470  1.00 67.88  ? 60   ASN D ND2   1 
ATOM   2570  N  N     . SER D  4 61  ? -32.784 -29.405 28.556  1.00 60.27  ? 61   SER D N     1 
ATOM   2571  C  CA    . SER D  4 61  ? -31.840 -28.533 29.228  1.00 59.81  ? 61   SER D CA    1 
ATOM   2572  C  C     . SER D  4 61  ? -30.589 -29.308 29.555  1.00 59.25  ? 61   SER D C     1 
ATOM   2573  O  O     . SER D  4 61  ? -29.481 -28.872 29.209  1.00 59.02  ? 61   SER D O     1 
ATOM   2574  C  CB    . SER D  4 61  ? -32.440 -27.929 30.494  1.00 59.97  ? 61   SER D CB    1 
ATOM   2575  O  OG    . SER D  4 61  ? -33.274 -26.830 30.157  1.00 60.61  ? 61   SER D OG    1 
ATOM   2576  N  N     . PHE D  4 62  ? -30.783 -30.475 30.186  1.00 58.66  ? 62   PHE D N     1 
ATOM   2577  C  CA    . PHE D  4 62  ? -29.691 -31.390 30.539  1.00 57.86  ? 62   PHE D CA    1 
ATOM   2578  C  C     . PHE D  4 62  ? -28.736 -31.680 29.360  1.00 57.06  ? 62   PHE D C     1 
ATOM   2579  O  O     . PHE D  4 62  ? -27.513 -31.594 29.508  1.00 57.05  ? 62   PHE D O     1 
ATOM   2580  C  CB    . PHE D  4 62  ? -30.230 -32.674 31.183  1.00 57.93  ? 62   PHE D CB    1 
ATOM   2581  C  CG    . PHE D  4 62  ? -29.169 -33.716 31.468  1.00 58.82  ? 62   PHE D CG    1 
ATOM   2582  C  CD1   . PHE D  4 62  ? -28.262 -33.548 32.515  1.00 58.30  ? 62   PHE D CD1   1 
ATOM   2583  C  CD2   . PHE D  4 62  ? -29.078 -34.882 30.678  1.00 59.46  ? 62   PHE D CD2   1 
ATOM   2584  C  CE1   . PHE D  4 62  ? -27.265 -34.519 32.779  1.00 58.48  ? 62   PHE D CE1   1 
ATOM   2585  C  CE2   . PHE D  4 62  ? -28.087 -35.860 30.931  1.00 59.64  ? 62   PHE D CE2   1 
ATOM   2586  C  CZ    . PHE D  4 62  ? -27.183 -35.680 31.991  1.00 58.74  ? 62   PHE D CZ    1 
ATOM   2587  N  N     . VAL D  4 63  ? -29.283 -31.978 28.188  1.00 56.00  ? 63   VAL D N     1 
ATOM   2588  C  CA    . VAL D  4 63  ? -28.432 -32.290 27.046  1.00 55.08  ? 63   VAL D CA    1 
ATOM   2589  C  C     . VAL D  4 63  ? -27.613 -31.081 26.621  1.00 54.72  ? 63   VAL D C     1 
ATOM   2590  O  O     . VAL D  4 63  ? -26.398 -31.186 26.459  1.00 55.38  ? 63   VAL D O     1 
ATOM   2591  C  CB    . VAL D  4 63  ? -29.227 -32.880 25.875  1.00 55.23  ? 63   VAL D CB    1 
ATOM   2592  C  CG1   . VAL D  4 63  ? -28.290 -33.331 24.775  1.00 54.61  ? 63   VAL D CG1   1 
ATOM   2593  C  CG2   . VAL D  4 63  ? -30.052 -34.046 26.357  1.00 54.28  ? 63   VAL D CG2   1 
ATOM   2594  N  N     . ASN D  4 64  ? -28.267 -29.930 26.481  1.00 54.17  ? 64   ASN D N     1 
ATOM   2595  C  CA    . ASN D  4 64  ? -27.592 -28.666 26.155  1.00 53.21  ? 64   ASN D CA    1 
ATOM   2596  C  C     . ASN D  4 64  ? -26.521 -28.287 27.168  1.00 52.94  ? 64   ASN D C     1 
ATOM   2597  O  O     . ASN D  4 64  ? -25.372 -27.997 26.800  1.00 52.49  ? 64   ASN D O     1 
ATOM   2598  C  CB    . ASN D  4 64  ? -28.605 -27.535 26.038  1.00 53.18  ? 64   ASN D CB    1 
ATOM   2599  C  CG    . ASN D  4 64  ? -29.469 -27.652 24.810  1.00 53.62  ? 64   ASN D CG    1 
ATOM   2600  O  OD1   . ASN D  4 64  ? -28.972 -27.834 23.699  1.00 52.21  ? 64   ASN D OD1   1 
ATOM   2601  N  ND2   . ASN D  4 64  ? -30.781 -27.538 25.000  1.00 55.10  ? 64   ASN D ND2   1 
ATOM   2602  N  N     . ASP D  4 65  ? -26.908 -28.300 28.445  1.00 52.31  ? 65   ASP D N     1 
ATOM   2603  C  CA    . ASP D  4 65  ? -26.001 -28.012 29.532  1.00 52.17  ? 65   ASP D CA    1 
ATOM   2604  C  C     . ASP D  4 65  ? -24.739 -28.857 29.385  1.00 52.30  ? 65   ASP D C     1 
ATOM   2605  O  O     . ASP D  4 65  ? -23.641 -28.324 29.234  1.00 52.10  ? 65   ASP D O     1 
ATOM   2606  C  CB    . ASP D  4 65  ? -26.706 -28.272 30.864  1.00 52.65  ? 65   ASP D CB    1 
ATOM   2607  C  CG    . ASP D  4 65  ? -25.852 -27.921 32.065  1.00 54.19  ? 65   ASP D CG    1 
ATOM   2608  O  OD1   . ASP D  4 65  ? -24.721 -27.415 31.870  1.00 57.10  ? 65   ASP D OD1   1 
ATOM   2609  O  OD2   . ASP D  4 65  ? -26.299 -28.169 33.208  1.00 53.75  ? 65   ASP D OD2   1 
ATOM   2610  N  N     . VAL D  4 66  ? -24.903 -30.179 29.400  1.00 52.71  ? 66   VAL D N     1 
ATOM   2611  C  CA    . VAL D  4 66  ? -23.776 -31.100 29.260  1.00 52.63  ? 66   VAL D CA    1 
ATOM   2612  C  C     . VAL D  4 66  ? -23.007 -30.827 27.968  1.00 52.65  ? 66   VAL D C     1 
ATOM   2613  O  O     . VAL D  4 66  ? -21.790 -30.754 27.996  1.00 52.90  ? 66   VAL D O     1 
ATOM   2614  C  CB    . VAL D  4 66  ? -24.213 -32.595 29.335  1.00 52.69  ? 66   VAL D CB    1 
ATOM   2615  C  CG1   . VAL D  4 66  ? -23.058 -33.513 28.955  1.00 52.33  ? 66   VAL D CG1   1 
ATOM   2616  C  CG2   . VAL D  4 66  ? -24.721 -32.942 30.718  1.00 52.05  ? 66   VAL D CG2   1 
ATOM   2617  N  N     . PHE D  4 67  ? -23.709 -30.672 26.849  1.00 52.69  ? 67   PHE D N     1 
ATOM   2618  C  CA    . PHE D  4 67  ? -23.052 -30.408 25.571  1.00 53.30  ? 67   PHE D CA    1 
ATOM   2619  C  C     . PHE D  4 67  ? -22.055 -29.262 25.690  1.00 53.15  ? 67   PHE D C     1 
ATOM   2620  O  O     . PHE D  4 67  ? -20.923 -29.364 25.219  1.00 53.39  ? 67   PHE D O     1 
ATOM   2621  C  CB    . PHE D  4 67  ? -24.082 -30.089 24.473  1.00 54.27  ? 67   PHE D CB    1 
ATOM   2622  C  CG    . PHE D  4 67  ? -23.471 -29.610 23.182  1.00 54.90  ? 67   PHE D CG    1 
ATOM   2623  C  CD1   . PHE D  4 67  ? -23.408 -30.452 22.076  1.00 56.62  ? 67   PHE D CD1   1 
ATOM   2624  C  CD2   . PHE D  4 67  ? -22.977 -28.315 23.064  1.00 56.45  ? 67   PHE D CD2   1 
ATOM   2625  C  CE1   . PHE D  4 67  ? -22.828 -30.027 20.868  1.00 57.44  ? 67   PHE D CE1   1 
ATOM   2626  C  CE2   . PHE D  4 67  ? -22.388 -27.874 21.867  1.00 57.42  ? 67   PHE D CE2   1 
ATOM   2627  C  CZ    . PHE D  4 67  ? -22.313 -28.738 20.765  1.00 57.18  ? 67   PHE D CZ    1 
ATOM   2628  N  N     . GLU D  4 68  ? -22.496 -28.172 26.315  1.00 53.27  ? 68   GLU D N     1 
ATOM   2629  C  CA    . GLU D  4 68  ? -21.698 -26.961 26.489  1.00 53.53  ? 68   GLU D CA    1 
ATOM   2630  C  C     . GLU D  4 68  ? -20.534 -27.151 27.423  1.00 52.40  ? 68   GLU D C     1 
ATOM   2631  O  O     . GLU D  4 68  ? -19.411 -26.748 27.102  1.00 52.26  ? 68   GLU D O     1 
ATOM   2632  C  CB    . GLU D  4 68  ? -22.563 -25.811 27.007  1.00 54.46  ? 68   GLU D CB    1 
ATOM   2633  C  CG    . GLU D  4 68  ? -22.914 -24.813 25.912  1.00 59.19  ? 68   GLU D CG    1 
ATOM   2634  C  CD    . GLU D  4 68  ? -24.298 -24.187 26.100  1.00 64.85  ? 68   GLU D CD    1 
ATOM   2635  O  OE1   . GLU D  4 68  ? -24.971 -24.493 27.133  1.00 65.85  ? 68   GLU D OE1   1 
ATOM   2636  O  OE2   . GLU D  4 68  ? -24.697 -23.388 25.202  1.00 67.00  ? 68   GLU D OE2   1 
ATOM   2637  N  N     . ARG D  4 69  ? -20.803 -27.764 28.573  1.00 51.24  ? 69   ARG D N     1 
ATOM   2638  C  CA    . ARG D  4 69  ? -19.755 -28.101 29.505  1.00 51.13  ? 69   ARG D CA    1 
ATOM   2639  C  C     . ARG D  4 69  ? -18.655 -28.883 28.805  1.00 51.39  ? 69   ARG D C     1 
ATOM   2640  O  O     . ARG D  4 69  ? -17.454 -28.590 29.000  1.00 51.28  ? 69   ARG D O     1 
ATOM   2641  C  CB    . ARG D  4 69  ? -20.300 -28.911 30.656  1.00 50.84  ? 69   ARG D CB    1 
ATOM   2642  C  CG    . ARG D  4 69  ? -21.233 -28.163 31.584  1.00 52.14  ? 69   ARG D CG    1 
ATOM   2643  C  CD    . ARG D  4 69  ? -21.374 -28.965 32.879  1.00 51.97  ? 69   ARG D CD    1 
ATOM   2644  N  NE    . ARG D  4 69  ? -22.719 -28.920 33.425  1.00 50.88  ? 69   ARG D NE    1 
ATOM   2645  C  CZ    . ARG D  4 69  ? -23.078 -29.483 34.576  1.00 51.30  ? 69   ARG D CZ    1 
ATOM   2646  N  NH1   . ARG D  4 69  ? -22.187 -30.134 35.328  1.00 48.67  ? 69   ARG D NH1   1 
ATOM   2647  N  NH2   . ARG D  4 69  ? -24.346 -29.388 34.975  1.00 51.90  ? 69   ARG D NH2   1 
ATOM   2648  N  N     . ILE D  4 70  ? -19.053 -29.854 27.974  1.00 51.20  ? 70   ILE D N     1 
ATOM   2649  C  CA    . ILE D  4 70  ? -18.075 -30.671 27.281  1.00 51.74  ? 70   ILE D CA    1 
ATOM   2650  C  C     . ILE D  4 70  ? -17.329 -29.939 26.178  1.00 51.92  ? 70   ILE D C     1 
ATOM   2651  O  O     . ILE D  4 70  ? -16.097 -29.950 26.155  1.00 52.07  ? 70   ILE D O     1 
ATOM   2652  C  CB    . ILE D  4 70  ? -18.638 -32.021 26.804  1.00 52.28  ? 70   ILE D CB    1 
ATOM   2653  C  CG1   . ILE D  4 70  ? -18.889 -32.931 28.008  1.00 51.57  ? 70   ILE D CG1   1 
ATOM   2654  C  CG2   . ILE D  4 70  ? -17.655 -32.719 25.838  1.00 51.99  ? 70   ILE D CG2   1 
ATOM   2655  C  CD1   . ILE D  4 70  ? -19.733 -34.099 27.687  1.00 50.60  ? 70   ILE D CD1   1 
ATOM   2656  N  N     . ALA D  4 71  ? -18.053 -29.306 25.264  1.00 52.26  ? 71   ALA D N     1 
ATOM   2657  C  CA    . ALA D  4 71  ? -17.385 -28.628 24.153  1.00 52.43  ? 71   ALA D CA    1 
ATOM   2658  C  C     . ALA D  4 71  ? -16.538 -27.491 24.677  1.00 52.48  ? 71   ALA D C     1 
ATOM   2659  O  O     . ALA D  4 71  ? -15.485 -27.182 24.112  1.00 52.76  ? 71   ALA D O     1 
ATOM   2660  C  CB    . ALA D  4 71  ? -18.376 -28.119 23.170  1.00 52.99  ? 71   ALA D CB    1 
ATOM   2661  N  N     . GLY D  4 72  ? -17.008 -26.882 25.764  1.00 52.16  ? 72   GLY D N     1 
ATOM   2662  C  CA    . GLY D  4 72  ? -16.270 -25.843 26.449  1.00 51.98  ? 72   GLY D CA    1 
ATOM   2663  C  C     . GLY D  4 72  ? -14.897 -26.297 26.883  1.00 52.09  ? 72   GLY D C     1 
ATOM   2664  O  O     . GLY D  4 72  ? -13.926 -25.603 26.637  1.00 52.44  ? 72   GLY D O     1 
ATOM   2665  N  N     . GLU D  4 73  ? -14.801 -27.465 27.513  1.00 52.14  ? 73   GLU D N     1 
ATOM   2666  C  CA    . GLU D  4 73  ? -13.509 -27.952 27.959  1.00 52.57  ? 73   GLU D CA    1 
ATOM   2667  C  C     . GLU D  4 73  ? -12.631 -28.268 26.795  1.00 52.90  ? 73   GLU D C     1 
ATOM   2668  O  O     . GLU D  4 73  ? -11.427 -27.967 26.804  1.00 53.14  ? 73   GLU D O     1 
ATOM   2669  C  CB    . GLU D  4 73  ? -13.620 -29.197 28.802  1.00 51.96  ? 73   GLU D CB    1 
ATOM   2670  C  CG    . GLU D  4 73  ? -13.800 -28.938 30.255  1.00 54.14  ? 73   GLU D CG    1 
ATOM   2671  C  CD    . GLU D  4 73  ? -12.551 -28.406 30.987  1.00 57.05  ? 73   GLU D CD    1 
ATOM   2672  O  OE1   . GLU D  4 73  ? -11.414 -28.329 30.427  1.00 55.65  ? 73   GLU D OE1   1 
ATOM   2673  O  OE2   . GLU D  4 73  ? -12.739 -28.061 32.173  1.00 59.26  ? 73   GLU D OE2   1 
ATOM   2674  N  N     . ALA D  4 74  ? -13.242 -28.889 25.797  1.00 53.50  ? 74   ALA D N     1 
ATOM   2675  C  CA    . ALA D  4 74  ? -12.504 -29.422 24.668  1.00 53.97  ? 74   ALA D CA    1 
ATOM   2676  C  C     . ALA D  4 74  ? -11.841 -28.260 23.951  1.00 53.92  ? 74   ALA D C     1 
ATOM   2677  O  O     . ALA D  4 74  ? -10.661 -28.328 23.605  1.00 53.72  ? 74   ALA D O     1 
ATOM   2678  C  CB    . ALA D  4 74  ? -13.447 -30.222 23.736  1.00 53.99  ? 74   ALA D CB    1 
ATOM   2679  N  N     . SER D  4 75  ? -12.606 -27.179 23.787  1.00 54.46  ? 75   SER D N     1 
ATOM   2680  C  CA    . SER D  4 75  ? -12.118 -25.920 23.232  1.00 54.70  ? 75   SER D CA    1 
ATOM   2681  C  C     . SER D  4 75  ? -10.874 -25.446 23.960  1.00 55.25  ? 75   SER D C     1 
ATOM   2682  O  O     . SER D  4 75  ? -9.870  -25.128 23.334  1.00 55.81  ? 75   SER D O     1 
ATOM   2683  C  CB    . SER D  4 75  ? -13.205 -24.862 23.322  1.00 54.57  ? 75   SER D CB    1 
ATOM   2684  O  OG    . SER D  4 75  ? -12.765 -23.652 22.736  1.00 55.04  ? 75   SER D OG    1 
ATOM   2685  N  N     . ARG D  4 76  ? -10.930 -25.421 25.285  1.00 55.81  ? 76   ARG D N     1 
ATOM   2686  C  CA    . ARG D  4 76  ? -9.791  -24.981 26.069  1.00 56.88  ? 76   ARG D CA    1 
ATOM   2687  C  C     . ARG D  4 76  ? -8.604  -25.915 25.907  1.00 57.43  ? 76   ARG D C     1 
ATOM   2688  O  O     . ARG D  4 76  ? -7.468  -25.450 25.752  1.00 57.82  ? 76   ARG D O     1 
ATOM   2689  C  CB    . ARG D  4 76  ? -10.155 -24.835 27.548  1.00 57.54  ? 76   ARG D CB    1 
ATOM   2690  C  CG    . ARG D  4 76  ? -11.232 -23.808 27.852  1.00 57.22  ? 76   ARG D CG    1 
ATOM   2691  C  CD    . ARG D  4 76  ? -11.554 -23.809 29.335  1.00 57.66  ? 76   ARG D CD    1 
ATOM   2692  N  NE    . ARG D  4 76  ? -12.958 -23.493 29.550  1.00 58.04  ? 76   ARG D NE    1 
ATOM   2693  C  CZ    . ARG D  4 76  ? -13.871 -24.358 29.985  1.00 60.62  ? 76   ARG D CZ    1 
ATOM   2694  N  NH1   . ARG D  4 76  ? -13.527 -25.603 30.288  1.00 61.07  ? 76   ARG D NH1   1 
ATOM   2695  N  NH2   . ARG D  4 76  ? -15.134 -23.973 30.139  1.00 60.89  ? 76   ARG D NH2   1 
ATOM   2696  N  N     . LEU D  4 77  ? -8.868  -27.225 25.939  1.00 57.91  ? 77   LEU D N     1 
ATOM   2697  C  CA    . LEU D  4 77  ? -7.832  -28.240 25.731  1.00 57.90  ? 77   LEU D CA    1 
ATOM   2698  C  C     . LEU D  4 77  ? -7.124  -27.982 24.422  1.00 58.65  ? 77   LEU D C     1 
ATOM   2699  O  O     . LEU D  4 77  ? -5.895  -28.048 24.355  1.00 58.52  ? 77   LEU D O     1 
ATOM   2700  C  CB    . LEU D  4 77  ? -8.421  -29.652 25.728  1.00 57.67  ? 77   LEU D CB    1 
ATOM   2701  C  CG    . LEU D  4 77  ? -8.547  -30.603 26.939  1.00 57.00  ? 77   LEU D CG    1 
ATOM   2702  C  CD1   . LEU D  4 77  ? -7.455  -30.419 27.978  1.00 55.17  ? 77   LEU D CD1   1 
ATOM   2703  C  CD2   . LEU D  4 77  ? -9.923  -30.579 27.598  1.00 55.88  ? 77   LEU D CD2   1 
ATOM   2704  N  N     . ALA D  4 78  ? -7.894  -27.681 23.376  1.00 59.64  ? 78   ALA D N     1 
ATOM   2705  C  CA    . ALA D  4 78  ? -7.301  -27.338 22.084  1.00 60.91  ? 78   ALA D CA    1 
ATOM   2706  C  C     . ALA D  4 78  ? -6.455  -26.066 22.184  1.00 62.04  ? 78   ALA D C     1 
ATOM   2707  O  O     . ALA D  4 78  ? -5.320  -26.035 21.696  1.00 62.25  ? 78   ALA D O     1 
ATOM   2708  C  CB    . ALA D  4 78  ? -8.354  -27.178 21.051  1.00 61.07  ? 78   ALA D CB    1 
ATOM   2709  N  N     . HIS D  4 79  ? -6.996  -25.028 22.828  1.00 63.06  ? 79   HIS D N     1 
ATOM   2710  C  CA    . HIS D  4 79  ? -6.226  -23.797 23.049  1.00 64.54  ? 79   HIS D CA    1 
ATOM   2711  C  C     . HIS D  4 79  ? -4.969  -24.115 23.854  1.00 64.77  ? 79   HIS D C     1 
ATOM   2712  O  O     . HIS D  4 79  ? -3.868  -23.815 23.400  1.00 64.68  ? 79   HIS D O     1 
ATOM   2713  C  CB    . HIS D  4 79  ? -7.029  -22.684 23.767  1.00 64.76  ? 79   HIS D CB    1 
ATOM   2714  C  CG    . HIS D  4 79  ? -8.257  -22.227 23.038  1.00 66.52  ? 79   HIS D CG    1 
ATOM   2715  N  ND1   . HIS D  4 79  ? -8.222  -21.719 21.753  1.00 67.38  ? 79   HIS D ND1   1 
ATOM   2716  C  CD2   . HIS D  4 79  ? -9.554  -22.159 23.434  1.00 67.18  ? 79   HIS D CD2   1 
ATOM   2717  C  CE1   . HIS D  4 79  ? -9.447  -21.381 21.384  1.00 67.81  ? 79   HIS D CE1   1 
ATOM   2718  N  NE2   . HIS D  4 79  ? -10.274 -21.642 22.383  1.00 67.91  ? 79   HIS D NE2   1 
ATOM   2719  N  N     . TYR D  4 80  ? -5.136  -24.727 25.032  1.00 65.28  ? 80   TYR D N     1 
ATOM   2720  C  CA    . TYR D  4 80  ? -4.002  -25.005 25.910  1.00 66.86  ? 80   TYR D CA    1 
ATOM   2721  C  C     . TYR D  4 80  ? -2.871  -25.667 25.154  1.00 67.42  ? 80   TYR D C     1 
ATOM   2722  O  O     . TYR D  4 80  ? -1.708  -25.440 25.452  1.00 67.83  ? 80   TYR D O     1 
ATOM   2723  C  CB    . TYR D  4 80  ? -4.383  -25.885 27.111  1.00 67.49  ? 80   TYR D CB    1 
ATOM   2724  C  CG    . TYR D  4 80  ? -5.363  -25.250 28.089  1.00 69.50  ? 80   TYR D CG    1 
ATOM   2725  C  CD1   . TYR D  4 80  ? -6.033  -26.034 29.035  1.00 70.11  ? 80   TYR D CD1   1 
ATOM   2726  C  CD2   . TYR D  4 80  ? -5.631  -23.866 28.069  1.00 69.01  ? 80   TYR D CD2   1 
ATOM   2727  C  CE1   . TYR D  4 80  ? -6.938  -25.468 29.940  1.00 70.27  ? 80   TYR D CE1   1 
ATOM   2728  C  CE2   . TYR D  4 80  ? -6.528  -23.298 28.960  1.00 69.74  ? 80   TYR D CE2   1 
ATOM   2729  C  CZ    . TYR D  4 80  ? -7.183  -24.108 29.896  1.00 70.71  ? 80   TYR D CZ    1 
ATOM   2730  O  OH    . TYR D  4 80  ? -8.086  -23.554 30.784  1.00 71.32  ? 80   TYR D OH    1 
ATOM   2731  N  N     . ASN D  4 81  ? -3.216  -26.475 24.159  1.00 68.14  ? 81   ASN D N     1 
ATOM   2732  C  CA    . ASN D  4 81  ? -2.231  -27.284 23.487  1.00 68.54  ? 81   ASN D CA    1 
ATOM   2733  C  C     . ASN D  4 81  ? -1.866  -26.757 22.115  1.00 68.99  ? 81   ASN D C     1 
ATOM   2734  O  O     . ASN D  4 81  ? -1.252  -27.466 21.326  1.00 69.00  ? 81   ASN D O     1 
ATOM   2735  C  CB    . ASN D  4 81  ? -2.705  -28.735 23.440  1.00 68.69  ? 81   ASN D CB    1 
ATOM   2736  C  CG    . ASN D  4 81  ? -2.631  -29.398 24.794  1.00 69.02  ? 81   ASN D CG    1 
ATOM   2737  O  OD1   . ASN D  4 81  ? -1.584  -29.906 25.176  1.00 69.07  ? 81   ASN D OD1   1 
ATOM   2738  N  ND2   . ASN D  4 81  ? -3.736  -29.373 25.543  1.00 69.60  ? 81   ASN D ND2   1 
ATOM   2739  N  N     . LYS D  4 82  ? -2.224  -25.503 21.849  1.00 69.54  ? 82   LYS D N     1 
ATOM   2740  C  CA    . LYS D  4 82  ? -1.873  -24.827 20.591  1.00 70.14  ? 82   LYS D CA    1 
ATOM   2741  C  C     . LYS D  4 82  ? -2.297  -25.652 19.386  1.00 69.87  ? 82   LYS D C     1 
ATOM   2742  O  O     . LYS D  4 82  ? -1.499  -25.927 18.494  1.00 69.82  ? 82   LYS D O     1 
ATOM   2743  C  CB    . LYS D  4 82  ? -0.372  -24.497 20.526  1.00 70.53  ? 82   LYS D CB    1 
ATOM   2744  C  CG    . LYS D  4 82  ? 0.130   -23.663 21.698  1.00 72.29  ? 82   LYS D CG    1 
ATOM   2745  C  CD    . LYS D  4 82  ? 1.125   -22.592 21.239  1.00 76.12  ? 82   LYS D CD    1 
ATOM   2746  C  CE    . LYS D  4 82  ? 1.577   -21.697 22.408  1.00 75.88  ? 82   LYS D CE    1 
ATOM   2747  N  NZ    . LYS D  4 82  ? 2.274   -20.455 21.923  1.00 79.03  ? 82   LYS D NZ    1 
ATOM   2748  N  N     . ARG D  4 83  ? -3.561  -26.049 19.377  1.00 69.83  ? 83   ARG D N     1 
ATOM   2749  C  CA    . ARG D  4 83  ? -4.082  -26.890 18.319  1.00 70.36  ? 83   ARG D CA    1 
ATOM   2750  C  C     . ARG D  4 83  ? -5.401  -26.332 17.806  1.00 70.09  ? 83   ARG D C     1 
ATOM   2751  O  O     . ARG D  4 83  ? -6.170  -25.744 18.568  1.00 70.35  ? 83   ARG D O     1 
ATOM   2752  C  CB    . ARG D  4 83  ? -4.260  -28.320 18.825  1.00 70.75  ? 83   ARG D CB    1 
ATOM   2753  C  CG    . ARG D  4 83  ? -2.956  -29.105 18.987  1.00 72.63  ? 83   ARG D CG    1 
ATOM   2754  C  CD    . ARG D  4 83  ? -3.206  -30.610 19.052  1.00 77.34  ? 83   ARG D CD    1 
ATOM   2755  N  NE    . ARG D  4 83  ? -3.907  -31.094 17.856  1.00 81.35  ? 83   ARG D NE    1 
ATOM   2756  C  CZ    . ARG D  4 83  ? -5.237  -31.216 17.732  1.00 82.94  ? 83   ARG D CZ    1 
ATOM   2757  N  NH1   . ARG D  4 83  ? -6.063  -30.910 18.741  1.00 81.97  ? 83   ARG D NH1   1 
ATOM   2758  N  NH2   . ARG D  4 83  ? -5.748  -31.656 16.584  1.00 82.97  ? 83   ARG D NH2   1 
ATOM   2759  N  N     . SER D  4 84  ? -5.671  -26.535 16.521  1.00 69.65  ? 84   SER D N     1 
ATOM   2760  C  CA    . SER D  4 84  ? -6.778  -25.848 15.863  1.00 69.32  ? 84   SER D CA    1 
ATOM   2761  C  C     . SER D  4 84  ? -8.057  -26.655 15.749  1.00 69.04  ? 84   SER D C     1 
ATOM   2762  O  O     . SER D  4 84  ? -9.077  -26.141 15.267  1.00 69.80  ? 84   SER D O     1 
ATOM   2763  C  CB    . SER D  4 84  ? -6.355  -25.393 14.472  1.00 69.26  ? 84   SER D CB    1 
ATOM   2764  O  OG    . SER D  4 84  ? -5.149  -24.655 14.536  1.00 70.49  ? 84   SER D OG    1 
ATOM   2765  N  N     . THR D  4 85  ? -8.017  -27.910 16.186  1.00 68.13  ? 85   THR D N     1 
ATOM   2766  C  CA    . THR D  4 85  ? -9.116  -28.842 15.942  1.00 66.77  ? 85   THR D CA    1 
ATOM   2767  C  C     . THR D  4 85  ? -9.649  -29.449 17.224  1.00 65.69  ? 85   THR D C     1 
ATOM   2768  O  O     . THR D  4 85  ? -8.886  -29.762 18.134  1.00 65.28  ? 85   THR D O     1 
ATOM   2769  C  CB    . THR D  4 85  ? -8.666  -29.984 15.024  1.00 66.87  ? 85   THR D CB    1 
ATOM   2770  O  OG1   . THR D  4 85  ? -7.237  -29.975 14.924  1.00 67.84  ? 85   THR D OG1   1 
ATOM   2771  C  CG2   . THR D  4 85  ? -9.221  -29.806 13.661  1.00 68.19  ? 85   THR D CG2   1 
ATOM   2772  N  N     . ILE D  4 86  ? -10.961 -29.622 17.295  1.00 64.52  ? 86   ILE D N     1 
ATOM   2773  C  CA    . ILE D  4 86  ? -11.532 -30.401 18.371  1.00 63.95  ? 86   ILE D CA    1 
ATOM   2774  C  C     . ILE D  4 86  ? -11.750 -31.816 17.864  1.00 64.00  ? 86   ILE D C     1 
ATOM   2775  O  O     . ILE D  4 86  ? -12.592 -32.056 16.993  1.00 64.54  ? 86   ILE D O     1 
ATOM   2776  C  CB    . ILE D  4 86  ? -12.802 -29.749 18.922  1.00 64.00  ? 86   ILE D CB    1 
ATOM   2777  C  CG1   . ILE D  4 86  ? -12.392 -28.585 19.835  1.00 64.13  ? 86   ILE D CG1   1 
ATOM   2778  C  CG2   . ILE D  4 86  ? -13.649 -30.738 19.709  1.00 62.42  ? 86   ILE D CG2   1 
ATOM   2779  C  CD1   . ILE D  4 86  ? -13.471 -27.588 20.055  1.00 63.34  ? 86   ILE D CD1   1 
ATOM   2780  N  N     . THR D  4 87  ? -10.960 -32.748 18.390  1.00 63.18  ? 87   THR D N     1 
ATOM   2781  C  CA    . THR D  4 87  ? -11.034 -34.144 17.986  1.00 62.31  ? 87   THR D CA    1 
ATOM   2782  C  C     . THR D  4 87  ? -11.769 -34.934 19.048  1.00 61.96  ? 87   THR D C     1 
ATOM   2783  O  O     . THR D  4 87  ? -12.165 -34.387 20.075  1.00 61.95  ? 87   THR D O     1 
ATOM   2784  C  CB    . THR D  4 87  ? -9.625  -34.748 17.799  1.00 62.41  ? 87   THR D CB    1 
ATOM   2785  O  OG1   . THR D  4 87  ? -8.907  -34.684 19.041  1.00 62.28  ? 87   THR D OG1   1 
ATOM   2786  C  CG2   . THR D  4 87  ? -8.842  -33.991 16.723  1.00 61.57  ? 87   THR D CG2   1 
ATOM   2787  N  N     . SER D  4 88  ? -11.935 -36.232 18.814  1.00 61.59  ? 88   SER D N     1 
ATOM   2788  C  CA    . SER D  4 88  ? -12.600 -37.105 19.776  1.00 60.84  ? 88   SER D CA    1 
ATOM   2789  C  C     . SER D  4 88  ? -11.708 -37.302 20.990  1.00 59.90  ? 88   SER D C     1 
ATOM   2790  O  O     . SER D  4 88  ? -12.161 -37.679 22.058  1.00 59.70  ? 88   SER D O     1 
ATOM   2791  C  CB    . SER D  4 88  ? -12.917 -38.445 19.126  1.00 61.12  ? 88   SER D CB    1 
ATOM   2792  O  OG    . SER D  4 88  ? -11.712 -39.111 18.824  1.00 62.26  ? 88   SER D OG    1 
ATOM   2793  N  N     . ARG D  4 89  ? -10.428 -37.038 20.809  1.00 59.35  ? 89   ARG D N     1 
ATOM   2794  C  CA    . ARG D  4 89  ? -9.482  -37.053 21.904  1.00 59.00  ? 89   ARG D CA    1 
ATOM   2795  C  C     . ARG D  4 89  ? -9.730  -35.917 22.926  1.00 58.91  ? 89   ARG D C     1 
ATOM   2796  O  O     . ARG D  4 89  ? -9.598  -36.131 24.129  1.00 59.20  ? 89   ARG D O     1 
ATOM   2797  C  CB    . ARG D  4 89  ? -8.088  -36.966 21.334  1.00 58.88  ? 89   ARG D CB    1 
ATOM   2798  C  CG    . ARG D  4 89  ? -7.021  -37.200 22.316  1.00 60.79  ? 89   ARG D CG    1 
ATOM   2799  C  CD    . ARG D  4 89  ? -5.681  -37.326 21.603  1.00 64.66  ? 89   ARG D CD    1 
ATOM   2800  N  NE    . ARG D  4 89  ? -4.689  -37.902 22.503  1.00 67.82  ? 89   ARG D NE    1 
ATOM   2801  C  CZ    . ARG D  4 89  ? -4.043  -37.203 23.424  1.00 68.63  ? 89   ARG D CZ    1 
ATOM   2802  N  NH1   . ARG D  4 89  ? -4.285  -35.900 23.549  1.00 69.73  ? 89   ARG D NH1   1 
ATOM   2803  N  NH2   . ARG D  4 89  ? -3.164  -37.804 24.215  1.00 68.40  ? 89   ARG D NH2   1 
ATOM   2804  N  N     . GLU D  4 90  ? -10.095 -34.716 22.463  1.00 58.15  ? 90   GLU D N     1 
ATOM   2805  C  CA    . GLU D  4 90  ? -10.468 -33.649 23.396  1.00 56.96  ? 90   GLU D CA    1 
ATOM   2806  C  C     . GLU D  4 90  ? -11.785 -33.908 24.055  1.00 55.98  ? 90   GLU D C     1 
ATOM   2807  O  O     . GLU D  4 90  ? -11.979 -33.516 25.197  1.00 56.51  ? 90   GLU D O     1 
ATOM   2808  C  CB    . GLU D  4 90  ? -10.537 -32.283 22.737  1.00 57.24  ? 90   GLU D CB    1 
ATOM   2809  C  CG    . GLU D  4 90  ? -9.220  -31.614 22.670  1.00 58.03  ? 90   GLU D CG    1 
ATOM   2810  C  CD    . GLU D  4 90  ? -8.468  -32.065 21.486  1.00 61.17  ? 90   GLU D CD    1 
ATOM   2811  O  OE1   . GLU D  4 90  ? -9.083  -32.108 20.399  1.00 64.14  ? 90   GLU D OE1   1 
ATOM   2812  O  OE2   . GLU D  4 90  ? -7.273  -32.390 21.634  1.00 63.72  ? 90   GLU D OE2   1 
ATOM   2813  N  N     . ILE D  4 91  ? -12.699 -34.554 23.343  1.00 54.64  ? 91   ILE D N     1 
ATOM   2814  C  CA    . ILE D  4 91  ? -13.996 -34.873 23.915  1.00 53.43  ? 91   ILE D CA    1 
ATOM   2815  C  C     . ILE D  4 91  ? -13.793 -35.861 25.040  1.00 53.49  ? 91   ILE D C     1 
ATOM   2816  O  O     . ILE D  4 91  ? -14.462 -35.783 26.091  1.00 53.47  ? 91   ILE D O     1 
ATOM   2817  C  CB    . ILE D  4 91  ? -14.933 -35.478 22.864  1.00 53.07  ? 91   ILE D CB    1 
ATOM   2818  C  CG1   . ILE D  4 91  ? -15.161 -34.488 21.716  1.00 52.45  ? 91   ILE D CG1   1 
ATOM   2819  C  CG2   . ILE D  4 91  ? -16.237 -35.922 23.498  1.00 52.24  ? 91   ILE D CG2   1 
ATOM   2820  C  CD1   . ILE D  4 91  ? -15.752 -33.140 22.144  1.00 51.31  ? 91   ILE D CD1   1 
ATOM   2821  N  N     . GLN D  4 92  ? -12.851 -36.778 24.816  1.00 52.99  ? 92   GLN D N     1 
ATOM   2822  C  CA    . GLN D  4 92  ? -12.589 -37.836 25.763  1.00 52.89  ? 92   GLN D CA    1 
ATOM   2823  C  C     . GLN D  4 92  ? -12.089 -37.288 27.080  1.00 52.14  ? 92   GLN D C     1 
ATOM   2824  O  O     . GLN D  4 92  ? -12.696 -37.531 28.129  1.00 51.46  ? 92   GLN D O     1 
ATOM   2825  C  CB    . GLN D  4 92  ? -11.620 -38.891 25.220  1.00 53.17  ? 92   GLN D CB    1 
ATOM   2826  C  CG    . GLN D  4 92  ? -11.560 -40.098 26.175  1.00 55.34  ? 92   GLN D CG    1 
ATOM   2827  C  CD    . GLN D  4 92  ? -10.982 -41.337 25.550  1.00 57.64  ? 92   GLN D CD    1 
ATOM   2828  O  OE1   . GLN D  4 92  ? -9.781  -41.612 25.667  1.00 59.19  ? 92   GLN D OE1   1 
ATOM   2829  N  NE2   . GLN D  4 92  ? -11.831 -42.104 24.894  1.00 56.49  ? 92   GLN D NE2   1 
ATOM   2830  N  N     . THR D  4 93  ? -10.999 -36.528 27.032  1.00 51.72  ? 93   THR D N     1 
ATOM   2831  C  CA    . THR D  4 93  ? -10.484 -35.962 28.277  1.00 51.24  ? 93   THR D CA    1 
ATOM   2832  C  C     . THR D  4 93  ? -11.398 -34.904 28.899  1.00 51.59  ? 93   THR D C     1 
ATOM   2833  O  O     . THR D  4 93  ? -11.454 -34.761 30.123  1.00 50.82  ? 93   THR D O     1 
ATOM   2834  C  CB    . THR D  4 93  ? -9.057  -35.479 28.190  1.00 50.75  ? 93   THR D CB    1 
ATOM   2835  O  OG1   . THR D  4 93  ? -9.023  -34.135 28.673  1.00 50.37  ? 93   THR D OG1   1 
ATOM   2836  C  CG2   . THR D  4 93  ? -8.544  -35.551 26.792  1.00 49.46  ? 93   THR D CG2   1 
ATOM   2837  N  N     . ALA D  4 94  ? -12.150 -34.196 28.065  1.00 52.35  ? 94   ALA D N     1 
ATOM   2838  C  CA    . ALA D  4 94  ? -13.167 -33.298 28.592  1.00 53.29  ? 94   ALA D CA    1 
ATOM   2839  C  C     . ALA D  4 94  ? -14.145 -34.072 29.479  1.00 53.95  ? 94   ALA D C     1 
ATOM   2840  O  O     . ALA D  4 94  ? -14.436 -33.652 30.594  1.00 54.51  ? 94   ALA D O     1 
ATOM   2841  C  CB    . ALA D  4 94  ? -13.882 -32.604 27.478  1.00 53.21  ? 94   ALA D CB    1 
ATOM   2842  N  N     . VAL D  4 95  ? -14.614 -35.216 28.985  1.00 54.39  ? 95   VAL D N     1 
ATOM   2843  C  CA    . VAL D  4 95  ? -15.489 -36.127 29.734  1.00 54.53  ? 95   VAL D CA    1 
ATOM   2844  C  C     . VAL D  4 95  ? -14.838 -36.618 31.027  1.00 54.69  ? 95   VAL D C     1 
ATOM   2845  O  O     . VAL D  4 95  ? -15.472 -36.671 32.081  1.00 54.60  ? 95   VAL D O     1 
ATOM   2846  C  CB    . VAL D  4 95  ? -15.842 -37.330 28.854  1.00 54.65  ? 95   VAL D CB    1 
ATOM   2847  C  CG1   . VAL D  4 95  ? -16.600 -38.409 29.635  1.00 54.47  ? 95   VAL D CG1   1 
ATOM   2848  C  CG2   . VAL D  4 95  ? -16.631 -36.861 27.650  1.00 55.45  ? 95   VAL D CG2   1 
ATOM   2849  N  N     . ARG D  4 96  ? -13.568 -36.982 30.943  1.00 54.93  ? 96   ARG D N     1 
ATOM   2850  C  CA    . ARG D  4 96  ? -12.840 -37.407 32.121  1.00 55.47  ? 96   ARG D CA    1 
ATOM   2851  C  C     . ARG D  4 96  ? -12.748 -36.308 33.167  1.00 54.89  ? 96   ARG D C     1 
ATOM   2852  O  O     . ARG D  4 96  ? -12.802 -36.599 34.347  1.00 55.15  ? 96   ARG D O     1 
ATOM   2853  C  CB    . ARG D  4 96  ? -11.434 -37.901 31.762  1.00 56.45  ? 96   ARG D CB    1 
ATOM   2854  C  CG    . ARG D  4 96  ? -11.374 -39.320 31.228  1.00 58.70  ? 96   ARG D CG    1 
ATOM   2855  C  CD    . ARG D  4 96  ? -9.966  -39.849 31.288  1.00 63.58  ? 96   ARG D CD    1 
ATOM   2856  N  NE    . ARG D  4 96  ? -9.584  -40.346 29.971  1.00 69.66  ? 96   ARG D NE    1 
ATOM   2857  C  CZ    . ARG D  4 96  ? -8.501  -39.959 29.292  1.00 72.32  ? 96   ARG D CZ    1 
ATOM   2858  N  NH1   . ARG D  4 96  ? -7.637  -39.075 29.824  1.00 73.18  ? 96   ARG D NH1   1 
ATOM   2859  N  NH2   . ARG D  4 96  ? -8.268  -40.481 28.086  1.00 71.26  ? 96   ARG D NH2   1 
ATOM   2860  N  N     . LEU D  4 97  ? -12.600 -35.053 32.738  1.00 54.61  ? 97   LEU D N     1 
ATOM   2861  C  CA    . LEU D  4 97  ? -12.554 -33.921 33.668  1.00 53.43  ? 97   LEU D CA    1 
ATOM   2862  C  C     . LEU D  4 97  ? -13.936 -33.600 34.164  1.00 53.44  ? 97   LEU D C     1 
ATOM   2863  O  O     . LEU D  4 97  ? -14.127 -33.251 35.309  1.00 53.41  ? 97   LEU D O     1 
ATOM   2864  C  CB    . LEU D  4 97  ? -11.932 -32.685 33.024  1.00 52.78  ? 97   LEU D CB    1 
ATOM   2865  C  CG    . LEU D  4 97  ? -10.463 -32.778 32.588  1.00 52.01  ? 97   LEU D CG    1 
ATOM   2866  C  CD1   . LEU D  4 97  ? -10.155 -31.790 31.473  1.00 49.16  ? 97   LEU D CD1   1 
ATOM   2867  C  CD2   . LEU D  4 97  ? -9.457  -32.661 33.740  1.00 50.56  ? 97   LEU D CD2   1 
ATOM   2868  N  N     . LEU D  4 98  ? -14.919 -33.751 33.307  1.00 54.22  ? 98   LEU D N     1 
ATOM   2869  C  CA    . LEU D  4 98  ? -16.252 -33.341 33.669  1.00 55.28  ? 98   LEU D CA    1 
ATOM   2870  C  C     . LEU D  4 98  ? -17.058 -34.295 34.524  1.00 55.32  ? 98   LEU D C     1 
ATOM   2871  O  O     . LEU D  4 98  ? -17.814 -33.858 35.380  1.00 55.43  ? 98   LEU D O     1 
ATOM   2872  C  CB    . LEU D  4 98  ? -17.044 -33.049 32.422  1.00 55.84  ? 98   LEU D CB    1 
ATOM   2873  C  CG    . LEU D  4 98  ? -17.931 -31.870 32.799  1.00 59.52  ? 98   LEU D CG    1 
ATOM   2874  C  CD1   . LEU D  4 98  ? -17.224 -30.525 32.465  1.00 58.83  ? 98   LEU D CD1   1 
ATOM   2875  C  CD2   . LEU D  4 98  ? -19.324 -32.029 32.146  1.00 62.13  ? 98   LEU D CD2   1 
ATOM   2876  N  N     . LEU D  4 99  ? -16.929 -35.591 34.268  1.00 56.16  ? 99   LEU D N     1 
ATOM   2877  C  CA    . LEU D  4 99  ? -17.816 -36.574 34.864  1.00 56.53  ? 99   LEU D CA    1 
ATOM   2878  C  C     . LEU D  4 99  ? -17.157 -37.302 36.027  1.00 57.52  ? 99   LEU D C     1 
ATOM   2879  O  O     . LEU D  4 99  ? -15.956 -37.604 35.983  1.00 57.77  ? 99   LEU D O     1 
ATOM   2880  C  CB    . LEU D  4 99  ? -18.303 -37.553 33.798  1.00 56.31  ? 99   LEU D CB    1 
ATOM   2881  C  CG    . LEU D  4 99  ? -19.139 -36.959 32.652  1.00 56.22  ? 99   LEU D CG    1 
ATOM   2882  C  CD1   . LEU D  4 99  ? -19.707 -38.053 31.768  1.00 56.85  ? 99   LEU D CD1   1 
ATOM   2883  C  CD2   . LEU D  4 99  ? -20.276 -36.137 33.187  1.00 54.64  ? 99   LEU D CD2   1 
ATOM   2884  N  N     . PRO D  4 100 ? -17.938 -37.592 37.079  1.00 58.28  ? 100  PRO D N     1 
ATOM   2885  C  CA    . PRO D  4 100 ? -17.386 -38.315 38.227  1.00 59.24  ? 100  PRO D CA    1 
ATOM   2886  C  C     . PRO D  4 100 ? -17.172 -39.816 37.936  1.00 59.94  ? 100  PRO D C     1 
ATOM   2887  O  O     . PRO D  4 100 ? -17.840 -40.385 37.068  1.00 60.26  ? 100  PRO D O     1 
ATOM   2888  C  CB    . PRO D  4 100 ? -18.453 -38.114 39.304  1.00 59.31  ? 100  PRO D CB    1 
ATOM   2889  C  CG    . PRO D  4 100 ? -19.734 -37.979 38.535  1.00 58.71  ? 100  PRO D CG    1 
ATOM   2890  C  CD    . PRO D  4 100 ? -19.368 -37.281 37.253  1.00 58.23  ? 100  PRO D CD    1 
ATOM   2891  N  N     . GLY D  4 101 ? -16.234 -40.419 38.663  1.00 60.55  ? 101  GLY D N     1 
ATOM   2892  C  CA    . GLY D  4 101 ? -15.836 -41.832 38.538  1.00 61.05  ? 101  GLY D CA    1 
ATOM   2893  C  C     . GLY D  4 101 ? -16.514 -42.739 37.524  1.00 61.67  ? 101  GLY D C     1 
ATOM   2894  O  O     . GLY D  4 101 ? -16.023 -42.905 36.387  1.00 61.44  ? 101  GLY D O     1 
ATOM   2895  N  N     . GLU D  4 102 ? -17.631 -43.338 37.932  1.00 61.85  ? 102  GLU D N     1 
ATOM   2896  C  CA    . GLU D  4 102 ? -18.239 -44.426 37.150  1.00 62.79  ? 102  GLU D CA    1 
ATOM   2897  C  C     . GLU D  4 102 ? -18.844 -43.927 35.824  1.00 62.53  ? 102  GLU D C     1 
ATOM   2898  O  O     . GLU D  4 102 ? -18.627 -44.531 34.762  1.00 62.84  ? 102  GLU D O     1 
ATOM   2899  C  CB    . GLU D  4 102 ? -19.237 -45.240 38.006  1.00 63.12  ? 102  GLU D CB    1 
ATOM   2900  C  CG    . GLU D  4 102 ? -19.279 -46.738 37.706  1.00 65.78  ? 102  GLU D CG    1 
ATOM   2901  C  CD    . GLU D  4 102 ? -17.933 -47.435 37.964  1.00 69.54  ? 102  GLU D CD    1 
ATOM   2902  O  OE1   . GLU D  4 102 ? -17.295 -47.117 38.996  1.00 70.38  ? 102  GLU D OE1   1 
ATOM   2903  O  OE2   . GLU D  4 102 ? -17.516 -48.303 37.146  1.00 69.95  ? 102  GLU D OE2   1 
ATOM   2904  N  N     . LEU D  4 103 ? -19.572 -42.812 35.889  1.00 62.36  ? 103  LEU D N     1 
ATOM   2905  C  CA    . LEU D  4 103 ? -20.083 -42.114 34.707  1.00 61.48  ? 103  LEU D CA    1 
ATOM   2906  C  C     . LEU D  4 103 ? -18.984 -41.819 33.699  1.00 61.22  ? 103  LEU D C     1 
ATOM   2907  O  O     . LEU D  4 103 ? -19.148 -42.079 32.502  1.00 60.84  ? 103  LEU D O     1 
ATOM   2908  C  CB    . LEU D  4 103 ? -20.729 -40.814 35.132  1.00 61.52  ? 103  LEU D CB    1 
ATOM   2909  C  CG    . LEU D  4 103 ? -22.247 -40.667 35.233  1.00 62.31  ? 103  LEU D CG    1 
ATOM   2910  C  CD1   . LEU D  4 103 ? -23.011 -41.964 35.410  1.00 61.70  ? 103  LEU D CD1   1 
ATOM   2911  C  CD2   . LEU D  4 103 ? -22.565 -39.674 36.340  1.00 63.03  ? 103  LEU D CD2   1 
ATOM   2912  N  N     . ALA D  4 104 ? -17.860 -41.287 34.180  1.00 61.21  ? 104  ALA D N     1 
ATOM   2913  C  CA    . ALA D  4 104 ? -16.688 -41.040 33.316  1.00 61.21  ? 104  ALA D CA    1 
ATOM   2914  C  C     . ALA D  4 104 ? -16.263 -42.298 32.573  1.00 61.15  ? 104  ALA D C     1 
ATOM   2915  O  O     . ALA D  4 104 ? -16.081 -42.268 31.370  1.00 60.95  ? 104  ALA D O     1 
ATOM   2916  C  CB    . ALA D  4 104 ? -15.526 -40.470 34.117  1.00 60.74  ? 104  ALA D CB    1 
ATOM   2917  N  N     . LYS D  4 105 ? -16.155 -43.403 33.309  1.00 61.74  ? 105  LYS D N     1 
ATOM   2918  C  CA    . LYS D  4 105 ? -15.724 -44.688 32.778  1.00 62.33  ? 105  LYS D CA    1 
ATOM   2919  C  C     . LYS D  4 105 ? -16.678 -45.210 31.724  1.00 62.00  ? 105  LYS D C     1 
ATOM   2920  O  O     . LYS D  4 105 ? -16.252 -45.537 30.620  1.00 62.22  ? 105  LYS D O     1 
ATOM   2921  C  CB    . LYS D  4 105 ? -15.567 -45.700 33.902  1.00 62.00  ? 105  LYS D CB    1 
ATOM   2922  C  CG    . LYS D  4 105 ? -14.951 -47.024 33.458  1.00 64.40  ? 105  LYS D CG    1 
ATOM   2923  C  CD    . LYS D  4 105 ? -15.101 -48.127 34.523  1.00 63.89  ? 105  LYS D CD    1 
ATOM   2924  C  CE    . LYS D  4 105 ? -14.240 -47.850 35.764  1.00 66.59  ? 105  LYS D CE    1 
ATOM   2925  N  NZ    . LYS D  4 105 ? -14.873 -48.432 36.984  1.00 67.63  ? 105  LYS D NZ    1 
ATOM   2926  N  N     . HIS D  4 106 ? -17.963 -45.274 32.045  1.00 61.88  ? 106  HIS D N     1 
ATOM   2927  C  CA    . HIS D  4 106 ? -18.930 -45.698 31.056  1.00 62.61  ? 106  HIS D CA    1 
ATOM   2928  C  C     . HIS D  4 106 ? -19.004 -44.798 29.807  1.00 62.66  ? 106  HIS D C     1 
ATOM   2929  O  O     . HIS D  4 106 ? -19.026 -45.303 28.675  1.00 63.44  ? 106  HIS D O     1 
ATOM   2930  C  CB    . HIS D  4 106 ? -20.303 -45.879 31.687  1.00 63.07  ? 106  HIS D CB    1 
ATOM   2931  C  CG    . HIS D  4 106 ? -20.387 -47.053 32.611  1.00 66.17  ? 106  HIS D CG    1 
ATOM   2932  N  ND1   . HIS D  4 106 ? -21.091 -47.019 33.797  1.00 69.31  ? 106  HIS D ND1   1 
ATOM   2933  C  CD2   . HIS D  4 106 ? -19.845 -48.292 32.530  1.00 68.58  ? 106  HIS D CD2   1 
ATOM   2934  C  CE1   . HIS D  4 106 ? -20.977 -48.186 34.408  1.00 69.90  ? 106  HIS D CE1   1 
ATOM   2935  N  NE2   . HIS D  4 106 ? -20.224 -48.975 33.660  1.00 70.32  ? 106  HIS D NE2   1 
ATOM   2936  N  N     . ALA D  4 107 ? -19.033 -43.476 29.996  1.00 61.91  ? 107  ALA D N     1 
ATOM   2937  C  CA    . ALA D  4 107 ? -19.113 -42.553 28.869  1.00 60.68  ? 107  ALA D CA    1 
ATOM   2938  C  C     . ALA D  4 107 ? -17.921 -42.707 27.927  1.00 60.18  ? 107  ALA D C     1 
ATOM   2939  O  O     . ALA D  4 107 ? -18.086 -42.659 26.714  1.00 59.67  ? 107  ALA D O     1 
ATOM   2940  C  CB    . ALA D  4 107 ? -19.234 -41.126 29.361  1.00 60.98  ? 107  ALA D CB    1 
ATOM   2941  N  N     . VAL D  4 108 ? -16.727 -42.900 28.486  1.00 59.74  ? 108  VAL D N     1 
ATOM   2942  C  CA    . VAL D  4 108 ? -15.534 -43.189 27.691  1.00 59.91  ? 108  VAL D CA    1 
ATOM   2943  C  C     . VAL D  4 108 ? -15.656 -44.493 26.877  1.00 60.97  ? 108  VAL D C     1 
ATOM   2944  O  O     . VAL D  4 108 ? -15.218 -44.543 25.720  1.00 61.11  ? 108  VAL D O     1 
ATOM   2945  C  CB    . VAL D  4 108 ? -14.268 -43.215 28.562  1.00 59.66  ? 108  VAL D CB    1 
ATOM   2946  C  CG1   . VAL D  4 108 ? -13.045 -43.558 27.729  1.00 58.36  ? 108  VAL D CG1   1 
ATOM   2947  C  CG2   . VAL D  4 108 ? -14.077 -41.869 29.250  1.00 59.44  ? 108  VAL D CG2   1 
ATOM   2948  N  N     . SER D  4 109 ? -16.254 -45.538 27.465  1.00 61.62  ? 109  SER D N     1 
ATOM   2949  C  CA    . SER D  4 109 ? -16.608 -46.728 26.685  1.00 62.71  ? 109  SER D CA    1 
ATOM   2950  C  C     . SER D  4 109 ? -17.567 -46.374 25.574  1.00 63.10  ? 109  SER D C     1 
ATOM   2951  O  O     . SER D  4 109 ? -17.227 -46.540 24.394  1.00 63.46  ? 109  SER D O     1 
ATOM   2952  C  CB    . SER D  4 109 ? -17.254 -47.813 27.532  1.00 62.64  ? 109  SER D CB    1 
ATOM   2953  O  OG    . SER D  4 109 ? -16.367 -48.216 28.547  1.00 64.37  ? 109  SER D OG    1 
ATOM   2954  N  N     . GLU D  4 110 ? -18.754 -45.884 25.942  1.00 63.20  ? 110  GLU D N     1 
ATOM   2955  C  CA    . GLU D  4 110 ? -19.787 -45.624 24.947  1.00 63.87  ? 110  GLU D CA    1 
ATOM   2956  C  C     . GLU D  4 110 ? -19.284 -44.780 23.795  1.00 63.86  ? 110  GLU D C     1 
ATOM   2957  O  O     . GLU D  4 110 ? -19.579 -45.078 22.642  1.00 64.59  ? 110  GLU D O     1 
ATOM   2958  C  CB    . GLU D  4 110 ? -21.031 -45.041 25.570  1.00 64.01  ? 110  GLU D CB    1 
ATOM   2959  C  CG    . GLU D  4 110 ? -21.700 -45.998 26.539  1.00 67.06  ? 110  GLU D CG    1 
ATOM   2960  C  CD    . GLU D  4 110 ? -22.061 -47.319 25.881  1.00 71.47  ? 110  GLU D CD    1 
ATOM   2961  O  OE1   . GLU D  4 110 ? -23.027 -47.337 25.082  1.00 73.81  ? 110  GLU D OE1   1 
ATOM   2962  O  OE2   . GLU D  4 110 ? -21.370 -48.336 26.145  1.00 73.43  ? 110  GLU D OE2   1 
ATOM   2963  N  N     . GLY D  4 111 ? -18.477 -43.773 24.103  1.00 63.68  ? 111  GLY D N     1 
ATOM   2964  C  CA    . GLY D  4 111 ? -17.911 -42.908 23.083  1.00 63.58  ? 111  GLY D CA    1 
ATOM   2965  C  C     . GLY D  4 111 ? -16.832 -43.545 22.217  1.00 63.80  ? 111  GLY D C     1 
ATOM   2966  O  O     . GLY D  4 111 ? -16.835 -43.350 20.994  1.00 63.54  ? 111  GLY D O     1 
ATOM   2967  N  N     . THR D  4 112 ? -15.902 -44.287 22.834  1.00 63.75  ? 112  THR D N     1 
ATOM   2968  C  CA    . THR D  4 112 ? -14.820 -44.940 22.076  1.00 64.04  ? 112  THR D CA    1 
ATOM   2969  C  C     . THR D  4 112 ? -15.384 -45.959 21.099  1.00 64.16  ? 112  THR D C     1 
ATOM   2970  O  O     . THR D  4 112 ? -14.891 -46.103 19.982  1.00 63.94  ? 112  THR D O     1 
ATOM   2971  C  CB    . THR D  4 112 ? -13.809 -45.656 22.987  1.00 64.20  ? 112  THR D CB    1 
ATOM   2972  O  OG1   . THR D  4 112 ? -13.364 -44.754 24.004  1.00 64.66  ? 112  THR D OG1   1 
ATOM   2973  C  CG2   . THR D  4 112 ? -12.596 -46.156 22.190  1.00 62.71  ? 112  THR D CG2   1 
ATOM   2974  N  N     . LYS D  4 113 ? -16.439 -46.637 21.531  1.00 64.74  ? 113  LYS D N     1 
ATOM   2975  C  CA    . LYS D  4 113 ? -17.069 -47.684 20.744  1.00 65.59  ? 113  LYS D CA    1 
ATOM   2976  C  C     . LYS D  4 113 ? -17.782 -47.169 19.499  1.00 65.92  ? 113  LYS D C     1 
ATOM   2977  O  O     . LYS D  4 113 ? -17.611 -47.731 18.402  1.00 66.12  ? 113  LYS D O     1 
ATOM   2978  C  CB    . LYS D  4 113 ? -17.981 -48.528 21.621  1.00 65.34  ? 113  LYS D CB    1 
ATOM   2979  C  CG    . LYS D  4 113 ? -17.185 -49.564 22.404  1.00 66.41  ? 113  LYS D CG    1 
ATOM   2980  C  CD    . LYS D  4 113 ? -17.907 -50.082 23.645  1.00 69.64  ? 113  LYS D CD    1 
ATOM   2981  C  CE    . LYS D  4 113 ? -19.201 -50.817 23.313  1.00 71.39  ? 113  LYS D CE    1 
ATOM   2982  N  NZ    . LYS D  4 113 ? -20.347 -49.933 22.856  1.00 72.38  ? 113  LYS D NZ    1 
ATOM   2983  N  N     . ALA D  4 114 ? -18.535 -46.083 19.663  1.00 66.34  ? 114  ALA D N     1 
ATOM   2984  C  CA    . ALA D  4 114 ? -19.221 -45.421 18.553  1.00 66.33  ? 114  ALA D CA    1 
ATOM   2985  C  C     . ALA D  4 114 ? -18.238 -44.959 17.484  1.00 66.59  ? 114  ALA D C     1 
ATOM   2986  O  O     . ALA D  4 114 ? -18.500 -45.072 16.300  1.00 66.23  ? 114  ALA D O     1 
ATOM   2987  C  CB    . ALA D  4 114 ? -20.031 -44.261 19.072  1.00 66.35  ? 114  ALA D CB    1 
ATOM   2988  N  N     . VAL D  4 115 ? -17.094 -44.451 17.903  1.00 67.63  ? 115  VAL D N     1 
ATOM   2989  C  CA    . VAL D  4 115 ? -16.075 -44.026 16.952  1.00 69.21  ? 115  VAL D CA    1 
ATOM   2990  C  C     . VAL D  4 115 ? -15.474 -45.217 16.220  1.00 70.07  ? 115  VAL D C     1 
ATOM   2991  O  O     . VAL D  4 115 ? -15.280 -45.173 15.006  1.00 70.21  ? 115  VAL D O     1 
ATOM   2992  C  CB    . VAL D  4 115 ? -14.971 -43.184 17.631  1.00 69.22  ? 115  VAL D CB    1 
ATOM   2993  C  CG1   . VAL D  4 115 ? -13.811 -42.937 16.676  1.00 69.11  ? 115  VAL D CG1   1 
ATOM   2994  C  CG2   . VAL D  4 115 ? -15.551 -41.851 18.082  1.00 69.76  ? 115  VAL D CG2   1 
ATOM   2995  N  N     . THR D  4 116 ? -15.184 -46.278 16.965  1.00 71.37  ? 116  THR D N     1 
ATOM   2996  C  CA    . THR D  4 116 ? -14.731 -47.521 16.378  1.00 72.56  ? 116  THR D CA    1 
ATOM   2997  C  C     . THR D  4 116 ? -15.751 -47.983 15.333  1.00 73.59  ? 116  THR D C     1 
ATOM   2998  O  O     . THR D  4 116 ? -15.394 -48.200 14.163  1.00 73.45  ? 116  THR D O     1 
ATOM   2999  C  CB    . THR D  4 116 ? -14.534 -48.587 17.461  1.00 72.72  ? 116  THR D CB    1 
ATOM   3000  O  OG1   . THR D  4 116 ? -13.505 -48.153 18.362  1.00 72.82  ? 116  THR D OG1   1 
ATOM   3001  C  CG2   . THR D  4 116 ? -14.137 -49.935 16.841  1.00 72.74  ? 116  THR D CG2   1 
ATOM   3002  N  N     . LYS D  4 117 ? -17.016 -48.087 15.750  1.00 74.38  ? 117  LYS D N     1 
ATOM   3003  C  CA    . LYS D  4 117 ? -18.092 -48.496 14.859  1.00 75.62  ? 117  LYS D CA    1 
ATOM   3004  C  C     . LYS D  4 117 ? -18.319 -47.525 13.694  1.00 76.58  ? 117  LYS D C     1 
ATOM   3005  O  O     . LYS D  4 117 ? -18.516 -47.942 12.555  1.00 76.72  ? 117  LYS D O     1 
ATOM   3006  C  CB    . LYS D  4 117 ? -19.382 -48.761 15.640  1.00 75.52  ? 117  LYS D CB    1 
ATOM   3007  C  CG    . LYS D  4 117 ? -20.581 -49.013 14.749  1.00 77.34  ? 117  LYS D CG    1 
ATOM   3008  C  CD    . LYS D  4 117 ? -21.713 -49.768 15.427  1.00 79.99  ? 117  LYS D CD    1 
ATOM   3009  C  CE    . LYS D  4 117 ? -22.703 -50.266 14.347  1.00 82.38  ? 117  LYS D CE    1 
ATOM   3010  N  NZ    . LYS D  4 117 ? -24.030 -50.740 14.879  1.00 82.83  ? 117  LYS D NZ    1 
ATOM   3011  N  N     . TYR D  4 118 ? -18.270 -46.230 13.963  1.00 78.10  ? 118  TYR D N     1 
ATOM   3012  C  CA    . TYR D  4 118 ? -18.479 -45.266 12.903  1.00 79.46  ? 118  TYR D CA    1 
ATOM   3013  C  C     . TYR D  4 118 ? -17.409 -45.397 11.826  1.00 80.86  ? 118  TYR D C     1 
ATOM   3014  O  O     . TYR D  4 118 ? -17.720 -45.309 10.643  1.00 81.08  ? 118  TYR D O     1 
ATOM   3015  C  CB    . TYR D  4 118 ? -18.551 -43.841 13.453  1.00 79.07  ? 118  TYR D CB    1 
ATOM   3016  C  CG    . TYR D  4 118 ? -18.556 -42.760 12.393  1.00 78.71  ? 118  TYR D CG    1 
ATOM   3017  C  CD1   . TYR D  4 118 ? -19.759 -42.308 11.831  1.00 77.56  ? 118  TYR D CD1   1 
ATOM   3018  C  CD2   . TYR D  4 118 ? -17.353 -42.176 11.956  1.00 77.78  ? 118  TYR D CD2   1 
ATOM   3019  C  CE1   . TYR D  4 118 ? -19.763 -41.309 10.857  1.00 77.06  ? 118  TYR D CE1   1 
ATOM   3020  C  CE2   . TYR D  4 118 ? -17.345 -41.183 10.981  1.00 77.58  ? 118  TYR D CE2   1 
ATOM   3021  C  CZ    . TYR D  4 118 ? -18.553 -40.753 10.440  1.00 78.37  ? 118  TYR D CZ    1 
ATOM   3022  O  OH    . TYR D  4 118 ? -18.547 -39.765 9.479   1.00 79.49  ? 118  TYR D OH    1 
ATOM   3023  N  N     . THR D  4 119 ? -16.159 -45.611 12.227  1.00 82.69  ? 119  THR D N     1 
ATOM   3024  C  CA    . THR D  4 119 ? -15.072 -45.671 11.251  1.00 84.90  ? 119  THR D CA    1 
ATOM   3025  C  C     . THR D  4 119 ? -15.032 -47.022 10.526  1.00 86.60  ? 119  THR D C     1 
ATOM   3026  O  O     . THR D  4 119 ? -14.438 -47.133 9.441   1.00 87.15  ? 119  THR D O     1 
ATOM   3027  C  CB    . THR D  4 119 ? -13.695 -45.312 11.854  1.00 84.46  ? 119  THR D CB    1 
ATOM   3028  O  OG1   . THR D  4 119 ? -13.530 -45.986 13.102  1.00 85.91  ? 119  THR D OG1   1 
ATOM   3029  C  CG2   . THR D  4 119 ? -13.599 -43.832 12.103  1.00 84.77  ? 119  THR D CG2   1 
ATOM   3030  N  N     . SER D  4 120 ? -15.665 -48.038 11.121  1.00 88.28  ? 120  SER D N     1 
ATOM   3031  C  CA    . SER D  4 120 ? -15.935 -49.293 10.424  1.00 89.81  ? 120  SER D CA    1 
ATOM   3032  C  C     . SER D  4 120 ? -16.787 -49.016 9.205   1.00 91.11  ? 120  SER D C     1 
ATOM   3033  O  O     . SER D  4 120 ? -16.378 -49.301 8.076   1.00 91.39  ? 120  SER D O     1 
ATOM   3034  C  CB    . SER D  4 120 ? -16.687 -50.272 11.320  1.00 89.66  ? 120  SER D CB    1 
ATOM   3035  O  OG    . SER D  4 120 ? -15.793 -51.052 12.073  1.00 89.98  ? 120  SER D OG    1 
ATOM   3036  N  N     . ALA D  4 121 ? -17.967 -48.445 9.450   1.00 92.68  ? 121  ALA D N     1 
ATOM   3037  C  CA    . ALA D  4 121 ? -18.985 -48.258 8.422   1.00 94.39  ? 121  ALA D CA    1 
ATOM   3038  C  C     . ALA D  4 121 ? -18.538 -47.279 7.334   1.00 95.66  ? 121  ALA D C     1 
ATOM   3039  O  O     . ALA D  4 121 ? -18.148 -46.143 7.622   1.00 96.28  ? 121  ALA D O     1 
ATOM   3040  C  CB    . ALA D  4 121 ? -20.302 -47.820 9.051   1.00 94.14  ? 121  ALA D CB    1 
ATOM   3041  N  N     . LYS D  4 122 ? -18.576 -47.747 6.085   1.00 97.02  ? 122  LYS D N     1 
ATOM   3042  C  CA    . LYS D  4 122 ? -18.204 -46.939 4.917   1.00 98.24  ? 122  LYS D CA    1 
ATOM   3043  C  C     . LYS D  4 122 ? -19.098 -47.298 3.714   1.00 98.62  ? 122  LYS D C     1 
ATOM   3044  O  O     . LYS D  4 122 ? -19.431 -46.430 2.894   1.00 98.99  ? 122  LYS D O     1 
ATOM   3045  C  CB    . LYS D  4 122 ? -16.725 -47.156 4.558   1.00 98.21  ? 122  LYS D CB    1 
ATOM   3046  C  CG    . LYS D  4 122 ? -16.190 -46.204 3.488   1.00 98.99  ? 122  LYS D CG    1 
ATOM   3047  C  CD    . LYS D  4 122 ? -14.978 -46.786 2.765   1.00 99.10  ? 122  LYS D CD    1 
ATOM   3048  C  CE    . LYS D  4 122 ? -14.394 -45.774 1.784   1.00 100.22 ? 122  LYS D CE    1 
ATOM   3049  N  NZ    . LYS D  4 122 ? -13.077 -46.222 1.238   1.00 100.38 ? 122  LYS D NZ    1 
ATOM   3050  O  OXT   . LYS D  4 122 ? -19.510 -48.458 3.526   1.00 98.84  ? 122  LYS D OXT   1 
ATOM   3051  N  N     . HIS E  1 39  ? -58.813 -32.512 72.238  1.00 100.51 ? 39   HIS E N     1 
ATOM   3052  C  CA    . HIS E  1 39  ? -57.570 -33.206 71.794  1.00 100.32 ? 39   HIS E CA    1 
ATOM   3053  C  C     . HIS E  1 39  ? -56.526 -32.217 71.319  1.00 99.95  ? 39   HIS E C     1 
ATOM   3054  O  O     . HIS E  1 39  ? -56.799 -31.339 70.485  1.00 99.88  ? 39   HIS E O     1 
ATOM   3055  C  CB    . HIS E  1 39  ? -57.851 -34.232 70.694  1.00 100.56 ? 39   HIS E CB    1 
ATOM   3056  C  CG    . HIS E  1 39  ? -56.658 -35.066 70.330  1.00 101.18 ? 39   HIS E CG    1 
ATOM   3057  N  ND1   . HIS E  1 39  ? -55.937 -34.868 69.170  1.00 101.84 ? 39   HIS E ND1   1 
ATOM   3058  C  CD2   . HIS E  1 39  ? -56.059 -36.096 70.976  1.00 101.55 ? 39   HIS E CD2   1 
ATOM   3059  C  CE1   . HIS E  1 39  ? -54.952 -35.748 69.112  1.00 102.12 ? 39   HIS E CE1   1 
ATOM   3060  N  NE2   . HIS E  1 39  ? -55.002 -36.503 70.196  1.00 101.54 ? 39   HIS E NE2   1 
ATOM   3061  N  N     . ARG E  1 40  ? -55.324 -32.398 71.859  1.00 99.46  ? 40   ARG E N     1 
ATOM   3062  C  CA    . ARG E  1 40  ? -54.209 -31.495 71.646  1.00 98.68  ? 40   ARG E CA    1 
ATOM   3063  C  C     . ARG E  1 40  ? -52.985 -32.288 71.251  1.00 97.88  ? 40   ARG E C     1 
ATOM   3064  O  O     . ARG E  1 40  ? -52.501 -33.123 72.023  1.00 98.17  ? 40   ARG E O     1 
ATOM   3065  C  CB    . ARG E  1 40  ? -53.887 -30.751 72.937  1.00 98.84  ? 40   ARG E CB    1 
ATOM   3066  C  CG    . ARG E  1 40  ? -53.420 -29.340 72.721  1.00 100.01 ? 40   ARG E CG    1 
ATOM   3067  C  CD    . ARG E  1 40  ? -54.578 -28.383 72.925  1.00 101.72 ? 40   ARG E CD    1 
ATOM   3068  N  NE    . ARG E  1 40  ? -54.539 -27.254 71.998  1.00 103.36 ? 40   ARG E NE    1 
ATOM   3069  C  CZ    . ARG E  1 40  ? -53.771 -26.175 72.135  1.00 103.63 ? 40   ARG E CZ    1 
ATOM   3070  N  NH1   . ARG E  1 40  ? -52.939 -26.056 73.165  1.00 103.47 ? 40   ARG E NH1   1 
ATOM   3071  N  NH2   . ARG E  1 40  ? -53.837 -25.211 71.226  1.00 104.37 ? 40   ARG E NH2   1 
ATOM   3072  N  N     . TYR E  1 41  ? -52.475 -32.036 70.053  1.00 96.61  ? 41   TYR E N     1 
ATOM   3073  C  CA    . TYR E  1 41  ? -51.158 -32.530 69.720  1.00 95.16  ? 41   TYR E CA    1 
ATOM   3074  C  C     . TYR E  1 41  ? -50.134 -31.667 70.439  1.00 94.50  ? 41   TYR E C     1 
ATOM   3075  O  O     . TYR E  1 41  ? -50.322 -30.461 70.597  1.00 94.20  ? 41   TYR E O     1 
ATOM   3076  C  CB    . TYR E  1 41  ? -50.932 -32.516 68.220  1.00 94.79  ? 41   TYR E CB    1 
ATOM   3077  C  CG    . TYR E  1 41  ? -51.696 -33.589 67.484  1.00 94.31  ? 41   TYR E CG    1 
ATOM   3078  C  CD1   . TYR E  1 41  ? -52.801 -33.264 66.691  1.00 93.17  ? 41   TYR E CD1   1 
ATOM   3079  C  CD2   . TYR E  1 41  ? -51.312 -34.932 67.574  1.00 94.07  ? 41   TYR E CD2   1 
ATOM   3080  C  CE1   . TYR E  1 41  ? -53.505 -34.242 66.005  1.00 93.29  ? 41   TYR E CE1   1 
ATOM   3081  C  CE2   . TYR E  1 41  ? -52.008 -35.922 66.887  1.00 94.40  ? 41   TYR E CE2   1 
ATOM   3082  C  CZ    . TYR E  1 41  ? -53.107 -35.569 66.105  1.00 94.17  ? 41   TYR E CZ    1 
ATOM   3083  O  OH    . TYR E  1 41  ? -53.803 -36.545 65.426  1.00 94.06  ? 41   TYR E OH    1 
ATOM   3084  N  N     . ARG E  1 42  ? -49.071 -32.307 70.904  1.00 93.74  ? 42   ARG E N     1 
ATOM   3085  C  CA    . ARG E  1 42  ? -47.973 -31.619 71.569  1.00 93.12  ? 42   ARG E CA    1 
ATOM   3086  C  C     . ARG E  1 42  ? -47.207 -30.714 70.584  1.00 92.08  ? 42   ARG E C     1 
ATOM   3087  O  O     . ARG E  1 42  ? -47.183 -30.995 69.377  1.00 92.07  ? 42   ARG E O     1 
ATOM   3088  C  CB    . ARG E  1 42  ? -47.011 -32.649 72.165  1.00 93.58  ? 42   ARG E CB    1 
ATOM   3089  C  CG    . ARG E  1 42  ? -47.680 -33.842 72.829  1.00 94.53  ? 42   ARG E CG    1 
ATOM   3090  C  CD    . ARG E  1 42  ? -47.659 -33.709 74.331  1.00 96.88  ? 42   ARG E CD    1 
ATOM   3091  N  NE    . ARG E  1 42  ? -47.316 -34.984 74.965  1.00 99.81  ? 42   ARG E NE    1 
ATOM   3092  C  CZ    . ARG E  1 42  ? -46.082 -35.496 75.007  1.00 100.97 ? 42   ARG E CZ    1 
ATOM   3093  N  NH1   . ARG E  1 42  ? -45.053 -34.848 74.447  1.00 101.16 ? 42   ARG E NH1   1 
ATOM   3094  N  NH2   . ARG E  1 42  ? -45.876 -36.666 75.606  1.00 101.48 ? 42   ARG E NH2   1 
ATOM   3095  N  N     . PRO E  1 43  ? -46.589 -29.625 71.089  1.00 90.89  ? 43   PRO E N     1 
ATOM   3096  C  CA    . PRO E  1 43  ? -45.704 -28.803 70.264  1.00 89.98  ? 43   PRO E CA    1 
ATOM   3097  C  C     . PRO E  1 43  ? -44.662 -29.629 69.506  1.00 89.02  ? 43   PRO E C     1 
ATOM   3098  O  O     . PRO E  1 43  ? -43.918 -30.403 70.120  1.00 89.07  ? 43   PRO E O     1 
ATOM   3099  C  CB    . PRO E  1 43  ? -45.021 -27.906 71.296  1.00 89.92  ? 43   PRO E CB    1 
ATOM   3100  C  CG    . PRO E  1 43  ? -46.045 -27.733 72.349  1.00 90.23  ? 43   PRO E CG    1 
ATOM   3101  C  CD    . PRO E  1 43  ? -46.704 -29.081 72.456  1.00 90.88  ? 43   PRO E CD    1 
ATOM   3102  N  N     . GLY E  1 44  ? -44.639 -29.480 68.181  1.00 87.91  ? 44   GLY E N     1 
ATOM   3103  C  CA    . GLY E  1 44  ? -43.630 -30.130 67.346  1.00 86.87  ? 44   GLY E CA    1 
ATOM   3104  C  C     . GLY E  1 44  ? -44.148 -31.274 66.498  1.00 86.22  ? 44   GLY E C     1 
ATOM   3105  O  O     . GLY E  1 44  ? -43.539 -31.644 65.481  1.00 86.54  ? 44   GLY E O     1 
ATOM   3106  N  N     . THR E  1 45  ? -45.279 -31.830 66.919  1.00 85.19  ? 45   THR E N     1 
ATOM   3107  C  CA    . THR E  1 45  ? -45.886 -32.992 66.282  1.00 83.92  ? 45   THR E CA    1 
ATOM   3108  C  C     . THR E  1 45  ? -46.524 -32.653 64.942  1.00 83.12  ? 45   THR E C     1 
ATOM   3109  O  O     . THR E  1 45  ? -46.376 -33.396 63.966  1.00 82.83  ? 45   THR E O     1 
ATOM   3110  C  CB    . THR E  1 45  ? -46.901 -33.625 67.235  1.00 83.89  ? 45   THR E CB    1 
ATOM   3111  O  OG1   . THR E  1 45  ? -46.214 -33.999 68.434  1.00 83.86  ? 45   THR E OG1   1 
ATOM   3112  C  CG2   . THR E  1 45  ? -47.550 -34.855 66.626  1.00 83.87  ? 45   THR E CG2   1 
ATOM   3113  N  N     . VAL E  1 46  ? -47.232 -31.532 64.894  1.00 82.46  ? 46   VAL E N     1 
ATOM   3114  C  CA    . VAL E  1 46  ? -47.820 -31.066 63.641  1.00 82.11  ? 46   VAL E CA    1 
ATOM   3115  C  C     . VAL E  1 46  ? -46.705 -30.554 62.718  1.00 81.89  ? 46   VAL E C     1 
ATOM   3116  O  O     . VAL E  1 46  ? -46.709 -30.818 61.504  1.00 82.19  ? 46   VAL E O     1 
ATOM   3117  C  CB    . VAL E  1 46  ? -48.889 -29.968 63.871  1.00 82.04  ? 46   VAL E CB    1 
ATOM   3118  C  CG1   . VAL E  1 46  ? -49.589 -29.611 62.555  1.00 82.06  ? 46   VAL E CG1   1 
ATOM   3119  C  CG2   . VAL E  1 46  ? -49.903 -30.431 64.898  1.00 81.49  ? 46   VAL E CG2   1 
ATOM   3120  N  N     . ALA E  1 47  ? -45.755 -29.827 63.307  1.00 80.96  ? 47   ALA E N     1 
ATOM   3121  C  CA    . ALA E  1 47  ? -44.592 -29.356 62.583  1.00 80.07  ? 47   ALA E CA    1 
ATOM   3122  C  C     . ALA E  1 47  ? -43.927 -30.529 61.845  1.00 79.32  ? 47   ALA E C     1 
ATOM   3123  O  O     . ALA E  1 47  ? -43.734 -30.464 60.626  1.00 79.40  ? 47   ALA E O     1 
ATOM   3124  C  CB    . ALA E  1 47  ? -43.618 -28.652 63.535  1.00 80.16  ? 47   ALA E CB    1 
ATOM   3125  N  N     . LEU E  1 48  ? -43.618 -31.606 62.569  1.00 78.25  ? 48   LEU E N     1 
ATOM   3126  C  CA    . LEU E  1 48  ? -43.087 -32.829 61.952  1.00 77.68  ? 48   LEU E CA    1 
ATOM   3127  C  C     . LEU E  1 48  ? -43.932 -33.335 60.786  1.00 77.29  ? 48   LEU E C     1 
ATOM   3128  O  O     . LEU E  1 48  ? -43.393 -33.723 59.746  1.00 77.29  ? 48   LEU E O     1 
ATOM   3129  C  CB    . LEU E  1 48  ? -42.947 -33.937 62.989  1.00 77.50  ? 48   LEU E CB    1 
ATOM   3130  C  CG    . LEU E  1 48  ? -41.644 -33.947 63.781  1.00 77.74  ? 48   LEU E CG    1 
ATOM   3131  C  CD1   . LEU E  1 48  ? -41.888 -34.392 65.214  1.00 77.91  ? 48   LEU E CD1   1 
ATOM   3132  C  CD2   . LEU E  1 48  ? -40.597 -34.826 63.100  1.00 77.83  ? 48   LEU E CD2   1 
ATOM   3133  N  N     . ARG E  1 49  ? -45.251 -33.322 60.968  1.00 76.92  ? 49   ARG E N     1 
ATOM   3134  C  CA    . ARG E  1 49  ? -46.196 -33.776 59.951  1.00 76.86  ? 49   ARG E CA    1 
ATOM   3135  C  C     . ARG E  1 49  ? -46.086 -32.912 58.706  1.00 76.44  ? 49   ARG E C     1 
ATOM   3136  O  O     . ARG E  1 49  ? -46.020 -33.433 57.582  1.00 76.62  ? 49   ARG E O     1 
ATOM   3137  C  CB    . ARG E  1 49  ? -47.624 -33.725 60.504  1.00 77.36  ? 49   ARG E CB    1 
ATOM   3138  C  CG    . ARG E  1 49  ? -48.643 -34.557 59.737  1.00 78.06  ? 49   ARG E CG    1 
ATOM   3139  C  CD    . ARG E  1 49  ? -50.042 -33.898 59.720  1.00 79.45  ? 49   ARG E CD    1 
ATOM   3140  N  NE    . ARG E  1 49  ? -50.536 -33.377 61.006  1.00 79.86  ? 49   ARG E NE    1 
ATOM   3141  C  CZ    . ARG E  1 49  ? -50.707 -34.094 62.118  1.00 80.86  ? 49   ARG E CZ    1 
ATOM   3142  N  NH1   . ARG E  1 49  ? -50.395 -35.389 62.144  1.00 81.78  ? 49   ARG E NH1   1 
ATOM   3143  N  NH2   . ARG E  1 49  ? -51.171 -33.508 63.222  1.00 80.10  ? 49   ARG E NH2   1 
ATOM   3144  N  N     . GLU E  1 50  ? -46.060 -31.594 58.922  1.00 75.92  ? 50   GLU E N     1 
ATOM   3145  C  CA    . GLU E  1 50  ? -45.830 -30.598 57.862  1.00 75.52  ? 50   GLU E CA    1 
ATOM   3146  C  C     . GLU E  1 50  ? -44.551 -30.855 57.052  1.00 74.34  ? 50   GLU E C     1 
ATOM   3147  O  O     . GLU E  1 50  ? -44.561 -30.817 55.816  1.00 74.04  ? 50   GLU E O     1 
ATOM   3148  C  CB    . GLU E  1 50  ? -45.797 -29.191 58.456  1.00 75.41  ? 50   GLU E CB    1 
ATOM   3149  C  CG    . GLU E  1 50  ? -47.173 -28.609 58.731  1.00 76.56  ? 50   GLU E CG    1 
ATOM   3150  C  CD    . GLU E  1 50  ? -47.107 -27.254 59.406  1.00 77.24  ? 50   GLU E CD    1 
ATOM   3151  O  OE1   . GLU E  1 50  ? -47.952 -26.967 60.289  1.00 79.06  ? 50   GLU E OE1   1 
ATOM   3152  O  OE2   . GLU E  1 50  ? -46.200 -26.471 59.053  1.00 80.62  ? 50   GLU E OE2   1 
ATOM   3153  N  N     . ILE E  1 51  ? -43.461 -31.129 57.756  1.00 73.18  ? 51   ILE E N     1 
ATOM   3154  C  CA    . ILE E  1 51  ? -42.211 -31.428 57.101  1.00 72.50  ? 51   ILE E CA    1 
ATOM   3155  C  C     . ILE E  1 51  ? -42.415 -32.542 56.084  1.00 72.71  ? 51   ILE E C     1 
ATOM   3156  O  O     . ILE E  1 51  ? -42.019 -32.393 54.920  1.00 72.36  ? 51   ILE E O     1 
ATOM   3157  C  CB    . ILE E  1 51  ? -41.099 -31.751 58.122  1.00 72.10  ? 51   ILE E CB    1 
ATOM   3158  C  CG1   . ILE E  1 51  ? -40.755 -30.485 58.915  1.00 71.39  ? 51   ILE E CG1   1 
ATOM   3159  C  CG2   . ILE E  1 51  ? -39.858 -32.268 57.419  1.00 71.59  ? 51   ILE E CG2   1 
ATOM   3160  C  CD1   . ILE E  1 51  ? -39.952 -30.713 60.171  1.00 70.04  ? 51   ILE E CD1   1 
ATOM   3161  N  N     . ARG E  1 52  ? -43.071 -33.629 56.515  1.00 73.12  ? 52   ARG E N     1 
ATOM   3162  C  CA    . ARG E  1 52  ? -43.301 -34.824 55.670  1.00 73.14  ? 52   ARG E CA    1 
ATOM   3163  C  C     . ARG E  1 52  ? -44.104 -34.462 54.452  1.00 72.62  ? 52   ARG E C     1 
ATOM   3164  O  O     . ARG E  1 52  ? -43.803 -34.911 53.340  1.00 72.23  ? 52   ARG E O     1 
ATOM   3165  C  CB    . ARG E  1 52  ? -44.051 -35.923 56.428  1.00 73.37  ? 52   ARG E CB    1 
ATOM   3166  C  CG    . ARG E  1 52  ? -43.354 -36.382 57.686  1.00 75.11  ? 52   ARG E CG    1 
ATOM   3167  C  CD    . ARG E  1 52  ? -43.939 -37.657 58.261  1.00 76.99  ? 52   ARG E CD    1 
ATOM   3168  N  NE    . ARG E  1 52  ? -43.417 -37.860 59.614  1.00 79.46  ? 52   ARG E NE    1 
ATOM   3169  C  CZ    . ARG E  1 52  ? -42.194 -38.326 59.904  1.00 80.88  ? 52   ARG E CZ    1 
ATOM   3170  N  NH1   . ARG E  1 52  ? -41.338 -38.657 58.933  1.00 79.85  ? 52   ARG E NH1   1 
ATOM   3171  N  NH2   . ARG E  1 52  ? -41.824 -38.459 61.181  1.00 81.63  ? 52   ARG E NH2   1 
ATOM   3172  N  N     . ARG E  1 53  ? -45.125 -33.645 54.686  1.00 72.33  ? 53   ARG E N     1 
ATOM   3173  C  CA    . ARG E  1 53  ? -46.004 -33.192 53.633  1.00 72.87  ? 53   ARG E CA    1 
ATOM   3174  C  C     . ARG E  1 53  ? -45.244 -32.363 52.595  1.00 72.90  ? 53   ARG E C     1 
ATOM   3175  O  O     . ARG E  1 53  ? -45.254 -32.687 51.405  1.00 73.29  ? 53   ARG E O     1 
ATOM   3176  C  CB    . ARG E  1 53  ? -47.174 -32.393 54.216  1.00 73.12  ? 53   ARG E CB    1 
ATOM   3177  C  CG    . ARG E  1 53  ? -48.149 -31.959 53.146  1.00 74.04  ? 53   ARG E CG    1 
ATOM   3178  C  CD    . ARG E  1 53  ? -49.128 -30.925 53.642  1.00 75.87  ? 53   ARG E CD    1 
ATOM   3179  N  NE    . ARG E  1 53  ? -49.819 -30.335 52.495  1.00 77.78  ? 53   ARG E NE    1 
ATOM   3180  C  CZ    . ARG E  1 53  ? -50.506 -29.195 52.523  1.00 78.33  ? 53   ARG E CZ    1 
ATOM   3181  N  NH1   . ARG E  1 53  ? -50.603 -28.491 53.649  1.00 77.66  ? 53   ARG E NH1   1 
ATOM   3182  N  NH2   . ARG E  1 53  ? -51.099 -28.760 51.414  1.00 77.32  ? 53   ARG E NH2   1 
ATOM   3183  N  N     . TYR E  1 54  ? -44.573 -31.302 53.040  1.00 72.83  ? 54   TYR E N     1 
ATOM   3184  C  CA    . TYR E  1 54  ? -43.875 -30.418 52.099  1.00 72.51  ? 54   TYR E CA    1 
ATOM   3185  C  C     . TYR E  1 54  ? -42.658 -31.050 51.427  1.00 72.12  ? 54   TYR E C     1 
ATOM   3186  O  O     . TYR E  1 54  ? -42.363 -30.743 50.270  1.00 72.07  ? 54   TYR E O     1 
ATOM   3187  C  CB    . TYR E  1 54  ? -43.594 -29.047 52.720  1.00 72.35  ? 54   TYR E CB    1 
ATOM   3188  C  CG    . TYR E  1 54  ? -44.884 -28.319 53.007  1.00 72.12  ? 54   TYR E CG    1 
ATOM   3189  C  CD1   . TYR E  1 54  ? -45.255 -27.987 54.314  1.00 72.25  ? 54   TYR E CD1   1 
ATOM   3190  C  CD2   . TYR E  1 54  ? -45.765 -28.008 51.968  1.00 71.29  ? 54   TYR E CD2   1 
ATOM   3191  C  CE1   . TYR E  1 54  ? -46.468 -27.332 54.576  1.00 72.16  ? 54   TYR E CE1   1 
ATOM   3192  C  CE2   . TYR E  1 54  ? -46.969 -27.362 52.211  1.00 71.21  ? 54   TYR E CE2   1 
ATOM   3193  C  CZ    . TYR E  1 54  ? -47.322 -27.030 53.513  1.00 72.69  ? 54   TYR E CZ    1 
ATOM   3194  O  OH    . TYR E  1 54  ? -48.525 -26.386 53.738  1.00 72.99  ? 54   TYR E OH    1 
ATOM   3195  N  N     . GLN E  1 55  ? -41.985 -31.965 52.116  1.00 72.07  ? 55   GLN E N     1 
ATOM   3196  C  CA    . GLN E  1 55  ? -40.880 -32.691 51.483  1.00 72.44  ? 55   GLN E CA    1 
ATOM   3197  C  C     . GLN E  1 55  ? -41.378 -33.706 50.442  1.00 73.36  ? 55   GLN E C     1 
ATOM   3198  O  O     . GLN E  1 55  ? -40.600 -34.201 49.633  1.00 73.85  ? 55   GLN E O     1 
ATOM   3199  C  CB    . GLN E  1 55  ? -39.955 -33.335 52.522  1.00 71.95  ? 55   GLN E CB    1 
ATOM   3200  C  CG    . GLN E  1 55  ? -39.275 -32.316 53.437  1.00 71.49  ? 55   GLN E CG    1 
ATOM   3201  C  CD    . GLN E  1 55  ? -38.176 -32.891 54.317  1.00 71.86  ? 55   GLN E CD    1 
ATOM   3202  O  OE1   . GLN E  1 55  ? -38.156 -34.078 54.634  1.00 72.41  ? 55   GLN E OE1   1 
ATOM   3203  N  NE2   . GLN E  1 55  ? -37.248 -32.033 54.718  1.00 72.02  ? 55   GLN E NE2   1 
ATOM   3204  N  N     . LYS E  1 56  ? -42.681 -33.987 50.445  1.00 74.50  ? 56   LYS E N     1 
ATOM   3205  C  CA    . LYS E  1 56  ? -43.266 -34.964 49.526  1.00 75.67  ? 56   LYS E CA    1 
ATOM   3206  C  C     . LYS E  1 56  ? -43.860 -34.346 48.271  1.00 75.71  ? 56   LYS E C     1 
ATOM   3207  O  O     . LYS E  1 56  ? -44.106 -35.053 47.299  1.00 75.82  ? 56   LYS E O     1 
ATOM   3208  C  CB    . LYS E  1 56  ? -44.333 -35.810 50.235  1.00 75.87  ? 56   LYS E CB    1 
ATOM   3209  C  CG    . LYS E  1 56  ? -43.778 -37.065 50.915  1.00 76.89  ? 56   LYS E CG    1 
ATOM   3210  C  CD    . LYS E  1 56  ? -44.881 -37.845 51.657  1.00 76.94  ? 56   LYS E CD    1 
ATOM   3211  C  CE    . LYS E  1 56  ? -44.364 -39.201 52.179  1.00 78.20  ? 56   LYS E CE    1 
ATOM   3212  N  NZ    . LYS E  1 56  ? -43.397 -39.069 53.326  1.00 79.85  ? 56   LYS E NZ    1 
ATOM   3213  N  N     . SER E  1 57  ? -44.112 -33.042 48.299  1.00 75.95  ? 57   SER E N     1 
ATOM   3214  C  CA    . SER E  1 57  ? -44.685 -32.350 47.148  1.00 76.44  ? 57   SER E CA    1 
ATOM   3215  C  C     . SER E  1 57  ? -43.662 -31.443 46.465  1.00 76.91  ? 57   SER E C     1 
ATOM   3216  O  O     . SER E  1 57  ? -42.562 -31.201 46.999  1.00 77.34  ? 57   SER E O     1 
ATOM   3217  C  CB    . SER E  1 57  ? -45.890 -31.521 47.582  1.00 76.50  ? 57   SER E CB    1 
ATOM   3218  O  OG    . SER E  1 57  ? -45.474 -30.393 48.327  1.00 76.32  ? 57   SER E OG    1 
ATOM   3219  N  N     . THR E  1 58  ? -44.022 -30.930 45.292  1.00 76.86  ? 58   THR E N     1 
ATOM   3220  C  CA    . THR E  1 58  ? -43.108 -30.083 44.546  1.00 76.87  ? 58   THR E CA    1 
ATOM   3221  C  C     . THR E  1 58  ? -43.722 -28.736 44.165  1.00 77.10  ? 58   THR E C     1 
ATOM   3222  O  O     . THR E  1 58  ? -43.123 -27.943 43.440  1.00 77.07  ? 58   THR E O     1 
ATOM   3223  C  CB    . THR E  1 58  ? -42.636 -30.792 43.301  1.00 76.80  ? 58   THR E CB    1 
ATOM   3224  O  OG1   . THR E  1 58  ? -43.716 -30.832 42.351  1.00 76.67  ? 58   THR E OG1   1 
ATOM   3225  C  CG2   . THR E  1 58  ? -42.174 -32.211 43.649  1.00 76.58  ? 58   THR E CG2   1 
ATOM   3226  N  N     . GLU E  1 59  ? -44.926 -28.497 44.667  1.00 77.46  ? 59   GLU E N     1 
ATOM   3227  C  CA    . GLU E  1 59  ? -45.677 -27.261 44.432  1.00 77.74  ? 59   GLU E CA    1 
ATOM   3228  C  C     . GLU E  1 59  ? -45.009 -26.049 45.064  1.00 77.36  ? 59   GLU E C     1 
ATOM   3229  O  O     . GLU E  1 59  ? -44.406 -26.161 46.135  1.00 77.46  ? 59   GLU E O     1 
ATOM   3230  C  CB    . GLU E  1 59  ? -47.061 -27.418 45.046  1.00 77.79  ? 59   GLU E CB    1 
ATOM   3231  C  CG    . GLU E  1 59  ? -47.015 -28.356 46.232  1.00 78.75  ? 59   GLU E CG    1 
ATOM   3232  C  CD    . GLU E  1 59  ? -47.690 -27.792 47.447  1.00 79.97  ? 59   GLU E CD    1 
ATOM   3233  O  OE1   . GLU E  1 59  ? -48.424 -26.782 47.297  1.00 81.04  ? 59   GLU E OE1   1 
ATOM   3234  O  OE2   . GLU E  1 59  ? -47.486 -28.366 48.545  1.00 78.60  ? 59   GLU E OE2   1 
ATOM   3235  N  N     . LEU E  1 60  ? -45.134 -24.896 44.408  1.00 77.12  ? 60   LEU E N     1 
ATOM   3236  C  CA    . LEU E  1 60  ? -44.594 -23.645 44.943  1.00 77.03  ? 60   LEU E CA    1 
ATOM   3237  C  C     . LEU E  1 60  ? -45.325 -23.267 46.223  1.00 76.81  ? 60   LEU E C     1 
ATOM   3238  O  O     . LEU E  1 60  ? -46.492 -23.614 46.387  1.00 76.73  ? 60   LEU E O     1 
ATOM   3239  C  CB    . LEU E  1 60  ? -44.635 -22.524 43.896  1.00 76.89  ? 60   LEU E CB    1 
ATOM   3240  C  CG    . LEU E  1 60  ? -43.695 -22.792 42.703  1.00 77.71  ? 60   LEU E CG    1 
ATOM   3241  C  CD1   . LEU E  1 60  ? -43.843 -21.755 41.587  1.00 77.07  ? 60   LEU E CD1   1 
ATOM   3242  C  CD2   . LEU E  1 60  ? -42.205 -22.948 43.134  1.00 78.19  ? 60   LEU E CD2   1 
ATOM   3243  N  N     . LEU E  1 61  ? -44.623 -22.593 47.134  1.00 76.58  ? 61   LEU E N     1 
ATOM   3244  C  CA    . LEU E  1 61  ? -45.145 -22.330 48.474  1.00 76.49  ? 61   LEU E CA    1 
ATOM   3245  C  C     . LEU E  1 61  ? -45.322 -20.843 48.791  1.00 76.75  ? 61   LEU E C     1 
ATOM   3246  O  O     . LEU E  1 61  ? -45.836 -20.493 49.852  1.00 76.70  ? 61   LEU E O     1 
ATOM   3247  C  CB    . LEU E  1 61  ? -44.261 -22.987 49.534  1.00 76.36  ? 61   LEU E CB    1 
ATOM   3248  C  CG    . LEU E  1 61  ? -43.841 -24.446 49.392  1.00 75.85  ? 61   LEU E CG    1 
ATOM   3249  C  CD1   . LEU E  1 61  ? -42.776 -24.777 50.432  1.00 75.28  ? 61   LEU E CD1   1 
ATOM   3250  C  CD2   . LEU E  1 61  ? -45.038 -25.336 49.561  1.00 75.53  ? 61   LEU E CD2   1 
ATOM   3251  N  N     . ILE E  1 62  ? -44.879 -19.980 47.880  1.00 77.04  ? 62   ILE E N     1 
ATOM   3252  C  CA    . ILE E  1 62  ? -45.167 -18.547 47.944  1.00 77.33  ? 62   ILE E CA    1 
ATOM   3253  C  C     . ILE E  1 62  ? -46.317 -18.290 46.972  1.00 77.63  ? 62   ILE E C     1 
ATOM   3254  O  O     . ILE E  1 62  ? -46.259 -18.745 45.828  1.00 77.84  ? 62   ILE E O     1 
ATOM   3255  C  CB    . ILE E  1 62  ? -43.926 -17.713 47.512  1.00 77.24  ? 62   ILE E CB    1 
ATOM   3256  C  CG1   . ILE E  1 62  ? -42.820 -17.803 48.552  1.00 77.08  ? 62   ILE E CG1   1 
ATOM   3257  C  CG2   . ILE E  1 62  ? -44.274 -16.246 47.306  1.00 77.49  ? 62   ILE E CG2   1 
ATOM   3258  C  CD1   . ILE E  1 62  ? -41.458 -17.479 47.988  1.00 77.49  ? 62   ILE E CD1   1 
ATOM   3259  N  N     . ARG E  1 63  ? -47.352 -17.573 47.405  1.00 77.85  ? 63   ARG E N     1 
ATOM   3260  C  CA    . ARG E  1 63  ? -48.472 -17.257 46.511  1.00 78.70  ? 63   ARG E CA    1 
ATOM   3261  C  C     . ARG E  1 63  ? -48.005 -16.407 45.326  1.00 78.08  ? 63   ARG E C     1 
ATOM   3262  O  O     . ARG E  1 63  ? -47.325 -15.399 45.514  1.00 78.08  ? 63   ARG E O     1 
ATOM   3263  C  CB    . ARG E  1 63  ? -49.606 -16.548 47.258  1.00 78.83  ? 63   ARG E CB    1 
ATOM   3264  C  CG    . ARG E  1 63  ? -50.210 -17.345 48.424  1.00 80.28  ? 63   ARG E CG    1 
ATOM   3265  C  CD    . ARG E  1 63  ? -51.149 -16.481 49.283  1.00 81.01  ? 63   ARG E CD    1 
ATOM   3266  N  NE    . ARG E  1 63  ? -50.698 -15.085 49.450  1.00 86.35  ? 63   ARG E NE    1 
ATOM   3267  C  CZ    . ARG E  1 63  ? -49.715 -14.668 50.262  1.00 89.10  ? 63   ARG E CZ    1 
ATOM   3268  N  NH1   . ARG E  1 63  ? -49.013 -15.527 51.009  1.00 89.71  ? 63   ARG E NH1   1 
ATOM   3269  N  NH2   . ARG E  1 63  ? -49.420 -13.368 50.322  1.00 90.39  ? 63   ARG E NH2   1 
ATOM   3270  N  N     . LYS E  1 64  ? -48.405 -16.816 44.121  1.00 77.59  ? 64   LYS E N     1 
ATOM   3271  C  CA    . LYS E  1 64  ? -47.869 -16.315 42.851  1.00 77.13  ? 64   LYS E CA    1 
ATOM   3272  C  C     . LYS E  1 64  ? -47.864 -14.798 42.663  1.00 76.76  ? 64   LYS E C     1 
ATOM   3273  O  O     . LYS E  1 64  ? -46.848 -14.226 42.267  1.00 76.71  ? 64   LYS E O     1 
ATOM   3274  C  CB    . LYS E  1 64  ? -48.592 -16.984 41.677  1.00 77.23  ? 64   LYS E CB    1 
ATOM   3275  C  CG    . LYS E  1 64  ? -48.555 -18.504 41.731  1.00 78.57  ? 64   LYS E CG    1 
ATOM   3276  C  CD    . LYS E  1 64  ? -48.912 -19.118 40.384  1.00 81.50  ? 64   LYS E CD    1 
ATOM   3277  C  CE    . LYS E  1 64  ? -48.730 -20.642 40.385  1.00 81.93  ? 64   LYS E CE    1 
ATOM   3278  N  NZ    . LYS E  1 64  ? -48.522 -21.136 38.978  1.00 82.82  ? 64   LYS E NZ    1 
ATOM   3279  N  N     . LEU E  1 65  ? -48.997 -14.157 42.937  1.00 76.48  ? 65   LEU E N     1 
ATOM   3280  C  CA    . LEU E  1 65  ? -49.134 -12.712 42.753  1.00 75.89  ? 65   LEU E CA    1 
ATOM   3281  C  C     . LEU E  1 65  ? -48.279 -11.843 43.693  1.00 75.35  ? 65   LEU E C     1 
ATOM   3282  O  O     . LEU E  1 65  ? -47.554 -10.968 43.211  1.00 75.59  ? 65   LEU E O     1 
ATOM   3283  C  CB    . LEU E  1 65  ? -50.603 -12.284 42.797  1.00 76.14  ? 65   LEU E CB    1 
ATOM   3284  C  CG    . LEU E  1 65  ? -50.858 -10.842 42.332  1.00 76.70  ? 65   LEU E CG    1 
ATOM   3285  C  CD1   . LEU E  1 65  ? -50.683 -10.713 40.802  1.00 76.53  ? 65   LEU E CD1   1 
ATOM   3286  C  CD2   . LEU E  1 65  ? -52.237 -10.366 42.788  1.00 76.07  ? 65   LEU E CD2   1 
ATOM   3287  N  N     . PRO E  1 66  ? -48.346 -12.067 45.025  1.00 74.75  ? 66   PRO E N     1 
ATOM   3288  C  CA    . PRO E  1 66  ? -47.457 -11.268 45.883  1.00 74.49  ? 66   PRO E CA    1 
ATOM   3289  C  C     . PRO E  1 66  ? -46.006 -11.348 45.385  1.00 74.32  ? 66   PRO E C     1 
ATOM   3290  O  O     . PRO E  1 66  ? -45.315 -10.326 45.301  1.00 74.50  ? 66   PRO E O     1 
ATOM   3291  C  CB    . PRO E  1 66  ? -47.569 -11.945 47.255  1.00 74.51  ? 66   PRO E CB    1 
ATOM   3292  C  CG    . PRO E  1 66  ? -48.814 -12.717 47.226  1.00 74.61  ? 66   PRO E CG    1 
ATOM   3293  C  CD    . PRO E  1 66  ? -49.158 -13.023 45.798  1.00 74.71  ? 66   PRO E CD    1 
ATOM   3294  N  N     . PHE E  1 67  ? -45.569 -12.557 45.030  1.00 73.86  ? 67   PHE E N     1 
ATOM   3295  C  CA    . PHE E  1 67  ? -44.245 -12.756 44.467  1.00 73.46  ? 67   PHE E CA    1 
ATOM   3296  C  C     . PHE E  1 67  ? -44.059 -11.974 43.174  1.00 73.68  ? 67   PHE E C     1 
ATOM   3297  O  O     . PHE E  1 67  ? -42.983 -11.414 42.933  1.00 73.79  ? 67   PHE E O     1 
ATOM   3298  C  CB    . PHE E  1 67  ? -43.925 -14.239 44.228  1.00 72.97  ? 67   PHE E CB    1 
ATOM   3299  C  CG    . PHE E  1 67  ? -42.528 -14.465 43.715  1.00 71.61  ? 67   PHE E CG    1 
ATOM   3300  C  CD1   . PHE E  1 67  ? -41.445 -14.472 44.595  1.00 69.94  ? 67   PHE E CD1   1 
ATOM   3301  C  CD2   . PHE E  1 67  ? -42.289 -14.623 42.356  1.00 70.69  ? 67   PHE E CD2   1 
ATOM   3302  C  CE1   . PHE E  1 67  ? -40.159 -14.652 44.134  1.00 69.33  ? 67   PHE E CE1   1 
ATOM   3303  C  CE2   . PHE E  1 67  ? -40.997 -14.793 41.882  1.00 70.81  ? 67   PHE E CE2   1 
ATOM   3304  C  CZ    . PHE E  1 67  ? -39.929 -14.810 42.781  1.00 70.48  ? 67   PHE E CZ    1 
ATOM   3305  N  N     . GLN E  1 68  ? -45.092 -11.931 42.341  1.00 73.66  ? 68   GLN E N     1 
ATOM   3306  C  CA    . GLN E  1 68  ? -44.976 -11.205 41.081  1.00 74.04  ? 68   GLN E CA    1 
ATOM   3307  C  C     . GLN E  1 68  ? -44.819 -9.705  41.308  1.00 73.80  ? 68   GLN E C     1 
ATOM   3308  O  O     . GLN E  1 68  ? -44.007 -9.051  40.656  1.00 73.70  ? 68   GLN E O     1 
ATOM   3309  C  CB    . GLN E  1 68  ? -46.159 -11.487 40.170  1.00 73.86  ? 68   GLN E CB    1 
ATOM   3310  C  CG    . GLN E  1 68  ? -45.886 -11.068 38.766  1.00 75.54  ? 68   GLN E CG    1 
ATOM   3311  C  CD    . GLN E  1 68  ? -46.948 -11.518 37.823  1.00 78.14  ? 68   GLN E CD    1 
ATOM   3312  O  OE1   . GLN E  1 68  ? -48.117 -11.638 38.204  1.00 79.48  ? 68   GLN E OE1   1 
ATOM   3313  N  NE2   . GLN E  1 68  ? -46.561 -11.767 36.564  1.00 78.93  ? 68   GLN E NE2   1 
ATOM   3314  N  N     . ARG E  1 69  ? -45.588 -9.166  42.243  1.00 73.85  ? 69   ARG E N     1 
ATOM   3315  C  CA    . ARG E  1 69  ? -45.476 -7.755  42.560  1.00 74.11  ? 69   ARG E CA    1 
ATOM   3316  C  C     . ARG E  1 69  ? -44.043 -7.430  42.950  1.00 73.78  ? 69   ARG E C     1 
ATOM   3317  O  O     . ARG E  1 69  ? -43.447 -6.472  42.439  1.00 74.01  ? 69   ARG E O     1 
ATOM   3318  C  CB    . ARG E  1 69  ? -46.451 -7.364  43.671  1.00 74.35  ? 69   ARG E CB    1 
ATOM   3319  C  CG    . ARG E  1 69  ? -47.769 -6.841  43.135  1.00 76.18  ? 69   ARG E CG    1 
ATOM   3320  C  CD    . ARG E  1 69  ? -48.688 -6.329  44.245  1.00 80.02  ? 69   ARG E CD    1 
ATOM   3321  N  NE    . ARG E  1 69  ? -49.667 -7.337  44.663  1.00 81.65  ? 69   ARG E NE    1 
ATOM   3322  C  CZ    . ARG E  1 69  ? -49.604 -8.023  45.801  1.00 82.52  ? 69   ARG E CZ    1 
ATOM   3323  N  NH1   . ARG E  1 69  ? -48.612 -7.818  46.665  1.00 83.14  ? 69   ARG E NH1   1 
ATOM   3324  N  NH2   . ARG E  1 69  ? -50.541 -8.918  46.080  1.00 82.96  ? 69   ARG E NH2   1 
ATOM   3325  N  N     . LEU E  1 70  ? -43.484 -8.258  43.826  1.00 73.05  ? 70   LEU E N     1 
ATOM   3326  C  CA    . LEU E  1 70  ? -42.134 -8.049  44.333  1.00 72.36  ? 70   LEU E CA    1 
ATOM   3327  C  C     . LEU E  1 70  ? -41.103 -8.031  43.216  1.00 71.83  ? 70   LEU E C     1 
ATOM   3328  O  O     . LEU E  1 70  ? -40.132 -7.280  43.273  1.00 71.91  ? 70   LEU E O     1 
ATOM   3329  C  CB    . LEU E  1 70  ? -41.790 -9.125  45.352  1.00 72.28  ? 70   LEU E CB    1 
ATOM   3330  C  CG    . LEU E  1 70  ? -40.495 -8.980  46.137  1.00 72.43  ? 70   LEU E CG    1 
ATOM   3331  C  CD1   . LEU E  1 70  ? -40.525 -7.766  47.058  1.00 72.78  ? 70   LEU E CD1   1 
ATOM   3332  C  CD2   . LEU E  1 70  ? -40.276 -10.256 46.937  1.00 72.33  ? 70   LEU E CD2   1 
ATOM   3333  N  N     . VAL E  1 71  ? -41.327 -8.839  42.190  1.00 71.26  ? 71   VAL E N     1 
ATOM   3334  C  CA    . VAL E  1 71  ? -40.375 -8.923  41.086  1.00 70.82  ? 71   VAL E CA    1 
ATOM   3335  C  C     . VAL E  1 71  ? -40.402 -7.643  40.271  1.00 70.60  ? 71   VAL E C     1 
ATOM   3336  O  O     . VAL E  1 71  ? -39.353 -7.111  39.922  1.00 70.54  ? 71   VAL E O     1 
ATOM   3337  C  CB    . VAL E  1 71  ? -40.604 -10.183 40.208  1.00 70.54  ? 71   VAL E CB    1 
ATOM   3338  C  CG1   . VAL E  1 71  ? -39.823 -10.124 38.914  1.00 69.93  ? 71   VAL E CG1   1 
ATOM   3339  C  CG2   . VAL E  1 71  ? -40.186 -11.405 40.975  1.00 70.52  ? 71   VAL E CG2   1 
ATOM   3340  N  N     . ARG E  1 72  ? -41.600 -7.137  40.001  1.00 70.88  ? 72   ARG E N     1 
ATOM   3341  C  CA    . ARG E  1 72  ? -41.775 -5.943  39.150  1.00 70.88  ? 72   ARG E CA    1 
ATOM   3342  C  C     . ARG E  1 72  ? -41.282 -4.677  39.854  1.00 70.59  ? 72   ARG E C     1 
ATOM   3343  O  O     . ARG E  1 72  ? -40.671 -3.820  39.233  1.00 70.07  ? 72   ARG E O     1 
ATOM   3344  C  CB    . ARG E  1 72  ? -43.232 -5.816  38.698  1.00 70.90  ? 72   ARG E CB    1 
ATOM   3345  C  CG    . ARG E  1 72  ? -43.716 -7.034  37.903  1.00 71.07  ? 72   ARG E CG    1 
ATOM   3346  C  CD    . ARG E  1 72  ? -45.187 -6.929  37.561  1.00 71.48  ? 72   ARG E CD    1 
ATOM   3347  N  NE    . ARG E  1 72  ? -45.644 -8.042  36.729  1.00 71.48  ? 72   ARG E NE    1 
ATOM   3348  C  CZ    . ARG E  1 72  ? -45.596 -8.064  35.398  1.00 71.27  ? 72   ARG E CZ    1 
ATOM   3349  N  NH1   . ARG E  1 72  ? -45.104 -7.046  34.716  1.00 70.59  ? 72   ARG E NH1   1 
ATOM   3350  N  NH2   . ARG E  1 72  ? -46.043 -9.121  34.742  1.00 73.21  ? 72   ARG E NH2   1 
ATOM   3351  N  N     . GLU E  1 73  ? -41.525 -4.600  41.158  1.00 70.65  ? 73   GLU E N     1 
ATOM   3352  C  CA    . GLU E  1 73  ? -41.008 -3.532  41.993  1.00 71.48  ? 73   GLU E CA    1 
ATOM   3353  C  C     . GLU E  1 73  ? -39.493 -3.466  41.894  1.00 70.91  ? 73   GLU E C     1 
ATOM   3354  O  O     . GLU E  1 73  ? -38.935 -2.394  41.676  1.00 71.17  ? 73   GLU E O     1 
ATOM   3355  C  CB    . GLU E  1 73  ? -41.427 -3.756  43.446  1.00 71.37  ? 73   GLU E CB    1 
ATOM   3356  C  CG    . GLU E  1 73  ? -40.776 -2.813  44.452  1.00 73.17  ? 73   GLU E CG    1 
ATOM   3357  C  CD    . GLU E  1 73  ? -41.329 -2.989  45.871  1.00 73.94  ? 73   GLU E CD    1 
ATOM   3358  O  OE1   . GLU E  1 73  ? -42.495 -2.603  46.117  1.00 77.37  ? 73   GLU E OE1   1 
ATOM   3359  O  OE2   . GLU E  1 73  ? -40.593 -3.507  46.747  1.00 78.00  ? 73   GLU E OE2   1 
ATOM   3360  N  N     . ILE E  1 74  ? -38.843 -4.621  42.056  1.00 70.60  ? 74   ILE E N     1 
ATOM   3361  C  CA    . ILE E  1 74  ? -37.381 -4.740  42.038  1.00 69.70  ? 74   ILE E CA    1 
ATOM   3362  C  C     . ILE E  1 74  ? -36.811 -4.458  40.659  1.00 69.54  ? 74   ILE E C     1 
ATOM   3363  O  O     . ILE E  1 74  ? -35.834 -3.732  40.536  1.00 69.19  ? 74   ILE E O     1 
ATOM   3364  C  CB    . ILE E  1 74  ? -36.909 -6.129  42.561  1.00 69.79  ? 74   ILE E CB    1 
ATOM   3365  C  CG1   . ILE E  1 74  ? -37.069 -6.195  44.081  1.00 68.89  ? 74   ILE E CG1   1 
ATOM   3366  C  CG2   . ILE E  1 74  ? -35.453 -6.431  42.145  1.00 69.01  ? 74   ILE E CG2   1 
ATOM   3367  C  CD1   . ILE E  1 74  ? -37.008 -7.586  44.661  1.00 68.54  ? 74   ILE E CD1   1 
ATOM   3368  N  N     . ALA E  1 75  ? -37.422 -5.016  39.622  1.00 69.57  ? 75   ALA E N     1 
ATOM   3369  C  CA    . ALA E  1 75  ? -36.988 -4.708  38.273  1.00 70.15  ? 75   ALA E CA    1 
ATOM   3370  C  C     . ALA E  1 75  ? -37.135 -3.219  38.014  1.00 71.00  ? 75   ALA E C     1 
ATOM   3371  O  O     . ALA E  1 75  ? -36.304 -2.624  37.326  1.00 71.06  ? 75   ALA E O     1 
ATOM   3372  C  CB    . ALA E  1 75  ? -37.759 -5.501  37.265  1.00 69.64  ? 75   ALA E CB    1 
ATOM   3373  N  N     . GLN E  1 76  ? -38.180 -2.621  38.591  1.00 72.32  ? 76   GLN E N     1 
ATOM   3374  C  CA    . GLN E  1 76  ? -38.471 -1.189  38.428  1.00 73.45  ? 76   GLN E CA    1 
ATOM   3375  C  C     . GLN E  1 76  ? -37.319 -0.318  38.919  1.00 74.01  ? 76   GLN E C     1 
ATOM   3376  O  O     . GLN E  1 76  ? -36.929 0.628   38.237  1.00 74.10  ? 76   GLN E O     1 
ATOM   3377  C  CB    . GLN E  1 76  ? -39.774 -0.809  39.147  1.00 73.56  ? 76   GLN E CB    1 
ATOM   3378  C  CG    . GLN E  1 76  ? -40.303 0.583   38.832  1.00 74.48  ? 76   GLN E CG    1 
ATOM   3379  C  CD    . GLN E  1 76  ? -40.631 0.768   37.362  1.00 76.55  ? 76   GLN E CD    1 
ATOM   3380  O  OE1   . GLN E  1 76  ? -40.815 -0.195  36.618  1.00 76.75  ? 76   GLN E OE1   1 
ATOM   3381  N  NE2   . GLN E  1 76  ? -40.708 2.019   36.935  1.00 78.53  ? 76   GLN E NE2   1 
ATOM   3382  N  N     . ASP E  1 77  ? -36.784 -0.651  40.092  1.00 74.75  ? 77   ASP E N     1 
ATOM   3383  C  CA    . ASP E  1 77  ? -35.582 -0.008  40.615  1.00 76.10  ? 77   ASP E CA    1 
ATOM   3384  C  C     . ASP E  1 77  ? -34.323 -0.160  39.734  1.00 76.42  ? 77   ASP E C     1 
ATOM   3385  O  O     . ASP E  1 77  ? -33.318 0.483   40.010  1.00 77.08  ? 77   ASP E O     1 
ATOM   3386  C  CB    . ASP E  1 77  ? -35.289 -0.490  42.045  1.00 76.41  ? 77   ASP E CB    1 
ATOM   3387  C  CG    . ASP E  1 77  ? -35.958 0.385   43.118  1.00 79.12  ? 77   ASP E CG    1 
ATOM   3388  O  OD1   . ASP E  1 77  ? -37.217 0.439   43.182  1.00 81.60  ? 77   ASP E OD1   1 
ATOM   3389  O  OD2   . ASP E  1 77  ? -35.219 1.024   43.912  1.00 82.06  ? 77   ASP E OD2   1 
ATOM   3390  N  N     . PHE E  1 78  ? -34.370 -0.981  38.682  1.00 76.86  ? 78   PHE E N     1 
ATOM   3391  C  CA    . PHE E  1 78  ? -33.208 -1.178  37.799  1.00 77.30  ? 78   PHE E CA    1 
ATOM   3392  C  C     . PHE E  1 78  ? -33.409 -0.586  36.424  1.00 77.86  ? 78   PHE E C     1 
ATOM   3393  O  O     . PHE E  1 78  ? -32.471 -0.055  35.828  1.00 77.91  ? 78   PHE E O     1 
ATOM   3394  C  CB    . PHE E  1 78  ? -32.860 -2.662  37.642  1.00 77.07  ? 78   PHE E CB    1 
ATOM   3395  C  CG    . PHE E  1 78  ? -32.149 -3.248  38.823  1.00 76.74  ? 78   PHE E CG    1 
ATOM   3396  C  CD1   . PHE E  1 78  ? -30.910 -2.763  39.215  1.00 76.81  ? 78   PHE E CD1   1 
ATOM   3397  C  CD2   . PHE E  1 78  ? -32.714 -4.294  39.538  1.00 75.92  ? 78   PHE E CD2   1 
ATOM   3398  C  CE1   . PHE E  1 78  ? -30.252 -3.304  40.307  1.00 77.30  ? 78   PHE E CE1   1 
ATOM   3399  C  CE2   . PHE E  1 78  ? -32.069 -4.839  40.626  1.00 75.65  ? 78   PHE E CE2   1 
ATOM   3400  C  CZ    . PHE E  1 78  ? -30.834 -4.345  41.013  1.00 77.13  ? 78   PHE E CZ    1 
ATOM   3401  N  N     . LYS E  1 79  ? -34.629 -0.721  35.915  1.00 78.57  ? 79   LYS E N     1 
ATOM   3402  C  CA    . LYS E  1 79  ? -35.021 -0.165  34.629  1.00 79.48  ? 79   LYS E CA    1 
ATOM   3403  C  C     . LYS E  1 79  ? -36.525 0.069   34.649  1.00 79.76  ? 79   LYS E C     1 
ATOM   3404  O  O     . LYS E  1 79  ? -37.289 -0.763  35.152  1.00 79.74  ? 79   LYS E O     1 
ATOM   3405  C  CB    . LYS E  1 79  ? -34.652 -1.112  33.493  1.00 79.72  ? 79   LYS E CB    1 
ATOM   3406  C  CG    . LYS E  1 79  ? -34.083 -0.428  32.266  1.00 81.60  ? 79   LYS E CG    1 
ATOM   3407  C  CD    . LYS E  1 79  ? -35.170 0.171   31.387  1.00 85.04  ? 79   LYS E CD    1 
ATOM   3408  C  CE    . LYS E  1 79  ? -34.625 1.289   30.487  1.00 85.98  ? 79   LYS E CE    1 
ATOM   3409  N  NZ    . LYS E  1 79  ? -35.731 2.080   29.867  1.00 85.77  ? 79   LYS E NZ    1 
ATOM   3410  N  N     . THR E  1 80  ? -36.936 1.222   34.125  1.00 80.18  ? 80   THR E N     1 
ATOM   3411  C  CA    . THR E  1 80  ? -38.346 1.610   34.085  1.00 80.56  ? 80   THR E CA    1 
ATOM   3412  C  C     . THR E  1 80  ? -38.944 1.168   32.759  1.00 80.68  ? 80   THR E C     1 
ATOM   3413  O  O     . THR E  1 80  ? -38.235 1.095   31.751  1.00 80.50  ? 80   THR E O     1 
ATOM   3414  C  CB    . THR E  1 80  ? -38.534 3.146   34.238  1.00 80.58  ? 80   THR E CB    1 
ATOM   3415  O  OG1   . THR E  1 80  ? -37.732 3.836   33.267  1.00 81.18  ? 80   THR E OG1   1 
ATOM   3416  C  CG2   . THR E  1 80  ? -38.149 3.622   35.640  1.00 80.75  ? 80   THR E CG2   1 
ATOM   3417  N  N     . ASP E  1 81  ? -40.245 0.878   32.766  1.00 81.01  ? 81   ASP E N     1 
ATOM   3418  C  CA    . ASP E  1 81  ? -40.972 0.488   31.547  1.00 81.43  ? 81   ASP E CA    1 
ATOM   3419  C  C     . ASP E  1 81  ? -40.405 -0.849  31.068  1.00 80.65  ? 81   ASP E C     1 
ATOM   3420  O  O     . ASP E  1 81  ? -39.612 -0.914  30.117  1.00 80.87  ? 81   ASP E O     1 
ATOM   3421  C  CB    . ASP E  1 81  ? -40.936 1.617   30.474  1.00 82.08  ? 81   ASP E CB    1 
ATOM   3422  C  CG    . ASP E  1 81  ? -41.776 1.298   29.226  1.00 84.67  ? 81   ASP E CG    1 
ATOM   3423  O  OD1   . ASP E  1 81  ? -41.175 0.761   28.250  1.00 88.32  ? 81   ASP E OD1   1 
ATOM   3424  O  OD2   . ASP E  1 81  ? -43.024 1.594   29.198  1.00 87.10  ? 81   ASP E OD2   1 
ATOM   3425  N  N     . LEU E  1 82  ? -40.798 -1.902  31.788  1.00 79.71  ? 82   LEU E N     1 
ATOM   3426  C  CA    . LEU E  1 82  ? -40.351 -3.272  31.545  1.00 78.36  ? 82   LEU E CA    1 
ATOM   3427  C  C     . LEU E  1 82  ? -41.519 -4.226  31.647  1.00 77.64  ? 82   LEU E C     1 
ATOM   3428  O  O     . LEU E  1 82  ? -42.372 -4.084  32.518  1.00 77.41  ? 82   LEU E O     1 
ATOM   3429  C  CB    . LEU E  1 82  ? -39.303 -3.691  32.576  1.00 78.06  ? 82   LEU E CB    1 
ATOM   3430  C  CG    . LEU E  1 82  ? -37.840 -3.359  32.310  1.00 78.24  ? 82   LEU E CG    1 
ATOM   3431  C  CD1   . LEU E  1 82  ? -37.005 -3.824  33.486  1.00 78.24  ? 82   LEU E CD1   1 
ATOM   3432  C  CD2   . LEU E  1 82  ? -37.343 -3.989  31.009  1.00 77.57  ? 82   LEU E CD2   1 
ATOM   3433  N  N     . ARG E  1 83  ? -41.540 -5.210  30.763  1.00 76.94  ? 83   ARG E N     1 
ATOM   3434  C  CA    . ARG E  1 83  ? -42.540 -6.264  30.811  1.00 76.69  ? 83   ARG E CA    1 
ATOM   3435  C  C     . ARG E  1 83  ? -41.872 -7.603  31.131  1.00 75.90  ? 83   ARG E C     1 
ATOM   3436  O  O     . ARG E  1 83  ? -40.644 -7.673  31.214  1.00 76.18  ? 83   ARG E O     1 
ATOM   3437  C  CB    . ARG E  1 83  ? -43.278 -6.313  29.477  1.00 77.01  ? 83   ARG E CB    1 
ATOM   3438  C  CG    . ARG E  1 83  ? -44.051 -5.055  29.209  1.00 78.19  ? 83   ARG E CG    1 
ATOM   3439  C  CD    . ARG E  1 83  ? -44.248 -4.796  27.730  1.00 81.11  ? 83   ARG E CD    1 
ATOM   3440  N  NE    . ARG E  1 83  ? -45.528 -4.128  27.520  1.00 83.25  ? 83   ARG E NE    1 
ATOM   3441  C  CZ    . ARG E  1 83  ? -46.681 -4.770  27.334  1.00 84.70  ? 83   ARG E CZ    1 
ATOM   3442  N  NH1   . ARG E  1 83  ? -46.712 -6.100  27.305  1.00 84.80  ? 83   ARG E NH1   1 
ATOM   3443  N  NH2   . ARG E  1 83  ? -47.807 -4.086  27.168  1.00 85.76  ? 83   ARG E NH2   1 
ATOM   3444  N  N     . PHE E  1 84  ? -42.673 -8.654  31.302  1.00 74.92  ? 84   PHE E N     1 
ATOM   3445  C  CA    . PHE E  1 84  ? -42.170 -9.988  31.653  1.00 74.24  ? 84   PHE E CA    1 
ATOM   3446  C  C     . PHE E  1 84  ? -42.938 -11.092 30.950  1.00 73.85  ? 84   PHE E C     1 
ATOM   3447  O  O     . PHE E  1 84  ? -44.165 -11.169 31.073  1.00 73.79  ? 84   PHE E O     1 
ATOM   3448  C  CB    . PHE E  1 84  ? -42.329 -10.241 33.154  1.00 74.25  ? 84   PHE E CB    1 
ATOM   3449  C  CG    . PHE E  1 84  ? -41.244 -9.655  33.996  1.00 74.26  ? 84   PHE E CG    1 
ATOM   3450  C  CD1   . PHE E  1 84  ? -41.311 -8.330  34.420  1.00 74.52  ? 84   PHE E CD1   1 
ATOM   3451  C  CD2   . PHE E  1 84  ? -40.169 -10.432 34.393  1.00 73.67  ? 84   PHE E CD2   1 
ATOM   3452  C  CE1   . PHE E  1 84  ? -40.305 -7.782  35.212  1.00 74.54  ? 84   PHE E CE1   1 
ATOM   3453  C  CE2   . PHE E  1 84  ? -39.158 -9.892  35.188  1.00 74.31  ? 84   PHE E CE2   1 
ATOM   3454  C  CZ    . PHE E  1 84  ? -39.229 -8.567  35.598  1.00 73.98  ? 84   PHE E CZ    1 
ATOM   3455  N  N     . GLN E  1 85  ? -42.223 -11.975 30.251  1.00 73.08  ? 85   GLN E N     1 
ATOM   3456  C  CA    . GLN E  1 85  ? -42.801 -13.250 29.848  1.00 72.25  ? 85   GLN E CA    1 
ATOM   3457  C  C     . GLN E  1 85  ? -43.233 -13.943 31.128  1.00 71.41  ? 85   GLN E C     1 
ATOM   3458  O  O     . GLN E  1 85  ? -42.536 -13.872 32.136  1.00 71.28  ? 85   GLN E O     1 
ATOM   3459  C  CB    . GLN E  1 85  ? -41.777 -14.105 29.109  1.00 72.29  ? 85   GLN E CB    1 
ATOM   3460  C  CG    . GLN E  1 85  ? -41.410 -13.582 27.729  1.00 72.74  ? 85   GLN E CG    1 
ATOM   3461  C  CD    . GLN E  1 85  ? -40.450 -14.497 26.997  1.00 73.69  ? 85   GLN E CD    1 
ATOM   3462  O  OE1   . GLN E  1 85  ? -39.759 -15.312 27.623  1.00 77.16  ? 85   GLN E OE1   1 
ATOM   3463  N  NE2   . GLN E  1 85  ? -40.392 -14.368 25.661  1.00 74.64  ? 85   GLN E NE2   1 
ATOM   3464  N  N     . SER E  1 86  ? -44.390 -14.589 31.113  1.00 70.77  ? 86   SER E N     1 
ATOM   3465  C  CA    . SER E  1 86  ? -44.900 -15.225 32.336  1.00 70.33  ? 86   SER E CA    1 
ATOM   3466  C  C     . SER E  1 86  ? -43.974 -16.331 32.838  1.00 69.35  ? 86   SER E C     1 
ATOM   3467  O  O     . SER E  1 86  ? -43.903 -16.604 34.044  1.00 69.21  ? 86   SER E O     1 
ATOM   3468  C  CB    . SER E  1 86  ? -46.312 -15.773 32.118  1.00 70.55  ? 86   SER E CB    1 
ATOM   3469  O  OG    . SER E  1 86  ? -46.432 -16.323 30.811  1.00 72.15  ? 86   SER E OG    1 
ATOM   3470  N  N     . SER E  1 87  ? -43.267 -16.967 31.912  1.00 68.16  ? 87   SER E N     1 
ATOM   3471  C  CA    . SER E  1 87  ? -42.347 -18.017 32.299  1.00 67.72  ? 87   SER E CA    1 
ATOM   3472  C  C     . SER E  1 87  ? -41.161 -17.425 33.064  1.00 66.95  ? 87   SER E C     1 
ATOM   3473  O  O     . SER E  1 87  ? -40.668 -18.030 34.014  1.00 67.12  ? 87   SER E O     1 
ATOM   3474  C  CB    . SER E  1 87  ? -41.907 -18.870 31.091  1.00 67.73  ? 87   SER E CB    1 
ATOM   3475  O  OG    . SER E  1 87  ? -41.585 -18.071 29.966  1.00 67.93  ? 87   SER E OG    1 
ATOM   3476  N  N     . ALA E  1 88  ? -40.736 -16.231 32.673  1.00 65.90  ? 88   ALA E N     1 
ATOM   3477  C  CA    . ALA E  1 88  ? -39.645 -15.561 33.362  1.00 65.45  ? 88   ALA E CA    1 
ATOM   3478  C  C     . ALA E  1 88  ? -39.933 -15.424 34.843  1.00 64.93  ? 88   ALA E C     1 
ATOM   3479  O  O     . ALA E  1 88  ? -39.070 -15.716 35.675  1.00 64.92  ? 88   ALA E O     1 
ATOM   3480  C  CB    . ALA E  1 88  ? -39.339 -14.197 32.736  1.00 65.53  ? 88   ALA E CB    1 
ATOM   3481  N  N     . VAL E  1 89  ? -41.147 -15.008 35.177  1.00 64.74  ? 89   VAL E N     1 
ATOM   3482  C  CA    . VAL E  1 89  ? -41.522 -14.860 36.581  1.00 64.45  ? 89   VAL E CA    1 
ATOM   3483  C  C     . VAL E  1 89  ? -41.459 -16.222 37.239  1.00 64.47  ? 89   VAL E C     1 
ATOM   3484  O  O     . VAL E  1 89  ? -40.824 -16.379 38.287  1.00 64.82  ? 89   VAL E O     1 
ATOM   3485  C  CB    . VAL E  1 89  ? -42.911 -14.212 36.761  1.00 64.32  ? 89   VAL E CB    1 
ATOM   3486  C  CG1   . VAL E  1 89  ? -43.259 -14.103 38.252  1.00 64.25  ? 89   VAL E CG1   1 
ATOM   3487  C  CG2   . VAL E  1 89  ? -42.938 -12.833 36.103  1.00 63.27  ? 89   VAL E CG2   1 
ATOM   3488  N  N     . MET E  1 90  ? -42.078 -17.210 36.592  1.00 64.49  ? 90   MET E N     1 
ATOM   3489  C  CA    . MET E  1 90  ? -41.990 -18.611 37.018  1.00 64.37  ? 90   MET E CA    1 
ATOM   3490  C  C     . MET E  1 90  ? -40.558 -19.006 37.354  1.00 63.39  ? 90   MET E C     1 
ATOM   3491  O  O     . MET E  1 90  ? -40.268 -19.392 38.499  1.00 63.16  ? 90   MET E O     1 
ATOM   3492  C  CB    . MET E  1 90  ? -42.583 -19.546 35.954  1.00 65.30  ? 90   MET E CB    1 
ATOM   3493  C  CG    . MET E  1 90  ? -44.099 -19.434 35.830  1.00 68.03  ? 90   MET E CG    1 
ATOM   3494  S  SD    . MET E  1 90  ? -44.751 -18.926 37.440  1.00 75.32  ? 90   MET E SD    1 
ATOM   3495  C  CE    . MET E  1 90  ? -45.218 -20.508 38.164  1.00 76.21  ? 90   MET E CE    1 
ATOM   3496  N  N     . ALA E  1 91  ? -39.664 -18.872 36.371  1.00 62.18  ? 91   ALA E N     1 
ATOM   3497  C  CA    . ALA E  1 91  ? -38.240 -19.138 36.587  1.00 61.54  ? 91   ALA E CA    1 
ATOM   3498  C  C     . ALA E  1 91  ? -37.778 -18.518 37.910  1.00 61.26  ? 91   ALA E C     1 
ATOM   3499  O  O     . ALA E  1 91  ? -37.264 -19.222 38.789  1.00 61.14  ? 91   ALA E O     1 
ATOM   3500  C  CB    . ALA E  1 91  ? -37.398 -18.635 35.416  1.00 60.83  ? 91   ALA E CB    1 
ATOM   3501  N  N     . LEU E  1 92  ? -38.016 -17.216 38.073  1.00 60.85  ? 92   LEU E N     1 
ATOM   3502  C  CA    . LEU E  1 92  ? -37.545 -16.514 39.259  1.00 60.30  ? 92   LEU E CA    1 
ATOM   3503  C  C     . LEU E  1 92  ? -38.076 -17.139 40.520  1.00 60.22  ? 92   LEU E C     1 
ATOM   3504  O  O     . LEU E  1 92  ? -37.348 -17.260 41.506  1.00 59.95  ? 92   LEU E O     1 
ATOM   3505  C  CB    . LEU E  1 92  ? -37.876 -15.028 39.209  1.00 59.72  ? 92   LEU E CB    1 
ATOM   3506  C  CG    . LEU E  1 92  ? -37.007 -14.261 38.213  1.00 59.52  ? 92   LEU E CG    1 
ATOM   3507  C  CD1   . LEU E  1 92  ? -37.516 -12.861 38.003  1.00 60.96  ? 92   LEU E CD1   1 
ATOM   3508  C  CD2   . LEU E  1 92  ? -35.570 -14.230 38.632  1.00 60.02  ? 92   LEU E CD2   1 
ATOM   3509  N  N     . GLN E  1 93  ? -39.327 -17.578 40.484  1.00 60.29  ? 93   GLN E N     1 
ATOM   3510  C  CA    . GLN E  1 93  ? -39.906 -18.193 41.672  1.00 60.14  ? 93   GLN E CA    1 
ATOM   3511  C  C     . GLN E  1 93  ? -39.328 -19.571 41.977  1.00 59.77  ? 93   GLN E C     1 
ATOM   3512  O  O     . GLN E  1 93  ? -39.055 -19.885 43.137  1.00 59.54  ? 93   GLN E O     1 
ATOM   3513  C  CB    . GLN E  1 93  ? -41.426 -18.221 41.598  1.00 60.17  ? 93   GLN E CB    1 
ATOM   3514  C  CG    . GLN E  1 93  ? -42.044 -18.341 42.970  1.00 60.59  ? 93   GLN E CG    1 
ATOM   3515  C  CD    . GLN E  1 93  ? -43.540 -18.241 42.946  1.00 62.27  ? 93   GLN E CD    1 
ATOM   3516  O  OE1   . GLN E  1 93  ? -44.133 -17.759 41.974  1.00 62.63  ? 93   GLN E OE1   1 
ATOM   3517  N  NE2   . GLN E  1 93  ? -44.173 -18.680 44.034  1.00 64.06  ? 93   GLN E NE2   1 
ATOM   3518  N  N     . GLU E  1 94  ? -39.135 -20.378 40.941  1.00 59.81  ? 94   GLU E N     1 
ATOM   3519  C  CA    . GLU E  1 94  ? -38.486 -21.688 41.093  1.00 60.37  ? 94   GLU E CA    1 
ATOM   3520  C  C     . GLU E  1 94  ? -37.101 -21.512 41.688  1.00 59.66  ? 94   GLU E C     1 
ATOM   3521  O  O     . GLU E  1 94  ? -36.795 -22.051 42.759  1.00 59.69  ? 94   GLU E O     1 
ATOM   3522  C  CB    . GLU E  1 94  ? -38.394 -22.431 39.755  1.00 60.83  ? 94   GLU E CB    1 
ATOM   3523  C  CG    . GLU E  1 94  ? -39.754 -22.769 39.130  1.00 63.94  ? 94   GLU E CG    1 
ATOM   3524  C  CD    . GLU E  1 94  ? -40.492 -23.888 39.874  1.00 69.08  ? 94   GLU E CD    1 
ATOM   3525  O  OE1   . GLU E  1 94  ? -39.825 -24.812 40.405  1.00 72.57  ? 94   GLU E OE1   1 
ATOM   3526  O  OE2   . GLU E  1 94  ? -41.744 -23.858 39.917  1.00 70.52  ? 94   GLU E OE2   1 
ATOM   3527  N  N     . ALA E  1 95  ? -36.278 -20.717 41.011  1.00 59.15  ? 95   ALA E N     1 
ATOM   3528  C  CA    . ALA E  1 95  ? -34.977 -20.347 41.553  1.00 58.61  ? 95   ALA E CA    1 
ATOM   3529  C  C     . ALA E  1 95  ? -35.048 -19.880 43.014  1.00 58.38  ? 95   ALA E C     1 
ATOM   3530  O  O     . ALA E  1 95  ? -34.295 -20.378 43.858  1.00 58.73  ? 95   ALA E O     1 
ATOM   3531  C  CB    . ALA E  1 95  ? -34.328 -19.313 40.695  1.00 58.16  ? 95   ALA E CB    1 
ATOM   3532  N  N     . SER E  1 96  ? -35.962 -18.962 43.319  1.00 57.92  ? 96   SER E N     1 
ATOM   3533  C  CA    . SER E  1 96  ? -35.972 -18.316 44.626  1.00 58.14  ? 96   SER E CA    1 
ATOM   3534  C  C     . SER E  1 96  ? -36.300 -19.282 45.727  1.00 58.38  ? 96   SER E C     1 
ATOM   3535  O  O     . SER E  1 96  ? -35.688 -19.252 46.799  1.00 58.53  ? 96   SER E O     1 
ATOM   3536  C  CB    . SER E  1 96  ? -36.978 -17.176 44.664  1.00 58.26  ? 96   SER E CB    1 
ATOM   3537  O  OG    . SER E  1 96  ? -36.628 -16.162 43.742  1.00 59.19  ? 96   SER E OG    1 
ATOM   3538  N  N     . GLU E  1 97  ? -37.263 -20.160 45.469  1.00 58.39  ? 97   GLU E N     1 
ATOM   3539  C  CA    . GLU E  1 97  ? -37.678 -21.097 46.506  1.00 58.12  ? 97   GLU E CA    1 
ATOM   3540  C  C     . GLU E  1 97  ? -36.674 -22.236 46.689  1.00 56.85  ? 97   GLU E C     1 
ATOM   3541  O  O     . GLU E  1 97  ? -36.372 -22.621 47.813  1.00 56.67  ? 97   GLU E O     1 
ATOM   3542  C  CB    . GLU E  1 97  ? -39.084 -21.604 46.236  1.00 58.57  ? 97   GLU E CB    1 
ATOM   3543  C  CG    . GLU E  1 97  ? -40.104 -20.494 46.179  1.00 61.41  ? 97   GLU E CG    1 
ATOM   3544  C  CD    . GLU E  1 97  ? -41.513 -21.025 46.162  1.00 67.61  ? 97   GLU E CD    1 
ATOM   3545  O  OE1   . GLU E  1 97  ? -41.720 -22.144 46.668  1.00 71.03  ? 97   GLU E OE1   1 
ATOM   3546  O  OE2   . GLU E  1 97  ? -42.427 -20.334 45.653  1.00 70.97  ? 97   GLU E OE2   1 
ATOM   3547  N  N     . ALA E  1 98  ? -36.142 -22.758 45.591  1.00 55.70  ? 98   ALA E N     1 
ATOM   3548  C  CA    . ALA E  1 98  ? -35.090 -23.769 45.685  1.00 54.91  ? 98   ALA E CA    1 
ATOM   3549  C  C     . ALA E  1 98  ? -33.948 -23.204 46.528  1.00 54.90  ? 98   ALA E C     1 
ATOM   3550  O  O     . ALA E  1 98  ? -33.404 -23.883 47.419  1.00 55.02  ? 98   ALA E O     1 
ATOM   3551  C  CB    . ALA E  1 98  ? -34.607 -24.179 44.315  1.00 54.23  ? 98   ALA E CB    1 
ATOM   3552  N  N     . TYR E  1 99  ? -33.629 -21.937 46.276  1.00 54.59  ? 99   TYR E N     1 
ATOM   3553  C  CA    . TYR E  1 99  ? -32.566 -21.265 46.975  1.00 54.02  ? 99   TYR E CA    1 
ATOM   3554  C  C     . TYR E  1 99  ? -32.861 -21.232 48.442  1.00 54.15  ? 99   TYR E C     1 
ATOM   3555  O  O     . TYR E  1 99  ? -31.993 -21.559 49.240  1.00 54.89  ? 99   TYR E O     1 
ATOM   3556  C  CB    . TYR E  1 99  ? -32.365 -19.835 46.452  1.00 54.29  ? 99   TYR E CB    1 
ATOM   3557  C  CG    . TYR E  1 99  ? -31.508 -19.007 47.375  1.00 53.59  ? 99   TYR E CG    1 
ATOM   3558  C  CD1   . TYR E  1 99  ? -30.111 -19.135 47.365  1.00 52.67  ? 99   TYR E CD1   1 
ATOM   3559  C  CD2   . TYR E  1 99  ? -32.087 -18.139 48.286  1.00 51.57  ? 99   TYR E CD2   1 
ATOM   3560  C  CE1   . TYR E  1 99  ? -29.319 -18.410 48.223  1.00 51.58  ? 99   TYR E CE1   1 
ATOM   3561  C  CE2   . TYR E  1 99  ? -31.307 -17.403 49.139  1.00 53.56  ? 99   TYR E CE2   1 
ATOM   3562  C  CZ    . TYR E  1 99  ? -29.923 -17.540 49.106  1.00 53.83  ? 99   TYR E CZ    1 
ATOM   3563  O  OH    . TYR E  1 99  ? -29.154 -16.792 49.977  1.00 55.74  ? 99   TYR E OH    1 
ATOM   3564  N  N     . LEU E  1 100 ? -34.075 -20.831 48.810  1.00 54.49  ? 100  LEU E N     1 
ATOM   3565  C  CA    . LEU E  1 100 ? -34.406 -20.660 50.223  1.00 54.60  ? 100  LEU E CA    1 
ATOM   3566  C  C     . LEU E  1 100 ? -34.533 -21.979 50.941  1.00 54.62  ? 100  LEU E C     1 
ATOM   3567  O  O     . LEU E  1 100 ? -34.049 -22.130 52.076  1.00 54.98  ? 100  LEU E O     1 
ATOM   3568  C  CB    . LEU E  1 100 ? -35.661 -19.810 50.413  1.00 55.20  ? 100  LEU E CB    1 
ATOM   3569  C  CG    . LEU E  1 100 ? -35.530 -18.299 50.120  1.00 56.09  ? 100  LEU E CG    1 
ATOM   3570  C  CD1   . LEU E  1 100 ? -36.921 -17.671 50.039  1.00 56.53  ? 100  LEU E CD1   1 
ATOM   3571  C  CD2   . LEU E  1 100 ? -34.685 -17.568 51.161  1.00 54.76  ? 100  LEU E CD2   1 
ATOM   3572  N  N     . VAL E  1 101 ? -35.160 -22.947 50.279  1.00 54.50  ? 101  VAL E N     1 
ATOM   3573  C  CA    . VAL E  1 101 ? -35.282 -24.281 50.843  1.00 54.16  ? 101  VAL E CA    1 
ATOM   3574  C  C     . VAL E  1 101 ? -33.876 -24.788 51.174  1.00 54.01  ? 101  VAL E C     1 
ATOM   3575  O  O     . VAL E  1 101 ? -33.602 -25.201 52.303  1.00 53.50  ? 101  VAL E O     1 
ATOM   3576  C  CB    . VAL E  1 101 ? -36.011 -25.240 49.884  1.00 54.59  ? 101  VAL E CB    1 
ATOM   3577  C  CG1   . VAL E  1 101 ? -35.941 -26.648 50.410  1.00 54.04  ? 101  VAL E CG1   1 
ATOM   3578  C  CG2   . VAL E  1 101 ? -37.482 -24.806 49.698  1.00 54.38  ? 101  VAL E CG2   1 
ATOM   3579  N  N     . ALA E  1 102 ? -32.975 -24.709 50.196  1.00 53.61  ? 102  ALA E N     1 
ATOM   3580  C  CA    . ALA E  1 102 ? -31.614 -25.172 50.403  1.00 53.47  ? 102  ALA E CA    1 
ATOM   3581  C  C     . ALA E  1 102 ? -31.008 -24.432 51.585  1.00 53.95  ? 102  ALA E C     1 
ATOM   3582  O  O     . ALA E  1 102 ? -30.361 -25.045 52.456  1.00 54.00  ? 102  ALA E O     1 
ATOM   3583  C  CB    . ALA E  1 102 ? -30.793 -24.970 49.161  1.00 53.11  ? 102  ALA E CB    1 
ATOM   3584  N  N     . LEU E  1 103 ? -31.258 -23.120 51.636  1.00 54.25  ? 103  LEU E N     1 
ATOM   3585  C  CA    . LEU E  1 103 ? -30.762 -22.281 52.718  1.00 54.30  ? 103  LEU E CA    1 
ATOM   3586  C  C     . LEU E  1 103 ? -31.271 -22.722 54.075  1.00 54.90  ? 103  LEU E C     1 
ATOM   3587  O  O     . LEU E  1 103 ? -30.509 -22.729 55.049  1.00 55.25  ? 103  LEU E O     1 
ATOM   3588  C  CB    . LEU E  1 103 ? -31.094 -20.805 52.468  1.00 54.29  ? 103  LEU E CB    1 
ATOM   3589  C  CG    . LEU E  1 103 ? -30.491 -19.795 53.466  1.00 53.92  ? 103  LEU E CG    1 
ATOM   3590  C  CD1   . LEU E  1 103 ? -28.978 -19.876 53.499  1.00 51.44  ? 103  LEU E CD1   1 
ATOM   3591  C  CD2   . LEU E  1 103 ? -30.954 -18.398 53.119  1.00 53.94  ? 103  LEU E CD2   1 
ATOM   3592  N  N     . PHE E  1 104 ? -32.548 -23.104 54.151  1.00 55.68  ? 104  PHE E N     1 
ATOM   3593  C  CA    . PHE E  1 104 ? -33.100 -23.617 55.415  1.00 55.75  ? 104  PHE E CA    1 
ATOM   3594  C  C     . PHE E  1 104 ? -32.478 -24.942 55.860  1.00 56.24  ? 104  PHE E C     1 
ATOM   3595  O  O     . PHE E  1 104 ? -32.241 -25.144 57.057  1.00 56.23  ? 104  PHE E O     1 
ATOM   3596  C  CB    . PHE E  1 104 ? -34.617 -23.723 55.351  1.00 55.86  ? 104  PHE E CB    1 
ATOM   3597  C  CG    . PHE E  1 104 ? -35.329 -22.400 55.520  1.00 55.88  ? 104  PHE E CG    1 
ATOM   3598  C  CD1   . PHE E  1 104 ? -36.238 -21.959 54.559  1.00 54.79  ? 104  PHE E CD1   1 
ATOM   3599  C  CD2   . PHE E  1 104 ? -35.095 -21.602 56.645  1.00 55.26  ? 104  PHE E CD2   1 
ATOM   3600  C  CE1   . PHE E  1 104 ? -36.898 -20.734 54.711  1.00 55.02  ? 104  PHE E CE1   1 
ATOM   3601  C  CE2   . PHE E  1 104 ? -35.746 -20.381 56.814  1.00 55.38  ? 104  PHE E CE2   1 
ATOM   3602  C  CZ    . PHE E  1 104 ? -36.649 -19.939 55.843  1.00 55.42  ? 104  PHE E CZ    1 
ATOM   3603  N  N     . GLU E  1 105 ? -32.203 -25.841 54.914  1.00 56.48  ? 105  GLU E N     1 
ATOM   3604  C  CA    . GLU E  1 105 ? -31.483 -27.074 55.248  1.00 57.72  ? 105  GLU E CA    1 
ATOM   3605  C  C     . GLU E  1 105 ? -30.193 -26.702 55.965  1.00 56.59  ? 105  GLU E C     1 
ATOM   3606  O  O     . GLU E  1 105 ? -29.932 -27.194 57.057  1.00 56.65  ? 105  GLU E O     1 
ATOM   3607  C  CB    . GLU E  1 105 ? -31.158 -27.924 54.007  1.00 57.48  ? 105  GLU E CB    1 
ATOM   3608  C  CG    . GLU E  1 105 ? -32.358 -28.564 53.325  1.00 60.26  ? 105  GLU E CG    1 
ATOM   3609  C  CD    . GLU E  1 105 ? -32.105 -28.932 51.850  1.00 61.67  ? 105  GLU E CD    1 
ATOM   3610  O  OE1   . GLU E  1 105 ? -30.902 -29.027 51.462  1.00 66.71  ? 105  GLU E OE1   1 
ATOM   3611  O  OE2   . GLU E  1 105 ? -33.110 -29.128 51.081  1.00 65.39  ? 105  GLU E OE2   1 
ATOM   3612  N  N     . ASP E  1 106 ? -29.403 -25.820 55.355  1.00 56.01  ? 106  ASP E N     1 
ATOM   3613  C  CA    . ASP E  1 106 ? -28.144 -25.365 55.944  1.00 55.68  ? 106  ASP E CA    1 
ATOM   3614  C  C     . ASP E  1 106 ? -28.336 -24.656 57.285  1.00 54.97  ? 106  ASP E C     1 
ATOM   3615  O  O     . ASP E  1 106 ? -27.596 -24.899 58.242  1.00 54.49  ? 106  ASP E O     1 
ATOM   3616  C  CB    . ASP E  1 106 ? -27.411 -24.435 54.984  1.00 55.82  ? 106  ASP E CB    1 
ATOM   3617  C  CG    . ASP E  1 106 ? -26.869 -25.153 53.751  1.00 59.15  ? 106  ASP E CG    1 
ATOM   3618  O  OD1   . ASP E  1 106 ? -26.822 -26.414 53.733  1.00 63.07  ? 106  ASP E OD1   1 
ATOM   3619  O  OD2   . ASP E  1 106 ? -26.476 -24.441 52.782  1.00 62.08  ? 106  ASP E OD2   1 
ATOM   3620  N  N     . THR E  1 107 ? -29.319 -23.770 57.356  1.00 54.16  ? 107  THR E N     1 
ATOM   3621  C  CA    . THR E  1 107 ? -29.605 -23.064 58.601  1.00 53.86  ? 107  THR E CA    1 
ATOM   3622  C  C     . THR E  1 107 ? -29.933 -24.055 59.725  1.00 53.51  ? 107  THR E C     1 
ATOM   3623  O  O     . THR E  1 107 ? -29.376 -23.998 60.824  1.00 53.38  ? 107  THR E O     1 
ATOM   3624  C  CB    . THR E  1 107 ? -30.767 -22.102 58.371  1.00 54.15  ? 107  THR E CB    1 
ATOM   3625  O  OG1   . THR E  1 107 ? -30.457 -21.274 57.243  1.00 54.33  ? 107  THR E OG1   1 
ATOM   3626  C  CG2   . THR E  1 107 ? -31.043 -21.254 59.598  1.00 52.39  ? 107  THR E CG2   1 
ATOM   3627  N  N     . ASN E  1 108 ? -30.838 -24.975 59.425  1.00 53.41  ? 108  ASN E N     1 
ATOM   3628  C  CA    . ASN E  1 108 ? -31.185 -26.065 60.339  1.00 52.77  ? 108  ASN E CA    1 
ATOM   3629  C  C     . ASN E  1 108 ? -29.986 -26.852 60.877  1.00 51.78  ? 108  ASN E C     1 
ATOM   3630  O  O     . ASN E  1 108 ? -29.901 -27.125 62.075  1.00 51.72  ? 108  ASN E O     1 
ATOM   3631  C  CB    . ASN E  1 108 ? -32.172 -27.001 59.659  1.00 53.14  ? 108  ASN E CB    1 
ATOM   3632  C  CG    . ASN E  1 108 ? -32.947 -27.823 60.641  1.00 53.64  ? 108  ASN E CG    1 
ATOM   3633  O  OD1   . ASN E  1 108 ? -33.266 -27.363 61.724  1.00 54.73  ? 108  ASN E OD1   1 
ATOM   3634  N  ND2   . ASN E  1 108 ? -33.247 -29.049 60.272  1.00 54.28  ? 108  ASN E ND2   1 
ATOM   3635  N  N     . LEU E  1 109 ? -29.050 -27.198 60.005  1.00 50.99  ? 109  LEU E N     1 
ATOM   3636  C  CA    . LEU E  1 109 ? -27.817 -27.845 60.459  1.00 50.63  ? 109  LEU E CA    1 
ATOM   3637  C  C     . LEU E  1 109 ? -27.029 -26.999 61.440  1.00 50.69  ? 109  LEU E C     1 
ATOM   3638  O  O     . LEU E  1 109 ? -26.504 -27.519 62.420  1.00 51.55  ? 109  LEU E O     1 
ATOM   3639  C  CB    . LEU E  1 109 ? -26.928 -28.254 59.291  1.00 50.18  ? 109  LEU E CB    1 
ATOM   3640  C  CG    . LEU E  1 109 ? -27.441 -29.424 58.447  1.00 49.92  ? 109  LEU E CG    1 
ATOM   3641  C  CD1   . LEU E  1 109 ? -26.560 -29.582 57.218  1.00 48.60  ? 109  LEU E CD1   1 
ATOM   3642  C  CD2   . LEU E  1 109 ? -27.495 -30.737 59.265  1.00 48.36  ? 109  LEU E CD2   1 
ATOM   3643  N  N     . CYS E  1 110 ? -26.956 -25.699 61.206  1.00 50.72  ? 110  CYS E N     1 
ATOM   3644  C  CA    . CYS E  1 110 ? -26.248 -24.824 62.129  1.00 51.34  ? 110  CYS E CA    1 
ATOM   3645  C  C     . CYS E  1 110 ? -26.977 -24.744 63.470  1.00 51.84  ? 110  CYS E C     1 
ATOM   3646  O  O     . CYS E  1 110 ? -26.351 -24.846 64.531  1.00 51.76  ? 110  CYS E O     1 
ATOM   3647  C  CB    . CYS E  1 110 ? -26.054 -23.425 61.533  1.00 51.73  ? 110  CYS E CB    1 
ATOM   3648  S  SG    . CYS E  1 110 ? -25.087 -23.321 59.991  1.00 51.65  ? 110  CYS E SG    1 
ATOM   3649  N  N     . ALA E  1 111 ? -28.297 -24.569 63.428  1.00 52.47  ? 111  ALA E N     1 
ATOM   3650  C  CA    . ALA E  1 111 ? -29.101 -24.709 64.639  1.00 53.18  ? 111  ALA E CA    1 
ATOM   3651  C  C     . ALA E  1 111 ? -28.719 -25.987 65.391  1.00 54.07  ? 111  ALA E C     1 
ATOM   3652  O  O     . ALA E  1 111 ? -28.329 -25.924 66.555  1.00 54.68  ? 111  ALA E O     1 
ATOM   3653  C  CB    . ALA E  1 111 ? -30.571 -24.713 64.302  1.00 52.98  ? 111  ALA E CB    1 
ATOM   3654  N  N     . ILE E  1 112 ? -28.793 -27.141 64.724  1.00 54.48  ? 112  ILE E N     1 
ATOM   3655  C  CA    . ILE E  1 112 ? -28.495 -28.398 65.398  1.00 55.37  ? 112  ILE E CA    1 
ATOM   3656  C  C     . ILE E  1 112 ? -27.053 -28.463 65.908  1.00 56.56  ? 112  ILE E C     1 
ATOM   3657  O  O     . ILE E  1 112 ? -26.786 -29.037 66.962  1.00 57.51  ? 112  ILE E O     1 
ATOM   3658  C  CB    . ILE E  1 112 ? -28.797 -29.623 64.504  1.00 55.32  ? 112  ILE E CB    1 
ATOM   3659  C  CG1   . ILE E  1 112 ? -30.302 -29.840 64.399  1.00 54.47  ? 112  ILE E CG1   1 
ATOM   3660  C  CG2   . ILE E  1 112 ? -28.109 -30.881 65.045  1.00 54.11  ? 112  ILE E CG2   1 
ATOM   3661  C  CD1   . ILE E  1 112 ? -30.741 -30.271 63.035  1.00 52.97  ? 112  ILE E CD1   1 
ATOM   3662  N  N     . HIS E  1 113 ? -26.123 -27.891 65.154  1.00 57.25  ? 113  HIS E N     1 
ATOM   3663  C  CA    . HIS E  1 113 ? -24.737 -27.825 65.592  1.00 57.66  ? 113  HIS E CA    1 
ATOM   3664  C  C     . HIS E  1 113 ? -24.620 -27.162 66.959  1.00 58.36  ? 113  HIS E C     1 
ATOM   3665  O  O     . HIS E  1 113 ? -23.720 -27.478 67.722  1.00 58.83  ? 113  HIS E O     1 
ATOM   3666  C  CB    . HIS E  1 113 ? -23.900 -27.065 64.564  1.00 57.38  ? 113  HIS E CB    1 
ATOM   3667  C  CG    . HIS E  1 113 ? -22.431 -27.095 64.846  1.00 56.61  ? 113  HIS E CG    1 
ATOM   3668  N  ND1   . HIS E  1 113 ? -21.651 -28.201 64.591  1.00 54.58  ? 113  HIS E ND1   1 
ATOM   3669  C  CD2   . HIS E  1 113 ? -21.600 -26.158 65.365  1.00 55.21  ? 113  HIS E CD2   1 
ATOM   3670  C  CE1   . HIS E  1 113 ? -20.400 -27.943 64.932  1.00 54.59  ? 113  HIS E CE1   1 
ATOM   3671  N  NE2   . HIS E  1 113 ? -20.344 -26.714 65.412  1.00 54.29  ? 113  HIS E NE2   1 
ATOM   3672  N  N     . ALA E  1 114 ? -25.533 -26.247 67.270  1.00 59.49  ? 114  ALA E N     1 
ATOM   3673  C  CA    . ALA E  1 114 ? -25.502 -25.518 68.547  1.00 60.77  ? 114  ALA E CA    1 
ATOM   3674  C  C     . ALA E  1 114 ? -26.399 -26.166 69.604  1.00 61.74  ? 114  ALA E C     1 
ATOM   3675  O  O     . ALA E  1 114 ? -26.845 -25.500 70.542  1.00 61.72  ? 114  ALA E O     1 
ATOM   3676  C  CB    . ALA E  1 114 ? -25.887 -24.064 68.341  1.00 60.49  ? 114  ALA E CB    1 
ATOM   3677  N  N     . LYS E  1 115 ? -26.627 -27.479 69.453  1.00 62.85  ? 115  LYS E N     1 
ATOM   3678  C  CA    . LYS E  1 115 ? -27.547 -28.251 70.300  1.00 63.48  ? 115  LYS E CA    1 
ATOM   3679  C  C     . LYS E  1 115 ? -28.909 -27.560 70.436  1.00 63.23  ? 115  LYS E C     1 
ATOM   3680  O  O     . LYS E  1 115 ? -29.484 -27.538 71.510  1.00 63.22  ? 115  LYS E O     1 
ATOM   3681  C  CB    . LYS E  1 115 ? -26.973 -28.507 71.703  1.00 64.08  ? 115  LYS E CB    1 
ATOM   3682  C  CG    . LYS E  1 115 ? -25.473 -28.417 71.845  1.00 65.78  ? 115  LYS E CG    1 
ATOM   3683  C  CD    . LYS E  1 115 ? -24.873 -29.779 72.106  1.00 69.49  ? 115  LYS E CD    1 
ATOM   3684  C  CE    . LYS E  1 115 ? -23.651 -29.634 73.014  1.00 72.35  ? 115  LYS E CE    1 
ATOM   3685  N  NZ    . LYS E  1 115 ? -22.863 -30.902 73.107  1.00 75.67  ? 115  LYS E NZ    1 
ATOM   3686  N  N     . ARG E  1 116 ? -29.403 -26.983 69.348  1.00 63.11  ? 116  ARG E N     1 
ATOM   3687  C  CA    . ARG E  1 116 ? -30.713 -26.358 69.329  1.00 62.65  ? 116  ARG E CA    1 
ATOM   3688  C  C     . ARG E  1 116 ? -31.581 -27.055 68.290  1.00 62.97  ? 116  ARG E C     1 
ATOM   3689  O  O     . ARG E  1 116 ? -31.130 -27.957 67.574  1.00 63.53  ? 116  ARG E O     1 
ATOM   3690  C  CB    . ARG E  1 116 ? -30.601 -24.867 69.018  1.00 62.40  ? 116  ARG E CB    1 
ATOM   3691  C  CG    . ARG E  1 116 ? -30.218 -23.990 70.205  1.00 62.05  ? 116  ARG E CG    1 
ATOM   3692  C  CD    . ARG E  1 116 ? -30.262 -22.487 69.824  1.00 62.31  ? 116  ARG E CD    1 
ATOM   3693  N  NE    . ARG E  1 116 ? -29.068 -22.015 69.095  1.00 60.79  ? 116  ARG E NE    1 
ATOM   3694  C  CZ    . ARG E  1 116 ? -29.022 -21.779 67.781  1.00 60.09  ? 116  ARG E CZ    1 
ATOM   3695  N  NH1   . ARG E  1 116 ? -30.101 -21.963 67.021  1.00 58.72  ? 116  ARG E NH1   1 
ATOM   3696  N  NH2   . ARG E  1 116 ? -27.894 -21.355 67.220  1.00 58.82  ? 116  ARG E NH2   1 
ATOM   3697  N  N     . VAL E  1 117 ? -32.828 -26.618 68.206  1.00 62.76  ? 117  VAL E N     1 
ATOM   3698  C  CA    . VAL E  1 117 ? -33.853 -27.272 67.421  1.00 62.47  ? 117  VAL E CA    1 
ATOM   3699  C  C     . VAL E  1 117 ? -34.607 -26.154 66.731  1.00 62.64  ? 117  VAL E C     1 
ATOM   3700  O  O     . VAL E  1 117 ? -35.375 -26.384 65.792  1.00 62.74  ? 117  VAL E O     1 
ATOM   3701  C  CB    . VAL E  1 117 ? -34.806 -28.045 68.376  1.00 62.65  ? 117  VAL E CB    1 
ATOM   3702  C  CG1   . VAL E  1 117 ? -36.187 -28.210 67.774  1.00 62.55  ? 117  VAL E CG1   1 
ATOM   3703  C  CG2   . VAL E  1 117 ? -34.194 -29.395 68.778  1.00 61.86  ? 117  VAL E CG2   1 
ATOM   3704  N  N     . THR E  1 118 ? -34.370 -24.936 67.226  1.00 62.62  ? 118  THR E N     1 
ATOM   3705  C  CA    . THR E  1 118 ? -35.007 -23.726 66.743  1.00 62.40  ? 118  THR E CA    1 
ATOM   3706  C  C     . THR E  1 118 ? -34.018 -22.932 65.901  1.00 62.22  ? 118  THR E C     1 
ATOM   3707  O  O     . THR E  1 118 ? -32.909 -22.639 66.351  1.00 62.46  ? 118  THR E O     1 
ATOM   3708  C  CB    . THR E  1 118 ? -35.443 -22.836 67.917  1.00 62.84  ? 118  THR E CB    1 
ATOM   3709  O  OG1   . THR E  1 118 ? -35.879 -23.649 69.028  1.00 62.89  ? 118  THR E OG1   1 
ATOM   3710  C  CG2   . THR E  1 118 ? -36.561 -21.882 67.470  1.00 62.59  ? 118  THR E CG2   1 
ATOM   3711  N  N     . ILE E  1 119 ? -34.407 -22.582 64.680  1.00 61.73  ? 119  ILE E N     1 
ATOM   3712  C  CA    . ILE E  1 119 ? -33.541 -21.768 63.839  1.00 61.11  ? 119  ILE E CA    1 
ATOM   3713  C  C     . ILE E  1 119 ? -33.663 -20.279 64.176  1.00 61.61  ? 119  ILE E C     1 
ATOM   3714  O  O     . ILE E  1 119 ? -34.766 -19.740 64.325  1.00 61.25  ? 119  ILE E O     1 
ATOM   3715  C  CB    . ILE E  1 119 ? -33.742 -22.033 62.322  1.00 60.66  ? 119  ILE E CB    1 
ATOM   3716  C  CG1   . ILE E  1 119 ? -35.119 -21.580 61.842  1.00 58.90  ? 119  ILE E CG1   1 
ATOM   3717  C  CG2   . ILE E  1 119 ? -33.517 -23.503 62.014  1.00 60.57  ? 119  ILE E CG2   1 
ATOM   3718  C  CD1   . ILE E  1 119 ? -35.217 -21.464 60.340  1.00 58.41  ? 119  ILE E CD1   1 
ATOM   3719  N  N     . MET E  1 120 ? -32.508 -19.633 64.310  1.00 62.14  ? 120  MET E N     1 
ATOM   3720  C  CA    . MET E  1 120 ? -32.415 -18.206 64.623  1.00 62.55  ? 120  MET E CA    1 
ATOM   3721  C  C     . MET E  1 120 ? -31.620 -17.505 63.528  1.00 62.16  ? 120  MET E C     1 
ATOM   3722  O  O     . MET E  1 120 ? -30.909 -18.163 62.780  1.00 62.68  ? 120  MET E O     1 
ATOM   3723  C  CB    . MET E  1 120 ? -31.759 -18.031 65.986  1.00 62.19  ? 120  MET E CB    1 
ATOM   3724  C  CG    . MET E  1 120 ? -32.555 -18.707 67.082  1.00 62.38  ? 120  MET E CG    1 
ATOM   3725  S  SD    . MET E  1 120 ? -31.776 -18.718 68.692  1.00 64.32  ? 120  MET E SD    1 
ATOM   3726  C  CE    . MET E  1 120 ? -32.915 -19.742 69.618  1.00 63.63  ? 120  MET E CE    1 
ATOM   3727  N  N     . PRO E  1 121 ? -31.770 -16.178 63.388  1.00 61.96  ? 121  PRO E N     1 
ATOM   3728  C  CA    . PRO E  1 121 ? -30.957 -15.418 62.435  1.00 61.28  ? 121  PRO E CA    1 
ATOM   3729  C  C     . PRO E  1 121 ? -29.446 -15.724 62.464  1.00 60.73  ? 121  PRO E C     1 
ATOM   3730  O  O     . PRO E  1 121 ? -28.847 -15.853 61.399  1.00 60.75  ? 121  PRO E O     1 
ATOM   3731  C  CB    . PRO E  1 121 ? -31.239 -13.973 62.833  1.00 61.06  ? 121  PRO E CB    1 
ATOM   3732  C  CG    . PRO E  1 121 ? -32.655 -14.016 63.253  1.00 61.63  ? 121  PRO E CG    1 
ATOM   3733  C  CD    . PRO E  1 121 ? -32.747 -15.301 64.063  1.00 62.31  ? 121  PRO E CD    1 
ATOM   3734  N  N     . LYS E  1 122 ? -28.835 -15.851 63.644  1.00 59.95  ? 122  LYS E N     1 
ATOM   3735  C  CA    . LYS E  1 122 ? -27.415 -16.222 63.717  1.00 59.65  ? 122  LYS E CA    1 
ATOM   3736  C  C     . LYS E  1 122 ? -27.109 -17.477 62.878  1.00 59.01  ? 122  LYS E C     1 
ATOM   3737  O  O     . LYS E  1 122 ? -26.028 -17.610 62.297  1.00 59.22  ? 122  LYS E O     1 
ATOM   3738  C  CB    . LYS E  1 122 ? -26.943 -16.392 65.165  1.00 59.24  ? 122  LYS E CB    1 
ATOM   3739  C  CG    . LYS E  1 122 ? -27.740 -17.432 65.981  1.00 61.35  ? 122  LYS E CG    1 
ATOM   3740  C  CD    . LYS E  1 122 ? -27.116 -17.762 67.350  1.00 60.99  ? 122  LYS E CD    1 
ATOM   3741  C  CE    . LYS E  1 122 ? -27.121 -16.553 68.295  1.00 64.49  ? 122  LYS E CE    1 
ATOM   3742  N  NZ    . LYS E  1 122 ? -26.817 -16.945 69.700  1.00 65.89  ? 122  LYS E NZ    1 
ATOM   3743  N  N     . ASP E  1 123 ? -28.081 -18.379 62.790  1.00 58.26  ? 123  ASP E N     1 
ATOM   3744  C  CA    . ASP E  1 123 ? -27.940 -19.582 61.984  1.00 57.28  ? 123  ASP E CA    1 
ATOM   3745  C  C     . ASP E  1 123 ? -27.900 -19.252 60.500  1.00 56.77  ? 123  ASP E C     1 
ATOM   3746  O  O     . ASP E  1 123 ? -26.993 -19.688 59.797  1.00 56.87  ? 123  ASP E O     1 
ATOM   3747  C  CB    . ASP E  1 123 ? -29.045 -20.594 62.301  1.00 56.59  ? 123  ASP E CB    1 
ATOM   3748  C  CG    . ASP E  1 123 ? -28.986 -21.101 63.731  1.00 56.40  ? 123  ASP E CG    1 
ATOM   3749  O  OD1   . ASP E  1 123 ? -27.878 -21.354 64.265  1.00 55.72  ? 123  ASP E OD1   1 
ATOM   3750  O  OD2   . ASP E  1 123 ? -30.064 -21.264 64.330  1.00 55.61  ? 123  ASP E OD2   1 
ATOM   3751  N  N     . ILE E  1 124 ? -28.869 -18.483 60.022  1.00 56.63  ? 124  ILE E N     1 
ATOM   3752  C  CA    . ILE E  1 124 ? -28.869 -18.059 58.609  1.00 56.87  ? 124  ILE E CA    1 
ATOM   3753  C  C     . ILE E  1 124 ? -27.574 -17.306 58.262  1.00 56.61  ? 124  ILE E C     1 
ATOM   3754  O  O     . ILE E  1 124 ? -26.940 -17.566 57.241  1.00 56.38  ? 124  ILE E O     1 
ATOM   3755  C  CB    . ILE E  1 124 ? -30.079 -17.165 58.264  1.00 56.44  ? 124  ILE E CB    1 
ATOM   3756  C  CG1   . ILE E  1 124 ? -31.394 -17.897 58.544  1.00 56.73  ? 124  ILE E CG1   1 
ATOM   3757  C  CG2   . ILE E  1 124 ? -30.037 -16.773 56.801  1.00 57.30  ? 124  ILE E CG2   1 
ATOM   3758  C  CD1   . ILE E  1 124 ? -32.642 -17.203 57.938  1.00 57.32  ? 124  ILE E CD1   1 
ATOM   3759  N  N     . GLN E  1 125 ? -27.192 -16.399 59.155  1.00 56.57  ? 125  GLN E N     1 
ATOM   3760  C  CA    . GLN E  1 125 ? -26.003 -15.574 59.014  1.00 56.59  ? 125  GLN E CA    1 
ATOM   3761  C  C     . GLN E  1 125 ? -24.754 -16.418 58.866  1.00 56.00  ? 125  GLN E C     1 
ATOM   3762  O  O     . GLN E  1 125 ? -23.923 -16.141 57.996  1.00 56.13  ? 125  GLN E O     1 
ATOM   3763  C  CB    . GLN E  1 125 ? -25.896 -14.606 60.195  1.00 56.32  ? 125  GLN E CB    1 
ATOM   3764  C  CG    . GLN E  1 125 ? -26.876 -13.439 60.041  1.00 58.03  ? 125  GLN E CG    1 
ATOM   3765  C  CD    . GLN E  1 125 ? -27.271 -12.760 61.357  1.00 59.46  ? 125  GLN E CD    1 
ATOM   3766  O  OE1   . GLN E  1 125 ? -26.506 -12.749 62.341  1.00 57.44  ? 125  GLN E OE1   1 
ATOM   3767  N  NE2   . GLN E  1 125 ? -28.480 -12.172 61.365  1.00 58.17  ? 125  GLN E NE2   1 
ATOM   3768  N  N     . LEU E  1 126 ? -24.640 -17.461 59.690  1.00 55.29  ? 126  LEU E N     1 
ATOM   3769  C  CA    . LEU E  1 126 ? -23.523 -18.390 59.593  1.00 54.52  ? 126  LEU E CA    1 
ATOM   3770  C  C     . LEU E  1 126 ? -23.562 -19.209 58.302  1.00 54.92  ? 126  LEU E C     1 
ATOM   3771  O  O     . LEU E  1 126 ? -22.534 -19.381 57.632  1.00 54.94  ? 126  LEU E O     1 
ATOM   3772  C  CB    . LEU E  1 126 ? -23.514 -19.315 60.783  1.00 54.05  ? 126  LEU E CB    1 
ATOM   3773  C  CG    . LEU E  1 126 ? -22.344 -20.277 60.797  1.00 54.43  ? 126  LEU E CG    1 
ATOM   3774  C  CD1   . LEU E  1 126 ? -21.013 -19.512 60.852  1.00 54.42  ? 126  LEU E CD1   1 
ATOM   3775  C  CD2   . LEU E  1 126 ? -22.464 -21.248 61.961  1.00 53.98  ? 126  LEU E CD2   1 
ATOM   3776  N  N     . ALA E  1 127 ? -24.740 -19.706 57.934  1.00 54.85  ? 127  ALA E N     1 
ATOM   3777  C  CA    . ALA E  1 127 ? -24.840 -20.491 56.722  1.00 55.30  ? 127  ALA E CA    1 
ATOM   3778  C  C     . ALA E  1 127 ? -24.366 -19.674 55.539  1.00 55.76  ? 127  ALA E C     1 
ATOM   3779  O  O     . ALA E  1 127 ? -23.555 -20.138 54.719  1.00 55.70  ? 127  ALA E O     1 
ATOM   3780  C  CB    . ALA E  1 127 ? -26.256 -20.982 56.500  1.00 55.28  ? 127  ALA E CB    1 
ATOM   3781  N  N     . ARG E  1 128 ? -24.865 -18.449 55.457  1.00 56.10  ? 128  ARG E N     1 
ATOM   3782  C  CA    . ARG E  1 128 ? -24.546 -17.604 54.330  1.00 56.74  ? 128  ARG E CA    1 
ATOM   3783  C  C     . ARG E  1 128 ? -23.067 -17.227 54.321  1.00 56.78  ? 128  ARG E C     1 
ATOM   3784  O  O     . ARG E  1 128 ? -22.463 -17.166 53.254  1.00 56.41  ? 128  ARG E O     1 
ATOM   3785  C  CB    . ARG E  1 128 ? -25.466 -16.393 54.270  1.00 56.84  ? 128  ARG E CB    1 
ATOM   3786  C  CG    . ARG E  1 128 ? -26.931 -16.773 54.026  1.00 57.75  ? 128  ARG E CG    1 
ATOM   3787  C  CD    . ARG E  1 128 ? -27.611 -15.773 53.100  1.00 59.74  ? 128  ARG E CD    1 
ATOM   3788  N  NE    . ARG E  1 128 ? -27.453 -14.411 53.608  1.00 62.77  ? 128  ARG E NE    1 
ATOM   3789  C  CZ    . ARG E  1 128 ? -27.136 -13.348 52.869  1.00 62.34  ? 128  ARG E CZ    1 
ATOM   3790  N  NH1   . ARG E  1 128 ? -26.919 -13.452 51.567  1.00 61.59  ? 128  ARG E NH1   1 
ATOM   3791  N  NH2   . ARG E  1 128 ? -27.026 -12.172 53.446  1.00 63.47  ? 128  ARG E NH2   1 
ATOM   3792  N  N     . ARG E  1 129 ? -22.474 -17.034 55.494  1.00 57.28  ? 129  ARG E N     1 
ATOM   3793  C  CA    . ARG E  1 129 ? -21.052 -16.751 55.547  1.00 58.70  ? 129  ARG E CA    1 
ATOM   3794  C  C     . ARG E  1 129 ? -20.242 -17.931 55.050  1.00 59.34  ? 129  ARG E C     1 
ATOM   3795  O  O     . ARG E  1 129 ? -19.413 -17.785 54.151  1.00 59.20  ? 129  ARG E O     1 
ATOM   3796  C  CB    . ARG E  1 129 ? -20.597 -16.319 56.934  1.00 59.20  ? 129  ARG E CB    1 
ATOM   3797  C  CG    . ARG E  1 129 ? -19.093 -16.047 56.995  1.00 62.11  ? 129  ARG E CG    1 
ATOM   3798  C  CD    . ARG E  1 129 ? -18.777 -15.112 58.136  1.00 67.96  ? 129  ARG E CD    1 
ATOM   3799  N  NE    . ARG E  1 129 ? -17.374 -14.683 58.133  1.00 72.24  ? 129  ARG E NE    1 
ATOM   3800  C  CZ    . ARG E  1 129 ? -16.762 -14.077 59.157  1.00 73.53  ? 129  ARG E CZ    1 
ATOM   3801  N  NH1   . ARG E  1 129 ? -17.417 -13.811 60.294  1.00 72.77  ? 129  ARG E NH1   1 
ATOM   3802  N  NH2   . ARG E  1 129 ? -15.481 -13.739 59.044  1.00 73.68  ? 129  ARG E NH2   1 
ATOM   3803  N  N     . ILE E  1 130 ? -20.498 -19.110 55.610  1.00 60.61  ? 130  ILE E N     1 
ATOM   3804  C  CA    . ILE E  1 130 ? -19.808 -20.313 55.162  1.00 61.78  ? 130  ILE E CA    1 
ATOM   3805  C  C     . ILE E  1 130 ? -20.047 -20.603 53.678  1.00 62.90  ? 130  ILE E C     1 
ATOM   3806  O  O     . ILE E  1 130 ? -19.159 -21.087 53.005  1.00 63.57  ? 130  ILE E O     1 
ATOM   3807  C  CB    . ILE E  1 130 ? -20.081 -21.522 56.076  1.00 61.68  ? 130  ILE E CB    1 
ATOM   3808  C  CG1   . ILE E  1 130 ? -19.533 -21.227 57.467  1.00 62.14  ? 130  ILE E CG1   1 
ATOM   3809  C  CG2   . ILE E  1 130 ? -19.386 -22.762 55.570  1.00 60.74  ? 130  ILE E CG2   1 
ATOM   3810  C  CD1   . ILE E  1 130 ? -20.022 -22.161 58.516  1.00 62.95  ? 130  ILE E CD1   1 
ATOM   3811  N  N     . ARG E  1 131 ? -21.217 -20.276 53.158  1.00 64.71  ? 131  ARG E N     1 
ATOM   3812  C  CA    . ARG E  1 131 ? -21.440 -20.366 51.715  1.00 66.88  ? 131  ARG E CA    1 
ATOM   3813  C  C     . ARG E  1 131 ? -20.564 -19.412 50.908  1.00 68.80  ? 131  ARG E C     1 
ATOM   3814  O  O     . ARG E  1 131 ? -20.432 -19.569 49.703  1.00 68.80  ? 131  ARG E O     1 
ATOM   3815  C  CB    . ARG E  1 131 ? -22.895 -20.061 51.381  1.00 66.63  ? 131  ARG E CB    1 
ATOM   3816  C  CG    . ARG E  1 131 ? -23.786 -21.261 51.315  1.00 65.91  ? 131  ARG E CG    1 
ATOM   3817  C  CD    . ARG E  1 131 ? -25.107 -20.919 51.953  1.00 66.06  ? 131  ARG E CD    1 
ATOM   3818  N  NE    . ARG E  1 131 ? -26.110 -21.954 51.737  1.00 65.92  ? 131  ARG E NE    1 
ATOM   3819  C  CZ    . ARG E  1 131 ? -27.009 -21.929 50.759  1.00 65.65  ? 131  ARG E CZ    1 
ATOM   3820  N  NH1   . ARG E  1 131 ? -27.036 -20.911 49.905  1.00 64.26  ? 131  ARG E NH1   1 
ATOM   3821  N  NH2   . ARG E  1 131 ? -27.887 -22.923 50.640  1.00 64.64  ? 131  ARG E NH2   1 
ATOM   3822  N  N     . GLY E  1 132 ? -19.987 -18.410 51.563  1.00 71.29  ? 132  GLY E N     1 
ATOM   3823  C  CA    . GLY E  1 132 ? -19.327 -17.320 50.846  1.00 74.32  ? 132  GLY E CA    1 
ATOM   3824  C  C     . GLY E  1 132 ? -20.293 -16.475 50.022  1.00 76.57  ? 132  GLY E C     1 
ATOM   3825  O  O     . GLY E  1 132 ? -19.963 -16.041 48.918  1.00 76.95  ? 132  GLY E O     1 
ATOM   3826  N  N     . GLU E  1 133 ? -21.495 -16.263 50.556  1.00 78.79  ? 133  GLU E N     1 
ATOM   3827  C  CA    . GLU E  1 133 ? -22.490 -15.360 49.972  1.00 80.78  ? 133  GLU E CA    1 
ATOM   3828  C  C     . GLU E  1 133 ? -22.331 -13.999 50.626  1.00 82.63  ? 133  GLU E C     1 
ATOM   3829  O  O     . GLU E  1 133 ? -22.733 -12.968 50.082  1.00 82.89  ? 133  GLU E O     1 
ATOM   3830  C  CB    . GLU E  1 133 ? -23.906 -15.871 50.255  1.00 80.51  ? 133  GLU E CB    1 
ATOM   3831  C  CG    . GLU E  1 133 ? -24.301 -17.121 49.495  1.00 80.23  ? 133  GLU E CG    1 
ATOM   3832  C  CD    . GLU E  1 133 ? -25.740 -17.518 49.745  1.00 80.53  ? 133  GLU E CD    1 
ATOM   3833  O  OE1   . GLU E  1 133 ? -26.582 -16.628 49.975  1.00 80.36  ? 133  GLU E OE1   1 
ATOM   3834  O  OE2   . GLU E  1 133 ? -26.040 -18.728 49.707  1.00 80.95  ? 133  GLU E OE2   1 
ATOM   3835  N  N     . ARG E  1 134 ? -21.751 -14.031 51.819  1.00 84.93  ? 134  ARG E N     1 
ATOM   3836  C  CA    . ARG E  1 134 ? -21.598 -12.878 52.671  1.00 87.32  ? 134  ARG E CA    1 
ATOM   3837  C  C     . ARG E  1 134 ? -20.140 -12.841 53.119  1.00 88.40  ? 134  ARG E C     1 
ATOM   3838  O  O     . ARG E  1 134 ? -19.534 -13.892 53.385  1.00 88.39  ? 134  ARG E O     1 
ATOM   3839  C  CB    . ARG E  1 134 ? -22.550 -13.010 53.878  1.00 87.60  ? 134  ARG E CB    1 
ATOM   3840  C  CG    . ARG E  1 134 ? -22.338 -12.022 55.044  1.00 90.06  ? 134  ARG E CG    1 
ATOM   3841  C  CD    . ARG E  1 134 ? -22.835 -10.596 54.729  1.00 93.77  ? 134  ARG E CD    1 
ATOM   3842  N  NE    . ARG E  1 134 ? -24.298 -10.503 54.725  1.00 96.45  ? 134  ARG E NE    1 
ATOM   3843  C  CZ    . ARG E  1 134 ? -24.989 -9.387  54.485  1.00 98.53  ? 134  ARG E CZ    1 
ATOM   3844  N  NH1   . ARG E  1 134 ? -24.357 -8.241  54.226  1.00 100.23 ? 134  ARG E NH1   1 
ATOM   3845  N  NH2   . ARG E  1 134 ? -26.321 -9.411  54.503  1.00 98.37  ? 134  ARG E NH2   1 
ATOM   3846  N  N     . ALA E  1 135 ? -19.582 -11.629 53.178  1.00 89.79  ? 135  ALA E N     1 
ATOM   3847  C  CA    . ALA E  1 135 ? -18.242 -11.401 53.733  1.00 90.91  ? 135  ALA E CA    1 
ATOM   3848  C  C     . ALA E  1 135 ? -18.136 -11.915 55.190  1.00 91.51  ? 135  ALA E C     1 
ATOM   3849  O  O     . ALA E  1 135 ? -17.118 -12.511 55.584  1.00 91.97  ? 135  ALA E O     1 
ATOM   3850  C  CB    . ALA E  1 135 ? -17.864 -9.903  53.639  1.00 91.01  ? 135  ALA E CB    1 
ATOM   3851  O  OXT   . ALA E  1 135 ? -19.069 -11.769 56.005  1.00 91.64  ? 135  ALA E OXT   1 
ATOM   3852  N  N     . ASN F  2 25  ? -44.560 -4.633  49.596  1.00 78.41  ? 25   ASN F N     1 
ATOM   3853  C  CA    . ASN F  2 25  ? -44.437 -5.782  48.651  1.00 78.71  ? 25   ASN F CA    1 
ATOM   3854  C  C     . ASN F  2 25  ? -43.670 -6.960  49.265  1.00 78.67  ? 25   ASN F C     1 
ATOM   3855  O  O     . ASN F  2 25  ? -44.094 -8.114  49.172  1.00 78.82  ? 25   ASN F O     1 
ATOM   3856  C  CB    . ASN F  2 25  ? -43.768 -5.333  47.344  1.00 78.73  ? 25   ASN F CB    1 
ATOM   3857  C  CG    . ASN F  2 25  ? -44.777 -4.948  46.250  1.00 79.02  ? 25   ASN F CG    1 
ATOM   3858  O  OD1   . ASN F  2 25  ? -45.967 -5.284  46.317  1.00 78.31  ? 25   ASN F OD1   1 
ATOM   3859  N  ND2   . ASN F  2 25  ? -44.286 -4.259  45.222  1.00 79.16  ? 25   ASN F ND2   1 
ATOM   3860  N  N     . ILE F  2 26  ? -42.548 -6.636  49.902  1.00 78.54  ? 26   ILE F N     1 
ATOM   3861  C  CA    . ILE F  2 26  ? -41.669 -7.589  50.555  1.00 78.26  ? 26   ILE F CA    1 
ATOM   3862  C  C     . ILE F  2 26  ? -42.399 -8.362  51.657  1.00 78.27  ? 26   ILE F C     1 
ATOM   3863  O  O     . ILE F  2 26  ? -41.975 -9.451  52.051  1.00 78.17  ? 26   ILE F O     1 
ATOM   3864  C  CB    . ILE F  2 26  ? -40.398 -6.847  51.113  1.00 78.14  ? 26   ILE F CB    1 
ATOM   3865  C  CG1   . ILE F  2 26  ? -39.080 -7.569  50.765  1.00 78.11  ? 26   ILE F CG1   1 
ATOM   3866  C  CG2   . ILE F  2 26  ? -40.541 -6.455  52.600  1.00 78.58  ? 26   ILE F CG2   1 
ATOM   3867  C  CD1   . ILE F  2 26  ? -39.040 -9.074  50.969  1.00 77.47  ? 26   ILE F CD1   1 
ATOM   3868  N  N     . GLN F  2 27  ? -43.498 -7.795  52.150  1.00 78.33  ? 27   GLN F N     1 
ATOM   3869  C  CA    . GLN F  2 27  ? -44.316 -8.459  53.166  1.00 78.31  ? 27   GLN F CA    1 
ATOM   3870  C  C     . GLN F  2 27  ? -45.393 -9.364  52.539  1.00 78.04  ? 27   GLN F C     1 
ATOM   3871  O  O     . GLN F  2 27  ? -46.094 -10.085 53.249  1.00 78.46  ? 27   GLN F O     1 
ATOM   3872  C  CB    . GLN F  2 27  ? -44.936 -7.434  54.119  1.00 78.45  ? 27   GLN F CB    1 
ATOM   3873  C  CG    . GLN F  2 27  ? -43.933 -6.480  54.770  1.00 79.76  ? 27   GLN F CG    1 
ATOM   3874  C  CD    . GLN F  2 27  ? -43.221 -7.084  55.971  1.00 82.22  ? 27   GLN F CD    1 
ATOM   3875  O  OE1   . GLN F  2 27  ? -43.765 -7.955  56.653  1.00 84.20  ? 27   GLN F OE1   1 
ATOM   3876  N  NE2   . GLN F  2 27  ? -41.999 -6.620  56.239  1.00 82.27  ? 27   GLN F NE2   1 
ATOM   3877  N  N     . GLY F  2 28  ? -45.524 -9.330  51.214  1.00 77.47  ? 28   GLY F N     1 
ATOM   3878  C  CA    . GLY F  2 28  ? -46.332 -10.322 50.505  1.00 77.24  ? 28   GLY F CA    1 
ATOM   3879  C  C     . GLY F  2 28  ? -45.791 -11.734 50.721  1.00 77.10  ? 28   GLY F C     1 
ATOM   3880  O  O     . GLY F  2 28  ? -46.537 -12.724 50.669  1.00 77.63  ? 28   GLY F O     1 
ATOM   3881  N  N     . ILE F  2 29  ? -44.481 -11.826 50.944  1.00 76.35  ? 29   ILE F N     1 
ATOM   3882  C  CA    . ILE F  2 29  ? -43.845 -13.060 51.372  1.00 75.47  ? 29   ILE F CA    1 
ATOM   3883  C  C     . ILE F  2 29  ? -44.162 -13.187 52.853  1.00 75.30  ? 29   ILE F C     1 
ATOM   3884  O  O     . ILE F  2 29  ? -43.478 -12.627 53.721  1.00 75.14  ? 29   ILE F O     1 
ATOM   3885  C  CB    . ILE F  2 29  ? -42.313 -13.043 51.148  1.00 75.45  ? 29   ILE F CB    1 
ATOM   3886  C  CG1   . ILE F  2 29  ? -41.953 -12.480 49.765  1.00 74.83  ? 29   ILE F CG1   1 
ATOM   3887  C  CG2   . ILE F  2 29  ? -41.721 -14.424 51.386  1.00 75.32  ? 29   ILE F CG2   1 
ATOM   3888  C  CD1   . ILE F  2 29  ? -42.631 -13.162 48.588  1.00 74.63  ? 29   ILE F CD1   1 
ATOM   3889  N  N     . THR F  2 30  ? -45.218 -13.934 53.127  1.00 74.90  ? 30   THR F N     1 
ATOM   3890  C  CA    . THR F  2 30  ? -45.822 -13.962 54.438  1.00 74.97  ? 30   THR F CA    1 
ATOM   3891  C  C     . THR F  2 30  ? -45.181 -14.975 55.394  1.00 74.49  ? 30   THR F C     1 
ATOM   3892  O  O     . THR F  2 30  ? -44.576 -15.959 54.964  1.00 74.65  ? 30   THR F O     1 
ATOM   3893  C  CB    . THR F  2 30  ? -47.320 -14.254 54.295  1.00 75.26  ? 30   THR F CB    1 
ATOM   3894  O  OG1   . THR F  2 30  ? -47.495 -15.507 53.615  1.00 76.14  ? 30   THR F OG1   1 
ATOM   3895  C  CG2   . THR F  2 30  ? -48.004 -13.134 53.488  1.00 75.50  ? 30   THR F CG2   1 
ATOM   3896  N  N     . LYS F  2 31  ? -45.325 -14.713 56.692  1.00 73.71  ? 31   LYS F N     1 
ATOM   3897  C  CA    . LYS F  2 31  ? -44.941 -15.640 57.766  1.00 73.18  ? 31   LYS F CA    1 
ATOM   3898  C  C     . LYS F  2 31  ? -45.328 -17.123 57.501  1.00 72.73  ? 31   LYS F C     1 
ATOM   3899  O  O     . LYS F  2 31  ? -44.470 -18.007 57.596  1.00 72.56  ? 31   LYS F O     1 
ATOM   3900  C  CB    . LYS F  2 31  ? -45.523 -15.119 59.089  1.00 72.90  ? 31   LYS F CB    1 
ATOM   3901  C  CG    . LYS F  2 31  ? -45.333 -15.966 60.317  1.00 72.91  ? 31   LYS F CG    1 
ATOM   3902  C  CD    . LYS F  2 31  ? -45.975 -15.249 61.501  1.00 73.90  ? 31   LYS F CD    1 
ATOM   3903  C  CE    . LYS F  2 31  ? -46.129 -16.150 62.732  1.00 76.43  ? 31   LYS F CE    1 
ATOM   3904  N  NZ    . LYS F  2 31  ? -44.857 -16.322 63.479  1.00 78.07  ? 31   LYS F NZ    1 
ATOM   3905  N  N     . PRO F  2 32  ? -46.615 -17.406 57.184  1.00 72.33  ? 32   PRO F N     1 
ATOM   3906  C  CA    . PRO F  2 32  ? -46.963 -18.791 56.817  1.00 71.52  ? 32   PRO F CA    1 
ATOM   3907  C  C     . PRO F  2 32  ? -46.249 -19.332 55.578  1.00 70.66  ? 32   PRO F C     1 
ATOM   3908  O  O     . PRO F  2 32  ? -45.922 -20.527 55.534  1.00 70.72  ? 32   PRO F O     1 
ATOM   3909  C  CB    . PRO F  2 32  ? -48.478 -18.733 56.569  1.00 71.60  ? 32   PRO F CB    1 
ATOM   3910  C  CG    . PRO F  2 32  ? -48.792 -17.292 56.371  1.00 72.23  ? 32   PRO F CG    1 
ATOM   3911  C  CD    . PRO F  2 32  ? -47.807 -16.533 57.203  1.00 72.13  ? 32   PRO F CD    1 
ATOM   3912  N  N     . ALA F  2 33  ? -46.020 -18.482 54.579  1.00 69.58  ? 33   ALA F N     1 
ATOM   3913  C  CA    . ALA F  2 33  ? -45.283 -18.906 53.378  1.00 68.77  ? 33   ALA F CA    1 
ATOM   3914  C  C     . ALA F  2 33  ? -43.848 -19.291 53.715  1.00 68.08  ? 33   ALA F C     1 
ATOM   3915  O  O     . ALA F  2 33  ? -43.336 -20.296 53.237  1.00 68.26  ? 33   ALA F O     1 
ATOM   3916  C  CB    . ALA F  2 33  ? -45.297 -17.822 52.322  1.00 68.75  ? 33   ALA F CB    1 
ATOM   3917  N  N     . ILE F  2 34  ? -43.218 -18.486 54.555  1.00 67.40  ? 34   ILE F N     1 
ATOM   3918  C  CA    . ILE F  2 34  ? -41.840 -18.690 54.955  1.00 66.96  ? 34   ILE F CA    1 
ATOM   3919  C  C     . ILE F  2 34  ? -41.698 -19.958 55.778  1.00 67.17  ? 34   ILE F C     1 
ATOM   3920  O  O     . ILE F  2 34  ? -40.725 -20.701 55.628  1.00 67.44  ? 34   ILE F O     1 
ATOM   3921  C  CB    . ILE F  2 34  ? -41.307 -17.460 55.720  1.00 66.71  ? 34   ILE F CB    1 
ATOM   3922  C  CG1   . ILE F  2 34  ? -41.086 -16.299 54.737  1.00 65.50  ? 34   ILE F CG1   1 
ATOM   3923  C  CG2   . ILE F  2 34  ? -40.043 -17.807 56.503  1.00 66.25  ? 34   ILE F CG2   1 
ATOM   3924  C  CD1   . ILE F  2 34  ? -40.966 -14.950 55.371  1.00 63.56  ? 34   ILE F CD1   1 
ATOM   3925  N  N     . ARG F  2 35  ? -42.676 -20.197 56.641  1.00 67.45  ? 35   ARG F N     1 
ATOM   3926  C  CA    . ARG F  2 35  ? -42.769 -21.411 57.453  1.00 67.94  ? 35   ARG F CA    1 
ATOM   3927  C  C     . ARG F  2 35  ? -42.842 -22.622 56.522  1.00 67.24  ? 35   ARG F C     1 
ATOM   3928  O  O     . ARG F  2 35  ? -42.135 -23.612 56.715  1.00 67.11  ? 35   ARG F O     1 
ATOM   3929  C  CB    . ARG F  2 35  ? -44.032 -21.331 58.306  1.00 67.88  ? 35   ARG F CB    1 
ATOM   3930  C  CG    . ARG F  2 35  ? -43.958 -21.866 59.727  1.00 69.67  ? 35   ARG F CG    1 
ATOM   3931  C  CD    . ARG F  2 35  ? -45.379 -22.101 60.282  1.00 70.49  ? 35   ARG F CD    1 
ATOM   3932  N  NE    . ARG F  2 35  ? -46.026 -23.222 59.584  1.00 77.60  ? 35   ARG F NE    1 
ATOM   3933  C  CZ    . ARG F  2 35  ? -46.929 -23.112 58.597  1.00 79.62  ? 35   ARG F CZ    1 
ATOM   3934  N  NH1   . ARG F  2 35  ? -47.352 -21.916 58.173  1.00 80.33  ? 35   ARG F NH1   1 
ATOM   3935  N  NH2   . ARG F  2 35  ? -47.428 -24.213 58.038  1.00 80.18  ? 35   ARG F NH2   1 
ATOM   3936  N  N     . ARG F  2 36  ? -43.677 -22.521 55.489  1.00 66.81  ? 36   ARG F N     1 
ATOM   3937  C  CA    . ARG F  2 36  ? -43.847 -23.609 54.538  1.00 66.47  ? 36   ARG F CA    1 
ATOM   3938  C  C     . ARG F  2 36  ? -42.518 -23.948 53.883  1.00 66.19  ? 36   ARG F C     1 
ATOM   3939  O  O     . ARG F  2 36  ? -42.135 -25.118 53.817  1.00 66.79  ? 36   ARG F O     1 
ATOM   3940  C  CB    . ARG F  2 36  ? -44.908 -23.272 53.484  1.00 66.76  ? 36   ARG F CB    1 
ATOM   3941  C  CG    . ARG F  2 36  ? -46.345 -23.341 54.002  1.00 66.58  ? 36   ARG F CG    1 
ATOM   3942  C  CD    . ARG F  2 36  ? -47.361 -23.442 52.858  1.00 68.35  ? 36   ARG F CD    1 
ATOM   3943  N  NE    . ARG F  2 36  ? -47.446 -22.229 52.038  1.00 70.10  ? 36   ARG F NE    1 
ATOM   3944  C  CZ    . ARG F  2 36  ? -48.155 -21.140 52.354  1.00 71.09  ? 36   ARG F CZ    1 
ATOM   3945  N  NH1   . ARG F  2 36  ? -48.862 -21.088 53.487  1.00 70.21  ? 36   ARG F NH1   1 
ATOM   3946  N  NH2   . ARG F  2 36  ? -48.156 -20.091 51.532  1.00 69.94  ? 36   ARG F NH2   1 
ATOM   3947  N  N     . LEU F  2 37  ? -41.813 -22.923 53.410  1.00 65.47  ? 37   LEU F N     1 
ATOM   3948  C  CA    . LEU F  2 37  ? -40.453 -23.086 52.894  1.00 64.33  ? 37   LEU F CA    1 
ATOM   3949  C  C     . LEU F  2 37  ? -39.562 -23.730 53.940  1.00 63.96  ? 37   LEU F C     1 
ATOM   3950  O  O     . LEU F  2 37  ? -38.852 -24.689 53.653  1.00 64.20  ? 37   LEU F O     1 
ATOM   3951  C  CB    . LEU F  2 37  ? -39.862 -21.751 52.430  1.00 63.83  ? 37   LEU F CB    1 
ATOM   3952  C  CG    . LEU F  2 37  ? -40.488 -21.154 51.169  1.00 62.76  ? 37   LEU F CG    1 
ATOM   3953  C  CD1   . LEU F  2 37  ? -40.273 -19.656 51.124  1.00 61.58  ? 37   LEU F CD1   1 
ATOM   3954  C  CD2   . LEU F  2 37  ? -40.000 -21.813 49.889  1.00 61.84  ? 37   LEU F CD2   1 
ATOM   3955  N  N     . ALA F  2 38  ? -39.607 -23.232 55.164  1.00 63.38  ? 38   ALA F N     1 
ATOM   3956  C  CA    . ALA F  2 38  ? -38.741 -23.797 56.179  1.00 63.42  ? 38   ALA F CA    1 
ATOM   3957  C  C     . ALA F  2 38  ? -39.040 -25.294 56.403  1.00 63.57  ? 38   ALA F C     1 
ATOM   3958  O  O     . ALA F  2 38  ? -38.134 -26.075 56.707  1.00 63.85  ? 38   ALA F O     1 
ATOM   3959  C  CB    . ALA F  2 38  ? -38.826 -22.999 57.469  1.00 63.22  ? 38   ALA F CB    1 
ATOM   3960  N  N     . ARG F  2 39  ? -40.300 -25.689 56.221  1.00 63.36  ? 39   ARG F N     1 
ATOM   3961  C  CA    . ARG F  2 39  ? -40.711 -27.073 56.422  1.00 62.80  ? 39   ARG F CA    1 
ATOM   3962  C  C     . ARG F  2 39  ? -40.140 -27.968 55.329  1.00 62.45  ? 39   ARG F C     1 
ATOM   3963  O  O     . ARG F  2 39  ? -39.587 -29.033 55.634  1.00 62.36  ? 39   ARG F O     1 
ATOM   3964  C  CB    . ARG F  2 39  ? -42.242 -27.205 56.492  1.00 62.99  ? 39   ARG F CB    1 
ATOM   3965  C  CG    . ARG F  2 39  ? -42.913 -26.474 57.674  1.00 63.24  ? 39   ARG F CG    1 
ATOM   3966  C  CD    . ARG F  2 39  ? -42.627 -27.119 59.023  1.00 63.23  ? 39   ARG F CD    1 
ATOM   3967  N  NE    . ARG F  2 39  ? -43.351 -26.458 60.108  1.00 63.20  ? 39   ARG F NE    1 
ATOM   3968  C  CZ    . ARG F  2 39  ? -42.790 -25.877 61.171  1.00 64.08  ? 39   ARG F CZ    1 
ATOM   3969  N  NH1   . ARG F  2 39  ? -41.473 -25.858 61.336  1.00 64.71  ? 39   ARG F NH1   1 
ATOM   3970  N  NH2   . ARG F  2 39  ? -43.556 -25.315 62.090  1.00 64.72  ? 39   ARG F NH2   1 
ATOM   3971  N  N     . ARG F  2 40  ? -40.259 -27.543 54.065  1.00 61.64  ? 40   ARG F N     1 
ATOM   3972  C  CA    . ARG F  2 40  ? -39.663 -28.300 52.965  1.00 61.06  ? 40   ARG F CA    1 
ATOM   3973  C  C     . ARG F  2 40  ? -38.181 -28.439 53.260  1.00 61.12  ? 40   ARG F C     1 
ATOM   3974  O  O     . ARG F  2 40  ? -37.565 -29.454 52.953  1.00 61.75  ? 40   ARG F O     1 
ATOM   3975  C  CB    . ARG F  2 40  ? -39.894 -27.619 51.623  1.00 60.72  ? 40   ARG F CB    1 
ATOM   3976  C  CG    . ARG F  2 40  ? -39.422 -28.437 50.414  1.00 60.72  ? 40   ARG F CG    1 
ATOM   3977  C  CD    . ARG F  2 40  ? -40.062 -27.951 49.115  1.00 59.20  ? 40   ARG F CD    1 
ATOM   3978  N  NE    . ARG F  2 40  ? -41.466 -28.320 49.063  1.00 62.01  ? 40   ARG F NE    1 
ATOM   3979  C  CZ    . ARG F  2 40  ? -42.349 -27.927 48.143  1.00 64.32  ? 40   ARG F CZ    1 
ATOM   3980  N  NH1   . ARG F  2 40  ? -42.011 -27.119 47.147  1.00 63.85  ? 40   ARG F NH1   1 
ATOM   3981  N  NH2   . ARG F  2 40  ? -43.604 -28.357 48.225  1.00 66.62  ? 40   ARG F NH2   1 
ATOM   3982  N  N     . GLY F  2 41  ? -37.633 -27.420 53.915  1.00 60.99  ? 41   GLY F N     1 
ATOM   3983  C  CA    . GLY F  2 41  ? -36.246 -27.398 54.332  1.00 60.61  ? 41   GLY F CA    1 
ATOM   3984  C  C     . GLY F  2 41  ? -35.954 -28.272 55.520  1.00 60.50  ? 41   GLY F C     1 
ATOM   3985  O  O     . GLY F  2 41  ? -34.787 -28.511 55.830  1.00 61.39  ? 41   GLY F O     1 
ATOM   3986  N  N     . GLY F  2 42  ? -36.997 -28.754 56.186  1.00 60.04  ? 42   GLY F N     1 
ATOM   3987  C  CA    . GLY F  2 42  ? -36.831 -29.721 57.272  1.00 60.24  ? 42   GLY F CA    1 
ATOM   3988  C  C     . GLY F  2 42  ? -36.788 -29.114 58.655  1.00 60.68  ? 42   GLY F C     1 
ATOM   3989  O  O     . GLY F  2 42  ? -36.305 -29.732 59.595  1.00 60.78  ? 42   GLY F O     1 
ATOM   3990  N  N     . VAL F  2 43  ? -37.332 -27.908 58.779  1.00 61.51  ? 43   VAL F N     1 
ATOM   3991  C  CA    . VAL F  2 43  ? -37.210 -27.106 59.983  1.00 61.92  ? 43   VAL F CA    1 
ATOM   3992  C  C     . VAL F  2 43  ? -38.442 -27.262 60.836  1.00 62.76  ? 43   VAL F C     1 
ATOM   3993  O  O     . VAL F  2 43  ? -39.537 -27.000 60.379  1.00 62.79  ? 43   VAL F O     1 
ATOM   3994  C  CB    . VAL F  2 43  ? -37.023 -25.609 59.653  1.00 61.53  ? 43   VAL F CB    1 
ATOM   3995  C  CG1   . VAL F  2 43  ? -36.826 -24.821 60.925  1.00 60.64  ? 43   VAL F CG1   1 
ATOM   3996  C  CG2   . VAL F  2 43  ? -35.840 -25.406 58.719  1.00 61.46  ? 43   VAL F CG2   1 
ATOM   3997  N  N     . LYS F  2 44  ? -38.235 -27.645 62.091  1.00 64.13  ? 44   LYS F N     1 
ATOM   3998  C  CA    . LYS F  2 44  ? -39.313 -27.952 63.027  1.00 65.38  ? 44   LYS F CA    1 
ATOM   3999  C  C     . LYS F  2 44  ? -39.717 -26.751 63.893  1.00 66.09  ? 44   LYS F C     1 
ATOM   4000  O  O     . LYS F  2 44  ? -40.901 -26.564 64.173  1.00 66.34  ? 44   LYS F O     1 
ATOM   4001  C  CB    . LYS F  2 44  ? -38.907 -29.143 63.900  1.00 65.05  ? 44   LYS F CB    1 
ATOM   4002  C  CG    . LYS F  2 44  ? -39.950 -29.636 64.887  1.00 65.75  ? 44   LYS F CG    1 
ATOM   4003  C  CD    . LYS F  2 44  ? -39.470 -30.911 65.563  1.00 66.35  ? 44   LYS F CD    1 
ATOM   4004  C  CE    . LYS F  2 44  ? -40.094 -31.114 66.925  1.00 66.85  ? 44   LYS F CE    1 
ATOM   4005  N  NZ    . LYS F  2 44  ? -39.701 -32.456 67.461  1.00 67.63  ? 44   LYS F NZ    1 
ATOM   4006  N  N     . ARG F  2 45  ? -38.744 -25.938 64.308  1.00 67.03  ? 45   ARG F N     1 
ATOM   4007  C  CA    . ARG F  2 45  ? -39.012 -24.801 65.195  1.00 67.58  ? 45   ARG F CA    1 
ATOM   4008  C  C     . ARG F  2 45  ? -38.335 -23.512 64.713  1.00 67.60  ? 45   ARG F C     1 
ATOM   4009  O  O     . ARG F  2 45  ? -37.119 -23.482 64.497  1.00 67.87  ? 45   ARG F O     1 
ATOM   4010  C  CB    . ARG F  2 45  ? -38.548 -25.139 66.605  1.00 68.00  ? 45   ARG F CB    1 
ATOM   4011  C  CG    . ARG F  2 45  ? -39.425 -24.591 67.697  1.00 69.67  ? 45   ARG F CG    1 
ATOM   4012  C  CD    . ARG F  2 45  ? -38.902 -25.061 69.041  1.00 73.55  ? 45   ARG F CD    1 
ATOM   4013  N  NE    . ARG F  2 45  ? -39.696 -24.562 70.165  1.00 76.48  ? 45   ARG F NE    1 
ATOM   4014  C  CZ    . ARG F  2 45  ? -39.525 -23.374 70.744  1.00 78.16  ? 45   ARG F CZ    1 
ATOM   4015  N  NH1   . ARG F  2 45  ? -38.595 -22.521 70.312  1.00 79.05  ? 45   ARG F NH1   1 
ATOM   4016  N  NH2   . ARG F  2 45  ? -40.297 -23.036 71.762  1.00 79.24  ? 45   ARG F NH2   1 
ATOM   4017  N  N     . ILE F  2 46  ? -39.119 -22.448 64.575  1.00 67.04  ? 46   ILE F N     1 
ATOM   4018  C  CA    . ILE F  2 46  ? -38.637 -21.220 63.976  1.00 67.04  ? 46   ILE F CA    1 
ATOM   4019  C  C     . ILE F  2 46  ? -38.672 -20.035 64.939  1.00 67.30  ? 46   ILE F C     1 
ATOM   4020  O  O     . ILE F  2 46  ? -39.732 -19.674 65.444  1.00 67.91  ? 46   ILE F O     1 
ATOM   4021  C  CB    . ILE F  2 46  ? -39.483 -20.876 62.757  1.00 66.73  ? 46   ILE F CB    1 
ATOM   4022  C  CG1   . ILE F  2 46  ? -39.421 -22.012 61.739  1.00 67.23  ? 46   ILE F CG1   1 
ATOM   4023  C  CG2   . ILE F  2 46  ? -39.012 -19.581 62.139  1.00 66.95  ? 46   ILE F CG2   1 
ATOM   4024  C  CD1   . ILE F  2 46  ? -40.314 -21.800 60.524  1.00 66.40  ? 46   ILE F CD1   1 
ATOM   4025  N  N     . SER F  2 47  ? -37.526 -19.408 65.188  1.00 67.28  ? 47   SER F N     1 
ATOM   4026  C  CA    . SER F  2 47  ? -37.510 -18.198 66.024  1.00 66.77  ? 47   SER F CA    1 
ATOM   4027  C  C     . SER F  2 47  ? -38.279 -17.063 65.341  1.00 66.71  ? 47   SER F C     1 
ATOM   4028  O  O     . SER F  2 47  ? -38.288 -16.968 64.115  1.00 66.52  ? 47   SER F O     1 
ATOM   4029  C  CB    . SER F  2 47  ? -36.084 -17.766 66.343  1.00 66.23  ? 47   SER F CB    1 
ATOM   4030  O  OG    . SER F  2 47  ? -36.022 -16.363 66.469  1.00 65.83  ? 47   SER F OG    1 
ATOM   4031  N  N     . GLY F  2 48  ? -38.916 -16.205 66.140  1.00 66.74  ? 48   GLY F N     1 
ATOM   4032  C  CA    . GLY F  2 48  ? -39.814 -15.168 65.612  1.00 66.67  ? 48   GLY F CA    1 
ATOM   4033  C  C     . GLY F  2 48  ? -39.121 -14.162 64.718  1.00 66.83  ? 48   GLY F C     1 
ATOM   4034  O  O     . GLY F  2 48  ? -39.745 -13.517 63.864  1.00 66.62  ? 48   GLY F O     1 
ATOM   4035  N  N     . LEU F  2 49  ? -37.815 -14.033 64.914  1.00 66.91  ? 49   LEU F N     1 
ATOM   4036  C  CA    . LEU F  2 49  ? -37.025 -13.074 64.160  1.00 66.84  ? 49   LEU F CA    1 
ATOM   4037  C  C     . LEU F  2 49  ? -36.660 -13.552 62.741  1.00 66.66  ? 49   LEU F C     1 
ATOM   4038  O  O     . LEU F  2 49  ? -36.209 -12.758 61.906  1.00 66.96  ? 49   LEU F O     1 
ATOM   4039  C  CB    . LEU F  2 49  ? -35.786 -12.683 64.971  1.00 66.87  ? 49   LEU F CB    1 
ATOM   4040  C  CG    . LEU F  2 49  ? -36.028 -11.611 66.045  1.00 67.12  ? 49   LEU F CG    1 
ATOM   4041  C  CD1   . LEU F  2 49  ? -34.913 -11.599 67.090  1.00 66.39  ? 49   LEU F CD1   1 
ATOM   4042  C  CD2   . LEU F  2 49  ? -36.207 -10.209 65.420  1.00 65.83  ? 49   LEU F CD2   1 
ATOM   4043  N  N     . ILE F  2 50  ? -36.878 -14.838 62.469  1.00 66.30  ? 50   ILE F N     1 
ATOM   4044  C  CA    . ILE F  2 50  ? -36.487 -15.451 61.188  1.00 65.86  ? 50   ILE F CA    1 
ATOM   4045  C  C     . ILE F  2 50  ? -37.173 -14.838 59.973  1.00 66.06  ? 50   ILE F C     1 
ATOM   4046  O  O     . ILE F  2 50  ? -36.547 -14.692 58.916  1.00 66.28  ? 50   ILE F O     1 
ATOM   4047  C  CB    . ILE F  2 50  ? -36.720 -16.990 61.185  1.00 65.29  ? 50   ILE F CB    1 
ATOM   4048  C  CG1   . ILE F  2 50  ? -35.573 -17.724 61.877  1.00 64.90  ? 50   ILE F CG1   1 
ATOM   4049  C  CG2   . ILE F  2 50  ? -36.927 -17.520 59.784  1.00 64.96  ? 50   ILE F CG2   1 
ATOM   4050  C  CD1   . ILE F  2 50  ? -34.202 -17.529 61.254  1.00 65.21  ? 50   ILE F CD1   1 
ATOM   4051  N  N     . TYR F  2 51  ? -38.453 -14.491 60.129  1.00 66.14  ? 51   TYR F N     1 
ATOM   4052  C  CA    . TYR F  2 51  ? -39.282 -14.028 59.017  1.00 66.10  ? 51   TYR F CA    1 
ATOM   4053  C  C     . TYR F  2 51  ? -38.768 -12.719 58.442  1.00 66.17  ? 51   TYR F C     1 
ATOM   4054  O  O     . TYR F  2 51  ? -38.834 -12.503 57.230  1.00 66.59  ? 51   TYR F O     1 
ATOM   4055  C  CB    . TYR F  2 51  ? -40.762 -13.936 59.436  1.00 66.50  ? 51   TYR F CB    1 
ATOM   4056  C  CG    . TYR F  2 51  ? -41.233 -15.180 60.152  1.00 65.90  ? 51   TYR F CG    1 
ATOM   4057  C  CD1   . TYR F  2 51  ? -41.200 -15.254 61.541  1.00 66.93  ? 51   TYR F CD1   1 
ATOM   4058  C  CD2   . TYR F  2 51  ? -41.652 -16.303 59.442  1.00 65.42  ? 51   TYR F CD2   1 
ATOM   4059  C  CE1   . TYR F  2 51  ? -41.594 -16.414 62.221  1.00 67.23  ? 51   TYR F CE1   1 
ATOM   4060  C  CE2   . TYR F  2 51  ? -42.041 -17.473 60.103  1.00 65.83  ? 51   TYR F CE2   1 
ATOM   4061  C  CZ    . TYR F  2 51  ? -42.015 -17.514 61.494  1.00 67.02  ? 51   TYR F CZ    1 
ATOM   4062  O  OH    . TYR F  2 51  ? -42.408 -18.652 62.166  1.00 68.22  ? 51   TYR F OH    1 
ATOM   4063  N  N     . GLU F  2 52  ? -38.234 -11.854 59.298  1.00 65.92  ? 52   GLU F N     1 
ATOM   4064  C  CA    . GLU F  2 52  ? -37.631 -10.625 58.812  1.00 66.04  ? 52   GLU F CA    1 
ATOM   4065  C  C     . GLU F  2 52  ? -36.323 -10.895 58.058  1.00 65.42  ? 52   GLU F C     1 
ATOM   4066  O  O     . GLU F  2 52  ? -36.161 -10.420 56.927  1.00 65.41  ? 52   GLU F O     1 
ATOM   4067  C  CB    . GLU F  2 52  ? -37.454 -9.595  59.937  1.00 66.66  ? 52   GLU F CB    1 
ATOM   4068  C  CG    . GLU F  2 52  ? -38.595 -8.571  60.022  1.00 69.16  ? 52   GLU F CG    1 
ATOM   4069  C  CD    . GLU F  2 52  ? -38.822 -7.827  58.702  1.00 73.23  ? 52   GLU F CD    1 
ATOM   4070  O  OE1   . GLU F  2 52  ? -37.866 -7.158  58.227  1.00 74.32  ? 52   GLU F OE1   1 
ATOM   4071  O  OE2   . GLU F  2 52  ? -39.949 -7.917  58.136  1.00 74.40  ? 52   GLU F OE2   1 
ATOM   4072  N  N     . GLU F  2 53  ? -35.415 -11.673 58.656  1.00 64.45  ? 53   GLU F N     1 
ATOM   4073  C  CA    . GLU F  2 53  ? -34.173 -12.076 57.973  1.00 63.97  ? 53   GLU F CA    1 
ATOM   4074  C  C     . GLU F  2 53  ? -34.419 -12.681 56.594  1.00 62.78  ? 53   GLU F C     1 
ATOM   4075  O  O     . GLU F  2 53  ? -33.728 -12.356 55.628  1.00 62.76  ? 53   GLU F O     1 
ATOM   4076  C  CB    . GLU F  2 53  ? -33.408 -13.101 58.791  1.00 64.42  ? 53   GLU F CB    1 
ATOM   4077  C  CG    . GLU F  2 53  ? -32.829 -12.564 60.049  1.00 68.01  ? 53   GLU F CG    1 
ATOM   4078  C  CD    . GLU F  2 53  ? -31.528 -11.845 59.818  1.00 72.75  ? 53   GLU F CD    1 
ATOM   4079  O  OE1   . GLU F  2 53  ? -31.411 -10.704 60.318  1.00 75.22  ? 53   GLU F OE1   1 
ATOM   4080  O  OE2   . GLU F  2 53  ? -30.633 -12.407 59.134  1.00 74.46  ? 53   GLU F OE2   1 
ATOM   4081  N  N     . THR F  2 54  ? -35.396 -13.572 56.505  1.00 61.20  ? 54   THR F N     1 
ATOM   4082  C  CA    . THR F  2 54  ? -35.642 -14.248 55.256  1.00 60.35  ? 54   THR F CA    1 
ATOM   4083  C  C     . THR F  2 54  ? -36.062 -13.251 54.183  1.00 59.64  ? 54   THR F C     1 
ATOM   4084  O  O     . THR F  2 54  ? -35.619 -13.339 53.041  1.00 59.75  ? 54   THR F O     1 
ATOM   4085  C  CB    . THR F  2 54  ? -36.638 -15.403 55.428  1.00 60.37  ? 54   THR F CB    1 
ATOM   4086  O  OG1   . THR F  2 54  ? -36.101 -16.327 56.382  1.00 60.54  ? 54   THR F OG1   1 
ATOM   4087  C  CG2   . THR F  2 54  ? -36.858 -16.139 54.118  1.00 59.89  ? 54   THR F CG2   1 
ATOM   4088  N  N     . ARG F  2 55  ? -36.862 -12.264 54.563  1.00 58.90  ? 55   ARG F N     1 
ATOM   4089  C  CA    . ARG F  2 55  ? -37.270 -11.242 53.612  1.00 58.01  ? 55   ARG F CA    1 
ATOM   4090  C  C     . ARG F  2 55  ? -36.061 -10.450 53.134  1.00 57.10  ? 55   ARG F C     1 
ATOM   4091  O  O     . ARG F  2 55  ? -35.937 -10.132 51.954  1.00 56.71  ? 55   ARG F O     1 
ATOM   4092  C  CB    . ARG F  2 55  ? -38.321 -10.338 54.231  1.00 58.29  ? 55   ARG F CB    1 
ATOM   4093  C  CG    . ARG F  2 55  ? -39.602 -11.069 54.554  1.00 59.61  ? 55   ARG F CG    1 
ATOM   4094  C  CD    . ARG F  2 55  ? -40.705 -10.110 54.965  1.00 61.31  ? 55   ARG F CD    1 
ATOM   4095  N  NE    . ARG F  2 55  ? -41.918 -10.843 55.293  1.00 61.56  ? 55   ARG F NE    1 
ATOM   4096  C  CZ    . ARG F  2 55  ? -42.213 -11.293 56.509  1.00 62.68  ? 55   ARG F CZ    1 
ATOM   4097  N  NH1   . ARG F  2 55  ? -41.390 -11.075 57.534  1.00 63.58  ? 55   ARG F NH1   1 
ATOM   4098  N  NH2   . ARG F  2 55  ? -43.340 -11.967 56.697  1.00 62.44  ? 55   ARG F NH2   1 
ATOM   4099  N  N     . GLY F  2 56  ? -35.159 -10.152 54.053  1.00 56.48  ? 56   GLY F N     1 
ATOM   4100  C  CA    . GLY F  2 56  ? -33.913 -9.467  53.697  1.00 56.51  ? 56   GLY F CA    1 
ATOM   4101  C  C     . GLY F  2 56  ? -33.062 -10.276 52.748  1.00 56.02  ? 56   GLY F C     1 
ATOM   4102  O  O     . GLY F  2 56  ? -32.685 -9.795  51.670  1.00 56.12  ? 56   GLY F O     1 
ATOM   4103  N  N     . VAL F  2 57  ? -32.797 -11.521 53.139  1.00 55.59  ? 57   VAL F N     1 
ATOM   4104  C  CA    . VAL F  2 57  ? -32.083 -12.471 52.296  1.00 55.07  ? 57   VAL F CA    1 
ATOM   4105  C  C     . VAL F  2 57  ? -32.720 -12.656 50.911  1.00 55.46  ? 57   VAL F C     1 
ATOM   4106  O  O     . VAL F  2 57  ? -31.999 -12.691 49.899  1.00 56.03  ? 57   VAL F O     1 
ATOM   4107  C  CB    . VAL F  2 57  ? -31.888 -13.821 53.003  1.00 54.73  ? 57   VAL F CB    1 
ATOM   4108  C  CG1   . VAL F  2 57  ? -31.579 -14.909 51.993  1.00 55.20  ? 57   VAL F CG1   1 
ATOM   4109  C  CG2   . VAL F  2 57  ? -30.788 -13.738 54.049  1.00 52.83  ? 57   VAL F CG2   1 
ATOM   4110  N  N     . LEU F  2 58  ? -34.048 -12.753 50.849  1.00 55.37  ? 58   LEU F N     1 
ATOM   4111  C  CA    . LEU F  2 58  ? -34.732 -12.959 49.560  1.00 56.01  ? 58   LEU F CA    1 
ATOM   4112  C  C     . LEU F  2 58  ? -34.623 -11.746 48.637  1.00 56.64  ? 58   LEU F C     1 
ATOM   4113  O  O     . LEU F  2 58  ? -34.435 -11.878 47.427  1.00 57.32  ? 58   LEU F O     1 
ATOM   4114  C  CB    . LEU F  2 58  ? -36.199 -13.352 49.772  1.00 56.00  ? 58   LEU F CB    1 
ATOM   4115  C  CG    . LEU F  2 58  ? -37.094 -13.566 48.540  1.00 56.41  ? 58   LEU F CG    1 
ATOM   4116  C  CD1   . LEU F  2 58  ? -36.565 -14.649 47.631  1.00 57.59  ? 58   LEU F CD1   1 
ATOM   4117  C  CD2   . LEU F  2 58  ? -38.515 -13.888 48.953  1.00 56.40  ? 58   LEU F CD2   1 
ATOM   4118  N  N     . LYS F  2 59  ? -34.740 -10.557 49.219  1.00 57.04  ? 59   LYS F N     1 
ATOM   4119  C  CA    . LYS F  2 59  ? -34.508 -9.319  48.502  1.00 57.07  ? 59   LYS F CA    1 
ATOM   4120  C  C     . LYS F  2 59  ? -33.150 -9.318  47.792  1.00 56.23  ? 59   LYS F C     1 
ATOM   4121  O  O     . LYS F  2 59  ? -33.068 -9.030  46.593  1.00 55.82  ? 59   LYS F O     1 
ATOM   4122  C  CB    . LYS F  2 59  ? -34.582 -8.147  49.483  1.00 57.89  ? 59   LYS F CB    1 
ATOM   4123  C  CG    . LYS F  2 59  ? -35.134 -6.866  48.889  1.00 60.63  ? 59   LYS F CG    1 
ATOM   4124  C  CD    . LYS F  2 59  ? -34.963 -5.692  49.856  1.00 66.11  ? 59   LYS F CD    1 
ATOM   4125  C  CE    . LYS F  2 59  ? -35.194 -4.339  49.154  1.00 69.02  ? 59   LYS F CE    1 
ATOM   4126  N  NZ    . LYS F  2 59  ? -36.520 -4.278  48.409  1.00 71.96  ? 59   LYS F NZ    1 
ATOM   4127  N  N     . VAL F  2 60  ? -32.092 -9.652  48.533  1.00 55.21  ? 60   VAL F N     1 
ATOM   4128  C  CA    . VAL F  2 60  ? -30.731 -9.599  47.986  1.00 54.34  ? 60   VAL F CA    1 
ATOM   4129  C  C     . VAL F  2 60  ? -30.558 -10.598 46.850  1.00 54.42  ? 60   VAL F C     1 
ATOM   4130  O  O     . VAL F  2 60  ? -29.859 -10.314 45.863  1.00 54.76  ? 60   VAL F O     1 
ATOM   4131  C  CB    . VAL F  2 60  ? -29.669 -9.847  49.071  1.00 54.24  ? 60   VAL F CB    1 
ATOM   4132  C  CG1   . VAL F  2 60  ? -28.331 -10.162 48.455  1.00 52.86  ? 60   VAL F CG1   1 
ATOM   4133  C  CG2   . VAL F  2 60  ? -29.575 -8.649  49.999  1.00 53.34  ? 60   VAL F CG2   1 
ATOM   4134  N  N     . PHE F  2 61  ? -31.206 -11.760 46.993  1.00 53.70  ? 61   PHE F N     1 
ATOM   4135  C  CA    . PHE F  2 61  ? -31.172 -12.791 45.975  1.00 52.70  ? 61   PHE F CA    1 
ATOM   4136  C  C     . PHE F  2 61  ? -31.880 -12.303 44.725  1.00 52.91  ? 61   PHE F C     1 
ATOM   4137  O  O     . PHE F  2 61  ? -31.297 -12.318 43.649  1.00 53.31  ? 61   PHE F O     1 
ATOM   4138  C  CB    . PHE F  2 61  ? -31.789 -14.107 46.493  1.00 52.69  ? 61   PHE F CB    1 
ATOM   4139  C  CG    . PHE F  2 61  ? -31.828 -15.202 45.467  1.00 51.21  ? 61   PHE F CG    1 
ATOM   4140  C  CD1   . PHE F  2 61  ? -30.744 -16.061 45.308  1.00 51.17  ? 61   PHE F CD1   1 
ATOM   4141  C  CD2   . PHE F  2 61  ? -32.929 -15.345 44.624  1.00 50.21  ? 61   PHE F CD2   1 
ATOM   4142  C  CE1   . PHE F  2 61  ? -30.762 -17.059 44.326  1.00 50.53  ? 61   PHE F CE1   1 
ATOM   4143  C  CE2   . PHE F  2 61  ? -32.961 -16.340 43.642  1.00 49.81  ? 61   PHE F CE2   1 
ATOM   4144  C  CZ    . PHE F  2 61  ? -31.875 -17.197 43.494  1.00 50.91  ? 61   PHE F CZ    1 
ATOM   4145  N  N     . LEU F  2 62  ? -33.129 -11.861 44.858  1.00 53.32  ? 62   LEU F N     1 
ATOM   4146  C  CA    . LEU F  2 62  ? -33.872 -11.335 43.699  1.00 53.72  ? 62   LEU F CA    1 
ATOM   4147  C  C     . LEU F  2 62  ? -33.201 -10.129 43.029  1.00 54.12  ? 62   LEU F C     1 
ATOM   4148  O  O     . LEU F  2 62  ? -33.186 -10.025 41.797  1.00 53.44  ? 62   LEU F O     1 
ATOM   4149  C  CB    . LEU F  2 62  ? -35.298 -10.986 44.079  1.00 53.61  ? 62   LEU F CB    1 
ATOM   4150  C  CG    . LEU F  2 62  ? -36.300 -12.134 44.151  1.00 53.34  ? 62   LEU F CG    1 
ATOM   4151  C  CD1   . LEU F  2 62  ? -37.569 -11.638 44.823  1.00 51.32  ? 62   LEU F CD1   1 
ATOM   4152  C  CD2   . LEU F  2 62  ? -36.601 -12.675 42.745  1.00 51.71  ? 62   LEU F CD2   1 
ATOM   4153  N  N     . GLU F  2 63  ? -32.637 -9.236  43.844  1.00 54.62  ? 63   GLU F N     1 
ATOM   4154  C  CA    . GLU F  2 63  ? -31.933 -8.066  43.328  1.00 55.55  ? 63   GLU F CA    1 
ATOM   4155  C  C     . GLU F  2 63  ? -30.849 -8.489  42.352  1.00 55.06  ? 63   GLU F C     1 
ATOM   4156  O  O     . GLU F  2 63  ? -30.843 -8.041  41.208  1.00 54.72  ? 63   GLU F O     1 
ATOM   4157  C  CB    . GLU F  2 63  ? -31.322 -7.237  44.466  1.00 56.38  ? 63   GLU F CB    1 
ATOM   4158  C  CG    . GLU F  2 63  ? -32.224 -6.112  44.957  1.00 59.12  ? 63   GLU F CG    1 
ATOM   4159  C  CD    . GLU F  2 63  ? -31.965 -5.686  46.406  1.00 64.14  ? 63   GLU F CD    1 
ATOM   4160  O  OE1   . GLU F  2 63  ? -30.834 -5.864  46.936  1.00 64.77  ? 63   GLU F OE1   1 
ATOM   4161  O  OE2   . GLU F  2 63  ? -32.921 -5.153  47.021  1.00 67.75  ? 63   GLU F OE2   1 
ATOM   4162  N  N     . ASN F  2 64  ? -29.968 -9.382  42.805  1.00 54.69  ? 64   ASN F N     1 
ATOM   4163  C  CA    . ASN F  2 64  ? -28.828 -9.834  42.007  1.00 54.11  ? 64   ASN F CA    1 
ATOM   4164  C  C     . ASN F  2 64  ? -29.207 -10.550 40.728  1.00 53.90  ? 64   ASN F C     1 
ATOM   4165  O  O     . ASN F  2 64  ? -28.617 -10.272 39.670  1.00 54.13  ? 64   ASN F O     1 
ATOM   4166  C  CB    . ASN F  2 64  ? -27.900 -10.728 42.830  1.00 54.27  ? 64   ASN F CB    1 
ATOM   4167  C  CG    . ASN F  2 64  ? -27.247 -9.996  43.976  1.00 54.41  ? 64   ASN F CG    1 
ATOM   4168  O  OD1   . ASN F  2 64  ? -27.155 -8.767  43.979  1.00 56.64  ? 64   ASN F OD1   1 
ATOM   4169  N  ND2   . ASN F  2 64  ? -26.778 -10.750 44.959  1.00 55.11  ? 64   ASN F ND2   1 
ATOM   4170  N  N     . VAL F  2 65  ? -30.161 -11.477 40.819  1.00 53.21  ? 65   VAL F N     1 
ATOM   4171  C  CA    . VAL F  2 65  ? -30.584 -12.216 39.642  1.00 53.41  ? 65   VAL F CA    1 
ATOM   4172  C  C     . VAL F  2 65  ? -31.230 -11.280 38.648  1.00 53.62  ? 65   VAL F C     1 
ATOM   4173  O  O     . VAL F  2 65  ? -30.917 -11.341 37.462  1.00 53.66  ? 65   VAL F O     1 
ATOM   4174  C  CB    . VAL F  2 65  ? -31.589 -13.328 39.962  1.00 53.31  ? 65   VAL F CB    1 
ATOM   4175  C  CG1   . VAL F  2 65  ? -31.985 -14.030 38.700  1.00 52.40  ? 65   VAL F CG1   1 
ATOM   4176  C  CG2   . VAL F  2 65  ? -30.986 -14.324 40.917  1.00 55.31  ? 65   VAL F CG2   1 
ATOM   4177  N  N     . ILE F  2 66  ? -32.137 -10.422 39.129  1.00 54.21  ? 66   ILE F N     1 
ATOM   4178  C  CA    . ILE F  2 66  ? -32.860 -9.484  38.254  1.00 54.68  ? 66   ILE F CA    1 
ATOM   4179  C  C     . ILE F  2 66  ? -31.953 -8.394  37.703  1.00 54.77  ? 66   ILE F C     1 
ATOM   4180  O  O     . ILE F  2 66  ? -32.056 -8.034  36.528  1.00 54.52  ? 66   ILE F O     1 
ATOM   4181  C  CB    . ILE F  2 66  ? -34.088 -8.864  38.938  1.00 55.29  ? 66   ILE F CB    1 
ATOM   4182  C  CG1   . ILE F  2 66  ? -35.080 -9.975  39.305  1.00 55.33  ? 66   ILE F CG1   1 
ATOM   4183  C  CG2   . ILE F  2 66  ? -34.734 -7.791  38.041  1.00 53.43  ? 66   ILE F CG2   1 
ATOM   4184  C  CD1   . ILE F  2 66  ? -36.057 -9.584  40.397  1.00 56.75  ? 66   ILE F CD1   1 
ATOM   4185  N  N     . ARG F  2 67  ? -31.040 -7.897  38.527  1.00 54.83  ? 67   ARG F N     1 
ATOM   4186  C  CA    . ARG F  2 67  ? -30.024 -7.029  37.994  1.00 55.71  ? 67   ARG F CA    1 
ATOM   4187  C  C     . ARG F  2 67  ? -29.454 -7.657  36.732  1.00 55.10  ? 67   ARG F C     1 
ATOM   4188  O  O     . ARG F  2 67  ? -29.511 -7.041  35.665  1.00 54.81  ? 67   ARG F O     1 
ATOM   4189  C  CB    . ARG F  2 67  ? -28.911 -6.759  38.999  1.00 55.90  ? 67   ARG F CB    1 
ATOM   4190  C  CG    . ARG F  2 67  ? -28.042 -5.551  38.600  1.00 57.44  ? 67   ARG F CG    1 
ATOM   4191  C  CD    . ARG F  2 67  ? -26.813 -5.403  39.481  1.00 59.05  ? 67   ARG F CD    1 
ATOM   4192  N  NE    . ARG F  2 67  ? -27.160 -5.118  40.876  1.00 66.42  ? 67   ARG F NE    1 
ATOM   4193  C  CZ    . ARG F  2 67  ? -27.065 -6.009  41.864  1.00 70.43  ? 67   ARG F CZ    1 
ATOM   4194  N  NH1   . ARG F  2 67  ? -26.626 -7.249  41.616  1.00 72.14  ? 67   ARG F NH1   1 
ATOM   4195  N  NH2   . ARG F  2 67  ? -27.402 -5.666  43.104  1.00 73.43  ? 67   ARG F NH2   1 
ATOM   4196  N  N     . ASP F  2 68  ? -28.932 -8.884  36.835  1.00 54.51  ? 68   ASP F N     1 
ATOM   4197  C  CA    . ASP F  2 68  ? -28.356 -9.538  35.654  1.00 54.41  ? 68   ASP F CA    1 
ATOM   4198  C  C     . ASP F  2 68  ? -29.381 -9.815  34.556  1.00 53.60  ? 68   ASP F C     1 
ATOM   4199  O  O     . ASP F  2 68  ? -29.091 -9.628  33.362  1.00 52.89  ? 68   ASP F O     1 
ATOM   4200  C  CB    . ASP F  2 68  ? -27.575 -10.810 36.014  1.00 54.99  ? 68   ASP F CB    1 
ATOM   4201  C  CG    . ASP F  2 68  ? -26.259 -10.518 36.737  1.00 56.94  ? 68   ASP F CG    1 
ATOM   4202  O  OD1   . ASP F  2 68  ? -25.879 -9.333  36.926  1.00 58.78  ? 68   ASP F OD1   1 
ATOM   4203  O  OD2   . ASP F  2 68  ? -25.590 -11.494 37.139  1.00 59.80  ? 68   ASP F OD2   1 
ATOM   4204  N  N     . ALA F  2 69  ? -30.575 -10.252 34.943  1.00 53.11  ? 69   ALA F N     1 
ATOM   4205  C  CA    . ALA F  2 69  ? -31.591 -10.574 33.941  1.00 53.25  ? 69   ALA F CA    1 
ATOM   4206  C  C     . ALA F  2 69  ? -31.873 -9.353  33.067  1.00 53.72  ? 69   ALA F C     1 
ATOM   4207  O  O     . ALA F  2 69  ? -31.849 -9.458  31.842  1.00 53.90  ? 69   ALA F O     1 
ATOM   4208  C  CB    . ALA F  2 69  ? -32.847 -11.100 34.597  1.00 53.02  ? 69   ALA F CB    1 
ATOM   4209  N  N     . VAL F  2 70  ? -32.062 -8.189  33.714  1.00 53.76  ? 70   VAL F N     1 
ATOM   4210  C  CA    . VAL F  2 70  ? -32.366 -6.916  33.049  1.00 53.27  ? 70   VAL F CA    1 
ATOM   4211  C  C     . VAL F  2 70  ? -31.204 -6.421  32.176  1.00 53.28  ? 70   VAL F C     1 
ATOM   4212  O  O     . VAL F  2 70  ? -31.411 -5.904  31.072  1.00 53.35  ? 70   VAL F O     1 
ATOM   4213  C  CB    . VAL F  2 70  ? -32.771 -5.827  34.080  1.00 53.47  ? 70   VAL F CB    1 
ATOM   4214  C  CG1   . VAL F  2 70  ? -32.967 -4.483  33.409  1.00 52.83  ? 70   VAL F CG1   1 
ATOM   4215  C  CG2   . VAL F  2 70  ? -34.034 -6.237  34.844  1.00 53.43  ? 70   VAL F CG2   1 
ATOM   4216  N  N     . THR F  2 71  ? -29.981 -6.588  32.666  1.00 52.85  ? 71   THR F N     1 
ATOM   4217  C  CA    . THR F  2 71  ? -28.805 -6.321  31.847  1.00 52.18  ? 71   THR F CA    1 
ATOM   4218  C  C     . THR F  2 71  ? -28.871 -7.066  30.527  1.00 53.61  ? 71   THR F C     1 
ATOM   4219  O  O     . THR F  2 71  ? -28.597 -6.465  29.503  1.00 54.03  ? 71   THR F O     1 
ATOM   4220  C  CB    . THR F  2 71  ? -27.537 -6.666  32.584  1.00 51.37  ? 71   THR F CB    1 
ATOM   4221  O  OG1   . THR F  2 71  ? -27.548 -5.989  33.839  1.00 49.96  ? 71   THR F OG1   1 
ATOM   4222  C  CG2   . THR F  2 71  ? -26.312 -6.280  31.793  1.00 49.44  ? 71   THR F CG2   1 
ATOM   4223  N  N     . TYR F  2 72  ? -29.252 -8.350  30.542  1.00 54.86  ? 72   TYR F N     1 
ATOM   4224  C  CA    . TYR F  2 72  ? -29.406 -9.119  29.297  1.00 56.47  ? 72   TYR F CA    1 
ATOM   4225  C  C     . TYR F  2 72  ? -30.539 -8.556  28.419  1.00 58.23  ? 72   TYR F C     1 
ATOM   4226  O  O     . TYR F  2 72  ? -30.375 -8.399  27.198  1.00 57.78  ? 72   TYR F O     1 
ATOM   4227  C  CB    . TYR F  2 72  ? -29.631 -10.623 29.572  1.00 56.13  ? 72   TYR F CB    1 
ATOM   4228  C  CG    . TYR F  2 72  ? -28.382 -11.396 29.986  1.00 55.72  ? 72   TYR F CG    1 
ATOM   4229  C  CD1   . TYR F  2 72  ? -28.261 -11.965 31.270  1.00 53.84  ? 72   TYR F CD1   1 
ATOM   4230  C  CD2   . TYR F  2 72  ? -27.324 -11.562 29.095  1.00 54.88  ? 72   TYR F CD2   1 
ATOM   4231  C  CE1   . TYR F  2 72  ? -27.121 -12.670 31.640  1.00 52.49  ? 72   TYR F CE1   1 
ATOM   4232  C  CE2   . TYR F  2 72  ? -26.184 -12.260 29.457  1.00 55.09  ? 72   TYR F CE2   1 
ATOM   4233  C  CZ    . TYR F  2 72  ? -26.086 -12.809 30.724  1.00 54.87  ? 72   TYR F CZ    1 
ATOM   4234  O  OH    . TYR F  2 72  ? -24.928 -13.490 31.040  1.00 55.98  ? 72   TYR F OH    1 
ATOM   4235  N  N     . THR F  2 73  ? -31.687 -8.265  29.040  1.00 60.21  ? 73   THR F N     1 
ATOM   4236  C  CA    . THR F  2 73  ? -32.791 -7.615  28.328  1.00 62.12  ? 73   THR F CA    1 
ATOM   4237  C  C     . THR F  2 73  ? -32.325 -6.325  27.635  1.00 63.64  ? 73   THR F C     1 
ATOM   4238  O  O     . THR F  2 73  ? -32.477 -6.195  26.412  1.00 64.10  ? 73   THR F O     1 
ATOM   4239  C  CB    . THR F  2 73  ? -33.964 -7.260  29.244  1.00 62.09  ? 73   THR F CB    1 
ATOM   4240  O  OG1   . THR F  2 73  ? -34.343 -8.398  30.029  1.00 62.25  ? 73   THR F OG1   1 
ATOM   4241  C  CG2   . THR F  2 73  ? -35.145 -6.790  28.402  1.00 61.74  ? 73   THR F CG2   1 
ATOM   4242  N  N     . GLU F  2 74  ? -31.757 -5.385  28.403  1.00 64.97  ? 74   GLU F N     1 
ATOM   4243  C  CA    . GLU F  2 74  ? -31.289 -4.119  27.826  1.00 66.56  ? 74   GLU F CA    1 
ATOM   4244  C  C     . GLU F  2 74  ? -30.395 -4.444  26.651  1.00 66.71  ? 74   GLU F C     1 
ATOM   4245  O  O     . GLU F  2 74  ? -30.628 -3.956  25.552  1.00 67.01  ? 74   GLU F O     1 
ATOM   4246  C  CB    . GLU F  2 74  ? -30.525 -3.238  28.825  1.00 67.19  ? 74   GLU F CB    1 
ATOM   4247  C  CG    . GLU F  2 74  ? -31.365 -2.578  29.921  1.00 71.98  ? 74   GLU F CG    1 
ATOM   4248  C  CD    . GLU F  2 74  ? -32.167 -1.370  29.419  1.00 79.80  ? 74   GLU F CD    1 
ATOM   4249  O  OE1   . GLU F  2 74  ? -31.542 -0.298  29.179  1.00 81.81  ? 74   GLU F OE1   1 
ATOM   4250  O  OE2   . GLU F  2 74  ? -33.423 -1.491  29.270  1.00 82.01  ? 74   GLU F OE2   1 
ATOM   4251  N  N     . HIS F  2 75  ? -29.402 -5.306  26.861  1.00 66.97  ? 75   HIS F N     1 
ATOM   4252  C  CA    . HIS F  2 75  ? -28.427 -5.577  25.808  1.00 67.12  ? 75   HIS F CA    1 
ATOM   4253  C  C     . HIS F  2 75  ? -29.058 -6.063  24.515  1.00 67.87  ? 75   HIS F C     1 
ATOM   4254  O  O     . HIS F  2 75  ? -28.561 -5.768  23.429  1.00 68.19  ? 75   HIS F O     1 
ATOM   4255  C  CB    . HIS F  2 75  ? -27.350 -6.547  26.254  1.00 66.62  ? 75   HIS F CB    1 
ATOM   4256  C  CG    . HIS F  2 75  ? -26.290 -6.754  25.223  1.00 65.54  ? 75   HIS F CG    1 
ATOM   4257  N  ND1   . HIS F  2 75  ? -26.390 -7.706  24.233  1.00 65.46  ? 75   HIS F ND1   1 
ATOM   4258  C  CD2   . HIS F  2 75  ? -25.124 -6.111  25.005  1.00 64.84  ? 75   HIS F CD2   1 
ATOM   4259  C  CE1   . HIS F  2 75  ? -25.324 -7.652  23.456  1.00 64.14  ? 75   HIS F CE1   1 
ATOM   4260  N  NE2   . HIS F  2 75  ? -24.536 -6.694  23.907  1.00 65.35  ? 75   HIS F NE2   1 
ATOM   4261  N  N     . ALA F  2 76  ? -30.153 -6.808  24.627  1.00 68.76  ? 76   ALA F N     1 
ATOM   4262  C  CA    . ALA F  2 76  ? -30.836 -7.331  23.443  1.00 69.20  ? 76   ALA F CA    1 
ATOM   4263  C  C     . ALA F  2 76  ? -31.742 -6.272  22.807  1.00 69.65  ? 76   ALA F C     1 
ATOM   4264  O  O     . ALA F  2 76  ? -32.512 -6.571  21.890  1.00 70.00  ? 76   ALA F O     1 
ATOM   4265  C  CB    . ALA F  2 76  ? -31.635 -8.563  23.806  1.00 69.13  ? 76   ALA F CB    1 
ATOM   4266  N  N     . LYS F  2 77  ? -31.644 -5.037  23.296  1.00 69.72  ? 77   LYS F N     1 
ATOM   4267  C  CA    . LYS F  2 77  ? -32.515 -3.940  22.859  1.00 69.99  ? 77   LYS F CA    1 
ATOM   4268  C  C     . LYS F  2 77  ? -34.007 -4.295  22.939  1.00 70.21  ? 77   LYS F C     1 
ATOM   4269  O  O     . LYS F  2 77  ? -34.802 -3.854  22.116  1.00 70.60  ? 77   LYS F O     1 
ATOM   4270  C  CB    . LYS F  2 77  ? -32.110 -3.438  21.466  1.00 69.45  ? 77   LYS F CB    1 
ATOM   4271  C  CG    . LYS F  2 77  ? -31.092 -2.316  21.531  1.00 69.76  ? 77   LYS F CG    1 
ATOM   4272  C  CD    . LYS F  2 77  ? -30.282 -2.161  20.250  1.00 69.22  ? 77   LYS F CD    1 
ATOM   4273  C  CE    . LYS F  2 77  ? -29.050 -1.279  20.519  1.00 70.65  ? 77   LYS F CE    1 
ATOM   4274  N  NZ    . LYS F  2 77  ? -28.185 -0.994  19.314  1.00 69.99  ? 77   LYS F NZ    1 
ATOM   4275  N  N     . ARG F  2 78  ? -34.376 -5.100  23.932  1.00 70.43  ? 78   ARG F N     1 
ATOM   4276  C  CA    . ARG F  2 78  ? -35.774 -5.465  24.151  1.00 70.66  ? 78   ARG F CA    1 
ATOM   4277  C  C     . ARG F  2 78  ? -36.319 -4.745  25.369  1.00 70.98  ? 78   ARG F C     1 
ATOM   4278  O  O     . ARG F  2 78  ? -35.560 -4.194  26.154  1.00 71.20  ? 78   ARG F O     1 
ATOM   4279  C  CB    . ARG F  2 78  ? -35.921 -6.971  24.349  1.00 70.34  ? 78   ARG F CB    1 
ATOM   4280  C  CG    . ARG F  2 78  ? -35.765 -7.779  23.084  1.00 69.92  ? 78   ARG F CG    1 
ATOM   4281  C  CD    . ARG F  2 78  ? -36.018 -9.259  23.345  1.00 68.83  ? 78   ARG F CD    1 
ATOM   4282  N  NE    . ARG F  2 78  ? -34.827 -9.955  23.846  1.00 66.78  ? 78   ARG F NE    1 
ATOM   4283  C  CZ    . ARG F  2 78  ? -34.603 -10.237 25.132  1.00 64.95  ? 78   ARG F CZ    1 
ATOM   4284  N  NH1   . ARG F  2 78  ? -35.480 -9.892  26.061  1.00 62.24  ? 78   ARG F NH1   1 
ATOM   4285  N  NH2   . ARG F  2 78  ? -33.496 -10.872 25.489  1.00 64.61  ? 78   ARG F NH2   1 
ATOM   4286  N  N     . LYS F  2 79  ? -37.635 -4.752  25.518  1.00 71.65  ? 79   LYS F N     1 
ATOM   4287  C  CA    . LYS F  2 79  ? -38.288 -4.164  26.682  1.00 72.38  ? 79   LYS F CA    1 
ATOM   4288  C  C     . LYS F  2 79  ? -38.901 -5.262  27.514  1.00 72.13  ? 79   LYS F C     1 
ATOM   4289  O  O     . LYS F  2 79  ? -39.451 -4.997  28.575  1.00 72.71  ? 79   LYS F O     1 
ATOM   4290  C  CB    . LYS F  2 79  ? -39.385 -3.169  26.273  1.00 72.79  ? 79   LYS F CB    1 
ATOM   4291  C  CG    . LYS F  2 79  ? -38.851 -1.838  25.762  1.00 75.34  ? 79   LYS F CG    1 
ATOM   4292  C  CD    . LYS F  2 79  ? -39.856 -0.699  25.891  1.00 78.18  ? 79   LYS F CD    1 
ATOM   4293  C  CE    . LYS F  2 79  ? -39.146 0.643   25.657  1.00 80.22  ? 79   LYS F CE    1 
ATOM   4294  N  NZ    . LYS F  2 79  ? -40.039 1.851   25.844  1.00 82.83  ? 79   LYS F NZ    1 
ATOM   4295  N  N     . THR F  2 80  ? -38.808 -6.496  27.026  1.00 71.91  ? 80   THR F N     1 
ATOM   4296  C  CA    . THR F  2 80  ? -39.401 -7.649  27.718  1.00 71.59  ? 80   THR F CA    1 
ATOM   4297  C  C     . THR F  2 80  ? -38.345 -8.581  28.327  1.00 70.19  ? 80   THR F C     1 
ATOM   4298  O  O     . THR F  2 80  ? -37.431 -9.035  27.645  1.00 69.84  ? 80   THR F O     1 
ATOM   4299  C  CB    . THR F  2 80  ? -40.344 -8.429  26.769  1.00 72.05  ? 80   THR F CB    1 
ATOM   4300  O  OG1   . THR F  2 80  ? -41.293 -7.511  26.207  1.00 73.74  ? 80   THR F OG1   1 
ATOM   4301  C  CG2   . THR F  2 80  ? -41.099 -9.542  27.515  1.00 72.22  ? 80   THR F CG2   1 
ATOM   4302  N  N     . VAL F  2 81  ? -38.478 -8.840  29.622  1.00 68.93  ? 81   VAL F N     1 
ATOM   4303  C  CA    . VAL F  2 81  ? -37.582 -9.756  30.319  1.00 67.70  ? 81   VAL F CA    1 
ATOM   4304  C  C     . VAL F  2 81  ? -38.036 -11.168 29.968  1.00 66.79  ? 81   VAL F C     1 
ATOM   4305  O  O     . VAL F  2 81  ? -39.137 -11.583 30.363  1.00 66.28  ? 81   VAL F O     1 
ATOM   4306  C  CB    . VAL F  2 81  ? -37.649 -9.558  31.861  1.00 67.51  ? 81   VAL F CB    1 
ATOM   4307  C  CG1   . VAL F  2 81  ? -36.711 -10.524 32.569  1.00 67.58  ? 81   VAL F CG1   1 
ATOM   4308  C  CG2   . VAL F  2 81  ? -37.303 -8.148  32.241  1.00 67.20  ? 81   VAL F CG2   1 
ATOM   4309  N  N     . THR F  2 82  ? -37.199 -11.896 29.231  1.00 65.60  ? 82   THR F N     1 
ATOM   4310  C  CA    . THR F  2 82  ? -37.528 -13.265 28.823  1.00 65.08  ? 82   THR F CA    1 
ATOM   4311  C  C     . THR F  2 82  ? -37.146 -14.313 29.851  1.00 64.42  ? 82   THR F C     1 
ATOM   4312  O  O     . THR F  2 82  ? -36.362 -14.046 30.770  1.00 64.97  ? 82   THR F O     1 
ATOM   4313  C  CB    . THR F  2 82  ? -36.836 -13.657 27.521  1.00 65.01  ? 82   THR F CB    1 
ATOM   4314  O  OG1   . THR F  2 82  ? -35.421 -13.468 27.656  1.00 65.86  ? 82   THR F OG1   1 
ATOM   4315  C  CG2   . THR F  2 82  ? -37.350 -12.811 26.372  1.00 65.74  ? 82   THR F CG2   1 
ATOM   4316  N  N     . ALA F  2 83  ? -37.691 -15.515 29.678  1.00 63.54  ? 83   ALA F N     1 
ATOM   4317  C  CA    . ALA F  2 83  ? -37.252 -16.696 30.435  1.00 62.55  ? 83   ALA F CA    1 
ATOM   4318  C  C     . ALA F  2 83  ? -35.755 -16.947 30.254  1.00 62.20  ? 83   ALA F C     1 
ATOM   4319  O  O     . ALA F  2 83  ? -35.058 -17.228 31.227  1.00 61.74  ? 83   ALA F O     1 
ATOM   4320  C  CB    . ALA F  2 83  ? -38.027 -17.900 30.024  1.00 61.86  ? 83   ALA F CB    1 
ATOM   4321  N  N     . MET F  2 84  ? -35.279 -16.844 29.013  1.00 62.26  ? 84   MET F N     1 
ATOM   4322  C  CA    . MET F  2 84  ? -33.867 -17.032 28.686  1.00 62.92  ? 84   MET F CA    1 
ATOM   4323  C  C     . MET F  2 84  ? -32.975 -16.041 29.436  1.00 62.65  ? 84   MET F C     1 
ATOM   4324  O  O     . MET F  2 84  ? -31.976 -16.452 30.051  1.00 62.35  ? 84   MET F O     1 
ATOM   4325  C  CB    . MET F  2 84  ? -33.628 -16.964 27.171  1.00 63.25  ? 84   MET F CB    1 
ATOM   4326  C  CG    . MET F  2 84  ? -34.103 -18.227 26.432  1.00 67.24  ? 84   MET F CG    1 
ATOM   4327  S  SD    . MET F  2 84  ? -33.621 -19.793 27.300  1.00 74.96  ? 84   MET F SD    1 
ATOM   4328  C  CE    . MET F  2 84  ? -31.918 -20.031 26.702  1.00 72.26  ? 84   MET F CE    1 
ATOM   4329  N  N     . ASP F  2 85  ? -33.360 -14.756 29.407  1.00 62.13  ? 85   ASP F N     1 
ATOM   4330  C  CA    . ASP F  2 85  ? -32.681 -13.707 30.171  1.00 61.45  ? 85   ASP F CA    1 
ATOM   4331  C  C     . ASP F  2 85  ? -32.476 -14.178 31.598  1.00 60.47  ? 85   ASP F C     1 
ATOM   4332  O  O     . ASP F  2 85  ? -31.377 -14.095 32.136  1.00 59.96  ? 85   ASP F O     1 
ATOM   4333  C  CB    . ASP F  2 85  ? -33.494 -12.406 30.189  1.00 61.65  ? 85   ASP F CB    1 
ATOM   4334  C  CG    . ASP F  2 85  ? -33.463 -11.651 28.860  1.00 63.74  ? 85   ASP F CG    1 
ATOM   4335  O  OD1   . ASP F  2 85  ? -32.602 -11.948 27.990  1.00 66.64  ? 85   ASP F OD1   1 
ATOM   4336  O  OD2   . ASP F  2 85  ? -34.312 -10.739 28.686  1.00 65.55  ? 85   ASP F OD2   1 
ATOM   4337  N  N     . VAL F  2 86  ? -33.544 -14.668 32.212  1.00 59.52  ? 86   VAL F N     1 
ATOM   4338  C  CA    . VAL F  2 86  ? -33.442 -15.154 33.567  1.00 59.48  ? 86   VAL F CA    1 
ATOM   4339  C  C     . VAL F  2 86  ? -32.531 -16.373 33.660  1.00 59.68  ? 86   VAL F C     1 
ATOM   4340  O  O     . VAL F  2 86  ? -31.657 -16.440 34.522  1.00 60.48  ? 86   VAL F O     1 
ATOM   4341  C  CB    . VAL F  2 86  ? -34.797 -15.524 34.111  1.00 59.30  ? 86   VAL F CB    1 
ATOM   4342  C  CG1   . VAL F  2 86  ? -34.645 -16.045 35.508  1.00 58.96  ? 86   VAL F CG1   1 
ATOM   4343  C  CG2   . VAL F  2 86  ? -35.716 -14.315 34.074  1.00 59.01  ? 86   VAL F CG2   1 
ATOM   4344  N  N     . VAL F  2 87  ? -32.726 -17.333 32.764  1.00 59.60  ? 87   VAL F N     1 
ATOM   4345  C  CA    . VAL F  2 87  ? -31.963 -18.569 32.817  1.00 59.14  ? 87   VAL F CA    1 
ATOM   4346  C  C     . VAL F  2 87  ? -30.495 -18.222 32.675  1.00 58.99  ? 87   VAL F C     1 
ATOM   4347  O  O     . VAL F  2 87  ? -29.660 -18.731 33.417  1.00 59.38  ? 87   VAL F O     1 
ATOM   4348  C  CB    . VAL F  2 87  ? -32.464 -19.623 31.789  1.00 58.98  ? 87   VAL F CB    1 
ATOM   4349  C  CG1   . VAL F  2 87  ? -31.469 -20.726 31.597  1.00 58.78  ? 87   VAL F CG1   1 
ATOM   4350  C  CG2   . VAL F  2 87  ? -33.794 -20.222 32.256  1.00 58.14  ? 87   VAL F CG2   1 
ATOM   4351  N  N     . TYR F  2 88  ? -30.185 -17.314 31.763  1.00 58.73  ? 88   TYR F N     1 
ATOM   4352  C  CA    . TYR F  2 88  ? -28.818 -16.822 31.642  1.00 58.22  ? 88   TYR F CA    1 
ATOM   4353  C  C     . TYR F  2 88  ? -28.347 -16.159 32.920  1.00 57.43  ? 88   TYR F C     1 
ATOM   4354  O  O     . TYR F  2 88  ? -27.197 -16.342 33.329  1.00 57.76  ? 88   TYR F O     1 
ATOM   4355  C  CB    . TYR F  2 88  ? -28.694 -15.848 30.493  1.00 59.04  ? 88   TYR F CB    1 
ATOM   4356  C  CG    . TYR F  2 88  ? -28.914 -16.472 29.146  1.00 60.60  ? 88   TYR F CG    1 
ATOM   4357  C  CD1   . TYR F  2 88  ? -29.648 -15.819 28.171  1.00 62.11  ? 88   TYR F CD1   1 
ATOM   4358  C  CD2   . TYR F  2 88  ? -28.398 -17.730 28.845  1.00 62.90  ? 88   TYR F CD2   1 
ATOM   4359  C  CE1   . TYR F  2 88  ? -29.849 -16.399 26.907  1.00 64.15  ? 88   TYR F CE1   1 
ATOM   4360  C  CE2   . TYR F  2 88  ? -28.598 -18.323 27.587  1.00 63.52  ? 88   TYR F CE2   1 
ATOM   4361  C  CZ    . TYR F  2 88  ? -29.316 -17.644 26.627  1.00 63.51  ? 88   TYR F CZ    1 
ATOM   4362  O  OH    . TYR F  2 88  ? -29.503 -18.216 25.388  1.00 64.65  ? 88   TYR F OH    1 
ATOM   4363  N  N     . ALA F  2 89  ? -29.228 -15.410 33.570  1.00 56.34  ? 89   ALA F N     1 
ATOM   4364  C  CA    . ALA F  2 89  ? -28.811 -14.673 34.753  1.00 56.24  ? 89   ALA F CA    1 
ATOM   4365  C  C     . ALA F  2 89  ? -28.531 -15.648 35.879  1.00 55.88  ? 89   ALA F C     1 
ATOM   4366  O  O     . ALA F  2 89  ? -27.509 -15.537 36.562  1.00 55.85  ? 89   ALA F O     1 
ATOM   4367  C  CB    . ALA F  2 89  ? -29.842 -13.626 35.162  1.00 55.66  ? 89   ALA F CB    1 
ATOM   4368  N  N     . LEU F  2 90  ? -29.430 -16.616 36.040  1.00 55.75  ? 90   LEU F N     1 
ATOM   4369  C  CA    . LEU F  2 90  ? -29.256 -17.696 37.000  1.00 55.54  ? 90   LEU F CA    1 
ATOM   4370  C  C     . LEU F  2 90  ? -28.011 -18.530 36.722  1.00 56.13  ? 90   LEU F C     1 
ATOM   4371  O  O     . LEU F  2 90  ? -27.344 -18.953 37.645  1.00 56.74  ? 90   LEU F O     1 
ATOM   4372  C  CB    . LEU F  2 90  ? -30.498 -18.561 37.035  1.00 55.13  ? 90   LEU F CB    1 
ATOM   4373  C  CG    . LEU F  2 90  ? -31.627 -17.917 37.842  1.00 54.23  ? 90   LEU F CG    1 
ATOM   4374  C  CD1   . LEU F  2 90  ? -32.918 -18.636 37.600  1.00 54.79  ? 90   LEU F CD1   1 
ATOM   4375  C  CD2   . LEU F  2 90  ? -31.300 -17.935 39.318  1.00 52.79  ? 90   LEU F CD2   1 
ATOM   4376  N  N     . LYS F  2 91  ? -27.677 -18.726 35.452  1.00 56.63  ? 91   LYS F N     1 
ATOM   4377  C  CA    . LYS F  2 91  ? -26.443 -19.393 35.084  1.00 57.68  ? 91   LYS F CA    1 
ATOM   4378  C  C     . LYS F  2 91  ? -25.184 -18.634 35.505  1.00 58.59  ? 91   LYS F C     1 
ATOM   4379  O  O     . LYS F  2 91  ? -24.218 -19.246 35.928  1.00 59.16  ? 91   LYS F O     1 
ATOM   4380  C  CB    . LYS F  2 91  ? -26.399 -19.643 33.594  1.00 57.18  ? 91   LYS F CB    1 
ATOM   4381  C  CG    . LYS F  2 91  ? -25.471 -20.756 33.221  1.00 58.74  ? 91   LYS F CG    1 
ATOM   4382  C  CD    . LYS F  2 91  ? -25.441 -20.896 31.711  1.00 63.77  ? 91   LYS F CD    1 
ATOM   4383  C  CE    . LYS F  2 91  ? -24.846 -22.236 31.283  1.00 66.11  ? 91   LYS F CE    1 
ATOM   4384  N  NZ    . LYS F  2 91  ? -25.501 -22.734 30.019  1.00 67.60  ? 91   LYS F NZ    1 
ATOM   4385  N  N     . ARG F  2 92  ? -25.194 -17.309 35.387  1.00 59.50  ? 92   ARG F N     1 
ATOM   4386  C  CA    . ARG F  2 92  ? -24.029 -16.492 35.736  1.00 60.46  ? 92   ARG F CA    1 
ATOM   4387  C  C     . ARG F  2 92  ? -23.762 -16.492 37.215  1.00 60.35  ? 92   ARG F C     1 
ATOM   4388  O  O     . ARG F  2 92  ? -22.627 -16.362 37.626  1.00 60.83  ? 92   ARG F O     1 
ATOM   4389  C  CB    . ARG F  2 92  ? -24.251 -15.044 35.337  1.00 61.24  ? 92   ARG F CB    1 
ATOM   4390  C  CG    . ARG F  2 92  ? -23.856 -14.707 33.945  1.00 63.47  ? 92   ARG F CG    1 
ATOM   4391  C  CD    . ARG F  2 92  ? -23.500 -13.244 33.938  1.00 66.89  ? 92   ARG F CD    1 
ATOM   4392  N  NE    . ARG F  2 92  ? -22.211 -13.021 34.590  1.00 69.14  ? 92   ARG F NE    1 
ATOM   4393  C  CZ    . ARG F  2 92  ? -22.055 -12.564 35.830  1.00 70.22  ? 92   ARG F CZ    1 
ATOM   4394  N  NH1   . ARG F  2 92  ? -23.113 -12.254 36.585  1.00 69.80  ? 92   ARG F NH1   1 
ATOM   4395  N  NH2   . ARG F  2 92  ? -20.827 -12.404 36.310  1.00 70.15  ? 92   ARG F NH2   1 
ATOM   4396  N  N     . GLN F  2 93  ? -24.819 -16.590 38.011  1.00 60.38  ? 93   GLN F N     1 
ATOM   4397  C  CA    . GLN F  2 93  ? -24.691 -16.661 39.455  1.00 60.37  ? 93   GLN F CA    1 
ATOM   4398  C  C     . GLN F  2 93  ? -24.360 -18.085 39.891  1.00 59.28  ? 93   GLN F C     1 
ATOM   4399  O  O     . GLN F  2 93  ? -24.385 -18.373 41.081  1.00 59.22  ? 93   GLN F O     1 
ATOM   4400  C  CB    . GLN F  2 93  ? -26.004 -16.238 40.134  1.00 61.39  ? 93   GLN F CB    1 
ATOM   4401  C  CG    . GLN F  2 93  ? -26.676 -14.974 39.567  1.00 63.85  ? 93   GLN F CG    1 
ATOM   4402  C  CD    . GLN F  2 93  ? -26.003 -13.694 40.022  1.00 68.84  ? 93   GLN F CD    1 
ATOM   4403  O  OE1   . GLN F  2 93  ? -25.563 -13.574 41.175  1.00 70.61  ? 93   GLN F OE1   1 
ATOM   4404  N  NE2   . GLN F  2 93  ? -25.919 -12.721 39.115  1.00 70.15  ? 93   GLN F NE2   1 
ATOM   4405  N  N     . GLY F  2 94  ? -24.087 -18.970 38.930  1.00 58.12  ? 94   GLY F N     1 
ATOM   4406  C  CA    . GLY F  2 94  ? -23.837 -20.380 39.207  1.00 56.69  ? 94   GLY F CA    1 
ATOM   4407  C  C     . GLY F  2 94  ? -25.029 -21.115 39.787  1.00 56.00  ? 94   GLY F C     1 
ATOM   4408  O  O     . GLY F  2 94  ? -24.883 -21.955 40.674  1.00 56.20  ? 94   GLY F O     1 
ATOM   4409  N  N     . ARG F  2 95  ? -26.217 -20.788 39.295  1.00 55.26  ? 95   ARG F N     1 
ATOM   4410  C  CA    . ARG F  2 95  ? -27.426 -21.419 39.749  1.00 54.54  ? 95   ARG F CA    1 
ATOM   4411  C  C     . ARG F  2 95  ? -28.269 -21.895 38.584  1.00 54.49  ? 95   ARG F C     1 
ATOM   4412  O  O     . ARG F  2 95  ? -29.465 -21.604 38.541  1.00 54.86  ? 95   ARG F O     1 
ATOM   4413  C  CB    . ARG F  2 95  ? -28.218 -20.481 40.651  1.00 54.57  ? 95   ARG F CB    1 
ATOM   4414  C  CG    . ARG F  2 95  ? -27.545 -20.262 41.974  1.00 55.57  ? 95   ARG F CG    1 
ATOM   4415  C  CD    . ARG F  2 95  ? -28.488 -19.865 43.067  1.00 56.88  ? 95   ARG F CD    1 
ATOM   4416  N  NE    . ARG F  2 95  ? -28.068 -20.479 44.326  1.00 59.11  ? 95   ARG F NE    1 
ATOM   4417  C  CZ    . ARG F  2 95  ? -28.521 -21.656 44.782  1.00 60.32  ? 95   ARG F CZ    1 
ATOM   4418  N  NH1   . ARG F  2 95  ? -29.428 -22.341 44.097  1.00 59.74  ? 95   ARG F NH1   1 
ATOM   4419  N  NH2   . ARG F  2 95  ? -28.082 -22.149 45.941  1.00 60.75  ? 95   ARG F NH2   1 
ATOM   4420  N  N     . THR F  2 96  ? -27.646 -22.643 37.665  1.00 54.20  ? 96   THR F N     1 
ATOM   4421  C  CA    . THR F  2 96  ? -28.308 -23.245 36.500  1.00 54.51  ? 96   THR F CA    1 
ATOM   4422  C  C     . THR F  2 96  ? -29.673 -23.830 36.836  1.00 54.56  ? 96   THR F C     1 
ATOM   4423  O  O     . THR F  2 96  ? -29.808 -24.587 37.793  1.00 54.94  ? 96   THR F O     1 
ATOM   4424  C  CB    . THR F  2 96  ? -27.451 -24.358 35.874  1.00 54.70  ? 96   THR F CB    1 
ATOM   4425  O  OG1   . THR F  2 96  ? -26.215 -23.814 35.399  1.00 55.91  ? 96   THR F OG1   1 
ATOM   4426  C  CG2   . THR F  2 96  ? -28.176 -25.011 34.708  1.00 54.56  ? 96   THR F CG2   1 
ATOM   4427  N  N     . LEU F  2 97  ? -30.683 -23.448 36.057  1.00 54.61  ? 97   LEU F N     1 
ATOM   4428  C  CA    . LEU F  2 97  ? -32.052 -23.911 36.256  1.00 54.31  ? 97   LEU F CA    1 
ATOM   4429  C  C     . LEU F  2 97  ? -32.486 -24.699 35.032  1.00 54.43  ? 97   LEU F C     1 
ATOM   4430  O  O     . LEU F  2 97  ? -32.307 -24.249 33.918  1.00 54.13  ? 97   LEU F O     1 
ATOM   4431  C  CB    . LEU F  2 97  ? -32.976 -22.730 36.489  1.00 53.99  ? 97   LEU F CB    1 
ATOM   4432  C  CG    . LEU F  2 97  ? -34.488 -22.902 36.565  1.00 53.93  ? 97   LEU F CG    1 
ATOM   4433  C  CD1   . LEU F  2 97  ? -34.920 -23.512 37.868  1.00 51.37  ? 97   LEU F CD1   1 
ATOM   4434  C  CD2   . LEU F  2 97  ? -35.114 -21.544 36.400  1.00 54.35  ? 97   LEU F CD2   1 
ATOM   4435  N  N     . TYR F  2 98  ? -32.996 -25.905 35.257  1.00 55.25  ? 98   TYR F N     1 
ATOM   4436  C  CA    . TYR F  2 98  ? -33.527 -26.741 34.189  1.00 56.26  ? 98   TYR F CA    1 
ATOM   4437  C  C     . TYR F  2 98  ? -35.040 -26.603 34.124  1.00 56.95  ? 98   TYR F C     1 
ATOM   4438  O  O     . TYR F  2 98  ? -35.715 -26.505 35.160  1.00 55.88  ? 98   TYR F O     1 
ATOM   4439  C  CB    . TYR F  2 98  ? -33.206 -28.204 34.433  1.00 56.11  ? 98   TYR F CB    1 
ATOM   4440  C  CG    . TYR F  2 98  ? -31.771 -28.634 34.175  1.00 56.79  ? 98   TYR F CG    1 
ATOM   4441  C  CD1   . TYR F  2 98  ? -30.827 -27.775 33.607  1.00 55.91  ? 98   TYR F CD1   1 
ATOM   4442  C  CD2   . TYR F  2 98  ? -31.377 -29.943 34.458  1.00 55.87  ? 98   TYR F CD2   1 
ATOM   4443  C  CE1   . TYR F  2 98  ? -29.523 -28.208 33.378  1.00 56.30  ? 98   TYR F CE1   1 
ATOM   4444  C  CE2   . TYR F  2 98  ? -30.098 -30.372 34.226  1.00 55.65  ? 98   TYR F CE2   1 
ATOM   4445  C  CZ    . TYR F  2 98  ? -29.179 -29.518 33.688  1.00 56.29  ? 98   TYR F CZ    1 
ATOM   4446  O  OH    . TYR F  2 98  ? -27.918 -30.012 33.472  1.00 56.77  ? 98   TYR F OH    1 
ATOM   4447  N  N     . GLY F  2 99  ? -35.554 -26.581 32.896  1.00 58.06  ? 99   GLY F N     1 
ATOM   4448  C  CA    . GLY F  2 99  ? -36.984 -26.559 32.667  1.00 59.94  ? 99   GLY F CA    1 
ATOM   4449  C  C     . GLY F  2 99  ? -37.568 -25.311 32.041  1.00 61.42  ? 99   GLY F C     1 
ATOM   4450  O  O     . GLY F  2 99  ? -38.791 -25.192 31.959  1.00 62.25  ? 99   GLY F O     1 
ATOM   4451  N  N     . PHE F  2 100 ? -36.737 -24.367 31.603  1.00 62.48  ? 100  PHE F N     1 
ATOM   4452  C  CA    . PHE F  2 100 ? -37.291 -23.155 30.994  1.00 63.22  ? 100  PHE F CA    1 
ATOM   4453  C  C     . PHE F  2 100 ? -36.596 -22.705 29.714  1.00 64.70  ? 100  PHE F C     1 
ATOM   4454  O  O     . PHE F  2 100 ? -36.817 -21.574 29.270  1.00 65.50  ? 100  PHE F O     1 
ATOM   4455  C  CB    . PHE F  2 100 ? -37.324 -21.989 31.995  1.00 62.46  ? 100  PHE F CB    1 
ATOM   4456  C  CG    . PHE F  2 100 ? -38.264 -22.187 33.151  1.00 60.91  ? 100  PHE F CG    1 
ATOM   4457  C  CD1   . PHE F  2 100 ? -37.800 -22.707 34.357  1.00 60.19  ? 100  PHE F CD1   1 
ATOM   4458  C  CD2   . PHE F  2 100 ? -39.601 -21.822 33.046  1.00 60.03  ? 100  PHE F CD2   1 
ATOM   4459  C  CE1   . PHE F  2 100 ? -38.660 -22.889 35.450  1.00 59.87  ? 100  PHE F CE1   1 
ATOM   4460  C  CE2   . PHE F  2 100 ? -40.478 -21.989 34.125  1.00 60.19  ? 100  PHE F CE2   1 
ATOM   4461  C  CZ    . PHE F  2 100 ? -40.006 -22.522 35.341  1.00 60.26  ? 100  PHE F CZ    1 
ATOM   4462  N  N     . GLY F  2 101 ? -35.759 -23.552 29.126  1.00 65.91  ? 101  GLY F N     1 
ATOM   4463  C  CA    . GLY F  2 101 ? -35.088 -23.201 27.875  1.00 68.20  ? 101  GLY F CA    1 
ATOM   4464  C  C     . GLY F  2 101 ? -33.566 -23.328 27.899  1.00 70.17  ? 101  GLY F C     1 
ATOM   4465  O  O     . GLY F  2 101 ? -32.889 -22.937 26.936  1.00 69.96  ? 101  GLY F O     1 
ATOM   4466  N  N     . GLY F  2 102 ? -33.029 -23.871 29.000  1.00 71.87  ? 102  GLY F N     1 
ATOM   4467  C  CA    . GLY F  2 102 ? -31.604 -24.244 29.100  1.00 73.75  ? 102  GLY F CA    1 
ATOM   4468  C  C     . GLY F  2 102 ? -30.905 -24.516 27.762  1.00 74.94  ? 102  GLY F C     1 
ATOM   4469  O  O     . GLY F  2 102 ? -29.999 -23.767 27.353  1.00 75.48  ? 102  GLY F O     1 
ATOM   4470  O  OXT   . GLY F  2 102 ? -31.226 -25.477 27.033  1.00 75.58  ? 102  GLY F OXT   1 
ATOM   4471  N  N     . ALA G  3 14  ? -0.268  9.986   14.847  1.00 83.91  ? 14   ALA G N     1 
ATOM   4472  C  CA    . ALA G  3 14  ? -0.023  8.907   15.855  1.00 83.68  ? 14   ALA G CA    1 
ATOM   4473  C  C     . ALA G  3 14  ? -0.251  7.510   15.273  1.00 83.30  ? 14   ALA G C     1 
ATOM   4474  O  O     . ALA G  3 14  ? -1.336  7.179   14.780  1.00 83.77  ? 14   ALA G O     1 
ATOM   4475  C  CB    . ALA G  3 14  ? -0.868  9.129   17.124  1.00 83.87  ? 14   ALA G CB    1 
ATOM   4476  N  N     . LYS G  3 15  ? 0.793   6.698   15.347  1.00 82.60  ? 15   LYS G N     1 
ATOM   4477  C  CA    . LYS G  3 15  ? 0.819   5.394   14.717  1.00 81.72  ? 15   LYS G CA    1 
ATOM   4478  C  C     . LYS G  3 15  ? 0.006   4.350   15.497  1.00 80.68  ? 15   LYS G C     1 
ATOM   4479  O  O     . LYS G  3 15  ? -1.030  3.896   15.018  1.00 80.84  ? 15   LYS G O     1 
ATOM   4480  C  CB    . LYS G  3 15  ? 2.276   4.951   14.514  1.00 82.21  ? 15   LYS G CB    1 
ATOM   4481  C  CG    . LYS G  3 15  ? 3.166   6.000   13.820  1.00 83.43  ? 15   LYS G CG    1 
ATOM   4482  C  CD    . LYS G  3 15  ? 2.796   6.176   12.335  1.00 86.52  ? 15   LYS G CD    1 
ATOM   4483  C  CE    . LYS G  3 15  ? 3.331   7.496   11.767  1.00 87.20  ? 15   LYS G CE    1 
ATOM   4484  N  NZ    . LYS G  3 15  ? 2.775   7.770   10.403  1.00 88.07  ? 15   LYS G NZ    1 
ATOM   4485  N  N     . THR G  3 16  ? 0.460   3.984   16.697  1.00 79.05  ? 16   THR G N     1 
ATOM   4486  C  CA    . THR G  3 16  ? -0.177  2.900   17.457  1.00 77.36  ? 16   THR G CA    1 
ATOM   4487  C  C     . THR G  3 16  ? -1.601  3.214   17.872  1.00 76.01  ? 16   THR G C     1 
ATOM   4488  O  O     . THR G  3 16  ? -1.933  4.363   18.194  1.00 76.10  ? 16   THR G O     1 
ATOM   4489  C  CB    . THR G  3 16  ? 0.579   2.551   18.741  1.00 77.41  ? 16   THR G CB    1 
ATOM   4490  O  OG1   . THR G  3 16  ? 0.520   3.672   19.638  1.00 78.03  ? 16   THR G OG1   1 
ATOM   4491  C  CG2   . THR G  3 16  ? 2.030   2.157   18.440  1.00 77.08  ? 16   THR G CG2   1 
ATOM   4492  N  N     . ARG G  3 17  ? -2.415  2.163   17.893  1.00 74.05  ? 17   ARG G N     1 
ATOM   4493  C  CA    . ARG G  3 17  ? -3.807  2.230   18.308  1.00 72.33  ? 17   ARG G CA    1 
ATOM   4494  C  C     . ARG G  3 17  ? -3.990  2.583   19.772  1.00 71.50  ? 17   ARG G C     1 
ATOM   4495  O  O     . ARG G  3 17  ? -5.011  3.153   20.150  1.00 71.42  ? 17   ARG G O     1 
ATOM   4496  C  CB    . ARG G  3 17  ? -4.487  0.908   18.015  1.00 72.23  ? 17   ARG G CB    1 
ATOM   4497  C  CG    . ARG G  3 17  ? -4.631  0.649   16.548  1.00 71.77  ? 17   ARG G CG    1 
ATOM   4498  C  CD    . ARG G  3 17  ? -5.718  -0.330  16.291  1.00 70.92  ? 17   ARG G CD    1 
ATOM   4499  N  NE    . ARG G  3 17  ? -5.206  -1.693  16.240  1.00 70.93  ? 17   ARG G NE    1 
ATOM   4500  C  CZ    . ARG G  3 17  ? -5.982  -2.768  16.148  1.00 71.06  ? 17   ARG G CZ    1 
ATOM   4501  N  NH1   . ARG G  3 17  ? -7.307  -2.637  16.105  1.00 70.77  ? 17   ARG G NH1   1 
ATOM   4502  N  NH2   . ARG G  3 17  ? -5.438  -3.972  16.100  1.00 70.26  ? 17   ARG G NH2   1 
ATOM   4503  N  N     . SER G  3 18  ? -3.008  2.233   20.596  1.00 70.58  ? 18   SER G N     1 
ATOM   4504  C  CA    . SER G  3 18  ? -3.006  2.630   22.002  1.00 69.66  ? 18   SER G CA    1 
ATOM   4505  C  C     . SER G  3 18  ? -2.867  4.143   22.101  1.00 68.93  ? 18   SER G C     1 
ATOM   4506  O  O     . SER G  3 18  ? -3.656  4.814   22.766  1.00 68.30  ? 18   SER G O     1 
ATOM   4507  C  CB    . SER G  3 18  ? -1.863  1.952   22.759  1.00 69.34  ? 18   SER G CB    1 
ATOM   4508  O  OG    . SER G  3 18  ? -2.088  0.568   22.841  1.00 68.79  ? 18   SER G OG    1 
ATOM   4509  N  N     . SER G  3 19  ? -1.849  4.657   21.419  1.00 68.52  ? 19   SER G N     1 
ATOM   4510  C  CA    . SER G  3 19  ? -1.613  6.084   21.329  1.00 68.00  ? 19   SER G CA    1 
ATOM   4511  C  C     . SER G  3 19  ? -2.873  6.818   20.876  1.00 67.28  ? 19   SER G C     1 
ATOM   4512  O  O     . SER G  3 19  ? -3.249  7.814   21.493  1.00 66.98  ? 19   SER G O     1 
ATOM   4513  C  CB    . SER G  3 19  ? -0.464  6.361   20.381  1.00 67.91  ? 19   SER G CB    1 
ATOM   4514  O  OG    . SER G  3 19  ? -0.343  7.746   20.187  1.00 69.22  ? 19   SER G OG    1 
ATOM   4515  N  N     . ARG G  3 20  ? -3.521  6.312   19.822  1.00 66.48  ? 20   ARG G N     1 
ATOM   4516  C  CA    . ARG G  3 20  ? -4.824  6.827   19.382  1.00 66.54  ? 20   ARG G CA    1 
ATOM   4517  C  C     . ARG G  3 20  ? -5.870  6.832   20.485  1.00 65.89  ? 20   ARG G C     1 
ATOM   4518  O  O     . ARG G  3 20  ? -6.637  7.776   20.617  1.00 66.50  ? 20   ARG G O     1 
ATOM   4519  C  CB    . ARG G  3 20  ? -5.392  6.008   18.230  1.00 66.88  ? 20   ARG G CB    1 
ATOM   4520  C  CG    . ARG G  3 20  ? -4.981  6.462   16.866  1.00 69.27  ? 20   ARG G CG    1 
ATOM   4521  C  CD    . ARG G  3 20  ? -5.668  5.639   15.772  1.00 73.33  ? 20   ARG G CD    1 
ATOM   4522  N  NE    . ARG G  3 20  ? -5.027  5.923   14.488  1.00 78.30  ? 20   ARG G NE    1 
ATOM   4523  C  CZ    . ARG G  3 20  ? -4.077  5.174   13.930  1.00 79.65  ? 20   ARG G CZ    1 
ATOM   4524  N  NH1   . ARG G  3 20  ? -3.674  4.047   14.516  1.00 79.38  ? 20   ARG G NH1   1 
ATOM   4525  N  NH2   . ARG G  3 20  ? -3.544  5.548   12.768  1.00 80.36  ? 20   ARG G NH2   1 
ATOM   4526  N  N     . ALA G  3 21  ? -5.912  5.766   21.267  1.00 65.13  ? 21   ALA G N     1 
ATOM   4527  C  CA    . ALA G  3 21  ? -6.956  5.608   22.258  1.00 64.17  ? 21   ALA G CA    1 
ATOM   4528  C  C     . ALA G  3 21  ? -6.585  6.280   23.568  1.00 63.57  ? 21   ALA G C     1 
ATOM   4529  O  O     . ALA G  3 21  ? -7.413  6.378   24.478  1.00 63.92  ? 21   ALA G O     1 
ATOM   4530  C  CB    . ALA G  3 21  ? -7.224  4.142   22.469  1.00 64.47  ? 21   ALA G CB    1 
ATOM   4531  N  N     . GLY G  3 22  ? -5.341  6.739   23.660  1.00 62.35  ? 22   GLY G N     1 
ATOM   4532  C  CA    . GLY G  3 22  ? -4.854  7.400   24.854  1.00 61.54  ? 22   GLY G CA    1 
ATOM   4533  C  C     . GLY G  3 22  ? -4.507  6.406   25.933  1.00 61.33  ? 22   GLY G C     1 
ATOM   4534  O  O     . GLY G  3 22  ? -4.681  6.689   27.117  1.00 61.67  ? 22   GLY G O     1 
ATOM   4535  N  N     . LEU G  3 23  ? -3.979  5.251   25.522  1.00 60.92  ? 23   LEU G N     1 
ATOM   4536  C  CA    . LEU G  3 23  ? -3.802  4.113   26.413  1.00 60.20  ? 23   LEU G CA    1 
ATOM   4537  C  C     . LEU G  3 23  ? -2.381  3.560   26.531  1.00 60.14  ? 23   LEU G C     1 
ATOM   4538  O  O     . LEU G  3 23  ? -1.614  3.557   25.565  1.00 60.15  ? 23   LEU G O     1 
ATOM   4539  C  CB    . LEU G  3 23  ? -4.725  2.986   25.962  1.00 60.12  ? 23   LEU G CB    1 
ATOM   4540  C  CG    . LEU G  3 23  ? -6.239  3.173   25.987  1.00 59.02  ? 23   LEU G CG    1 
ATOM   4541  C  CD1   . LEU G  3 23  ? -6.815  1.929   25.383  1.00 60.00  ? 23   LEU G CD1   1 
ATOM   4542  C  CD2   . LEU G  3 23  ? -6.759  3.341   27.385  1.00 57.52  ? 23   LEU G CD2   1 
ATOM   4543  N  N     . GLN G  3 24  ? -2.064  3.064   27.729  1.00 60.04  ? 24   GLN G N     1 
ATOM   4544  C  CA    . GLN G  3 24  ? -0.817  2.343   28.028  1.00 59.77  ? 24   GLN G CA    1 
ATOM   4545  C  C     . GLN G  3 24  ? -0.895  0.872   27.648  1.00 59.65  ? 24   GLN G C     1 
ATOM   4546  O  O     . GLN G  3 24  ? 0.071   0.312   27.167  1.00 60.01  ? 24   GLN G O     1 
ATOM   4547  C  CB    . GLN G  3 24  ? -0.496  2.434   29.519  1.00 59.88  ? 24   GLN G CB    1 
ATOM   4548  C  CG    . GLN G  3 24  ? -0.341  3.858   30.059  1.00 60.69  ? 24   GLN G CG    1 
ATOM   4549  C  CD    . GLN G  3 24  ? 0.689   4.666   29.277  1.00 59.78  ? 24   GLN G CD    1 
ATOM   4550  O  OE1   . GLN G  3 24  ? 1.844   4.243   29.104  1.00 59.05  ? 24   GLN G OE1   1 
ATOM   4551  N  NE2   . GLN G  3 24  ? 0.269   5.819   28.789  1.00 58.22  ? 24   GLN G NE2   1 
ATOM   4552  N  N     . PHE G  3 25  ? -2.047  0.249   27.867  1.00 59.68  ? 25   PHE G N     1 
ATOM   4553  C  CA    . PHE G  3 25  ? -2.237  -1.166  27.553  1.00 59.88  ? 25   PHE G CA    1 
ATOM   4554  C  C     . PHE G  3 25  ? -2.334  -1.341  26.041  1.00 60.35  ? 25   PHE G C     1 
ATOM   4555  O  O     . PHE G  3 25  ? -2.778  -0.431  25.381  1.00 60.03  ? 25   PHE G O     1 
ATOM   4556  C  CB    . PHE G  3 25  ? -3.460  -1.740  28.306  1.00 59.03  ? 25   PHE G CB    1 
ATOM   4557  C  CG    . PHE G  3 25  ? -3.093  -2.439  29.592  1.00 57.08  ? 25   PHE G CG    1 
ATOM   4558  C  CD1   . PHE G  3 25  ? -2.351  -1.779  30.575  1.00 53.75  ? 25   PHE G CD1   1 
ATOM   4559  C  CD2   . PHE G  3 25  ? -3.467  -3.764  29.818  1.00 54.99  ? 25   PHE G CD2   1 
ATOM   4560  C  CE1   . PHE G  3 25  ? -1.988  -2.418  31.755  1.00 51.13  ? 25   PHE G CE1   1 
ATOM   4561  C  CE2   . PHE G  3 25  ? -3.108  -4.404  31.002  1.00 51.76  ? 25   PHE G CE2   1 
ATOM   4562  C  CZ    . PHE G  3 25  ? -2.364  -3.727  31.963  1.00 52.59  ? 25   PHE G CZ    1 
ATOM   4563  N  N     . PRO G  3 26  ? -1.911  -2.514  25.500  1.00 60.93  ? 26   PRO G N     1 
ATOM   4564  C  CA    . PRO G  3 26  ? -1.608  -2.660  24.072  1.00 60.90  ? 26   PRO G CA    1 
ATOM   4565  C  C     . PRO G  3 26  ? -2.803  -3.087  23.244  1.00 61.05  ? 26   PRO G C     1 
ATOM   4566  O  O     . PRO G  3 26  ? -3.175  -4.263  23.249  1.00 61.61  ? 26   PRO G O     1 
ATOM   4567  C  CB    . PRO G  3 26  ? -0.549  -3.765  24.060  1.00 60.63  ? 26   PRO G CB    1 
ATOM   4568  C  CG    . PRO G  3 26  ? -0.869  -4.602  25.219  1.00 60.59  ? 26   PRO G CG    1 
ATOM   4569  C  CD    . PRO G  3 26  ? -1.699  -3.789  26.206  1.00 60.84  ? 26   PRO G CD    1 
ATOM   4570  N  N     . VAL G  3 27  ? -3.390  -2.146  22.519  1.00 60.97  ? 27   VAL G N     1 
ATOM   4571  C  CA    . VAL G  3 27  ? -4.620  -2.420  21.781  1.00 60.93  ? 27   VAL G CA    1 
ATOM   4572  C  C     . VAL G  3 27  ? -4.448  -3.519  20.724  1.00 61.20  ? 27   VAL G C     1 
ATOM   4573  O  O     . VAL G  3 27  ? -5.333  -4.364  20.566  1.00 61.88  ? 27   VAL G O     1 
ATOM   4574  C  CB    . VAL G  3 27  ? -5.230  -1.133  21.213  1.00 60.88  ? 27   VAL G CB    1 
ATOM   4575  C  CG1   . VAL G  3 27  ? -6.464  -1.429  20.379  1.00 61.25  ? 27   VAL G CG1   1 
ATOM   4576  C  CG2   . VAL G  3 27  ? -5.574  -0.191  22.353  1.00 60.03  ? 27   VAL G CG2   1 
ATOM   4577  N  N     . GLY G  3 28  ? -3.304  -3.535  20.040  1.00 61.16  ? 28   GLY G N     1 
ATOM   4578  C  CA    . GLY G  3 28  ? -3.015  -4.555  19.025  1.00 60.66  ? 28   GLY G CA    1 
ATOM   4579  C  C     . GLY G  3 28  ? -2.989  -5.964  19.581  1.00 60.63  ? 28   GLY G C     1 
ATOM   4580  O  O     . GLY G  3 28  ? -3.592  -6.871  19.002  1.00 61.02  ? 28   GLY G O     1 
ATOM   4581  N  N     . ARG G  3 29  ? -2.298  -6.141  20.711  1.00 60.29  ? 29   ARG G N     1 
ATOM   4582  C  CA    . ARG G  3 29  ? -2.235  -7.420  21.404  1.00 59.44  ? 29   ARG G CA    1 
ATOM   4583  C  C     . ARG G  3 29  ? -3.639  -7.871  21.794  1.00 59.92  ? 29   ARG G C     1 
ATOM   4584  O  O     . ARG G  3 29  ? -4.044  -8.985  21.466  1.00 60.70  ? 29   ARG G O     1 
ATOM   4585  C  CB    . ARG G  3 29  ? -1.307  -7.359  22.625  1.00 59.32  ? 29   ARG G CB    1 
ATOM   4586  C  CG    . ARG G  3 29  ? -0.985  -8.742  23.240  1.00 59.00  ? 29   ARG G CG    1 
ATOM   4587  C  CD    . ARG G  3 29  ? 0.117   -8.701  24.343  1.00 58.41  ? 29   ARG G CD    1 
ATOM   4588  N  NE    . ARG G  3 29  ? 1.456   -8.427  23.808  1.00 56.89  ? 29   ARG G NE    1 
ATOM   4589  C  CZ    . ARG G  3 29  ? 2.590   -8.431  24.513  1.00 57.06  ? 29   ARG G CZ    1 
ATOM   4590  N  NH1   . ARG G  3 29  ? 2.588   -8.721  25.816  1.00 55.38  ? 29   ARG G NH1   1 
ATOM   4591  N  NH2   . ARG G  3 29  ? 3.742   -8.150  23.903  1.00 56.85  ? 29   ARG G NH2   1 
ATOM   4592  N  N     . VAL G  3 30  ? -4.405  -7.009  22.455  1.00 59.79  ? 30   VAL G N     1 
ATOM   4593  C  CA    . VAL G  3 30  ? -5.762  -7.381  22.847  1.00 59.69  ? 30   VAL G CA    1 
ATOM   4594  C  C     . VAL G  3 30  ? -6.627  -7.751  21.630  1.00 60.48  ? 30   VAL G C     1 
ATOM   4595  O  O     . VAL G  3 30  ? -7.481  -8.624  21.715  1.00 60.97  ? 30   VAL G O     1 
ATOM   4596  C  CB    . VAL G  3 30  ? -6.431  -6.287  23.711  1.00 59.64  ? 30   VAL G CB    1 
ATOM   4597  C  CG1   . VAL G  3 30  ? -7.850  -6.673  24.067  1.00 58.45  ? 30   VAL G CG1   1 
ATOM   4598  C  CG2   . VAL G  3 30  ? -5.616  -6.028  24.982  1.00 58.39  ? 30   VAL G CG2   1 
ATOM   4599  N  N     . HIS G  3 31  ? -6.395  -7.106  20.493  1.00 61.13  ? 31   HIS G N     1 
ATOM   4600  C  CA    . HIS G  3 31  ? -7.136  -7.424  19.293  1.00 61.89  ? 31   HIS G CA    1 
ATOM   4601  C  C     . HIS G  3 31  ? -6.805  -8.840  18.878  1.00 62.44  ? 31   HIS G C     1 
ATOM   4602  O  O     . HIS G  3 31  ? -7.689  -9.633  18.553  1.00 62.46  ? 31   HIS G O     1 
ATOM   4603  C  CB    . HIS G  3 31  ? -6.760  -6.475  18.163  1.00 62.10  ? 31   HIS G CB    1 
ATOM   4604  C  CG    . HIS G  3 31  ? -7.761  -6.426  17.050  1.00 63.84  ? 31   HIS G CG    1 
ATOM   4605  N  ND1   . HIS G  3 31  ? -8.678  -7.430  16.820  1.00 65.92  ? 31   HIS G ND1   1 
ATOM   4606  C  CD2   . HIS G  3 31  ? -7.977  -5.495  16.089  1.00 65.77  ? 31   HIS G CD2   1 
ATOM   4607  C  CE1   . HIS G  3 31  ? -9.427  -7.110  15.778  1.00 67.40  ? 31   HIS G CE1   1 
ATOM   4608  N  NE2   . HIS G  3 31  ? -9.019  -5.942  15.313  1.00 67.29  ? 31   HIS G NE2   1 
ATOM   4609  N  N     . ARG G  3 32  ? -5.519  -9.159  18.891  1.00 62.91  ? 32   ARG G N     1 
ATOM   4610  C  CA    . ARG G  3 32  ? -5.075  -10.434 18.388  1.00 63.48  ? 32   ARG G CA    1 
ATOM   4611  C  C     . ARG G  3 32  ? -5.583  -11.555 19.269  1.00 63.93  ? 32   ARG G C     1 
ATOM   4612  O  O     . ARG G  3 32  ? -6.089  -12.559 18.759  1.00 64.60  ? 32   ARG G O     1 
ATOM   4613  C  CB    . ARG G  3 32  ? -3.561  -10.461 18.301  1.00 63.72  ? 32   ARG G CB    1 
ATOM   4614  C  CG    . ARG G  3 32  ? -3.004  -11.747 17.757  1.00 64.01  ? 32   ARG G CG    1 
ATOM   4615  C  CD    . ARG G  3 32  ? -1.539  -11.826 18.115  1.00 64.69  ? 32   ARG G CD    1 
ATOM   4616  N  NE    . ARG G  3 32  ? -1.361  -12.248 19.497  1.00 65.08  ? 32   ARG G NE    1 
ATOM   4617  C  CZ    . ARG G  3 32  ? -0.341  -11.896 20.267  1.00 66.53  ? 32   ARG G CZ    1 
ATOM   4618  N  NH1   . ARG G  3 32  ? 0.608   -11.092 19.810  1.00 66.59  ? 32   ARG G NH1   1 
ATOM   4619  N  NH2   . ARG G  3 32  ? -0.278  -12.348 21.509  1.00 68.45  ? 32   ARG G NH2   1 
ATOM   4620  N  N     . LEU G  3 33  ? -5.455  -11.382 20.584  1.00 64.00  ? 33   LEU G N     1 
ATOM   4621  C  CA    . LEU G  3 33  ? -5.950  -12.373 21.542  1.00 64.16  ? 33   LEU G CA    1 
ATOM   4622  C  C     . LEU G  3 33  ? -7.461  -12.600 21.442  1.00 64.34  ? 33   LEU G C     1 
ATOM   4623  O  O     . LEU G  3 33  ? -7.936  -13.666 21.767  1.00 64.73  ? 33   LEU G O     1 
ATOM   4624  C  CB    . LEU G  3 33  ? -5.539  -12.029 22.993  1.00 64.01  ? 33   LEU G CB    1 
ATOM   4625  C  CG    . LEU G  3 33  ? -4.040  -12.032 23.368  1.00 63.59  ? 33   LEU G CG    1 
ATOM   4626  C  CD1   . LEU G  3 33  ? -3.767  -11.277 24.672  1.00 63.60  ? 33   LEU G CD1   1 
ATOM   4627  C  CD2   . LEU G  3 33  ? -3.434  -13.413 23.441  1.00 60.29  ? 33   LEU G CD2   1 
ATOM   4628  N  N     . LEU G  3 34  ? -8.226  -11.617 20.993  1.00 64.85  ? 34   LEU G N     1 
ATOM   4629  C  CA    . LEU G  3 34  ? -9.660  -11.846 20.865  1.00 65.60  ? 34   LEU G CA    1 
ATOM   4630  C  C     . LEU G  3 34  ? -9.963  -12.671 19.632  1.00 67.08  ? 34   LEU G C     1 
ATOM   4631  O  O     . LEU G  3 34  ? -10.902 -13.467 19.626  1.00 67.45  ? 34   LEU G O     1 
ATOM   4632  C  CB    . LEU G  3 34  ? -10.427 -10.535 20.812  1.00 64.96  ? 34   LEU G CB    1 
ATOM   4633  C  CG    . LEU G  3 34  ? -10.679 -9.795  22.119  1.00 62.50  ? 34   LEU G CG    1 
ATOM   4634  C  CD1   . LEU G  3 34  ? -11.060 -8.386  21.807  1.00 59.93  ? 34   LEU G CD1   1 
ATOM   4635  C  CD2   . LEU G  3 34  ? -11.765 -10.475 22.920  1.00 60.72  ? 34   LEU G CD2   1 
ATOM   4636  N  N     . ARG G  3 35  ? -9.152  -12.472 18.594  1.00 68.54  ? 35   ARG G N     1 
ATOM   4637  C  CA    . ARG G  3 35  ? -9.290  -13.170 17.314  1.00 70.14  ? 35   ARG G CA    1 
ATOM   4638  C  C     . ARG G  3 35  ? -8.887  -14.652 17.386  1.00 70.17  ? 35   ARG G C     1 
ATOM   4639  O  O     . ARG G  3 35  ? -9.546  -15.512 16.803  1.00 70.47  ? 35   ARG G O     1 
ATOM   4640  C  CB    . ARG G  3 35  ? -8.491  -12.435 16.225  1.00 70.07  ? 35   ARG G CB    1 
ATOM   4641  C  CG    . ARG G  3 35  ? -9.222  -11.209 15.657  1.00 71.56  ? 35   ARG G CG    1 
ATOM   4642  C  CD    . ARG G  3 35  ? -8.571  -10.667 14.378  1.00 72.13  ? 35   ARG G CD    1 
ATOM   4643  N  NE    . ARG G  3 35  ? -7.650  -9.545  14.603  1.00 76.52  ? 35   ARG G NE    1 
ATOM   4644  C  CZ    . ARG G  3 35  ? -6.316  -9.627  14.574  1.00 78.44  ? 35   ARG G CZ    1 
ATOM   4645  N  NH1   . ARG G  3 35  ? -5.701  -10.788 14.334  1.00 78.26  ? 35   ARG G NH1   1 
ATOM   4646  N  NH2   . ARG G  3 35  ? -5.587  -8.537  14.793  1.00 79.03  ? 35   ARG G NH2   1 
ATOM   4647  N  N     . LYS G  3 36  ? -7.821  -14.936 18.128  1.00 70.39  ? 36   LYS G N     1 
ATOM   4648  C  CA    . LYS G  3 36  ? -7.236  -16.271 18.194  1.00 70.13  ? 36   LYS G CA    1 
ATOM   4649  C  C     . LYS G  3 36  ? -7.707  -16.988 19.454  1.00 69.46  ? 36   LYS G C     1 
ATOM   4650  O  O     . LYS G  3 36  ? -6.982  -17.813 20.030  1.00 69.92  ? 36   LYS G O     1 
ATOM   4651  C  CB    . LYS G  3 36  ? -5.697  -16.171 18.226  1.00 70.68  ? 36   LYS G CB    1 
ATOM   4652  C  CG    . LYS G  3 36  ? -5.045  -15.285 17.156  1.00 73.12  ? 36   LYS G CG    1 
ATOM   4653  C  CD    . LYS G  3 36  ? -4.986  -15.987 15.805  1.00 77.75  ? 36   LYS G CD    1 
ATOM   4654  C  CE    . LYS G  3 36  ? -3.781  -15.530 14.993  1.00 80.23  ? 36   LYS G CE    1 
ATOM   4655  N  NZ    . LYS G  3 36  ? -3.735  -16.294 13.700  1.00 83.51  ? 36   LYS G NZ    1 
ATOM   4656  N  N     . GLY G  3 37  ? -8.907  -16.665 19.903  1.00 68.21  ? 37   GLY G N     1 
ATOM   4657  C  CA    . GLY G  3 37  ? -9.415  -17.251 21.131  1.00 66.82  ? 37   GLY G CA    1 
ATOM   4658  C  C     . GLY G  3 37  ? -10.834 -17.693 20.916  1.00 66.09  ? 37   GLY G C     1 
ATOM   4659  O  O     . GLY G  3 37  ? -11.533 -18.056 21.865  1.00 66.14  ? 37   GLY G O     1 
ATOM   4660  N  N     . ASN G  3 38  ? -11.263 -17.627 19.658  1.00 65.24  ? 38   ASN G N     1 
ATOM   4661  C  CA    . ASN G  3 38  ? -12.514 -18.214 19.245  1.00 64.99  ? 38   ASN G CA    1 
ATOM   4662  C  C     . ASN G  3 38  ? -13.662 -17.720 20.078  1.00 64.18  ? 38   ASN G C     1 
ATOM   4663  O  O     . ASN G  3 38  ? -14.465 -18.503 20.571  1.00 64.77  ? 38   ASN G O     1 
ATOM   4664  C  CB    . ASN G  3 38  ? -12.434 -19.746 19.342  1.00 65.38  ? 38   ASN G CB    1 
ATOM   4665  C  CG    . ASN G  3 38  ? -11.394 -20.319 18.416  1.00 66.83  ? 38   ASN G CG    1 
ATOM   4666  O  OD1   . ASN G  3 38  ? -11.524 -20.229 17.180  1.00 67.28  ? 38   ASN G OD1   1 
ATOM   4667  N  ND2   . ASN G  3 38  ? -10.337 -20.902 19.001  1.00 66.40  ? 38   ASN G ND2   1 
ATOM   4668  N  N     . TYR G  3 39  ? -13.755 -16.418 20.252  1.00 63.07  ? 39   TYR G N     1 
ATOM   4669  C  CA    . TYR G  3 39  ? -14.838 -15.909 21.057  1.00 62.02  ? 39   TYR G CA    1 
ATOM   4670  C  C     . TYR G  3 39  ? -15.978 -15.614 20.120  1.00 62.46  ? 39   TYR G C     1 
ATOM   4671  O  O     . TYR G  3 39  ? -17.144 -15.690 20.502  1.00 62.66  ? 39   TYR G O     1 
ATOM   4672  C  CB    . TYR G  3 39  ? -14.385 -14.679 21.833  1.00 60.83  ? 39   TYR G CB    1 
ATOM   4673  C  CG    . TYR G  3 39  ? -13.278 -14.963 22.823  1.00 57.73  ? 39   TYR G CG    1 
ATOM   4674  C  CD1   . TYR G  3 39  ? -11.961 -14.629 22.530  1.00 55.86  ? 39   TYR G CD1   1 
ATOM   4675  C  CD2   . TYR G  3 39  ? -13.551 -15.565 24.045  1.00 54.15  ? 39   TYR G CD2   1 
ATOM   4676  C  CE1   . TYR G  3 39  ? -10.939 -14.874 23.443  1.00 56.78  ? 39   TYR G CE1   1 
ATOM   4677  C  CE2   . TYR G  3 39  ? -12.540 -15.814 24.974  1.00 54.43  ? 39   TYR G CE2   1 
ATOM   4678  C  CZ    . TYR G  3 39  ? -11.239 -15.473 24.666  1.00 57.13  ? 39   TYR G CZ    1 
ATOM   4679  O  OH    . TYR G  3 39  ? -10.232 -15.726 25.570  1.00 57.32  ? 39   TYR G OH    1 
ATOM   4680  N  N     . ALA G  3 40  ? -15.623 -15.296 18.878  1.00 63.11  ? 40   ALA G N     1 
ATOM   4681  C  CA    . ALA G  3 40  ? -16.585 -15.101 17.800  1.00 64.02  ? 40   ALA G CA    1 
ATOM   4682  C  C     . ALA G  3 40  ? -15.845 -14.997 16.493  1.00 64.87  ? 40   ALA G C     1 
ATOM   4683  O  O     . ALA G  3 40  ? -14.631 -14.792 16.465  1.00 64.54  ? 40   ALA G O     1 
ATOM   4684  C  CB    . ALA G  3 40  ? -17.419 -13.848 18.018  1.00 63.97  ? 40   ALA G CB    1 
ATOM   4685  N  N     . GLU G  3 41  ? -16.589 -15.128 15.407  1.00 66.31  ? 41   GLU G N     1 
ATOM   4686  C  CA    . GLU G  3 41  ? -16.007 -15.047 14.077  1.00 68.49  ? 41   GLU G CA    1 
ATOM   4687  C  C     . GLU G  3 41  ? -15.314 -13.709 13.846  1.00 68.48  ? 41   GLU G C     1 
ATOM   4688  O  O     . GLU G  3 41  ? -14.170 -13.655 13.388  1.00 68.67  ? 41   GLU G O     1 
ATOM   4689  C  CB    . GLU G  3 41  ? -17.090 -15.248 13.020  1.00 69.21  ? 41   GLU G CB    1 
ATOM   4690  C  CG    . GLU G  3 41  ? -17.757 -16.607 13.087  1.00 73.13  ? 41   GLU G CG    1 
ATOM   4691  C  CD    . GLU G  3 41  ? -17.729 -17.303 11.743  1.00 77.65  ? 41   GLU G CD    1 
ATOM   4692  O  OE1   . GLU G  3 41  ? -18.425 -16.834 10.806  1.00 77.39  ? 41   GLU G OE1   1 
ATOM   4693  O  OE2   . GLU G  3 41  ? -16.984 -18.311 11.633  1.00 80.90  ? 41   GLU G OE2   1 
ATOM   4694  N  N     . ARG G  3 42  ? -16.019 -12.632 14.185  1.00 68.48  ? 42   ARG G N     1 
ATOM   4695  C  CA    . ARG G  3 42  ? -15.549 -11.290 13.890  1.00 68.56  ? 42   ARG G CA    1 
ATOM   4696  C  C     . ARG G  3 42  ? -15.412 -10.427 15.147  1.00 67.86  ? 42   ARG G C     1 
ATOM   4697  O  O     . ARG G  3 42  ? -16.206 -10.533 16.096  1.00 67.81  ? 42   ARG G O     1 
ATOM   4698  C  CB    . ARG G  3 42  ? -16.472 -10.645 12.848  1.00 69.25  ? 42   ARG G CB    1 
ATOM   4699  C  CG    . ARG G  3 42  ? -16.795 -11.621 11.721  1.00 71.25  ? 42   ARG G CG    1 
ATOM   4700  C  CD    . ARG G  3 42  ? -18.035 -11.274 10.975  1.00 75.11  ? 42   ARG G CD    1 
ATOM   4701  N  NE    . ARG G  3 42  ? -17.710 -10.528 9.768   1.00 78.45  ? 42   ARG G NE    1 
ATOM   4702  C  CZ    . ARG G  3 42  ? -17.974 -9.238  9.600   1.00 81.28  ? 42   ARG G CZ    1 
ATOM   4703  N  NH1   . ARG G  3 42  ? -18.578 -8.545  10.567  1.00 81.85  ? 42   ARG G NH1   1 
ATOM   4704  N  NH2   . ARG G  3 42  ? -17.634 -8.639  8.461   1.00 82.36  ? 42   ARG G NH2   1 
ATOM   4705  N  N     . VAL G  3 43  ? -14.380 -9.588  15.141  1.00 66.81  ? 43   VAL G N     1 
ATOM   4706  C  CA    . VAL G  3 43  ? -14.093 -8.683  16.245  1.00 65.80  ? 43   VAL G CA    1 
ATOM   4707  C  C     . VAL G  3 43  ? -14.180 -7.241  15.758  1.00 65.25  ? 43   VAL G C     1 
ATOM   4708  O  O     . VAL G  3 43  ? -13.423 -6.826  14.894  1.00 65.18  ? 43   VAL G O     1 
ATOM   4709  C  CB    . VAL G  3 43  ? -12.689 -8.960  16.827  1.00 65.55  ? 43   VAL G CB    1 
ATOM   4710  C  CG1   . VAL G  3 43  ? -12.392 -8.023  17.979  1.00 64.30  ? 43   VAL G CG1   1 
ATOM   4711  C  CG2   . VAL G  3 43  ? -12.578 -10.422 17.264  1.00 65.35  ? 43   VAL G CG2   1 
ATOM   4712  N  N     . GLY G  3 44  ? -15.107 -6.479  16.315  1.00 64.81  ? 44   GLY G N     1 
ATOM   4713  C  CA    . GLY G  3 44  ? -15.269 -5.077  15.925  1.00 64.00  ? 44   GLY G CA    1 
ATOM   4714  C  C     . GLY G  3 44  ? -14.093 -4.195  16.286  1.00 63.30  ? 44   GLY G C     1 
ATOM   4715  O  O     . GLY G  3 44  ? -13.327 -4.499  17.204  1.00 63.68  ? 44   GLY G O     1 
ATOM   4716  N  N     . ALA G  3 45  ? -13.966 -3.085  15.570  1.00 62.66  ? 45   ALA G N     1 
ATOM   4717  C  CA    . ALA G  3 45  ? -12.870 -2.125  15.766  1.00 61.79  ? 45   ALA G CA    1 
ATOM   4718  C  C     . ALA G  3 45  ? -12.680 -1.626  17.211  1.00 60.96  ? 45   ALA G C     1 
ATOM   4719  O  O     . ALA G  3 45  ? -11.537 -1.555  17.690  1.00 61.15  ? 45   ALA G O     1 
ATOM   4720  C  CB    . ALA G  3 45  ? -13.034 -0.946  14.826  1.00 61.79  ? 45   ALA G CB    1 
ATOM   4721  N  N     . GLY G  3 46  ? -13.773 -1.288  17.896  1.00 59.35  ? 46   GLY G N     1 
ATOM   4722  C  CA    . GLY G  3 46  ? -13.670 -0.715  19.252  1.00 57.76  ? 46   GLY G CA    1 
ATOM   4723  C  C     . GLY G  3 46  ? -13.531 -1.683  20.432  1.00 56.58  ? 46   GLY G C     1 
ATOM   4724  O  O     . GLY G  3 46  ? -13.209 -1.267  21.546  1.00 56.30  ? 46   GLY G O     1 
ATOM   4725  N  N     . ALA G  3 47  ? -13.765 -2.974  20.198  1.00 55.31  ? 47   ALA G N     1 
ATOM   4726  C  CA    . ALA G  3 47  ? -13.800 -3.956  21.284  1.00 53.64  ? 47   ALA G CA    1 
ATOM   4727  C  C     . ALA G  3 47  ? -12.472 -4.086  22.031  1.00 52.76  ? 47   ALA G C     1 
ATOM   4728  O  O     . ALA G  3 47  ? -12.481 -4.024  23.259  1.00 52.97  ? 47   ALA G O     1 
ATOM   4729  C  CB    . ALA G  3 47  ? -14.280 -5.304  20.785  1.00 53.78  ? 47   ALA G CB    1 
ATOM   4730  N  N     . PRO G  3 48  ? -11.337 -4.249  21.312  1.00 51.54  ? 48   PRO G N     1 
ATOM   4731  C  CA    . PRO G  3 48  ? -10.035 -4.256  21.982  1.00 51.25  ? 48   PRO G CA    1 
ATOM   4732  C  C     . PRO G  3 48  ? -9.663  -2.935  22.607  1.00 51.11  ? 48   PRO G C     1 
ATOM   4733  O  O     . PRO G  3 48  ? -8.893  -2.921  23.581  1.00 51.74  ? 48   PRO G O     1 
ATOM   4734  C  CB    . PRO G  3 48  ? -9.031  -4.536  20.849  1.00 51.21  ? 48   PRO G CB    1 
ATOM   4735  C  CG    . PRO G  3 48  ? -9.720  -4.252  19.628  1.00 51.01  ? 48   PRO G CG    1 
ATOM   4736  C  CD    . PRO G  3 48  ? -11.191 -4.465  19.865  1.00 51.31  ? 48   PRO G CD    1 
ATOM   4737  N  N     . VAL G  3 49  ? -10.157 -1.831  22.035  1.00 50.25  ? 49   VAL G N     1 
ATOM   4738  C  CA    . VAL G  3 49  ? -9.918  -0.509  22.621  1.00 49.12  ? 49   VAL G CA    1 
ATOM   4739  C  C     . VAL G  3 49  ? -10.619 -0.514  23.980  1.00 48.58  ? 49   VAL G C     1 
ATOM   4740  O  O     . VAL G  3 49  ? -9.975  -0.355  25.038  1.00 48.18  ? 49   VAL G O     1 
ATOM   4741  C  CB    . VAL G  3 49  ? -10.421 0.655   21.701  1.00 49.21  ? 49   VAL G CB    1 
ATOM   4742  C  CG1   . VAL G  3 49  ? -10.221 1.982   22.366  1.00 48.29  ? 49   VAL G CG1   1 
ATOM   4743  C  CG2   . VAL G  3 49  ? -9.722  0.638   20.328  1.00 47.92  ? 49   VAL G CG2   1 
ATOM   4744  N  N     . TYR G  3 50  ? -11.926 -0.763  23.948  1.00 47.58  ? 50   TYR G N     1 
ATOM   4745  C  CA    . TYR G  3 50  ? -12.710 -0.818  25.160  1.00 47.69  ? 50   TYR G CA    1 
ATOM   4746  C  C     . TYR G  3 50  ? -12.066 -1.761  26.158  1.00 48.59  ? 50   TYR G C     1 
ATOM   4747  O  O     . TYR G  3 50  ? -11.873 -1.408  27.332  1.00 49.72  ? 50   TYR G O     1 
ATOM   4748  C  CB    . TYR G  3 50  ? -14.101 -1.297  24.850  1.00 47.06  ? 50   TYR G CB    1 
ATOM   4749  C  CG    . TYR G  3 50  ? -15.097 -0.883  25.862  1.00 46.96  ? 50   TYR G CG    1 
ATOM   4750  C  CD1   . TYR G  3 50  ? -16.115 -0.011  25.527  1.00 45.74  ? 50   TYR G CD1   1 
ATOM   4751  C  CD2   . TYR G  3 50  ? -15.028 -1.342  27.171  1.00 48.48  ? 50   TYR G CD2   1 
ATOM   4752  C  CE1   . TYR G  3 50  ? -17.052 0.385   26.449  1.00 43.93  ? 50   TYR G CE1   1 
ATOM   4753  C  CE2   . TYR G  3 50  ? -15.974 -0.940  28.110  1.00 47.81  ? 50   TYR G CE2   1 
ATOM   4754  C  CZ    . TYR G  3 50  ? -16.979 -0.068  27.726  1.00 46.21  ? 50   TYR G CZ    1 
ATOM   4755  O  OH    . TYR G  3 50  ? -17.921 0.353   28.636  1.00 47.72  ? 50   TYR G OH    1 
ATOM   4756  N  N     . LEU G  3 51  ? -11.699 -2.955  25.690  1.00 48.29  ? 51   LEU G N     1 
ATOM   4757  C  CA    . LEU G  3 51  ? -11.174 -3.967  26.580  1.00 47.50  ? 51   LEU G CA    1 
ATOM   4758  C  C     . LEU G  3 51  ? -9.801  -3.613  27.120  1.00 47.04  ? 51   LEU G C     1 
ATOM   4759  O  O     . LEU G  3 51  ? -9.554  -3.809  28.297  1.00 47.81  ? 51   LEU G O     1 
ATOM   4760  C  CB    . LEU G  3 51  ? -11.179 -5.349  25.924  1.00 47.51  ? 51   LEU G CB    1 
ATOM   4761  C  CG    . LEU G  3 51  ? -10.693 -6.552  26.732  1.00 46.56  ? 51   LEU G CG    1 
ATOM   4762  C  CD1   . LEU G  3 51  ? -11.366 -6.632  28.111  1.00 46.68  ? 51   LEU G CD1   1 
ATOM   4763  C  CD2   . LEU G  3 51  ? -10.964 -7.797  25.938  1.00 45.27  ? 51   LEU G CD2   1 
ATOM   4764  N  N     . ALA G  3 52  ? -8.907  -3.089  26.297  1.00 46.79  ? 52   ALA G N     1 
ATOM   4765  C  CA    . ALA G  3 52  ? -7.602  -2.666  26.834  1.00 46.58  ? 52   ALA G CA    1 
ATOM   4766  C  C     . ALA G  3 52  ? -7.778  -1.564  27.878  1.00 46.78  ? 52   ALA G C     1 
ATOM   4767  O  O     . ALA G  3 52  ? -7.040  -1.496  28.850  1.00 47.24  ? 52   ALA G O     1 
ATOM   4768  C  CB    . ALA G  3 52  ? -6.698  -2.214  25.751  1.00 46.59  ? 52   ALA G CB    1 
ATOM   4769  N  N     . ALA G  3 53  ? -8.786  -0.720  27.698  1.00 46.90  ? 53   ALA G N     1 
ATOM   4770  C  CA    . ALA G  3 53  ? -9.020  0.344   28.653  1.00 46.98  ? 53   ALA G CA    1 
ATOM   4771  C  C     . ALA G  3 53  ? -9.456  -0.208  30.001  1.00 46.87  ? 53   ALA G C     1 
ATOM   4772  O  O     . ALA G  3 53  ? -8.918  0.187   31.038  1.00 46.86  ? 53   ALA G O     1 
ATOM   4773  C  CB    . ALA G  3 53  ? -10.024 1.380   28.108  1.00 46.88  ? 53   ALA G CB    1 
ATOM   4774  N  N     . VAL G  3 54  ? -10.429 -1.120  29.978  1.00 47.18  ? 54   VAL G N     1 
ATOM   4775  C  CA    . VAL G  3 54  ? -10.884 -1.806  31.197  1.00 47.02  ? 54   VAL G CA    1 
ATOM   4776  C  C     . VAL G  3 54  ? -9.743  -2.528  31.909  1.00 46.57  ? 54   VAL G C     1 
ATOM   4777  O  O     . VAL G  3 54  ? -9.582  -2.391  33.121  1.00 46.64  ? 54   VAL G O     1 
ATOM   4778  C  CB    . VAL G  3 54  ? -11.995 -2.780  30.911  1.00 46.91  ? 54   VAL G CB    1 
ATOM   4779  C  CG1   . VAL G  3 54  ? -12.357 -3.528  32.176  1.00 47.68  ? 54   VAL G CG1   1 
ATOM   4780  C  CG2   . VAL G  3 54  ? -13.215 -2.031  30.350  1.00 47.40  ? 54   VAL G CG2   1 
ATOM   4781  N  N     . LEU G  3 55  ? -8.936  -3.267  31.164  1.00 46.25  ? 55   LEU G N     1 
ATOM   4782  C  CA    . LEU G  3 55  ? -7.792  -3.930  31.771  1.00 46.81  ? 55   LEU G CA    1 
ATOM   4783  C  C     . LEU G  3 55  ? -6.816  -2.962  32.424  1.00 46.83  ? 55   LEU G C     1 
ATOM   4784  O  O     . LEU G  3 55  ? -6.332  -3.238  33.507  1.00 47.44  ? 55   LEU G O     1 
ATOM   4785  C  CB    . LEU G  3 55  ? -7.063  -4.824  30.769  1.00 46.82  ? 55   LEU G CB    1 
ATOM   4786  C  CG    . LEU G  3 55  ? -7.880  -5.972  30.159  1.00 47.03  ? 55   LEU G CG    1 
ATOM   4787  C  CD1   . LEU G  3 55  ? -7.005  -6.701  29.140  1.00 45.89  ? 55   LEU G CD1   1 
ATOM   4788  C  CD2   . LEU G  3 55  ? -8.453  -6.929  31.215  1.00 43.91  ? 55   LEU G CD2   1 
ATOM   4789  N  N     . GLU G  3 56  ? -6.544  -1.831  31.777  1.00 46.91  ? 56   GLU G N     1 
ATOM   4790  C  CA    . GLU G  3 56  ? -5.621  -0.829  32.297  1.00 47.01  ? 56   GLU G CA    1 
ATOM   4791  C  C     . GLU G  3 56  ? -6.176  -0.250  33.580  1.00 46.11  ? 56   GLU G C     1 
ATOM   4792  O  O     . GLU G  3 56  ? -5.465  -0.127  34.592  1.00 47.07  ? 56   GLU G O     1 
ATOM   4793  C  CB    . GLU G  3 56  ? -5.418  0.279   31.273  1.00 46.75  ? 56   GLU G CB    1 
ATOM   4794  C  CG    . GLU G  3 56  ? -4.454  1.414   31.691  1.00 48.68  ? 56   GLU G CG    1 
ATOM   4795  C  CD    . GLU G  3 56  ? -4.025  2.286   30.496  1.00 50.50  ? 56   GLU G CD    1 
ATOM   4796  O  OE1   . GLU G  3 56  ? -3.873  1.728   29.381  1.00 56.29  ? 56   GLU G OE1   1 
ATOM   4797  O  OE2   . GLU G  3 56  ? -3.841  3.519   30.650  1.00 53.46  ? 56   GLU G OE2   1 
ATOM   4798  N  N     . TYR G  3 57  ? -7.450  0.093   33.547  1.00 44.52  ? 57   TYR G N     1 
ATOM   4799  C  CA    . TYR G  3 57  ? -8.084  0.664   34.696  1.00 43.81  ? 57   TYR G CA    1 
ATOM   4800  C  C     . TYR G  3 57  ? -7.965  -0.229  35.925  1.00 43.08  ? 57   TYR G C     1 
ATOM   4801  O  O     . TYR G  3 57  ? -7.565  0.241   37.007  1.00 41.79  ? 57   TYR G O     1 
ATOM   4802  C  CB    . TYR G  3 57  ? -9.552  0.938   34.389  1.00 44.59  ? 57   TYR G CB    1 
ATOM   4803  C  CG    . TYR G  3 57  ? -10.343 1.184   35.620  1.00 45.67  ? 57   TYR G CG    1 
ATOM   4804  C  CD1   . TYR G  3 57  ? -10.151 2.331   36.372  1.00 46.05  ? 57   TYR G CD1   1 
ATOM   4805  C  CD2   . TYR G  3 57  ? -11.288 0.270   36.044  1.00 48.14  ? 57   TYR G CD2   1 
ATOM   4806  C  CE1   . TYR G  3 57  ? -10.883 2.555   37.502  1.00 46.53  ? 57   TYR G CE1   1 
ATOM   4807  C  CE2   . TYR G  3 57  ? -12.021 0.491   37.164  1.00 47.63  ? 57   TYR G CE2   1 
ATOM   4808  C  CZ    . TYR G  3 57  ? -11.806 1.627   37.892  1.00 47.46  ? 57   TYR G CZ    1 
ATOM   4809  O  OH    . TYR G  3 57  ? -12.549 1.842   39.023  1.00 50.61  ? 57   TYR G OH    1 
ATOM   4810  N  N     . LEU G  3 58  ? -8.314  -1.514  35.759  1.00 42.49  ? 58   LEU G N     1 
ATOM   4811  C  CA    . LEU G  3 58  ? -8.315  -2.448  36.903  1.00 41.88  ? 58   LEU G CA    1 
ATOM   4812  C  C     . LEU G  3 58  ? -6.930  -2.679  37.444  1.00 42.13  ? 58   LEU G C     1 
ATOM   4813  O  O     . LEU G  3 58  ? -6.766  -2.765  38.665  1.00 42.63  ? 58   LEU G O     1 
ATOM   4814  C  CB    . LEU G  3 58  ? -8.992  -3.765  36.599  1.00 41.75  ? 58   LEU G CB    1 
ATOM   4815  C  CG    . LEU G  3 58  ? -10.515 -3.679  36.504  1.00 40.33  ? 58   LEU G CG    1 
ATOM   4816  C  CD1   . LEU G  3 58  ? -11.040 -4.890  35.736  1.00 36.18  ? 58   LEU G CD1   1 
ATOM   4817  C  CD2   . LEU G  3 58  ? -11.081 -3.584  37.914  1.00 37.73  ? 58   LEU G CD2   1 
ATOM   4818  N  N     . THR G  3 59  ? -5.919  -2.693  36.576  1.00 41.64  ? 59   THR G N     1 
ATOM   4819  C  CA    . THR G  3 59  ? -4.583  -2.844  37.093  1.00 41.78  ? 59   THR G CA    1 
ATOM   4820  C  C     . THR G  3 59  ? -4.155  -1.596  37.848  1.00 42.15  ? 59   THR G C     1 
ATOM   4821  O  O     . THR G  3 59  ? -3.448  -1.700  38.855  1.00 42.17  ? 59   THR G O     1 
ATOM   4822  C  CB    . THR G  3 59  ? -3.536  -3.321  36.040  1.00 42.41  ? 59   THR G CB    1 
ATOM   4823  O  OG1   . THR G  3 59  ? -2.587  -2.284  35.765  1.00 44.29  ? 59   THR G OG1   1 
ATOM   4824  C  CG2   . THR G  3 59  ? -4.193  -3.783  34.773  1.00 40.37  ? 59   THR G CG2   1 
ATOM   4825  N  N     . ALA G  3 60  ? -4.607  -0.423  37.390  1.00 42.56  ? 60   ALA G N     1 
ATOM   4826  C  CA    . ALA G  3 60  ? -4.330  0.839   38.098  1.00 42.58  ? 60   ALA G CA    1 
ATOM   4827  C  C     . ALA G  3 60  ? -4.955  0.853   39.479  1.00 43.21  ? 60   ALA G C     1 
ATOM   4828  O  O     . ALA G  3 60  ? -4.332  1.264   40.463  1.00 43.16  ? 60   ALA G O     1 
ATOM   4829  C  CB    . ALA G  3 60  ? -4.815  2.039   37.303  1.00 42.95  ? 60   ALA G CB    1 
ATOM   4830  N  N     . GLU G  3 61  ? -6.191  0.384   39.565  1.00 44.01  ? 61   GLU G N     1 
ATOM   4831  C  CA    . GLU G  3 61  ? -6.842  0.312   40.863  1.00 44.62  ? 61   GLU G CA    1 
ATOM   4832  C  C     . GLU G  3 61  ? -6.121  -0.644  41.835  1.00 43.78  ? 61   GLU G C     1 
ATOM   4833  O  O     . GLU G  3 61  ? -6.057  -0.367  43.036  1.00 43.83  ? 61   GLU G O     1 
ATOM   4834  C  CB    . GLU G  3 61  ? -8.312  -0.045  40.691  1.00 44.90  ? 61   GLU G CB    1 
ATOM   4835  C  CG    . GLU G  3 61  ? -9.085  -0.169  41.982  1.00 50.24  ? 61   GLU G CG    1 
ATOM   4836  C  CD    . GLU G  3 61  ? -9.395  1.186   42.637  1.00 58.98  ? 61   GLU G CD    1 
ATOM   4837  O  OE1   . GLU G  3 61  ? -8.989  2.248   42.083  1.00 62.39  ? 61   GLU G OE1   1 
ATOM   4838  O  OE2   . GLU G  3 61  ? -10.051 1.189   43.710  1.00 61.02  ? 61   GLU G OE2   1 
ATOM   4839  N  N     . ILE G  3 62  ? -5.578  -1.761  41.340  1.00 43.00  ? 62   ILE G N     1 
ATOM   4840  C  CA    . ILE G  3 62  ? -4.907  -2.701  42.254  1.00 42.40  ? 62   ILE G CA    1 
ATOM   4841  C  C     . ILE G  3 62  ? -3.548  -2.160  42.631  1.00 41.00  ? 62   ILE G C     1 
ATOM   4842  O  O     . ILE G  3 62  ? -3.206  -2.162  43.790  1.00 39.84  ? 62   ILE G O     1 
ATOM   4843  C  CB    . ILE G  3 62  ? -4.758  -4.153  41.699  1.00 42.91  ? 62   ILE G CB    1 
ATOM   4844  C  CG1   . ILE G  3 62  ? -6.013  -4.568  40.992  1.00 45.59  ? 62   ILE G CG1   1 
ATOM   4845  C  CG2   . ILE G  3 62  ? -4.528  -5.176  42.831  1.00 42.71  ? 62   ILE G CG2   1 
ATOM   4846  C  CD1   . ILE G  3 62  ? -6.220  -6.051  41.023  1.00 51.01  ? 62   ILE G CD1   1 
ATOM   4847  N  N     . LEU G  3 63  ? -2.775  -1.709  41.642  1.00 41.00  ? 63   LEU G N     1 
ATOM   4848  C  CA    . LEU G  3 63  ? -1.478  -1.112  41.920  1.00 41.60  ? 63   LEU G CA    1 
ATOM   4849  C  C     . LEU G  3 63  ? -1.593  0.045   42.895  1.00 42.17  ? 63   LEU G C     1 
ATOM   4850  O  O     . LEU G  3 63  ? -0.852  0.098   43.858  1.00 41.98  ? 63   LEU G O     1 
ATOM   4851  C  CB    . LEU G  3 63  ? -0.788  -0.685  40.657  1.00 41.23  ? 63   LEU G CB    1 
ATOM   4852  C  CG    . LEU G  3 63  ? -0.517  -1.833  39.703  1.00 42.30  ? 63   LEU G CG    1 
ATOM   4853  C  CD1   . LEU G  3 63  ? 0.040   -1.235  38.415  1.00 42.20  ? 63   LEU G CD1   1 
ATOM   4854  C  CD2   . LEU G  3 63  ? 0.464   -2.854  40.313  1.00 40.00  ? 63   LEU G CD2   1 
ATOM   4855  N  N     . GLU G  3 64  ? -2.554  0.932   42.676  1.00 42.96  ? 64   GLU G N     1 
ATOM   4856  C  CA    . GLU G  3 64  ? -2.815  1.984   43.617  1.00 45.05  ? 64   GLU G CA    1 
ATOM   4857  C  C     . GLU G  3 64  ? -2.946  1.405   45.021  1.00 45.54  ? 64   GLU G C     1 
ATOM   4858  O  O     . GLU G  3 64  ? -2.165  1.739   45.908  1.00 46.59  ? 64   GLU G O     1 
ATOM   4859  C  CB    . GLU G  3 64  ? -4.076  2.780   43.203  1.00 45.73  ? 64   GLU G CB    1 
ATOM   4860  C  CG    . GLU G  3 64  ? -4.616  3.798   44.220  1.00 49.45  ? 64   GLU G CG    1 
ATOM   4861  C  CD    . GLU G  3 64  ? -3.754  5.069   44.396  1.00 54.20  ? 64   GLU G CD    1 
ATOM   4862  O  OE1   . GLU G  3 64  ? -4.196  6.020   45.108  1.00 57.20  ? 64   GLU G OE1   1 
ATOM   4863  O  OE2   . GLU G  3 64  ? -2.647  5.133   43.835  1.00 53.94  ? 64   GLU G OE2   1 
ATOM   4864  N  N     . LEU G  3 65  ? -3.914  0.520   45.223  1.00 45.70  ? 65   LEU G N     1 
ATOM   4865  C  CA    . LEU G  3 65  ? -4.207  -0.006  46.558  1.00 45.67  ? 65   LEU G CA    1 
ATOM   4866  C  C     . LEU G  3 65  ? -3.086  -0.848  47.159  1.00 45.36  ? 65   LEU G C     1 
ATOM   4867  O  O     . LEU G  3 65  ? -2.883  -0.837  48.375  1.00 46.33  ? 65   LEU G O     1 
ATOM   4868  C  CB    . LEU G  3 65  ? -5.516  -0.802  46.542  1.00 45.34  ? 65   LEU G CB    1 
ATOM   4869  C  CG    . LEU G  3 65  ? -6.823  -0.010  46.431  1.00 46.31  ? 65   LEU G CG    1 
ATOM   4870  C  CD1   . LEU G  3 65  ? -8.034  -0.974  46.385  1.00 45.93  ? 65   LEU G CD1   1 
ATOM   4871  C  CD2   . LEU G  3 65  ? -6.956  0.954   47.603  1.00 43.84  ? 65   LEU G CD2   1 
ATOM   4872  N  N     . ALA G  3 66  ? -2.370  -1.585  46.326  1.00 44.59  ? 66   ALA G N     1 
ATOM   4873  C  CA    . ALA G  3 66  ? -1.231  -2.344  46.801  1.00 44.85  ? 66   ALA G CA    1 
ATOM   4874  C  C     . ALA G  3 66  ? -0.105  -1.402  47.153  1.00 44.89  ? 66   ALA G C     1 
ATOM   4875  O  O     . ALA G  3 66  ? 0.531   -1.575  48.184  1.00 44.92  ? 66   ALA G O     1 
ATOM   4876  C  CB    . ALA G  3 66  ? -0.766  -3.363  45.753  1.00 44.92  ? 66   ALA G CB    1 
ATOM   4877  N  N     . GLY G  3 67  ? 0.137   -0.410  46.291  1.00 45.08  ? 67   GLY G N     1 
ATOM   4878  C  CA    . GLY G  3 67  ? 1.068   0.711   46.569  1.00 44.62  ? 67   GLY G CA    1 
ATOM   4879  C  C     . GLY G  3 67  ? 0.930   1.302   47.958  1.00 44.52  ? 67   GLY G C     1 
ATOM   4880  O  O     . GLY G  3 67  ? 1.927   1.455   48.668  1.00 43.75  ? 67   GLY G O     1 
ATOM   4881  N  N     . ASN G  3 68  ? -0.304  1.620   48.347  1.00 44.93  ? 68   ASN G N     1 
ATOM   4882  C  CA    . ASN G  3 68  ? -0.582  2.140   49.685  1.00 46.42  ? 68   ASN G CA    1 
ATOM   4883  C  C     . ASN G  3 68  ? -0.183  1.161   50.761  1.00 47.62  ? 68   ASN G C     1 
ATOM   4884  O  O     . ASN G  3 68  ? 0.351   1.563   51.790  1.00 48.26  ? 68   ASN G O     1 
ATOM   4885  C  CB    . ASN G  3 68  ? -2.057  2.500   49.873  1.00 46.11  ? 68   ASN G CB    1 
ATOM   4886  C  CG    . ASN G  3 68  ? -2.506  3.621   48.961  1.00 47.60  ? 68   ASN G CG    1 
ATOM   4887  O  OD1   . ASN G  3 68  ? -1.678  4.326   48.376  1.00 47.31  ? 68   ASN G OD1   1 
ATOM   4888  N  ND2   . ASN G  3 68  ? -3.832  3.790   48.822  1.00 47.14  ? 68   ASN G ND2   1 
ATOM   4889  N  N     . ALA G  3 69  ? -0.447  -0.129  50.517  1.00 48.67  ? 69   ALA G N     1 
ATOM   4890  C  CA    . ALA G  3 69  ? -0.190  -1.167  51.488  1.00 49.26  ? 69   ALA G CA    1 
ATOM   4891  C  C     . ALA G  3 69  ? 1.304   -1.331  51.680  1.00 50.35  ? 69   ALA G C     1 
ATOM   4892  O  O     . ALA G  3 69  ? 1.746   -1.549  52.793  1.00 50.42  ? 69   ALA G O     1 
ATOM   4893  C  CB    . ALA G  3 69  ? -0.828  -2.476  51.053  1.00 49.66  ? 69   ALA G CB    1 
ATOM   4894  N  N     . ALA G  3 70  ? 2.070   -1.237  50.594  1.00 51.65  ? 70   ALA G N     1 
ATOM   4895  C  CA    . ALA G  3 70  ? 3.514   -1.245  50.659  1.00 53.71  ? 70   ALA G CA    1 
ATOM   4896  C  C     . ALA G  3 70  ? 4.010   -0.134  51.590  1.00 56.34  ? 70   ALA G C     1 
ATOM   4897  O  O     . ALA G  3 70  ? 4.895   -0.367  52.415  1.00 56.83  ? 70   ALA G O     1 
ATOM   4898  C  CB    . ALA G  3 70  ? 4.090   -1.077  49.289  1.00 52.75  ? 70   ALA G CB    1 
ATOM   4899  N  N     . ARG G  3 71  ? 3.415   1.059   51.473  1.00 59.06  ? 71   ARG G N     1 
ATOM   4900  C  CA    . ARG G  3 71  ? 3.855   2.223   52.226  1.00 61.38  ? 71   ARG G CA    1 
ATOM   4901  C  C     . ARG G  3 71  ? 3.486   2.104   53.699  1.00 62.51  ? 71   ARG G C     1 
ATOM   4902  O  O     . ARG G  3 71  ? 4.287   2.456   54.567  1.00 63.05  ? 71   ARG G O     1 
ATOM   4903  C  CB    . ARG G  3 71  ? 3.281   3.514   51.643  1.00 61.90  ? 71   ARG G CB    1 
ATOM   4904  C  CG    . ARG G  3 71  ? 3.990   4.784   52.142  1.00 64.95  ? 71   ARG G CG    1 
ATOM   4905  C  CD    . ARG G  3 71  ? 3.018   5.950   52.370  1.00 71.13  ? 71   ARG G CD    1 
ATOM   4906  N  NE    . ARG G  3 71  ? 3.498   6.849   53.431  1.00 75.13  ? 71   ARG G NE    1 
ATOM   4907  C  CZ    . ARG G  3 71  ? 3.133   8.125   53.595  1.00 77.84  ? 71   ARG G CZ    1 
ATOM   4908  N  NH1   . ARG G  3 71  ? 2.259   8.713   52.777  1.00 77.97  ? 71   ARG G NH1   1 
ATOM   4909  N  NH2   . ARG G  3 71  ? 3.655   8.826   54.596  1.00 79.32  ? 71   ARG G NH2   1 
ATOM   4910  N  N     . ASP G  3 72  ? 2.288   1.598   53.983  1.00 63.37  ? 72   ASP G N     1 
ATOM   4911  C  CA    . ASP G  3 72  ? 1.870   1.346   55.368  1.00 64.73  ? 72   ASP G CA    1 
ATOM   4912  C  C     . ASP G  3 72  ? 2.762   0.341   56.104  1.00 64.96  ? 72   ASP G C     1 
ATOM   4913  O  O     . ASP G  3 72  ? 2.824   0.347   57.323  1.00 64.82  ? 72   ASP G O     1 
ATOM   4914  C  CB    . ASP G  3 72  ? 0.418   0.869   55.417  1.00 64.89  ? 72   ASP G CB    1 
ATOM   4915  C  CG    . ASP G  3 72  ? -0.537  1.873   54.813  1.00 67.59  ? 72   ASP G CG    1 
ATOM   4916  O  OD1   . ASP G  3 72  ? -0.072  2.752   54.056  1.00 70.12  ? 72   ASP G OD1   1 
ATOM   4917  O  OD2   . ASP G  3 72  ? -1.752  1.798   55.102  1.00 71.68  ? 72   ASP G OD2   1 
ATOM   4918  N  N     . ASN G  3 73  ? 3.427   -0.531  55.355  1.00 65.56  ? 73   ASN G N     1 
ATOM   4919  C  CA    . ASN G  3 73  ? 4.309   -1.519  55.941  1.00 66.54  ? 73   ASN G CA    1 
ATOM   4920  C  C     . ASN G  3 73  ? 5.750   -1.101  55.692  1.00 66.52  ? 73   ASN G C     1 
ATOM   4921  O  O     . ASN G  3 73  ? 6.630   -1.947  55.523  1.00 66.81  ? 73   ASN G O     1 
ATOM   4922  C  CB    . ASN G  3 73  ? 4.043   -2.937  55.380  1.00 66.90  ? 73   ASN G CB    1 
ATOM   4923  C  CG    . ASN G  3 73  ? 2.595   -3.411  55.594  1.00 68.69  ? 73   ASN G CG    1 
ATOM   4924  O  OD1   . ASN G  3 73  ? 2.235   -3.948  56.656  1.00 70.31  ? 73   ASN G OD1   1 
ATOM   4925  N  ND2   . ASN G  3 73  ? 1.764   -3.221  54.573  1.00 69.33  ? 73   ASN G ND2   1 
ATOM   4926  N  N     . LYS G  3 74  ? 5.982   0.206   55.649  1.00 66.35  ? 74   LYS G N     1 
ATOM   4927  C  CA    . LYS G  3 74  ? 7.341   0.756   55.501  1.00 66.72  ? 74   LYS G CA    1 
ATOM   4928  C  C     . LYS G  3 74  ? 8.133   0.121   54.358  1.00 65.34  ? 74   LYS G C     1 
ATOM   4929  O  O     . LYS G  3 74  ? 9.290   -0.253  54.534  1.00 65.67  ? 74   LYS G O     1 
ATOM   4930  C  CB    . LYS G  3 74  ? 8.121   0.625   56.826  1.00 67.09  ? 74   LYS G CB    1 
ATOM   4931  C  CG    . LYS G  3 74  ? 7.604   1.541   57.942  1.00 68.36  ? 74   LYS G CG    1 
ATOM   4932  C  CD    . LYS G  3 74  ? 8.299   1.305   59.291  1.00 68.36  ? 74   LYS G CD    1 
ATOM   4933  C  CE    . LYS G  3 74  ? 7.866   2.387   60.291  1.00 70.41  ? 74   LYS G CE    1 
ATOM   4934  N  NZ    . LYS G  3 74  ? 8.351   2.127   61.682  1.00 72.56  ? 74   LYS G NZ    1 
ATOM   4935  N  N     . LYS G  3 75  ? 7.508   0.000   53.193  1.00 64.01  ? 75   LYS G N     1 
ATOM   4936  C  CA    . LYS G  3 75  ? 8.107   -0.724  52.078  1.00 62.82  ? 75   LYS G CA    1 
ATOM   4937  C  C     . LYS G  3 75  ? 7.975   0.043   50.790  1.00 61.73  ? 75   LYS G C     1 
ATOM   4938  O  O     . LYS G  3 75  ? 7.030   0.803   50.594  1.00 61.85  ? 75   LYS G O     1 
ATOM   4939  C  CB    . LYS G  3 75  ? 7.461   -2.111  51.903  1.00 63.46  ? 75   LYS G CB    1 
ATOM   4940  C  CG    . LYS G  3 75  ? 7.785   -3.135  52.990  1.00 63.69  ? 75   LYS G CG    1 
ATOM   4941  C  CD    . LYS G  3 75  ? 9.168   -3.715  52.817  1.00 65.08  ? 75   LYS G CD    1 
ATOM   4942  C  CE    . LYS G  3 75  ? 9.448   -4.797  53.853  1.00 66.84  ? 75   LYS G CE    1 
ATOM   4943  N  NZ    . LYS G  3 75  ? 9.231   -4.318  55.256  1.00 67.75  ? 75   LYS G NZ    1 
ATOM   4944  N  N     . THR G  3 76  ? 8.906   -0.235  49.891  1.00 60.22  ? 76   THR G N     1 
ATOM   4945  C  CA    . THR G  3 76  ? 9.154   0.544   48.701  1.00 58.88  ? 76   THR G CA    1 
ATOM   4946  C  C     . THR G  3 76  ? 8.817   -0.261  47.456  1.00 57.67  ? 76   THR G C     1 
ATOM   4947  O  O     . THR G  3 76  ? 8.598   0.280   46.370  1.00 57.57  ? 76   THR G O     1 
ATOM   4948  C  CB    . THR G  3 76  ? 10.658  0.915   48.706  1.00 59.23  ? 76   THR G CB    1 
ATOM   4949  O  OG1   . THR G  3 76  ? 10.817  2.239   49.249  1.00 60.95  ? 76   THR G OG1   1 
ATOM   4950  C  CG2   . THR G  3 76  ? 11.312  0.801   47.309  1.00 58.93  ? 76   THR G CG2   1 
ATOM   4951  N  N     . ARG G  3 77  ? 8.801   -1.573  47.620  1.00 56.15  ? 77   ARG G N     1 
ATOM   4952  C  CA    . ARG G  3 77  ? 8.609   -2.484  46.503  1.00 54.79  ? 77   ARG G CA    1 
ATOM   4953  C  C     . ARG G  3 77  ? 7.402   -3.371  46.769  1.00 52.55  ? 77   ARG G C     1 
ATOM   4954  O  O     . ARG G  3 77  ? 7.261   -3.892  47.872  1.00 53.20  ? 77   ARG G O     1 
ATOM   4955  C  CB    . ARG G  3 77  ? 9.849   -3.323  46.343  1.00 54.78  ? 77   ARG G CB    1 
ATOM   4956  C  CG    . ARG G  3 77  ? 9.842   -4.127  45.115  1.00 58.76  ? 77   ARG G CG    1 
ATOM   4957  C  CD    . ARG G  3 77  ? 11.014  -5.050  45.160  1.00 64.01  ? 77   ARG G CD    1 
ATOM   4958  N  NE    . ARG G  3 77  ? 12.255  -4.316  44.987  1.00 68.22  ? 77   ARG G NE    1 
ATOM   4959  C  CZ    . ARG G  3 77  ? 13.436  -4.751  45.409  1.00 71.29  ? 77   ARG G CZ    1 
ATOM   4960  N  NH1   . ARG G  3 77  ? 13.527  -5.917  46.042  1.00 72.34  ? 77   ARG G NH1   1 
ATOM   4961  N  NH2   . ARG G  3 77  ? 14.522  -4.016  45.201  1.00 72.32  ? 77   ARG G NH2   1 
ATOM   4962  N  N     . ILE G  3 78  ? 6.529   -3.525  45.778  1.00 49.78  ? 78   ILE G N     1 
ATOM   4963  C  CA    . ILE G  3 78  ? 5.292   -4.286  45.962  1.00 47.27  ? 78   ILE G CA    1 
ATOM   4964  C  C     . ILE G  3 78  ? 5.542   -5.805  45.909  1.00 46.38  ? 78   ILE G C     1 
ATOM   4965  O  O     . ILE G  3 78  ? 6.134   -6.314  44.954  1.00 46.91  ? 78   ILE G O     1 
ATOM   4966  C  CB    . ILE G  3 78  ? 4.235   -3.872  44.926  1.00 47.11  ? 78   ILE G CB    1 
ATOM   4967  C  CG1   . ILE G  3 78  ? 3.802   -2.426  45.179  1.00 45.44  ? 78   ILE G CG1   1 
ATOM   4968  C  CG2   . ILE G  3 78  ? 3.017   -4.851  44.902  1.00 45.17  ? 78   ILE G CG2   1 
ATOM   4969  C  CD1   . ILE G  3 78  ? 2.881   -1.904  44.138  1.00 42.22  ? 78   ILE G CD1   1 
ATOM   4970  N  N     . ILE G  3 79  ? 5.105   -6.514  46.942  1.00 44.23  ? 79   ILE G N     1 
ATOM   4971  C  CA    . ILE G  3 79  ? 5.157   -7.969  46.941  1.00 42.57  ? 79   ILE G CA    1 
ATOM   4972  C  C     . ILE G  3 79  ? 3.744   -8.561  47.047  1.00 42.54  ? 79   ILE G C     1 
ATOM   4973  O  O     . ILE G  3 79  ? 2.786   -7.833  47.364  1.00 43.29  ? 79   ILE G O     1 
ATOM   4974  C  CB    . ILE G  3 79  ? 6.098   -8.535  48.065  1.00 43.09  ? 79   ILE G CB    1 
ATOM   4975  C  CG1   . ILE G  3 79  ? 5.529   -8.242  49.449  1.00 41.14  ? 79   ILE G CG1   1 
ATOM   4976  C  CG2   . ILE G  3 79  ? 7.559   -8.019  47.885  1.00 42.21  ? 79   ILE G CG2   1 
ATOM   4977  C  CD1   . ILE G  3 79  ? 6.361   -8.749  50.570  1.00 39.64  ? 79   ILE G CD1   1 
ATOM   4978  N  N     . PRO G  3 80  ? 3.597   -9.883  46.787  1.00 41.14  ? 80   PRO G N     1 
ATOM   4979  C  CA    . PRO G  3 80  ? 2.291   -10.513 46.813  1.00 39.73  ? 80   PRO G CA    1 
ATOM   4980  C  C     . PRO G  3 80  ? 1.487   -10.237 48.096  1.00 39.59  ? 80   PRO G C     1 
ATOM   4981  O  O     . PRO G  3 80  ? 0.289   -10.005 48.024  1.00 39.65  ? 80   PRO G O     1 
ATOM   4982  C  CB    . PRO G  3 80  ? 2.653   -11.978 46.672  1.00 40.23  ? 80   PRO G CB    1 
ATOM   4983  C  CG    . PRO G  3 80  ? 3.866   -11.947 45.819  1.00 39.03  ? 80   PRO G CG    1 
ATOM   4984  C  CD    . PRO G  3 80  ? 4.644   -10.861 46.434  1.00 40.43  ? 80   PRO G CD    1 
ATOM   4985  N  N     . ARG G  3 81  ? 2.122   -10.219 49.260  1.00 39.13  ? 81   ARG G N     1 
ATOM   4986  C  CA    . ARG G  3 81  ? 1.394   -9.829  50.472  1.00 39.50  ? 81   ARG G CA    1 
ATOM   4987  C  C     . ARG G  3 81  ? 0.712   -8.436  50.369  1.00 39.39  ? 81   ARG G C     1 
ATOM   4988  O  O     . ARG G  3 81  ? -0.350  -8.217  50.975  1.00 40.60  ? 81   ARG G O     1 
ATOM   4989  C  CB    . ARG G  3 81  ? 2.274   -9.967  51.742  1.00 38.72  ? 81   ARG G CB    1 
ATOM   4990  C  CG    . ARG G  3 81  ? 1.852   -9.081  52.850  1.00 40.93  ? 81   ARG G CG    1 
ATOM   4991  C  CD    . ARG G  3 81  ? 1.549   -9.760  54.170  1.00 42.75  ? 81   ARG G CD    1 
ATOM   4992  N  NE    . ARG G  3 81  ? 0.282   -10.461 54.105  1.00 46.31  ? 81   ARG G NE    1 
ATOM   4993  C  CZ    . ARG G  3 81  ? -0.529  -10.721 55.138  1.00 46.00  ? 81   ARG G CZ    1 
ATOM   4994  N  NH1   . ARG G  3 81  ? -0.242  -10.326 56.371  1.00 40.00  ? 81   ARG G NH1   1 
ATOM   4995  N  NH2   . ARG G  3 81  ? -1.651  -11.405 54.915  1.00 44.42  ? 81   ARG G NH2   1 
ATOM   4996  N  N     . HIS G  3 82  ? 1.308   -7.501  49.624  1.00 38.31  ? 82   HIS G N     1 
ATOM   4997  C  CA    . HIS G  3 82  ? 0.690   -6.180  49.450  1.00 37.37  ? 82   HIS G CA    1 
ATOM   4998  C  C     . HIS G  3 82  ? -0.509  -6.240  48.542  1.00 36.91  ? 82   HIS G C     1 
ATOM   4999  O  O     . HIS G  3 82  ? -1.514  -5.585  48.797  1.00 36.23  ? 82   HIS G O     1 
ATOM   5000  C  CB    . HIS G  3 82  ? 1.684   -5.119  48.958  1.00 36.59  ? 82   HIS G CB    1 
ATOM   5001  C  CG    . HIS G  3 82  ? 2.882   -5.007  49.828  1.00 35.62  ? 82   HIS G CG    1 
ATOM   5002  N  ND1   . HIS G  3 82  ? 4.170   -5.028  49.330  1.00 35.40  ? 82   HIS G ND1   1 
ATOM   5003  C  CD2   . HIS G  3 82  ? 2.994   -4.958  51.175  1.00 34.36  ? 82   HIS G CD2   1 
ATOM   5004  C  CE1   . HIS G  3 82  ? 5.023   -4.973  50.338  1.00 35.65  ? 82   HIS G CE1   1 
ATOM   5005  N  NE2   . HIS G  3 82  ? 4.334   -4.924  51.467  1.00 35.02  ? 82   HIS G NE2   1 
ATOM   5006  N  N     . LEU G  3 83  ? -0.388  -7.022  47.481  1.00 36.70  ? 83   LEU G N     1 
ATOM   5007  C  CA    . LEU G  3 83  ? -1.527  -7.252  46.626  1.00 37.29  ? 83   LEU G CA    1 
ATOM   5008  C  C     . LEU G  3 83  ? -2.673  -7.905  47.416  1.00 38.04  ? 83   LEU G C     1 
ATOM   5009  O  O     . LEU G  3 83  ? -3.839  -7.498  47.292  1.00 38.18  ? 83   LEU G O     1 
ATOM   5010  C  CB    . LEU G  3 83  ? -1.121  -8.049  45.403  1.00 37.06  ? 83   LEU G CB    1 
ATOM   5011  C  CG    . LEU G  3 83  ? -0.285  -7.240  44.416  1.00 36.07  ? 83   LEU G CG    1 
ATOM   5012  C  CD1   . LEU G  3 83  ? 0.497   -8.118  43.490  1.00 36.30  ? 83   LEU G CD1   1 
ATOM   5013  C  CD2   . LEU G  3 83  ? -1.176  -6.368  43.609  1.00 38.57  ? 83   LEU G CD2   1 
ATOM   5014  N  N     . GLN G  3 84  ? -2.323  -8.859  48.280  1.00 38.11  ? 84   GLN G N     1 
ATOM   5015  C  CA    . GLN G  3 84  ? -3.316  -9.553  49.057  1.00 38.54  ? 84   GLN G CA    1 
ATOM   5016  C  C     . GLN G  3 84  ? -3.970  -8.646  50.075  1.00 38.67  ? 84   GLN G C     1 
ATOM   5017  O  O     . GLN G  3 84  ? -5.210  -8.604  50.162  1.00 38.52  ? 84   GLN G O     1 
ATOM   5018  C  CB    . GLN G  3 84  ? -2.732  -10.807 49.716  1.00 39.25  ? 84   GLN G CB    1 
ATOM   5019  C  CG    . GLN G  3 84  ? -3.614  -11.436 50.779  1.00 39.42  ? 84   GLN G CG    1 
ATOM   5020  C  CD    . GLN G  3 84  ? -4.771  -12.258 50.212  1.00 41.53  ? 84   GLN G CD    1 
ATOM   5021  O  OE1   . GLN G  3 84  ? -5.301  -13.130 50.908  1.00 43.71  ? 84   GLN G OE1   1 
ATOM   5022  N  NE2   . GLN G  3 84  ? -5.173  -11.992 48.962  1.00 39.27  ? 84   GLN G NE2   1 
ATOM   5023  N  N     . LEU G  3 85  ? -3.163  -7.919  50.848  1.00 38.75  ? 85   LEU G N     1 
ATOM   5024  C  CA    . LEU G  3 85  ? -3.727  -6.873  51.713  1.00 39.41  ? 85   LEU G CA    1 
ATOM   5025  C  C     . LEU G  3 85  ? -4.634  -5.895  50.930  1.00 39.71  ? 85   LEU G C     1 
ATOM   5026  O  O     . LEU G  3 85  ? -5.760  -5.583  51.391  1.00 40.16  ? 85   LEU G O     1 
ATOM   5027  C  CB    . LEU G  3 85  ? -2.635  -6.093  52.419  1.00 39.43  ? 85   LEU G CB    1 
ATOM   5028  C  CG    . LEU G  3 85  ? -1.764  -6.779  53.470  1.00 40.54  ? 85   LEU G CG    1 
ATOM   5029  C  CD1   . LEU G  3 85  ? -0.803  -5.746  54.079  1.00 35.87  ? 85   LEU G CD1   1 
ATOM   5030  C  CD2   . LEU G  3 85  ? -2.605  -7.495  54.537  1.00 38.80  ? 85   LEU G CD2   1 
ATOM   5031  N  N     . ALA G  3 86  ? -4.169  -5.443  49.762  1.00 38.56  ? 86   ALA G N     1 
ATOM   5032  C  CA    . ALA G  3 86  ? -4.940  -4.536  48.947  1.00 39.51  ? 86   ALA G CA    1 
ATOM   5033  C  C     . ALA G  3 86  ? -6.274  -5.156  48.604  1.00 40.26  ? 86   ALA G C     1 
ATOM   5034  O  O     . ALA G  3 86  ? -7.308  -4.608  48.919  1.00 40.73  ? 86   ALA G O     1 
ATOM   5035  C  CB    . ALA G  3 86  ? -4.194  -4.180  47.656  1.00 39.38  ? 86   ALA G CB    1 
ATOM   5036  N  N     . VAL G  3 87  ? -6.240  -6.316  47.955  1.00 41.05  ? 87   VAL G N     1 
ATOM   5037  C  CA    . VAL G  3 87  ? -7.456  -6.952  47.507  1.00 41.16  ? 87   VAL G CA    1 
ATOM   5038  C  C     . VAL G  3 87  ? -8.456  -7.210  48.634  1.00 41.53  ? 87   VAL G C     1 
ATOM   5039  O  O     . VAL G  3 87  ? -9.617  -6.873  48.482  1.00 41.16  ? 87   VAL G O     1 
ATOM   5040  C  CB    . VAL G  3 87  ? -7.161  -8.212  46.694  1.00 41.20  ? 87   VAL G CB    1 
ATOM   5041  C  CG1   . VAL G  3 87  ? -8.430  -9.101  46.514  1.00 41.04  ? 87   VAL G CG1   1 
ATOM   5042  C  CG2   . VAL G  3 87  ? -6.568  -7.803  45.370  1.00 39.30  ? 87   VAL G CG2   1 
ATOM   5043  N  N     . ARG G  3 88  ? -8.032  -7.799  49.749  1.00 42.34  ? 88   ARG G N     1 
ATOM   5044  C  CA    . ARG G  3 88  ? -9.039  -8.233  50.732  1.00 43.56  ? 88   ARG G CA    1 
ATOM   5045  C  C     . ARG G  3 88  ? -9.475  -7.114  51.690  1.00 44.09  ? 88   ARG G C     1 
ATOM   5046  O  O     . ARG G  3 88  ? -10.449 -7.250  52.413  1.00 44.26  ? 88   ARG G O     1 
ATOM   5047  C  CB    . ARG G  3 88  ? -8.652  -9.521  51.489  1.00 43.63  ? 88   ARG G CB    1 
ATOM   5048  C  CG    . ARG G  3 88  ? -7.516  -10.352 50.898  1.00 44.78  ? 88   ARG G CG    1 
ATOM   5049  C  CD    . ARG G  3 88  ? -7.858  -11.696 50.173  1.00 43.28  ? 88   ARG G CD    1 
ATOM   5050  N  NE    . ARG G  3 88  ? -9.025  -11.728 49.311  1.00 41.91  ? 88   ARG G NE    1 
ATOM   5051  C  CZ    . ARG G  3 88  ? -9.119  -12.386 48.153  1.00 40.91  ? 88   ARG G CZ    1 
ATOM   5052  N  NH1   . ARG G  3 88  ? -8.087  -13.020 47.630  1.00 34.74  ? 88   ARG G NH1   1 
ATOM   5053  N  NH2   . ARG G  3 88  ? -10.269 -12.357 47.472  1.00 43.06  ? 88   ARG G NH2   1 
ATOM   5054  N  N     . ASN G  3 89  ? -8.758  -5.995  51.697  1.00 45.40  ? 89   ASN G N     1 
ATOM   5055  C  CA    . ASN G  3 89  ? -9.220  -4.820  52.443  1.00 45.50  ? 89   ASN G CA    1 
ATOM   5056  C  C     . ASN G  3 89  ? -10.172 -3.971  51.625  1.00 45.71  ? 89   ASN G C     1 
ATOM   5057  O  O     . ASN G  3 89  ? -10.730 -3.054  52.146  1.00 45.52  ? 89   ASN G O     1 
ATOM   5058  C  CB    . ASN G  3 89  ? -8.058  -3.981  52.952  1.00 45.07  ? 89   ASN G CB    1 
ATOM   5059  C  CG    . ASN G  3 89  ? -7.501  -4.502  54.265  1.00 44.63  ? 89   ASN G CG    1 
ATOM   5060  O  OD1   . ASN G  3 89  ? -8.244  -4.850  55.178  1.00 45.35  ? 89   ASN G OD1   1 
ATOM   5061  N  ND2   . ASN G  3 89  ? -6.197  -4.570  54.357  1.00 42.49  ? 89   ASN G ND2   1 
ATOM   5062  N  N     . ASP G  3 90  ? -10.366 -4.316  50.358  1.00 46.89  ? 90   ASP G N     1 
ATOM   5063  C  CA    . ASP G  3 90  ? -11.238 -3.578  49.462  1.00 48.58  ? 90   ASP G CA    1 
ATOM   5064  C  C     . ASP G  3 90  ? -12.493 -4.342  49.098  1.00 49.52  ? 90   ASP G C     1 
ATOM   5065  O  O     . ASP G  3 90  ? -12.439 -5.290  48.316  1.00 50.18  ? 90   ASP G O     1 
ATOM   5066  C  CB    . ASP G  3 90  ? -10.513 -3.265  48.173  1.00 48.35  ? 90   ASP G CB    1 
ATOM   5067  C  CG    . ASP G  3 90  ? -11.260 -2.246  47.340  1.00 52.26  ? 90   ASP G CG    1 
ATOM   5068  O  OD1   . ASP G  3 90  ? -11.464 -1.105  47.850  1.00 54.90  ? 90   ASP G OD1   1 
ATOM   5069  O  OD2   . ASP G  3 90  ? -11.661 -2.578  46.192  1.00 55.15  ? 90   ASP G OD2   1 
ATOM   5070  N  N     . GLU G  3 91  ? -13.630 -3.907  49.607  1.00 50.45  ? 91   GLU G N     1 
ATOM   5071  C  CA    . GLU G  3 91  ? -14.862 -4.639  49.410  1.00 52.24  ? 91   GLU G CA    1 
ATOM   5072  C  C     . GLU G  3 91  ? -15.084 -5.130  47.985  1.00 52.13  ? 91   GLU G C     1 
ATOM   5073  O  O     . GLU G  3 91  ? -15.515 -6.259  47.786  1.00 53.18  ? 91   GLU G O     1 
ATOM   5074  C  CB    . GLU G  3 91  ? -16.053 -3.808  49.867  1.00 53.11  ? 91   GLU G CB    1 
ATOM   5075  C  CG    . GLU G  3 91  ? -17.027 -4.555  50.781  1.00 58.59  ? 91   GLU G CG    1 
ATOM   5076  C  CD    . GLU G  3 91  ? -18.234 -3.700  51.149  1.00 66.48  ? 91   GLU G CD    1 
ATOM   5077  O  OE1   . GLU G  3 91  ? -19.092 -3.458  50.262  1.00 68.66  ? 91   GLU G OE1   1 
ATOM   5078  O  OE2   . GLU G  3 91  ? -18.320 -3.269  52.329  1.00 69.49  ? 91   GLU G OE2   1 
ATOM   5079  N  N     . GLU G  3 92  ? -14.765 -4.306  47.000  1.00 52.28  ? 92   GLU G N     1 
ATOM   5080  C  CA    . GLU G  3 92  ? -15.073 -4.612  45.598  1.00 52.27  ? 92   GLU G CA    1 
ATOM   5081  C  C     . GLU G  3 92  ? -14.043 -5.495  44.884  1.00 51.18  ? 92   GLU G C     1 
ATOM   5082  O  O     . GLU G  3 92  ? -14.408 -6.376  44.108  1.00 51.27  ? 92   GLU G O     1 
ATOM   5083  C  CB    . GLU G  3 92  ? -15.339 -3.323  44.802  1.00 52.95  ? 92   GLU G CB    1 
ATOM   5084  C  CG    . GLU G  3 92  ? -16.578 -2.542  45.301  1.00 56.72  ? 92   GLU G CG    1 
ATOM   5085  C  CD    . GLU G  3 92  ? -17.265 -1.718  44.215  1.00 62.55  ? 92   GLU G CD    1 
ATOM   5086  O  OE1   . GLU G  3 92  ? -16.629 -1.400  43.178  1.00 65.54  ? 92   GLU G OE1   1 
ATOM   5087  O  OE2   . GLU G  3 92  ? -18.458 -1.380  44.398  1.00 65.27  ? 92   GLU G OE2   1 
ATOM   5088  N  N     . LEU G  3 93  ? -12.760 -5.255  45.116  1.00 50.07  ? 93   LEU G N     1 
ATOM   5089  C  CA    . LEU G  3 93  ? -11.745 -6.152  44.574  1.00 49.07  ? 93   LEU G CA    1 
ATOM   5090  C  C     . LEU G  3 93  ? -11.873 -7.516  45.248  1.00 48.76  ? 93   LEU G C     1 
ATOM   5091  O  O     . LEU G  3 93  ? -11.757 -8.552  44.605  1.00 47.84  ? 93   LEU G O     1 
ATOM   5092  C  CB    . LEU G  3 93  ? -10.357 -5.597  44.827  1.00 48.91  ? 93   LEU G CB    1 
ATOM   5093  C  CG    . LEU G  3 93  ? -9.956  -4.429  43.956  1.00 47.87  ? 93   LEU G CG    1 
ATOM   5094  C  CD1   . LEU G  3 93  ? -8.639  -3.912  44.473  1.00 47.85  ? 93   LEU G CD1   1 
ATOM   5095  C  CD2   . LEU G  3 93  ? -9.849  -4.893  42.525  1.00 48.02  ? 93   LEU G CD2   1 
ATOM   5096  N  N     . ASN G  3 94  ? -12.151 -7.501  46.551  1.00 48.64  ? 94   ASN G N     1 
ATOM   5097  C  CA    . ASN G  3 94  ? -12.344 -8.738  47.268  1.00 48.86  ? 94   ASN G CA    1 
ATOM   5098  C  C     . ASN G  3 94  ? -13.449 -9.589  46.677  1.00 48.61  ? 94   ASN G C     1 
ATOM   5099  O  O     . ASN G  3 94  ? -13.347 -10.812 46.675  1.00 49.29  ? 94   ASN G O     1 
ATOM   5100  C  CB    . ASN G  3 94  ? -12.558 -8.531  48.758  1.00 48.22  ? 94   ASN G CB    1 
ATOM   5101  C  CG    . ASN G  3 94  ? -12.692 -9.843  49.495  1.00 49.25  ? 94   ASN G CG    1 
ATOM   5102  O  OD1   . ASN G  3 94  ? -11.937 -10.795 49.246  1.00 51.53  ? 94   ASN G OD1   1 
ATOM   5103  N  ND2   . ASN G  3 94  ? -13.668 -9.923  50.378  1.00 48.52  ? 94   ASN G ND2   1 
ATOM   5104  N  N     . LYS G  3 95  ? -14.484 -8.946  46.161  1.00 48.34  ? 95   LYS G N     1 
ATOM   5105  C  CA    . LYS G  3 95  ? -15.605 -9.659  45.576  1.00 47.95  ? 95   LYS G CA    1 
ATOM   5106  C  C     . LYS G  3 95  ? -15.220 -10.182 44.213  1.00 47.10  ? 95   LYS G C     1 
ATOM   5107  O  O     . LYS G  3 95  ? -15.522 -11.322 43.866  1.00 48.02  ? 95   LYS G O     1 
ATOM   5108  C  CB    . LYS G  3 95  ? -16.828 -8.766  45.479  1.00 48.32  ? 95   LYS G CB    1 
ATOM   5109  C  CG    . LYS G  3 95  ? -18.063 -9.503  45.047  1.00 51.32  ? 95   LYS G CG    1 
ATOM   5110  C  CD    . LYS G  3 95  ? -19.292 -8.720  45.478  1.00 59.09  ? 95   LYS G CD    1 
ATOM   5111  C  CE    . LYS G  3 95  ? -20.556 -9.194  44.752  1.00 61.96  ? 95   LYS G CE    1 
ATOM   5112  N  NZ    . LYS G  3 95  ? -21.596 -8.101  44.734  1.00 64.94  ? 95   LYS G NZ    1 
ATOM   5113  N  N     . LEU G  3 96  ? -14.524 -9.360  43.449  1.00 45.53  ? 96   LEU G N     1 
ATOM   5114  C  CA    . LEU G  3 96  ? -14.128 -9.732  42.103  1.00 43.78  ? 96   LEU G CA    1 
ATOM   5115  C  C     . LEU G  3 96  ? -13.159 -10.908 42.137  1.00 43.51  ? 96   LEU G C     1 
ATOM   5116  O  O     . LEU G  3 96  ? -13.130 -11.710 41.237  1.00 43.98  ? 96   LEU G O     1 
ATOM   5117  C  CB    . LEU G  3 96  ? -13.488 -8.520  41.405  1.00 42.78  ? 96   LEU G CB    1 
ATOM   5118  C  CG    . LEU G  3 96  ? -12.907 -8.741  40.010  1.00 41.47  ? 96   LEU G CG    1 
ATOM   5119  C  CD1   . LEU G  3 96  ? -13.978 -9.090  39.006  1.00 38.81  ? 96   LEU G CD1   1 
ATOM   5120  C  CD2   . LEU G  3 96  ? -12.088 -7.572  39.564  1.00 39.64  ? 96   LEU G CD2   1 
ATOM   5121  N  N     . LEU G  3 97  ? -12.334 -10.975 43.166  1.00 43.29  ? 97   LEU G N     1 
ATOM   5122  C  CA    . LEU G  3 97  ? -11.353 -12.028 43.300  1.00 43.03  ? 97   LEU G CA    1 
ATOM   5123  C  C     . LEU G  3 97  ? -11.756 -12.890 44.491  1.00 43.46  ? 97   LEU G C     1 
ATOM   5124  O  O     . LEU G  3 97  ? -10.912 -13.412 45.246  1.00 43.30  ? 97   LEU G O     1 
ATOM   5125  C  CB    . LEU G  3 97  ? -9.957  -11.442 43.487  1.00 43.08  ? 97   LEU G CB    1 
ATOM   5126  C  CG    . LEU G  3 97  ? -9.449  -10.422 42.469  1.00 42.99  ? 97   LEU G CG    1 
ATOM   5127  C  CD1   . LEU G  3 97  ? -7.953  -10.156 42.692  1.00 43.57  ? 97   LEU G CD1   1 
ATOM   5128  C  CD2   . LEU G  3 97  ? -9.689  -10.918 41.058  1.00 42.56  ? 97   LEU G CD2   1 
ATOM   5129  N  N     . GLY G  3 98  ? -13.070 -13.018 44.661  1.00 43.35  ? 98   GLY G N     1 
ATOM   5130  C  CA    . GLY G  3 98  ? -13.615 -13.827 45.719  1.00 43.97  ? 98   GLY G CA    1 
ATOM   5131  C  C     . GLY G  3 98  ? -13.169 -15.273 45.642  1.00 44.56  ? 98   GLY G C     1 
ATOM   5132  O  O     . GLY G  3 98  ? -13.028 -15.906 46.665  1.00 45.50  ? 98   GLY G O     1 
ATOM   5133  N  N     . ARG G  3 99  ? -12.947 -15.794 44.437  1.00 44.34  ? 99   ARG G N     1 
ATOM   5134  C  CA    . ARG G  3 99  ? -12.596 -17.197 44.271  1.00 44.47  ? 99   ARG G CA    1 
ATOM   5135  C  C     . ARG G  3 99  ? -11.157 -17.370 43.779  1.00 43.28  ? 99   ARG G C     1 
ATOM   5136  O  O     . ARG G  3 99  ? -10.868 -18.227 42.955  1.00 43.66  ? 99   ARG G O     1 
ATOM   5137  C  CB    . ARG G  3 99  ? -13.601 -17.873 43.314  1.00 45.20  ? 99   ARG G CB    1 
ATOM   5138  C  CG    . ARG G  3 99  ? -14.990 -18.142 43.953  1.00 49.84  ? 99   ARG G CG    1 
ATOM   5139  C  CD    . ARG G  3 99  ? -14.915 -19.379 44.852  1.00 59.38  ? 99   ARG G CD    1 
ATOM   5140  N  NE    . ARG G  3 99  ? -15.464 -19.177 46.205  1.00 65.71  ? 99   ARG G NE    1 
ATOM   5141  C  CZ    . ARG G  3 99  ? -15.240 -20.003 47.237  1.00 68.50  ? 99   ARG G CZ    1 
ATOM   5142  N  NH1   . ARG G  3 99  ? -14.463 -21.078 47.066  1.00 69.73  ? 99   ARG G NH1   1 
ATOM   5143  N  NH2   . ARG G  3 99  ? -15.787 -19.761 48.438  1.00 68.70  ? 99   ARG G NH2   1 
ATOM   5144  N  N     . VAL G  3 100 ? -10.253 -16.539 44.269  1.00 41.54  ? 100  VAL G N     1 
ATOM   5145  C  CA    . VAL G  3 100 ? -8.924  -16.477 43.709  1.00 40.34  ? 100  VAL G CA    1 
ATOM   5146  C  C     . VAL G  3 100 ? -7.950  -16.578 44.860  1.00 40.24  ? 100  VAL G C     1 
ATOM   5147  O  O     . VAL G  3 100 ? -8.267  -16.184 45.984  1.00 39.90  ? 100  VAL G O     1 
ATOM   5148  C  CB    . VAL G  3 100 ? -8.741  -15.155 42.871  1.00 40.59  ? 100  VAL G CB    1 
ATOM   5149  C  CG1   . VAL G  3 100 ? -7.282  -14.849 42.593  1.00 39.68  ? 100  VAL G CG1   1 
ATOM   5150  C  CG2   . VAL G  3 100 ? -9.523  -15.235 41.552  1.00 39.53  ? 100  VAL G CG2   1 
ATOM   5151  N  N     . THR G  3 101 ? -6.793  -17.165 44.597  1.00 40.33  ? 101  THR G N     1 
ATOM   5152  C  CA    . THR G  3 101 ? -5.784  -17.321 45.604  1.00 40.90  ? 101  THR G CA    1 
ATOM   5153  C  C     . THR G  3 101 ? -4.524  -16.673 45.111  1.00 41.67  ? 101  THR G C     1 
ATOM   5154  O  O     . THR G  3 101 ? -4.000  -16.998 44.041  1.00 42.31  ? 101  THR G O     1 
ATOM   5155  C  CB    . THR G  3 101 ? -5.514  -18.778 45.941  1.00 41.48  ? 101  THR G CB    1 
ATOM   5156  O  OG1   . THR G  3 101 ? -6.600  -19.271 46.741  1.00 43.89  ? 101  THR G OG1   1 
ATOM   5157  C  CG2   . THR G  3 101 ? -4.136  -18.940 46.728  1.00 40.47  ? 101  THR G CG2   1 
ATOM   5158  N  N     . ILE G  3 102 ? -4.051  -15.727 45.908  1.00 41.93  ? 102  ILE G N     1 
ATOM   5159  C  CA    . ILE G  3 102 ? -2.848  -15.012 45.594  1.00 41.43  ? 102  ILE G CA    1 
ATOM   5160  C  C     . ILE G  3 102 ? -1.731  -15.734 46.286  1.00 41.38  ? 102  ILE G C     1 
ATOM   5161  O  O     . ILE G  3 102 ? -1.607  -15.684 47.517  1.00 40.55  ? 102  ILE G O     1 
ATOM   5162  C  CB    . ILE G  3 102 ? -2.938  -13.520 46.021  1.00 40.90  ? 102  ILE G CB    1 
ATOM   5163  C  CG1   . ILE G  3 102 ? -4.080  -12.847 45.254  1.00 40.13  ? 102  ILE G CG1   1 
ATOM   5164  C  CG2   . ILE G  3 102 ? -1.622  -12.842 45.785  1.00 39.01  ? 102  ILE G CG2   1 
ATOM   5165  C  CD1   . ILE G  3 102 ? -4.396  -11.405 45.711  1.00 42.58  ? 102  ILE G CD1   1 
ATOM   5166  N  N     . ALA G  3 103 ? -0.925  -16.415 45.487  1.00 41.93  ? 103  ALA G N     1 
ATOM   5167  C  CA    . ALA G  3 103 ? 0.225   -17.115 46.020  1.00 43.73  ? 103  ALA G CA    1 
ATOM   5168  C  C     . ALA G  3 103 ? 1.050   -16.172 46.895  1.00 44.69  ? 103  ALA G C     1 
ATOM   5169  O  O     . ALA G  3 103 ? 1.318   -15.042 46.487  1.00 46.55  ? 103  ALA G O     1 
ATOM   5170  C  CB    . ALA G  3 103 ? 1.073   -17.682 44.872  1.00 43.89  ? 103  ALA G CB    1 
ATOM   5171  N  N     . GLN G  3 104 ? 1.441   -16.633 48.082  1.00 45.00  ? 104  GLN G N     1 
ATOM   5172  C  CA    . GLN G  3 104 ? 2.303   -15.893 49.012  1.00 45.48  ? 104  GLN G CA    1 
ATOM   5173  C  C     . GLN G  3 104 ? 1.642   -14.620 49.565  1.00 45.98  ? 104  GLN G C     1 
ATOM   5174  O  O     . GLN G  3 104 ? 2.312   -13.641 49.872  1.00 47.40  ? 104  GLN G O     1 
ATOM   5175  C  CB    . GLN G  3 104 ? 3.666   -15.576 48.371  1.00 46.20  ? 104  GLN G CB    1 
ATOM   5176  C  CG    . GLN G  3 104 ? 4.709   -16.728 48.367  1.00 48.81  ? 104  GLN G CG    1 
ATOM   5177  C  CD    . GLN G  3 104 ? 5.007   -17.249 49.788  1.00 55.00  ? 104  GLN G CD    1 
ATOM   5178  O  OE1   . GLN G  3 104 ? 5.369   -16.471 50.691  1.00 59.66  ? 104  GLN G OE1   1 
ATOM   5179  N  NE2   . GLN G  3 104 ? 4.815   -18.552 50.000  1.00 53.47  ? 104  GLN G NE2   1 
ATOM   5180  N  N     . GLY G  3 105 ? 0.324   -14.622 49.698  1.00 45.03  ? 105  GLY G N     1 
ATOM   5181  C  CA    . GLY G  3 105 ? -0.362  -13.455 50.153  1.00 43.08  ? 105  GLY G CA    1 
ATOM   5182  C  C     . GLY G  3 105 ? -0.692  -13.504 51.614  1.00 42.59  ? 105  GLY G C     1 
ATOM   5183  O  O     . GLY G  3 105 ? -0.914  -12.455 52.265  1.00 43.32  ? 105  GLY G O     1 
ATOM   5184  N  N     . GLY G  3 106 ? -0.728  -14.704 52.153  1.00 40.79  ? 106  GLY G N     1 
ATOM   5185  C  CA    . GLY G  3 106 ? -1.178  -14.875 53.513  1.00 39.63  ? 106  GLY G CA    1 
ATOM   5186  C  C     . GLY G  3 106 ? -2.630  -14.485 53.643  1.00 39.69  ? 106  GLY G C     1 
ATOM   5187  O  O     . GLY G  3 106 ? -3.390  -14.445 52.659  1.00 38.93  ? 106  GLY G O     1 
ATOM   5188  N  N     . VAL G  3 107 ? -3.017  -14.170 54.872  1.00 40.44  ? 107  VAL G N     1 
ATOM   5189  C  CA    . VAL G  3 107 ? -4.377  -13.740 55.157  1.00 40.13  ? 107  VAL G CA    1 
ATOM   5190  C  C     . VAL G  3 107 ? -4.391  -12.400 55.918  1.00 41.10  ? 107  VAL G C     1 
ATOM   5191  O  O     . VAL G  3 107 ? -3.345  -11.920 56.318  1.00 40.63  ? 107  VAL G O     1 
ATOM   5192  C  CB    . VAL G  3 107 ? -5.106  -14.829 55.985  1.00 39.88  ? 107  VAL G CB    1 
ATOM   5193  C  CG1   . VAL G  3 107 ? -5.059  -16.150 55.272  1.00 37.37  ? 107  VAL G CG1   1 
ATOM   5194  C  CG2   . VAL G  3 107 ? -4.497  -14.926 57.348  1.00 38.86  ? 107  VAL G CG2   1 
ATOM   5195  N  N     . LEU G  3 108 ? -5.576  -11.821 56.122  1.00 42.39  ? 108  LEU G N     1 
ATOM   5196  C  CA    . LEU G  3 108 ? -5.752  -10.647 56.975  1.00 44.41  ? 108  LEU G CA    1 
ATOM   5197  C  C     . LEU G  3 108 ? -5.570  -10.956 58.441  1.00 46.19  ? 108  LEU G C     1 
ATOM   5198  O  O     . LEU G  3 108 ? -6.082  -11.952 58.917  1.00 47.64  ? 108  LEU G O     1 
ATOM   5199  C  CB    . LEU G  3 108 ? -7.158  -10.076 56.792  1.00 44.11  ? 108  LEU G CB    1 
ATOM   5200  C  CG    . LEU G  3 108 ? -7.428  -9.212  55.550  1.00 43.06  ? 108  LEU G CG    1 
ATOM   5201  C  CD1   . LEU G  3 108 ? -8.618  -8.355  55.853  1.00 38.96  ? 108  LEU G CD1   1 
ATOM   5202  C  CD2   . LEU G  3 108 ? -6.216  -8.341  55.224  1.00 40.65  ? 108  LEU G CD2   1 
ATOM   5203  N  N     . PRO G  3 109 ? -4.832  -10.112 59.176  1.00 48.26  ? 109  PRO G N     1 
ATOM   5204  C  CA    . PRO G  3 109 ? -4.782  -10.270 60.640  1.00 49.28  ? 109  PRO G CA    1 
ATOM   5205  C  C     . PRO G  3 109 ? -6.181  -10.144 61.214  1.00 50.96  ? 109  PRO G C     1 
ATOM   5206  O  O     . PRO G  3 109 ? -6.893  -9.251  60.864  1.00 53.00  ? 109  PRO G O     1 
ATOM   5207  C  CB    . PRO G  3 109 ? -3.928  -9.097  61.086  1.00 48.12  ? 109  PRO G CB    1 
ATOM   5208  C  CG    . PRO G  3 109 ? -3.083  -8.781  59.918  1.00 48.51  ? 109  PRO G CG    1 
ATOM   5209  C  CD    . PRO G  3 109 ? -3.974  -8.999  58.719  1.00 48.46  ? 109  PRO G CD    1 
ATOM   5210  N  N     . ASN G  3 110 ? -6.605  -11.060 62.052  1.00 52.89  ? 110  ASN G N     1 
ATOM   5211  C  CA    . ASN G  3 110 ? -7.978  -11.056 62.506  1.00 54.23  ? 110  ASN G CA    1 
ATOM   5212  C  C     . ASN G  3 110 ? -8.162  -12.204 63.484  1.00 54.63  ? 110  ASN G C     1 
ATOM   5213  O  O     . ASN G  3 110 ? -7.923  -13.356 63.148  1.00 55.09  ? 110  ASN G O     1 
ATOM   5214  C  CB    . ASN G  3 110 ? -8.921  -11.172 61.298  1.00 54.32  ? 110  ASN G CB    1 
ATOM   5215  C  CG    . ASN G  3 110 ? -10.397 -11.125 61.677  1.00 55.66  ? 110  ASN G CG    1 
ATOM   5216  O  OD1   . ASN G  3 110 ? -10.767 -10.784 62.806  1.00 57.94  ? 110  ASN G OD1   1 
ATOM   5217  N  ND2   . ASN G  3 110 ? -11.256 -11.460 60.715  1.00 55.33  ? 110  ASN G ND2   1 
ATOM   5218  N  N     . ILE G  3 111 ? -8.559  -11.854 64.696  1.00 55.32  ? 111  ILE G N     1 
ATOM   5219  C  CA    . ILE G  3 111 ? -8.763  -12.782 65.785  1.00 56.73  ? 111  ILE G CA    1 
ATOM   5220  C  C     . ILE G  3 111 ? -10.124 -12.507 66.342  1.00 57.73  ? 111  ILE G C     1 
ATOM   5221  O  O     . ILE G  3 111 ? -10.399 -11.415 66.795  1.00 58.73  ? 111  ILE G O     1 
ATOM   5222  C  CB    . ILE G  3 111 ? -7.763  -12.536 66.933  1.00 56.55  ? 111  ILE G CB    1 
ATOM   5223  C  CG1   . ILE G  3 111 ? -6.324  -12.559 66.402  1.00 56.75  ? 111  ILE G CG1   1 
ATOM   5224  C  CG2   . ILE G  3 111 ? -8.017  -13.528 68.084  1.00 56.80  ? 111  ILE G CG2   1 
ATOM   5225  C  CD1   . ILE G  3 111 ? -5.237  -12.356 67.442  1.00 56.97  ? 111  ILE G CD1   1 
ATOM   5226  N  N     . GLN G  3 112 ? -10.982 -13.504 66.331  1.00 59.69  ? 112  GLN G N     1 
ATOM   5227  C  CA    . GLN G  3 112 ? -12.328 -13.346 66.847  1.00 60.75  ? 112  GLN G CA    1 
ATOM   5228  C  C     . GLN G  3 112 ? -12.262 -12.900 68.296  1.00 61.67  ? 112  GLN G C     1 
ATOM   5229  O  O     . GLN G  3 112 ? -11.297 -13.216 69.005  1.00 61.74  ? 112  GLN G O     1 
ATOM   5230  C  CB    . GLN G  3 112 ? -13.086 -14.663 66.726  1.00 60.50  ? 112  GLN G CB    1 
ATOM   5231  C  CG    . GLN G  3 112 ? -13.234 -15.119 65.299  1.00 60.96  ? 112  GLN G CG    1 
ATOM   5232  C  CD    . GLN G  3 112 ? -14.188 -14.259 64.480  1.00 61.68  ? 112  GLN G CD    1 
ATOM   5233  O  OE1   . GLN G  3 112 ? -15.364 -14.071 64.832  1.00 62.49  ? 112  GLN G OE1   1 
ATOM   5234  N  NE2   . GLN G  3 112 ? -13.695 -13.766 63.360  1.00 61.92  ? 112  GLN G NE2   1 
ATOM   5235  N  N     . SER G  3 113 ? -13.296 -12.174 68.719  1.00 62.98  ? 113  SER G N     1 
ATOM   5236  C  CA    . SER G  3 113 ? -13.366 -11.580 70.055  1.00 64.26  ? 113  SER G CA    1 
ATOM   5237  C  C     . SER G  3 113 ? -13.227 -12.578 71.195  1.00 64.69  ? 113  SER G C     1 
ATOM   5238  O  O     . SER G  3 113 ? -12.356 -12.414 72.048  1.00 65.03  ? 113  SER G O     1 
ATOM   5239  C  CB    . SER G  3 113 ? -14.656 -10.778 70.217  1.00 64.30  ? 113  SER G CB    1 
ATOM   5240  O  OG    . SER G  3 113 ? -14.656 -9.674  69.329  1.00 65.95  ? 113  SER G OG    1 
ATOM   5241  N  N     . VAL G  3 114 ? -14.070 -13.610 71.191  1.00 65.09  ? 114  VAL G N     1 
ATOM   5242  C  CA    . VAL G  3 114 ? -14.141 -14.587 72.291  1.00 65.69  ? 114  VAL G CA    1 
ATOM   5243  C  C     . VAL G  3 114 ? -12.808 -15.227 72.688  1.00 66.25  ? 114  VAL G C     1 
ATOM   5244  O  O     . VAL G  3 114 ? -12.669 -15.763 73.794  1.00 66.34  ? 114  VAL G O     1 
ATOM   5245  C  CB    . VAL G  3 114 ? -15.155 -15.714 72.002  1.00 65.68  ? 114  VAL G CB    1 
ATOM   5246  C  CG1   . VAL G  3 114 ? -16.578 -15.239 72.293  1.00 66.11  ? 114  VAL G CG1   1 
ATOM   5247  C  CG2   . VAL G  3 114 ? -15.011 -16.231 70.562  1.00 65.39  ? 114  VAL G CG2   1 
ATOM   5248  N  N     . LEU G  3 115 ? -11.835 -15.162 71.789  1.00 66.86  ? 115  LEU G N     1 
ATOM   5249  C  CA    . LEU G  3 115 ? -10.563 -15.822 71.999  1.00 67.58  ? 115  LEU G CA    1 
ATOM   5250  C  C     . LEU G  3 115 ? -9.572  -14.899 72.719  1.00 68.85  ? 115  LEU G C     1 
ATOM   5251  O  O     . LEU G  3 115 ? -8.545  -15.355 73.237  1.00 68.40  ? 115  LEU G O     1 
ATOM   5252  C  CB    . LEU G  3 115 ? -10.005 -16.346 70.663  1.00 67.18  ? 115  LEU G CB    1 
ATOM   5253  C  CG    . LEU G  3 115 ? -10.955 -17.053 69.679  1.00 65.79  ? 115  LEU G CG    1 
ATOM   5254  C  CD1   . LEU G  3 115 ? -10.195 -17.519 68.481  1.00 64.30  ? 115  LEU G CD1   1 
ATOM   5255  C  CD2   . LEU G  3 115 ? -11.714 -18.221 70.292  1.00 65.63  ? 115  LEU G CD2   1 
ATOM   5256  N  N     . LEU G  3 116 ? -9.894  -13.606 72.762  1.00 70.54  ? 116  LEU G N     1 
ATOM   5257  C  CA    . LEU G  3 116 ? -9.061  -12.620 73.466  1.00 72.20  ? 116  LEU G CA    1 
ATOM   5258  C  C     . LEU G  3 116 ? -9.049  -12.863 74.971  1.00 73.27  ? 116  LEU G C     1 
ATOM   5259  O  O     . LEU G  3 116 ? -10.054 -13.287 75.528  1.00 73.10  ? 116  LEU G O     1 
ATOM   5260  C  CB    . LEU G  3 116 ? -9.510  -11.195 73.159  1.00 71.98  ? 116  LEU G CB    1 
ATOM   5261  C  CG    . LEU G  3 116 ? -9.316  -10.737 71.715  1.00 72.79  ? 116  LEU G CG    1 
ATOM   5262  C  CD1   . LEU G  3 116 ? -9.894  -9.338  71.547  1.00 72.99  ? 116  LEU G CD1   1 
ATOM   5263  C  CD2   . LEU G  3 116 ? -7.839  -10.796 71.286  1.00 72.57  ? 116  LEU G CD2   1 
ATOM   5264  N  N     . PRO G  3 117 ? -7.905  -12.607 75.632  1.00 74.88  ? 117  PRO G N     1 
ATOM   5265  C  CA    . PRO G  3 117 ? -7.816  -12.937 77.059  1.00 76.33  ? 117  PRO G CA    1 
ATOM   5266  C  C     . PRO G  3 117 ? -8.785  -12.074 77.870  1.00 77.90  ? 117  PRO G C     1 
ATOM   5267  O  O     . PRO G  3 117 ? -9.094  -10.943 77.468  1.00 78.24  ? 117  PRO G O     1 
ATOM   5268  C  CB    . PRO G  3 117 ? -6.365  -12.601 77.408  1.00 76.29  ? 117  PRO G CB    1 
ATOM   5269  C  CG    . PRO G  3 117 ? -5.951  -11.590 76.369  1.00 75.77  ? 117  PRO G CG    1 
ATOM   5270  C  CD    . PRO G  3 117 ? -6.666  -11.988 75.122  1.00 74.71  ? 117  PRO G CD    1 
ATOM   5271  N  N     . LYS G  3 118 ? -9.275  -12.606 78.987  1.00 79.40  ? 118  LYS G N     1 
ATOM   5272  C  CA    . LYS G  3 118 ? -10.315 -11.919 79.752  1.00 80.88  ? 118  LYS G CA    1 
ATOM   5273  C  C     . LYS G  3 118 ? -10.070 -11.995 81.261  1.00 81.01  ? 118  LYS G C     1 
ATOM   5274  O  O     . LYS G  3 118 ? -10.993 -11.813 82.064  1.00 81.47  ? 118  LYS G O     1 
ATOM   5275  C  CB    . LYS G  3 118 ? -11.709 -12.461 79.375  1.00 81.23  ? 118  LYS G CB    1 
ATOM   5276  C  CG    . LYS G  3 118 ? -11.965 -13.945 79.732  1.00 82.31  ? 118  LYS G CG    1 
ATOM   5277  C  CD    . LYS G  3 118 ? -13.444 -14.335 79.494  1.00 82.09  ? 118  LYS G CD    1 
ATOM   5278  C  CE    . LYS G  3 118 ? -13.777 -15.702 80.116  1.00 83.47  ? 118  LYS G CE    1 
ATOM   5279  N  NZ    . LYS G  3 118 ? -15.148 -16.216 79.766  1.00 83.82  ? 118  LYS G NZ    1 
ATOM   5280  N  N     . THR H  4 29  ? 12.258  -19.315 22.946  1.00 86.28  ? 29   THR H N     1 
ATOM   5281  C  CA    . THR H  4 29  ? 11.052  -18.666 22.339  1.00 86.31  ? 29   THR H CA    1 
ATOM   5282  C  C     . THR H  4 29  ? 10.497  -17.514 23.181  1.00 85.92  ? 29   THR H C     1 
ATOM   5283  O  O     . THR H  4 29  ? 10.731  -17.436 24.393  1.00 86.02  ? 29   THR H O     1 
ATOM   5284  C  CB    . THR H  4 29  ? 9.907   -19.679 22.073  1.00 86.56  ? 29   THR H CB    1 
ATOM   5285  O  OG1   . THR H  4 29  ? 9.685   -20.490 23.240  1.00 86.96  ? 29   THR H OG1   1 
ATOM   5286  C  CG2   . THR H  4 29  ? 10.238  -20.565 20.871  1.00 86.72  ? 29   THR H CG2   1 
ATOM   5287  N  N     . ARG H  4 30  ? 9.752   -16.633 22.512  1.00 85.29  ? 30   ARG H N     1 
ATOM   5288  C  CA    . ARG H  4 30  ? 9.166   -15.440 23.121  1.00 84.57  ? 30   ARG H CA    1 
ATOM   5289  C  C     . ARG H  4 30  ? 8.111   -15.822 24.155  1.00 83.36  ? 30   ARG H C     1 
ATOM   5290  O  O     . ARG H  4 30  ? 7.194   -16.594 23.867  1.00 83.49  ? 30   ARG H O     1 
ATOM   5291  C  CB    . ARG H  4 30  ? 8.522   -14.553 22.044  1.00 84.85  ? 30   ARG H CB    1 
ATOM   5292  C  CG    . ARG H  4 30  ? 9.341   -14.409 20.753  1.00 87.14  ? 30   ARG H CG    1 
ATOM   5293  C  CD    . ARG H  4 30  ? 10.186  -13.135 20.722  1.00 90.71  ? 30   ARG H CD    1 
ATOM   5294  N  NE    . ARG H  4 30  ? 9.396   -11.946 20.358  1.00 92.61  ? 30   ARG H NE    1 
ATOM   5295  C  CZ    . ARG H  4 30  ? 9.899   -10.718 20.217  1.00 93.23  ? 30   ARG H CZ    1 
ATOM   5296  N  NH1   . ARG H  4 30  ? 11.205  -10.486 20.406  1.00 93.04  ? 30   ARG H NH1   1 
ATOM   5297  N  NH2   . ARG H  4 30  ? 9.092   -9.713  19.889  1.00 93.05  ? 30   ARG H NH2   1 
ATOM   5298  N  N     . LYS H  4 31  ? 8.260   -15.293 25.365  1.00 81.55  ? 31   LYS H N     1 
ATOM   5299  C  CA    . LYS H  4 31  ? 7.207   -15.377 26.359  1.00 79.70  ? 31   LYS H CA    1 
ATOM   5300  C  C     . LYS H  4 31  ? 6.556   -14.003 26.473  1.00 77.71  ? 31   LYS H C     1 
ATOM   5301  O  O     . LYS H  4 31  ? 7.132   -13.075 27.058  1.00 77.53  ? 31   LYS H O     1 
ATOM   5302  C  CB    . LYS H  4 31  ? 7.769   -15.828 27.713  1.00 80.23  ? 31   LYS H CB    1 
ATOM   5303  C  CG    . LYS H  4 31  ? 7.318   -17.200 28.172  1.00 81.75  ? 31   LYS H CG    1 
ATOM   5304  C  CD    . LYS H  4 31  ? 5.914   -17.125 28.776  1.00 84.17  ? 31   LYS H CD    1 
ATOM   5305  C  CE    . LYS H  4 31  ? 5.290   -18.515 28.967  1.00 84.61  ? 31   LYS H CE    1 
ATOM   5306  N  NZ    . LYS H  4 31  ? 3.793   -18.381 29.023  1.00 85.19  ? 31   LYS H NZ    1 
ATOM   5307  N  N     . GLU H  4 32  ? 5.372   -13.874 25.876  1.00 75.02  ? 32   GLU H N     1 
ATOM   5308  C  CA    . GLU H  4 32  ? 4.533   -12.685 26.036  1.00 72.42  ? 32   GLU H CA    1 
ATOM   5309  C  C     . GLU H  4 32  ? 4.006   -12.514 27.459  1.00 70.16  ? 32   GLU H C     1 
ATOM   5310  O  O     . GLU H  4 32  ? 3.692   -13.488 28.150  1.00 70.07  ? 32   GLU H O     1 
ATOM   5311  C  CB    . GLU H  4 32  ? 3.347   -12.728 25.092  1.00 72.47  ? 32   GLU H CB    1 
ATOM   5312  C  CG    . GLU H  4 32  ? 3.508   -11.892 23.863  1.00 74.10  ? 32   GLU H CG    1 
ATOM   5313  C  CD    . GLU H  4 32  ? 2.235   -11.870 23.024  1.00 78.10  ? 32   GLU H CD    1 
ATOM   5314  O  OE1   . GLU H  4 32  ? 1.181   -12.384 23.509  1.00 78.35  ? 32   GLU H OE1   1 
ATOM   5315  O  OE2   . GLU H  4 32  ? 2.288   -11.350 21.878  1.00 78.28  ? 32   GLU H OE2   1 
ATOM   5316  N  N     . SER H  4 33  ? 3.888   -11.254 27.864  1.00 67.14  ? 33   SER H N     1 
ATOM   5317  C  CA    . SER H  4 33  ? 3.518   -10.872 29.206  1.00 63.81  ? 33   SER H CA    1 
ATOM   5318  C  C     . SER H  4 33  ? 3.055   -9.425  29.181  1.00 61.90  ? 33   SER H C     1 
ATOM   5319  O  O     . SER H  4 33  ? 3.474   -8.642  28.335  1.00 61.68  ? 33   SER H O     1 
ATOM   5320  C  CB    . SER H  4 33  ? 4.729   -11.036 30.122  1.00 63.97  ? 33   SER H CB    1 
ATOM   5321  O  OG    . SER H  4 33  ? 4.789   -10.050 31.127  1.00 63.76  ? 33   SER H OG    1 
ATOM   5322  N  N     . TYR H  4 34  ? 2.174   -9.082  30.108  1.00 59.30  ? 34   TYR H N     1 
ATOM   5323  C  CA    . TYR H  4 34  ? 1.780   -7.708  30.322  1.00 56.94  ? 34   TYR H CA    1 
ATOM   5324  C  C     . TYR H  4 34  ? 2.784   -6.905  31.171  1.00 55.60  ? 34   TYR H C     1 
ATOM   5325  O  O     . TYR H  4 34  ? 2.538   -5.763  31.508  1.00 54.98  ? 34   TYR H O     1 
ATOM   5326  C  CB    . TYR H  4 34  ? 0.400   -7.669  30.970  1.00 56.35  ? 34   TYR H CB    1 
ATOM   5327  C  CG    . TYR H  4 34  ? -0.720  -8.095  30.063  1.00 55.95  ? 34   TYR H CG    1 
ATOM   5328  C  CD1   . TYR H  4 34  ? -1.242  -9.382  30.128  1.00 55.66  ? 34   TYR H CD1   1 
ATOM   5329  C  CD2   . TYR H  4 34  ? -1.271  -7.209  29.139  1.00 55.98  ? 34   TYR H CD2   1 
ATOM   5330  C  CE1   . TYR H  4 34  ? -2.283  -9.782  29.295  1.00 54.13  ? 34   TYR H CE1   1 
ATOM   5331  C  CE2   . TYR H  4 34  ? -2.313  -7.600  28.299  1.00 55.23  ? 34   TYR H CE2   1 
ATOM   5332  C  CZ    . TYR H  4 34  ? -2.816  -8.885  28.384  1.00 54.84  ? 34   TYR H CZ    1 
ATOM   5333  O  OH    . TYR H  4 34  ? -3.860  -9.274  27.560  1.00 55.34  ? 34   TYR H OH    1 
ATOM   5334  N  N     . ALA H  4 35  ? 3.927   -7.480  31.503  1.00 54.74  ? 35   ALA H N     1 
ATOM   5335  C  CA    . ALA H  4 35  ? 4.868   -6.780  32.382  1.00 54.02  ? 35   ALA H CA    1 
ATOM   5336  C  C     . ALA H  4 35  ? 5.119   -5.302  32.054  1.00 53.78  ? 35   ALA H C     1 
ATOM   5337  O  O     . ALA H  4 35  ? 5.042   -4.473  32.956  1.00 53.91  ? 35   ALA H O     1 
ATOM   5338  C  CB    . ALA H  4 35  ? 6.164   -7.539  32.517  1.00 53.47  ? 35   ALA H CB    1 
ATOM   5339  N  N     . ILE H  4 36  ? 5.392   -4.950  30.796  1.00 53.76  ? 36   ILE H N     1 
ATOM   5340  C  CA    . ILE H  4 36  ? 5.777   -3.553  30.497  1.00 53.84  ? 36   ILE H CA    1 
ATOM   5341  C  C     . ILE H  4 36  ? 4.668   -2.562  30.769  1.00 53.35  ? 36   ILE H C     1 
ATOM   5342  O  O     . ILE H  4 36  ? 4.902   -1.498  31.347  1.00 53.57  ? 36   ILE H O     1 
ATOM   5343  C  CB    . ILE H  4 36  ? 6.353   -3.311  29.069  1.00 54.22  ? 36   ILE H CB    1 
ATOM   5344  C  CG1   . ILE H  4 36  ? 5.470   -3.936  27.992  1.00 56.20  ? 36   ILE H CG1   1 
ATOM   5345  C  CG2   . ILE H  4 36  ? 7.799   -3.805  28.971  1.00 53.29  ? 36   ILE H CG2   1 
ATOM   5346  C  CD1   . ILE H  4 36  ? 5.736   -3.349  26.612  1.00 57.50  ? 36   ILE H CD1   1 
ATOM   5347  N  N     . TYR H  4 37  ? 3.454   -2.921  30.380  1.00 53.13  ? 37   TYR H N     1 
ATOM   5348  C  CA    . TYR H  4 37  ? 2.296   -2.072  30.652  1.00 52.82  ? 37   TYR H CA    1 
ATOM   5349  C  C     . TYR H  4 37  ? 2.030   -1.931  32.137  1.00 52.16  ? 37   TYR H C     1 
ATOM   5350  O  O     . TYR H  4 37  ? 1.679   -0.855  32.595  1.00 53.24  ? 37   TYR H O     1 
ATOM   5351  C  CB    . TYR H  4 37  ? 1.083   -2.599  29.919  1.00 53.20  ? 37   TYR H CB    1 
ATOM   5352  C  CG    . TYR H  4 37  ? 1.480   -3.167  28.585  1.00 54.69  ? 37   TYR H CG    1 
ATOM   5353  C  CD1   . TYR H  4 37  ? 1.506   -4.549  28.378  1.00 54.95  ? 37   TYR H CD1   1 
ATOM   5354  C  CD2   . TYR H  4 37  ? 1.887   -2.322  27.534  1.00 53.79  ? 37   TYR H CD2   1 
ATOM   5355  C  CE1   . TYR H  4 37  ? 1.898   -5.077  27.155  1.00 56.14  ? 37   TYR H CE1   1 
ATOM   5356  C  CE2   . TYR H  4 37  ? 2.279   -2.835  26.313  1.00 54.20  ? 37   TYR H CE2   1 
ATOM   5357  C  CZ    . TYR H  4 37  ? 2.288   -4.212  26.126  1.00 56.53  ? 37   TYR H CZ    1 
ATOM   5358  O  OH    . TYR H  4 37  ? 2.658   -4.736  24.904  1.00 57.05  ? 37   TYR H OH    1 
ATOM   5359  N  N     . VAL H  4 38  ? 2.235   -2.993  32.900  1.00 51.18  ? 38   VAL H N     1 
ATOM   5360  C  CA    . VAL H  4 38  ? 1.998   -2.926  34.319  1.00 50.53  ? 38   VAL H CA    1 
ATOM   5361  C  C     . VAL H  4 38  ? 2.993   -2.013  34.996  1.00 51.20  ? 38   VAL H C     1 
ATOM   5362  O  O     . VAL H  4 38  ? 2.596   -1.260  35.875  1.00 51.57  ? 38   VAL H O     1 
ATOM   5363  C  CB    . VAL H  4 38  ? 1.919   -4.305  34.961  1.00 50.07  ? 38   VAL H CB    1 
ATOM   5364  C  CG1   . VAL H  4 38  ? 1.721   -4.194  36.476  1.00 48.58  ? 38   VAL H CG1   1 
ATOM   5365  C  CG2   . VAL H  4 38  ? 0.758   -5.063  34.342  1.00 49.05  ? 38   VAL H CG2   1 
ATOM   5366  N  N     . TYR H  4 39  ? 4.257   -2.023  34.565  1.00 52.09  ? 39   TYR H N     1 
ATOM   5367  C  CA    . TYR H  4 39  ? 5.237   -1.024  35.033  1.00 52.67  ? 39   TYR H CA    1 
ATOM   5368  C  C     . TYR H  4 39  ? 4.795   0.387   34.718  1.00 51.92  ? 39   TYR H C     1 
ATOM   5369  O  O     . TYR H  4 39  ? 4.883   1.271   35.576  1.00 51.94  ? 39   TYR H O     1 
ATOM   5370  C  CB    . TYR H  4 39  ? 6.624   -1.223  34.426  1.00 54.34  ? 39   TYR H CB    1 
ATOM   5371  C  CG    . TYR H  4 39  ? 7.378   -2.371  34.996  1.00 56.60  ? 39   TYR H CG    1 
ATOM   5372  C  CD1   . TYR H  4 39  ? 7.623   -3.528  34.230  1.00 60.51  ? 39   TYR H CD1   1 
ATOM   5373  C  CD2   . TYR H  4 39  ? 7.869   -2.318  36.294  1.00 58.59  ? 39   TYR H CD2   1 
ATOM   5374  C  CE1   . TYR H  4 39  ? 8.341   -4.622  34.763  1.00 61.47  ? 39   TYR H CE1   1 
ATOM   5375  C  CE2   . TYR H  4 39  ? 8.574   -3.397  36.839  1.00 60.62  ? 39   TYR H CE2   1 
ATOM   5376  C  CZ    . TYR H  4 39  ? 8.805   -4.546  36.077  1.00 60.42  ? 39   TYR H CZ    1 
ATOM   5377  O  OH    . TYR H  4 39  ? 9.494   -5.601  36.647  1.00 60.40  ? 39   TYR H OH    1 
ATOM   5378  N  N     . LYS H  4 40  ? 4.332   0.596   33.489  1.00 51.26  ? 40   LYS H N     1 
ATOM   5379  C  CA    . LYS H  4 40  ? 3.942   1.936   33.052  1.00 51.23  ? 40   LYS H CA    1 
ATOM   5380  C  C     . LYS H  4 40  ? 2.841   2.450   33.936  1.00 50.58  ? 40   LYS H C     1 
ATOM   5381  O  O     . LYS H  4 40  ? 2.951   3.539   34.510  1.00 51.55  ? 40   LYS H O     1 
ATOM   5382  C  CB    . LYS H  4 40  ? 3.516   1.969   31.591  1.00 51.29  ? 40   LYS H CB    1 
ATOM   5383  C  CG    . LYS H  4 40  ? 4.694   1.951   30.633  1.00 53.29  ? 40   LYS H CG    1 
ATOM   5384  C  CD    . LYS H  4 40  ? 4.243   1.608   29.212  1.00 58.80  ? 40   LYS H CD    1 
ATOM   5385  C  CE    . LYS H  4 40  ? 5.417   1.666   28.221  1.00 61.05  ? 40   LYS H CE    1 
ATOM   5386  N  NZ    . LYS H  4 40  ? 4.955   1.389   26.827  1.00 62.03  ? 40   LYS H NZ    1 
ATOM   5387  N  N     . VAL H  4 41  ? 1.795   1.651   34.090  1.00 49.45  ? 41   VAL H N     1 
ATOM   5388  C  CA    . VAL H  4 41  ? 0.691   2.053   34.931  1.00 48.05  ? 41   VAL H CA    1 
ATOM   5389  C  C     . VAL H  4 41  ? 1.186   2.194   36.375  1.00 48.04  ? 41   VAL H C     1 
ATOM   5390  O  O     . VAL H  4 41  ? 0.686   3.030   37.130  1.00 48.10  ? 41   VAL H O     1 
ATOM   5391  C  CB    . VAL H  4 41  ? -0.499  1.083   34.801  1.00 47.91  ? 41   VAL H CB    1 
ATOM   5392  C  CG1   . VAL H  4 41  ? -1.625  1.504   35.687  1.00 45.27  ? 41   VAL H CG1   1 
ATOM   5393  C  CG2   . VAL H  4 41  ? -0.959  0.985   33.336  1.00 46.02  ? 41   VAL H CG2   1 
ATOM   5394  N  N     . LEU H  4 42  ? 2.189   1.416   36.763  1.00 47.46  ? 42   LEU H N     1 
ATOM   5395  C  CA    . LEU H  4 42  ? 2.667   1.545   38.140  1.00 47.35  ? 42   LEU H CA    1 
ATOM   5396  C  C     . LEU H  4 42  ? 3.412   2.857   38.356  1.00 47.82  ? 42   LEU H C     1 
ATOM   5397  O  O     . LEU H  4 42  ? 3.345   3.440   39.441  1.00 48.46  ? 42   LEU H O     1 
ATOM   5398  C  CB    . LEU H  4 42  ? 3.494   0.339   38.597  1.00 46.13  ? 42   LEU H CB    1 
ATOM   5399  C  CG    . LEU H  4 42  ? 4.082   0.464   40.004  1.00 45.21  ? 42   LEU H CG    1 
ATOM   5400  C  CD1   . LEU H  4 42  ? 3.066   0.431   41.094  1.00 42.66  ? 42   LEU H CD1   1 
ATOM   5401  C  CD2   . LEU H  4 42  ? 5.160   -0.563  40.243  1.00 45.43  ? 42   LEU H CD2   1 
ATOM   5402  N  N     . LYS H  4 43  ? 4.122   3.325   37.337  1.00 48.12  ? 43   LYS H N     1 
ATOM   5403  C  CA    . LYS H  4 43  ? 4.810   4.603   37.454  1.00 48.41  ? 43   LYS H CA    1 
ATOM   5404  C  C     . LYS H  4 43  ? 3.840   5.784   37.478  1.00 47.62  ? 43   LYS H C     1 
ATOM   5405  O  O     . LYS H  4 43  ? 4.032   6.727   38.236  1.00 48.44  ? 43   LYS H O     1 
ATOM   5406  C  CB    . LYS H  4 43  ? 5.932   4.747   36.420  1.00 48.99  ? 43   LYS H CB    1 
ATOM   5407  C  CG    . LYS H  4 43  ? 7.171   3.893   36.785  1.00 51.60  ? 43   LYS H CG    1 
ATOM   5408  C  CD    . LYS H  4 43  ? 7.375   3.871   38.333  1.00 55.44  ? 43   LYS H CD    1 
ATOM   5409  C  CE    . LYS H  4 43  ? 8.200   2.673   38.835  1.00 56.02  ? 43   LYS H CE    1 
ATOM   5410  N  NZ    . LYS H  4 43  ? 9.562   3.039   39.347  1.00 57.21  ? 43   LYS H NZ    1 
ATOM   5411  N  N     . GLN H  4 44  ? 2.760   5.696   36.723  1.00 46.26  ? 44   GLN H N     1 
ATOM   5412  C  CA    . GLN H  4 44  ? 1.738   6.712   36.800  1.00 45.53  ? 44   GLN H CA    1 
ATOM   5413  C  C     . GLN H  4 44  ? 1.141   6.831   38.189  1.00 45.40  ? 44   GLN H C     1 
ATOM   5414  O  O     . GLN H  4 44  ? 0.880   7.937   38.657  1.00 46.37  ? 44   GLN H O     1 
ATOM   5415  C  CB    . GLN H  4 44  ? 0.635   6.456   35.783  1.00 44.86  ? 44   GLN H CB    1 
ATOM   5416  C  CG    . GLN H  4 44  ? 1.150   6.372   34.388  1.00 46.33  ? 44   GLN H CG    1 
ATOM   5417  C  CD    . GLN H  4 44  ? 0.053   6.189   33.401  1.00 50.17  ? 44   GLN H CD    1 
ATOM   5418  O  OE1   . GLN H  4 44  ? -1.069  5.857   33.769  1.00 54.86  ? 44   GLN H OE1   1 
ATOM   5419  N  NE2   . GLN H  4 44  ? 0.360   6.387   32.129  1.00 51.19  ? 44   GLN H NE2   1 
ATOM   5420  N  N     . VAL H  4 45  ? 0.943   5.701   38.853  1.00 44.94  ? 45   VAL H N     1 
ATOM   5421  C  CA    . VAL H  4 45  ? 0.162   5.650   40.067  1.00 44.50  ? 45   VAL H CA    1 
ATOM   5422  C  C     . VAL H  4 45  ? 1.041   5.788   41.328  1.00 44.86  ? 45   VAL H C     1 
ATOM   5423  O  O     . VAL H  4 45  ? 0.645   6.416   42.287  1.00 45.13  ? 45   VAL H O     1 
ATOM   5424  C  CB    . VAL H  4 45  ? -0.714  4.366   40.070  1.00 44.84  ? 45   VAL H CB    1 
ATOM   5425  C  CG1   . VAL H  4 45  ? -1.351  4.127   41.393  1.00 45.34  ? 45   VAL H CG1   1 
ATOM   5426  C  CG2   . VAL H  4 45  ? -1.803  4.439   38.999  1.00 44.53  ? 45   VAL H CG2   1 
ATOM   5427  N  N     . HIS H  4 46  ? 2.222   5.191   41.336  1.00 45.43  ? 46   HIS H N     1 
ATOM   5428  C  CA    . HIS H  4 46  ? 3.121   5.285   42.481  1.00 46.75  ? 46   HIS H CA    1 
ATOM   5429  C  C     . HIS H  4 46  ? 4.538   5.380   41.970  1.00 48.28  ? 46   HIS H C     1 
ATOM   5430  O  O     . HIS H  4 46  ? 5.240   4.391   41.944  1.00 48.01  ? 46   HIS H O     1 
ATOM   5431  C  CB    . HIS H  4 46  ? 3.021   4.094   43.411  1.00 45.83  ? 46   HIS H CB    1 
ATOM   5432  C  CG    . HIS H  4 46  ? 1.832   4.126   44.303  1.00 45.74  ? 46   HIS H CG    1 
ATOM   5433  N  ND1   . HIS H  4 46  ? 0.695   3.395   44.050  1.00 45.73  ? 46   HIS H ND1   1 
ATOM   5434  C  CD2   . HIS H  4 46  ? 1.607   4.780   45.467  1.00 47.75  ? 46   HIS H CD2   1 
ATOM   5435  C  CE1   . HIS H  4 46  ? -0.183  3.605   45.014  1.00 47.15  ? 46   HIS H CE1   1 
ATOM   5436  N  NE2   . HIS H  4 46  ? 0.345   4.443   45.888  1.00 45.78  ? 46   HIS H NE2   1 
ATOM   5437  N  N     . PRO H  4 47  ? 4.957   6.593   41.574  1.00 50.03  ? 47   PRO H N     1 
ATOM   5438  C  CA    . PRO H  4 47  ? 6.157   6.736   40.756  1.00 51.21  ? 47   PRO H CA    1 
ATOM   5439  C  C     . PRO H  4 47  ? 7.470   6.322   41.432  1.00 52.14  ? 47   PRO H C     1 
ATOM   5440  O  O     . PRO H  4 47  ? 8.427   5.999   40.732  1.00 52.80  ? 47   PRO H O     1 
ATOM   5441  C  CB    . PRO H  4 47  ? 6.144   8.218   40.345  1.00 51.36  ? 47   PRO H CB    1 
ATOM   5442  C  CG    . PRO H  4 47  ? 5.237   8.893   41.271  1.00 50.66  ? 47   PRO H CG    1 
ATOM   5443  C  CD    . PRO H  4 47  ? 4.306   7.883   41.866  1.00 49.78  ? 47   PRO H CD    1 
ATOM   5444  N  N     . ASP H  4 48  ? 7.523   6.291   42.756  1.00 53.10  ? 48   ASP H N     1 
ATOM   5445  C  CA    . ASP H  4 48  ? 8.757   5.827   43.421  1.00 54.61  ? 48   ASP H CA    1 
ATOM   5446  C  C     . ASP H  4 48  ? 8.693   4.413   44.016  1.00 54.63  ? 48   ASP H C     1 
ATOM   5447  O  O     . ASP H  4 48  ? 9.342   4.136   45.026  1.00 54.99  ? 48   ASP H O     1 
ATOM   5448  C  CB    . ASP H  4 48  ? 9.189   6.831   44.487  1.00 55.20  ? 48   ASP H CB    1 
ATOM   5449  C  CG    . ASP H  4 48  ? 9.576   8.161   43.886  1.00 58.33  ? 48   ASP H CG    1 
ATOM   5450  O  OD1   . ASP H  4 48  ? 10.436  8.172   42.955  1.00 60.96  ? 48   ASP H OD1   1 
ATOM   5451  O  OD2   . ASP H  4 48  ? 9.003   9.191   44.323  1.00 60.95  ? 48   ASP H OD2   1 
ATOM   5452  N  N     . THR H  4 49  ? 7.925   3.527   43.378  1.00 54.18  ? 49   THR H N     1 
ATOM   5453  C  CA    . THR H  4 49  ? 7.581   2.237   43.952  1.00 53.57  ? 49   THR H CA    1 
ATOM   5454  C  C     . THR H  4 49  ? 7.840   1.133   42.967  1.00 53.55  ? 49   THR H C     1 
ATOM   5455  O  O     . THR H  4 49  ? 7.480   1.229   41.796  1.00 54.34  ? 49   THR H O     1 
ATOM   5456  C  CB    . THR H  4 49  ? 6.107   2.216   44.395  1.00 54.06  ? 49   THR H CB    1 
ATOM   5457  O  OG1   . THR H  4 49  ? 5.923   3.171   45.450  1.00 54.74  ? 49   THR H OG1   1 
ATOM   5458  C  CG2   . THR H  4 49  ? 5.656   0.819   44.877  1.00 53.37  ? 49   THR H CG2   1 
ATOM   5459  N  N     . GLY H  4 50  ? 8.469   0.070   43.438  1.00 53.19  ? 50   GLY H N     1 
ATOM   5460  C  CA    . GLY H  4 50  ? 8.764   -1.043  42.564  1.00 52.55  ? 50   GLY H CA    1 
ATOM   5461  C  C     . GLY H  4 50  ? 7.840   -2.220  42.790  1.00 52.23  ? 50   GLY H C     1 
ATOM   5462  O  O     . GLY H  4 50  ? 6.916   -2.161  43.600  1.00 52.40  ? 50   GLY H O     1 
ATOM   5463  N  N     . ILE H  4 51  ? 8.107   -3.300  42.065  1.00 51.93  ? 51   ILE H N     1 
ATOM   5464  C  CA    . ILE H  4 51  ? 7.290   -4.502  42.132  1.00 50.77  ? 51   ILE H CA    1 
ATOM   5465  C  C     . ILE H  4 51  ? 8.204   -5.692  41.993  1.00 51.01  ? 51   ILE H C     1 
ATOM   5466  O  O     . ILE H  4 51  ? 9.028   -5.735  41.092  1.00 51.12  ? 51   ILE H O     1 
ATOM   5467  C  CB    . ILE H  4 51  ? 6.147   -4.486  41.067  1.00 51.12  ? 51   ILE H CB    1 
ATOM   5468  C  CG1   . ILE H  4 51  ? 5.234   -5.720  41.200  1.00 51.28  ? 51   ILE H CG1   1 
ATOM   5469  C  CG2   . ILE H  4 51  ? 6.693   -4.304  39.659  1.00 49.64  ? 51   ILE H CG2   1 
ATOM   5470  C  CD1   . ILE H  4 51  ? 3.794   -5.560  40.651  1.00 47.35  ? 51   ILE H CD1   1 
ATOM   5471  N  N     . SER H  4 52  ? 8.080   -6.646  42.915  1.00 51.06  ? 52   SER H N     1 
ATOM   5472  C  CA    . SER H  4 52  ? 8.847   -7.890  42.831  1.00 50.59  ? 52   SER H CA    1 
ATOM   5473  C  C     . SER H  4 52  ? 8.373   -8.730  41.664  1.00 50.55  ? 52   SER H C     1 
ATOM   5474  O  O     . SER H  4 52  ? 7.241   -8.592  41.208  1.00 50.81  ? 52   SER H O     1 
ATOM   5475  C  CB    . SER H  4 52  ? 8.758   -8.686  44.126  1.00 50.39  ? 52   SER H CB    1 
ATOM   5476  O  OG    . SER H  4 52  ? 7.536   -9.381  44.224  1.00 50.30  ? 52   SER H OG    1 
ATOM   5477  N  N     . SER H  4 53  ? 9.253   -9.597  41.181  1.00 50.78  ? 53   SER H N     1 
ATOM   5478  C  CA    . SER H  4 53  ? 8.949   -10.550 40.114  1.00 50.72  ? 53   SER H CA    1 
ATOM   5479  C  C     . SER H  4 53  ? 7.679   -11.418 40.351  1.00 50.12  ? 53   SER H C     1 
ATOM   5480  O  O     . SER H  4 53  ? 6.844   -11.575 39.449  1.00 50.02  ? 53   SER H O     1 
ATOM   5481  C  CB    . SER H  4 53  ? 10.166  -11.417 39.902  1.00 50.56  ? 53   SER H CB    1 
ATOM   5482  O  OG    . SER H  4 53  ? 9.805   -12.627 39.282  1.00 55.54  ? 53   SER H OG    1 
ATOM   5483  N  N     . LYS H  4 54  ? 7.541   -11.975 41.552  1.00 49.66  ? 54   LYS H N     1 
ATOM   5484  C  CA    . LYS H  4 54  ? 6.343   -12.729 41.921  1.00 49.52  ? 54   LYS H CA    1 
ATOM   5485  C  C     . LYS H  4 54  ? 5.098   -11.855 41.899  1.00 48.51  ? 54   LYS H C     1 
ATOM   5486  O  O     . LYS H  4 54  ? 4.038   -12.285 41.420  1.00 48.15  ? 54   LYS H O     1 
ATOM   5487  C  CB    . LYS H  4 54  ? 6.474   -13.312 43.326  1.00 50.05  ? 54   LYS H CB    1 
ATOM   5488  C  CG    . LYS H  4 54  ? 7.380   -14.497 43.480  1.00 53.11  ? 54   LYS H CG    1 
ATOM   5489  C  CD    . LYS H  4 54  ? 7.582   -14.762 44.985  1.00 58.63  ? 54   LYS H CD    1 
ATOM   5490  C  CE    . LYS H  4 54  ? 8.772   -15.690 45.262  1.00 61.18  ? 54   LYS H CE    1 
ATOM   5491  N  NZ    . LYS H  4 54  ? 9.478   -15.316 46.551  1.00 62.92  ? 54   LYS H NZ    1 
ATOM   5492  N  N     . ALA H  4 55  ? 5.223   -10.644 42.450  1.00 47.50  ? 55   ALA H N     1 
ATOM   5493  C  CA    . ALA H  4 55  ? 4.118   -9.681  42.472  1.00 46.57  ? 55   ALA H CA    1 
ATOM   5494  C  C     . ALA H  4 55  ? 3.633   -9.376  41.068  1.00 46.05  ? 55   ALA H C     1 
ATOM   5495  O  O     . ALA H  4 55  ? 2.436   -9.285  40.825  1.00 45.40  ? 55   ALA H O     1 
ATOM   5496  C  CB    . ALA H  4 55  ? 4.523   -8.456  43.161  1.00 46.60  ? 55   ALA H CB    1 
ATOM   5497  N  N     . MET H  4 56  ? 4.581   -9.279  40.146  1.00 46.14  ? 56   MET H N     1 
ATOM   5498  C  CA    . MET H  4 56  ? 4.312   -9.087  38.730  1.00 46.78  ? 56   MET H CA    1 
ATOM   5499  C  C     . MET H  4 56  ? 3.638   -10.299 38.097  1.00 46.60  ? 56   MET H C     1 
ATOM   5500  O  O     . MET H  4 56  ? 2.757   -10.147 37.237  1.00 47.30  ? 56   MET H O     1 
ATOM   5501  C  CB    . MET H  4 56  ? 5.617   -8.767  37.981  1.00 47.10  ? 56   MET H CB    1 
ATOM   5502  C  CG    . MET H  4 56  ? 5.446   -8.455  36.508  1.00 48.17  ? 56   MET H CG    1 
ATOM   5503  S  SD    . MET H  4 56  ? 4.544   -6.901  36.271  1.00 55.47  ? 56   MET H SD    1 
ATOM   5504  C  CE    . MET H  4 56  ? 3.058   -7.534  35.500  1.00 54.34  ? 56   MET H CE    1 
ATOM   5505  N  N     . SER H  4 57  ? 4.046   -11.498 38.502  1.00 46.04  ? 57   SER H N     1 
ATOM   5506  C  CA    . SER H  4 57  ? 3.466   -12.713 37.925  1.00 46.13  ? 57   SER H CA    1 
ATOM   5507  C  C     . SER H  4 57  ? 1.985   -12.770 38.305  1.00 45.49  ? 57   SER H C     1 
ATOM   5508  O  O     . SER H  4 57  ? 1.122   -13.001 37.469  1.00 45.45  ? 57   SER H O     1 
ATOM   5509  C  CB    . SER H  4 57  ? 4.226   -13.952 38.402  1.00 46.80  ? 57   SER H CB    1 
ATOM   5510  O  OG    . SER H  4 57  ? 3.532   -15.144 38.062  1.00 50.52  ? 57   SER H OG    1 
ATOM   5511  N  N     . ILE H  4 58  ? 1.703   -12.505 39.570  1.00 44.85  ? 58   ILE H N     1 
ATOM   5512  C  CA    . ILE H  4 58  ? 0.363   -12.257 40.015  1.00 44.67  ? 58   ILE H CA    1 
ATOM   5513  C  C     . ILE H  4 58  ? -0.385  -11.189 39.178  1.00 46.21  ? 58   ILE H C     1 
ATOM   5514  O  O     . ILE H  4 58  ? -1.541  -11.424 38.741  1.00 46.94  ? 58   ILE H O     1 
ATOM   5515  C  CB    . ILE H  4 58  ? 0.382   -11.902 41.481  1.00 44.24  ? 58   ILE H CB    1 
ATOM   5516  C  CG1   . ILE H  4 58  ? 0.734   -13.169 42.242  1.00 42.89  ? 58   ILE H CG1   1 
ATOM   5517  C  CG2   . ILE H  4 58  ? -0.956  -11.258 41.915  1.00 41.76  ? 58   ILE H CG2   1 
ATOM   5518  C  CD1   . ILE H  4 58  ? 1.151   -12.956 43.615  1.00 44.64  ? 58   ILE H CD1   1 
ATOM   5519  N  N     . MET H  4 59  ? 0.253   -10.041 38.927  1.00 45.98  ? 59   MET H N     1 
ATOM   5520  C  CA    . MET H  4 59  ? -0.392  -9.025  38.096  1.00 45.77  ? 59   MET H CA    1 
ATOM   5521  C  C     . MET H  4 59  ? -0.704  -9.594  36.730  1.00 45.40  ? 59   MET H C     1 
ATOM   5522  O  O     . MET H  4 59  ? -1.804  -9.416  36.220  1.00 45.40  ? 59   MET H O     1 
ATOM   5523  C  CB    . MET H  4 59  ? 0.445   -7.743  37.974  1.00 45.89  ? 59   MET H CB    1 
ATOM   5524  C  CG    . MET H  4 59  ? 0.426   -6.855  39.193  1.00 44.80  ? 59   MET H CG    1 
ATOM   5525  S  SD    . MET H  4 59  ? -1.249  -6.519  39.729  1.00 48.27  ? 59   MET H SD    1 
ATOM   5526  C  CE    . MET H  4 59  ? -1.877  -5.509  38.369  1.00 42.43  ? 59   MET H CE    1 
ATOM   5527  N  N     . ASN H  4 60  ? 0.253   -10.295 36.144  1.00 45.50  ? 60   ASN H N     1 
ATOM   5528  C  CA    . ASN H  4 60  ? 0.003   -10.932 34.855  1.00 46.26  ? 60   ASN H CA    1 
ATOM   5529  C  C     . ASN H  4 60  ? -1.141  -11.963 34.866  1.00 45.82  ? 60   ASN H C     1 
ATOM   5530  O  O     . ASN H  4 60  ? -1.907  -12.054 33.889  1.00 45.98  ? 60   ASN H O     1 
ATOM   5531  C  CB    . ASN H  4 60  ? 1.279   -11.533 34.273  1.00 46.88  ? 60   ASN H CB    1 
ATOM   5532  C  CG    . ASN H  4 60  ? 1.131   -11.877 32.806  1.00 49.97  ? 60   ASN H CG    1 
ATOM   5533  O  OD1   . ASN H  4 60  ? 0.845   -13.024 32.469  1.00 56.42  ? 60   ASN H OD1   1 
ATOM   5534  N  ND2   . ASN H  4 60  ? 1.282   -10.890 31.928  1.00 49.86  ? 60   ASN H ND2   1 
ATOM   5535  N  N     . SER H  4 61  ? -1.266  -12.722 35.960  1.00 44.87  ? 61   SER H N     1 
ATOM   5536  C  CA    . SER H  4 61  ? -2.354  -13.676 36.097  1.00 44.80  ? 61   SER H CA    1 
ATOM   5537  C  C     . SER H  4 61  ? -3.684  -12.945 36.123  1.00 44.70  ? 61   SER H C     1 
ATOM   5538  O  O     . SER H  4 61  ? -4.582  -13.262 35.343  1.00 44.75  ? 61   SER H O     1 
ATOM   5539  C  CB    . SER H  4 61  ? -2.201  -14.542 37.360  1.00 45.57  ? 61   SER H CB    1 
ATOM   5540  O  OG    . SER H  4 61  ? -1.136  -15.468 37.227  1.00 45.38  ? 61   SER H OG    1 
ATOM   5541  N  N     . PHE H  4 62  ? -3.793  -11.954 37.017  1.00 44.78  ? 62   PHE H N     1 
ATOM   5542  C  CA    . PHE H  4 62  ? -4.955  -11.040 37.107  1.00 44.03  ? 62   PHE H CA    1 
ATOM   5543  C  C     . PHE H  4 62  ? -5.379  -10.469 35.743  1.00 43.33  ? 62   PHE H C     1 
ATOM   5544  O  O     . PHE H  4 62  ? -6.552  -10.536 35.376  1.00 42.91  ? 62   PHE H O     1 
ATOM   5545  C  CB    . PHE H  4 62  ? -4.648  -9.939  38.117  1.00 44.61  ? 62   PHE H CB    1 
ATOM   5546  C  CG    . PHE H  4 62  ? -5.693  -8.879  38.218  1.00 45.01  ? 62   PHE H CG    1 
ATOM   5547  C  CD1   . PHE H  4 62  ? -6.916  -9.145  38.794  1.00 45.45  ? 62   PHE H CD1   1 
ATOM   5548  C  CD2   . PHE H  4 62  ? -5.434  -7.590  37.752  1.00 47.37  ? 62   PHE H CD2   1 
ATOM   5549  C  CE1   . PHE H  4 62  ? -7.873  -8.161  38.897  1.00 48.41  ? 62   PHE H CE1   1 
ATOM   5550  C  CE2   . PHE H  4 62  ? -6.390  -6.580  37.845  1.00 46.22  ? 62   PHE H CE2   1 
ATOM   5551  C  CZ    . PHE H  4 62  ? -7.602  -6.854  38.422  1.00 47.54  ? 62   PHE H CZ    1 
ATOM   5552  N  N     . VAL H  4 63  ? -4.436  -9.964  34.963  1.00 42.86  ? 63   VAL H N     1 
ATOM   5553  C  CA    . VAL H  4 63  ? -4.813  -9.395  33.665  1.00 43.49  ? 63   VAL H CA    1 
ATOM   5554  C  C     . VAL H  4 63  ? -5.370  -10.455 32.720  1.00 43.74  ? 63   VAL H C     1 
ATOM   5555  O  O     . VAL H  4 63  ? -6.480  -10.306 32.216  1.00 44.44  ? 63   VAL H O     1 
ATOM   5556  C  CB    . VAL H  4 63  ? -3.687  -8.554  32.998  1.00 43.41  ? 63   VAL H CB    1 
ATOM   5557  C  CG1   . VAL H  4 63  ? -4.173  -8.018  31.713  1.00 43.80  ? 63   VAL H CG1   1 
ATOM   5558  C  CG2   . VAL H  4 63  ? -3.263  -7.388  33.888  1.00 42.35  ? 63   VAL H CG2   1 
ATOM   5559  N  N     . ASN H  4 64  ? -4.625  -11.544 32.507  1.00 44.21  ? 64   ASN H N     1 
ATOM   5560  C  CA    . ASN H  4 64  ? -5.173  -12.728 31.813  1.00 43.80  ? 64   ASN H CA    1 
ATOM   5561  C  C     . ASN H  4 64  ? -6.498  -13.251 32.365  1.00 43.08  ? 64   ASN H C     1 
ATOM   5562  O  O     . ASN H  4 64  ? -7.386  -13.604 31.608  1.00 42.76  ? 64   ASN H O     1 
ATOM   5563  C  CB    . ASN H  4 64  ? -4.150  -13.829 31.790  1.00 44.10  ? 64   ASN H CB    1 
ATOM   5564  C  CG    . ASN H  4 64  ? -3.015  -13.521 30.865  1.00 46.42  ? 64   ASN H CG    1 
ATOM   5565  O  OD1   . ASN H  4 64  ? -3.234  -13.252 29.687  1.00 49.35  ? 64   ASN H OD1   1 
ATOM   5566  N  ND2   . ASN H  4 64  ? -1.786  -13.548 31.385  1.00 48.22  ? 64   ASN H ND2   1 
ATOM   5567  N  N     . ASP H  4 65  ? -6.637  -13.288 33.683  1.00 42.90  ? 65   ASP H N     1 
ATOM   5568  C  CA    . ASP H  4 65  ? -7.856  -13.776 34.269  1.00 43.85  ? 65   ASP H CA    1 
ATOM   5569  C  C     . ASP H  4 65  ? -9.054  -12.899 33.870  1.00 45.04  ? 65   ASP H C     1 
ATOM   5570  O  O     . ASP H  4 65  ? -10.019 -13.401 33.297  1.00 45.87  ? 65   ASP H O     1 
ATOM   5571  C  CB    . ASP H  4 65  ? -7.722  -13.916 35.793  1.00 43.77  ? 65   ASP H CB    1 
ATOM   5572  C  CG    . ASP H  4 65  ? -9.017  -14.419 36.452  1.00 44.72  ? 65   ASP H CG    1 
ATOM   5573  O  OD1   . ASP H  4 65  ? -9.824  -15.028 35.726  1.00 45.36  ? 65   ASP H OD1   1 
ATOM   5574  O  OD2   . ASP H  4 65  ? -9.241  -14.189 37.669  1.00 43.18  ? 65   ASP H OD2   1 
ATOM   5575  N  N     . VAL H  4 66  ? -8.984  -11.596 34.164  1.00 45.88  ? 66   VAL H N     1 
ATOM   5576  C  CA    . VAL H  4 66  ? -10.081 -10.656 33.908  1.00 46.05  ? 66   VAL H CA    1 
ATOM   5577  C  C     . VAL H  4 66  ? -10.382 -10.624 32.428  1.00 45.99  ? 66   VAL H C     1 
ATOM   5578  O  O     . VAL H  4 66  ? -11.537 -10.596 32.020  1.00 46.07  ? 66   VAL H O     1 
ATOM   5579  C  CB    . VAL H  4 66  ? -9.748  -9.200  34.408  1.00 46.41  ? 66   VAL H CB    1 
ATOM   5580  C  CG1   . VAL H  4 66  ? -10.756 -8.227  33.880  1.00 46.85  ? 66   VAL H CG1   1 
ATOM   5581  C  CG2   . VAL H  4 66  ? -9.743  -9.121  35.916  1.00 46.29  ? 66   VAL H CG2   1 
ATOM   5582  N  N     . PHE H  4 67  ? -9.334  -10.625 31.621  1.00 46.42  ? 67   PHE H N     1 
ATOM   5583  C  CA    . PHE H  4 67  ? -9.504  -10.707 30.186  1.00 47.30  ? 67   PHE H CA    1 
ATOM   5584  C  C     . PHE H  4 67  ? -10.403 -11.893 29.819  1.00 47.94  ? 67   PHE H C     1 
ATOM   5585  O  O     . PHE H  4 67  ? -11.388 -11.725 29.109  1.00 48.64  ? 67   PHE H O     1 
ATOM   5586  C  CB    . PHE H  4 67  ? -8.150  -10.855 29.513  1.00 47.04  ? 67   PHE H CB    1 
ATOM   5587  C  CG    . PHE H  4 67  ? -8.227  -10.936 28.021  1.00 47.69  ? 67   PHE H CG    1 
ATOM   5588  C  CD1   . PHE H  4 67  ? -7.682  -9.945  27.238  1.00 47.20  ? 67   PHE H CD1   1 
ATOM   5589  C  CD2   . PHE H  4 67  ? -8.826  -12.015 27.398  1.00 49.48  ? 67   PHE H CD2   1 
ATOM   5590  C  CE1   . PHE H  4 67  ? -7.748  -10.014 25.862  1.00 50.35  ? 67   PHE H CE1   1 
ATOM   5591  C  CE2   . PHE H  4 67  ? -8.890  -12.097 25.999  1.00 50.20  ? 67   PHE H CE2   1 
ATOM   5592  C  CZ    . PHE H  4 67  ? -8.357  -11.099 25.234  1.00 48.72  ? 67   PHE H CZ    1 
ATOM   5593  N  N     . GLU H  4 68  ? -10.056 -13.082 30.323  1.00 48.41  ? 68   GLU H N     1 
ATOM   5594  C  CA    . GLU H  4 68  ? -10.781 -14.318 30.039  1.00 48.59  ? 68   GLU H CA    1 
ATOM   5595  C  C     . GLU H  4 68  ? -12.229 -14.182 30.412  1.00 47.05  ? 68   GLU H C     1 
ATOM   5596  O  O     . GLU H  4 68  ? -13.084 -14.489 29.595  1.00 46.48  ? 68   GLU H O     1 
ATOM   5597  C  CB    . GLU H  4 68  ? -10.200 -15.477 30.846  1.00 50.06  ? 68   GLU H CB    1 
ATOM   5598  C  CG    . GLU H  4 68  ? -9.902  -16.755 30.088  1.00 53.94  ? 68   GLU H CG    1 
ATOM   5599  C  CD    . GLU H  4 68  ? -8.469  -17.223 30.407  1.00 61.21  ? 68   GLU H CD    1 
ATOM   5600  O  OE1   . GLU H  4 68  ? -8.102  -17.170 31.622  1.00 62.40  ? 68   GLU H OE1   1 
ATOM   5601  O  OE2   . GLU H  4 68  ? -7.708  -17.602 29.460  1.00 62.06  ? 68   GLU H OE2   1 
ATOM   5602  N  N     . ARG H  4 69  ? -12.493 -13.724 31.639  1.00 45.52  ? 69   ARG H N     1 
ATOM   5603  C  CA    . ARG H  4 69  ? -13.864 -13.552 32.092  1.00 45.54  ? 69   ARG H CA    1 
ATOM   5604  C  C     . ARG H  4 69  ? -14.660 -12.574 31.211  1.00 46.16  ? 69   ARG H C     1 
ATOM   5605  O  O     . ARG H  4 69  ? -15.841 -12.809 30.957  1.00 46.36  ? 69   ARG H O     1 
ATOM   5606  C  CB    . ARG H  4 69  ? -13.943 -13.095 33.541  1.00 45.25  ? 69   ARG H CB    1 
ATOM   5607  C  CG    . ARG H  4 69  ? -13.063 -13.854 34.511  1.00 45.20  ? 69   ARG H CG    1 
ATOM   5608  C  CD    . ARG H  4 69  ? -13.591 -13.669 35.936  1.00 45.58  ? 69   ARG H CD    1 
ATOM   5609  N  NE    . ARG H  4 69  ? -12.495 -13.653 36.891  1.00 41.78  ? 69   ARG H NE    1 
ATOM   5610  C  CZ    . ARG H  4 69  ? -12.621 -13.324 38.165  1.00 41.47  ? 69   ARG H CZ    1 
ATOM   5611  N  NH1   . ARG H  4 69  ? -13.802 -13.003 38.649  1.00 38.83  ? 69   ARG H NH1   1 
ATOM   5612  N  NH2   . ARG H  4 69  ? -11.550 -13.321 38.961  1.00 44.04  ? 69   ARG H NH2   1 
ATOM   5613  N  N     . ILE H  4 70  ? -14.029 -11.485 30.752  1.00 46.09  ? 70   ILE H N     1 
ATOM   5614  C  CA    . ILE H  4 70  ? -14.750 -10.509 29.957  1.00 45.99  ? 70   ILE H CA    1 
ATOM   5615  C  C     . ILE H  4 70  ? -14.984 -11.078 28.561  1.00 46.57  ? 70   ILE H C     1 
ATOM   5616  O  O     . ILE H  4 70  ? -16.138 -11.237 28.170  1.00 47.05  ? 70   ILE H O     1 
ATOM   5617  C  CB    . ILE H  4 70  ? -14.092 -9.076  29.974  1.00 46.23  ? 70   ILE H CB    1 
ATOM   5618  C  CG1   . ILE H  4 70  ? -14.300 -8.401  31.338  1.00 44.55  ? 70   ILE H CG1   1 
ATOM   5619  C  CG2   . ILE H  4 70  ? -14.629 -8.178  28.828  1.00 43.50  ? 70   ILE H CG2   1 
ATOM   5620  C  CD1   . ILE H  4 70  ? -13.217 -7.404  31.692  1.00 42.12  ? 70   ILE H CD1   1 
ATOM   5621  N  N     . ALA H  4 71  ? -13.925 -11.409 27.829  1.00 46.60  ? 71   ALA H N     1 
ATOM   5622  C  CA    . ALA H  4 71  ? -14.086 -12.037 26.508  1.00 47.99  ? 71   ALA H CA    1 
ATOM   5623  C  C     . ALA H  4 71  ? -15.086 -13.185 26.550  1.00 48.87  ? 71   ALA H C     1 
ATOM   5624  O  O     . ALA H  4 71  ? -15.918 -13.325 25.658  1.00 49.63  ? 71   ALA H O     1 
ATOM   5625  C  CB    . ALA H  4 71  ? -12.744 -12.542 25.964  1.00 47.42  ? 71   ALA H CB    1 
ATOM   5626  N  N     . GLY H  4 72  ? -14.995 -14.005 27.592  1.00 49.55  ? 72   GLY H N     1 
ATOM   5627  C  CA    . GLY H  4 72  ? -15.897 -15.114 27.765  1.00 50.74  ? 72   GLY H CA    1 
ATOM   5628  C  C     . GLY H  4 72  ? -17.348 -14.689 27.753  1.00 51.56  ? 72   GLY H C     1 
ATOM   5629  O  O     . GLY H  4 72  ? -18.128 -15.142 26.929  1.00 51.40  ? 72   GLY H O     1 
ATOM   5630  N  N     . GLU H  4 73  ? -17.712 -13.807 28.668  1.00 52.86  ? 73   GLU H N     1 
ATOM   5631  C  CA    . GLU H  4 73  ? -19.101 -13.391 28.766  1.00 54.51  ? 73   GLU H CA    1 
ATOM   5632  C  C     . GLU H  4 73  ? -19.549 -12.641 27.507  1.00 54.95  ? 73   GLU H C     1 
ATOM   5633  O  O     . GLU H  4 73  ? -20.687 -12.803 27.059  1.00 55.52  ? 73   GLU H O     1 
ATOM   5634  C  CB    . GLU H  4 73  ? -19.339 -12.578 30.028  1.00 54.32  ? 73   GLU H CB    1 
ATOM   5635  C  CG    . GLU H  4 73  ? -20.775 -12.083 30.149  1.00 58.32  ? 73   GLU H CG    1 
ATOM   5636  C  CD    . GLU H  4 73  ? -21.783 -13.197 30.366  1.00 61.73  ? 73   GLU H CD    1 
ATOM   5637  O  OE1   . GLU H  4 73  ? -22.786 -13.267 29.612  1.00 61.08  ? 73   GLU H OE1   1 
ATOM   5638  O  OE2   . GLU H  4 73  ? -21.571 -13.996 31.308  1.00 66.05  ? 73   GLU H OE2   1 
ATOM   5639  N  N     . ALA H  4 74  ? -18.649 -11.859 26.922  1.00 55.15  ? 74   ALA H N     1 
ATOM   5640  C  CA    . ALA H  4 74  ? -18.939 -11.169 25.674  1.00 55.88  ? 74   ALA H CA    1 
ATOM   5641  C  C     . ALA H  4 74  ? -19.274 -12.155 24.584  1.00 56.23  ? 74   ALA H C     1 
ATOM   5642  O  O     . ALA H  4 74  ? -20.186 -11.927 23.792  1.00 56.43  ? 74   ALA H O     1 
ATOM   5643  C  CB    . ALA H  4 74  ? -17.756 -10.293 25.240  1.00 56.21  ? 74   ALA H CB    1 
ATOM   5644  N  N     . SER H  4 75  ? -18.521 -13.247 24.541  1.00 56.79  ? 75   SER H N     1 
ATOM   5645  C  CA    . SER H  4 75  ? -18.773 -14.333 23.596  1.00 57.10  ? 75   SER H CA    1 
ATOM   5646  C  C     . SER H  4 75  ? -20.202 -14.862 23.678  1.00 57.32  ? 75   SER H C     1 
ATOM   5647  O  O     . SER H  4 75  ? -20.878 -14.986 22.663  1.00 56.67  ? 75   SER H O     1 
ATOM   5648  C  CB    . SER H  4 75  ? -17.807 -15.468 23.854  1.00 56.79  ? 75   SER H CB    1 
ATOM   5649  O  OG    . SER H  4 75  ? -17.746 -16.287 22.716  1.00 58.05  ? 75   SER H OG    1 
ATOM   5650  N  N     . ARG H  4 76  ? -20.643 -15.166 24.898  1.00 58.33  ? 76   ARG H N     1 
ATOM   5651  C  CA    . ARG H  4 76  ? -21.994 -15.646 25.156  1.00 59.34  ? 76   ARG H CA    1 
ATOM   5652  C  C     . ARG H  4 76  ? -23.035 -14.663 24.662  1.00 60.14  ? 76   ARG H C     1 
ATOM   5653  O  O     . ARG H  4 76  ? -23.947 -15.058 23.931  1.00 60.55  ? 76   ARG H O     1 
ATOM   5654  C  CB    . ARG H  4 76  ? -22.196 -15.943 26.645  1.00 59.20  ? 76   ARG H CB    1 
ATOM   5655  C  CG    . ARG H  4 76  ? -21.387 -17.136 27.085  1.00 59.78  ? 76   ARG H CG    1 
ATOM   5656  C  CD    . ARG H  4 76  ? -21.364 -17.378 28.593  1.00 60.09  ? 76   ARG H CD    1 
ATOM   5657  N  NE    . ARG H  4 76  ? -20.045 -17.924 28.900  1.00 59.79  ? 76   ARG H NE    1 
ATOM   5658  C  CZ    . ARG H  4 76  ? -19.177 -17.387 29.749  1.00 60.76  ? 76   ARG H CZ    1 
ATOM   5659  N  NH1   . ARG H  4 76  ? -19.498 -16.308 30.457  1.00 62.55  ? 76   ARG H NH1   1 
ATOM   5660  N  NH2   . ARG H  4 76  ? -17.986 -17.948 29.915  1.00 61.08  ? 76   ARG H NH2   1 
ATOM   5661  N  N     . LEU H  4 77  ? -22.884 -13.389 25.047  1.00 60.67  ? 77   LEU H N     1 
ATOM   5662  C  CA    . LEU H  4 77  ? -23.799 -12.316 24.642  1.00 60.77  ? 77   LEU H CA    1 
ATOM   5663  C  C     . LEU H  4 77  ? -24.049 -12.257 23.140  1.00 60.98  ? 77   LEU H C     1 
ATOM   5664  O  O     . LEU H  4 77  ? -25.201 -12.157 22.706  1.00 60.67  ? 77   LEU H O     1 
ATOM   5665  C  CB    . LEU H  4 77  ? -23.288 -10.964 25.125  1.00 60.70  ? 77   LEU H CB    1 
ATOM   5666  C  CG    . LEU H  4 77  ? -23.568 -10.613 26.580  1.00 61.66  ? 77   LEU H CG    1 
ATOM   5667  C  CD1   . LEU H  4 77  ? -22.566 -9.572  27.038  1.00 61.82  ? 77   LEU H CD1   1 
ATOM   5668  C  CD2   . LEU H  4 77  ? -25.009 -10.111 26.773  1.00 61.16  ? 77   LEU H CD2   1 
ATOM   5669  N  N     . ALA H  4 78  ? -22.979 -12.310 22.353  1.00 61.89  ? 78   ALA H N     1 
ATOM   5670  C  CA    . ALA H  4 78  ? -23.110 -12.345 20.899  1.00 63.54  ? 78   ALA H CA    1 
ATOM   5671  C  C     . ALA H  4 78  ? -23.874 -13.600 20.463  1.00 64.97  ? 78   ALA H C     1 
ATOM   5672  O  O     . ALA H  4 78  ? -24.797 -13.516 19.643  1.00 65.53  ? 78   ALA H O     1 
ATOM   5673  C  CB    . ALA H  4 78  ? -21.755 -12.271 20.228  1.00 62.89  ? 78   ALA H CB    1 
ATOM   5674  N  N     . HIS H  4 79  ? -23.519 -14.754 21.032  1.00 66.36  ? 79   HIS H N     1 
ATOM   5675  C  CA    . HIS H  4 79  ? -24.229 -15.988 20.717  1.00 67.90  ? 79   HIS H CA    1 
ATOM   5676  C  C     . HIS H  4 79  ? -25.702 -15.831 21.080  1.00 68.67  ? 79   HIS H C     1 
ATOM   5677  O  O     . HIS H  4 79  ? -26.551 -15.962 20.216  1.00 68.86  ? 79   HIS H O     1 
ATOM   5678  C  CB    . HIS H  4 79  ? -23.601 -17.231 21.384  1.00 67.86  ? 79   HIS H CB    1 
ATOM   5679  C  CG    . HIS H  4 79  ? -22.282 -17.642 20.794  1.00 68.60  ? 79   HIS H CG    1 
ATOM   5680  N  ND1   . HIS H  4 79  ? -21.262 -18.186 21.551  1.00 69.38  ? 79   HIS H ND1   1 
ATOM   5681  C  CD2   . HIS H  4 79  ? -21.814 -17.589 19.522  1.00 69.27  ? 79   HIS H CD2   1 
ATOM   5682  C  CE1   . HIS H  4 79  ? -20.225 -18.445 20.773  1.00 69.59  ? 79   HIS H CE1   1 
ATOM   5683  N  NE2   . HIS H  4 79  ? -20.535 -18.093 19.537  1.00 69.68  ? 79   HIS H NE2   1 
ATOM   5684  N  N     . TYR H  4 80  ? -25.997 -15.505 22.335  1.00 69.91  ? 80   TYR H N     1 
ATOM   5685  C  CA    . TYR H  4 80  ? -27.383 -15.373 22.782  1.00 71.85  ? 80   TYR H CA    1 
ATOM   5686  C  C     . TYR H  4 80  ? -28.224 -14.530 21.834  1.00 72.34  ? 80   TYR H C     1 
ATOM   5687  O  O     . TYR H  4 80  ? -29.426 -14.752 21.725  1.00 72.22  ? 80   TYR H O     1 
ATOM   5688  C  CB    . TYR H  4 80  ? -27.476 -14.736 24.174  1.00 72.88  ? 80   TYR H CB    1 
ATOM   5689  C  CG    . TYR H  4 80  ? -26.839 -15.503 25.319  1.00 74.94  ? 80   TYR H CG    1 
ATOM   5690  C  CD1   . TYR H  4 80  ? -26.447 -16.849 25.186  1.00 76.55  ? 80   TYR H CD1   1 
ATOM   5691  C  CD2   . TYR H  4 80  ? -26.666 -14.889 26.558  1.00 75.42  ? 80   TYR H CD2   1 
ATOM   5692  C  CE1   . TYR H  4 80  ? -25.869 -17.534 26.255  1.00 76.20  ? 80   TYR H CE1   1 
ATOM   5693  C  CE2   . TYR H  4 80  ? -26.103 -15.562 27.626  1.00 75.46  ? 80   TYR H CE2   1 
ATOM   5694  C  CZ    . TYR H  4 80  ? -25.703 -16.876 27.478  1.00 75.81  ? 80   TYR H CZ    1 
ATOM   5695  O  OH    . TYR H  4 80  ? -25.140 -17.527 28.563  1.00 76.24  ? 80   TYR H OH    1 
ATOM   5696  N  N     . ASN H  4 81  ? -27.577 -13.570 21.163  1.00 72.98  ? 81   ASN H N     1 
ATOM   5697  C  CA    . ASN H  4 81  ? -28.245 -12.602 20.283  1.00 73.28  ? 81   ASN H CA    1 
ATOM   5698  C  C     . ASN H  4 81  ? -27.946 -12.814 18.803  1.00 73.29  ? 81   ASN H C     1 
ATOM   5699  O  O     . ASN H  4 81  ? -27.999 -11.875 18.004  1.00 73.11  ? 81   ASN H O     1 
ATOM   5700  C  CB    . ASN H  4 81  ? -27.872 -11.170 20.691  1.00 73.28  ? 81   ASN H CB    1 
ATOM   5701  C  CG    . ASN H  4 81  ? -28.368 -10.820 22.072  1.00 73.87  ? 81   ASN H CG    1 
ATOM   5702  O  OD1   . ASN H  4 81  ? -29.578 -10.719 22.309  1.00 73.99  ? 81   ASN H OD1   1 
ATOM   5703  N  ND2   . ASN H  4 81  ? -27.438 -10.651 23.004  1.00 73.93  ? 81   ASN H ND2   1 
ATOM   5704  N  N     . LYS H  4 82  ? -27.632 -14.055 18.453  1.00 73.49  ? 82   LYS H N     1 
ATOM   5705  C  CA    . LYS H  4 82  ? -27.364 -14.455 17.067  1.00 73.86  ? 82   LYS H CA    1 
ATOM   5706  C  C     . LYS H  4 82  ? -26.426 -13.514 16.302  1.00 73.36  ? 82   LYS H C     1 
ATOM   5707  O  O     . LYS H  4 82  ? -26.677 -13.196 15.145  1.00 73.80  ? 82   LYS H O     1 
ATOM   5708  C  CB    . LYS H  4 82  ? -28.676 -14.685 16.282  1.00 73.97  ? 82   LYS H CB    1 
ATOM   5709  C  CG    . LYS H  4 82  ? -29.557 -15.821 16.821  1.00 75.69  ? 82   LYS H CG    1 
ATOM   5710  C  CD    . LYS H  4 82  ? -30.865 -15.291 17.425  1.00 78.11  ? 82   LYS H CD    1 
ATOM   5711  C  CE    . LYS H  4 82  ? -32.038 -15.359 16.410  1.00 79.31  ? 82   LYS H CE    1 
ATOM   5712  N  NZ    . LYS H  4 82  ? -33.299 -14.664 16.877  1.00 78.33  ? 82   LYS H NZ    1 
ATOM   5713  N  N     . ARG H  4 83  ? -25.341 -13.084 16.934  1.00 72.70  ? 83   ARG H N     1 
ATOM   5714  C  CA    . ARG H  4 83  ? -24.393 -12.192 16.269  1.00 72.63  ? 83   ARG H CA    1 
ATOM   5715  C  C     . ARG H  4 83  ? -23.064 -12.880 16.005  1.00 71.98  ? 83   ARG H C     1 
ATOM   5716  O  O     . ARG H  4 83  ? -22.671 -13.754 16.768  1.00 72.50  ? 83   ARG H O     1 
ATOM   5717  C  CB    . ARG H  4 83  ? -24.182 -10.933 17.111  1.00 73.05  ? 83   ARG H CB    1 
ATOM   5718  C  CG    . ARG H  4 83  ? -24.819 -9.649  16.584  1.00 74.62  ? 83   ARG H CG    1 
ATOM   5719  C  CD    . ARG H  4 83  ? -26.143 -9.843  15.850  1.00 78.87  ? 83   ARG H CD    1 
ATOM   5720  N  NE    . ARG H  4 83  ? -26.669 -8.552  15.404  1.00 82.30  ? 83   ARG H NE    1 
ATOM   5721  C  CZ    . ARG H  4 83  ? -27.692 -7.915  15.974  1.00 83.74  ? 83   ARG H CZ    1 
ATOM   5722  N  NH1   . ARG H  4 83  ? -28.338 -8.457  17.005  1.00 84.05  ? 83   ARG H NH1   1 
ATOM   5723  N  NH2   . ARG H  4 83  ? -28.079 -6.735  15.501  1.00 85.12  ? 83   ARG H NH2   1 
ATOM   5724  N  N     . SER H  4 84  ? -22.380 -12.484 14.933  1.00 71.01  ? 84   SER H N     1 
ATOM   5725  C  CA    . SER H  4 84  ? -21.118 -13.098 14.520  1.00 70.31  ? 84   SER H CA    1 
ATOM   5726  C  C     . SER H  4 84  ? -19.929 -12.349 15.073  1.00 69.73  ? 84   SER H C     1 
ATOM   5727  O  O     . SER H  4 84  ? -18.778 -12.742 14.837  1.00 70.03  ? 84   SER H O     1 
ATOM   5728  C  CB    . SER H  4 84  ? -20.966 -13.070 12.998  1.00 70.34  ? 84   SER H CB    1 
ATOM   5729  O  OG    . SER H  4 84  ? -22.216 -13.166 12.348  1.00 71.76  ? 84   SER H OG    1 
ATOM   5730  N  N     . THR H  4 85  ? -20.190 -11.255 15.780  1.00 68.76  ? 85   THR H N     1 
ATOM   5731  C  CA    . THR H  4 85  ? -19.119 -10.296 16.075  1.00 67.50  ? 85   THR H CA    1 
ATOM   5732  C  C     . THR H  4 85  ? -19.133 -9.749  17.498  1.00 66.14  ? 85   THR H C     1 
ATOM   5733  O  O     . THR H  4 85  ? -20.183 -9.437  18.040  1.00 66.15  ? 85   THR H O     1 
ATOM   5734  C  CB    . THR H  4 85  ? -19.108 -9.148  15.023  1.00 67.81  ? 85   THR H CB    1 
ATOM   5735  O  OG1   . THR H  4 85  ? -18.550 -7.950  15.583  1.00 68.51  ? 85   THR H OG1   1 
ATOM   5736  C  CG2   . THR H  4 85  ? -20.510 -8.855  14.541  1.00 67.47  ? 85   THR H CG2   1 
ATOM   5737  N  N     . ILE H  4 86  ? -17.956 -9.662  18.103  1.00 64.84  ? 86   ILE H N     1 
ATOM   5738  C  CA    . ILE H  4 86  ? -17.823 -9.026  19.414  1.00 63.88  ? 86   ILE H CA    1 
ATOM   5739  C  C     . ILE H  4 86  ? -17.467 -7.550  19.248  1.00 62.76  ? 86   ILE H C     1 
ATOM   5740  O  O     . ILE H  4 86  ? -16.410 -7.198  18.719  1.00 62.47  ? 86   ILE H O     1 
ATOM   5741  C  CB    . ILE H  4 86  ? -16.793 -9.760  20.323  1.00 64.11  ? 86   ILE H CB    1 
ATOM   5742  C  CG1   . ILE H  4 86  ? -17.243 -11.203 20.551  1.00 64.61  ? 86   ILE H CG1   1 
ATOM   5743  C  CG2   . ILE H  4 86  ? -16.626 -9.051  21.684  1.00 63.01  ? 86   ILE H CG2   1 
ATOM   5744  C  CD1   . ILE H  4 86  ? -16.138 -12.090 20.970  1.00 66.01  ? 86   ILE H CD1   1 
ATOM   5745  N  N     . THR H  4 87  ? -18.377 -6.699  19.690  1.00 61.48  ? 87   THR H N     1 
ATOM   5746  C  CA    . THR H  4 87  ? -18.184 -5.265  19.611  1.00 60.91  ? 87   THR H CA    1 
ATOM   5747  C  C     . THR H  4 87  ? -17.972 -4.714  21.013  1.00 60.35  ? 87   THR H C     1 
ATOM   5748  O  O     . THR H  4 87  ? -18.212 -5.400  22.023  1.00 60.82  ? 87   THR H O     1 
ATOM   5749  C  CB    . THR H  4 87  ? -19.419 -4.554  19.033  1.00 60.76  ? 87   THR H CB    1 
ATOM   5750  O  OG1   . THR H  4 87  ? -20.471 -4.611  20.002  1.00 62.04  ? 87   THR H OG1   1 
ATOM   5751  C  CG2   . THR H  4 87  ? -19.900 -5.218  17.746  1.00 59.90  ? 87   THR H CG2   1 
ATOM   5752  N  N     . SER H  4 88  ? -17.566 -3.456  21.075  1.00 59.19  ? 88   SER H N     1 
ATOM   5753  C  CA    . SER H  4 88  ? -17.402 -2.792  22.346  1.00 58.13  ? 88   SER H CA    1 
ATOM   5754  C  C     . SER H  4 88  ? -18.692 -2.807  23.145  1.00 57.29  ? 88   SER H C     1 
ATOM   5755  O  O     . SER H  4 88  ? -18.673 -2.673  24.359  1.00 57.82  ? 88   SER H O     1 
ATOM   5756  C  CB    . SER H  4 88  ? -16.925 -1.366  22.126  1.00 58.20  ? 88   SER H CB    1 
ATOM   5757  O  OG    . SER H  4 88  ? -17.916 -0.645  21.452  1.00 58.81  ? 88   SER H OG    1 
ATOM   5758  N  N     . ARG H  4 89  ? -19.818 -2.995  22.481  1.00 56.20  ? 89   ARG H N     1 
ATOM   5759  C  CA    . ARG H  4 89  ? -21.067 -3.101  23.206  1.00 55.95  ? 89   ARG H CA    1 
ATOM   5760  C  C     . ARG H  4 89  ? -21.109 -4.357  24.104  1.00 55.61  ? 89   ARG H C     1 
ATOM   5761  O  O     . ARG H  4 89  ? -21.427 -4.260  25.292  1.00 55.13  ? 89   ARG H O     1 
ATOM   5762  C  CB    . ARG H  4 89  ? -22.228 -3.061  22.231  1.00 56.05  ? 89   ARG H CB    1 
ATOM   5763  C  CG    . ARG H  4 89  ? -23.502 -2.611  22.837  1.00 58.44  ? 89   ARG H CG    1 
ATOM   5764  C  CD    . ARG H  4 89  ? -24.575 -2.497  21.750  1.00 64.03  ? 89   ARG H CD    1 
ATOM   5765  N  NE    . ARG H  4 89  ? -25.840 -2.015  22.308  1.00 67.19  ? 89   ARG H NE    1 
ATOM   5766  C  CZ    . ARG H  4 89  ? -26.704 -2.777  22.970  1.00 67.03  ? 89   ARG H CZ    1 
ATOM   5767  N  NH1   . ARG H  4 89  ? -26.448 -4.064  23.147  1.00 67.00  ? 89   ARG H NH1   1 
ATOM   5768  N  NH2   . ARG H  4 89  ? -27.823 -2.250  23.452  1.00 67.43  ? 89   ARG H NH2   1 
ATOM   5769  N  N     . GLU H  4 90  ? -20.751 -5.521  23.543  1.00 55.17  ? 90   GLU H N     1 
ATOM   5770  C  CA    . GLU H  4 90  ? -20.644 -6.757  24.321  1.00 54.58  ? 90   GLU H CA    1 
ATOM   5771  C  C     . GLU H  4 90  ? -19.640 -6.604  25.441  1.00 53.45  ? 90   GLU H C     1 
ATOM   5772  O  O     . GLU H  4 90  ? -19.891 -7.075  26.559  1.00 53.30  ? 90   GLU H O     1 
ATOM   5773  C  CB    . GLU H  4 90  ? -20.238 -7.971  23.467  1.00 55.50  ? 90   GLU H CB    1 
ATOM   5774  C  CG    . GLU H  4 90  ? -21.327 -8.520  22.572  1.00 57.72  ? 90   GLU H CG    1 
ATOM   5775  C  CD    . GLU H  4 90  ? -21.728 -7.510  21.532  1.00 63.68  ? 90   GLU H CD    1 
ATOM   5776  O  OE1   . GLU H  4 90  ? -20.834 -7.069  20.770  1.00 64.77  ? 90   GLU H OE1   1 
ATOM   5777  O  OE2   . GLU H  4 90  ? -22.925 -7.123  21.510  1.00 66.66  ? 90   GLU H OE2   1 
ATOM   5778  N  N     . ILE H  4 91  ? -18.512 -5.949  25.164  1.00 51.84  ? 91   ILE H N     1 
ATOM   5779  C  CA    . ILE H  4 91  ? -17.534 -5.770  26.224  1.00 50.83  ? 91   ILE H CA    1 
ATOM   5780  C  C     . ILE H  4 91  ? -18.156 -4.993  27.371  1.00 51.10  ? 91   ILE H C     1 
ATOM   5781  O  O     . ILE H  4 91  ? -17.910 -5.279  28.554  1.00 50.68  ? 91   ILE H O     1 
ATOM   5782  C  CB    . ILE H  4 91  ? -16.259 -5.067  25.759  1.00 50.64  ? 91   ILE H CB    1 
ATOM   5783  C  CG1   . ILE H  4 91  ? -15.638 -5.790  24.554  1.00 49.77  ? 91   ILE H CG1   1 
ATOM   5784  C  CG2   . ILE H  4 91  ? -15.290 -4.928  26.912  1.00 47.98  ? 91   ILE H CG2   1 
ATOM   5785  C  CD1   . ILE H  4 91  ? -15.204 -7.196  24.786  1.00 47.08  ? 91   ILE H CD1   1 
ATOM   5786  N  N     . GLN H  4 92  ? -18.988 -4.026  27.009  1.00 51.19  ? 92   GLN H N     1 
ATOM   5787  C  CA    . GLN H  4 92  ? -19.553 -3.119  27.986  1.00 51.53  ? 92   GLN H CA    1 
ATOM   5788  C  C     . GLN H  4 92  ? -20.518 -3.821  28.865  1.00 51.06  ? 92   GLN H C     1 
ATOM   5789  O  O     . GLN H  4 92  ? -20.481 -3.653  30.079  1.00 51.07  ? 92   GLN H O     1 
ATOM   5790  C  CB    . GLN H  4 92  ? -20.270 -1.950  27.321  1.00 52.15  ? 92   GLN H CB    1 
ATOM   5791  C  CG    . GLN H  4 92  ? -20.985 -1.057  28.321  1.00 52.86  ? 92   GLN H CG    1 
ATOM   5792  C  CD    . GLN H  4 92  ? -21.117 0.359   27.828  1.00 54.58  ? 92   GLN H CD    1 
ATOM   5793  O  OE1   . GLN H  4 92  ? -22.220 0.885   27.734  1.00 56.29  ? 92   GLN H OE1   1 
ATOM   5794  N  NE2   . GLN H  4 92  ? -19.993 0.983   27.499  1.00 53.89  ? 92   GLN H NE2   1 
ATOM   5795  N  N     . THR H  4 93  ? -21.409 -4.598  28.271  1.00 51.09  ? 93   THR H N     1 
ATOM   5796  C  CA    . THR H  4 93  ? -22.362 -5.292  29.126  1.00 51.37  ? 93   THR H CA    1 
ATOM   5797  C  C     . THR H  4 93  ? -21.722 -6.494  29.839  1.00 50.56  ? 93   THR H C     1 
ATOM   5798  O  O     . THR H  4 93  ? -22.083 -6.796  30.986  1.00 49.71  ? 93   THR H O     1 
ATOM   5799  C  CB    . THR H  4 93  ? -23.738 -5.538  28.474  1.00 51.51  ? 93   THR H CB    1 
ATOM   5800  O  OG1   . THR H  4 93  ? -24.181 -6.861  28.784  1.00 54.53  ? 93   THR H OG1   1 
ATOM   5801  C  CG2   . THR H  4 93  ? -23.669 -5.382  27.005  1.00 51.67  ? 93   THR H CG2   1 
ATOM   5802  N  N     . ALA H  4 94  ? -20.722 -7.116  29.206  1.00 50.20  ? 94   ALA H N     1 
ATOM   5803  C  CA    . ALA H  4 94  ? -19.867 -8.079  29.934  1.00 50.13  ? 94   ALA H CA    1 
ATOM   5804  C  C     . ALA H  4 94  ? -19.282 -7.450  31.197  1.00 50.21  ? 94   ALA H C     1 
ATOM   5805  O  O     . ALA H  4 94  ? -19.322 -8.052  32.261  1.00 51.27  ? 94   ALA H O     1 
ATOM   5806  C  CB    . ALA H  4 94  ? -18.761 -8.614  29.064  1.00 50.02  ? 94   ALA H CB    1 
ATOM   5807  N  N     . VAL H  4 95  ? -18.744 -6.239  31.078  1.00 50.29  ? 95   VAL H N     1 
ATOM   5808  C  CA    . VAL H  4 95  ? -18.158 -5.506  32.211  1.00 49.73  ? 95   VAL H CA    1 
ATOM   5809  C  C     . VAL H  4 95  ? -19.211 -5.256  33.283  1.00 50.27  ? 95   VAL H C     1 
ATOM   5810  O  O     . VAL H  4 95  ? -18.973 -5.483  34.474  1.00 50.04  ? 95   VAL H O     1 
ATOM   5811  C  CB    . VAL H  4 95  ? -17.486 -4.172  31.736  1.00 49.34  ? 95   VAL H CB    1 
ATOM   5812  C  CG1   . VAL H  4 95  ? -17.284 -3.190  32.873  1.00 47.74  ? 95   VAL H CG1   1 
ATOM   5813  C  CG2   . VAL H  4 95  ? -16.152 -4.463  31.047  1.00 49.13  ? 95   VAL H CG2   1 
ATOM   5814  N  N     . ARG H  4 96  ? -20.388 -4.811  32.859  1.00 50.97  ? 96   ARG H N     1 
ATOM   5815  C  CA    . ARG H  4 96  ? -21.441 -4.519  33.813  1.00 52.11  ? 96   ARG H CA    1 
ATOM   5816  C  C     . ARG H  4 96  ? -21.838 -5.755  34.586  1.00 51.95  ? 96   ARG H C     1 
ATOM   5817  O  O     . ARG H  4 96  ? -22.214 -5.659  35.737  1.00 52.16  ? 96   ARG H O     1 
ATOM   5818  C  CB    . ARG H  4 96  ? -22.659 -3.896  33.130  1.00 52.71  ? 96   ARG H CB    1 
ATOM   5819  C  CG    . ARG H  4 96  ? -22.468 -2.432  32.720  1.00 55.51  ? 96   ARG H CG    1 
ATOM   5820  C  CD    . ARG H  4 96  ? -23.804 -1.732  32.479  1.00 60.08  ? 96   ARG H CD    1 
ATOM   5821  N  NE    . ARG H  4 96  ? -23.638 -0.284  32.353  1.00 63.85  ? 96   ARG H NE    1 
ATOM   5822  C  CZ    . ARG H  4 96  ? -23.611 0.388   31.197  1.00 66.70  ? 96   ARG H CZ    1 
ATOM   5823  N  NH1   . ARG H  4 96  ? -23.753 -0.238  30.028  1.00 65.91  ? 96   ARG H NH1   1 
ATOM   5824  N  NH2   . ARG H  4 96  ? -23.450 1.710   31.209  1.00 68.76  ? 96   ARG H NH2   1 
ATOM   5825  N  N     . LEU H  4 97  ? -21.738 -6.920  33.955  1.00 52.73  ? 97   LEU H N     1 
ATOM   5826  C  CA    . LEU H  4 97  ? -22.139 -8.180  34.591  1.00 53.05  ? 97   LEU H CA    1 
ATOM   5827  C  C     . LEU H  4 97  ? -21.075 -8.737  35.525  1.00 53.98  ? 97   LEU H C     1 
ATOM   5828  O  O     . LEU H  4 97  ? -21.389 -9.280  36.588  1.00 54.78  ? 97   LEU H O     1 
ATOM   5829  C  CB    . LEU H  4 97  ? -22.495 -9.226  33.543  1.00 52.60  ? 97   LEU H CB    1 
ATOM   5830  C  CG    . LEU H  4 97  ? -23.810 -9.071  32.789  1.00 51.40  ? 97   LEU H CG    1 
ATOM   5831  C  CD1   . LEU H  4 97  ? -23.738 -9.826  31.494  1.00 50.33  ? 97   LEU H CD1   1 
ATOM   5832  C  CD2   . LEU H  4 97  ? -24.990 -9.543  33.625  1.00 51.76  ? 97   LEU H CD2   1 
ATOM   5833  N  N     . LEU H  4 98  ? -19.817 -8.567  35.143  1.00 54.38  ? 98   LEU H N     1 
ATOM   5834  C  CA    . LEU H  4 98  ? -18.705 -9.137  35.887  1.00 54.88  ? 98   LEU H CA    1 
ATOM   5835  C  C     . LEU H  4 98  ? -18.171 -8.317  37.047  1.00 54.89  ? 98   LEU H C     1 
ATOM   5836  O  O     . LEU H  4 98  ? -17.811 -8.873  38.078  1.00 55.33  ? 98   LEU H O     1 
ATOM   5837  C  CB    . LEU H  4 98  ? -17.568 -9.468  34.920  1.00 54.86  ? 98   LEU H CB    1 
ATOM   5838  C  CG    . LEU H  4 98  ? -17.970 -10.701 34.111  1.00 55.98  ? 98   LEU H CG    1 
ATOM   5839  C  CD1   . LEU H  4 98  ? -17.299 -10.729 32.762  1.00 56.96  ? 98   LEU H CD1   1 
ATOM   5840  C  CD2   . LEU H  4 98  ? -17.712 -11.973 34.915  1.00 54.35  ? 98   LEU H CD2   1 
ATOM   5841  N  N     . LEU H  4 99  ? -18.092 -6.999  36.876  1.00 55.13  ? 99   LEU H N     1 
ATOM   5842  C  CA    . LEU H  4 99  ? -17.465 -6.157  37.886  1.00 54.77  ? 99   LEU H CA    1 
ATOM   5843  C  C     . LEU H  4 99  ? -18.509 -5.682  38.872  1.00 54.65  ? 99   LEU H C     1 
ATOM   5844  O  O     . LEU H  4 99  ? -19.621 -5.389  38.488  1.00 54.96  ? 99   LEU H O     1 
ATOM   5845  C  CB    . LEU H  4 99  ? -16.706 -4.989  37.253  1.00 54.46  ? 99   LEU H CB    1 
ATOM   5846  C  CG    . LEU H  4 99  ? -15.664 -5.325  36.178  1.00 54.95  ? 99   LEU H CG    1 
ATOM   5847  C  CD1   . LEU H  4 99  ? -14.805 -4.120  35.792  1.00 54.32  ? 99   LEU H CD1   1 
ATOM   5848  C  CD2   . LEU H  4 99  ? -14.762 -6.447  36.628  1.00 57.89  ? 99   LEU H CD2   1 
ATOM   5849  N  N     . PRO H  4 100 ? -18.165 -5.657  40.159  1.00 54.91  ? 100  PRO H N     1 
ATOM   5850  C  CA    . PRO H  4 100 ? -19.079 -5.116  41.147  1.00 55.31  ? 100  PRO H CA    1 
ATOM   5851  C  C     . PRO H  4 100 ? -19.217 -3.586  41.054  1.00 56.16  ? 100  PRO H C     1 
ATOM   5852  O  O     . PRO H  4 100 ? -18.272 -2.895  40.676  1.00 56.29  ? 100  PRO H O     1 
ATOM   5853  C  CB    . PRO H  4 100 ? -18.462 -5.547  42.475  1.00 55.16  ? 100  PRO H CB    1 
ATOM   5854  C  CG    . PRO H  4 100 ? -17.022 -5.757  42.183  1.00 55.26  ? 100  PRO H CG    1 
ATOM   5855  C  CD    . PRO H  4 100 ? -16.911 -6.157  40.756  1.00 55.20  ? 100  PRO H CD    1 
ATOM   5856  N  N     . GLY H  4 101 ? -20.405 -3.103  41.420  1.00 56.74  ? 101  GLY H N     1 
ATOM   5857  C  CA    . GLY H  4 101 ? -20.882 -1.728  41.219  1.00 57.56  ? 101  GLY H CA    1 
ATOM   5858  C  C     . GLY H  4 101 ? -19.978 -0.575  40.828  1.00 57.95  ? 101  GLY H C     1 
ATOM   5859  O  O     . GLY H  4 101 ? -20.070 -0.052  39.708  1.00 57.63  ? 101  GLY H O     1 
ATOM   5860  N  N     . GLU H  4 102 ? -19.127 -0.145  41.750  1.00 58.43  ? 102  GLU H N     1 
ATOM   5861  C  CA    . GLU H  4 102 ? -18.353 1.074   41.506  1.00 59.04  ? 102  GLU H CA    1 
ATOM   5862  C  C     . GLU H  4 102 ? -17.307 0.860   40.436  1.00 58.42  ? 102  GLU H C     1 
ATOM   5863  O  O     . GLU H  4 102 ? -17.044 1.741   39.596  1.00 58.68  ? 102  GLU H O     1 
ATOM   5864  C  CB    . GLU H  4 102 ? -17.686 1.548   42.789  1.00 59.36  ? 102  GLU H CB    1 
ATOM   5865  C  CG    . GLU H  4 102 ? -17.456 3.018   42.841  1.00 62.75  ? 102  GLU H CG    1 
ATOM   5866  C  CD    . GLU H  4 102 ? -18.765 3.806   43.006  1.00 68.08  ? 102  GLU H CD    1 
ATOM   5867  O  OE1   . GLU H  4 102 ? -19.513 4.000   42.001  1.00 68.23  ? 102  GLU H OE1   1 
ATOM   5868  O  OE2   . GLU H  4 102 ? -19.027 4.245   44.154  1.00 70.04  ? 102  GLU H OE2   1 
ATOM   5869  N  N     . LEU H  4 103 ? -16.727 -0.333  40.480  1.00 57.75  ? 103  LEU H N     1 
ATOM   5870  C  CA    . LEU H  4 103 ? -15.668 -0.753  39.592  1.00 57.51  ? 103  LEU H CA    1 
ATOM   5871  C  C     . LEU H  4 103 ? -16.227 -0.871  38.176  1.00 57.63  ? 103  LEU H C     1 
ATOM   5872  O  O     . LEU H  4 103 ? -15.536 -0.562  37.199  1.00 57.44  ? 103  LEU H O     1 
ATOM   5873  C  CB    . LEU H  4 103 ? -15.145 -2.093  40.092  1.00 56.99  ? 103  LEU H CB    1 
ATOM   5874  C  CG    . LEU H  4 103 ? -13.670 -2.431  40.296  1.00 56.91  ? 103  LEU H CG    1 
ATOM   5875  C  CD1   . LEU H  4 103 ? -12.805 -1.301  40.822  1.00 55.23  ? 103  LEU H CD1   1 
ATOM   5876  C  CD2   . LEU H  4 103 ? -13.578 -3.646  41.225  1.00 57.67  ? 103  LEU H CD2   1 
ATOM   5877  N  N     . ALA H  4 104 ? -17.490 -1.288  38.067  1.00 57.82  ? 104  ALA H N     1 
ATOM   5878  C  CA    . ALA H  4 104 ? -18.174 -1.311  36.777  1.00 58.14  ? 104  ALA H CA    1 
ATOM   5879  C  C     . ALA H  4 104 ? -18.421 0.096   36.261  1.00 58.47  ? 104  ALA H C     1 
ATOM   5880  O  O     . ALA H  4 104 ? -18.180 0.378   35.088  1.00 59.31  ? 104  ALA H O     1 
ATOM   5881  C  CB    . ALA H  4 104 ? -19.463 -2.081  36.859  1.00 58.17  ? 104  ALA H CB    1 
ATOM   5882  N  N     . LYS H  4 105 ? -18.874 0.997   37.126  1.00 58.62  ? 105  LYS H N     1 
ATOM   5883  C  CA    . LYS H  4 105 ? -19.059 2.388   36.716  1.00 58.32  ? 105  LYS H CA    1 
ATOM   5884  C  C     . LYS H  4 105 ? -17.779 2.990   36.123  1.00 57.47  ? 105  LYS H C     1 
ATOM   5885  O  O     . LYS H  4 105 ? -17.794 3.426   34.975  1.00 57.40  ? 105  LYS H O     1 
ATOM   5886  C  CB    . LYS H  4 105 ? -19.578 3.244   37.869  1.00 59.14  ? 105  LYS H CB    1 
ATOM   5887  C  CG    . LYS H  4 105 ? -19.713 4.741   37.510  1.00 62.51  ? 105  LYS H CG    1 
ATOM   5888  C  CD    . LYS H  4 105 ? -19.505 5.665   38.717  1.00 67.59  ? 105  LYS H CD    1 
ATOM   5889  C  CE    . LYS H  4 105 ? -20.811 5.909   39.476  1.00 70.90  ? 105  LYS H CE    1 
ATOM   5890  N  NZ    . LYS H  4 105 ? -20.556 6.633   40.769  1.00 74.33  ? 105  LYS H NZ    1 
ATOM   5891  N  N     . HIS H  4 106 ? -16.673 2.999   36.869  1.00 56.18  ? 106  HIS H N     1 
ATOM   5892  C  CA    . HIS H  4 106 ? -15.467 3.630   36.334  1.00 55.57  ? 106  HIS H CA    1 
ATOM   5893  C  C     . HIS H  4 106 ? -14.870 2.972   35.102  1.00 54.94  ? 106  HIS H C     1 
ATOM   5894  O  O     . HIS H  4 106 ? -14.440 3.661   34.187  1.00 54.89  ? 106  HIS H O     1 
ATOM   5895  C  CB    . HIS H  4 106 ? -14.401 3.833   37.400  1.00 55.96  ? 106  HIS H CB    1 
ATOM   5896  C  CG    . HIS H  4 106 ? -14.895 4.563   38.608  1.00 56.93  ? 106  HIS H CG    1 
ATOM   5897  N  ND1   . HIS H  4 106 ? -14.321 4.413   39.852  1.00 57.39  ? 106  HIS H ND1   1 
ATOM   5898  C  CD2   . HIS H  4 106 ? -15.929 5.423   38.769  1.00 56.52  ? 106  HIS H CD2   1 
ATOM   5899  C  CE1   . HIS H  4 106 ? -14.977 5.157   40.726  1.00 57.52  ? 106  HIS H CE1   1 
ATOM   5900  N  NE2   . HIS H  4 106 ? -15.960 5.772   40.094  1.00 57.21  ? 106  HIS H NE2   1 
ATOM   5901  N  N     . ALA H  4 107 ? -14.860 1.645   35.073  1.00 55.02  ? 107  ALA H N     1 
ATOM   5902  C  CA    . ALA H  4 107 ? -14.340 0.888   33.930  1.00 54.43  ? 107  ALA H CA    1 
ATOM   5903  C  C     . ALA H  4 107 ? -15.184 1.129   32.696  1.00 53.70  ? 107  ALA H C     1 
ATOM   5904  O  O     . ALA H  4 107 ? -14.645 1.370   31.635  1.00 53.09  ? 107  ALA H O     1 
ATOM   5905  C  CB    . ALA H  4 107 ? -14.257 -0.604  34.247  1.00 54.67  ? 107  ALA H CB    1 
ATOM   5906  N  N     . VAL H  4 108 ? -16.505 1.083   32.845  1.00 53.77  ? 108  VAL H N     1 
ATOM   5907  C  CA    . VAL H  4 108 ? -17.414 1.504   31.773  1.00 53.94  ? 108  VAL H CA    1 
ATOM   5908  C  C     . VAL H  4 108 ? -17.072 2.909   31.244  1.00 54.83  ? 108  VAL H C     1 
ATOM   5909  O  O     . VAL H  4 108 ? -16.972 3.120   30.031  1.00 55.06  ? 108  VAL H O     1 
ATOM   5910  C  CB    . VAL H  4 108 ? -18.858 1.501   32.251  1.00 54.01  ? 108  VAL H CB    1 
ATOM   5911  C  CG1   . VAL H  4 108 ? -19.764 2.194   31.235  1.00 52.79  ? 108  VAL H CG1   1 
ATOM   5912  C  CG2   . VAL H  4 108 ? -19.321 0.068   32.565  1.00 52.61  ? 108  VAL H CG2   1 
ATOM   5913  N  N     . SER H  4 109 ? -16.870 3.865   32.148  1.00 55.52  ? 109  SER H N     1 
ATOM   5914  C  CA    . SER H  4 109 ? -16.506 5.212   31.725  1.00 56.46  ? 109  SER H CA    1 
ATOM   5915  C  C     . SER H  4 109 ? -15.101 5.317   31.112  1.00 56.96  ? 109  SER H C     1 
ATOM   5916  O  O     . SER H  4 109 ? -14.911 6.050   30.142  1.00 57.08  ? 109  SER H O     1 
ATOM   5917  C  CB    . SER H  4 109 ? -16.743 6.240   32.845  1.00 56.90  ? 109  SER H CB    1 
ATOM   5918  O  OG    . SER H  4 109 ? -15.543 6.671   33.471  1.00 57.25  ? 109  SER H OG    1 
ATOM   5919  N  N     . GLU H  4 110 ? -14.123 4.584   31.645  1.00 57.51  ? 110  GLU H N     1 
ATOM   5920  C  CA    . GLU H  4 110 ? -12.794 4.583   31.022  1.00 58.23  ? 110  GLU H CA    1 
ATOM   5921  C  C     . GLU H  4 110 ? -12.870 3.929   29.658  1.00 58.42  ? 110  GLU H C     1 
ATOM   5922  O  O     . GLU H  4 110 ? -12.145 4.301   28.755  1.00 58.62  ? 110  GLU H O     1 
ATOM   5923  C  CB    . GLU H  4 110 ? -11.728 3.890   31.877  1.00 58.01  ? 110  GLU H CB    1 
ATOM   5924  C  CG    . GLU H  4 110 ? -11.507 4.460   33.282  1.00 61.45  ? 110  GLU H CG    1 
ATOM   5925  C  CD    . GLU H  4 110 ? -11.093 5.947   33.301  1.00 67.58  ? 110  GLU H CD    1 
ATOM   5926  O  OE1   . GLU H  4 110 ? -10.007 6.299   32.740  1.00 67.46  ? 110  GLU H OE1   1 
ATOM   5927  O  OE2   . GLU H  4 110 ? -11.871 6.760   33.885  1.00 67.98  ? 110  GLU H OE2   1 
ATOM   5928  N  N     . GLY H  4 111 ? -13.769 2.962   29.510  1.00 59.22  ? 111  GLY H N     1 
ATOM   5929  C  CA    . GLY H  4 111 ? -13.929 2.237   28.250  1.00 59.89  ? 111  GLY H CA    1 
ATOM   5930  C  C     . GLY H  4 111 ? -14.445 3.125   27.139  1.00 60.64  ? 111  GLY H C     1 
ATOM   5931  O  O     . GLY H  4 111 ? -13.767 3.306   26.126  1.00 60.33  ? 111  GLY H O     1 
ATOM   5932  N  N     . THR H  4 112 ? -15.648 3.678   27.349  1.00 61.34  ? 112  THR H N     1 
ATOM   5933  C  CA    . THR H  4 112 ? -16.325 4.572   26.403  1.00 62.09  ? 112  THR H CA    1 
ATOM   5934  C  C     . THR H  4 112 ? -15.439 5.771   26.050  1.00 62.18  ? 112  THR H C     1 
ATOM   5935  O  O     . THR H  4 112 ? -15.304 6.146   24.886  1.00 62.28  ? 112  THR H O     1 
ATOM   5936  C  CB    . THR H  4 112 ? -17.631 5.097   26.999  1.00 62.25  ? 112  THR H CB    1 
ATOM   5937  O  OG1   . THR H  4 112 ? -17.343 5.704   28.264  1.00 65.70  ? 112  THR H OG1   1 
ATOM   5938  C  CG2   . THR H  4 112 ? -18.611 3.975   27.239  1.00 62.12  ? 112  THR H CG2   1 
ATOM   5939  N  N     . LYS H  4 113 ? -14.801 6.343   27.060  1.00 62.35  ? 113  LYS H N     1 
ATOM   5940  C  CA    . LYS H  4 113 ? -13.878 7.444   26.839  1.00 62.55  ? 113  LYS H CA    1 
ATOM   5941  C  C     . LYS H  4 113 ? -12.736 7.097   25.885  1.00 62.42  ? 113  LYS H C     1 
ATOM   5942  O  O     . LYS H  4 113 ? -12.331 7.940   25.091  1.00 62.85  ? 113  LYS H O     1 
ATOM   5943  C  CB    . LYS H  4 113 ? -13.338 7.971   28.169  1.00 62.52  ? 113  LYS H CB    1 
ATOM   5944  C  CG    . LYS H  4 113 ? -12.307 9.053   28.005  1.00 63.29  ? 113  LYS H CG    1 
ATOM   5945  C  CD    . LYS H  4 113 ? -11.589 9.266   29.291  1.00 66.81  ? 113  LYS H CD    1 
ATOM   5946  C  CE    . LYS H  4 113 ? -10.157 9.657   29.020  1.00 69.62  ? 113  LYS H CE    1 
ATOM   5947  N  NZ    . LYS H  4 113 ? -9.527  10.137  30.296  1.00 73.49  ? 113  LYS H NZ    1 
ATOM   5948  N  N     . ALA H  4 114 ? -12.218 5.872   25.953  1.00 62.59  ? 114  ALA H N     1 
ATOM   5949  C  CA    . ALA H  4 114 ? -11.120 5.472   25.071  1.00 62.54  ? 114  ALA H CA    1 
ATOM   5950  C  C     . ALA H  4 114 ? -11.606 5.190   23.654  1.00 62.90  ? 114  ALA H C     1 
ATOM   5951  O  O     . ALA H  4 114 ? -10.880 5.422   22.697  1.00 62.81  ? 114  ALA H O     1 
ATOM   5952  C  CB    . ALA H  4 114 ? -10.388 4.282   25.624  1.00 62.29  ? 114  ALA H CB    1 
ATOM   5953  N  N     . VAL H  4 115 ? -12.830 4.691   23.519  1.00 63.55  ? 115  VAL H N     1 
ATOM   5954  C  CA    . VAL H  4 115 ? -13.372 4.406   22.195  1.00 64.56  ? 115  VAL H CA    1 
ATOM   5955  C  C     . VAL H  4 115 ? -13.686 5.734   21.515  1.00 65.44  ? 115  VAL H C     1 
ATOM   5956  O  O     . VAL H  4 115 ? -13.273 5.968   20.370  1.00 65.53  ? 115  VAL H O     1 
ATOM   5957  C  CB    . VAL H  4 115 ? -14.615 3.457   22.251  1.00 64.78  ? 115  VAL H CB    1 
ATOM   5958  C  CG1   . VAL H  4 115 ? -15.330 3.377   20.901  1.00 63.44  ? 115  VAL H CG1   1 
ATOM   5959  C  CG2   . VAL H  4 115 ? -14.182 2.070   22.685  1.00 64.38  ? 115  VAL H CG2   1 
ATOM   5960  N  N     . THR H  4 116 ? -14.392 6.602   22.247  1.00 66.05  ? 116  THR H N     1 
ATOM   5961  C  CA    . THR H  4 116 ? -14.640 7.976   21.828  1.00 66.30  ? 116  THR H CA    1 
ATOM   5962  C  C     . THR H  4 116 ? -13.359 8.635   21.320  1.00 66.64  ? 116  THR H C     1 
ATOM   5963  O  O     . THR H  4 116 ? -13.305 9.050   20.169  1.00 66.66  ? 116  THR H O     1 
ATOM   5964  C  CB    . THR H  4 116 ? -15.271 8.789   22.955  1.00 66.35  ? 116  THR H CB    1 
ATOM   5965  O  OG1   . THR H  4 116 ? -16.565 8.248   23.255  1.00 66.27  ? 116  THR H OG1   1 
ATOM   5966  C  CG2   . THR H  4 116 ? -15.453 10.227  22.538  1.00 66.68  ? 116  THR H CG2   1 
ATOM   5967  N  N     . LYS H  4 117 ? -12.318 8.673   22.147  1.00 67.30  ? 117  LYS H N     1 
ATOM   5968  C  CA    . LYS H  4 117 ? -11.033 9.227   21.726  1.00 68.10  ? 117  LYS H CA    1 
ATOM   5969  C  C     . LYS H  4 117 ? -10.465 8.524   20.500  1.00 69.21  ? 117  LYS H C     1 
ATOM   5970  O  O     . LYS H  4 117 ? -9.816  9.144   19.663  1.00 69.54  ? 117  LYS H O     1 
ATOM   5971  C  CB    . LYS H  4 117 ? -10.023 9.181   22.869  1.00 67.91  ? 117  LYS H CB    1 
ATOM   5972  C  CG    . LYS H  4 117 ? -8.635  9.643   22.484  1.00 67.44  ? 117  LYS H CG    1 
ATOM   5973  C  CD    . LYS H  4 117 ? -7.806  10.007  23.711  1.00 69.92  ? 117  LYS H CD    1 
ATOM   5974  C  CE    . LYS H  4 117 ? -6.371  10.478  23.338  1.00 71.17  ? 117  LYS H CE    1 
ATOM   5975  N  NZ    . LYS H  4 117 ? -6.294  11.780  22.567  1.00 72.42  ? 117  LYS H NZ    1 
ATOM   5976  N  N     . TYR H  4 118 ? -10.714 7.225   20.396  1.00 70.75  ? 118  TYR H N     1 
ATOM   5977  C  CA    . TYR H  4 118 ? -10.104 6.407   19.352  1.00 71.84  ? 118  TYR H CA    1 
ATOM   5978  C  C     . TYR H  4 118 ? -10.732 6.648   17.974  1.00 73.50  ? 118  TYR H C     1 
ATOM   5979  O  O     . TYR H  4 118 ? -10.012 6.655   16.984  1.00 73.71  ? 118  TYR H O     1 
ATOM   5980  C  CB    . TYR H  4 118 ? -10.129 4.916   19.745  1.00 71.18  ? 118  TYR H CB    1 
ATOM   5981  C  CG    . TYR H  4 118 ? -9.676  3.986   18.649  1.00 69.03  ? 118  TYR H CG    1 
ATOM   5982  C  CD1   . TYR H  4 118 ? -8.324  3.765   18.420  1.00 67.09  ? 118  TYR H CD1   1 
ATOM   5983  C  CD2   . TYR H  4 118 ? -10.606 3.338   17.837  1.00 66.88  ? 118  TYR H CD2   1 
ATOM   5984  C  CE1   . TYR H  4 118 ? -7.906  2.925   17.401  1.00 67.33  ? 118  TYR H CE1   1 
ATOM   5985  C  CE2   . TYR H  4 118 ? -10.207 2.509   16.819  1.00 67.07  ? 118  TYR H CE2   1 
ATOM   5986  C  CZ    . TYR H  4 118 ? -8.856  2.307   16.602  1.00 68.21  ? 118  TYR H CZ    1 
ATOM   5987  O  OH    . TYR H  4 118 ? -8.453  1.478   15.584  1.00 69.09  ? 118  TYR H OH    1 
ATOM   5988  N  N     . THR H  4 119 ? -12.057 6.825   17.921  1.00 75.67  ? 119  THR H N     1 
ATOM   5989  C  CA    . THR H  4 119 ? -12.787 7.186   16.678  1.00 77.84  ? 119  THR H CA    1 
ATOM   5990  C  C     . THR H  4 119 ? -12.449 8.616   16.202  1.00 79.26  ? 119  THR H C     1 
ATOM   5991  O  O     . THR H  4 119 ? -12.353 8.882   15.001  1.00 79.15  ? 119  THR H O     1 
ATOM   5992  C  CB    . THR H  4 119 ? -14.337 7.110   16.870  1.00 77.67  ? 119  THR H CB    1 
ATOM   5993  O  OG1   . THR H  4 119 ? -14.686 5.907   17.556  1.00 77.27  ? 119  THR H OG1   1 
ATOM   5994  C  CG2   . THR H  4 119 ? -15.062 7.137   15.535  1.00 77.85  ? 119  THR H CG2   1 
ATOM   5995  N  N     . SER H  4 120 ? -12.292 9.518   17.171  1.00 81.40  ? 120  SER H N     1 
ATOM   5996  C  CA    . SER H  4 120 ? -11.880 10.914  16.963  1.00 83.52  ? 120  SER H CA    1 
ATOM   5997  C  C     . SER H  4 120 ? -10.569 11.103  16.180  1.00 84.98  ? 120  SER H C     1 
ATOM   5998  O  O     . SER H  4 120 ? -10.266 12.220  15.740  1.00 85.12  ? 120  SER H O     1 
ATOM   5999  C  CB    . SER H  4 120 ? -11.781 11.627  18.320  1.00 83.58  ? 120  SER H CB    1 
ATOM   6000  O  OG    . SER H  4 120 ? -10.775 12.637  18.317  1.00 84.46  ? 120  SER H OG    1 
ATOM   6001  N  N     . ALA H  4 121 ? -9.793  10.032  16.020  1.00 86.58  ? 121  ALA H N     1 
ATOM   6002  C  CA    . ALA H  4 121 ? -8.599  10.083  15.179  1.00 88.34  ? 121  ALA H CA    1 
ATOM   6003  C  C     . ALA H  4 121 ? -8.630  9.041   14.042  1.00 89.72  ? 121  ALA H C     1 
ATOM   6004  O  O     . ALA H  4 121 ? -9.699  8.511   13.689  1.00 89.78  ? 121  ALA H O     1 
ATOM   6005  C  CB    . ALA H  4 121 ? -7.330  9.952   16.030  1.00 88.21  ? 121  ALA H CB    1 
ATOM   6006  N  N     . LYS H  4 122 ? -7.446  8.774   13.484  1.00 91.16  ? 122  LYS H N     1 
ATOM   6007  C  CA    . LYS H  4 122 ? -7.211  7.866   12.345  1.00 92.54  ? 122  LYS H CA    1 
ATOM   6008  C  C     . LYS H  4 122 ? -6.533  8.624   11.200  1.00 93.03  ? 122  LYS H C     1 
ATOM   6009  O  O     . LYS H  4 122 ? -6.841  9.802   10.947  1.00 93.28  ? 122  LYS H O     1 
ATOM   6010  C  CB    . LYS H  4 122 ? -8.488  7.185   11.831  1.00 92.77  ? 122  LYS H CB    1 
ATOM   6011  C  CG    . LYS H  4 122 ? -8.199  5.941   10.990  1.00 94.04  ? 122  LYS H CG    1 
ATOM   6012  C  CD    . LYS H  4 122 ? -9.056  5.885   9.728   1.00 95.25  ? 122  LYS H CD    1 
ATOM   6013  C  CE    . LYS H  4 122 ? -8.262  5.262   8.575   1.00 95.46  ? 122  LYS H CE    1 
ATOM   6014  N  NZ    . LYS H  4 122 ? -9.096  5.074   7.345   1.00 95.66  ? 122  LYS H NZ    1 
ATOM   6015  O  OXT   . LYS H  4 122 ? -5.667  8.065   10.506  1.00 93.35  ? 122  LYS H OXT   1 
ATOM   6016  O  "O5'" . DA  I  5 1   ? -44.554 -52.798 77.482  1.00 158.18 ? -72  DA  I "O5'" 1 
ATOM   6017  C  "C5'" . DA  I  5 1   ? -45.322 -53.385 78.556  1.00 158.22 ? -72  DA  I "C5'" 1 
ATOM   6018  C  "C4'" . DA  I  5 1   ? -46.823 -52.968 78.561  1.00 158.24 ? -72  DA  I "C4'" 1 
ATOM   6019  O  "O4'" . DA  I  5 1   ? -47.010 -51.626 79.176  1.00 157.70 ? -72  DA  I "O4'" 1 
ATOM   6020  C  "C3'" . DA  I  5 1   ? -47.603 -53.030 77.214  1.00 158.66 ? -72  DA  I "C3'" 1 
ATOM   6021  O  "O3'" . DA  I  5 1   ? -48.700 -53.974 77.326  1.00 159.93 ? -72  DA  I "O3'" 1 
ATOM   6022  C  "C2'" . DA  I  5 1   ? -48.063 -51.584 77.000  1.00 158.05 ? -72  DA  I "C2'" 1 
ATOM   6023  C  "C1'" . DA  I  5 1   ? -48.091 -51.006 78.478  1.00 156.75 ? -72  DA  I "C1'" 1 
ATOM   6024  N  N9    . DA  I  5 1   ? -47.985 -49.520 78.544  1.00 156.36 ? -72  DA  I N9    1 
ATOM   6025  C  C8    . DA  I  5 1   ? -46.889 -48.688 78.402  1.00 155.77 ? -72  DA  I C8    1 
ATOM   6026  N  N7    . DA  I  5 1   ? -47.226 -47.387 78.519  1.00 154.65 ? -72  DA  I N7    1 
ATOM   6027  C  C5    . DA  I  5 1   ? -48.521 -47.374 78.746  1.00 155.48 ? -72  DA  I C5    1 
ATOM   6028  C  C6    . DA  I  5 1   ? -49.478 -46.339 78.957  1.00 155.90 ? -72  DA  I C6    1 
ATOM   6029  N  N6    . DA  I  5 1   ? -49.268 -45.031 78.972  1.00 156.10 ? -72  DA  I N6    1 
ATOM   6030  N  N1    . DA  I  5 1   ? -50.766 -46.721 79.173  1.00 156.00 ? -72  DA  I N1    1 
ATOM   6031  C  C2    . DA  I  5 1   ? -51.122 -48.053 79.171  1.00 155.76 ? -72  DA  I C2    1 
ATOM   6032  N  N3    . DA  I  5 1   ? -50.335 -49.059 78.973  1.00 155.85 ? -72  DA  I N3    1 
ATOM   6033  C  C4    . DA  I  5 1   ? -49.047 -48.680 78.765  1.00 155.88 ? -72  DA  I C4    1 
ATOM   6034  P  P     . DT  I  5 2   ? -49.720 -54.287 76.061  1.00 160.86 ? -71  DT  I P     1 
ATOM   6035  O  OP1   . DT  I  5 2   ? -50.014 -55.755 76.078  1.00 160.74 ? -71  DT  I OP1   1 
ATOM   6036  O  OP2   . DT  I  5 2   ? -49.214 -53.690 74.790  1.00 160.95 ? -71  DT  I OP2   1 
ATOM   6037  O  "O5'" . DT  I  5 2   ? -51.052 -53.435 76.494  1.00 161.49 ? -71  DT  I "O5'" 1 
ATOM   6038  C  "C5'" . DT  I  5 2   ? -52.000 -54.013 77.392  1.00 162.36 ? -71  DT  I "C5'" 1 
ATOM   6039  C  "C4'" . DT  I  5 2   ? -53.267 -53.177 77.397  1.00 163.19 ? -71  DT  I "C4'" 1 
ATOM   6040  O  "O4'" . DT  I  5 2   ? -52.920 -51.770 77.534  1.00 163.68 ? -71  DT  I "O4'" 1 
ATOM   6041  C  "C3'" . DT  I  5 2   ? -54.127 -53.292 76.141  1.00 163.52 ? -71  DT  I "C3'" 1 
ATOM   6042  O  "O3'" . DT  I  5 2   ? -55.511 -53.373 76.506  1.00 163.89 ? -71  DT  I "O3'" 1 
ATOM   6043  C  "C2'" . DT  I  5 2   ? -53.788 -52.023 75.356  1.00 163.65 ? -71  DT  I "C2'" 1 
ATOM   6044  C  "C1'" . DT  I  5 2   ? -53.493 -51.021 76.472  1.00 163.73 ? -71  DT  I "C1'" 1 
ATOM   6045  N  N1    . DT  I  5 2   ? -52.570 -49.886 76.084  1.00 163.78 ? -71  DT  I N1    1 
ATOM   6046  C  C2    . DT  I  5 2   ? -52.942 -48.571 76.344  1.00 163.62 ? -71  DT  I C2    1 
ATOM   6047  O  O2    . DT  I  5 2   ? -53.987 -48.239 76.881  1.00 163.45 ? -71  DT  I O2    1 
ATOM   6048  N  N3    . DT  I  5 2   ? -52.022 -47.629 75.949  1.00 163.54 ? -71  DT  I N3    1 
ATOM   6049  C  C4    . DT  I  5 2   ? -50.800 -47.854 75.334  1.00 163.64 ? -71  DT  I C4    1 
ATOM   6050  O  O4    . DT  I  5 2   ? -50.052 -46.933 75.022  1.00 163.69 ? -71  DT  I O4    1 
ATOM   6051  C  C5    . DT  I  5 2   ? -50.469 -49.240 75.086  1.00 163.60 ? -71  DT  I C5    1 
ATOM   6052  C  C7    . DT  I  5 2   ? -49.173 -49.606 74.420  1.00 163.47 ? -71  DT  I C7    1 
ATOM   6053  C  C6    . DT  I  5 2   ? -51.357 -50.174 75.468  1.00 163.73 ? -71  DT  I C6    1 
ATOM   6054  P  P     . DC  I  5 3   ? -56.704 -53.390 75.414  1.00 164.18 ? -70  DC  I P     1 
ATOM   6055  O  OP1   . DC  I  5 3   ? -57.736 -54.337 75.903  1.00 164.24 ? -70  DC  I OP1   1 
ATOM   6056  O  OP2   . DC  I  5 3   ? -56.146 -53.597 74.046  1.00 164.38 ? -70  DC  I OP2   1 
ATOM   6057  O  "O5'" . DC  I  5 3   ? -57.248 -51.869 75.501  1.00 163.64 ? -70  DC  I "O5'" 1 
ATOM   6058  C  "C5'" . DC  I  5 3   ? -58.423 -51.583 76.302  1.00 163.01 ? -70  DC  I "C5'" 1 
ATOM   6059  C  "C4'" . DC  I  5 3   ? -58.864 -50.155 76.046  1.00 162.63 ? -70  DC  I "C4'" 1 
ATOM   6060  O  "O4'" . DC  I  5 3   ? -57.677 -49.314 75.954  1.00 162.82 ? -70  DC  I "O4'" 1 
ATOM   6061  C  "C3'" . DC  I  5 3   ? -59.665 -49.955 74.757  1.00 162.41 ? -70  DC  I "C3'" 1 
ATOM   6062  O  "O3'" . DC  I  5 3   ? -60.850 -49.168 75.009  1.00 161.70 ? -70  DC  I "O3'" 1 
ATOM   6063  C  "C2'" . DC  I  5 3   ? -58.664 -49.256 73.834  1.00 162.87 ? -70  DC  I "C2'" 1 
ATOM   6064  C  "C1'" . DC  I  5 3   ? -57.777 -48.484 74.810  1.00 162.83 ? -70  DC  I "C1'" 1 
ATOM   6065  N  N1    . DC  I  5 3   ? -56.413 -48.136 74.242  1.00 162.67 ? -70  DC  I N1    1 
ATOM   6066  C  C2    . DC  I  5 3   ? -55.885 -46.831 74.357  1.00 162.31 ? -70  DC  I C2    1 
ATOM   6067  O  O2    . DC  I  5 3   ? -56.518 -45.940 74.939  1.00 162.13 ? -70  DC  I O2    1 
ATOM   6068  N  N3    . DC  I  5 3   ? -54.664 -46.570 73.820  1.00 162.24 ? -70  DC  I N3    1 
ATOM   6069  C  C4    . DC  I  5 3   ? -53.982 -47.534 73.190  1.00 162.44 ? -70  DC  I C4    1 
ATOM   6070  N  N4    . DC  I  5 3   ? -52.786 -47.228 72.681  1.00 162.37 ? -70  DC  I N4    1 
ATOM   6071  C  C5    . DC  I  5 3   ? -54.496 -48.860 73.054  1.00 162.54 ? -70  DC  I C5    1 
ATOM   6072  C  C6    . DC  I  5 3   ? -55.699 -49.110 73.588  1.00 162.75 ? -70  DC  I C6    1 
ATOM   6073  P  P     . DT  I  5 4   ? -61.763 -48.478 73.871  1.00 161.17 ? -69  DT  I P     1 
ATOM   6074  O  OP1   . DT  I  5 4   ? -63.179 -48.640 74.266  1.00 161.35 ? -69  DT  I OP1   1 
ATOM   6075  O  OP2   . DT  I  5 4   ? -61.341 -48.940 72.529  1.00 161.04 ? -69  DT  I OP2   1 
ATOM   6076  O  "O5'" . DT  I  5 4   ? -61.367 -46.935 74.029  1.00 160.49 ? -69  DT  I "O5'" 1 
ATOM   6077  C  "C5'" . DT  I  5 4   ? -62.357 -45.901 73.996  1.00 159.13 ? -69  DT  I "C5'" 1 
ATOM   6078  C  "C4'" . DT  I  5 4   ? -61.708 -44.558 73.678  1.00 158.53 ? -69  DT  I "C4'" 1 
ATOM   6079  O  "O4'" . DT  I  5 4   ? -60.288 -44.696 73.377  1.00 158.54 ? -69  DT  I "O4'" 1 
ATOM   6080  C  "C3'" . DT  I  5 4   ? -62.300 -43.824 72.482  1.00 157.98 ? -69  DT  I "C3'" 1 
ATOM   6081  O  "O3'" . DT  I  5 4   ? -62.385 -42.445 72.855  1.00 157.17 ? -69  DT  I "O3'" 1 
ATOM   6082  C  "C2'" . DT  I  5 4   ? -61.299 -44.126 71.367  1.00 157.98 ? -69  DT  I "C2'" 1 
ATOM   6083  C  "C1'" . DT  I  5 4   ? -59.998 -44.028 72.161  1.00 158.07 ? -69  DT  I "C1'" 1 
ATOM   6084  N  N1    . DT  I  5 4   ? -58.777 -44.629 71.522  1.00 157.97 ? -69  DT  I N1    1 
ATOM   6085  C  C2    . DT  I  5 4   ? -57.690 -43.822 71.217  1.00 157.96 ? -69  DT  I C2    1 
ATOM   6086  O  O2    . DT  I  5 4   ? -57.641 -42.621 71.424  1.00 157.96 ? -69  DT  I O2    1 
ATOM   6087  N  N3    . DT  I  5 4   ? -56.630 -44.483 70.645  1.00 158.00 ? -69  DT  I N3    1 
ATOM   6088  C  C4    . DT  I  5 4   ? -56.543 -45.835 70.354  1.00 158.09 ? -69  DT  I C4    1 
ATOM   6089  O  O4    . DT  I  5 4   ? -55.546 -46.330 69.839  1.00 158.14 ? -69  DT  I O4    1 
ATOM   6090  C  C5    . DT  I  5 4   ? -57.704 -46.622 70.697  1.00 158.04 ? -69  DT  I C5    1 
ATOM   6091  C  C7    . DT  I  5 4   ? -57.725 -48.099 70.427  1.00 157.95 ? -69  DT  I C7    1 
ATOM   6092  C  C6    . DT  I  5 4   ? -58.748 -45.990 71.257  1.00 158.02 ? -69  DT  I C6    1 
ATOM   6093  P  P     . DC  I  5 5   ? -62.613 -41.241 71.818  1.00 156.75 ? -68  DC  I P     1 
ATOM   6094  O  OP1   . DC  I  5 5   ? -62.984 -40.045 72.620  1.00 156.40 ? -68  DC  I OP1   1 
ATOM   6095  O  OP2   . DC  I  5 5   ? -63.510 -41.718 70.733  1.00 156.77 ? -68  DC  I OP2   1 
ATOM   6096  O  "O5'" . DC  I  5 5   ? -61.146 -41.058 71.198  1.00 155.46 ? -68  DC  I "O5'" 1 
ATOM   6097  C  "C5'" . DC  I  5 5   ? -60.350 -39.906 71.460  1.00 153.04 ? -68  DC  I "C5'" 1 
ATOM   6098  C  "C4'" . DC  I  5 5   ? -59.606 -39.506 70.200  1.00 151.21 ? -68  DC  I "C4'" 1 
ATOM   6099  O  "O4'" . DC  I  5 5   ? -58.822 -40.625 69.713  1.00 150.88 ? -68  DC  I "O4'" 1 
ATOM   6100  C  "C3'" . DC  I  5 5   ? -60.488 -39.048 69.046  1.00 150.05 ? -68  DC  I "C3'" 1 
ATOM   6101  O  "O3'" . DC  I  5 5   ? -59.959 -37.836 68.528  1.00 148.85 ? -68  DC  I "O3'" 1 
ATOM   6102  C  "C2'" . DC  I  5 5   ? -60.401 -40.189 68.029  1.00 150.17 ? -68  DC  I "C2'" 1 
ATOM   6103  C  "C1'" . DC  I  5 5   ? -59.024 -40.784 68.325  1.00 150.37 ? -68  DC  I "C1'" 1 
ATOM   6104  N  N1    . DC  I  5 5   ? -58.844 -42.239 67.968  1.00 150.27 ? -68  DC  I N1    1 
ATOM   6105  C  C2    . DC  I  5 5   ? -57.709 -42.643 67.241  1.00 150.35 ? -68  DC  I C2    1 
ATOM   6106  O  O2    . DC  I  5 5   ? -56.872 -41.801 66.894  1.00 150.31 ? -68  DC  I O2    1 
ATOM   6107  N  N3    . DC  I  5 5   ? -57.562 -43.958 66.927  1.00 150.32 ? -68  DC  I N3    1 
ATOM   6108  C  C4    . DC  I  5 5   ? -58.482 -44.849 67.311  1.00 150.17 ? -68  DC  I C4    1 
ATOM   6109  N  N4    . DC  I  5 5   ? -58.288 -46.129 66.977  1.00 150.18 ? -68  DC  I N4    1 
ATOM   6110  C  C5    . DC  I  5 5   ? -59.641 -44.465 68.054  1.00 150.06 ? -68  DC  I C5    1 
ATOM   6111  C  C6    . DC  I  5 5   ? -59.776 -43.166 68.355  1.00 150.02 ? -68  DC  I C6    1 
ATOM   6112  P  P     . DC  I  5 6   ? -60.882 -36.543 68.294  1.00 147.60 ? -67  DC  I P     1 
ATOM   6113  O  OP1   . DC  I  5 6   ? -60.718 -35.670 69.487  1.00 147.09 ? -67  DC  I OP1   1 
ATOM   6114  O  OP2   . DC  I  5 6   ? -62.222 -37.002 67.837  1.00 147.68 ? -67  DC  I OP2   1 
ATOM   6115  O  "O5'" . DC  I  5 6   ? -60.192 -35.837 67.035  1.00 146.09 ? -67  DC  I "O5'" 1 
ATOM   6116  C  "C5'" . DC  I  5 6   ? -59.916 -36.601 65.870  1.00 143.37 ? -67  DC  I "C5'" 1 
ATOM   6117  C  "C4'" . DC  I  5 6   ? -58.442 -36.483 65.534  1.00 141.04 ? -67  DC  I "C4'" 1 
ATOM   6118  O  "O4'" . DC  I  5 6   ? -57.788 -37.771 65.654  1.00 140.45 ? -67  DC  I "O4'" 1 
ATOM   6119  C  "C3'" . DC  I  5 6   ? -58.152 -35.963 64.137  1.00 139.92 ? -67  DC  I "C3'" 1 
ATOM   6120  O  "O3'" . DC  I  5 6   ? -57.057 -35.056 64.211  1.00 137.89 ? -67  DC  I "O3'" 1 
ATOM   6121  C  "C2'" . DC  I  5 6   ? -57.832 -37.234 63.350  1.00 140.10 ? -67  DC  I "C2'" 1 
ATOM   6122  C  "C1'" . DC  I  5 6   ? -57.238 -38.162 64.408  1.00 140.21 ? -67  DC  I "C1'" 1 
ATOM   6123  N  N1    . DC  I  5 6   ? -57.485 -39.637 64.179  1.00 140.25 ? -67  DC  I N1    1 
ATOM   6124  C  C2    . DC  I  5 6   ? -56.470 -40.435 63.618  1.00 140.36 ? -67  DC  I C2    1 
ATOM   6125  O  O2    . DC  I  5 6   ? -55.386 -39.924 63.312  1.00 140.45 ? -67  DC  I O2    1 
ATOM   6126  N  N3    . DC  I  5 6   ? -56.696 -41.762 63.417  1.00 140.31 ? -67  DC  I N3    1 
ATOM   6127  C  C4    . DC  I  5 6   ? -57.871 -42.299 63.750  1.00 140.20 ? -67  DC  I C4    1 
ATOM   6128  N  N4    . DC  I  5 6   ? -58.033 -43.607 63.525  1.00 140.19 ? -67  DC  I N4    1 
ATOM   6129  C  C5    . DC  I  5 6   ? -58.922 -41.513 64.320  1.00 140.22 ? -67  DC  I C5    1 
ATOM   6130  C  C6    . DC  I  5 6   ? -58.689 -40.205 64.516  1.00 140.18 ? -67  DC  I C6    1 
ATOM   6131  P  P     . DA  I  5 7   ? -56.955 -33.766 63.269  1.00 136.43 ? -66  DA  I P     1 
ATOM   6132  O  OP1   . DA  I  5 7   ? -56.198 -32.751 64.038  1.00 136.14 ? -66  DA  I OP1   1 
ATOM   6133  O  OP2   . DA  I  5 7   ? -58.301 -33.435 62.741  1.00 136.06 ? -66  DA  I OP2   1 
ATOM   6134  O  "O5'" . DA  I  5 7   ? -56.056 -34.297 62.044  1.00 136.18 ? -66  DA  I "O5'" 1 
ATOM   6135  C  "C5'" . DA  I  5 7   ? -54.698 -34.739 62.247  1.00 135.21 ? -66  DA  I "C5'" 1 
ATOM   6136  C  "C4'" . DA  I  5 7   ? -54.220 -35.754 61.209  1.00 134.71 ? -66  DA  I "C4'" 1 
ATOM   6137  O  "O4'" . DA  I  5 7   ? -54.914 -37.025 61.360  1.00 135.08 ? -66  DA  I "O4'" 1 
ATOM   6138  C  "C3'" . DA  I  5 7   ? -54.390 -35.360 59.742  1.00 134.26 ? -66  DA  I "C3'" 1 
ATOM   6139  O  "O3'" . DA  I  5 7   ? -53.153 -35.599 59.049  1.00 133.11 ? -66  DA  I "O3'" 1 
ATOM   6140  C  "C2'" . DA  I  5 7   ? -55.527 -36.273 59.268  1.00 134.79 ? -66  DA  I "C2'" 1 
ATOM   6141  C  "C1'" . DA  I  5 7   ? -55.214 -37.530 60.070  1.00 135.21 ? -66  DA  I "C1'" 1 
ATOM   6142  N  N9    . DA  I  5 7   ? -56.265 -38.555 60.163  1.00 135.32 ? -66  DA  I N9    1 
ATOM   6143  C  C8    . DA  I  5 7   ? -57.608 -38.384 60.380  1.00 135.18 ? -66  DA  I C8    1 
ATOM   6144  N  N7    . DA  I  5 7   ? -58.291 -39.504 60.424  1.00 135.10 ? -66  DA  I N7    1 
ATOM   6145  C  C5    . DA  I  5 7   ? -57.337 -40.490 60.216  1.00 135.49 ? -66  DA  I C5    1 
ATOM   6146  C  C6    . DA  I  5 7   ? -57.401 -41.908 60.143  1.00 135.34 ? -66  DA  I C6    1 
ATOM   6147  N  N6    . DA  I  5 7   ? -58.528 -42.615 60.278  1.00 135.32 ? -66  DA  I N6    1 
ATOM   6148  N  N1    . DA  I  5 7   ? -56.253 -42.587 59.925  1.00 135.11 ? -66  DA  I N1    1 
ATOM   6149  C  C2    . DA  I  5 7   ? -55.112 -41.897 59.789  1.00 135.22 ? -66  DA  I C2    1 
ATOM   6150  N  N3    . DA  I  5 7   ? -54.926 -40.575 59.835  1.00 135.39 ? -66  DA  I N3    1 
ATOM   6151  C  C4    . DA  I  5 7   ? -56.083 -39.919 60.055  1.00 135.49 ? -66  DA  I C4    1 
ATOM   6152  P  P     . DA  I  5 8   ? -52.876 -35.062 57.560  1.00 132.27 ? -65  DA  I P     1 
ATOM   6153  O  OP1   . DA  I  5 8   ? -51.997 -33.881 57.661  1.00 132.54 ? -65  DA  I OP1   1 
ATOM   6154  O  OP2   . DA  I  5 8   ? -54.143 -34.979 56.795  1.00 131.99 ? -65  DA  I OP2   1 
ATOM   6155  O  "O5'" . DA  I  5 8   ? -52.037 -36.234 56.896  1.00 131.65 ? -65  DA  I "O5'" 1 
ATOM   6156  C  "C5'" . DA  I  5 8   ? -51.091 -36.973 57.635  1.00 130.91 ? -65  DA  I "C5'" 1 
ATOM   6157  C  "C4'" . DA  I  5 8   ? -51.020 -38.352 57.020  1.00 130.54 ? -65  DA  I "C4'" 1 
ATOM   6158  O  "O4'" . DA  I  5 8   ? -52.297 -39.004 57.207  1.00 131.01 ? -65  DA  I "O4'" 1 
ATOM   6159  C  "C3'" . DA  I  5 8   ? -50.771 -38.382 55.518  1.00 130.11 ? -65  DA  I "C3'" 1 
ATOM   6160  O  "O3'" . DA  I  5 8   ? -49.905 -39.476 55.283  1.00 129.05 ? -65  DA  I "O3'" 1 
ATOM   6161  C  "C2'" . DA  I  5 8   ? -52.168 -38.582 54.923  1.00 130.65 ? -65  DA  I "C2'" 1 
ATOM   6162  C  "C1'" . DA  I  5 8   ? -52.758 -39.511 55.973  1.00 131.88 ? -65  DA  I "C1'" 1 
ATOM   6163  N  N9    . DA  I  5 8   ? -54.215 -39.581 56.047  1.00 132.35 ? -65  DA  I N9    1 
ATOM   6164  C  C8    . DA  I  5 8   ? -55.110 -38.551 55.944  1.00 132.55 ? -65  DA  I C8    1 
ATOM   6165  N  N7    . DA  I  5 8   ? -56.361 -38.925 56.067  1.00 132.76 ? -65  DA  I N7    1 
ATOM   6166  C  C5    . DA  I  5 8   ? -56.281 -40.292 56.273  1.00 132.79 ? -65  DA  I C5    1 
ATOM   6167  C  C6    . DA  I  5 8   ? -57.263 -41.289 56.477  1.00 132.49 ? -65  DA  I C6    1 
ATOM   6168  N  N6    . DA  I  5 8   ? -58.572 -41.030 56.502  1.00 132.44 ? -65  DA  I N6    1 
ATOM   6169  N  N1    . DA  I  5 8   ? -56.851 -42.567 56.642  1.00 132.49 ? -65  DA  I N1    1 
ATOM   6170  C  C2    . DA  I  5 8   ? -55.536 -42.833 56.614  1.00 132.55 ? -65  DA  I C2    1 
ATOM   6171  N  N3    . DA  I  5 8   ? -54.523 -41.982 56.433  1.00 132.64 ? -65  DA  I N3    1 
ATOM   6172  C  C4    . DA  I  5 8   ? -54.964 -40.717 56.268  1.00 132.68 ? -65  DA  I C4    1 
ATOM   6173  P  P     . DA  I  5 9   ? -49.363 -39.839 53.826  1.00 128.58 ? -64  DA  I P     1 
ATOM   6174  O  OP1   . DA  I  5 9   ? -47.888 -39.887 53.913  1.00 129.23 ? -64  DA  I OP1   1 
ATOM   6175  O  OP2   . DA  I  5 9   ? -50.017 -38.972 52.818  1.00 128.28 ? -64  DA  I OP2   1 
ATOM   6176  O  "O5'" . DA  I  5 9   ? -49.902 -41.328 53.595  1.00 129.00 ? -64  DA  I "O5'" 1 
ATOM   6177  C  "C5'" . DA  I  5 9   ? -49.967 -42.320 54.634  1.00 128.54 ? -64  DA  I "C5'" 1 
ATOM   6178  C  "C4'" . DA  I  5 9   ? -50.631 -43.595 54.122  1.00 128.12 ? -64  DA  I "C4'" 1 
ATOM   6179  O  "O4'" . DA  I  5 9   ? -52.067 -43.548 54.343  1.00 127.22 ? -64  DA  I "O4'" 1 
ATOM   6180  C  "C3'" . DA  I  5 9   ? -50.448 -43.871 52.629  1.00 128.50 ? -64  DA  I "C3'" 1 
ATOM   6181  O  "O3'" . DA  I  5 9   ? -50.185 -45.268 52.410  1.00 129.79 ? -64  DA  I "O3'" 1 
ATOM   6182  C  "C2'" . DA  I  5 9   ? -51.754 -43.369 52.003  1.00 127.70 ? -64  DA  I "C2'" 1 
ATOM   6183  C  "C1'" . DA  I  5 9   ? -52.768 -43.615 53.114  1.00 126.83 ? -64  DA  I "C1'" 1 
ATOM   6184  N  N9    . DA  I  5 9   ? -53.843 -42.628 53.156  1.00 126.52 ? -64  DA  I N9    1 
ATOM   6185  C  C8    . DA  I  5 9   ? -53.724 -41.271 53.056  1.00 126.43 ? -64  DA  I C8    1 
ATOM   6186  N  N7    . DA  I  5 9   ? -54.860 -40.624 53.132  1.00 126.15 ? -64  DA  I N7    1 
ATOM   6187  C  C5    . DA  I  5 9   ? -55.791 -41.629 53.296  1.00 126.34 ? -64  DA  I C5    1 
ATOM   6188  C  C6    . DA  I  5 9   ? -57.190 -41.604 53.437  1.00 126.53 ? -64  DA  I C6    1 
ATOM   6189  N  N6    . DA  I  5 9   ? -57.892 -40.470 53.445  1.00 126.59 ? -64  DA  I N6    1 
ATOM   6190  N  N1    . DA  I  5 9   ? -57.836 -42.779 53.585  1.00 126.48 ? -64  DA  I N1    1 
ATOM   6191  C  C2    . DA  I  5 9   ? -57.121 -43.911 53.587  1.00 126.39 ? -64  DA  I C2    1 
ATOM   6192  N  N3    . DA  I  5 9   ? -55.802 -44.062 53.458  1.00 126.52 ? -64  DA  I N3    1 
ATOM   6193  C  C4    . DA  I  5 9   ? -55.187 -42.872 53.313  1.00 126.47 ? -64  DA  I C4    1 
ATOM   6194  P  P     . DT  I  5 10  ? -50.152 -45.906 50.933  1.00 131.22 ? -63  DT  I P     1 
ATOM   6195  O  OP1   . DT  I  5 10  ? -49.288 -47.108 50.951  1.00 131.12 ? -63  DT  I OP1   1 
ATOM   6196  O  OP2   . DT  I  5 10  ? -49.881 -44.843 49.932  1.00 131.18 ? -63  DT  I OP2   1 
ATOM   6197  O  "O5'" . DT  I  5 10  ? -51.681 -46.345 50.766  1.00 131.91 ? -63  DT  I "O5'" 1 
ATOM   6198  C  "C5'" . DT  I  5 10  ? -52.268 -47.366 51.574  1.00 132.59 ? -63  DT  I "C5'" 1 
ATOM   6199  C  "C4'" . DT  I  5 10  ? -53.572 -47.782 50.924  1.00 133.00 ? -63  DT  I "C4'" 1 
ATOM   6200  O  "O4'" . DT  I  5 10  ? -54.545 -46.733 51.164  1.00 133.07 ? -63  DT  I "O4'" 1 
ATOM   6201  C  "C3'" . DT  I  5 10  ? -53.473 -47.968 49.404  1.00 133.18 ? -63  DT  I "C3'" 1 
ATOM   6202  O  "O3'" . DT  I  5 10  ? -53.931 -49.306 49.054  1.00 133.27 ? -63  DT  I "O3'" 1 
ATOM   6203  C  "C2'" . DT  I  5 10  ? -54.254 -46.778 48.822  1.00 133.11 ? -63  DT  I "C2'" 1 
ATOM   6204  C  "C1'" . DT  I  5 10  ? -55.206 -46.406 49.957  1.00 133.21 ? -63  DT  I "C1'" 1 
ATOM   6205  N  N1    . DT  I  5 10  ? -55.621 -44.958 50.029  1.00 133.34 ? -63  DT  I N1    1 
ATOM   6206  C  C2    . DT  I  5 10  ? -56.926 -44.640 50.387  1.00 133.26 ? -63  DT  I C2    1 
ATOM   6207  O  O2    . DT  I  5 10  ? -57.788 -45.467 50.648  1.00 133.30 ? -63  DT  I O2    1 
ATOM   6208  N  N3    . DT  I  5 10  ? -57.196 -43.293 50.431  1.00 133.07 ? -63  DT  I N3    1 
ATOM   6209  C  C4    . DT  I  5 10  ? -56.319 -42.256 50.161  1.00 133.27 ? -63  DT  I C4    1 
ATOM   6210  O  O4    . DT  I  5 10  ? -56.688 -41.087 50.244  1.00 133.19 ? -63  DT  I O4    1 
ATOM   6211  C  C5    . DT  I  5 10  ? -54.967 -42.654 49.797  1.00 133.25 ? -63  DT  I C5    1 
ATOM   6212  C  C7    . DT  I  5 10  ? -53.901 -41.646 49.474  1.00 133.01 ? -63  DT  I C7    1 
ATOM   6213  C  C6    . DT  I  5 10  ? -54.692 -43.966 49.752  1.00 133.32 ? -63  DT  I C6    1 
ATOM   6214  P  P     . DA  I  5 11  ? -55.028 -49.676 47.930  1.00 132.92 ? -62  DA  I P     1 
ATOM   6215  O  OP1   . DA  I  5 11  ? -55.158 -51.152 47.957  1.00 133.45 ? -62  DA  I OP1   1 
ATOM   6216  O  OP2   . DA  I  5 11  ? -54.696 -49.001 46.644  1.00 132.43 ? -62  DA  I OP2   1 
ATOM   6217  O  "O5'" . DA  I  5 11  ? -56.362 -49.009 48.523  1.00 132.70 ? -62  DA  I "O5'" 1 
ATOM   6218  C  "C5'" . DA  I  5 11  ? -57.340 -49.771 49.222  1.00 132.65 ? -62  DA  I "C5'" 1 
ATOM   6219  C  "C4'" . DA  I  5 11  ? -58.655 -49.653 48.477  1.00 132.99 ? -62  DA  I "C4'" 1 
ATOM   6220  O  "O4'" . DA  I  5 11  ? -59.144 -48.289 48.538  1.00 133.07 ? -62  DA  I "O4'" 1 
ATOM   6221  C  "C3'" . DA  I  5 11  ? -58.617 -50.033 47.000  1.00 133.32 ? -62  DA  I "C3'" 1 
ATOM   6222  O  "O3'" . DA  I  5 11  ? -59.768 -50.838 46.737  1.00 134.19 ? -62  DA  I "O3'" 1 
ATOM   6223  C  "C2'" . DA  I  5 11  ? -58.593 -48.687 46.271  1.00 133.06 ? -62  DA  I "C2'" 1 
ATOM   6224  C  "C1'" . DA  I  5 11  ? -59.315 -47.752 47.239  1.00 132.97 ? -62  DA  I "C1'" 1 
ATOM   6225  N  N9    . DA  I  5 11  ? -58.784 -46.388 47.246  1.00 133.05 ? -62  DA  I N9    1 
ATOM   6226  C  C8    . DA  I  5 11  ? -57.473 -46.020 47.093  1.00 133.12 ? -62  DA  I C8    1 
ATOM   6227  N  N7    . DA  I  5 11  ? -57.266 -44.724 47.141  1.00 133.17 ? -62  DA  I N7    1 
ATOM   6228  C  C5    . DA  I  5 11  ? -58.529 -44.200 47.347  1.00 132.95 ? -62  DA  I C5    1 
ATOM   6229  C  C6    . DA  I  5 11  ? -58.986 -42.874 47.485  1.00 132.79 ? -62  DA  I C6    1 
ATOM   6230  N  N6    . DA  I  5 11  ? -58.174 -41.817 47.440  1.00 132.77 ? -62  DA  I N6    1 
ATOM   6231  N  N1    . DA  I  5 11  ? -60.309 -42.679 47.674  1.00 132.98 ? -62  DA  I N1    1 
ATOM   6232  C  C2    . DA  I  5 11  ? -61.118 -43.751 47.714  1.00 133.02 ? -62  DA  I C2    1 
ATOM   6233  N  N3    . DA  I  5 11  ? -60.805 -45.047 47.601  1.00 132.74 ? -62  DA  I N3    1 
ATOM   6234  C  C4    . DA  I  5 11  ? -59.481 -45.208 47.414  1.00 132.97 ? -62  DA  I C4    1 
ATOM   6235  P  P     . DT  I  5 12  ? -60.457 -51.016 45.303  1.00 134.82 ? -61  DT  I P     1 
ATOM   6236  O  OP1   . DT  I  5 12  ? -61.442 -52.106 45.457  1.00 135.26 ? -61  DT  I OP1   1 
ATOM   6237  O  OP2   . DT  I  5 12  ? -59.411 -51.132 44.259  1.00 135.25 ? -61  DT  I OP2   1 
ATOM   6238  O  "O5'" . DT  I  5 12  ? -61.244 -49.636 45.103  1.00 135.31 ? -61  DT  I "O5'" 1 
ATOM   6239  C  "C5'" . DT  I  5 12  ? -62.431 -49.366 45.844  1.00 136.22 ? -61  DT  I "C5'" 1 
ATOM   6240  C  "C4'" . DT  I  5 12  ? -63.300 -48.348 45.122  1.00 137.18 ? -61  DT  I "C4'" 1 
ATOM   6241  O  "O4'" . DT  I  5 12  ? -62.720 -47.027 45.270  1.00 137.33 ? -61  DT  I "O4'" 1 
ATOM   6242  C  "C3'" . DT  I  5 12  ? -63.498 -48.567 43.622  1.00 137.80 ? -61  DT  I "C3'" 1 
ATOM   6243  O  "O3'" . DT  I  5 12  ? -64.880 -48.386 43.314  1.00 138.82 ? -61  DT  I "O3'" 1 
ATOM   6244  C  "C2'" . DT  I  5 12  ? -62.610 -47.501 42.976  1.00 137.73 ? -61  DT  I "C2'" 1 
ATOM   6245  C  "C1'" . DT  I  5 12  ? -62.663 -46.381 44.013  1.00 137.48 ? -61  DT  I "C1'" 1 
ATOM   6246  N  N1    . DT  I  5 12  ? -61.481 -45.456 44.053  1.00 137.34 ? -61  DT  I N1    1 
ATOM   6247  C  C2    . DT  I  5 12  ? -61.662 -44.121 44.392  1.00 137.22 ? -61  DT  I C2    1 
ATOM   6248  O  O2    . DT  I  5 12  ? -62.737 -43.608 44.660  1.00 137.07 ? -61  DT  I O2    1 
ATOM   6249  N  N3    . DT  I  5 12  ? -60.505 -43.378 44.408  1.00 137.45 ? -61  DT  I N3    1 
ATOM   6250  C  C4    . DT  I  5 12  ? -59.216 -43.815 44.128  1.00 137.49 ? -61  DT  I C4    1 
ATOM   6251  O  O4    . DT  I  5 12  ? -58.255 -43.047 44.180  1.00 137.28 ? -61  DT  I O4    1 
ATOM   6252  C  C5    . DT  I  5 12  ? -59.096 -45.221 43.784  1.00 137.48 ? -61  DT  I C5    1 
ATOM   6253  C  C7    . DT  I  5 12  ? -57.762 -45.836 43.458  1.00 137.37 ? -61  DT  I C7    1 
ATOM   6254  C  C6    . DT  I  5 12  ? -60.219 -45.959 43.768  1.00 137.44 ? -61  DT  I C6    1 
ATOM   6255  P  P     . DC  I  5 13  ? -65.551 -48.856 41.927  1.00 139.69 ? -60  DC  I P     1 
ATOM   6256  O  OP1   . DC  I  5 13  ? -66.777 -49.609 42.295  1.00 139.80 ? -60  DC  I OP1   1 
ATOM   6257  O  OP2   . DC  I  5 13  ? -64.523 -49.491 41.063  1.00 139.31 ? -60  DC  I OP2   1 
ATOM   6258  O  "O5'" . DC  I  5 13  ? -65.996 -47.468 41.244  1.00 140.07 ? -60  DC  I "O5'" 1 
ATOM   6259  C  "C5'" . DC  I  5 13  ? -66.773 -46.495 41.974  1.00 140.58 ? -60  DC  I "C5'" 1 
ATOM   6260  C  "C4'" . DC  I  5 13  ? -66.721 -45.116 41.318  1.00 140.66 ? -60  DC  I "C4'" 1 
ATOM   6261  O  "O4'" . DC  I  5 13  ? -65.436 -44.486 41.587  1.00 140.70 ? -60  DC  I "O4'" 1 
ATOM   6262  C  "C3'" . DC  I  5 13  ? -66.872 -45.118 39.798  1.00 140.80 ? -60  DC  I "C3'" 1 
ATOM   6263  O  "O3'" . DC  I  5 13  ? -67.685 -44.031 39.366  1.00 140.85 ? -60  DC  I "O3'" 1 
ATOM   6264  C  "C2'" . DC  I  5 13  ? -65.439 -44.969 39.296  1.00 140.73 ? -60  DC  I "C2'" 1 
ATOM   6265  C  "C1'" . DC  I  5 13  ? -64.893 -44.020 40.361  1.00 140.71 ? -60  DC  I "C1'" 1 
ATOM   6266  N  N1    . DC  I  5 13  ? -63.394 -43.953 40.444  1.00 140.58 ? -60  DC  I N1    1 
ATOM   6267  C  C2    . DC  I  5 13  ? -62.773 -42.805 40.970  1.00 140.23 ? -60  DC  I C2    1 
ATOM   6268  O  O2    . DC  I  5 13  ? -63.463 -41.858 41.369  1.00 140.03 ? -60  DC  I O2    1 
ATOM   6269  N  N3    . DC  I  5 13  ? -61.414 -42.767 41.031  1.00 140.35 ? -60  DC  I N3    1 
ATOM   6270  C  C4    . DC  I  5 13  ? -60.686 -43.806 40.594  1.00 140.63 ? -60  DC  I C4    1 
ATOM   6271  N  N4    . DC  I  5 13  ? -59.352 -43.724 40.674  1.00 140.41 ? -60  DC  I N4    1 
ATOM   6272  C  C5    . DC  I  5 13  ? -61.297 -44.982 40.052  1.00 140.69 ? -60  DC  I C5    1 
ATOM   6273  C  C6    . DC  I  5 13  ? -62.637 -45.008 39.998  1.00 140.79 ? -60  DC  I C6    1 
ATOM   6274  P  P     . DC  I  5 14  ? -68.462 -44.163 37.974  1.00 140.77 ? -59  DC  I P     1 
ATOM   6275  O  OP1   . DC  I  5 14  ? -69.728 -44.854 38.298  1.00 140.85 ? -59  DC  I OP1   1 
ATOM   6276  O  OP2   . DC  I  5 14  ? -67.532 -44.759 36.983  1.00 140.74 ? -59  DC  I OP2   1 
ATOM   6277  O  "O5'" . DC  I  5 14  ? -68.781 -42.666 37.487  1.00 140.83 ? -59  DC  I "O5'" 1 
ATOM   6278  C  "C5'" . DC  I  5 14  ? -68.860 -41.537 38.364  1.00 141.45 ? -59  DC  I "C5'" 1 
ATOM   6279  C  "C4'" . DC  I  5 14  ? -68.199 -40.312 37.741  1.00 142.20 ? -59  DC  I "C4'" 1 
ATOM   6280  O  "O4'" . DC  I  5 14  ? -66.783 -40.322 38.074  1.00 142.61 ? -59  DC  I "O4'" 1 
ATOM   6281  C  "C3'" . DC  I  5 14  ? -68.295 -40.195 36.214  1.00 142.52 ? -59  DC  I "C3'" 1 
ATOM   6282  O  "O3'" . DC  I  5 14  ? -68.703 -38.874 35.814  1.00 142.65 ? -59  DC  I "O3'" 1 
ATOM   6283  C  "C2'" . DC  I  5 14  ? -66.887 -40.539 35.727  1.00 142.69 ? -59  DC  I "C2'" 1 
ATOM   6284  C  "C1'" . DC  I  5 14  ? -65.999 -40.151 36.905  1.00 142.82 ? -59  DC  I "C1'" 1 
ATOM   6285  N  N1    . DC  I  5 14  ? -64.732 -40.974 36.987  1.00 142.82 ? -59  DC  I N1    1 
ATOM   6286  C  C2    . DC  I  5 14  ? -63.584 -40.494 37.657  1.00 142.63 ? -59  DC  I C2    1 
ATOM   6287  O  O2    . DC  I  5 14  ? -63.590 -39.383 38.203  1.00 142.45 ? -59  DC  I O2    1 
ATOM   6288  N  N3    . DC  I  5 14  ? -62.470 -41.277 37.692  1.00 142.78 ? -59  DC  I N3    1 
ATOM   6289  C  C4    . DC  I  5 14  ? -62.466 -42.481 37.098  1.00 143.05 ? -59  DC  I C4    1 
ATOM   6290  N  N4    . DC  I  5 14  ? -61.350 -43.219 37.159  1.00 142.95 ? -59  DC  I N4    1 
ATOM   6291  C  C5    . DC  I  5 14  ? -63.615 -42.986 36.412  1.00 142.92 ? -59  DC  I C5    1 
ATOM   6292  C  C6    . DC  I  5 14  ? -64.707 -42.209 36.385  1.00 142.84 ? -59  DC  I C6    1 
ATOM   6293  P  P     . DC  I  5 15  ? -68.765 -38.410 34.268  1.00 142.92 ? -58  DC  I P     1 
ATOM   6294  O  OP1   . DC  I  5 15  ? -70.068 -37.743 34.037  1.00 142.98 ? -58  DC  I OP1   1 
ATOM   6295  O  OP2   . DC  I  5 15  ? -68.372 -39.537 33.393  1.00 142.94 ? -58  DC  I OP2   1 
ATOM   6296  O  "O5'" . DC  I  5 15  ? -67.616 -37.296 34.191  1.00 143.27 ? -58  DC  I "O5'" 1 
ATOM   6297  C  "C5'" . DC  I  5 15  ? -67.628 -36.185 35.092  1.00 143.21 ? -58  DC  I "C5'" 1 
ATOM   6298  C  "C4'" . DC  I  5 15  ? -66.265 -35.508 35.152  1.00 143.26 ? -58  DC  I "C4'" 1 
ATOM   6299  O  "O4'" . DC  I  5 15  ? -65.207 -36.465 35.436  1.00 143.02 ? -58  DC  I "O4'" 1 
ATOM   6300  C  "C3'" . DC  I  5 15  ? -65.858 -34.741 33.895  1.00 143.01 ? -58  DC  I "C3'" 1 
ATOM   6301  O  "O3'" . DC  I  5 15  ? -65.521 -33.406 34.265  1.00 142.49 ? -58  DC  I "O3'" 1 
ATOM   6302  C  "C2'" . DC  I  5 15  ? -64.667 -35.525 33.333  1.00 142.93 ? -58  DC  I "C2'" 1 
ATOM   6303  C  "C1'" . DC  I  5 15  ? -64.109 -36.233 34.568  1.00 142.72 ? -58  DC  I "C1'" 1 
ATOM   6304  N  N1    . DC  I  5 15  ? -63.442 -37.541 34.266  1.00 142.51 ? -58  DC  I N1    1 
ATOM   6305  C  C2    . DC  I  5 15  ? -62.065 -37.588 33.993  1.00 142.53 ? -58  DC  I C2    1 
ATOM   6306  O  O2    . DC  I  5 15  ? -61.399 -36.546 34.001  1.00 142.67 ? -58  DC  I O2    1 
ATOM   6307  N  N3    . DC  I  5 15  ? -61.488 -38.790 33.724  1.00 142.72 ? -58  DC  I N3    1 
ATOM   6308  C  C4    . DC  I  5 15  ? -62.223 -39.908 33.719  1.00 142.66 ? -58  DC  I C4    1 
ATOM   6309  N  N4    . DC  I  5 15  ? -61.606 -41.063 33.448  1.00 142.53 ? -58  DC  I N4    1 
ATOM   6310  C  C5    . DC  I  5 15  ? -63.626 -39.882 33.991  1.00 142.60 ? -58  DC  I C5    1 
ATOM   6311  C  C6    . DC  I  5 15  ? -64.183 -38.692 34.254  1.00 142.43 ? -58  DC  I C6    1 
ATOM   6312  P  P     . DT  I  5 16  ? -65.276 -32.263 33.170  1.00 142.01 ? -57  DT  I P     1 
ATOM   6313  O  OP1   . DT  I  5 16  ? -65.610 -30.972 33.816  1.00 142.20 ? -57  DT  I OP1   1 
ATOM   6314  O  OP2   . DT  I  5 16  ? -65.932 -32.656 31.901  1.00 141.85 ? -57  DT  I OP2   1 
ATOM   6315  O  "O5'" . DT  I  5 16  ? -63.693 -32.327 32.931  1.00 142.24 ? -57  DT  I "O5'" 1 
ATOM   6316  C  "C5'" . DT  I  5 16  ? -62.794 -32.193 34.030  1.00 141.93 ? -57  DT  I "C5'" 1 
ATOM   6317  C  "C4'" . DT  I  5 16  ? -61.358 -32.284 33.550  1.00 141.82 ? -57  DT  I "C4'" 1 
ATOM   6318  O  "O4'" . DT  I  5 16  ? -61.040 -33.666 33.264  1.00 142.13 ? -57  DT  I "O4'" 1 
ATOM   6319  C  "C3'" . DT  I  5 16  ? -61.019 -31.473 32.298  1.00 141.61 ? -57  DT  I "C3'" 1 
ATOM   6320  O  "O3'" . DT  I  5 16  ? -59.920 -30.590 32.588  1.00 140.43 ? -57  DT  I "O3'" 1 
ATOM   6321  C  "C2'" . DT  I  5 16  ? -60.689 -32.535 31.243  1.00 141.97 ? -57  DT  I "C2'" 1 
ATOM   6322  C  "C1'" . DT  I  5 16  ? -60.239 -33.716 32.103  1.00 142.55 ? -57  DT  I "C1'" 1 
ATOM   6323  N  N1    . DT  I  5 16  ? -60.391 -35.068 31.467  1.00 142.65 ? -57  DT  I N1    1 
ATOM   6324  C  C2    . DT  I  5 16  ? -59.304 -35.930 31.425  1.00 142.95 ? -57  DT  I C2    1 
ATOM   6325  O  O2    . DT  I  5 16  ? -58.200 -35.668 31.875  1.00 143.06 ? -57  DT  I O2    1 
ATOM   6326  N  N3    . DT  I  5 16  ? -59.552 -37.140 30.821  1.00 143.15 ? -57  DT  I N3    1 
ATOM   6327  C  C4    . DT  I  5 16  ? -60.749 -37.570 30.271  1.00 143.02 ? -57  DT  I C4    1 
ATOM   6328  O  O4    . DT  I  5 16  ? -60.858 -38.680 29.756  1.00 142.88 ? -57  DT  I O4    1 
ATOM   6329  C  C5    . DT  I  5 16  ? -61.845 -36.623 30.351  1.00 143.04 ? -57  DT  I C5    1 
ATOM   6330  C  C7    . DT  I  5 16  ? -63.199 -36.962 29.793  1.00 143.04 ? -57  DT  I C7    1 
ATOM   6331  C  C6    . DT  I  5 16  ? -61.616 -35.436 30.937  1.00 142.67 ? -57  DT  I C6    1 
ATOM   6332  P  P     . DT  I  5 17  ? -59.502 -29.346 31.656  1.00 139.22 ? -56  DT  I P     1 
ATOM   6333  O  OP1   . DT  I  5 17  ? -59.614 -28.127 32.495  1.00 138.58 ? -56  DT  I OP1   1 
ATOM   6334  O  OP2   . DT  I  5 17  ? -60.222 -29.433 30.358  1.00 138.68 ? -56  DT  I OP2   1 
ATOM   6335  O  "O5'" . DT  I  5 17  ? -57.945 -29.627 31.358  1.00 138.64 ? -56  DT  I "O5'" 1 
ATOM   6336  C  "C5'" . DT  I  5 17  ? -57.200 -30.643 32.063  1.00 137.05 ? -56  DT  I "C5'" 1 
ATOM   6337  C  "C4'" . DT  I  5 17  ? -56.162 -31.339 31.184  1.00 135.96 ? -56  DT  I "C4'" 1 
ATOM   6338  O  "O4'" . DT  I  5 17  ? -56.701 -32.575 30.637  1.00 136.26 ? -56  DT  I "O4'" 1 
ATOM   6339  C  "C3'" . DT  I  5 17  ? -55.633 -30.539 29.989  1.00 134.82 ? -56  DT  I "C3'" 1 
ATOM   6340  O  "O3'" . DT  I  5 17  ? -54.227 -30.717 29.893  1.00 131.79 ? -56  DT  I "O3'" 1 
ATOM   6341  C  "C2'" . DT  I  5 17  ? -56.340 -31.173 28.792  1.00 135.70 ? -56  DT  I "C2'" 1 
ATOM   6342  C  "C1'" . DT  I  5 17  ? -56.390 -32.630 29.253  1.00 136.99 ? -56  DT  I "C1'" 1 
ATOM   6343  N  N1    . DT  I  5 17  ? -57.381 -33.520 28.540  1.00 137.38 ? -56  DT  I N1    1 
ATOM   6344  C  C2    . DT  I  5 17  ? -57.181 -34.893 28.541  1.00 137.38 ? -56  DT  I C2    1 
ATOM   6345  O  O2    . DT  I  5 17  ? -56.239 -35.452 29.084  1.00 137.51 ? -56  DT  I O2    1 
ATOM   6346  N  N3    . DT  I  5 17  ? -58.138 -35.607 27.863  1.00 137.44 ? -56  DT  I N3    1 
ATOM   6347  C  C4    . DT  I  5 17  ? -59.252 -35.109 27.202  1.00 137.59 ? -56  DT  I C4    1 
ATOM   6348  O  O4    . DT  I  5 17  ? -60.042 -35.857 26.633  1.00 137.61 ? -56  DT  I O4    1 
ATOM   6349  C  C5    . DT  I  5 17  ? -59.407 -33.667 27.237  1.00 137.71 ? -56  DT  I C5    1 
ATOM   6350  C  C7    . DT  I  5 17  ? -60.568 -32.984 26.564  1.00 137.41 ? -56  DT  I C7    1 
ATOM   6351  C  C6    . DT  I  5 17  ? -58.477 -32.957 27.895  1.00 137.75 ? -56  DT  I C6    1 
ATOM   6352  P  P     . DG  I  5 18  ? -53.187 -29.503 30.028  1.00 128.98 ? -55  DG  I P     1 
ATOM   6353  O  OP1   . DG  I  5 18  ? -53.409 -28.825 31.331  1.00 128.40 ? -55  DG  I OP1   1 
ATOM   6354  O  OP2   . DG  I  5 18  ? -53.253 -28.726 28.762  1.00 128.77 ? -55  DG  I OP2   1 
ATOM   6355  O  "O5'" . DG  I  5 18  ? -51.792 -30.306 30.084  1.00 126.44 ? -55  DG  I "O5'" 1 
ATOM   6356  C  "C5'" . DG  I  5 18  ? -51.705 -31.622 30.691  1.00 122.32 ? -55  DG  I "C5'" 1 
ATOM   6357  C  "C4'" . DG  I  5 18  ? -51.206 -32.730 29.756  1.00 119.72 ? -55  DG  I "C4'" 1 
ATOM   6358  O  "O4'" . DG  I  5 18  ? -52.258 -33.231 28.890  1.00 119.32 ? -55  DG  I "O4'" 1 
ATOM   6359  C  "C3'" . DG  I  5 18  ? -50.057 -32.424 28.793  1.00 117.96 ? -55  DG  I "C3'" 1 
ATOM   6360  O  "O3'" . DG  I  5 18  ? -49.300 -33.623 28.680  1.00 114.49 ? -55  DG  I "O3'" 1 
ATOM   6361  C  "C2'" . DG  I  5 18  ? -50.767 -32.104 27.476  1.00 118.32 ? -55  DG  I "C2'" 1 
ATOM   6362  C  "C1'" . DG  I  5 18  ? -51.866 -33.153 27.527  1.00 119.70 ? -55  DG  I "C1'" 1 
ATOM   6363  N  N9    . DG  I  5 18  ? -53.095 -32.863 26.805  1.00 120.11 ? -55  DG  I N9    1 
ATOM   6364  C  C8    . DG  I  5 18  ? -53.598 -31.651 26.388  1.00 120.45 ? -55  DG  I C8    1 
ATOM   6365  N  N7    . DG  I  5 18  ? -54.756 -31.745 25.790  1.00 120.50 ? -55  DG  I N7    1 
ATOM   6366  C  C5    . DG  I  5 18  ? -55.040 -33.105 25.823  1.00 120.41 ? -55  DG  I C5    1 
ATOM   6367  C  C6    . DG  I  5 18  ? -56.162 -33.823 25.333  1.00 120.44 ? -55  DG  I C6    1 
ATOM   6368  O  O6    . DG  I  5 18  ? -57.162 -33.379 24.745  1.00 120.29 ? -55  DG  I O6    1 
ATOM   6369  N  N1    . DG  I  5 18  ? -56.045 -35.198 25.577  1.00 120.45 ? -55  DG  I N1    1 
ATOM   6370  C  C2    . DG  I  5 18  ? -54.981 -35.802 26.218  1.00 120.28 ? -55  DG  I C2    1 
ATOM   6371  N  N2    . DG  I  5 18  ? -55.044 -37.130 26.367  1.00 120.25 ? -55  DG  I N2    1 
ATOM   6372  N  N3    . DG  I  5 18  ? -53.928 -35.142 26.685  1.00 120.28 ? -55  DG  I N3    1 
ATOM   6373  C  C4    . DG  I  5 18  ? -54.028 -33.805 26.451  1.00 120.37 ? -55  DG  I C4    1 
ATOM   6374  P  P     . DC  I  5 19  ? -47.776 -33.618 28.219  1.00 111.68 ? -54  DC  I P     1 
ATOM   6375  O  OP1   . DC  I  5 19  ? -46.966 -33.279 29.407  1.00 112.36 ? -54  DC  I OP1   1 
ATOM   6376  O  OP2   . DC  I  5 19  ? -47.647 -32.825 26.972  1.00 111.54 ? -54  DC  I OP2   1 
ATOM   6377  O  "O5'" . DC  I  5 19  ? -47.539 -35.150 27.833  1.00 112.47 ? -54  DC  I "O5'" 1 
ATOM   6378  C  "C5'" . DC  I  5 19  ? -47.794 -36.212 28.757  1.00 112.96 ? -54  DC  I "C5'" 1 
ATOM   6379  C  "C4'" . DC  I  5 19  ? -48.321 -37.452 28.045  1.00 113.27 ? -54  DC  I "C4'" 1 
ATOM   6380  O  "O4'" . DC  I  5 19  ? -49.540 -37.129 27.342  1.00 113.13 ? -54  DC  I "O4'" 1 
ATOM   6381  C  "C3'" . DC  I  5 19  ? -47.413 -38.131 27.019  1.00 114.09 ? -54  DC  I "C3'" 1 
ATOM   6382  O  "O3'" . DC  I  5 19  ? -47.562 -39.544 27.173  1.00 115.57 ? -54  DC  I "O3'" 1 
ATOM   6383  C  "C2'" . DC  I  5 19  ? -47.936 -37.621 25.673  1.00 113.28 ? -54  DC  I "C2'" 1 
ATOM   6384  C  "C1'" . DC  I  5 19  ? -49.430 -37.486 25.972  1.00 113.23 ? -54  DC  I "C1'" 1 
ATOM   6385  N  N1    . DC  I  5 19  ? -50.247 -36.477 25.189  1.00 113.35 ? -54  DC  I N1    1 
ATOM   6386  C  C2    . DC  I  5 19  ? -51.419 -36.915 24.533  1.00 113.36 ? -54  DC  I C2    1 
ATOM   6387  O  O2    . DC  I  5 19  ? -51.743 -38.116 24.584  1.00 112.89 ? -54  DC  I O2    1 
ATOM   6388  N  N3    . DC  I  5 19  ? -52.168 -36.008 23.844  1.00 112.89 ? -54  DC  I N3    1 
ATOM   6389  C  C4    . DC  I  5 19  ? -51.803 -34.725 23.807  1.00 112.87 ? -54  DC  I C4    1 
ATOM   6390  N  N4    . DC  I  5 19  ? -52.583 -33.891 23.116  1.00 113.05 ? -54  DC  I N4    1 
ATOM   6391  C  C5    . DC  I  5 19  ? -50.625 -34.252 24.469  1.00 113.03 ? -54  DC  I C5    1 
ATOM   6392  C  C6    . DC  I  5 19  ? -49.889 -35.150 25.145  1.00 113.20 ? -54  DC  I C6    1 
ATOM   6393  P  P     . DG  I  5 20  ? -46.459 -40.597 26.672  1.00 117.26 ? -53  DG  I P     1 
ATOM   6394  O  OP1   . DG  I  5 20  ? -46.701 -41.838 27.445  1.00 116.39 ? -53  DG  I OP1   1 
ATOM   6395  O  OP2   . DG  I  5 20  ? -45.121 -39.956 26.667  1.00 116.98 ? -53  DG  I OP2   1 
ATOM   6396  O  "O5'" . DG  I  5 20  ? -46.816 -40.840 25.126  1.00 118.11 ? -53  DG  I "O5'" 1 
ATOM   6397  C  "C5'" . DG  I  5 20  ? -48.104 -41.292 24.671  1.00 119.21 ? -53  DG  I "C5'" 1 
ATOM   6398  C  "C4'" . DG  I  5 20  ? -48.262 -41.063 23.172  1.00 120.08 ? -53  DG  I "C4'" 1 
ATOM   6399  O  "O4'" . DG  I  5 20  ? -48.741 -39.713 22.923  1.00 119.94 ? -53  DG  I "O4'" 1 
ATOM   6400  C  "C3'" . DG  I  5 20  ? -46.981 -41.221 22.349  1.00 121.34 ? -53  DG  I "C3'" 1 
ATOM   6401  O  "O3'" . DG  I  5 20  ? -47.247 -41.949 21.160  1.00 123.27 ? -53  DG  I "O3'" 1 
ATOM   6402  C  "C2'" . DG  I  5 20  ? -46.565 -39.783 22.038  1.00 120.94 ? -53  DG  I "C2'" 1 
ATOM   6403  C  "C1'" . DG  I  5 20  ? -47.932 -39.110 21.928  1.00 120.10 ? -53  DG  I "C1'" 1 
ATOM   6404  N  N9    . DG  I  5 20  ? -47.956 -37.637 22.021  1.00 120.15 ? -53  DG  I N9    1 
ATOM   6405  C  C8    . DG  I  5 20  ? -46.998 -36.747 22.492  1.00 120.02 ? -53  DG  I C8    1 
ATOM   6406  N  N7    . DG  I  5 20  ? -47.345 -35.483 22.425  1.00 119.51 ? -53  DG  I N7    1 
ATOM   6407  C  C5    . DG  I  5 20  ? -48.617 -35.539 21.863  1.00 119.89 ? -53  DG  I C5    1 
ATOM   6408  C  C6    . DG  I  5 20  ? -49.522 -34.502 21.529  1.00 119.99 ? -53  DG  I C6    1 
ATOM   6409  O  O6    . DG  I  5 20  ? -49.363 -33.282 21.680  1.00 120.04 ? -53  DG  I O6    1 
ATOM   6410  N  N1    . DG  I  5 20  ? -50.710 -34.996 20.973  1.00 119.95 ? -53  DG  I N1    1 
ATOM   6411  C  C2    . DG  I  5 20  ? -50.990 -36.331 20.770  1.00 119.74 ? -53  DG  I C2    1 
ATOM   6412  N  N2    . DG  I  5 20  ? -52.173 -36.639 20.229  1.00 119.94 ? -53  DG  I N2    1 
ATOM   6413  N  N3    . DG  I  5 20  ? -50.156 -37.310 21.071  1.00 119.67 ? -53  DG  I N3    1 
ATOM   6414  C  C4    . DG  I  5 20  ? -49.000 -36.846 21.610  1.00 119.95 ? -53  DG  I C4    1 
ATOM   6415  P  P     . DG  I  5 21  ? -46.436 -43.281 20.775  1.00 124.70 ? -52  DG  I P     1 
ATOM   6416  O  OP1   . DG  I  5 21  ? -46.687 -44.288 21.833  1.00 124.29 ? -52  DG  I OP1   1 
ATOM   6417  O  OP2   . DG  I  5 21  ? -45.047 -42.902 20.419  1.00 124.52 ? -52  DG  I OP2   1 
ATOM   6418  O  "O5'" . DG  I  5 21  ? -47.176 -43.725 19.419  1.00 126.96 ? -52  DG  I "O5'" 1 
ATOM   6419  C  "C5'" . DG  I  5 21  ? -48.608 -43.832 19.350  1.00 129.80 ? -52  DG  I "C5'" 1 
ATOM   6420  C  "C4'" . DG  I  5 21  ? -49.210 -42.980 18.234  1.00 132.40 ? -52  DG  I "C4'" 1 
ATOM   6421  O  "O4'" . DG  I  5 21  ? -49.323 -41.589 18.641  1.00 132.82 ? -52  DG  I "O4'" 1 
ATOM   6422  C  "C3'" . DG  I  5 21  ? -48.471 -42.969 16.889  1.00 134.08 ? -52  DG  I "C3'" 1 
ATOM   6423  O  "O3'" . DG  I  5 21  ? -49.424 -43.038 15.812  1.00 136.65 ? -52  DG  I "O3'" 1 
ATOM   6424  C  "C2'" . DG  I  5 21  ? -47.765 -41.620 16.919  1.00 133.85 ? -52  DG  I "C2'" 1 
ATOM   6425  C  "C1'" . DG  I  5 21  ? -48.897 -40.809 17.541  1.00 133.79 ? -52  DG  I "C1'" 1 
ATOM   6426  N  N9    . DG  I  5 21  ? -48.526 -39.467 17.974  1.00 133.94 ? -52  DG  I N9    1 
ATOM   6427  C  C8    . DG  I  5 21  ? -47.401 -39.087 18.667  1.00 134.08 ? -52  DG  I C8    1 
ATOM   6428  N  N7    . DG  I  5 21  ? -47.346 -37.806 18.909  1.00 134.17 ? -52  DG  I N7    1 
ATOM   6429  C  C5    . DG  I  5 21  ? -48.505 -37.304 18.331  1.00 134.09 ? -52  DG  I C5    1 
ATOM   6430  C  C6    . DG  I  5 21  ? -48.997 -35.976 18.269  1.00 133.98 ? -52  DG  I C6    1 
ATOM   6431  O  O6    . DG  I  5 21  ? -48.484 -34.947 18.725  1.00 133.97 ? -52  DG  I O6    1 
ATOM   6432  N  N1    . DG  I  5 21  ? -50.213 -35.902 17.591  1.00 133.95 ? -52  DG  I N1    1 
ATOM   6433  C  C2    . DG  I  5 21  ? -50.870 -36.979 17.041  1.00 133.95 ? -52  DG  I C2    1 
ATOM   6434  N  N2    . DG  I  5 21  ? -52.030 -36.722 16.422  1.00 134.02 ? -52  DG  I N2    1 
ATOM   6435  N  N3    . DG  I  5 21  ? -50.423 -38.227 17.094  1.00 133.98 ? -52  DG  I N3    1 
ATOM   6436  C  C4    . DG  I  5 21  ? -49.242 -38.316 17.754  1.00 133.95 ? -52  DG  I C4    1 
ATOM   6437  P  P     . DA  I  5 22  ? -48.998 -43.442 14.314  1.00 138.49 ? -51  DA  I P     1 
ATOM   6438  O  OP1   . DA  I  5 22  ? -48.505 -44.840 14.346  1.00 138.10 ? -51  DA  I OP1   1 
ATOM   6439  O  OP2   . DA  I  5 22  ? -48.102 -42.382 13.790  1.00 138.54 ? -51  DA  I OP2   1 
ATOM   6440  O  "O5'" . DA  I  5 22  ? -50.379 -43.410 13.483  1.00 139.48 ? -51  DA  I "O5'" 1 
ATOM   6441  C  "C5'" . DA  I  5 22  ? -51.359 -42.368 13.624  1.00 141.45 ? -51  DA  I "C5'" 1 
ATOM   6442  C  "C4'" . DA  I  5 22  ? -51.286 -41.273 12.557  1.00 143.23 ? -51  DA  I "C4'" 1 
ATOM   6443  O  "O4'" . DA  I  5 22  ? -51.042 -40.008 13.235  1.00 143.86 ? -51  DA  I "O4'" 1 
ATOM   6444  C  "C3'" . DA  I  5 22  ? -50.226 -41.411 11.449  1.00 144.16 ? -51  DA  I "C3'" 1 
ATOM   6445  O  "O3'" . DA  I  5 22  ? -50.813 -41.414 10.107  1.00 145.19 ? -51  DA  I "O3'" 1 
ATOM   6446  C  "C2'" . DA  I  5 22  ? -49.253 -40.262 11.715  1.00 144.33 ? -51  DA  I "C2'" 1 
ATOM   6447  C  "C1'" . DA  I  5 22  ? -50.042 -39.269 12.563  1.00 144.59 ? -51  DA  I "C1'" 1 
ATOM   6448  N  N9    . DA  I  5 22  ? -49.181 -38.565 13.517  1.00 144.76 ? -51  DA  I N9    1 
ATOM   6449  C  C8    . DA  I  5 22  ? -48.328 -39.126 14.430  1.00 144.83 ? -51  DA  I C8    1 
ATOM   6450  N  N7    . DA  I  5 22  ? -47.660 -38.254 15.147  1.00 144.93 ? -51  DA  I N7    1 
ATOM   6451  C  C5    . DA  I  5 22  ? -48.102 -37.030 14.672  1.00 144.90 ? -51  DA  I C5    1 
ATOM   6452  C  C6    . DA  I  5 22  ? -47.783 -35.698 15.018  1.00 144.84 ? -51  DA  I C6    1 
ATOM   6453  N  N6    . DA  I  5 22  ? -46.903 -35.371 15.967  1.00 144.81 ? -51  DA  I N6    1 
ATOM   6454  N  N1    . DA  I  5 22  ? -48.402 -34.702 14.345  1.00 144.98 ? -51  DA  I N1    1 
ATOM   6455  C  C2    . DA  I  5 22  ? -49.290 -35.020 13.391  1.00 144.99 ? -51  DA  I C2    1 
ATOM   6456  N  N3    . DA  I  5 22  ? -49.670 -36.232 12.978  1.00 144.87 ? -51  DA  I N3    1 
ATOM   6457  C  C4    . DA  I  5 22  ? -49.038 -37.203 13.664  1.00 144.84 ? -51  DA  I C4    1 
ATOM   6458  P  P     . DT  I  5 23  ? -50.420 -40.427 8.885   1.00 145.58 ? -50  DT  I P     1 
ATOM   6459  O  OP1   . DT  I  5 23  ? -51.235 -40.815 7.711   1.00 145.32 ? -50  DT  I OP1   1 
ATOM   6460  O  OP2   . DT  I  5 23  ? -48.945 -40.380 8.722   1.00 145.32 ? -50  DT  I OP2   1 
ATOM   6461  O  "O5'" . DT  I  5 23  ? -50.921 -39.008 9.451   1.00 145.99 ? -50  DT  I "O5'" 1 
ATOM   6462  C  "C5'" . DT  I  5 23  ? -52.212 -38.445 9.163   1.00 146.13 ? -50  DT  I "C5'" 1 
ATOM   6463  C  "C4'" . DT  I  5 23  ? -52.022 -37.076 8.526   1.00 146.41 ? -50  DT  I "C4'" 1 
ATOM   6464  O  "O4'" . DT  I  5 23  ? -51.230 -36.231 9.406   1.00 146.82 ? -50  DT  I "O4'" 1 
ATOM   6465  C  "C3'" . DT  I  5 23  ? -51.271 -37.128 7.198   1.00 146.37 ? -50  DT  I "C3'" 1 
ATOM   6466  O  "O3'" . DT  I  5 23  ? -51.809 -36.207 6.257   1.00 145.69 ? -50  DT  I "O3'" 1 
ATOM   6467  C  "C2'" . DT  I  5 23  ? -49.839 -36.761 7.575   1.00 146.72 ? -50  DT  I "C2'" 1 
ATOM   6468  C  "C1'" . DT  I  5 23  ? -50.062 -35.796 8.732   1.00 147.28 ? -50  DT  I "C1'" 1 
ATOM   6469  N  N1    . DT  I  5 23  ? -48.876 -35.739 9.649   1.00 147.48 ? -50  DT  I N1    1 
ATOM   6470  C  C2    . DT  I  5 23  ? -48.388 -34.499 10.017  1.00 147.65 ? -50  DT  I C2    1 
ATOM   6471  O  O2    . DT  I  5 23  ? -48.870 -33.439 9.651   1.00 147.71 ? -50  DT  I O2    1 
ATOM   6472  N  N3    . DT  I  5 23  ? -47.292 -34.549 10.840  1.00 147.74 ? -50  DT  I N3    1 
ATOM   6473  C  C4    . DT  I  5 23  ? -46.647 -35.672 11.326  1.00 147.64 ? -50  DT  I C4    1 
ATOM   6474  O  O4    . DT  I  5 23  ? -45.669 -35.592 12.064  1.00 147.72 ? -50  DT  I O4    1 
ATOM   6475  C  C5    . DT  I  5 23  ? -47.201 -36.934 10.901  1.00 147.54 ? -50  DT  I C5    1 
ATOM   6476  C  C7    . DT  I  5 23  ? -46.568 -38.211 11.369  1.00 147.54 ? -50  DT  I C7    1 
ATOM   6477  C  C6    . DT  I  5 23  ? -48.274 -36.911 10.093  1.00 147.37 ? -50  DT  I C6    1 
ATOM   6478  P  P     . DC  I  5 24  ? -51.122 -36.036 4.817   1.00 145.00 ? -49  DC  I P     1 
ATOM   6479  O  OP1   . DC  I  5 24  ? -52.196 -35.679 3.864   1.00 145.21 ? -49  DC  I OP1   1 
ATOM   6480  O  OP2   . DC  I  5 24  ? -50.249 -37.204 4.540   1.00 144.70 ? -49  DC  I OP2   1 
ATOM   6481  O  "O5'" . DC  I  5 24  ? -50.186 -34.760 5.029   1.00 144.62 ? -49  DC  I "O5'" 1 
ATOM   6482  C  "C5'" . DC  I  5 24  ? -50.746 -33.461 5.210   1.00 144.05 ? -49  DC  I "C5'" 1 
ATOM   6483  C  "C4'" . DC  I  5 24  ? -49.637 -32.426 5.278   1.00 143.53 ? -49  DC  I "C4'" 1 
ATOM   6484  O  "O4'" . DC  I  5 24  ? -48.766 -32.716 6.407   1.00 143.65 ? -49  DC  I "O4'" 1 
ATOM   6485  C  "C3'" . DC  I  5 24  ? -48.738 -32.382 4.044   1.00 142.93 ? -49  DC  I "C3'" 1 
ATOM   6486  O  "O3'" . DC  I  5 24  ? -48.412 -31.041 3.737   1.00 142.30 ? -49  DC  I "O3'" 1 
ATOM   6487  C  "C2'" . DC  I  5 24  ? -47.488 -33.129 4.495   1.00 143.25 ? -49  DC  I "C2'" 1 
ATOM   6488  C  "C1'" . DC  I  5 24  ? -47.424 -32.693 5.955   1.00 143.49 ? -49  DC  I "C1'" 1 
ATOM   6489  N  N1    . DC  I  5 24  ? -46.543 -33.538 6.829   1.00 143.49 ? -49  DC  I N1    1 
ATOM   6490  C  C2    . DC  I  5 24  ? -45.403 -32.964 7.419   1.00 143.53 ? -49  DC  I C2    1 
ATOM   6491  O  O2    . DC  I  5 24  ? -45.137 -31.771 7.215   1.00 143.45 ? -49  DC  I O2    1 
ATOM   6492  N  N3    . DC  I  5 24  ? -44.614 -33.741 8.206   1.00 143.56 ? -49  DC  I N3    1 
ATOM   6493  C  C4    . DC  I  5 24  ? -44.922 -35.028 8.409   1.00 143.45 ? -49  DC  I C4    1 
ATOM   6494  N  N4    . DC  I  5 24  ? -44.116 -35.753 9.191   1.00 143.43 ? -49  DC  I N4    1 
ATOM   6495  C  C5    . DC  I  5 24  ? -46.072 -35.631 7.815   1.00 143.29 ? -49  DC  I C5    1 
ATOM   6496  C  C6    . DC  I  5 24  ? -46.844 -34.856 7.044   1.00 143.27 ? -49  DC  I C6    1 
ATOM   6497  P  P     . DG  I  5 25  ? -48.110 -30.626 2.219   1.00 141.52 ? -48  DG  I P     1 
ATOM   6498  O  OP1   . DG  I  5 25  ? -49.434 -30.127 1.694   1.00 141.63 ? -48  DG  I OP1   1 
ATOM   6499  O  OP2   . DG  I  5 25  ? -47.394 -31.760 1.517   1.00 141.46 ? -48  DG  I OP2   1 
ATOM   6500  O  "O5'" . DG  I  5 25  ? -47.061 -29.389 2.345   1.00 141.12 ? -48  DG  I "O5'" 1 
ATOM   6501  C  "C5'" . DG  I  5 25  ? -47.014 -28.546 3.519   1.00 139.94 ? -48  DG  I "C5'" 1 
ATOM   6502  C  "C4'" . DG  I  5 25  ? -45.587 -28.267 3.988   1.00 138.89 ? -48  DG  I "C4'" 1 
ATOM   6503  O  "O4'" . DG  I  5 25  ? -45.100 -29.394 4.763   1.00 138.81 ? -48  DG  I "O4'" 1 
ATOM   6504  C  "C3'" . DG  I  5 25  ? -44.547 -28.025 2.893   1.00 138.19 ? -48  DG  I "C3'" 1 
ATOM   6505  O  "O3'" . DG  I  5 25  ? -43.678 -26.952 3.247   1.00 137.09 ? -48  DG  I "O3'" 1 
ATOM   6506  C  "C2'" . DG  I  5 25  ? -43.783 -29.343 2.842   1.00 138.50 ? -48  DG  I "C2'" 1 
ATOM   6507  C  "C1'" . DG  I  5 25  ? -43.811 -29.746 4.308   1.00 139.05 ? -48  DG  I "C1'" 1 
ATOM   6508  N  N9    . DG  I  5 25  ? -43.607 -31.171 4.536   1.00 139.18 ? -48  DG  I N9    1 
ATOM   6509  C  C8    . DG  I  5 25  ? -44.197 -32.212 3.862   1.00 139.12 ? -48  DG  I C8    1 
ATOM   6510  N  N7    . DG  I  5 25  ? -43.822 -33.383 4.287   1.00 139.20 ? -48  DG  I N7    1 
ATOM   6511  C  C5    . DG  I  5 25  ? -42.923 -33.099 5.306   1.00 139.16 ? -48  DG  I C5    1 
ATOM   6512  C  C6    . DG  I  5 25  ? -42.190 -33.971 6.144   1.00 139.12 ? -48  DG  I C6    1 
ATOM   6513  O  O6    . DG  I  5 25  ? -42.190 -35.207 6.137   1.00 139.23 ? -48  DG  I O6    1 
ATOM   6514  N  N1    . DG  I  5 25  ? -41.388 -33.284 7.055   1.00 139.19 ? -48  DG  I N1    1 
ATOM   6515  C  C2    . DG  I  5 25  ? -41.308 -31.914 7.149   1.00 139.27 ? -48  DG  I C2    1 
ATOM   6516  N  N2    . DG  I  5 25  ? -40.480 -31.429 8.089   1.00 139.28 ? -48  DG  I N2    1 
ATOM   6517  N  N3    . DG  I  5 25  ? -41.996 -31.083 6.369   1.00 139.30 ? -48  DG  I N3    1 
ATOM   6518  C  C4    . DG  I  5 25  ? -42.778 -31.741 5.474   1.00 139.17 ? -48  DG  I C4    1 
ATOM   6519  P  P     . DT  I  5 26  ? -42.828 -26.173 2.130   1.00 136.48 ? -47  DT  I P     1 
ATOM   6520  O  OP1   . DT  I  5 26  ? -43.433 -24.832 2.001   1.00 136.77 ? -47  DT  I OP1   1 
ATOM   6521  O  OP2   . DT  I  5 26  ? -42.659 -27.020 0.929   1.00 136.29 ? -47  DT  I OP2   1 
ATOM   6522  O  "O5'" . DT  I  5 26  ? -41.385 -26.024 2.794   1.00 136.29 ? -47  DT  I "O5'" 1 
ATOM   6523  C  "C5'" . DT  I  5 26  ? -41.168 -25.211 3.943   1.00 135.91 ? -47  DT  I "C5'" 1 
ATOM   6524  C  "C4'" . DT  I  5 26  ? -39.933 -25.704 4.674   1.00 135.60 ? -47  DT  I "C4'" 1 
ATOM   6525  O  "O4'" . DT  I  5 26  ? -40.044 -27.133 4.897   1.00 136.02 ? -47  DT  I "O4'" 1 
ATOM   6526  C  "C3'" . DT  I  5 26  ? -38.613 -25.487 3.931   1.00 135.23 ? -47  DT  I "C3'" 1 
ATOM   6527  O  "O3'" . DT  I  5 26  ? -37.617 -25.046 4.848   1.00 134.30 ? -47  DT  I "O3'" 1 
ATOM   6528  C  "C2'" . DT  I  5 26  ? -38.277 -26.865 3.361   1.00 135.72 ? -47  DT  I "C2'" 1 
ATOM   6529  C  "C1'" . DT  I  5 26  ? -38.875 -27.779 4.430   1.00 136.38 ? -47  DT  I "C1'" 1 
ATOM   6530  N  N1    . DT  I  5 26  ? -39.254 -29.162 3.986   1.00 136.47 ? -47  DT  I N1    1 
ATOM   6531  C  C2    . DT  I  5 26  ? -38.926 -30.232 4.797   1.00 136.48 ? -47  DT  I C2    1 
ATOM   6532  O  O2    . DT  I  5 26  ? -38.334 -30.125 5.856   1.00 136.48 ? -47  DT  I O2    1 
ATOM   6533  N  N3    . DT  I  5 26  ? -39.316 -31.457 4.314   1.00 136.74 ? -47  DT  I N3    1 
ATOM   6534  C  C4    . DT  I  5 26  ? -39.993 -31.719 3.134   1.00 136.78 ? -47  DT  I C4    1 
ATOM   6535  O  O4    . DT  I  5 26  ? -40.293 -32.866 2.807   1.00 136.77 ? -47  DT  I O4    1 
ATOM   6536  C  C5    . DT  I  5 26  ? -40.312 -30.553 2.332   1.00 136.65 ? -47  DT  I C5    1 
ATOM   6537  C  C7    . DT  I  5 26  ? -41.038 -30.689 1.024   1.00 136.44 ? -47  DT  I C7    1 
ATOM   6538  C  C6    . DT  I  5 26  ? -39.934 -29.350 2.793   1.00 136.54 ? -47  DT  I C6    1 
ATOM   6539  P  P     . DA  I  5 27  ? -37.464 -23.490 5.192   1.00 133.41 ? -46  DA  I P     1 
ATOM   6540  O  OP1   . DA  I  5 27  ? -38.736 -23.033 5.807   1.00 132.92 ? -46  DA  I OP1   1 
ATOM   6541  O  OP2   . DA  I  5 27  ? -36.919 -22.836 3.977   1.00 133.70 ? -46  DA  I OP2   1 
ATOM   6542  O  "O5'" . DA  I  5 27  ? -36.307 -23.406 6.296   1.00 131.83 ? -46  DA  I "O5'" 1 
ATOM   6543  C  "C5'" . DA  I  5 27  ? -36.397 -24.148 7.514   1.00 129.67 ? -46  DA  I "C5'" 1 
ATOM   6544  C  "C4'" . DA  I  5 27  ? -35.382 -25.287 7.523   1.00 128.07 ? -46  DA  I "C4'" 1 
ATOM   6545  O  "O4'" . DA  I  5 27  ? -35.678 -26.256 6.479   1.00 127.60 ? -46  DA  I "O4'" 1 
ATOM   6546  C  "C3'" . DA  I  5 27  ? -33.918 -24.896 7.318   1.00 126.82 ? -46  DA  I "C3'" 1 
ATOM   6547  O  "O3'" . DA  I  5 27  ? -33.144 -25.663 8.222   1.00 124.60 ? -46  DA  I "O3'" 1 
ATOM   6548  C  "C2'" . DA  I  5 27  ? -33.631 -25.321 5.877   1.00 127.07 ? -46  DA  I "C2'" 1 
ATOM   6549  C  "C1'" . DA  I  5 27  ? -34.459 -26.600 5.850   1.00 127.53 ? -46  DA  I "C1'" 1 
ATOM   6550  N  N9    . DA  I  5 27  ? -34.735 -27.167 4.534   1.00 127.52 ? -46  DA  I N9    1 
ATOM   6551  C  C8    . DA  I  5 27  ? -34.677 -26.551 3.314   1.00 127.55 ? -46  DA  I C8    1 
ATOM   6552  N  N7    . DA  I  5 27  ? -34.984 -27.341 2.314   1.00 127.62 ? -46  DA  I N7    1 
ATOM   6553  C  C5    . DA  I  5 27  ? -35.260 -28.557 2.923   1.00 127.62 ? -46  DA  I C5    1 
ATOM   6554  C  C6    . DA  I  5 27  ? -35.650 -29.818 2.417   1.00 127.73 ? -46  DA  I C6    1 
ATOM   6555  N  N6    . DA  I  5 27  ? -35.835 -30.057 1.114   1.00 127.73 ? -46  DA  I N6    1 
ATOM   6556  N  N1    . DA  I  5 27  ? -35.844 -30.828 3.300   1.00 127.65 ? -46  DA  I N1    1 
ATOM   6557  C  C2    . DA  I  5 27  ? -35.652 -30.592 4.603   1.00 127.52 ? -46  DA  I C2    1 
ATOM   6558  N  N3    . DA  I  5 27  ? -35.294 -29.453 5.195   1.00 127.70 ? -46  DA  I N3    1 
ATOM   6559  C  C4    . DA  I  5 27  ? -35.110 -28.467 4.293   1.00 127.57 ? -46  DA  I C4    1 
ATOM   6560  P  P     . DG  I  5 28  ? -31.831 -25.043 8.885   1.00 123.08 ? -45  DG  I P     1 
ATOM   6561  O  OP1   . DG  I  5 28  ? -32.329 -24.066 9.883   1.00 122.95 ? -45  DG  I OP1   1 
ATOM   6562  O  OP2   . DG  I  5 28  ? -30.876 -24.648 7.811   1.00 122.01 ? -45  DG  I OP2   1 
ATOM   6563  O  "O5'" . DG  I  5 28  ? -31.176 -26.271 9.681   1.00 121.37 ? -45  DG  I "O5'" 1 
ATOM   6564  C  "C5'" . DG  I  5 28  ? -31.878 -27.501 9.879   1.00 118.32 ? -45  DG  I "C5'" 1 
ATOM   6565  C  "C4'" . DG  I  5 28  ? -31.238 -28.643 9.106   1.00 115.82 ? -45  DG  I "C4'" 1 
ATOM   6566  O  "O4'" . DG  I  5 28  ? -31.765 -28.683 7.754   1.00 116.31 ? -45  DG  I "O4'" 1 
ATOM   6567  C  "C3'" . DG  I  5 28  ? -29.718 -28.583 8.959   1.00 113.78 ? -45  DG  I "C3'" 1 
ATOM   6568  O  "O3'" . DG  I  5 28  ? -29.201 -29.872 9.190   1.00 110.16 ? -45  DG  I "O3'" 1 
ATOM   6569  C  "C2'" . DG  I  5 28  ? -29.504 -28.207 7.501   1.00 114.66 ? -45  DG  I "C2'" 1 
ATOM   6570  C  "C1'" . DG  I  5 28  ? -30.679 -28.957 6.890   1.00 116.56 ? -45  DG  I "C1'" 1 
ATOM   6571  N  N9    . DG  I  5 28  ? -30.998 -28.613 5.505   1.00 116.87 ? -45  DG  I N9    1 
ATOM   6572  C  C8    . DG  I  5 28  ? -30.837 -27.402 4.871   1.00 117.01 ? -45  DG  I C8    1 
ATOM   6573  N  N7    . DG  I  5 28  ? -31.212 -27.412 3.621   1.00 117.05 ? -45  DG  I N7    1 
ATOM   6574  C  C5    . DG  I  5 28  ? -31.639 -28.717 3.415   1.00 117.08 ? -45  DG  I C5    1 
ATOM   6575  C  C6    . DG  I  5 28  ? -32.155 -29.333 2.250   1.00 117.24 ? -45  DG  I C6    1 
ATOM   6576  O  O6    . DG  I  5 28  ? -32.340 -28.819 1.137   1.00 117.37 ? -45  DG  I O6    1 
ATOM   6577  N  N1    . DG  I  5 28  ? -32.478 -30.676 2.460   1.00 116.98 ? -45  DG  I N1    1 
ATOM   6578  C  C2    . DG  I  5 28  ? -32.317 -31.338 3.653   1.00 116.86 ? -45  DG  I C2    1 
ATOM   6579  N  N2    . DG  I  5 28  ? -32.683 -32.624 3.664   1.00 117.10 ? -45  DG  I N2    1 
ATOM   6580  N  N3    . DG  I  5 28  ? -31.835 -30.775 4.753   1.00 116.75 ? -45  DG  I N3    1 
ATOM   6581  C  C4    . DG  I  5 28  ? -31.517 -29.469 4.563   1.00 116.86 ? -45  DG  I C4    1 
ATOM   6582  P  P     . DA  I  5 29  ? -27.949 -30.106 10.153  1.00 106.73 ? -44  DA  I P     1 
ATOM   6583  O  OP1   . DA  I  5 29  ? -28.453 -29.936 11.533  1.00 106.12 ? -44  DA  I OP1   1 
ATOM   6584  O  OP2   . DA  I  5 29  ? -26.773 -29.342 9.664   1.00 105.70 ? -44  DA  I OP2   1 
ATOM   6585  O  "O5'" . DA  I  5 29  ? -27.640 -31.650 9.879   1.00 106.25 ? -44  DA  I "O5'" 1 
ATOM   6586  C  "C5'" . DA  I  5 29  ? -28.678 -32.631 9.784   1.00 105.34 ? -44  DA  I "C5'" 1 
ATOM   6587  C  "C4'" . DA  I  5 29  ? -28.402 -33.584 8.629   1.00 105.22 ? -44  DA  I "C4'" 1 
ATOM   6588  O  "O4'" . DA  I  5 29  ? -28.811 -32.952 7.390   1.00 105.59 ? -44  DA  I "O4'" 1 
ATOM   6589  C  "C3'" . DA  I  5 29  ? -26.941 -33.991 8.427   1.00 104.88 ? -44  DA  I "C3'" 1 
ATOM   6590  O  "O3'" . DA  I  5 29  ? -26.811 -35.423 8.318   1.00 103.66 ? -44  DA  I "O3'" 1 
ATOM   6591  C  "C2'" . DA  I  5 29  ? -26.537 -33.248 7.149   1.00 105.71 ? -44  DA  I "C2'" 1 
ATOM   6592  C  "C1'" . DA  I  5 29  ? -27.854 -33.207 6.389   1.00 106.86 ? -44  DA  I "C1'" 1 
ATOM   6593  N  N9    . DA  I  5 29  ? -27.987 -32.147 5.392   1.00 107.40 ? -44  DA  I N9    1 
ATOM   6594  C  C8    . DA  I  5 29  ? -27.668 -30.826 5.547   1.00 107.95 ? -44  DA  I C8    1 
ATOM   6595  N  N7    . DA  I  5 29  ? -27.906 -30.088 4.490   1.00 108.27 ? -44  DA  I N7    1 
ATOM   6596  C  C5    . DA  I  5 29  ? -28.425 -30.987 3.573   1.00 108.14 ? -44  DA  I C5    1 
ATOM   6597  C  C6    . DA  I  5 29  ? -28.884 -30.830 2.247   1.00 107.80 ? -44  DA  I C6    1 
ATOM   6598  N  N6    . DA  I  5 29  ? -28.880 -29.663 1.598   1.00 107.75 ? -44  DA  I N6    1 
ATOM   6599  N  N1    . DA  I  5 29  ? -29.335 -31.926 1.608   1.00 107.76 ? -44  DA  I N1    1 
ATOM   6600  C  C2    . DA  I  5 29  ? -29.335 -33.102 2.254   1.00 107.99 ? -44  DA  I C2    1 
ATOM   6601  N  N3    . DA  I  5 29  ? -28.934 -33.374 3.497   1.00 108.14 ? -44  DA  I N3    1 
ATOM   6602  C  C4    . DA  I  5 29  ? -28.486 -32.263 4.112   1.00 107.87 ? -44  DA  I C4    1 
ATOM   6603  P  P     . DA  I  5 30  ? -25.379 -36.154 8.240   1.00 102.93 ? -43  DA  I P     1 
ATOM   6604  O  OP1   . DA  I  5 30  ? -25.356 -37.156 9.332   1.00 101.79 ? -43  DA  I OP1   1 
ATOM   6605  O  OP2   . DA  I  5 30  ? -24.307 -35.137 8.061   1.00 102.14 ? -43  DA  I OP2   1 
ATOM   6606  O  "O5'" . DA  I  5 30  ? -25.401 -36.943 6.855   1.00 103.58 ? -43  DA  I "O5'" 1 
ATOM   6607  C  "C5'" . DA  I  5 30  ? -26.589 -37.581 6.393   1.00 105.41 ? -43  DA  I "C5'" 1 
ATOM   6608  C  "C4'" . DA  I  5 30  ? -26.491 -37.737 4.893   1.00 106.40 ? -43  DA  I "C4'" 1 
ATOM   6609  O  "O4'" . DA  I  5 30  ? -26.782 -36.465 4.271   1.00 106.38 ? -43  DA  I "O4'" 1 
ATOM   6610  C  "C3'" . DA  I  5 30  ? -25.104 -38.149 4.411   1.00 107.62 ? -43  DA  I "C3'" 1 
ATOM   6611  O  "O3'" . DA  I  5 30  ? -25.244 -39.214 3.490   1.00 109.35 ? -43  DA  I "O3'" 1 
ATOM   6612  C  "C2'" . DA  I  5 30  ? -24.537 -36.890 3.758   1.00 107.31 ? -43  DA  I "C2'" 1 
ATOM   6613  C  "C1'" . DA  I  5 30  ? -25.816 -36.223 3.274   1.00 107.88 ? -43  DA  I "C1'" 1 
ATOM   6614  N  N9    . DA  I  5 30  ? -25.711 -34.784 3.092   1.00 108.30 ? -43  DA  I N9    1 
ATOM   6615  C  C8    . DA  I  5 30  ? -25.297 -33.852 4.006   1.00 108.57 ? -43  DA  I C8    1 
ATOM   6616  N  N7    . DA  I  5 30  ? -25.309 -32.619 3.559   1.00 108.78 ? -43  DA  I N7    1 
ATOM   6617  C  C5    . DA  I  5 30  ? -25.766 -32.756 2.254   1.00 109.04 ? -43  DA  I C5    1 
ATOM   6618  C  C6    . DA  I  5 30  ? -26.006 -31.822 1.225   1.00 108.72 ? -43  DA  I C6    1 
ATOM   6619  N  N6    . DA  I  5 30  ? -25.807 -30.506 1.363   1.00 108.46 ? -43  DA  I N6    1 
ATOM   6620  N  N1    . DA  I  5 30  ? -26.457 -32.298 0.041   1.00 108.74 ? -43  DA  I N1    1 
ATOM   6621  C  C2    . DA  I  5 30  ? -26.657 -33.615 -0.108  1.00 108.50 ? -43  DA  I C2    1 
ATOM   6622  N  N3    . DA  I  5 30  ? -26.469 -34.585 0.783   1.00 108.69 ? -43  DA  I N3    1 
ATOM   6623  C  C4    . DA  I  5 30  ? -26.020 -34.085 1.951   1.00 108.80 ? -43  DA  I C4    1 
ATOM   6624  P  P     . DA  I  5 31  ? -23.992 -40.068 2.965   1.00 111.08 ? -42  DA  I P     1 
ATOM   6625  O  OP1   . DA  I  5 31  ? -24.453 -41.480 2.970   1.00 110.89 ? -42  DA  I OP1   1 
ATOM   6626  O  OP2   . DA  I  5 31  ? -22.729 -39.676 3.639   1.00 110.52 ? -42  DA  I OP2   1 
ATOM   6627  O  "O5'" . DA  I  5 31  ? -23.842 -39.537 1.464   1.00 112.69 ? -42  DA  I "O5'" 1 
ATOM   6628  C  "C5'" . DA  I  5 31  ? -24.877 -39.755 0.510   1.00 115.39 ? -42  DA  I "C5'" 1 
ATOM   6629  C  "C4'" . DA  I  5 31  ? -24.436 -39.194 -0.829  1.00 117.80 ? -42  DA  I "C4'" 1 
ATOM   6630  O  "O4'" . DA  I  5 31  ? -24.515 -37.748 -0.788  1.00 117.87 ? -42  DA  I "O4'" 1 
ATOM   6631  C  "C3'" . DA  I  5 31  ? -23.005 -39.543 -1.238  1.00 119.23 ? -42  DA  I "C3'" 1 
ATOM   6632  O  "O3'" . DA  I  5 31  ? -22.999 -39.925 -2.609  1.00 121.79 ? -42  DA  I "O3'" 1 
ATOM   6633  C  "C2'" . DA  I  5 31  ? -22.216 -38.257 -0.986  1.00 118.95 ? -42  DA  I "C2'" 1 
ATOM   6634  C  "C1'" . DA  I  5 31  ? -23.282 -37.187 -1.189  1.00 118.77 ? -42  DA  I "C1'" 1 
ATOM   6635  N  N9    . DA  I  5 31  ? -23.113 -35.994 -0.373  1.00 118.96 ? -42  DA  I N9    1 
ATOM   6636  C  C8    . DA  I  5 31  ? -22.923 -35.940 0.978   1.00 119.05 ? -42  DA  I C8    1 
ATOM   6637  N  N7    . DA  I  5 31  ? -22.818 -34.727 1.454   1.00 119.01 ? -42  DA  I N7    1 
ATOM   6638  C  C5    . DA  I  5 31  ? -22.956 -33.930 0.334   1.00 119.02 ? -42  DA  I C5    1 
ATOM   6639  C  C6    . DA  I  5 31  ? -22.943 -32.535 0.160   1.00 118.89 ? -42  DA  I C6    1 
ATOM   6640  N  N6    . DA  I  5 31  ? -22.771 -31.687 1.173   1.00 119.04 ? -42  DA  I N6    1 
ATOM   6641  N  N1    . DA  I  5 31  ? -23.109 -32.045 -1.087  1.00 118.95 ? -42  DA  I N1    1 
ATOM   6642  C  C2    . DA  I  5 31  ? -23.281 -32.907 -2.102  1.00 119.09 ? -42  DA  I C2    1 
ATOM   6643  N  N3    . DA  I  5 31  ? -23.314 -34.241 -2.063  1.00 119.15 ? -42  DA  I N3    1 
ATOM   6644  C  C4    . DA  I  5 31  ? -23.144 -34.692 -0.804  1.00 119.14 ? -42  DA  I C4    1 
ATOM   6645  P  P     . DA  I  5 32  ? -21.726 -40.605 -3.302  1.00 123.81 ? -41  DA  I P     1 
ATOM   6646  O  OP1   . DA  I  5 32  ? -22.254 -41.665 -4.188  1.00 124.13 ? -41  DA  I OP1   1 
ATOM   6647  O  OP2   . DA  I  5 32  ? -20.702 -40.928 -2.279  1.00 123.65 ? -41  DA  I OP2   1 
ATOM   6648  O  "O5'" . DA  I  5 32  ? -21.111 -39.439 -4.198  1.00 125.34 ? -41  DA  I "O5'" 1 
ATOM   6649  C  "C5'" . DA  I  5 32  ? -21.943 -38.488 -4.854  1.00 128.98 ? -41  DA  I "C5'" 1 
ATOM   6650  C  "C4'" . DA  I  5 32  ? -21.066 -37.515 -5.628  1.00 131.65 ? -41  DA  I "C4'" 1 
ATOM   6651  O  "O4'" . DA  I  5 32  ? -21.020 -36.230 -4.953  1.00 132.63 ? -41  DA  I "O4'" 1 
ATOM   6652  C  "C3'" . DA  I  5 32  ? -19.612 -37.949 -5.784  1.00 133.16 ? -41  DA  I "C3'" 1 
ATOM   6653  O  "O3'" . DA  I  5 32  ? -19.164 -37.555 -7.084  1.00 134.98 ? -41  DA  I "O3'" 1 
ATOM   6654  C  "C2'" . DA  I  5 32  ? -18.905 -37.235 -4.627  1.00 133.25 ? -41  DA  I "C2'" 1 
ATOM   6655  C  "C1'" . DA  I  5 32  ? -19.697 -35.935 -4.535  1.00 133.49 ? -41  DA  I "C1'" 1 
ATOM   6656  N  N9    . DA  I  5 32  ? -19.734 -35.349 -3.194  1.00 133.80 ? -41  DA  I N9    1 
ATOM   6657  C  C8    . DA  I  5 32  ? -19.819 -36.013 -1.998  1.00 133.83 ? -41  DA  I C8    1 
ATOM   6658  N  N7    . DA  I  5 32  ? -19.838 -35.226 -0.949  1.00 133.93 ? -41  DA  I N7    1 
ATOM   6659  C  C5    . DA  I  5 32  ? -19.759 -33.955 -1.495  1.00 134.01 ? -41  DA  I C5    1 
ATOM   6660  C  C6    . DA  I  5 32  ? -19.733 -32.670 -0.912  1.00 133.91 ? -41  DA  I C6    1 
ATOM   6661  N  N6    . DA  I  5 32  ? -19.786 -32.480 0.410   1.00 133.78 ? -41  DA  I N6    1 
ATOM   6662  N  N1    . DA  I  5 32  ? -19.649 -31.594 -1.733  1.00 133.82 ? -41  DA  I N1    1 
ATOM   6663  C  C2    . DA  I  5 32  ? -19.594 -31.794 -3.058  1.00 133.73 ? -41  DA  I C2    1 
ATOM   6664  N  N3    . DA  I  5 32  ? -19.611 -32.954 -3.720  1.00 133.85 ? -41  DA  I N3    1 
ATOM   6665  C  C4    . DA  I  5 32  ? -19.694 -34.007 -2.877  1.00 133.94 ? -41  DA  I C4    1 
ATOM   6666  P  P     . DA  I  5 33  ? -17.616 -37.475 -7.489  1.00 136.02 ? -40  DA  I P     1 
ATOM   6667  O  OP1   . DA  I  5 33  ? -17.546 -37.512 -8.967  1.00 136.40 ? -40  DA  I OP1   1 
ATOM   6668  O  OP2   . DA  I  5 33  ? -16.858 -38.477 -6.700  1.00 135.85 ? -40  DA  I OP2   1 
ATOM   6669  O  "O5'" . DA  I  5 33  ? -17.215 -36.000 -7.013  1.00 137.21 ? -40  DA  I "O5'" 1 
ATOM   6670  C  "C5'" . DA  I  5 33  ? -17.861 -34.848 -7.579  1.00 139.00 ? -40  DA  I "C5'" 1 
ATOM   6671  C  "C4'" . DA  I  5 33  ? -16.979 -33.604 -7.522  1.00 140.37 ? -40  DA  I "C4'" 1 
ATOM   6672  O  "O4'" . DA  I  5 33  ? -17.001 -33.022 -6.192  1.00 140.68 ? -40  DA  I "O4'" 1 
ATOM   6673  C  "C3'" . DA  I  5 33  ? -15.509 -33.825 -7.864  1.00 141.23 ? -40  DA  I "C3'" 1 
ATOM   6674  O  "O3'" . DA  I  5 33  ? -15.021 -32.733 -8.636  1.00 142.26 ? -40  DA  I "O3'" 1 
ATOM   6675  C  "C2'" . DA  I  5 33  ? -14.818 -33.911 -6.503  1.00 141.26 ? -40  DA  I "C2'" 1 
ATOM   6676  C  "C1'" . DA  I  5 33  ? -15.716 -33.067 -5.597  1.00 140.95 ? -40  DA  I "C1'" 1 
ATOM   6677  N  N9    . DA  I  5 33  ? -15.859 -33.578 -4.231  1.00 140.97 ? -40  DA  I N9    1 
ATOM   6678  C  C8    . DA  I  5 33  ? -15.869 -34.888 -3.832  1.00 140.95 ? -40  DA  I C8    1 
ATOM   6679  N  N7    . DA  I  5 33  ? -16.018 -35.059 -2.543  1.00 140.81 ? -40  DA  I N7    1 
ATOM   6680  C  C5    . DA  I  5 33  ? -16.113 -33.770 -2.062  1.00 140.75 ? -40  DA  I C5    1 
ATOM   6681  C  C6    . DA  I  5 33  ? -16.285 -33.267 -0.763  1.00 140.87 ? -40  DA  I C6    1 
ATOM   6682  N  N6    . DA  I  5 33  ? -16.389 -34.065 0.304   1.00 140.87 ? -40  DA  I N6    1 
ATOM   6683  N  N1    . DA  I  5 33  ? -16.341 -31.923 -0.611  1.00 140.99 ? -40  DA  I N1    1 
ATOM   6684  C  C2    . DA  I  5 33  ? -16.238 -31.136 -1.692  1.00 140.88 ? -40  DA  I C2    1 
ATOM   6685  N  N3    . DA  I  5 33  ? -16.073 -31.501 -2.963  1.00 140.84 ? -40  DA  I N3    1 
ATOM   6686  C  C4    . DA  I  5 33  ? -16.019 -32.840 -3.082  1.00 140.79 ? -40  DA  I C4    1 
ATOM   6687  P  P     . DG  I  5 34  ? -13.767 -32.923 -9.613  1.00 142.92 ? -39  DG  I P     1 
ATOM   6688  O  OP1   . DG  I  5 34  ? -14.219 -32.562 -10.981 1.00 142.63 ? -39  DG  I OP1   1 
ATOM   6689  O  OP2   . DG  I  5 34  ? -13.150 -34.246 -9.347  1.00 142.82 ? -39  DG  I OP2   1 
ATOM   6690  O  "O5'" . DG  I  5 34  ? -12.742 -31.815 -9.075  1.00 143.43 ? -39  DG  I "O5'" 1 
ATOM   6691  C  "C5'" . DG  I  5 34  ? -13.020 -30.423 -9.234  1.00 143.85 ? -39  DG  I "C5'" 1 
ATOM   6692  C  "C4'" . DG  I  5 34  ? -12.513 -29.627 -8.043  1.00 144.17 ? -39  DG  I "C4'" 1 
ATOM   6693  O  "O4'" . DG  I  5 34  ? -12.988 -30.215 -6.803  1.00 144.42 ? -39  DG  I "O4'" 1 
ATOM   6694  C  "C3'" . DG  I  5 34  ? -10.993 -29.528 -7.910  1.00 144.10 ? -39  DG  I "C3'" 1 
ATOM   6695  O  "O3'" . DG  I  5 34  ? -10.666 -28.136 -7.807  1.00 143.52 ? -39  DG  I "O3'" 1 
ATOM   6696  C  "C2'" . DG  I  5 34  ? -10.675 -30.334 -6.643  1.00 144.24 ? -39  DG  I "C2'" 1 
ATOM   6697  C  "C1'" . DG  I  5 34  ? -11.955 -30.114 -5.843  1.00 144.72 ? -39  DG  I "C1'" 1 
ATOM   6698  N  N9    . DG  I  5 34  ? -12.234 -31.057 -4.756  1.00 144.90 ? -39  DG  I N9    1 
ATOM   6699  C  C8    . DG  I  5 34  ? -12.333 -32.428 -4.839  1.00 144.93 ? -39  DG  I C8    1 
ATOM   6700  N  N7    . DG  I  5 34  ? -12.610 -33.012 -3.705  1.00 144.85 ? -39  DG  I N7    1 
ATOM   6701  C  C5    . DG  I  5 34  ? -12.701 -31.958 -2.807  1.00 144.88 ? -39  DG  I C5    1 
ATOM   6702  C  C6    . DG  I  5 34  ? -12.977 -31.975 -1.420  1.00 144.76 ? -39  DG  I C6    1 
ATOM   6703  O  O6    . DG  I  5 34  ? -13.199 -32.961 -0.712  1.00 144.73 ? -39  DG  I O6    1 
ATOM   6704  N  N1    . DG  I  5 34  ? -12.983 -30.692 -0.868  1.00 144.89 ? -39  DG  I N1    1 
ATOM   6705  C  C2    . DG  I  5 34  ? -12.746 -29.535 -1.581  1.00 144.88 ? -39  DG  I C2    1 
ATOM   6706  N  N2    . DG  I  5 34  ? -12.786 -28.386 -0.891  1.00 144.87 ? -39  DG  I N2    1 
ATOM   6707  N  N3    . DG  I  5 34  ? -12.482 -29.505 -2.883  1.00 144.73 ? -39  DG  I N3    1 
ATOM   6708  C  C4    . DG  I  5 34  ? -12.477 -30.748 -3.433  1.00 144.84 ? -39  DG  I C4    1 
ATOM   6709  P  P     . DT  I  5 35  ? -9.181  -27.594 -7.544  1.00 143.10 ? -38  DT  I P     1 
ATOM   6710  O  OP1   . DT  I  5 35  ? -9.092  -26.251 -8.164  1.00 143.06 ? -38  DT  I OP1   1 
ATOM   6711  O  OP2   . DT  I  5 35  ? -8.195  -28.640 -7.905  1.00 143.18 ? -38  DT  I OP2   1 
ATOM   6712  O  "O5'" . DT  I  5 35  ? -9.153  -27.458 -5.951  1.00 142.39 ? -38  DT  I "O5'" 1 
ATOM   6713  C  "C5'" . DT  I  5 35  ? -9.696  -26.313 -5.288  1.00 141.08 ? -38  DT  I "C5'" 1 
ATOM   6714  C  "C4'" . DT  I  5 35  ? -8.851  -25.935 -4.077  1.00 139.94 ? -38  DT  I "C4'" 1 
ATOM   6715  O  "O4'" . DT  I  5 35  ? -9.104  -26.851 -2.977  1.00 140.12 ? -38  DT  I "O4'" 1 
ATOM   6716  C  "C3'" . DT  I  5 35  ? -7.341  -25.937 -4.301  1.00 138.86 ? -38  DT  I "C3'" 1 
ATOM   6717  O  "O3'" . DT  I  5 35  ? -6.819  -24.722 -3.745  1.00 136.97 ? -38  DT  I "O3'" 1 
ATOM   6718  C  "C2'" . DT  I  5 35  ? -6.858  -27.236 -3.640  1.00 139.15 ? -38  DT  I "C2'" 1 
ATOM   6719  C  "C1'" . DT  I  5 35  ? -7.922  -27.524 -2.578  1.00 139.90 ? -38  DT  I "C1'" 1 
ATOM   6720  N  N1    . DT  I  5 35  ? -8.279  -28.978 -2.397  1.00 139.93 ? -38  DT  I N1    1 
ATOM   6721  C  C2    . DT  I  5 35  ? -9.136  -29.360 -1.371  1.00 139.98 ? -38  DT  I C2    1 
ATOM   6722  O  O2    . DT  I  5 35  ? -9.631  -28.589 -0.569  1.00 140.10 ? -38  DT  I O2    1 
ATOM   6723  N  N3    . DT  I  5 35  ? -9.399  -30.707 -1.307  1.00 139.95 ? -38  DT  I N3    1 
ATOM   6724  C  C4    . DT  I  5 35  ? -8.907  -31.694 -2.147  1.00 140.11 ? -38  DT  I C4    1 
ATOM   6725  O  O4    . DT  I  5 35  ? -9.217  -32.874 -1.989  1.00 139.89 ? -38  DT  I O4    1 
ATOM   6726  C  C5    . DT  I  5 35  ? -8.018  -31.229 -3.202  1.00 140.22 ? -38  DT  I C5    1 
ATOM   6727  C  C7    . DT  I  5 35  ? -7.401  -32.173 -4.197  1.00 140.23 ? -38  DT  I C7    1 
ATOM   6728  C  C6    . DT  I  5 35  ? -7.757  -29.916 -3.272  1.00 140.06 ? -38  DT  I C6    1 
ATOM   6729  P  P     . DG  I  5 36  ? -5.395  -24.595 -3.019  1.00 135.47 ? -37  DG  I P     1 
ATOM   6730  O  OP1   . DG  I  5 36  ? -5.025  -23.158 -3.007  1.00 135.28 ? -37  DG  I OP1   1 
ATOM   6731  O  OP2   . DG  I  5 36  ? -4.443  -25.589 -3.578  1.00 135.13 ? -37  DG  I OP2   1 
ATOM   6732  O  "O5'" . DG  I  5 36  ? -5.778  -25.069 -1.536  1.00 134.10 ? -37  DG  I "O5'" 1 
ATOM   6733  C  "C5'" . DG  I  5 36  ? -6.146  -24.159 -0.493  1.00 130.91 ? -37  DG  I "C5'" 1 
ATOM   6734  C  "C4'" . DG  I  5 36  ? -5.503  -24.580 0.824   1.00 128.33 ? -37  DG  I "C4'" 1 
ATOM   6735  O  "O4'" . DG  I  5 36  ? -5.793  -25.963 1.150   1.00 127.93 ? -37  DG  I "O4'" 1 
ATOM   6736  C  "C3'" . DG  I  5 36  ? -3.983  -24.485 0.904   1.00 126.75 ? -37  DG  I "C3'" 1 
ATOM   6737  O  "O3'" . DG  I  5 36  ? -3.647  -24.149 2.238   1.00 124.07 ? -37  DG  I "O3'" 1 
ATOM   6738  C  "C2'" . DG  I  5 36  ? -3.512  -25.899 0.556   1.00 127.20 ? -37  DG  I "C2'" 1 
ATOM   6739  C  "C1'" . DG  I  5 36  ? -4.602  -26.729 1.229   1.00 127.88 ? -37  DG  I "C1'" 1 
ATOM   6740  N  N9    . DG  I  5 36  ? -4.949  -28.004 0.612   1.00 127.96 ? -37  DG  I N9    1 
ATOM   6741  C  C8    . DG  I  5 36  ? -4.759  -28.427 -0.683  1.00 128.15 ? -37  DG  I C8    1 
ATOM   6742  N  N7    . DG  I  5 36  ? -5.219  -29.626 -0.914  1.00 128.16 ? -37  DG  I N7    1 
ATOM   6743  C  C5    . DG  I  5 36  ? -5.760  -30.016 0.305   1.00 128.21 ? -37  DG  I C5    1 
ATOM   6744  C  C6    . DG  I  5 36  ? -6.408  -31.220 0.687   1.00 128.17 ? -37  DG  I C6    1 
ATOM   6745  O  O6    . DG  I  5 36  ? -6.636  -32.218 -0.009  1.00 128.04 ? -37  DG  I O6    1 
ATOM   6746  N  N1    . DG  I  5 36  ? -6.804  -31.201 2.027   1.00 128.26 ? -37  DG  I N1    1 
ATOM   6747  C  C2    . DG  I  5 36  ? -6.597  -30.148 2.894   1.00 128.27 ? -37  DG  I C2    1 
ATOM   6748  N  N2    . DG  I  5 36  ? -7.042  -30.297 4.150   1.00 128.07 ? -37  DG  I N2    1 
ATOM   6749  N  N3    . DG  I  5 36  ? -5.996  -29.017 2.546   1.00 128.34 ? -37  DG  I N3    1 
ATOM   6750  C  C4    . DG  I  5 36  ? -5.605  -29.023 1.247   1.00 128.12 ? -37  DG  I C4    1 
ATOM   6751  P  P     . DT  I  5 37  ? -3.690  -22.636 2.756   1.00 121.91 ? -36  DT  I P     1 
ATOM   6752  O  OP1   . DT  I  5 37  ? -4.864  -21.926 2.186   1.00 121.90 ? -36  DT  I OP1   1 
ATOM   6753  O  OP2   . DT  I  5 37  ? -2.319  -22.125 2.524   1.00 122.27 ? -36  DT  I OP2   1 
ATOM   6754  O  "O5'" . DT  I  5 37  ? -3.898  -22.758 4.345   1.00 119.70 ? -36  DT  I "O5'" 1 
ATOM   6755  C  "C5'" . DT  I  5 37  ? -4.909  -23.604 4.903   1.00 116.54 ? -36  DT  I "C5'" 1 
ATOM   6756  C  "C4'" . DT  I  5 37  ? -4.335  -24.684 5.814   1.00 113.80 ? -36  DT  I "C4'" 1 
ATOM   6757  O  "O4'" . DT  I  5 37  ? -4.187  -25.932 5.090   1.00 112.67 ? -36  DT  I "O4'" 1 
ATOM   6758  C  "C3'" . DT  I  5 37  ? -2.966  -24.415 6.445   1.00 112.59 ? -36  DT  I "C3'" 1 
ATOM   6759  O  "O3'" . DT  I  5 37  ? -2.993  -24.839 7.801   1.00 111.41 ? -36  DT  I "O3'" 1 
ATOM   6760  C  "C2'" . DT  I  5 37  ? -2.033  -25.304 5.631   1.00 112.32 ? -36  DT  I "C2'" 1 
ATOM   6761  C  "C1'" . DT  I  5 37  ? -2.956  -26.502 5.475   1.00 112.27 ? -36  DT  I "C1'" 1 
ATOM   6762  N  N1    . DT  I  5 37  ? -2.580  -27.527 4.462   1.00 112.13 ? -36  DT  I N1    1 
ATOM   6763  C  C2    . DT  I  5 37  ? -3.180  -28.772 4.540   1.00 111.97 ? -36  DT  I C2    1 
ATOM   6764  O  O2    . DT  I  5 37  ? -3.993  -29.090 5.391   1.00 111.56 ? -36  DT  I O2    1 
ATOM   6765  N  N3    . DT  I  5 37  ? -2.784  -29.651 3.562   1.00 112.35 ? -36  DT  I N3    1 
ATOM   6766  C  C4    . DT  I  5 37  ? -1.876  -29.425 2.539   1.00 112.23 ? -36  DT  I C4    1 
ATOM   6767  O  O4    . DT  I  5 37  ? -1.606  -30.304 1.728   1.00 112.02 ? -36  DT  I O4    1 
ATOM   6768  C  C5    . DT  I  5 37  ? -1.283  -28.101 2.510   1.00 112.31 ? -36  DT  I C5    1 
ATOM   6769  C  C7    . DT  I  5 37  ? -0.278  -27.713 1.457   1.00 112.15 ? -36  DT  I C7    1 
ATOM   6770  C  C6    . DT  I  5 37  ? -1.663  -27.230 3.464   1.00 112.40 ? -36  DT  I C6    1 
ATOM   6771  P  P     . DG  I  5 38  ? -3.380  -23.846 8.997   1.00 110.23 ? -35  DG  I P     1 
ATOM   6772  O  OP1   . DG  I  5 38  ? -4.632  -23.137 8.630   1.00 110.07 ? -35  DG  I OP1   1 
ATOM   6773  O  OP2   . DG  I  5 38  ? -2.124  -23.122 9.321   1.00 109.87 ? -35  DG  I OP2   1 
ATOM   6774  O  "O5'" . DG  I  5 38  ? -3.736  -24.816 10.217  1.00 108.36 ? -35  DG  I "O5'" 1 
ATOM   6775  C  "C5'" . DG  I  5 38  ? -4.853  -25.696 10.117  1.00 106.62 ? -35  DG  I "C5'" 1 
ATOM   6776  C  "C4'" . DG  I  5 38  ? -4.646  -26.997 10.881  1.00 105.40 ? -35  DG  I "C4'" 1 
ATOM   6777  O  "O4'" . DG  I  5 38  ? -3.983  -27.997 10.068  1.00 105.30 ? -35  DG  I "O4'" 1 
ATOM   6778  C  "C3'" . DG  I  5 38  ? -3.858  -26.963 12.188  1.00 104.75 ? -35  DG  I "C3'" 1 
ATOM   6779  O  "O3'" . DG  I  5 38  ? -4.586  -27.829 13.056  1.00 103.53 ? -35  DG  I "O3'" 1 
ATOM   6780  C  "C2'" . DG  I  5 38  ? -2.461  -27.464 11.816  1.00 105.27 ? -35  DG  I "C2'" 1 
ATOM   6781  C  "C1'" . DG  I  5 38  ? -2.719  -28.346 10.601  1.00 105.97 ? -35  DG  I "C1'" 1 
ATOM   6782  N  N9    . DG  I  5 38  ? -1.820  -28.140 9.480   1.00 106.11 ? -35  DG  I N9    1 
ATOM   6783  C  C8    . DG  I  5 38  ? -1.081  -27.028 9.151   1.00 106.55 ? -35  DG  I C8    1 
ATOM   6784  N  N7    . DG  I  5 38  ? -0.388  -27.160 8.052   1.00 106.49 ? -35  DG  I N7    1 
ATOM   6785  C  C5    . DG  I  5 38  ? -0.699  -28.441 7.624   1.00 106.59 ? -35  DG  I C5    1 
ATOM   6786  C  C6    . DG  I  5 38  ? -0.260  -29.154 6.483   1.00 106.60 ? -35  DG  I C6    1 
ATOM   6787  O  O6    . DG  I  5 38  ? 0.521   -28.775 5.600   1.00 106.40 ? -35  DG  I O6    1 
ATOM   6788  N  N1    . DG  I  5 38  ? -0.827  -30.431 6.423   1.00 106.80 ? -35  DG  I N1    1 
ATOM   6789  C  C2    . DG  I  5 38  ? -1.711  -30.945 7.357   1.00 106.68 ? -35  DG  I C2    1 
ATOM   6790  N  N2    . DG  I  5 38  ? -2.162  -32.191 7.154   1.00 106.47 ? -35  DG  I N2    1 
ATOM   6791  N  N3    . DG  I  5 38  ? -2.127  -30.284 8.430   1.00 106.44 ? -35  DG  I N3    1 
ATOM   6792  C  C4    . DG  I  5 38  ? -1.583  -29.048 8.492   1.00 106.35 ? -35  DG  I C4    1 
ATOM   6793  P  P     . DT  I  5 39  ? -4.012  -28.627 14.306  1.00 100.90 ? -34  DT  I P     1 
ATOM   6794  O  OP1   . DT  I  5 39  ? -5.177  -28.893 15.170  1.00 100.90 ? -34  DT  I OP1   1 
ATOM   6795  O  OP2   . DT  I  5 39  ? -2.826  -27.925 14.841  1.00 101.16 ? -34  DT  I OP2   1 
ATOM   6796  O  "O5'" . DT  I  5 39  ? -3.500  -29.981 13.659  1.00 101.81 ? -34  DT  I "O5'" 1 
ATOM   6797  C  "C5'" . DT  I  5 39  ? -4.372  -30.944 13.076  1.00 103.18 ? -34  DT  I "C5'" 1 
ATOM   6798  C  "C4'" . DT  I  5 39  ? -3.572  -32.205 12.761  1.00 104.26 ? -34  DT  I "C4'" 1 
ATOM   6799  O  "O4'" . DT  I  5 39  ? -2.611  -31.952 11.695  1.00 104.27 ? -34  DT  I "O4'" 1 
ATOM   6800  C  "C3'" . DT  I  5 39  ? -2.735  -32.732 13.925  1.00 105.09 ? -34  DT  I "C3'" 1 
ATOM   6801  O  "O3'" . DT  I  5 39  ? -2.614  -34.144 13.842  1.00 106.18 ? -34  DT  I "O3'" 1 
ATOM   6802  C  "C2'" . DT  I  5 39  ? -1.379  -32.071 13.701  1.00 104.39 ? -34  DT  I "C2'" 1 
ATOM   6803  C  "C1'" . DT  I  5 39  ? -1.317  -32.246 12.188  1.00 104.75 ? -34  DT  I "C1'" 1 
ATOM   6804  N  N1    . DT  I  5 39  ? -0.284  -31.434 11.491  1.00 105.09 ? -34  DT  I N1    1 
ATOM   6805  C  C2    . DT  I  5 39  ? 0.110   -31.858 10.236  1.00 104.95 ? -34  DT  I C2    1 
ATOM   6806  O  O2    . DT  I  5 39  ? -0.355  -32.845 9.689   1.00 104.69 ? -34  DT  I O2    1 
ATOM   6807  N  N3    . DT  I  5 39  ? 1.071   -31.075 9.647   1.00 105.04 ? -34  DT  I N3    1 
ATOM   6808  C  C4    . DT  I  5 39  ? 1.659   -29.943 10.187  1.00 105.02 ? -34  DT  I C4    1 
ATOM   6809  O  O4    . DT  I  5 39  ? 2.514   -29.322 9.567   1.00 105.35 ? -34  DT  I O4    1 
ATOM   6810  C  C5    . DT  I  5 39  ? 1.203   -29.554 11.509  1.00 104.68 ? -34  DT  I C5    1 
ATOM   6811  C  C7    . DT  I  5 39  ? 1.764   -28.344 12.199  1.00 104.73 ? -34  DT  I C7    1 
ATOM   6812  C  C6    . DT  I  5 39  ? 0.262   -30.308 12.092  1.00 104.87 ? -34  DT  I C6    1 
ATOM   6813  P  P     . DC  I  5 40  ? -2.248  -34.995 15.150  1.00 106.49 ? -33  DC  I P     1 
ATOM   6814  O  OP1   . DC  I  5 40  ? -3.575  -35.245 15.764  1.00 106.34 ? -33  DC  I OP1   1 
ATOM   6815  O  OP2   . DC  I  5 40  ? -1.146  -34.368 15.937  1.00 104.34 ? -33  DC  I OP2   1 
ATOM   6816  O  "O5'" . DC  I  5 40  ? -1.660  -36.362 14.541  1.00 109.44 ? -33  DC  I "O5'" 1 
ATOM   6817  C  "C5'" . DC  I  5 40  ? -1.679  -36.671 13.128  1.00 112.49 ? -33  DC  I "C5'" 1 
ATOM   6818  C  "C4'" . DC  I  5 40  ? -0.307  -37.103 12.612  1.00 114.60 ? -33  DC  I "C4'" 1 
ATOM   6819  O  "O4'" . DC  I  5 40  ? 0.399   -35.957 12.050  1.00 115.19 ? -33  DC  I "O4'" 1 
ATOM   6820  C  "C3'" . DC  I  5 40  ? 0.636   -37.721 13.650  1.00 115.73 ? -33  DC  I "C3'" 1 
ATOM   6821  O  "O3'" . DC  I  5 40  ? 1.239   -38.900 13.107  1.00 116.85 ? -33  DC  I "O3'" 1 
ATOM   6822  C  "C2'" . DC  I  5 40  ? 1.656   -36.605 13.912  1.00 115.90 ? -33  DC  I "C2'" 1 
ATOM   6823  C  "C1'" . DC  I  5 40  ? 1.737   -35.962 12.524  1.00 115.86 ? -33  DC  I "C1'" 1 
ATOM   6824  N  N1    . DC  I  5 40  ? 2.338   -34.566 12.427  1.00 116.01 ? -33  DC  I N1    1 
ATOM   6825  C  C2    . DC  I  5 40  ? 3.153   -34.251 11.323  1.00 115.99 ? -33  DC  I C2    1 
ATOM   6826  O  O2    . DC  I  5 40  ? 3.365   -35.109 10.460  1.00 116.16 ? -33  DC  I O2    1 
ATOM   6827  N  N3    . DC  I  5 40  ? 3.696   -33.009 11.218  1.00 116.06 ? -33  DC  I N3    1 
ATOM   6828  C  C4    . DC  I  5 40  ? 3.453   -32.091 12.155  1.00 116.16 ? -33  DC  I C4    1 
ATOM   6829  N  N4    . DC  I  5 40  ? 4.024   -30.889 12.000  1.00 115.95 ? -33  DC  I N4    1 
ATOM   6830  C  C5    . DC  I  5 40  ? 2.633   -32.384 13.293  1.00 116.28 ? -33  DC  I C5    1 
ATOM   6831  C  C6    . DC  I  5 40  ? 2.100   -33.614 13.386  1.00 116.18 ? -33  DC  I C6    1 
ATOM   6832  P  P     . DA  I  5 41  ? 1.657   -40.152 14.025  1.00 117.83 ? -32  DA  I P     1 
ATOM   6833  O  OP1   . DA  I  5 41  ? 0.439   -40.988 14.187  1.00 116.95 ? -32  DA  I OP1   1 
ATOM   6834  O  OP2   . DA  I  5 41  ? 2.413   -39.681 15.216  1.00 117.17 ? -32  DA  I OP2   1 
ATOM   6835  O  "O5'" . DA  I  5 41  ? 2.729   -40.920 13.112  1.00 118.09 ? -32  DA  I "O5'" 1 
ATOM   6836  C  "C5'" . DA  I  5 41  ? 3.023   -40.517 11.773  1.00 118.67 ? -32  DA  I "C5'" 1 
ATOM   6837  C  "C4'" . DA  I  5 41  ? 4.508   -40.241 11.590  1.00 119.73 ? -32  DA  I "C4'" 1 
ATOM   6838  O  "O4'" . DA  I  5 41  ? 4.739   -38.816 11.708  1.00 119.58 ? -32  DA  I "O4'" 1 
ATOM   6839  C  "C3'" . DA  I  5 41  ? 5.496   -40.893 12.563  1.00 120.48 ? -32  DA  I "C3'" 1 
ATOM   6840  O  "O3'" . DA  I  5 41  ? 6.660   -41.286 11.829  1.00 122.30 ? -32  DA  I "O3'" 1 
ATOM   6841  C  "C2'" . DA  I  5 41  ? 5.823   -39.759 13.533  1.00 119.68 ? -32  DA  I "C2'" 1 
ATOM   6842  C  "C1'" . DA  I  5 41  ? 5.862   -38.607 12.537  1.00 119.51 ? -32  DA  I "C1'" 1 
ATOM   6843  N  N9    . DA  I  5 41  ? 5.734   -37.255 13.068  1.00 119.62 ? -32  DA  I N9    1 
ATOM   6844  C  C8    . DA  I  5 41  ? 5.087   -36.846 14.206  1.00 119.72 ? -32  DA  I C8    1 
ATOM   6845  N  N7    . DA  I  5 41  ? 5.130   -35.550 14.408  1.00 119.64 ? -32  DA  I N7    1 
ATOM   6846  C  C5    . DA  I  5 41  ? 5.851   -35.075 13.323  1.00 119.83 ? -32  DA  I C5    1 
ATOM   6847  C  C6    . DA  I  5 41  ? 6.257   -33.780 12.933  1.00 119.58 ? -32  DA  I C6    1 
ATOM   6848  N  N6    . DA  I  5 41  ? 5.976   -32.682 13.638  1.00 119.71 ? -32  DA  I N6    1 
ATOM   6849  N  N1    . DA  I  5 41  ? 6.969   -33.652 11.791  1.00 119.54 ? -32  DA  I N1    1 
ATOM   6850  C  C2    . DA  I  5 41  ? 7.263   -34.745 11.077  1.00 119.43 ? -32  DA  I C2    1 
ATOM   6851  N  N3    . DA  I  5 41  ? 6.937   -36.010 11.339  1.00 119.62 ? -32  DA  I N3    1 
ATOM   6852  C  C4    . DA  I  5 41  ? 6.227   -36.111 12.484  1.00 119.79 ? -32  DA  I C4    1 
ATOM   6853  P  P     . DA  I  5 42  ? 7.581   -42.531 12.246  1.00 123.33 ? -31  DA  I P     1 
ATOM   6854  O  OP1   . DA  I  5 42  ? 7.047   -43.690 11.492  1.00 123.12 ? -31  DA  I OP1   1 
ATOM   6855  O  OP2   . DA  I  5 42  ? 7.696   -42.571 13.724  1.00 123.25 ? -31  DA  I OP2   1 
ATOM   6856  O  "O5'" . DA  I  5 42  ? 9.042   -42.151 11.706  1.00 124.73 ? -31  DA  I "O5'" 1 
ATOM   6857  C  "C5'" . DA  I  5 42  ? 9.230   -41.123 10.734  1.00 127.70 ? -31  DA  I "C5'" 1 
ATOM   6858  C  "C4'" . DA  I  5 42  ? 10.365  -40.177 11.096  1.00 130.09 ? -31  DA  I "C4'" 1 
ATOM   6859  O  "O4'" . DA  I  5 42  ? 9.838   -38.910 11.574  1.00 130.62 ? -31  DA  I "O4'" 1 
ATOM   6860  C  "C3'" . DA  I  5 42  ? 11.342  -40.639 12.171  1.00 131.71 ? -31  DA  I "C3'" 1 
ATOM   6861  O  "O3'" . DA  I  5 42  ? 12.626  -40.256 11.739  1.00 134.45 ? -31  DA  I "O3'" 1 
ATOM   6862  C  "C2'" . DA  I  5 42  ? 10.931  -39.827 13.394  1.00 131.22 ? -31  DA  I "C2'" 1 
ATOM   6863  C  "C1'" . DA  I  5 42  ? 10.589  -38.511 12.705  1.00 130.85 ? -31  DA  I "C1'" 1 
ATOM   6864  N  N9    . DA  I  5 42  ? 9.829   -37.548 13.511  1.00 130.89 ? -31  DA  I N9    1 
ATOM   6865  C  C8    . DA  I  5 42  ? 8.785   -37.813 14.358  1.00 130.79 ? -31  DA  I C8    1 
ATOM   6866  N  N7    . DA  I  5 42  ? 8.295   -36.748 14.948  1.00 130.85 ? -31  DA  I N7    1 
ATOM   6867  C  C5    . DA  I  5 42  ? 9.067   -35.705 14.459  1.00 130.97 ? -31  DA  I C5    1 
ATOM   6868  C  C6    . DA  I  5 42  ? 9.057   -34.305 14.695  1.00 130.92 ? -31  DA  I C6    1 
ATOM   6869  N  N6    . DA  I  5 42  ? 8.202   -33.703 15.529  1.00 130.79 ? -31  DA  I N6    1 
ATOM   6870  N  N1    . DA  I  5 42  ? 9.967   -33.540 14.045  1.00 130.70 ? -31  DA  I N1    1 
ATOM   6871  C  C2    . DA  I  5 42  ? 10.827  -34.140 13.209  1.00 130.77 ? -31  DA  I C2    1 
ATOM   6872  N  N3    . DA  I  5 42  ? 10.933  -35.441 12.909  1.00 130.88 ? -31  DA  I N3    1 
ATOM   6873  C  C4    . DA  I  5 42  ? 10.017  -36.181 13.567  1.00 130.87 ? -31  DA  I C4    1 
ATOM   6874  P  P     . DA  I  5 43  ? 13.931  -41.068 12.172  1.00 136.74 ? -30  DA  I P     1 
ATOM   6875  O  OP1   . DA  I  5 43  ? 14.271  -41.975 11.052  1.00 136.66 ? -30  DA  I OP1   1 
ATOM   6876  O  OP2   . DA  I  5 43  ? 13.755  -41.603 13.546  1.00 136.72 ? -30  DA  I OP2   1 
ATOM   6877  O  "O5'" . DA  I  5 43  ? 15.024  -39.909 12.246  1.00 138.19 ? -30  DA  I "O5'" 1 
ATOM   6878  C  "C5'" . DA  I  5 43  ? 15.195  -38.995 11.165  1.00 140.99 ? -30  DA  I "C5'" 1 
ATOM   6879  C  "C4'" . DA  I  5 43  ? 15.640  -37.650 11.707  1.00 143.06 ? -30  DA  I "C4'" 1 
ATOM   6880  O  "O4'" . DA  I  5 43  ? 14.496  -36.991 12.313  1.00 143.95 ? -30  DA  I "O4'" 1 
ATOM   6881  C  "C3'" . DA  I  5 43  ? 16.724  -37.734 12.785  1.00 144.08 ? -30  DA  I "C3'" 1 
ATOM   6882  O  "O3'" . DA  I  5 43  ? 17.822  -36.860 12.496  1.00 145.23 ? -30  DA  I "O3'" 1 
ATOM   6883  C  "C2'" . DA  I  5 43  ? 15.983  -37.339 14.058  1.00 144.43 ? -30  DA  I "C2'" 1 
ATOM   6884  C  "C1'" . DA  I  5 43  ? 14.916  -36.398 13.524  1.00 144.92 ? -30  DA  I "C1'" 1 
ATOM   6885  N  N9    . DA  I  5 43  ? 13.805  -36.259 14.463  1.00 145.26 ? -30  DA  I N9    1 
ATOM   6886  C  C8    . DA  I  5 43  ? 12.983  -37.253 14.924  1.00 145.39 ? -30  DA  I C8    1 
ATOM   6887  N  N7    . DA  I  5 43  ? 12.075  -36.842 15.778  1.00 145.40 ? -30  DA  I N7    1 
ATOM   6888  C  C5    . DA  I  5 43  ? 12.321  -35.484 15.892  1.00 145.44 ? -30  DA  I C5    1 
ATOM   6889  C  C6    . DA  I  5 43  ? 11.703  -34.463 16.646  1.00 145.41 ? -30  DA  I C6    1 
ATOM   6890  N  N6    . DA  I  5 43  ? 10.664  -34.685 17.458  1.00 145.33 ? -30  DA  I N6    1 
ATOM   6891  N  N1    . DA  I  5 43  ? 12.189  -33.202 16.533  1.00 145.45 ? -30  DA  I N1    1 
ATOM   6892  C  C2    . DA  I  5 43  ? 13.233  -32.983 15.718  1.00 145.32 ? -30  DA  I C2    1 
ATOM   6893  N  N3    . DA  I  5 43  ? 13.896  -33.863 14.960  1.00 145.28 ? -30  DA  I N3    1 
ATOM   6894  C  C4    . DA  I  5 43  ? 13.389  -35.105 15.092  1.00 145.40 ? -30  DA  I C4    1 
ATOM   6895  P  P     . DC  I  5 44  ? 18.930  -36.452 13.596  1.00 146.08 ? -29  DC  I P     1 
ATOM   6896  O  OP1   . DC  I  5 44  ? 20.209  -36.242 12.875  1.00 146.48 ? -29  DC  I OP1   1 
ATOM   6897  O  OP2   . DC  I  5 44  ? 18.897  -37.411 14.734  1.00 145.77 ? -29  DC  I OP2   1 
ATOM   6898  O  "O5'" . DC  I  5 44  ? 18.382  -35.027 14.093  1.00 145.67 ? -29  DC  I "O5'" 1 
ATOM   6899  C  "C5'" . DC  I  5 44  ? 19.179  -33.842 13.959  1.00 144.92 ? -29  DC  I "C5'" 1 
ATOM   6900  C  "C4'" . DC  I  5 44  ? 19.286  -33.134 15.299  1.00 144.40 ? -29  DC  I "C4'" 1 
ATOM   6901  O  "O4'" . DC  I  5 44  ? 17.989  -33.170 15.952  1.00 144.61 ? -29  DC  I "O4'" 1 
ATOM   6902  C  "C3'" . DC  I  5 44  ? 20.290  -33.760 16.267  1.00 143.95 ? -29  DC  I "C3'" 1 
ATOM   6903  O  "O3'" . DC  I  5 44  ? 21.193  -32.750 16.784  1.00 142.79 ? -29  DC  I "O3'" 1 
ATOM   6904  C  "C2'" . DC  I  5 44  ? 19.409  -34.476 17.299  1.00 144.38 ? -29  DC  I "C2'" 1 
ATOM   6905  C  "C1'" . DC  I  5 44  ? 18.116  -33.660 17.274  1.00 144.83 ? -29  DC  I "C1'" 1 
ATOM   6906  N  N1    . DC  I  5 44  ? 16.852  -34.393 17.688  1.00 145.06 ? -29  DC  I N1    1 
ATOM   6907  C  C2    . DC  I  5 44  ? 15.926  -33.785 18.569  1.00 145.11 ? -29  DC  I C2    1 
ATOM   6908  O  O2    . DC  I  5 44  ? 16.137  -32.647 19.014  1.00 144.90 ? -29  DC  I O2    1 
ATOM   6909  N  N3    . DC  I  5 44  ? 14.803  -34.468 18.922  1.00 145.04 ? -29  DC  I N3    1 
ATOM   6910  C  C4    . DC  I  5 44  ? 14.583  -35.695 18.438  1.00 144.94 ? -29  DC  I C4    1 
ATOM   6911  N  N4    . DC  I  5 44  ? 13.466  -36.322 18.812  1.00 144.93 ? -29  DC  I N4    1 
ATOM   6912  C  C5    . DC  I  5 44  ? 15.501  -36.332 17.548  1.00 145.01 ? -29  DC  I C5    1 
ATOM   6913  C  C6    . DC  I  5 44  ? 16.604  -35.652 17.203  1.00 145.11 ? -29  DC  I C6    1 
ATOM   6914  P  P     . DT  I  5 45  ? 21.192  -32.132 18.273  1.00 142.00 ? -28  DT  I P     1 
ATOM   6915  O  OP1   . DT  I  5 45  ? 22.378  -31.250 18.395  1.00 141.82 ? -28  DT  I OP1   1 
ATOM   6916  O  OP2   . DT  I  5 45  ? 21.025  -33.245 19.236  1.00 141.95 ? -28  DT  I OP2   1 
ATOM   6917  O  "O5'" . DT  I  5 45  ? 19.860  -31.234 18.311  1.00 141.32 ? -28  DT  I "O5'" 1 
ATOM   6918  C  "C5'" . DT  I  5 45  ? 19.848  -29.855 18.729  1.00 139.75 ? -28  DT  I "C5'" 1 
ATOM   6919  C  "C4'" . DT  I  5 45  ? 19.451  -29.689 20.193  1.00 138.47 ? -28  DT  I "C4'" 1 
ATOM   6920  O  "O4'" . DT  I  5 45  ? 18.357  -30.576 20.551  1.00 138.52 ? -28  DT  I "O4'" 1 
ATOM   6921  C  "C3'" . DT  I  5 45  ? 20.565  -29.993 21.194  1.00 137.49 ? -28  DT  I "C3'" 1 
ATOM   6922  O  "O3'" . DT  I  5 45  ? 20.581  -29.001 22.198  1.00 135.30 ? -28  DT  I "O3'" 1 
ATOM   6923  C  "C2'" . DT  I  5 45  ? 20.197  -31.350 21.779  1.00 137.90 ? -28  DT  I "C2'" 1 
ATOM   6924  C  "C1'" . DT  I  5 45  ? 18.679  -31.241 21.760  1.00 138.44 ? -28  DT  I "C1'" 1 
ATOM   6925  N  N1    . DT  I  5 45  ? 17.949  -32.548 21.833  1.00 138.53 ? -28  DT  I N1    1 
ATOM   6926  C  C2    . DT  I  5 45  ? 16.799  -32.603 22.592  1.00 138.42 ? -28  DT  I C2    1 
ATOM   6927  O  O2    . DT  I  5 45  ? 16.365  -31.642 23.203  1.00 138.45 ? -28  DT  I O2    1 
ATOM   6928  N  N3    . DT  I  5 45  ? 16.180  -33.831 22.618  1.00 138.37 ? -28  DT  I N3    1 
ATOM   6929  C  C4    . DT  I  5 45  ? 16.593  -34.986 21.967  1.00 138.63 ? -28  DT  I C4    1 
ATOM   6930  O  O4    . DT  I  5 45  ? 15.966  -36.039 22.051  1.00 138.60 ? -28  DT  I O4    1 
ATOM   6931  C  C5    . DT  I  5 45  ? 17.809  -34.860 21.187  1.00 138.63 ? -28  DT  I C5    1 
ATOM   6932  C  C7    . DT  I  5 45  ? 18.361  -36.037 20.437  1.00 138.52 ? -28  DT  I C7    1 
ATOM   6933  C  C6    . DT  I  5 45  ? 18.419  -33.664 21.156  1.00 138.58 ? -28  DT  I C6    1 
ATOM   6934  P  P     . DG  I  5 46  ? 21.807  -27.983 22.204  1.00 133.80 ? -27  DG  I P     1 
ATOM   6935  O  OP1   . DG  I  5 46  ? 21.762  -27.255 20.915  1.00 133.41 ? -27  DG  I OP1   1 
ATOM   6936  O  OP2   . DG  I  5 46  ? 23.005  -28.773 22.583  1.00 133.81 ? -27  DG  I OP2   1 
ATOM   6937  O  "O5'" . DG  I  5 46  ? 21.484  -26.953 23.397  1.00 131.99 ? -27  DG  I "O5'" 1 
ATOM   6938  C  "C5'" . DG  I  5 46  ? 20.138  -26.606 23.763  1.00 128.65 ? -27  DG  I "C5'" 1 
ATOM   6939  C  "C4'" . DG  I  5 46  ? 19.730  -27.136 25.137  1.00 126.15 ? -27  DG  I "C4'" 1 
ATOM   6940  O  "O4'" . DG  I  5 46  ? 19.253  -28.504 25.034  1.00 126.03 ? -27  DG  I "O4'" 1 
ATOM   6941  C  "C3'" . DG  I  5 46  ? 20.803  -27.162 26.231  1.00 124.35 ? -27  DG  I "C3'" 1 
ATOM   6942  O  "O3'" . DG  I  5 46  ? 20.240  -26.667 27.448  1.00 121.49 ? -27  DG  I "O3'" 1 
ATOM   6943  C  "C2'" . DG  I  5 46  ? 21.160  -28.648 26.350  1.00 124.70 ? -27  DG  I "C2'" 1 
ATOM   6944  C  "C1'" . DG  I  5 46  ? 19.789  -29.265 26.098  1.00 125.73 ? -27  DG  I "C1'" 1 
ATOM   6945  N  N9    . DG  I  5 46  ? 19.734  -30.666 25.686  1.00 125.95 ? -27  DG  I N9    1 
ATOM   6946  C  C8    . DG  I  5 46  ? 20.730  -31.432 25.126  1.00 126.01 ? -27  DG  I C8    1 
ATOM   6947  N  N7    . DG  I  5 46  ? 20.357  -32.653 24.852  1.00 125.90 ? -27  DG  I N7    1 
ATOM   6948  C  C5    . DG  I  5 46  ? 19.028  -32.704 25.250  1.00 125.89 ? -27  DG  I C5    1 
ATOM   6949  C  C6    . DG  I  5 46  ? 18.092  -33.772 25.202  1.00 125.99 ? -27  DG  I C6    1 
ATOM   6950  O  O6    . DG  I  5 46  ? 18.260  -34.928 24.782  1.00 126.02 ? -27  DG  I O6    1 
ATOM   6951  N  N1    . DG  I  5 46  ? 16.842  -33.404 25.712  1.00 126.12 ? -27  DG  I N1    1 
ATOM   6952  C  C2    . DG  I  5 46  ? 16.534  -32.155 26.208  1.00 126.02 ? -27  DG  I C2    1 
ATOM   6953  N  N2    . DG  I  5 46  ? 15.281  -31.986 26.657  1.00 125.79 ? -27  DG  I N2    1 
ATOM   6954  N  N3    . DG  I  5 46  ? 17.402  -31.146 26.256  1.00 126.15 ? -27  DG  I N3    1 
ATOM   6955  C  C4    . DG  I  5 46  ? 18.627  -31.487 25.763  1.00 126.12 ? -27  DG  I C4    1 
ATOM   6956  P  P     . DC  I  5 47  ? 20.156  -25.101 27.799  1.00 119.36 ? -26  DC  I P     1 
ATOM   6957  O  OP1   . DC  I  5 47  ? 19.903  -24.339 26.542  1.00 118.86 ? -26  DC  I OP1   1 
ATOM   6958  O  OP2   . DC  I  5 47  ? 21.326  -24.785 28.654  1.00 118.73 ? -26  DC  I OP2   1 
ATOM   6959  O  "O5'" . DC  I  5 47  ? 18.884  -24.998 28.780  1.00 117.46 ? -26  DC  I "O5'" 1 
ATOM   6960  C  "C5'" . DC  I  5 47  ? 17.577  -24.583 28.334  1.00 114.09 ? -26  DC  I "C5'" 1 
ATOM   6961  C  "C4'" . DC  I  5 47  ? 16.454  -25.257 29.123  1.00 111.50 ? -26  DC  I "C4'" 1 
ATOM   6962  O  "O4'" . DC  I  5 47  ? 16.547  -26.698 28.959  1.00 111.36 ? -26  DC  I "O4'" 1 
ATOM   6963  C  "C3'" . DC  I  5 47  ? 16.415  -25.040 30.636  1.00 109.60 ? -26  DC  I "C3'" 1 
ATOM   6964  O  "O3'" . DC  I  5 47  ? 15.035  -25.032 31.038  1.00 106.61 ? -26  DC  I "O3'" 1 
ATOM   6965  C  "C2'" . DC  I  5 47  ? 17.179  -26.254 31.173  1.00 110.19 ? -26  DC  I "C2'" 1 
ATOM   6966  C  "C1'" . DC  I  5 47  ? 16.673  -27.341 30.222  1.00 111.63 ? -26  DC  I "C1'" 1 
ATOM   6967  N  N1    . DC  I  5 47  ? 17.522  -28.583 30.013  1.00 112.08 ? -26  DC  I N1    1 
ATOM   6968  C  C2    . DC  I  5 47  ? 16.945  -29.883 30.045  1.00 112.36 ? -26  DC  I C2    1 
ATOM   6969  O  O2    . DC  I  5 47  ? 15.734  -30.052 30.270  1.00 111.94 ? -26  DC  I O2    1 
ATOM   6970  N  N3    . DC  I  5 47  ? 17.749  -30.960 29.828  1.00 112.49 ? -26  DC  I N3    1 
ATOM   6971  C  C4    . DC  I  5 47  ? 19.053  -30.791 29.580  1.00 112.09 ? -26  DC  I C4    1 
ATOM   6972  N  N4    . DC  I  5 47  ? 19.798  -31.880 29.379  1.00 112.14 ? -26  DC  I N4    1 
ATOM   6973  C  C5    . DC  I  5 47  ? 19.656  -29.496 29.543  1.00 112.14 ? -26  DC  I C5    1 
ATOM   6974  C  C6    . DC  I  5 47  ? 18.861  -28.437 29.754  1.00 112.12 ? -26  DC  I C6    1 
ATOM   6975  P  P     . DG  I  5 48  ? 14.467  -24.397 32.411  1.00 104.16 ? -25  DG  I P     1 
ATOM   6976  O  OP1   . DG  I  5 48  ? 13.194  -23.716 32.076  1.00 103.79 ? -25  DG  I OP1   1 
ATOM   6977  O  OP2   . DG  I  5 48  ? 15.550  -23.661 33.109  1.00 103.50 ? -25  DG  I OP2   1 
ATOM   6978  O  "O5'" . DG  I  5 48  ? 14.102  -25.671 33.316  1.00 102.77 ? -25  DG  I "O5'" 1 
ATOM   6979  C  "C5'" . DG  I  5 48  ? 13.517  -26.866 32.777  1.00 99.96  ? -25  DG  I "C5'" 1 
ATOM   6980  C  "C4'" . DG  I  5 48  ? 13.833  -28.055 33.666  1.00 98.12  ? -25  DG  I "C4'" 1 
ATOM   6981  O  "O4'" . DG  I  5 48  ? 14.996  -28.761 33.159  1.00 99.45  ? -25  DG  I "O4'" 1 
ATOM   6982  C  "C3'" . DG  I  5 48  ? 14.118  -27.713 35.132  1.00 95.84  ? -25  DG  I "C3'" 1 
ATOM   6983  O  "O3'" . DG  I  5 48  ? 13.423  -28.568 36.040  1.00 90.65  ? -25  DG  I "O3'" 1 
ATOM   6984  C  "C2'" . DG  I  5 48  ? 15.622  -27.954 35.263  1.00 98.27  ? -25  DG  I "C2'" 1 
ATOM   6985  C  "C1'" . DG  I  5 48  ? 15.844  -29.076 34.251  1.00 102.02 ? -25  DG  I "C1'" 1 
ATOM   6986  N  N9    . DG  I  5 48  ? 17.231  -29.245 33.790  1.00 103.10 ? -25  DG  I N9    1 
ATOM   6987  C  C8    . DG  I  5 48  ? 18.204  -28.275 33.658  1.00 103.62 ? -25  DG  I C8    1 
ATOM   6988  N  N7    . DG  I  5 48  ? 19.351  -28.731 33.221  1.00 103.95 ? -25  DG  I N7    1 
ATOM   6989  C  C5    . DG  I  5 48  ? 19.131  -30.095 33.052  1.00 103.71 ? -25  DG  I C5    1 
ATOM   6990  C  C6    . DG  I  5 48  ? 20.011  -31.121 32.603  1.00 103.71 ? -25  DG  I C6    1 
ATOM   6991  O  O6    . DG  I  5 48  ? 21.198  -31.018 32.253  1.00 103.59 ? -25  DG  I O6    1 
ATOM   6992  N  N1    . DG  I  5 48  ? 19.393  -32.377 32.579  1.00 103.45 ? -25  DG  I N1    1 
ATOM   6993  C  C2    . DG  I  5 48  ? 18.084  -32.607 32.947  1.00 103.64 ? -25  DG  I C2    1 
ATOM   6994  N  N2    . DG  I  5 48  ? 17.656  -33.877 32.866  1.00 103.41 ? -25  DG  I N2    1 
ATOM   6995  N  N3    . DG  I  5 48  ? 17.250  -31.654 33.367  1.00 103.78 ? -25  DG  I N3    1 
ATOM   6996  C  C4    . DG  I  5 48  ? 17.833  -30.425 33.398  1.00 103.47 ? -25  DG  I C4    1 
ATOM   6997  P  P     . DC  I  5 49  ? 11.832  -28.717 36.183  1.00 85.72  ? -24  DC  I P     1 
ATOM   6998  O  OP1   . DC  I  5 49  ? 11.134  -28.628 34.876  1.00 84.66  ? -24  DC  I OP1   1 
ATOM   6999  O  OP2   . DC  I  5 49  ? 11.452  -27.890 37.340  1.00 86.08  ? -24  DC  I OP2   1 
ATOM   7000  O  "O5'" . DC  I  5 49  ? 11.729  -30.222 36.694  1.00 85.11  ? -24  DC  I "O5'" 1 
ATOM   7001  C  "C5'" . DC  I  5 49  ? 11.224  -31.251 35.830  1.00 83.45  ? -24  DC  I "C5'" 1 
ATOM   7002  C  "C4'" . DC  I  5 49  ? 11.910  -32.564 36.134  1.00 81.03  ? -24  DC  I "C4'" 1 
ATOM   7003  O  "O4'" . DC  I  5 49  ? 13.306  -32.350 35.866  1.00 81.89  ? -24  DC  I "O4'" 1 
ATOM   7004  C  "C3'" . DC  I  5 49  ? 11.828  -32.983 37.599  1.00 80.29  ? -24  DC  I "C3'" 1 
ATOM   7005  O  "O3'" . DC  I  5 49  ? 11.205  -34.260 37.743  1.00 76.56  ? -24  DC  I "O3'" 1 
ATOM   7006  C  "C2'" . DC  I  5 49  ? 13.271  -32.955 38.107  1.00 80.97  ? -24  DC  I "C2'" 1 
ATOM   7007  C  "C1'" . DC  I  5 49  ? 14.053  -33.064 36.811  1.00 83.21  ? -24  DC  I "C1'" 1 
ATOM   7008  N  N1    . DC  I  5 49  ? 15.390  -32.443 36.858  1.00 84.25  ? -24  DC  I N1    1 
ATOM   7009  C  C2    . DC  I  5 49  ? 16.473  -33.094 36.253  1.00 84.60  ? -24  DC  I C2    1 
ATOM   7010  O  O2    . DC  I  5 49  ? 16.291  -34.179 35.690  1.00 84.80  ? -24  DC  I O2    1 
ATOM   7011  N  N3    . DC  I  5 49  ? 17.695  -32.498 36.314  1.00 85.10  ? -24  DC  I N3    1 
ATOM   7012  C  C4    . DC  I  5 49  ? 17.838  -31.317 36.934  1.00 84.77  ? -24  DC  I C4    1 
ATOM   7013  N  N4    . DC  I  5 49  ? 19.045  -30.758 36.968  1.00 84.78  ? -24  DC  I N4    1 
ATOM   7014  C  C5    . DC  I  5 49  ? 16.746  -30.639 37.553  1.00 85.28  ? -24  DC  I C5    1 
ATOM   7015  C  C6    . DC  I  5 49  ? 15.551  -31.237 37.485  1.00 85.12  ? -24  DC  I C6    1 
ATOM   7016  P  P     . DT  I  5 50  ? 10.962  -34.854 39.202  1.00 75.24  ? -23  DT  I P     1 
ATOM   7017  O  OP1   . DT  I  5 50  ? 9.620   -35.467 39.232  1.00 72.29  ? -23  DT  I OP1   1 
ATOM   7018  O  OP2   . DT  I  5 50  ? 11.407  -33.876 40.215  1.00 75.17  ? -23  DT  I OP2   1 
ATOM   7019  O  "O5'" . DT  I  5 50  ? 12.050  -36.003 39.324  1.00 81.03  ? -23  DT  I "O5'" 1 
ATOM   7020  C  "C5'" . DT  I  5 50  ? 12.270  -36.931 38.257  1.00 87.74  ? -23  DT  I "C5'" 1 
ATOM   7021  C  "C4'" . DT  I  5 50  ? 13.493  -37.772 38.571  1.00 92.58  ? -23  DT  I "C4'" 1 
ATOM   7022  O  "O4'" . DT  I  5 50  ? 14.699  -36.986 38.432  1.00 92.74  ? -23  DT  I "O4'" 1 
ATOM   7023  C  "C3'" . DT  I  5 50  ? 13.530  -38.362 39.979  1.00 94.87  ? -23  DT  I "C3'" 1 
ATOM   7024  O  "O3'" . DT  I  5 50  ? 13.948  -39.704 39.811  1.00 99.20  ? -23  DT  I "O3'" 1 
ATOM   7025  C  "C2'" . DT  I  5 50  ? 14.538  -37.494 40.733  1.00 93.97  ? -23  DT  I "C2'" 1 
ATOM   7026  C  "C1'" . DT  I  5 50  ? 15.483  -37.143 39.592  1.00 94.59  ? -23  DT  I "C1'" 1 
ATOM   7027  N  N1    . DT  I  5 50  ? 16.251  -35.887 39.676  1.00 94.94  ? -23  DT  I N1    1 
ATOM   7028  C  C2    . DT  I  5 50  ? 17.453  -35.886 39.011  1.00 95.62  ? -23  DT  I C2    1 
ATOM   7029  O  O2    . DT  I  5 50  ? 17.882  -36.861 38.408  1.00 96.25  ? -23  DT  I O2    1 
ATOM   7030  N  N3    . DT  I  5 50  ? 18.148  -34.707 39.086  1.00 95.96  ? -23  DT  I N3    1 
ATOM   7031  C  C4    . DT  I  5 50  ? 17.760  -33.551 39.729  1.00 95.99  ? -23  DT  I C4    1 
ATOM   7032  O  O4    . DT  I  5 50  ? 18.478  -32.553 39.722  1.00 96.14  ? -23  DT  I O4    1 
ATOM   7033  C  C5    . DT  I  5 50  ? 16.477  -33.617 40.405  1.00 96.16  ? -23  DT  I C5    1 
ATOM   7034  C  C7    . DT  I  5 50  ? 15.955  -32.421 41.149  1.00 95.71  ? -23  DT  I C7    1 
ATOM   7035  C  C6    . DT  I  5 50  ? 15.782  -34.768 40.343  1.00 95.52  ? -23  DT  I C6    1 
ATOM   7036  P  P     . DA  I  5 51  ? 14.027  -40.754 41.013  1.00 102.31 ? -22  DA  I P     1 
ATOM   7037  O  OP1   . DA  I  5 51  ? 13.765  -42.081 40.407  1.00 102.93 ? -22  DA  I OP1   1 
ATOM   7038  O  OP2   . DA  I  5 51  ? 13.243  -40.293 42.184  1.00 101.98 ? -22  DA  I OP2   1 
ATOM   7039  O  "O5'" . DA  I  5 51  ? 15.569  -40.660 41.383  1.00 104.65 ? -22  DA  I "O5'" 1 
ATOM   7040  C  "C5'" . DA  I  5 51  ? 16.531  -40.889 40.367  1.00 109.57 ? -22  DA  I "C5'" 1 
ATOM   7041  C  "C4'" . DA  I  5 51  ? 17.882  -40.704 40.998  1.00 113.34 ? -22  DA  I "C4'" 1 
ATOM   7042  O  "O4'" . DA  I  5 51  ? 18.246  -39.318 40.870  1.00 113.62 ? -22  DA  I "O4'" 1 
ATOM   7043  C  "C3'" . DA  I  5 51  ? 17.853  -41.023 42.492  1.00 116.61 ? -22  DA  I "C3'" 1 
ATOM   7044  O  "O3'" . DA  I  5 51  ? 18.743  -42.111 42.766  1.00 121.22 ? -22  DA  I "O3'" 1 
ATOM   7045  C  "C2'" . DA  I  5 51  ? 18.249  -39.722 43.186  1.00 115.97 ? -22  DA  I "C2'" 1 
ATOM   7046  C  "C1'" . DA  I  5 51  ? 18.891  -38.932 42.058  1.00 115.23 ? -22  DA  I "C1'" 1 
ATOM   7047  N  N9    . DA  I  5 51  ? 18.704  -37.507 42.238  1.00 115.50 ? -22  DA  I N9    1 
ATOM   7048  C  C8    . DA  I  5 51  ? 17.558  -36.860 42.611  1.00 115.83 ? -22  DA  I C8    1 
ATOM   7049  N  N7    . DA  I  5 51  ? 17.701  -35.560 42.701  1.00 116.31 ? -22  DA  I N7    1 
ATOM   7050  C  C5    . DA  I  5 51  ? 19.027  -35.348 42.358  1.00 115.99 ? -22  DA  I C5    1 
ATOM   7051  C  C6    . DA  I  5 51  ? 19.816  -34.186 42.250  1.00 115.68 ? -22  DA  I C6    1 
ATOM   7052  N  N6    . DA  I  5 51  ? 19.350  -32.958 42.497  1.00 115.76 ? -22  DA  I N6    1 
ATOM   7053  N  N1    . DA  I  5 51  ? 21.108  -34.331 41.886  1.00 115.69 ? -22  DA  I N1    1 
ATOM   7054  C  C2    . DA  I  5 51  ? 21.583  -35.558 41.641  1.00 115.73 ? -22  DA  I C2    1 
ATOM   7055  N  N3    . DA  I  5 51  ? 20.938  -36.719 41.703  1.00 115.91 ? -22  DA  I N3    1 
ATOM   7056  C  C4    . DA  I  5 51  ? 19.659  -36.542 42.072  1.00 115.80 ? -22  DA  I C4    1 
ATOM   7057  P  P     . DT  I  5 52  ? 18.964  -42.696 44.241  1.00 124.35 ? -21  DT  I P     1 
ATOM   7058  O  OP1   . DT  I  5 52  ? 19.395  -44.101 44.094  1.00 124.68 ? -21  DT  I OP1   1 
ATOM   7059  O  OP2   . DT  I  5 52  ? 17.793  -42.377 45.093  1.00 124.60 ? -21  DT  I OP2   1 
ATOM   7060  O  "O5'" . DT  I  5 52  ? 20.213  -41.842 44.736  1.00 126.56 ? -21  DT  I "O5'" 1 
ATOM   7061  C  "C5'" . DT  I  5 52  ? 21.368  -41.765 43.911  1.00 130.71 ? -21  DT  I "C5'" 1 
ATOM   7062  C  "C4'" . DT  I  5 52  ? 22.458  -41.018 44.654  1.00 134.43 ? -21  DT  I "C4'" 1 
ATOM   7063  O  "O4'" . DT  I  5 52  ? 22.338  -39.597 44.354  1.00 135.69 ? -21  DT  I "O4'" 1 
ATOM   7064  C  "C3'" . DT  I  5 52  ? 22.412  -41.140 46.183  1.00 136.09 ? -21  DT  I "C3'" 1 
ATOM   7065  O  "O3'" . DT  I  5 52  ? 23.739  -41.303 46.665  1.00 137.70 ? -21  DT  I "O3'" 1 
ATOM   7066  C  "C2'" . DT  I  5 52  ? 21.830  -39.800 46.619  1.00 136.58 ? -21  DT  I "C2'" 1 
ATOM   7067  C  "C1'" . DT  I  5 52  ? 22.448  -38.880 45.567  1.00 137.30 ? -21  DT  I "C1'" 1 
ATOM   7068  N  N1    . DT  I  5 52  ? 21.797  -37.532 45.447  1.00 137.88 ? -21  DT  I N1    1 
ATOM   7069  C  C2    . DT  I  5 52  ? 22.564  -36.428 45.102  1.00 138.18 ? -21  DT  I C2    1 
ATOM   7070  O  O2    . DT  I  5 52  ? 23.763  -36.471 44.871  1.00 138.31 ? -21  DT  I O2    1 
ATOM   7071  N  N3    . DT  I  5 52  ? 21.858  -35.247 45.033  1.00 138.43 ? -21  DT  I N3    1 
ATOM   7072  C  C4    . DT  I  5 52  ? 20.502  -35.063 45.273  1.00 138.28 ? -21  DT  I C4    1 
ATOM   7073  O  O4    . DT  I  5 52  ? 19.968  -33.960 45.183  1.00 138.25 ? -21  DT  I O4    1 
ATOM   7074  C  C5    . DT  I  5 52  ? 19.763  -36.257 45.628  1.00 138.32 ? -21  DT  I C5    1 
ATOM   7075  C  C7    . DT  I  5 52  ? 18.290  -36.201 45.915  1.00 138.11 ? -21  DT  I C7    1 
ATOM   7076  C  C6    . DT  I  5 52  ? 20.438  -37.413 45.698  1.00 138.13 ? -21  DT  I C6    1 
ATOM   7077  P  P     . DC  I  5 53  ? 24.106  -41.821 48.137  1.00 138.45 ? -20  DC  I P     1 
ATOM   7078  O  OP1   . DC  I  5 53  ? 23.805  -43.274 48.170  1.00 138.63 ? -20  DC  I OP1   1 
ATOM   7079  O  OP2   . DC  I  5 53  ? 23.516  -40.930 49.166  1.00 137.91 ? -20  DC  I OP2   1 
ATOM   7080  O  "O5'" . DC  I  5 53  ? 25.693  -41.580 48.139  1.00 139.07 ? -20  DC  I "O5'" 1 
ATOM   7081  C  "C5'" . DC  I  5 53  ? 26.277  -40.546 47.337  1.00 140.29 ? -20  DC  I "C5'" 1 
ATOM   7082  C  "C4'" . DC  I  5 53  ? 26.607  -39.290 48.131  1.00 141.60 ? -20  DC  I "C4'" 1 
ATOM   7083  O  "O4'" . DC  I  5 53  ? 25.656  -38.237 47.825  1.00 141.78 ? -20  DC  I "O4'" 1 
ATOM   7084  C  "C3'" . DC  I  5 53  ? 26.622  -39.401 49.655  1.00 142.61 ? -20  DC  I "C3'" 1 
ATOM   7085  O  "O3'" . DC  I  5 53  ? 27.753  -38.704 50.138  1.00 144.46 ? -20  DC  I "O3'" 1 
ATOM   7086  C  "C2'" . DC  I  5 53  ? 25.358  -38.673 50.085  1.00 142.11 ? -20  DC  I "C2'" 1 
ATOM   7087  C  "C1'" . DC  I  5 53  ? 25.329  -37.575 49.029  1.00 142.23 ? -20  DC  I "C1'" 1 
ATOM   7088  N  N1    . DC  I  5 53  ? 24.020  -36.842 48.883  1.00 142.54 ? -20  DC  I N1    1 
ATOM   7089  C  C2    . DC  I  5 53  ? 24.016  -35.524 48.370  1.00 142.63 ? -20  DC  I C2    1 
ATOM   7090  O  O2    . DC  I  5 53  ? 25.082  -34.978 48.039  1.00 142.39 ? -20  DC  I O2    1 
ATOM   7091  N  N3    . DC  I  5 53  ? 22.822  -34.876 48.249  1.00 142.88 ? -20  DC  I N3    1 
ATOM   7092  C  C4    . DC  I  5 53  ? 21.678  -35.481 48.612  1.00 142.70 ? -20  DC  I C4    1 
ATOM   7093  N  N4    . DC  I  5 53  ? 20.535  -34.795 48.470  1.00 142.45 ? -20  DC  I N4    1 
ATOM   7094  C  C5    . DC  I  5 53  ? 21.660  -36.818 49.136  1.00 142.41 ? -20  DC  I C5    1 
ATOM   7095  C  C6    . DC  I  5 53  ? 22.840  -37.449 49.250  1.00 142.43 ? -20  DC  I C6    1 
ATOM   7096  P  P     . DA  I  5 54  ? 28.517  -39.199 51.456  1.00 145.50 ? -19  DA  I P     1 
ATOM   7097  O  OP1   . DA  I  5 54  ? 29.178  -40.480 51.104  1.00 145.69 ? -19  DA  I OP1   1 
ATOM   7098  O  OP2   . DA  I  5 54  ? 27.571  -39.150 52.600  1.00 145.10 ? -19  DA  I OP2   1 
ATOM   7099  O  "O5'" . DA  I  5 54  ? 29.646  -38.076 51.668  1.00 145.25 ? -19  DA  I "O5'" 1 
ATOM   7100  C  "C5'" . DA  I  5 54  ? 29.490  -36.753 51.151  1.00 145.43 ? -19  DA  I "C5'" 1 
ATOM   7101  C  "C4'" . DA  I  5 54  ? 28.829  -35.812 52.148  1.00 145.62 ? -19  DA  I "C4'" 1 
ATOM   7102  O  "O4'" . DA  I  5 54  ? 27.473  -35.510 51.727  1.00 146.08 ? -19  DA  I "O4'" 1 
ATOM   7103  C  "C3'" . DA  I  5 54  ? 28.717  -36.287 53.597  1.00 145.58 ? -19  DA  I "C3'" 1 
ATOM   7104  O  "O3'" . DA  I  5 54  ? 29.315  -35.299 54.414  1.00 145.58 ? -19  DA  I "O3'" 1 
ATOM   7105  C  "C2'" . DA  I  5 54  ? 27.212  -36.378 53.852  1.00 145.88 ? -19  DA  I "C2'" 1 
ATOM   7106  C  "C1'" . DA  I  5 54  ? 26.715  -35.292 52.901  1.00 146.36 ? -19  DA  I "C1'" 1 
ATOM   7107  N  N9    . DA  I  5 54  ? 25.281  -35.303 52.587  1.00 146.42 ? -19  DA  I N9    1 
ATOM   7108  C  C8    . DA  I  5 54  ? 24.473  -36.392 52.388  1.00 146.48 ? -19  DA  I C8    1 
ATOM   7109  N  N7    . DA  I  5 54  ? 23.225  -36.096 52.117  1.00 146.37 ? -19  DA  I N7    1 
ATOM   7110  C  C5    . DA  I  5 54  ? 23.207  -34.714 52.138  1.00 146.34 ? -19  DA  I C5    1 
ATOM   7111  C  C6    . DA  I  5 54  ? 22.173  -33.779 51.926  1.00 146.36 ? -19  DA  I C6    1 
ATOM   7112  N  N6    . DA  I  5 54  ? 20.917  -34.136 51.643  1.00 146.40 ? -19  DA  I N6    1 
ATOM   7113  N  N1    . DA  I  5 54  ? 22.481  -32.465 52.024  1.00 146.44 ? -19  DA  I N1    1 
ATOM   7114  C  C2    . DA  I  5 54  ? 23.748  -32.117 52.310  1.00 146.44 ? -19  DA  I C2    1 
ATOM   7115  N  N3    . DA  I  5 54  ? 24.804  -32.905 52.528  1.00 146.26 ? -19  DA  I N3    1 
ATOM   7116  C  C4    . DA  I  5 54  ? 24.464  -34.205 52.427  1.00 146.28 ? -19  DA  I C4    1 
ATOM   7117  P  P     . DA  I  5 55  ? 29.898  -35.650 55.866  1.00 145.47 ? -18  DA  I P     1 
ATOM   7118  O  OP1   . DA  I  5 55  ? 31.142  -36.432 55.653  1.00 145.31 ? -18  DA  I OP1   1 
ATOM   7119  O  OP2   . DA  I  5 55  ? 28.789  -36.236 56.664  1.00 145.36 ? -18  DA  I OP2   1 
ATOM   7120  O  "O5'" . DA  I  5 55  ? 30.274  -34.209 56.483  1.00 143.98 ? -18  DA  I "O5'" 1 
ATOM   7121  C  "C5'" . DA  I  5 55  ? 30.213  -32.992 55.716  1.00 141.67 ? -18  DA  I "C5'" 1 
ATOM   7122  C  "C4'" . DA  I  5 55  ? 29.252  -31.985 56.331  1.00 140.11 ? -18  DA  I "C4'" 1 
ATOM   7123  O  "O4'" . DA  I  5 55  ? 27.929  -32.100 55.740  1.00 139.49 ? -18  DA  I "O4'" 1 
ATOM   7124  C  "C3'" . DA  I  5 55  ? 29.070  -32.092 57.845  1.00 139.44 ? -18  DA  I "C3'" 1 
ATOM   7125  O  "O3'" . DA  I  5 55  ? 29.451  -30.819 58.402  1.00 138.95 ? -18  DA  I "O3'" 1 
ATOM   7126  C  "C2'" . DA  I  5 55  ? 27.602  -32.505 58.023  1.00 139.17 ? -18  DA  I "C2'" 1 
ATOM   7127  C  "C1'" . DA  I  5 55  ? 26.942  -31.984 56.749  1.00 138.62 ? -18  DA  I "C1'" 1 
ATOM   7128  N  N9    . DA  I  5 55  ? 25.750  -32.727 56.327  1.00 138.33 ? -18  DA  I N9    1 
ATOM   7129  C  C8    . DA  I  5 55  ? 25.648  -34.081 56.150  1.00 138.18 ? -18  DA  I C8    1 
ATOM   7130  N  N7    . DA  I  5 55  ? 24.466  -34.491 55.756  1.00 138.08 ? -18  DA  I N7    1 
ATOM   7131  C  C5    . DA  I  5 55  ? 23.731  -33.325 55.663  1.00 138.19 ? -18  DA  I C5    1 
ATOM   7132  C  C6    . DA  I  5 55  ? 22.390  -33.081 55.291  1.00 138.12 ? -18  DA  I C6    1 
ATOM   7133  N  N6    . DA  I  5 55  ? 21.542  -34.051 54.939  1.00 137.93 ? -18  DA  I N6    1 
ATOM   7134  N  N1    . DA  I  5 55  ? 21.960  -31.799 55.297  1.00 138.16 ? -18  DA  I N1    1 
ATOM   7135  C  C2    . DA  I  5 55  ? 22.822  -30.831 55.653  1.00 138.14 ? -18  DA  I C2    1 
ATOM   7136  N  N3    . DA  I  5 55  ? 24.103  -30.937 56.025  1.00 137.84 ? -18  DA  I N3    1 
ATOM   7137  C  C4    . DA  I  5 55  ? 24.505  -32.223 56.009  1.00 138.16 ? -18  DA  I C4    1 
ATOM   7138  P  P     . DA  I  5 56  ? 28.718  -30.059 59.619  1.00 138.36 ? -17  DA  I P     1 
ATOM   7139  O  OP1   . DA  I  5 56  ? 29.477  -28.806 59.859  1.00 138.17 ? -17  DA  I OP1   1 
ATOM   7140  O  OP2   . DA  I  5 56  ? 28.511  -31.015 60.741  1.00 138.19 ? -17  DA  I OP2   1 
ATOM   7141  O  "O5'" . DA  I  5 56  ? 27.292  -29.695 58.974  1.00 136.41 ? -17  DA  I "O5'" 1 
ATOM   7142  C  "C5'" . DA  I  5 56  ? 27.020  -28.391 58.452  1.00 133.31 ? -17  DA  I "C5'" 1 
ATOM   7143  C  "C4'" . DA  I  5 56  ? 25.765  -27.813 59.096  1.00 130.68 ? -17  DA  I "C4'" 1 
ATOM   7144  O  "O4'" . DA  I  5 56  ? 24.604  -28.639 58.810  1.00 130.29 ? -17  DA  I "O4'" 1 
ATOM   7145  C  "C3'" . DA  I  5 56  ? 25.767  -27.669 60.612  1.00 128.80 ? -17  DA  I "C3'" 1 
ATOM   7146  O  "O3'" . DA  I  5 56  ? 24.926  -26.565 60.888  1.00 126.49 ? -17  DA  I "O3'" 1 
ATOM   7147  C  "C2'" . DA  I  5 56  ? 25.153  -28.986 61.096  1.00 128.84 ? -17  DA  I "C2'" 1 
ATOM   7148  C  "C1'" . DA  I  5 56  ? 24.092  -29.204 60.011  1.00 129.27 ? -17  DA  I "C1'" 1 
ATOM   7149  N  N9    . DA  I  5 56  ? 23.693  -30.589 59.724  1.00 129.15 ? -17  DA  I N9    1 
ATOM   7150  C  C8    . DA  I  5 56  ? 24.380  -31.754 59.963  1.00 128.89 ? -17  DA  I C8    1 
ATOM   7151  N  N7    . DA  I  5 56  ? 23.742  -32.837 59.580  1.00 128.72 ? -17  DA  I N7    1 
ATOM   7152  C  C5    . DA  I  5 56  ? 22.556  -32.353 59.048  1.00 128.85 ? -17  DA  I C5    1 
ATOM   7153  C  C6    . DA  I  5 56  ? 21.432  -32.982 58.466  1.00 128.74 ? -17  DA  I C6    1 
ATOM   7154  N  N6    . DA  I  5 56  ? 21.323  -34.301 58.315  1.00 128.79 ? -17  DA  I N6    1 
ATOM   7155  N  N1    . DA  I  5 56  ? 20.416  -32.204 58.035  1.00 128.85 ? -17  DA  I N1    1 
ATOM   7156  C  C2    . DA  I  5 56  ? 20.513  -30.873 58.177  1.00 128.93 ? -17  DA  I C2    1 
ATOM   7157  N  N3    . DA  I  5 56  ? 21.512  -30.165 58.708  1.00 128.76 ? -17  DA  I N3    1 
ATOM   7158  C  C4    . DA  I  5 56  ? 22.510  -30.969 59.128  1.00 128.95 ? -17  DA  I C4    1 
ATOM   7159  P  P     . DG  I  5 57  ? 25.022  -25.719 62.249  1.00 124.70 ? -16  DG  I P     1 
ATOM   7160  O  OP1   . DG  I  5 57  ? 25.647  -24.403 61.900  1.00 124.98 ? -16  DG  I OP1   1 
ATOM   7161  O  OP2   . DG  I  5 57  ? 25.622  -26.580 63.303  1.00 124.73 ? -16  DG  I OP2   1 
ATOM   7162  O  "O5'" . DG  I  5 57  ? 23.478  -25.470 62.652  1.00 121.98 ? -16  DG  I "O5'" 1 
ATOM   7163  C  "C5'" . DG  I  5 57  ? 22.438  -25.393 61.666  1.00 117.26 ? -16  DG  I "C5'" 1 
ATOM   7164  C  "C4'" . DG  I  5 57  ? 21.253  -26.197 62.162  1.00 114.21 ? -16  DG  I "C4'" 1 
ATOM   7165  O  "O4'" . DG  I  5 57  ? 21.535  -27.609 61.985  1.00 113.19 ? -16  DG  I "O4'" 1 
ATOM   7166  C  "C3'" . DG  I  5 57  ? 20.930  -26.030 63.654  1.00 112.45 ? -16  DG  I "C3'" 1 
ATOM   7167  O  "O3'" . DG  I  5 57  ? 19.579  -25.569 63.808  1.00 110.95 ? -16  DG  I "O3'" 1 
ATOM   7168  C  "C2'" . DG  I  5 57  ? 21.146  -27.430 64.249  1.00 112.59 ? -16  DG  I "C2'" 1 
ATOM   7169  C  "C1'" . DG  I  5 57  ? 20.848  -28.289 63.020  1.00 112.32 ? -16  DG  I "C1'" 1 
ATOM   7170  N  N9    . DG  I  5 57  ? 21.200  -29.721 63.020  1.00 111.82 ? -16  DG  I N9    1 
ATOM   7171  C  C8    . DG  I  5 57  ? 22.224  -30.370 63.675  1.00 111.67 ? -16  DG  I C8    1 
ATOM   7172  N  N7    . DG  I  5 57  ? 22.253  -31.658 63.448  1.00 111.64 ? -16  DG  I N7    1 
ATOM   7173  C  C5    . DG  I  5 57  ? 21.177  -31.884 62.585  1.00 111.79 ? -16  DG  I C5    1 
ATOM   7174  C  C6    . DG  I  5 57  ? 20.688  -33.080 61.971  1.00 111.96 ? -16  DG  I C6    1 
ATOM   7175  O  O6    . DG  I  5 57  ? 21.113  -34.239 62.074  1.00 111.98 ? -16  DG  I O6    1 
ATOM   7176  N  N1    . DG  I  5 57  ? 19.575  -32.867 61.159  1.00 111.68 ? -16  DG  I N1    1 
ATOM   7177  C  C2    . DG  I  5 57  ? 18.994  -31.643 60.961  1.00 111.57 ? -16  DG  I C2    1 
ATOM   7178  N  N2    . DG  I  5 57  ? 17.934  -31.628 60.146  1.00 111.71 ? -16  DG  I N2    1 
ATOM   7179  N  N3    . DG  I  5 57  ? 19.433  -30.519 61.517  1.00 111.53 ? -16  DG  I N3    1 
ATOM   7180  C  C4    . DG  I  5 57  ? 20.524  -30.702 62.314  1.00 111.60 ? -16  DG  I C4    1 
ATOM   7181  P  P     . DG  I  5 58  ? 19.188  -24.004 63.807  1.00 109.34 ? -15  DG  I P     1 
ATOM   7182  O  OP1   . DG  I  5 58  ? 20.372  -23.234 63.330  1.00 109.23 ? -15  DG  I OP1   1 
ATOM   7183  O  OP2   . DG  I  5 58  ? 18.577  -23.719 65.133  1.00 109.04 ? -15  DG  I OP2   1 
ATOM   7184  O  "O5'" . DG  I  5 58  ? 18.012  -23.826 62.717  1.00 107.34 ? -15  DG  I "O5'" 1 
ATOM   7185  C  "C5'" . DG  I  5 58  ? 17.823  -24.687 61.570  1.00 103.70 ? -15  DG  I "C5'" 1 
ATOM   7186  C  "C4'" . DG  I  5 58  ? 16.415  -25.285 61.553  1.00 101.85 ? -15  DG  I "C4'" 1 
ATOM   7187  O  "O4'" . DG  I  5 58  ? 16.447  -26.681 61.967  1.00 101.81 ? -15  DG  I "O4'" 1 
ATOM   7188  C  "C3'" . DG  I  5 58  ? 15.366  -24.674 62.479  1.00 99.91  ? -15  DG  I "C3'" 1 
ATOM   7189  O  "O3'" . DG  I  5 58  ? 14.109  -24.983 61.901  1.00 96.66  ? -15  DG  I "O3'" 1 
ATOM   7190  C  "C2'" . DG  I  5 58  ? 15.611  -25.447 63.783  1.00 100.44 ? -15  DG  I "C2'" 1 
ATOM   7191  C  "C1'" . DG  I  5 58  ? 15.785  -26.856 63.218  1.00 101.64 ? -15  DG  I "C1'" 1 
ATOM   7192  N  N9    . DG  I  5 58  ? 16.538  -27.839 64.021  1.00 101.89 ? -15  DG  I N9    1 
ATOM   7193  C  C8    . DG  I  5 58  ? 17.382  -27.635 65.095  1.00 101.86 ? -15  DG  I C8    1 
ATOM   7194  N  N7    . DG  I  5 58  ? 17.905  -28.738 65.578  1.00 101.49 ? -15  DG  I N7    1 
ATOM   7195  C  C5    . DG  I  5 58  ? 17.376  -29.743 64.773  1.00 101.72 ? -15  DG  I C5    1 
ATOM   7196  C  C6    . DG  I  5 58  ? 17.566  -31.149 64.800  1.00 101.57 ? -15  DG  I C6    1 
ATOM   7197  O  O6    . DG  I  5 58  ? 18.264  -31.818 65.566  1.00 101.86 ? -15  DG  I O6    1 
ATOM   7198  N  N1    . DG  I  5 58  ? 16.847  -31.811 63.811  1.00 101.47 ? -15  DG  I N1    1 
ATOM   7199  C  C2    . DG  I  5 58  ? 16.029  -31.198 62.898  1.00 101.83 ? -15  DG  I C2    1 
ATOM   7200  N  N2    . DG  I  5 58  ? 15.414  -32.008 62.024  1.00 101.84 ? -15  DG  I N2    1 
ATOM   7201  N  N3    . DG  I  5 58  ? 15.832  -29.881 62.850  1.00 102.22 ? -15  DG  I N3    1 
ATOM   7202  C  C4    . DG  I  5 58  ? 16.535  -29.211 63.814  1.00 102.25 ? -15  DG  I C4    1 
ATOM   7203  P  P     . DG  I  5 59  ? 12.716  -24.628 62.614  1.00 94.41  ? -14  DG  I P     1 
ATOM   7204  O  OP1   . DG  I  5 59  ? 12.342  -23.267 62.148  1.00 95.34  ? -14  DG  I OP1   1 
ATOM   7205  O  OP2   . DG  I  5 59  ? 12.787  -24.890 64.079  1.00 91.78  ? -14  DG  I OP2   1 
ATOM   7206  O  "O5'" . DG  I  5 59  ? 11.666  -25.638 61.928  1.00 90.33  ? -14  DG  I "O5'" 1 
ATOM   7207  C  "C5'" . DG  I  5 59  ? 12.008  -26.868 61.261  1.00 83.50  ? -14  DG  I "C5'" 1 
ATOM   7208  C  "C4'" . DG  I  5 59  ? 11.558  -28.088 62.061  1.00 78.39  ? -14  DG  I "C4'" 1 
ATOM   7209  O  "O4'" . DG  I  5 59  ? 12.564  -28.448 63.037  1.00 75.94  ? -14  DG  I "O4'" 1 
ATOM   7210  C  "C3'" . DG  I  5 59  ? 10.245  -27.970 62.839  1.00 75.33  ? -14  DG  I "C3'" 1 
ATOM   7211  O  "O3'" . DG  I  5 59  ? 9.471   -29.022 62.349  1.00 71.01  ? -14  DG  I "O3'" 1 
ATOM   7212  C  "C2'" . DG  I  5 59  ? 10.627  -28.163 64.306  1.00 75.32  ? -14  DG  I "C2'" 1 
ATOM   7213  C  "C1'" . DG  I  5 59  ? 11.934  -28.939 64.180  1.00 76.51  ? -14  DG  I "C1'" 1 
ATOM   7214  N  N9    . DG  I  5 59  ? 12.901  -28.820 65.265  1.00 76.83  ? -14  DG  I N9    1 
ATOM   7215  C  C8    . DG  I  5 59  ? 13.260  -27.713 65.992  1.00 77.46  ? -14  DG  I C8    1 
ATOM   7216  N  N7    . DG  I  5 59  ? 14.175  -27.939 66.901  1.00 77.32  ? -14  DG  I N7    1 
ATOM   7217  C  C5    . DG  I  5 59  ? 14.427  -29.301 66.767  1.00 77.39  ? -14  DG  I C5    1 
ATOM   7218  C  C6    . DG  I  5 59  ? 15.319  -30.145 67.476  1.00 77.61  ? -14  DG  I C6    1 
ATOM   7219  O  O6    . DG  I  5 59  ? 16.081  -29.819 68.396  1.00 78.21  ? -14  DG  I O6    1 
ATOM   7220  N  N1    . DG  I  5 59  ? 15.280  -31.470 67.038  1.00 76.93  ? -14  DG  I N1    1 
ATOM   7221  C  C2    . DG  I  5 59  ? 14.463  -31.914 66.023  1.00 77.41  ? -14  DG  I C2    1 
ATOM   7222  N  N2    . DG  I  5 59  ? 14.534  -33.208 65.711  1.00 77.55  ? -14  DG  I N2    1 
ATOM   7223  N  N3    . DG  I  5 59  ? 13.629  -31.140 65.340  1.00 78.21  ? -14  DG  I N3    1 
ATOM   7224  C  C4    . DG  I  5 59  ? 13.659  -29.849 65.766  1.00 77.47  ? -14  DG  I C4    1 
ATOM   7225  P  P     . DA  I  5 60  ? 7.905   -29.197 62.573  1.00 67.38  ? -13  DA  I P     1 
ATOM   7226  O  OP1   . DA  I  5 60  ? 7.281   -29.172 61.239  1.00 66.68  ? -13  DA  I OP1   1 
ATOM   7227  O  OP2   . DA  I  5 60  ? 7.415   -28.414 63.735  1.00 66.88  ? -13  DA  I OP2   1 
ATOM   7228  O  "O5'" . DA  I  5 60  ? 7.893   -30.711 63.074  1.00 69.49  ? -13  DA  I "O5'" 1 
ATOM   7229  C  "C5'" . DA  I  5 60  ? 8.495   -31.726 62.266  1.00 69.92  ? -13  DA  I "C5'" 1 
ATOM   7230  C  "C4'" . DA  I  5 60  ? 8.621   -32.989 63.085  1.00 69.98  ? -13  DA  I "C4'" 1 
ATOM   7231  O  "O4'" . DA  I  5 60  ? 9.653   -32.838 64.091  1.00 70.30  ? -13  DA  I "O4'" 1 
ATOM   7232  C  "C3'" . DA  I  5 60  ? 7.349   -33.401 63.816  1.00 69.33  ? -13  DA  I "C3'" 1 
ATOM   7233  O  "O3'" . DA  I  5 60  ? 7.180   -34.776 63.482  1.00 65.71  ? -13  DA  I "O3'" 1 
ATOM   7234  C  "C2'" . DA  I  5 60  ? 7.616   -33.096 65.295  1.00 68.93  ? -13  DA  I "C2'" 1 
ATOM   7235  C  "C1'" . DA  I  5 60  ? 9.138   -33.172 65.368  1.00 71.84  ? -13  DA  I "C1'" 1 
ATOM   7236  N  N9    . DA  I  5 60  ? 9.811   -32.268 66.306  1.00 73.45  ? -13  DA  I N9    1 
ATOM   7237  C  C8    . DA  I  5 60  ? 9.558   -30.939 66.531  1.00 73.02  ? -13  DA  I C8    1 
ATOM   7238  N  N7    . DA  I  5 60  ? 10.338  -30.394 67.422  1.00 71.90  ? -13  DA  I N7    1 
ATOM   7239  C  C5    . DA  I  5 60  ? 11.169  -31.429 67.807  1.00 73.44  ? -13  DA  I C5    1 
ATOM   7240  C  C6    . DA  I  5 60  ? 12.231  -31.517 68.733  1.00 73.54  ? -13  DA  I C6    1 
ATOM   7241  N  N6    . DA  I  5 60  ? 12.656  -30.480 69.459  1.00 72.87  ? -13  DA  I N6    1 
ATOM   7242  N  N1    . DA  I  5 60  ? 12.852  -32.716 68.871  1.00 73.54  ? -13  DA  I N1    1 
ATOM   7243  C  C2    . DA  I  5 60  ? 12.451  -33.760 68.147  1.00 72.67  ? -13  DA  I C2    1 
ATOM   7244  N  N3    . DA  I  5 60  ? 11.468  -33.791 67.255  1.00 73.64  ? -13  DA  I N3    1 
ATOM   7245  C  C4    . DA  I  5 60  ? 10.867  -32.593 67.127  1.00 73.62  ? -13  DA  I C4    1 
ATOM   7246  P  P     . DA  I  5 61  ? 5.971   -35.672 64.002  1.00 64.24  ? -12  DA  I P     1 
ATOM   7247  O  OP1   . DA  I  5 61  ? 5.811   -36.677 62.925  1.00 64.92  ? -12  DA  I OP1   1 
ATOM   7248  O  OP2   . DA  I  5 61  ? 4.824   -34.916 64.551  1.00 62.55  ? -12  DA  I OP2   1 
ATOM   7249  O  "O5'" . DA  I  5 61  ? 6.607   -36.339 65.306  1.00 66.21  ? -12  DA  I "O5'" 1 
ATOM   7250  C  "C5'" . DA  I  5 61  ? 7.825   -37.060 65.280  1.00 67.39  ? -12  DA  I "C5'" 1 
ATOM   7251  C  "C4'" . DA  I  5 61  ? 8.057   -37.622 66.665  1.00 70.20  ? -12  DA  I "C4'" 1 
ATOM   7252  O  "O4'" . DA  I  5 61  ? 8.631   -36.613 67.526  1.00 70.14  ? -12  DA  I "O4'" 1 
ATOM   7253  C  "C3'" . DA  I  5 61  ? 6.842   -38.151 67.416  1.00 72.52  ? -12  DA  I "C3'" 1 
ATOM   7254  O  "O3'" . DA  I  5 61  ? 7.289   -39.389 67.968  1.00 77.09  ? -12  DA  I "O3'" 1 
ATOM   7255  C  "C2'" . DA  I  5 61  ? 6.545   -37.079 68.470  1.00 70.74  ? -12  DA  I "C2'" 1 
ATOM   7256  C  "C1'" . DA  I  5 61  ? 7.956   -36.577 68.764  1.00 70.80  ? -12  DA  I "C1'" 1 
ATOM   7257  N  N9    . DA  I  5 61  ? 8.121   -35.194 69.189  1.00 70.99  ? -12  DA  I N9    1 
ATOM   7258  C  C8    . DA  I  5 61  ? 7.346   -34.134 68.834  1.00 70.88  ? -12  DA  I C8    1 
ATOM   7259  N  N7    . DA  I  5 61  ? 7.747   -33.003 69.352  1.00 71.40  ? -12  DA  I N7    1 
ATOM   7260  C  C5    . DA  I  5 61  ? 8.876   -33.325 70.088  1.00 71.81  ? -12  DA  I C5    1 
ATOM   7261  C  C6    . DA  I  5 61  ? 9.772   -32.561 70.883  1.00 71.40  ? -12  DA  I C6    1 
ATOM   7262  N  N6    . DA  I  5 61  ? 9.668   -31.252 71.070  1.00 70.98  ? -12  DA  I N6    1 
ATOM   7263  N  N1    . DA  I  5 61  ? 10.790  -33.191 71.492  1.00 70.87  ? -12  DA  I N1    1 
ATOM   7264  C  C2    . DA  I  5 61  ? 10.905  -34.511 71.308  1.00 71.17  ? -12  DA  I C2    1 
ATOM   7265  N  N3    . DA  I  5 61  ? 10.136  -35.333 70.591  1.00 71.55  ? -12  DA  I N3    1 
ATOM   7266  C  C4    . DA  I  5 61  ? 9.123   -34.680 69.993  1.00 71.58  ? -12  DA  I C4    1 
ATOM   7267  P  P     . DA  I  5 62  ? 6.333   -40.514 68.583  1.00 80.47  ? -11  DA  I P     1 
ATOM   7268  O  OP1   . DA  I  5 62  ? 6.881   -41.783 68.054  1.00 81.30  ? -11  DA  I OP1   1 
ATOM   7269  O  OP2   . DA  I  5 62  ? 4.914   -40.141 68.378  1.00 81.89  ? -11  DA  I OP2   1 
ATOM   7270  O  "O5'" . DA  I  5 62  ? 6.570   -40.438 70.164  1.00 81.38  ? -11  DA  I "O5'" 1 
ATOM   7271  C  "C5'" . DA  I  5 62  ? 7.875   -40.604 70.689  1.00 84.04  ? -11  DA  I "C5'" 1 
ATOM   7272  C  "C4'" . DA  I  5 62  ? 7.955   -40.090 72.112  1.00 86.36  ? -11  DA  I "C4'" 1 
ATOM   7273  O  "O4'" . DA  I  5 62  ? 8.207   -38.656 72.091  1.00 87.11  ? -11  DA  I "O4'" 1 
ATOM   7274  C  "C3'" . DA  I  5 62  ? 6.703   -40.318 72.959  1.00 87.73  ? -11  DA  I "C3'" 1 
ATOM   7275  O  "O3'" . DA  I  5 62  ? 7.074   -40.836 74.228  1.00 89.88  ? -11  DA  I "O3'" 1 
ATOM   7276  C  "C2'" . DA  I  5 62  ? 6.135   -38.915 73.114  1.00 87.96  ? -11  DA  I "C2'" 1 
ATOM   7277  C  "C1'" . DA  I  5 62  ? 7.398   -38.058 73.086  1.00 88.01  ? -11  DA  I "C1'" 1 
ATOM   7278  N  N9    . DA  I  5 62  ? 7.120   -36.644 72.795  1.00 88.34  ? -11  DA  I N9    1 
ATOM   7279  C  C8    . DA  I  5 62  ? 6.227   -36.152 71.881  1.00 88.29  ? -11  DA  I C8    1 
ATOM   7280  N  N7    . DA  I  5 62  ? 6.167   -34.847 71.843  1.00 88.65  ? -11  DA  I N7    1 
ATOM   7281  C  C5    . DA  I  5 62  ? 7.076   -34.448 72.801  1.00 88.24  ? -11  DA  I C5    1 
ATOM   7282  C  C6    . DA  I  5 62  ? 7.484   -33.180 73.249  1.00 87.99  ? -11  DA  I C6    1 
ATOM   7283  N  N6    . DA  I  5 62  ? 7.006   -32.038 72.764  1.00 88.11  ? -11  DA  I N6    1 
ATOM   7284  N  N1    . DA  I  5 62  ? 8.418   -33.123 74.218  1.00 88.52  ? -11  DA  I N1    1 
ATOM   7285  C  C2    . DA  I  5 62  ? 8.914   -34.265 74.717  1.00 88.56  ? -11  DA  I C2    1 
ATOM   7286  N  N3    . DA  I  5 62  ? 8.605   -35.515 74.376  1.00 88.77  ? -11  DA  I N3    1 
ATOM   7287  C  C4    . DA  I  5 62  ? 7.676   -35.539 73.400  1.00 88.46  ? -11  DA  I C4    1 
ATOM   7288  P  P     . DC  I  5 63  ? 6.016   -41.476 75.249  1.00 91.02  ? -10  DC  I P     1 
ATOM   7289  O  OP1   . DC  I  5 63  ? 6.284   -42.927 75.195  1.00 93.43  ? -10  DC  I OP1   1 
ATOM   7290  O  OP2   . DC  I  5 63  ? 4.633   -41.005 74.990  1.00 91.15  ? -10  DC  I OP2   1 
ATOM   7291  O  "O5'" . DC  I  5 63  ? 6.474   -40.901 76.668  1.00 90.50  ? -10  DC  I "O5'" 1 
ATOM   7292  C  "C5'" . DC  I  5 63  ? 7.771   -40.356 76.878  1.00 90.71  ? -10  DC  I "C5'" 1 
ATOM   7293  C  "C4'" . DC  I  5 63  ? 7.725   -39.129 77.781  1.00 91.47  ? -10  DC  I "C4'" 1 
ATOM   7294  O  "O4'" . DC  I  5 63  ? 7.709   -37.942 76.947  1.00 92.23  ? -10  DC  I "O4'" 1 
ATOM   7295  C  "C3'" . DC  I  5 63  ? 6.518   -39.002 78.717  1.00 91.21  ? -10  DC  I "C3'" 1 
ATOM   7296  O  "O3'" . DC  I  5 63  ? 6.812   -39.493 80.039  1.00 89.81  ? -10  DC  I "O3'" 1 
ATOM   7297  C  "C2'" . DC  I  5 63  ? 6.247   -37.502 78.768  1.00 92.16  ? -10  DC  I "C2'" 1 
ATOM   7298  C  "C1'" . DC  I  5 63  ? 7.099   -36.890 77.665  1.00 93.41  ? -10  DC  I "C1'" 1 
ATOM   7299  N  N1    . DC  I  5 63  ? 6.256   -36.009 76.790  1.00 94.12  ? -10  DC  I N1    1 
ATOM   7300  C  C2    . DC  I  5 63  ? 6.268   -34.628 77.029  1.00 94.77  ? -10  DC  I C2    1 
ATOM   7301  O  O2    . DC  I  5 63  ? 6.981   -34.180 77.931  1.00 94.97  ? -10  DC  I O2    1 
ATOM   7302  N  N3    . DC  I  5 63  ? 5.503   -33.807 76.263  1.00 95.13  ? -10  DC  I N3    1 
ATOM   7303  C  C4    . DC  I  5 63  ? 4.745   -34.323 75.296  1.00 94.87  ? -10  DC  I C4    1 
ATOM   7304  N  N4    . DC  I  5 63  ? 4.021   -33.468 74.575  1.00 94.69  ? -10  DC  I N4    1 
ATOM   7305  C  C5    . DC  I  5 63  ? 4.701   -35.732 75.037  1.00 94.91  ? -10  DC  I C5    1 
ATOM   7306  C  C6    . DC  I  5 63  ? 5.460   -36.529 75.804  1.00 94.34  ? -10  DC  I C6    1 
ATOM   7307  P  P     . DT  I  5 64  ? 5.719   -39.556 81.227  1.00 89.03  ? -9   DT  I P     1 
ATOM   7308  O  OP1   . DT  I  5 64  ? 6.158   -40.656 82.113  1.00 89.41  ? -9   DT  I OP1   1 
ATOM   7309  O  OP2   . DT  I  5 64  ? 4.358   -39.585 80.636  1.00 88.15  ? -9   DT  I OP2   1 
ATOM   7310  O  "O5'" . DT  I  5 64  ? 5.860   -38.195 82.056  1.00 86.69  ? -9   DT  I "O5'" 1 
ATOM   7311  C  "C5'" . DT  I  5 64  ? 7.110   -37.542 82.329  1.00 84.99  ? -9   DT  I "C5'" 1 
ATOM   7312  C  "C4'" . DT  I  5 64  ? 6.862   -36.178 82.984  1.00 84.44  ? -9   DT  I "C4'" 1 
ATOM   7313  O  "O4'" . DT  I  5 64  ? 6.499   -35.177 81.987  1.00 83.35  ? -9   DT  I "O4'" 1 
ATOM   7314  C  "C3'" . DT  I  5 64  ? 5.752   -36.139 84.038  1.00 84.10  ? -9   DT  I "C3'" 1 
ATOM   7315  O  "O3'" . DT  I  5 64  ? 6.213   -35.505 85.219  1.00 85.89  ? -9   DT  I "O3'" 1 
ATOM   7316  C  "C2'" . DT  I  5 64  ? 4.607   -35.352 83.399  1.00 83.16  ? -9   DT  I "C2'" 1 
ATOM   7317  C  "C1'" . DT  I  5 64  ? 5.303   -34.507 82.346  1.00 81.56  ? -9   DT  I "C1'" 1 
ATOM   7318  N  N1    . DT  I  5 64  ? 4.473   -34.285 81.110  1.00 81.47  ? -9   DT  I N1    1 
ATOM   7319  C  C2    . DT  I  5 64  ? 4.194   -32.988 80.680  1.00 80.76  ? -9   DT  I C2    1 
ATOM   7320  O  O2    . DT  I  5 64  ? 4.582   -31.971 81.246  1.00 79.95  ? -9   DT  I O2    1 
ATOM   7321  N  N3    . DT  I  5 64  ? 3.430   -32.926 79.537  1.00 79.95  ? -9   DT  I N3    1 
ATOM   7322  C  C4    . DT  I  5 64  ? 2.925   -33.978 78.794  1.00 80.34  ? -9   DT  I C4    1 
ATOM   7323  O  O4    . DT  I  5 64  ? 2.255   -33.795 77.780  1.00 79.92  ? -9   DT  I O4    1 
ATOM   7324  C  C5    . DT  I  5 64  ? 3.249   -35.299 79.300  1.00 81.16  ? -9   DT  I C5    1 
ATOM   7325  C  C7    . DT  I  5 64  ? 2.762   -36.536 78.600  1.00 80.33  ? -9   DT  I C7    1 
ATOM   7326  C  C6    . DT  I  5 64  ? 4.003   -35.385 80.409  1.00 81.07  ? -9   DT  I C6    1 
ATOM   7327  P  P     . DT  I  5 65  ? 5.249   -35.320 86.492  1.00 87.16  ? -8   DT  I P     1 
ATOM   7328  O  OP1   . DT  I  5 65  ? 6.126   -35.117 87.666  1.00 87.33  ? -8   DT  I OP1   1 
ATOM   7329  O  OP2   . DT  I  5 65  ? 4.252   -36.414 86.485  1.00 87.32  ? -8   DT  I OP2   1 
ATOM   7330  O  "O5'" . DT  I  5 65  ? 4.477   -33.942 86.218  1.00 85.90  ? -8   DT  I "O5'" 1 
ATOM   7331  C  "C5'" . DT  I  5 65  ? 5.166   -32.691 86.255  1.00 84.50  ? -8   DT  I "C5'" 1 
ATOM   7332  C  "C4'" . DT  I  5 65  ? 4.204   -31.546 85.978  1.00 84.16  ? -8   DT  I "C4'" 1 
ATOM   7333  O  "O4'" . DT  I  5 65  ? 3.691   -31.632 84.616  1.00 83.83  ? -8   DT  I "O4'" 1 
ATOM   7334  C  "C3'" . DT  I  5 65  ? 2.992   -31.479 86.903  1.00 83.35  ? -8   DT  I "C3'" 1 
ATOM   7335  O  "O3'" . DT  I  5 65  ? 3.050   -30.236 87.564  1.00 83.06  ? -8   DT  I "O3'" 1 
ATOM   7336  C  "C2'" . DT  I  5 65  ? 1.765   -31.613 85.990  1.00 82.80  ? -8   DT  I "C2'" 1 
ATOM   7337  C  "C1'" . DT  I  5 65  ? 2.325   -31.275 84.611  1.00 83.33  ? -8   DT  I "C1'" 1 
ATOM   7338  N  N1    . DT  I  5 65  ? 1.701   -31.933 83.418  1.00 83.24  ? -8   DT  I N1    1 
ATOM   7339  C  C2    . DT  I  5 65  ? 1.326   -31.136 82.353  1.00 83.04  ? -8   DT  I C2    1 
ATOM   7340  O  O2    . DT  I  5 65  ? 1.457   -29.929 82.336  1.00 83.57  ? -8   DT  I O2    1 
ATOM   7341  N  N3    . DT  I  5 65  ? 0.773   -31.799 81.290  1.00 82.85  ? -8   DT  I N3    1 
ATOM   7342  C  C4    . DT  I  5 65  ? 0.572   -33.159 81.171  1.00 83.74  ? -8   DT  I C4    1 
ATOM   7343  O  O4    . DT  I  5 65  ? 0.066   -33.655 80.171  1.00 83.50  ? -8   DT  I O4    1 
ATOM   7344  C  C5    . DT  I  5 65  ? 0.991   -33.946 82.312  1.00 83.84  ? -8   DT  I C5    1 
ATOM   7345  C  C7    . DT  I  5 65  ? 0.816   -35.433 82.293  1.00 83.40  ? -8   DT  I C7    1 
ATOM   7346  C  C6    . DT  I  5 65  ? 1.535   -33.307 83.366  1.00 83.66  ? -8   DT  I C6    1 
ATOM   7347  P  P     . DC  I  5 66  ? 2.046   -29.869 88.756  1.00 83.86  ? -7   DC  I P     1 
ATOM   7348  O  OP1   . DC  I  5 66  ? 2.784   -28.945 89.637  1.00 83.47  ? -7   DC  I OP1   1 
ATOM   7349  O  OP2   . DC  I  5 66  ? 1.472   -31.122 89.294  1.00 84.00  ? -7   DC  I OP2   1 
ATOM   7350  O  "O5'" . DC  I  5 66  ? 0.827   -29.086 88.066  1.00 82.08  ? -7   DC  I "O5'" 1 
ATOM   7351  C  "C5'" . DC  I  5 66  ? 1.024   -28.019 87.132  1.00 79.81  ? -7   DC  I "C5'" 1 
ATOM   7352  C  "C4'" . DC  I  5 66  ? -0.281  -27.654 86.428  1.00 78.24  ? -7   DC  I "C4'" 1 
ATOM   7353  O  "O4'" . DC  I  5 66  ? -0.526  -28.573 85.336  1.00 77.81  ? -7   DC  I "O4'" 1 
ATOM   7354  C  "C3'" . DC  I  5 66  ? -1.573  -27.691 87.258  1.00 77.98  ? -7   DC  I "C3'" 1 
ATOM   7355  O  "O3'" . DC  I  5 66  ? -2.388  -26.580 86.914  1.00 77.32  ? -7   DC  I "O3'" 1 
ATOM   7356  C  "C2'" . DC  I  5 66  ? -2.254  -28.993 86.850  1.00 76.87  ? -7   DC  I "C2'" 1 
ATOM   7357  C  "C1'" . DC  I  5 66  ? -1.893  -28.942 85.377  1.00 76.46  ? -7   DC  I "C1'" 1 
ATOM   7358  N  N1    . DC  I  5 66  ? -1.999  -30.194 84.616  1.00 75.98  ? -7   DC  I N1    1 
ATOM   7359  C  C2    . DC  I  5 66  ? -2.441  -30.105 83.291  1.00 74.76  ? -7   DC  I C2    1 
ATOM   7360  O  O2    . DC  I  5 66  ? -2.739  -28.997 82.852  1.00 74.31  ? -7   DC  I O2    1 
ATOM   7361  N  N3    . DC  I  5 66  ? -2.537  -31.232 82.541  1.00 74.32  ? -7   DC  I N3    1 
ATOM   7362  C  C4    . DC  I  5 66  ? -2.202  -32.404 83.078  1.00 75.38  ? -7   DC  I C4    1 
ATOM   7363  N  N4    . DC  I  5 66  ? -2.320  -33.487 82.314  1.00 75.53  ? -7   DC  I N4    1 
ATOM   7364  C  C5    . DC  I  5 66  ? -1.741  -32.517 84.432  1.00 75.97  ? -7   DC  I C5    1 
ATOM   7365  C  C6    . DC  I  5 66  ? -1.650  -31.396 85.169  1.00 75.64  ? -7   DC  I C6    1 
ATOM   7366  P  P     . DA  I  5 67  ? -2.431  -25.265 87.820  1.00 76.77  ? -6   DA  I P     1 
ATOM   7367  O  OP1   . DA  I  5 67  ? -1.037  -24.925 88.218  1.00 74.12  ? -6   DA  I OP1   1 
ATOM   7368  O  OP2   . DA  I  5 67  ? -3.534  -25.486 88.794  1.00 76.84  ? -6   DA  I OP2   1 
ATOM   7369  O  "O5'" . DA  I  5 67  ? -2.964  -24.117 86.830  1.00 76.35  ? -6   DA  I "O5'" 1 
ATOM   7370  C  "C5'" . DA  I  5 67  ? -2.269  -23.814 85.617  1.00 76.22  ? -6   DA  I "C5'" 1 
ATOM   7371  C  "C4'" . DA  I  5 67  ? -3.249  -23.546 84.487  1.00 75.68  ? -6   DA  I "C4'" 1 
ATOM   7372  O  "O4'" . DA  I  5 67  ? -3.762  -24.774 83.903  1.00 75.66  ? -6   DA  I "O4'" 1 
ATOM   7373  C  "C3'" . DA  I  5 67  ? -4.485  -22.748 84.878  1.00 75.74  ? -6   DA  I "C3'" 1 
ATOM   7374  O  "O3'" . DA  I  5 67  ? -4.740  -21.899 83.781  1.00 75.36  ? -6   DA  I "O3'" 1 
ATOM   7375  C  "C2'" . DA  I  5 67  ? -5.568  -23.807 85.118  1.00 75.62  ? -6   DA  I "C2'" 1 
ATOM   7376  C  "C1'" . DA  I  5 67  ? -5.162  -24.940 84.172  1.00 76.24  ? -6   DA  I "C1'" 1 
ATOM   7377  N  N9    . DA  I  5 67  ? -5.307  -26.330 84.635  1.00 76.25  ? -6   DA  I N9    1 
ATOM   7378  C  C8    . DA  I  5 67  ? -5.177  -26.831 85.898  1.00 76.30  ? -6   DA  I C8    1 
ATOM   7379  N  N7    . DA  I  5 67  ? -5.313  -28.140 85.979  1.00 76.52  ? -6   DA  I N7    1 
ATOM   7380  C  C5    . DA  I  5 67  ? -5.536  -28.532 84.677  1.00 76.14  ? -6   DA  I C5    1 
ATOM   7381  C  C6    . DA  I  5 67  ? -5.763  -29.787 84.075  1.00 76.32  ? -6   DA  I C6    1 
ATOM   7382  N  N6    . DA  I  5 67  ? -5.807  -30.944 84.738  1.00 76.23  ? -6   DA  I N6    1 
ATOM   7383  N  N1    . DA  I  5 67  ? -5.953  -29.819 82.739  1.00 76.48  ? -6   DA  I N1    1 
ATOM   7384  C  C2    . DA  I  5 67  ? -5.921  -28.678 82.048  1.00 76.04  ? -6   DA  I C2    1 
ATOM   7385  N  N3    . DA  I  5 67  ? -5.718  -27.447 82.506  1.00 76.31  ? -6   DA  I N3    1 
ATOM   7386  C  C4    . DA  I  5 67  ? -5.532  -27.434 83.838  1.00 76.55  ? -6   DA  I C4    1 
ATOM   7387  P  P     . DA  I  5 68  ? -5.878  -20.787 83.753  1.00 75.89  ? -5   DA  I P     1 
ATOM   7388  O  OP1   . DA  I  5 68  ? -5.288  -19.672 82.982  1.00 77.59  ? -5   DA  I OP1   1 
ATOM   7389  O  OP2   . DA  I  5 68  ? -6.442  -20.584 85.112  1.00 75.73  ? -5   DA  I OP2   1 
ATOM   7390  O  "O5'" . DA  I  5 68  ? -7.035  -21.415 82.850  1.00 76.62  ? -5   DA  I "O5'" 1 
ATOM   7391  C  "C5'" . DA  I  5 68  ? -6.752  -22.029 81.594  1.00 77.05  ? -5   DA  I "C5'" 1 
ATOM   7392  C  "C4'" . DA  I  5 68  ? -7.979  -22.769 81.084  1.00 78.17  ? -5   DA  I "C4'" 1 
ATOM   7393  O  "O4'" . DA  I  5 68  ? -7.996  -24.142 81.554  1.00 78.60  ? -5   DA  I "O4'" 1 
ATOM   7394  C  "C3'" . DA  I  5 68  ? -9.320  -22.188 81.508  1.00 78.53  ? -5   DA  I "C3'" 1 
ATOM   7395  O  "O3'" . DA  I  5 68  ? -10.237 -22.368 80.454  1.00 80.01  ? -5   DA  I "O3'" 1 
ATOM   7396  C  "C2'" . DA  I  5 68  ? -9.705  -23.062 82.692  1.00 78.27  ? -5   DA  I "C2'" 1 
ATOM   7397  C  "C1'" . DA  I  5 68  ? -9.230  -24.417 82.190  1.00 79.12  ? -5   DA  I "C1'" 1 
ATOM   7398  N  N9    . DA  I  5 68  ? -9.021  -25.447 83.217  1.00 79.57  ? -5   DA  I N9    1 
ATOM   7399  C  C8    . DA  I  5 68  ? -8.717  -25.251 84.535  1.00 79.53  ? -5   DA  I C8    1 
ATOM   7400  N  N7    . DA  I  5 68  ? -8.564  -26.356 85.223  1.00 80.23  ? -5   DA  I N7    1 
ATOM   7401  C  C5    . DA  I  5 68  ? -8.785  -27.358 84.293  1.00 79.87  ? -5   DA  I C5    1 
ATOM   7402  C  C6    . DA  I  5 68  ? -8.777  -28.767 84.389  1.00 79.53  ? -5   DA  I C6    1 
ATOM   7403  N  N6    . DA  I  5 68  ? -8.520  -29.420 85.520  1.00 78.82  ? -5   DA  I N6    1 
ATOM   7404  N  N1    . DA  I  5 68  ? -9.036  -29.483 83.269  1.00 80.10  ? -5   DA  I N1    1 
ATOM   7405  C  C2    . DA  I  5 68  ? -9.291  -28.829 82.124  1.00 79.96  ? -5   DA  I C2    1 
ATOM   7406  N  N3    . DA  I  5 68  ? -9.323  -27.508 81.921  1.00 80.07  ? -5   DA  I N3    1 
ATOM   7407  C  C4    . DA  I  5 68  ? -9.066  -26.818 83.050  1.00 79.60  ? -5   DA  I C4    1 
ATOM   7408  P  P     . DC  I  5 69  ? -10.357 -21.365 79.210  1.00 80.55  ? -4   DC  I P     1 
ATOM   7409  O  OP1   . DC  I  5 69  ? -9.026  -21.165 78.571  1.00 78.86  ? -4   DC  I OP1   1 
ATOM   7410  O  OP2   . DC  I  5 69  ? -11.185 -20.226 79.671  1.00 79.84  ? -4   DC  I OP2   1 
ATOM   7411  O  "O5'" . DC  I  5 69  ? -11.232 -22.260 78.205  1.00 79.13  ? -4   DC  I "O5'" 1 
ATOM   7412  C  "C5'" . DC  I  5 69  ? -10.537 -23.228 77.422  1.00 77.23  ? -4   DC  I "C5'" 1 
ATOM   7413  C  "C4'" . DC  I  5 69  ? -11.283 -24.538 77.411  1.00 75.88  ? -4   DC  I "C4'" 1 
ATOM   7414  O  "O4'" . DC  I  5 69  ? -11.147 -25.210 78.691  1.00 77.40  ? -4   DC  I "O4'" 1 
ATOM   7415  C  "C3'" . DC  I  5 69  ? -12.769 -24.372 77.139  1.00 73.90  ? -4   DC  I "C3'" 1 
ATOM   7416  O  "O3'" . DC  I  5 69  ? -13.019 -25.045 75.922  1.00 69.87  ? -4   DC  I "O3'" 1 
ATOM   7417  C  "C2'" . DC  I  5 69  ? -13.449 -25.025 78.344  1.00 75.99  ? -4   DC  I "C2'" 1 
ATOM   7418  C  "C1'" . DC  I  5 69  ? -12.360 -25.867 79.011  1.00 78.31  ? -4   DC  I "C1'" 1 
ATOM   7419  N  N1    . DC  I  5 69  ? -12.455 -26.049 80.524  1.00 78.76  ? -4   DC  I N1    1 
ATOM   7420  C  C2    . DC  I  5 69  ? -12.380 -27.336 81.104  1.00 79.16  ? -4   DC  I C2    1 
ATOM   7421  O  O2    . DC  I  5 69  ? -12.240 -28.350 80.403  1.00 80.06  ? -4   DC  I O2    1 
ATOM   7422  N  N3    . DC  I  5 69  ? -12.458 -27.454 82.450  1.00 78.62  ? -4   DC  I N3    1 
ATOM   7423  C  C4    . DC  I  5 69  ? -12.608 -26.368 83.212  1.00 79.58  ? -4   DC  I C4    1 
ATOM   7424  N  N4    . DC  I  5 69  ? -12.684 -26.544 84.537  1.00 79.93  ? -4   DC  I N4    1 
ATOM   7425  C  C5    . DC  I  5 69  ? -12.698 -25.054 82.657  1.00 79.36  ? -4   DC  I C5    1 
ATOM   7426  C  C6    . DC  I  5 69  ? -12.613 -24.949 81.326  1.00 78.88  ? -4   DC  I C6    1 
ATOM   7427  P  P     . DT  I  5 70  ? -14.389 -24.961 75.122  1.00 65.90  ? -3   DT  I P     1 
ATOM   7428  O  OP1   . DT  I  5 70  ? -14.042 -24.778 73.699  1.00 67.11  ? -3   DT  I OP1   1 
ATOM   7429  O  OP2   . DT  I  5 70  ? -15.370 -24.078 75.766  1.00 65.74  ? -3   DT  I OP2   1 
ATOM   7430  O  "O5'" . DT  I  5 70  ? -14.948 -26.439 75.340  1.00 69.14  ? -3   DT  I "O5'" 1 
ATOM   7431  C  "C5'" . DT  I  5 70  ? -14.154 -27.607 75.098  1.00 70.53  ? -3   DT  I "C5'" 1 
ATOM   7432  C  "C4'" . DT  I  5 70  ? -14.823 -28.828 75.702  1.00 72.28  ? -3   DT  I "C4'" 1 
ATOM   7433  O  "O4'" . DT  I  5 70  ? -14.834 -28.713 77.148  1.00 73.17  ? -3   DT  I "O4'" 1 
ATOM   7434  C  "C3'" . DT  I  5 70  ? -16.274 -29.066 75.301  1.00 74.02  ? -3   DT  I "C3'" 1 
ATOM   7435  O  "O3'" . DT  I  5 70  ? -16.403 -30.436 74.953  1.00 75.19  ? -3   DT  I "O3'" 1 
ATOM   7436  C  "C2'" . DT  I  5 70  ? -17.090 -28.661 76.542  1.00 74.21  ? -3   DT  I "C2'" 1 
ATOM   7437  C  "C1'" . DT  I  5 70  ? -16.121 -28.968 77.682  1.00 74.14  ? -3   DT  I "C1'" 1 
ATOM   7438  N  N1    . DT  I  5 70  ? -16.197 -28.154 78.965  1.00 74.73  ? -3   DT  I N1    1 
ATOM   7439  C  C2    . DT  I  5 70  ? -16.132 -28.796 80.194  1.00 74.70  ? -3   DT  I C2    1 
ATOM   7440  O  O2    . DT  I  5 70  ? -16.048 -30.002 80.331  1.00 75.07  ? -3   DT  I O2    1 
ATOM   7441  N  N3    . DT  I  5 70  ? -16.175 -27.971 81.282  1.00 74.24  ? -3   DT  I N3    1 
ATOM   7442  C  C4    . DT  I  5 70  ? -16.263 -26.590 81.289  1.00 75.13  ? -3   DT  I C4    1 
ATOM   7443  O  O4    . DT  I  5 70  ? -16.306 -25.945 82.340  1.00 74.73  ? -3   DT  I O4    1 
ATOM   7444  C  C5    . DT  I  5 70  ? -16.324 -25.975 79.977  1.00 75.52  ? -3   DT  I C5    1 
ATOM   7445  C  C7    . DT  I  5 70  ? -16.431 -24.477 79.822  1.00 74.90  ? -3   DT  I C7    1 
ATOM   7446  C  C6    . DT  I  5 70  ? -16.284 -26.779 78.902  1.00 74.89  ? -3   DT  I C6    1 
ATOM   7447  P  P     . DG  I  5 71  ? -17.749 -31.022 74.335  1.00 76.81  ? -2   DG  I P     1 
ATOM   7448  O  OP1   . DG  I  5 71  ? -17.373 -32.256 73.632  1.00 78.11  ? -2   DG  I OP1   1 
ATOM   7449  O  OP2   . DG  I  5 71  ? -18.492 -29.965 73.619  1.00 77.75  ? -2   DG  I OP2   1 
ATOM   7450  O  "O5'" . DG  I  5 71  ? -18.612 -31.365 75.638  1.00 78.65  ? -2   DG  I "O5'" 1 
ATOM   7451  C  "C5'" . DG  I  5 71  ? -18.313 -32.461 76.505  1.00 80.97  ? -2   DG  I "C5'" 1 
ATOM   7452  C  "C4'" . DG  I  5 71  ? -19.346 -32.531 77.621  1.00 83.22  ? -2   DG  I "C4'" 1 
ATOM   7453  O  "O4'" . DG  I  5 71  ? -19.106 -31.471 78.589  1.00 83.77  ? -2   DG  I "O4'" 1 
ATOM   7454  C  "C3'" . DG  I  5 71  ? -20.806 -32.351 77.192  1.00 85.20  ? -2   DG  I "C3'" 1 
ATOM   7455  O  "O3'" . DG  I  5 71  ? -21.643 -33.061 78.077  1.00 88.25  ? -2   DG  I "O3'" 1 
ATOM   7456  C  "C2'" . DG  I  5 71  ? -21.050 -30.866 77.395  1.00 84.48  ? -2   DG  I "C2'" 1 
ATOM   7457  C  "C1'" . DG  I  5 71  ? -20.297 -30.713 78.715  1.00 83.29  ? -2   DG  I "C1'" 1 
ATOM   7458  N  N9    . DG  I  5 71  ? -20.032 -29.340 79.119  1.00 82.61  ? -2   DG  I N9    1 
ATOM   7459  C  C8    . DG  I  5 71  ? -20.000 -28.200 78.348  1.00 82.93  ? -2   DG  I C8    1 
ATOM   7460  N  N7    . DG  I  5 71  ? -19.749 -27.110 79.025  1.00 83.43  ? -2   DG  I N7    1 
ATOM   7461  C  C5    . DG  I  5 71  ? -19.622 -27.570 80.338  1.00 83.59  ? -2   DG  I C5    1 
ATOM   7462  C  C6    . DG  I  5 71  ? -19.358 -26.863 81.541  1.00 82.96  ? -2   DG  I C6    1 
ATOM   7463  O  O6    . DG  I  5 71  ? -19.168 -25.653 81.688  1.00 82.89  ? -2   DG  I O6    1 
ATOM   7464  N  N1    . DG  I  5 71  ? -19.312 -27.706 82.647  1.00 82.53  ? -2   DG  I N1    1 
ATOM   7465  C  C2    . DG  I  5 71  ? -19.500 -29.070 82.594  1.00 82.95  ? -2   DG  I C2    1 
ATOM   7466  N  N2    . DG  I  5 71  ? -19.417 -29.719 83.760  1.00 83.38  ? -2   DG  I N2    1 
ATOM   7467  N  N3    . DG  I  5 71  ? -19.750 -29.755 81.485  1.00 82.44  ? -2   DG  I N3    1 
ATOM   7468  C  C4    . DG  I  5 71  ? -19.795 -28.941 80.403  1.00 82.88  ? -2   DG  I C4    1 
ATOM   7469  P  P     . DA  I  5 72  ? -22.207 -34.507 77.700  1.00 90.47  ? -1   DA  I P     1 
ATOM   7470  O  OP1   . DA  I  5 72  ? -21.128 -35.367 77.138  1.00 89.75  ? -1   DA  I OP1   1 
ATOM   7471  O  OP2   . DA  I  5 72  ? -23.463 -34.224 76.961  1.00 89.49  ? -1   DA  I OP2   1 
ATOM   7472  O  "O5'" . DA  I  5 72  ? -22.546 -35.109 79.143  1.00 90.45  ? -1   DA  I "O5'" 1 
ATOM   7473  C  "C5'" . DA  I  5 72  ? -21.600 -35.011 80.213  1.00 90.39  ? -1   DA  I "C5'" 1 
ATOM   7474  C  "C4'" . DA  I  5 72  ? -22.316 -34.875 81.551  1.00 90.87  ? -1   DA  I "C4'" 1 
ATOM   7475  O  "O4'" . DA  I  5 72  ? -22.170 -33.525 82.063  1.00 90.43  ? -1   DA  I "O4'" 1 
ATOM   7476  C  "C3'" . DA  I  5 72  ? -23.821 -35.164 81.567  1.00 91.56  ? -1   DA  I "C3'" 1 
ATOM   7477  O  "O3'" . DA  I  5 72  ? -24.096 -35.928 82.762  1.00 93.04  ? -1   DA  I "O3'" 1 
ATOM   7478  C  "C2'" . DA  I  5 72  ? -24.458 -33.765 81.517  1.00 90.48  ? -1   DA  I "C2'" 1 
ATOM   7479  C  "C1'" . DA  I  5 72  ? -23.432 -32.912 82.265  1.00 89.57  ? -1   DA  I "C1'" 1 
ATOM   7480  N  N9    . DA  I  5 72  ? -23.324 -31.515 81.828  1.00 89.38  ? -1   DA  I N9    1 
ATOM   7481  C  C8    . DA  I  5 72  ? -23.473 -31.027 80.556  1.00 89.10  ? -1   DA  I C8    1 
ATOM   7482  N  N7    . DA  I  5 72  ? -23.316 -29.728 80.466  1.00 89.00  ? -1   DA  I N7    1 
ATOM   7483  C  C5    . DA  I  5 72  ? -23.044 -29.331 81.761  1.00 88.72  ? -1   DA  I C5    1 
ATOM   7484  C  C6    . DA  I  5 72  ? -22.779 -28.070 82.337  1.00 88.80  ? -1   DA  I C6    1 
ATOM   7485  N  N6    . DA  I  5 72  ? -22.747 -26.940 81.637  1.00 89.24  ? -1   DA  I N6    1 
ATOM   7486  N  N1    . DA  I  5 72  ? -22.548 -28.007 83.665  1.00 88.92  ? -1   DA  I N1    1 
ATOM   7487  C  C2    . DA  I  5 72  ? -22.580 -29.144 84.376  1.00 89.02  ? -1   DA  I C2    1 
ATOM   7488  N  N3    . DA  I  5 72  ? -22.812 -30.390 83.945  1.00 89.23  ? -1   DA  I N3    1 
ATOM   7489  C  C4    . DA  I  5 72  ? -23.041 -30.419 82.615  1.00 89.06  ? -1   DA  I C4    1 
ATOM   7490  P  P     . DA  I  5 73  ? -25.558 -36.275 83.342  1.00 94.32  ? 0    DA  I P     1 
ATOM   7491  O  OP1   . DA  I  5 73  ? -25.325 -37.401 84.281  1.00 94.71  ? 0    DA  I OP1   1 
ATOM   7492  O  OP2   . DA  I  5 73  ? -26.555 -36.381 82.242  1.00 92.54  ? 0    DA  I OP2   1 
ATOM   7493  O  "O5'" . DA  I  5 73  ? -25.917 -35.003 84.229  1.00 93.64  ? 0    DA  I "O5'" 1 
ATOM   7494  C  "C5'" . DA  I  5 73  ? -25.264 -34.830 85.475  1.00 95.40  ? 0    DA  I "C5'" 1 
ATOM   7495  C  "C4'" . DA  I  5 73  ? -25.926 -33.669 86.182  1.00 97.07  ? 0    DA  I "C4'" 1 
ATOM   7496  O  "O4'" . DA  I  5 73  ? -25.514 -32.432 85.541  1.00 96.88  ? 0    DA  I "O4'" 1 
ATOM   7497  C  "C3'" . DA  I  5 73  ? -27.452 -33.712 86.106  1.00 98.16  ? 0    DA  I "C3'" 1 
ATOM   7498  O  "O3'" . DA  I  5 73  ? -28.005 -33.437 87.390  1.00 100.18 ? 0    DA  I "O3'" 1 
ATOM   7499  C  "C2'" . DA  I  5 73  ? -27.798 -32.612 85.108  1.00 97.75  ? 0    DA  I "C2'" 1 
ATOM   7500  C  "C1'" . DA  I  5 73  ? -26.658 -31.630 85.351  1.00 96.69  ? 0    DA  I "C1'" 1 
ATOM   7501  N  N9    . DA  I  5 73  ? -26.481 -30.742 84.212  1.00 96.52  ? 0    DA  I N9    1 
ATOM   7502  C  C8    . DA  I  5 73  ? -26.544 -31.094 82.895  1.00 96.45  ? 0    DA  I C8    1 
ATOM   7503  N  N7    . DA  I  5 73  ? -26.364 -30.089 82.076  1.00 96.93  ? 0    DA  I N7    1 
ATOM   7504  C  C5    . DA  I  5 73  ? -26.173 -28.998 82.911  1.00 96.77  ? 0    DA  I C5    1 
ATOM   7505  C  C6    . DA  I  5 73  ? -25.928 -27.625 82.657  1.00 96.70  ? 0    DA  I C6    1 
ATOM   7506  N  N6    . DA  I  5 73  ? -25.828 -27.101 81.429  1.00 95.93  ? 0    DA  I N6    1 
ATOM   7507  N  N1    . DA  I  5 73  ? -25.779 -26.807 83.726  1.00 96.75  ? 0    DA  I N1    1 
ATOM   7508  C  C2    . DA  I  5 73  ? -25.873 -27.324 84.960  1.00 96.34  ? 0    DA  I C2    1 
ATOM   7509  N  N3    . DA  I  5 73  ? -26.097 -28.589 85.315  1.00 96.16  ? 0    DA  I N3    1 
ATOM   7510  C  C4    . DA  I  5 73  ? -26.242 -29.385 84.237  1.00 96.51  ? 0    DA  I C4    1 
ATOM   7511  P  P     . DT  I  5 74  ? -29.566 -33.644 87.711  1.00 101.11 ? 1    DT  I P     1 
ATOM   7512  O  OP1   . DT  I  5 74  ? -29.620 -34.553 88.881  1.00 101.58 ? 1    DT  I OP1   1 
ATOM   7513  O  OP2   . DT  I  5 74  ? -30.297 -33.995 86.461  1.00 100.81 ? 1    DT  I OP2   1 
ATOM   7514  O  "O5'" . DT  I  5 74  ? -30.052 -32.188 88.177  1.00 101.07 ? 1    DT  I "O5'" 1 
ATOM   7515  C  "C5'" . DT  I  5 74  ? -29.196 -31.292 88.897  1.00 101.70 ? 1    DT  I "C5'" 1 
ATOM   7516  C  "C4'" . DT  I  5 74  ? -29.704 -29.876 88.714  1.00 102.37 ? 1    DT  I "C4'" 1 
ATOM   7517  O  "O4'" . DT  I  5 74  ? -29.126 -29.326 87.503  1.00 102.42 ? 1    DT  I "O4'" 1 
ATOM   7518  C  "C3'" . DT  I  5 74  ? -31.224 -29.775 88.547  1.00 103.13 ? 1    DT  I "C3'" 1 
ATOM   7519  O  "O3'" . DT  I  5 74  ? -31.821 -28.931 89.523  1.00 104.57 ? 1    DT  I "O3'" 1 
ATOM   7520  C  "C2'" . DT  I  5 74  ? -31.422 -29.177 87.166  1.00 102.48 ? 1    DT  I "C2'" 1 
ATOM   7521  C  "C1'" . DT  I  5 74  ? -30.093 -28.490 86.904  1.00 102.02 ? 1    DT  I "C1'" 1 
ATOM   7522  N  N1    . DT  I  5 74  ? -29.866 -28.350 85.432  1.00 101.88 ? 1    DT  I N1    1 
ATOM   7523  C  C2    . DT  I  5 74  ? -29.525 -27.119 84.909  1.00 101.64 ? 1    DT  I C2    1 
ATOM   7524  O  O2    . DT  I  5 74  ? -29.370 -26.118 85.581  1.00 101.61 ? 1    DT  I O2    1 
ATOM   7525  N  N3    . DT  I  5 74  ? -29.360 -27.104 83.546  1.00 101.62 ? 1    DT  I N3    1 
ATOM   7526  C  C4    . DT  I  5 74  ? -29.507 -28.168 82.674  1.00 101.53 ? 1    DT  I C4    1 
ATOM   7527  O  O4    . DT  I  5 74  ? -29.332 -28.027 81.470  1.00 101.44 ? 1    DT  I O4    1 
ATOM   7528  C  C5    . DT  I  5 74  ? -29.876 -29.429 83.281  1.00 101.60 ? 1    DT  I C5    1 
ATOM   7529  C  C7    . DT  I  5 74  ? -30.074 -30.671 82.461  1.00 101.74 ? 1    DT  I C7    1 
ATOM   7530  C  C6    . DT  I  5 74  ? -30.035 -29.455 84.611  1.00 101.84 ? 1    DT  I C6    1 
ATOM   7531  P  P     . DT  I  5 75  ? -33.408 -28.951 89.771  1.00 105.31 ? 2    DT  I P     1 
ATOM   7532  O  OP1   . DT  I  5 75  ? -33.621 -29.696 91.038  1.00 105.17 ? 2    DT  I OP1   1 
ATOM   7533  O  OP2   . DT  I  5 75  ? -34.105 -29.391 88.527  1.00 104.80 ? 2    DT  I OP2   1 
ATOM   7534  O  "O5'" . DT  I  5 75  ? -33.777 -27.398 90.014  1.00 106.23 ? 2    DT  I "O5'" 1 
ATOM   7535  C  "C5'" . DT  I  5 75  ? -32.775 -26.360 90.116  1.00 107.60 ? 2    DT  I "C5'" 1 
ATOM   7536  C  "C4'" . DT  I  5 75  ? -33.073 -25.189 89.183  1.00 108.96 ? 2    DT  I "C4'" 1 
ATOM   7537  O  "O4'" . DT  I  5 75  ? -32.554 -25.458 87.851  1.00 109.78 ? 2    DT  I "O4'" 1 
ATOM   7538  C  "C3'" . DT  I  5 75  ? -34.553 -24.843 88.982  1.00 109.76 ? 2    DT  I "C3'" 1 
ATOM   7539  O  "O3'" . DT  I  5 75  ? -34.835 -23.519 89.401  1.00 110.75 ? 2    DT  I "O3'" 1 
ATOM   7540  C  "C2'" . DT  I  5 75  ? -34.801 -24.963 87.478  1.00 109.84 ? 2    DT  I "C2'" 1 
ATOM   7541  C  "C1'" . DT  I  5 75  ? -33.398 -24.826 86.906  1.00 109.36 ? 2    DT  I "C1'" 1 
ATOM   7542  N  N1    . DT  I  5 75  ? -33.240 -25.470 85.562  1.00 109.35 ? 2    DT  I N1    1 
ATOM   7543  C  C2    . DT  I  5 75  ? -32.864 -24.697 84.480  1.00 109.08 ? 2    DT  I C2    1 
ATOM   7544  O  O2    . DT  I  5 75  ? -32.646 -23.501 84.556  1.00 108.95 ? 2    DT  I O2    1 
ATOM   7545  N  N3    . DT  I  5 75  ? -32.749 -25.389 83.293  1.00 109.11 ? 2    DT  I N3    1 
ATOM   7546  C  C4    . DT  I  5 75  ? -32.969 -26.745 83.086  1.00 109.08 ? 2    DT  I C4    1 
ATOM   7547  O  O4    . DT  I  5 75  ? -32.837 -27.269 81.983  1.00 109.04 ? 2    DT  I O4    1 
ATOM   7548  C  C5    . DT  I  5 75  ? -33.365 -27.494 84.258  1.00 109.11 ? 2    DT  I C5    1 
ATOM   7549  C  C7    . DT  I  5 75  ? -33.640 -28.968 84.175  1.00 109.13 ? 2    DT  I C7    1 
ATOM   7550  C  C6    . DT  I  5 75  ? -33.480 -26.830 85.419  1.00 109.36 ? 2    DT  I C6    1 
ATOM   7551  P  P     . DC  I  5 76  ? -36.354 -23.085 89.692  1.00 111.97 ? 3    DC  I P     1 
ATOM   7552  O  OP1   . DC  I  5 76  ? -36.277 -22.207 90.887  1.00 111.88 ? 3    DC  I OP1   1 
ATOM   7553  O  OP2   . DC  I  5 76  ? -37.249 -24.275 89.644  1.00 110.86 ? 3    DC  I OP2   1 
ATOM   7554  O  "O5'" . DC  I  5 76  ? -36.763 -22.197 88.431  1.00 111.82 ? 3    DC  I "O5'" 1 
ATOM   7555  C  "C5'" . DC  I  5 76  ? -36.049 -21.007 88.076  1.00 111.37 ? 3    DC  I "C5'" 1 
ATOM   7556  C  "C4'" . DC  I  5 76  ? -36.510 -20.593 86.693  1.00 110.70 ? 3    DC  I "C4'" 1 
ATOM   7557  O  "O4'" . DC  I  5 76  ? -36.024 -21.550 85.712  1.00 111.31 ? 3    DC  I "O4'" 1 
ATOM   7558  C  "C3'" . DC  I  5 76  ? -38.029 -20.573 86.535  1.00 109.92 ? 3    DC  I "C3'" 1 
ATOM   7559  O  "O3'" . DC  I  5 76  ? -38.396 -19.369 85.915  1.00 108.73 ? 3    DC  I "O3'" 1 
ATOM   7560  C  "C2'" . DC  I  5 76  ? -38.342 -21.775 85.649  1.00 110.49 ? 3    DC  I "C2'" 1 
ATOM   7561  C  "C1'" . DC  I  5 76  ? -37.074 -21.810 84.803  1.00 111.00 ? 3    DC  I "C1'" 1 
ATOM   7562  N  N1    . DC  I  5 76  ? -36.815 -23.078 84.043  1.00 111.38 ? 3    DC  I N1    1 
ATOM   7563  C  C2    . DC  I  5 76  ? -36.133 -22.998 82.813  1.00 111.29 ? 3    DC  I C2    1 
ATOM   7564  O  O2    . DC  I  5 76  ? -35.756 -21.892 82.392  1.00 110.90 ? 3    DC  I O2    1 
ATOM   7565  N  N3    . DC  I  5 76  ? -35.904 -24.146 82.118  1.00 111.02 ? 3    DC  I N3    1 
ATOM   7566  C  C4    . DC  I  5 76  ? -36.321 -25.323 82.599  1.00 110.94 ? 3    DC  I C4    1 
ATOM   7567  N  N4    . DC  I  5 76  ? -36.068 -26.415 81.872  1.00 111.04 ? 3    DC  I N4    1 
ATOM   7568  C  C5    . DC  I  5 76  ? -37.016 -25.430 83.845  1.00 110.98 ? 3    DC  I C5    1 
ATOM   7569  C  C6    . DC  I  5 76  ? -37.239 -24.294 84.526  1.00 111.36 ? 3    DC  I C6    1 
ATOM   7570  P  P     . DA  I  5 77  ? -39.192 -18.294 86.772  1.00 107.48 ? 4    DA  I P     1 
ATOM   7571  O  OP1   . DA  I  5 77  ? -38.444 -18.120 88.040  1.00 107.46 ? 4    DA  I OP1   1 
ATOM   7572  O  OP2   . DA  I  5 77  ? -40.616 -18.710 86.753  1.00 107.29 ? 4    DA  I OP2   1 
ATOM   7573  O  "O5'" . DA  I  5 77  ? -39.079 -16.942 85.930  1.00 106.67 ? 4    DA  I "O5'" 1 
ATOM   7574  C  "C5'" . DA  I  5 77  ? -37.823 -16.463 85.472  1.00 106.03 ? 4    DA  I "C5'" 1 
ATOM   7575  C  "C4'" . DA  I  5 77  ? -37.884 -16.120 83.990  1.00 105.77 ? 4    DA  I "C4'" 1 
ATOM   7576  O  "O4'" . DA  I  5 77  ? -37.800 -17.325 83.188  1.00 105.29 ? 4    DA  I "O4'" 1 
ATOM   7577  C  "C3'" . DA  I  5 77  ? -39.126 -15.369 83.510  1.00 105.92 ? 4    DA  I "C3'" 1 
ATOM   7578  O  "O3'" . DA  I  5 77  ? -38.642 -14.282 82.687  1.00 107.24 ? 4    DA  I "O3'" 1 
ATOM   7579  C  "C2'" . DA  I  5 77  ? -39.973 -16.455 82.826  1.00 105.04 ? 4    DA  I "C2'" 1 
ATOM   7580  C  "C1'" . DA  I  5 77  ? -38.924 -17.454 82.335  1.00 104.68 ? 4    DA  I "C1'" 1 
ATOM   7581  N  N9    . DA  I  5 77  ? -39.275 -18.879 82.359  1.00 104.34 ? 4    DA  I N9    1 
ATOM   7582  C  C8    . DA  I  5 77  ? -40.024 -19.547 83.287  1.00 104.23 ? 4    DA  I C8    1 
ATOM   7583  N  N7    . DA  I  5 77  ? -40.145 -20.832 83.053  1.00 104.21 ? 4    DA  I N7    1 
ATOM   7584  C  C5    . DA  I  5 77  ? -39.415 -21.032 81.898  1.00 104.28 ? 4    DA  I C5    1 
ATOM   7585  C  C6    . DA  I  5 77  ? -39.143 -22.178 81.117  1.00 104.44 ? 4    DA  I C6    1 
ATOM   7586  N  N6    . DA  I  5 77  ? -39.605 -23.392 81.415  1.00 104.50 ? 4    DA  I N6    1 
ATOM   7587  N  N1    . DA  I  5 77  ? -38.382 -22.038 80.008  1.00 104.47 ? 4    DA  I N1    1 
ATOM   7588  C  C2    . DA  I  5 77  ? -37.919 -20.822 79.705  1.00 104.33 ? 4    DA  I C2    1 
ATOM   7589  N  N3    . DA  I  5 77  ? -38.105 -19.676 80.362  1.00 104.47 ? 4    DA  I N3    1 
ATOM   7590  C  C4    . DA  I  5 77  ? -38.870 -19.841 81.458  1.00 104.40 ? 4    DA  I C4    1 
ATOM   7591  P  P     . DG  I  5 78  ? -39.397 -13.640 81.414  1.00 108.84 ? 5    DG  I P     1 
ATOM   7592  O  OP1   . DG  I  5 78  ? -38.662 -12.414 81.004  1.00 108.58 ? 5    DG  I OP1   1 
ATOM   7593  O  OP2   . DG  I  5 78  ? -40.865 -13.599 81.684  1.00 108.85 ? 5    DG  I OP2   1 
ATOM   7594  O  "O5'" . DG  I  5 78  ? -39.143 -14.776 80.318  1.00 108.60 ? 5    DG  I "O5'" 1 
ATOM   7595  C  "C5'" . DG  I  5 78  ? -38.324 -14.598 79.174  1.00 107.62 ? 5    DG  I "C5'" 1 
ATOM   7596  C  "C4'" . DG  I  5 78  ? -39.001 -15.427 78.107  1.00 107.58 ? 5    DG  I "C4'" 1 
ATOM   7597  O  "O4'" . DG  I  5 78  ? -39.406 -16.696 78.683  1.00 107.74 ? 5    DG  I "O4'" 1 
ATOM   7598  C  "C3'" . DG  I  5 78  ? -40.293 -14.821 77.567  1.00 107.06 ? 5    DG  I "C3'" 1 
ATOM   7599  O  "O3'" . DG  I  5 78  ? -40.305 -15.039 76.171  1.00 105.85 ? 5    DG  I "O3'" 1 
ATOM   7600  C  "C2'" . DG  I  5 78  ? -41.405 -15.607 78.269  1.00 107.41 ? 5    DG  I "C2'" 1 
ATOM   7601  C  "C1'" . DG  I  5 78  ? -40.733 -16.967 78.277  1.00 107.94 ? 5    DG  I "C1'" 1 
ATOM   7602  N  N9    . DG  I  5 78  ? -41.288 -18.011 79.137  1.00 108.24 ? 5    DG  I N9    1 
ATOM   7603  C  C8    . DG  I  5 78  ? -41.858 -17.920 80.386  1.00 108.19 ? 5    DG  I C8    1 
ATOM   7604  N  N7    . DG  I  5 78  ? -42.236 -19.077 80.867  1.00 108.21 ? 5    DG  I N7    1 
ATOM   7605  C  C5    . DG  I  5 78  ? -41.892 -19.989 79.873  1.00 108.28 ? 5    DG  I C5    1 
ATOM   7606  C  C6    . DG  I  5 78  ? -42.047 -21.399 79.798  1.00 108.26 ? 5    DG  I C6    1 
ATOM   7607  O  O6    . DG  I  5 78  ? -42.539 -22.162 80.629  1.00 108.21 ? 5    DG  I O6    1 
ATOM   7608  N  N1    . DG  I  5 78  ? -41.563 -21.936 78.606  1.00 108.18 ? 5    DG  I N1    1 
ATOM   7609  C  C2    . DG  I  5 78  ? -40.993 -21.200 77.595  1.00 108.14 ? 5    DG  I C2    1 
ATOM   7610  N  N2    . DG  I  5 78  ? -40.585 -21.883 76.517  1.00 108.32 ? 5    DG  I N2    1 
ATOM   7611  N  N3    . DG  I  5 78  ? -40.839 -19.883 77.645  1.00 107.91 ? 5    DG  I N3    1 
ATOM   7612  C  C4    . DG  I  5 78  ? -41.307 -19.347 78.805  1.00 108.30 ? 5    DG  I C4    1 
ATOM   7613  P  P     . DT  I  5 79  ? -39.947 -13.859 75.160  1.00 104.55 ? 6    DT  I P     1 
ATOM   7614  O  OP1   . DT  I  5 79  ? -39.070 -12.885 75.853  1.00 104.11 ? 6    DT  I OP1   1 
ATOM   7615  O  OP2   . DT  I  5 79  ? -41.246 -13.450 74.565  1.00 104.55 ? 6    DT  I OP2   1 
ATOM   7616  O  "O5'" . DT  I  5 79  ? -39.066 -14.569 74.028  1.00 102.57 ? 6    DT  I "O5'" 1 
ATOM   7617  C  "C5'" . DT  I  5 79  ? -38.462 -15.829 74.280  1.00 99.76  ? 6    DT  I "C5'" 1 
ATOM   7618  C  "C4'" . DT  I  5 79  ? -38.979 -16.888 73.318  1.00 97.96  ? 6    DT  I "C4'" 1 
ATOM   7619  O  "O4'" . DT  I  5 79  ? -39.954 -17.745 73.958  1.00 98.00  ? 6    DT  I "O4'" 1 
ATOM   7620  C  "C3'" . DT  I  5 79  ? -39.652 -16.403 72.040  1.00 96.97  ? 6    DT  I "C3'" 1 
ATOM   7621  O  "O3'" . DT  I  5 79  ? -39.226 -17.293 71.021  1.00 94.88  ? 6    DT  I "O3'" 1 
ATOM   7622  C  "C2'" . DT  I  5 79  ? -41.145 -16.516 72.343  1.00 97.42  ? 6    DT  I "C2'" 1 
ATOM   7623  C  "C1'" . DT  I  5 79  ? -41.163 -17.761 73.220  1.00 99.12  ? 6    DT  I "C1'" 1 
ATOM   7624  N  N1    . DT  I  5 79  ? -42.254 -17.852 74.235  1.00 99.71  ? 6    DT  I N1    1 
ATOM   7625  C  C2    . DT  I  5 79  ? -42.568 -19.098 74.738  1.00 100.15 ? 6    DT  I C2    1 
ATOM   7626  O  O2    . DT  I  5 79  ? -42.027 -20.130 74.386  1.00 100.61 ? 6    DT  I O2    1 
ATOM   7627  N  N3    . DT  I  5 79  ? -43.563 -19.105 75.679  1.00 100.43 ? 6    DT  I N3    1 
ATOM   7628  C  C4    . DT  I  5 79  ? -44.256 -18.016 76.166  1.00 100.21 ? 6    DT  I C4    1 
ATOM   7629  O  O4    . DT  I  5 79  ? -45.128 -18.166 77.012  1.00 100.30 ? 6    DT  I O4    1 
ATOM   7630  C  C5    . DT  I  5 79  ? -43.880 -16.730 75.610  1.00 100.56 ? 6    DT  I C5    1 
ATOM   7631  C  C7    . DT  I  5 79  ? -44.554 -15.456 76.050  1.00 99.88  ? 6    DT  I C7    1 
ATOM   7632  C  C6    . DT  I  5 79  ? -42.904 -16.716 74.685  1.00 100.32 ? 6    DT  I C6    1 
ATOM   7633  P  P     . DT  I  5 80  ? -39.359 -17.001 69.459  1.00 92.81  ? 7    DT  I P     1 
ATOM   7634  O  OP1   . DT  I  5 80  ? -38.021 -16.640 68.950  1.00 94.32  ? 7    DT  I OP1   1 
ATOM   7635  O  OP2   . DT  I  5 80  ? -40.548 -16.160 69.159  1.00 92.67  ? 7    DT  I OP2   1 
ATOM   7636  O  "O5'" . DT  I  5 80  ? -39.713 -18.475 68.994  1.00 92.91  ? 7    DT  I "O5'" 1 
ATOM   7637  C  "C5'" . DT  I  5 80  ? -40.992 -18.860 69.336  1.00 90.95  ? 7    DT  I "C5'" 1 
ATOM   7638  C  "C4'" . DT  I  5 80  ? -41.198 -20.333 69.183  1.00 90.22  ? 7    DT  I "C4'" 1 
ATOM   7639  O  "O4'" . DT  I  5 80  ? -41.808 -20.786 70.412  1.00 90.80  ? 7    DT  I "O4'" 1 
ATOM   7640  C  "C3'" . DT  I  5 80  ? -42.184 -20.601 68.060  1.00 89.29  ? 7    DT  I "C3'" 1 
ATOM   7641  O  "O3'" . DT  I  5 80  ? -41.922 -21.820 67.429  1.00 87.02  ? 7    DT  I "O3'" 1 
ATOM   7642  C  "C2'" . DT  I  5 80  ? -43.529 -20.686 68.759  1.00 91.03  ? 7    DT  I "C2'" 1 
ATOM   7643  C  "C1'" . DT  I  5 80  ? -43.205 -20.916 70.234  1.00 92.47  ? 7    DT  I "C1'" 1 
ATOM   7644  N  N1    . DT  I  5 80  ? -43.964 -19.972 71.132  1.00 93.01  ? 7    DT  I N1    1 
ATOM   7645  C  C2    . DT  I  5 80  ? -44.528 -20.474 72.283  1.00 93.16  ? 7    DT  I C2    1 
ATOM   7646  O  O2    . DT  I  5 80  ? -44.427 -21.643 72.616  1.00 93.36  ? 7    DT  I O2    1 
ATOM   7647  N  N3    . DT  I  5 80  ? -45.215 -19.545 73.029  1.00 93.30  ? 7    DT  I N3    1 
ATOM   7648  C  C4    . DT  I  5 80  ? -45.398 -18.200 72.740  1.00 93.46  ? 7    DT  I C4    1 
ATOM   7649  O  O4    . DT  I  5 80  ? -46.029 -17.452 73.483  1.00 93.46  ? 7    DT  I O4    1 
ATOM   7650  C  C5    . DT  I  5 80  ? -44.792 -17.739 71.512  1.00 93.55  ? 7    DT  I C5    1 
ATOM   7651  C  C7    . DT  I  5 80  ? -44.913 -16.302 71.078  1.00 93.12  ? 7    DT  I C7    1 
ATOM   7652  C  C6    . DT  I  5 80  ? -44.121 -18.639 70.781  1.00 93.19  ? 7    DT  I C6    1 
ATOM   7653  P  P     . DG  I  5 81  ? -42.742 -22.213 66.121  1.00 84.76  ? 8    DG  I P     1 
ATOM   7654  O  OP1   . DG  I  5 81  ? -41.838 -22.887 65.159  1.00 86.02  ? 8    DG  I OP1   1 
ATOM   7655  O  OP2   . DG  I  5 81  ? -43.570 -21.071 65.683  1.00 83.50  ? 8    DG  I OP2   1 
ATOM   7656  O  "O5'" . DG  I  5 81  ? -43.714 -23.320 66.719  1.00 84.79  ? 8    DG  I "O5'" 1 
ATOM   7657  C  "C5'" . DG  I  5 81  ? -43.307 -24.389 67.550  1.00 83.68  ? 8    DG  I "C5'" 1 
ATOM   7658  C  "C4'" . DG  I  5 81  ? -44.592 -25.040 68.030  1.00 84.14  ? 8    DG  I "C4'" 1 
ATOM   7659  O  "O4'" . DG  I  5 81  ? -45.301 -24.124 68.898  1.00 84.16  ? 8    DG  I "O4'" 1 
ATOM   7660  C  "C3'" . DG  I  5 81  ? -45.600 -25.402 66.935  1.00 84.43  ? 8    DG  I "C3'" 1 
ATOM   7661  O  "O3'" . DG  I  5 81  ? -46.159 -26.676 67.235  1.00 83.23  ? 8    DG  I "O3'" 1 
ATOM   7662  C  "C2'" . DG  I  5 81  ? -46.649 -24.280 66.954  1.00 83.86  ? 8    DG  I "C2'" 1 
ATOM   7663  C  "C1'" . DG  I  5 81  ? -46.617 -23.891 68.421  1.00 84.73  ? 8    DG  I "C1'" 1 
ATOM   7664  N  N9    . DG  I  5 81  ? -46.859 -22.495 68.747  1.00 85.25  ? 8    DG  I N9    1 
ATOM   7665  C  C8    . DG  I  5 81  ? -46.398 -21.373 68.112  1.00 85.16  ? 8    DG  I C8    1 
ATOM   7666  N  N7    . DG  I  5 81  ? -46.770 -20.259 68.676  1.00 84.66  ? 8    DG  I N7    1 
ATOM   7667  C  C5    . DG  I  5 81  ? -47.526 -20.671 69.756  1.00 85.49  ? 8    DG  I C5    1 
ATOM   7668  C  C6    . DG  I  5 81  ? -48.200 -19.915 70.743  1.00 85.39  ? 8    DG  I C6    1 
ATOM   7669  O  O6    . DG  I  5 81  ? -48.251 -18.688 70.845  1.00 85.73  ? 8    DG  I O6    1 
ATOM   7670  N  N1    . DG  I  5 81  ? -48.863 -20.721 71.669  1.00 84.91  ? 8    DG  I N1    1 
ATOM   7671  C  C2    . DG  I  5 81  ? -48.864 -22.098 71.642  1.00 85.20  ? 8    DG  I C2    1 
ATOM   7672  N  N2    . DG  I  5 81  ? -49.552 -22.718 72.610  1.00 85.41  ? 8    DG  I N2    1 
ATOM   7673  N  N3    . DG  I  5 81  ? -48.239 -22.825 70.721  1.00 85.68  ? 8    DG  I N3    1 
ATOM   7674  C  C4    . DG  I  5 81  ? -47.588 -22.046 69.817  1.00 85.84  ? 8    DG  I C4    1 
ATOM   7675  P  P     . DA  I  5 82  ? -47.015 -27.475 66.152  1.00 83.17  ? 9    DA  I P     1 
ATOM   7676  O  OP1   . DA  I  5 82  ? -46.558 -28.883 66.199  1.00 83.77  ? 9    DA  I OP1   1 
ATOM   7677  O  OP2   . DA  I  5 82  ? -47.081 -26.757 64.860  1.00 83.27  ? 9    DA  I OP2   1 
ATOM   7678  O  "O5'" . DA  I  5 82  ? -48.469 -27.344 66.800  1.00 85.95  ? 9    DA  I "O5'" 1 
ATOM   7679  C  "C5'" . DA  I  5 82  ? -48.727 -27.883 68.105  1.00 88.27  ? 9    DA  I "C5'" 1 
ATOM   7680  C  "C4'" . DA  I  5 82  ? -50.160 -27.634 68.535  1.00 89.36  ? 9    DA  I "C4'" 1 
ATOM   7681  O  "O4'" . DA  I  5 82  ? -50.320 -26.265 68.978  1.00 89.06  ? 9    DA  I "O4'" 1 
ATOM   7682  C  "C3'" . DA  I  5 82  ? -51.224 -27.876 67.468  1.00 90.48  ? 9    DA  I "C3'" 1 
ATOM   7683  O  "O3'" . DA  I  5 82  ? -52.343 -28.509 68.095  1.00 92.88  ? 9    DA  I "O3'" 1 
ATOM   7684  C  "C2'" . DA  I  5 82  ? -51.541 -26.468 66.978  1.00 89.80  ? 9    DA  I "C2'" 1 
ATOM   7685  C  "C1'" . DA  I  5 82  ? -51.371 -25.658 68.259  1.00 89.41  ? 9    DA  I "C1'" 1 
ATOM   7686  N  N9    . DA  I  5 82  ? -51.003 -24.260 68.071  1.00 89.59  ? 9    DA  I N9    1 
ATOM   7687  C  C8    . DA  I  5 82  ? -50.330 -23.677 67.026  1.00 89.71  ? 9    DA  I C8    1 
ATOM   7688  N  N7    . DA  I  5 82  ? -50.147 -22.388 67.161  1.00 89.18  ? 9    DA  I N7    1 
ATOM   7689  C  C5    . DA  I  5 82  ? -50.733 -22.117 68.384  1.00 89.25  ? 9    DA  I C5    1 
ATOM   7690  C  C6    . DA  I  5 82  ? -50.896 -20.933 69.119  1.00 89.50  ? 9    DA  I C6    1 
ATOM   7691  N  N6    . DA  I  5 82  ? -50.444 -19.752 68.702  1.00 89.75  ? 9    DA  I N6    1 
ATOM   7692  N  N1    . DA  I  5 82  ? -51.542 -21.005 70.304  1.00 89.73  ? 9    DA  I N1    1 
ATOM   7693  C  C2    . DA  I  5 82  ? -52.009 -22.182 70.736  1.00 89.23  ? 9    DA  I C2    1 
ATOM   7694  N  N3    . DA  I  5 82  ? -51.910 -23.362 70.128  1.00 89.75  ? 9    DA  I N3    1 
ATOM   7695  C  C4    . DA  I  5 82  ? -51.265 -23.254 68.954  1.00 89.32  ? 9    DA  I C4    1 
ATOM   7696  P  P     . DA  I  5 83  ? -53.508 -29.300 67.317  1.00 95.09  ? 10   DA  I P     1 
ATOM   7697  O  OP1   . DA  I  5 83  ? -53.809 -30.519 68.115  1.00 94.95  ? 10   DA  I OP1   1 
ATOM   7698  O  OP2   . DA  I  5 83  ? -53.209 -29.449 65.867  1.00 94.62  ? 10   DA  I OP2   1 
ATOM   7699  O  "O5'" . DA  I  5 83  ? -54.695 -28.241 67.499  1.00 96.56  ? 10   DA  I "O5'" 1 
ATOM   7700  C  "C5'" . DA  I  5 83  ? -55.180 -27.969 68.821  1.00 99.63  ? 10   DA  I "C5'" 1 
ATOM   7701  C  "C4'" . DA  I  5 83  ? -56.105 -26.767 68.848  1.00 101.89 ? 10   DA  I "C4'" 1 
ATOM   7702  O  "O4'" . DA  I  5 83  ? -55.306 -25.560 68.763  1.00 101.52 ? 10   DA  I "O4'" 1 
ATOM   7703  C  "C3'" . DA  I  5 83  ? -57.153 -26.723 67.723  1.00 103.75 ? 10   DA  I "C3'" 1 
ATOM   7704  O  "O3'" . DA  I  5 83  ? -58.495 -26.698 68.290  1.00 106.99 ? 10   DA  I "O3'" 1 
ATOM   7705  C  "C2'" . DA  I  5 83  ? -56.789 -25.465 66.930  1.00 102.70 ? 10   DA  I "C2'" 1 
ATOM   7706  C  "C1'" . DA  I  5 83  ? -55.975 -24.637 67.925  1.00 102.27 ? 10   DA  I "C1'" 1 
ATOM   7707  N  N9    . DA  I  5 83  ? -54.986 -23.774 67.276  1.00 102.56 ? 10   DA  I N9    1 
ATOM   7708  C  C8    . DA  I  5 83  ? -54.126 -24.111 66.262  1.00 102.61 ? 10   DA  I C8    1 
ATOM   7709  N  N7    . DA  I  5 83  ? -53.347 -23.129 65.871  1.00 102.89 ? 10   DA  I N7    1 
ATOM   7710  C  C5    . DA  I  5 83  ? -53.717 -22.068 66.681  1.00 102.40 ? 10   DA  I C5    1 
ATOM   7711  C  C6    . DA  I  5 83  ? -53.268 -20.734 66.771  1.00 101.99 ? 10   DA  I C6    1 
ATOM   7712  N  N6    . DA  I  5 83  ? -52.308 -20.219 66.007  1.00 102.41 ? 10   DA  I N6    1 
ATOM   7713  N  N1    . DA  I  5 83  ? -53.840 -19.933 67.683  1.00 102.37 ? 10   DA  I N1    1 
ATOM   7714  C  C2    . DA  I  5 83  ? -54.808 -20.439 68.460  1.00 102.85 ? 10   DA  I C2    1 
ATOM   7715  N  N3    . DA  I  5 83  ? -55.317 -21.673 68.472  1.00 102.62 ? 10   DA  I N3    1 
ATOM   7716  C  C4    . DA  I  5 83  ? -54.724 -22.449 67.551  1.00 102.43 ? 10   DA  I C4    1 
ATOM   7717  P  P     . DG  I  5 84  ? -59.871 -26.630 67.444  1.00 109.01 ? 11   DG  I P     1 
ATOM   7718  O  OP1   . DG  I  5 84  ? -60.871 -27.435 68.178  1.00 108.89 ? 11   DG  I OP1   1 
ATOM   7719  O  OP2   . DG  I  5 84  ? -59.629 -26.929 66.007  1.00 108.98 ? 11   DG  I OP2   1 
ATOM   7720  O  "O5'" . DG  I  5 84  ? -60.263 -25.086 67.613  1.00 110.15 ? 11   DG  I "O5'" 1 
ATOM   7721  C  "C5'" . DG  I  5 84  ? -60.535 -24.573 68.920  1.00 112.96 ? 11   DG  I "C5'" 1 
ATOM   7722  C  "C4'" . DG  I  5 84  ? -60.791 -23.077 68.880  1.00 115.22 ? 11   DG  I "C4'" 1 
ATOM   7723  O  "O4'" . DG  I  5 84  ? -59.523 -22.418 68.610  1.00 115.70 ? 11   DG  I "O4'" 1 
ATOM   7724  C  "C3'" . DG  I  5 84  ? -61.777 -22.633 67.796  1.00 117.00 ? 11   DG  I "C3'" 1 
ATOM   7725  O  "O3'" . DG  I  5 84  ? -62.867 -21.838 68.295  1.00 118.89 ? 11   DG  I "O3'" 1 
ATOM   7726  C  "C2'" . DG  I  5 84  ? -60.918 -21.855 66.805  1.00 116.86 ? 11   DG  I "C2'" 1 
ATOM   7727  C  "C1'" . DG  I  5 84  ? -59.700 -21.430 67.615  1.00 116.09 ? 11   DG  I "C1'" 1 
ATOM   7728  N  N9    . DG  I  5 84  ? -58.536 -21.314 66.734  1.00 116.26 ? 11   DG  I N9    1 
ATOM   7729  C  C8    . DG  I  5 84  ? -57.975 -22.303 65.951  1.00 116.19 ? 11   DG  I C8    1 
ATOM   7730  N  N7    . DG  I  5 84  ? -56.956 -21.906 65.244  1.00 116.00 ? 11   DG  I N7    1 
ATOM   7731  C  C5    . DG  I  5 84  ? -56.842 -20.564 65.572  1.00 115.95 ? 11   DG  I C5    1 
ATOM   7732  C  C6    . DG  I  5 84  ? -55.916 -19.605 65.119  1.00 115.93 ? 11   DG  I C6    1 
ATOM   7733  O  O6    . DG  I  5 84  ? -54.994 -19.778 64.317  1.00 116.16 ? 11   DG  I O6    1 
ATOM   7734  N  N1    . DG  I  5 84  ? -56.136 -18.354 65.693  1.00 116.16 ? 11   DG  I N1    1 
ATOM   7735  C  C2    . DG  I  5 84  ? -57.134 -18.066 66.597  1.00 115.96 ? 11   DG  I C2    1 
ATOM   7736  N  N2    . DG  I  5 84  ? -57.205 -16.807 67.042  1.00 115.91 ? 11   DG  I N2    1 
ATOM   7737  N  N3    . DG  I  5 84  ? -58.008 -18.958 67.033  1.00 115.98 ? 11   DG  I N3    1 
ATOM   7738  C  C4    . DG  I  5 84  ? -57.804 -20.180 66.479  1.00 116.05 ? 11   DG  I C4    1 
ATOM   7739  P  P     . DT  I  5 85  ? -63.929 -21.123 67.313  1.00 120.25 ? 12   DT  I P     1 
ATOM   7740  O  OP1   . DT  I  5 85  ? -65.192 -21.016 68.080  1.00 120.73 ? 12   DT  I OP1   1 
ATOM   7741  O  OP2   . DT  I  5 85  ? -63.936 -21.769 65.978  1.00 119.71 ? 12   DT  I OP2   1 
ATOM   7742  O  "O5'" . DT  I  5 85  ? -63.313 -19.664 67.105  1.00 121.23 ? 12   DT  I "O5'" 1 
ATOM   7743  C  "C5'" . DT  I  5 85  ? -63.148 -18.756 68.193  1.00 123.02 ? 12   DT  I "C5'" 1 
ATOM   7744  C  "C4'" . DT  I  5 85  ? -62.921 -17.352 67.655  1.00 124.46 ? 12   DT  I "C4'" 1 
ATOM   7745  O  "O4'" . DT  I  5 85  ? -61.628 -17.284 66.991  1.00 124.96 ? 12   DT  I "O4'" 1 
ATOM   7746  C  "C3'" . DT  I  5 85  ? -63.959 -16.887 66.635  1.00 125.40 ? 12   DT  I "C3'" 1 
ATOM   7747  O  "O3'" . DT  I  5 85  ? -64.363 -15.545 66.945  1.00 126.89 ? 12   DT  I "O3'" 1 
ATOM   7748  C  "C2'" . DT  I  5 85  ? -63.250 -17.031 65.286  1.00 125.23 ? 12   DT  I "C2'" 1 
ATOM   7749  C  "C1'" . DT  I  5 85  ? -61.779 -16.841 65.649  1.00 124.71 ? 12   DT  I "C1'" 1 
ATOM   7750  N  N1    . DT  I  5 85  ? -60.810 -17.562 64.732  1.00 124.44 ? 12   DT  I N1    1 
ATOM   7751  C  C2    . DT  I  5 85  ? -59.777 -16.856 64.133  1.00 124.21 ? 12   DT  I C2    1 
ATOM   7752  O  O2    . DT  I  5 85  ? -59.572 -15.663 64.287  1.00 124.13 ? 12   DT  I O2    1 
ATOM   7753  N  N3    . DT  I  5 85  ? -58.966 -17.610 63.324  1.00 124.09 ? 12   DT  I N3    1 
ATOM   7754  C  C4    . DT  I  5 85  ? -59.069 -18.960 63.051  1.00 124.21 ? 12   DT  I C4    1 
ATOM   7755  O  O4    . DT  I  5 85  ? -58.278 -19.524 62.304  1.00 124.28 ? 12   DT  I O4    1 
ATOM   7756  C  C5    . DT  I  5 85  ? -60.164 -19.645 63.700  1.00 124.35 ? 12   DT  I C5    1 
ATOM   7757  C  C7    . DT  I  5 85  ? -60.384 -21.116 63.478  1.00 124.37 ? 12   DT  I C7    1 
ATOM   7758  C  C6    . DT  I  5 85  ? -60.968 -18.922 64.499  1.00 124.36 ? 12   DT  I C6    1 
ATOM   7759  P  P     . DT  I  5 86  ? -65.221 -14.602 65.959  1.00 127.88 ? 13   DT  I P     1 
ATOM   7760  O  OP1   . DT  I  5 86  ? -65.856 -13.559 66.799  1.00 127.39 ? 13   DT  I OP1   1 
ATOM   7761  O  OP2   . DT  I  5 86  ? -66.037 -15.437 65.035  1.00 127.69 ? 13   DT  I OP2   1 
ATOM   7762  O  "O5'" . DT  I  5 86  ? -64.081 -13.894 65.099  1.00 128.16 ? 13   DT  I "O5'" 1 
ATOM   7763  C  "C5'" . DT  I  5 86  ? -63.087 -13.099 65.739  1.00 128.45 ? 13   DT  I "C5'" 1 
ATOM   7764  C  "C4'" . DT  I  5 86  ? -62.248 -12.452 64.662  1.00 128.54 ? 13   DT  I "C4'" 1 
ATOM   7765  O  "O4'" . DT  I  5 86  ? -61.485 -13.488 63.990  1.00 128.18 ? 13   DT  I "O4'" 1 
ATOM   7766  C  "C3'" . DT  I  5 86  ? -63.100 -11.752 63.607  1.00 128.83 ? 13   DT  I "C3'" 1 
ATOM   7767  O  "O3'" . DT  I  5 86  ? -62.847 -10.345 63.630  1.00 129.65 ? 13   DT  I "O3'" 1 
ATOM   7768  C  "C2'" . DT  I  5 86  ? -62.729 -12.442 62.290  1.00 128.46 ? 13   DT  I "C2'" 1 
ATOM   7769  C  "C1'" . DT  I  5 86  ? -61.454 -13.214 62.609  1.00 127.56 ? 13   DT  I "C1'" 1 
ATOM   7770  N  N1    . DT  I  5 86  ? -61.319 -14.485 61.835  1.00 127.14 ? 13   DT  I N1    1 
ATOM   7771  C  C2    . DT  I  5 86  ? -60.325 -14.563 60.881  1.00 127.04 ? 13   DT  I C2    1 
ATOM   7772  O  O2    . DT  I  5 86  ? -59.547 -13.657 60.646  1.00 126.85 ? 13   DT  I O2    1 
ATOM   7773  N  N3    . DT  I  5 86  ? -60.266 -15.757 60.204  1.00 127.24 ? 13   DT  I N3    1 
ATOM   7774  C  C4    . DT  I  5 86  ? -61.085 -16.859 60.381  1.00 127.12 ? 13   DT  I C4    1 
ATOM   7775  O  O4    . DT  I  5 86  ? -60.931 -17.878 59.709  1.00 126.99 ? 13   DT  I O4    1 
ATOM   7776  C  C5    . DT  I  5 86  ? -62.110 -16.709 61.397  1.00 126.86 ? 13   DT  I C5    1 
ATOM   7777  C  C7    . DT  I  5 86  ? -63.070 -17.822 61.690  1.00 126.97 ? 13   DT  I C7    1 
ATOM   7778  C  C6    . DT  I  5 86  ? -62.180 -15.546 62.065  1.00 126.87 ? 13   DT  I C6    1 
ATOM   7779  P  P     . DT  I  5 87  ? -63.427 -9.354  62.512  1.00 130.44 ? 14   DT  I P     1 
ATOM   7780  O  OP1   . DT  I  5 87  ? -63.533 -8.002  63.113  1.00 129.87 ? 14   DT  I OP1   1 
ATOM   7781  O  OP2   . DT  I  5 87  ? -64.605 -9.987  61.864  1.00 129.86 ? 14   DT  I OP2   1 
ATOM   7782  O  "O5'" . DT  I  5 87  ? -62.238 -9.342  61.434  1.00 131.51 ? 14   DT  I "O5'" 1 
ATOM   7783  C  "C5'" . DT  I  5 87  ? -60.896 -8.943  61.754  1.00 131.59 ? 14   DT  I "C5'" 1 
ATOM   7784  C  "C4'" . DT  I  5 87  ? -60.051 -8.905  60.489  1.00 131.93 ? 14   DT  I "C4'" 1 
ATOM   7785  O  "O4'" . DT  I  5 87  ? -59.883 -10.241 59.956  1.00 132.09 ? 14   DT  I "O4'" 1 
ATOM   7786  C  "C3'" . DT  I  5 87  ? -60.619 -8.063  59.350  1.00 132.41 ? 14   DT  I "C3'" 1 
ATOM   7787  O  "O3'" . DT  I  5 87  ? -59.579 -7.211  58.863  1.00 133.04 ? 14   DT  I "O3'" 1 
ATOM   7788  C  "C2'" . DT  I  5 87  ? -61.129 -9.086  58.329  1.00 132.33 ? 14   DT  I "C2'" 1 
ATOM   7789  C  "C1'" . DT  I  5 87  ? -60.201 -10.265 58.577  1.00 132.61 ? 14   DT  I "C1'" 1 
ATOM   7790  N  N1    . DT  I  5 87  ? -60.774 -11.616 58.219  1.00 132.96 ? 14   DT  I N1    1 
ATOM   7791  C  C2    . DT  I  5 87  ? -60.090 -12.399 57.305  1.00 133.26 ? 14   DT  I C2    1 
ATOM   7792  O  O2    . DT  I  5 87  ? -59.051 -12.053 56.766  1.00 133.53 ? 14   DT  I O2    1 
ATOM   7793  N  N3    . DT  I  5 87  ? -60.666 -13.618 57.031  1.00 133.44 ? 14   DT  I N3    1 
ATOM   7794  C  C4    . DT  I  5 87  ? -61.832 -14.133 57.567  1.00 133.11 ? 14   DT  I C4    1 
ATOM   7795  O  O4    . DT  I  5 87  ? -62.245 -15.243 57.240  1.00 133.02 ? 14   DT  I O4    1 
ATOM   7796  C  C5    . DT  I  5 87  ? -62.503 -13.269 58.521  1.00 133.12 ? 14   DT  I C5    1 
ATOM   7797  C  C7    . DT  I  5 87  ? -63.781 -13.704 59.177  1.00 133.14 ? 14   DT  I C7    1 
ATOM   7798  C  C6    . DT  I  5 87  ? -61.951 -12.073 58.795  1.00 132.95 ? 14   DT  I C6    1 
ATOM   7799  P  P     . DC  I  5 88  ? -59.617 -6.479  57.432  1.00 133.73 ? 15   DC  I P     1 
ATOM   7800  O  OP1   . DC  I  5 88  ? -58.745 -5.280  57.533  1.00 133.59 ? 15   DC  I OP1   1 
ATOM   7801  O  OP2   . DC  I  5 88  ? -61.018 -6.331  56.960  1.00 133.67 ? 15   DC  I OP2   1 
ATOM   7802  O  "O5'" . DC  I  5 88  ? -58.921 -7.578  56.501  1.00 133.43 ? 15   DC  I "O5'" 1 
ATOM   7803  C  "C5'" . DC  I  5 88  ? -57.518 -7.824  56.565  1.00 132.58 ? 15   DC  I "C5'" 1 
ATOM   7804  C  "C4'" . DC  I  5 88  ? -57.096 -8.531  55.291  1.00 131.80 ? 15   DC  I "C4'" 1 
ATOM   7805  O  "O4'" . DC  I  5 88  ? -57.817 -9.784  55.159  1.00 131.77 ? 15   DC  I "O4'" 1 
ATOM   7806  C  "C3'" . DC  I  5 88  ? -57.359 -7.761  54.002  1.00 131.22 ? 15   DC  I "C3'" 1 
ATOM   7807  O  "O3'" . DC  I  5 88  ? -56.271 -8.031  53.147  1.00 130.74 ? 15   DC  I "O3'" 1 
ATOM   7808  C  "C2'" . DC  I  5 88  ? -58.653 -8.374  53.466  1.00 131.22 ? 15   DC  I "C2'" 1 
ATOM   7809  C  "C1'" . DC  I  5 88  ? -58.482 -9.828  53.906  1.00 131.50 ? 15   DC  I "C1'" 1 
ATOM   7810  N  N1    . DC  I  5 88  ? -59.736 -10.664 54.047  1.00 131.45 ? 15   DC  I N1    1 
ATOM   7811  C  C2    . DC  I  5 88  ? -59.728 -12.000 53.585  1.00 131.67 ? 15   DC  I C2    1 
ATOM   7812  O  O2    . DC  I  5 88  ? -58.710 -12.478 53.062  1.00 131.72 ? 15   DC  I O2    1 
ATOM   7813  N  N3    . DC  I  5 88  ? -60.852 -12.755 53.717  1.00 131.65 ? 15   DC  I N3    1 
ATOM   7814  C  C4    . DC  I  5 88  ? -61.943 -12.237 54.283  1.00 131.50 ? 15   DC  I C4    1 
ATOM   7815  N  N4    . DC  I  5 88  ? -63.010 -13.037 54.383  1.00 131.52 ? 15   DC  I N4    1 
ATOM   7816  C  C5    . DC  I  5 88  ? -61.978 -10.886 54.765  1.00 131.41 ? 15   DC  I C5    1 
ATOM   7817  C  C6    . DC  I  5 88  ? -60.866 -10.145 54.630  1.00 131.25 ? 15   DC  I C6    1 
ATOM   7818  P  P     . DC  I  5 89  ? -55.711 -6.974  52.086  1.00 129.70 ? 16   DC  I P     1 
ATOM   7819  O  OP1   . DC  I  5 89  ? -54.758 -6.098  52.810  1.00 129.20 ? 16   DC  I OP1   1 
ATOM   7820  O  OP2   . DC  I  5 89  ? -56.852 -6.397  51.332  1.00 128.96 ? 16   DC  I OP2   1 
ATOM   7821  O  "O5'" . DC  I  5 89  ? -54.894 -7.935  51.088  1.00 128.79 ? 16   DC  I "O5'" 1 
ATOM   7822  C  "C5'" . DC  I  5 89  ? -54.637 -9.318  51.408  1.00 127.21 ? 16   DC  I "C5'" 1 
ATOM   7823  C  "C4'" . DC  I  5 89  ? -54.960 -10.269 50.258  1.00 126.20 ? 16   DC  I "C4'" 1 
ATOM   7824  O  "O4'" . DC  I  5 89  ? -56.244 -10.916 50.472  1.00 125.85 ? 16   DC  I "O4'" 1 
ATOM   7825  C  "C3'" . DC  I  5 89  ? -55.048 -9.660  48.857  1.00 125.74 ? 16   DC  I "C3'" 1 
ATOM   7826  O  "O3'" . DC  I  5 89  ? -54.534 -10.590 47.914  1.00 125.09 ? 16   DC  I "O3'" 1 
ATOM   7827  C  "C2'" . DC  I  5 89  ? -56.549 -9.502  48.653  1.00 125.87 ? 16   DC  I "C2'" 1 
ATOM   7828  C  "C1'" . DC  I  5 89  ? -56.991 -10.827 49.269  1.00 125.91 ? 16   DC  I "C1'" 1 
ATOM   7829  N  N1    . DC  I  5 89  ? -58.468 -10.975 49.541  1.00 126.04 ? 16   DC  I N1    1 
ATOM   7830  C  C2    . DC  I  5 89  ? -59.183 -12.075 49.017  1.00 125.82 ? 16   DC  I C2    1 
ATOM   7831  O  O2    . DC  I  5 89  ? -58.613 -12.932 48.326  1.00 125.88 ? 16   DC  I O2    1 
ATOM   7832  N  N3    . DC  I  5 89  ? -60.507 -12.180 49.287  1.00 125.64 ? 16   DC  I N3    1 
ATOM   7833  C  C4    . DC  I  5 89  ? -61.113 -11.253 50.034  1.00 125.72 ? 16   DC  I C4    1 
ATOM   7834  N  N4    . DC  I  5 89  ? -62.416 -11.406 50.267  1.00 125.90 ? 16   DC  I N4    1 
ATOM   7835  C  C5    . DC  I  5 89  ? -60.417 -10.131 50.575  1.00 125.85 ? 16   DC  I C5    1 
ATOM   7836  C  C6    . DC  I  5 89  ? -59.110 -10.034 50.305  1.00 125.97 ? 16   DC  I C6    1 
ATOM   7837  P  P     . DC  I  5 90  ? -53.029 -10.543 47.371  1.00 124.10 ? 17   DC  I P     1 
ATOM   7838  O  OP1   . DC  I  5 90  ? -52.130 -10.087 48.460  1.00 123.39 ? 17   DC  I OP1   1 
ATOM   7839  O  OP2   . DC  I  5 90  ? -53.056 -9.843  46.065  1.00 123.93 ? 17   DC  I OP2   1 
ATOM   7840  O  "O5'" . DC  I  5 90  ? -52.728 -12.082 47.044  1.00 124.72 ? 17   DC  I "O5'" 1 
ATOM   7841  C  "C5'" . DC  I  5 90  ? -52.940 -13.123 47.999  1.00 125.01 ? 17   DC  I "C5'" 1 
ATOM   7842  C  "C4'" . DC  I  5 90  ? -53.440 -14.392 47.322  1.00 125.50 ? 17   DC  I "C4'" 1 
ATOM   7843  O  "O4'" . DC  I  5 90  ? -54.889 -14.373 47.300  1.00 125.87 ? 17   DC  I "O4'" 1 
ATOM   7844  C  "C3'" . DC  I  5 90  ? -52.982 -14.628 45.881  1.00 125.87 ? 17   DC  I "C3'" 1 
ATOM   7845  O  "O3'" . DC  I  5 90  ? -52.518 -15.968 45.713  1.00 126.01 ? 17   DC  I "O3'" 1 
ATOM   7846  C  "C2'" . DC  I  5 90  ? -54.219 -14.326 45.029  1.00 125.93 ? 17   DC  I "C2'" 1 
ATOM   7847  C  "C1'" . DC  I  5 90  ? -55.381 -14.569 45.985  1.00 125.80 ? 17   DC  I "C1'" 1 
ATOM   7848  N  N1    . DC  I  5 90  ? -56.561 -13.654 45.771  1.00 125.69 ? 17   DC  I N1    1 
ATOM   7849  C  C2    . DC  I  5 90  ? -57.824 -14.200 45.485  1.00 125.45 ? 17   DC  I C2    1 
ATOM   7850  O  O2    . DC  I  5 90  ? -57.939 -15.429 45.410  1.00 125.26 ? 17   DC  I O2    1 
ATOM   7851  N  N3    . DC  I  5 90  ? -58.884 -13.361 45.295  1.00 125.44 ? 17   DC  I N3    1 
ATOM   7852  C  C4    . DC  I  5 90  ? -58.711 -12.035 45.382  1.00 125.51 ? 17   DC  I C4    1 
ATOM   7853  N  N4    . DC  I  5 90  ? -59.768 -11.242 45.192  1.00 125.43 ? 17   DC  I N4    1 
ATOM   7854  C  C5    . DC  I  5 90  ? -57.438 -11.457 45.672  1.00 125.51 ? 17   DC  I C5    1 
ATOM   7855  C  C6    . DC  I  5 90  ? -56.405 -12.293 45.859  1.00 125.64 ? 17   DC  I C6    1 
ATOM   7856  P  P     . DT  I  5 91  ? -52.031 -16.513 44.285  1.00 126.06 ? 18   DT  I P     1 
ATOM   7857  O  OP1   . DT  I  5 91  ? -51.155 -17.682 44.539  1.00 126.53 ? 18   DT  I OP1   1 
ATOM   7858  O  OP2   . DT  I  5 91  ? -51.568 -15.384 43.443  1.00 125.44 ? 18   DT  I OP2   1 
ATOM   7859  O  "O5'" . DT  I  5 91  ? -53.392 -17.045 43.659  1.00 127.58 ? 18   DT  I "O5'" 1 
ATOM   7860  C  "C5'" . DT  I  5 91  ? -54.072 -18.111 44.310  1.00 130.46 ? 18   DT  I "C5'" 1 
ATOM   7861  C  "C4'" . DT  I  5 91  ? -55.335 -18.454 43.548  1.00 132.24 ? 18   DT  I "C4'" 1 
ATOM   7862  O  "O4'" . DT  I  5 91  ? -56.244 -17.330 43.619  1.00 132.17 ? 18   DT  I "O4'" 1 
ATOM   7863  C  "C3'" . DT  I  5 91  ? -55.105 -18.742 42.067  1.00 133.48 ? 18   DT  I "C3'" 1 
ATOM   7864  O  "O3'" . DT  I  5 91  ? -55.648 -20.023 41.786  1.00 135.85 ? 18   DT  I "O3'" 1 
ATOM   7865  C  "C2'" . DT  I  5 91  ? -55.825 -17.604 41.338  1.00 133.06 ? 18   DT  I "C2'" 1 
ATOM   7866  C  "C1'" . DT  I  5 91  ? -56.869 -17.181 42.364  1.00 132.39 ? 18   DT  I "C1'" 1 
ATOM   7867  N  N1    . DT  I  5 91  ? -57.333 -15.765 42.308  1.00 132.42 ? 18   DT  I N1    1 
ATOM   7868  C  C2    . DT  I  5 91  ? -58.691 -15.505 42.415  1.00 132.21 ? 18   DT  I C2    1 
ATOM   7869  O  O2    . DT  I  5 91  ? -59.544 -16.375 42.534  1.00 131.89 ? 18   DT  I O2    1 
ATOM   7870  N  N3    . DT  I  5 91  ? -59.015 -14.168 42.372  1.00 131.99 ? 18   DT  I N3    1 
ATOM   7871  C  C4    . DT  I  5 91  ? -58.142 -13.101 42.238  1.00 132.02 ? 18   DT  I C4    1 
ATOM   7872  O  O4    . DT  I  5 91  ? -58.549 -11.945 42.214  1.00 132.10 ? 18   DT  I O4    1 
ATOM   7873  C  C5    . DT  I  5 91  ? -56.739 -13.443 42.141  1.00 132.10 ? 18   DT  I C5    1 
ATOM   7874  C  C7    . DT  I  5 91  ? -55.688 -12.380 41.994  1.00 132.13 ? 18   DT  I C7    1 
ATOM   7875  C  C6    . DT  I  5 91  ? -56.407 -14.742 42.182  1.00 132.24 ? 18   DT  I C6    1 
ATOM   7876  P  P     . DT  I  5 92  ? -55.500 -20.733 40.355  1.00 138.40 ? 19   DT  I P     1 
ATOM   7877  O  OP1   . DT  I  5 92  ? -55.347 -22.183 40.628  1.00 138.07 ? 19   DT  I OP1   1 
ATOM   7878  O  OP2   . DT  I  5 92  ? -54.478 -20.019 39.547  1.00 138.22 ? 19   DT  I OP2   1 
ATOM   7879  O  "O5'" . DT  I  5 92  ? -56.930 -20.452 39.668  1.00 140.47 ? 19   DT  I "O5'" 1 
ATOM   7880  C  "C5'" . DT  I  5 92  ? -58.183 -20.763 40.319  1.00 142.85 ? 19   DT  I "C5'" 1 
ATOM   7881  C  "C4'" . DT  I  5 92  ? -59.393 -20.208 39.573  1.00 144.53 ? 19   DT  I "C4'" 1 
ATOM   7882  O  "O4'" . DT  I  5 92  ? -59.534 -18.785 39.815  1.00 144.78 ? 19   DT  I "O4'" 1 
ATOM   7883  C  "C3'" . DT  I  5 92  ? -59.398 -20.397 38.057  1.00 145.98 ? 19   DT  I "C3'" 1 
ATOM   7884  O  "O3'" . DT  I  5 92  ? -60.584 -21.095 37.667  1.00 148.60 ? 19   DT  I "O3'" 1 
ATOM   7885  C  "C2'" . DT  I  5 92  ? -59.320 -18.980 37.478  1.00 145.40 ? 19   DT  I "C2'" 1 
ATOM   7886  C  "C1'" . DT  I  5 92  ? -59.839 -18.103 38.612  1.00 144.81 ? 19   DT  I "C1'" 1 
ATOM   7887  N  N1    . DT  I  5 92  ? -59.221 -16.733 38.713  1.00 144.70 ? 19   DT  I N1    1 
ATOM   7888  C  C2    . DT  I  5 92  ? -60.019 -15.628 38.967  1.00 144.55 ? 19   DT  I C2    1 
ATOM   7889  O  O2    . DT  I  5 92  ? -61.230 -15.677 39.102  1.00 144.67 ? 19   DT  I O2    1 
ATOM   7890  N  N3    . DT  I  5 92  ? -59.339 -14.435 39.055  1.00 144.62 ? 19   DT  I N3    1 
ATOM   7891  C  C4    . DT  I  5 92  ? -57.971 -14.233 38.925  1.00 144.73 ? 19   DT  I C4    1 
ATOM   7892  O  O4    . DT  I  5 92  ? -57.468 -13.115 39.022  1.00 144.62 ? 19   DT  I O4    1 
ATOM   7893  C  C5    . DT  I  5 92  ? -57.193 -15.427 38.667  1.00 144.70 ? 19   DT  I C5    1 
ATOM   7894  C  C7    . DT  I  5 92  ? -55.703 -15.359 38.499  1.00 144.60 ? 19   DT  I C7    1 
ATOM   7895  C  C6    . DT  I  5 92  ? -57.847 -16.596 38.578  1.00 144.82 ? 19   DT  I C6    1 
ATOM   7896  P  P     . DT  I  5 93  ? -60.835 -21.562 36.149  1.00 150.93 ? 20   DT  I P     1 
ATOM   7897  O  OP1   . DT  I  5 93  ? -61.726 -22.744 36.179  1.00 150.78 ? 20   DT  I OP1   1 
ATOM   7898  O  OP2   . DT  I  5 93  ? -59.538 -21.646 35.435  1.00 151.09 ? 20   DT  I OP2   1 
ATOM   7899  O  "O5'" . DT  I  5 93  ? -61.626 -20.310 35.542  1.00 152.37 ? 20   DT  I "O5'" 1 
ATOM   7900  C  "C5'" . DT  I  5 93  ? -62.927 -19.939 36.002  1.00 154.63 ? 20   DT  I "C5'" 1 
ATOM   7901  C  "C4'" . DT  I  5 93  ? -63.471 -18.833 35.117  1.00 156.39 ? 20   DT  I "C4'" 1 
ATOM   7902  O  "O4'" . DT  I  5 93  ? -62.868 -17.574 35.515  1.00 157.03 ? 20   DT  I "O4'" 1 
ATOM   7903  C  "C3'" . DT  I  5 93  ? -63.177 -19.024 33.628  1.00 157.43 ? 20   DT  I "C3'" 1 
ATOM   7904  O  "O3'" . DT  I  5 93  ? -64.384 -18.995 32.865  1.00 158.36 ? 20   DT  I "O3'" 1 
ATOM   7905  C  "C2'" . DT  I  5 93  ? -62.223 -17.888 33.258  1.00 157.67 ? 20   DT  I "C2'" 1 
ATOM   7906  C  "C1'" . DT  I  5 93  ? -62.444 -16.861 34.366  1.00 157.92 ? 20   DT  I "C1'" 1 
ATOM   7907  N  N1    . DT  I  5 93  ? -61.203 -16.074 34.693  1.00 158.23 ? 20   DT  I N1    1 
ATOM   7908  C  C2    . DT  I  5 93  ? -61.293 -14.730 35.031  1.00 158.21 ? 20   DT  I C2    1 
ATOM   7909  O  O2    . DT  I  5 93  ? -62.339 -14.104 35.094  1.00 158.20 ? 20   DT  I O2    1 
ATOM   7910  N  N3    . DT  I  5 93  ? -60.086 -14.131 35.304  1.00 158.17 ? 20   DT  I N3    1 
ATOM   7911  C  C4    . DT  I  5 93  ? -58.831 -14.721 35.272  1.00 158.17 ? 20   DT  I C4    1 
ATOM   7912  O  O4    . DT  I  5 93  ? -57.814 -14.085 35.535  1.00 158.29 ? 20   DT  I O4    1 
ATOM   7913  C  C5    . DT  I  5 93  ? -58.805 -16.120 34.910  1.00 158.17 ? 20   DT  I C5    1 
ATOM   7914  C  C7    . DT  I  5 93  ? -57.513 -16.881 34.838  1.00 158.12 ? 20   DT  I C7    1 
ATOM   7915  C  C6    . DT  I  5 93  ? -59.975 -16.717 34.643  1.00 158.30 ? 20   DT  I C6    1 
ATOM   7916  P  P     . DG  I  5 94  ? -64.383 -19.182 31.270  1.00 158.99 ? 21   DG  I P     1 
ATOM   7917  O  OP1   . DG  I  5 94  ? -65.638 -19.876 30.893  1.00 159.11 ? 21   DG  I OP1   1 
ATOM   7918  O  OP2   . DG  I  5 94  ? -63.075 -19.731 30.827  1.00 159.06 ? 21   DG  I OP2   1 
ATOM   7919  O  "O5'" . DG  I  5 94  ? -64.467 -17.666 30.778  1.00 159.16 ? 21   DG  I "O5'" 1 
ATOM   7920  C  "C5'" . DG  I  5 94  ? -65.633 -16.862 30.977  1.00 159.49 ? 21   DG  I "C5'" 1 
ATOM   7921  C  "C4'" . DG  I  5 94  ? -65.413 -15.509 30.318  1.00 159.84 ? 21   DG  I "C4'" 1 
ATOM   7922  O  "O4'" . DG  I  5 94  ? -64.373 -14.792 31.038  1.00 159.88 ? 21   DG  I "O4'" 1 
ATOM   7923  C  "C3'" . DG  I  5 94  ? -64.946 -15.584 28.863  1.00 160.04 ? 21   DG  I "C3'" 1 
ATOM   7924  O  "O3'" . DG  I  5 94  ? -65.583 -14.579 28.076  1.00 160.15 ? 21   DG  I "O3'" 1 
ATOM   7925  C  "C2'" . DG  I  5 94  ? -63.436 -15.361 28.949  1.00 160.06 ? 21   DG  I "C2'" 1 
ATOM   7926  C  "C1'" . DG  I  5 94  ? -63.364 -14.393 30.124  1.00 160.02 ? 21   DG  I "C1'" 1 
ATOM   7927  N  N9    . DG  I  5 94  ? -62.060 -14.314 30.794  1.00 160.09 ? 21   DG  I N9    1 
ATOM   7928  C  C8    . DG  I  5 94  ? -61.106 -15.299 30.973  1.00 159.92 ? 21   DG  I C8    1 
ATOM   7929  N  N7    . DG  I  5 94  ? -60.046 -14.885 31.614  1.00 159.76 ? 21   DG  I N7    1 
ATOM   7930  C  C5    . DG  I  5 94  ? -60.312 -13.542 31.878  1.00 159.92 ? 21   DG  I C5    1 
ATOM   7931  C  C6    . DG  I  5 94  ? -59.543 -12.552 32.546  1.00 159.99 ? 21   DG  I C6    1 
ATOM   7932  O  O6    . DG  I  5 94  ? -58.423 -12.671 33.059  1.00 159.96 ? 21   DG  I O6    1 
ATOM   7933  N  N1    . DG  I  5 94  ? -60.189 -11.309 32.592  1.00 160.06 ? 21   DG  I N1    1 
ATOM   7934  C  C2    . DG  I  5 94  ? -61.434 -11.048 32.058  1.00 159.94 ? 21   DG  I C2    1 
ATOM   7935  N  N2    . DG  I  5 94  ? -61.906 -9.798  32.192  1.00 159.91 ? 21   DG  I N2    1 
ATOM   7936  N  N3    . DG  I  5 94  ? -62.165 -11.962 31.431  1.00 160.02 ? 21   DG  I N3    1 
ATOM   7937  C  C4    . DG  I  5 94  ? -61.546 -13.178 31.377  1.00 160.10 ? 21   DG  I C4    1 
ATOM   7938  P  P     . DA  I  5 95  ? -65.726 -14.767 26.489  1.00 160.33 ? 22   DA  I P     1 
ATOM   7939  O  OP1   . DA  I  5 95  ? -66.466 -13.591 25.966  1.00 160.13 ? 22   DA  I OP1   1 
ATOM   7940  O  OP2   . DA  I  5 95  ? -66.261 -16.130 26.242  1.00 160.23 ? 22   DA  I OP2   1 
ATOM   7941  O  "O5'" . DA  I  5 95  ? -64.200 -14.741 25.984  1.00 159.94 ? 22   DA  I "O5'" 1 
ATOM   7942  C  "C5'" . DA  I  5 95  ? -63.753 -13.856 24.959  1.00 159.48 ? 22   DA  I "C5'" 1 
ATOM   7943  C  "C4'" . DA  I  5 95  ? -63.513 -12.464 25.516  1.00 159.32 ? 22   DA  I "C4'" 1 
ATOM   7944  O  "O4'" . DA  I  5 95  ? -62.875 -12.544 26.819  1.00 159.12 ? 22   DA  I "O4'" 1 
ATOM   7945  C  "C3'" . DA  I  5 95  ? -62.627 -11.587 24.642  1.00 159.42 ? 22   DA  I "C3'" 1 
ATOM   7946  O  "O3'" . DA  I  5 95  ? -63.220 -10.297 24.517  1.00 159.57 ? 22   DA  I "O3'" 1 
ATOM   7947  C  "C2'" . DA  I  5 95  ? -61.308 -11.521 25.405  1.00 159.19 ? 22   DA  I "C2'" 1 
ATOM   7948  C  "C1'" . DA  I  5 95  ? -61.754 -11.684 26.854  1.00 158.65 ? 22   DA  I "C1'" 1 
ATOM   7949  N  N9    . DA  I  5 95  ? -60.693 -12.259 27.681  1.00 158.46 ? 22   DA  I N9    1 
ATOM   7950  C  C8    . DA  I  5 95  ? -60.468 -13.583 27.953  1.00 158.26 ? 22   DA  I C8    1 
ATOM   7951  N  N7    . DA  I  5 95  ? -59.428 -13.799 28.719  1.00 158.16 ? 22   DA  I N7    1 
ATOM   7952  C  C5    . DA  I  5 95  ? -58.932 -12.531 28.963  1.00 158.17 ? 22   DA  I C5    1 
ATOM   7953  C  C6    . DA  I  5 95  ? -57.833 -12.069 29.712  1.00 158.22 ? 22   DA  I C6    1 
ATOM   7954  N  N6    . DA  I  5 95  ? -57.015 -12.887 30.377  1.00 158.30 ? 22   DA  I N6    1 
ATOM   7955  N  N1    . DA  I  5 95  ? -57.606 -10.736 29.757  1.00 158.32 ? 22   DA  I N1    1 
ATOM   7956  C  C2    . DA  I  5 95  ? -58.433 -9.917  29.092  1.00 158.25 ? 22   DA  I C2    1 
ATOM   7957  N  N3    . DA  I  5 95  ? -59.497 -10.234 28.353  1.00 158.21 ? 22   DA  I N3    1 
ATOM   7958  C  C4    . DA  I  5 95  ? -59.695 -11.567 28.329  1.00 158.26 ? 22   DA  I C4    1 
ATOM   7959  P  P     . DT  I  5 96  ? -63.700 -9.767  23.081  1.00 159.59 ? 23   DT  I P     1 
ATOM   7960  O  OP1   . DT  I  5 96  ? -64.858 -10.595 22.668  1.00 159.58 ? 23   DT  I OP1   1 
ATOM   7961  O  OP2   . DT  I  5 96  ? -62.509 -9.699  22.198  1.00 159.47 ? 23   DT  I OP2   1 
ATOM   7962  O  "O5'" . DT  I  5 96  ? -64.198 -8.262  23.372  1.00 158.63 ? 23   DT  I "O5'" 1 
ATOM   7963  C  "C5'" . DT  I  5 96  ? -63.819 -7.524  24.551  1.00 156.89 ? 23   DT  I "C5'" 1 
ATOM   7964  C  "C4'" . DT  I  5 96  ? -62.508 -6.764  24.386  1.00 155.64 ? 23   DT  I "C4'" 1 
ATOM   7965  O  "O4'" . DT  I  5 96  ? -61.434 -7.491  25.033  1.00 155.21 ? 23   DT  I "O4'" 1 
ATOM   7966  C  "C3'" . DT  I  5 96  ? -62.046 -6.494  22.948  1.00 154.85 ? 23   DT  I "C3'" 1 
ATOM   7967  O  "O3'" . DT  I  5 96  ? -62.181 -5.077  22.661  1.00 153.94 ? 23   DT  I "O3'" 1 
ATOM   7968  C  "C2'" . DT  I  5 96  ? -60.627 -7.075  22.873  1.00 154.68 ? 23   DT  I "C2'" 1 
ATOM   7969  C  "C1'" . DT  I  5 96  ? -60.234 -7.218  24.341  1.00 154.82 ? 23   DT  I "C1'" 1 
ATOM   7970  N  N1    . DT  I  5 96  ? -59.235 -8.303  24.658  1.00 154.80 ? 23   DT  I N1    1 
ATOM   7971  C  C2    . DT  I  5 96  ? -58.514 -8.224  25.841  1.00 154.79 ? 23   DT  I C2    1 
ATOM   7972  O  O2    . DT  I  5 96  ? -58.629 -7.321  26.654  1.00 154.76 ? 23   DT  I O2    1 
ATOM   7973  N  N3    . DT  I  5 96  ? -57.630 -9.254  26.050  1.00 154.70 ? 23   DT  I N3    1 
ATOM   7974  C  C4    . DT  I  5 96  ? -57.400 -10.336 25.221  1.00 154.75 ? 23   DT  I C4    1 
ATOM   7975  O  O4    . DT  I  5 96  ? -56.580 -11.197 25.522  1.00 154.72 ? 23   DT  I O4    1 
ATOM   7976  C  C5    . DT  I  5 96  ? -58.181 -10.365 23.998  1.00 154.67 ? 23   DT  I C5    1 
ATOM   7977  C  C7    . DT  I  5 96  ? -58.029 -11.482 23.006  1.00 154.55 ? 23   DT  I C7    1 
ATOM   7978  C  C6    . DT  I  5 96  ? -59.048 -9.363  23.782  1.00 154.67 ? 23   DT  I C6    1 
ATOM   7979  P  P     . DA  I  5 97  ? -60.966 -4.054  22.369  1.00 152.86 ? 24   DA  I P     1 
ATOM   7980  O  OP1   . DA  I  5 97  ? -61.559 -2.769  21.917  1.00 152.92 ? 24   DA  I OP1   1 
ATOM   7981  O  OP2   . DA  I  5 97  ? -59.950 -4.723  21.508  1.00 152.94 ? 24   DA  I OP2   1 
ATOM   7982  O  "O5'" . DA  I  5 97  ? -60.346 -3.846  23.843  1.00 151.28 ? 24   DA  I "O5'" 1 
ATOM   7983  C  "C5'" . DA  I  5 97  ? -60.062 -2.540  24.358  1.00 147.91 ? 24   DA  I "C5'" 1 
ATOM   7984  C  "C4'" . DA  I  5 97  ? -58.566 -2.268  24.309  1.00 145.30 ? 24   DA  I "C4'" 1 
ATOM   7985  O  "O4'" . DA  I  5 97  ? -57.800 -3.470  24.612  1.00 144.87 ? 24   DA  I "O4'" 1 
ATOM   7986  C  "C3'" . DA  I  5 97  ? -58.053 -1.748  22.969  1.00 143.12 ? 24   DA  I "C3'" 1 
ATOM   7987  O  "O3'" . DA  I  5 97  ? -57.183 -0.647  23.241  1.00 139.99 ? 24   DA  I "O3'" 1 
ATOM   7988  C  "C2'" . DA  I  5 97  ? -57.336 -2.961  22.369  1.00 143.67 ? 24   DA  I "C2'" 1 
ATOM   7989  C  "C1'" . DA  I  5 97  ? -56.802 -3.650  23.625  1.00 144.38 ? 24   DA  I "C1'" 1 
ATOM   7990  N  N9    . DA  I  5 97  ? -56.527 -5.082  23.492  1.00 144.33 ? 24   DA  I N9    1 
ATOM   7991  C  C8    . DA  I  5 97  ? -57.265 -6.016  22.818  1.00 144.33 ? 24   DA  I C8    1 
ATOM   7992  N  N7    . DA  I  5 97  ? -56.772 -7.230  22.877  1.00 144.38 ? 24   DA  I N7    1 
ATOM   7993  C  C5    . DA  I  5 97  ? -55.630 -7.089  23.646  1.00 144.33 ? 24   DA  I C5    1 
ATOM   7994  C  C6    . DA  I  5 97  ? -54.654 -8.012  24.085  1.00 144.19 ? 24   DA  I C6    1 
ATOM   7995  N  N6    . DA  I  5 97  ? -54.682 -9.312  23.785  1.00 144.22 ? 24   DA  I N6    1 
ATOM   7996  N  N1    . DA  I  5 97  ? -53.634 -7.544  24.838  1.00 144.33 ? 24   DA  I N1    1 
ATOM   7997  C  C2    . DA  I  5 97  ? -53.598 -6.236  25.137  1.00 144.49 ? 24   DA  I C2    1 
ATOM   7998  N  N3    . DA  I  5 97  ? -54.460 -5.275  24.786  1.00 144.49 ? 24   DA  I N3    1 
ATOM   7999  C  C4    . DA  I  5 97  ? -55.462 -5.769  24.034  1.00 144.41 ? 24   DA  I C4    1 
ATOM   8000  P  P     . DG  I  5 98  ? -56.390 0.148   22.099  1.00 137.56 ? 25   DG  I P     1 
ATOM   8001  O  OP1   . DG  I  5 98  ? -56.180 1.528   22.601  1.00 137.36 ? 25   DG  I OP1   1 
ATOM   8002  O  OP2   . DG  I  5 98  ? -57.059 -0.081  20.795  1.00 137.20 ? 25   DG  I OP2   1 
ATOM   8003  O  "O5'" . DG  I  5 98  ? -54.992 -0.634  22.043  1.00 135.52 ? 25   DG  I "O5'" 1 
ATOM   8004  C  "C5'" . DG  I  5 98  ? -53.865 -0.263  22.839  1.00 131.74 ? 25   DG  I "C5'" 1 
ATOM   8005  C  "C4'" . DG  I  5 98  ? -52.660 -1.101  22.443  1.00 128.62 ? 25   DG  I "C4'" 1 
ATOM   8006  O  "O4'" . DG  I  5 98  ? -53.039 -2.497  22.377  1.00 128.21 ? 25   DG  I "O4'" 1 
ATOM   8007  C  "C3'" . DG  I  5 98  ? -52.041 -0.775  21.081  1.00 126.71 ? 25   DG  I "C3'" 1 
ATOM   8008  O  "O3'" . DG  I  5 98  ? -50.625 -0.728  21.225  1.00 123.83 ? 25   DG  I "O3'" 1 
ATOM   8009  C  "C2'" . DG  I  5 98  ? -52.453 -1.956  20.198  1.00 127.08 ? 25   DG  I "C2'" 1 
ATOM   8010  C  "C1'" . DG  I  5 98  ? -52.410 -3.063  21.248  1.00 128.03 ? 25   DG  I "C1'" 1 
ATOM   8011  N  N9    . DG  I  5 98  ? -53.074 -4.331  20.944  1.00 128.11 ? 25   DG  I N9    1 
ATOM   8012  C  C8    . DG  I  5 98  ? -54.212 -4.547  20.202  1.00 128.15 ? 25   DG  I C8    1 
ATOM   8013  N  N7    . DG  I  5 98  ? -54.550 -5.806  20.127  1.00 128.21 ? 25   DG  I N7    1 
ATOM   8014  C  C5    . DG  I  5 98  ? -53.576 -6.467  20.870  1.00 128.21 ? 25   DG  I C5    1 
ATOM   8015  C  C6    . DG  I  5 98  ? -53.405 -7.850  21.150  1.00 128.20 ? 25   DG  I C6    1 
ATOM   8016  O  O6    . DG  I  5 98  ? -54.109 -8.801  20.788  1.00 128.23 ? 25   DG  I O6    1 
ATOM   8017  N  N1    . DG  I  5 98  ? -52.284 -8.104  21.942  1.00 128.18 ? 25   DG  I N1    1 
ATOM   8018  C  C2    . DG  I  5 98  ? -51.425 -7.134  22.408  1.00 128.27 ? 25   DG  I C2    1 
ATOM   8019  N  N2    . DG  I  5 98  ? -50.398 -7.564  23.156  1.00 128.25 ? 25   DG  I N2    1 
ATOM   8020  N  N3    . DG  I  5 98  ? -51.571 -5.834  22.156  1.00 128.39 ? 25   DG  I N3    1 
ATOM   8021  C  C4    . DG  I  5 98  ? -52.662 -5.571  21.381  1.00 128.16 ? 25   DG  I C4    1 
ATOM   8022  P  P     . DC  I  5 99  ? -49.843 0.552   21.789  1.00 121.23 ? 26   DC  I P     1 
ATOM   8023  O  OP1   . DC  I  5 99  ? -50.723 1.298   22.729  1.00 120.82 ? 26   DC  I OP1   1 
ATOM   8024  O  OP2   . DC  I  5 99  ? -49.237 1.212   20.606  1.00 120.53 ? 26   DC  I OP2   1 
ATOM   8025  O  "O5'" . DC  I  5 99  ? -48.635 -0.084  22.629  1.00 119.34 ? 26   DC  I "O5'" 1 
ATOM   8026  C  "C5'" . DC  I  5 99  ? -48.798 -0.548  23.985  1.00 115.79 ? 26   DC  I "C5'" 1 
ATOM   8027  C  "C4'" . DC  I  5 99  ? -47.832 -1.691  24.289  1.00 112.84 ? 26   DC  I "C4'" 1 
ATOM   8028  O  "O4'" . DC  I  5 99  ? -48.305 -2.905  23.646  1.00 111.72 ? 26   DC  I "O4'" 1 
ATOM   8029  C  "C3'" . DC  I  5 99  ? -46.391 -1.483  23.809  1.00 111.29 ? 26   DC  I "C3'" 1 
ATOM   8030  O  "O3'" . DC  I  5 99  ? -45.446 -1.963  24.786  1.00 109.19 ? 26   DC  I "O3'" 1 
ATOM   8031  C  "C2'" . DC  I  5 99  ? -46.320 -2.250  22.487  1.00 110.93 ? 26   DC  I "C2'" 1 
ATOM   8032  C  "C1'" . DC  I  5 99  ? -47.336 -3.370  22.722  1.00 111.74 ? 26   DC  I "C1'" 1 
ATOM   8033  N  N1    . DC  I  5 99  ? -48.038 -3.845  21.482  1.00 111.75 ? 26   DC  I N1    1 
ATOM   8034  C  C2    . DC  I  5 99  ? -48.338 -5.211  21.337  1.00 112.02 ? 26   DC  I C2    1 
ATOM   8035  O  O2    . DC  I  5 99  ? -48.026 -6.014  22.228  1.00 111.79 ? 26   DC  I O2    1 
ATOM   8036  N  N3    . DC  I  5 99  ? -48.969 -5.626  20.205  1.00 112.21 ? 26   DC  I N3    1 
ATOM   8037  C  C4    . DC  I  5 99  ? -49.301 -4.743  19.257  1.00 111.82 ? 26   DC  I C4    1 
ATOM   8038  N  N4    . DC  I  5 99  ? -49.919 -5.208  18.169  1.00 111.61 ? 26   DC  I N4    1 
ATOM   8039  C  C5    . DC  I  5 99  ? -49.003 -3.349  19.383  1.00 111.83 ? 26   DC  I C5    1 
ATOM   8040  C  C6    . DC  I  5 99  ? -48.374 -2.953  20.498  1.00 111.76 ? 26   DC  I C6    1 
ATOM   8041  P  P     . DG  I  5 100 ? -43.888 -1.560  24.698  1.00 108.14 ? 27   DG  I P     1 
ATOM   8042  O  OP1   . DG  I  5 100 ? -43.375 -1.407  26.089  1.00 109.23 ? 27   DG  I OP1   1 
ATOM   8043  O  OP2   . DG  I  5 100 ? -43.726 -0.454  23.721  1.00 107.23 ? 27   DG  I OP2   1 
ATOM   8044  O  "O5'" . DG  I  5 100 ? -43.199 -2.841  24.028  1.00 107.18 ? 27   DG  I "O5'" 1 
ATOM   8045  C  "C5'" . DG  I  5 100 ? -43.594 -4.198  24.268  1.00 105.20 ? 27   DG  I "C5'" 1 
ATOM   8046  C  "C4'" . DG  I  5 100 ? -42.989 -5.103  23.199  1.00 104.16 ? 27   DG  I "C4'" 1 
ATOM   8047  O  "O4'" . DG  I  5 100 ? -43.916 -5.236  22.091  1.00 103.77 ? 27   DG  I "O4'" 1 
ATOM   8048  C  "C3'" . DG  I  5 100 ? -41.693 -4.616  22.545  1.00 103.37 ? 27   DG  I "C3'" 1 
ATOM   8049  O  "O3'" . DG  I  5 100 ? -40.998 -5.755  22.100  1.00 101.66 ? 27   DG  I "O3'" 1 
ATOM   8050  C  "C2'" . DG  I  5 100 ? -42.197 -3.864  21.322  1.00 103.49 ? 27   DG  I "C2'" 1 
ATOM   8051  C  "C1'" . DG  I  5 100 ? -43.253 -4.873  20.891  1.00 105.08 ? 27   DG  I "C1'" 1 
ATOM   8052  N  N9    . DG  I  5 100 ? -44.237 -4.420  19.910  1.00 105.62 ? 27   DG  I N9    1 
ATOM   8053  C  C8    . DG  I  5 100 ? -44.536 -3.136  19.511  1.00 106.18 ? 27   DG  I C8    1 
ATOM   8054  N  N7    . DG  I  5 100 ? -45.477 -3.065  18.606  1.00 106.32 ? 27   DG  I N7    1 
ATOM   8055  C  C5    . DG  I  5 100 ? -45.825 -4.392  18.396  1.00 106.07 ? 27   DG  I C5    1 
ATOM   8056  C  C6    . DG  I  5 100 ? -46.788 -4.955  17.519  1.00 106.22 ? 27   DG  I C6    1 
ATOM   8057  O  O6    . DG  I  5 100 ? -47.554 -4.361  16.746  1.00 106.03 ? 27   DG  I O6    1 
ATOM   8058  N  N1    . DG  I  5 100 ? -46.833 -6.350  17.614  1.00 106.15 ? 27   DG  I N1    1 
ATOM   8059  C  C2    . DG  I  5 100 ? -46.028 -7.102  18.449  1.00 105.94 ? 27   DG  I C2    1 
ATOM   8060  N  N2    . DG  I  5 100 ? -46.193 -8.428  18.408  1.00 105.65 ? 27   DG  I N2    1 
ATOM   8061  N  N3    . DG  I  5 100 ? -45.120 -6.587  19.269  1.00 105.94 ? 27   DG  I N3    1 
ATOM   8062  C  C4    . DG  I  5 100 ? -45.074 -5.234  19.190  1.00 105.65 ? 27   DG  I C4    1 
ATOM   8063  P  P     . DC  I  5 101 ? -39.639 -6.281  22.729  1.00 99.12  ? 28   DC  I P     1 
ATOM   8064  O  OP1   . DC  I  5 101 ? -39.673 -6.031  24.185  1.00 99.43  ? 28   DC  I OP1   1 
ATOM   8065  O  OP2   . DC  I  5 101 ? -38.538 -5.799  21.863  1.00 99.42  ? 28   DC  I OP2   1 
ATOM   8066  O  "O5'" . DC  I  5 101 ? -39.720 -7.860  22.478  1.00 101.53 ? 28   DC  I "O5'" 1 
ATOM   8067  C  "C5'" . DC  I  5 101 ? -40.936 -8.617  22.630  1.00 103.19 ? 28   DC  I "C5'" 1 
ATOM   8068  C  "C4'" . DC  I  5 101 ? -41.051 -9.711  21.570  1.00 105.10 ? 28   DC  I "C4'" 1 
ATOM   8069  O  "O4'" . DC  I  5 101 ? -41.899 -9.275  20.470  1.00 105.88 ? 28   DC  I "O4'" 1 
ATOM   8070  C  "C3'" . DC  I  5 101 ? -39.737 -10.183 20.941  1.00 106.17 ? 28   DC  I "C3'" 1 
ATOM   8071  O  "O3'" . DC  I  5 101 ? -39.693 -11.602 20.840  1.00 106.70 ? 28   DC  I "O3'" 1 
ATOM   8072  C  "C2'" . DC  I  5 101 ? -39.717 -9.555  19.547  1.00 106.76 ? 28   DC  I "C2'" 1 
ATOM   8073  C  "C1'" . DC  I  5 101 ? -41.177 -9.223  19.251  1.00 107.57 ? 28   DC  I "C1'" 1 
ATOM   8074  N  N1    . DC  I  5 101 ? -41.336 -7.852  18.669  1.00 108.53 ? 28   DC  I N1    1 
ATOM   8075  C  C2    . DC  I  5 101 ? -42.340 -7.600  17.724  1.00 108.65 ? 28   DC  I C2    1 
ATOM   8076  O  O2    . DC  I  5 101 ? -43.087 -8.522  17.386  1.00 108.56 ? 28   DC  I O2    1 
ATOM   8077  N  N3    . DC  I  5 101 ? -42.460 -6.341  17.215  1.00 108.87 ? 28   DC  I N3    1 
ATOM   8078  C  C4    . DC  I  5 101 ? -41.622 -5.372  17.620  1.00 108.80 ? 28   DC  I C4    1 
ATOM   8079  N  N4    . DC  I  5 101 ? -41.763 -4.146  17.107  1.00 108.80 ? 28   DC  I N4    1 
ATOM   8080  C  C5    . DC  I  5 101 ? -40.590 -5.607  18.578  1.00 108.82 ? 28   DC  I C5    1 
ATOM   8081  C  C6    . DC  I  5 101 ? -40.491 -6.846  19.070  1.00 109.01 ? 28   DC  I C6    1 
ATOM   8082  P  P     . DA  I  5 102 ? -38.363 -12.353 20.334  1.00 106.97 ? 29   DA  I P     1 
ATOM   8083  O  OP1   . DA  I  5 102 ? -38.149 -13.452 21.310  1.00 106.47 ? 29   DA  I OP1   1 
ATOM   8084  O  OP2   . DA  I  5 102 ? -37.271 -11.386 20.070  1.00 105.76 ? 29   DA  I OP2   1 
ATOM   8085  O  "O5'" . DA  I  5 102 ? -38.750 -12.929 18.888  1.00 108.07 ? 29   DA  I "O5'" 1 
ATOM   8086  C  "C5'" . DA  I  5 102 ? -40.086 -13.155 18.457  1.00 110.50 ? 29   DA  I "C5'" 1 
ATOM   8087  C  "C4'" . DA  I  5 102 ? -40.172 -13.027 16.942  1.00 112.48 ? 29   DA  I "C4'" 1 
ATOM   8088  O  "O4'" . DA  I  5 102 ? -40.452 -11.646 16.607  1.00 113.10 ? 29   DA  I "O4'" 1 
ATOM   8089  C  "C3'" . DA  I  5 102 ? -38.927 -13.411 16.140  1.00 113.73 ? 29   DA  I "C3'" 1 
ATOM   8090  O  "O3'" . DA  I  5 102 ? -39.297 -14.156 14.975  1.00 115.89 ? 29   DA  I "O3'" 1 
ATOM   8091  C  "C2'" . DA  I  5 102 ? -38.323 -12.059 15.769  1.00 113.66 ? 29   DA  I "C2'" 1 
ATOM   8092  C  "C1'" . DA  I  5 102 ? -39.597 -11.254 15.551  1.00 114.33 ? 29   DA  I "C1'" 1 
ATOM   8093  N  N9    . DA  I  5 102 ? -39.430 -9.795  15.546  1.00 114.79 ? 29   DA  I N9    1 
ATOM   8094  C  C8    . DA  I  5 102 ? -38.502 -9.044  16.221  1.00 115.02 ? 29   DA  I C8    1 
ATOM   8095  N  N7    . DA  I  5 102 ? -38.596 -7.750  16.018  1.00 114.89 ? 29   DA  I N7    1 
ATOM   8096  C  C5    . DA  I  5 102 ? -39.663 -7.643  15.144  1.00 115.10 ? 29   DA  I C5    1 
ATOM   8097  C  C6    . DA  I  5 102 ? -40.285 -6.532  14.533  1.00 114.97 ? 29   DA  I C6    1 
ATOM   8098  N  N6    . DA  I  5 102 ? -39.889 -5.270  14.726  1.00 114.90 ? 29   DA  I N6    1 
ATOM   8099  N  N1    . DA  I  5 102 ? -41.329 -6.768  13.705  1.00 114.80 ? 29   DA  I N1    1 
ATOM   8100  C  C2    . DA  I  5 102 ? -41.726 -8.034  13.507  1.00 114.79 ? 29   DA  I C2    1 
ATOM   8101  N  N3    . DA  I  5 102 ? -41.226 -9.157  14.028  1.00 114.69 ? 29   DA  I N3    1 
ATOM   8102  C  C4    . DA  I  5 102 ? -40.190 -8.891  14.845  1.00 114.81 ? 29   DA  I C4    1 
ATOM   8103  P  P     . DG  I  5 103 ? -38.179 -14.844 14.035  1.00 117.16 ? 30   DG  I P     1 
ATOM   8104  O  OP1   . DG  I  5 103 ? -37.634 -15.958 14.851  1.00 117.22 ? 30   DG  I OP1   1 
ATOM   8105  O  OP2   . DG  I  5 103 ? -37.265 -13.795 13.496  1.00 116.47 ? 30   DG  I OP2   1 
ATOM   8106  O  "O5'" . DG  I  5 103 ? -39.001 -15.450 12.782  1.00 117.97 ? 30   DG  I "O5'" 1 
ATOM   8107  C  "C5'" . DG  I  5 103 ? -40.371 -15.097 12.525  1.00 118.99 ? 30   DG  I "C5'" 1 
ATOM   8108  C  "C4'" . DG  I  5 103 ? -40.603 -14.409 11.175  1.00 119.95 ? 30   DG  I "C4'" 1 
ATOM   8109  O  "O4'" . DG  I  5 103 ? -40.760 -12.974 11.355  1.00 120.15 ? 30   DG  I "O4'" 1 
ATOM   8110  C  "C3'" . DG  I  5 103 ? -39.569 -14.602 10.065  1.00 120.19 ? 30   DG  I "C3'" 1 
ATOM   8111  O  "O3'" . DG  I  5 103 ? -40.255 -14.912 8.854   1.00 121.40 ? 30   DG  I "O3'" 1 
ATOM   8112  C  "C2'" . DG  I  5 103 ? -38.871 -13.247 9.981   1.00 120.12 ? 30   DG  I "C2'" 1 
ATOM   8113  C  "C1'" . DG  I  5 103 ? -39.977 -12.282 10.403  1.00 120.38 ? 30   DG  I "C1'" 1 
ATOM   8114  N  N9    . DG  I  5 103 ? -39.509 -11.044 11.029  1.00 120.50 ? 30   DG  I N9    1 
ATOM   8115  C  C8    . DG  I  5 103 ? -38.753 -10.919 12.173  1.00 120.67 ? 30   DG  I C8    1 
ATOM   8116  N  N7    . DG  I  5 103 ? -38.481 -9.686  12.503  1.00 120.62 ? 30   DG  I N7    1 
ATOM   8117  C  C5    . DG  I  5 103 ? -39.102 -8.937  11.517  1.00 120.55 ? 30   DG  I C5    1 
ATOM   8118  C  C6    . DG  I  5 103 ? -39.157 -7.532  11.345  1.00 120.69 ? 30   DG  I C6    1 
ATOM   8119  O  O6    . DG  I  5 103 ? -38.649 -6.653  12.056  1.00 120.68 ? 30   DG  I O6    1 
ATOM   8120  N  N1    . DG  I  5 103 ? -39.893 -7.176  10.211  1.00 120.78 ? 30   DG  I N1    1 
ATOM   8121  C  C2    . DG  I  5 103 ? -40.494 -8.075  9.352   1.00 120.54 ? 30   DG  I C2    1 
ATOM   8122  N  N2    . DG  I  5 103 ? -41.159 -7.555  8.312   1.00 120.64 ? 30   DG  I N2    1 
ATOM   8123  N  N3    . DG  I  5 103 ? -40.448 -9.394  9.501   1.00 120.25 ? 30   DG  I N3    1 
ATOM   8124  C  C4    . DG  I  5 103 ? -39.740 -9.755  10.602  1.00 120.49 ? 30   DG  I C4    1 
ATOM   8125  P  P     . DT  I  5 104 ? -39.509 -15.458 7.541   1.00 122.59 ? 31   DT  I P     1 
ATOM   8126  O  OP1   . DT  I  5 104 ? -40.470 -16.339 6.834   1.00 122.47 ? 31   DT  I OP1   1 
ATOM   8127  O  OP2   . DT  I  5 104 ? -38.172 -15.966 7.927   1.00 122.27 ? 31   DT  I OP2   1 
ATOM   8128  O  "O5'" . DT  I  5 104 ? -39.270 -14.140 6.663   1.00 123.01 ? 31   DT  I "O5'" 1 
ATOM   8129  C  "C5'" . DT  I  5 104 ? -40.379 -13.403 6.131   1.00 124.01 ? 31   DT  I "C5'" 1 
ATOM   8130  C  "C4'" . DT  I  5 104 ? -39.935 -12.127 5.420   1.00 124.56 ? 31   DT  I "C4'" 1 
ATOM   8131  O  "O4'" . DT  I  5 104 ? -39.620 -11.085 6.387   1.00 124.37 ? 31   DT  I "O4'" 1 
ATOM   8132  C  "C3'" . DT  I  5 104 ? -38.705 -12.276 4.526   1.00 125.04 ? 31   DT  I "C3'" 1 
ATOM   8133  O  "O3'" . DT  I  5 104 ? -38.959 -11.729 3.246   1.00 126.87 ? 31   DT  I "O3'" 1 
ATOM   8134  C  "C2'" . DT  I  5 104 ? -37.636 -11.463 5.240   1.00 124.39 ? 31   DT  I "C2'" 1 
ATOM   8135  C  "C1'" . DT  I  5 104 ? -38.473 -10.400 5.934   1.00 123.80 ? 31   DT  I "C1'" 1 
ATOM   8136  N  N1    . DT  I  5 104 ? -37.781 -9.720  7.076   1.00 123.58 ? 31   DT  I N1    1 
ATOM   8137  C  C2    . DT  I  5 104 ? -37.772 -8.339  7.115   1.00 123.54 ? 31   DT  I C2    1 
ATOM   8138  O  O2    . DT  I  5 104 ? -38.301 -7.639  6.271   1.00 123.37 ? 31   DT  I O2    1 
ATOM   8139  N  N3    . DT  I  5 104 ? -37.109 -7.796  8.193   1.00 123.90 ? 31   DT  I N3    1 
ATOM   8140  C  C4    . DT  I  5 104 ? -36.468 -8.481  9.216   1.00 123.66 ? 31   DT  I C4    1 
ATOM   8141  O  O4    . DT  I  5 104 ? -35.905 -7.893  10.136  1.00 123.31 ? 31   DT  I O4    1 
ATOM   8142  C  C5    . DT  I  5 104 ? -36.513 -9.925  9.113   1.00 123.44 ? 31   DT  I C5    1 
ATOM   8143  C  C7    . DT  I  5 104 ? -35.856 -10.783 10.153  1.00 123.48 ? 31   DT  I C7    1 
ATOM   8144  C  C6    . DT  I  5 104 ? -37.159 -10.468 8.066   1.00 123.40 ? 31   DT  I C6    1 
ATOM   8145  P  P     . DT  I  5 105 ? -38.167 -12.263 1.956   1.00 128.41 ? 32   DT  I P     1 
ATOM   8146  O  OP1   . DT  I  5 105 ? -39.169 -12.979 1.135   1.00 128.33 ? 32   DT  I OP1   1 
ATOM   8147  O  OP2   . DT  I  5 105 ? -36.935 -12.964 2.403   1.00 127.96 ? 32   DT  I OP2   1 
ATOM   8148  O  "O5'" . DT  I  5 105 ? -37.720 -10.932 1.173   1.00 129.11 ? 32   DT  I "O5'" 1 
ATOM   8149  C  "C5'" . DT  I  5 105 ? -38.481 -9.713  1.220   1.00 130.47 ? 32   DT  I "C5'" 1 
ATOM   8150  C  "C4'" . DT  I  5 105 ? -37.580 -8.485  1.151   1.00 131.51 ? 32   DT  I "C4'" 1 
ATOM   8151  O  "O4'" . DT  I  5 105 ? -37.159 -8.101  2.492   1.00 131.99 ? 32   DT  I "O4'" 1 
ATOM   8152  C  "C3'" . DT  I  5 105 ? -36.304 -8.657  0.326   1.00 132.06 ? 32   DT  I "C3'" 1 
ATOM   8153  O  "O3'" . DT  I  5 105 ? -36.165 -7.549  -0.574  1.00 132.65 ? 32   DT  I "O3'" 1 
ATOM   8154  C  "C2'" . DT  I  5 105 ? -35.196 -8.720  1.383   1.00 132.25 ? 32   DT  I "C2'" 1 
ATOM   8155  C  "C1'" . DT  I  5 105 ? -35.767 -7.839  2.490   1.00 132.08 ? 32   DT  I "C1'" 1 
ATOM   8156  N  N1    . DT  I  5 105 ? -35.187 -8.061  3.877   1.00 132.23 ? 32   DT  I N1    1 
ATOM   8157  C  C2    . DT  I  5 105 ? -34.805 -6.961  4.630   1.00 132.15 ? 32   DT  I C2    1 
ATOM   8158  O  O2    . DT  I  5 105 ? -34.903 -5.805  4.247   1.00 132.06 ? 32   DT  I O2    1 
ATOM   8159  N  N3    . DT  I  5 105 ? -34.295 -7.261  5.872   1.00 132.05 ? 32   DT  I N3    1 
ATOM   8160  C  C4    . DT  I  5 105 ? -34.126 -8.515  6.433   1.00 131.92 ? 32   DT  I C4    1 
ATOM   8161  O  O4    . DT  I  5 105 ? -33.656 -8.658  7.558   1.00 132.05 ? 32   DT  I O4    1 
ATOM   8162  C  C5    . DT  I  5 105 ? -34.538 -9.624  5.602   1.00 131.86 ? 32   DT  I C5    1 
ATOM   8163  C  C7    . DT  I  5 105 ? -34.395 -11.036 6.097   1.00 131.92 ? 32   DT  I C7    1 
ATOM   8164  C  C6    . DT  I  5 105 ? -35.040 -9.347  4.385   1.00 131.93 ? 32   DT  I C6    1 
ATOM   8165  P  P     . DT  I  5 106 ? -34.847 -7.311  -1.464  1.00 133.01 ? 33   DT  I P     1 
ATOM   8166  O  OP1   . DT  I  5 106 ? -35.242 -6.481  -2.625  1.00 133.09 ? 33   DT  I OP1   1 
ATOM   8167  O  OP2   . DT  I  5 106 ? -34.163 -8.607  -1.687  1.00 132.61 ? 33   DT  I OP2   1 
ATOM   8168  O  "O5'" . DT  I  5 106 ? -33.923 -6.431  -0.497  1.00 133.15 ? 33   DT  I "O5'" 1 
ATOM   8169  C  "C5'" . DT  I  5 106 ? -34.227 -5.061  -0.226  1.00 133.41 ? 33   DT  I "C5'" 1 
ATOM   8170  C  "C4'" . DT  I  5 106 ? -32.964 -4.285  0.124   1.00 133.50 ? 33   DT  I "C4'" 1 
ATOM   8171  O  "O4'" . DT  I  5 106 ? -32.554 -4.594  1.483   1.00 133.69 ? 33   DT  I "O4'" 1 
ATOM   8172  C  "C3'" . DT  I  5 106 ? -31.743 -4.579  -0.745  1.00 133.51 ? 33   DT  I "C3'" 1 
ATOM   8173  O  "O3'" . DT  I  5 106 ? -30.984 -3.395  -0.931  1.00 133.27 ? 33   DT  I "O3'" 1 
ATOM   8174  C  "C2'" . DT  I  5 106 ? -30.961 -5.606  0.065   1.00 133.54 ? 33   DT  I "C2'" 1 
ATOM   8175  C  "C1'" . DT  I  5 106 ? -31.238 -5.127  1.487   1.00 133.34 ? 33   DT  I "C1'" 1 
ATOM   8176  N  N1    . DT  I  5 106 ? -31.166 -6.184  2.543   1.00 133.33 ? 33   DT  I N1    1 
ATOM   8177  C  C2    . DT  I  5 106 ? -31.160 -5.796  3.873   1.00 133.32 ? 33   DT  I C2    1 
ATOM   8178  O  O2    . DT  I  5 106 ? -31.202 -4.630  4.237   1.00 133.17 ? 33   DT  I O2    1 
ATOM   8179  N  N3    . DT  I  5 106 ? -31.097 -6.836  4.772   1.00 133.20 ? 33   DT  I N3    1 
ATOM   8180  C  C4    . DT  I  5 106 ? -31.045 -8.188  4.477   1.00 133.02 ? 33   DT  I C4    1 
ATOM   8181  O  O4    . DT  I  5 106 ? -30.993 -9.029  5.366   1.00 133.02 ? 33   DT  I O4    1 
ATOM   8182  C  C5    . DT  I  5 106 ? -31.058 -8.524  3.067   1.00 133.01 ? 33   DT  I C5    1 
ATOM   8183  C  C7    . DT  I  5 106 ? -31.003 -9.947  2.600   1.00 133.10 ? 33   DT  I C7    1 
ATOM   8184  C  C6    . DT  I  5 106 ? -31.120 -7.521  2.181   1.00 133.17 ? 33   DT  I C6    1 
ATOM   8185  P  P     . DG  I  5 107 ? -30.925 -2.761  -2.392  1.00 132.97 ? 34   DG  I P     1 
ATOM   8186  O  OP1   . DG  I  5 107 ? -32.222 -2.072  -2.623  1.00 132.39 ? 34   DG  I OP1   1 
ATOM   8187  O  OP2   . DG  I  5 107 ? -30.459 -3.839  -3.303  1.00 132.18 ? 34   DG  I OP2   1 
ATOM   8188  O  "O5'" . DG  I  5 107 ? -29.753 -1.665  -2.296  1.00 132.95 ? 34   DG  I "O5'" 1 
ATOM   8189  C  "C5'" . DG  I  5 107 ? -29.719 -0.645  -1.286  1.00 132.28 ? 34   DG  I "C5'" 1 
ATOM   8190  C  "C4'" . DG  I  5 107 ? -28.434 -0.723  -0.469  1.00 131.76 ? 34   DG  I "C4'" 1 
ATOM   8191  O  "O4'" . DG  I  5 107 ? -28.475 -1.898  0.385   1.00 132.10 ? 34   DG  I "O4'" 1 
ATOM   8192  C  "C3'" . DG  I  5 107 ? -27.118 -0.831  -1.245  1.00 131.06 ? 34   DG  I "C3'" 1 
ATOM   8193  O  "O3'" . DG  I  5 107 ? -26.138 -0.047  -0.581  1.00 129.55 ? 34   DG  I "O3'" 1 
ATOM   8194  C  "C2'" . DG  I  5 107 ? -26.763 -2.313  -1.132  1.00 131.53 ? 34   DG  I "C2'" 1 
ATOM   8195  C  "C1'" . DG  I  5 107 ? -27.234 -2.575  0.299   1.00 132.58 ? 34   DG  I "C1'" 1 
ATOM   8196  N  N9    . DG  I  5 107 ? -27.444 -3.969  0.700   1.00 132.80 ? 34   DG  I N9    1 
ATOM   8197  C  C8    . DG  I  5 107 ? -27.554 -5.081  -0.107  1.00 132.92 ? 34   DG  I C8    1 
ATOM   8198  N  N7    . DG  I  5 107 ? -27.746 -6.193  0.550   1.00 132.93 ? 34   DG  I N7    1 
ATOM   8199  C  C5    . DG  I  5 107 ? -27.765 -5.798  1.884   1.00 133.13 ? 34   DG  I C5    1 
ATOM   8200  C  C6    . DG  I  5 107 ? -27.938 -6.568  3.070   1.00 133.05 ? 34   DG  I C6    1 
ATOM   8201  O  O6    . DG  I  5 107 ? -28.117 -7.790  3.171   1.00 132.87 ? 34   DG  I O6    1 
ATOM   8202  N  N1    . DG  I  5 107 ? -27.891 -5.782  4.226   1.00 132.91 ? 34   DG  I N1    1 
ATOM   8203  C  C2    . DG  I  5 107 ? -27.704 -4.417  4.231   1.00 132.90 ? 34   DG  I C2    1 
ATOM   8204  N  N2    . DG  I  5 107 ? -27.686 -3.831  5.435   1.00 132.85 ? 34   DG  I N2    1 
ATOM   8205  N  N3    . DG  I  5 107 ? -27.535 -3.681  3.132   1.00 132.95 ? 34   DG  I N3    1 
ATOM   8206  C  C4    . DG  I  5 107 ? -27.581 -4.431  1.994   1.00 133.07 ? 34   DG  I C4    1 
ATOM   8207  P  P     . DA  I  5 108 ? -25.426 1.227   -1.236  1.00 128.16 ? 35   DA  I P     1 
ATOM   8208  O  OP1   . DA  I  5 108 ? -26.165 1.603   -2.463  1.00 127.96 ? 35   DA  I OP1   1 
ATOM   8209  O  OP2   . DA  I  5 108 ? -23.975 0.928   -1.317  1.00 128.11 ? 35   DA  I OP2   1 
ATOM   8210  O  "O5'" . DA  I  5 108 ? -25.621 2.383   -0.134  1.00 126.79 ? 35   DA  I "O5'" 1 
ATOM   8211  C  "C5'" . DA  I  5 108 ? -26.269 2.123   1.122   1.00 125.04 ? 35   DA  I "C5'" 1 
ATOM   8212  C  "C4'" . DA  I  5 108 ? -25.332 2.223   2.332   1.00 123.88 ? 35   DA  I "C4'" 1 
ATOM   8213  O  "O4'" . DA  I  5 108 ? -25.120 0.922   2.947   1.00 123.56 ? 35   DA  I "O4'" 1 
ATOM   8214  C  "C3'" . DA  I  5 108 ? -23.927 2.781   2.115   1.00 123.04 ? 35   DA  I "C3'" 1 
ATOM   8215  O  "O3'" . DA  I  5 108 ? -23.578 3.496   3.310   1.00 121.48 ? 35   DA  I "O3'" 1 
ATOM   8216  C  "C2'" . DA  I  5 108 ? -23.096 1.518   1.857   1.00 122.95 ? 35   DA  I "C2'" 1 
ATOM   8217  C  "C1'" . DA  I  5 108 ? -23.770 0.508   2.786   1.00 123.18 ? 35   DA  I "C1'" 1 
ATOM   8218  N  N9    . DA  I  5 108 ? -23.786 -0.886  2.328   1.00 123.01 ? 35   DA  I N9    1 
ATOM   8219  C  C8    . DA  I  5 108 ? -23.519 -1.382  1.080   1.00 122.98 ? 35   DA  I C8    1 
ATOM   8220  N  N7    . DA  I  5 108 ? -23.629 -2.690  0.989   1.00 122.92 ? 35   DA  I N7    1 
ATOM   8221  C  C5    . DA  I  5 108 ? -23.995 -3.084  2.265   1.00 123.00 ? 35   DA  I C5    1 
ATOM   8222  C  C6    . DA  I  5 108 ? -24.267 -4.346  2.843   1.00 122.89 ? 35   DA  I C6    1 
ATOM   8223  N  N6    . DA  I  5 108 ? -24.217 -5.500  2.177   1.00 122.99 ? 35   DA  I N6    1 
ATOM   8224  N  N1    . DA  I  5 108 ? -24.599 -4.383  4.148   1.00 122.88 ? 35   DA  I N1    1 
ATOM   8225  C  C2    . DA  I  5 108 ? -24.651 -3.231  4.832   1.00 123.10 ? 35   DA  I C2    1 
ATOM   8226  N  N3    . DA  I  5 108 ? -24.425 -1.988  4.405   1.00 123.06 ? 35   DA  I N3    1 
ATOM   8227  C  C4    . DA  I  5 108 ? -24.097 -1.982  3.100   1.00 123.03 ? 35   DA  I C4    1 
ATOM   8228  P  P     . DC  I  5 109 ? -22.079 3.898   3.719   1.00 120.57 ? 36   DC  I P     1 
ATOM   8229  O  OP1   . DC  I  5 109 ? -22.173 5.021   4.683   1.00 120.64 ? 36   DC  I OP1   1 
ATOM   8230  O  OP2   . DC  I  5 109 ? -21.241 4.036   2.505   1.00 119.92 ? 36   DC  I OP2   1 
ATOM   8231  O  "O5'" . DC  I  5 109 ? -21.592 2.594   4.503   1.00 118.72 ? 36   DC  I "O5'" 1 
ATOM   8232  C  "C5'" . DC  I  5 109 ? -22.229 2.196   5.719   1.00 115.63 ? 36   DC  I "C5'" 1 
ATOM   8233  C  "C4'" . DC  I  5 109 ? -21.415 1.098   6.379   1.00 113.24 ? 36   DC  I "C4'" 1 
ATOM   8234  O  "O4'" . DC  I  5 109 ? -21.441 -0.111  5.569   1.00 112.59 ? 36   DC  I "O4'" 1 
ATOM   8235  C  "C3'" . DC  I  5 109 ? -19.941 1.435   6.584   1.00 111.58 ? 36   DC  I "C3'" 1 
ATOM   8236  O  "O3'" . DC  I  5 109 ? -19.561 0.858   7.807   1.00 109.35 ? 36   DC  I "O3'" 1 
ATOM   8237  C  "C2'" . DC  I  5 109 ? -19.245 0.736   5.420   1.00 112.01 ? 36   DC  I "C2'" 1 
ATOM   8238  C  "C1'" . DC  I  5 109 ? -20.108 -0.517  5.304   1.00 112.45 ? 36   DC  I "C1'" 1 
ATOM   8239  N  N1    . DC  I  5 109 ? -20.042 -1.245  3.987   1.00 112.55 ? 36   DC  I N1    1 
ATOM   8240  C  C2    . DC  I  5 109 ? -20.003 -2.650  3.993   1.00 112.54 ? 36   DC  I C2    1 
ATOM   8241  O  O2    . DC  I  5 109 ? -20.022 -3.266  5.065   1.00 112.69 ? 36   DC  I O2    1 
ATOM   8242  N  N3    . DC  I  5 109 ? -19.945 -3.313  2.810   1.00 112.70 ? 36   DC  I N3    1 
ATOM   8243  C  C4    . DC  I  5 109 ? -19.930 -2.641  1.656   1.00 112.78 ? 36   DC  I C4    1 
ATOM   8244  N  N4    . DC  I  5 109 ? -19.875 -3.364  0.530   1.00 112.61 ? 36   DC  I N4    1 
ATOM   8245  C  C5    . DC  I  5 109 ? -19.971 -1.209  1.619   1.00 112.77 ? 36   DC  I C5    1 
ATOM   8246  C  C6    . DC  I  5 109 ? -20.026 -0.560  2.796   1.00 112.80 ? 36   DC  I C6    1 
ATOM   8247  P  P     . DA  I  5 110 ? -18.670 1.648   8.866   1.00 107.63 ? 37   DA  I P     1 
ATOM   8248  O  OP1   . DA  I  5 110 ? -19.422 2.827   9.350   1.00 107.64 ? 37   DA  I OP1   1 
ATOM   8249  O  OP2   . DA  I  5 110 ? -17.328 1.761   8.250   1.00 106.54 ? 37   DA  I OP2   1 
ATOM   8250  O  "O5'" . DA  I  5 110 ? -18.611 0.653   10.115  1.00 107.10 ? 37   DA  I "O5'" 1 
ATOM   8251  C  "C5'" . DA  I  5 110 ? -19.472 -0.480  10.200  1.00 105.10 ? 37   DA  I "C5'" 1 
ATOM   8252  C  "C4'" . DA  I  5 110 ? -18.682 -1.764  10.003  1.00 103.80 ? 37   DA  I "C4'" 1 
ATOM   8253  O  "O4'" . DA  I  5 110 ? -18.540 -2.057  8.590   1.00 103.45 ? 37   DA  I "O4'" 1 
ATOM   8254  C  "C3'" . DA  I  5 110 ? -17.263 -1.780  10.576  1.00 103.03 ? 37   DA  I "C3'" 1 
ATOM   8255  O  "O3'" . DA  I  5 110 ? -17.067 -3.030  11.218  1.00 100.99 ? 37   DA  I "O3'" 1 
ATOM   8256  C  "C2'" . DA  I  5 110 ? -16.370 -1.686  9.342   1.00 103.42 ? 37   DA  I "C2'" 1 
ATOM   8257  C  "C1'" . DA  I  5 110 ? -17.214 -2.483  8.359   1.00 104.50 ? 37   DA  I "C1'" 1 
ATOM   8258  N  N9    . DA  I  5 110 ? -16.902 -2.241  6.958   1.00 104.90 ? 37   DA  I N9    1 
ATOM   8259  C  C8    . DA  I  5 110 ? -16.462 -1.081  6.375   1.00 105.15 ? 37   DA  I C8    1 
ATOM   8260  N  N7    . DA  I  5 110 ? -16.273 -1.178  5.080   1.00 105.00 ? 37   DA  I N7    1 
ATOM   8261  C  C5    . DA  I  5 110 ? -16.616 -2.491  4.803   1.00 105.01 ? 37   DA  I C5    1 
ATOM   8262  C  C6    . DA  I  5 110 ? -16.635 -3.236  3.608   1.00 105.01 ? 37   DA  I C6    1 
ATOM   8263  N  N6    . DA  I  5 110 ? -16.284 -2.723  2.427   1.00 105.01 ? 37   DA  I N6    1 
ATOM   8264  N  N1    . DA  I  5 110 ? -17.030 -4.529  3.677   1.00 105.17 ? 37   DA  I N1    1 
ATOM   8265  C  C2    . DA  I  5 110 ? -17.382 -5.049  4.866   1.00 105.09 ? 37   DA  I C2    1 
ATOM   8266  N  N3    . DA  I  5 110 ? -17.406 -4.447  6.056   1.00 105.09 ? 37   DA  I N3    1 
ATOM   8267  C  C4    . DA  I  5 110 ? -17.006 -3.163  5.950   1.00 105.01 ? 37   DA  I C4    1 
ATOM   8268  P  P     . DC  I  5 111 ? -16.027 -3.237  12.412  1.00 98.74  ? 38   DC  I P     1 
ATOM   8269  O  OP1   . DC  I  5 111 ? -16.848 -3.342  13.645  1.00 98.80  ? 38   DC  I OP1   1 
ATOM   8270  O  OP2   . DC  I  5 111 ? -14.909 -2.270  12.286  1.00 98.34  ? 38   DC  I OP2   1 
ATOM   8271  O  "O5'" . DC  I  5 111 ? -15.372 -4.651  12.068  1.00 96.77  ? 38   DC  I "O5'" 1 
ATOM   8272  C  "C5'" . DC  I  5 111 ? -16.119 -5.858  12.014  1.00 93.82  ? 38   DC  I "C5'" 1 
ATOM   8273  C  "C4'" . DC  I  5 111 ? -15.420 -6.773  11.033  1.00 91.99  ? 38   DC  I "C4'" 1 
ATOM   8274  O  "O4'" . DC  I  5 111 ? -15.466 -6.144  9.729   1.00 92.43  ? 38   DC  I "O4'" 1 
ATOM   8275  C  "C3'" . DC  I  5 111 ? -13.939 -7.030  11.312  1.00 91.21  ? 38   DC  I "C3'" 1 
ATOM   8276  O  "O3'" . DC  I  5 111 ? -13.680 -8.385  11.050  1.00 90.79  ? 38   DC  I "O3'" 1 
ATOM   8277  C  "C2'" . DC  I  5 111 ? -13.226 -6.159  10.286  1.00 91.35  ? 38   DC  I "C2'" 1 
ATOM   8278  C  "C1'" . DC  I  5 111 ? -14.205 -6.327  9.132   1.00 91.80  ? 38   DC  I "C1'" 1 
ATOM   8279  N  N1    . DC  I  5 111 ? -14.013 -5.420  7.948   1.00 91.78  ? 38   DC  I N1    1 
ATOM   8280  C  C2    . DC  I  5 111 ? -14.147 -5.965  6.658   1.00 91.43  ? 38   DC  I C2    1 
ATOM   8281  O  O2    . DC  I  5 111 ? -14.421 -7.166  6.540   1.00 91.18  ? 38   DC  I O2    1 
ATOM   8282  N  N3    . DC  I  5 111 ? -13.962 -5.156  5.578   1.00 91.36  ? 38   DC  I N3    1 
ATOM   8283  C  C4    . DC  I  5 111 ? -13.667 -3.861  5.760   1.00 91.82  ? 38   DC  I C4    1 
ATOM   8284  N  N4    . DC  I  5 111 ? -13.496 -3.095  4.679   1.00 91.45  ? 38   DC  I N4    1 
ATOM   8285  C  C5    . DC  I  5 111 ? -13.525 -3.286  7.066   1.00 91.88  ? 38   DC  I C5    1 
ATOM   8286  C  C6    . DC  I  5 111 ? -13.705 -4.094  8.120   1.00 91.77  ? 38   DC  I C6    1 
ATOM   8287  P  P     . DA  I  5 112 ? -12.453 -9.204  11.661  1.00 89.56  ? 39   DA  I P     1 
ATOM   8288  O  OP1   . DA  I  5 112 ? -12.925 -9.706  12.962  1.00 89.52  ? 39   DA  I OP1   1 
ATOM   8289  O  OP2   . DA  I  5 112 ? -11.167 -8.491  11.528  1.00 88.09  ? 39   DA  I OP2   1 
ATOM   8290  O  "O5'" . DA  I  5 112 ? -12.390 -10.427 10.646  1.00 92.75  ? 39   DA  I "O5'" 1 
ATOM   8291  C  "C5'" . DA  I  5 112 ? -13.527 -10.788 9.859   1.00 97.15  ? 39   DA  I "C5'" 1 
ATOM   8292  C  "C4'" . DA  I  5 112 ? -13.050 -11.465 8.588   1.00 100.40 ? 39   DA  I "C4'" 1 
ATOM   8293  O  "O4'" . DA  I  5 112 ? -13.040 -10.520 7.489   1.00 101.41 ? 39   DA  I "O4'" 1 
ATOM   8294  C  "C3'" . DA  I  5 112 ? -11.638 -12.022 8.704   1.00 102.36 ? 39   DA  I "C3'" 1 
ATOM   8295  O  "O3'" . DA  I  5 112 ? -11.594 -13.336 8.187   1.00 104.87 ? 39   DA  I "O3'" 1 
ATOM   8296  C  "C2'" . DA  I  5 112 ? -10.759 -11.049 7.920   1.00 102.39 ? 39   DA  I "C2'" 1 
ATOM   8297  C  "C1'" . DA  I  5 112 ? -11.729 -10.338 6.984   1.00 103.01 ? 39   DA  I "C1'" 1 
ATOM   8298  N  N9    . DA  I  5 112 ? -11.473 -8.903  6.911   1.00 103.22 ? 39   DA  I N9    1 
ATOM   8299  C  C8    . DA  I  5 112 ? -11.469 -8.039  7.965   1.00 103.66 ? 39   DA  I C8    1 
ATOM   8300  N  N7    . DA  I  5 112 ? -11.210 -6.797  7.642   1.00 104.01 ? 39   DA  I N7    1 
ATOM   8301  C  C5    . DA  I  5 112 ? -11.031 -6.844  6.273   1.00 103.81 ? 39   DA  I C5    1 
ATOM   8302  C  C6    . DA  I  5 112 ? -10.731 -5.845  5.323   1.00 103.70 ? 39   DA  I C6    1 
ATOM   8303  N  N6    . DA  I  5 112 ? -10.552 -4.558  5.647   1.00 103.55 ? 39   DA  I N6    1 
ATOM   8304  N  N1    . DA  I  5 112 ? -10.615 -6.221  4.027   1.00 103.87 ? 39   DA  I N1    1 
ATOM   8305  C  C2    . DA  I  5 112 ? -10.791 -7.513  3.707   1.00 103.81 ? 39   DA  I C2    1 
ATOM   8306  N  N3    . DA  I  5 112 ? -11.077 -8.537  4.517   1.00 104.07 ? 39   DA  I N3    1 
ATOM   8307  C  C4    . DA  I  5 112 ? -11.191 -8.136  5.800   1.00 103.71 ? 39   DA  I C4    1 
ATOM   8308  P  P     . DC  I  5 113 ? -10.231 -14.173 8.247   1.00 107.22 ? 40   DC  I P     1 
ATOM   8309  O  OP1   . DC  I  5 113 ? -10.628 -15.597 8.288   1.00 107.12 ? 40   DC  I OP1   1 
ATOM   8310  O  OP2   . DC  I  5 113 ? -9.322  -13.619 9.281   1.00 106.31 ? 40   DC  I OP2   1 
ATOM   8311  O  "O5'" . DC  I  5 113 ? -9.550  -13.851 6.840   1.00 108.77 ? 40   DC  I "O5'" 1 
ATOM   8312  C  "C5'" . DC  I  5 113 ? -10.229 -14.006 5.599   1.00 111.46 ? 40   DC  I "C5'" 1 
ATOM   8313  C  "C4'" . DC  I  5 113 ? -9.286  -13.505 4.526   1.00 113.75 ? 40   DC  I "C4'" 1 
ATOM   8314  O  "O4'" . DC  I  5 113 ? -9.386  -12.061 4.456   1.00 114.48 ? 40   DC  I "O4'" 1 
ATOM   8315  C  "C3'" . DC  I  5 113 ? -7.823  -13.827 4.825   1.00 115.10 ? 40   DC  I "C3'" 1 
ATOM   8316  O  "O3'" . DC  I  5 113 ? -7.285  -14.707 3.825   1.00 117.64 ? 40   DC  I "O3'" 1 
ATOM   8317  C  "C2'" . DC  I  5 113 ? -7.127  -12.469 4.883   1.00 114.91 ? 40   DC  I "C2'" 1 
ATOM   8318  C  "C1'" . DC  I  5 113 ? -8.105  -11.519 4.210   1.00 115.39 ? 40   DC  I "C1'" 1 
ATOM   8319  N  N1    . DC  I  5 113 ? -7.992  -10.115 4.752   1.00 116.20 ? 40   DC  I N1    1 
ATOM   8320  C  C2    . DC  I  5 113 ? -7.642  -9.041  3.904   1.00 116.69 ? 40   DC  I C2    1 
ATOM   8321  O  O2    . DC  I  5 113 ? -7.441  -9.241  2.699   1.00 116.84 ? 40   DC  I O2    1 
ATOM   8322  N  N3    . DC  I  5 113 ? -7.537  -7.789  4.433   1.00 116.75 ? 40   DC  I N3    1 
ATOM   8323  C  C4    . DC  I  5 113 ? -7.754  -7.586  5.738   1.00 116.30 ? 40   DC  I C4    1 
ATOM   8324  N  N4    . DC  I  5 113 ? -7.638  -6.340  6.206   1.00 116.20 ? 40   DC  I N4    1 
ATOM   8325  C  C5    . DC  I  5 113 ? -8.099  -8.657  6.621   1.00 116.45 ? 40   DC  I C5    1 
ATOM   8326  C  C6    . DC  I  5 113 ? -8.203  -9.883  6.089   1.00 116.27 ? 40   DC  I C6    1 
ATOM   8327  P  P     . DT  I  5 114 ? -5.707  -14.851 3.545   1.00 119.41 ? 41   DT  I P     1 
ATOM   8328  O  OP1   . DT  I  5 114 ? -5.513  -16.014 2.649   1.00 119.70 ? 41   DT  I OP1   1 
ATOM   8329  O  OP2   . DT  I  5 114 ? -4.977  -14.804 4.835   1.00 119.37 ? 41   DT  I OP2   1 
ATOM   8330  O  "O5'" . DT  I  5 114 ? -5.398  -13.492 2.754   1.00 119.92 ? 41   DT  I "O5'" 1 
ATOM   8331  C  "C5'" . DT  I  5 114 ? -5.275  -13.431 1.340   1.00 120.77 ? 41   DT  I "C5'" 1 
ATOM   8332  C  "C4'" . DT  I  5 114 ? -4.152  -12.470 0.990   1.00 121.64 ? 41   DT  I "C4'" 1 
ATOM   8333  O  "O4'" . DT  I  5 114 ? -4.361  -11.193 1.649   1.00 121.77 ? 41   DT  I "O4'" 1 
ATOM   8334  C  "C3'" . DT  I  5 114 ? -2.758  -12.904 1.423   1.00 122.25 ? 41   DT  I "C3'" 1 
ATOM   8335  O  "O3'" . DT  I  5 114 ? -1.876  -12.440 0.429   1.00 123.61 ? 41   DT  I "O3'" 1 
ATOM   8336  C  "C2'" . DT  I  5 114 ? -2.551  -12.157 2.740   1.00 121.70 ? 41   DT  I "C2'" 1 
ATOM   8337  C  "C1'" . DT  I  5 114 ? -3.187  -10.828 2.354   1.00 121.18 ? 41   DT  I "C1'" 1 
ATOM   8338  N  N1    . DT  I  5 114 ? -3.573  -9.889  3.463   1.00 120.97 ? 41   DT  I N1    1 
ATOM   8339  C  C2    . DT  I  5 114 ? -3.574  -8.535  3.204   1.00 120.58 ? 41   DT  I C2    1 
ATOM   8340  O  O2    . DT  I  5 114 ? -3.266  -8.058  2.128   1.00 120.62 ? 41   DT  I O2    1 
ATOM   8341  N  N3    . DT  I  5 114 ? -3.951  -7.747  4.262   1.00 120.49 ? 41   DT  I N3    1 
ATOM   8342  C  C4    . DT  I  5 114 ? -4.321  -8.170  5.526   1.00 120.65 ? 41   DT  I C4    1 
ATOM   8343  O  O4    . DT  I  5 114 ? -4.638  -7.374  6.399   1.00 120.75 ? 41   DT  I O4    1 
ATOM   8344  C  C5    . DT  I  5 114 ? -4.303  -9.599  5.737   1.00 120.71 ? 41   DT  I C5    1 
ATOM   8345  C  C7    . DT  I  5 114 ? -4.681  -10.190 7.065   1.00 120.62 ? 41   DT  I C7    1 
ATOM   8346  C  C6    . DT  I  5 114 ? -3.940  -10.378 4.707   1.00 121.02 ? 41   DT  I C6    1 
ATOM   8347  P  P     . DT  I  5 115 ? -0.368  -12.959 0.330   1.00 124.83 ? 42   DT  I P     1 
ATOM   8348  O  OP1   . DT  I  5 115 ? -0.416  -14.305 -0.301  1.00 124.99 ? 42   DT  I OP1   1 
ATOM   8349  O  OP2   . DT  I  5 115 ? 0.333   -12.803 1.638   1.00 124.64 ? 42   DT  I OP2   1 
ATOM   8350  O  "O5'" . DT  I  5 115 ? 0.277   -11.910 -0.708  1.00 125.66 ? 42   DT  I "O5'" 1 
ATOM   8351  C  "C5'" . DT  I  5 115 ? -0.442  -10.758 -1.158  1.00 127.26 ? 42   DT  I "C5'" 1 
ATOM   8352  C  "C4'" . DT  I  5 115 ? 0.313   -9.473  -0.850  1.00 129.11 ? 42   DT  I "C4'" 1 
ATOM   8353  O  "O4'" . DT  I  5 115 ? -0.253  -8.837  0.330   1.00 129.95 ? 42   DT  I "O4'" 1 
ATOM   8354  C  "C3'" . DT  I  5 115 ? 1.813   -9.620  -0.582  1.00 130.06 ? 42   DT  I "C3'" 1 
ATOM   8355  O  "O3'" . DT  I  5 115 ? 2.548   -8.707  -1.412  1.00 130.99 ? 42   DT  I "O3'" 1 
ATOM   8356  C  "C2'" . DT  I  5 115 ? 1.946   -9.298  0.907   1.00 130.46 ? 42   DT  I "C2'" 1 
ATOM   8357  C  "C1'" . DT  I  5 115 ? 0.795   -8.322  1.128   1.00 130.58 ? 42   DT  I "C1'" 1 
ATOM   8358  N  N1    . DT  I  5 115 ? 0.345   -8.201  2.566   1.00 130.87 ? 42   DT  I N1    1 
ATOM   8359  C  C2    . DT  I  5 115 ? 0.121   -6.952  3.123   1.00 130.78 ? 42   DT  I C2    1 
ATOM   8360  O  O2    . DT  I  5 115 ? 0.265   -5.902  2.522   1.00 130.78 ? 42   DT  I O2    1 
ATOM   8361  N  N3    . DT  I  5 115 ? -0.286  -6.975  4.436   1.00 130.83 ? 42   DT  I N3    1 
ATOM   8362  C  C4    . DT  I  5 115 ? -0.486  -8.093  5.235   1.00 130.83 ? 42   DT  I C4    1 
ATOM   8363  O  O4    . DT  I  5 115 ? -0.851  -8.000  6.404   1.00 130.73 ? 42   DT  I O4    1 
ATOM   8364  C  C5    . DT  I  5 115 ? -0.235  -9.365  4.596   1.00 130.84 ? 42   DT  I C5    1 
ATOM   8365  C  C7    . DT  I  5 115 ? -0.408  -10.655 5.342   1.00 130.76 ? 42   DT  I C7    1 
ATOM   8366  C  C6    . DT  I  5 115 ? 0.161   -9.354  3.316   1.00 131.07 ? 42   DT  I C6    1 
ATOM   8367  P  P     . DT  I  5 116 ? 4.145   -8.514  -1.314  1.00 131.57 ? 43   DT  I P     1 
ATOM   8368  O  OP1   . DT  I  5 116 ? 4.635   -8.211  -2.683  1.00 131.64 ? 43   DT  I OP1   1 
ATOM   8369  O  OP2   . DT  I  5 116 ? 4.736   -9.646  -0.556  1.00 131.43 ? 43   DT  I OP2   1 
ATOM   8370  O  "O5'" . DT  I  5 116 ? 4.281   -7.193  -0.420  1.00 131.21 ? 43   DT  I "O5'" 1 
ATOM   8371  C  "C5'" . DT  I  5 116 ? 3.994   -5.922  -1.002  1.00 130.93 ? 43   DT  I "C5'" 1 
ATOM   8372  C  "C4'" . DT  I  5 116 ? 4.386   -4.793  -0.065  1.00 130.44 ? 43   DT  I "C4'" 1 
ATOM   8373  O  "O4'" . DT  I  5 116 ? 3.745   -4.977  1.225   1.00 130.65 ? 43   DT  I "O4'" 1 
ATOM   8374  C  "C3'" . DT  I  5 116 ? 5.881   -4.634  0.198   1.00 129.88 ? 43   DT  I "C3'" 1 
ATOM   8375  O  "O3'" . DT  I  5 116 ? 6.170   -3.243  -0.032  1.00 129.13 ? 43   DT  I "O3'" 1 
ATOM   8376  C  "C2'" . DT  I  5 116 ? 6.056   -5.138  1.638   1.00 130.09 ? 43   DT  I "C2'" 1 
ATOM   8377  C  "C1'" . DT  I  5 116 ? 4.693   -4.843  2.268   1.00 130.52 ? 43   DT  I "C1'" 1 
ATOM   8378  N  N1    . DT  I  5 116 ? 4.226   -5.723  3.415   1.00 130.57 ? 43   DT  I N1    1 
ATOM   8379  C  C2    . DT  I  5 116 ? 3.599   -5.139  4.508   1.00 130.38 ? 43   DT  I C2    1 
ATOM   8380  O  O2    . DT  I  5 116 ? 3.411   -3.938  4.620   1.00 130.17 ? 43   DT  I O2    1 
ATOM   8381  N  N3    . DT  I  5 116 ? 3.200   -6.024  5.487   1.00 130.44 ? 43   DT  I N3    1 
ATOM   8382  C  C4    . DT  I  5 116 ? 3.352   -7.406  5.485   1.00 130.51 ? 43   DT  I C4    1 
ATOM   8383  O  O4    . DT  I  5 116 ? 2.959   -8.111  6.411   1.00 130.31 ? 43   DT  I O4    1 
ATOM   8384  C  C5    . DT  I  5 116 ? 4.006   -7.954  4.317   1.00 130.57 ? 43   DT  I C5    1 
ATOM   8385  C  C7    . DT  I  5 116 ? 4.231   -9.435  4.194   1.00 130.38 ? 43   DT  I C7    1 
ATOM   8386  C  C6    . DT  I  5 116 ? 4.399   -7.100  3.355   1.00 130.65 ? 43   DT  I C6    1 
ATOM   8387  P  P     . DT  I  5 117 ? 7.414   -2.428  0.573   1.00 128.89 ? 44   DT  I P     1 
ATOM   8388  O  OP1   . DT  I  5 117 ? 7.651   -1.251  -0.296  1.00 128.67 ? 44   DT  I OP1   1 
ATOM   8389  O  OP2   . DT  I  5 117 ? 8.527   -3.367  0.861   1.00 128.86 ? 44   DT  I OP2   1 
ATOM   8390  O  "O5'" . DT  I  5 117 ? 6.826   -1.904  1.964   1.00 128.11 ? 44   DT  I "O5'" 1 
ATOM   8391  C  "C5'" . DT  I  5 117 ? 6.132   -0.653  2.068   1.00 126.86 ? 44   DT  I "C5'" 1 
ATOM   8392  C  "C4'" . DT  I  5 117 ? 6.208   -0.168  3.506   1.00 125.96 ? 44   DT  I "C4'" 1 
ATOM   8393  O  "O4'" . DT  I  5 117 ? 5.661   -1.185  4.402   1.00 126.38 ? 44   DT  I "O4'" 1 
ATOM   8394  C  "C3'" . DT  I  5 117 ? 7.640   0.110   3.959   1.00 124.82 ? 44   DT  I "C3'" 1 
ATOM   8395  O  "O3'" . DT  I  5 117 ? 7.752   1.471   4.411   1.00 122.52 ? 44   DT  I "O3'" 1 
ATOM   8396  C  "C2'" . DT  I  5 117 ? 7.928   -0.973  5.007   1.00 125.44 ? 44   DT  I "C2'" 1 
ATOM   8397  C  "C1'" . DT  I  5 117 ? 6.541   -1.391  5.495   1.00 126.06 ? 44   DT  I "C1'" 1 
ATOM   8398  N  N1    . DT  I  5 117 ? 6.468   -2.815  6.042   1.00 126.18 ? 44   DT  I N1    1 
ATOM   8399  C  C2    . DT  I  5 117 ? 5.756   -3.061  7.210   1.00 126.39 ? 44   DT  I C2    1 
ATOM   8400  O  O2    . DT  I  5 117 ? 5.158   -2.198  7.840   1.00 126.35 ? 44   DT  I O2    1 
ATOM   8401  N  N3    . DT  I  5 117 ? 5.767   -4.377  7.624   1.00 126.31 ? 44   DT  I N3    1 
ATOM   8402  C  C4    . DT  I  5 117 ? 6.399   -5.451  7.012   1.00 126.22 ? 44   DT  I C4    1 
ATOM   8403  O  O4    . DT  I  5 117 ? 6.341   -6.592  7.468   1.00 126.21 ? 44   DT  I O4    1 
ATOM   8404  C  C5    . DT  I  5 117 ? 7.125   -5.129  5.805   1.00 126.11 ? 44   DT  I C5    1 
ATOM   8405  C  C7    . DT  I  5 117 ? 7.850   -6.204  5.047   1.00 126.27 ? 44   DT  I C7    1 
ATOM   8406  C  C6    . DT  I  5 117 ? 7.126   -3.851  5.389   1.00 125.97 ? 44   DT  I C6    1 
ATOM   8407  P  P     . DT  I  5 118 ? 8.724   1.939   5.602   1.00 121.00 ? 45   DT  I P     1 
ATOM   8408  O  OP1   . DT  I  5 118 ? 8.682   3.420   5.644   1.00 120.95 ? 45   DT  I OP1   1 
ATOM   8409  O  OP2   . DT  I  5 118 ? 10.028  1.237   5.516   1.00 119.66 ? 45   DT  I OP2   1 
ATOM   8410  O  "O5'" . DT  I  5 118 ? 7.941   1.377   6.878   1.00 119.69 ? 45   DT  I "O5'" 1 
ATOM   8411  C  "C5'" . DT  I  5 118 ? 6.678   1.909   7.308   1.00 116.09 ? 45   DT  I "C5'" 1 
ATOM   8412  C  "C4'" . DT  I  5 118 ? 6.541   1.696   8.807   1.00 113.29 ? 45   DT  I "C4'" 1 
ATOM   8413  O  "O4'" . DT  I  5 118 ? 6.489   0.276   9.097   1.00 113.08 ? 45   DT  I "O4'" 1 
ATOM   8414  C  "C3'" . DT  I  5 118 ? 7.705   2.250   9.630   1.00 111.41 ? 45   DT  I "C3'" 1 
ATOM   8415  O  "O3'" . DT  I  5 118 ? 7.171   2.940   10.751  1.00 107.88 ? 45   DT  I "O3'" 1 
ATOM   8416  C  "C2'" . DT  I  5 118 ? 8.531   1.018   10.008  1.00 111.69 ? 45   DT  I "C2'" 1 
ATOM   8417  C  "C1'" . DT  I  5 118 ? 7.420   -0.018  10.124  1.00 113.12 ? 45   DT  I "C1'" 1 
ATOM   8418  N  N1    . DT  I  5 118 ? 7.856   -1.445  10.002  1.00 113.51 ? 45   DT  I N1    1 
ATOM   8419  C  C2    . DT  I  5 118 ? 7.381   -2.369  10.920  1.00 113.66 ? 45   DT  I C2    1 
ATOM   8420  O  O2    . DT  I  5 118 ? 6.627   -2.099  11.844  1.00 113.74 ? 45   DT  I O2    1 
ATOM   8421  N  N3    . DT  I  5 118 ? 7.833   -3.650  10.721  1.00 113.62 ? 45   DT  I N3    1 
ATOM   8422  C  C4    . DT  I  5 118 ? 8.685   -4.092  9.727   1.00 113.28 ? 45   DT  I C4    1 
ATOM   8423  O  O4    . DT  I  5 118 ? 9.012   -5.268  9.660   1.00 113.48 ? 45   DT  I O4    1 
ATOM   8424  C  C5    . DT  I  5 118 ? 9.147   -3.083  8.798   1.00 113.71 ? 45   DT  I C5    1 
ATOM   8425  C  C7    . DT  I  5 118 ? 10.076  -3.430  7.666   1.00 113.48 ? 45   DT  I C7    1 
ATOM   8426  C  C6    . DT  I  5 118 ? 8.713   -1.824  8.980   1.00 113.72 ? 45   DT  I C6    1 
ATOM   8427  P  P     . DC  I  5 119 ? 8.086   3.615   11.875  1.00 105.38 ? 46   DC  I P     1 
ATOM   8428  O  OP1   . DC  I  5 119 ? 7.346   4.800   12.354  1.00 105.80 ? 46   DC  I OP1   1 
ATOM   8429  O  OP2   . DC  I  5 119 ? 9.495   3.747   11.434  1.00 104.71 ? 46   DC  I OP2   1 
ATOM   8430  O  "O5'" . DC  I  5 119 ? 8.046   2.489   13.012  1.00 105.31 ? 46   DC  I "O5'" 1 
ATOM   8431  C  "C5'" . DC  I  5 119 ? 6.800   2.026   13.585  1.00 102.39 ? 46   DC  I "C5'" 1 
ATOM   8432  C  "C4'" . DC  I  5 119 ? 7.029   1.075   14.755  1.00 99.98  ? 46   DC  I "C4'" 1 
ATOM   8433  O  "O4'" . DC  I  5 119 ? 7.520   -0.203  14.264  1.00 99.54  ? 46   DC  I "O4'" 1 
ATOM   8434  C  "C3'" . DC  I  5 119 ? 8.033   1.525   15.818  1.00 98.53  ? 46   DC  I "C3'" 1 
ATOM   8435  O  "O3'" . DC  I  5 119 ? 7.602   1.036   17.074  1.00 95.91  ? 46   DC  I "O3'" 1 
ATOM   8436  C  "C2'" . DC  I  5 119 ? 9.323   0.827   15.392  1.00 99.13  ? 46   DC  I "C2'" 1 
ATOM   8437  C  "C1'" . DC  I  5 119 ? 8.754   -0.503  14.894  1.00 100.37 ? 46   DC  I "C1'" 1 
ATOM   8438  N  N1    . DC  I  5 119 ? 9.607   -1.274  13.924  1.00 101.25 ? 46   DC  I N1    1 
ATOM   8439  C  C2    . DC  I  5 119 ? 9.279   -2.617  13.643  1.00 101.34 ? 46   DC  I C2    1 
ATOM   8440  O  O2    . DC  I  5 119 ? 8.300   -3.146  14.190  1.00 101.25 ? 46   DC  I O2    1 
ATOM   8441  N  N3    . DC  I  5 119 ? 10.051  -3.313  12.764  1.00 101.01 ? 46   DC  I N3    1 
ATOM   8442  C  C4    . DC  I  5 119 ? 11.101  -2.726  12.183  1.00 100.96 ? 46   DC  I C4    1 
ATOM   8443  N  N4    . DC  I  5 119 ? 11.824  -3.461  11.329  1.00 101.07 ? 46   DC  I N4    1 
ATOM   8444  C  C5    . DC  I  5 119 ? 11.455  -1.364  12.457  1.00 101.27 ? 46   DC  I C5    1 
ATOM   8445  C  C6    . DC  I  5 119 ? 10.691  -0.681  13.320  1.00 101.22 ? 46   DC  I C6    1 
ATOM   8446  P  P     . DT  I  5 120 ? 7.447   1.973   18.358  1.00 93.57  ? 47   DT  I P     1 
ATOM   8447  O  OP1   . DT  I  5 120 ? 6.687   3.181   17.975  1.00 93.87  ? 47   DT  I OP1   1 
ATOM   8448  O  OP2   . DT  I  5 120 ? 8.780   2.079   18.977  1.00 92.83  ? 47   DT  I OP2   1 
ATOM   8449  O  "O5'" . DT  I  5 120 ? 6.520   1.095   19.319  1.00 92.06  ? 47   DT  I "O5'" 1 
ATOM   8450  C  "C5'" . DT  I  5 120 ? 5.432   0.350   18.778  1.00 88.45  ? 47   DT  I "C5'" 1 
ATOM   8451  C  "C4'" . DT  I  5 120 ? 5.528   -1.110  19.188  1.00 86.03  ? 47   DT  I "C4'" 1 
ATOM   8452  O  "O4'" . DT  I  5 120 ? 6.553   -1.794  18.423  1.00 86.55  ? 47   DT  I "O4'" 1 
ATOM   8453  C  "C3'" . DT  I  5 120 ? 5.862   -1.347  20.659  1.00 83.50  ? 47   DT  I "C3'" 1 
ATOM   8454  O  "O3'" . DT  I  5 120 ? 4.902   -2.256  21.198  1.00 78.97  ? 47   DT  I "O3'" 1 
ATOM   8455  C  "C2'" . DT  I  5 120 ? 7.270   -1.930  20.647  1.00 84.55  ? 47   DT  I "C2'" 1 
ATOM   8456  C  "C1'" . DT  I  5 120 ? 7.282   -2.632  19.295  1.00 86.54  ? 47   DT  I "C1'" 1 
ATOM   8457  N  N1    . DT  I  5 120 ? 8.647   -2.851  18.727  1.00 86.99  ? 47   DT  I N1    1 
ATOM   8458  C  C2    . DT  I  5 120 ? 9.014   -4.133  18.358  1.00 87.34  ? 47   DT  I C2    1 
ATOM   8459  O  O2    . DT  I  5 120 ? 8.288   -5.107  18.467  1.00 87.64  ? 47   DT  I O2    1 
ATOM   8460  N  N3    . DT  I  5 120 ? 10.283  -4.246  17.853  1.00 87.36  ? 47   DT  I N3    1 
ATOM   8461  C  C4    . DT  I  5 120 ? 11.199  -3.226  17.674  1.00 87.33  ? 47   DT  I C4    1 
ATOM   8462  O  O4    . DT  I  5 120 ? 12.311  -3.444  17.207  1.00 87.36  ? 47   DT  I O4    1 
ATOM   8463  C  C5    . DT  I  5 120 ? 10.758  -1.909  18.084  1.00 87.52  ? 47   DT  I C5    1 
ATOM   8464  C  C7    . DT  I  5 120 ? 11.669  -0.728  17.945  1.00 87.07  ? 47   DT  I C7    1 
ATOM   8465  C  C6    . DT  I  5 120 ? 9.517   -1.781  18.583  1.00 87.10  ? 47   DT  I C6    1 
ATOM   8466  P  P     . DA  I  5 121 ? 4.809   -2.544  22.766  1.00 74.25  ? 48   DA  I P     1 
ATOM   8467  O  OP1   . DA  I  5 121 ? 3.423   -2.990  23.022  1.00 73.74  ? 48   DA  I OP1   1 
ATOM   8468  O  OP2   . DA  I  5 121 ? 5.405   -1.426  23.543  1.00 73.37  ? 48   DA  I OP2   1 
ATOM   8469  O  "O5'" . DA  I  5 121 ? 5.791   -3.787  22.925  1.00 74.52  ? 48   DA  I "O5'" 1 
ATOM   8470  C  "C5'" . DA  I  5 121 ? 5.387   -5.019  22.358  1.00 75.61  ? 48   DA  I "C5'" 1 
ATOM   8471  C  "C4'" . DA  I  5 121 ? 6.426   -6.089  22.611  1.00 76.26  ? 48   DA  I "C4'" 1 
ATOM   8472  O  "O4'" . DA  I  5 121 ? 7.654   -5.669  21.981  1.00 76.79  ? 48   DA  I "O4'" 1 
ATOM   8473  C  "C3'" . DA  I  5 121 ? 6.766   -6.354  24.077  1.00 76.58  ? 48   DA  I "C3'" 1 
ATOM   8474  O  "O3'" . DA  I  5 121 ? 6.809   -7.761  24.297  1.00 74.41  ? 48   DA  I "O3'" 1 
ATOM   8475  C  "C2'" . DA  I  5 121 ? 8.134   -5.688  24.277  1.00 77.03  ? 48   DA  I "C2'" 1 
ATOM   8476  C  "C1'" . DA  I  5 121 ? 8.730   -5.827  22.887  1.00 78.57  ? 48   DA  I "C1'" 1 
ATOM   8477  N  N9    . DA  I  5 121 ? 9.718   -4.835  22.486  1.00 78.91  ? 48   DA  I N9    1 
ATOM   8478  C  C8    . DA  I  5 121 ? 9.867   -3.529  22.886  1.00 79.16  ? 48   DA  I C8    1 
ATOM   8479  N  N7    . DA  I  5 121 ? 10.860  -2.909  22.294  1.00 78.43  ? 48   DA  I N7    1 
ATOM   8480  C  C5    . DA  I  5 121 ? 11.381  -3.875  21.447  1.00 79.32  ? 48   DA  I C5    1 
ATOM   8481  C  C6    . DA  I  5 121 ? 12.457  -3.868  20.532  1.00 79.86  ? 48   DA  I C6    1 
ATOM   8482  N  N6    . DA  I  5 121 ? 13.222  -2.789  20.322  1.00 79.51  ? 48   DA  I N6    1 
ATOM   8483  N  N1    . DA  I  5 121 ? 12.713  -5.015  19.844  1.00 79.62  ? 48   DA  I N1    1 
ATOM   8484  C  C2    . DA  I  5 121 ? 11.941  -6.094  20.058  1.00 79.43  ? 48   DA  I C2    1 
ATOM   8485  N  N3    . DA  I  5 121 ? 10.903  -6.219  20.888  1.00 79.21  ? 48   DA  I N3    1 
ATOM   8486  C  C4    . DA  I  5 121 ? 10.685  -5.067  21.551  1.00 78.97  ? 48   DA  I C4    1 
ATOM   8487  P  P     . DC  I  5 122 ? 6.967   -8.366  25.766  1.00 72.57  ? 49   DC  I P     1 
ATOM   8488  O  OP1   . DC  I  5 122 ? 5.600   -8.841  26.096  1.00 71.95  ? 49   DC  I OP1   1 
ATOM   8489  O  OP2   . DC  I  5 122 ? 7.754   -7.455  26.620  1.00 69.58  ? 49   DC  I OP2   1 
ATOM   8490  O  "O5'" . DC  I  5 122 ? 7.929   -9.630  25.575  1.00 77.00  ? 49   DC  I "O5'" 1 
ATOM   8491  C  "C5'" . DC  I  5 122 ? 8.044   -10.313 24.307  1.00 82.02  ? 49   DC  I "C5'" 1 
ATOM   8492  C  "C4'" . DC  I  5 122 ? 9.464   -10.815 24.078  1.00 85.10  ? 49   DC  I "C4'" 1 
ATOM   8493  O  "O4'" . DC  I  5 122 ? 10.261  -9.775  23.447  1.00 85.98  ? 49   DC  I "O4'" 1 
ATOM   8494  C  "C3'" . DC  I  5 122 ? 10.204  -11.223 25.357  1.00 86.63  ? 49   DC  I "C3'" 1 
ATOM   8495  O  "O3'" . DC  I  5 122 ? 10.824  -12.504 25.227  1.00 88.32  ? 49   DC  I "O3'" 1 
ATOM   8496  C  "C2'" . DC  I  5 122 ? 11.253  -10.134 25.529  1.00 86.70  ? 49   DC  I "C2'" 1 
ATOM   8497  C  "C1'" . DC  I  5 122 ? 11.523  -9.724  24.091  1.00 87.25  ? 49   DC  I "C1'" 1 
ATOM   8498  N  N1    . DC  I  5 122 ? 12.078  -8.344  24.021  1.00 87.72  ? 49   DC  I N1    1 
ATOM   8499  C  C2    . DC  I  5 122 ? 13.195  -8.067  23.236  1.00 87.34  ? 49   DC  I C2    1 
ATOM   8500  O  O2    . DC  I  5 122 ? 13.715  -8.979  22.600  1.00 88.08  ? 49   DC  I O2    1 
ATOM   8501  N  N3    . DC  I  5 122 ? 13.675  -6.799  23.196  1.00 87.85  ? 49   DC  I N3    1 
ATOM   8502  C  C4    . DC  I  5 122 ? 13.087  -5.831  23.914  1.00 88.36  ? 49   DC  I C4    1 
ATOM   8503  N  N4    . DC  I  5 122 ? 13.584  -4.585  23.866  1.00 88.05  ? 49   DC  I N4    1 
ATOM   8504  C  C5    . DC  I  5 122 ? 11.947  -6.096  24.731  1.00 88.68  ? 49   DC  I C5    1 
ATOM   8505  C  C6    . DC  I  5 122 ? 11.484  -7.350  24.749  1.00 88.70  ? 49   DC  I C6    1 
ATOM   8506  P  P     . DG  I  5 123 ? 11.263  -13.359 26.508  1.00 88.13  ? 50   DG  I P     1 
ATOM   8507  O  OP1   . DG  I  5 123 ? 10.201  -14.362 26.717  1.00 87.69  ? 50   DG  I OP1   1 
ATOM   8508  O  OP2   . DG  I  5 123 ? 11.699  -12.480 27.616  1.00 86.96  ? 50   DG  I OP2   1 
ATOM   8509  O  "O5'" . DG  I  5 123 ? 12.571  -14.109 25.981  1.00 92.56  ? 50   DG  I "O5'" 1 
ATOM   8510  C  "C5'" . DG  I  5 123 ? 12.948  -14.166 24.610  1.00 98.02  ? 50   DG  I "C5'" 1 
ATOM   8511  C  "C4'" . DG  I  5 123 ? 14.455  -13.999 24.495  1.00 102.29 ? 50   DG  I "C4'" 1 
ATOM   8512  O  "O4'" . DG  I  5 123 ? 14.747  -12.608 24.205  1.00 103.36 ? 50   DG  I "O4'" 1 
ATOM   8513  C  "C3'" . DG  I  5 123 ? 15.234  -14.342 25.765  1.00 105.08 ? 50   DG  I "C3'" 1 
ATOM   8514  O  "O3'" . DG  I  5 123 ? 16.445  -15.036 25.447  1.00 109.35 ? 50   DG  I "O3'" 1 
ATOM   8515  C  "C2'" . DG  I  5 123 ? 15.512  -12.977 26.383  1.00 104.96 ? 50   DG  I "C2'" 1 
ATOM   8516  C  "C1'" . DG  I  5 123 ? 15.694  -12.124 25.135  1.00 105.14 ? 50   DG  I "C1'" 1 
ATOM   8517  N  N9    . DG  I  5 123 ? 15.457  -10.710 25.412  1.00 105.57 ? 50   DG  I N9    1 
ATOM   8518  C  C8    . DG  I  5 123 ? 14.453  -10.189 26.191  1.00 105.55 ? 50   DG  I C8    1 
ATOM   8519  N  N7    . DG  I  5 123 ? 14.479  -8.892  26.281  1.00 105.59 ? 50   DG  I N7    1 
ATOM   8520  C  C5    . DG  I  5 123 ? 15.578  -8.525  25.522  1.00 105.62 ? 50   DG  I C5    1 
ATOM   8521  C  C6    . DG  I  5 123 ? 16.105  -7.240  25.253  1.00 105.58 ? 50   DG  I C6    1 
ATOM   8522  O  O6    . DG  I  5 123 ? 15.682  -6.150  25.659  1.00 105.69 ? 50   DG  I O6    1 
ATOM   8523  N  N1    . DG  I  5 123 ? 17.238  -7.292  24.440  1.00 105.47 ? 50   DG  I N1    1 
ATOM   8524  C  C2    . DG  I  5 123 ? 17.785  -8.451  23.942  1.00 105.56 ? 50   DG  I C2    1 
ATOM   8525  N  N2    . DG  I  5 123 ? 18.874  -8.311  23.170  1.00 105.69 ? 50   DG  I N2    1 
ATOM   8526  N  N3    . DG  I  5 123 ? 17.295  -9.663  24.185  1.00 105.73 ? 50   DG  I N3    1 
ATOM   8527  C  C4    . DG  I  5 123 ? 16.195  -9.629  24.979  1.00 105.60 ? 50   DG  I C4    1 
ATOM   8528  P  P     . DA  I  5 124 ? 17.537  -15.397 26.576  1.00 112.53 ? 51   DA  I P     1 
ATOM   8529  O  OP1   . DA  I  5 124 ? 18.052  -16.740 26.224  1.00 112.33 ? 51   DA  I OP1   1 
ATOM   8530  O  OP2   . DA  I  5 124 ? 16.969  -15.154 27.929  1.00 112.41 ? 51   DA  I OP2   1 
ATOM   8531  O  "O5'" . DA  I  5 124 ? 18.686  -14.299 26.361  1.00 114.60 ? 51   DA  I "O5'" 1 
ATOM   8532  C  "C5'" . DA  I  5 124 ? 19.444  -14.213 25.146  1.00 118.18 ? 51   DA  I "C5'" 1 
ATOM   8533  C  "C4'" . DA  I  5 124 ? 20.647  -13.289 25.302  1.00 120.95 ? 51   DA  I "C4'" 1 
ATOM   8534  O  "O4'" . DA  I  5 124 ? 20.193  -11.910 25.337  1.00 120.95 ? 51   DA  I "O4'" 1 
ATOM   8535  C  "C3'" . DA  I  5 124 ? 21.489  -13.481 26.568  1.00 123.67 ? 51   DA  I "C3'" 1 
ATOM   8536  O  "O3'" . DA  I  5 124 ? 22.896  -13.381 26.265  1.00 128.12 ? 51   DA  I "O3'" 1 
ATOM   8537  C  "C2'" . DA  I  5 124 ? 21.021  -12.373 27.511  1.00 122.34 ? 51   DA  I "C2'" 1 
ATOM   8538  C  "C1'" . DA  I  5 124 ? 20.599  -11.281 26.540  1.00 120.93 ? 51   DA  I "C1'" 1 
ATOM   8539  N  N9    . DA  I  5 124 ? 19.490  -10.481 27.047  1.00 120.72 ? 51   DA  I N9    1 
ATOM   8540  C  C8    . DA  I  5 124 ? 18.310  -10.935 27.576  1.00 120.59 ? 51   DA  I C8    1 
ATOM   8541  N  N7    . DA  I  5 124 ? 17.497  -9.978  27.952  1.00 120.58 ? 51   DA  I N7    1 
ATOM   8542  C  C5    . DA  I  5 124 ? 18.193  -8.818  27.646  1.00 120.55 ? 51   DA  I C5    1 
ATOM   8543  C  C6    . DA  I  5 124 ? 17.881  -7.450  27.799  1.00 120.64 ? 51   DA  I C6    1 
ATOM   8544  N  N6    . DA  I  5 124 ? 16.727  -7.018  28.318  1.00 120.34 ? 51   DA  I N6    1 
ATOM   8545  N  N1    . DA  I  5 124 ? 18.801  -6.541  27.389  1.00 120.83 ? 51   DA  I N1    1 
ATOM   8546  C  C2    . DA  I  5 124 ? 19.958  -6.973  26.865  1.00 120.53 ? 51   DA  I C2    1 
ATOM   8547  N  N3    . DA  I  5 124 ? 20.359  -8.231  26.672  1.00 120.23 ? 51   DA  I N3    1 
ATOM   8548  C  C4    . DA  I  5 124 ? 19.425  -9.109  27.087  1.00 120.43 ? 51   DA  I C4    1 
ATOM   8549  P  P     . DT  I  5 125 ? 24.047  -13.657 27.359  1.00 131.25 ? 52   DT  I P     1 
ATOM   8550  O  OP1   . DT  I  5 125 ? 25.258  -14.075 26.611  1.00 130.94 ? 52   DT  I OP1   1 
ATOM   8551  O  OP2   . DT  I  5 125 ? 23.509  -14.534 28.432  1.00 131.18 ? 52   DT  I OP2   1 
ATOM   8552  O  "O5'" . DT  I  5 125 ? 24.284  -12.201 27.988  1.00 133.04 ? 52   DT  I "O5'" 1 
ATOM   8553  C  "C5'" . DT  I  5 125 ? 24.689  -11.108 27.161  1.00 136.08 ? 52   DT  I "C5'" 1 
ATOM   8554  C  "C4'" . DT  I  5 125 ? 24.853  -9.855  27.994  1.00 138.47 ? 52   DT  I "C4'" 1 
ATOM   8555  O  "O4'" . DT  I  5 125 ? 23.548  -9.284  28.253  1.00 138.82 ? 52   DT  I "O4'" 1 
ATOM   8556  C  "C3'" . DT  I  5 125 ? 25.506  -10.082 29.356  1.00 140.30 ? 52   DT  I "C3'" 1 
ATOM   8557  O  "O3'" . DT  I  5 125 ? 26.732  -9.354  29.398  1.00 143.59 ? 52   DT  I "O3'" 1 
ATOM   8558  C  "C2'" . DT  I  5 125 ? 24.472  -9.596  30.372  1.00 139.64 ? 52   DT  I "C2'" 1 
ATOM   8559  C  "C1'" . DT  I  5 125 ? 23.578  -8.693  29.534  1.00 138.76 ? 52   DT  I "C1'" 1 
ATOM   8560  N  N1    . DT  I  5 125 ? 22.191  -8.575  30.088  1.00 138.54 ? 52   DT  I N1    1 
ATOM   8561  C  C2    . DT  I  5 125 ? 21.667  -7.319  30.342  1.00 138.18 ? 52   DT  I C2    1 
ATOM   8562  O  O2    . DT  I  5 125 ? 22.268  -6.280  30.133  1.00 137.95 ? 52   DT  I O2    1 
ATOM   8563  N  N3    . DT  I  5 125 ? 20.391  -7.327  30.856  1.00 138.26 ? 52   DT  I N3    1 
ATOM   8564  C  C4    . DT  I  5 125 ? 19.609  -8.439  31.140  1.00 138.34 ? 52   DT  I C4    1 
ATOM   8565  O  O4    . DT  I  5 125 ? 18.476  -8.333  31.601  1.00 138.37 ? 52   DT  I O4    1 
ATOM   8566  C  C5    . DT  I  5 125 ? 20.217  -9.722  30.852  1.00 138.13 ? 52   DT  I C5    1 
ATOM   8567  C  C7    . DT  I  5 125 ? 19.478  -11.002 31.108  1.00 138.13 ? 52   DT  I C7    1 
ATOM   8568  C  C6    . DT  I  5 125 ? 21.460  -9.726  30.349  1.00 138.32 ? 52   DT  I C6    1 
ATOM   8569  P  P     . DC  I  5 126 ? 27.483  -8.953  30.761  1.00 146.33 ? 53   DC  I P     1 
ATOM   8570  O  OP1   . DC  I  5 126 ? 28.930  -8.864  30.449  1.00 146.07 ? 53   DC  I OP1   1 
ATOM   8571  O  OP2   . DC  I  5 126 ? 27.037  -9.821  31.885  1.00 146.00 ? 53   DC  I OP2   1 
ATOM   8572  O  "O5'" . DC  I  5 126 ? 26.902  -7.473  30.992  1.00 148.74 ? 53   DC  I "O5'" 1 
ATOM   8573  C  "C5'" . DC  I  5 126 ? 27.718  -6.333  30.712  1.00 152.30 ? 53   DC  I "C5'" 1 
ATOM   8574  C  "C4'" . DC  I  5 126 ? 27.456  -5.261  31.750  1.00 155.07 ? 53   DC  I "C4'" 1 
ATOM   8575  O  "O4'" . DC  I  5 126 ? 26.023  -5.050  31.827  1.00 155.60 ? 53   DC  I "O4'" 1 
ATOM   8576  C  "C3'" . DC  I  5 126 ? 27.946  -5.603  33.163  1.00 156.68 ? 53   DC  I "C3'" 1 
ATOM   8577  O  "O3'" . DC  I  5 126 ? 28.965  -4.644  33.579  1.00 158.89 ? 53   DC  I "O3'" 1 
ATOM   8578  C  "C2'" . DC  I  5 126 ? 26.665  -5.686  34.011  1.00 156.48 ? 53   DC  I "C2'" 1 
ATOM   8579  C  "C1'" . DC  I  5 126 ? 25.650  -4.898  33.181  1.00 156.27 ? 53   DC  I "C1'" 1 
ATOM   8580  N  N1    . DC  I  5 126 ? 24.202  -5.293  33.328  1.00 156.51 ? 53   DC  I N1    1 
ATOM   8581  C  C2    . DC  I  5 126 ? 23.224  -4.280  33.297  1.00 156.56 ? 53   DC  I C2    1 
ATOM   8582  O  O2    . DC  I  5 126 ? 23.563  -3.096  33.152  1.00 156.32 ? 53   DC  I O2    1 
ATOM   8583  N  N3    . DC  I  5 126 ? 21.915  -4.630  33.428  1.00 156.59 ? 53   DC  I N3    1 
ATOM   8584  C  C4    . DC  I  5 126 ? 21.566  -5.912  33.584  1.00 156.53 ? 53   DC  I C4    1 
ATOM   8585  N  N4    . DC  I  5 126 ? 20.260  -6.176  33.708  1.00 156.45 ? 53   DC  I N4    1 
ATOM   8586  C  C5    . DC  I  5 126 ? 22.542  -6.962  33.620  1.00 156.47 ? 53   DC  I C5    1 
ATOM   8587  C  C6    . DC  I  5 126 ? 23.832  -6.609  33.485  1.00 156.57 ? 53   DC  I C6    1 
ATOM   8588  P  P     . DC  I  5 127 ? 28.880  -3.544  34.758  1.00 160.73 ? 54   DC  I P     1 
ATOM   8589  O  OP1   . DC  I  5 127 ? 30.144  -2.770  34.691  1.00 160.72 ? 54   DC  I OP1   1 
ATOM   8590  O  OP2   . DC  I  5 127 ? 28.518  -4.218  36.028  1.00 160.90 ? 54   DC  I OP2   1 
ATOM   8591  O  "O5'" . DC  I  5 127 ? 27.666  -2.585  34.333  1.00 162.09 ? 54   DC  I "O5'" 1 
ATOM   8592  C  "C5'" . DC  I  5 127 ? 27.751  -1.154  34.431  1.00 163.84 ? 54   DC  I "C5'" 1 
ATOM   8593  C  "C4'" . DC  I  5 127 ? 26.813  -0.603  35.499  1.00 165.10 ? 54   DC  I "C4'" 1 
ATOM   8594  O  "O4'" . DC  I  5 127 ? 25.537  -1.304  35.505  1.00 165.71 ? 54   DC  I "O4'" 1 
ATOM   8595  C  "C3'" . DC  I  5 127 ? 27.342  -0.692  36.926  1.00 165.66 ? 54   DC  I "C3'" 1 
ATOM   8596  O  "O3'" . DC  I  5 127 ? 27.057  0.520   37.616  1.00 166.27 ? 54   DC  I "O3'" 1 
ATOM   8597  C  "C2'" . DC  I  5 127 ? 26.568  -1.862  37.526  1.00 165.86 ? 54   DC  I "C2'" 1 
ATOM   8598  C  "C1'" . DC  I  5 127 ? 25.220  -1.655  36.840  1.00 166.16 ? 54   DC  I "C1'" 1 
ATOM   8599  N  N1    . DC  I  5 127 ? 24.278  -2.830  36.859  1.00 166.36 ? 54   DC  I N1    1 
ATOM   8600  C  C2    . DC  I  5 127 ? 22.897  -2.595  36.991  1.00 166.52 ? 54   DC  I C2    1 
ATOM   8601  O  O2    . DC  I  5 127 ? 22.482  -1.430  37.087  1.00 166.48 ? 54   DC  I O2    1 
ATOM   8602  N  N3    . DC  I  5 127 ? 22.048  -3.661  37.011  1.00 166.61 ? 54   DC  I N3    1 
ATOM   8603  C  C4    . DC  I  5 127 ? 22.527  -4.907  36.904  1.00 166.54 ? 54   DC  I C4    1 
ATOM   8604  N  N4    . DC  I  5 127 ? 21.653  -5.917  36.925  1.00 166.52 ? 54   DC  I N4    1 
ATOM   8605  C  C5    . DC  I  5 127 ? 23.927  -5.170  36.768  1.00 166.49 ? 54   DC  I C5    1 
ATOM   8606  C  C6    . DC  I  5 127 ? 24.754  -4.114  36.751  1.00 166.45 ? 54   DC  I C6    1 
ATOM   8607  P  P     . DG  I  5 128 ? 28.096  1.051   38.708  1.00 166.61 ? 55   DG  I P     1 
ATOM   8608  O  OP1   . DG  I  5 128 ? 29.273  1.552   37.958  1.00 166.60 ? 55   DG  I OP1   1 
ATOM   8609  O  OP2   . DG  I  5 128 ? 28.240  -0.023  39.724  1.00 166.49 ? 55   DG  I OP2   1 
ATOM   8610  O  "O5'" . DG  I  5 128 ? 27.392  2.303   39.425  1.00 166.78 ? 55   DG  I "O5'" 1 
ATOM   8611  C  "C5'" . DG  I  5 128 ? 26.371  3.092   38.811  1.00 167.02 ? 55   DG  I "C5'" 1 
ATOM   8612  C  "C4'" . DG  I  5 128 ? 25.205  3.320   39.769  1.00 167.16 ? 55   DG  I "C4'" 1 
ATOM   8613  O  "O4'" . DG  I  5 128 ? 24.288  2.192   39.712  1.00 167.38 ? 55   DG  I "O4'" 1 
ATOM   8614  C  "C3'" . DG  I  5 128 ? 25.566  3.504   41.244  1.00 167.14 ? 55   DG  I "C3'" 1 
ATOM   8615  O  "O3'" . DG  I  5 128 ? 24.768  4.563   41.797  1.00 167.21 ? 55   DG  I "O3'" 1 
ATOM   8616  C  "C2'" . DG  I  5 128 ? 25.280  2.137   41.870  1.00 167.22 ? 55   DG  I "C2'" 1 
ATOM   8617  C  "C1'" . DG  I  5 128 ? 24.172  1.570   40.981  1.00 167.37 ? 55   DG  I "C1'" 1 
ATOM   8618  N  N9    . DG  I  5 128 ? 24.225  0.115   40.801  1.00 167.41 ? 55   DG  I N9    1 
ATOM   8619  C  C8    . DG  I  5 128 ? 25.346  -0.688  40.754  1.00 167.34 ? 55   DG  I C8    1 
ATOM   8620  N  N7    . DG  I  5 128 ? 25.083  -1.955  40.583  1.00 167.38 ? 55   DG  I N7    1 
ATOM   8621  C  C5    . DG  I  5 128 ? 23.693  -2.002  40.507  1.00 167.54 ? 55   DG  I C5    1 
ATOM   8622  C  C6    . DG  I  5 128 ? 22.821  -3.111  40.327  1.00 167.46 ? 55   DG  I C6    1 
ATOM   8623  O  O6    . DG  I  5 128 ? 23.130  -4.306  40.191  1.00 167.28 ? 55   DG  I O6    1 
ATOM   8624  N  N1    . DG  I  5 128 ? 21.474  -2.725  40.308  1.00 167.36 ? 55   DG  I N1    1 
ATOM   8625  C  C2    . DG  I  5 128 ? 21.027  -1.425  40.450  1.00 167.35 ? 55   DG  I C2    1 
ATOM   8626  N  N2    . DG  I  5 128 ? 19.700  -1.235  40.411  1.00 167.33 ? 55   DG  I N2    1 
ATOM   8627  N  N3    . DG  I  5 128 ? 21.832  -0.378  40.618  1.00 167.36 ? 55   DG  I N3    1 
ATOM   8628  C  C4    . DG  I  5 128 ? 23.148  -0.735  40.640  1.00 167.55 ? 55   DG  I C4    1 
ATOM   8629  P  P     . DC  I  5 129 ? 24.941  5.125   43.297  1.00 166.90 ? 56   DC  I P     1 
ATOM   8630  O  OP1   . DC  I  5 129 ? 24.308  6.464   43.359  1.00 167.01 ? 56   DC  I OP1   1 
ATOM   8631  O  OP2   . DC  I  5 129 ? 26.351  4.961   43.732  1.00 166.89 ? 56   DC  I OP2   1 
ATOM   8632  O  "O5'" . DC  I  5 129 ? 24.037  4.104   44.121  1.00 165.82 ? 56   DC  I "O5'" 1 
ATOM   8633  C  "C5'" . DC  I  5 129 ? 22.657  3.926   43.820  1.00 164.28 ? 56   DC  I "C5'" 1 
ATOM   8634  C  "C4'" . DC  I  5 129 ? 22.125  2.836   44.727  1.00 163.22 ? 56   DC  I "C4'" 1 
ATOM   8635  O  "O4'" . DC  I  5 129 ? 22.404  1.548   44.121  1.00 162.93 ? 56   DC  I "O4'" 1 
ATOM   8636  C  "C3'" . DC  I  5 129 ? 22.801  2.829   46.100  1.00 162.50 ? 56   DC  I "C3'" 1 
ATOM   8637  O  "O3'" . DC  I  5 129 ? 21.836  3.046   47.142  1.00 161.50 ? 56   DC  I "O3'" 1 
ATOM   8638  C  "C2'" . DC  I  5 129 ? 23.500  1.467   46.169  1.00 162.61 ? 56   DC  I "C2'" 1 
ATOM   8639  C  "C1'" . DC  I  5 129 ? 22.695  0.646   45.163  1.00 162.65 ? 56   DC  I "C1'" 1 
ATOM   8640  N  N1    . DC  I  5 129 ? 23.363  -0.589  44.601  1.00 162.53 ? 56   DC  I N1    1 
ATOM   8641  C  C2    . DC  I  5 129 ? 22.574  -1.686  44.197  1.00 162.54 ? 56   DC  I C2    1 
ATOM   8642  O  O2    . DC  I  5 129 ? 21.339  -1.636  44.303  1.00 162.39 ? 56   DC  I O2    1 
ATOM   8643  N  N3    . DC  I  5 129 ? 23.190  -2.791  43.695  1.00 162.53 ? 56   DC  I N3    1 
ATOM   8644  C  C4    . DC  I  5 129 ? 24.522  -2.832  43.588  1.00 162.44 ? 56   DC  I C4    1 
ATOM   8645  N  N4    . DC  I  5 129 ? 25.072  -3.942  43.082  1.00 162.48 ? 56   DC  I N4    1 
ATOM   8646  C  C5    . DC  I  5 129 ? 25.341  -1.733  43.987  1.00 162.27 ? 56   DC  I C5    1 
ATOM   8647  C  C6    . DC  I  5 129 ? 24.728  -0.647  44.480  1.00 162.29 ? 56   DC  I C6    1 
ATOM   8648  P  P     . DA  I  5 130 ? 21.577  4.500   47.785  1.00 160.43 ? 57   DA  I P     1 
ATOM   8649  O  OP1   . DA  I  5 130 ? 21.825  5.543   46.764  1.00 160.63 ? 57   DA  I OP1   1 
ATOM   8650  O  OP2   . DA  I  5 130 ? 22.303  4.548   49.073  1.00 160.41 ? 57   DA  I OP2   1 
ATOM   8651  O  "O5'" . DA  I  5 130 ? 20.009  4.480   48.100  1.00 160.21 ? 57   DA  I "O5'" 1 
ATOM   8652  C  "C5'" . DA  I  5 130 ? 19.083  4.105   47.076  1.00 159.83 ? 57   DA  I "C5'" 1 
ATOM   8653  C  "C4'" . DA  I  5 130 ? 18.128  2.999   47.509  1.00 159.41 ? 57   DA  I "C4'" 1 
ATOM   8654  O  "O4'" . DA  I  5 130 ? 18.652  1.699   47.115  1.00 159.17 ? 57   DA  I "O4'" 1 
ATOM   8655  C  "C3'" . DA  I  5 130 ? 17.824  2.906   49.003  1.00 159.08 ? 57   DA  I "C3'" 1 
ATOM   8656  O  "O3'" . DA  I  5 130 ? 16.397  2.801   49.133  1.00 158.78 ? 57   DA  I "O3'" 1 
ATOM   8657  C  "C2'" . DA  I  5 130 ? 18.635  1.693   49.472  1.00 158.96 ? 57   DA  I "C2'" 1 
ATOM   8658  C  "C1'" . DA  I  5 130 ? 18.683  0.819   48.222  1.00 159.21 ? 57   DA  I "C1'" 1 
ATOM   8659  N  N9    . DA  I  5 130 ? 19.886  -0.002  48.102  1.00 159.26 ? 57   DA  I N9    1 
ATOM   8660  C  C8    . DA  I  5 130 ? 21.151  0.336   48.495  1.00 159.37 ? 57   DA  I C8    1 
ATOM   8661  N  N7    . DA  I  5 130 ? 22.050  -0.592  48.266  1.00 159.53 ? 57   DA  I N7    1 
ATOM   8662  C  C5    . DA  I  5 130 ? 21.330  -1.616  47.677  1.00 159.42 ? 57   DA  I C5    1 
ATOM   8663  C  C6    . DA  I  5 130 ? 21.710  -2.891  47.199  1.00 159.31 ? 57   DA  I C6    1 
ATOM   8664  N  N6    . DA  I  5 130 ? 22.967  -3.349  47.241  1.00 159.07 ? 57   DA  I N6    1 
ATOM   8665  N  N1    . DA  I  5 130 ? 20.740  -3.675  46.670  1.00 159.44 ? 57   DA  I N1    1 
ATOM   8666  C  C2    . DA  I  5 130 ? 19.478  -3.210  46.631  1.00 159.46 ? 57   DA  I C2    1 
ATOM   8667  N  N3    . DA  I  5 130 ? 19.004  -2.033  47.050  1.00 159.41 ? 57   DA  I N3    1 
ATOM   8668  C  C4    . DA  I  5 130 ? 19.989  -1.270  47.568  1.00 159.42 ? 57   DA  I C4    1 
ATOM   8669  P  P     . DA  I  5 131 ? 15.618  2.040   50.309  1.00 158.45 ? 58   DA  I P     1 
ATOM   8670  O  OP1   . DA  I  5 131 ? 14.205  2.474   50.256  1.00 158.50 ? 58   DA  I OP1   1 
ATOM   8671  O  OP2   . DA  I  5 131 ? 16.370  2.186   51.577  1.00 158.51 ? 58   DA  I OP2   1 
ATOM   8672  O  "O5'" . DA  I  5 131 ? 15.721  0.511   49.853  1.00 158.17 ? 58   DA  I "O5'" 1 
ATOM   8673  C  "C5'" . DA  I  5 131 ? 15.158  0.032   48.623  1.00 157.44 ? 58   DA  I "C5'" 1 
ATOM   8674  C  "C4'" . DA  I  5 131 ? 14.953  -1.473  48.710  1.00 156.81 ? 58   DA  I "C4'" 1 
ATOM   8675  O  "O4'" . DA  I  5 131 ? 16.228  -2.163  48.775  1.00 156.66 ? 58   DA  I "O4'" 1 
ATOM   8676  C  "C3'" . DA  I  5 131 ? 14.181  -1.917  49.944  1.00 156.57 ? 58   DA  I "C3'" 1 
ATOM   8677  O  "O3'" . DA  I  5 131 ? 13.291  -2.974  49.614  1.00 156.08 ? 58   DA  I "O3'" 1 
ATOM   8678  C  "C2'" . DA  I  5 131 ? 15.262  -2.346  50.938  1.00 156.44 ? 58   DA  I "C2'" 1 
ATOM   8679  C  "C1'" . DA  I  5 131 ? 16.392  -2.811  50.026  1.00 156.52 ? 58   DA  I "C1'" 1 
ATOM   8680  N  N9    . DA  I  5 131 ? 17.728  -2.501  50.536  1.00 156.61 ? 58   DA  I N9    1 
ATOM   8681  C  C8    . DA  I  5 131 ? 18.107  -1.412  51.281  1.00 156.49 ? 58   DA  I C8    1 
ATOM   8682  N  N7    . DA  I  5 131 ? 19.381  -1.397  51.595  1.00 156.44 ? 58   DA  I N7    1 
ATOM   8683  C  C5    . DA  I  5 131 ? 19.876  -2.557  51.016  1.00 156.64 ? 58   DA  I C5    1 
ATOM   8684  C  C6    . DA  I  5 131 ? 21.169  -3.132  50.977  1.00 156.51 ? 58   DA  I C6    1 
ATOM   8685  N  N6    . DA  I  5 131 ? 22.234  -2.577  51.566  1.00 156.39 ? 58   DA  I N6    1 
ATOM   8686  N  N1    . DA  I  5 131 ? 21.324  -4.303  50.311  1.00 156.54 ? 58   DA  I N1    1 
ATOM   8687  C  C2    . DA  I  5 131 ? 20.257  -4.866  49.721  1.00 156.45 ? 58   DA  I C2    1 
ATOM   8688  N  N3    . DA  I  5 131 ? 18.998  -4.419  49.687  1.00 156.46 ? 58   DA  I N3    1 
ATOM   8689  C  C4    . DA  I  5 131 ? 18.871  -3.252  50.357  1.00 156.65 ? 58   DA  I C4    1 
ATOM   8690  P  P     . DG  I  5 132 ? 11.979  -3.207  50.498  1.00 155.60 ? 59   DG  I P     1 
ATOM   8691  O  OP1   . DG  I  5 132 ? 10.816  -3.184  49.587  1.00 156.13 ? 59   DG  I OP1   1 
ATOM   8692  O  OP2   . DG  I  5 132 ? 11.985  -2.288  51.661  1.00 155.88 ? 59   DG  I OP2   1 
ATOM   8693  O  "O5'" . DG  I  5 132 ? 12.206  -4.705  51.021  1.00 155.44 ? 59   DG  I "O5'" 1 
ATOM   8694  C  "C5'" . DG  I  5 132 ? 13.153  -5.001  52.045  1.00 154.68 ? 59   DG  I "C5'" 1 
ATOM   8695  C  "C4'" . DG  I  5 132 ? 14.134  -6.059  51.568  1.00 154.36 ? 59   DG  I "C4'" 1 
ATOM   8696  O  "O4'" . DG  I  5 132 ? 15.466  -5.491  51.510  1.00 154.24 ? 59   DG  I "O4'" 1 
ATOM   8697  C  "C3'" . DG  I  5 132 ? 14.226  -7.296  52.465  1.00 154.38 ? 59   DG  I "C3'" 1 
ATOM   8698  O  "O3'" . DG  I  5 132 ? 14.263  -8.494  51.675  1.00 154.04 ? 59   DG  I "O3'" 1 
ATOM   8699  C  "C2'" . DG  I  5 132 ? 15.542  -7.102  53.216  1.00 154.47 ? 59   DG  I "C2'" 1 
ATOM   8700  C  "C1'" . DG  I  5 132 ? 16.373  -6.341  52.185  1.00 154.31 ? 59   DG  I "C1'" 1 
ATOM   8701  N  N9    . DG  I  5 132 ? 17.436  -5.557  52.815  1.00 154.33 ? 59   DG  I N9    1 
ATOM   8702  C  C8    . DG  I  5 132 ? 17.342  -4.333  53.439  1.00 154.28 ? 59   DG  I C8    1 
ATOM   8703  N  N7    . DG  I  5 132 ? 18.480  -3.903  53.915  1.00 154.22 ? 59   DG  I N7    1 
ATOM   8704  C  C5    . DG  I  5 132 ? 19.384  -4.909  53.589  1.00 154.20 ? 59   DG  I C5    1 
ATOM   8705  C  C6    . DG  I  5 132 ? 20.777  -5.019  53.839  1.00 154.17 ? 59   DG  I C6    1 
ATOM   8706  O  O6    . DG  I  5 132 ? 21.517  -4.217  54.422  1.00 154.26 ? 59   DG  I O6    1 
ATOM   8707  N  N1    . DG  I  5 132 ? 21.310  -6.208  53.338  1.00 154.30 ? 59   DG  I N1    1 
ATOM   8708  C  C2    . DG  I  5 132 ? 20.585  -7.173  52.675  1.00 154.23 ? 59   DG  I C2    1 
ATOM   8709  N  N2    . DG  I  5 132 ? 21.256  -8.253  52.259  1.00 154.31 ? 59   DG  I N2    1 
ATOM   8710  N  N3    . DG  I  5 132 ? 19.285  -7.085  52.433  1.00 154.17 ? 59   DG  I N3    1 
ATOM   8711  C  C4    . DG  I  5 132 ? 18.753  -5.933  52.915  1.00 154.23 ? 59   DG  I C4    1 
ATOM   8712  P  P     . DG  I  5 133 ? 13.596  -9.859  52.191  1.00 153.54 ? 60   DG  I P     1 
ATOM   8713  O  OP1   . DG  I  5 133 ? 12.417  -10.108 51.330  1.00 153.33 ? 60   DG  I OP1   1 
ATOM   8714  O  OP2   . DG  I  5 133 ? 13.424  -9.769  53.661  1.00 153.56 ? 60   DG  I OP2   1 
ATOM   8715  O  "O5'" . DG  I  5 133 ? 14.696  -10.990 51.873  1.00 153.12 ? 60   DG  I "O5'" 1 
ATOM   8716  C  "C5'" . DG  I  5 133 ? 16.100  -10.700 51.804  1.00 152.25 ? 60   DG  I "C5'" 1 
ATOM   8717  C  "C4'" . DG  I  5 133 ? 16.883  -11.305 52.961  1.00 151.51 ? 60   DG  I "C4'" 1 
ATOM   8718  O  "O4'" . DG  I  5 133 ? 17.783  -10.309 53.525  1.00 151.04 ? 60   DG  I "O4'" 1 
ATOM   8719  C  "C3'" . DG  I  5 133 ? 16.061  -11.837 54.139  1.00 151.44 ? 60   DG  I "C3'" 1 
ATOM   8720  O  "O3'" . DG  I  5 133 ? 16.638  -13.079 54.565  1.00 151.71 ? 60   DG  I "O3'" 1 
ATOM   8721  C  "C2'" . DG  I  5 133 ? 16.210  -10.713 55.161  1.00 151.11 ? 60   DG  I "C2'" 1 
ATOM   8722  C  "C1'" . DG  I  5 133 ? 17.679  -10.399 54.931  1.00 150.79 ? 60   DG  I "C1'" 1 
ATOM   8723  N  N9    . DG  I  5 133 ? 18.166  -9.181  55.568  1.00 150.70 ? 60   DG  I N9    1 
ATOM   8724  C  C8    . DG  I  5 133 ? 17.430  -8.198  56.191  1.00 150.65 ? 60   DG  I C8    1 
ATOM   8725  N  N7    . DG  I  5 133 ? 18.162  -7.233  56.675  1.00 150.63 ? 60   DG  I N7    1 
ATOM   8726  C  C5    . DG  I  5 133 ? 19.464  -7.602  56.356  1.00 150.71 ? 60   DG  I C5    1 
ATOM   8727  C  C6    . DG  I  5 133 ? 20.697  -6.950  56.620  1.00 150.74 ? 60   DG  I C6    1 
ATOM   8728  O  O6    . DG  I  5 133 ? 20.883  -5.878  57.210  1.00 150.73 ? 60   DG  I O6    1 
ATOM   8729  N  N1    . DG  I  5 133 ? 21.793  -7.662  56.125  1.00 150.68 ? 60   DG  I N1    1 
ATOM   8730  C  C2    . DG  I  5 133 ? 21.707  -8.862  55.456  1.00 150.65 ? 60   DG  I C2    1 
ATOM   8731  N  N2    . DG  I  5 133 ? 22.866  -9.402  55.052  1.00 150.61 ? 60   DG  I N2    1 
ATOM   8732  N  N3    . DG  I  5 133 ? 20.559  -9.483  55.201  1.00 150.66 ? 60   DG  I N3    1 
ATOM   8733  C  C4    . DG  I  5 133 ? 19.483  -8.801  55.677  1.00 150.69 ? 60   DG  I C4    1 
ATOM   8734  P  P     . DG  I  5 134 ? 16.227  -13.888 55.900  1.00 151.69 ? 61   DG  I P     1 
ATOM   8735  O  OP1   . DG  I  5 134 ? 14.982  -14.639 55.591  1.00 151.53 ? 61   DG  I OP1   1 
ATOM   8736  O  OP2   . DG  I  5 134 ? 16.259  -12.990 57.082  1.00 151.59 ? 61   DG  I OP2   1 
ATOM   8737  O  "O5'" . DG  I  5 134 ? 17.462  -14.910 56.059  1.00 151.54 ? 61   DG  I "O5'" 1 
ATOM   8738  C  "C5'" . DG  I  5 134 ? 18.687  -14.771 55.306  1.00 150.75 ? 61   DG  I "C5'" 1 
ATOM   8739  C  "C4'" . DG  I  5 134 ? 19.911  -14.563 56.191  1.00 150.27 ? 61   DG  I "C4'" 1 
ATOM   8740  O  "O4'" . DG  I  5 134 ? 20.090  -13.142 56.460  1.00 150.26 ? 61   DG  I "O4'" 1 
ATOM   8741  C  "C3'" . DG  I  5 134 ? 19.876  -15.263 57.551  1.00 149.89 ? 61   DG  I "C3'" 1 
ATOM   8742  O  "O3'" . DG  I  5 134 ? 21.082  -16.004 57.755  1.00 149.30 ? 61   DG  I "O3'" 1 
ATOM   8743  C  "C2'" . DG  I  5 134 ? 19.719  -14.113 58.544  1.00 150.03 ? 61   DG  I "C2'" 1 
ATOM   8744  C  "C1'" . DG  I  5 134 ? 20.435  -12.976 57.822  1.00 150.40 ? 61   DG  I "C1'" 1 
ATOM   8745  N  N9    . DG  I  5 134 ? 20.066  -11.640 58.310  1.00 150.49 ? 61   DG  I N9    1 
ATOM   8746  C  C8    . DG  I  5 134 ? 18.795  -11.126 58.459  1.00 150.49 ? 61   DG  I C8    1 
ATOM   8747  N  N7    . DG  I  5 134 ? 18.765  -9.908  58.926  1.00 150.43 ? 61   DG  I N7    1 
ATOM   8748  C  C5    . DG  I  5 134 ? 20.104  -9.588  59.106  1.00 150.52 ? 61   DG  I C5    1 
ATOM   8749  C  C6    . DG  I  5 134 ? 20.696  -8.394  59.590  1.00 150.49 ? 61   DG  I C6    1 
ATOM   8750  O  O6    . DG  I  5 134 ? 20.125  -7.360  59.960  1.00 150.39 ? 61   DG  I O6    1 
ATOM   8751  N  N1    . DG  I  5 134 ? 22.092  -8.470  59.620  1.00 150.51 ? 61   DG  I N1    1 
ATOM   8752  C  C2    . DG  I  5 134 ? 22.825  -9.569  59.228  1.00 150.42 ? 61   DG  I C2    1 
ATOM   8753  N  N2    . DG  I  5 134 ? 24.157  -9.462  59.325  1.00 150.38 ? 61   DG  I N2    1 
ATOM   8754  N  N3    . DG  I  5 134 ? 22.282  -10.696 58.772  1.00 150.45 ? 61   DG  I N3    1 
ATOM   8755  C  C4    . DG  I  5 134 ? 20.921  -10.641 58.736  1.00 150.53 ? 61   DG  I C4    1 
ATOM   8756  P  P     . DA  I  5 135 ? 21.346  -16.869 59.082  1.00 148.84 ? 62   DA  I P     1 
ATOM   8757  O  OP1   . DA  I  5 135 ? 22.108  -18.070 58.678  1.00 149.23 ? 62   DA  I OP1   1 
ATOM   8758  O  OP2   . DA  I  5 135 ? 20.067  -17.056 59.805  1.00 148.50 ? 62   DA  I OP2   1 
ATOM   8759  O  "O5'" . DA  I  5 135 ? 22.304  -15.908 59.946  1.00 148.62 ? 62   DA  I "O5'" 1 
ATOM   8760  C  "C5'" . DA  I  5 135 ? 23.711  -15.834 59.680  1.00 147.90 ? 62   DA  I "C5'" 1 
ATOM   8761  C  "C4'" . DA  I  5 135 ? 24.495  -15.098 60.765  1.00 147.60 ? 62   DA  I "C4'" 1 
ATOM   8762  O  "O4'" . DA  I  5 135 ? 24.012  -13.728 60.872  1.00 147.59 ? 62   DA  I "O4'" 1 
ATOM   8763  C  "C3'" . DA  I  5 135 ? 24.459  -15.654 62.192  1.00 147.16 ? 62   DA  I "C3'" 1 
ATOM   8764  O  "O3'" . DA  I  5 135 ? 25.784  -15.543 62.746  1.00 146.67 ? 62   DA  I "O3'" 1 
ATOM   8765  C  "C2'" . DA  I  5 135 ? 23.439  -14.740 62.878  1.00 147.09 ? 62   DA  I "C2'" 1 
ATOM   8766  C  "C1'" . DA  I  5 135 ? 23.807  -13.407 62.235  1.00 146.97 ? 62   DA  I "C1'" 1 
ATOM   8767  N  N9    . DA  I  5 135 ? 22.798  -12.350 62.303  1.00 146.81 ? 62   DA  I N9    1 
ATOM   8768  C  C8    . DA  I  5 135 ? 21.460  -12.449 62.025  1.00 146.81 ? 62   DA  I C8    1 
ATOM   8769  N  N7    . DA  I  5 135 ? 20.795  -11.325 62.159  1.00 146.66 ? 62   DA  I N7    1 
ATOM   8770  C  C5    . DA  I  5 135 ? 21.767  -10.420 62.548  1.00 146.71 ? 62   DA  I C5    1 
ATOM   8771  C  C6    . DA  I  5 135 ? 21.714  -9.044  62.855  1.00 146.80 ? 62   DA  I C6    1 
ATOM   8772  N  N6    . DA  I  5 135 ? 20.585  -8.328  62.812  1.00 146.84 ? 62   DA  I N6    1 
ATOM   8773  N  N1    . DA  I  5 135 ? 22.867  -8.429  63.211  1.00 146.77 ? 62   DA  I N1    1 
ATOM   8774  C  C2    . DA  I  5 135 ? 23.998  -9.153  63.254  1.00 146.81 ? 62   DA  I C2    1 
ATOM   8775  N  N3    . DA  I  5 135 ? 24.172  -10.451 62.986  1.00 146.77 ? 62   DA  I N3    1 
ATOM   8776  C  C4    . DA  I  5 135 ? 23.008  -11.033 62.638  1.00 146.75 ? 62   DA  I C4    1 
ATOM   8777  P  P     . DT  I  5 136 ? 26.124  -15.691 64.311  1.00 146.55 ? 63   DT  I P     1 
ATOM   8778  O  OP1   . DT  I  5 136 ? 27.592  -15.875 64.436  1.00 146.42 ? 63   DT  I OP1   1 
ATOM   8779  O  OP2   . DT  I  5 136 ? 25.218  -16.722 64.874  1.00 146.68 ? 63   DT  I OP2   1 
ATOM   8780  O  "O5'" . DT  I  5 136 ? 25.720  -14.268 64.940  1.00 145.46 ? 63   DT  I "O5'" 1 
ATOM   8781  C  "C5'" . DT  I  5 136 ? 26.645  -13.170 64.981  1.00 143.67 ? 63   DT  I "C5'" 1 
ATOM   8782  C  "C4'" . DT  I  5 136 ? 26.252  -12.108 66.000  1.00 142.10 ? 63   DT  I "C4'" 1 
ATOM   8783  O  "O4'" . DT  I  5 136 ? 25.022  -11.460 65.580  1.00 141.46 ? 63   DT  I "O4'" 1 
ATOM   8784  C  "C3'" . DT  I  5 136 ? 26.022  -12.567 67.448  1.00 141.27 ? 63   DT  I "C3'" 1 
ATOM   8785  O  "O3'" . DT  I  5 136 ? 26.905  -11.839 68.327  1.00 140.18 ? 63   DT  I "O3'" 1 
ATOM   8786  C  "C2'" . DT  I  5 136 ? 24.540  -12.267 67.693  1.00 140.97 ? 63   DT  I "C2'" 1 
ATOM   8787  C  "C1'" . DT  I  5 136 ? 24.347  -11.078 66.759  1.00 140.89 ? 63   DT  I "C1'" 1 
ATOM   8788  N  N1    . DT  I  5 136 ? 22.924  -10.714 66.456  1.00 140.67 ? 63   DT  I N1    1 
ATOM   8789  C  C2    . DT  I  5 136 ? 22.524  -9.405  66.642  1.00 140.42 ? 63   DT  I C2    1 
ATOM   8790  O  O2    . DT  I  5 136 ? 23.258  -8.521  67.044  1.00 140.42 ? 63   DT  I O2    1 
ATOM   8791  N  N3    . DT  I  5 136 ? 21.208  -9.160  66.341  1.00 140.56 ? 63   DT  I N3    1 
ATOM   8792  C  C4    . DT  I  5 136 ? 20.266  -10.066 65.882  1.00 140.68 ? 63   DT  I C4    1 
ATOM   8793  O  O4    . DT  I  5 136 ? 19.109  -9.727  65.647  1.00 140.69 ? 63   DT  I O4    1 
ATOM   8794  C  C5    . DT  I  5 136 ? 20.745  -11.420 65.704  1.00 140.61 ? 63   DT  I C5    1 
ATOM   8795  C  C7    . DT  I  5 136 ? 19.822  -12.499 65.211  1.00 140.46 ? 63   DT  I C7    1 
ATOM   8796  C  C6    . DT  I  5 136 ? 22.034  -11.674 65.995  1.00 140.73 ? 63   DT  I C6    1 
ATOM   8797  P  P     . DA  I  5 137 ? 26.714  -11.740 69.923  1.00 139.39 ? 64   DA  I P     1 
ATOM   8798  O  OP1   . DA  I  5 137 ? 28.041  -11.486 70.531  1.00 139.49 ? 64   DA  I OP1   1 
ATOM   8799  O  OP2   . DA  I  5 137 ? 25.905  -12.884 70.406  1.00 139.30 ? 64   DA  I OP2   1 
ATOM   8800  O  "O5'" . DA  I  5 137 ? 25.823  -10.419 70.062  1.00 138.49 ? 64   DA  I "O5'" 1 
ATOM   8801  C  "C5'" . DA  I  5 137 ? 26.399  -9.130  69.871  1.00 136.25 ? 64   DA  I "C5'" 1 
ATOM   8802  C  "C4'" . DA  I  5 137 ? 25.481  -8.069  70.449  1.00 134.56 ? 64   DA  I "C4'" 1 
ATOM   8803  O  "O4'" . DA  I  5 137 ? 24.226  -8.091  69.726  1.00 133.76 ? 64   DA  I "O4'" 1 
ATOM   8804  C  "C3'" . DA  I  5 137 ? 25.133  -8.237  71.929  1.00 133.61 ? 64   DA  I "C3'" 1 
ATOM   8805  O  "O3'" . DA  I  5 137 ? 25.541  -7.037  72.610  1.00 132.72 ? 64   DA  I "O3'" 1 
ATOM   8806  C  "C2'" . DA  I  5 137 ? 23.622  -8.511  71.933  1.00 133.23 ? 64   DA  I "C2'" 1 
ATOM   8807  C  "C1'" . DA  I  5 137 ? 23.166  -7.867  70.629  1.00 132.82 ? 64   DA  I "C1'" 1 
ATOM   8808  N  N9    . DA  I  5 137 ? 21.960  -8.438  70.028  1.00 132.57 ? 64   DA  I N9    1 
ATOM   8809  C  C8    . DA  I  5 137 ? 21.749  -9.752  69.717  1.00 132.43 ? 64   DA  I C8    1 
ATOM   8810  N  N7    . DA  I  5 137 ? 20.577  -9.985  69.176  1.00 132.53 ? 64   DA  I N7    1 
ATOM   8811  C  C5    . DA  I  5 137 ? 19.975  -8.741  69.122  1.00 132.30 ? 64   DA  I C5    1 
ATOM   8812  C  C6    . DA  I  5 137 ? 18.717  -8.312  68.648  1.00 132.30 ? 64   DA  I C6    1 
ATOM   8813  N  N6    . DA  I  5 137 ? 17.816  -9.141  68.123  1.00 132.27 ? 64   DA  I N6    1 
ATOM   8814  N  N1    . DA  I  5 137 ? 18.415  -6.999  68.733  1.00 132.35 ? 64   DA  I N1    1 
ATOM   8815  C  C2    . DA  I  5 137 ? 19.327  -6.170  69.256  1.00 132.41 ? 64   DA  I C2    1 
ATOM   8816  N  N3    . DA  I  5 137 ? 20.542  -6.457  69.733  1.00 132.23 ? 64   DA  I N3    1 
ATOM   8817  C  C4    . DA  I  5 137 ? 20.815  -7.771  69.635  1.00 132.29 ? 64   DA  I C4    1 
ATOM   8818  P  P     . DT  I  5 138 ? 25.040  -6.605  74.074  1.00 132.13 ? 65   DT  I P     1 
ATOM   8819  O  OP1   . DT  I  5 138 ? 26.005  -5.625  74.622  1.00 132.16 ? 65   DT  I OP1   1 
ATOM   8820  O  OP2   . DT  I  5 138 ? 24.706  -7.814  74.867  1.00 132.15 ? 65   DT  I OP2   1 
ATOM   8821  O  "O5'" . DT  I  5 138 ? 23.680  -5.842  73.733  1.00 130.62 ? 65   DT  I "O5'" 1 
ATOM   8822  C  "C5'" . DT  I  5 138 ? 23.679  -4.659  72.942  1.00 128.05 ? 65   DT  I "C5'" 1 
ATOM   8823  C  "C4'" . DT  I  5 138 ? 22.335  -3.965  73.077  1.00 126.19 ? 65   DT  I "C4'" 1 
ATOM   8824  O  "O4'" . DT  I  5 138 ? 21.307  -4.716  72.382  1.00 125.83 ? 65   DT  I "O4'" 1 
ATOM   8825  C  "C3'" . DT  I  5 138 ? 21.828  -3.795  74.505  1.00 124.82 ? 65   DT  I "C3'" 1 
ATOM   8826  O  "O3'" . DT  I  5 138 ? 21.247  -2.518  74.578  1.00 123.17 ? 65   DT  I "O3'" 1 
ATOM   8827  C  "C2'" . DT  I  5 138 ? 20.773  -4.889  74.642  1.00 125.00 ? 65   DT  I "C2'" 1 
ATOM   8828  C  "C1'" . DT  I  5 138 ? 20.191  -4.862  73.237  1.00 125.36 ? 65   DT  I "C1'" 1 
ATOM   8829  N  N1    . DT  I  5 138 ? 19.428  -6.079  72.842  1.00 125.32 ? 65   DT  I N1    1 
ATOM   8830  C  C2    . DT  I  5 138 ? 18.131  -5.932  72.393  1.00 125.19 ? 65   DT  I C2    1 
ATOM   8831  O  O2    . DT  I  5 138 ? 17.566  -4.860  72.302  1.00 125.20 ? 65   DT  I O2    1 
ATOM   8832  N  N3    . DT  I  5 138 ? 17.509  -7.105  72.046  1.00 125.53 ? 65   DT  I N3    1 
ATOM   8833  C  C4    . DT  I  5 138 ? 18.041  -8.382  72.101  1.00 125.36 ? 65   DT  I C4    1 
ATOM   8834  O  O4    . DT  I  5 138 ? 17.383  -9.360  71.763  1.00 125.31 ? 65   DT  I O4    1 
ATOM   8835  C  C5    . DT  I  5 138 ? 19.406  -8.467  72.580  1.00 125.22 ? 65   DT  I C5    1 
ATOM   8836  C  C7    . DT  I  5 138 ? 20.110  -9.786  72.693  1.00 125.26 ? 65   DT  I C7    1 
ATOM   8837  C  C6    . DT  I  5 138 ? 20.025  -7.327  72.923  1.00 125.31 ? 65   DT  I C6    1 
ATOM   8838  P  P     . DT  I  5 139 ? 20.913  -1.811  75.971  1.00 122.13 ? 66   DT  I P     1 
ATOM   8839  O  OP1   . DT  I  5 139 ? 22.037  -0.867  76.224  1.00 122.18 ? 66   DT  I OP1   1 
ATOM   8840  O  OP2   . DT  I  5 139 ? 20.529  -2.821  76.995  1.00 122.22 ? 66   DT  I OP2   1 
ATOM   8841  O  "O5'" . DT  I  5 139 ? 19.577  -0.990  75.619  1.00 121.69 ? 66   DT  I "O5'" 1 
ATOM   8842  C  "C5'" . DT  I  5 139 ? 19.132  -0.881  74.256  1.00 120.20 ? 66   DT  I "C5'" 1 
ATOM   8843  C  "C4'" . DT  I  5 139 ? 17.617  -0.944  74.150  1.00 119.03 ? 66   DT  I "C4'" 1 
ATOM   8844  O  "O4'" . DT  I  5 139 ? 17.186  -2.304  73.880  1.00 118.53 ? 66   DT  I "O4'" 1 
ATOM   8845  C  "C3'" . DT  I  5 139 ? 16.859  -0.486  75.392  1.00 118.34 ? 66   DT  I "C3'" 1 
ATOM   8846  O  "O3'" . DT  I  5 139 ? 15.902  0.481   74.953  1.00 117.94 ? 66   DT  I "O3'" 1 
ATOM   8847  C  "C2'" . DT  I  5 139 ? 16.283  -1.783  75.969  1.00 118.11 ? 66   DT  I "C2'" 1 
ATOM   8848  C  "C1'" . DT  I  5 139 ? 16.094  -2.634  74.716  1.00 117.97 ? 66   DT  I "C1'" 1 
ATOM   8849  N  N1    . DT  I  5 139 ? 16.087  -4.129  74.920  1.00 117.86 ? 66   DT  I N1    1 
ATOM   8850  C  C2    . DT  I  5 139 ? 15.155  -4.920  74.257  1.00 117.30 ? 66   DT  I C2    1 
ATOM   8851  O  O2    . DT  I  5 139 ? 14.300  -4.496  73.502  1.00 117.05 ? 66   DT  I O2    1 
ATOM   8852  N  N3    . DT  I  5 139 ? 15.263  -6.264  74.518  1.00 117.48 ? 66   DT  I N3    1 
ATOM   8853  C  C4    . DT  I  5 139 ? 16.185  -6.887  75.350  1.00 117.74 ? 66   DT  I C4    1 
ATOM   8854  O  O4    . DT  I  5 139 ? 16.197  -8.102  75.510  1.00 117.75 ? 66   DT  I O4    1 
ATOM   8855  C  C5    . DT  I  5 139 ? 17.130  -6.012  76.010  1.00 117.58 ? 66   DT  I C5    1 
ATOM   8856  C  C7    . DT  I  5 139 ? 18.178  -6.564  76.933  1.00 117.39 ? 66   DT  I C7    1 
ATOM   8857  C  C6    . DT  I  5 139 ? 17.036  -4.696  75.763  1.00 117.87 ? 66   DT  I C6    1 
ATOM   8858  P  P     . DT  I  5 140 ? 14.500  0.766   75.669  1.00 118.00 ? 67   DT  I P     1 
ATOM   8859  O  OP1   . DT  I  5 140 ? 13.949  2.013   75.085  1.00 118.26 ? 67   DT  I OP1   1 
ATOM   8860  O  OP2   . DT  I  5 140 ? 14.660  0.632   77.137  1.00 117.94 ? 67   DT  I OP2   1 
ATOM   8861  O  "O5'" . DT  I  5 140 ? 13.620  -0.466  75.164  1.00 117.75 ? 67   DT  I "O5'" 1 
ATOM   8862  C  "C5'" . DT  I  5 140 ? 13.035  -0.520  73.863  1.00 116.19 ? 67   DT  I "C5'" 1 
ATOM   8863  C  "C4'" . DT  I  5 140 ? 11.741  -1.310  73.968  1.00 115.22 ? 67   DT  I "C4'" 1 
ATOM   8864  O  "O4'" . DT  I  5 140 ? 12.042  -2.699  74.279  1.00 115.09 ? 67   DT  I "O4'" 1 
ATOM   8865  C  "C3'" . DT  I  5 140 ? 10.801  -0.834  75.073  1.00 114.27 ? 67   DT  I "C3'" 1 
ATOM   8866  O  "O3'" . DT  I  5 140 ? 9.485   -0.893  74.574  1.00 113.34 ? 67   DT  I "O3'" 1 
ATOM   8867  C  "C2'" . DT  I  5 140 ? 11.012  -1.837  76.207  1.00 114.36 ? 67   DT  I "C2'" 1 
ATOM   8868  C  "C1'" . DT  I  5 140 ? 11.303  -3.112  75.419  1.00 114.65 ? 67   DT  I "C1'" 1 
ATOM   8869  N  N1    . DT  I  5 140 ? 12.050  -4.218  76.149  1.00 114.60 ? 67   DT  I N1    1 
ATOM   8870  C  C2    . DT  I  5 140 ? 11.766  -5.538  75.839  1.00 114.45 ? 67   DT  I C2    1 
ATOM   8871  O  O2    . DT  I  5 140 ? 10.940  -5.890  75.015  1.00 114.39 ? 67   DT  I O2    1 
ATOM   8872  N  N3    . DT  I  5 140 ? 12.492  -6.461  76.543  1.00 114.48 ? 67   DT  I N3    1 
ATOM   8873  C  C4    . DT  I  5 140 ? 13.452  -6.224  77.508  1.00 114.44 ? 67   DT  I C4    1 
ATOM   8874  O  O4    . DT  I  5 140 ? 14.036  -7.145  78.068  1.00 114.35 ? 67   DT  I O4    1 
ATOM   8875  C  C5    . DT  I  5 140 ? 13.709  -4.830  77.789  1.00 114.49 ? 67   DT  I C5    1 
ATOM   8876  C  C7    . DT  I  5 140 ? 14.735  -4.428  78.810  1.00 114.56 ? 67   DT  I C7    1 
ATOM   8877  C  C6    . DT  I  5 140 ? 13.007  -3.912  77.106  1.00 114.61 ? 67   DT  I C6    1 
ATOM   8878  P  P     . DG  I  5 141 ? 8.333   0.036   75.178  1.00 113.08 ? 68   DG  I P     1 
ATOM   8879  O  OP1   . DG  I  5 141 ? 8.383   1.295   74.401  1.00 113.53 ? 68   DG  I OP1   1 
ATOM   8880  O  OP2   . DG  I  5 141 ? 8.416   0.069   76.657  1.00 112.93 ? 68   DG  I OP2   1 
ATOM   8881  O  "O5'" . DG  I  5 141 ? 6.979   -0.748  74.812  1.00 112.98 ? 68   DG  I "O5'" 1 
ATOM   8882  C  "C5'" . DG  I  5 141 ? 6.983   -2.013  74.101  1.00 111.99 ? 68   DG  I "C5'" 1 
ATOM   8883  C  "C4'" . DG  I  5 141 ? 5.924   -2.993  74.630  1.00 110.48 ? 68   DG  I "C4'" 1 
ATOM   8884  O  "O4'" . DG  I  5 141 ? 6.559   -3.977  75.504  1.00 110.22 ? 68   DG  I "O4'" 1 
ATOM   8885  C  "C3'" . DG  I  5 141 ? 4.760   -2.427  75.441  1.00 109.52 ? 68   DG  I "C3'" 1 
ATOM   8886  O  "O3'" . DG  I  5 141 ? 3.592   -3.172  75.054  1.00 108.55 ? 68   DG  I "O3'" 1 
ATOM   8887  C  "C2'" . DG  I  5 141 ? 5.219   -2.602  76.892  1.00 109.48 ? 68   DG  I "C2'" 1 
ATOM   8888  C  "C1'" . DG  I  5 141 ? 6.032   -3.895  76.820  1.00 110.30 ? 68   DG  I "C1'" 1 
ATOM   8889  N  N9    . DG  I  5 141 ? 7.172   -4.051  77.740  1.00 110.43 ? 68   DG  I N9    1 
ATOM   8890  C  C8    . DG  I  5 141 ? 7.745   -3.158  78.625  1.00 110.44 ? 68   DG  I C8    1 
ATOM   8891  N  N7    . DG  I  5 141 ? 8.767   -3.645  79.282  1.00 110.34 ? 68   DG  I N7    1 
ATOM   8892  C  C5    . DG  I  5 141 ? 8.882   -4.948  78.805  1.00 110.39 ? 68   DG  I C5    1 
ATOM   8893  C  C6    . DG  I  5 141 ? 9.796   -5.990  79.128  1.00 110.37 ? 68   DG  I C6    1 
ATOM   8894  O  O6    . DG  I  5 141 ? 10.734  -5.986  79.936  1.00 110.39 ? 68   DG  I O6    1 
ATOM   8895  N  N1    . DG  I  5 141 ? 9.543   -7.152  78.399  1.00 110.57 ? 68   DG  I N1    1 
ATOM   8896  C  C2    . DG  I  5 141 ? 8.535   -7.295  77.469  1.00 110.37 ? 68   DG  I C2    1 
ATOM   8897  N  N2    . DG  I  5 141 ? 8.433   -8.480  76.858  1.00 110.25 ? 68   DG  I N2    1 
ATOM   8898  N  N3    . DG  I  5 141 ? 7.678   -6.338  77.158  1.00 110.30 ? 68   DG  I N3    1 
ATOM   8899  C  C4    . DG  I  5 141 ? 7.909   -5.202  77.859  1.00 110.38 ? 68   DG  I C4    1 
ATOM   8900  P  P     . DG  I  5 142 ? 2.261   -3.336  75.943  1.00 108.25 ? 69   DG  I P     1 
ATOM   8901  O  OP1   . DG  I  5 142 ? 1.145   -3.620  75.011  1.00 107.49 ? 69   DG  I OP1   1 
ATOM   8902  O  OP2   . DG  I  5 142 ? 2.154   -2.217  76.907  1.00 108.26 ? 69   DG  I OP2   1 
ATOM   8903  O  "O5'" . DG  I  5 142 ? 2.593   -4.630  76.814  1.00 106.02 ? 69   DG  I "O5'" 1 
ATOM   8904  C  "C5'" . DG  I  5 142 ? 2.213   -5.931  76.409  1.00 102.99 ? 69   DG  I "C5'" 1 
ATOM   8905  C  "C4'" . DG  I  5 142 ? 2.418   -6.856  77.590  1.00 101.23 ? 69   DG  I "C4'" 1 
ATOM   8906  O  "O4'" . DG  I  5 142 ? 3.728   -6.616  78.167  1.00 101.61 ? 69   DG  I "O4'" 1 
ATOM   8907  C  "C3'" . DG  I  5 142 ? 1.420   -6.661  78.734  1.00 99.59  ? 69   DG  I "C3'" 1 
ATOM   8908  O  "O3'" . DG  I  5 142 ? 0.946   -7.924  79.190  1.00 95.85  ? 69   DG  I "O3'" 1 
ATOM   8909  C  "C2'" . DG  I  5 142 ? 2.237   -5.962  79.819  1.00 100.50 ? 69   DG  I "C2'" 1 
ATOM   8910  C  "C1'" . DG  I  5 142 ? 3.556   -6.670  79.569  1.00 102.63 ? 69   DG  I "C1'" 1 
ATOM   8911  N  N9    . DG  I  5 142 ? 4.729   -6.134  80.243  1.00 103.24 ? 69   DG  I N9    1 
ATOM   8912  C  C8    . DG  I  5 142 ? 4.997   -4.841  80.642  1.00 103.57 ? 69   DG  I C8    1 
ATOM   8913  N  N7    . DG  I  5 142 ? 6.157   -4.714  81.227  1.00 103.68 ? 69   DG  I N7    1 
ATOM   8914  C  C5    . DG  I  5 142 ? 6.678   -6.006  81.211  1.00 103.58 ? 69   DG  I C5    1 
ATOM   8915  C  C6    . DG  I  5 142 ? 7.904   -6.513  81.699  1.00 103.48 ? 69   DG  I C6    1 
ATOM   8916  O  O6    . DG  I  5 142 ? 8.805   -5.883  82.258  1.00 103.52 ? 69   DG  I O6    1 
ATOM   8917  N  N1    . DG  I  5 142 ? 8.045   -7.889  81.482  1.00 103.57 ? 69   DG  I N1    1 
ATOM   8918  C  C2    . DG  I  5 142 ? 7.107   -8.684  80.864  1.00 103.48 ? 69   DG  I C2    1 
ATOM   8919  N  N2    . DG  I  5 142 ? 7.398   -9.986  80.731  1.00 103.45 ? 69   DG  I N2    1 
ATOM   8920  N  N3    . DG  I  5 142 ? 5.952   -8.220  80.408  1.00 103.68 ? 69   DG  I N3    1 
ATOM   8921  C  C4    . DG  I  5 142 ? 5.811   -6.886  80.612  1.00 103.40 ? 69   DG  I C4    1 
ATOM   8922  P  P     . DA  I  5 143 ? -0.458  -8.516  78.706  1.00 92.67  ? 70   DA  I P     1 
ATOM   8923  O  OP1   . DA  I  5 143 ? -0.618  -8.238  77.263  1.00 92.52  ? 70   DA  I OP1   1 
ATOM   8924  O  OP2   . DA  I  5 143 ? -1.471  -8.060  79.680  1.00 91.40  ? 70   DA  I OP2   1 
ATOM   8925  O  "O5'" . DA  I  5 143 ? -0.257  -10.100 78.864  1.00 90.72  ? 70   DA  I "O5'" 1 
ATOM   8926  C  "C5'" . DA  I  5 143 ? 0.842   -10.768 78.230  1.00 87.66  ? 70   DA  I "C5'" 1 
ATOM   8927  C  "C4'" . DA  I  5 143 ? 1.414   -11.876 79.102  1.00 86.02  ? 70   DA  I "C4'" 1 
ATOM   8928  O  "O4'" . DA  I  5 143 ? 2.543   -11.373 79.859  1.00 85.73  ? 70   DA  I "O4'" 1 
ATOM   8929  C  "C3'" . DA  I  5 143 ? 0.450   -12.488 80.123  1.00 84.96  ? 70   DA  I "C3'" 1 
ATOM   8930  O  "O3'" . DA  I  5 143 ? 0.639   -13.914 80.163  1.00 81.81  ? 70   DA  I "O3'" 1 
ATOM   8931  C  "C2'" . DA  I  5 143 ? 0.814   -11.781 81.432  1.00 85.10  ? 70   DA  I "C2'" 1 
ATOM   8932  C  "C1'" . DA  I  5 143 ? 2.301   -11.494 81.248  1.00 86.89  ? 70   DA  I "C1'" 1 
ATOM   8933  N  N9    . DA  I  5 143 ? 2.741   -10.254 81.885  1.00 87.86  ? 70   DA  I N9    1 
ATOM   8934  C  C8    . DA  I  5 143 ? 2.084   -9.050  81.890  1.00 87.91  ? 70   DA  I C8    1 
ATOM   8935  N  N7    . DA  I  5 143 ? 2.708   -8.102  82.537  1.00 88.00  ? 70   DA  I N7    1 
ATOM   8936  C  C5    . DA  I  5 143 ? 3.855   -8.727  82.986  1.00 88.23  ? 70   DA  I C5    1 
ATOM   8937  C  C6    . DA  I  5 143 ? 4.943   -8.262  83.740  1.00 87.90  ? 70   DA  I C6    1 
ATOM   8938  N  N6    . DA  I  5 143 ? 5.020   -7.006  84.177  1.00 87.93  ? 70   DA  I N6    1 
ATOM   8939  N  N1    . DA  I  5 143 ? 5.935   -9.133  84.030  1.00 87.85  ? 70   DA  I N1    1 
ATOM   8940  C  C2    . DA  I  5 143 ? 5.845   -10.392 83.592  1.00 87.64  ? 70   DA  I C2    1 
ATOM   8941  N  N3    . DA  I  5 143 ? 4.868   -10.941 82.871  1.00 88.48  ? 70   DA  I N3    1 
ATOM   8942  C  C4    . DA  I  5 143 ? 3.896   -10.051 82.601  1.00 88.08  ? 70   DA  I C4    1 
ATOM   8943  P  P     . DG  I  5 144 ? -0.129  -14.877 81.180  1.00 79.77  ? 71   DG  I P     1 
ATOM   8944  O  OP1   . DG  I  5 144 ? -0.050  -16.218 80.582  1.00 81.03  ? 71   DG  I OP1   1 
ATOM   8945  O  OP2   . DG  I  5 144 ? -1.423  -14.330 81.610  1.00 79.94  ? 71   DG  I OP2   1 
ATOM   8946  O  "O5'" . DG  I  5 144 ? 0.778   -14.849 82.472  1.00 83.32  ? 71   DG  I "O5'" 1 
ATOM   8947  C  "C5'" . DG  I  5 144 ? 2.172   -15.094 82.340  1.00 87.39  ? 71   DG  I "C5'" 1 
ATOM   8948  C  "C4'" . DG  I  5 144 ? 2.869   -14.956 83.679  1.00 89.82  ? 71   DG  I "C4'" 1 
ATOM   8949  O  "O4'" . DG  I  5 144 ? 3.041   -13.551 83.995  1.00 90.09  ? 71   DG  I "O4'" 1 
ATOM   8950  C  "C3'" . DG  I  5 144 ? 2.111   -15.580 84.854  1.00 91.46  ? 71   DG  I "C3'" 1 
ATOM   8951  O  "O3'" . DG  I  5 144 ? 3.089   -16.319 85.612  1.00 93.67  ? 71   DG  I "O3'" 1 
ATOM   8952  C  "C2'" . DG  I  5 144 ? 1.496   -14.361 85.557  1.00 90.50  ? 71   DG  I "C2'" 1 
ATOM   8953  C  "C1'" . DG  I  5 144 ? 2.634   -13.368 85.337  1.00 90.42  ? 71   DG  I "C1'" 1 
ATOM   8954  N  N9    . DG  I  5 144 ? 2.344   -11.954 85.559  1.00 90.52  ? 71   DG  I N9    1 
ATOM   8955  C  C8    . DG  I  5 144 ? 1.193   -11.246 85.292  1.00 90.30  ? 71   DG  I C8    1 
ATOM   8956  N  N7    . DG  I  5 144 ? 1.269   -9.987  85.618  1.00 90.38  ? 71   DG  I N7    1 
ATOM   8957  C  C5    . DG  I  5 144 ? 2.554   -9.854  86.135  1.00 90.62  ? 71   DG  I C5    1 
ATOM   8958  C  C6    . DG  I  5 144 ? 3.228   -8.720  86.653  1.00 90.50  ? 71   DG  I C6    1 
ATOM   8959  O  O6    . DG  I  5 144 ? 2.803   -7.566  86.756  1.00 90.36  ? 71   DG  I O6    1 
ATOM   8960  N  N1    . DG  I  5 144 ? 4.526   -9.017  87.073  1.00 90.14  ? 71   DG  I N1    1 
ATOM   8961  C  C2    . DG  I  5 144 ? 5.107   -10.258 87.005  1.00 90.31  ? 71   DG  I C2    1 
ATOM   8962  N  N2    . DG  I  5 144 ? 6.360   -10.347 87.458  1.00 90.25  ? 71   DG  I N2    1 
ATOM   8963  N  N3    . DG  I  5 144 ? 4.496   -11.335 86.520  1.00 90.53  ? 71   DG  I N3    1 
ATOM   8964  C  C4    . DG  I  5 144 ? 3.229   -11.056 86.103  1.00 90.71  ? 71   DG  I C4    1 
ATOM   8965  P  P     . DA  I  5 145 ? 2.804   -17.047 87.013  1.00 95.31  ? 72   DA  I P     1 
ATOM   8966  O  OP1   . DA  I  5 145 ? 3.417   -18.395 86.932  1.00 95.57  ? 72   DA  I OP1   1 
ATOM   8967  O  OP2   . DA  I  5 145 ? 1.372   -16.882 87.395  1.00 94.83  ? 72   DA  I OP2   1 
ATOM   8968  O  "O5'" . DA  I  5 145 ? 3.706   -16.177 88.000  1.00 95.42  ? 72   DA  I "O5'" 1 
ATOM   8969  C  "C5'" . DA  I  5 145 ? 5.130   -16.160 87.855  1.00 96.54  ? 72   DA  I "C5'" 1 
ATOM   8970  C  "C4'" . DA  I  5 145 ? 5.705   -15.320 88.978  1.00 97.49  ? 72   DA  I "C4'" 1 
ATOM   8971  O  "O4'" . DA  I  5 145 ? 5.231   -13.953 88.840  1.00 97.16  ? 72   DA  I "O4'" 1 
ATOM   8972  C  "C3'" . DA  I  5 145 ? 5.270   -15.794 90.363  1.00 98.67  ? 72   DA  I "C3'" 1 
ATOM   8973  O  "O3'" . DA  I  5 145 ? 6.392   -15.849 91.246  1.00 101.20 ? 72   DA  I "O3'" 1 
ATOM   8974  C  "C2'" . DA  I  5 145 ? 4.219   -14.778 90.813  1.00 97.02  ? 72   DA  I "C2'" 1 
ATOM   8975  C  "C1'" . DA  I  5 145 ? 4.602   -13.525 90.033  1.00 95.52  ? 72   DA  I "C1'" 1 
ATOM   8976  N  N9    . DA  I  5 145 ? 3.449   -12.672 89.732  1.00 94.91  ? 72   DA  I N9    1 
ATOM   8977  C  C8    . DA  I  5 145 ? 2.229   -13.077 89.267  1.00 94.23  ? 72   DA  I C8    1 
ATOM   8978  N  N7    . DA  I  5 145 ? 1.375   -12.097 89.108  1.00 94.40  ? 72   DA  I N7    1 
ATOM   8979  C  C5    . DA  I  5 145 ? 2.080   -10.971 89.498  1.00 94.63  ? 72   DA  I C5    1 
ATOM   8980  C  C6    . DA  I  5 145 ? 1.737   -9.606  89.559  1.00 94.61  ? 72   DA  I C6    1 
ATOM   8981  N  N6    . DA  I  5 145 ? 0.536   -9.153  89.197  1.00 94.47  ? 72   DA  I N6    1 
ATOM   8982  N  N1    . DA  I  5 145 ? 2.669   -8.728  89.996  1.00 94.41  ? 72   DA  I N1    1 
ATOM   8983  C  C2    . DA  I  5 145 ? 3.872   -9.190  90.349  1.00 94.33  ? 72   DA  I C2    1 
ATOM   8984  N  N3    . DA  I  5 145 ? 4.312   -10.447 90.333  1.00 94.54  ? 72   DA  I N3    1 
ATOM   8985  C  C4    . DA  I  5 145 ? 3.363   -11.301 89.891  1.00 94.90  ? 72   DA  I C4    1 
ATOM   8986  P  P     . DT  I  5 146 ? 6.312   -16.582 92.676  1.00 102.52 ? 73   DT  I P     1 
ATOM   8987  O  OP1   . DT  I  5 146 ? 7.516   -17.451 92.754  1.00 102.37 ? 73   DT  I OP1   1 
ATOM   8988  O  OP2   . DT  I  5 146 ? 4.944   -17.117 92.919  1.00 100.98 ? 73   DT  I OP2   1 
ATOM   8989  O  "O5'" . DT  I  5 146 ? 6.509   -15.350 93.672  1.00 103.19 ? 73   DT  I "O5'" 1 
ATOM   8990  C  "C5'" . DT  I  5 146 ? 7.605   -14.450 93.505  1.00 104.82 ? 73   DT  I "C5'" 1 
ATOM   8991  C  "C4'" . DT  I  5 146 ? 7.370   -13.209 94.351  1.00 105.89 ? 73   DT  I "C4'" 1 
ATOM   8992  O  "O4'" . DT  I  5 146 ? 6.321   -12.405 93.741  1.00 106.19 ? 73   DT  I "O4'" 1 
ATOM   8993  C  "C3'" . DT  I  5 146 ? 6.920   -13.516 95.783  1.00 106.27 ? 73   DT  I "C3'" 1 
ATOM   8994  O  "O3'" . DT  I  5 146 ? 7.802   -12.870 96.710  1.00 106.16 ? 73   DT  I "O3'" 1 
ATOM   8995  C  "C2'" . DT  I  5 146 ? 5.466   -13.024 95.850  1.00 106.10 ? 73   DT  I "C2'" 1 
ATOM   8996  C  "C1'" . DT  I  5 146 ? 5.461   -11.945 94.763  1.00 106.58 ? 73   DT  I "C1'" 1 
ATOM   8997  N  N1    . DT  I  5 146 ? 4.121   -11.582 94.179  1.00 106.54 ? 73   DT  I N1    1 
ATOM   8998  C  C2    . DT  I  5 146 ? 3.762   -10.246 94.134  1.00 106.58 ? 73   DT  I C2    1 
ATOM   8999  O  O2    . DT  I  5 146 ? 4.471   -9.342  94.546  1.00 106.97 ? 73   DT  I O2    1 
ATOM   9000  N  N3    . DT  I  5 146 ? 2.528   -9.995  93.590  1.00 106.38 ? 73   DT  I N3    1 
ATOM   9001  C  C4    . DT  I  5 146 ? 1.637   -10.926 93.091  1.00 106.37 ? 73   DT  I C4    1 
ATOM   9002  O  O4    . DT  I  5 146 ? 0.553   -10.605 92.628  1.00 106.53 ? 73   DT  I O4    1 
ATOM   9003  C  C5    . DT  I  5 146 ? 2.065   -12.302 93.160  1.00 106.63 ? 73   DT  I C5    1 
ATOM   9004  C  C7    . DT  I  5 146 ? 1.167   -13.390 92.641  1.00 106.56 ? 73   DT  I C7    1 
ATOM   9005  C  C6    . DT  I  5 146 ? 3.273   -12.563 93.693  1.00 106.55 ? 73   DT  I C6    1 
ATOM   9006  O  "O5'" . DA  J  5 1   ? -2.454  0.576   92.584  1.00 138.48 ? -73  DA  J "O5'" 1 
ATOM   9007  C  "C5'" . DA  J  5 1   ? -2.440  0.550   94.017  1.00 138.34 ? -73  DA  J "C5'" 1 
ATOM   9008  C  "C4'" . DA  J  5 1   ? -1.234  -0.209  94.551  1.00 138.16 ? -73  DA  J "C4'" 1 
ATOM   9009  O  "O4'" . DA  J  5 1   ? -1.602  -1.591  94.809  1.00 137.94 ? -73  DA  J "O4'" 1 
ATOM   9010  C  "C3'" . DA  J  5 1   ? -0.022  -0.241  93.623  1.00 138.19 ? -73  DA  J "C3'" 1 
ATOM   9011  O  "O3'" . DA  J  5 1   ? 1.155   0.168   94.318  1.00 138.48 ? -73  DA  J "O3'" 1 
ATOM   9012  C  "C2'" . DA  J  5 1   ? 0.051   -1.694  93.151  1.00 137.89 ? -73  DA  J "C2'" 1 
ATOM   9013  C  "C1'" . DA  J  5 1   ? -0.605  -2.451  94.301  1.00 137.48 ? -73  DA  J "C1'" 1 
ATOM   9014  N  N9    . DA  J  5 1   ? -1.182  -3.729  93.868  1.00 137.35 ? -73  DA  J N9    1 
ATOM   9015  C  C8    . DA  J  5 1   ? -2.478  -4.040  93.519  1.00 137.07 ? -73  DA  J C8    1 
ATOM   9016  N  N7    . DA  J  5 1   ? -2.664  -5.293  93.167  1.00 136.41 ? -73  DA  J N7    1 
ATOM   9017  C  C5    . DA  J  5 1   ? -1.391  -5.833  93.295  1.00 137.09 ? -73  DA  J C5    1 
ATOM   9018  C  C6    . DA  J  5 1   ? -0.874  -7.129  93.078  1.00 137.34 ? -73  DA  J C6    1 
ATOM   9019  N  N6    . DA  J  5 1   ? -1.640  -8.145  92.667  1.00 137.37 ? -73  DA  J N6    1 
ATOM   9020  N  N1    . DA  J  5 1   ? 0.451   -7.345  93.298  1.00 137.31 ? -73  DA  J N1    1 
ATOM   9021  C  C2    . DA  J  5 1   ? 1.223   -6.325  93.709  1.00 137.18 ? -73  DA  J C2    1 
ATOM   9022  N  N3    . DA  J  5 1   ? 0.854   -5.063  93.951  1.00 137.39 ? -73  DA  J N3    1 
ATOM   9023  C  C4    . DA  J  5 1   ? -0.469  -4.890  93.722  1.00 137.28 ? -73  DA  J C4    1 
ATOM   9024  P  P     . DT  J  5 2   ? 2.538   0.392   93.526  1.00 139.13 ? -72  DT  J P     1 
ATOM   9025  O  OP1   . DT  J  5 2   ? 3.347   1.369   94.294  1.00 139.37 ? -72  DT  J OP1   1 
ATOM   9026  O  OP2   . DT  J  5 2   ? 2.236   0.680   92.101  1.00 139.37 ? -72  DT  J OP2   1 
ATOM   9027  O  "O5'" . DT  J  5 2   ? 3.209   -1.069  93.592  1.00 138.20 ? -72  DT  J "O5'" 1 
ATOM   9028  C  "C5'" . DT  J  5 2   ? 4.132   -1.399  94.619  1.00 136.73 ? -72  DT  J "C5'" 1 
ATOM   9029  C  "C4'" . DT  J  5 2   ? 5.352   -2.125  94.069  1.00 135.54 ? -72  DT  J "C4'" 1 
ATOM   9030  O  "O4'" . DT  J  5 2   ? 4.953   -3.422  93.556  1.00 135.68 ? -72  DT  J "O4'" 1 
ATOM   9031  C  "C3'" . DT  J  5 2   ? 6.124   -1.415  92.957  1.00 134.30 ? -72  DT  J "C3'" 1 
ATOM   9032  O  "O3'" . DT  J  5 2   ? 7.525   -1.484  93.268  1.00 132.44 ? -72  DT  J "O3'" 1 
ATOM   9033  C  "C2'" . DT  J  5 2   ? 5.718   -2.163  91.686  1.00 134.78 ? -72  DT  J "C2'" 1 
ATOM   9034  C  "C1'" . DT  J  5 2   ? 5.279   -3.538  92.186  1.00 135.30 ? -72  DT  J "C1'" 1 
ATOM   9035  N  N1    . DT  J  5 2   ? 4.082   -4.103  91.473  1.00 135.30 ? -72  DT  J N1    1 
ATOM   9036  C  C2    . DT  J  5 2   ? 3.922   -5.475  91.395  1.00 135.27 ? -72  DT  J C2    1 
ATOM   9037  O  O2    . DT  J  5 2   ? 4.702   -6.280  91.870  1.00 135.37 ? -72  DT  J O2    1 
ATOM   9038  N  N3    . DT  J  5 2   ? 2.799   -5.885  90.722  1.00 135.20 ? -72  DT  J N3    1 
ATOM   9039  C  C4    . DT  J  5 2   ? 1.840   -5.078  90.136  1.00 135.23 ? -72  DT  J C4    1 
ATOM   9040  O  O4    . DT  J  5 2   ? 0.870   -5.556  89.560  1.00 135.26 ? -72  DT  J O4    1 
ATOM   9041  C  C5    . DT  J  5 2   ? 2.061   -3.653  90.251  1.00 135.23 ? -72  DT  J C5    1 
ATOM   9042  C  C7    . DT  J  5 2   ? 1.097   -2.668  89.656  1.00 135.20 ? -72  DT  J C7    1 
ATOM   9043  C  C6    . DT  J  5 2   ? 3.155   -3.243  90.906  1.00 135.22 ? -72  DT  J C6    1 
ATOM   9044  P  P     . DC  J  5 3   ? 8.720   -1.453  92.193  1.00 130.57 ? -71  DC  J P     1 
ATOM   9045  O  OP1   . DC  J  5 3   ? 9.928   -0.914  92.860  1.00 130.41 ? -71  DC  J OP1   1 
ATOM   9046  O  OP2   . DC  J  5 3   ? 8.243   -0.810  90.947  1.00 129.65 ? -71  DC  J OP2   1 
ATOM   9047  O  "O5'" . DC  J  5 3   ? 8.960   -3.014  91.944  1.00 128.84 ? -71  DC  J "O5'" 1 
ATOM   9048  C  "C5'" . DC  J  5 3   ? 9.052   -3.904  93.058  1.00 126.65 ? -71  DC  J "C5'" 1 
ATOM   9049  C  "C4'" . DC  J  5 3   ? 9.552   -5.282  92.648  1.00 125.03 ? -71  DC  J "C4'" 1 
ATOM   9050  O  "O4'" . DC  J  5 3   ? 8.482   -6.020  91.998  1.00 125.25 ? -71  DC  J "O4'" 1 
ATOM   9051  C  "C3'" . DC  J  5 3   ? 10.739  -5.304  91.691  1.00 123.46 ? -71  DC  J "C3'" 1 
ATOM   9052  O  "O3'" . DC  J  5 3   ? 11.650  -6.327  92.088  1.00 121.20 ? -71  DC  J "O3'" 1 
ATOM   9053  C  "C2'" . DC  J  5 3   ? 10.086  -5.555  90.333  1.00 124.02 ? -71  DC  J "C2'" 1 
ATOM   9054  C  "C1'" . DC  J  5 3   ? 8.845   -6.374  90.675  1.00 124.63 ? -71  DC  J "C1'" 1 
ATOM   9055  N  N1    . DC  J  5 3   ? 7.672   -6.147  89.741  1.00 124.62 ? -71  DC  J N1    1 
ATOM   9056  C  C2    . DC  J  5 3   ? 7.001   -7.236  89.154  1.00 124.59 ? -71  DC  J C2    1 
ATOM   9057  O  O2    . DC  J  5 3   ? 7.360   -8.396  89.395  1.00 124.60 ? -71  DC  J O2    1 
ATOM   9058  N  N3    . DC  J  5 3   ? 5.956   -6.985  88.323  1.00 124.75 ? -71  DC  J N3    1 
ATOM   9059  C  C4    . DC  J  5 3   ? 5.573   -5.732  88.067  1.00 124.36 ? -71  DC  J C4    1 
ATOM   9060  N  N4    . DC  J  5 3   ? 4.542   -5.549  87.244  1.00 124.24 ? -71  DC  J N4    1 
ATOM   9061  C  C5    . DC  J  5 3   ? 6.234   -4.611  88.647  1.00 124.41 ? -71  DC  J C5    1 
ATOM   9062  C  C6    . DC  J  5 3   ? 7.263   -4.867  89.464  1.00 124.59 ? -71  DC  J C6    1 
ATOM   9063  P  P     . DT  J  5 4   ? 12.654  -7.042  91.067  1.00 119.60 ? -70  DT  J P     1 
ATOM   9064  O  OP1   . DT  J  5 4   ? 13.775  -7.590  91.863  1.00 120.13 ? -70  DT  J OP1   1 
ATOM   9065  O  OP2   . DT  J  5 4   ? 12.953  -6.129  89.943  1.00 119.45 ? -70  DT  J OP2   1 
ATOM   9066  O  "O5'" . DT  J  5 4   ? 11.751  -8.231  90.487  1.00 118.61 ? -70  DT  J "O5'" 1 
ATOM   9067  C  "C5'" . DT  J  5 4   ? 11.725  -9.547  91.051  1.00 116.35 ? -70  DT  J "C5'" 1 
ATOM   9068  C  "C4'" . DT  J  5 4   ? 11.489  -10.583 89.958  1.00 114.75 ? -70  DT  J "C4'" 1 
ATOM   9069  O  "O4'" . DT  J  5 4   ? 10.342  -10.212 89.143  1.00 114.48 ? -70  DT  J "O4'" 1 
ATOM   9070  C  "C3'" . DT  J  5 4   ? 12.645  -10.812 88.981  1.00 113.39 ? -70  DT  J "C3'" 1 
ATOM   9071  O  "O3'" . DT  J  5 4   ? 12.736  -12.217 88.735  1.00 112.02 ? -70  DT  J "O3'" 1 
ATOM   9072  C  "C2'" . DT  J  5 4   ? 12.227  -10.011 87.746  1.00 113.38 ? -70  DT  J "C2'" 1 
ATOM   9073  C  "C1'" . DT  J  5 4   ? 10.710  -10.196 87.772  1.00 113.63 ? -70  DT  J "C1'" 1 
ATOM   9074  N  N1    . DT  J  5 4   ? 9.887   -9.148  87.071  1.00 113.35 ? -70  DT  J N1    1 
ATOM   9075  C  C2    . DT  J  5 4   ? 8.834   -9.547  86.268  1.00 113.28 ? -70  DT  J C2    1 
ATOM   9076  O  O2    . DT  J  5 4   ? 8.523   -10.709 86.077  1.00 113.24 ? -70  DT  J O2    1 
ATOM   9077  N  N3    . DT  J  5 4   ? 8.136   -8.522  85.684  1.00 113.15 ? -70  DT  J N3    1 
ATOM   9078  C  C4    . DT  J  5 4   ? 8.376   -7.168  85.812  1.00 113.20 ? -70  DT  J C4    1 
ATOM   9079  O  O4    . DT  J  5 4   ? 7.688   -6.333  85.241  1.00 113.28 ? -70  DT  J O4    1 
ATOM   9080  C  C5    . DT  J  5 4   ? 9.484   -6.814  86.663  1.00 113.27 ? -70  DT  J C5    1 
ATOM   9081  C  C7    . DT  J  5 4   ? 9.839   -5.372  86.876  1.00 113.52 ? -70  DT  J C7    1 
ATOM   9082  C  C6    . DT  J  5 4   ? 10.177  -7.805  87.243  1.00 113.25 ? -70  DT  J C6    1 
ATOM   9083  P  P     . DC  J  5 5   ? 13.779  -12.880 87.718  1.00 111.45 ? -69  DC  J P     1 
ATOM   9084  O  OP1   . DC  J  5 5   ? 13.962  -14.284 88.145  1.00 111.79 ? -69  DC  J OP1   1 
ATOM   9085  O  OP2   . DC  J  5 5   ? 14.958  -11.998 87.570  1.00 111.63 ? -69  DC  J OP2   1 
ATOM   9086  O  "O5'" . DC  J  5 5   ? 12.981  -12.862 86.333  1.00 110.62 ? -69  DC  J "O5'" 1 
ATOM   9087  C  "C5'" . DC  J  5 5   ? 11.939  -13.803 86.042  1.00 108.77 ? -69  DC  J "C5'" 1 
ATOM   9088  C  "C4'" . DC  J  5 5   ? 11.562  -13.744 84.568  1.00 107.10 ? -69  DC  J "C4'" 1 
ATOM   9089  O  "O4'" . DC  J  5 5   ? 10.903  -12.481 84.294  1.00 106.58 ? -69  DC  J "O4'" 1 
ATOM   9090  C  "C3'" . DC  J  5 5   ? 12.730  -13.829 83.585  1.00 106.25 ? -69  DC  J "C3'" 1 
ATOM   9091  O  "O3'" . DC  J  5 5   ? 12.355  -14.540 82.421  1.00 104.72 ? -69  DC  J "O3'" 1 
ATOM   9092  C  "C2'" . DC  J  5 5   ? 12.992  -12.372 83.227  1.00 106.63 ? -69  DC  J "C2'" 1 
ATOM   9093  C  "C1'" . DC  J  5 5   ? 11.569  -11.822 83.232  1.00 106.63 ? -69  DC  J "C1'" 1 
ATOM   9094  N  N1    . DC  J  5 5   ? 11.472  -10.352 83.451  1.00 106.35 ? -69  DC  J N1    1 
ATOM   9095  C  C2    . DC  J  5 5   ? 10.289  -9.677  83.110  1.00 106.64 ? -69  DC  J C2    1 
ATOM   9096  O  O2    . DC  J  5 5   ? 9.336   -10.301 82.624  1.00 106.79 ? -69  DC  J O2    1 
ATOM   9097  N  N3    . DC  J  5 5   ? 10.216  -8.338  83.325  1.00 106.83 ? -69  DC  J N3    1 
ATOM   9098  C  C4    . DC  J  5 5   ? 11.260  -7.687  83.853  1.00 106.98 ? -69  DC  J C4    1 
ATOM   9099  N  N4    . DC  J  5 5   ? 11.144  -6.370  84.043  1.00 106.60 ? -69  DC  J N4    1 
ATOM   9100  C  C5    . DC  J  5 5   ? 12.473  -8.357  84.209  1.00 106.74 ? -69  DC  J C5    1 
ATOM   9101  C  C6    . DC  J  5 5   ? 12.530  -9.675  83.993  1.00 106.33 ? -69  DC  J C6    1 
ATOM   9102  P  P     . DC  J  5 6   ? 12.866  -16.026 82.179  1.00 103.20 ? -68  DC  J P     1 
ATOM   9103  O  OP1   . DC  J  5 6   ? 12.635  -16.776 83.434  1.00 103.74 ? -68  DC  J OP1   1 
ATOM   9104  O  OP2   . DC  J  5 6   ? 14.205  -15.952 81.559  1.00 103.28 ? -68  DC  J OP2   1 
ATOM   9105  O  "O5'" . DC  J  5 6   ? 11.868  -16.588 81.072  1.00 102.62 ? -68  DC  J "O5'" 1 
ATOM   9106  C  "C5'" . DC  J  5 6   ? 10.509  -16.169 81.064  1.00 101.08 ? -68  DC  J "C5'" 1 
ATOM   9107  C  "C4'" . DC  J  5 6   ? 10.080  -15.608 79.716  1.00 99.60  ? -68  DC  J "C4'" 1 
ATOM   9108  O  "O4'" . DC  J  5 6   ? 9.982   -14.159 79.740  1.00 99.36  ? -68  DC  J "O4'" 1 
ATOM   9109  C  "C3'" . DC  J  5 6   ? 10.989  -15.947 78.545  1.00 98.71  ? -68  DC  J "C3'" 1 
ATOM   9110  O  "O3'" . DC  J  5 6   ? 10.133  -16.340 77.502  1.00 97.62  ? -68  DC  J "O3'" 1 
ATOM   9111  C  "C2'" . DC  J  5 6   ? 11.728  -14.637 78.259  1.00 98.73  ? -68  DC  J "C2'" 1 
ATOM   9112  C  "C1'" . DC  J  5 6   ? 10.656  -13.614 78.620  1.00 98.61  ? -68  DC  J "C1'" 1 
ATOM   9113  N  N1    . DC  J  5 6   ? 11.119  -12.233 78.995  1.00 98.26  ? -68  DC  J N1    1 
ATOM   9114  C  C2    . DC  J  5 6   ? 10.265  -11.139 78.758  1.00 98.17  ? -68  DC  J C2    1 
ATOM   9115  O  O2    . DC  J  5 6   ? 9.155   -11.323 78.238  1.00 97.65  ? -68  DC  J O2    1 
ATOM   9116  N  N3    . DC  J  5 6   ? 10.680  -9.890  79.104  1.00 98.13  ? -68  DC  J N3    1 
ATOM   9117  C  C4    . DC  J  5 6   ? 11.876  -9.712  79.669  1.00 98.18  ? -68  DC  J C4    1 
ATOM   9118  N  N4    . DC  J  5 6   ? 12.227  -8.465  79.990  1.00 98.32  ? -68  DC  J N4    1 
ATOM   9119  C  C5    . DC  J  5 6   ? 12.759  -10.807 79.925  1.00 98.19  ? -68  DC  J C5    1 
ATOM   9120  C  C6    . DC  J  5 6   ? 12.343  -12.035 79.579  1.00 98.26  ? -68  DC  J C6    1 
ATOM   9121  P  P     . DA  J  5 7   ? 10.668  -17.132 76.232  1.00 97.07  ? -67  DA  J P     1 
ATOM   9122  O  OP1   . DA  J  5 7   ? 10.097  -18.487 76.380  1.00 97.50  ? -67  DA  J OP1   1 
ATOM   9123  O  OP2   . DA  J  5 7   ? 12.119  -16.903 76.030  1.00 96.47  ? -67  DA  J OP2   1 
ATOM   9124  O  "O5'" . DA  J  5 7   ? 9.940   -16.390 75.021  1.00 96.63  ? -67  DA  J "O5'" 1 
ATOM   9125  C  "C5'" . DA  J  5 7   ? 8.683   -15.763 75.227  1.00 96.22  ? -67  DA  J "C5'" 1 
ATOM   9126  C  "C4'" . DA  J  5 7   ? 8.433   -14.672 74.198  1.00 96.18  ? -67  DA  J "C4'" 1 
ATOM   9127  O  "O4'" . DA  J  5 7   ? 9.078   -13.421 74.551  1.00 96.57  ? -67  DA  J "O4'" 1 
ATOM   9128  C  "C3'" . DA  J  5 7   ? 8.934   -14.951 72.795  1.00 96.10  ? -67  DA  J "C3'" 1 
ATOM   9129  O  "O3'" . DA  J  5 7   ? 8.069   -14.235 71.971  1.00 96.02  ? -67  DA  J "O3'" 1 
ATOM   9130  C  "C2'" . DA  J  5 7   ? 10.340  -14.354 72.773  1.00 95.67  ? -67  DA  J "C2'" 1 
ATOM   9131  C  "C1'" . DA  J  5 7   ? 10.113  -13.113 73.627  1.00 96.41  ? -67  DA  J "C1'" 1 
ATOM   9132  N  N9    . DA  J  5 7   ? 11.248  -12.668 74.423  1.00 96.24  ? -67  DA  J N9    1 
ATOM   9133  C  C8    . DA  J  5 7   ? 12.334  -13.381 74.856  1.00 96.42  ? -67  DA  J C8    1 
ATOM   9134  N  N7    . DA  J  5 7   ? 13.176  -12.683 75.582  1.00 96.29  ? -67  DA  J N7    1 
ATOM   9135  C  C5    . DA  J  5 7   ? 12.594  -11.425 75.628  1.00 96.41  ? -67  DA  J C5    1 
ATOM   9136  C  C6    . DA  J  5 7   ? 12.976  -10.209 76.241  1.00 96.58  ? -67  DA  J C6    1 
ATOM   9137  N  N6    . DA  J  5 7   ? 14.097  -10.058 76.957  1.00 96.53  ? -67  DA  J N6    1 
ATOM   9138  N  N1    . DA  J  5 7   ? 12.153  -9.145  76.094  1.00 96.40  ? -67  DA  J N1    1 
ATOM   9139  C  C2    . DA  J  5 7   ? 11.029  -9.282  75.378  1.00 96.12  ? -67  DA  J C2    1 
ATOM   9140  N  N3    . DA  J  5 7   ? 10.566  -10.366 74.757  1.00 95.99  ? -67  DA  J N3    1 
ATOM   9141  C  C4    . DA  J  5 7   ? 11.402  -11.405 74.924  1.00 96.12  ? -67  DA  J C4    1 
ATOM   9142  P  P     . DA  J  5 8   ? 7.959   -14.617 70.435  1.00 96.82  ? -66  DA  J P     1 
ATOM   9143  O  OP1   . DA  J  5 8   ? 6.689   -15.349 70.226  1.00 96.48  ? -66  DA  J OP1   1 
ATOM   9144  O  OP2   . DA  J  5 8   ? 9.266   -15.174 69.998  1.00 95.56  ? -66  DA  J OP2   1 
ATOM   9145  O  "O5'" . DA  J  5 8   ? 7.766   -13.179 69.777  1.00 96.78  ? -66  DA  J "O5'" 1 
ATOM   9146  C  "C5'" . DA  J  5 8   ? 6.673   -12.374 70.181  1.00 96.70  ? -66  DA  J "C5'" 1 
ATOM   9147  C  "C4'" . DA  J  5 8   ? 7.078   -10.922 70.076  1.00 96.79  ? -66  DA  J "C4'" 1 
ATOM   9148  O  "O4'" . DA  J  5 8   ? 8.233   -10.672 70.912  1.00 96.44  ? -66  DA  J "O4'" 1 
ATOM   9149  C  "C3'" . DA  J  5 8   ? 7.455   -10.487 68.666  1.00 97.39  ? -66  DA  J "C3'" 1 
ATOM   9150  O  "O3'" . DA  J  5 8   ? 6.601   -9.378  68.353  1.00 98.65  ? -66  DA  J "O3'" 1 
ATOM   9151  C  "C2'" . DA  J  5 8   ? 8.962   -10.193 68.752  1.00 96.27  ? -66  DA  J "C2'" 1 
ATOM   9152  C  "C1'" . DA  J  5 8   ? 9.141   -9.848  70.226  1.00 95.69  ? -66  DA  J "C1'" 1 
ATOM   9153  N  N9    . DA  J  5 8   ? 10.463  -10.104 70.786  1.00 95.43  ? -66  DA  J N9    1 
ATOM   9154  C  C8    . DA  J  5 8   ? 11.208  -11.242 70.677  1.00 95.57  ? -66  DA  J C8    1 
ATOM   9155  N  N7    . DA  J  5 8   ? 12.363  -11.191 71.296  1.00 95.48  ? -66  DA  J N7    1 
ATOM   9156  C  C5    . DA  J  5 8   ? 12.379  -9.929  71.855  1.00 95.44  ? -66  DA  J C5    1 
ATOM   9157  C  C6    . DA  J  5 8   ? 13.334  -9.247  72.640  1.00 95.43  ? -66  DA  J C6    1 
ATOM   9158  N  N6    . DA  J  5 8   ? 14.504  -9.779  73.007  1.00 95.35  ? -66  DA  J N6    1 
ATOM   9159  N  N1    . DA  J  5 8   ? 13.039  -7.990  73.037  1.00 95.45  ? -66  DA  J N1    1 
ATOM   9160  C  C2    . DA  J  5 8   ? 11.868  -7.455  72.669  1.00 95.76  ? -66  DA  J C2    1 
ATOM   9161  N  N3    . DA  J  5 8   ? 10.892  -7.997  71.937  1.00 96.15  ? -66  DA  J N3    1 
ATOM   9162  C  C4    . DA  J  5 8   ? 11.212  -9.248  71.556  1.00 95.65  ? -66  DA  J C4    1 
ATOM   9163  P  P     . DA  J  5 9   ? 6.798   -8.435  67.075  1.00 100.08 ? -65  DA  J P     1 
ATOM   9164  O  OP1   . DA  J  5 9   ? 5.469   -7.825  66.829  1.00 99.30  ? -65  DA  J OP1   1 
ATOM   9165  O  OP2   . DA  J  5 9   ? 7.529   -9.192  66.023  1.00 99.08  ? -65  DA  J OP2   1 
ATOM   9166  O  "O5'" . DA  J  5 9   ? 7.799   -7.296  67.593  1.00 100.40 ? -65  DA  J "O5'" 1 
ATOM   9167  C  "C5'" . DA  J  5 9   ? 7.373   -6.247  68.468  1.00 101.30 ? -65  DA  J "C5'" 1 
ATOM   9168  C  "C4'" . DA  J  5 9   ? 8.539   -5.312  68.741  1.00 102.24 ? -65  DA  J "C4'" 1 
ATOM   9169  O  "O4'" . DA  J  5 9   ? 9.659   -6.059  69.290  1.00 101.58 ? -65  DA  J "O4'" 1 
ATOM   9170  C  "C3'" . DA  J  5 9   ? 9.077   -4.575  67.514  1.00 103.22 ? -65  DA  J "C3'" 1 
ATOM   9171  O  "O3'" . DA  J  5 9   ? 9.222   -3.173  67.819  1.00 105.84 ? -65  DA  J "O3'" 1 
ATOM   9172  C  "C2'" . DA  J  5 9   ? 10.409  -5.276  67.233  1.00 101.81 ? -65  DA  J "C2'" 1 
ATOM   9173  C  "C1'" . DA  J  5 9   ? 10.844  -5.652  68.640  1.00 100.93 ? -65  DA  J "C1'" 1 
ATOM   9174  N  N9    . DA  J  5 9   ? 11.802  -6.748  68.725  1.00 100.57 ? -65  DA  J N9    1 
ATOM   9175  C  C8    . DA  J  5 9   ? 11.716  -7.972  68.128  1.00 100.57 ? -65  DA  J C8    1 
ATOM   9176  N  N7    . DA  J  5 9   ? 12.721  -8.765  68.391  1.00 100.13 ? -65  DA  J N7    1 
ATOM   9177  C  C5    . DA  J  5 9   ? 13.523  -8.011  69.222  1.00 100.28 ? -65  DA  J C5    1 
ATOM   9178  C  C6    . DA  J  5 9   ? 14.753  -8.280  69.856  1.00 100.89 ? -65  DA  J C6    1 
ATOM   9179  N  N6    . DA  J  5 9   ? 15.397  -9.445  69.732  1.00 100.61 ? -65  DA  J N6    1 
ATOM   9180  N  N1    . DA  J  5 9   ? 15.296  -7.306  70.627  1.00 100.79 ? -65  DA  J N1    1 
ATOM   9181  C  C2    . DA  J  5 9   ? 14.646  -6.141  70.750  1.00 100.43 ? -65  DA  J C2    1 
ATOM   9182  N  N3    . DA  J  5 9   ? 13.486  -5.780  70.201  1.00 100.32 ? -65  DA  J N3    1 
ATOM   9183  C  C4    . DA  J  5 9   ? 12.971  -6.764  69.442  1.00 100.27 ? -65  DA  J C4    1 
ATOM   9184  P  P     . DT  J  5 10  ? 9.574   -2.046  66.721  1.00 106.93 ? -64  DT  J P     1 
ATOM   9185  O  OP1   . DT  J  5 10  ? 8.725   -0.870  67.037  1.00 107.32 ? -64  DT  J OP1   1 
ATOM   9186  O  OP2   . DT  J  5 10  ? 9.583   -2.638  65.357  1.00 105.93 ? -64  DT  J OP2   1 
ATOM   9187  O  "O5'" . DT  J  5 10  ? 11.084  -1.687  67.069  1.00 107.05 ? -64  DT  J "O5'" 1 
ATOM   9188  C  "C5'" . DT  J  5 10  ? 11.399  -1.064  68.301  1.00 109.08 ? -64  DT  J "C5'" 1 
ATOM   9189  C  "C4'" . DT  J  5 10  ? 12.903  -1.044  68.437  1.00 110.39 ? -64  DT  J "C4'" 1 
ATOM   9190  O  "O4'" . DT  J  5 10  ? 13.393  -2.408  68.446  1.00 110.19 ? -64  DT  J "O4'" 1 
ATOM   9191  C  "C3'" . DT  J  5 10  ? 13.628  -0.332  67.297  1.00 111.73 ? -64  DT  J "C3'" 1 
ATOM   9192  O  "O3'" . DT  J  5 10  ? 14.486  0.660   67.877  1.00 114.49 ? -64  DT  J "O3'" 1 
ATOM   9193  C  "C2'" . DT  J  5 10  ? 14.371  -1.456  66.563  1.00 110.84 ? -64  DT  J "C2'" 1 
ATOM   9194  C  "C1'" . DT  J  5 10  ? 14.592  -2.443  67.705  1.00 109.88 ? -64  DT  J "C1'" 1 
ATOM   9195  N  N1    . DT  J  5 10  ? 14.910  -3.860  67.312  1.00 109.75 ? -64  DT  J N1    1 
ATOM   9196  C  C2    . DT  J  5 10  ? 16.110  -4.410  67.738  1.00 109.33 ? -64  DT  J C2    1 
ATOM   9197  O  O2    . DT  J  5 10  ? 16.934  -3.814  68.411  1.00 108.96 ? -64  DT  J O2    1 
ATOM   9198  N  N3    . DT  J  5 10  ? 16.318  -5.707  67.342  1.00 109.08 ? -64  DT  J N3    1 
ATOM   9199  C  C4    . DT  J  5 10  ? 15.468  -6.491  66.583  1.00 109.14 ? -64  DT  J C4    1 
ATOM   9200  O  O4    . DT  J  5 10  ? 15.767  -7.640  66.290  1.00 109.23 ? -64  DT  J O4    1 
ATOM   9201  C  C5    . DT  J  5 10  ? 14.229  -5.867  66.171  1.00 109.20 ? -64  DT  J C5    1 
ATOM   9202  C  C7    . DT  J  5 10  ? 13.230  -6.621  65.342  1.00 109.20 ? -64  DT  J C7    1 
ATOM   9203  C  C6    . DT  J  5 10  ? 14.009  -4.597  66.551  1.00 109.41 ? -64  DT  J C6    1 
ATOM   9204  P  P     . DA  J  5 11  ? 15.448  1.617   67.017  1.00 115.95 ? -63  DA  J P     1 
ATOM   9205  O  OP1   . DA  J  5 11  ? 15.628  2.854   67.818  1.00 115.60 ? -63  DA  J OP1   1 
ATOM   9206  O  OP2   . DA  J  5 11  ? 14.950  1.674   65.617  1.00 115.55 ? -63  DA  J OP2   1 
ATOM   9207  O  "O5'" . DA  J  5 11  ? 16.831  0.810   67.001  1.00 117.24 ? -63  DA  J "O5'" 1 
ATOM   9208  C  "C5'" . DA  J  5 11  ? 17.580  0.627   68.211  1.00 119.72 ? -63  DA  J "C5'" 1 
ATOM   9209  C  "C4'" . DA  J  5 11  ? 19.035  0.317   67.897  1.00 121.02 ? -63  DA  J "C4'" 1 
ATOM   9210  O  "O4'" . DA  J  5 11  ? 19.197  -1.117  67.739  1.00 121.48 ? -63  DA  J "O4'" 1 
ATOM   9211  C  "C3'" . DA  J  5 11  ? 19.517  0.965   66.604  1.00 121.88 ? -63  DA  J "C3'" 1 
ATOM   9212  O  "O3'" . DA  J  5 11  ? 20.775  1.605   66.850  1.00 123.42 ? -63  DA  J "O3'" 1 
ATOM   9213  C  "C2'" . DA  J  5 11  ? 19.531  -0.180  65.591  1.00 122.09 ? -63  DA  J "C2'" 1 
ATOM   9214  C  "C1'" . DA  J  5 11  ? 19.721  -1.421  66.461  1.00 122.34 ? -63  DA  J "C1'" 1 
ATOM   9215  N  N9    . DA  J  5 11  ? 19.068  -2.615  65.907  1.00 122.49 ? -63  DA  J N9    1 
ATOM   9216  C  C8    . DA  J  5 11  ? 17.841  -2.675  65.297  1.00 122.52 ? -63  DA  J C8    1 
ATOM   9217  N  N7    . DA  J  5 11  ? 17.510  -3.874  64.880  1.00 122.66 ? -63  DA  J N7    1 
ATOM   9218  C  C5    . DA  J  5 11  ? 18.591  -4.662  65.241  1.00 122.55 ? -63  DA  J C5    1 
ATOM   9219  C  C6    . DA  J  5 11  ? 18.855  -6.042  65.085  1.00 122.52 ? -63  DA  J C6    1 
ATOM   9220  N  N6    . DA  J  5 11  ? 18.001  -6.887  64.495  1.00 122.44 ? -63  DA  J N6    1 
ATOM   9221  N  N1    . DA  J  5 11  ? 20.033  -6.519  65.555  1.00 122.41 ? -63  DA  J N1    1 
ATOM   9222  C  C2    . DA  J  5 11  ? 20.883  -5.666  66.150  1.00 122.42 ? -63  DA  J C2    1 
ATOM   9223  N  N3    . DA  J  5 11  ? 20.744  -4.353  66.354  1.00 122.25 ? -63  DA  J N3    1 
ATOM   9224  C  C4    . DA  J  5 11  ? 19.565  -3.904  65.875  1.00 122.40 ? -63  DA  J C4    1 
ATOM   9225  P  P     . DT  J  5 12  ? 21.928  1.807   65.753  1.00 125.09 ? -62  DT  J P     1 
ATOM   9226  O  OP1   . DT  J  5 12  ? 22.840  2.858   66.257  1.00 125.16 ? -62  DT  J OP1   1 
ATOM   9227  O  OP2   . DT  J  5 12  ? 21.358  1.924   64.390  1.00 124.95 ? -62  DT  J OP2   1 
ATOM   9228  O  "O5'" . DT  J  5 12  ? 22.636  0.384   65.825  1.00 127.36 ? -62  DT  J "O5'" 1 
ATOM   9229  C  "C5'" . DT  J  5 12  ? 23.690  0.105   66.729  1.00 130.56 ? -62  DT  J "C5'" 1 
ATOM   9230  C  "C4'" . DT  J  5 12  ? 24.583  -0.897  66.037  1.00 132.96 ? -62  DT  J "C4'" 1 
ATOM   9231  O  "O4'" . DT  J  5 12  ? 23.811  -2.100  65.779  1.00 133.41 ? -62  DT  J "O4'" 1 
ATOM   9232  C  "C3'" . DT  J  5 12  ? 25.075  -0.392  64.687  1.00 134.53 ? -62  DT  J "C3'" 1 
ATOM   9233  O  "O3'" . DT  J  5 12  ? 26.484  -0.239  64.717  1.00 137.23 ? -62  DT  J "O3'" 1 
ATOM   9234  C  "C2'" . DT  J  5 12  ? 24.618  -1.431  63.663  1.00 134.06 ? -62  DT  J "C2'" 1 
ATOM   9235  C  "C1'" . DT  J  5 12  ? 24.155  -2.615  64.508  1.00 133.42 ? -62  DT  J "C1'" 1 
ATOM   9236  N  N1    . DT  J  5 12  ? 22.999  -3.362  63.887  1.00 133.12 ? -62  DT  J N1    1 
ATOM   9237  C  C2    . DT  J  5 12  ? 23.087  -4.732  63.721  1.00 133.05 ? -62  DT  J C2    1 
ATOM   9238  O  O2    . DT  J  5 12  ? 24.045  -5.399  64.066  1.00 133.16 ? -62  DT  J O2    1 
ATOM   9239  N  N3    . DT  J  5 12  ? 21.990  -5.314  63.134  1.00 133.11 ? -62  DT  J N3    1 
ATOM   9240  C  C4    . DT  J  5 12  ? 20.838  -4.677  62.704  1.00 133.07 ? -62  DT  J C4    1 
ATOM   9241  O  O4    . DT  J  5 12  ? 19.913  -5.292  62.188  1.00 133.09 ? -62  DT  J O4    1 
ATOM   9242  C  C5    . DT  J  5 12  ? 20.811  -3.248  62.895  1.00 132.97 ? -62  DT  J C5    1 
ATOM   9243  C  C7    . DT  J  5 12  ? 19.616  -2.450  62.463  1.00 133.16 ? -62  DT  J C7    1 
ATOM   9244  C  C6    . DT  J  5 12  ? 21.874  -2.667  63.470  1.00 132.88 ? -62  DT  J C6    1 
ATOM   9245  P  P     . DC  J  5 13  ? 27.274  0.363   63.459  1.00 139.50 ? -61  DC  J P     1 
ATOM   9246  O  OP1   . DC  J  5 13  ? 28.481  1.029   63.996  1.00 139.55 ? -61  DC  J OP1   1 
ATOM   9247  O  OP2   . DC  J  5 13  ? 26.338  1.139   62.609  1.00 139.55 ? -61  DC  J OP2   1 
ATOM   9248  O  "O5'" . DC  J  5 13  ? 27.707  -0.958  62.657  1.00 141.30 ? -61  DC  J "O5'" 1 
ATOM   9249  C  "C5'" . DC  J  5 13  ? 28.364  -2.046  63.322  1.00 143.78 ? -61  DC  J "C5'" 1 
ATOM   9250  C  "C4'" . DC  J  5 13  ? 28.369  -3.294  62.454  1.00 145.71 ? -61  DC  J "C4'" 1 
ATOM   9251  O  "O4'" . DC  J  5 13  ? 27.020  -3.821  62.319  1.00 146.15 ? -61  DC  J "O4'" 1 
ATOM   9252  C  "C3'" . DC  J  5 13  ? 28.880  -3.076  61.032  1.00 147.08 ? -61  DC  J "C3'" 1 
ATOM   9253  O  "O3'" . DC  J  5 13  ? 29.892  -4.029  60.731  1.00 149.30 ? -61  DC  J "O3'" 1 
ATOM   9254  C  "C2'" . DC  J  5 13  ? 27.643  -3.267  60.155  1.00 146.80 ? -61  DC  J "C2'" 1 
ATOM   9255  C  "C1'" . DC  J  5 13  ? 26.852  -4.268  60.988  1.00 146.37 ? -61  DC  J "C1'" 1 
ATOM   9256  N  N1    . DC  J  5 13  ? 25.390  -4.376  60.640  1.00 146.19 ? -61  DC  J N1    1 
ATOM   9257  C  C2    . DC  J  5 13  ? 24.815  -5.639  60.371  1.00 146.31 ? -61  DC  J C2    1 
ATOM   9258  O  O2    . DC  J  5 13  ? 25.503  -6.671  60.420  1.00 146.30 ? -61  DC  J O2    1 
ATOM   9259  N  N3    . DC  J  5 13  ? 23.494  -5.707  60.059  1.00 146.33 ? -61  DC  J N3    1 
ATOM   9260  C  C4    . DC  J  5 13  ? 22.756  -4.593  60.005  1.00 146.28 ? -61  DC  J C4    1 
ATOM   9261  N  N4    . DC  J  5 13  ? 21.463  -4.719  59.693  1.00 146.24 ? -61  DC  J N4    1 
ATOM   9262  C  C5    . DC  J  5 13  ? 23.317  -3.304  60.273  1.00 146.22 ? -61  DC  J C5    1 
ATOM   9263  C  C6    . DC  J  5 13  ? 24.620  -3.244  60.582  1.00 146.01 ? -61  DC  J C6    1 
ATOM   9264  P  P     . DC  J  5 14  ? 30.936  -3.770  59.541  1.00 151.13 ? -60  DC  J P     1 
ATOM   9265  O  OP1   . DC  J  5 14  ? 32.288  -4.081  60.064  1.00 150.95 ? -60  DC  J OP1   1 
ATOM   9266  O  OP2   . DC  J  5 14  ? 30.663  -2.439  58.944  1.00 151.00 ? -60  DC  J OP2   1 
ATOM   9267  O  "O5'" . DC  J  5 14  ? 30.532  -4.872  58.453  1.00 151.76 ? -60  DC  J "O5'" 1 
ATOM   9268  C  "C5'" . DC  J  5 14  ? 30.619  -6.262  58.745  1.00 152.92 ? -60  DC  J "C5'" 1 
ATOM   9269  C  "C4'" . DC  J  5 14  ? 29.761  -7.040  57.768  1.00 153.97 ? -60  DC  J "C4'" 1 
ATOM   9270  O  "O4'" . DC  J  5 14  ? 28.367  -6.686  57.963  1.00 154.08 ? -60  DC  J "O4'" 1 
ATOM   9271  C  "C3'" . DC  J  5 14  ? 30.081  -6.777  56.293  1.00 154.73 ? -60  DC  J "C3'" 1 
ATOM   9272  O  "O3'" . DC  J  5 14  ? 30.577  -7.990  55.675  1.00 155.79 ? -60  DC  J "O3'" 1 
ATOM   9273  C  "C2'" . DC  J  5 14  ? 28.777  -6.208  55.721  1.00 154.58 ? -60  DC  J "C2'" 1 
ATOM   9274  C  "C1'" . DC  J  5 14  ? 27.731  -6.732  56.702  1.00 154.26 ? -60  DC  J "C1'" 1 
ATOM   9275  N  N1    . DC  J  5 14  ? 26.447  -5.940  56.718  1.00 154.28 ? -60  DC  J N1    1 
ATOM   9276  C  C2    . DC  J  5 14  ? 25.227  -6.544  56.336  1.00 154.33 ? -60  DC  J C2    1 
ATOM   9277  O  O2    . DC  J  5 14  ? 25.191  -7.736  55.987  1.00 154.30 ? -60  DC  J O2    1 
ATOM   9278  N  N3    . DC  J  5 14  ? 24.091  -5.794  56.359  1.00 154.22 ? -60  DC  J N3    1 
ATOM   9279  C  C4    . DC  J  5 14  ? 24.135  -4.510  56.737  1.00 154.17 ? -60  DC  J C4    1 
ATOM   9280  N  N4    . DC  J  5 14  ? 22.990  -3.822  56.743  1.00 154.14 ? -60  DC  J N4    1 
ATOM   9281  C  C5    . DC  J  5 14  ? 25.358  -3.878  57.125  1.00 154.18 ? -60  DC  J C5    1 
ATOM   9282  C  C6    . DC  J  5 14  ? 26.473  -4.622  57.099  1.00 154.19 ? -60  DC  J C6    1 
ATOM   9283  P  P     . DC  J  5 15  ? 30.203  -8.539  54.208  1.00 156.49 ? -59  DC  J P     1 
ATOM   9284  O  OP1   . DC  J  5 15  ? 31.062  -9.721  53.954  1.00 156.39 ? -59  DC  J OP1   1 
ATOM   9285  O  OP2   . DC  J  5 15  ? 30.235  -7.418  53.238  1.00 156.48 ? -59  DC  J OP2   1 
ATOM   9286  O  "O5'" . DC  J  5 15  ? 28.682  -9.013  54.402  1.00 156.51 ? -59  DC  J "O5'" 1 
ATOM   9287  C  "C5'" . DC  J  5 15  ? 28.236  -10.294 53.969  1.00 156.63 ? -59  DC  J "C5'" 1 
ATOM   9288  C  "C4'" . DC  J  5 15  ? 27.391  -10.160 52.714  1.00 156.56 ? -59  DC  J "C4'" 1 
ATOM   9289  O  "O4'" . DC  J  5 15  ? 26.383  -9.139  52.919  1.00 156.77 ? -59  DC  J "O4'" 1 
ATOM   9290  C  "C3'" . DC  J  5 15  ? 28.141  -9.792  51.434  1.00 156.31 ? -59  DC  J "C3'" 1 
ATOM   9291  O  "O3'" . DC  J  5 15  ? 27.685  -10.605 50.350  1.00 155.76 ? -59  DC  J "O3'" 1 
ATOM   9292  C  "C2'" . DC  J  5 15  ? 27.789  -8.319  51.221  1.00 156.64 ? -59  DC  J "C2'" 1 
ATOM   9293  C  "C1'" . DC  J  5 15  ? 26.385  -8.246  51.823  1.00 157.16 ? -59  DC  J "C1'" 1 
ATOM   9294  N  N1    . DC  J  5 15  ? 25.916  -6.907  52.332  1.00 157.42 ? -59  DC  J N1    1 
ATOM   9295  C  C2    . DC  J  5 15  ? 24.558  -6.754  52.689  1.00 157.60 ? -59  DC  J C2    1 
ATOM   9296  O  O2    . DC  J  5 15  ? 23.773  -7.709  52.575  1.00 157.48 ? -59  DC  J O2    1 
ATOM   9297  N  N3    . DC  J  5 15  ? 24.132  -5.547  53.155  1.00 157.67 ? -59  DC  J N3    1 
ATOM   9298  C  C4    . DC  J  5 15  ? 24.994  -4.526  53.272  1.00 157.59 ? -59  DC  J C4    1 
ATOM   9299  N  N4    . DC  J  5 15  ? 24.519  -3.363  53.735  1.00 157.52 ? -59  DC  J N4    1 
ATOM   9300  C  C5    . DC  J  5 15  ? 26.377  -4.657  52.918  1.00 157.56 ? -59  DC  J C5    1 
ATOM   9301  C  C6    . DC  J  5 15  ? 26.789  -5.851  52.461  1.00 157.48 ? -59  DC  J C6    1 
ATOM   9302  P  P     . DT  J  5 16  ? 28.408  -11.978 49.928  1.00 155.30 ? -58  DT  J P     1 
ATOM   9303  O  OP1   . DT  J  5 16  ? 28.906  -12.674 51.139  1.00 155.27 ? -58  DT  J OP1   1 
ATOM   9304  O  OP2   . DT  J  5 16  ? 29.347  -11.655 48.828  1.00 154.93 ? -58  DT  J OP2   1 
ATOM   9305  O  "O5'" . DT  J  5 16  ? 27.204  -12.842 49.314  1.00 154.94 ? -58  DT  J "O5'" 1 
ATOM   9306  C  "C5'" . DT  J  5 16  ? 26.032  -13.155 50.090  1.00 154.15 ? -58  DT  J "C5'" 1 
ATOM   9307  C  "C4'" . DT  J  5 16  ? 24.755  -12.564 49.495  1.00 153.31 ? -58  DT  J "C4'" 1 
ATOM   9308  O  "O4'" . DT  J  5 16  ? 24.667  -11.140 49.768  1.00 153.19 ? -58  DT  J "O4'" 1 
ATOM   9309  C  "C3'" . DT  J  5 16  ? 24.569  -12.724 47.982  1.00 152.58 ? -58  DT  J "C3'" 1 
ATOM   9310  O  "O3'" . DT  J  5 16  ? 23.390  -13.491 47.724  1.00 151.32 ? -58  DT  J "O3'" 1 
ATOM   9311  C  "C2'" . DT  J  5 16  ? 24.451  -11.291 47.454  1.00 152.76 ? -58  DT  J "C2'" 1 
ATOM   9312  C  "C1'" . DT  J  5 16  ? 23.968  -10.542 48.694  1.00 152.98 ? -58  DT  J "C1'" 1 
ATOM   9313  N  N1    . DT  J  5 16  ? 24.215  -9.055  48.699  1.00 153.03 ? -58  DT  J N1    1 
ATOM   9314  C  C2    . DT  J  5 16  ? 23.221  -8.199  49.152  1.00 152.95 ? -58  DT  J C2    1 
ATOM   9315  O  O2    . DT  J  5 16  ? 22.129  -8.570  49.554  1.00 152.84 ? -58  DT  J O2    1 
ATOM   9316  N  N3    . DT  J  5 16  ? 23.553  -6.864  49.115  1.00 152.80 ? -58  DT  J N3    1 
ATOM   9317  C  C4    . DT  J  5 16  ? 24.748  -6.311  48.686  1.00 152.75 ? -58  DT  J C4    1 
ATOM   9318  O  O4    . DT  J  5 16  ? 24.930  -5.097  48.701  1.00 152.78 ? -58  DT  J O4    1 
ATOM   9319  C  C5    . DT  J  5 16  ? 25.744  -7.260  48.229  1.00 152.80 ? -58  DT  J C5    1 
ATOM   9320  C  C7    . DT  J  5 16  ? 27.086  -6.803  47.734  1.00 152.87 ? -58  DT  J C7    1 
ATOM   9321  C  C6    . DT  J  5 16  ? 25.434  -8.564  48.257  1.00 152.86 ? -58  DT  J C6    1 
ATOM   9322  P  P     . DT  J  5 17  ? 23.140  -14.245 46.325  1.00 150.56 ? -57  DT  J P     1 
ATOM   9323  O  OP1   . DT  J  5 17  ? 23.091  -15.697 46.615  1.00 150.64 ? -57  DT  J OP1   1 
ATOM   9324  O  OP2   . DT  J  5 17  ? 24.097  -13.727 45.316  1.00 150.50 ? -57  DT  J OP2   1 
ATOM   9325  O  "O5'" . DT  J  5 17  ? 21.668  -13.766 45.897  1.00 149.19 ? -57  DT  J "O5'" 1 
ATOM   9326  C  "C5'" . DT  J  5 17  ? 20.834  -12.967 46.757  1.00 146.70 ? -57  DT  J "C5'" 1 
ATOM   9327  C  "C4'" . DT  J  5 17  ? 19.938  -12.007 45.974  1.00 144.79 ? -57  DT  J "C4'" 1 
ATOM   9328  O  "O4'" . DT  J  5 17  ? 20.315  -10.630 46.253  1.00 144.53 ? -57  DT  J "O4'" 1 
ATOM   9329  C  "C3'" . DT  J  5 17  ? 19.969  -12.152 44.447  1.00 143.45 ? -57  DT  J "C3'" 1 
ATOM   9330  O  "O3'" . DT  J  5 17  ? 18.653  -11.948 43.904  1.00 141.27 ? -57  DT  J "O3'" 1 
ATOM   9331  C  "C2'" . DT  J  5 17  ? 20.927  -11.034 44.042  1.00 143.78 ? -57  DT  J "C2'" 1 
ATOM   9332  C  "C1'" . DT  J  5 17  ? 20.463  -9.953  45.020  1.00 144.70 ? -57  DT  J "C1'" 1 
ATOM   9333  N  N1    . DT  J  5 17  ? 21.362  -8.756  45.207  1.00 145.00 ? -57  DT  J N1    1 
ATOM   9334  C  C2    . DT  J  5 17  ? 20.896  -7.676  45.950  1.00 145.14 ? -57  DT  J C2    1 
ATOM   9335  O  O2    . DT  J  5 17  ? 19.793  -7.626  46.476  1.00 145.01 ? -57  DT  J O2    1 
ATOM   9336  N  N3    . DT  J  5 17  ? 21.785  -6.632  46.063  1.00 145.33 ? -57  DT  J N3    1 
ATOM   9337  C  C4    . DT  J  5 17  ? 23.063  -6.553  45.524  1.00 145.18 ? -57  DT  J C4    1 
ATOM   9338  O  O4    . DT  J  5 17  ? 23.769  -5.559  45.695  1.00 145.01 ? -57  DT  J O4    1 
ATOM   9339  C  C5    . DT  J  5 17  ? 23.491  -7.714  44.759  1.00 145.15 ? -57  DT  J C5    1 
ATOM   9340  C  C7    . DT  J  5 17  ? 24.852  -7.768  44.119  1.00 145.05 ? -57  DT  J C7    1 
ATOM   9341  C  C6    . DT  J  5 17  ? 22.632  -8.741  44.640  1.00 145.01 ? -57  DT  J C6    1 
ATOM   9342  P  P     . DG  J  5 18  ? 17.554  -13.114 43.721  1.00 139.10 ? -56  DG  J P     1 
ATOM   9343  O  OP1   . DG  J  5 18  ? 17.665  -14.079 44.840  1.00 139.18 ? -56  DG  J OP1   1 
ATOM   9344  O  OP2   . DG  J  5 18  ? 17.655  -13.580 42.316  1.00 138.98 ? -56  DG  J OP2   1 
ATOM   9345  O  "O5'" . DG  J  5 18  ? 16.149  -12.354 43.885  1.00 136.30 ? -56  DG  J "O5'" 1 
ATOM   9346  C  "C5'" . DG  J  5 18  ? 16.001  -11.207 44.733  1.00 131.68 ? -56  DG  J "C5'" 1 
ATOM   9347  C  "C4'" . DG  J  5 18  ? 15.703  -9.934  43.942  1.00 128.43 ? -56  DG  J "C4'" 1 
ATOM   9348  O  "O4'" . DG  J  5 18  ? 16.908  -9.143  43.751  1.00 127.63 ? -56  DG  J "O4'" 1 
ATOM   9349  C  "C3'" . DG  J  5 18  ? 15.099  -10.084 42.546  1.00 126.21 ? -56  DG  J "C3'" 1 
ATOM   9350  O  "O3'" . DG  J  5 18  ? 14.215  -8.982  42.375  1.00 123.28 ? -56  DG  J "O3'" 1 
ATOM   9351  C  "C2'" . DG  J  5 18  ? 16.322  -9.951  41.642  1.00 126.23 ? -56  DG  J "C2'" 1 
ATOM   9352  C  "C1'" . DG  J  5 18  ? 17.048  -8.829  42.379  1.00 126.91 ? -56  DG  J "C1'" 1 
ATOM   9353  N  N9    . DG  J  5 18  ? 18.471  -8.631  42.082  1.00 126.92 ? -56  DG  J N9    1 
ATOM   9354  C  C8    . DG  J  5 18  ? 19.359  -9.481  41.458  1.00 126.96 ? -56  DG  J C8    1 
ATOM   9355  N  N7    . DG  J  5 18  ? 20.568  -8.993  41.352  1.00 126.96 ? -56  DG  J N7    1 
ATOM   9356  C  C5    . DG  J  5 18  ? 20.481  -7.735  41.940  1.00 127.06 ? -56  DG  J C5    1 
ATOM   9357  C  C6    . DG  J  5 18  ? 21.466  -6.722  42.122  1.00 127.10 ? -56  DG  J C6    1 
ATOM   9358  O  O6    . DG  J  5 18  ? 22.662  -6.739  41.790  1.00 127.06 ? -56  DG  J O6    1 
ATOM   9359  N  N1    . DG  J  5 18  ? 20.951  -5.592  42.768  1.00 127.05 ? -56  DG  J N1    1 
ATOM   9360  C  C2    . DG  J  5 18  ? 19.641  -5.456  43.186  1.00 127.14 ? -56  DG  J C2    1 
ATOM   9361  N  N2    . DG  J  5 18  ? 19.307  -4.304  43.786  1.00 127.01 ? -56  DG  J N2    1 
ATOM   9362  N  N3    . DG  J  5 18  ? 18.711  -6.393  43.018  1.00 127.26 ? -56  DG  J N3    1 
ATOM   9363  C  C4    . DG  J  5 18  ? 19.196  -7.501  42.392  1.00 127.09 ? -56  DG  J C4    1 
ATOM   9364  P  P     . DC  J  5 19  ? 12.773  -9.069  41.690  1.00 119.87 ? -55  DC  J P     1 
ATOM   9365  O  OP1   . DC  J  5 19  ? 11.792  -9.502  42.710  1.00 119.43 ? -55  DC  J OP1   1 
ATOM   9366  O  OP2   . DC  J  5 19  ? 12.894  -9.794  40.409  1.00 119.77 ? -55  DC  J OP2   1 
ATOM   9367  O  "O5'" . DC  J  5 19  ? 12.544  -7.525  41.324  1.00 120.66 ? -55  DC  J "O5'" 1 
ATOM   9368  C  "C5'" . DC  J  5 19  ? 12.621  -6.505  42.329  1.00 120.46 ? -55  DC  J "C5'" 1 
ATOM   9369  C  "C4'" . DC  J  5 19  ? 13.473  -5.313  41.906  1.00 120.40 ? -55  DC  J "C4'" 1 
ATOM   9370  O  "O4'" . DC  J  5 19  ? 14.834  -5.767  41.722  1.00 120.17 ? -55  DC  J "O4'" 1 
ATOM   9371  C  "C3'" . DC  J  5 19  ? 13.076  -4.605  40.607  1.00 120.52 ? -55  DC  J "C3'" 1 
ATOM   9372  O  "O3'" . DC  J  5 19  ? 12.359  -3.369  40.794  1.00 120.66 ? -55  DC  J "O3'" 1 
ATOM   9373  C  "C2'" . DC  J  5 19  ? 14.388  -4.329  39.873  1.00 120.35 ? -55  DC  J "C2'" 1 
ATOM   9374  C  "C1'" . DC  J  5 19  ? 15.467  -4.896  40.804  1.00 120.10 ? -55  DC  J "C1'" 1 
ATOM   9375  N  N1    . DC  J  5 19  ? 16.508  -5.629  40.022  1.00 119.90 ? -55  DC  J N1    1 
ATOM   9376  C  C2    . DC  J  5 19  ? 17.848  -5.184  40.044  1.00 119.51 ? -55  DC  J C2    1 
ATOM   9377  O  O2    . DC  J  5 19  ? 18.166  -4.193  40.725  1.00 119.71 ? -55  DC  J O2    1 
ATOM   9378  N  N3    . DC  J  5 19  ? 18.768  -5.869  39.309  1.00 119.26 ? -55  DC  J N3    1 
ATOM   9379  C  C4    . DC  J  5 19  ? 18.394  -6.938  38.589  1.00 119.79 ? -55  DC  J C4    1 
ATOM   9380  N  N4    . DC  J  5 19  ? 19.335  -7.578  37.888  1.00 119.76 ? -55  DC  J N4    1 
ATOM   9381  C  C5    . DC  J  5 19  ? 17.036  -7.401  38.548  1.00 120.02 ? -55  DC  J C5    1 
ATOM   9382  C  C6    . DC  J  5 19  ? 16.135  -6.721  39.272  1.00 119.82 ? -55  DC  J C6    1 
ATOM   9383  P  P     . DG  J  5 20  ? 11.301  -2.914  39.664  1.00 121.45 ? -54  DG  J P     1 
ATOM   9384  O  OP1   . DG  J  5 20  ? 9.982   -2.777  40.308  1.00 121.39 ? -54  DG  J OP1   1 
ATOM   9385  O  OP2   . DG  J  5 20  ? 11.438  -3.813  38.490  1.00 120.97 ? -54  DG  J OP2   1 
ATOM   9386  O  "O5'" . DG  J  5 20  ? 11.764  -1.460  39.186  1.00 123.85 ? -54  DG  J "O5'" 1 
ATOM   9387  C  "C5'" . DG  J  5 20  ? 12.333  -0.452  40.036  1.00 126.00 ? -54  DG  J "C5'" 1 
ATOM   9388  C  "C4'" . DG  J  5 20  ? 13.420  0.295   39.267  1.00 127.68 ? -54  DG  J "C4'" 1 
ATOM   9389  O  "O4'" . DG  J  5 20  ? 14.510  -0.625  38.988  1.00 127.15 ? -54  DG  J "O4'" 1 
ATOM   9390  C  "C3'" . DG  J  5 20  ? 13.009  0.904   37.917  1.00 129.21 ? -54  DG  J "C3'" 1 
ATOM   9391  O  "O3'" . DG  J  5 20  ? 13.556  2.225   37.773  1.00 131.98 ? -54  DG  J "O3'" 1 
ATOM   9392  C  "C2'" . DG  J  5 20  ? 13.586  -0.065  36.878  1.00 127.96 ? -54  DG  J "C2'" 1 
ATOM   9393  C  "C1'" . DG  J  5 20  ? 14.819  -0.583  37.611  1.00 126.21 ? -54  DG  J "C1'" 1 
ATOM   9394  N  N9    . DG  J  5 20  ? 15.300  -1.893  37.186  1.00 125.72 ? -54  DG  J N9    1 
ATOM   9395  C  C8    . DG  J  5 20  ? 14.601  -3.007  36.783  1.00 125.65 ? -54  DG  J C8    1 
ATOM   9396  N  N7    . DG  J  5 20  ? 15.372  -4.016  36.460  1.00 125.69 ? -54  DG  J N7    1 
ATOM   9397  C  C5    . DG  J  5 20  ? 16.664  -3.537  36.655  1.00 125.80 ? -54  DG  J C5    1 
ATOM   9398  C  C6    . DG  J  5 20  ? 17.933  -4.157  36.478  1.00 125.66 ? -54  DG  J C6    1 
ATOM   9399  O  O6    . DG  J  5 20  ? 18.176  -5.307  36.086  1.00 125.48 ? -54  DG  J O6    1 
ATOM   9400  N  N1    . DG  J  5 20  ? 18.990  -3.292  36.799  1.00 125.69 ? -54  DG  J N1    1 
ATOM   9401  C  C2    . DG  J  5 20  ? 18.834  -1.985  37.243  1.00 125.76 ? -54  DG  J C2    1 
ATOM   9402  N  N2    . DG  J  5 20  ? 19.935  -1.269  37.513  1.00 125.75 ? -54  DG  J N2    1 
ATOM   9403  N  N3    . DG  J  5 20  ? 17.658  -1.401  37.414  1.00 125.62 ? -54  DG  J N3    1 
ATOM   9404  C  C4    . DG  J  5 20  ? 16.626  -2.231  37.106  1.00 125.90 ? -54  DG  J C4    1 
ATOM   9405  P  P     . DG  J  5 21  ? 12.847  3.382   36.897  1.00 134.14 ? -53  DG  J P     1 
ATOM   9406  O  OP1   . DG  J  5 21  ? 11.981  4.170   37.815  1.00 133.71 ? -53  DG  J OP1   1 
ATOM   9407  O  OP2   . DG  J  5 21  ? 12.266  2.773   35.673  1.00 134.04 ? -53  DG  J OP2   1 
ATOM   9408  O  "O5'" . DG  J  5 21  ? 14.102  4.284   36.431  1.00 135.18 ? -53  DG  J "O5'" 1 
ATOM   9409  C  "C5'" . DG  J  5 21  ? 15.465  3.992   36.824  1.00 136.11 ? -53  DG  J "C5'" 1 
ATOM   9410  C  "C4'" . DG  J  5 21  ? 16.421  3.802   35.648  1.00 136.77 ? -53  DG  J "C4'" 1 
ATOM   9411  O  "O4'" . DG  J  5 21  ? 16.923  2.435   35.622  1.00 136.60 ? -53  DG  J "O4'" 1 
ATOM   9412  C  "C3'" . DG  J  5 21  ? 15.874  4.095   34.244  1.00 137.48 ? -53  DG  J "C3'" 1 
ATOM   9413  O  "O3'" . DG  J  5 21  ? 16.728  5.050   33.552  1.00 138.50 ? -53  DG  J "O3'" 1 
ATOM   9414  C  "C2'" . DG  J  5 21  ? 15.842  2.703   33.600  1.00 137.15 ? -53  DG  J "C2'" 1 
ATOM   9415  C  "C1'" . DG  J  5 21  ? 17.042  2.041   34.269  1.00 136.43 ? -53  DG  J "C1'" 1 
ATOM   9416  N  N9    . DG  J  5 21  ? 17.107  0.581   34.131  1.00 136.19 ? -53  DG  J N9    1 
ATOM   9417  C  C8    . DG  J  5 21  ? 16.063  -0.314  34.147  1.00 136.23 ? -53  DG  J C8    1 
ATOM   9418  N  N7    . DG  J  5 21  ? 16.429  -1.558  33.991  1.00 136.09 ? -53  DG  J N7    1 
ATOM   9419  C  C5    . DG  J  5 21  ? 17.809  -1.494  33.864  1.00 136.06 ? -53  DG  J C5    1 
ATOM   9420  C  C6    . DG  J  5 21  ? 18.763  -2.532  33.671  1.00 136.22 ? -53  DG  J C6    1 
ATOM   9421  O  O6    . DG  J  5 21  ? 18.568  -3.756  33.574  1.00 136.15 ? -53  DG  J O6    1 
ATOM   9422  N  N1    . DG  J  5 21  ? 20.063  -2.025  33.590  1.00 136.33 ? -53  DG  J N1    1 
ATOM   9423  C  C2    . DG  J  5 21  ? 20.400  -0.688  33.684  1.00 136.30 ? -53  DG  J C2    1 
ATOM   9424  N  N2    . DG  J  5 21  ? 21.703  -0.377  33.584  1.00 136.19 ? -53  DG  J N2    1 
ATOM   9425  N  N3    . DG  J  5 21  ? 19.510  0.285   33.863  1.00 136.13 ? -53  DG  J N3    1 
ATOM   9426  C  C4    . DG  J  5 21  ? 18.239  -0.184  33.945  1.00 136.00 ? -53  DG  J C4    1 
ATOM   9427  P  P     . DA  J  5 22  ? 16.454  5.604   32.059  1.00 139.44 ? -52  DA  J P     1 
ATOM   9428  O  OP1   . DA  J  5 22  ? 16.449  7.085   32.149  1.00 138.85 ? -52  DA  J OP1   1 
ATOM   9429  O  OP2   . DA  J  5 22  ? 15.275  4.903   31.486  1.00 139.15 ? -52  DA  J OP2   1 
ATOM   9430  O  "O5'" . DA  J  5 22  ? 17.761  5.143   31.236  1.00 139.51 ? -52  DA  J "O5'" 1 
ATOM   9431  C  "C5'" . DA  J  5 22  ? 17.986  3.773   30.882  1.00 140.20 ? -52  DA  J "C5'" 1 
ATOM   9432  C  "C4'" . DA  J  5 22  ? 19.470  3.449   30.845  1.00 140.91 ? -52  DA  J "C4'" 1 
ATOM   9433  O  "O4'" . DA  J  5 22  ? 19.756  2.206   31.529  1.00 140.97 ? -52  DA  J "O4'" 1 
ATOM   9434  C  "C3'" . DA  J  5 22  ? 20.024  3.302   29.440  1.00 142.05 ? -52  DA  J "C3'" 1 
ATOM   9435  O  "O3'" . DA  J  5 22  ? 21.128  4.182   29.295  1.00 143.78 ? -52  DA  J "O3'" 1 
ATOM   9436  C  "C2'" . DA  J  5 22  ? 20.451  1.844   29.283  1.00 141.52 ? -52  DA  J "C2'" 1 
ATOM   9437  C  "C1'" . DA  J  5 22  ? 20.252  1.213   30.649  1.00 140.97 ? -52  DA  J "C1'" 1 
ATOM   9438  N  N9    . DA  J  5 22  ? 19.298  0.105   30.624  1.00 141.01 ? -52  DA  J N9    1 
ATOM   9439  C  C8    . DA  J  5 22  ? 17.944  0.198   30.787  1.00 141.05 ? -52  DA  J C8    1 
ATOM   9440  N  N7    . DA  J  5 22  ? 17.317  -0.952  30.725  1.00 141.10 ? -52  DA  J N7    1 
ATOM   9441  C  C5    . DA  J  5 22  ? 18.324  -1.871  30.499  1.00 140.82 ? -52  DA  J C5    1 
ATOM   9442  C  C6    . DA  J  5 22  ? 18.308  -3.275  30.342  1.00 140.82 ? -52  DA  J C6    1 
ATOM   9443  N  N6    . DA  J  5 22  ? 17.190  -4.009  30.379  1.00 140.79 ? -52  DA  J N6    1 
ATOM   9444  N  N1    . DA  J  5 22  ? 19.487  -3.897  30.130  1.00 140.93 ? -52  DA  J N1    1 
ATOM   9445  C  C2    . DA  J  5 22  ? 20.605  -3.155  30.090  1.00 141.06 ? -52  DA  J C2    1 
ATOM   9446  N  N3    . DA  J  5 22  ? 20.742  -1.832  30.229  1.00 140.97 ? -52  DA  J N3    1 
ATOM   9447  C  C4    . DA  J  5 22  ? 19.554  -1.238  30.434  1.00 140.87 ? -52  DA  J C4    1 
ATOM   9448  P  P     . DT  J  5 23  ? 21.342  4.974   27.915  1.00 144.96 ? -51  DT  J P     1 
ATOM   9449  O  OP1   . DT  J  5 23  ? 22.389  5.997   28.147  1.00 144.97 ? -51  DT  J OP1   1 
ATOM   9450  O  OP2   . DT  J  5 23  ? 20.012  5.392   27.400  1.00 144.71 ? -51  DT  J OP2   1 
ATOM   9451  O  "O5'" . DT  J  5 23  ? 21.929  3.839   26.944  1.00 145.28 ? -51  DT  J "O5'" 1 
ATOM   9452  C  "C5'" . DT  J  5 23  ? 23.150  3.151   27.249  1.00 145.49 ? -51  DT  J "C5'" 1 
ATOM   9453  C  "C4'" . DT  J  5 23  ? 23.288  1.912   26.382  1.00 145.70 ? -51  DT  J "C4'" 1 
ATOM   9454  O  "O4'" . DT  J  5 23  ? 22.540  0.809   26.960  1.00 145.41 ? -51  DT  J "O4'" 1 
ATOM   9455  C  "C3'" . DT  J  5 23  ? 22.782  2.085   24.945  1.00 146.14 ? -51  DT  J "C3'" 1 
ATOM   9456  O  "O3'" . DT  J  5 23  ? 23.832  1.707   24.022  1.00 146.85 ? -51  DT  J "O3'" 1 
ATOM   9457  C  "C2'" . DT  J  5 23  ? 21.533  1.205   24.919  1.00 145.92 ? -51  DT  J "C2'" 1 
ATOM   9458  C  "C1'" . DT  J  5 23  ? 21.970  0.106   25.880  1.00 145.86 ? -51  DT  J "C1'" 1 
ATOM   9459  N  N1    . DT  J  5 23  ? 20.866  -0.804  26.318  1.00 146.03 ? -51  DT  J N1    1 
ATOM   9460  C  C2    . DT  J  5 23  ? 21.094  -2.170  26.415  1.00 146.05 ? -51  DT  J C2    1 
ATOM   9461  O  O2    . DT  J  5 23  ? 22.166  -2.701  26.179  1.00 145.89 ? -51  DT  J O2    1 
ATOM   9462  N  N3    . DT  J  5 23  ? 20.002  -2.907  26.812  1.00 146.11 ? -51  DT  J N3    1 
ATOM   9463  C  C4    . DT  J  5 23  ? 18.734  -2.428  27.111  1.00 146.01 ? -51  DT  J C4    1 
ATOM   9464  O  O4    . DT  J  5 23  ? 17.827  -3.181  27.456  1.00 145.85 ? -51  DT  J O4    1 
ATOM   9465  C  C5    . DT  J  5 23  ? 18.562  -0.994  26.981  1.00 146.08 ? -51  DT  J C5    1 
ATOM   9466  C  C7    . DT  J  5 23  ? 17.244  -0.333  27.269  1.00 146.04 ? -51  DT  J C7    1 
ATOM   9467  C  C6    . DT  J  5 23  ? 19.619  -0.267  26.594  1.00 146.10 ? -51  DT  J C6    1 
ATOM   9468  P  P     . DC  J  5 24  ? 23.621  1.036   22.570  1.00 147.30 ? -50  DC  J P     1 
ATOM   9469  O  OP1   . DC  J  5 24  ? 24.928  1.041   21.866  1.00 147.20 ? -50  DC  J OP1   1 
ATOM   9470  O  OP2   . DC  J  5 24  ? 22.452  1.679   21.918  1.00 147.44 ? -50  DC  J OP2   1 
ATOM   9471  O  "O5'" . DC  J  5 24  ? 23.239  -0.478  22.935  1.00 146.64 ? -50  DC  J "O5'" 1 
ATOM   9472  C  "C5'" . DC  J  5 24  ? 24.223  -1.485  23.164  1.00 145.55 ? -50  DC  J "C5'" 1 
ATOM   9473  C  "C4'" . DC  J  5 24  ? 23.738  -2.790  22.563  1.00 145.07 ? -50  DC  J "C4'" 1 
ATOM   9474  O  "O4'" . DC  J  5 24  ? 22.576  -3.246  23.307  1.00 145.13 ? -50  DC  J "O4'" 1 
ATOM   9475  C  "C3'" . DC  J  5 24  ? 23.297  -2.667  21.105  1.00 144.78 ? -50  DC  J "C3'" 1 
ATOM   9476  O  "O3'" . DC  J  5 24  ? 23.865  -3.687  20.293  1.00 144.31 ? -50  DC  J "O3'" 1 
ATOM   9477  C  "C2'" . DC  J  5 24  ? 21.780  -2.808  21.163  1.00 144.91 ? -50  DC  J "C2'" 1 
ATOM   9478  C  "C1'" . DC  J  5 24  ? 21.606  -3.701  22.384  1.00 144.91 ? -50  DC  J "C1'" 1 
ATOM   9479  N  N1    . DC  J  5 24  ? 20.228  -3.626  22.964  1.00 144.77 ? -50  DC  J N1    1 
ATOM   9480  C  C2    . DC  J  5 24  ? 19.529  -4.807  23.259  1.00 144.74 ? -50  DC  J C2    1 
ATOM   9481  O  O2    . DC  J  5 24  ? 20.057  -5.908  23.051  1.00 144.67 ? -50  DC  J O2    1 
ATOM   9482  N  N3    . DC  J  5 24  ? 18.276  -4.708  23.775  1.00 144.83 ? -50  DC  J N3    1 
ATOM   9483  C  C4    . DC  J  5 24  ? 17.727  -3.507  23.988  1.00 144.83 ? -50  DC  J C4    1 
ATOM   9484  N  N4    . DC  J  5 24  ? 16.494  -3.467  24.497  1.00 144.89 ? -50  DC  J N4    1 
ATOM   9485  C  C5    . DC  J  5 24  ? 18.415  -2.294  23.690  1.00 144.79 ? -50  DC  J C5    1 
ATOM   9486  C  C6    . DC  J  5 24  ? 19.650  -2.403  23.186  1.00 144.84 ? -50  DC  J C6    1 
ATOM   9487  P  P     . DG  J  5 25  ? 23.936  -3.484  18.701  1.00 144.08 ? -49  DG  J P     1 
ATOM   9488  O  OP1   . DG  J  5 25  ? 24.938  -2.428  18.425  1.00 143.73 ? -49  DG  J OP1   1 
ATOM   9489  O  OP2   . DG  J  5 25  ? 22.559  -3.313  18.182  1.00 144.06 ? -49  DG  J OP2   1 
ATOM   9490  O  "O5'" . DG  J  5 25  ? 24.504  -4.896  18.180  1.00 142.83 ? -49  DG  J "O5'" 1 
ATOM   9491  C  "C5'" . DG  J  5 25  ? 24.207  -6.132  18.845  1.00 140.37 ? -49  DG  J "C5'" 1 
ATOM   9492  C  "C4'" . DG  J  5 25  ? 22.908  -6.742  18.348  1.00 138.88 ? -49  DG  J "C4'" 1 
ATOM   9493  O  "O4'" . DG  J  5 25  ? 21.812  -6.296  19.184  1.00 138.35 ? -49  DG  J "O4'" 1 
ATOM   9494  C  "C3'" . DG  J  5 25  ? 22.511  -6.402  16.910  1.00 138.17 ? -49  DG  J "C3'" 1 
ATOM   9495  O  "O3'" . DG  J  5 25  ? 22.559  -7.604  16.121  1.00 138.08 ? -49  DG  J "O3'" 1 
ATOM   9496  C  "C2'" . DG  J  5 25  ? 21.132  -5.745  17.042  1.00 137.90 ? -49  DG  J "C2'" 1 
ATOM   9497  C  "C1'" . DG  J  5 25  ? 20.656  -6.308  18.377  1.00 137.49 ? -49  DG  J "C1'" 1 
ATOM   9498  N  N9    . DG  J  5 25  ? 19.561  -5.584  19.030  1.00 137.39 ? -49  DG  J N9    1 
ATOM   9499  C  C8    . DG  J  5 25  ? 19.401  -4.219  19.135  1.00 137.23 ? -49  DG  J C8    1 
ATOM   9500  N  N7    . DG  J  5 25  ? 18.321  -3.861  19.776  1.00 137.12 ? -49  DG  J N7    1 
ATOM   9501  C  C5    . DG  J  5 25  ? 17.720  -5.066  20.117  1.00 137.13 ? -49  DG  J C5    1 
ATOM   9502  C  C6    . DG  J  5 25  ? 16.517  -5.312  20.822  1.00 137.00 ? -49  DG  J C6    1 
ATOM   9503  O  O6    . DG  J  5 25  ? 15.736  -4.477  21.290  1.00 137.01 ? -49  DG  J O6    1 
ATOM   9504  N  N1    . DG  J  5 25  ? 16.253  -6.676  20.961  1.00 137.04 ? -49  DG  J N1    1 
ATOM   9505  C  C2    . DG  J  5 25  ? 17.062  -7.679  20.473  1.00 137.06 ? -49  DG  J C2    1 
ATOM   9506  N  N2    . DG  J  5 25  ? 16.658  -8.935  20.698  1.00 137.12 ? -49  DG  J N2    1 
ATOM   9507  N  N3    . DG  J  5 25  ? 18.195  -7.464  19.810  1.00 137.03 ? -49  DG  J N3    1 
ATOM   9508  C  C4    . DG  J  5 25  ? 18.466  -6.138  19.666  1.00 137.25 ? -49  DG  J C4    1 
ATOM   9509  P  P     . DT  J  5 26  ? 21.303  -8.305  15.395  1.00 138.37 ? -48  DT  J P     1 
ATOM   9510  O  OP1   . DT  J  5 26  ? 21.811  -9.515  14.698  1.00 138.36 ? -48  DT  J OP1   1 
ATOM   9511  O  OP2   . DT  J  5 26  ? 20.570  -7.287  14.595  1.00 138.18 ? -48  DT  J OP2   1 
ATOM   9512  O  "O5'" . DT  J  5 26  ? 20.386  -8.758  16.640  1.00 137.37 ? -48  DT  J "O5'" 1 
ATOM   9513  C  "C5'" . DT  J  5 26  ? 19.872  -10.085 16.779  1.00 135.46 ? -48  DT  J "C5'" 1 
ATOM   9514  C  "C4'" . DT  J  5 26  ? 18.369  -10.094 16.561  1.00 133.86 ? -48  DT  J "C4'" 1 
ATOM   9515  O  "O4'" . DT  J  5 26  ? 17.771  -8.891  17.116  1.00 133.98 ? -48  DT  J "O4'" 1 
ATOM   9516  C  "C3'" . DT  J  5 26  ? 17.920  -10.143 15.102  1.00 132.54 ? -48  DT  J "C3'" 1 
ATOM   9517  O  "O3'" . DT  J  5 26  ? 16.933  -11.151 14.958  1.00 130.52 ? -48  DT  J "O3'" 1 
ATOM   9518  C  "C2'" . DT  J  5 26  ? 17.308  -8.761  14.864  1.00 133.25 ? -48  DT  J "C2'" 1 
ATOM   9519  C  "C1'" . DT  J  5 26  ? 16.727  -8.496  16.246  1.00 133.72 ? -48  DT  J "C1'" 1 
ATOM   9520  N  N1    . DT  J  5 26  ? 16.318  -7.087  16.560  1.00 133.68 ? -48  DT  J N1    1 
ATOM   9521  C  C2    . DT  J  5 26  ? 15.325  -6.882  17.501  1.00 133.56 ? -48  DT  J C2    1 
ATOM   9522  O  O2    . DT  J  5 26  ? 14.751  -7.779  18.093  1.00 133.62 ? -48  DT  J O2    1 
ATOM   9523  N  N3    . DT  J  5 26  ? 15.017  -5.565  17.731  1.00 133.64 ? -48  DT  J N3    1 
ATOM   9524  C  C4    . DT  J  5 26  ? 15.589  -4.457  17.130  1.00 133.69 ? -48  DT  J C4    1 
ATOM   9525  O  O4    . DT  J  5 26  ? 15.233  -3.318  17.417  1.00 133.82 ? -48  DT  J O4    1 
ATOM   9526  C  C5    . DT  J  5 26  ? 16.624  -4.738  16.156  1.00 133.71 ? -48  DT  J C5    1 
ATOM   9527  C  C7    . DT  J  5 26  ? 17.327  -3.622  15.433  1.00 133.58 ? -48  DT  J C7    1 
ATOM   9528  C  C6    . DT  J  5 26  ? 16.934  -6.023  15.922  1.00 133.64 ? -48  DT  J C6    1 
ATOM   9529  P  P     . DA  J  5 27  ? 16.591  -11.770 13.524  1.00 128.96 ? -47  DA  J P     1 
ATOM   9530  O  OP1   . DA  J  5 27  ? 17.721  -12.680 13.209  1.00 128.58 ? -47  DA  J OP1   1 
ATOM   9531  O  OP2   . DA  J  5 27  ? 16.214  -10.673 12.596  1.00 128.28 ? -47  DA  J OP2   1 
ATOM   9532  O  "O5'" . DA  J  5 27  ? 15.249  -12.617 13.788  1.00 127.64 ? -47  DA  J "O5'" 1 
ATOM   9533  C  "C5'" . DA  J  5 27  ? 15.180  -13.659 14.780  1.00 124.99 ? -47  DA  J "C5'" 1 
ATOM   9534  C  "C4'" . DA  J  5 27  ? 13.848  -13.688 15.533  1.00 122.52 ? -47  DA  J "C4'" 1 
ATOM   9535  O  "O4'" . DA  J  5 27  ? 13.460  -12.366 15.991  1.00 122.04 ? -47  DA  J "O4'" 1 
ATOM   9536  C  "C3'" . DA  J  5 27  ? 12.646  -14.216 14.763  1.00 120.85 ? -47  DA  J "C3'" 1 
ATOM   9537  O  "O3'" . DA  J  5 27  ? 11.815  -14.934 15.670  1.00 118.72 ? -47  DA  J "O3'" 1 
ATOM   9538  C  "C2'" . DA  J  5 27  ? 11.974  -12.948 14.236  1.00 121.00 ? -47  DA  J "C2'" 1 
ATOM   9539  C  "C1'" . DA  J  5 27  ? 12.277  -11.939 15.341  1.00 121.60 ? -47  DA  J "C1'" 1 
ATOM   9540  N  N9    . DA  J  5 27  ? 12.527  -10.564 14.913  1.00 121.56 ? -47  DA  J N9    1 
ATOM   9541  C  C8    . DA  J  5 27  ? 13.207  -10.130 13.810  1.00 121.45 ? -47  DA  J C8    1 
ATOM   9542  N  N7    . DA  J  5 27  ? 13.276  -8.826  13.709  1.00 121.43 ? -47  DA  J N7    1 
ATOM   9543  C  C5    . DA  J  5 27  ? 12.604  -8.370  14.826  1.00 121.56 ? -47  DA  J C5    1 
ATOM   9544  C  C6    . DA  J  5 27  ? 12.319  -7.076  15.311  1.00 121.61 ? -47  DA  J C6    1 
ATOM   9545  N  N6    . DA  J  5 27  ? 12.698  -5.954  14.694  1.00 121.60 ? -47  DA  J N6    1 
ATOM   9546  N  N1    . DA  J  5 27  ? 11.617  -6.973  16.461  1.00 121.53 ? -47  DA  J N1    1 
ATOM   9547  C  C2    . DA  J  5 27  ? 11.231  -8.093  17.087  1.00 121.55 ? -47  DA  J C2    1 
ATOM   9548  N  N3    . DA  J  5 27  ? 11.438  -9.360  16.730  1.00 121.66 ? -47  DA  J N3    1 
ATOM   9549  C  C4    . DA  J  5 27  ? 12.136  -9.430  15.581  1.00 121.73 ? -47  DA  J C4    1 
ATOM   9550  P  P     . DG  J  5 28  ? 10.614  -15.876 15.167  1.00 117.39 ? -46  DG  J P     1 
ATOM   9551  O  OP1   . DG  J  5 28  ? 10.546  -17.035 16.087  1.00 117.11 ? -46  DG  J OP1   1 
ATOM   9552  O  OP2   . DG  J  5 28  ? 10.736  -16.084 13.703  1.00 117.59 ? -46  DG  J OP2   1 
ATOM   9553  O  "O5'" . DG  J  5 28  ? 9.320   -14.964 15.389  1.00 115.86 ? -46  DG  J "O5'" 1 
ATOM   9554  C  "C5'" . DG  J  5 28  ? 9.025   -14.425 16.682  1.00 112.96 ? -46  DG  J "C5'" 1 
ATOM   9555  C  "C4'" . DG  J  5 28  ? 8.181   -13.167 16.564  1.00 109.80 ? -46  DG  J "C4'" 1 
ATOM   9556  O  "O4'" . DG  J  5 28  ? 8.921   -12.101 15.915  1.00 109.13 ? -46  DG  J "O4'" 1 
ATOM   9557  C  "C3'" . DG  J  5 28  ? 6.907   -13.350 15.756  1.00 107.32 ? -46  DG  J "C3'" 1 
ATOM   9558  O  "O3'" . DG  J  5 28  ? 5.851   -12.964 16.592  1.00 104.61 ? -46  DG  J "O3'" 1 
ATOM   9559  C  "C2'" . DG  J  5 28  ? 7.075   -12.396 14.580  1.00 107.54 ? -46  DG  J "C2'" 1 
ATOM   9560  C  "C1'" . DG  J  5 28  ? 8.004   -11.342 15.169  1.00 108.45 ? -46  DG  J "C1'" 1 
ATOM   9561  N  N9    . DG  J  5 28  ? 8.740   -10.562 14.177  1.00 108.41 ? -46  DG  J N9    1 
ATOM   9562  C  C8    . DG  J  5 28  ? 9.358   -11.064 13.062  1.00 108.49 ? -46  DG  J C8    1 
ATOM   9563  N  N7    . DG  J  5 28  ? 9.941   -10.153 12.340  1.00 109.06 ? -46  DG  J N7    1 
ATOM   9564  C  C5    . DG  J  5 28  ? 9.695   -8.966  13.019  1.00 108.53 ? -46  DG  J C5    1 
ATOM   9565  C  C6    . DG  J  5 28  ? 10.085  -7.639  12.702  1.00 108.28 ? -46  DG  J C6    1 
ATOM   9566  O  O6    . DG  J  5 28  ? 10.748  -7.258  11.734  1.00 108.38 ? -46  DG  J O6    1 
ATOM   9567  N  N1    . DG  J  5 28  ? 9.640   -6.704  13.631  1.00 108.42 ? -46  DG  J N1    1 
ATOM   9568  C  C2    . DG  J  5 28  ? 8.903   -7.025  14.746  1.00 108.70 ? -46  DG  J C2    1 
ATOM   9569  N  N2    . DG  J  5 28  ? 8.566   -5.994  15.531  1.00 108.39 ? -46  DG  J N2    1 
ATOM   9570  N  N3    . DG  J  5 28  ? 8.528   -8.270  15.059  1.00 109.03 ? -46  DG  J N3    1 
ATOM   9571  C  C4    . DG  J  5 28  ? 8.956   -9.197  14.155  1.00 108.47 ? -46  DG  J C4    1 
ATOM   9572  P  P     . DA  J  5 29  ? 4.378   -13.561 16.401  1.00 102.87 ? -45  DA  J P     1 
ATOM   9573  O  OP1   . DA  J  5 29  ? 4.259   -14.752 17.266  1.00 102.99 ? -45  DA  J OP1   1 
ATOM   9574  O  OP2   . DA  J  5 29  ? 4.070   -13.680 14.955  1.00 102.15 ? -45  DA  J OP2   1 
ATOM   9575  O  "O5'" . DA  J  5 29  ? 3.486   -12.391 17.029  1.00 100.25 ? -45  DA  J "O5'" 1 
ATOM   9576  C  "C5'" . DA  J  5 29  ? 4.121   -11.400 17.838  1.00 96.78  ? -45  DA  J "C5'" 1 
ATOM   9577  C  "C4'" . DA  J  5 29  ? 3.839   -10.001 17.325  1.00 93.86  ? -45  DA  J "C4'" 1 
ATOM   9578  O  "O4'" . DA  J  5 29  ? 4.816   -9.588  16.337  1.00 92.55  ? -45  DA  J "O4'" 1 
ATOM   9579  C  "C3'" . DA  J  5 29  ? 2.479   -9.836  16.658  1.00 93.07  ? -45  DA  J "C3'" 1 
ATOM   9580  O  "O3'" . DA  J  5 29  ? 1.969   -8.621  17.113  1.00 91.64  ? -45  DA  J "O3'" 1 
ATOM   9581  C  "C2'" . DA  J  5 29  ? 2.817   -9.693  15.183  1.00 92.68  ? -45  DA  J "C2'" 1 
ATOM   9582  C  "C1'" . DA  J  5 29  ? 4.112   -8.906  15.322  1.00 92.65  ? -45  DA  J "C1'" 1 
ATOM   9583  N  N9    . DA  J  5 29  ? 4.872   -8.869  14.082  1.00 92.70  ? -45  DA  J N9    1 
ATOM   9584  C  C8    . DA  J  5 29  ? 5.069   -9.901  13.207  1.00 92.85  ? -45  DA  J C8    1 
ATOM   9585  N  N7    . DA  J  5 29  ? 5.792   -9.573  12.162  1.00 93.51  ? -45  DA  J N7    1 
ATOM   9586  C  C5    . DA  J  5 29  ? 6.079   -8.228  12.363  1.00 93.46  ? -45  DA  J C5    1 
ATOM   9587  C  C6    . DA  J  5 29  ? 6.810   -7.275  11.613  1.00 92.91  ? -45  DA  J C6    1 
ATOM   9588  N  N6    . DA  J  5 29  ? 7.411   -7.548  10.453  1.00 92.78  ? -45  DA  J N6    1 
ATOM   9589  N  N1    . DA  J  5 29  ? 6.901   -6.020  12.099  1.00 92.72  ? -45  DA  J N1    1 
ATOM   9590  C  C2    . DA  J  5 29  ? 6.301   -5.728  13.259  1.00 92.92  ? -45  DA  J C2    1 
ATOM   9591  N  N3    . DA  J  5 29  ? 5.592   -6.534  14.050  1.00 93.34  ? -45  DA  J N3    1 
ATOM   9592  C  C4    . DA  J  5 29  ? 5.513   -7.779  13.544  1.00 93.03  ? -45  DA  J C4    1 
ATOM   9593  P  P     . DA  J  5 30  ? 0.472   -8.459  17.624  1.00 90.37  ? -44  DA  J P     1 
ATOM   9594  O  OP1   . DA  J  5 30  ? 0.570   -8.500  19.112  1.00 90.25  ? -44  DA  J OP1   1 
ATOM   9595  O  OP2   . DA  J  5 30  ? -0.434  -9.382  16.905  1.00 90.36  ? -44  DA  J OP2   1 
ATOM   9596  O  "O5'" . DA  J  5 30  ? 0.164   -6.973  17.090  1.00 90.76  ? -44  DA  J "O5'" 1 
ATOM   9597  C  "C5'" . DA  J  5 30  ? 0.868   -5.862  17.669  1.00 91.86  ? -44  DA  J "C5'" 1 
ATOM   9598  C  "C4'" . DA  J  5 30  ? 0.981   -4.619  16.791  1.00 92.71  ? -44  DA  J "C4'" 1 
ATOM   9599  O  "O4'" . DA  J  5 30  ? 1.895   -4.846  15.693  1.00 93.58  ? -44  DA  J "O4'" 1 
ATOM   9600  C  "C3'" . DA  J  5 30  ? -0.309  -4.067  16.180  1.00 92.88  ? -44  DA  J "C3'" 1 
ATOM   9601  O  "O3'" . DA  J  5 30  ? -0.352  -2.674  16.455  1.00 92.02  ? -44  DA  J "O3'" 1 
ATOM   9602  C  "C2'" . DA  J  5 30  ? -0.195  -4.375  14.687  1.00 93.15  ? -44  DA  J "C2'" 1 
ATOM   9603  C  "C1'" . DA  J  5 30  ? 1.313   -4.429  14.476  1.00 93.74  ? -44  DA  J "C1'" 1 
ATOM   9604  N  N9    . DA  J  5 30  ? 1.757   -5.371  13.447  1.00 94.14  ? -44  DA  J N9    1 
ATOM   9605  C  C8    . DA  J  5 30  ? 1.372   -6.672  13.256  1.00 93.58  ? -44  DA  J C8    1 
ATOM   9606  N  N7    . DA  J  5 30  ? 1.960   -7.257  12.239  1.00 93.51  ? -44  DA  J N7    1 
ATOM   9607  C  C5    . DA  J  5 30  ? 2.796   -6.277  11.731  1.00 94.12  ? -44  DA  J C5    1 
ATOM   9608  C  C6    . DA  J  5 30  ? 3.697   -6.255  10.645  1.00 93.93  ? -44  DA  J C6    1 
ATOM   9609  N  N6    . DA  J  5 30  ? 3.910   -7.298  9.842   1.00 93.66  ? -44  DA  J N6    1 
ATOM   9610  N  N1    . DA  J  5 30  ? 4.372   -5.106  10.411  1.00 94.06  ? -44  DA  J N1    1 
ATOM   9611  C  C2    . DA  J  5 30  ? 4.160   -4.039  11.206  1.00 93.95  ? -44  DA  J C2    1 
ATOM   9612  N  N3    . DA  J  5 30  ? 3.345   -3.931  12.258  1.00 93.93  ? -44  DA  J N3    1 
ATOM   9613  C  C4    . DA  J  5 30  ? 2.687   -5.100  12.465  1.00 94.72  ? -44  DA  J C4    1 
ATOM   9614  P  P     . DA  J  5 31  ? -1.568  -1.756  15.984  1.00 91.72  ? -43  DA  J P     1 
ATOM   9615  O  OP1   . DA  J  5 31  ? -1.680  -0.644  16.952  1.00 92.50  ? -43  DA  J OP1   1 
ATOM   9616  O  OP2   . DA  J  5 31  ? -2.748  -2.581  15.644  1.00 90.66  ? -43  DA  J OP2   1 
ATOM   9617  O  "O5'" . DA  J  5 31  ? -0.961  -1.162  14.636  1.00 93.55  ? -43  DA  J "O5'" 1 
ATOM   9618  C  "C5'" . DA  J  5 31  ? 0.338   -0.563  14.653  1.00 94.84  ? -43  DA  J "C5'" 1 
ATOM   9619  C  "C4'" . DA  J  5 31  ? 0.646   0.078   13.311  1.00 96.03  ? -43  DA  J "C4'" 1 
ATOM   9620  O  "O4'" . DA  J  5 31  ? 1.108   -0.913  12.361  1.00 95.45  ? -43  DA  J "O4'" 1 
ATOM   9621  C  "C3'" . DA  J  5 31  ? -0.507  0.803   12.623  1.00 97.52  ? -43  DA  J "C3'" 1 
ATOM   9622  O  "O3'" . DA  J  5 31  ? 0.069   2.022   12.138  1.00 100.06 ? -43  DA  J "O3'" 1 
ATOM   9623  C  "C2'" . DA  J  5 31  ? -0.982  -0.179  11.539  1.00 96.09  ? -43  DA  J "C2'" 1 
ATOM   9624  C  "C1'" . DA  J  5 31  ? 0.307   -0.928  11.194  1.00 94.91  ? -43  DA  J "C1'" 1 
ATOM   9625  N  N9    . DA  J  5 31  ? 0.209   -2.343  10.834  1.00 94.66  ? -43  DA  J N9    1 
ATOM   9626  C  C8    . DA  J  5 31  ? -0.546  -3.305  11.443  1.00 94.36  ? -43  DA  J C8    1 
ATOM   9627  N  N7    . DA  J  5 31  ? -0.411  -4.500  10.924  1.00 94.23  ? -43  DA  J N7    1 
ATOM   9628  C  C5    . DA  J  5 31  ? 0.507   -4.324  9.905   1.00 94.44  ? -43  DA  J C5    1 
ATOM   9629  C  C6    . DA  J  5 31  ? 1.075   -5.210  8.963   1.00 94.18  ? -43  DA  J C6    1 
ATOM   9630  N  N6    . DA  J  5 31  ? 0.787   -6.506  8.905   1.00 94.44  ? -43  DA  J N6    1 
ATOM   9631  N  N1    . DA  J  5 31  ? 1.962   -4.718  8.072   1.00 94.60  ? -43  DA  J N1    1 
ATOM   9632  C  C2    . DA  J  5 31  ? 2.265   -3.410  8.121   1.00 94.83  ? -43  DA  J C2    1 
ATOM   9633  N  N3    . DA  J  5 31  ? 1.795   -2.474  8.955   1.00 95.32  ? -43  DA  J N3    1 
ATOM   9634  C  C4    . DA  J  5 31  ? 0.909   -2.997  9.837   1.00 95.10  ? -43  DA  J C4    1 
ATOM   9635  P  P     . DA  J  5 32  ? -0.737  3.148   11.341  1.00 101.69 ? -42  DA  J P     1 
ATOM   9636  O  OP1   . DA  J  5 32  ? -0.046  4.433   11.618  1.00 101.74 ? -42  DA  J OP1   1 
ATOM   9637  O  OP2   . DA  J  5 32  ? -2.195  3.005   11.586  1.00 101.31 ? -42  DA  J OP2   1 
ATOM   9638  O  "O5'" . DA  J  5 32  ? -0.480  2.691   9.828   1.00 103.44 ? -42  DA  J "O5'" 1 
ATOM   9639  C  "C5'" . DA  J  5 32  ? 0.825   2.713   9.231   1.00 105.49 ? -42  DA  J "C5'" 1 
ATOM   9640  C  "C4'" . DA  J  5 32  ? 0.736   2.322   7.764   1.00 107.00 ? -42  DA  J "C4'" 1 
ATOM   9641  O  "O4'" . DA  J  5 32  ? 0.620   0.882   7.674   1.00 106.85 ? -42  DA  J "O4'" 1 
ATOM   9642  C  "C3'" . DA  J  5 32  ? -0.459  2.889   6.992   1.00 108.53 ? -42  DA  J "C3'" 1 
ATOM   9643  O  "O3'" . DA  J  5 32  ? -0.007  3.525   5.789   1.00 111.49 ? -42  DA  J "O3'" 1 
ATOM   9644  C  "C2'" . DA  J  5 32  ? -1.343  1.678   6.699   1.00 107.24 ? -42  DA  J "C2'" 1 
ATOM   9645  C  "C1'" . DA  J  5 32  ? -0.318  0.555   6.680   1.00 106.42 ? -42  DA  J "C1'" 1 
ATOM   9646  N  N9    . DA  J  5 32  ? -0.885  -0.732  7.025   1.00 106.43 ? -42  DA  J N9    1 
ATOM   9647  C  C8    . DA  J  5 32  ? -1.830  -0.967  7.985   1.00 106.69 ? -42  DA  J C8    1 
ATOM   9648  N  N7    . DA  J  5 32  ? -2.175  -2.226  8.085   1.00 107.00 ? -42  DA  J N7    1 
ATOM   9649  C  C5    . DA  J  5 32  ? -1.400  -2.862  7.128   1.00 106.68 ? -42  DA  J C5    1 
ATOM   9650  C  C6    . DA  J  5 32  ? -1.297  -4.213  6.736   1.00 106.27 ? -42  DA  J C6    1 
ATOM   9651  N  N6    . DA  J  5 32  ? -2.015  -5.182  7.301   1.00 106.50 ? -42  DA  J N6    1 
ATOM   9652  N  N1    . DA  J  5 32  ? -0.428  -4.528  5.752   1.00 106.30 ? -42  DA  J N1    1 
ATOM   9653  C  C2    . DA  J  5 32  ? 0.291   -3.544  5.192   1.00 106.60 ? -42  DA  J C2    1 
ATOM   9654  N  N3    . DA  J  5 32  ? 0.284   -2.237  5.476   1.00 106.63 ? -42  DA  J N3    1 
ATOM   9655  C  C4    . DA  J  5 32  ? -0.592  -1.955  6.463   1.00 106.76 ? -42  DA  J C4    1 
ATOM   9656  P  P     . DA  J  5 33  ? -0.977  4.416   4.868   1.00 113.49 ? -41  DA  J P     1 
ATOM   9657  O  OP1   . DA  J  5 33  ? -0.137  5.496   4.296   1.00 113.43 ? -41  DA  J OP1   1 
ATOM   9658  O  OP2   . DA  J  5 33  ? -2.215  4.775   5.606   1.00 112.93 ? -41  DA  J OP2   1 
ATOM   9659  O  "O5'" . DA  J  5 33  ? -1.391  3.377   3.727   1.00 114.38 ? -41  DA  J "O5'" 1 
ATOM   9660  C  "C5'" . DA  J  5 33  ? -0.407  2.684   2.973   1.00 117.09 ? -41  DA  J "C5'" 1 
ATOM   9661  C  "C4'" . DA  J  5 33  ? -1.078  1.686   2.044   1.00 119.75 ? -41  DA  J "C4'" 1 
ATOM   9662  O  "O4'" . DA  J  5 33  ? -1.416  0.478   2.772   1.00 120.21 ? -41  DA  J "O4'" 1 
ATOM   9663  C  "C3'" . DA  J  5 33  ? -2.383  2.163   1.397   1.00 121.43 ? -41  DA  J "C3'" 1 
ATOM   9664  O  "O3'" . DA  J  5 33  ? -2.407  1.726   0.031   1.00 123.48 ? -41  DA  J "O3'" 1 
ATOM   9665  C  "C2'" . DA  J  5 33  ? -3.457  1.483   2.245   1.00 121.04 ? -41  DA  J "C2'" 1 
ATOM   9666  C  "C1'" . DA  J  5 33  ? -2.756  0.148   2.464   1.00 121.02 ? -41  DA  J "C1'" 1 
ATOM   9667  N  N9    . DA  J  5 33  ? -3.343  -0.716  3.490   1.00 121.23 ? -41  DA  J N9    1 
ATOM   9668  C  C8    . DA  J  5 33  ? -3.996  -0.358  4.641   1.00 121.23 ? -41  DA  J C8    1 
ATOM   9669  N  N7    . DA  J  5 33  ? -4.419  -1.383  5.346   1.00 121.12 ? -41  DA  J N7    1 
ATOM   9670  C  C5    . DA  J  5 33  ? -4.020  -2.486  4.606   1.00 121.10 ? -41  DA  J C5    1 
ATOM   9671  C  C6    . DA  J  5 33  ? -4.156  -3.881  4.799   1.00 121.34 ? -41  DA  J C6    1 
ATOM   9672  N  N6    . DA  J  5 33  ? -4.768  -4.425  5.854   1.00 121.37 ? -41  DA  J N6    1 
ATOM   9673  N  N1    . DA  J  5 33  ? -3.643  -4.712  3.862   1.00 121.25 ? -41  DA  J N1    1 
ATOM   9674  C  C2    . DA  J  5 33  ? -3.029  -4.179  2.799   1.00 121.17 ? -41  DA  J C2    1 
ATOM   9675  N  N3    . DA  J  5 33  ? -2.838  -2.891  2.511   1.00 121.12 ? -41  DA  J N3    1 
ATOM   9676  C  C4    . DA  J  5 33  ? -3.359  -2.091  3.459   1.00 121.07 ? -41  DA  J C4    1 
ATOM   9677  P  P     . DG  J  5 34  ? -3.338  2.390   -1.095  1.00 124.66 ? -40  DG  J P     1 
ATOM   9678  O  OP1   . DG  J  5 34  ? -2.432  2.958   -2.120  1.00 124.38 ? -40  DG  J OP1   1 
ATOM   9679  O  OP2   . DG  J  5 34  ? -4.368  3.244   -0.448  1.00 124.27 ? -40  DG  J OP2   1 
ATOM   9680  O  "O5'" . DG  J  5 34  ? -4.064  1.104   -1.728  1.00 126.59 ? -40  DG  J "O5'" 1 
ATOM   9681  C  "C5'" . DG  J  5 34  ? -3.292  -0.015  -2.205  1.00 129.38 ? -40  DG  J "C5'" 1 
ATOM   9682  C  "C4'" . DG  J  5 34  ? -4.114  -1.293  -2.324  1.00 131.50 ? -40  DG  J "C4'" 1 
ATOM   9683  O  "O4'" . DG  J  5 34  ? -4.307  -1.924  -1.026  1.00 132.27 ? -40  DG  J "O4'" 1 
ATOM   9684  C  "C3'" . DG  J  5 34  ? -5.511  -1.115  -2.914  1.00 132.73 ? -40  DG  J "C3'" 1 
ATOM   9685  O  "O3'" . DG  J  5 34  ? -5.689  -2.055  -3.959  1.00 134.03 ? -40  DG  J "O3'" 1 
ATOM   9686  C  "C2'" . DG  J  5 34  ? -6.450  -1.397  -1.744  1.00 132.81 ? -40  DG  J "C2'" 1 
ATOM   9687  C  "C1'" . DG  J  5 34  ? -5.635  -2.406  -0.949  1.00 132.92 ? -40  DG  J "C1'" 1 
ATOM   9688  N  N9    . DG  J  5 34  ? -6.058  -2.520  0.448   1.00 133.11 ? -40  DG  J N9    1 
ATOM   9689  C  C8    . DG  J  5 34  ? -6.190  -1.491  1.352   1.00 133.15 ? -40  DG  J C8    1 
ATOM   9690  N  N7    . DG  J  5 34  ? -6.588  -1.875  2.533   1.00 133.23 ? -40  DG  J N7    1 
ATOM   9691  C  C5    . DG  J  5 34  ? -6.727  -3.251  2.411   1.00 133.16 ? -40  DG  J C5    1 
ATOM   9692  C  C6    . DG  J  5 34  ? -7.138  -4.212  3.370   1.00 133.05 ? -40  DG  J C6    1 
ATOM   9693  O  O6    . DG  J  5 34  ? -7.458  -4.018  4.550   1.00 133.09 ? -40  DG  J O6    1 
ATOM   9694  N  N1    . DG  J  5 34  ? -7.152  -5.507  2.851   1.00 132.98 ? -40  DG  J N1    1 
ATOM   9695  C  C2    . DG  J  5 34  ? -6.814  -5.829  1.557   1.00 133.00 ? -40  DG  J C2    1 
ATOM   9696  N  N2    . DG  J  5 34  ? -6.890  -7.125  1.235   1.00 132.94 ? -40  DG  J N2    1 
ATOM   9697  N  N3    . DG  J  5 34  ? -6.433  -4.938  0.644   1.00 133.16 ? -40  DG  J N3    1 
ATOM   9698  C  C4    . DG  J  5 34  ? -6.410  -3.668  1.133   1.00 133.20 ? -40  DG  J C4    1 
ATOM   9699  P  P     . DT  J  5 35  ? -6.960  -2.002  -4.931  1.00 135.23 ? -39  DT  J P     1 
ATOM   9700  O  OP1   . DT  J  5 35  ? -6.457  -2.251  -6.303  1.00 135.35 ? -39  DT  J OP1   1 
ATOM   9701  O  OP2   . DT  J  5 35  ? -7.787  -0.802  -4.640  1.00 135.28 ? -39  DT  J OP2   1 
ATOM   9702  O  "O5'" . DT  J  5 35  ? -7.800  -3.267  -4.442  1.00 135.72 ? -39  DT  J "O5'" 1 
ATOM   9703  C  "C5'" . DT  J  5 35  ? -7.291  -4.595  -4.554  1.00 136.27 ? -39  DT  J "C5'" 1 
ATOM   9704  C  "C4'" . DT  J  5 35  ? -8.224  -5.535  -3.818  1.00 136.59 ? -39  DT  J "C4'" 1 
ATOM   9705  O  "O4'" . DT  J  5 35  ? -8.174  -5.222  -2.398  1.00 136.77 ? -39  DT  J "O4'" 1 
ATOM   9706  C  "C3'" . DT  J  5 35  ? -9.686  -5.403  -4.250  1.00 137.04 ? -39  DT  J "C3'" 1 
ATOM   9707  O  "O3'" . DT  J  5 35  ? -10.254 -6.688  -4.494  1.00 137.79 ? -39  DT  J "O3'" 1 
ATOM   9708  C  "C2'" . DT  J  5 35  ? -10.345 -4.705  -3.061  1.00 137.07 ? -39  DT  J "C2'" 1 
ATOM   9709  C  "C1'" . DT  J  5 35  ? -9.498  -5.235  -1.906  1.00 136.68 ? -39  DT  J "C1'" 1 
ATOM   9710  N  N1    . DT  J  5 35  ? -9.634  -4.464  -0.621  1.00 136.45 ? -39  DT  J N1    1 
ATOM   9711  C  C2    . DT  J  5 35  ? -9.913  -5.155  0.545   1.00 136.30 ? -39  DT  J C2    1 
ATOM   9712  O  O2    . DT  J  5 35  ? -10.041 -6.368  0.598   1.00 136.19 ? -39  DT  J O2    1 
ATOM   9713  N  N3    . DT  J  5 35  ? -10.030 -4.360  1.663   1.00 136.30 ? -39  DT  J N3    1 
ATOM   9714  C  C4    . DT  J  5 35  ? -9.910  -2.979  1.732   1.00 136.43 ? -39  DT  J C4    1 
ATOM   9715  O  O4    . DT  J  5 35  ? -10.032 -2.371  2.794   1.00 136.32 ? -39  DT  J O4    1 
ATOM   9716  C  C5    . DT  J  5 35  ? -9.620  -2.316  0.477   1.00 136.41 ? -39  DT  J C5    1 
ATOM   9717  C  C7    . DT  J  5 35  ? -9.462  -0.823  0.406   1.00 136.35 ? -39  DT  J C7    1 
ATOM   9718  C  C6    . DT  J  5 35  ? -9.502  -3.083  -0.620  1.00 136.56 ? -39  DT  J C6    1 
ATOM   9719  P  P     . DG  J  5 36  ? -11.575 -6.868  -5.392  1.00 138.11 ? -38  DG  J P     1 
ATOM   9720  O  OP1   . DG  J  5 36  ? -11.250 -6.354  -6.743  1.00 137.71 ? -38  DG  J OP1   1 
ATOM   9721  O  OP2   . DG  J  5 36  ? -12.743 -6.311  -4.662  1.00 138.00 ? -38  DG  J OP2   1 
ATOM   9722  O  "O5'" . DG  J  5 36  ? -11.765 -8.467  -5.443  1.00 137.68 ? -38  DG  J "O5'" 1 
ATOM   9723  C  "C5'" . DG  J  5 36  ? -11.120 -9.356  -4.508  1.00 137.43 ? -38  DG  J "C5'" 1 
ATOM   9724  C  "C4'" . DG  J  5 36  ? -11.989 -9.747  -3.313  1.00 137.22 ? -38  DG  J "C4'" 1 
ATOM   9725  O  "O4'" . DG  J  5 36  ? -11.823 -8.785  -2.226  1.00 137.60 ? -38  DG  J "O4'" 1 
ATOM   9726  C  "C3'" . DG  J  5 36  ? -13.496 -9.867  -3.578  1.00 136.57 ? -38  DG  J "C3'" 1 
ATOM   9727  O  "O3'" . DG  J  5 36  ? -13.944 -11.220 -3.326  1.00 135.08 ? -38  DG  J "O3'" 1 
ATOM   9728  C  "C2'" . DG  J  5 36  ? -14.111 -8.817  -2.647  1.00 137.06 ? -38  DG  J "C2'" 1 
ATOM   9729  C  "C1'" . DG  J  5 36  ? -13.059 -8.644  -1.550  1.00 137.29 ? -38  DG  J "C1'" 1 
ATOM   9730  N  N9    . DG  J  5 36  ? -13.137 -7.339  -0.879  1.00 137.24 ? -38  DG  J N9    1 
ATOM   9731  C  C8    . DG  J  5 36  ? -12.928 -6.113  -1.469  1.00 137.24 ? -38  DG  J C8    1 
ATOM   9732  N  N7    . DG  J  5 36  ? -13.067 -5.097  -0.666  1.00 137.24 ? -38  DG  J N7    1 
ATOM   9733  C  C5    . DG  J  5 36  ? -13.396 -5.681  0.550   1.00 137.29 ? -38  DG  J C5    1 
ATOM   9734  C  C6    . DG  J  5 36  ? -13.665 -5.066  1.800   1.00 137.22 ? -38  DG  J C6    1 
ATOM   9735  O  O6    . DG  J  5 36  ? -13.661 -3.855  2.066   1.00 137.10 ? -38  DG  J O6    1 
ATOM   9736  N  N1    . DG  J  5 36  ? -13.961 -6.001  2.796   1.00 137.20 ? -38  DG  J N1    1 
ATOM   9737  C  C2    . DG  J  5 36  ? -13.994 -7.364  2.595   1.00 137.21 ? -38  DG  J C2    1 
ATOM   9738  N  N2    . DG  J  5 36  ? -14.298 -8.107  3.669   1.00 137.19 ? -38  DG  J N2    1 
ATOM   9739  N  N3    . DG  J  5 36  ? -13.742 -7.955  1.426   1.00 137.32 ? -38  DG  J N3    1 
ATOM   9740  C  C4    . DG  J  5 36  ? -13.449 -7.060  0.441   1.00 137.27 ? -38  DG  J C4    1 
ATOM   9741  P  P     . DT  J  5 37  ? -15.490 -11.664 -3.178  1.00 134.24 ? -37  DT  J P     1 
ATOM   9742  O  OP1   . DT  J  5 37  ? -15.534 -13.140 -3.311  1.00 133.90 ? -37  DT  J OP1   1 
ATOM   9743  O  OP2   . DT  J  5 37  ? -16.358 -10.836 -4.052  1.00 133.66 ? -37  DT  J OP2   1 
ATOM   9744  O  "O5'" . DT  J  5 37  ? -15.797 -11.253 -1.661  1.00 132.35 ? -37  DT  J "O5'" 1 
ATOM   9745  C  "C5'" . DT  J  5 37  ? -15.869 -12.211 -0.611  1.00 129.54 ? -37  DT  J "C5'" 1 
ATOM   9746  C  "C4'" . DT  J  5 37  ? -16.874 -11.732 0.420   1.00 127.50 ? -37  DT  J "C4'" 1 
ATOM   9747  O  "O4'" . DT  J  5 37  ? -16.599 -10.354 0.788   1.00 127.40 ? -37  DT  J "O4'" 1 
ATOM   9748  C  "C3'" . DT  J  5 37  ? -18.330 -11.751 -0.034  1.00 125.90 ? -37  DT  J "C3'" 1 
ATOM   9749  O  "O3'" . DT  J  5 37  ? -19.092 -12.196 1.061   1.00 124.18 ? -37  DT  J "O3'" 1 
ATOM   9750  C  "C2'" . DT  J  5 37  ? -18.636 -10.290 -0.346  1.00 126.12 ? -37  DT  J "C2'" 1 
ATOM   9751  C  "C1'" . DT  J  5 37  ? -17.815 -9.631  0.758   1.00 126.78 ? -37  DT  J "C1'" 1 
ATOM   9752  N  N1    . DT  J  5 37  ? -17.529 -8.168  0.591   1.00 126.77 ? -37  DT  J N1    1 
ATOM   9753  C  C2    . DT  J  5 37  ? -17.732 -7.316  1.664   1.00 126.78 ? -37  DT  J C2    1 
ATOM   9754  O  O2    . DT  J  5 37  ? -18.138 -7.670  2.757   1.00 126.72 ? -37  DT  J O2    1 
ATOM   9755  N  N3    . DT  J  5 37  ? -17.442 -6.000  1.408   1.00 126.89 ? -37  DT  J N3    1 
ATOM   9756  C  C4    . DT  J  5 37  ? -16.976 -5.459  0.222   1.00 126.95 ? -37  DT  J C4    1 
ATOM   9757  O  O4    . DT  J  5 37  ? -16.750 -4.259  0.113   1.00 126.91 ? -37  DT  J O4    1 
ATOM   9758  C  C5    . DT  J  5 37  ? -16.779 -6.399  -0.860  1.00 126.95 ? -37  DT  J C5    1 
ATOM   9759  C  C7    . DT  J  5 37  ? -16.281 -5.935  -2.202  1.00 126.77 ? -37  DT  J C7    1 
ATOM   9760  C  C6    . DT  J  5 37  ? -17.061 -7.690  -0.624  1.00 126.87 ? -37  DT  J C6    1 
ATOM   9761  P  P     . DG  J  5 38  ? -19.634 -13.693 1.092   1.00 122.55 ? -36  DG  J P     1 
ATOM   9762  O  OP1   . DG  J  5 38  ? -18.536 -14.615 0.706   1.00 122.35 ? -36  DG  J OP1   1 
ATOM   9763  O  OP2   . DG  J  5 38  ? -20.901 -13.633 0.323   1.00 122.68 ? -36  DG  J OP2   1 
ATOM   9764  O  "O5'" . DG  J  5 38  ? -20.024 -13.996 2.620   1.00 121.24 ? -36  DG  J "O5'" 1 
ATOM   9765  C  "C5'" . DG  J  5 38  ? -19.134 -13.745 3.716   1.00 118.97 ? -36  DG  J "C5'" 1 
ATOM   9766  C  "C4'" . DG  J  5 38  ? -19.736 -12.759 4.710   1.00 117.29 ? -36  DG  J "C4'" 1 
ATOM   9767  O  "O4'" . DG  J  5 38  ? -19.734 -11.423 4.135   1.00 116.97 ? -36  DG  J "O4'" 1 
ATOM   9768  C  "C3'" . DG  J  5 38  ? -21.185 -13.008 5.129   1.00 116.08 ? -36  DG  J "C3'" 1 
ATOM   9769  O  "O3'" . DG  J  5 38  ? -21.366 -12.609 6.487   1.00 114.34 ? -36  DG  J "O3'" 1 
ATOM   9770  C  "C2'" . DG  J  5 38  ? -21.957 -12.085 4.187   1.00 116.64 ? -36  DG  J "C2'" 1 
ATOM   9771  C  "C1'" . DG  J  5 38  ? -21.038 -10.874 4.225   1.00 117.22 ? -36  DG  J "C1'" 1 
ATOM   9772  N  N9    . DG  J  5 38  ? -21.166 -9.877  3.164   1.00 117.18 ? -36  DG  J N9    1 
ATOM   9773  C  C8    . DG  J  5 38  ? -21.246 -10.077 1.808   1.00 117.34 ? -36  DG  J C8    1 
ATOM   9774  N  N7    . DG  J  5 38  ? -21.320 -8.970  1.117   1.00 117.43 ? -36  DG  J N7    1 
ATOM   9775  C  C5    . DG  J  5 38  ? -21.282 -7.967  2.076   1.00 117.46 ? -36  DG  J C5    1 
ATOM   9776  C  C6    . DG  J  5 38  ? -21.328 -6.550  1.940   1.00 117.54 ? -36  DG  J C6    1 
ATOM   9777  O  O6    . DG  J  5 38  ? -21.420 -5.866  0.906   1.00 117.25 ? -36  DG  J O6    1 
ATOM   9778  N  N1    . DG  J  5 38  ? -21.265 -5.907  3.181   1.00 117.65 ? -36  DG  J N1    1 
ATOM   9779  C  C2    . DG  J  5 38  ? -21.162 -6.548  4.400   1.00 117.43 ? -36  DG  J C2    1 
ATOM   9780  N  N2    . DG  J  5 38  ? -21.109 -5.765  5.488   1.00 117.24 ? -36  DG  J N2    1 
ATOM   9781  N  N3    . DG  J  5 38  ? -21.118 -7.869  4.537   1.00 117.33 ? -36  DG  J N3    1 
ATOM   9782  C  C4    . DG  J  5 38  ? -21.182 -8.514  3.342   1.00 117.33 ? -36  DG  J C4    1 
ATOM   9783  P  P     . DT  J  5 39  ? -22.085 -13.565 7.551   1.00 112.64 ? -35  DT  J P     1 
ATOM   9784  O  OP1   . DT  J  5 39  ? -21.139 -14.668 7.835   1.00 112.62 ? -35  DT  J OP1   1 
ATOM   9785  O  OP2   . DT  J  5 39  ? -23.464 -13.830 7.084   1.00 111.65 ? -35  DT  J OP2   1 
ATOM   9786  O  "O5'" . DT  J  5 39  ? -22.200 -12.681 8.870   1.00 111.21 ? -35  DT  J "O5'" 1 
ATOM   9787  C  "C5'" . DT  J  5 39  ? -21.088 -11.917 9.301   1.00 109.92 ? -35  DT  J "C5'" 1 
ATOM   9788  C  "C4'" . DT  J  5 39  ? -21.548 -10.501 9.559   1.00 108.68 ? -35  DT  J "C4'" 1 
ATOM   9789  O  "O4'" . DT  J  5 39  ? -21.877 -9.884  8.292   1.00 108.94 ? -35  DT  J "O4'" 1 
ATOM   9790  C  "C3'" . DT  J  5 39  ? -22.808 -10.429 10.412  1.00 107.64 ? -35  DT  J "C3'" 1 
ATOM   9791  O  "O3'" . DT  J  5 39  ? -22.538 -9.637  11.556  1.00 106.09 ? -35  DT  J "O3'" 1 
ATOM   9792  C  "C2'" . DT  J  5 39  ? -23.870 -9.817  9.492   1.00 108.30 ? -35  DT  J "C2'" 1 
ATOM   9793  C  "C1'" . DT  J  5 39  ? -23.031 -9.090  8.454   1.00 109.21 ? -35  DT  J "C1'" 1 
ATOM   9794  N  N1    . DT  J  5 39  ? -23.648 -8.879  7.098   1.00 109.75 ? -35  DT  J N1    1 
ATOM   9795  C  C2    . DT  J  5 39  ? -23.780 -7.580  6.625   1.00 110.00 ? -35  DT  J C2    1 
ATOM   9796  O  O2    . DT  J  5 39  ? -23.448 -6.587  7.248   1.00 109.77 ? -35  DT  J O2    1 
ATOM   9797  N  N3    . DT  J  5 39  ? -24.337 -7.471  5.374   1.00 110.26 ? -35  DT  J N3    1 
ATOM   9798  C  C4    . DT  J  5 39  ? -24.758 -8.510  4.561   1.00 110.08 ? -35  DT  J C4    1 
ATOM   9799  O  O4    . DT  J  5 39  ? -25.238 -8.287  3.453   1.00 110.12 ? -35  DT  J O4    1 
ATOM   9800  C  C5    . DT  J  5 39  ? -24.592 -9.846  5.105   1.00 109.87 ? -35  DT  J C5    1 
ATOM   9801  C  C7    . DT  J  5 39  ? -25.022 -11.053 4.317   1.00 109.47 ? -35  DT  J C7    1 
ATOM   9802  C  C6    . DT  J  5 39  ? -24.050 -9.964  6.330   1.00 109.55 ? -35  DT  J C6    1 
ATOM   9803  P  P     . DC  J  5 40  ? -23.500 -9.650  12.833  1.00 104.75 ? -34  DC  J P     1 
ATOM   9804  O  OP1   . DC  J  5 40  ? -22.679 -10.161 13.939  1.00 105.58 ? -34  DC  J OP1   1 
ATOM   9805  O  OP2   . DC  J  5 40  ? -24.785 -10.327 12.537  1.00 105.37 ? -34  DC  J OP2   1 
ATOM   9806  O  "O5'" . DC  J  5 40  ? -23.823 -8.096  13.078  1.00 105.24 ? -34  DC  J "O5'" 1 
ATOM   9807  C  "C5'" . DC  J  5 40  ? -23.484 -7.070  12.116  1.00 105.01 ? -34  DC  J "C5'" 1 
ATOM   9808  C  "C4'" . DC  J  5 40  ? -24.550 -5.986  11.945  1.00 104.99 ? -34  DC  J "C4'" 1 
ATOM   9809  O  "O4'" . DC  J  5 40  ? -25.022 -6.013  10.571  1.00 104.80 ? -34  DC  J "O4'" 1 
ATOM   9810  C  "C3'" . DC  J  5 40  ? -25.823 -6.091  12.789  1.00 105.54 ? -34  DC  J "C3'" 1 
ATOM   9811  O  "O3'" . DC  J  5 40  ? -26.456 -4.826  12.858  1.00 105.98 ? -34  DC  J "O3'" 1 
ATOM   9812  C  "C2'" . DC  J  5 40  ? -26.692 -6.982  11.914  1.00 105.64 ? -34  DC  J "C2'" 1 
ATOM   9813  C  "C1'" . DC  J  5 40  ? -26.413 -6.304  10.569  1.00 105.29 ? -34  DC  J "C1'" 1 
ATOM   9814  N  N1    . DC  J  5 40  ? -26.747 -7.103  9.353   1.00 105.02 ? -34  DC  J N1    1 
ATOM   9815  C  C2    . DC  J  5 40  ? -26.713 -6.484  8.094   1.00 104.62 ? -34  DC  J C2    1 
ATOM   9816  O  O2    . DC  J  5 40  ? -26.414 -5.289  7.995   1.00 104.41 ? -34  DC  J O2    1 
ATOM   9817  N  N3    . DC  J  5 40  ? -27.015 -7.229  7.005   1.00 104.71 ? -34  DC  J N3    1 
ATOM   9818  C  C4    . DC  J  5 40  ? -27.338 -8.518  7.145   1.00 104.92 ? -34  DC  J C4    1 
ATOM   9819  N  N4    . DC  J  5 40  ? -27.629 -9.203  6.040   1.00 105.51 ? -34  DC  J N4    1 
ATOM   9820  C  C5    . DC  J  5 40  ? -27.381 -9.173  8.409   1.00 104.73 ? -34  DC  J C5    1 
ATOM   9821  C  C6    . DC  J  5 40  ? -27.083 -8.426  9.477   1.00 105.14 ? -34  DC  J C6    1 
ATOM   9822  P  P     . DA  J  5 41  ? -26.313 -3.824  14.086  1.00 106.11 ? -33  DA  J P     1 
ATOM   9823  O  OP1   . DA  J  5 41  ? -24.867 -3.617  14.325  1.00 105.02 ? -33  DA  J OP1   1 
ATOM   9824  O  OP2   . DA  J  5 41  ? -27.253 -4.249  15.153  1.00 104.82 ? -33  DA  J OP2   1 
ATOM   9825  O  "O5'" . DA  J  5 41  ? -26.894 -2.485  13.448  1.00 108.13 ? -33  DA  J "O5'" 1 
ATOM   9826  C  "C5'" . DA  J  5 41  ? -26.226 -1.873  12.336  1.00 111.37 ? -33  DA  J "C5'" 1 
ATOM   9827  C  "C4'" . DA  J  5 41