data_3REL
# 
_entry.id   3REL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3REL         
NDB   NA1066       
RCSB  RCSB064834   
WWPDB D_1000064834 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1KX3 .                       unspecified 
PDB 1KX4 .                       unspecified 
PDB 1KX5 .                       unspecified 
PDB 2NZD 'Molrep starting model' unspecified 
PDB 3REH .                       unspecified 
PDB 3REI .                       unspecified 
PDB 3REJ .                       unspecified 
PDB 3REK .                       unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3REL 
_pdbx_database_status.recvd_initial_deposition_date   2011-04-04 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wu, B.'      1 
'Davey, C.A.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.' 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_volume            39 
_citation.page_first                8200 
_citation.page_last                 8212 
_citation.year                      2011 
_citation.journal_id_ASTM           NARHAD 
_citation.country                   UK 
_citation.journal_id_ISSN           0305-1048 
_citation.journal_id_CSD            0389 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21724603 
_citation.pdbx_database_id_DOI      10.1093/nar/gkr491 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wu, B.'        1 
primary 'Davey, G.E.'   2 
primary 'Nazarov, A.A.' 3 
primary 'Dyson, P.J.'   4 
primary 'Davey, C.A.'   5 
# 
_cell.entry_id           3REL 
_cell.length_a           105.659 
_cell.length_b           109.697 
_cell.length_c           175.654 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3REL 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone H3.2'       15303.930 2  ? ? ? ? 
2 polymer     man 'Histone H4'         11263.231 2  ? ? ? ? 
3 polymer     man 'Histone H2A'        13978.241 2  ? ? ? ? 
4 polymer     man 'Histone H2B 1.1'    13524.752 2  ? ? ? ? 
5 polymer     syn 'DNA (146-MER)'      45054.840 2  ? ? ? ? 
6 non-polymer syn 'MANGANESE (II) ION' 54.938    2  ? ? ? ? 
7 non-polymer syn 'PLATINUM (II) ION'  195.078   48 ? ? ? ? 
8 non-polymer syn 'SULFATE ION'        96.063    3  ? ? ? ? 
# 
_entity_name_com.entity_id   4 
_entity_name_com.name        H2B1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
C,G ? 
4 'polypeptide(L)'        no no 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DC)(DT)(DT)(DG)(DC)(DG)
(DG)(DA)(DT)(DC)(DG)(DT)(DA)(DG)(DA)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DG)(DT)(DC)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DG)(DC)(DT)(DA)(DT)(DC)(DA)(DA)(DA)(DG)(DG)(DG)(DA)
(DA)(DA)(DC)(DT)(DT)(DC)(DA)(DA)(DC)(DT)(DG)(DA)(DA)(DT)(DT)(DC)(DA)(DG)(DT)(DT)
(DG)(DA)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DC)(DT)(DT)(DT)(DG)(DA)(DT)(DA)(DG)(DC)(DG)
(DC)(DA)(DG)(DT)(DT)(DT)(DG)(DA)(DC)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)(DT)(DC)(DT)
(DA)(DC)(DG)(DA)(DT)(DC)(DC)(DG)(DC)(DA)(DA)(DG)(DG)(DG)(DA)(DT)(DA)(DT)(DT)(DT)
(DG)(DG)(DA)(DG)(DA)(DT)
;
;ATCTCCAAATATCCCTTGCGGATCGTAGAAAAAGTGTGTCAAACTGCGCTATCAAAGGGAAACTTCAACTGAATTCAGTT
GAAGTTTCCCTTTGATAGCGCAGTTTGACACACTTTTTCTACGATCCGCAAGGGATATTTGGAGAT
;
I,J ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   THR n 
1 4   LYS n 
1 5   GLN n 
1 6   THR n 
1 7   ALA n 
1 8   ARG n 
1 9   LYS n 
1 10  SER n 
1 11  THR n 
1 12  GLY n 
1 13  GLY n 
1 14  LYS n 
1 15  ALA n 
1 16  PRO n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  LEU n 
1 21  ALA n 
1 22  THR n 
1 23  LYS n 
1 24  ALA n 
1 25  ALA n 
1 26  ARG n 
1 27  LYS n 
1 28  SER n 
1 29  ALA n 
1 30  PRO n 
1 31  ALA n 
1 32  THR n 
1 33  GLY n 
1 34  GLY n 
1 35  VAL n 
1 36  LYS n 
1 37  LYS n 
1 38  PRO n 
1 39  HIS n 
1 40  ARG n 
1 41  TYR n 
1 42  ARG n 
1 43  PRO n 
1 44  GLY n 
1 45  THR n 
1 46  VAL n 
1 47  ALA n 
1 48  LEU n 
1 49  ARG n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  ARG n 
1 54  TYR n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  GLU n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  GLN n 
1 69  ARG n 
1 70  LEU n 
1 71  VAL n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  ALA n 
1 76  GLN n 
1 77  ASP n 
1 78  PHE n 
1 79  LYS n 
1 80  THR n 
1 81  ASP n 
1 82  LEU n 
1 83  ARG n 
1 84  PHE n 
1 85  GLN n 
1 86  SER n 
1 87  SER n 
1 88  ALA n 
1 89  VAL n 
1 90  MET n 
1 91  ALA n 
1 92  LEU n 
1 93  GLN n 
1 94  GLU n 
1 95  ALA n 
1 96  SER n 
1 97  GLU n 
1 98  ALA n 
1 99  TYR n 
1 100 LEU n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 PHE n 
1 105 GLU n 
1 106 ASP n 
1 107 THR n 
1 108 ASN n 
1 109 LEU n 
1 110 CYS n 
1 111 ALA n 
1 112 ILE n 
1 113 HIS n 
1 114 ALA n 
1 115 LYS n 
1 116 ARG n 
1 117 VAL n 
1 118 THR n 
1 119 ILE n 
1 120 MET n 
1 121 PRO n 
1 122 LYS n 
1 123 ASP n 
1 124 ILE n 
1 125 GLN n 
1 126 LEU n 
1 127 ALA n 
1 128 ARG n 
1 129 ARG n 
1 130 ILE n 
1 131 ARG n 
1 132 GLY n 
1 133 GLU n 
1 134 ARG n 
1 135 ALA n 
2 1   SER n 
2 2   GLY n 
2 3   ARG n 
2 4   GLY n 
2 5   LYS n 
2 6   GLY n 
2 7   GLY n 
2 8   LYS n 
2 9   GLY n 
2 10  LEU n 
2 11  GLY n 
2 12  LYS n 
2 13  GLY n 
2 14  GLY n 
2 15  ALA n 
2 16  LYS n 
2 17  ARG n 
2 18  HIS n 
2 19  ARG n 
2 20  LYS n 
2 21  VAL n 
2 22  LEU n 
2 23  ARG n 
2 24  ASP n 
2 25  ASN n 
2 26  ILE n 
2 27  GLN n 
2 28  GLY n 
2 29  ILE n 
2 30  THR n 
2 31  LYS n 
2 32  PRO n 
2 33  ALA n 
2 34  ILE n 
2 35  ARG n 
2 36  ARG n 
2 37  LEU n 
2 38  ALA n 
2 39  ARG n 
2 40  ARG n 
2 41  GLY n 
2 42  GLY n 
2 43  VAL n 
2 44  LYS n 
2 45  ARG n 
2 46  ILE n 
2 47  SER n 
2 48  GLY n 
2 49  LEU n 
2 50  ILE n 
2 51  TYR n 
2 52  GLU n 
2 53  GLU n 
2 54  THR n 
2 55  ARG n 
2 56  GLY n 
2 57  VAL n 
2 58  LEU n 
2 59  LYS n 
2 60  VAL n 
2 61  PHE n 
2 62  LEU n 
2 63  GLU n 
2 64  ASN n 
2 65  VAL n 
2 66  ILE n 
2 67  ARG n 
2 68  ASP n 
2 69  ALA n 
2 70  VAL n 
2 71  THR n 
2 72  TYR n 
2 73  THR n 
2 74  GLU n 
2 75  HIS n 
2 76  ALA n 
2 77  LYS n 
2 78  ARG n 
2 79  LYS n 
2 80  THR n 
2 81  VAL n 
2 82  THR n 
2 83  ALA n 
2 84  MET n 
2 85  ASP n 
2 86  VAL n 
2 87  VAL n 
2 88  TYR n 
2 89  ALA n 
2 90  LEU n 
2 91  LYS n 
2 92  ARG n 
2 93  GLN n 
2 94  GLY n 
2 95  ARG n 
2 96  THR n 
2 97  LEU n 
2 98  TYR n 
2 99  GLY n 
2 100 PHE n 
2 101 GLY n 
2 102 GLY n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLN n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  THR n 
3 11  ARG n 
3 12  ALA n 
3 13  LYS n 
3 14  ALA n 
3 15  LYS n 
3 16  THR n 
3 17  ARG n 
3 18  SER n 
3 19  SER n 
3 20  ARG n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  GLN n 
3 25  PHE n 
3 26  PRO n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  VAL n 
3 31  HIS n 
3 32  ARG n 
3 33  LEU n 
3 34  LEU n 
3 35  ARG n 
3 36  LYS n 
3 37  GLY n 
3 38  ASN n 
3 39  TYR n 
3 40  ALA n 
3 41  GLU n 
3 42  ARG n 
3 43  VAL n 
3 44  GLY n 
3 45  ALA n 
3 46  GLY n 
3 47  ALA n 
3 48  PRO n 
3 49  VAL n 
3 50  TYR n 
3 51  LEU n 
3 52  ALA n 
3 53  ALA n 
3 54  VAL n 
3 55  LEU n 
3 56  GLU n 
3 57  TYR n 
3 58  LEU n 
3 59  THR n 
3 60  ALA n 
3 61  GLU n 
3 62  ILE n 
3 63  LEU n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  GLY n 
3 68  ASN n 
3 69  ALA n 
3 70  ALA n 
3 71  ARG n 
3 72  ASP n 
3 73  ASN n 
3 74  LYS n 
3 75  LYS n 
3 76  THR n 
3 77  ARG n 
3 78  ILE n 
3 79  ILE n 
3 80  PRO n 
3 81  ARG n 
3 82  HIS n 
3 83  LEU n 
3 84  GLN n 
3 85  LEU n 
3 86  ALA n 
3 87  VAL n 
3 88  ARG n 
3 89  ASN n 
3 90  ASP n 
3 91  GLU n 
3 92  GLU n 
3 93  LEU n 
3 94  ASN n 
3 95  LYS n 
3 96  LEU n 
3 97  LEU n 
3 98  GLY n 
3 99  ARG n 
3 100 VAL n 
3 101 THR n 
3 102 ILE n 
3 103 ALA n 
3 104 GLN n 
3 105 GLY n 
3 106 GLY n 
3 107 VAL n 
3 108 LEU n 
3 109 PRO n 
3 110 ASN n 
3 111 ILE n 
3 112 GLN n 
3 113 SER n 
3 114 VAL n 
3 115 LEU n 
3 116 LEU n 
3 117 PRO n 
3 118 LYS n 
3 119 LYS n 
3 120 THR n 
3 121 GLU n 
3 122 SER n 
3 123 SER n 
3 124 LYS n 
3 125 SER n 
3 126 ALA n 
3 127 LYS n 
3 128 SER n 
3 129 LYS n 
4 1   ALA n 
4 2   LYS n 
4 3   SER n 
4 4   ALA n 
4 5   PRO n 
4 6   ALA n 
4 7   PRO n 
4 8   LYS n 
4 9   LYS n 
4 10  GLY n 
4 11  SER n 
4 12  LYS n 
4 13  LYS n 
4 14  ALA n 
4 15  VAL n 
4 16  THR n 
4 17  LYS n 
4 18  THR n 
4 19  GLN n 
4 20  LYS n 
4 21  LYS n 
4 22  ASP n 
4 23  GLY n 
4 24  LYS n 
4 25  LYS n 
4 26  ARG n 
4 27  ARG n 
4 28  LYS n 
4 29  THR n 
4 30  ARG n 
4 31  LYS n 
4 32  GLU n 
4 33  SER n 
4 34  TYR n 
4 35  ALA n 
4 36  ILE n 
4 37  TYR n 
4 38  VAL n 
4 39  TYR n 
4 40  LYS n 
4 41  VAL n 
4 42  LEU n 
4 43  LYS n 
4 44  GLN n 
4 45  VAL n 
4 46  HIS n 
4 47  PRO n 
4 48  ASP n 
4 49  THR n 
4 50  GLY n 
4 51  ILE n 
4 52  SER n 
4 53  SER n 
4 54  LYS n 
4 55  ALA n 
4 56  MET n 
4 57  SER n 
4 58  ILE n 
4 59  MET n 
4 60  ASN n 
4 61  SER n 
4 62  PHE n 
4 63  VAL n 
4 64  ASN n 
4 65  ASP n 
4 66  VAL n 
4 67  PHE n 
4 68  GLU n 
4 69  ARG n 
4 70  ILE n 
4 71  ALA n 
4 72  GLY n 
4 73  GLU n 
4 74  ALA n 
4 75  SER n 
4 76  ARG n 
4 77  LEU n 
4 78  ALA n 
4 79  HIS n 
4 80  TYR n 
4 81  ASN n 
4 82  LYS n 
4 83  ARG n 
4 84  SER n 
4 85  THR n 
4 86  ILE n 
4 87  THR n 
4 88  SER n 
4 89  ARG n 
4 90  GLU n 
4 91  ILE n 
4 92  GLN n 
4 93  THR n 
4 94  ALA n 
4 95  VAL n 
4 96  ARG n 
4 97  LEU n 
4 98  LEU n 
4 99  LEU n 
4 100 PRO n 
4 101 GLY n 
4 102 GLU n 
4 103 LEU n 
4 104 ALA n 
4 105 LYS n 
4 106 HIS n 
4 107 ALA n 
4 108 VAL n 
4 109 SER n 
4 110 GLU n 
4 111 GLY n 
4 112 THR n 
4 113 LYS n 
4 114 ALA n 
4 115 VAL n 
4 116 THR n 
4 117 LYS n 
4 118 TYR n 
4 119 THR n 
4 120 SER n 
4 121 ALA n 
4 122 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DT  n 
5 5   DC  n 
5 6   DC  n 
5 7   DA  n 
5 8   DA  n 
5 9   DA  n 
5 10  DT  n 
5 11  DA  n 
5 12  DT  n 
5 13  DC  n 
5 14  DC  n 
5 15  DC  n 
5 16  DT  n 
5 17  DT  n 
5 18  DG  n 
5 19  DC  n 
5 20  DG  n 
5 21  DG  n 
5 22  DA  n 
5 23  DT  n 
5 24  DC  n 
5 25  DG  n 
5 26  DT  n 
5 27  DA  n 
5 28  DG  n 
5 29  DA  n 
5 30  DA  n 
5 31  DA  n 
5 32  DA  n 
5 33  DA  n 
5 34  DG  n 
5 35  DT  n 
5 36  DG  n 
5 37  DT  n 
5 38  DG  n 
5 39  DT  n 
5 40  DC  n 
5 41  DA  n 
5 42  DA  n 
5 43  DA  n 
5 44  DC  n 
5 45  DT  n 
5 46  DG  n 
5 47  DC  n 
5 48  DG  n 
5 49  DC  n 
5 50  DT  n 
5 51  DA  n 
5 52  DT  n 
5 53  DC  n 
5 54  DA  n 
5 55  DA  n 
5 56  DA  n 
5 57  DG  n 
5 58  DG  n 
5 59  DG  n 
5 60  DA  n 
5 61  DA  n 
5 62  DA  n 
5 63  DC  n 
5 64  DT  n 
5 65  DT  n 
5 66  DC  n 
5 67  DA  n 
5 68  DA  n 
5 69  DC  n 
5 70  DT  n 
5 71  DG  n 
5 72  DA  n 
5 73  DA  n 
5 74  DT  n 
5 75  DT  n 
5 76  DC  n 
5 77  DA  n 
5 78  DG  n 
5 79  DT  n 
5 80  DT  n 
5 81  DG  n 
5 82  DA  n 
5 83  DA  n 
5 84  DG  n 
5 85  DT  n 
5 86  DT  n 
5 87  DT  n 
5 88  DC  n 
5 89  DC  n 
5 90  DC  n 
5 91  DT  n 
5 92  DT  n 
5 93  DT  n 
5 94  DG  n 
5 95  DA  n 
5 96  DT  n 
5 97  DA  n 
5 98  DG  n 
5 99  DC  n 
5 100 DG  n 
5 101 DC  n 
5 102 DA  n 
5 103 DG  n 
5 104 DT  n 
5 105 DT  n 
5 106 DT  n 
5 107 DG  n 
5 108 DA  n 
5 109 DC  n 
5 110 DA  n 
5 111 DC  n 
5 112 DA  n 
5 113 DC  n 
5 114 DT  n 
5 115 DT  n 
5 116 DT  n 
5 117 DT  n 
5 118 DT  n 
5 119 DC  n 
5 120 DT  n 
5 121 DA  n 
5 122 DC  n 
5 123 DG  n 
5 124 DA  n 
5 125 DT  n 
5 126 DC  n 
5 127 DC  n 
5 128 DG  n 
5 129 DC  n 
5 130 DA  n 
5 131 DA  n 
5 132 DG  n 
5 133 DG  n 
5 134 DG  n 
5 135 DA  n 
5 136 DT  n 
5 137 DA  n 
5 138 DT  n 
5 139 DT  n 
5 140 DT  n 
5 141 DG  n 
5 142 DG  n 
5 143 DA  n 
5 144 DG  n 
5 145 DA  n 
5 146 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 'clawed frog,common platanna,platanna' ? ? ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              5 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP H32_XENLA   P84233 1 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2 ? 
2 UNP H4_XENLA    P62799 2 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2 ? 
3 UNP H2A1_XENLA  P06897 3 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
2 ? 
4 UNP H2B11_XENLA P02281 4 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
5 ? 
5 PDB 3REL        3REL   5 
;ATCTCCAAATATCCCTTGCGGATCGTAGAAAAAGTGTGTCAAACTGCGCTATCAAAGGGAAACTTCAACTGAATTCAGTT
GAAGTTTCCCTTTGATAGCGCAGTTTGACACACTTTTTCTACGATCCGCAAGGGATATTTGGAGAT
;
? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3REL A 1 ? 135 ? P84233 2   ? 136 ? 1   135 
2  2 3REL B 1 ? 102 ? P62799 2   ? 103 ? 1   102 
3  3 3REL C 1 ? 129 ? P06897 2   ? 130 ? 1   129 
4  4 3REL D 1 ? 122 ? P02281 5   ? 126 ? 1   122 
5  1 3REL E 1 ? 135 ? P84233 2   ? 136 ? 1   135 
6  2 3REL F 1 ? 102 ? P62799 2   ? 103 ? 1   102 
7  3 3REL G 1 ? 129 ? P06897 2   ? 130 ? 1   129 
8  4 3REL H 1 ? 122 ? P02281 5   ? 126 ? 1   122 
9  5 3REL I 1 ? 146 ? 3REL   -72 ? 73  ? -72 73  
10 5 3REL J 1 ? 146 ? 3REL   -73 ? 72  ? -73 72  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3REL ALA A 102 ? UNP P84233 GLY 103 VARIANT 102 1 
3 3REL ARG C 99  ? UNP P06897 GLY 100 VARIANT 99  2 
3 3REL SER C 123 ? UNP P06897 ALA 124 VARIANT 123 3 
4 3REL THR D 29  ? UNP P02281 SER 33  VARIANT 29  4 
5 3REL ALA E 102 ? UNP P84233 GLY 103 VARIANT 102 5 
7 3REL ARG G 99  ? UNP P06897 GLY 100 VARIANT 99  6 
7 3REL SER G 123 ? UNP P06897 ALA 124 VARIANT 123 7 
8 3REL THR H 29  ? UNP P02281 SER 33  VARIANT 29  8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
PT  non-polymer         . 'PLATINUM (II) ION'                  ? 'Pt 2'            195.078 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                        ? 'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3REL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.57 
_exptl_crystal.density_percent_sol   52.09 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.07 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.07 
# 
_reflns.entry_id                     3REL 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             59 
_reflns.d_resolution_high            2.70 
_reflns.number_obs                   53327 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.4 
_reflns.pdbx_Rmerge_I_obs            0.075 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 3REL 
_refine.ls_number_reflns_obs                     53327 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             59 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    95.88 
_refine.ls_R_factor_obs                          0.24972 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.24864 
_refine.ls_R_factor_R_free                       0.30162 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1110 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.911 
_refine.correlation_coeff_Fo_to_Fc_free          0.765 
_refine.B_iso_mean                               85.593 
_refine.aniso_B[1][1]                            0.73 
_refine.aniso_B[2][2]                            -2.75 
_refine.aniso_B[3][3]                            2.03 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      1KX4 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.395 
_refine.overall_SU_ML                            0.302 
_refine.overall_SU_B                             14.361 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6015 
_refine_hist.pdbx_number_atoms_nucleic_acid   5980 
_refine_hist.pdbx_number_atoms_ligand         65 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               12060 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        59 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d             0.010  0.021  ? 12814 ? 'X-RAY DIFFRACTION' 
r_bond_other_d               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg          1.447  2.548  ? 18561 ? 'X-RAY DIFFRACTION' 
r_angle_other_deg            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg       5.401  5.000  ? 749   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg       34.215 21.269 ? 268   ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg       19.108 15.000 ? 1163  ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg       19.137 15.000 ? 85    ? 'X-RAY DIFFRACTION' 
r_chiral_restr               0.077  0.200  ? 2111  ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined         0.004  0.020  ? 7537  ? 'X-RAY DIFFRACTION' 
r_gen_planes_other           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbd_refined                0.207  0.200  ? 4656  ? 'X-RAY DIFFRACTION' 
r_nbd_other                  ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_nbtor_refined              0.306  0.200  ? 7998  ? 'X-RAY DIFFRACTION' 
r_nbtor_other                ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_refined        0.170  0.200  ? 330   ? 'X-RAY DIFFRACTION' 
r_xyhbond_nbd_other          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_refined          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_metal_ion_other            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_refined       0.164  0.200  ? 22    ? 'X-RAY DIFFRACTION' 
r_symmetry_vdw_other         ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_refined     0.158  0.200  ? 5     ? 'X-RAY DIFFRACTION' 
r_symmetry_hbond_other       ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_refined ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_symmetry_metal_ion_other   ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcbond_it                  0.783  1.500  ? 3819  ? 'X-RAY DIFFRACTION' 
r_mcbond_other               ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_mcangle_it                 1.432  2.000  ? 6046  ? 'X-RAY DIFFRACTION' 
r_scbond_it                  1.258  3.000  ? 12124 ? 'X-RAY DIFFRACTION' 
r_scangle_it                 2.245  4.500  ? 12515 ? 'X-RAY DIFFRACTION' 
r_rigid_bond_restr           ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_free            ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
r_sphericity_bonded          ?      ?      ? ?     ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.700 
_refine_ls_shell.d_res_low                        2.770 
_refine_ls_shell.number_reflns_R_work             2959 
_refine_ls_shell.R_factor_R_work                  0.310 
_refine_ls_shell.percent_reflns_obs               72.58 
_refine_ls_shell.R_factor_R_free                  0.381 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             50 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3REL 
_struct.title                     
;2.7 Angstrom Crystal Structure of the Nucleosome Core Particle Assembled with a 146 bp Alpha-Satellite DNA (NCP146b) Derivatized with Triamminechloroplatinum(II) Chloride
;
_struct.pdbx_descriptor           'Histone H3.2, Histone H4, Histone H2A type 1, Histone H2B 1.1/DNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3REL 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN/DNA' 
_struct_keywords.text            'nucleosome, STRUCTURAL PROTEIN-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 4 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 3 ? 
H  N N 4 ? 
I  N N 5 ? 
J  N N 5 ? 
K  N N 6 ? 
L  N N 7 ? 
M  N N 8 ? 
N  N N 6 ? 
O  N N 8 ? 
P  N N 7 ? 
Q  N N 8 ? 
R  N N 7 ? 
S  N N 7 ? 
T  N N 7 ? 
U  N N 7 ? 
V  N N 7 ? 
W  N N 7 ? 
X  N N 7 ? 
Y  N N 7 ? 
Z  N N 7 ? 
AA N N 7 ? 
BA N N 7 ? 
CA N N 7 ? 
DA N N 7 ? 
EA N N 7 ? 
FA N N 7 ? 
GA N N 7 ? 
HA N N 7 ? 
IA N N 7 ? 
JA N N 7 ? 
KA N N 7 ? 
LA N N 7 ? 
MA N N 7 ? 
NA N N 7 ? 
OA N N 7 ? 
PA N N 7 ? 
QA N N 7 ? 
RA N N 7 ? 
SA N N 7 ? 
TA N N 7 ? 
UA N N 7 ? 
VA N N 7 ? 
WA N N 7 ? 
XA N N 7 ? 
YA N N 7 ? 
ZA N N 7 ? 
AB N N 7 ? 
BB N N 7 ? 
CB N N 7 ? 
DB N N 7 ? 
EB N N 7 ? 
FB N N 7 ? 
GB N N 7 ? 
HB N N 7 ? 
IB N N 7 ? 
JB N N 7 ? 
KB N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 44  ? SER A 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  2  ARG A 63  ? ASP A 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  3  GLN A 85  ? ALA A 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  4  MET A 120 ? ARG A 131 ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  5  ASP B 24  ? GLY B 28  ? ASP B 24  GLY B 28  5 ? 5  
HELX_P HELX_P6  6  THR B 30  ? GLY B 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  7  LEU B 49  ? ALA B 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  8  THR B 82  ? GLN B 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  9  THR C 16  ? ALA C 21  ? THR C 16  ALA C 21  1 ? 6  
HELX_P HELX_P10 10 PRO C 26  ? GLY C 37  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 11 ALA C 45  ? ASN C 73  ? ALA C 45  ASN C 73  1 ? 29 
HELX_P HELX_P12 12 ILE C 79  ? ASP C 90  ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P13 13 ASP C 90  ? LEU C 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 14 GLN C 112 ? LEU C 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 15 TYR D 34  ? HIS D 46  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 16 SER D 52  ? ASN D 81  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 17 THR D 87  ? LEU D 99  ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 18 PRO D 100 ? ALA D 121 ? PRO D 100 ALA D 121 1 ? 22 
HELX_P HELX_P19 19 GLY E 44  ? GLN E 55  ? GLY E 44  GLN E 55  1 ? 12 
HELX_P HELX_P20 20 ARG E 63  ? ASP E 77  ? ARG E 63  ASP E 77  1 ? 15 
HELX_P HELX_P21 21 GLN E 85  ? ALA E 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 22 MET E 120 ? ARG E 131 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P23 23 THR F 30  ? GLY F 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P24 24 LEU F 49  ? ALA F 76  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P25 25 THR F 82  ? GLN F 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P26 26 THR G 16  ? GLY G 22  ? THR G 16  GLY G 22  1 ? 7  
HELX_P HELX_P27 27 PRO G 26  ? LYS G 36  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P28 28 GLY G 46  ? ASN G 73  ? GLY G 46  ASN G 73  1 ? 28 
HELX_P HELX_P29 29 ILE G 79  ? ASP G 90  ? ILE G 79  ASP G 90  1 ? 12 
HELX_P HELX_P30 30 ASP G 90  ? LEU G 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P31 31 GLN G 112 ? LEU G 116 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P32 32 TYR H 34  ? HIS H 46  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P33 33 SER H 52  ? ASN H 81  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P34 34 THR H 87  ? LEU H 99  ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P35 35 PRO H 100 ? SER H 120 ? PRO H 100 SER H 120 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? J DG  144 N7  ? ? ? 1_555 YA PT .   PT ? ? J DG  70  J PT 82   1_555 ? ? ? ? ? ? ?               1.877 ? 
metalc2   metalc ? ? I DG  132 N7  ? ? ? 1_555 X  PT .   PT ? ? I DG  59  I PT 80   1_555 ? ? ? ? ? ? ?               1.971 ? 
metalc3   metalc ? ? I DG  57  N7  ? ? ? 1_555 AA PT .   PT ? ? I DG  -16 I PT 83   1_555 ? ? ? ? ? ? ?               2.013 ? 
metalc4   metalc ? ? J DG  71  N7  ? ? ? 1_555 SA PT .   PT ? ? J DG  -3  J PT 76   1_555 ? ? ? ? ? ? ?               2.058 ? 
metalc5   metalc ? ? J DC  99  N4  ? ? ? 1_555 IB PT .   PT ? ? J DC  25  J PT 92   1_555 ? ? ? ? ? ? ?               2.063 ? 
metalc6   metalc ? ? I DG  59  N7  ? ? ? 1_555 R  PT .   PT ? ? I DG  -14 I PT 74   1_555 ? ? ? ? ? ? ?               2.069 ? 
metalc7   metalc ? ? A ASP 77  OD1 ? ? ? 1_555 K  MN .   MN ? ? A ASP 77  A MN 1001 1_555 ? ? ? ? ? ? ?               2.119 ? 
metalc8   metalc ? ? I DG  100 N7  ? ? ? 1_555 BA PT .   PT ? ? I DG  27  I PT 84   1_555 ? ? ? ? ? ? ?               2.137 ? 
metalc9   metalc ? ? J DG  59  N7  ? ? ? 1_555 EB PT .   PT ? ? J DG  -15 J PT 88   1_555 ? ? ? ? ? ? ?               2.138 ? 
metalc10  metalc ? ? I DG  98  N7  ? ? ? 1_555 DA PT .   PT ? ? I DG  25  I PT 86   1_555 ? ? ? ? ? ? ?               2.146 ? 
metalc11  metalc ? ? J DG  81  N7  ? ? ? 1_555 PA PT .   PT ? ? J DG  7   J PT 73   1_555 ? ? ? ? ? ? ?               2.160 ? 
metalc12  metalc ? ? I DG  142 N7  ? ? ? 1_555 W  PT .   PT ? ? I DG  69  I PT 79   1_555 ? ? ? ? ? ? ?               2.177 ? 
metalc13  metalc ? ? I DG  28  N7  ? ? ? 1_555 Z  PT .   PT ? ? I DG  -45 I PT 82   1_555 ? ? ? ? ? ? ?               2.197 ? 
metalc14  metalc ? ? J DG  28  N7  ? ? ? 1_555 VA PT .   PT ? ? J DG  -46 J PT 79   1_555 ? ? ? ? ? ? ?               2.266 ? 
metalc15  metalc ? ? I DA  27  N7  ? ? ? 1_555 KA PT .   PT ? ? I DA  -46 I PT 93   1_555 ? ? ? ? ? ? ?               2.359 ? 
metalc16  metalc ? ? J DG  132 N7  ? ? ? 1_555 RA PT .   PT ? ? J DG  58  J PT 75   1_555 ? ? ? ? ? ? ?               2.434 ? 
metalc17  metalc ? ? I DG  144 N7  ? ? ? 1_555 S  PT .   PT ? ? I DG  71  I PT 75   1_555 ? ? ? ? ? ? ?               2.451 ? 
metalc18  metalc ? ? I DG  38  N7  ? ? ? 1_555 LA PT .   PT ? ? I DG  -35 I PT 94   1_555 ? ? ? ? ? ? ?               2.483 ? 
metalc19  metalc ? ? I DA  1   N9  ? ? ? 1_555 Y  PT .   PT ? ? I DA  -72 I PT 81   1_555 ? ? ? ? ? ? ?               2.518 ? 
metalc20  metalc ? ? J DG  134 N7  ? ? ? 1_555 XA PT .   PT ? ? J DG  60  J PT 81   1_555 ? ? ? ? ? ? ?               2.580 ? 
metalc21  metalc ? ? J DG  58  N7  ? ? ? 1_555 FB PT .   PT ? ? J DG  -16 J PT 89   1_555 ? ? ? ? ? ? ?               2.589 ? 
metalc22  metalc ? ? I DG  78  N7  ? ? ? 1_555 T  PT .   PT ? ? I DG  5   I PT 76   1_555 ? ? ? ? ? ? ?               2.590 ? 
metalc23  metalc ? ? J DG  142 N7  ? ? ? 1_555 QA PT .   PT ? ? J DG  68  J PT 74   1_555 ? ? ? ? ? ? ?               2.605 ? 
metalc24  metalc ? ? I DG  38  O6  ? ? ? 1_555 LA PT .   PT ? ? I DG  -35 I PT 94   1_555 ? ? ? ? ? ? ?               2.633 ? 
metalc25  metalc ? ? J DG  141 O6  ? ? ? 1_555 GB PT .   PT ? ? J DG  67  J PT 90   1_555 ? ? ? ? ? ? ?               2.672 ? 
metalc26  metalc ? ? J DG  144 O6  ? ? ? 1_555 YA PT .   PT ? ? J DG  70  J PT 82   1_555 ? ? ? ? ? ? ?               2.688 ? 
metalc27  metalc ? ? J DG  38  N7  ? ? ? 1_555 KB PT .   PT ? ? J DG  -36 J PT 106  1_555 ? ? ? ? ? ? ?               2.764 ? 
metalc28  metalc ? ? D VAL 45  O   ? ? ? 1_555 N  MN .   MN ? ? D VAL 45  D MN 1007 1_555 ? ? ? ? ? ? ?               2.770 ? 
metalc29  metalc ? ? B MET 84  SD  ? ? ? 1_555 L  PT .   PT ? ? B MET 84  B PT 103  1_555 ? ? ? ? ? ? ?               2.818 ? 
hydrog1   hydrog ? ? I DA  1   N1  ? ? ? 1_555 J  DT 146 N3 ? ? I DA  -72 J DT 72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? I DA  1   N6  ? ? ? 1_555 J  DT 146 O4 ? ? I DA  -72 J DT 72   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? I DT  2   N3  ? ? ? 1_555 J  DA 145 N1 ? ? I DT  -71 J DA 71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? I DT  2   O4  ? ? ? 1_555 J  DA 145 N6 ? ? I DT  -71 J DA 71   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? I DC  3   N4  ? ? ? 1_555 J  DG 144 O6 ? ? I DC  -70 J DG 70   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog6   hydrog ? ? I DT  4   N3  ? ? ? 1_555 J  DA 143 N1 ? ? I DT  -69 J DA 69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? I DT  4   O4  ? ? ? 1_555 J  DA 143 N6 ? ? I DT  -69 J DA 69   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? I DC  5   O2  ? ? ? 1_555 J  DG 142 N1 ? ? I DC  -68 J DG 68   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog9   hydrog ? ? I DC  6   N4  ? ? ? 1_555 J  DT 140 O4 ? ? I DC  -67 J DT 66   1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ?     ? 
hydrog10  hydrog ? ? I DC  6   N3  ? ? ? 1_555 J  DG 141 N1 ? ? I DC  -67 J DG 67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? I DC  6   N4  ? ? ? 1_555 J  DG 141 O6 ? ? I DC  -67 J DG 67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? I DC  6   O2  ? ? ? 1_555 J  DG 141 N2 ? ? I DC  -67 J DG 67   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? I DA  7   N1  ? ? ? 1_555 J  DT 140 N3 ? ? I DA  -66 J DT 66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? I DA  7   N6  ? ? ? 1_555 J  DT 140 O4 ? ? I DA  -66 J DT 66   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? I DA  8   N1  ? ? ? 1_555 J  DT 139 N3 ? ? I DA  -65 J DT 65   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog16  hydrog ? ? I DA  9   N1  ? ? ? 1_555 J  DT 138 N3 ? ? I DA  -64 J DT 64   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog17  hydrog ? ? I DT  10  N3  ? ? ? 1_555 J  DA 137 N1 ? ? I DT  -63 J DA 63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? I DT  10  O4  ? ? ? 1_555 J  DA 137 N6 ? ? I DT  -63 J DA 63   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19  hydrog ? ? I DA  11  N1  ? ? ? 1_555 J  DT 136 N3 ? ? I DA  -62 J DT 62   1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog20  hydrog ? ? I DT  12  N3  ? ? ? 1_555 J  DA 135 N1 ? ? I DT  -61 J DA 61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? I DT  12  O4  ? ? ? 1_555 J  DA 135 N6 ? ? I DT  -61 J DA 61   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? I DC  13  O2  ? ? ? 1_555 J  DG 134 N2 ? ? I DC  -60 J DG 60   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog23  hydrog ? ? I DC  14  O2  ? ? ? 1_555 J  DG 133 N2 ? ? I DC  -59 J DG 59   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog24  hydrog ? ? I DC  14  O2  ? ? ? 1_555 J  DG 134 N2 ? ? I DC  -59 J DG 60   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog25  hydrog ? ? I DC  15  O2  ? ? ? 1_555 J  DG 132 N2 ? ? I DC  -58 J DG 58   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog26  hydrog ? ? I DT  16  N3  ? ? ? 1_555 J  DA 131 N1 ? ? I DT  -57 J DA 57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? I DT  16  O4  ? ? ? 1_555 J  DA 131 N6 ? ? I DT  -57 J DA 57   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? I DT  17  N3  ? ? ? 1_555 J  DA 130 N1 ? ? I DT  -56 J DA 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? I DT  17  O4  ? ? ? 1_555 J  DA 130 N6 ? ? I DT  -56 J DA 56   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? I DG  18  N1  ? ? ? 1_555 J  DC 129 N3 ? ? I DG  -55 J DC 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? I DG  18  N2  ? ? ? 1_555 J  DC 129 O2 ? ? I DG  -55 J DC 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? I DG  18  O6  ? ? ? 1_555 J  DC 129 N4 ? ? I DG  -55 J DC 55   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? I DC  19  N3  ? ? ? 1_555 J  DG 128 N1 ? ? I DC  -54 J DG 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? I DC  19  N4  ? ? ? 1_555 J  DG 128 O6 ? ? I DC  -54 J DG 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? I DC  19  O2  ? ? ? 1_555 J  DG 128 N2 ? ? I DC  -54 J DG 54   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? I DG  20  N1  ? ? ? 1_555 J  DC 127 N3 ? ? I DG  -53 J DC 53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? I DG  20  N2  ? ? ? 1_555 J  DC 127 O2 ? ? I DG  -53 J DC 53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? I DG  20  O6  ? ? ? 1_555 J  DC 127 N4 ? ? I DG  -53 J DC 53   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? I DG  21  N1  ? ? ? 1_555 J  DC 126 N3 ? ? I DG  -52 J DC 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? I DG  21  N2  ? ? ? 1_555 J  DC 126 O2 ? ? I DG  -52 J DC 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? I DG  21  O6  ? ? ? 1_555 J  DC 126 N4 ? ? I DG  -52 J DC 52   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? I DA  22  N1  ? ? ? 1_555 J  DT 125 N3 ? ? I DA  -51 J DT 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? I DA  22  N6  ? ? ? 1_555 J  DT 125 O4 ? ? I DA  -51 J DT 51   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? I DT  23  N3  ? ? ? 1_555 J  DA 124 N1 ? ? I DT  -50 J DA 50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? I DT  23  O4  ? ? ? 1_555 J  DA 124 N6 ? ? I DT  -50 J DA 50   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? I DC  24  N3  ? ? ? 1_555 J  DG 123 N1 ? ? I DC  -49 J DG 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? I DC  24  N4  ? ? ? 1_555 J  DG 123 O6 ? ? I DC  -49 J DG 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? I DC  24  O2  ? ? ? 1_555 J  DG 123 N2 ? ? I DC  -49 J DG 49   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? I DG  25  N1  ? ? ? 1_555 J  DC 122 N3 ? ? I DG  -48 J DC 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? I DG  25  N2  ? ? ? 1_555 J  DC 122 O2 ? ? I DG  -48 J DC 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? I DG  25  O6  ? ? ? 1_555 J  DC 122 N4 ? ? I DG  -48 J DC 48   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? I DT  26  N3  ? ? ? 1_555 J  DA 121 N1 ? ? I DT  -47 J DA 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? I DT  26  O4  ? ? ? 1_555 J  DA 121 N6 ? ? I DT  -47 J DA 47   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? I DA  27  N1  ? ? ? 1_555 J  DT 120 N3 ? ? I DA  -46 J DT 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? I DA  27  N6  ? ? ? 1_555 J  DT 120 O4 ? ? I DA  -46 J DT 46   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? I DG  28  N2  ? ? ? 1_555 J  DC 119 O2 ? ? I DG  -45 J DC 45   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog57  hydrog ? ? I DA  29  N1  ? ? ? 1_555 J  DT 118 N3 ? ? I DA  -44 J DT 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? I DA  29  N6  ? ? ? 1_555 J  DT 118 O4 ? ? I DA  -44 J DT 44   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? I DA  30  N1  ? ? ? 1_555 J  DT 117 N3 ? ? I DA  -43 J DT 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? I DA  30  N6  ? ? ? 1_555 J  DT 117 O4 ? ? I DA  -43 J DT 43   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? I DA  31  N1  ? ? ? 1_555 J  DT 116 N3 ? ? I DA  -42 J DT 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? I DA  31  N6  ? ? ? 1_555 J  DT 116 O4 ? ? I DA  -42 J DT 42   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? I DA  32  N1  ? ? ? 1_555 J  DT 115 N3 ? ? I DA  -41 J DT 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? I DA  32  N6  ? ? ? 1_555 J  DT 115 O4 ? ? I DA  -41 J DT 41   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? I DG  34  N1  ? ? ? 1_555 J  DC 113 N3 ? ? I DG  -39 J DC 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? I DG  34  N2  ? ? ? 1_555 J  DC 113 O2 ? ? I DG  -39 J DC 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? I DG  34  O6  ? ? ? 1_555 J  DC 113 N4 ? ? I DG  -39 J DC 39   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? I DT  35  N3  ? ? ? 1_555 J  DA 112 N1 ? ? I DT  -38 J DA 38   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog69  hydrog ? ? I DG  36  N1  ? ? ? 1_555 J  DC 111 N3 ? ? I DG  -37 J DC 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? I DG  36  N2  ? ? ? 1_555 J  DC 111 O2 ? ? I DG  -37 J DC 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? I DG  36  O6  ? ? ? 1_555 J  DC 111 N4 ? ? I DG  -37 J DC 37   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? I DT  37  N3  ? ? ? 1_555 J  DA 110 N1 ? ? I DT  -36 J DA 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? I DT  37  O4  ? ? ? 1_555 J  DA 110 N6 ? ? I DT  -36 J DA 36   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? I DG  38  N1  ? ? ? 1_555 J  DC 109 N3 ? ? I DG  -35 J DC 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? I DG  38  N2  ? ? ? 1_555 J  DC 109 O2 ? ? I DG  -35 J DC 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? I DG  38  O6  ? ? ? 1_555 J  DC 109 N4 ? ? I DG  -35 J DC 35   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? I DT  39  N3  ? ? ? 1_555 J  DA 108 N1 ? ? I DT  -34 J DA 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? I DT  39  O4  ? ? ? 1_555 J  DA 108 N6 ? ? I DT  -34 J DA 34   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog79  hydrog ? ? I DC  40  O2  ? ? ? 1_555 J  DG 107 N2 ? ? I DC  -33 J DG 33   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog80  hydrog ? ? I DA  41  N1  ? ? ? 1_555 J  DT 106 N3 ? ? I DA  -32 J DT 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? I DA  41  N6  ? ? ? 1_555 J  DT 106 O4 ? ? I DA  -32 J DT 32   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? I DA  42  N1  ? ? ? 1_555 J  DT 105 N3 ? ? I DA  -31 J DT 31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? I DA  42  N6  ? ? ? 1_555 J  DT 105 O4 ? ? I DA  -31 J DT 31   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? I DA  43  N6  ? ? ? 1_555 J  DG 103 O6 ? ? I DA  -30 J DG 29   1_555 ? ? ? ? ? ? 'DA-DG MISPAIR' ?     ? 
hydrog85  hydrog ? ? I DA  43  N1  ? ? ? 1_555 J  DT 104 N3 ? ? I DA  -30 J DT 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? I DA  43  N6  ? ? ? 1_555 J  DT 104 O4 ? ? I DA  -30 J DT 30   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? I DC  44  O2  ? ? ? 1_555 J  DG 103 N2 ? ? I DC  -29 J DG 29   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog88  hydrog ? ? I DT  45  N3  ? ? ? 1_555 J  DA 102 N1 ? ? I DT  -28 J DA 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? I DT  45  O4  ? ? ? 1_555 J  DA 102 N6 ? ? I DT  -28 J DA 28   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? I DG  46  N1  ? ? ? 1_555 J  DC 101 N3 ? ? I DG  -27 J DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? I DG  46  N2  ? ? ? 1_555 J  DC 101 O2 ? ? I DG  -27 J DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? I DG  46  O6  ? ? ? 1_555 J  DC 101 N4 ? ? I DG  -27 J DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? I DC  47  N3  ? ? ? 1_555 J  DG 100 N2 ? ? I DC  -26 J DG 26   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog94  hydrog ? ? I DG  48  N1  ? ? ? 1_555 J  DC 99  N3 ? ? I DG  -25 J DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? I DG  48  N2  ? ? ? 1_555 J  DC 99  O2 ? ? I DG  -25 J DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? I DG  48  O6  ? ? ? 1_555 J  DC 99  N4 ? ? I DG  -25 J DC 25   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? I DC  49  O2  ? ? ? 1_555 J  DG 98  N2 ? ? I DC  -24 J DG 24   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog98  hydrog ? ? I DT  50  N3  ? ? ? 1_555 J  DA 97  N1 ? ? I DT  -23 J DA 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? I DT  50  O4  ? ? ? 1_555 J  DA 97  N6 ? ? I DT  -23 J DA 23   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? I DT  50  O2  ? ? ? 1_555 J  DG 98  N2 ? ? I DT  -23 J DG 24   1_555 ? ? ? ? ? ? 'DT-DG MISPAIR' ?     ? 
hydrog101 hydrog ? ? I DA  51  N1  ? ? ? 1_555 J  DT 96  N3 ? ? I DA  -22 J DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? I DA  51  N6  ? ? ? 1_555 J  DT 96  O4 ? ? I DA  -22 J DT 22   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? I DT  52  N3  ? ? ? 1_555 J  DA 95  N1 ? ? I DT  -21 J DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? I DT  52  O4  ? ? ? 1_555 J  DA 95  N6 ? ? I DT  -21 J DA 21   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? I DC  53  O2  ? ? ? 1_555 J  DG 94  N2 ? ? I DC  -20 J DG 20   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog106 hydrog ? ? I DA  54  N1  ? ? ? 1_555 J  DT 93  N3 ? ? I DA  -19 J DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? I DA  54  N6  ? ? ? 1_555 J  DT 93  O4 ? ? I DA  -19 J DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? I DA  55  N1  ? ? ? 1_555 J  DT 92  N3 ? ? I DA  -18 J DT 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? I DA  55  N6  ? ? ? 1_555 J  DT 92  O4 ? ? I DA  -18 J DT 18   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? I DA  56  N1  ? ? ? 1_555 J  DT 91  N3 ? ? I DA  -17 J DT 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? I DA  56  N6  ? ? ? 1_555 J  DT 91  O4 ? ? I DA  -17 J DT 17   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? I DG  57  N1  ? ? ? 1_555 J  DC 90  N3 ? ? I DG  -16 J DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? I DG  57  N2  ? ? ? 1_555 J  DC 90  O2 ? ? I DG  -16 J DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? I DG  57  O6  ? ? ? 1_555 J  DC 90  N4 ? ? I DG  -16 J DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? I DG  58  N1  ? ? ? 1_555 J  DC 89  N3 ? ? I DG  -15 J DC 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? I DG  58  N2  ? ? ? 1_555 J  DC 89  O2 ? ? I DG  -15 J DC 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? I DG  58  O6  ? ? ? 1_555 J  DC 89  N4 ? ? I DG  -15 J DC 15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? I DG  59  N1  ? ? ? 1_555 J  DC 88  N3 ? ? I DG  -14 J DC 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? I DG  59  N2  ? ? ? 1_555 J  DC 88  O2 ? ? I DG  -14 J DC 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? I DG  59  O6  ? ? ? 1_555 J  DC 88  N4 ? ? I DG  -14 J DC 14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? I DA  60  N1  ? ? ? 1_555 J  DT 87  N3 ? ? I DA  -13 J DT 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? I DA  60  N6  ? ? ? 1_555 J  DT 87  O4 ? ? I DA  -13 J DT 13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? I DA  61  N1  ? ? ? 1_555 J  DT 86  N3 ? ? I DA  -12 J DT 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? I DA  61  N6  ? ? ? 1_555 J  DT 86  O4 ? ? I DA  -12 J DT 12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? I DA  62  N1  ? ? ? 1_555 J  DT 85  N3 ? ? I DA  -11 J DT 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? I DA  62  N6  ? ? ? 1_555 J  DT 85  O4 ? ? I DA  -11 J DT 11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? I DC  63  N3  ? ? ? 1_555 J  DG 84  N1 ? ? I DC  -10 J DG 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? I DC  63  N4  ? ? ? 1_555 J  DG 84  O6 ? ? I DC  -10 J DG 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? I DC  63  O2  ? ? ? 1_555 J  DG 84  N2 ? ? I DC  -10 J DG 10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? I DT  64  N3  ? ? ? 1_555 J  DA 83  N1 ? ? I DT  -9  J DA 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? I DT  64  O4  ? ? ? 1_555 J  DA 83  N6 ? ? I DT  -9  J DA 9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? I DT  65  N3  ? ? ? 1_555 J  DA 82  N1 ? ? I DT  -8  J DA 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? I DT  65  O4  ? ? ? 1_555 J  DA 82  N6 ? ? I DT  -8  J DA 8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? I DC  66  N3  ? ? ? 1_555 J  DG 81  N1 ? ? I DC  -7  J DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? I DC  66  N4  ? ? ? 1_555 J  DG 81  O6 ? ? I DC  -7  J DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? I DC  66  O2  ? ? ? 1_555 J  DG 81  N2 ? ? I DC  -7  J DG 7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? I DA  67  N1  ? ? ? 1_555 J  DT 80  N3 ? ? I DA  -6  J DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? I DA  67  N6  ? ? ? 1_555 J  DT 80  O4 ? ? I DA  -6  J DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? I DA  68  N1  ? ? ? 1_555 J  DT 79  N3 ? ? I DA  -5  J DT 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? I DA  68  N6  ? ? ? 1_555 J  DT 79  O4 ? ? I DA  -5  J DT 5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? I DC  69  N3  ? ? ? 1_555 J  DG 78  N1 ? ? I DC  -4  J DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? I DC  69  N4  ? ? ? 1_555 J  DG 78  O6 ? ? I DC  -4  J DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? I DC  69  O2  ? ? ? 1_555 J  DG 78  N2 ? ? I DC  -4  J DG 4    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? I DT  70  N3  ? ? ? 1_555 J  DA 77  N1 ? ? I DT  -3  J DA 3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? I DT  70  O4  ? ? ? 1_555 J  DA 77  N6 ? ? I DT  -3  J DA 3    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? I DG  71  N1  ? ? ? 1_555 J  DC 76  N3 ? ? I DG  -2  J DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? I DG  71  N2  ? ? ? 1_555 J  DC 76  O2 ? ? I DG  -2  J DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? I DG  71  O6  ? ? ? 1_555 J  DC 76  N4 ? ? I DG  -2  J DC 2    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? I DA  72  N1  ? ? ? 1_555 J  DT 75  N3 ? ? I DA  -1  J DT 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? I DA  72  N6  ? ? ? 1_555 J  DT 75  O4 ? ? I DA  -1  J DT 1    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? I DA  73  N1  ? ? ? 1_555 J  DT 74  N3 ? ? I DA  0   J DT 0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? I DA  73  N6  ? ? ? 1_555 J  DT 74  O4 ? ? I DA  0   J DT 0    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? I DT  74  N3  ? ? ? 1_555 J  DA 73  N1 ? ? I DT  1   J DA -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? I DT  74  O4  ? ? ? 1_555 J  DA 73  N6 ? ? I DT  1   J DA -1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? I DT  75  N3  ? ? ? 1_555 J  DA 72  N1 ? ? I DT  2   J DA -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? I DT  75  O4  ? ? ? 1_555 J  DA 72  N6 ? ? I DT  2   J DA -2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? I DC  76  N3  ? ? ? 1_555 J  DG 71  N1 ? ? I DC  3   J DG -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? I DC  76  N4  ? ? ? 1_555 J  DG 71  O6 ? ? I DC  3   J DG -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? I DC  76  O2  ? ? ? 1_555 J  DG 71  N2 ? ? I DC  3   J DG -3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? I DA  77  N1  ? ? ? 1_555 J  DT 70  N3 ? ? I DA  4   J DT -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? I DA  77  N6  ? ? ? 1_555 J  DT 70  O4 ? ? I DA  4   J DT -4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? I DG  78  N1  ? ? ? 1_555 J  DC 69  N3 ? ? I DG  5   J DC -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? I DG  78  N2  ? ? ? 1_555 J  DC 69  O2 ? ? I DG  5   J DC -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? I DG  78  O6  ? ? ? 1_555 J  DC 69  N4 ? ? I DG  5   J DC -5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? I DT  79  N3  ? ? ? 1_555 J  DA 68  N1 ? ? I DT  6   J DA -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? I DT  79  O4  ? ? ? 1_555 J  DA 68  N6 ? ? I DT  6   J DA -6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? I DT  80  N3  ? ? ? 1_555 J  DA 67  N1 ? ? I DT  7   J DA -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? I DT  80  O4  ? ? ? 1_555 J  DA 67  N6 ? ? I DT  7   J DA -7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? I DG  81  N1  ? ? ? 1_555 J  DC 66  N3 ? ? I DG  8   J DC -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? I DG  81  N2  ? ? ? 1_555 J  DC 66  O2 ? ? I DG  8   J DC -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? I DG  81  O6  ? ? ? 1_555 J  DC 66  N4 ? ? I DG  8   J DC -8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? I DA  82  N1  ? ? ? 1_555 J  DT 65  N3 ? ? I DA  9   J DT -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? I DA  82  N6  ? ? ? 1_555 J  DT 65  O4 ? ? I DA  9   J DT -9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? I DA  83  N1  ? ? ? 1_555 J  DT 64  N3 ? ? I DA  10  J DT -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? I DA  83  N6  ? ? ? 1_555 J  DT 64  O4 ? ? I DA  10  J DT -10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? I DG  84  N1  ? ? ? 1_555 J  DC 63  N3 ? ? I DG  11  J DC -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? I DG  84  N2  ? ? ? 1_555 J  DC 63  O2 ? ? I DG  11  J DC -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? I DG  84  O6  ? ? ? 1_555 J  DC 63  N4 ? ? I DG  11  J DC -11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? I DT  85  N3  ? ? ? 1_555 J  DA 62  N1 ? ? I DT  12  J DA -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? I DT  85  O4  ? ? ? 1_555 J  DA 62  N6 ? ? I DT  12  J DA -12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? I DT  86  O4  ? ? ? 1_555 J  DA 60  N6 ? ? I DT  13  J DA -14  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog182 hydrog ? ? I DT  86  N3  ? ? ? 1_555 J  DA 61  N1 ? ? I DT  13  J DA -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? I DT  86  O4  ? ? ? 1_555 J  DA 61  N6 ? ? I DT  13  J DA -13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? I DT  87  N3  ? ? ? 1_555 J  DA 60  N1 ? ? I DT  14  J DA -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? I DT  87  O4  ? ? ? 1_555 J  DA 60  N6 ? ? I DT  14  J DA -14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? I DC  88  N3  ? ? ? 1_555 J  DG 59  N1 ? ? I DC  15  J DG -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? I DC  88  N4  ? ? ? 1_555 J  DG 59  O6 ? ? I DC  15  J DG -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? I DC  88  O2  ? ? ? 1_555 J  DG 59  N2 ? ? I DC  15  J DG -15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? I DC  89  N4  ? ? ? 1_555 J  DG 57  O6 ? ? I DC  16  J DG -17  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog190 hydrog ? ? I DC  89  N3  ? ? ? 1_555 J  DG 58  N1 ? ? I DC  16  J DG -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? I DC  89  N4  ? ? ? 1_555 J  DG 58  O6 ? ? I DC  16  J DG -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? I DC  89  O2  ? ? ? 1_555 J  DG 58  N2 ? ? I DC  16  J DG -16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? I DC  90  O2  ? ? ? 1_555 J  DG 57  N2 ? ? I DC  17  J DG -17  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog194 hydrog ? ? I DT  91  N3  ? ? ? 1_555 J  DA 56  N1 ? ? I DT  18  J DA -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? I DT  91  O4  ? ? ? 1_555 J  DA 56  N6 ? ? I DT  18  J DA -18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ? ? I DT  92  N3  ? ? ? 1_555 J  DA 55  N1 ? ? I DT  19  J DA -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ? ? I DT  92  O4  ? ? ? 1_555 J  DA 55  N6 ? ? I DT  19  J DA -19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? I DT  93  N3  ? ? ? 1_555 J  DA 54  N1 ? ? I DT  20  J DA -20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? I DT  93  O4  ? ? ? 1_555 J  DA 54  N6 ? ? I DT  20  J DA -20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? I DG  94  N1  ? ? ? 1_555 J  DC 53  N3 ? ? I DG  21  J DC -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? I DG  94  N2  ? ? ? 1_555 J  DC 53  O2 ? ? I DG  21  J DC -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? I DG  94  O6  ? ? ? 1_555 J  DC 53  N4 ? ? I DG  21  J DC -21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? I DA  95  N1  ? ? ? 1_555 J  DT 52  N3 ? ? I DA  22  J DT -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? I DA  95  N6  ? ? ? 1_555 J  DT 52  O4 ? ? I DA  22  J DT -22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? I DT  96  N3  ? ? ? 1_555 J  DA 51  N1 ? ? I DT  23  J DA -23  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog206 hydrog ? ? I DA  97  N1  ? ? ? 1_555 J  DT 50  N3 ? ? I DA  24  J DT -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? I DA  97  N6  ? ? ? 1_555 J  DT 50  O4 ? ? I DA  24  J DT -24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? I DG  98  N1  ? ? ? 1_555 J  DC 49  N3 ? ? I DG  25  J DC -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? I DG  98  N2  ? ? ? 1_555 J  DC 49  O2 ? ? I DG  25  J DC -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? I DG  98  O6  ? ? ? 1_555 J  DC 49  N4 ? ? I DG  25  J DC -25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ? ? I DC  99  N3  ? ? ? 1_555 J  DG 48  N1 ? ? I DC  26  J DG -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? I DC  99  N4  ? ? ? 1_555 J  DG 48  O6 ? ? I DC  26  J DG -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? I DC  99  O2  ? ? ? 1_555 J  DG 48  N2 ? ? I DC  26  J DG -26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? I DG  100 N1  ? ? ? 1_555 J  DC 47  N3 ? ? I DG  27  J DC -27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog215 hydrog ? ? I DG  100 N2  ? ? ? 1_555 J  DC 47  O2 ? ? I DG  27  J DC -27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? I DG  100 O6  ? ? ? 1_555 J  DC 47  N4 ? ? I DG  27  J DC -27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? I DC  101 O2  ? ? ? 1_555 J  DG 46  N2 ? ? I DC  28  J DG -28  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog218 hydrog ? ? I DA  102 N1  ? ? ? 1_555 J  DT 45  N3 ? ? I DA  29  J DT -29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? I DA  102 N6  ? ? ? 1_555 J  DT 45  O4 ? ? I DA  29  J DT -29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? I DG  103 N1  ? ? ? 1_555 J  DC 44  N3 ? ? I DG  30  J DC -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? I DG  103 N2  ? ? ? 1_555 J  DC 44  O2 ? ? I DG  30  J DC -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? I DG  103 O6  ? ? ? 1_555 J  DC 44  N4 ? ? I DG  30  J DC -30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? I DT  104 N3  ? ? ? 1_555 J  DA 43  N1 ? ? I DT  31  J DA -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? I DT  104 O4  ? ? ? 1_555 J  DA 43  N6 ? ? I DT  31  J DA -31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? I DT  105 N3  ? ? ? 1_555 J  DA 42  N1 ? ? I DT  32  J DA -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? I DT  105 O4  ? ? ? 1_555 J  DA 42  N6 ? ? I DT  32  J DA -32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? I DT  106 N3  ? ? ? 1_555 J  DA 41  N1 ? ? I DT  33  J DA -33  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog228 hydrog ? ? I DG  107 N1  ? ? ? 1_555 J  DC 40  N3 ? ? I DG  34  J DC -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? I DG  107 N2  ? ? ? 1_555 J  DC 40  O2 ? ? I DG  34  J DC -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? I DG  107 O6  ? ? ? 1_555 J  DC 40  N4 ? ? I DG  34  J DC -34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? I DA  108 N1  ? ? ? 1_555 J  DT 39  N3 ? ? I DA  35  J DT -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? I DA  108 N6  ? ? ? 1_555 J  DT 39  O4 ? ? I DA  35  J DT -35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? I DC  109 N4  ? ? ? 1_555 J  DT 37  O4 ? ? I DC  36  J DT -37  1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ?     ? 
hydrog234 hydrog ? ? I DC  109 N3  ? ? ? 1_555 J  DG 38  N1 ? ? I DC  36  J DG -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? I DC  109 N4  ? ? ? 1_555 J  DG 38  O6 ? ? I DC  36  J DG -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? I DC  109 O2  ? ? ? 1_555 J  DG 38  N2 ? ? I DC  36  J DG -36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? I DA  110 N1  ? ? ? 1_555 J  DT 37  N3 ? ? I DA  37  J DT -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? I DA  110 N6  ? ? ? 1_555 J  DT 37  O4 ? ? I DA  37  J DT -37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? I DC  111 N3  ? ? ? 1_555 J  DG 36  N1 ? ? I DC  38  J DG -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? I DC  111 N4  ? ? ? 1_555 J  DG 36  O6 ? ? I DC  38  J DG -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? I DC  111 O2  ? ? ? 1_555 J  DG 36  N2 ? ? I DC  38  J DG -38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ? ? I DA  112 N1  ? ? ? 1_555 J  DT 35  N3 ? ? I DA  39  J DT -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? I DA  112 N6  ? ? ? 1_555 J  DT 35  O4 ? ? I DA  39  J DT -39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? I DC  113 N3  ? ? ? 1_555 J  DG 34  N1 ? ? I DC  40  J DG -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? I DC  113 N4  ? ? ? 1_555 J  DG 34  O6 ? ? I DC  40  J DG -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? I DC  113 O2  ? ? ? 1_555 J  DG 34  N2 ? ? I DC  40  J DG -40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? I DT  114 N3  ? ? ? 1_555 J  DA 33  N1 ? ? I DT  41  J DA -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? I DT  114 O4  ? ? ? 1_555 J  DA 33  N6 ? ? I DT  41  J DA -41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? I DT  115 N3  ? ? ? 1_555 J  DA 32  N1 ? ? I DT  42  J DA -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? I DT  115 O4  ? ? ? 1_555 J  DA 32  N6 ? ? I DT  42  J DA -42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ? ? I DT  116 N3  ? ? ? 1_555 J  DA 31  N1 ? ? I DT  43  J DA -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog252 hydrog ? ? I DT  116 O4  ? ? ? 1_555 J  DA 31  N6 ? ? I DT  43  J DA -43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog253 hydrog ? ? I DT  117 N3  ? ? ? 1_555 J  DA 30  N1 ? ? I DT  44  J DA -44  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog254 hydrog ? ? I DT  118 N3  ? ? ? 1_555 J  DA 29  N1 ? ? I DT  45  J DA -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog255 hydrog ? ? I DT  118 O4  ? ? ? 1_555 J  DA 29  N6 ? ? I DT  45  J DA -45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog256 hydrog ? ? I DC  119 O2  ? ? ? 1_555 J  DG 28  N2 ? ? I DC  46  J DG -46  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog257 hydrog ? ? I DT  120 N3  ? ? ? 1_555 J  DA 27  N1 ? ? I DT  47  J DA -47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog258 hydrog ? ? I DT  120 O4  ? ? ? 1_555 J  DA 27  N6 ? ? I DT  47  J DA -47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog259 hydrog ? ? I DA  121 N1  ? ? ? 1_555 J  DT 26  N3 ? ? I DA  48  J DT -48  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog260 hydrog ? ? I DC  122 N4  ? ? ? 1_555 J  DG 25  O6 ? ? I DC  49  J DG -49  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog261 hydrog ? ? I DG  123 N1  ? ? ? 1_555 J  DC 24  N3 ? ? I DG  50  J DC -50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog262 hydrog ? ? I DG  123 N2  ? ? ? 1_555 J  DC 24  O2 ? ? I DG  50  J DC -50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog263 hydrog ? ? I DG  123 O6  ? ? ? 1_555 J  DC 24  N4 ? ? I DG  50  J DC -50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? I DC  126 N4  ? ? ? 1_555 J  DG 20  O6 ? ? I DC  53  J DG -54  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog265 hydrog ? ? I DC  126 O2  ? ? ? 1_555 J  DG 21  N1 ? ? I DC  53  J DG -53  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog266 hydrog ? ? I DC  127 O2  ? ? ? 1_555 J  DG 20  N2 ? ? I DC  54  J DG -54  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog267 hydrog ? ? I DA  130 N6  ? ? ? 1_555 J  DT 17  O4 ? ? I DA  57  J DT -57  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog268 hydrog ? ? I DG  132 O6  ? ? ? 1_555 J  DC 14  N4 ? ? I DG  59  J DC -60  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog269 hydrog ? ? I DG  132 N1  ? ? ? 1_555 J  DC 15  O2 ? ? I DG  59  J DC -59  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog270 hydrog ? ? I DG  133 N1  ? ? ? 1_555 J  DC 14  N3 ? ? I DG  60  J DC -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? I DG  133 N2  ? ? ? 1_555 J  DC 14  O2 ? ? I DG  60  J DC -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? I DG  133 O6  ? ? ? 1_555 J  DC 14  N4 ? ? I DG  60  J DC -60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? I DG  134 N1  ? ? ? 1_555 J  DC 13  N3 ? ? I DG  61  J DC -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog274 hydrog ? ? I DG  134 N2  ? ? ? 1_555 J  DC 13  O2 ? ? I DG  61  J DC -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog275 hydrog ? ? I DG  134 O6  ? ? ? 1_555 J  DC 13  N4 ? ? I DG  61  J DC -61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog276 hydrog ? ? I DA  135 N1  ? ? ? 1_555 J  DT 12  N3 ? ? I DA  62  J DT -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog277 hydrog ? ? I DA  135 N6  ? ? ? 1_555 J  DT 12  O4 ? ? I DA  62  J DT -62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog278 hydrog ? ? I DT  136 N3  ? ? ? 1_555 J  DA 11  N1 ? ? I DT  63  J DA -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog279 hydrog ? ? I DT  136 O4  ? ? ? 1_555 J  DA 11  N6 ? ? I DT  63  J DA -63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog280 hydrog ? ? I DA  137 N1  ? ? ? 1_555 J  DT 10  N3 ? ? I DA  64  J DT -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog281 hydrog ? ? I DA  137 N6  ? ? ? 1_555 J  DT 10  O4 ? ? I DA  64  J DT -64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog282 hydrog ? ? I DT  138 N3  ? ? ? 1_555 J  DA 9   N1 ? ? I DT  65  J DA -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog283 hydrog ? ? I DT  138 O4  ? ? ? 1_555 J  DA 9   N6 ? ? I DT  65  J DA -65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ? ? I DT  139 N3  ? ? ? 1_555 J  DA 8   N1 ? ? I DT  66  J DA -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog285 hydrog ? ? I DT  139 O4  ? ? ? 1_555 J  DA 8   N6 ? ? I DT  66  J DA -66  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ? ? I DT  140 N3  ? ? ? 1_555 J  DA 7   N1 ? ? I DT  67  J DA -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog287 hydrog ? ? I DT  140 O4  ? ? ? 1_555 J  DA 7   N6 ? ? I DT  67  J DA -67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog288 hydrog ? ? I DG  141 N1  ? ? ? 1_555 J  DC 6   N3 ? ? I DG  68  J DC -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog289 hydrog ? ? I DG  141 N2  ? ? ? 1_555 J  DC 6   O2 ? ? I DG  68  J DC -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog290 hydrog ? ? I DG  141 O6  ? ? ? 1_555 J  DC 6   N4 ? ? I DG  68  J DC -68  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog291 hydrog ? ? I DG  142 N1  ? ? ? 1_555 J  DC 5   N3 ? ? I DG  69  J DC -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog292 hydrog ? ? I DG  142 N2  ? ? ? 1_555 J  DC 5   O2 ? ? I DG  69  J DC -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog293 hydrog ? ? I DG  142 O6  ? ? ? 1_555 J  DC 5   N4 ? ? I DG  69  J DC -69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog294 hydrog ? ? I DA  143 N1  ? ? ? 1_555 J  DT 4   N3 ? ? I DA  70  J DT -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog295 hydrog ? ? I DA  143 N6  ? ? ? 1_555 J  DT 4   O4 ? ? I DA  70  J DT -70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog296 hydrog ? ? I DG  144 N1  ? ? ? 1_555 J  DC 3   N3 ? ? I DG  71  J DC -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog297 hydrog ? ? I DG  144 N2  ? ? ? 1_555 J  DC 3   O2 ? ? I DG  71  J DC -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog298 hydrog ? ? I DG  144 O6  ? ? ? 1_555 J  DC 3   N4 ? ? I DG  71  J DC -71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog299 hydrog ? ? I DA  145 N1  ? ? ? 1_555 J  DT 2   N3 ? ? I DA  72  J DT -72  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog300 hydrog ? ? I DT  146 N3  ? ? ? 1_555 J  DA 1   N1 ? ? I DT  73  J DA -73  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog301 hydrog ? ? I DT  146 O4  ? ? ? 1_555 J  DA 1   N6 ? ? I DT  73  J DA -73  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
B 1 2 ? parallel 
C 1 2 ? parallel 
D 1 2 ? parallel 
E 1 2 ? parallel 
F 1 2 ? parallel 
G 1 2 ? parallel 
H 1 2 ? parallel 
I 1 2 ? parallel 
J 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 83  ? PHE A 84  ? ARG A 83  PHE A 84  
A 2 THR B 80  ? VAL B 81  ? THR B 80  VAL B 81  
B 1 THR A 118 ? ILE A 119 ? THR A 118 ILE A 119 
B 2 ARG B 45  ? ILE B 46  ? ARG B 45  ILE B 46  
C 1 THR B 96  ? TYR B 98  ? THR B 96  TYR B 98  
C 2 VAL G 100 ? ILE G 102 ? VAL G 100 ILE G 102 
D 1 ARG C 42  ? VAL C 43  ? ARG C 42  VAL C 43  
D 2 THR D 85  ? ILE D 86  ? THR D 85  ILE D 86  
E 1 ARG C 77  ? ILE C 78  ? ARG C 77  ILE C 78  
E 2 GLY D 50  ? ILE D 51  ? GLY D 50  ILE D 51  
F 1 THR C 101 ? ILE C 102 ? THR C 101 ILE C 102 
F 2 LEU F 97  ? TYR F 98  ? LEU F 97  TYR F 98  
G 1 ARG E 83  ? PHE E 84  ? ARG E 83  PHE E 84  
G 2 THR F 80  ? VAL F 81  ? THR F 80  VAL F 81  
H 1 THR E 118 ? ILE E 119 ? THR E 118 ILE E 119 
H 2 ARG F 45  ? ILE F 46  ? ARG F 45  ILE F 46  
I 1 ARG G 42  ? VAL G 43  ? ARG G 42  VAL G 43  
I 2 THR H 85  ? ILE H 86  ? THR H 85  ILE H 86  
J 1 ARG G 77  ? ILE G 78  ? ARG G 77  ILE G 78  
J 2 GLY H 50  ? ILE H 51  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 83  ? N ARG A 83  O VAL B 81  ? O VAL B 81  
B 1 2 N ILE A 119 ? N ILE A 119 O ARG B 45  ? O ARG B 45  
C 1 2 N TYR B 98  ? N TYR B 98  O THR G 101 ? O THR G 101 
D 1 2 N ARG C 42  ? N ARG C 42  O ILE D 86  ? O ILE D 86  
E 1 2 N ILE C 78  ? N ILE C 78  O GLY D 50  ? O GLY D 50  
F 1 2 N THR C 101 ? N THR C 101 O TYR F 98  ? O TYR F 98  
G 1 2 N ARG E 83  ? N ARG E 83  O VAL F 81  ? O VAL F 81  
H 1 2 N ILE E 119 ? N ILE E 119 O ARG F 45  ? O ARG F 45  
I 1 2 N ARG G 42  ? N ARG G 42  O ILE H 86  ? O ILE H 86  
J 1 2 N ILE G 78  ? N ILE G 78  O GLY H 50  ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN A 1001'  
AC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MN D 1007'  
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 D 1101' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 C 1102' 
AC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 G 1103' 
AC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 73'    
AC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 74'    
AC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 75'    
AC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 76'    
BC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 74'    
BC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 75'    
BC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 77'    
BC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 76'    
BC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 78'    
BC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE PT I 77'    
BC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 79'    
BC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 78'    
BC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT I 79'    
CC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE PT I 80'    
CC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 81'    
CC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 82'    
CC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 80'    
CC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 83'    
CC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 81'    
CC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 82'    
CC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 84'    
CC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 83'    
DC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 85'    
DC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 86'    
DC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT I 87'    
DC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 84'    
DC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 85'    
DC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 88'    
DC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 86'    
DC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 87'    
DC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT F 103'   
EC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT B 103'   
EC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 89'    
EC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT I 90'    
EC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 88'    
EC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT I 91'    
EC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 89'    
EC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 90'    
EC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 91'    
EC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT J 92'    
FC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 93'    
FC2 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 93'    
FC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE PT I 94'    
FC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE PT I 95'    
FC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 96'    
FC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT I 97'    
FC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE PT J 106'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 ASP A  77  ? ASP A 77  . ? 1_555 ? 
2  AC1 2 VAL H  45  ? VAL H 45  . ? 3_545 ? 
3  AC2 1 VAL D  45  ? VAL D 45  . ? 1_555 ? 
4  AC3 5 ARG C  71  ? ARG C 71  . ? 1_555 ? 
5  AC3 5 HIS D  46  ? HIS D 46  . ? 1_555 ? 
6  AC3 5 PRO D  47  ? PRO D 47  . ? 1_555 ? 
7  AC3 5 ASP D  48  ? ASP D 48  . ? 1_555 ? 
8  AC3 5 THR D  49  ? THR D 49  . ? 1_555 ? 
9  AC4 5 ALA C  45  ? ALA C 45  . ? 1_555 ? 
10 AC4 5 GLY C  46  ? GLY C 46  . ? 1_555 ? 
11 AC4 5 ALA C  47  ? ALA C 47  . ? 1_555 ? 
12 AC4 5 THR D  87  ? THR D 87  . ? 1_555 ? 
13 AC4 5 SER D  88  ? SER D 88  . ? 1_555 ? 
14 AC5 6 GLY G  44  ? GLY G 44  . ? 1_555 ? 
15 AC5 6 ALA G  45  ? ALA G 45  . ? 1_555 ? 
16 AC5 6 GLY G  46  ? GLY G 46  . ? 1_555 ? 
17 AC5 6 ALA G  47  ? ALA G 47  . ? 1_555 ? 
18 AC5 6 THR H  87  ? THR H 87  . ? 1_555 ? 
19 AC5 6 SER H  88  ? SER H 88  . ? 1_555 ? 
20 AC6 1 DG  J  81  ? DG  J 7   . ? 1_555 ? 
21 AC7 1 DG  J  142 ? DG  J 68  . ? 1_555 ? 
22 AC8 1 DG  J  132 ? DG  J 58  . ? 1_555 ? 
23 AC9 2 DG  J  71  ? DG  J -3  . ? 1_555 ? 
24 AC9 2 DA  J  72  ? DA  J -2  . ? 1_555 ? 
25 BC1 1 DG  I  59  ? DG  I -14 . ? 1_555 ? 
26 BC2 1 DG  I  144 ? DG  I 71  . ? 1_555 ? 
27 BC3 1 DG  J  103 ? DG  J 29  . ? 1_555 ? 
28 BC4 1 DG  I  78  ? DG  I 5   . ? 1_555 ? 
29 BC5 1 DG  J  78  ? DG  J 4   . ? 1_555 ? 
30 BC6 3 DG  I  132 ? DG  I 59  . ? 1_555 ? 
31 BC6 3 DG  I  133 ? DG  I 60  . ? 1_555 ? 
32 BC6 3 PT  X  .   ? PT  I 80  . ? 1_555 ? 
33 BC7 1 DG  J  28  ? DG  J -46 . ? 1_555 ? 
34 BC8 1 DG  I  20  ? DG  I -53 . ? 1_555 ? 
35 BC9 2 DG  I  141 ? DG  I 68  . ? 1_555 ? 
36 BC9 2 DG  I  142 ? DG  I 69  . ? 1_555 ? 
37 CC1 3 DA  I  131 ? DA  I 58  . ? 1_555 ? 
38 CC1 3 DG  I  132 ? DG  I 59  . ? 1_555 ? 
39 CC1 3 PT  U  .   ? PT  I 77  . ? 1_555 ? 
40 CC2 1 DA  I  1   ? DA  I -72 . ? 1_555 ? 
41 CC3 1 DG  I  28  ? DG  I -45 . ? 1_555 ? 
42 CC4 1 DG  J  84  ? DG  J 10  . ? 1_555 ? 
43 CC5 1 DG  I  57  ? DG  I -16 . ? 1_555 ? 
44 CC6 1 DG  J  134 ? DG  J 60  . ? 1_555 ? 
45 CC7 1 DG  J  144 ? DG  J 70  . ? 1_555 ? 
46 CC8 1 DG  I  100 ? DG  I 27  . ? 1_555 ? 
47 CC9 1 DG  J  34  ? DG  J -40 . ? 1_555 ? 
48 DC1 1 DG  I  58  ? DG  I -15 . ? 1_555 ? 
49 DC2 1 DG  I  98  ? DG  I 25  . ? 1_555 ? 
50 DC3 2 DT  I  106 ? DT  I 33  . ? 1_555 ? 
51 DC3 2 DG  I  107 ? DG  I 34  . ? 1_555 ? 
52 DC4 1 DA  J  1   ? DA  J -73 . ? 1_555 ? 
53 DC5 1 DC  J  19  ? DC  J -55 . ? 1_555 ? 
54 DC6 1 DG  I  18  ? DG  I -55 . ? 1_555 ? 
55 DC7 2 DG  J  133 ? DG  J 59  . ? 1_555 ? 
56 DC7 2 DG  J  134 ? DG  J 60  . ? 1_555 ? 
57 DC8 2 DA  J  56  ? DA  J -18 . ? 1_555 ? 
58 DC8 2 DG  J  57  ? DG  J -17 . ? 1_555 ? 
59 DC9 1 MET F  84  ? MET F 84  . ? 1_555 ? 
60 EC1 1 MET B  84  ? MET B 84  . ? 1_555 ? 
61 EC2 1 DA  I  102 ? DA  I 29  . ? 1_555 ? 
62 EC3 2 DG  I  133 ? DG  I 60  . ? 1_555 ? 
63 EC3 2 DG  I  134 ? DG  I 61  . ? 1_555 ? 
64 EC4 1 DG  J  59  ? DG  J -15 . ? 1_555 ? 
65 EC5 2 DC  I  76  ? DC  I 3   . ? 1_555 ? 
66 EC5 2 DA  I  77  ? DA  I 4   . ? 1_555 ? 
67 EC6 2 DG  J  58  ? DG  J -16 . ? 1_555 ? 
68 EC6 2 DG  J  57  ? DG  J -17 . ? 1_555 ? 
69 EC7 2 DG  J  141 ? DG  J 67  . ? 1_555 ? 
70 EC7 2 DG  J  142 ? DG  J 68  . ? 1_555 ? 
71 EC8 1 PT  MA .   ? PT  I 95  . ? 1_555 ? 
72 EC9 2 DG  J  98  ? DG  J 24  . ? 1_555 ? 
73 EC9 2 DC  J  99  ? DC  J 25  . ? 1_555 ? 
74 FC1 1 DG  J  20  ? DG  J -54 . ? 1_555 ? 
75 FC2 1 DA  I  27  ? DA  I -46 . ? 1_555 ? 
76 FC3 2 DG  I  38  ? DG  I -35 . ? 1_555 ? 
77 FC3 2 PT  MA .   ? PT  I 95  . ? 1_555 ? 
78 FC4 3 DG  I  38  ? DG  I -35 . ? 1_555 ? 
79 FC4 3 PT  LA .   ? PT  I 94  . ? 1_555 ? 
80 FC4 3 PT  HB .   ? PT  J 91  . ? 1_555 ? 
81 FC5 1 DG  I  71  ? DG  I -2  . ? 1_555 ? 
82 FC6 1 DT  I  80  ? DT  I 7   . ? 1_555 ? 
83 FC7 1 DG  J  38  ? DG  J -36 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3REL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3REL 
_atom_sites.fract_transf_matrix[1][1]   0.009464 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009116 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005693 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
PT 
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . PRO A  1 38  ? 9.845   -21.499 87.742  1.00 71.07  ? 38   PRO A N     1 
ATOM   2     C  CA    . PRO A  1 38  ? 10.096  -20.980 86.384  1.00 70.71  ? 38   PRO A CA    1 
ATOM   3     C  C     . PRO A  1 38  ? 8.834   -20.437 85.685  1.00 70.25  ? 38   PRO A C     1 
ATOM   4     O  O     . PRO A  1 38  ? 7.734   -20.990 85.842  1.00 70.28  ? 38   PRO A O     1 
ATOM   5     C  CB    . PRO A  1 38  ? 10.663  -22.193 85.629  1.00 70.67  ? 38   PRO A CB    1 
ATOM   6     C  CG    . PRO A  1 38  ? 10.108  -23.384 86.345  1.00 70.92  ? 38   PRO A CG    1 
ATOM   7     C  CD    . PRO A  1 38  ? 9.862   -22.980 87.800  1.00 71.13  ? 38   PRO A CD    1 
ATOM   8     N  N     . HIS A  1 39  ? 9.027   -19.368 84.912  1.00 69.45  ? 39   HIS A N     1 
ATOM   9     C  CA    . HIS A  1 39  ? 7.966   -18.662 84.191  1.00 68.38  ? 39   HIS A CA    1 
ATOM   10    C  C     . HIS A  1 39  ? 7.131   -19.588 83.327  1.00 67.47  ? 39   HIS A C     1 
ATOM   11    O  O     . HIS A  1 39  ? 7.649   -20.523 82.722  1.00 67.05  ? 39   HIS A O     1 
ATOM   12    C  CB    . HIS A  1 39  ? 8.568   -17.554 83.315  1.00 68.65  ? 39   HIS A CB    1 
ATOM   13    C  CG    . HIS A  1 39  ? 7.546   -16.723 82.607  1.00 69.27  ? 39   HIS A CG    1 
ATOM   14    N  ND1   . HIS A  1 39  ? 7.277   -16.861 81.262  1.00 69.91  ? 39   HIS A ND1   1 
ATOM   15    C  CD2   . HIS A  1 39  ? 6.709   -15.760 83.062  1.00 70.36  ? 39   HIS A CD2   1 
ATOM   16    C  CE1   . HIS A  1 39  ? 6.327   -16.012 80.916  1.00 70.15  ? 39   HIS A CE1   1 
ATOM   17    N  NE2   . HIS A  1 39  ? 5.963   -15.332 81.989  1.00 71.04  ? 39   HIS A NE2   1 
ATOM   18    N  N     . ARG A  1 40  ? 5.835   -19.297 83.267  1.00 66.50  ? 40   ARG A N     1 
ATOM   19    C  CA    . ARG A  1 40  ? 4.892   -20.120 82.543  1.00 65.53  ? 40   ARG A CA    1 
ATOM   20    C  C     . ARG A  1 40  ? 3.709   -19.280 82.057  1.00 64.91  ? 40   ARG A C     1 
ATOM   21    O  O     . ARG A  1 40  ? 2.953   -18.753 82.882  1.00 65.02  ? 40   ARG A O     1 
ATOM   22    C  CB    . ARG A  1 40  ? 4.412   -21.237 83.473  1.00 65.60  ? 40   ARG A CB    1 
ATOM   23    C  CG    . ARG A  1 40  ? 3.863   -22.428 82.756  1.00 65.73  ? 40   ARG A CG    1 
ATOM   24    C  CD    . ARG A  1 40  ? 4.109   -23.683 83.533  1.00 64.52  ? 40   ARG A CD    1 
ATOM   25    N  NE    . ARG A  1 40  ? 4.752   -24.687 82.689  1.00 64.83  ? 40   ARG A NE    1 
ATOM   26    C  CZ    . ARG A  1 40  ? 4.114   -25.438 81.798  1.00 65.05  ? 40   ARG A CZ    1 
ATOM   27    N  NH1   . ARG A  1 40  ? 2.805   -25.303 81.617  1.00 65.17  ? 40   ARG A NH1   1 
ATOM   28    N  NH2   . ARG A  1 40  ? 4.790   -26.326 81.084  1.00 65.64  ? 40   ARG A NH2   1 
ATOM   29    N  N     . TYR A  1 41  ? 3.541   -19.163 80.734  1.00 63.85  ? 41   TYR A N     1 
ATOM   30    C  CA    . TYR A  1 41  ? 2.382   -18.452 80.156  1.00 62.93  ? 41   TYR A CA    1 
ATOM   31    C  C     . TYR A  1 41  ? 1.057   -19.205 80.333  1.00 62.41  ? 41   TYR A C     1 
ATOM   32    O  O     . TYR A  1 41  ? 1.004   -20.430 80.261  1.00 62.70  ? 41   TYR A O     1 
ATOM   33    C  CB    . TYR A  1 41  ? 2.595   -18.155 78.667  1.00 63.01  ? 41   TYR A CB    1 
ATOM   34    C  CG    . TYR A  1 41  ? 3.654   -17.115 78.376  1.00 62.86  ? 41   TYR A CG    1 
ATOM   35    C  CD1   . TYR A  1 41  ? 4.856   -17.475 77.773  1.00 63.64  ? 41   TYR A CD1   1 
ATOM   36    C  CD2   . TYR A  1 41  ? 3.455   -15.781 78.698  1.00 61.84  ? 41   TYR A CD2   1 
ATOM   37    C  CE1   . TYR A  1 41  ? 5.833   -16.543 77.502  1.00 63.52  ? 41   TYR A CE1   1 
ATOM   38    C  CE2   . TYR A  1 41  ? 4.422   -14.835 78.431  1.00 62.45  ? 41   TYR A CE2   1 
ATOM   39    C  CZ    . TYR A  1 41  ? 5.615   -15.222 77.836  1.00 63.88  ? 41   TYR A CZ    1 
ATOM   40    O  OH    . TYR A  1 41  ? 6.602   -14.288 77.572  1.00 64.78  ? 41   TYR A OH    1 
ATOM   41    N  N     . ARG A  1 42  ? -0.024  -18.472 80.547  1.00 61.75  ? 42   ARG A N     1 
ATOM   42    C  CA    . ARG A  1 42  ? -1.339  -19.099 80.672  1.00 61.28  ? 42   ARG A CA    1 
ATOM   43    C  C     . ARG A  1 42  ? -1.776  -19.691 79.331  1.00 60.11  ? 42   ARG A C     1 
ATOM   44    O  O     . ARG A  1 42  ? -1.450  -19.139 78.275  1.00 60.21  ? 42   ARG A O     1 
ATOM   45    C  CB    . ARG A  1 42  ? -2.363  -18.094 81.202  1.00 60.94  ? 42   ARG A CB    1 
ATOM   46    C  CG    . ARG A  1 42  ? -2.047  -17.601 82.618  1.00 61.93  ? 42   ARG A CG    1 
ATOM   47    C  CD    . ARG A  1 42  ? -3.044  -16.539 83.085  1.00 62.90  ? 42   ARG A CD    1 
ATOM   48    N  NE    . ARG A  1 42  ? -4.366  -17.121 83.292  1.00 66.26  ? 42   ARG A NE    1 
ATOM   49    C  CZ    . ARG A  1 42  ? -5.436  -16.468 83.731  1.00 67.00  ? 42   ARG A CZ    1 
ATOM   50    N  NH1   . ARG A  1 42  ? -5.366  -15.174 84.018  1.00 67.82  ? 42   ARG A NH1   1 
ATOM   51    N  NH2   . ARG A  1 42  ? -6.586  -17.125 83.874  1.00 67.40  ? 42   ARG A NH2   1 
ATOM   52    N  N     . PRO A  1 43  ? -2.495  -20.826 79.364  1.00 58.96  ? 43   PRO A N     1 
ATOM   53    C  CA    . PRO A  1 43  ? -2.961  -21.430 78.118  1.00 58.08  ? 43   PRO A CA    1 
ATOM   54    C  C     . PRO A  1 43  ? -3.867  -20.505 77.298  1.00 57.11  ? 43   PRO A C     1 
ATOM   55    O  O     . PRO A  1 43  ? -4.918  -20.062 77.757  1.00 56.78  ? 43   PRO A O     1 
ATOM   56    C  CB    . PRO A  1 43  ? -3.722  -22.673 78.591  1.00 57.93  ? 43   PRO A CB    1 
ATOM   57    C  CG    . PRO A  1 43  ? -3.165  -22.968 79.932  1.00 58.22  ? 43   PRO A CG    1 
ATOM   58    C  CD    . PRO A  1 43  ? -2.899  -21.627 80.532  1.00 59.01  ? 43   PRO A CD    1 
ATOM   59    N  N     . GLY A  1 44  ? -3.447  -20.233 76.073  1.00 56.21  ? 44   GLY A N     1 
ATOM   60    C  CA    . GLY A  1 44  ? -4.201  -19.353 75.214  1.00 54.99  ? 44   GLY A CA    1 
ATOM   61    C  C     . GLY A  1 44  ? -3.356  -18.157 74.878  1.00 54.13  ? 44   GLY A C     1 
ATOM   62    O  O     . GLY A  1 44  ? -3.536  -17.539 73.831  1.00 55.01  ? 44   GLY A O     1 
ATOM   63    N  N     . THR A  1 45  ? -2.423  -17.838 75.765  1.00 52.49  ? 45   THR A N     1 
ATOM   64    C  CA    . THR A  1 45  ? -1.568  -16.698 75.567  1.00 50.80  ? 45   THR A CA    1 
ATOM   65    C  C     . THR A  1 45  ? -0.642  -16.946 74.404  1.00 50.01  ? 45   THR A C     1 
ATOM   66    O  O     . THR A  1 45  ? -0.484  -16.082 73.548  1.00 49.82  ? 45   THR A O     1 
ATOM   67    C  CB    . THR A  1 45  ? -0.766  -16.393 76.812  1.00 50.81  ? 45   THR A CB    1 
ATOM   68    O  OG1   . THR A  1 45  ? -1.684  -16.202 77.896  1.00 51.33  ? 45   THR A OG1   1 
ATOM   69    C  CG2   . THR A  1 45  ? 0.086   -15.138 76.611  1.00 48.82  ? 45   THR A CG2   1 
ATOM   70    N  N     . VAL A  1 46  ? -0.041  -18.129 74.363  1.00 48.70  ? 46   VAL A N     1 
ATOM   71    C  CA    . VAL A  1 46  ? 0.892   -18.426 73.295  1.00 47.39  ? 46   VAL A CA    1 
ATOM   72    C  C     . VAL A  1 46  ? 0.095   -18.674 71.997  1.00 47.13  ? 46   VAL A C     1 
ATOM   73    O  O     . VAL A  1 46  ? 0.560   -18.390 70.887  1.00 46.72  ? 46   VAL A O     1 
ATOM   74    C  CB    . VAL A  1 46  ? 1.852   -19.559 73.690  1.00 46.96  ? 46   VAL A CB    1 
ATOM   75    C  CG1   . VAL A  1 46  ? 2.943   -19.756 72.633  1.00 46.53  ? 46   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A  1 46  ? 2.496   -19.234 75.000  1.00 45.34  ? 46   VAL A CG2   1 
ATOM   77    N  N     . ALA A  1 47  ? -1.133  -19.154 72.153  1.00 46.55  ? 47   ALA A N     1 
ATOM   78    C  CA    . ALA A  1 47  ? -1.957  -19.455 71.007  1.00 45.94  ? 47   ALA A CA    1 
ATOM   79    C  C     . ALA A  1 47  ? -2.268  -18.145 70.299  1.00 45.72  ? 47   ALA A C     1 
ATOM   80    O  O     . ALA A  1 47  ? -2.031  -18.023 69.092  1.00 45.92  ? 47   ALA A O     1 
ATOM   81    C  CB    . ALA A  1 47  ? -3.208  -20.188 71.420  1.00 45.75  ? 47   ALA A CB    1 
ATOM   82    N  N     . LEU A  1 48  ? -2.744  -17.160 71.056  1.00 45.26  ? 48   LEU A N     1 
ATOM   83    C  CA    . LEU A  1 48  ? -2.979  -15.806 70.529  1.00 44.98  ? 48   LEU A CA    1 
ATOM   84    C  C     . LEU A  1 48  ? -1.754  -15.181 69.879  1.00 44.31  ? 48   LEU A C     1 
ATOM   85    O  O     . LEU A  1 48  ? -1.852  -14.571 68.838  1.00 44.24  ? 48   LEU A O     1 
ATOM   86    C  CB    . LEU A  1 48  ? -3.515  -14.894 71.615  1.00 44.99  ? 48   LEU A CB    1 
ATOM   87    C  CG    . LEU A  1 48  ? -5.029  -14.705 71.695  1.00 46.11  ? 48   LEU A CG    1 
ATOM   88    C  CD1   . LEU A  1 48  ? -5.790  -15.508 70.695  1.00 47.66  ? 48   LEU A CD1   1 
ATOM   89    C  CD2   . LEU A  1 48  ? -5.527  -15.013 73.091  1.00 46.89  ? 48   LEU A CD2   1 
ATOM   90    N  N     . ARG A  1 49  ? -0.589  -15.374 70.453  1.00 44.11  ? 49   ARG A N     1 
ATOM   91    C  CA    . ARG A  1 49  ? 0.561   -14.724 69.901  1.00 45.03  ? 49   ARG A CA    1 
ATOM   92    C  C     . ARG A  1 49  ? 0.978   -15.413 68.602  1.00 44.73  ? 49   ARG A C     1 
ATOM   93    O  O     . ARG A  1 49  ? 1.368   -14.750 67.639  1.00 45.39  ? 49   ARG A O     1 
ATOM   94    C  CB    . ARG A  1 49  ? 1.654   -14.573 70.960  1.00 44.53  ? 49   ARG A CB    1 
ATOM   95    C  CG    . ARG A  1 49  ? 2.971   -15.223 70.692  1.00 47.60  ? 49   ARG A CG    1 
ATOM   96    C  CD    . ARG A  1 49  ? 4.010   -14.723 71.731  1.00 48.00  ? 49   ARG A CD    1 
ATOM   97    N  NE    . ARG A  1 49  ? 4.974   -15.774 72.068  1.00 53.59  ? 49   ARG A NE    1 
ATOM   98    C  CZ    . ARG A  1 49  ? 5.107   -16.323 73.276  1.00 55.04  ? 49   ARG A CZ    1 
ATOM   99    N  NH1   . ARG A  1 49  ? 4.358   -15.919 74.307  1.00 53.82  ? 49   ARG A NH1   1 
ATOM   100   N  NH2   . ARG A  1 49  ? 6.009   -17.282 73.450  1.00 57.54  ? 49   ARG A NH2   1 
ATOM   101   N  N     . GLU A  1 50  ? 0.807   -16.736 68.550  1.00 44.73  ? 50   GLU A N     1 
ATOM   102   C  CA    . GLU A  1 50  ? 0.997   -17.522 67.326  1.00 43.54  ? 50   GLU A CA    1 
ATOM   103   C  C     . GLU A  1 50  ? 0.055   -17.130 66.195  1.00 42.27  ? 50   GLU A C     1 
ATOM   104   O  O     . GLU A  1 50  ? 0.483   -17.053 65.062  1.00 42.33  ? 50   GLU A O     1 
ATOM   105   C  CB    . GLU A  1 50  ? 0.843   -19.005 67.618  1.00 44.01  ? 50   GLU A CB    1 
ATOM   106   C  CG    . GLU A  1 50  ? 2.109   -19.717 67.977  1.00 46.15  ? 50   GLU A CG    1 
ATOM   107   C  CD    . GLU A  1 50  ? 1.838   -21.130 68.536  1.00 52.13  ? 50   GLU A CD    1 
ATOM   108   O  OE1   . GLU A  1 50  ? 0.746   -21.720 68.264  1.00 53.57  ? 50   GLU A OE1   1 
ATOM   109   O  OE2   . GLU A  1 50  ? 2.724   -21.641 69.266  1.00 53.57  ? 50   GLU A OE2   1 
ATOM   110   N  N     . ILE A  1 51  ? -1.223  -16.916 66.485  1.00 41.38  ? 51   ILE A N     1 
ATOM   111   C  CA    . ILE A  1 51  ? -2.146  -16.394 65.474  1.00 41.00  ? 51   ILE A CA    1 
ATOM   112   C  C     . ILE A  1 51  ? -1.624  -15.094 64.853  1.00 41.44  ? 51   ILE A C     1 
ATOM   113   O  O     . ILE A  1 51  ? -1.669  -14.934 63.630  1.00 41.33  ? 51   ILE A O     1 
ATOM   114   C  CB    . ILE A  1 51  ? -3.566  -16.141 66.032  1.00 41.00  ? 51   ILE A CB    1 
ATOM   115   C  CG1   . ILE A  1 51  ? -4.202  -17.462 66.460  1.00 40.15  ? 51   ILE A CG1   1 
ATOM   116   C  CG2   . ILE A  1 51  ? -4.462  -15.412 64.992  1.00 39.15  ? 51   ILE A CG2   1 
ATOM   117   C  CD1   . ILE A  1 51  ? -5.590  -17.323 67.019  1.00 37.75  ? 51   ILE A CD1   1 
ATOM   118   N  N     . ARG A  1 52  ? -1.129  -14.176 65.687  1.00 41.77  ? 52   ARG A N     1 
ATOM   119   C  CA    . ARG A  1 52  ? -0.541  -12.925 65.194  1.00 42.38  ? 52   ARG A CA    1 
ATOM   120   C  C     . ARG A  1 52  ? 0.646   -13.165 64.299  1.00 42.58  ? 52   ARG A C     1 
ATOM   121   O  O     . ARG A  1 52  ? 0.774   -12.545 63.235  1.00 42.79  ? 52   ARG A O     1 
ATOM   122   C  CB    . ARG A  1 52  ? -0.133  -12.023 66.348  1.00 42.91  ? 52   ARG A CB    1 
ATOM   123   C  CG    . ARG A  1 52  ? -1.337  -11.580 67.127  1.00 44.86  ? 52   ARG A CG    1 
ATOM   124   C  CD    . ARG A  1 52  ? -1.108  -10.431 68.069  1.00 46.74  ? 52   ARG A CD    1 
ATOM   125   N  NE    . ARG A  1 52  ? -2.363  -10.293 68.806  1.00 50.69  ? 52   ARG A NE    1 
ATOM   126   C  CZ    . ARG A  1 52  ? -2.596  -10.853 69.993  1.00 51.66  ? 52   ARG A CZ    1 
ATOM   127   N  NH1   . ARG A  1 52  ? -1.626  -11.534 70.616  1.00 50.21  ? 52   ARG A NH1   1 
ATOM   128   N  NH2   . ARG A  1 52  ? -3.787  -10.706 70.568  1.00 51.95  ? 52   ARG A NH2   1 
ATOM   129   N  N     . ARG A  1 53  ? 1.525   -14.059 64.729  1.00 42.79  ? 53   ARG A N     1 
ATOM   130   C  CA    . ARG A  1 53  ? 2.733   -14.304 63.992  1.00 43.60  ? 53   ARG A CA    1 
ATOM   131   C  C     . ARG A  1 53  ? 2.373   -14.850 62.629  1.00 43.69  ? 53   ARG A C     1 
ATOM   132   O  O     . ARG A  1 53  ? 2.866   -14.350 61.614  1.00 44.48  ? 53   ARG A O     1 
ATOM   133   C  CB    . ARG A  1 53  ? 3.635   -15.270 64.733  1.00 43.42  ? 53   ARG A CB    1 
ATOM   134   C  CG    . ARG A  1 53  ? 4.886   -15.630 63.943  1.00 45.90  ? 53   ARG A CG    1 
ATOM   135   C  CD    . ARG A  1 53  ? 5.657   -16.825 64.534  1.00 45.98  ? 53   ARG A CD    1 
ATOM   136   N  NE    . ARG A  1 53  ? 6.662   -17.303 63.573  1.00 50.72  ? 53   ARG A NE    1 
ATOM   137   C  CZ    . ARG A  1 53  ? 7.512   -18.309 63.806  1.00 52.74  ? 53   ARG A CZ    1 
ATOM   138   N  NH1   . ARG A  1 53  ? 7.495   -18.950 64.974  1.00 53.41  ? 53   ARG A NH1   1 
ATOM   139   N  NH2   . ARG A  1 53  ? 8.392   -18.671 62.882  1.00 51.69  ? 53   ARG A NH2   1 
ATOM   140   N  N     . TYR A  1 54  ? 1.497   -15.861 62.595  1.00 43.32  ? 54   TYR A N     1 
ATOM   141   C  CA    . TYR A  1 54  ? 1.193   -16.546 61.345  1.00 42.28  ? 54   TYR A CA    1 
ATOM   142   C  C     . TYR A  1 54  ? 0.253   -15.763 60.454  1.00 41.94  ? 54   TYR A C     1 
ATOM   143   O  O     . TYR A  1 54  ? 0.277   -15.953 59.239  1.00 42.01  ? 54   TYR A O     1 
ATOM   144   C  CB    . TYR A  1 54  ? 0.722   -17.989 61.585  1.00 42.49  ? 54   TYR A CB    1 
ATOM   145   C  CG    . TYR A  1 54  ? 1.847   -18.821 62.087  1.00 41.84  ? 54   TYR A CG    1 
ATOM   146   C  CD1   . TYR A  1 54  ? 1.850   -19.307 63.388  1.00 41.86  ? 54   TYR A CD1   1 
ATOM   147   C  CD2   . TYR A  1 54  ? 2.958   -19.064 61.286  1.00 42.49  ? 54   TYR A CD2   1 
ATOM   148   C  CE1   . TYR A  1 54  ? 2.915   -20.042 63.879  1.00 40.19  ? 54   TYR A CE1   1 
ATOM   149   C  CE2   . TYR A  1 54  ? 4.042   -19.792 61.774  1.00 41.78  ? 54   TYR A CE2   1 
ATOM   150   C  CZ    . TYR A  1 54  ? 4.001   -20.262 63.069  1.00 41.27  ? 54   TYR A CZ    1 
ATOM   151   O  OH    . TYR A  1 54  ? 5.049   -20.985 63.548  1.00 45.01  ? 54   TYR A OH    1 
ATOM   152   N  N     . GLN A  1 55  ? -0.551  -14.875 61.039  1.00 41.57  ? 55   GLN A N     1 
ATOM   153   C  CA    . GLN A  1 55  ? -1.297  -13.899 60.231  1.00 41.78  ? 55   GLN A CA    1 
ATOM   154   C  C     . GLN A  1 55  ? -0.482  -12.731 59.650  1.00 42.17  ? 55   GLN A C     1 
ATOM   155   O  O     . GLN A  1 55  ? -0.875  -12.163 58.648  1.00 42.10  ? 55   GLN A O     1 
ATOM   156   C  CB    . GLN A  1 55  ? -2.545  -13.420 60.950  1.00 41.66  ? 55   GLN A CB    1 
ATOM   157   C  CG    . GLN A  1 55  ? -3.574  -14.535 61.152  1.00 41.68  ? 55   GLN A CG    1 
ATOM   158   C  CD    . GLN A  1 55  ? -4.889  -14.029 61.627  1.00 40.18  ? 55   GLN A CD    1 
ATOM   159   O  OE1   . GLN A  1 55  ? -5.008  -12.898 62.057  1.00 43.10  ? 55   GLN A OE1   1 
ATOM   160   N  NE2   . GLN A  1 55  ? -5.890  -14.858 61.562  1.00 40.50  ? 55   GLN A NE2   1 
ATOM   161   N  N     . LYS A  1 56  ? 0.654   -12.384 60.250  1.00 43.48  ? 56   LYS A N     1 
ATOM   162   C  CA    . LYS A  1 56  ? 1.541   -11.349 59.684  1.00 45.35  ? 56   LYS A CA    1 
ATOM   163   C  C     . LYS A  1 56  ? 2.265   -11.820 58.450  1.00 45.09  ? 56   LYS A C     1 
ATOM   164   O  O     . LYS A  1 56  ? 2.567   -11.025 57.587  1.00 45.95  ? 56   LYS A O     1 
ATOM   165   C  CB    . LYS A  1 56  ? 2.607   -10.879 60.688  1.00 45.35  ? 56   LYS A CB    1 
ATOM   166   C  CG    . LYS A  1 56  ? 2.204   -9.694  61.558  1.00 47.68  ? 56   LYS A CG    1 
ATOM   167   C  CD    . LYS A  1 56  ? 3.301   -9.348  62.581  1.00 47.78  ? 56   LYS A CD    1 
ATOM   168   C  CE    . LYS A  1 56  ? 2.689   -8.817  63.926  1.00 52.81  ? 56   LYS A CE    1 
ATOM   169   N  NZ    . LYS A  1 56  ? 2.755   -9.821  65.063  1.00 53.00  ? 56   LYS A NZ    1 
ATOM   170   N  N     . SER A  1 57  ? 2.559   -13.110 58.374  1.00 45.34  ? 57   SER A N     1 
ATOM   171   C  CA    . SER A  1 57  ? 3.515   -13.626 57.404  1.00 45.49  ? 57   SER A CA    1 
ATOM   172   C  C     . SER A  1 57  ? 2.853   -14.436 56.303  1.00 45.44  ? 57   SER A C     1 
ATOM   173   O  O     . SER A  1 57  ? 1.643   -14.684 56.353  1.00 45.66  ? 57   SER A O     1 
ATOM   174   C  CB    . SER A  1 57  ? 4.493   -14.515 58.122  1.00 45.44  ? 57   SER A CB    1 
ATOM   175   O  OG    . SER A  1 57  ? 3.754   -15.539 58.749  1.00 48.12  ? 57   SER A OG    1 
ATOM   176   N  N     . THR A  1 58  ? 3.656   -14.865 55.327  1.00 45.22  ? 58   THR A N     1 
ATOM   177   C  CA    . THR A  1 58  ? 3.135   -15.520 54.134  1.00 44.98  ? 58   THR A CA    1 
ATOM   178   C  C     . THR A  1 58  ? 3.875   -16.812 53.684  1.00 45.34  ? 58   THR A C     1 
ATOM   179   O  O     . THR A  1 58  ? 3.537   -17.398 52.653  1.00 45.35  ? 58   THR A O     1 
ATOM   180   C  CB    . THR A  1 58  ? 3.088   -14.520 52.947  1.00 45.04  ? 58   THR A CB    1 
ATOM   181   O  OG1   . THR A  1 58  ? 4.414   -14.262 52.475  1.00 44.18  ? 58   THR A OG1   1 
ATOM   182   C  CG2   . THR A  1 58  ? 2.435   -13.208 53.362  1.00 44.86  ? 58   THR A CG2   1 
ATOM   183   N  N     . GLU A  1 59  ? 4.868   -17.265 54.445  1.00 45.76  ? 59   GLU A N     1 
ATOM   184   C  CA    . GLU A  1 59  ? 5.612   -18.470 54.065  1.00 46.36  ? 59   GLU A CA    1 
ATOM   185   C  C     . GLU A  1 59  ? 4.748   -19.705 54.175  1.00 45.71  ? 59   GLU A C     1 
ATOM   186   O  O     . GLU A  1 59  ? 3.814   -19.728 54.997  1.00 45.72  ? 59   GLU A O     1 
ATOM   187   C  CB    . GLU A  1 59  ? 6.888   -18.661 54.887  1.00 46.54  ? 59   GLU A CB    1 
ATOM   188   C  CG    . GLU A  1 59  ? 6.969   -17.847 56.137  1.00 51.15  ? 59   GLU A CG    1 
ATOM   189   C  CD    . GLU A  1 59  ? 6.228   -18.464 57.286  1.00 57.26  ? 59   GLU A CD    1 
ATOM   190   O  OE1   . GLU A  1 59  ? 6.312   -19.712 57.398  1.00 60.71  ? 59   GLU A OE1   1 
ATOM   191   O  OE2   . GLU A  1 59  ? 5.594   -17.710 58.086  1.00 58.01  ? 59   GLU A OE2   1 
ATOM   192   N  N     . LEU A  1 60  ? 5.054   -20.697 53.320  1.00 44.94  ? 60   LEU A N     1 
ATOM   193   C  CA    . LEU A  1 60  ? 4.418   -22.016 53.327  1.00 44.35  ? 60   LEU A CA    1 
ATOM   194   C  C     . LEU A  1 60  ? 4.659   -22.660 54.672  1.00 44.27  ? 60   LEU A C     1 
ATOM   195   O  O     . LEU A  1 60  ? 5.780   -22.613 55.206  1.00 44.04  ? 60   LEU A O     1 
ATOM   196   C  CB    . LEU A  1 60  ? 4.968   -22.902 52.199  1.00 44.25  ? 60   LEU A CB    1 
ATOM   197   C  CG    . LEU A  1 60  ? 4.577   -22.468 50.767  1.00 44.62  ? 60   LEU A CG    1 
ATOM   198   C  CD1   . LEU A  1 60  ? 5.333   -23.224 49.667  1.00 42.79  ? 60   LEU A CD1   1 
ATOM   199   C  CD2   . LEU A  1 60  ? 3.056   -22.510 50.537  1.00 43.85  ? 60   LEU A CD2   1 
ATOM   200   N  N     . LEU A  1 61  ? 3.600   -23.224 55.237  1.00 43.91  ? 61   LEU A N     1 
ATOM   201   C  CA    . LEU A  1 61  ? 3.654   -23.740 56.596  1.00 44.34  ? 61   LEU A CA    1 
ATOM   202   C  C     . LEU A  1 61  ? 3.857   -25.266 56.673  1.00 45.06  ? 61   LEU A C     1 
ATOM   203   O  O     . LEU A  1 61  ? 4.254   -25.792 57.718  1.00 45.29  ? 61   LEU A O     1 
ATOM   204   C  CB    . LEU A  1 61  ? 2.406   -23.311 57.353  1.00 44.17  ? 61   LEU A CB    1 
ATOM   205   C  CG    . LEU A  1 61  ? 2.198   -21.793 57.492  1.00 43.24  ? 61   LEU A CG    1 
ATOM   206   C  CD1   . LEU A  1 61  ? 0.840   -21.510 58.093  1.00 41.13  ? 61   LEU A CD1   1 
ATOM   207   C  CD2   . LEU A  1 61  ? 3.288   -21.144 58.318  1.00 41.84  ? 61   LEU A CD2   1 
ATOM   208   N  N     . ILE A  1 62  ? 3.587   -25.961 55.566  1.00 45.40  ? 62   ILE A N     1 
ATOM   209   C  CA    . ILE A  1 62  ? 3.871   -27.388 55.439  1.00 45.83  ? 62   ILE A CA    1 
ATOM   210   C  C     . ILE A  1 62  ? 5.312   -27.560 54.949  1.00 46.33  ? 62   ILE A C     1 
ATOM   211   O  O     . ILE A  1 62  ? 5.770   -26.827 54.069  1.00 46.22  ? 62   ILE A O     1 
ATOM   212   C  CB    . ILE A  1 62  ? 2.863   -28.078 54.461  1.00 45.60  ? 62   ILE A CB    1 
ATOM   213   C  CG1   . ILE A  1 62  ? 1.526   -28.335 55.145  1.00 45.05  ? 62   ILE A CG1   1 
ATOM   214   C  CG2   . ILE A  1 62  ? 3.384   -29.416 53.939  1.00 45.00  ? 62   ILE A CG2   1 
ATOM   215   C  CD1   . ILE A  1 62  ? 0.388   -28.478 54.147  1.00 45.41  ? 62   ILE A CD1   1 
ATOM   216   N  N     . ARG A  1 63  ? 6.031   -28.524 55.511  1.00 46.91  ? 63   ARG A N     1 
ATOM   217   C  CA    . ARG A  1 63  ? 7.403   -28.757 55.071  1.00 47.65  ? 63   ARG A CA    1 
ATOM   218   C  C     . ARG A  1 63  ? 7.465   -29.215 53.626  1.00 47.31  ? 63   ARG A C     1 
ATOM   219   O  O     . ARG A  1 63  ? 6.555   -29.873 53.129  1.00 47.49  ? 63   ARG A O     1 
ATOM   220   C  CB    . ARG A  1 63  ? 8.101   -29.734 55.994  1.00 48.19  ? 63   ARG A CB    1 
ATOM   221   C  CG    . ARG A  1 63  ? 8.891   -29.057 57.096  1.00 52.39  ? 63   ARG A CG    1 
ATOM   222   C  CD    . ARG A  1 63  ? 8.751   -29.804 58.433  1.00 60.98  ? 63   ARG A CD    1 
ATOM   223   N  NE    . ARG A  1 63  ? 8.680   -31.267 58.274  1.00 66.22  ? 63   ARG A NE    1 
ATOM   224   C  CZ    . ARG A  1 63  ? 7.624   -32.012 58.624  1.00 68.54  ? 63   ARG A CZ    1 
ATOM   225   N  NH1   . ARG A  1 63  ? 6.542   -31.432 59.184  1.00 67.36  ? 63   ARG A NH1   1 
ATOM   226   N  NH2   . ARG A  1 63  ? 7.656   -33.333 58.417  1.00 66.91  ? 63   ARG A NH2   1 
ATOM   227   N  N     . LYS A  1 64  ? 8.558   -28.874 52.963  1.00 47.10  ? 64   LYS A N     1 
ATOM   228   C  CA    . LYS A  1 64  ? 8.664   -28.975 51.513  1.00 47.25  ? 64   LYS A CA    1 
ATOM   229   C  C     . LYS A  1 64  ? 8.862   -30.418 51.001  1.00 46.99  ? 64   LYS A C     1 
ATOM   230   O  O     . LYS A  1 64  ? 8.133   -30.860 50.119  1.00 46.95  ? 64   LYS A O     1 
ATOM   231   C  CB    . LYS A  1 64  ? 9.792   -28.060 51.052  1.00 47.53  ? 64   LYS A CB    1 
ATOM   232   C  CG    . LYS A  1 64  ? 9.740   -27.605 49.632  1.00 51.07  ? 64   LYS A CG    1 
ATOM   233   C  CD    . LYS A  1 64  ? 11.166  -27.348 49.149  1.00 56.32  ? 64   LYS A CD    1 
ATOM   234   C  CE    . LYS A  1 64  ? 11.330  -27.453 47.628  1.00 58.31  ? 64   LYS A CE    1 
ATOM   235   N  NZ    . LYS A  1 64  ? 12.806  -27.313 47.305  1.00 60.41  ? 64   LYS A NZ    1 
ATOM   236   N  N     . LEU A  1 65  ? 9.829   -31.159 51.547  1.00 46.85  ? 65   LEU A N     1 
ATOM   237   C  CA    . LEU A  1 65  ? 10.014  -32.570 51.137  1.00 46.37  ? 65   LEU A CA    1 
ATOM   238   C  C     . LEU A  1 65  ? 8.825   -33.513 51.461  1.00 44.99  ? 65   LEU A C     1 
ATOM   239   O  O     . LEU A  1 65  ? 8.378   -34.221 50.576  1.00 44.65  ? 65   LEU A O     1 
ATOM   240   C  CB    . LEU A  1 65  ? 11.360  -33.155 51.607  1.00 46.57  ? 65   LEU A CB    1 
ATOM   241   C  CG    . LEU A  1 65  ? 11.776  -34.508 50.997  1.00 47.21  ? 65   LEU A CG    1 
ATOM   242   C  CD1   . LEU A  1 65  ? 11.480  -34.603 49.484  1.00 45.43  ? 65   LEU A CD1   1 
ATOM   243   C  CD2   . LEU A  1 65  ? 13.259  -34.813 51.268  1.00 46.97  ? 65   LEU A CD2   1 
ATOM   244   N  N     . PRO A  1 66  ? 8.329   -33.530 52.716  1.00 43.76  ? 66   PRO A N     1 
ATOM   245   C  CA    . PRO A  1 66  ? 7.067   -34.217 52.974  1.00 43.04  ? 66   PRO A CA    1 
ATOM   246   C  C     . PRO A  1 66  ? 5.981   -33.947 51.925  1.00 42.69  ? 66   PRO A C     1 
ATOM   247   O  O     . PRO A  1 66  ? 5.449   -34.907 51.351  1.00 43.21  ? 66   PRO A O     1 
ATOM   248   C  CB    . PRO A  1 66  ? 6.631   -33.652 54.327  1.00 43.09  ? 66   PRO A CB    1 
ATOM   249   C  CG    . PRO A  1 66  ? 7.905   -33.377 55.028  1.00 43.71  ? 66   PRO A CG    1 
ATOM   250   C  CD    . PRO A  1 66  ? 8.900   -32.965 53.950  1.00 43.60  ? 66   PRO A CD    1 
ATOM   251   N  N     . PHE A  1 67  ? 5.670   -32.667 51.657  1.00 41.63  ? 67   PHE A N     1 
ATOM   252   C  CA    . PHE A  1 67  ? 4.597   -32.307 50.713  1.00 39.50  ? 67   PHE A CA    1 
ATOM   253   C  C     . PHE A  1 67  ? 4.844   -32.871 49.332  1.00 40.22  ? 67   PHE A C     1 
ATOM   254   O  O     . PHE A  1 67  ? 3.924   -33.312 48.658  1.00 41.14  ? 67   PHE A O     1 
ATOM   255   C  CB    . PHE A  1 67  ? 4.353   -30.776 50.588  1.00 37.80  ? 67   PHE A CB    1 
ATOM   256   C  CG    . PHE A  1 67  ? 3.172   -30.445 49.719  1.00 31.76  ? 67   PHE A CG    1 
ATOM   257   C  CD1   . PHE A  1 67  ? 1.904   -30.477 50.231  1.00 25.99  ? 67   PHE A CD1   1 
ATOM   258   C  CD2   . PHE A  1 67  ? 3.332   -30.207 48.378  1.00 27.52  ? 67   PHE A CD2   1 
ATOM   259   C  CE1   . PHE A  1 67  ? 0.805   -30.235 49.426  1.00 25.62  ? 67   PHE A CE1   1 
ATOM   260   C  CE2   . PHE A  1 67  ? 2.234   -29.995 47.563  1.00 26.63  ? 67   PHE A CE2   1 
ATOM   261   C  CZ    . PHE A  1 67  ? 0.961   -29.998 48.097  1.00 26.92  ? 67   PHE A CZ    1 
ATOM   262   N  N     . GLN A  1 68  ? 6.075   -32.825 48.882  1.00 40.80  ? 68   GLN A N     1 
ATOM   263   C  CA    . GLN A  1 68  ? 6.373   -33.313 47.559  1.00 42.25  ? 68   GLN A CA    1 
ATOM   264   C  C     . GLN A  1 68  ? 6.241   -34.856 47.478  1.00 42.36  ? 68   GLN A C     1 
ATOM   265   O  O     . GLN A  1 68  ? 5.794   -35.403 46.453  1.00 42.49  ? 68   GLN A O     1 
ATOM   266   C  CB    . GLN A  1 68  ? 7.753   -32.838 47.181  1.00 42.50  ? 68   GLN A CB    1 
ATOM   267   C  CG    . GLN A  1 68  ? 8.192   -33.254 45.830  1.00 48.78  ? 68   GLN A CG    1 
ATOM   268   C  CD    . GLN A  1 68  ? 9.095   -32.221 45.216  1.00 55.32  ? 68   GLN A CD    1 
ATOM   269   O  OE1   . GLN A  1 68  ? 9.796   -31.503 45.938  1.00 57.31  ? 68   GLN A OE1   1 
ATOM   270   N  NE2   . GLN A  1 68  ? 9.086   -32.126 43.876  1.00 56.62  ? 68   GLN A NE2   1 
ATOM   271   N  N     . ARG A  1 69  ? 6.588   -35.555 48.558  1.00 42.17  ? 69   ARG A N     1 
ATOM   272   C  CA    . ARG A  1 69  ? 6.443   -37.007 48.578  1.00 42.39  ? 69   ARG A CA    1 
ATOM   273   C  C     . ARG A  1 69  ? 4.982   -37.392 48.454  1.00 42.68  ? 69   ARG A C     1 
ATOM   274   O  O     . ARG A  1 69  ? 4.646   -38.323 47.717  1.00 43.33  ? 69   ARG A O     1 
ATOM   275   C  CB    . ARG A  1 69  ? 6.995   -37.600 49.852  1.00 42.57  ? 69   ARG A CB    1 
ATOM   276   C  CG    . ARG A  1 69  ? 8.499   -37.595 49.973  1.00 42.43  ? 69   ARG A CG    1 
ATOM   277   C  CD    . ARG A  1 69  ? 8.800   -38.466 51.150  1.00 43.26  ? 69   ARG A CD    1 
ATOM   278   N  NE    . ARG A  1 69  ? 9.775   -37.924 52.082  1.00 43.66  ? 69   ARG A NE    1 
ATOM   279   C  CZ    . ARG A  1 69  ? 9.479   -37.554 53.330  1.00 45.95  ? 69   ARG A CZ    1 
ATOM   280   N  NH1   . ARG A  1 69  ? 8.227   -37.631 53.779  1.00 42.85  ? 69   ARG A NH1   1 
ATOM   281   N  NH2   . ARG A  1 69  ? 10.443  -37.093 54.133  1.00 45.89  ? 69   ARG A NH2   1 
ATOM   282   N  N     . LEU A  1 70  ? 4.119   -36.649 49.155  1.00 42.39  ? 70   LEU A N     1 
ATOM   283   C  CA    . LEU A  1 70  ? 2.679   -36.863 49.118  1.00 41.76  ? 70   LEU A CA    1 
ATOM   284   C  C     . LEU A  1 70  ? 2.097   -36.657 47.719  1.00 41.56  ? 70   LEU A C     1 
ATOM   285   O  O     . LEU A  1 70  ? 1.244   -37.413 47.267  1.00 42.60  ? 70   LEU A O     1 
ATOM   286   C  CB    . LEU A  1 70  ? 1.985   -35.951 50.122  1.00 41.68  ? 70   LEU A CB    1 
ATOM   287   C  CG    . LEU A  1 70  ? 0.456   -36.060 50.181  1.00 42.94  ? 70   LEU A CG    1 
ATOM   288   C  CD1   . LEU A  1 70  ? -0.032  -37.488 50.363  1.00 43.83  ? 70   LEU A CD1   1 
ATOM   289   C  CD2   . LEU A  1 70  ? -0.091  -35.192 51.276  1.00 44.25  ? 70   LEU A CD2   1 
ATOM   290   N  N     . VAL A  1 71  ? 2.560   -35.642 47.019  1.00 40.80  ? 71   VAL A N     1 
ATOM   291   C  CA    . VAL A  1 71  ? 2.048   -35.369 45.695  1.00 39.75  ? 71   VAL A CA    1 
ATOM   292   C  C     . VAL A  1 71  ? 2.444   -36.500 44.755  1.00 40.21  ? 71   VAL A C     1 
ATOM   293   O  O     . VAL A  1 71  ? 1.636   -36.949 43.936  1.00 39.70  ? 71   VAL A O     1 
ATOM   294   C  CB    . VAL A  1 71  ? 2.523   -33.959 45.207  1.00 39.41  ? 71   VAL A CB    1 
ATOM   295   C  CG1   . VAL A  1 71  ? 2.592   -33.859 43.707  1.00 37.18  ? 71   VAL A CG1   1 
ATOM   296   C  CG2   . VAL A  1 71  ? 1.609   -32.918 45.752  1.00 37.56  ? 71   VAL A CG2   1 
ATOM   297   N  N     . ARG A  1 72  ? 3.683   -36.970 44.890  1.00 41.03  ? 72   ARG A N     1 
ATOM   298   C  CA    . ARG A  1 72  ? 4.218   -37.993 43.987  1.00 42.06  ? 72   ARG A CA    1 
ATOM   299   C  C     . ARG A  1 72  ? 3.523   -39.324 44.220  1.00 41.78  ? 72   ARG A C     1 
ATOM   300   O  O     . ARG A  1 72  ? 3.135   -39.993 43.260  1.00 41.97  ? 72   ARG A O     1 
ATOM   301   C  CB    . ARG A  1 72  ? 5.729   -38.137 44.137  1.00 42.58  ? 72   ARG A CB    1 
ATOM   302   C  CG    . ARG A  1 72  ? 6.477   -37.016 43.488  1.00 45.66  ? 72   ARG A CG    1 
ATOM   303   C  CD    . ARG A  1 72  ? 7.936   -37.129 43.777  1.00 52.62  ? 72   ARG A CD    1 
ATOM   304   N  NE    . ARG A  1 72  ? 8.664   -35.928 43.369  1.00 58.13  ? 72   ARG A NE    1 
ATOM   305   C  CZ    . ARG A  1 72  ? 8.975   -35.623 42.111  1.00 60.53  ? 72   ARG A CZ    1 
ATOM   306   N  NH1   . ARG A  1 72  ? 8.608   -36.410 41.107  1.00 61.93  ? 72   ARG A NH1   1 
ATOM   307   N  NH2   . ARG A  1 72  ? 9.653   -34.515 41.855  1.00 63.47  ? 72   ARG A NH2   1 
ATOM   308   N  N     . GLU A  1 73  ? 3.321   -39.666 45.486  1.00 40.68  ? 73   GLU A N     1 
ATOM   309   C  CA    . GLU A  1 73  ? 2.510   -40.804 45.819  1.00 41.17  ? 73   GLU A CA    1 
ATOM   310   C  C     . GLU A  1 73  ? 1.122   -40.780 45.165  1.00 41.27  ? 73   GLU A C     1 
ATOM   311   O  O     . GLU A  1 73  ? 0.676   -41.768 44.581  1.00 41.84  ? 73   GLU A O     1 
ATOM   312   C  CB    . GLU A  1 73  ? 2.401   -40.935 47.334  1.00 41.16  ? 73   GLU A CB    1 
ATOM   313   C  CG    . GLU A  1 73  ? 1.544   -42.067 47.795  1.00 40.85  ? 73   GLU A CG    1 
ATOM   314   C  CD    . GLU A  1 73  ? 1.303   -41.994 49.269  1.00 45.08  ? 73   GLU A CD    1 
ATOM   315   O  OE1   . GLU A  1 73  ? 2.287   -41.829 50.035  1.00 47.04  ? 73   GLU A OE1   1 
ATOM   316   O  OE2   . GLU A  1 73  ? 0.125   -42.089 49.682  1.00 48.24  ? 73   GLU A OE2   1 
ATOM   317   N  N     . ILE A  1 74  ? 0.438   -39.655 45.277  1.00 41.82  ? 74   ILE A N     1 
ATOM   318   C  CA    . ILE A  1 74  ? -0.910  -39.521 44.761  1.00 42.13  ? 74   ILE A CA    1 
ATOM   319   C  C     . ILE A  1 74  ? -0.867  -39.533 43.253  1.00 43.08  ? 74   ILE A C     1 
ATOM   320   O  O     . ILE A  1 74  ? -1.695  -40.191 42.615  1.00 43.10  ? 74   ILE A O     1 
ATOM   321   C  CB    . ILE A  1 74  ? -1.575  -38.240 45.279  1.00 42.17  ? 74   ILE A CB    1 
ATOM   322   C  CG1   . ILE A  1 74  ? -1.911  -38.399 46.762  1.00 40.47  ? 74   ILE A CG1   1 
ATOM   323   C  CG2   . ILE A  1 74  ? -2.801  -37.841 44.413  1.00 40.76  ? 74   ILE A CG2   1 
ATOM   324   C  CD1   . ILE A  1 74  ? -1.964  -37.058 47.508  1.00 40.30  ? 74   ILE A CD1   1 
ATOM   325   N  N     . ALA A  1 75  ? 0.102   -38.823 42.673  1.00 44.24  ? 75   ALA A N     1 
ATOM   326   C  CA    . ALA A  1 75  ? 0.200   -38.766 41.201  1.00 45.30  ? 75   ALA A CA    1 
ATOM   327   C  C     . ALA A  1 75  ? 0.320   -40.180 40.652  1.00 45.68  ? 75   ALA A C     1 
ATOM   328   O  O     . ALA A  1 75  ? -0.296  -40.502 39.635  1.00 45.21  ? 75   ALA A O     1 
ATOM   329   C  CB    . ALA A  1 75  ? 1.363   -37.909 40.741  1.00 44.69  ? 75   ALA A CB    1 
ATOM   330   N  N     . GLN A  1 76  ? 1.072   -41.008 41.385  1.00 46.53  ? 76   GLN A N     1 
ATOM   331   C  CA    . GLN A  1 76  ? 1.445   -42.360 40.973  1.00 47.61  ? 76   GLN A CA    1 
ATOM   332   C  C     . GLN A  1 76  ? 0.247   -43.262 40.871  1.00 48.24  ? 76   GLN A C     1 
ATOM   333   O  O     . GLN A  1 76  ? 0.110   -43.941 39.862  1.00 48.47  ? 76   GLN A O     1 
ATOM   334   C  CB    . GLN A  1 76  ? 2.439   -42.979 41.937  1.00 47.52  ? 76   GLN A CB    1 
ATOM   335   C  CG    . GLN A  1 76  ? 3.413   -43.893 41.255  1.00 50.05  ? 76   GLN A CG    1 
ATOM   336   C  CD    . GLN A  1 76  ? 4.520   -44.339 42.184  1.00 53.30  ? 76   GLN A CD    1 
ATOM   337   O  OE1   . GLN A  1 76  ? 4.331   -44.427 43.396  1.00 54.75  ? 76   GLN A OE1   1 
ATOM   338   N  NE2   . GLN A  1 76  ? 5.685   -44.617 41.620  1.00 54.53  ? 76   GLN A NE2   1 
ATOM   339   N  N     . ASP A  1 77  ? -0.614  -43.268 41.895  1.00 48.79  ? 77   ASP A N     1 
ATOM   340   C  CA    . ASP A  1 77  ? -1.875  -43.976 41.809  1.00 49.98  ? 77   ASP A CA    1 
ATOM   341   C  C     . ASP A  1 77  ? -2.717  -43.591 40.589  1.00 50.96  ? 77   ASP A C     1 
ATOM   342   O  O     . ASP A  1 77  ? -3.665  -44.284 40.282  1.00 51.90  ? 77   ASP A O     1 
ATOM   343   C  CB    . ASP A  1 77  ? -2.723  -43.800 43.067  1.00 50.08  ? 77   ASP A CB    1 
ATOM   344   C  CG    . ASP A  1 77  ? -1.997  -44.201 44.349  1.00 52.84  ? 77   ASP A CG    1 
ATOM   345   O  OD1   . ASP A  1 77  ? -1.022  -44.987 44.315  1.00 56.72  ? 77   ASP A OD1   1 
ATOM   346   O  OD2   . ASP A  1 77  ? -2.428  -43.730 45.427  1.00 55.54  ? 77   ASP A OD2   1 
ATOM   347   N  N     . PHE A  1 78  ? -2.402  -42.499 39.898  1.00 52.59  ? 78   PHE A N     1 
ATOM   348   C  CA    . PHE A  1 78  ? -3.149  -42.127 38.693  1.00 53.99  ? 78   PHE A CA    1 
ATOM   349   C  C     . PHE A  1 78  ? -2.392  -42.484 37.436  1.00 54.74  ? 78   PHE A C     1 
ATOM   350   O  O     . PHE A  1 78  ? -2.990  -42.679 36.369  1.00 54.95  ? 78   PHE A O     1 
ATOM   351   C  CB    . PHE A  1 78  ? -3.448  -40.628 38.650  1.00 54.22  ? 78   PHE A CB    1 
ATOM   352   C  CG    . PHE A  1 78  ? -4.484  -40.187 39.618  1.00 55.42  ? 78   PHE A CG    1 
ATOM   353   C  CD1   . PHE A  1 78  ? -4.168  -39.276 40.624  1.00 56.29  ? 78   PHE A CD1   1 
ATOM   354   C  CD2   . PHE A  1 78  ? -5.786  -40.661 39.531  1.00 57.35  ? 78   PHE A CD2   1 
ATOM   355   C  CE1   . PHE A  1 78  ? -5.134  -38.841 41.550  1.00 56.19  ? 78   PHE A CE1   1 
ATOM   356   C  CE2   . PHE A  1 78  ? -6.778  -40.223 40.454  1.00 59.13  ? 78   PHE A CE2   1 
ATOM   357   C  CZ    . PHE A  1 78  ? -6.441  -39.313 41.468  1.00 56.88  ? 78   PHE A CZ    1 
ATOM   358   N  N     . LYS A  1 79  ? -1.071  -42.522 37.550  1.00 55.77  ? 79   LYS A N     1 
ATOM   359   C  CA    . LYS A  1 79  ? -0.201  -42.763 36.409  1.00 56.95  ? 79   LYS A CA    1 
ATOM   360   C  C     . LYS A  1 79  ? 1.228   -42.933 36.888  1.00 57.58  ? 79   LYS A C     1 
ATOM   361   O  O     . LYS A  1 79  ? 1.775   -42.058 37.561  1.00 58.46  ? 79   LYS A O     1 
ATOM   362   C  CB    . LYS A  1 79  ? -0.286  -41.603 35.421  1.00 56.59  ? 79   LYS A CB    1 
ATOM   363   C  CG    . LYS A  1 79  ? 0.634   -41.717 34.224  1.00 58.22  ? 79   LYS A CG    1 
ATOM   364   C  CD    . LYS A  1 79  ? -0.074  -42.315 33.015  1.00 61.17  ? 79   LYS A CD    1 
ATOM   365   C  CE    . LYS A  1 79  ? 0.924   -42.641 31.880  1.00 63.72  ? 79   LYS A CE    1 
ATOM   366   N  NZ    . LYS A  1 79  ? 1.758   -43.891 32.093  1.00 63.53  ? 79   LYS A NZ    1 
ATOM   367   N  N     . THR A  1 80  ? 1.825   -44.064 36.546  1.00 58.25  ? 80   THR A N     1 
ATOM   368   C  CA    . THR A  1 80  ? 3.238   -44.302 36.801  1.00 59.00  ? 80   THR A CA    1 
ATOM   369   C  C     . THR A  1 80  ? 4.107   -43.481 35.847  1.00 59.20  ? 80   THR A C     1 
ATOM   370   O  O     . THR A  1 80  ? 3.672   -43.116 34.756  1.00 58.91  ? 80   THR A O     1 
ATOM   371   C  CB    . THR A  1 80  ? 3.582   -45.790 36.614  1.00 59.37  ? 80   THR A CB    1 
ATOM   372   O  OG1   . THR A  1 80  ? 3.457   -46.139 35.223  1.00 60.32  ? 80   THR A OG1   1 
ATOM   373   C  CG2   . THR A  1 80  ? 2.651   -46.678 37.468  1.00 59.53  ? 80   THR A CG2   1 
ATOM   374   N  N     . ASP A  1 81  ? 5.340   -43.208 36.270  1.00 60.00  ? 81   ASP A N     1 
ATOM   375   C  CA    . ASP A  1 81  ? 6.352   -42.520 35.450  1.00 60.83  ? 81   ASP A CA    1 
ATOM   376   C  C     . ASP A  1 81  ? 6.147   -41.020 35.228  1.00 60.20  ? 81   ASP A C     1 
ATOM   377   O  O     . ASP A  1 81  ? 6.681   -40.462 34.245  1.00 60.13  ? 81   ASP A O     1 
ATOM   378   C  CB    . ASP A  1 81  ? 6.536   -43.220 34.101  1.00 61.88  ? 81   ASP A CB    1 
ATOM   379   C  CG    . ASP A  1 81  ? 7.813   -44.058 34.054  1.00 66.48  ? 81   ASP A CG    1 
ATOM   380   O  OD1   . ASP A  1 81  ? 8.067   -44.843 35.026  1.00 68.49  ? 81   ASP A OD1   1 
ATOM   381   O  OD2   . ASP A  1 81  ? 8.558   -43.917 33.033  1.00 71.15  ? 81   ASP A OD2   1 
ATOM   382   N  N     . LEU A  1 82  ? 5.384   -40.373 36.124  1.00 59.04  ? 82   LEU A N     1 
ATOM   383   C  CA    . LEU A  1 82  ? 5.177   -38.923 36.038  1.00 57.41  ? 82   LEU A CA    1 
ATOM   384   C  C     . LEU A  1 82  ? 6.361   -38.238 36.666  1.00 56.73  ? 82   LEU A C     1 
ATOM   385   O  O     . LEU A  1 82  ? 6.927   -38.734 37.636  1.00 57.02  ? 82   LEU A O     1 
ATOM   386   C  CB    . LEU A  1 82  ? 3.866   -38.471 36.693  1.00 56.79  ? 82   LEU A CB    1 
ATOM   387   C  CG    . LEU A  1 82  ? 2.583   -38.914 35.965  1.00 56.45  ? 82   LEU A CG    1 
ATOM   388   C  CD1   . LEU A  1 82  ? 1.329   -38.423 36.654  1.00 55.25  ? 82   LEU A CD1   1 
ATOM   389   C  CD2   . LEU A  1 82  ? 2.559   -38.512 34.501  1.00 55.66  ? 82   LEU A CD2   1 
ATOM   390   N  N     . ARG A  1 83  ? 6.766   -37.124 36.078  1.00 55.60  ? 83   ARG A N     1 
ATOM   391   C  CA    . ARG A  1 83  ? 7.713   -36.235 36.726  1.00 55.13  ? 83   ARG A CA    1 
ATOM   392   C  C     . ARG A  1 83  ? 7.054   -34.864 36.988  1.00 53.81  ? 83   ARG A C     1 
ATOM   393   O  O     . ARG A  1 83  ? 6.017   -34.541 36.405  1.00 53.62  ? 83   ARG A O     1 
ATOM   394   C  CB    . ARG A  1 83  ? 8.958   -36.093 35.863  1.00 55.91  ? 83   ARG A CB    1 
ATOM   395   C  CG    . ARG A  1 83  ? 9.405   -37.396 35.221  1.00 57.91  ? 83   ARG A CG    1 
ATOM   396   C  CD    . ARG A  1 83  ? 10.595  -37.186 34.300  1.00 61.52  ? 83   ARG A CD    1 
ATOM   397   N  NE    . ARG A  1 83  ? 11.853  -37.353 35.025  1.00 65.99  ? 83   ARG A NE    1 
ATOM   398   C  CZ    . ARG A  1 83  ? 13.026  -36.875 34.612  1.00 68.72  ? 83   ARG A CZ    1 
ATOM   399   N  NH1   . ARG A  1 83  ? 13.094  -36.187 33.477  1.00 70.56  ? 83   ARG A NH1   1 
ATOM   400   N  NH2   . ARG A  1 83  ? 14.130  -37.073 35.331  1.00 68.32  ? 83   ARG A NH2   1 
ATOM   401   N  N     . PHE A  1 84  ? 7.653   -34.063 37.862  1.00 52.21  ? 84   PHE A N     1 
ATOM   402   C  CA    . PHE A  1 84  ? 7.076   -32.755 38.219  1.00 50.50  ? 84   PHE A CA    1 
ATOM   403   C  C     . PHE A  1 84  ? 8.044   -31.606 38.043  1.00 49.63  ? 84   PHE A C     1 
ATOM   404   O  O     . PHE A  1 84  ? 9.175   -31.674 38.514  1.00 49.35  ? 84   PHE A O     1 
ATOM   405   C  CB    . PHE A  1 84  ? 6.597   -32.770 39.671  1.00 50.02  ? 84   PHE A CB    1 
ATOM   406   C  CG    . PHE A  1 84  ? 5.292   -33.464 39.869  1.00 49.04  ? 84   PHE A CG    1 
ATOM   407   C  CD1   . PHE A  1 84  ? 5.244   -34.842 40.049  1.00 48.34  ? 84   PHE A CD1   1 
ATOM   408   C  CD2   . PHE A  1 84  ? 4.100   -32.739 39.875  1.00 48.77  ? 84   PHE A CD2   1 
ATOM   409   C  CE1   . PHE A  1 84  ? 4.026   -35.489 40.241  1.00 47.84  ? 84   PHE A CE1   1 
ATOM   410   C  CE2   . PHE A  1 84  ? 2.864   -33.370 40.066  1.00 48.18  ? 84   PHE A CE2   1 
ATOM   411   C  CZ    . PHE A  1 84  ? 2.830   -34.751 40.250  1.00 48.76  ? 84   PHE A CZ    1 
ATOM   412   N  N     . GLN A  1 85  ? 7.610   -30.537 37.388  1.00 49.04  ? 85   GLN A N     1 
ATOM   413   C  CA    . GLN A  1 85  ? 8.372   -29.295 37.481  1.00 49.00  ? 85   GLN A CA    1 
ATOM   414   C  C     . GLN A  1 85  ? 8.338   -28.866 38.940  1.00 48.73  ? 85   GLN A C     1 
ATOM   415   O  O     . GLN A  1 85  ? 7.310   -28.996 39.597  1.00 48.65  ? 85   GLN A O     1 
ATOM   416   C  CB    . GLN A  1 85  ? 7.762   -28.213 36.626  1.00 48.87  ? 85   GLN A CB    1 
ATOM   417   C  CG    . GLN A  1 85  ? 7.935   -28.379 35.153  1.00 50.71  ? 85   GLN A CG    1 
ATOM   418   C  CD    . GLN A  1 85  ? 7.249   -27.263 34.389  1.00 54.54  ? 85   GLN A CD    1 
ATOM   419   O  OE1   . GLN A  1 85  ? 6.356   -26.584 34.913  1.00 56.67  ? 85   GLN A OE1   1 
ATOM   420   N  NE2   . GLN A  1 85  ? 7.657   -27.064 33.148  1.00 56.13  ? 85   GLN A NE2   1 
ATOM   421   N  N     . SER A  1 86  ? 9.451   -28.377 39.466  1.00 49.14  ? 86   SER A N     1 
ATOM   422   C  CA    . SER A  1 86  ? 9.490   -27.999 40.883  1.00 50.02  ? 86   SER A CA    1 
ATOM   423   C  C     . SER A  1 86  ? 8.435   -26.951 41.152  1.00 49.83  ? 86   SER A C     1 
ATOM   424   O  O     . SER A  1 86  ? 7.873   -26.914 42.243  1.00 51.08  ? 86   SER A O     1 
ATOM   425   C  CB    . SER A  1 86  ? 10.832  -27.430 41.288  1.00 49.95  ? 86   SER A CB    1 
ATOM   426   O  OG    . SER A  1 86  ? 11.104  -26.325 40.447  1.00 52.79  ? 86   SER A OG    1 
ATOM   427   N  N     . SER A  1 87  ? 8.151   -26.116 40.161  1.00 48.96  ? 87   SER A N     1 
ATOM   428   C  CA    . SER A  1 87  ? 7.141   -25.092 40.339  1.00 48.72  ? 87   SER A CA    1 
ATOM   429   C  C     . SER A  1 87  ? 5.692   -25.619 40.270  1.00 48.41  ? 87   SER A C     1 
ATOM   430   O  O     . SER A  1 87  ? 4.772   -24.929 40.721  1.00 48.40  ? 87   SER A O     1 
ATOM   431   C  CB    . SER A  1 87  ? 7.357   -23.951 39.341  1.00 48.70  ? 87   SER A CB    1 
ATOM   432   O  OG    . SER A  1 87  ? 6.615   -24.173 38.155  1.00 48.94  ? 87   SER A OG    1 
ATOM   433   N  N     . ALA A  1 88  ? 5.489   -26.805 39.683  1.00 47.79  ? 88   ALA A N     1 
ATOM   434   C  CA    . ALA A  1 88  ? 4.179   -27.456 39.698  1.00 47.14  ? 88   ALA A CA    1 
ATOM   435   C  C     . ALA A  1 88  ? 3.870   -27.878 41.112  1.00 47.20  ? 88   ALA A C     1 
ATOM   436   O  O     . ALA A  1 88  ? 2.704   -27.828 41.550  1.00 47.48  ? 88   ALA A O     1 
ATOM   437   C  CB    . ALA A  1 88  ? 4.145   -28.647 38.808  1.00 46.63  ? 88   ALA A CB    1 
ATOM   438   N  N     . VAL A  1 89  ? 4.901   -28.292 41.844  1.00 46.62  ? 89   VAL A N     1 
ATOM   439   C  CA    . VAL A  1 89  ? 4.663   -28.719 43.215  1.00 46.12  ? 89   VAL A CA    1 
ATOM   440   C  C     . VAL A  1 89  ? 4.424   -27.510 44.083  1.00 45.69  ? 89   VAL A C     1 
ATOM   441   O  O     . VAL A  1 89  ? 3.554   -27.526 44.941  1.00 45.49  ? 89   VAL A O     1 
ATOM   442   C  CB    . VAL A  1 89  ? 5.787   -29.594 43.792  1.00 46.52  ? 89   VAL A CB    1 
ATOM   443   C  CG1   . VAL A  1 89  ? 5.576   -29.771 45.314  1.00 46.00  ? 89   VAL A CG1   1 
ATOM   444   C  CG2   . VAL A  1 89  ? 5.839   -30.942 43.071  1.00 44.95  ? 89   VAL A CG2   1 
ATOM   445   N  N     . MET A  1 90  ? 5.181   -26.449 43.834  1.00 45.91  ? 90   MET A N     1 
ATOM   446   C  CA    . MET A  1 90  ? 4.959   -25.183 44.530  1.00 45.62  ? 90   MET A CA    1 
ATOM   447   C  C     . MET A  1 90  ? 3.565   -24.587 44.276  1.00 43.55  ? 90   MET A C     1 
ATOM   448   O  O     . MET A  1 90  ? 2.922   -24.143 45.215  1.00 42.82  ? 90   MET A O     1 
ATOM   449   C  CB    . MET A  1 90  ? 6.092   -24.200 44.274  1.00 46.64  ? 90   MET A CB    1 
ATOM   450   C  CG    . MET A  1 90  ? 6.745   -23.722 45.582  1.00 53.35  ? 90   MET A CG    1 
ATOM   451   S  SD    . MET A  1 90  ? 7.072   -25.078 46.797  1.00 67.05  ? 90   MET A SD    1 
ATOM   452   C  CE    . MET A  1 90  ? 8.518   -25.894 46.064  1.00 63.64  ? 90   MET A CE    1 
ATOM   453   N  N     . ALA A  1 91  ? 3.068   -24.628 43.042  1.00 42.18  ? 91   ALA A N     1 
ATOM   454   C  CA    . ALA A  1 91  ? 1.670   -24.227 42.793  1.00 41.84  ? 91   ALA A CA    1 
ATOM   455   C  C     . ALA A  1 91  ? 0.684   -25.049 43.634  1.00 42.06  ? 91   ALA A C     1 
ATOM   456   O  O     . ALA A  1 91  ? -0.176  -24.472 44.303  1.00 43.02  ? 91   ALA A O     1 
ATOM   457   C  CB    . ALA A  1 91  ? 1.305   -24.284 41.326  1.00 40.84  ? 91   ALA A CB    1 
ATOM   458   N  N     . LEU A  1 92  ? 0.827   -26.380 43.625  1.00 41.55  ? 92   LEU A N     1 
ATOM   459   C  CA    . LEU A  1 92  ? -0.020  -27.265 44.418  1.00 40.30  ? 92   LEU A CA    1 
ATOM   460   C  C     . LEU A  1 92  ? 0.051   -26.902 45.899  1.00 39.90  ? 92   LEU A C     1 
ATOM   461   O  O     . LEU A  1 92  ? -0.983  -26.835 46.584  1.00 40.00  ? 92   LEU A O     1 
ATOM   462   C  CB    . LEU A  1 92  ? 0.362   -28.744 44.200  1.00 40.31  ? 92   LEU A CB    1 
ATOM   463   C  CG    . LEU A  1 92  ? -0.214  -29.415 42.933  1.00 40.27  ? 92   LEU A CG    1 
ATOM   464   C  CD1   . LEU A  1 92  ? 0.469   -30.730 42.581  1.00 39.32  ? 92   LEU A CD1   1 
ATOM   465   C  CD2   . LEU A  1 92  ? -1.701  -29.634 43.068  1.00 38.61  ? 92   LEU A CD2   1 
ATOM   466   N  N     . GLN A  1 93  ? 1.254   -26.653 46.403  1.00 38.40  ? 93   GLN A N     1 
ATOM   467   C  CA    . GLN A  1 93  ? 1.368   -26.335 47.816  1.00 37.40  ? 93   GLN A CA    1 
ATOM   468   C  C     . GLN A  1 93  ? 0.734   -24.988 48.149  1.00 37.54  ? 93   GLN A C     1 
ATOM   469   O  O     . GLN A  1 93  ? 0.081   -24.865 49.180  1.00 37.87  ? 93   GLN A O     1 
ATOM   470   C  CB    . GLN A  1 93  ? 2.805   -26.416 48.307  1.00 36.57  ? 93   GLN A CB    1 
ATOM   471   C  CG    . GLN A  1 93  ? 2.883   -26.584 49.807  1.00 36.06  ? 93   GLN A CG    1 
ATOM   472   C  CD    . GLN A  1 93  ? 4.316   -26.650 50.284  1.00 38.63  ? 93   GLN A CD    1 
ATOM   473   O  OE1   . GLN A  1 93  ? 5.252   -26.646 49.478  1.00 38.34  ? 93   GLN A OE1   1 
ATOM   474   N  NE2   . GLN A  1 93  ? 4.504   -26.673 51.598  1.00 39.31  ? 93   GLN A NE2   1 
ATOM   475   N  N     . GLU A  1 94  ? 0.908   -23.985 47.282  1.00 37.41  ? 94   GLU A N     1 
ATOM   476   C  CA    . GLU A  1 94  ? 0.242   -22.695 47.463  1.00 37.01  ? 94   GLU A CA    1 
ATOM   477   C  C     . GLU A  1 94  ? -1.270  -22.898 47.479  1.00 36.30  ? 94   GLU A C     1 
ATOM   478   O  O     . GLU A  1 94  ? -1.939  -22.465 48.412  1.00 36.21  ? 94   GLU A O     1 
ATOM   479   C  CB    . GLU A  1 94  ? 0.614   -21.718 46.351  1.00 37.85  ? 94   GLU A CB    1 
ATOM   480   C  CG    . GLU A  1 94  ? 2.034   -21.124 46.432  1.00 41.72  ? 94   GLU A CG    1 
ATOM   481   C  CD    . GLU A  1 94  ? 2.248   -20.147 47.608  1.00 46.92  ? 94   GLU A CD    1 
ATOM   482   O  OE1   . GLU A  1 94  ? 3.428   -19.814 47.854  1.00 51.65  ? 94   GLU A OE1   1 
ATOM   483   O  OE2   . GLU A  1 94  ? 1.274   -19.726 48.292  1.00 47.20  ? 94   GLU A OE2   1 
ATOM   484   N  N     . ALA A  1 95  ? -1.817  -23.590 46.481  1.00 35.21  ? 95   ALA A N     1 
ATOM   485   C  CA    . ALA A  1 95  ? -3.249  -23.878 46.500  1.00 35.16  ? 95   ALA A CA    1 
ATOM   486   C  C     . ALA A  1 95  ? -3.761  -24.648 47.750  1.00 35.49  ? 95   ALA A C     1 
ATOM   487   O  O     . ALA A  1 95  ? -4.853  -24.373 48.211  1.00 35.90  ? 95   ALA A O     1 
ATOM   488   C  CB    . ALA A  1 95  ? -3.687  -24.562 45.221  1.00 33.97  ? 95   ALA A CB    1 
ATOM   489   N  N     . SER A  1 96  ? -2.968  -25.573 48.298  1.00 35.92  ? 96   SER A N     1 
ATOM   490   C  CA    . SER A  1 96  ? -3.381  -26.441 49.413  1.00 36.65  ? 96   SER A CA    1 
ATOM   491   C  C     . SER A  1 96  ? -3.356  -25.742 50.753  1.00 36.96  ? 96   SER A C     1 
ATOM   492   O  O     . SER A  1 96  ? -4.318  -25.808 51.521  1.00 36.58  ? 96   SER A O     1 
ATOM   493   C  CB    . SER A  1 96  ? -2.490  -27.684 49.470  1.00 37.07  ? 96   SER A CB    1 
ATOM   494   O  OG    . SER A  1 96  ? -2.636  -28.437 48.261  1.00 39.98  ? 96   SER A OG    1 
ATOM   495   N  N     . GLU A  1 97  ? -2.255  -25.057 51.045  1.00 37.59  ? 97   GLU A N     1 
ATOM   496   C  CA    . GLU A  1 97  ? -2.230  -24.155 52.193  1.00 38.08  ? 97   GLU A CA    1 
ATOM   497   C  C     . GLU A  1 97  ? -3.337  -23.074 52.115  1.00 37.35  ? 97   GLU A C     1 
ATOM   498   O  O     . GLU A  1 97  ? -4.027  -22.821 53.107  1.00 37.08  ? 97   GLU A O     1 
ATOM   499   C  CB    . GLU A  1 97  ? -0.840  -23.574 52.372  1.00 38.80  ? 97   GLU A CB    1 
ATOM   500   C  CG    . GLU A  1 97  ? 0.218   -24.679 52.463  1.00 42.74  ? 97   GLU A CG    1 
ATOM   501   C  CD    . GLU A  1 97  ? 1.419   -24.333 53.353  1.00 50.03  ? 97   GLU A CD    1 
ATOM   502   O  OE1   . GLU A  1 97  ? 1.307   -23.423 54.219  1.00 52.84  ? 97   GLU A OE1   1 
ATOM   503   O  OE2   . GLU A  1 97  ? 2.483   -24.998 53.205  1.00 52.57  ? 97   GLU A OE2   1 
ATOM   504   N  N     . ALA A  1 98  ? -3.569  -22.480 50.943  1.00 36.28  ? 98   ALA A N     1 
ATOM   505   C  CA    . ALA A  1 98  ? -4.697  -21.543 50.844  1.00 35.38  ? 98   ALA A CA    1 
ATOM   506   C  C     . ALA A  1 98  ? -6.018  -22.215 51.201  1.00 35.22  ? 98   ALA A C     1 
ATOM   507   O  O     . ALA A  1 98  ? -6.807  -21.653 51.965  1.00 35.76  ? 98   ALA A O     1 
ATOM   508   C  CB    . ALA A  1 98  ? -4.778  -20.874 49.496  1.00 34.58  ? 98   ALA A CB    1 
ATOM   509   N  N     . TYR A  1 99  ? -6.266  -23.412 50.667  1.00 35.12  ? 99   TYR A N     1 
ATOM   510   C  CA    . TYR A  1 99  ? -7.561  -24.078 50.860  1.00 34.79  ? 99   TYR A CA    1 
ATOM   511   C  C     . TYR A  1 99  ? -7.788  -24.409 52.339  1.00 34.48  ? 99   TYR A C     1 
ATOM   512   O  O     . TYR A  1 99  ? -8.861  -24.180 52.881  1.00 34.03  ? 99   TYR A O     1 
ATOM   513   C  CB    . TYR A  1 99  ? -7.671  -25.329 49.983  1.00 35.89  ? 99   TYR A CB    1 
ATOM   514   C  CG    . TYR A  1 99  ? -8.823  -26.245 50.357  1.00 36.75  ? 99   TYR A CG    1 
ATOM   515   C  CD1   . TYR A  1 99  ? -10.093 -26.060 49.820  1.00 36.38  ? 99   TYR A CD1   1 
ATOM   516   C  CD2   . TYR A  1 99  ? -8.635  -27.291 51.260  1.00 37.39  ? 99   TYR A CD2   1 
ATOM   517   C  CE1   . TYR A  1 99  ? -11.143 -26.889 50.172  1.00 36.52  ? 99   TYR A CE1   1 
ATOM   518   C  CE2   . TYR A  1 99  ? -9.674  -28.124 51.617  1.00 37.28  ? 99   TYR A CE2   1 
ATOM   519   C  CZ    . TYR A  1 99  ? -10.924 -27.917 51.071  1.00 37.87  ? 99   TYR A CZ    1 
ATOM   520   O  OH    . TYR A  1 99  ? -11.967 -28.749 51.450  1.00 39.96  ? 99   TYR A OH    1 
ATOM   521   N  N     . LEU A  1 100 ? -6.760  -24.920 52.998  1.00 34.11  ? 100  LEU A N     1 
ATOM   522   C  CA    . LEU A  1 100 ? -6.907  -25.333 54.356  1.00 33.88  ? 100  LEU A CA    1 
ATOM   523   C  C     . LEU A  1 100 ? -7.029  -24.173 55.279  1.00 34.53  ? 100  LEU A C     1 
ATOM   524   O  O     . LEU A  1 100 ? -7.823  -24.247 56.227  1.00 35.31  ? 100  LEU A O     1 
ATOM   525   C  CB    . LEU A  1 100 ? -5.742  -26.188 54.788  1.00 34.58  ? 100  LEU A CB    1 
ATOM   526   C  CG    . LEU A  1 100 ? -5.613  -27.585 54.163  1.00 34.56  ? 100  LEU A CG    1 
ATOM   527   C  CD1   . LEU A  1 100 ? -4.415  -28.238 54.813  1.00 32.04  ? 100  LEU A CD1   1 
ATOM   528   C  CD2   . LEU A  1 100 ? -6.885  -28.388 54.393  1.00 33.31  ? 100  LEU A CD2   1 
ATOM   529   N  N     . VAL A  1 101 ? -6.270  -23.093 55.019  1.00 34.28  ? 101  VAL A N     1 
ATOM   530   C  CA    . VAL A  1 101 ? -6.331  -21.886 55.861  1.00 33.17  ? 101  VAL A CA    1 
ATOM   531   C  C     . VAL A  1 101 ? -7.756  -21.343 55.808  1.00 33.66  ? 101  VAL A C     1 
ATOM   532   O  O     . VAL A  1 101 ? -8.360  -21.052 56.833  1.00 33.99  ? 101  VAL A O     1 
ATOM   533   C  CB    . VAL A  1 101 ? -5.272  -20.816 55.468  1.00 33.45  ? 101  VAL A CB    1 
ATOM   534   C  CG1   . VAL A  1 101 ? -5.638  -19.479 56.010  1.00 31.55  ? 101  VAL A CG1   1 
ATOM   535   C  CG2   . VAL A  1 101 ? -3.833  -21.208 55.958  1.00 31.09  ? 101  VAL A CG2   1 
ATOM   536   N  N     . ALA A  1 102 ? -8.325  -21.279 54.612  1.00 34.14  ? 102  ALA A N     1 
ATOM   537   C  CA    . ALA A  1 102 ? -9.715  -20.824 54.449  1.00 34.54  ? 102  ALA A CA    1 
ATOM   538   C  C     . ALA A  1 102 ? -10.722 -21.746 55.167  1.00 35.49  ? 102  ALA A C     1 
ATOM   539   O  O     . ALA A  1 102 ? -11.637 -21.260 55.844  1.00 36.13  ? 102  ALA A O     1 
ATOM   540   C  CB    . ALA A  1 102 ? -10.046 -20.684 53.002  1.00 32.77  ? 102  ALA A CB    1 
ATOM   541   N  N     . LEU A  1 103 ? -10.542 -23.068 55.038  1.00 36.19  ? 103  LEU A N     1 
ATOM   542   C  CA    . LEU A  1 103 ? -11.391 -24.035 55.726  1.00 36.32  ? 103  LEU A CA    1 
ATOM   543   C  C     . LEU A  1 103 ? -11.355 -23.906 57.266  1.00 36.69  ? 103  LEU A C     1 
ATOM   544   O  O     . LEU A  1 103 ? -12.384 -24.009 57.921  1.00 36.38  ? 103  LEU A O     1 
ATOM   545   C  CB    . LEU A  1 103 ? -11.000 -25.445 55.309  1.00 36.62  ? 103  LEU A CB    1 
ATOM   546   C  CG    . LEU A  1 103 ? -11.906 -26.551 55.867  1.00 37.32  ? 103  LEU A CG    1 
ATOM   547   C  CD1   . LEU A  1 103 ? -13.204 -26.610 55.069  1.00 37.49  ? 103  LEU A CD1   1 
ATOM   548   C  CD2   . LEU A  1 103 ? -11.161 -27.849 55.838  1.00 36.30  ? 103  LEU A CD2   1 
ATOM   549   N  N     . PHE A  1 104 ? -10.173 -23.685 57.837  1.00 37.52  ? 104  PHE A N     1 
ATOM   550   C  CA    . PHE A  1 104 ? -10.059 -23.398 59.262  1.00 38.52  ? 104  PHE A CA    1 
ATOM   551   C  C     . PHE A  1 104 ? -10.760 -22.108 59.686  1.00 40.45  ? 104  PHE A C     1 
ATOM   552   O  O     . PHE A  1 104 ? -11.300 -22.049 60.799  1.00 40.99  ? 104  PHE A O     1 
ATOM   553   C  CB    . PHE A  1 104 ? -8.599  -23.365 59.690  1.00 37.75  ? 104  PHE A CB    1 
ATOM   554   C  CG    . PHE A  1 104 ? -7.961  -24.732 59.783  1.00 36.59  ? 104  PHE A CG    1 
ATOM   555   C  CD1   . PHE A  1 104 ? -6.826  -25.032 59.053  1.00 35.15  ? 104  PHE A CD1   1 
ATOM   556   C  CD2   . PHE A  1 104 ? -8.506  -25.720 60.607  1.00 34.78  ? 104  PHE A CD2   1 
ATOM   557   C  CE1   . PHE A  1 104 ? -6.229  -26.300 59.150  1.00 35.11  ? 104  PHE A CE1   1 
ATOM   558   C  CE2   . PHE A  1 104 ? -7.931  -26.968 60.689  1.00 33.79  ? 104  PHE A CE2   1 
ATOM   559   C  CZ    . PHE A  1 104 ? -6.789  -27.264 59.964  1.00 34.03  ? 104  PHE A CZ    1 
ATOM   560   N  N     . GLU A  1 105 ? -10.753 -21.077 58.828  1.00 42.04  ? 105  GLU A N     1 
ATOM   561   C  CA    . GLU A  1 105 ? -11.549 -19.871 59.090  1.00 44.44  ? 105  GLU A CA    1 
ATOM   562   C  C     . GLU A  1 105 ? -13.014 -20.263 59.269  1.00 44.11  ? 105  GLU A C     1 
ATOM   563   O  O     . GLU A  1 105 ? -13.636 -19.893 60.263  1.00 44.62  ? 105  GLU A O     1 
ATOM   564   C  CB    . GLU A  1 105 ? -11.457 -18.843 57.948  1.00 44.09  ? 105  GLU A CB    1 
ATOM   565   C  CG    . GLU A  1 105 ? -10.224 -17.939 57.951  1.00 47.73  ? 105  GLU A CG    1 
ATOM   566   C  CD    . GLU A  1 105 ? -9.819  -17.472 56.534  1.00 48.76  ? 105  GLU A CD    1 
ATOM   567   O  OE1   . GLU A  1 105 ? -10.722 -17.400 55.644  1.00 55.10  ? 105  GLU A OE1   1 
ATOM   568   O  OE2   . GLU A  1 105 ? -8.603  -17.178 56.314  1.00 51.28  ? 105  GLU A OE2   1 
ATOM   569   N  N     . ASP A  1 106 ? -13.564 -21.002 58.301  1.00 44.34  ? 106  ASP A N     1 
ATOM   570   C  CA    . ASP A  1 106 ? -14.953 -21.461 58.366  1.00 44.37  ? 106  ASP A CA    1 
ATOM   571   C  C     . ASP A  1 106 ? -15.197 -22.451 59.522  1.00 43.72  ? 106  ASP A C     1 
ATOM   572   O  O     . ASP A  1 106 ? -16.200 -22.357 60.232  1.00 43.19  ? 106  ASP A O     1 
ATOM   573   C  CB    . ASP A  1 106 ? -15.387 -22.031 57.019  1.00 44.98  ? 106  ASP A CB    1 
ATOM   574   C  CG    . ASP A  1 106 ? -15.383 -20.967 55.875  1.00 49.15  ? 106  ASP A CG    1 
ATOM   575   O  OD1   . ASP A  1 106 ? -15.037 -19.778 56.128  1.00 52.31  ? 106  ASP A OD1   1 
ATOM   576   O  OD2   . ASP A  1 106 ? -15.737 -21.318 54.705  1.00 52.13  ? 106  ASP A OD2   1 
ATOM   577   N  N     . THR A  1 107 ? -14.268 -23.376 59.749  1.00 43.27  ? 107  THR A N     1 
ATOM   578   C  CA    . THR A  1 107 ? -14.387 -24.285 60.897  1.00 42.78  ? 107  THR A CA    1 
ATOM   579   C  C     . THR A  1 107 ? -14.498 -23.491 62.198  1.00 43.15  ? 107  THR A C     1 
ATOM   580   O  O     . THR A  1 107 ? -15.327 -23.805 63.052  1.00 43.78  ? 107  THR A O     1 
ATOM   581   C  CB    . THR A  1 107 ? -13.203 -25.267 60.995  1.00 42.69  ? 107  THR A CB    1 
ATOM   582   O  OG1   . THR A  1 107 ? -13.036 -25.940 59.752  1.00 40.92  ? 107  THR A OG1   1 
ATOM   583   C  CG2   . THR A  1 107 ? -13.419 -26.282 62.093  1.00 41.74  ? 107  THR A CG2   1 
ATOM   584   N  N     . ASN A  1 108 ? -13.683 -22.453 62.357  1.00 42.90  ? 108  ASN A N     1 
ATOM   585   C  CA    . ASN A  1 108 ? -13.777 -21.628 63.572  1.00 42.71  ? 108  ASN A CA    1 
ATOM   586   C  C     . ASN A  1 108 ? -15.123 -20.952 63.767  1.00 42.23  ? 108  ASN A C     1 
ATOM   587   O  O     . ASN A  1 108 ? -15.669 -20.954 64.866  1.00 42.06  ? 108  ASN A O     1 
ATOM   588   C  CB    . ASN A  1 108 ? -12.704 -20.583 63.596  1.00 43.00  ? 108  ASN A CB    1 
ATOM   589   C  CG    . ASN A  1 108 ? -12.178 -20.350 64.966  1.00 44.72  ? 108  ASN A CG    1 
ATOM   590   O  OD1   . ASN A  1 108 ? -11.456 -19.380 65.201  1.00 47.68  ? 108  ASN A OD1   1 
ATOM   591   N  ND2   . ASN A  1 108 ? -12.509 -21.245 65.893  1.00 45.53  ? 108  ASN A ND2   1 
ATOM   592   N  N     . LEU A  1 109 ? -15.678 -20.405 62.693  1.00 41.92  ? 109  LEU A N     1 
ATOM   593   C  CA    . LEU A  1 109 ? -17.005 -19.821 62.762  1.00 42.33  ? 109  LEU A CA    1 
ATOM   594   C  C     . LEU A  1 109 ? -18.037 -20.830 63.239  1.00 42.69  ? 109  LEU A C     1 
ATOM   595   O  O     . LEU A  1 109 ? -18.977 -20.465 63.944  1.00 42.89  ? 109  LEU A O     1 
ATOM   596   C  CB    . LEU A  1 109 ? -17.433 -19.249 61.412  1.00 42.47  ? 109  LEU A CB    1 
ATOM   597   C  CG    . LEU A  1 109 ? -16.662 -18.080 60.798  1.00 42.05  ? 109  LEU A CG    1 
ATOM   598   C  CD1   . LEU A  1 109 ? -17.334 -17.718 59.496  1.00 39.69  ? 109  LEU A CD1   1 
ATOM   599   C  CD2   . LEU A  1 109 ? -16.589 -16.872 61.762  1.00 40.86  ? 109  LEU A CD2   1 
ATOM   600   N  N     . CYS A  1 110 ? -17.846 -22.098 62.862  1.00 43.12  ? 110  CYS A N     1 
ATOM   601   C  CA    . CYS A  1 110 ? -18.744 -23.184 63.270  1.00 42.85  ? 110  CYS A CA    1 
ATOM   602   C  C     . CYS A  1 110 ? -18.529 -23.544 64.749  1.00 42.86  ? 110  CYS A C     1 
ATOM   603   O  O     . CYS A  1 110 ? -19.492 -23.747 65.488  1.00 42.35  ? 110  CYS A O     1 
ATOM   604   C  CB    . CYS A  1 110 ? -18.577 -24.395 62.353  1.00 42.92  ? 110  CYS A CB    1 
ATOM   605   S  SG    . CYS A  1 110 ? -19.129 -24.146 60.591  1.00 43.81  ? 110  CYS A SG    1 
ATOM   606   N  N     . ALA A  1 111 ? -17.276 -23.585 65.201  1.00 42.97  ? 111  ALA A N     1 
ATOM   607   C  CA    . ALA A  1 111 ? -17.041 -23.814 66.618  1.00 42.99  ? 111  ALA A CA    1 
ATOM   608   C  C     . ALA A  1 111 ? -17.648 -22.680 67.452  1.00 43.59  ? 111  ALA A C     1 
ATOM   609   O  O     . ALA A  1 111 ? -18.423 -22.936 68.379  1.00 43.89  ? 111  ALA A O     1 
ATOM   610   C  CB    . ALA A  1 111 ? -15.594 -23.992 66.898  1.00 42.79  ? 111  ALA A CB    1 
ATOM   611   N  N     . ILE A  1 112 ? -17.341 -21.427 67.099  1.00 44.14  ? 112  ILE A N     1 
ATOM   612   C  CA    . ILE A  1 112 ? -17.890 -20.262 67.819  1.00 44.14  ? 112  ILE A CA    1 
ATOM   613   C  C     . ILE A  1 112 ? -19.425 -20.247 67.825  1.00 45.28  ? 112  ILE A C     1 
ATOM   614   O  O     . ILE A  1 112 ? -20.025 -19.911 68.832  1.00 46.34  ? 112  ILE A O     1 
ATOM   615   C  CB    . ILE A  1 112 ? -17.371 -18.945 67.237  1.00 43.67  ? 112  ILE A CB    1 
ATOM   616   C  CG1   . ILE A  1 112 ? -15.917 -18.725 67.622  1.00 42.97  ? 112  ILE A CG1   1 
ATOM   617   C  CG2   . ILE A  1 112 ? -18.203 -17.791 67.703  1.00 42.66  ? 112  ILE A CG2   1 
ATOM   618   C  CD1   . ILE A  1 112 ? -15.149 -17.911 66.596  1.00 41.16  ? 112  ILE A CD1   1 
ATOM   619   N  N     . HIS A  1 113 ? -20.052 -20.612 66.705  1.00 46.05  ? 113  HIS A N     1 
ATOM   620   C  CA    . HIS A  1 113 ? -21.508 -20.706 66.591  1.00 46.54  ? 113  HIS A CA    1 
ATOM   621   C  C     . HIS A  1 113 ? -22.083 -21.639 67.642  1.00 47.78  ? 113  HIS A C     1 
ATOM   622   O  O     . HIS A  1 113 ? -23.188 -21.440 68.121  1.00 48.53  ? 113  HIS A O     1 
ATOM   623   C  CB    . HIS A  1 113 ? -21.855 -21.239 65.208  1.00 46.21  ? 113  HIS A CB    1 
ATOM   624   C  CG    . HIS A  1 113 ? -23.315 -21.232 64.885  1.00 45.12  ? 113  HIS A CG    1 
ATOM   625   N  ND1   . HIS A  1 113 ? -24.019 -20.073 64.640  1.00 44.37  ? 113  HIS A ND1   1 
ATOM   626   C  CD2   . HIS A  1 113 ? -24.191 -22.248 64.701  1.00 44.73  ? 113  HIS A CD2   1 
ATOM   627   C  CE1   . HIS A  1 113 ? -25.274 -20.374 64.348  1.00 44.13  ? 113  HIS A CE1   1 
ATOM   628   N  NE2   . HIS A  1 113 ? -25.404 -21.688 64.374  1.00 42.89  ? 113  HIS A NE2   1 
ATOM   629   N  N     . ALA A  1 114 ? -21.320 -22.664 67.997  1.00 49.07  ? 114  ALA A N     1 
ATOM   630   C  CA    . ALA A  1 114 ? -21.756 -23.672 68.941  1.00 49.83  ? 114  ALA A CA    1 
ATOM   631   C  C     . ALA A  1 114 ? -21.287 -23.298 70.338  1.00 51.21  ? 114  ALA A C     1 
ATOM   632   O  O     . ALA A  1 114 ? -21.152 -24.180 71.197  1.00 52.31  ? 114  ALA A O     1 
ATOM   633   C  CB    . ALA A  1 114 ? -21.180 -25.007 68.543  1.00 49.25  ? 114  ALA A CB    1 
ATOM   634   N  N     . LYS A  1 115 ? -21.026 -22.004 70.563  1.00 51.87  ? 115  LYS A N     1 
ATOM   635   C  CA    . LYS A  1 115 ? -20.477 -21.491 71.836  1.00 52.50  ? 115  LYS A CA    1 
ATOM   636   C  C     . LYS A  1 115 ? -19.201 -22.208 72.329  1.00 52.49  ? 115  LYS A C     1 
ATOM   637   O  O     . LYS A  1 115 ? -18.963 -22.305 73.528  1.00 53.07  ? 115  LYS A O     1 
ATOM   638   C  CB    . LYS A  1 115 ? -21.539 -21.479 72.928  1.00 52.57  ? 115  LYS A CB    1 
ATOM   639   C  CG    . LYS A  1 115 ? -22.806 -20.692 72.543  1.00 55.87  ? 115  LYS A CG    1 
ATOM   640   C  CD    . LYS A  1 115 ? -24.107 -21.449 72.900  1.00 60.90  ? 115  LYS A CD    1 
ATOM   641   C  CE    . LYS A  1 115 ? -23.951 -22.997 72.712  1.00 64.17  ? 115  LYS A CE    1 
ATOM   642   N  NZ    . LYS A  1 115 ? -25.179 -23.731 72.223  1.00 65.84  ? 115  LYS A NZ    1 
ATOM   643   N  N     . ARG A  1 116 ? -18.372 -22.691 71.412  1.00 51.89  ? 116  ARG A N     1 
ATOM   644   C  CA    . ARG A  1 116 ? -17.095 -23.247 71.805  1.00 51.54  ? 116  ARG A CA    1 
ATOM   645   C  C     . ARG A  1 116 ? -15.976 -22.412 71.228  1.00 51.51  ? 116  ARG A C     1 
ATOM   646   O  O     . ARG A  1 116 ? -16.168 -21.656 70.292  1.00 52.38  ? 116  ARG A O     1 
ATOM   647   C  CB    . ARG A  1 116 ? -16.941 -24.677 71.282  1.00 52.04  ? 116  ARG A CB    1 
ATOM   648   C  CG    . ARG A  1 116 ? -17.882 -25.700 71.868  1.00 51.40  ? 116  ARG A CG    1 
ATOM   649   C  CD    . ARG A  1 116 ? -17.583 -27.062 71.284  1.00 50.74  ? 116  ARG A CD    1 
ATOM   650   N  NE    . ARG A  1 116 ? -18.285 -27.290 70.022  1.00 48.52  ? 116  ARG A NE    1 
ATOM   651   C  CZ    . ARG A  1 116 ? -17.724 -27.210 68.819  1.00 47.50  ? 116  ARG A CZ    1 
ATOM   652   N  NH1   . ARG A  1 116 ? -16.446 -26.898 68.679  1.00 44.64  ? 116  ARG A NH1   1 
ATOM   653   N  NH2   . ARG A  1 116 ? -18.459 -27.439 67.741  1.00 49.29  ? 116  ARG A NH2   1 
ATOM   654   N  N     . VAL A  1 117 ? -14.788 -22.592 71.767  1.00 51.10  ? 117  VAL A N     1 
ATOM   655   C  CA    . VAL A  1 117 ? -13.607 -21.901 71.319  1.00 50.53  ? 117  VAL A CA    1 
ATOM   656   C  C     . VAL A  1 117 ? -12.682 -22.925 70.650  1.00 50.10  ? 117  VAL A C     1 
ATOM   657   O  O     . VAL A  1 117 ? -11.671 -22.567 70.061  1.00 50.23  ? 117  VAL A O     1 
ATOM   658   C  CB    . VAL A  1 117 ? -12.946 -21.234 72.551  1.00 50.76  ? 117  VAL A CB    1 
ATOM   659   C  CG1   . VAL A  1 117 ? -11.471 -20.970 72.340  1.00 51.91  ? 117  VAL A CG1   1 
ATOM   660   C  CG2   . VAL A  1 117 ? -13.664 -19.943 72.884  1.00 51.36  ? 117  VAL A CG2   1 
ATOM   661   N  N     . THR A  1 118 ? -13.060 -24.201 70.723  1.00 49.54  ? 118  THR A N     1 
ATOM   662   C  CA    . THR A  1 118 ? -12.197 -25.315 70.360  1.00 48.95  ? 118  THR A CA    1 
ATOM   663   C  C     . THR A  1 118 ? -12.671 -25.925 69.068  1.00 48.47  ? 118  THR A C     1 
ATOM   664   O  O     . THR A  1 118 ? -13.781 -26.434 69.025  1.00 48.90  ? 118  THR A O     1 
ATOM   665   C  CB    . THR A  1 118 ? -12.294 -26.419 71.450  1.00 48.97  ? 118  THR A CB    1 
ATOM   666   O  OG1   . THR A  1 118 ? -11.928 -25.868 72.722  1.00 50.61  ? 118  THR A OG1   1 
ATOM   667   C  CG2   . THR A  1 118 ? -11.398 -27.611 71.146  1.00 48.15  ? 118  THR A CG2   1 
ATOM   668   N  N     . ILE A  1 119 ? -11.859 -25.917 68.012  1.00 48.02  ? 119  ILE A N     1 
ATOM   669   C  CA    . ILE A  1 119 ? -12.306 -26.628 66.794  1.00 47.45  ? 119  ILE A CA    1 
ATOM   670   C  C     . ILE A  1 119 ? -12.284 -28.141 66.929  1.00 47.70  ? 119  ILE A C     1 
ATOM   671   O  O     . ILE A  1 119 ? -11.417 -28.715 67.591  1.00 47.04  ? 119  ILE A O     1 
ATOM   672   C  CB    . ILE A  1 119 ? -11.646 -26.167 65.463  1.00 46.58  ? 119  ILE A CB    1 
ATOM   673   C  CG1   . ILE A  1 119 ? -10.154 -26.460 65.450  1.00 45.46  ? 119  ILE A CG1   1 
ATOM   674   C  CG2   . ILE A  1 119 ? -11.959 -24.717 65.228  1.00 46.71  ? 119  ILE A CG2   1 
ATOM   675   C  CD1   . ILE A  1 119 ? -9.527  -26.349 64.097  1.00 44.00  ? 119  ILE A CD1   1 
ATOM   676   N  N     . MET A  1 120 ? -13.267 -28.759 66.282  1.00 48.72  ? 120  MET A N     1 
ATOM   677   C  CA    . MET A  1 120 ? -13.533 -30.202 66.337  1.00 49.83  ? 120  MET A CA    1 
ATOM   678   C  C     . MET A  1 120 ? -13.985 -30.739 64.979  1.00 49.17  ? 120  MET A C     1 
ATOM   679   O  O     . MET A  1 120 ? -14.605 -30.013 64.191  1.00 49.42  ? 120  MET A O     1 
ATOM   680   C  CB    . MET A  1 120 ? -14.625 -30.480 67.356  1.00 48.54  ? 120  MET A CB    1 
ATOM   681   C  CG    . MET A  1 120 ? -14.171 -30.267 68.748  1.00 50.23  ? 120  MET A CG    1 
ATOM   682   S  SD    . MET A  1 120 ? -15.541 -30.401 69.899  1.00 54.52  ? 120  MET A SD    1 
ATOM   683   C  CE    . MET A  1 120 ? -15.648 -32.212 70.211  1.00 51.79  ? 120  MET A CE    1 
ATOM   684   N  N     . PRO A  1 121 ? -13.705 -32.025 64.712  1.00 48.89  ? 121  PRO A N     1 
ATOM   685   C  CA    . PRO A  1 121 ? -14.188 -32.704 63.517  1.00 48.44  ? 121  PRO A CA    1 
ATOM   686   C  C     . PRO A  1 121 ? -15.606 -32.324 63.005  1.00 47.96  ? 121  PRO A C     1 
ATOM   687   O  O     . PRO A  1 121 ? -15.783 -32.091 61.802  1.00 48.26  ? 121  PRO A O     1 
ATOM   688   C  CB    . PRO A  1 121 ? -14.098 -34.169 63.929  1.00 48.60  ? 121  PRO A CB    1 
ATOM   689   C  CG    . PRO A  1 121 ? -12.808 -34.191 64.732  1.00 48.47  ? 121  PRO A CG    1 
ATOM   690   C  CD    . PRO A  1 121 ? -12.878 -32.931 65.546  1.00 48.92  ? 121  PRO A CD    1 
ATOM   691   N  N     . LYS A  1 122 ? -16.600 -32.257 63.876  1.00 46.99  ? 122  LYS A N     1 
ATOM   692   C  CA    . LYS A  1 122 ? -17.927 -31.881 63.419  1.00 46.70  ? 122  LYS A CA    1 
ATOM   693   C  C     . LYS A  1 122 ? -18.003 -30.453 62.863  1.00 46.27  ? 122  LYS A C     1 
ATOM   694   O  O     . LYS A  1 122 ? -18.894 -30.143 62.061  1.00 46.59  ? 122  LYS A O     1 
ATOM   695   C  CB    . LYS A  1 122 ? -18.992 -32.104 64.496  1.00 46.90  ? 122  LYS A CB    1 
ATOM   696   C  CG    . LYS A  1 122 ? -18.715 -31.509 65.850  1.00 48.97  ? 122  LYS A CG    1 
ATOM   697   C  CD    . LYS A  1 122 ? -20.019 -31.453 66.631  1.00 54.34  ? 122  LYS A CD    1 
ATOM   698   C  CE    . LYS A  1 122 ? -19.807 -31.552 68.132  1.00 56.71  ? 122  LYS A CE    1 
ATOM   699   N  NZ    . LYS A  1 122 ? -18.861 -32.653 68.485  1.00 59.85  ? 122  LYS A NZ    1 
ATOM   700   N  N     . ASP A  1 123 ? -17.085 -29.586 63.287  1.00 45.35  ? 123  ASP A N     1 
ATOM   701   C  CA    . ASP A  1 123 ? -17.048 -28.212 62.784  1.00 43.84  ? 123  ASP A CA    1 
ATOM   702   C  C     . ASP A  1 123 ? -16.622 -28.218 61.305  1.00 43.60  ? 123  ASP A C     1 
ATOM   703   O  O     . ASP A  1 123 ? -17.275 -27.596 60.468  1.00 44.06  ? 123  ASP A O     1 
ATOM   704   C  CB    . ASP A  1 123 ? -16.116 -27.352 63.643  1.00 43.32  ? 123  ASP A CB    1 
ATOM   705   C  CG    . ASP A  1 123 ? -16.590 -27.217 65.105  1.00 41.93  ? 123  ASP A CG    1 
ATOM   706   O  OD1   . ASP A  1 123 ? -17.787 -26.953 65.337  1.00 39.18  ? 123  ASP A OD1   1 
ATOM   707   O  OD2   . ASP A  1 123 ? -15.752 -27.324 66.026  1.00 38.39  ? 123  ASP A OD2   1 
ATOM   708   N  N     . ILE A  1 124 ? -15.545 -28.936 60.985  1.00 42.85  ? 124  ILE A N     1 
ATOM   709   C  CA    . ILE A  1 124 ? -15.082 -29.094 59.604  1.00 42.11  ? 124  ILE A CA    1 
ATOM   710   C  C     . ILE A  1 124 ? -16.131 -29.771 58.742  1.00 42.44  ? 124  ILE A C     1 
ATOM   711   O  O     . ILE A  1 124 ? -16.348 -29.387 57.603  1.00 42.25  ? 124  ILE A O     1 
ATOM   712   C  CB    . ILE A  1 124 ? -13.841 -29.997 59.510  1.00 41.74  ? 124  ILE A CB    1 
ATOM   713   C  CG1   . ILE A  1 124 ? -12.675 -29.448 60.323  1.00 40.44  ? 124  ILE A CG1   1 
ATOM   714   C  CG2   . ILE A  1 124 ? -13.440 -30.150 58.079  1.00 41.59  ? 124  ILE A CG2   1 
ATOM   715   C  CD1   . ILE A  1 124 ? -11.333 -30.053 59.953  1.00 37.81  ? 124  ILE A CD1   1 
ATOM   716   N  N     . GLN A  1 125 ? -16.766 -30.806 59.286  1.00 42.97  ? 125  GLN A N     1 
ATOM   717   C  CA    . GLN A  1 125 ? -17.807 -31.523 58.560  1.00 42.91  ? 125  GLN A CA    1 
ATOM   718   C  C     . GLN A  1 125 ? -18.925 -30.544 58.239  1.00 42.59  ? 125  GLN A C     1 
ATOM   719   O  O     . GLN A  1 125 ? -19.396 -30.483 57.104  1.00 43.10  ? 125  GLN A O     1 
ATOM   720   C  CB    . GLN A  1 125 ? -18.291 -32.741 59.359  1.00 42.60  ? 125  GLN A CB    1 
ATOM   721   C  CG    . GLN A  1 125 ? -17.407 -33.988 59.170  1.00 43.72  ? 125  GLN A CG    1 
ATOM   722   C  CD    . GLN A  1 125 ? -17.218 -34.828 60.457  1.00 44.74  ? 125  GLN A CD    1 
ATOM   723   O  OE1   . GLN A  1 125 ? -18.154 -35.024 61.250  1.00 41.63  ? 125  GLN A OE1   1 
ATOM   724   N  NE2   . GLN A  1 125 ? -15.985 -35.313 60.661  1.00 43.59  ? 125  GLN A NE2   1 
ATOM   725   N  N     . LEU A  1 126 ? -19.319 -29.742 59.219  1.00 42.51  ? 126  LEU A N     1 
ATOM   726   C  CA    . LEU A  1 126 ? -20.340 -28.719 58.973  1.00 42.73  ? 126  LEU A CA    1 
ATOM   727   C  C     . LEU A  1 126 ? -19.888 -27.710 57.915  1.00 43.19  ? 126  LEU A C     1 
ATOM   728   O  O     . LEU A  1 126 ? -20.605 -27.500 56.936  1.00 43.88  ? 126  LEU A O     1 
ATOM   729   C  CB    . LEU A  1 126 ? -20.796 -28.018 60.253  1.00 42.00  ? 126  LEU A CB    1 
ATOM   730   C  CG    . LEU A  1 126 ? -21.898 -26.994 59.982  1.00 42.05  ? 126  LEU A CG    1 
ATOM   731   C  CD1   . LEU A  1 126 ? -23.154 -27.655 59.478  1.00 40.88  ? 126  LEU A CD1   1 
ATOM   732   C  CD2   . LEU A  1 126 ? -22.208 -26.151 61.215  1.00 42.41  ? 126  LEU A CD2   1 
ATOM   733   N  N     . ALA A  1 127 ? -18.707 -27.107 58.085  1.00 43.31  ? 127  ALA A N     1 
ATOM   734   C  CA    . ALA A  1 127 ? -18.151 -26.213 57.054  1.00 43.32  ? 127  ALA A CA    1 
ATOM   735   C  C     . ALA A  1 127 ? -18.170 -26.854 55.664  1.00 43.77  ? 127  ALA A C     1 
ATOM   736   O  O     . ALA A  1 127 ? -18.612 -26.230 54.712  1.00 43.64  ? 127  ALA A O     1 
ATOM   737   C  CB    . ALA A  1 127 ? -16.747 -25.751 57.413  1.00 42.60  ? 127  ALA A CB    1 
ATOM   738   N  N     . ARG A  1 128 ? -17.715 -28.098 55.544  1.00 44.68  ? 128  ARG A N     1 
ATOM   739   C  CA    . ARG A  1 128 ? -17.611 -28.731 54.230  1.00 46.17  ? 128  ARG A CA    1 
ATOM   740   C  C     . ARG A  1 128 ? -18.952 -29.051 53.606  1.00 47.32  ? 128  ARG A C     1 
ATOM   741   O  O     . ARG A  1 128 ? -19.112 -28.993 52.389  1.00 46.82  ? 128  ARG A O     1 
ATOM   742   C  CB    . ARG A  1 128 ? -16.750 -29.976 54.287  1.00 46.03  ? 128  ARG A CB    1 
ATOM   743   C  CG    . ARG A  1 128 ? -15.293 -29.673 54.530  1.00 46.79  ? 128  ARG A CG    1 
ATOM   744   C  CD    . ARG A  1 128 ? -14.452 -30.896 54.392  1.00 48.08  ? 128  ARG A CD    1 
ATOM   745   N  NE    . ARG A  1 128 ? -14.300 -31.311 53.003  1.00 51.10  ? 128  ARG A NE    1 
ATOM   746   C  CZ    . ARG A  1 128 ? -14.475 -32.557 52.566  1.00 51.50  ? 128  ARG A CZ    1 
ATOM   747   N  NH1   . ARG A  1 128 ? -14.805 -33.522 53.410  1.00 51.19  ? 128  ARG A NH1   1 
ATOM   748   N  NH2   . ARG A  1 128 ? -14.299 -32.841 51.283  1.00 53.03  ? 128  ARG A NH2   1 
ATOM   749   N  N     . ARG A  1 129 ? -19.915 -29.399 54.448  1.00 49.39  ? 129  ARG A N     1 
ATOM   750   C  CA    . ARG A  1 129 ? -21.254 -29.697 53.973  1.00 51.81  ? 129  ARG A CA    1 
ATOM   751   C  C     . ARG A  1 129 ? -21.864 -28.438 53.359  1.00 52.48  ? 129  ARG A C     1 
ATOM   752   O  O     . ARG A  1 129 ? -22.258 -28.437 52.212  1.00 52.80  ? 129  ARG A O     1 
ATOM   753   C  CB    . ARG A  1 129 ? -22.108 -30.256 55.111  1.00 52.23  ? 129  ARG A CB    1 
ATOM   754   C  CG    . ARG A  1 129 ? -23.397 -30.899 54.666  1.00 55.47  ? 129  ARG A CG    1 
ATOM   755   C  CD    . ARG A  1 129 ? -24.027 -31.741 55.794  1.00 63.61  ? 129  ARG A CD    1 
ATOM   756   N  NE    . ARG A  1 129 ? -23.922 -33.180 55.537  1.00 69.28  ? 129  ARG A NE    1 
ATOM   757   C  CZ    . ARG A  1 129 ? -23.148 -34.032 56.215  1.00 72.36  ? 129  ARG A CZ    1 
ATOM   758   N  NH1   . ARG A  1 129 ? -22.405 -33.607 57.244  1.00 72.82  ? 129  ARG A NH1   1 
ATOM   759   N  NH2   . ARG A  1 129 ? -23.125 -35.322 55.861  1.00 73.27  ? 129  ARG A NH2   1 
ATOM   760   N  N     . ILE A  1 130 ? -21.889 -27.358 54.127  1.00 54.11  ? 130  ILE A N     1 
ATOM   761   C  CA    . ILE A  1 130 ? -22.428 -26.076 53.689  1.00 55.34  ? 130  ILE A CA    1 
ATOM   762   C  C     . ILE A  1 130 ? -21.707 -25.477 52.473  1.00 56.39  ? 130  ILE A C     1 
ATOM   763   O  O     . ILE A  1 130 ? -22.358 -24.960 51.582  1.00 56.79  ? 130  ILE A O     1 
ATOM   764   C  CB    . ILE A  1 130 ? -22.495 -25.101 54.865  1.00 55.22  ? 130  ILE A CB    1 
ATOM   765   C  CG1   . ILE A  1 130 ? -23.443 -25.676 55.919  1.00 55.64  ? 130  ILE A CG1   1 
ATOM   766   C  CG2   . ILE A  1 130 ? -22.950 -23.709 54.410  1.00 54.79  ? 130  ILE A CG2   1 
ATOM   767   C  CD1   . ILE A  1 130 ? -23.422 -24.935 57.252  1.00 57.86  ? 130  ILE A CD1   1 
ATOM   768   N  N     . ARG A  1 131 ? -20.382 -25.563 52.422  1.00 57.96  ? 131  ARG A N     1 
ATOM   769   C  CA    . ARG A  1 131 ? -19.630 -25.190 51.216  1.00 59.65  ? 131  ARG A CA    1 
ATOM   770   C  C     . ARG A  1 131 ? -19.999 -26.007 49.961  1.00 61.33  ? 131  ARG A C     1 
ATOM   771   O  O     . ARG A  1 131 ? -19.626 -25.639 48.853  1.00 61.12  ? 131  ARG A O     1 
ATOM   772   C  CB    . ARG A  1 131 ? -18.138 -25.344 51.459  1.00 59.16  ? 131  ARG A CB    1 
ATOM   773   C  CG    . ARG A  1 131 ? -17.449 -24.143 52.024  1.00 58.77  ? 131  ARG A CG    1 
ATOM   774   C  CD    . ARG A  1 131 ? -16.216 -24.617 52.758  1.00 58.27  ? 131  ARG A CD    1 
ATOM   775   N  NE    . ARG A  1 131 ? -15.135 -23.644 52.908  1.00 56.77  ? 131  ARG A NE    1 
ATOM   776   C  CZ    . ARG A  1 131 ? -13.924 -23.820 52.394  1.00 57.58  ? 131  ARG A CZ    1 
ATOM   777   N  NH1   . ARG A  1 131 ? -13.674 -24.912 51.689  1.00 58.54  ? 131  ARG A NH1   1 
ATOM   778   N  NH2   . ARG A  1 131 ? -12.954 -22.932 52.591  1.00 57.55  ? 131  ARG A NH2   1 
ATOM   779   N  N     . GLY A  1 132 ? -20.709 -27.121 50.137  1.00 63.63  ? 132  GLY A N     1 
ATOM   780   C  CA    . GLY A  1 132 ? -21.102 -27.976 49.016  1.00 66.59  ? 132  GLY A CA    1 
ATOM   781   C  C     . GLY A  1 132 ? -20.020 -28.947 48.573  1.00 69.03  ? 132  GLY A C     1 
ATOM   782   O  O     . GLY A  1 132 ? -20.094 -29.516 47.486  1.00 69.19  ? 132  GLY A O     1 
ATOM   783   N  N     . GLU A  1 133 ? -19.004 -29.132 49.412  1.00 71.51  ? 133  GLU A N     1 
ATOM   784   C  CA    . GLU A  1 133 ? -17.985 -30.154 49.174  1.00 73.95  ? 133  GLU A CA    1 
ATOM   785   C  C     . GLU A  1 133 ? -18.472 -31.520 49.674  1.00 76.07  ? 133  GLU A C     1 
ATOM   786   O  O     . GLU A  1 133 ? -18.982 -31.669 50.805  1.00 76.47  ? 133  GLU A O     1 
ATOM   787   C  CB    . GLU A  1 133 ? -16.666 -29.804 49.863  1.00 73.51  ? 133  GLU A CB    1 
ATOM   788   C  CG    . GLU A  1 133 ? -16.104 -28.453 49.502  1.00 73.17  ? 133  GLU A CG    1 
ATOM   789   C  CD    . GLU A  1 133 ? -14.914 -28.073 50.365  1.00 72.84  ? 133  GLU A CD    1 
ATOM   790   O  OE1   . GLU A  1 133 ? -14.411 -28.940 51.116  1.00 71.40  ? 133  GLU A OE1   1 
ATOM   791   O  OE2   . GLU A  1 133 ? -14.482 -26.902 50.290  1.00 73.03  ? 133  GLU A OE2   1 
ATOM   792   N  N     . ARG A  1 134 ? -18.311 -32.522 48.822  1.00 78.20  ? 134  ARG A N     1 
ATOM   793   C  CA    . ARG A  1 134 ? -18.738 -33.873 49.152  1.00 80.04  ? 134  ARG A CA    1 
ATOM   794   C  C     . ARG A  1 134 ? -17.533 -34.790 48.984  1.00 80.53  ? 134  ARG A C     1 
ATOM   795   O  O     . ARG A  1 134 ? -16.475 -34.337 48.520  1.00 80.98  ? 134  ARG A O     1 
ATOM   796   C  CB    . ARG A  1 134 ? -19.921 -34.261 48.260  1.00 80.50  ? 134  ARG A CB    1 
ATOM   797   C  CG    . ARG A  1 134 ? -21.145 -33.348 48.474  1.00 82.69  ? 134  ARG A CG    1 
ATOM   798   C  CD    . ARG A  1 134 ? -21.663 -32.757 47.160  1.00 85.90  ? 134  ARG A CD    1 
ATOM   799   N  NE    . ARG A  1 134 ? -22.964 -32.091 47.312  1.00 87.43  ? 134  ARG A NE    1 
ATOM   800   C  CZ    . ARG A  1 134 ? -23.817 -31.851 46.312  1.00 88.65  ? 134  ARG A CZ    1 
ATOM   801   N  NH1   . ARG A  1 134 ? -23.520 -32.225 45.060  1.00 87.97  ? 134  ARG A NH1   1 
ATOM   802   N  NH2   . ARG A  1 134 ? -24.978 -31.239 46.563  1.00 88.65  ? 134  ARG A NH2   1 
ATOM   803   N  N     . ALA A  1 135 ? -17.675 -36.053 49.383  1.00 81.06  ? 135  ALA A N     1 
ATOM   804   C  CA    . ALA A  1 135 ? -16.553 -37.016 49.389  1.00 81.91  ? 135  ALA A CA    1 
ATOM   805   C  C     . ALA A  1 135 ? -15.436 -36.668 50.401  1.00 82.28  ? 135  ALA A C     1 
ATOM   806   O  O     . ALA A  1 135 ? -14.344 -37.260 50.359  1.00 82.58  ? 135  ALA A O     1 
ATOM   807   C  CB    . ALA A  1 135 ? -15.967 -37.220 47.962  1.00 81.74  ? 135  ALA A CB    1 
ATOM   808   O  OXT   . ALA A  1 135 ? -15.590 -35.809 51.287  1.00 82.28  ? 135  ALA A OXT   1 
ATOM   809   N  N     . LYS B  2 20  ? 11.170  -46.863 43.902  1.00 58.00  ? 20   LYS B N     1 
ATOM   810   C  CA    . LYS B  2 20  ? 10.873  -47.476 45.249  1.00 58.30  ? 20   LYS B CA    1 
ATOM   811   C  C     . LYS B  2 20  ? 9.451   -47.158 45.826  1.00 57.58  ? 20   LYS B C     1 
ATOM   812   O  O     . LYS B  2 20  ? 8.958   -46.038 45.682  1.00 57.70  ? 20   LYS B O     1 
ATOM   813   C  CB    . LYS B  2 20  ? 11.995  -47.160 46.251  1.00 58.40  ? 20   LYS B CB    1 
ATOM   814   C  CG    . LYS B  2 20  ? 11.496  -46.618 47.586  1.00 60.26  ? 20   LYS B CG    1 
ATOM   815   C  CD    . LYS B  2 20  ? 12.137  -47.299 48.807  1.00 63.07  ? 20   LYS B CD    1 
ATOM   816   C  CE    . LYS B  2 20  ? 11.469  -46.798 50.113  1.00 63.25  ? 20   LYS B CE    1 
ATOM   817   N  NZ    . LYS B  2 20  ? 11.579  -47.784 51.248  1.00 65.39  ? 20   LYS B NZ    1 
ATOM   818   N  N     . VAL B  2 21  ? 8.806   -48.133 46.479  1.00 56.13  ? 21   VAL B N     1 
ATOM   819   C  CA    . VAL B  2 21  ? 7.398   -47.964 46.862  1.00 54.93  ? 21   VAL B CA    1 
ATOM   820   C  C     . VAL B  2 21  ? 7.125   -46.775 47.811  1.00 54.03  ? 21   VAL B C     1 
ATOM   821   O  O     . VAL B  2 21  ? 7.714   -46.672 48.901  1.00 54.26  ? 21   VAL B O     1 
ATOM   822   C  CB    . VAL B  2 21  ? 6.730   -49.289 47.370  1.00 54.91  ? 21   VAL B CB    1 
ATOM   823   C  CG1   . VAL B  2 21  ? 7.573   -49.993 48.437  1.00 56.23  ? 21   VAL B CG1   1 
ATOM   824   C  CG2   . VAL B  2 21  ? 5.350   -49.022 47.926  1.00 54.89  ? 21   VAL B CG2   1 
ATOM   825   N  N     . LEU B  2 22  ? 6.224   -45.892 47.367  1.00 52.43  ? 22   LEU B N     1 
ATOM   826   C  CA    . LEU B  2 22  ? 5.705   -44.785 48.168  1.00 50.76  ? 22   LEU B CA    1 
ATOM   827   C  C     . LEU B  2 22  ? 4.463   -45.153 48.976  1.00 50.16  ? 22   LEU B C     1 
ATOM   828   O  O     . LEU B  2 22  ? 3.451   -45.509 48.404  1.00 50.14  ? 22   LEU B O     1 
ATOM   829   C  CB    . LEU B  2 22  ? 5.366   -43.621 47.246  1.00 50.76  ? 22   LEU B CB    1 
ATOM   830   C  CG    . LEU B  2 22  ? 6.491   -43.065 46.387  1.00 49.57  ? 22   LEU B CG    1 
ATOM   831   C  CD1   . LEU B  2 22  ? 5.930   -42.143 45.340  1.00 47.61  ? 22   LEU B CD1   1 
ATOM   832   C  CD2   . LEU B  2 22  ? 7.501   -42.366 47.280  1.00 49.50  ? 22   LEU B CD2   1 
ATOM   833   N  N     . ARG B  2 23  ? 4.531   -45.033 50.299  1.00 50.08  ? 23   ARG B N     1 
ATOM   834   C  CA    . ARG B  2 23  ? 3.439   -45.451 51.184  1.00 50.11  ? 23   ARG B CA    1 
ATOM   835   C  C     . ARG B  2 23  ? 3.252   -44.463 52.317  1.00 51.22  ? 23   ARG B C     1 
ATOM   836   O  O     . ARG B  2 23  ? 4.226   -43.975 52.865  1.00 52.03  ? 23   ARG B O     1 
ATOM   837   C  CB    . ARG B  2 23  ? 3.761   -46.790 51.859  1.00 49.97  ? 23   ARG B CB    1 
ATOM   838   C  CG    . ARG B  2 23  ? 4.164   -47.950 50.949  1.00 50.42  ? 23   ARG B CG    1 
ATOM   839   C  CD    . ARG B  2 23  ? 4.943   -49.020 51.727  1.00 47.63  ? 23   ARG B CD    1 
ATOM   840   N  NE    . ARG B  2 23  ? 4.153   -49.385 52.880  1.00 43.55  ? 23   ARG B NE    1 
ATOM   841   C  CZ    . ARG B  2 23  ? 4.657   -49.815 54.029  1.00 41.44  ? 23   ARG B CZ    1 
ATOM   842   N  NH1   . ARG B  2 23  ? 5.981   -49.971 54.161  1.00 38.46  ? 23   ARG B NH1   1 
ATOM   843   N  NH2   . ARG B  2 23  ? 3.821   -50.081 55.039  1.00 36.01  ? 23   ARG B NH2   1 
ATOM   844   N  N     . ASP B  2 24  ? 2.007   -44.210 52.709  1.00 52.16  ? 24   ASP B N     1 
ATOM   845   C  CA    . ASP B  2 24  ? 1.712   -43.475 53.943  1.00 53.27  ? 24   ASP B CA    1 
ATOM   846   C  C     . ASP B  2 24  ? 2.257   -42.037 54.060  1.00 53.66  ? 24   ASP B C     1 
ATOM   847   O  O     . ASP B  2 24  ? 2.527   -41.567 55.177  1.00 54.01  ? 24   ASP B O     1 
ATOM   848   C  CB    . ASP B  2 24  ? 2.178   -44.266 55.154  1.00 53.34  ? 24   ASP B CB    1 
ATOM   849   C  CG    . ASP B  2 24  ? 1.356   -43.953 56.394  1.00 56.09  ? 24   ASP B CG    1 
ATOM   850   O  OD1   . ASP B  2 24  ? 0.116   -43.743 56.257  1.00 57.53  ? 24   ASP B OD1   1 
ATOM   851   O  OD2   . ASP B  2 24  ? 1.954   -43.906 57.504  1.00 58.73  ? 24   ASP B OD2   1 
ATOM   852   N  N     . ASN B  2 25  ? 2.402   -41.327 52.937  1.00 53.31  ? 25   ASN B N     1 
ATOM   853   C  CA    . ASN B  2 25  ? 3.021   -40.007 52.986  1.00 52.90  ? 25   ASN B CA    1 
ATOM   854   C  C     . ASN B  2 25  ? 2.202   -38.845 53.605  1.00 52.84  ? 25   ASN B C     1 
ATOM   855   O  O     . ASN B  2 25  ? 2.762   -37.816 53.972  1.00 52.62  ? 25   ASN B O     1 
ATOM   856   C  CB    . ASN B  2 25  ? 3.530   -39.655 51.623  1.00 52.95  ? 25   ASN B CB    1 
ATOM   857   C  CG    . ASN B  2 25  ? 4.712   -40.480 51.244  1.00 53.84  ? 25   ASN B CG    1 
ATOM   858   O  OD1   . ASN B  2 25  ? 5.760   -40.393 51.891  1.00 55.68  ? 25   ASN B OD1   1 
ATOM   859   N  ND2   . ASN B  2 25  ? 4.574   -41.287 50.183  1.00 52.70  ? 25   ASN B ND2   1 
ATOM   860   N  N     . ILE B  2 26  ? 0.894   -39.030 53.756  1.00 53.02  ? 26   ILE B N     1 
ATOM   861   C  CA    . ILE B  2 26  ? 0.052   -38.044 54.403  1.00 53.04  ? 26   ILE B CA    1 
ATOM   862   C  C     . ILE B  2 26  ? 0.457   -37.859 55.862  1.00 53.54  ? 26   ILE B C     1 
ATOM   863   O  O     . ILE B  2 26  ? -0.027  -36.960 56.522  1.00 54.19  ? 26   ILE B O     1 
ATOM   864   C  CB    . ILE B  2 26  ? -1.475  -38.380 54.269  1.00 52.76  ? 26   ILE B CB    1 
ATOM   865   C  CG1   . ILE B  2 26  ? -2.363  -37.147 54.525  1.00 52.98  ? 26   ILE B CG1   1 
ATOM   866   C  CG2   . ILE B  2 26  ? -1.889  -39.503 55.217  1.00 52.12  ? 26   ILE B CG2   1 
ATOM   867   C  CD1   . ILE B  2 26  ? -2.401  -36.089 53.409  1.00 51.24  ? 26   ILE B CD1   1 
ATOM   868   N  N     . GLN B  2 27  ? 1.339   -38.699 56.380  1.00 54.18  ? 27   GLN B N     1 
ATOM   869   C  CA    . GLN B  2 27  ? 1.812   -38.497 57.765  1.00 54.48  ? 27   GLN B CA    1 
ATOM   870   C  C     . GLN B  2 27  ? 2.969   -37.492 57.777  1.00 54.30  ? 27   GLN B C     1 
ATOM   871   O  O     . GLN B  2 27  ? 3.405   -37.035 58.845  1.00 54.84  ? 27   GLN B O     1 
ATOM   872   C  CB    . GLN B  2 27  ? 2.178   -39.824 58.467  1.00 54.21  ? 27   GLN B CB    1 
ATOM   873   C  CG    . GLN B  2 27  ? 0.972   -40.752 58.727  1.00 55.06  ? 27   GLN B CG    1 
ATOM   874   C  CD    . GLN B  2 27  ? -0.080  -40.158 59.675  1.00 57.58  ? 27   GLN B CD    1 
ATOM   875   O  OE1   . GLN B  2 27  ? 0.259   -39.559 60.704  1.00 59.28  ? 27   GLN B OE1   1 
ATOM   876   N  NE2   . GLN B  2 27  ? -1.363  -40.337 59.339  1.00 56.24  ? 27   GLN B NE2   1 
ATOM   877   N  N     . GLY B  2 28  ? 3.454   -37.149 56.583  1.00 53.56  ? 28   GLY B N     1 
ATOM   878   C  CA    . GLY B  2 28  ? 4.430   -36.075 56.421  1.00 52.66  ? 28   GLY B CA    1 
ATOM   879   C  C     . GLY B  2 28  ? 3.814   -34.719 56.750  1.00 52.03  ? 28   GLY B C     1 
ATOM   880   O  O     . GLY B  2 28  ? 4.511   -33.807 57.202  1.00 52.59  ? 28   GLY B O     1 
ATOM   881   N  N     . ILE B  2 29  ? 2.508   -34.591 56.508  1.00 50.69  ? 29   ILE B N     1 
ATOM   882   C  CA    . ILE B  2 29  ? 1.709   -33.465 56.977  1.00 49.61  ? 29   ILE B CA    1 
ATOM   883   C  C     . ILE B  2 29  ? 1.589   -33.550 58.492  1.00 48.88  ? 29   ILE B C     1 
ATOM   884   O  O     . ILE B  2 29  ? 0.626   -34.096 59.007  1.00 48.74  ? 29   ILE B O     1 
ATOM   885   C  CB    . ILE B  2 29  ? 0.307   -33.522 56.334  1.00 49.70  ? 29   ILE B CB    1 
ATOM   886   C  CG1   . ILE B  2 29  ? 0.429   -33.700 54.816  1.00 50.33  ? 29   ILE B CG1   1 
ATOM   887   C  CG2   . ILE B  2 29  ? -0.549  -32.309 56.689  1.00 50.04  ? 29   ILE B CG2   1 
ATOM   888   C  CD1   . ILE B  2 29  ? 1.398   -32.737 54.149  1.00 50.42  ? 29   ILE B CD1   1 
ATOM   889   N  N     . THR B  2 30  ? 2.564   -33.006 59.205  1.00 48.28  ? 30   THR B N     1 
ATOM   890   C  CA    . THR B  2 30  ? 2.665   -33.222 60.644  1.00 48.64  ? 30   THR B CA    1 
ATOM   891   C  C     . THR B  2 30  ? 1.684   -32.462 61.546  1.00 48.82  ? 30   THR B C     1 
ATOM   892   O  O     . THR B  2 30  ? 0.967   -31.562 61.106  1.00 49.79  ? 30   THR B O     1 
ATOM   893   C  CB    . THR B  2 30  ? 4.079   -32.958 61.127  1.00 48.73  ? 30   THR B CB    1 
ATOM   894   O  OG1   . THR B  2 30  ? 4.406   -31.589 60.897  1.00 50.06  ? 30   THR B OG1   1 
ATOM   895   C  CG2   . THR B  2 30  ? 5.060   -33.836 60.370  1.00 48.73  ? 30   THR B CG2   1 
ATOM   896   N  N     . LYS B  2 31  ? 1.646   -32.829 62.819  1.00 48.71  ? 31   LYS B N     1 
ATOM   897   C  CA    . LYS B  2 31  ? 0.814   -32.134 63.792  1.00 48.74  ? 31   LYS B CA    1 
ATOM   898   C  C     . LYS B  2 31  ? 1.175   -30.629 63.907  1.00 48.61  ? 31   LYS B C     1 
ATOM   899   O  O     . LYS B  2 31  ? 0.286   -29.782 63.799  1.00 48.65  ? 31   LYS B O     1 
ATOM   900   C  CB    . LYS B  2 31  ? 0.921   -32.813 65.145  1.00 48.49  ? 31   LYS B CB    1 
ATOM   901   C  CG    . LYS B  2 31  ? -0.185  -32.494 66.091  1.00 50.78  ? 31   LYS B CG    1 
ATOM   902   C  CD    . LYS B  2 31  ? 0.312   -32.696 67.506  1.00 54.27  ? 31   LYS B CD    1 
ATOM   903   C  CE    . LYS B  2 31  ? -0.818  -32.543 68.502  1.00 57.24  ? 31   LYS B CE    1 
ATOM   904   N  NZ    . LYS B  2 31  ? -0.311  -32.564 69.910  1.00 59.91  ? 31   LYS B NZ    1 
ATOM   905   N  N     . PRO B  2 32  ? 2.467   -30.286 64.133  1.00 48.34  ? 32   PRO B N     1 
ATOM   906   C  CA    . PRO B  2 32  ? 2.795   -28.845 64.120  1.00 47.79  ? 32   PRO B CA    1 
ATOM   907   C  C     . PRO B  2 32  ? 2.374   -28.124 62.823  1.00 47.50  ? 32   PRO B C     1 
ATOM   908   O  O     . PRO B  2 32  ? 1.782   -27.038 62.893  1.00 47.29  ? 32   PRO B O     1 
ATOM   909   C  CB    . PRO B  2 32  ? 4.313   -28.809 64.327  1.00 47.04  ? 32   PRO B CB    1 
ATOM   910   C  CG    . PRO B  2 32  ? 4.780   -30.199 64.092  1.00 48.06  ? 32   PRO B CG    1 
ATOM   911   C  CD    . PRO B  2 32  ? 3.652   -31.113 64.426  1.00 48.16  ? 32   PRO B CD    1 
ATOM   912   N  N     . ALA B  2 33  ? 2.636   -28.722 61.663  1.00 47.15  ? 33   ALA B N     1 
ATOM   913   C  CA    . ALA B  2 33  ? 2.205   -28.109 60.395  1.00 47.01  ? 33   ALA B CA    1 
ATOM   914   C  C     . ALA B  2 33  ? 0.680   -27.819 60.343  1.00 47.05  ? 33   ALA B C     1 
ATOM   915   O  O     . ALA B  2 33  ? 0.275   -26.769 59.893  1.00 47.50  ? 33   ALA B O     1 
ATOM   916   C  CB    . ALA B  2 33  ? 2.647   -28.932 59.207  1.00 45.94  ? 33   ALA B CB    1 
ATOM   917   N  N     . ILE B  2 34  ? -0.164  -28.729 60.814  1.00 47.16  ? 34   ILE B N     1 
ATOM   918   C  CA    . ILE B  2 34  ? -1.617  -28.488 60.770  1.00 47.02  ? 34   ILE B CA    1 
ATOM   919   C  C     . ILE B  2 34  ? -2.024  -27.361 61.729  1.00 47.46  ? 34   ILE B C     1 
ATOM   920   O  O     . ILE B  2 34  ? -2.945  -26.595 61.459  1.00 47.58  ? 34   ILE B O     1 
ATOM   921   C  CB    . ILE B  2 34  ? -2.423  -29.794 61.029  1.00 46.79  ? 34   ILE B CB    1 
ATOM   922   C  CG1   . ILE B  2 34  ? -2.357  -30.713 59.793  1.00 45.95  ? 34   ILE B CG1   1 
ATOM   923   C  CG2   . ILE B  2 34  ? -3.869  -29.491 61.394  1.00 45.90  ? 34   ILE B CG2   1 
ATOM   924   C  CD1   . ILE B  2 34  ? -2.399  -32.213 60.111  1.00 43.07  ? 34   ILE B CD1   1 
ATOM   925   N  N     . ARG B  2 35  ? -1.293  -27.262 62.831  1.00 47.83  ? 35   ARG B N     1 
ATOM   926   C  CA    . ARG B  2 35  ? -1.508  -26.274 63.875  1.00 48.31  ? 35   ARG B CA    1 
ATOM   927   C  C     . ARG B  2 35  ? -1.162  -24.883 63.347  1.00 46.96  ? 35   ARG B C     1 
ATOM   928   O  O     . ARG B  2 35  ? -1.966  -23.972 63.460  1.00 46.86  ? 35   ARG B O     1 
ATOM   929   C  CB    . ARG B  2 35  ? -0.662  -26.675 65.078  1.00 48.02  ? 35   ARG B CB    1 
ATOM   930   C  CG    . ARG B  2 35  ? -0.463  -25.676 66.202  1.00 50.88  ? 35   ARG B CG    1 
ATOM   931   C  CD    . ARG B  2 35  ? 0.253   -26.398 67.400  1.00 52.06  ? 35   ARG B CD    1 
ATOM   932   N  NE    . ARG B  2 35  ? -0.683  -27.372 67.980  1.00 60.68  ? 35   ARG B NE    1 
ATOM   933   C  CZ    . ARG B  2 35  ? -1.256  -27.251 69.177  1.00 64.95  ? 35   ARG B CZ    1 
ATOM   934   N  NH1   . ARG B  2 35  ? -0.942  -26.236 69.985  1.00 68.02  ? 35   ARG B NH1   1 
ATOM   935   N  NH2   . ARG B  2 35  ? -2.123  -28.165 69.589  1.00 67.26  ? 35   ARG B NH2   1 
ATOM   936   N  N     . ARG B  2 36  ? 0.013   -24.733 62.736  1.00 45.97  ? 36   ARG B N     1 
ATOM   937   C  CA    . ARG B  2 36  ? 0.390   -23.485 62.074  1.00 44.56  ? 36   ARG B CA    1 
ATOM   938   C  C     . ARG B  2 36  ? -0.672  -23.010 61.061  1.00 43.70  ? 36   ARG B C     1 
ATOM   939   O  O     . ARG B  2 36  ? -1.069  -21.847 61.082  1.00 44.46  ? 36   ARG B O     1 
ATOM   940   C  CB    . ARG B  2 36  ? 1.751   -23.607 61.409  1.00 44.02  ? 36   ARG B CB    1 
ATOM   941   C  CG    . ARG B  2 36  ? 2.910   -23.728 62.393  1.00 44.44  ? 36   ARG B CG    1 
ATOM   942   C  CD    . ARG B  2 36  ? 4.274   -23.564 61.686  1.00 45.96  ? 36   ARG B CD    1 
ATOM   943   N  NE    . ARG B  2 36  ? 4.555   -24.582 60.639  1.00 48.17  ? 36   ARG B NE    1 
ATOM   944   C  CZ    . ARG B  2 36  ? 5.177   -25.744 60.873  1.00 48.20  ? 36   ARG B CZ    1 
ATOM   945   N  NH1   . ARG B  2 36  ? 5.595   -26.061 62.112  1.00 46.30  ? 36   ARG B NH1   1 
ATOM   946   N  NH2   . ARG B  2 36  ? 5.387   -26.590 59.874  1.00 47.20  ? 36   ARG B NH2   1 
ATOM   947   N  N     . LEU B  2 37  ? -1.166  -23.893 60.196  1.00 42.06  ? 37   LEU B N     1 
ATOM   948   C  CA    . LEU B  2 37  ? -2.250  -23.513 59.291  1.00 40.08  ? 37   LEU B CA    1 
ATOM   949   C  C     . LEU B  2 37  ? -3.516  -23.059 60.050  1.00 39.58  ? 37   LEU B C     1 
ATOM   950   O  O     . LEU B  2 37  ? -4.215  -22.162 59.610  1.00 39.51  ? 37   LEU B O     1 
ATOM   951   C  CB    . LEU B  2 37  ? -2.590  -24.660 58.343  1.00 39.40  ? 37   LEU B CB    1 
ATOM   952   C  CG    . LEU B  2 37  ? -1.512  -25.180 57.412  1.00 38.16  ? 37   LEU B CG    1 
ATOM   953   C  CD1   . LEU B  2 37  ? -1.832  -26.639 57.005  1.00 38.21  ? 37   LEU B CD1   1 
ATOM   954   C  CD2   . LEU B  2 37  ? -1.326  -24.315 56.188  1.00 37.20  ? 37   LEU B CD2   1 
ATOM   955   N  N     . ALA B  2 38  ? -3.828  -23.686 61.179  1.00 38.77  ? 38   ALA B N     1 
ATOM   956   C  CA    . ALA B  2 38  ? -5.013  -23.285 61.939  1.00 38.13  ? 38   ALA B CA    1 
ATOM   957   C  C     . ALA B  2 38  ? -4.810  -21.879 62.500  1.00 37.93  ? 38   ALA B C     1 
ATOM   958   O  O     . ALA B  2 38  ? -5.760  -21.110 62.597  1.00 38.03  ? 38   ALA B O     1 
ATOM   959   C  CB    . ALA B  2 38  ? -5.316  -24.260 63.062  1.00 37.08  ? 38   ALA B CB    1 
ATOM   960   N  N     . ARG B  2 39  ? -3.569  -21.572 62.877  1.00 37.35  ? 39   ARG B N     1 
ATOM   961   C  CA    . ARG B  2 39  ? -3.204  -20.282 63.442  1.00 37.16  ? 39   ARG B CA    1 
ATOM   962   C  C     . ARG B  2 39  ? -3.404  -19.172 62.403  1.00 36.28  ? 39   ARG B C     1 
ATOM   963   O  O     . ARG B  2 39  ? -4.164  -18.233 62.632  1.00 35.26  ? 39   ARG B O     1 
ATOM   964   C  CB    . ARG B  2 39  ? -1.746  -20.308 63.930  1.00 37.56  ? 39   ARG B CB    1 
ATOM   965   C  CG    . ARG B  2 39  ? -1.507  -21.182 65.132  1.00 38.04  ? 39   ARG B CG    1 
ATOM   966   C  CD    . ARG B  2 39  ? -2.400  -20.841 66.304  1.00 41.23  ? 39   ARG B CD    1 
ATOM   967   N  NE    . ARG B  2 39  ? -2.040  -21.673 67.450  1.00 45.02  ? 39   ARG B NE    1 
ATOM   968   C  CZ    . ARG B  2 39  ? -2.883  -22.508 68.066  1.00 47.97  ? 39   ARG B CZ    1 
ATOM   969   N  NH1   . ARG B  2 39  ? -4.153  -22.590 67.686  1.00 47.13  ? 39   ARG B NH1   1 
ATOM   970   N  NH2   . ARG B  2 39  ? -2.464  -23.248 69.089  1.00 49.90  ? 39   ARG B NH2   1 
ATOM   971   N  N     . ARG B  2 40  ? -2.769  -19.307 61.246  1.00 35.63  ? 40   ARG B N     1 
ATOM   972   C  CA    . ARG B  2 40  ? -3.096  -18.423 60.145  1.00 35.60  ? 40   ARG B CA    1 
ATOM   973   C  C     . ARG B  2 40  ? -4.617  -18.306 59.976  1.00 36.63  ? 40   ARG B C     1 
ATOM   974   O  O     . ARG B  2 40  ? -5.122  -17.272 59.592  1.00 37.91  ? 40   ARG B O     1 
ATOM   975   C  CB    . ARG B  2 40  ? -2.423  -18.866 58.854  1.00 35.61  ? 40   ARG B CB    1 
ATOM   976   C  CG    . ARG B  2 40  ? -2.565  -17.871 57.688  1.00 34.56  ? 40   ARG B CG    1 
ATOM   977   C  CD    . ARG B  2 40  ? -1.485  -18.096 56.593  1.00 32.90  ? 40   ARG B CD    1 
ATOM   978   N  NE    . ARG B  2 40  ? -0.162  -17.882 57.140  1.00 29.20  ? 40   ARG B NE    1 
ATOM   979   C  CZ    . ARG B  2 40  ? 0.969   -18.165 56.508  1.00 32.65  ? 40   ARG B CZ    1 
ATOM   980   N  NH1   . ARG B  2 40  ? 0.929   -18.711 55.302  1.00 33.21  ? 40   ARG B NH1   1 
ATOM   981   N  NH2   . ARG B  2 40  ? 2.153   -17.916 57.085  1.00 33.62  ? 40   ARG B NH2   1 
ATOM   982   N  N     . GLY B  2 41  ? -5.365  -19.344 60.305  1.00 37.00  ? 41   GLY B N     1 
ATOM   983   C  CA    . GLY B  2 41  ? -6.808  -19.271 60.156  1.00 37.07  ? 41   GLY B CA    1 
ATOM   984   C  C     . GLY B  2 41  ? -7.510  -18.712 61.367  1.00 37.06  ? 41   GLY B C     1 
ATOM   985   O  O     . GLY B  2 41  ? -8.734  -18.728 61.432  1.00 37.39  ? 41   GLY B O     1 
ATOM   986   N  N     . GLY B  2 42  ? -6.750  -18.223 62.335  1.00 37.11  ? 42   GLY B N     1 
ATOM   987   C  CA    . GLY B  2 42  ? -7.346  -17.657 63.545  1.00 37.73  ? 42   GLY B CA    1 
ATOM   988   C  C     . GLY B  2 42  ? -7.794  -18.630 64.625  1.00 38.15  ? 42   GLY B C     1 
ATOM   989   O  O     . GLY B  2 42  ? -8.452  -18.237 65.577  1.00 38.51  ? 42   GLY B O     1 
ATOM   990   N  N     . VAL B  2 43  ? -7.421  -19.895 64.495  1.00 38.48  ? 43   VAL B N     1 
ATOM   991   C  CA    . VAL B  2 43  ? -7.869  -20.915 65.410  1.00 38.88  ? 43   VAL B CA    1 
ATOM   992   C  C     . VAL B  2 43  ? -7.046  -20.856 66.697  1.00 39.72  ? 43   VAL B C     1 
ATOM   993   O  O     . VAL B  2 43  ? -5.814  -20.897 66.670  1.00 39.77  ? 43   VAL B O     1 
ATOM   994   C  CB    . VAL B  2 43  ? -7.850  -22.347 64.743  1.00 38.67  ? 43   VAL B CB    1 
ATOM   995   C  CG1   . VAL B  2 43  ? -8.298  -23.418 65.718  1.00 37.20  ? 43   VAL B CG1   1 
ATOM   996   C  CG2   . VAL B  2 43  ? -8.750  -22.385 63.504  1.00 38.34  ? 43   VAL B CG2   1 
ATOM   997   N  N     . LYS B  2 44  ? -7.733  -20.766 67.830  1.00 40.83  ? 44   LYS B N     1 
ATOM   998   C  CA    . LYS B  2 44  ? -7.036  -20.689 69.115  1.00 42.24  ? 44   LYS B CA    1 
ATOM   999   C  C     . LYS B  2 44  ? -6.820  -22.049 69.808  1.00 42.73  ? 44   LYS B C     1 
ATOM   1000  O  O     . LYS B  2 44  ? -5.704  -22.339 70.267  1.00 43.45  ? 44   LYS B O     1 
ATOM   1001  C  CB    . LYS B  2 44  ? -7.772  -19.738 70.031  1.00 42.41  ? 44   LYS B CB    1 
ATOM   1002  C  CG    . LYS B  2 44  ? -7.006  -19.377 71.268  1.00 44.41  ? 44   LYS B CG    1 
ATOM   1003  C  CD    . LYS B  2 44  ? -7.970  -18.787 72.295  1.00 46.23  ? 44   LYS B CD    1 
ATOM   1004  C  CE    . LYS B  2 44  ? -7.225  -18.272 73.476  1.00 47.13  ? 44   LYS B CE    1 
ATOM   1005  N  NZ    . LYS B  2 44  ? -8.124  -17.372 74.256  1.00 52.70  ? 44   LYS B NZ    1 
ATOM   1006  N  N     . ARG B  2 45  ? -7.874  -22.870 69.867  1.00 42.38  ? 45   ARG B N     1 
ATOM   1007  C  CA    . ARG B  2 45  ? -7.823  -24.182 70.486  1.00 42.48  ? 45   ARG B CA    1 
ATOM   1008  C  C     . ARG B  2 45  ? -8.221  -25.277 69.497  1.00 42.35  ? 45   ARG B C     1 
ATOM   1009  O  O     . ARG B  2 45  ? -9.276  -25.209 68.867  1.00 42.36  ? 45   ARG B O     1 
ATOM   1010  C  CB    . ARG B  2 45  ? -8.739  -24.219 71.704  1.00 42.96  ? 45   ARG B CB    1 
ATOM   1011  C  CG    . ARG B  2 45  ? -8.191  -24.997 72.876  1.00 44.39  ? 45   ARG B CG    1 
ATOM   1012  C  CD    . ARG B  2 45  ? -9.012  -24.718 74.126  1.00 49.19  ? 45   ARG B CD    1 
ATOM   1013  N  NE    . ARG B  2 45  ? -8.743  -25.664 75.216  1.00 53.73  ? 45   ARG B NE    1 
ATOM   1014  C  CZ    . ARG B  2 45  ? -9.281  -26.887 75.318  1.00 55.31  ? 45   ARG B CZ    1 
ATOM   1015  N  NH1   . ARG B  2 45  ? -10.126 -27.350 74.389  1.00 54.28  ? 45   ARG B NH1   1 
ATOM   1016  N  NH2   . ARG B  2 45  ? -8.968  -27.659 76.356  1.00 55.95  ? 45   ARG B NH2   1 
ATOM   1017  N  N     . ILE B  2 46  ? -7.375  -26.294 69.385  1.00 42.30  ? 46   ILE B N     1 
ATOM   1018  C  CA    . ILE B  2 46  ? -7.559  -27.394 68.437  1.00 42.63  ? 46   ILE B CA    1 
ATOM   1019  C  C     . ILE B  2 46  ? -7.730  -28.737 69.144  1.00 43.21  ? 46   ILE B C     1 
ATOM   1020  O  O     . ILE B  2 46  ? -6.818  -29.208 69.807  1.00 43.97  ? 46   ILE B O     1 
ATOM   1021  C  CB    . ILE B  2 46  ? -6.326  -27.509 67.548  1.00 42.38  ? 46   ILE B CB    1 
ATOM   1022  C  CG1   . ILE B  2 46  ? -6.078  -26.186 66.831  1.00 42.21  ? 46   ILE B CG1   1 
ATOM   1023  C  CG2   . ILE B  2 46  ? -6.449  -28.680 66.597  1.00 41.09  ? 46   ILE B CG2   1 
ATOM   1024  C  CD1   . ILE B  2 46  ? -4.736  -26.100 66.178  1.00 43.88  ? 46   ILE B CD1   1 
ATOM   1025  N  N     . SER B  2 47  ? -8.882  -29.370 68.994  1.00 43.85  ? 47   SER B N     1 
ATOM   1026  C  CA    . SER B  2 47  ? -9.070  -30.726 69.537  1.00 44.06  ? 47   SER B CA    1 
ATOM   1027  C  C     . SER B  2 47  ? -8.197  -31.803 68.865  1.00 43.75  ? 47   SER B C     1 
ATOM   1028  O  O     . SER B  2 47  ? -7.979  -31.768 67.653  1.00 43.59  ? 47   SER B O     1 
ATOM   1029  C  CB    . SER B  2 47  ? -10.522 -31.129 69.410  1.00 43.88  ? 47   SER B CB    1 
ATOM   1030  O  OG    . SER B  2 47  ? -10.572 -32.316 68.675  1.00 45.81  ? 47   SER B OG    1 
ATOM   1031  N  N     . GLY B  2 48  ? -7.740  -32.775 69.660  1.00 44.04  ? 48   GLY B N     1 
ATOM   1032  C  CA    . GLY B  2 48  ? -6.821  -33.849 69.204  1.00 44.18  ? 48   GLY B CA    1 
ATOM   1033  C  C     . GLY B  2 48  ? -7.251  -34.668 67.984  1.00 44.00  ? 48   GLY B C     1 
ATOM   1034  O  O     . GLY B  2 48  ? -6.421  -35.190 67.227  1.00 44.10  ? 48   GLY B O     1 
ATOM   1035  N  N     . LEU B  2 49  ? -8.547  -34.764 67.770  1.00 43.53  ? 49   LEU B N     1 
ATOM   1036  C  CA    . LEU B  2 49  ? -9.037  -35.477 66.627  1.00 44.30  ? 49   LEU B CA    1 
ATOM   1037  C  C     . LEU B  2 49  ? -8.917  -34.728 65.286  1.00 44.21  ? 49   LEU B C     1 
ATOM   1038  O  O     . LEU B  2 49  ? -9.036  -35.342 64.233  1.00 44.41  ? 49   LEU B O     1 
ATOM   1039  C  CB    . LEU B  2 49  ? -10.485 -35.851 66.898  1.00 45.31  ? 49   LEU B CB    1 
ATOM   1040  C  CG    . LEU B  2 49  ? -10.683 -36.825 68.072  1.00 46.32  ? 49   LEU B CG    1 
ATOM   1041  C  CD1   . LEU B  2 49  ? -12.021 -36.545 68.769  1.00 47.52  ? 49   LEU B CD1   1 
ATOM   1042  C  CD2   . LEU B  2 49  ? -10.581 -38.258 67.580  1.00 44.44  ? 49   LEU B CD2   1 
ATOM   1043  N  N     . ILE B  2 50  ? -8.699  -33.409 65.333  1.00 43.92  ? 50   ILE B N     1 
ATOM   1044  C  CA    . ILE B  2 50  ? -8.604  -32.545 64.148  1.00 43.00  ? 50   ILE B CA    1 
ATOM   1045  C  C     . ILE B  2 50  ? -7.526  -33.014 63.183  1.00 43.12  ? 50   ILE B C     1 
ATOM   1046  O  O     . ILE B  2 50  ? -7.736  -33.006 61.982  1.00 43.29  ? 50   ILE B O     1 
ATOM   1047  C  CB    . ILE B  2 50  ? -8.376  -31.012 64.548  1.00 43.05  ? 50   ILE B CB    1 
ATOM   1048  C  CG1   . ILE B  2 50  ? -9.676  -30.345 65.003  1.00 42.77  ? 50   ILE B CG1   1 
ATOM   1049  C  CG2   . ILE B  2 50  ? -7.762  -30.176 63.432  1.00 40.92  ? 50   ILE B CG2   1 
ATOM   1050  C  CD1   . ILE B  2 50  ? -10.673 -30.053 63.886  1.00 43.11  ? 50   ILE B CD1   1 
ATOM   1051  N  N     . TYR B  2 51  ? -6.368  -33.416 63.685  1.00 43.25  ? 51   TYR B N     1 
ATOM   1052  C  CA    . TYR B  2 51  ? -5.274  -33.710 62.773  1.00 44.31  ? 51   TYR B CA    1 
ATOM   1053  C  C     . TYR B  2 51  ? -5.559  -34.813 61.755  1.00 45.48  ? 51   TYR B C     1 
ATOM   1054  O  O     . TYR B  2 51  ? -5.109  -34.705 60.599  1.00 46.39  ? 51   TYR B O     1 
ATOM   1055  C  CB    . TYR B  2 51  ? -3.962  -33.907 63.516  1.00 44.30  ? 51   TYR B CB    1 
ATOM   1056  C  CG    . TYR B  2 51  ? -3.755  -32.816 64.525  1.00 45.73  ? 51   TYR B CG    1 
ATOM   1057  C  CD1   . TYR B  2 51  ? -3.506  -31.492 64.115  1.00 46.35  ? 51   TYR B CD1   1 
ATOM   1058  C  CD2   . TYR B  2 51  ? -3.857  -33.073 65.884  1.00 45.97  ? 51   TYR B CD2   1 
ATOM   1059  C  CE1   . TYR B  2 51  ? -3.356  -30.466 65.031  1.00 45.91  ? 51   TYR B CE1   1 
ATOM   1060  C  CE2   . TYR B  2 51  ? -3.707  -32.059 66.815  1.00 46.67  ? 51   TYR B CE2   1 
ATOM   1061  C  CZ    . TYR B  2 51  ? -3.453  -30.758 66.386  1.00 47.06  ? 51   TYR B CZ    1 
ATOM   1062  O  OH    . TYR B  2 51  ? -3.292  -29.752 67.323  1.00 48.06  ? 51   TYR B OH    1 
ATOM   1063  N  N     . GLU B  2 52  ? -6.298  -35.859 62.139  1.00 46.09  ? 52   GLU B N     1 
ATOM   1064  C  CA    . GLU B  2 52  ? -6.623  -36.884 61.156  1.00 47.46  ? 52   GLU B CA    1 
ATOM   1065  C  C     . GLU B  2 52  ? -7.767  -36.446 60.227  1.00 47.19  ? 52   GLU B C     1 
ATOM   1066  O  O     . GLU B  2 52  ? -7.736  -36.763 59.040  1.00 47.30  ? 52   GLU B O     1 
ATOM   1067  C  CB    . GLU B  2 52  ? -6.828  -38.285 61.771  1.00 48.17  ? 52   GLU B CB    1 
ATOM   1068  C  CG    . GLU B  2 52  ? -5.506  -39.036 62.096  1.00 51.30  ? 52   GLU B CG    1 
ATOM   1069  C  CD    . GLU B  2 52  ? -4.806  -39.666 60.866  1.00 55.84  ? 52   GLU B CD    1 
ATOM   1070  O  OE1   . GLU B  2 52  ? -5.523  -40.211 59.987  1.00 58.40  ? 52   GLU B OE1   1 
ATOM   1071  O  OE2   . GLU B  2 52  ? -3.537  -39.633 60.786  1.00 57.05  ? 52   GLU B OE2   1 
ATOM   1072  N  N     . GLU B  2 53  ? -8.744  -35.695 60.734  1.00 46.90  ? 53   GLU B N     1 
ATOM   1073  C  CA    . GLU B  2 53  ? -9.750  -35.090 59.841  1.00 47.26  ? 53   GLU B CA    1 
ATOM   1074  C  C     . GLU B  2 53  ? -9.072  -34.202 58.771  1.00 46.84  ? 53   GLU B C     1 
ATOM   1075  O  O     . GLU B  2 53  ? -9.419  -34.268 57.590  1.00 47.40  ? 53   GLU B O     1 
ATOM   1076  C  CB    . GLU B  2 53  ? -10.799 -34.298 60.619  1.00 46.84  ? 53   GLU B CB    1 
ATOM   1077  C  CG    . GLU B  2 53  ? -11.992 -33.901 59.778  1.00 50.68  ? 53   GLU B CG    1 
ATOM   1078  C  CD    . GLU B  2 53  ? -13.088 -34.992 59.680  1.00 56.80  ? 53   GLU B CD    1 
ATOM   1079  O  OE1   . GLU B  2 53  ? -13.113 -35.911 60.527  1.00 59.68  ? 53   GLU B OE1   1 
ATOM   1080  O  OE2   . GLU B  2 53  ? -13.958 -34.928 58.770  1.00 58.37  ? 53   GLU B OE2   1 
ATOM   1081  N  N     . THR B  2 54  ? -8.084  -33.404 59.180  1.00 45.95  ? 54   THR B N     1 
ATOM   1082  C  CA    . THR B  2 54  ? -7.383  -32.515 58.261  1.00 45.11  ? 54   THR B CA    1 
ATOM   1083  C  C     . THR B  2 54  ? -6.605  -33.275 57.200  1.00 44.48  ? 54   THR B C     1 
ATOM   1084  O  O     . THR B  2 54  ? -6.646  -32.898 56.027  1.00 45.02  ? 54   THR B O     1 
ATOM   1085  C  CB    . THR B  2 54  ? -6.496  -31.485 58.997  1.00 45.33  ? 54   THR B CB    1 
ATOM   1086  O  OG1   . THR B  2 54  ? -7.316  -30.711 59.869  1.00 44.24  ? 54   THR B OG1   1 
ATOM   1087  C  CG2   . THR B  2 54  ? -5.838  -30.523 58.016  1.00 45.09  ? 54   THR B CG2   1 
ATOM   1088  N  N     . ARG B  2 55  ? -5.930  -34.355 57.577  1.00 43.68  ? 55   ARG B N     1 
ATOM   1089  C  CA    . ARG B  2 55  ? -5.283  -35.210 56.555  1.00 42.68  ? 55   ARG B CA    1 
ATOM   1090  C  C     . ARG B  2 55  ? -6.262  -35.774 55.517  1.00 41.89  ? 55   ARG B C     1 
ATOM   1091  O  O     . ARG B  2 55  ? -5.970  -35.778 54.328  1.00 41.71  ? 55   ARG B O     1 
ATOM   1092  C  CB    . ARG B  2 55  ? -4.456  -36.303 57.192  1.00 42.30  ? 55   ARG B CB    1 
ATOM   1093  C  CG    . ARG B  2 55  ? -3.313  -35.730 58.003  1.00 42.99  ? 55   ARG B CG    1 
ATOM   1094  C  CD    . ARG B  2 55  ? -2.441  -36.772 58.597  1.00 41.20  ? 55   ARG B CD    1 
ATOM   1095  N  NE    . ARG B  2 55  ? -1.474  -36.157 59.489  1.00 42.31  ? 55   ARG B NE    1 
ATOM   1096  C  CZ    . ARG B  2 55  ? -1.565  -36.145 60.818  1.00 43.00  ? 55   ARG B CZ    1 
ATOM   1097  N  NH1   . ARG B  2 55  ? -2.589  -36.716 61.429  1.00 43.51  ? 55   ARG B NH1   1 
ATOM   1098  N  NH2   . ARG B  2 55  ? -0.624  -35.558 61.543  1.00 42.83  ? 55   ARG B NH2   1 
ATOM   1099  N  N     . GLY B  2 56  ? -7.437  -36.202 55.963  1.00 41.20  ? 56   GLY B N     1 
ATOM   1100  C  CA    . GLY B  2 56  ? -8.438  -36.745 55.062  1.00 40.69  ? 56   GLY B CA    1 
ATOM   1101  C  C     . GLY B  2 56  ? -8.766  -35.730 54.002  1.00 40.62  ? 56   GLY B C     1 
ATOM   1102  O  O     . GLY B  2 56  ? -8.567  -35.976 52.802  1.00 40.69  ? 56   GLY B O     1 
ATOM   1103  N  N     . VAL B  2 57  ? -9.245  -34.575 54.478  1.00 40.38  ? 57   VAL B N     1 
ATOM   1104  C  CA    . VAL B  2 57  ? -9.570  -33.389 53.682  1.00 39.09  ? 57   VAL B CA    1 
ATOM   1105  C  C     . VAL B  2 57  ? -8.471  -33.003 52.694  1.00 37.93  ? 57   VAL B C     1 
ATOM   1106  O  O     . VAL B  2 57  ? -8.736  -32.869 51.495  1.00 37.33  ? 57   VAL B O     1 
ATOM   1107  C  CB    . VAL B  2 57  ? -9.879  -32.245 54.615  1.00 39.65  ? 57   VAL B CB    1 
ATOM   1108  C  CG1   . VAL B  2 57  ? -9.852  -30.897 53.890  1.00 40.11  ? 57   VAL B CG1   1 
ATOM   1109  C  CG2   . VAL B  2 57  ? -11.221 -32.491 55.290  1.00 40.44  ? 57   VAL B CG2   1 
ATOM   1110  N  N     . LEU B  2 58  ? -7.240  -32.864 53.176  1.00 36.87  ? 58   LEU B N     1 
ATOM   1111  C  CA    . LEU B  2 58  ? -6.148  -32.487 52.287  1.00 36.63  ? 58   LEU B CA    1 
ATOM   1112  C  C     . LEU B  2 58  ? -5.972  -33.520 51.167  1.00 37.16  ? 58   LEU B C     1 
ATOM   1113  O  O     . LEU B  2 58  ? -5.922  -33.165 50.001  1.00 37.67  ? 58   LEU B O     1 
ATOM   1114  C  CB    . LEU B  2 58  ? -4.859  -32.234 53.066  1.00 35.96  ? 58   LEU B CB    1 
ATOM   1115  C  CG    . LEU B  2 58  ? -3.546  -32.026 52.301  1.00 36.32  ? 58   LEU B CG    1 
ATOM   1116  C  CD1   . LEU B  2 58  ? -3.592  -30.850 51.342  1.00 38.36  ? 58   LEU B CD1   1 
ATOM   1117  C  CD2   . LEU B  2 58  ? -2.389  -31.837 53.265  1.00 36.71  ? 58   LEU B CD2   1 
ATOM   1118  N  N     . LYS B  2 59  ? -5.919  -34.801 51.533  1.00 37.88  ? 59   LYS B N     1 
ATOM   1119  C  CA    . LYS B  2 59  ? -5.857  -35.927 50.610  1.00 37.49  ? 59   LYS B CA    1 
ATOM   1120  C  C     . LYS B  2 59  ? -6.946  -35.884 49.515  1.00 36.78  ? 59   LYS B C     1 
ATOM   1121  O  O     . LYS B  2 59  ? -6.642  -35.962 48.308  1.00 36.06  ? 59   LYS B O     1 
ATOM   1122  C  CB    . LYS B  2 59  ? -5.968  -37.189 51.443  1.00 38.58  ? 59   LYS B CB    1 
ATOM   1123  C  CG    . LYS B  2 59  ? -5.644  -38.458 50.702  1.00 43.94  ? 59   LYS B CG    1 
ATOM   1124  C  CD    . LYS B  2 59  ? -4.543  -39.253 51.390  1.00 49.93  ? 59   LYS B CD    1 
ATOM   1125  C  CE    . LYS B  2 59  ? -4.043  -40.333 50.413  1.00 55.65  ? 59   LYS B CE    1 
ATOM   1126  N  NZ    . LYS B  2 59  ? -5.099  -41.413 50.175  1.00 58.17  ? 59   LYS B NZ    1 
ATOM   1127  N  N     . VAL B  2 60  ? -8.209  -35.756 49.918  1.00 35.86  ? 60   VAL B N     1 
ATOM   1128  C  CA    . VAL B  2 60  ? -9.293  -35.605 48.941  1.00 35.71  ? 60   VAL B CA    1 
ATOM   1129  C  C     . VAL B  2 60  ? -9.097  -34.348 48.068  1.00 36.44  ? 60   VAL B C     1 
ATOM   1130  O  O     . VAL B  2 60  ? -9.481  -34.345 46.879  1.00 36.70  ? 60   VAL B O     1 
ATOM   1131  C  CB    . VAL B  2 60  ? -10.654 -35.448 49.616  1.00 35.56  ? 60   VAL B CB    1 
ATOM   1132  C  CG1   . VAL B  2 60  ? -11.685 -35.008 48.596  1.00 34.56  ? 60   VAL B CG1   1 
ATOM   1133  C  CG2   . VAL B  2 60  ? -11.080 -36.730 50.280  1.00 36.36  ? 60   VAL B CG2   1 
ATOM   1134  N  N     . PHE B  2 61  ? -8.530  -33.278 48.658  1.00 35.74  ? 61   PHE B N     1 
ATOM   1135  C  CA    . PHE B  2 61  ? -8.323  -32.053 47.917  1.00 35.19  ? 61   PHE B CA    1 
ATOM   1136  C  C     . PHE B  2 61  ? -7.282  -32.324 46.839  1.00 35.51  ? 61   PHE B C     1 
ATOM   1137  O  O     . PHE B  2 61  ? -7.524  -32.077 45.660  1.00 35.54  ? 61   PHE B O     1 
ATOM   1138  C  CB    . PHE B  2 61  ? -7.926  -30.862 48.831  1.00 34.94  ? 61   PHE B CB    1 
ATOM   1139  C  CG    . PHE B  2 61  ? -7.479  -29.639 48.070  1.00 32.55  ? 61   PHE B CG    1 
ATOM   1140  C  CD1   . PHE B  2 61  ? -8.404  -28.697 47.631  1.00 33.98  ? 61   PHE B CD1   1 
ATOM   1141  C  CD2   . PHE B  2 61  ? -6.147  -29.441 47.778  1.00 32.18  ? 61   PHE B CD2   1 
ATOM   1142  C  CE1   . PHE B  2 61  ? -8.012  -27.569 46.921  1.00 32.84  ? 61   PHE B CE1   1 
ATOM   1143  C  CE2   . PHE B  2 61  ? -5.728  -28.316 47.037  1.00 33.32  ? 61   PHE B CE2   1 
ATOM   1144  C  CZ    . PHE B  2 61  ? -6.666  -27.384 46.605  1.00 33.47  ? 61   PHE B CZ    1 
ATOM   1145  N  N     . LEU B  2 62  ? -6.130  -32.830 47.254  1.00 35.97  ? 62   LEU B N     1 
ATOM   1146  C  CA    . LEU B  2 62  ? -5.041  -33.130 46.338  1.00 36.85  ? 62   LEU B CA    1 
ATOM   1147  C  C     . LEU B  2 62  ? -5.380  -34.219 45.309  1.00 38.03  ? 62   LEU B C     1 
ATOM   1148  O  O     . LEU B  2 62  ? -4.922  -34.132 44.167  1.00 38.60  ? 62   LEU B O     1 
ATOM   1149  C  CB    . LEU B  2 62  ? -3.794  -33.540 47.108  1.00 36.34  ? 62   LEU B CB    1 
ATOM   1150  C  CG    . LEU B  2 62  ? -2.985  -32.439 47.768  1.00 35.93  ? 62   LEU B CG    1 
ATOM   1151  C  CD1   . LEU B  2 62  ? -1.959  -33.046 48.701  1.00 35.90  ? 62   LEU B CD1   1 
ATOM   1152  C  CD2   . LEU B  2 62  ? -2.289  -31.594 46.738  1.00 34.51  ? 62   LEU B CD2   1 
ATOM   1153  N  N     . GLU B  2 63  ? -6.157  -35.242 45.684  1.00 38.79  ? 63   GLU B N     1 
ATOM   1154  C  CA    . GLU B  2 63  ? -6.512  -36.268 44.703  1.00 39.92  ? 63   GLU B CA    1 
ATOM   1155  C  C     . GLU B  2 63  ? -7.293  -35.604 43.586  1.00 40.15  ? 63   GLU B C     1 
ATOM   1156  O  O     . GLU B  2 63  ? -6.999  -35.821 42.415  1.00 40.95  ? 63   GLU B O     1 
ATOM   1157  C  CB    . GLU B  2 63  ? -7.341  -37.405 45.303  1.00 40.48  ? 63   GLU B CB    1 
ATOM   1158  C  CG    . GLU B  2 63  ? -6.576  -38.443 46.066  1.00 42.59  ? 63   GLU B CG    1 
ATOM   1159  C  CD    . GLU B  2 63  ? -7.448  -39.100 47.140  1.00 48.76  ? 63   GLU B CD    1 
ATOM   1160  O  OE1   . GLU B  2 63  ? -8.691  -39.156 46.938  1.00 49.54  ? 63   GLU B OE1   1 
ATOM   1161  O  OE2   . GLU B  2 63  ? -6.898  -39.549 48.195  1.00 51.43  ? 63   GLU B OE2   1 
ATOM   1162  N  N     . ASN B  2 64  ? -8.273  -34.775 43.936  1.00 40.07  ? 64   ASN B N     1 
ATOM   1163  C  CA    . ASN B  2 64  ? -9.021  -34.057 42.918  1.00 40.51  ? 64   ASN B CA    1 
ATOM   1164  C  C     . ASN B  2 64  ? -8.198  -33.137 42.011  1.00 40.32  ? 64   ASN B C     1 
ATOM   1165  O  O     . ASN B  2 64  ? -8.398  -33.170 40.800  1.00 41.58  ? 64   ASN B O     1 
ATOM   1166  C  CB    . ASN B  2 64  ? -10.218 -33.335 43.514  1.00 40.57  ? 64   ASN B CB    1 
ATOM   1167  C  CG    . ASN B  2 64  ? -11.219 -34.286 44.066  1.00 42.78  ? 64   ASN B CG    1 
ATOM   1168  O  OD1   . ASN B  2 64  ? -11.471 -35.333 43.464  1.00 49.73  ? 64   ASN B OD1   1 
ATOM   1169  N  ND2   . ASN B  2 64  ? -11.802 -33.960 45.212  1.00 43.84  ? 64   ASN B ND2   1 
ATOM   1170  N  N     . VAL B  2 65  ? -7.285  -32.331 42.552  1.00 39.49  ? 65   VAL B N     1 
ATOM   1171  C  CA    . VAL B  2 65  ? -6.560  -31.390 41.693  1.00 39.19  ? 65   VAL B CA    1 
ATOM   1172  C  C     . VAL B  2 65  ? -5.613  -32.172 40.828  1.00 39.30  ? 65   VAL B C     1 
ATOM   1173  O  O     . VAL B  2 65  ? -5.656  -32.034 39.598  1.00 39.00  ? 65   VAL B O     1 
ATOM   1174  C  CB    . VAL B  2 65  ? -5.779  -30.263 42.449  1.00 39.23  ? 65   VAL B CB    1 
ATOM   1175  C  CG1   . VAL B  2 65  ? -5.034  -29.374 41.469  1.00 36.50  ? 65   VAL B CG1   1 
ATOM   1176  C  CG2   . VAL B  2 65  ? -6.729  -29.428 43.248  1.00 39.16  ? 65   VAL B CG2   1 
ATOM   1177  N  N     . ILE B  2 66  ? -4.792  -33.014 41.468  1.00 39.49  ? 66   ILE B N     1 
ATOM   1178  C  CA    . ILE B  2 66  ? -3.824  -33.846 40.744  1.00 39.79  ? 66   ILE B CA    1 
ATOM   1179  C  C     . ILE B  2 66  ? -4.468  -34.706 39.638  1.00 40.04  ? 66   ILE B C     1 
ATOM   1180  O  O     . ILE B  2 66  ? -3.954  -34.754 38.507  1.00 39.88  ? 66   ILE B O     1 
ATOM   1181  C  CB    . ILE B  2 66  ? -2.945  -34.675 41.671  1.00 39.60  ? 66   ILE B CB    1 
ATOM   1182  C  CG1   . ILE B  2 66  ? -2.258  -33.750 42.675  1.00 39.68  ? 66   ILE B CG1   1 
ATOM   1183  C  CG2   . ILE B  2 66  ? -1.904  -35.440 40.864  1.00 38.71  ? 66   ILE B CG2   1 
ATOM   1184  C  CD1   . ILE B  2 66  ? -1.489  -34.464 43.755  1.00 39.50  ? 66   ILE B CD1   1 
ATOM   1185  N  N     . ARG B  2 67  ? -5.606  -35.325 39.929  1.00 39.98  ? 67   ARG B N     1 
ATOM   1186  C  CA    . ARG B  2 67  ? -6.317  -36.047 38.874  1.00 41.01  ? 67   ARG B CA    1 
ATOM   1187  C  C     . ARG B  2 67  ? -6.453  -35.242 37.593  1.00 41.18  ? 67   ARG B C     1 
ATOM   1188  O  O     . ARG B  2 67  ? -6.059  -35.711 36.533  1.00 41.25  ? 67   ARG B O     1 
ATOM   1189  C  CB    . ARG B  2 67  ? -7.677  -36.521 39.331  1.00 41.33  ? 67   ARG B CB    1 
ATOM   1190  C  CG    . ARG B  2 67  ? -8.351  -37.400 38.306  1.00 43.47  ? 67   ARG B CG    1 
ATOM   1191  C  CD    . ARG B  2 67  ? -9.829  -37.603 38.615  1.00 46.40  ? 67   ARG B CD    1 
ATOM   1192  N  NE    . ARG B  2 67  ? -9.912  -38.476 39.775  1.00 52.54  ? 67   ARG B NE    1 
ATOM   1193  C  CZ    . ARG B  2 67  ? -10.397 -38.123 40.962  1.00 55.76  ? 67   ARG B CZ    1 
ATOM   1194  N  NH1   . ARG B  2 67  ? -10.897 -36.898 41.161  1.00 55.12  ? 67   ARG B NH1   1 
ATOM   1195  N  NH2   . ARG B  2 67  ? -10.407 -39.023 41.950  1.00 57.31  ? 67   ARG B NH2   1 
ATOM   1196  N  N     . ASP B  2 68  ? -6.983  -34.019 37.710  1.00 42.01  ? 68   ASP B N     1 
ATOM   1197  C  CA    . ASP B  2 68  ? -7.105  -33.069 36.586  1.00 41.93  ? 68   ASP B CA    1 
ATOM   1198  C  C     . ASP B  2 68  ? -5.775  -32.571 36.033  1.00 40.90  ? 68   ASP B C     1 
ATOM   1199  O  O     . ASP B  2 68  ? -5.619  -32.437 34.814  1.00 40.46  ? 68   ASP B O     1 
ATOM   1200  C  CB    . ASP B  2 68  ? -8.019  -31.913 36.948  1.00 42.21  ? 68   ASP B CB    1 
ATOM   1201  C  CG    . ASP B  2 68  ? -9.445  -32.381 37.280  1.00 47.66  ? 68   ASP B CG    1 
ATOM   1202  O  OD1   . ASP B  2 68  ? -9.669  -33.623 37.443  1.00 49.82  ? 68   ASP B OD1   1 
ATOM   1203  O  OD2   . ASP B  2 68  ? -10.348 -31.501 37.394  1.00 52.93  ? 68   ASP B OD2   1 
ATOM   1204  N  N     . ALA B  2 69  ? -4.804  -32.319 36.899  1.00 40.04  ? 69   ALA B N     1 
ATOM   1205  C  CA    . ALA B  2 69  ? -3.510  -31.898 36.387  1.00 39.91  ? 69   ALA B CA    1 
ATOM   1206  C  C     . ALA B  2 69  ? -2.994  -32.980 35.424  1.00 40.01  ? 69   ALA B C     1 
ATOM   1207  O  O     . ALA B  2 69  ? -2.596  -32.685 34.284  1.00 39.29  ? 69   ALA B O     1 
ATOM   1208  C  CB    . ALA B  2 69  ? -2.515  -31.621 37.529  1.00 39.47  ? 69   ALA B CB    1 
ATOM   1209  N  N     . VAL B  2 70  ? -3.066  -34.236 35.886  1.00 40.33  ? 70   VAL B N     1 
ATOM   1210  C  CA    . VAL B  2 70  ? -2.539  -35.388 35.169  1.00 40.00  ? 70   VAL B CA    1 
ATOM   1211  C  C     . VAL B  2 70  ? -3.290  -35.662 33.869  1.00 40.34  ? 70   VAL B C     1 
ATOM   1212  O  O     . VAL B  2 70  ? -2.665  -35.996 32.869  1.00 40.32  ? 70   VAL B O     1 
ATOM   1213  C  CB    . VAL B  2 70  ? -2.479  -36.623 36.073  1.00 40.57  ? 70   VAL B CB    1 
ATOM   1214  C  CG1   . VAL B  2 70  ? -2.173  -37.879 35.260  1.00 39.82  ? 70   VAL B CG1   1 
ATOM   1215  C  CG2   . VAL B  2 70  ? -1.429  -36.406 37.203  1.00 39.69  ? 70   VAL B CG2   1 
ATOM   1216  N  N     . THR B  2 71  ? -4.612  -35.493 33.858  1.00 40.31  ? 71   THR B N     1 
ATOM   1217  C  CA    . THR B  2 71  ? -5.353  -35.519 32.601  1.00 40.41  ? 71   THR B CA    1 
ATOM   1218  C  C     . THR B  2 71  ? -4.830  -34.494 31.578  1.00 41.98  ? 71   THR B C     1 
ATOM   1219  O  O     . THR B  2 71  ? -4.602  -34.853 30.413  1.00 42.52  ? 71   THR B O     1 
ATOM   1220  C  CB    . THR B  2 71  ? -6.799  -35.249 32.840  1.00 40.06  ? 71   THR B CB    1 
ATOM   1221  O  OG1   . THR B  2 71  ? -7.305  -36.227 33.734  1.00 39.50  ? 71   THR B OG1   1 
ATOM   1222  C  CG2   . THR B  2 71  ? -7.575  -35.300 31.552  1.00 39.21  ? 71   THR B CG2   1 
ATOM   1223  N  N     . TYR B  2 72  ? -4.664  -33.225 31.996  1.00 43.08  ? 72   TYR B N     1 
ATOM   1224  C  CA    . TYR B  2 72  ? -4.015  -32.206 31.150  1.00 44.09  ? 72   TYR B CA    1 
ATOM   1225  C  C     . TYR B  2 72  ? -2.658  -32.688 30.632  1.00 45.35  ? 72   TYR B C     1 
ATOM   1226  O  O     . TYR B  2 72  ? -2.392  -32.593 29.434  1.00 45.36  ? 72   TYR B O     1 
ATOM   1227  C  CB    . TYR B  2 72  ? -3.890  -30.834 31.852  1.00 44.27  ? 72   TYR B CB    1 
ATOM   1228  C  CG    . TYR B  2 72  ? -5.217  -30.100 31.988  1.00 43.21  ? 72   TYR B CG    1 
ATOM   1229  C  CD1   . TYR B  2 72  ? -5.820  -29.922 33.234  1.00 42.39  ? 72   TYR B CD1   1 
ATOM   1230  C  CD2   . TYR B  2 72  ? -5.858  -29.594 30.868  1.00 41.58  ? 72   TYR B CD2   1 
ATOM   1231  C  CE1   . TYR B  2 72  ? -7.033  -29.280 33.351  1.00 42.40  ? 72   TYR B CE1   1 
ATOM   1232  C  CE2   . TYR B  2 72  ? -7.044  -28.944 30.969  1.00 42.80  ? 72   TYR B CE2   1 
ATOM   1233  C  CZ    . TYR B  2 72  ? -7.642  -28.795 32.207  1.00 44.09  ? 72   TYR B CZ    1 
ATOM   1234  O  OH    . TYR B  2 72  ? -8.865  -28.155 32.264  1.00 44.91  ? 72   TYR B OH    1 
ATOM   1235  N  N     . THR B  2 73  ? -1.824  -33.231 31.521  1.00 46.79  ? 73   THR B N     1 
ATOM   1236  C  CA    . THR B  2 73  ? -0.528  -33.809 31.121  1.00 48.51  ? 73   THR B CA    1 
ATOM   1237  C  C     . THR B  2 73  ? -0.634  -34.927 30.088  1.00 49.58  ? 73   THR B C     1 
ATOM   1238  O  O     . THR B  2 73  ? 0.087   -34.908 29.076  1.00 49.90  ? 73   THR B O     1 
ATOM   1239  C  CB    . THR B  2 73  ? 0.266   -34.348 32.311  1.00 48.22  ? 73   THR B CB    1 
ATOM   1240  O  OG1   . THR B  2 73  ? 0.152   -33.439 33.407  1.00 50.29  ? 73   THR B OG1   1 
ATOM   1241  C  CG2   . THR B  2 73  ? 1.712   -34.482 31.958  1.00 47.77  ? 73   THR B CG2   1 
ATOM   1242  N  N     . GLU B  2 74  ? -1.512  -35.898 30.341  1.00 50.77  ? 74   GLU B N     1 
ATOM   1243  C  CA    . GLU B  2 74  ? -1.689  -37.027 29.421  1.00 52.46  ? 74   GLU B CA    1 
ATOM   1244  C  C     . GLU B  2 74  ? -2.135  -36.498 28.062  1.00 52.34  ? 74   GLU B C     1 
ATOM   1245  O  O     . GLU B  2 74  ? -1.680  -36.985 27.020  1.00 52.54  ? 74   GLU B O     1 
ATOM   1246  C  CB    . GLU B  2 74  ? -2.699  -38.052 29.953  1.00 52.12  ? 74   GLU B CB    1 
ATOM   1247  C  CG    . GLU B  2 74  ? -2.263  -38.717 31.266  1.00 54.41  ? 74   GLU B CG    1 
ATOM   1248  C  CD    . GLU B  2 74  ? -3.359  -39.565 31.953  1.00 55.31  ? 74   GLU B CD    1 
ATOM   1249  O  OE1   . GLU B  2 74  ? -4.587  -39.240 31.927  1.00 55.80  ? 74   GLU B OE1   1 
ATOM   1250  O  OE2   . GLU B  2 74  ? -2.955  -40.587 32.548  1.00 61.79  ? 74   GLU B OE2   1 
ATOM   1251  N  N     . HIS B  2 75  ? -2.986  -35.470 28.071  1.00 52.19  ? 75   HIS B N     1 
ATOM   1252  C  CA    . HIS B  2 75  ? -3.463  -34.907 26.814  1.00 51.94  ? 75   HIS B CA    1 
ATOM   1253  C  C     . HIS B  2 75  ? -2.343  -34.302 25.978  1.00 52.00  ? 75   HIS B C     1 
ATOM   1254  O  O     . HIS B  2 75  ? -2.347  -34.406 24.760  1.00 52.43  ? 75   HIS B O     1 
ATOM   1255  C  CB    . HIS B  2 75  ? -4.584  -33.901 27.020  1.00 51.55  ? 75   HIS B CB    1 
ATOM   1256  C  CG    . HIS B  2 75  ? -5.181  -33.435 25.740  1.00 51.38  ? 75   HIS B CG    1 
ATOM   1257  N  ND1   . HIS B  2 75  ? -4.729  -32.315 25.074  1.00 52.06  ? 75   HIS B ND1   1 
ATOM   1258  C  CD2   . HIS B  2 75  ? -6.154  -33.967 24.966  1.00 51.72  ? 75   HIS B CD2   1 
ATOM   1259  C  CE1   . HIS B  2 75  ? -5.423  -32.157 23.960  1.00 52.81  ? 75   HIS B CE1   1 
ATOM   1260  N  NE2   . HIS B  2 75  ? -6.299  -33.144 23.872  1.00 53.53  ? 75   HIS B NE2   1 
ATOM   1261  N  N     . ALA B  2 76  ? -1.380  -33.675 26.635  1.00 52.26  ? 76   ALA B N     1 
ATOM   1262  C  CA    . ALA B  2 76  ? -0.277  -33.037 25.936  1.00 52.58  ? 76   ALA B CA    1 
ATOM   1263  C  C     . ALA B  2 76  ? 0.769   -34.066 25.474  1.00 52.96  ? 76   ALA B C     1 
ATOM   1264  O  O     . ALA B  2 76  ? 1.798   -33.703 24.902  1.00 52.53  ? 76   ALA B O     1 
ATOM   1265  C  CB    . ALA B  2 76  ? 0.358   -31.987 26.837  1.00 52.71  ? 76   ALA B CB    1 
ATOM   1266  N  N     . LYS B  2 77  ? 0.495   -35.350 25.728  1.00 53.34  ? 77   LYS B N     1 
ATOM   1267  C  CA    . LYS B  2 77  ? 1.456   -36.432 25.481  1.00 53.60  ? 77   LYS B CA    1 
ATOM   1268  C  C     . LYS B  2 77  ? 2.792   -36.154 26.172  1.00 53.28  ? 77   LYS B C     1 
ATOM   1269  O  O     . LYS B  2 77  ? 3.855   -36.312 25.580  1.00 53.80  ? 77   LYS B O     1 
ATOM   1270  C  CB    . LYS B  2 77  ? 1.636   -36.671 23.981  1.00 53.75  ? 77   LYS B CB    1 
ATOM   1271  C  CG    . LYS B  2 77  ? 0.360   -37.120 23.294  1.00 56.13  ? 77   LYS B CG    1 
ATOM   1272  C  CD    . LYS B  2 77  ? 0.618   -37.566 21.858  1.00 60.03  ? 77   LYS B CD    1 
ATOM   1273  C  CE    . LYS B  2 77  ? -0.689  -37.653 21.033  1.00 62.43  ? 77   LYS B CE    1 
ATOM   1274  N  NZ    . LYS B  2 77  ? -0.863  -36.478 20.078  1.00 64.61  ? 77   LYS B NZ    1 
ATOM   1275  N  N     . ARG B  2 78  ? 2.721   -35.723 27.428  1.00 52.86  ? 78   ARG B N     1 
ATOM   1276  C  CA    . ARG B  2 78  ? 3.895   -35.321 28.188  1.00 52.11  ? 78   ARG B CA    1 
ATOM   1277  C  C     . ARG B  2 78  ? 4.036   -36.288 29.348  1.00 52.19  ? 78   ARG B C     1 
ATOM   1278  O  O     . ARG B  2 78  ? 3.104   -37.004 29.672  1.00 51.91  ? 78   ARG B O     1 
ATOM   1279  C  CB    . ARG B  2 78  ? 3.740   -33.872 28.709  1.00 52.23  ? 78   ARG B CB    1 
ATOM   1280  C  CG    . ARG B  2 78  ? 4.107   -32.765 27.711  1.00 51.57  ? 78   ARG B CG    1 
ATOM   1281  C  CD    . ARG B  2 78  ? 4.271   -31.380 28.371  1.00 51.31  ? 78   ARG B CD    1 
ATOM   1282  N  NE    . ARG B  2 78  ? 2.967   -30.744 28.590  1.00 51.37  ? 78   ARG B NE    1 
ATOM   1283  C  CZ    . ARG B  2 78  ? 2.373   -30.615 29.780  1.00 51.60  ? 78   ARG B CZ    1 
ATOM   1284  N  NH1   . ARG B  2 78  ? 2.977   -31.056 30.880  1.00 52.30  ? 78   ARG B NH1   1 
ATOM   1285  N  NH2   . ARG B  2 78  ? 1.175   -30.045 29.879  1.00 48.32  ? 78   ARG B NH2   1 
ATOM   1286  N  N     . LYS B  2 79  ? 5.200   -36.311 29.981  1.00 52.66  ? 79   LYS B N     1 
ATOM   1287  C  CA    . LYS B  2 79  ? 5.402   -37.172 31.136  1.00 53.70  ? 79   LYS B CA    1 
ATOM   1288  C  C     . LYS B  2 79  ? 5.678   -36.302 32.368  1.00 53.34  ? 79   LYS B C     1 
ATOM   1289  O  O     . LYS B  2 79  ? 5.557   -36.766 33.515  1.00 53.38  ? 79   LYS B O     1 
ATOM   1290  C  CB    . LYS B  2 79  ? 6.528   -38.196 30.878  1.00 53.23  ? 79   LYS B CB    1 
ATOM   1291  C  CG    . LYS B  2 79  ? 6.304   -39.067 29.636  1.00 54.77  ? 79   LYS B CG    1 
ATOM   1292  C  CD    . LYS B  2 79  ? 7.469   -40.023 29.342  1.00 56.12  ? 79   LYS B CD    1 
ATOM   1293  C  CE    . LYS B  2 79  ? 7.092   -41.493 29.668  1.00 61.10  ? 79   LYS B CE    1 
ATOM   1294  N  NZ    . LYS B  2 79  ? 8.087   -42.232 30.566  1.00 62.32  ? 79   LYS B NZ    1 
ATOM   1295  N  N     . THR B  2 80  ? 6.031   -35.039 32.112  1.00 53.04  ? 80   THR B N     1 
ATOM   1296  C  CA    . THR B  2 80  ? 6.350   -34.061 33.162  1.00 52.94  ? 80   THR B CA    1 
ATOM   1297  C  C     . THR B  2 80  ? 5.116   -33.208 33.390  1.00 52.06  ? 80   THR B C     1 
ATOM   1298  O  O     . THR B  2 80  ? 4.658   -32.556 32.452  1.00 53.11  ? 80   THR B O     1 
ATOM   1299  C  CB    . THR B  2 80  ? 7.523   -33.098 32.746  1.00 53.30  ? 80   THR B CB    1 
ATOM   1300  O  OG1   . THR B  2 80  ? 8.677   -33.844 32.319  1.00 52.99  ? 80   THR B OG1   1 
ATOM   1301  C  CG2   . THR B  2 80  ? 7.914   -32.187 33.901  1.00 53.77  ? 80   THR B CG2   1 
ATOM   1302  N  N     . VAL B  2 81  ? 4.576   -33.230 34.608  1.00 50.35  ? 81   VAL B N     1 
ATOM   1303  C  CA    . VAL B  2 81  ? 3.455   -32.357 35.018  1.00 48.93  ? 81   VAL B CA    1 
ATOM   1304  C  C     . VAL B  2 81  ? 3.947   -30.907 35.214  1.00 47.99  ? 81   VAL B C     1 
ATOM   1305  O  O     . VAL B  2 81  ? 4.886   -30.659 35.978  1.00 47.77  ? 81   VAL B O     1 
ATOM   1306  C  CB    . VAL B  2 81  ? 2.809   -32.865 36.363  1.00 49.17  ? 81   VAL B CB    1 
ATOM   1307  C  CG1   . VAL B  2 81  ? 1.731   -31.892 36.882  1.00 48.26  ? 81   VAL B CG1   1 
ATOM   1308  C  CG2   . VAL B  2 81  ? 2.276   -34.299 36.216  1.00 47.35  ? 81   VAL B CG2   1 
ATOM   1309  N  N     . THR B  2 82  ? 3.322   -29.952 34.538  1.00 46.75  ? 82   THR B N     1 
ATOM   1310  C  CA    . THR B  2 82  ? 3.806   -28.558 34.581  1.00 45.90  ? 82   THR B CA    1 
ATOM   1311  C  C     . THR B  2 82  ? 2.963   -27.650 35.468  1.00 45.19  ? 82   THR B C     1 
ATOM   1312  O  O     . THR B  2 82  ? 1.824   -28.005 35.835  1.00 45.29  ? 82   THR B O     1 
ATOM   1313  C  CB    . THR B  2 82  ? 3.819   -27.935 33.191  1.00 45.78  ? 82   THR B CB    1 
ATOM   1314  O  OG1   . THR B  2 82  ? 2.490   -27.972 32.632  1.00 45.57  ? 82   THR B OG1   1 
ATOM   1315  C  CG2   . THR B  2 82  ? 4.770   -28.682 32.304  1.00 46.06  ? 82   THR B CG2   1 
ATOM   1316  N  N     . ALA B  2 83  ? 3.502   -26.469 35.783  1.00 44.35  ? 83   ALA B N     1 
ATOM   1317  C  CA    . ALA B  2 83  ? 2.749   -25.453 36.558  1.00 43.56  ? 83   ALA B CA    1 
ATOM   1318  C  C     . ALA B  2 83  ? 1.420   -25.114 35.902  1.00 42.94  ? 83   ALA B C     1 
ATOM   1319  O  O     . ALA B  2 83  ? 0.411   -24.957 36.583  1.00 42.15  ? 83   ALA B O     1 
ATOM   1320  C  CB    . ALA B  2 83  ? 3.570   -24.200 36.772  1.00 43.31  ? 83   ALA B CB    1 
ATOM   1321  N  N     . MET B  2 84  ? 1.421   -25.040 34.575  1.00 43.15  ? 84   MET B N     1 
ATOM   1322  C  CA    . MET B  2 84  ? 0.197   -24.768 33.837  1.00 43.84  ? 84   MET B CA    1 
ATOM   1323  C  C     . MET B  2 84  ? -0.861  -25.879 33.919  1.00 43.50  ? 84   MET B C     1 
ATOM   1324  O  O     . MET B  2 84  ? -2.066  -25.570 33.905  1.00 43.96  ? 84   MET B O     1 
ATOM   1325  C  CB    . MET B  2 84  ? 0.494   -24.369 32.388  1.00 44.61  ? 84   MET B CB    1 
ATOM   1326  C  CG    . MET B  2 84  ? 1.340   -23.071 32.268  1.00 47.74  ? 84   MET B CG    1 
ATOM   1327  S  SD    . MET B  2 84  ? 0.679   -21.639 33.247  1.00 57.79  ? 84   MET B SD    1 
ATOM   1328  C  CE    . MET B  2 84  ? -1.052  -21.545 32.629  1.00 51.70  ? 84   MET B CE    1 
ATOM   1329  N  N     . ASP B  2 85  ? -0.447  -27.148 34.051  1.00 42.00  ? 85   ASP B N     1 
ATOM   1330  C  CA    . ASP B  2 85  ? -1.434  -28.208 34.237  1.00 40.69  ? 85   ASP B CA    1 
ATOM   1331  C  C     . ASP B  2 85  ? -2.090  -28.012 35.578  1.00 39.13  ? 85   ASP B C     1 
ATOM   1332  O  O     . ASP B  2 85  ? -3.309  -28.120 35.703  1.00 38.71  ? 85   ASP B O     1 
ATOM   1333  C  CB    . ASP B  2 85  ? -0.830  -29.608 34.164  1.00 41.47  ? 85   ASP B CB    1 
ATOM   1334  C  CG    . ASP B  2 85  ? -0.148  -29.893 32.839  1.00 44.31  ? 85   ASP B CG    1 
ATOM   1335  O  OD1   . ASP B  2 85  ? -0.738  -29.604 31.768  1.00 46.48  ? 85   ASP B OD1   1 
ATOM   1336  O  OD2   . ASP B  2 85  ? 0.995   -30.413 32.877  1.00 48.59  ? 85   ASP B OD2   1 
ATOM   1337  N  N     . VAL B  2 86  ? -1.290  -27.716 36.590  1.00 37.68  ? 86   VAL B N     1 
ATOM   1338  C  CA    . VAL B  2 86  ? -1.852  -27.450 37.912  1.00 36.97  ? 86   VAL B CA    1 
ATOM   1339  C  C     . VAL B  2 86  ? -2.722  -26.185 37.897  1.00 37.71  ? 86   VAL B C     1 
ATOM   1340  O  O     . VAL B  2 86  ? -3.849  -26.187 38.463  1.00 37.59  ? 86   VAL B O     1 
ATOM   1341  C  CB    . VAL B  2 86  ? -0.766  -27.281 38.957  1.00 36.71  ? 86   VAL B CB    1 
ATOM   1342  C  CG1   . VAL B  2 86  ? -1.387  -27.101 40.297  1.00 36.03  ? 86   VAL B CG1   1 
ATOM   1343  C  CG2   . VAL B  2 86  ? 0.205   -28.498 38.949  1.00 35.96  ? 86   VAL B CG2   1 
ATOM   1344  N  N     . VAL B  2 87  ? -2.219  -25.110 37.256  1.00 37.26  ? 87   VAL B N     1 
ATOM   1345  C  CA    . VAL B  2 87  ? -2.989  -23.878 37.180  1.00 37.07  ? 87   VAL B CA    1 
ATOM   1346  C  C     . VAL B  2 87  ? -4.320  -24.130 36.475  1.00 37.62  ? 87   VAL B C     1 
ATOM   1347  O  O     . VAL B  2 87  ? -5.347  -23.727 36.991  1.00 37.72  ? 87   VAL B O     1 
ATOM   1348  C  CB    . VAL B  2 87  ? -2.192  -22.654 36.592  1.00 37.66  ? 87   VAL B CB    1 
ATOM   1349  C  CG1   . VAL B  2 87  ? -3.131  -21.520 36.209  1.00 34.44  ? 87   VAL B CG1   1 
ATOM   1350  C  CG2   . VAL B  2 87  ? -1.104  -22.167 37.584  1.00 35.23  ? 87   VAL B CG2   1 
ATOM   1351  N  N     . TYR B  2 88  ? -4.322  -24.841 35.349  1.00 38.62  ? 88   TYR B N     1 
ATOM   1352  C  CA    . TYR B  2 88  ? -5.590  -25.174 34.660  1.00 39.51  ? 88   TYR B CA    1 
ATOM   1353  C  C     . TYR B  2 88  ? -6.530  -26.073 35.460  1.00 39.22  ? 88   TYR B C     1 
ATOM   1354  O  O     . TYR B  2 88  ? -7.753  -25.962 35.329  1.00 38.94  ? 88   TYR B O     1 
ATOM   1355  C  CB    . TYR B  2 88  ? -5.352  -25.875 33.332  1.00 40.66  ? 88   TYR B CB    1 
ATOM   1356  C  CG    . TYR B  2 88  ? -4.558  -25.129 32.335  1.00 43.35  ? 88   TYR B CG    1 
ATOM   1357  C  CD1   . TYR B  2 88  ? -3.705  -25.804 31.484  1.00 46.36  ? 88   TYR B CD1   1 
ATOM   1358  C  CD2   . TYR B  2 88  ? -4.660  -23.739 32.211  1.00 45.67  ? 88   TYR B CD2   1 
ATOM   1359  C  CE1   . TYR B  2 88  ? -2.965  -25.121 30.534  1.00 48.19  ? 88   TYR B CE1   1 
ATOM   1360  C  CE2   . TYR B  2 88  ? -3.924  -23.046 31.274  1.00 45.08  ? 88   TYR B CE2   1 
ATOM   1361  C  CZ    . TYR B  2 88  ? -3.078  -23.737 30.444  1.00 46.51  ? 88   TYR B CZ    1 
ATOM   1362  O  OH    . TYR B  2 88  ? -2.320  -23.070 29.493  1.00 48.90  ? 88   TYR B OH    1 
ATOM   1363  N  N     . ALA B  2 89  ? -5.957  -27.006 36.228  1.00 39.20  ? 89   ALA B N     1 
ATOM   1364  C  CA    . ALA B  2 89  ? -6.738  -27.918 37.070  1.00 38.89  ? 89   ALA B CA    1 
ATOM   1365  C  C     . ALA B  2 89  ? -7.457  -27.112 38.127  1.00 39.24  ? 89   ALA B C     1 
ATOM   1366  O  O     . ALA B  2 89  ? -8.677  -27.232 38.270  1.00 39.50  ? 89   ALA B O     1 
ATOM   1367  C  CB    . ALA B  2 89  ? -5.872  -28.936 37.700  1.00 38.48  ? 89   ALA B CB    1 
ATOM   1368  N  N     . LEU B  2 90  ? -6.720  -26.242 38.822  1.00 39.37  ? 90   LEU B N     1 
ATOM   1369  C  CA    . LEU B  2 90  ? -7.327  -25.377 39.835  1.00 39.44  ? 90   LEU B CA    1 
ATOM   1370  C  C     . LEU B  2 90  ? -8.413  -24.490 39.255  1.00 40.54  ? 90   LEU B C     1 
ATOM   1371  O  O     . LEU B  2 90  ? -9.453  -24.297 39.896  1.00 40.51  ? 90   LEU B O     1 
ATOM   1372  C  CB    . LEU B  2 90  ? -6.278  -24.546 40.569  1.00 38.85  ? 90   LEU B CB    1 
ATOM   1373  C  CG    . LEU B  2 90  ? -5.355  -25.314 41.517  1.00 36.98  ? 90   LEU B CG    1 
ATOM   1374  C  CD1   . LEU B  2 90  ? -4.043  -24.608 41.747  1.00 33.84  ? 90   LEU B CD1   1 
ATOM   1375  C  CD2   . LEU B  2 90  ? -6.078  -25.650 42.813  1.00 35.44  ? 90   LEU B CD2   1 
ATOM   1376  N  N     . LYS B  2 91  ? -8.202  -23.965 38.043  1.00 42.20  ? 91   LYS B N     1 
ATOM   1377  C  CA    . LYS B  2 91  ? -9.234  -23.115 37.415  1.00 43.81  ? 91   LYS B CA    1 
ATOM   1378  C  C     . LYS B  2 91  ? -10.500 -23.916 37.231  1.00 44.14  ? 91   LYS B C     1 
ATOM   1379  O  O     . LYS B  2 91  ? -11.558 -23.478 37.659  1.00 44.14  ? 91   LYS B O     1 
ATOM   1380  C  CB    . LYS B  2 91  ? -8.799  -22.490 36.100  1.00 43.93  ? 91   LYS B CB    1 
ATOM   1381  C  CG    . LYS B  2 91  ? -9.713  -21.346 35.676  1.00 47.83  ? 91   LYS B CG    1 
ATOM   1382  C  CD    . LYS B  2 91  ? -9.003  -20.359 34.742  1.00 54.73  ? 91   LYS B CD    1 
ATOM   1383  C  CE    . LYS B  2 91  ? -8.963  -20.914 33.299  1.00 60.73  ? 91   LYS B CE    1 
ATOM   1384  N  NZ    . LYS B  2 91  ? -7.921  -20.283 32.418  1.00 64.93  ? 91   LYS B NZ    1 
ATOM   1385  N  N     . ARG B  2 92  ? -10.365 -25.108 36.640  1.00 45.02  ? 92   ARG B N     1 
ATOM   1386  C  CA    . ARG B  2 92  ? -11.459 -26.078 36.543  1.00 45.74  ? 92   ARG B CA    1 
ATOM   1387  C  C     . ARG B  2 92  ? -12.239 -26.271 37.841  1.00 45.32  ? 92   ARG B C     1 
ATOM   1388  O  O     . ARG B  2 92  ? -13.449 -26.259 37.787  1.00 45.15  ? 92   ARG B O     1 
ATOM   1389  C  CB    . ARG B  2 92  ? -10.956 -27.444 36.051  1.00 46.29  ? 92   ARG B CB    1 
ATOM   1390  C  CG    . ARG B  2 92  ? -11.097 -27.649 34.559  1.00 49.04  ? 92   ARG B CG    1 
ATOM   1391  C  CD    . ARG B  2 92  ? -11.519 -29.052 34.230  1.00 52.60  ? 92   ARG B CD    1 
ATOM   1392  N  NE    . ARG B  2 92  ? -12.924 -29.260 34.592  1.00 57.91  ? 92   ARG B NE    1 
ATOM   1393  C  CZ    . ARG B  2 92  ? -13.334 -29.924 35.682  1.00 59.82  ? 92   ARG B CZ    1 
ATOM   1394  N  NH1   . ARG B  2 92  ? -12.436 -30.465 36.513  1.00 59.85  ? 92   ARG B NH1   1 
ATOM   1395  N  NH2   . ARG B  2 92  ? -14.643 -30.060 35.939  1.00 58.11  ? 92   ARG B NH2   1 
ATOM   1396  N  N     . GLN B  2 93  ? -11.563 -26.460 38.982  1.00 44.98  ? 93   GLN B N     1 
ATOM   1397  C  CA    . GLN B  2 93  ? -12.264 -26.629 40.261  1.00 45.44  ? 93   GLN B CA    1 
ATOM   1398  C  C     . GLN B  2 93  ? -12.819 -25.302 40.812  1.00 44.90  ? 93   GLN B C     1 
ATOM   1399  O  O     . GLN B  2 93  ? -13.396 -25.290 41.904  1.00 45.26  ? 93   GLN B O     1 
ATOM   1400  C  CB    . GLN B  2 93  ? -11.389 -27.294 41.358  1.00 46.19  ? 93   GLN B CB    1 
ATOM   1401  C  CG    . GLN B  2 93  ? -10.492 -28.499 40.960  1.00 49.33  ? 93   GLN B CG    1 
ATOM   1402  C  CD    . GLN B  2 93  ? -11.250 -29.827 40.754  1.00 53.42  ? 93   GLN B CD    1 
ATOM   1403  O  OE1   . GLN B  2 93  ? -12.077 -30.229 41.591  1.00 55.59  ? 93   GLN B OE1   1 
ATOM   1404  N  NE2   . GLN B  2 93  ? -10.945 -30.525 39.648  1.00 51.87  ? 93   GLN B NE2   1 
ATOM   1405  N  N     . GLY B  2 94  ? -12.645 -24.192 40.085  1.00 43.77  ? 94   GLY B N     1 
ATOM   1406  C  CA    . GLY B  2 94  ? -13.082 -22.886 40.569  1.00 41.97  ? 94   GLY B CA    1 
ATOM   1407  C  C     . GLY B  2 94  ? -12.200 -22.376 41.706  1.00 41.81  ? 94   GLY B C     1 
ATOM   1408  O  O     . GLY B  2 94  ? -12.688 -21.741 42.637  1.00 41.96  ? 94   GLY B O     1 
ATOM   1409  N  N     . ARG B  2 95  ? -10.902 -22.669 41.636  1.00 40.81  ? 95   ARG B N     1 
ATOM   1410  C  CA    . ARG B  2 95  ? -9.943  -22.227 42.619  1.00 40.04  ? 95   ARG B CA    1 
ATOM   1411  C  C     . ARG B  2 95  ? -8.724  -21.659 41.910  1.00 39.82  ? 95   ARG B C     1 
ATOM   1412  O  O     . ARG B  2 95  ? -7.585  -22.028 42.212  1.00 40.57  ? 95   ARG B O     1 
ATOM   1413  C  CB    . ARG B  2 95  ? -9.527  -23.369 43.532  1.00 40.20  ? 95   ARG B CB    1 
ATOM   1414  C  CG    . ARG B  2 95  ? -10.663 -23.940 44.357  1.00 43.69  ? 95   ARG B CG    1 
ATOM   1415  C  CD    . ARG B  2 95  ? -10.154 -24.615 45.610  1.00 48.43  ? 95   ARG B CD    1 
ATOM   1416  N  NE    . ARG B  2 95  ? -9.607  -23.606 46.525  1.00 54.10  ? 95   ARG B NE    1 
ATOM   1417  C  CZ    . ARG B  2 95  ? -10.322 -22.958 47.445  1.00 56.53  ? 95   ARG B CZ    1 
ATOM   1418  N  NH1   . ARG B  2 95  ? -11.623 -23.237 47.599  1.00 57.35  ? 95   ARG B NH1   1 
ATOM   1419  N  NH2   . ARG B  2 95  ? -9.729  -22.052 48.233  1.00 56.06  ? 95   ARG B NH2   1 
ATOM   1420  N  N     . THR B  2 96  ? -8.984  -20.747 40.975  1.00 38.87  ? 96   THR B N     1 
ATOM   1421  C  CA    . THR B  2 96  ? -7.987  -19.931 40.272  1.00 37.84  ? 96   THR B CA    1 
ATOM   1422  C  C     . THR B  2 96  ? -6.783  -19.472 41.086  1.00 37.03  ? 96   THR B C     1 
ATOM   1423  O  O     . THR B  2 96  ? -6.938  -18.906 42.144  1.00 36.93  ? 96   THR B O     1 
ATOM   1424  C  CB    . THR B  2 96  ? -8.668  -18.668 39.698  1.00 37.76  ? 96   THR B CB    1 
ATOM   1425  O  OG1   . THR B  2 96  ? -9.752  -19.081 38.868  1.00 37.98  ? 96   THR B OG1   1 
ATOM   1426  C  CG2   . THR B  2 96  ? -7.709  -17.849 38.862  1.00 35.97  ? 96   THR B CG2   1 
ATOM   1427  N  N     . LEU B  2 97  ? -5.588  -19.671 40.548  1.00 36.46  ? 97   LEU B N     1 
ATOM   1428  C  CA    . LEU B  2 97  ? -4.369  -19.301 41.236  1.00 36.65  ? 97   LEU B CA    1 
ATOM   1429  C  C     . LEU B  2 97  ? -3.510  -18.306 40.447  1.00 37.29  ? 97   LEU B C     1 
ATOM   1430  O  O     . LEU B  2 97  ? -3.179  -18.547 39.271  1.00 37.15  ? 97   LEU B O     1 
ATOM   1431  C  CB    . LEU B  2 97  ? -3.555  -20.556 41.499  1.00 36.07  ? 97   LEU B CB    1 
ATOM   1432  C  CG    . LEU B  2 97  ? -2.226  -20.388 42.196  1.00 35.64  ? 97   LEU B CG    1 
ATOM   1433  C  CD1   . LEU B  2 97  ? -2.450  -20.193 43.663  1.00 36.41  ? 97   LEU B CD1   1 
ATOM   1434  C  CD2   . LEU B  2 97  ? -1.455  -21.627 41.975  1.00 38.91  ? 97   LEU B CD2   1 
ATOM   1435  N  N     . TYR B  2 98  ? -3.103  -17.222 41.110  1.00 37.60  ? 98   TYR B N     1 
ATOM   1436  C  CA    . TYR B  2 98  ? -2.230  -16.241 40.483  1.00 38.79  ? 98   TYR B CA    1 
ATOM   1437  C  C     . TYR B  2 98  ? -0.804  -16.445 40.945  1.00 39.07  ? 98   TYR B C     1 
ATOM   1438  O  O     . TYR B  2 98  ? -0.552  -16.624 42.131  1.00 38.61  ? 98   TYR B O     1 
ATOM   1439  C  CB    . TYR B  2 98  ? -2.649  -14.817 40.839  1.00 39.36  ? 98   TYR B CB    1 
ATOM   1440  C  CG    . TYR B  2 98  ? -3.952  -14.291 40.258  1.00 39.14  ? 98   TYR B CG    1 
ATOM   1441  C  CD1   . TYR B  2 98  ? -4.772  -15.070 39.435  1.00 39.13  ? 98   TYR B CD1   1 
ATOM   1442  C  CD2   . TYR B  2 98  ? -4.365  -12.998 40.571  1.00 37.10  ? 98   TYR B CD2   1 
ATOM   1443  C  CE1   . TYR B  2 98  ? -5.977  -14.536 38.921  1.00 41.16  ? 98   TYR B CE1   1 
ATOM   1444  C  CE2   . TYR B  2 98  ? -5.538  -12.464 40.083  1.00 37.69  ? 98   TYR B CE2   1 
ATOM   1445  C  CZ    . TYR B  2 98  ? -6.348  -13.218 39.265  1.00 40.69  ? 98   TYR B CZ    1 
ATOM   1446  O  OH    . TYR B  2 98  ? -7.520  -12.642 38.808  1.00 40.12  ? 98   TYR B OH    1 
ATOM   1447  N  N     . GLY B  2 99  ? 0.122   -16.424 39.994  1.00 40.06  ? 99   GLY B N     1 
ATOM   1448  C  CA    . GLY B  2 99  ? 1.538   -16.446 40.299  1.00 41.63  ? 99   GLY B CA    1 
ATOM   1449  C  C     . GLY B  2 99  ? 2.353   -17.575 39.708  1.00 43.29  ? 99   GLY B C     1 
ATOM   1450  O  O     . GLY B  2 99  ? 3.517   -17.729 40.090  1.00 44.17  ? 99   GLY B O     1 
ATOM   1451  N  N     . PHE B  2 100 ? 1.772   -18.370 38.792  1.00 43.90  ? 100  PHE B N     1 
ATOM   1452  C  CA    . PHE B  2 100 ? 2.507   -19.469 38.136  1.00 43.96  ? 100  PHE B CA    1 
ATOM   1453  C  C     . PHE B  2 100 ? 2.173   -19.617 36.614  1.00 45.64  ? 100  PHE B C     1 
ATOM   1454  O  O     . PHE B  2 100 ? 2.369   -20.710 36.006  1.00 46.01  ? 100  PHE B O     1 
ATOM   1455  C  CB    . PHE B  2 100 ? 2.247   -20.803 38.881  1.00 42.56  ? 100  PHE B CB    1 
ATOM   1456  C  CG    . PHE B  2 100 ? 2.629   -20.792 40.346  1.00 39.67  ? 100  PHE B CG    1 
ATOM   1457  C  CD1   . PHE B  2 100 ? 1.670   -20.555 41.329  1.00 38.39  ? 100  PHE B CD1   1 
ATOM   1458  C  CD2   . PHE B  2 100 ? 3.937   -21.068 40.749  1.00 36.10  ? 100  PHE B CD2   1 
ATOM   1459  C  CE1   . PHE B  2 100 ? 2.021   -20.563 42.696  1.00 37.85  ? 100  PHE B CE1   1 
ATOM   1460  C  CE2   . PHE B  2 100 ? 4.302   -21.087 42.098  1.00 33.52  ? 100  PHE B CE2   1 
ATOM   1461  C  CZ    . PHE B  2 100 ? 3.349   -20.825 43.081  1.00 36.36  ? 100  PHE B CZ    1 
ATOM   1462  N  N     . GLY B  2 101 ? 1.664   -18.541 36.006  1.00 46.81  ? 101  GLY B N     1 
ATOM   1463  C  CA    . GLY B  2 101 ? 1.197   -18.555 34.607  1.00 48.81  ? 101  GLY B CA    1 
ATOM   1464  C  C     . GLY B  2 101 ? -0.317  -18.396 34.467  1.00 51.02  ? 101  GLY B C     1 
ATOM   1465  O  O     . GLY B  2 101 ? -1.058  -18.260 35.463  1.00 50.50  ? 101  GLY B O     1 
ATOM   1466  N  N     . GLY B  2 102 ? -0.791  -18.396 33.223  1.00 53.23  ? 102  GLY B N     1 
ATOM   1467  C  CA    . GLY B  2 102 ? -2.217  -18.125 32.932  1.00 55.46  ? 102  GLY B CA    1 
ATOM   1468  C  C     . GLY B  2 102 ? -2.618  -16.663 33.156  1.00 57.46  ? 102  GLY B C     1 
ATOM   1469  O  O     . GLY B  2 102 ? -3.830  -16.332 33.122  1.00 58.22  ? 102  GLY B O     1 
ATOM   1470  O  OXT   . GLY B  2 102 ? -1.760  -15.762 33.381  1.00 58.19  ? 102  GLY B OXT   1 
ATOM   1471  N  N     . THR C  3 16  ? -27.107 -41.351 6.745   1.00 76.81  ? 16   THR C N     1 
ATOM   1472  C  CA    . THR C  3 16  ? -26.730 -40.577 7.965   1.00 76.92  ? 16   THR C CA    1 
ATOM   1473  C  C     . THR C  3 16  ? -25.509 -41.153 8.679   1.00 77.02  ? 16   THR C C     1 
ATOM   1474  O  O     . THR C  3 16  ? -25.346 -42.372 8.802   1.00 77.25  ? 16   THR C O     1 
ATOM   1475  C  CB    . THR C  3 16  ? -27.872 -40.501 9.021   1.00 76.84  ? 16   THR C CB    1 
ATOM   1476  O  OG1   . THR C  3 16  ? -27.962 -41.746 9.728   1.00 77.15  ? 16   THR C OG1   1 
ATOM   1477  C  CG2   . THR C  3 16  ? -29.214 -40.141 8.394   1.00 76.54  ? 16   THR C CG2   1 
ATOM   1478  N  N     . ARG C  3 17  ? -24.676 -40.252 9.183   1.00 76.91  ? 17   ARG C N     1 
ATOM   1479  C  CA    . ARG C  3 17  ? -23.541 -40.617 10.005  1.00 76.94  ? 17   ARG C CA    1 
ATOM   1480  C  C     . ARG C  3 17  ? -23.964 -41.288 11.322  1.00 76.78  ? 17   ARG C C     1 
ATOM   1481  O  O     . ARG C  3 17  ? -23.186 -42.034 11.915  1.00 76.55  ? 17   ARG C O     1 
ATOM   1482  C  CB    . ARG C  3 17  ? -22.674 -39.379 10.252  1.00 76.91  ? 17   ARG C CB    1 
ATOM   1483  C  CG    . ARG C  3 17  ? -22.000 -38.848 8.984   1.00 77.09  ? 17   ARG C CG    1 
ATOM   1484  C  CD    . ARG C  3 17  ? -21.076 -37.671 9.260   1.00 77.34  ? 17   ARG C CD    1 
ATOM   1485  N  NE    . ARG C  3 17  ? -21.829 -36.426 9.443   1.00 78.52  ? 17   ARG C NE    1 
ATOM   1486  C  CZ    . ARG C  3 17  ? -21.288 -35.232 9.682   1.00 77.48  ? 17   ARG C CZ    1 
ATOM   1487  N  NH1   . ARG C  3 17  ? -19.966 -35.086 9.777   1.00 77.32  ? 17   ARG C NH1   1 
ATOM   1488  N  NH2   . ARG C  3 17  ? -22.080 -34.181 9.829   1.00 76.43  ? 17   ARG C NH2   1 
ATOM   1489  N  N     . SER C  3 18  ? -25.197 -41.040 11.759  1.00 76.82  ? 18   SER C N     1 
ATOM   1490  C  CA    . SER C  3 18  ? -25.701 -41.614 13.004  1.00 77.32  ? 18   SER C CA    1 
ATOM   1491  C  C     . SER C  3 18  ? -25.785 -43.133 12.945  1.00 77.61  ? 18   SER C C     1 
ATOM   1492  O  O     . SER C  3 18  ? -25.436 -43.823 13.910  1.00 77.79  ? 18   SER C O     1 
ATOM   1493  C  CB    . SER C  3 18  ? -27.070 -41.037 13.355  1.00 77.22  ? 18   SER C CB    1 
ATOM   1494  O  OG    . SER C  3 18  ? -26.978 -39.645 13.586  1.00 77.90  ? 18   SER C OG    1 
ATOM   1495  N  N     . SER C  3 19  ? -26.251 -43.640 11.805  1.00 77.87  ? 19   SER C N     1 
ATOM   1496  C  CA    . SER C  3 19  ? -26.401 -45.079 11.573  1.00 77.73  ? 19   SER C CA    1 
ATOM   1497  C  C     . SER C  3 19  ? -25.043 -45.768 11.444  1.00 77.48  ? 19   SER C C     1 
ATOM   1498  O  O     . SER C  3 19  ? -24.806 -46.780 12.097  1.00 77.21  ? 19   SER C O     1 
ATOM   1499  C  CB    . SER C  3 19  ? -27.267 -45.328 10.337  1.00 77.93  ? 19   SER C CB    1 
ATOM   1500  O  OG    . SER C  3 19  ? -26.955 -44.393 9.310   1.00 78.33  ? 19   SER C OG    1 
ATOM   1501  N  N     . ARG C  3 20  ? -24.154 -45.207 10.620  1.00 77.34  ? 20   ARG C N     1 
ATOM   1502  C  CA    . ARG C  3 20  ? -22.770 -45.689 10.511  1.00 77.64  ? 20   ARG C CA    1 
ATOM   1503  C  C     . ARG C  3 20  ? -22.097 -45.837 11.874  1.00 77.22  ? 20   ARG C C     1 
ATOM   1504  O  O     . ARG C  3 20  ? -21.198 -46.661 12.037  1.00 77.75  ? 20   ARG C O     1 
ATOM   1505  C  CB    . ARG C  3 20  ? -21.927 -44.751 9.649   1.00 77.41  ? 20   ARG C CB    1 
ATOM   1506  C  CG    . ARG C  3 20  ? -22.328 -44.700 8.189   1.00 78.77  ? 20   ARG C CG    1 
ATOM   1507  C  CD    . ARG C  3 20  ? -21.476 -43.709 7.399   1.00 79.53  ? 20   ARG C CD    1 
ATOM   1508  N  NE    . ARG C  3 20  ? -22.060 -43.407 6.082   1.00 84.88  ? 20   ARG C NE    1 
ATOM   1509  C  CZ    . ARG C  3 20  ? -21.773 -44.054 4.945   1.00 86.87  ? 20   ARG C CZ    1 
ATOM   1510  N  NH1   . ARG C  3 20  ? -20.895 -45.062 4.932   1.00 88.34  ? 20   ARG C NH1   1 
ATOM   1511  N  NH2   . ARG C  3 20  ? -22.362 -43.690 3.808   1.00 86.53  ? 20   ARG C NH2   1 
ATOM   1512  N  N     . ALA C  3 21  ? -22.536 -45.035 12.848  1.00 76.76  ? 21   ALA C N     1 
ATOM   1513  C  CA    . ALA C  3 21  ? -21.950 -45.018 14.193  1.00 75.78  ? 21   ALA C CA    1 
ATOM   1514  C  C     . ALA C  3 21  ? -22.799 -45.761 15.229  1.00 74.92  ? 21   ALA C C     1 
ATOM   1515  O  O     . ALA C  3 21  ? -22.381 -45.955 16.370  1.00 74.62  ? 21   ALA C O     1 
ATOM   1516  C  CB    . ALA C  3 21  ? -21.701 -43.590 14.635  1.00 75.93  ? 21   ALA C CB    1 
ATOM   1517  N  N     . GLY C  3 22  ? -23.988 -46.175 14.823  1.00 74.18  ? 22   GLY C N     1 
ATOM   1518  C  CA    . GLY C  3 22  ? -24.854 -46.964 15.688  1.00 73.60  ? 22   GLY C CA    1 
ATOM   1519  C  C     . GLY C  3 22  ? -25.591 -46.145 16.721  1.00 73.06  ? 22   GLY C C     1 
ATOM   1520  O  O     . GLY C  3 22  ? -26.005 -46.676 17.746  1.00 73.19  ? 22   GLY C O     1 
ATOM   1521  N  N     . LEU C  3 23  ? -25.785 -44.857 16.438  1.00 72.78  ? 23   LEU C N     1 
ATOM   1522  C  CA    . LEU C  3 23  ? -26.365 -43.913 17.404  1.00 72.07  ? 23   LEU C CA    1 
ATOM   1523  C  C     . LEU C  3 23  ? -27.767 -43.415 17.037  1.00 72.05  ? 23   LEU C C     1 
ATOM   1524  O  O     . LEU C  3 23  ? -28.115 -43.304 15.860  1.00 72.03  ? 23   LEU C O     1 
ATOM   1525  C  CB    . LEU C  3 23  ? -25.433 -42.717 17.579  1.00 71.61  ? 23   LEU C CB    1 
ATOM   1526  C  CG    . LEU C  3 23  ? -24.046 -43.057 18.105  1.00 71.11  ? 23   LEU C CG    1 
ATOM   1527  C  CD1   . LEU C  3 23  ? -23.080 -41.909 17.913  1.00 70.59  ? 23   LEU C CD1   1 
ATOM   1528  C  CD2   . LEU C  3 23  ? -24.134 -43.456 19.561  1.00 70.92  ? 23   LEU C CD2   1 
ATOM   1529  N  N     . GLN C  3 24  ? -28.558 -43.121 18.065  1.00 71.85  ? 24   GLN C N     1 
ATOM   1530  C  CA    . GLN C  3 24  ? -29.826 -42.416 17.923  1.00 71.78  ? 24   GLN C CA    1 
ATOM   1531  C  C     . GLN C  3 24  ? -29.631 -40.899 17.762  1.00 71.42  ? 24   GLN C C     1 
ATOM   1532  O  O     . GLN C  3 24  ? -30.401 -40.242 17.047  1.00 71.70  ? 24   GLN C O     1 
ATOM   1533  C  CB    . GLN C  3 24  ? -30.701 -42.679 19.147  1.00 72.26  ? 24   GLN C CB    1 
ATOM   1534  C  CG    . GLN C  3 24  ? -30.975 -44.169 19.431  1.00 74.35  ? 24   GLN C CG    1 
ATOM   1535  C  CD    . GLN C  3 24  ? -31.683 -44.870 18.272  1.00 76.09  ? 24   GLN C CD    1 
ATOM   1536  O  OE1   . GLN C  3 24  ? -32.911 -44.833 18.152  1.00 76.75  ? 24   GLN C OE1   1 
ATOM   1537  N  NE2   . GLN C  3 24  ? -30.905 -45.519 17.420  1.00 76.99  ? 24   GLN C NE2   1 
ATOM   1538  N  N     . PHE C  3 25  ? -28.601 -40.360 18.424  1.00 70.44  ? 25   PHE C N     1 
ATOM   1539  C  CA    . PHE C  3 25  ? -28.342 -38.923 18.491  1.00 69.32  ? 25   PHE C CA    1 
ATOM   1540  C  C     . PHE C  3 25  ? -27.643 -38.408 17.237  1.00 69.08  ? 25   PHE C C     1 
ATOM   1541  O  O     . PHE C  3 25  ? -26.739 -39.060 16.738  1.00 69.18  ? 25   PHE C O     1 
ATOM   1542  C  CB    . PHE C  3 25  ? -27.538 -38.580 19.756  1.00 69.30  ? 25   PHE C CB    1 
ATOM   1543  C  CG    . PHE C  3 25  ? -28.393 -38.144 20.925  1.00 68.10  ? 25   PHE C CG    1 
ATOM   1544  C  CD1   . PHE C  3 25  ? -29.190 -39.059 21.611  1.00 67.26  ? 25   PHE C CD1   1 
ATOM   1545  C  CD2   . PHE C  3 25  ? -28.406 -36.817 21.330  1.00 66.48  ? 25   PHE C CD2   1 
ATOM   1546  C  CE1   . PHE C  3 25  ? -29.988 -38.657 22.678  1.00 66.00  ? 25   PHE C CE1   1 
ATOM   1547  C  CE2   . PHE C  3 25  ? -29.198 -36.407 22.390  1.00 65.94  ? 25   PHE C CE2   1 
ATOM   1548  C  CZ    . PHE C  3 25  ? -29.991 -37.331 23.066  1.00 66.83  ? 25   PHE C CZ    1 
ATOM   1549  N  N     . PRO C  3 26  ? -28.046 -37.213 16.751  1.00 68.66  ? 26   PRO C N     1 
ATOM   1550  C  CA    . PRO C  3 26  ? -27.755 -36.728 15.406  1.00 68.02  ? 26   PRO C CA    1 
ATOM   1551  C  C     . PRO C  3 26  ? -26.326 -36.267 15.205  1.00 67.56  ? 26   PRO C C     1 
ATOM   1552  O  O     . PRO C  3 26  ? -26.007 -35.106 15.481  1.00 67.89  ? 26   PRO C O     1 
ATOM   1553  C  CB    . PRO C  3 26  ? -28.691 -35.525 15.271  1.00 68.30  ? 26   PRO C CB    1 
ATOM   1554  C  CG    . PRO C  3 26  ? -28.798 -35.000 16.650  1.00 68.28  ? 26   PRO C CG    1 
ATOM   1555  C  CD    . PRO C  3 26  ? -28.821 -36.217 17.522  1.00 68.72  ? 26   PRO C CD    1 
ATOM   1556  N  N     . VAL C  3 27  ? -25.484 -37.154 14.682  1.00 66.69  ? 27   VAL C N     1 
ATOM   1557  C  CA    . VAL C  3 27  ? -24.090 -36.824 14.413  1.00 65.56  ? 27   VAL C CA    1 
ATOM   1558  C  C     . VAL C  3 27  ? -23.909 -35.591 13.527  1.00 65.30  ? 27   VAL C C     1 
ATOM   1559  O  O     . VAL C  3 27  ? -22.932 -34.872 13.686  1.00 65.79  ? 27   VAL C O     1 
ATOM   1560  C  CB    . VAL C  3 27  ? -23.341 -38.027 13.835  1.00 65.43  ? 27   VAL C CB    1 
ATOM   1561  C  CG1   . VAL C  3 27  ? -21.937 -37.638 13.384  1.00 65.44  ? 27   VAL C CG1   1 
ATOM   1562  C  CG2   . VAL C  3 27  ? -23.270 -39.126 14.868  1.00 65.01  ? 27   VAL C CG2   1 
ATOM   1563  N  N     . GLY C  3 28  ? -24.843 -35.340 12.610  1.00 65.02  ? 28   GLY C N     1 
ATOM   1564  C  CA    . GLY C  3 28  ? -24.739 -34.209 11.668  1.00 64.16  ? 28   GLY C CA    1 
ATOM   1565  C  C     . GLY C  3 28  ? -25.000 -32.866 12.325  1.00 63.78  ? 28   GLY C C     1 
ATOM   1566  O  O     . GLY C  3 28  ? -24.267 -31.895 12.118  1.00 63.62  ? 28   GLY C O     1 
ATOM   1567  N  N     . ARG C  3 29  ? -26.057 -32.820 13.127  1.00 63.46  ? 29   ARG C N     1 
ATOM   1568  C  CA    . ARG C  3 29  ? -26.386 -31.648 13.921  1.00 62.92  ? 29   ARG C CA    1 
ATOM   1569  C  C     . ARG C  3 29  ? -25.267 -31.284 14.901  1.00 63.04  ? 29   ARG C C     1 
ATOM   1570  O  O     . ARG C  3 29  ? -24.838 -30.127 14.965  1.00 63.19  ? 29   ARG C O     1 
ATOM   1571  C  CB    . ARG C  3 29  ? -27.669 -31.908 14.694  1.00 62.63  ? 29   ARG C CB    1 
ATOM   1572  C  CG    . ARG C  3 29  ? -28.189 -30.703 15.383  1.00 61.96  ? 29   ARG C CG    1 
ATOM   1573  C  CD    . ARG C  3 29  ? -29.618 -30.514 14.971  1.00 62.22  ? 29   ARG C CD    1 
ATOM   1574  N  NE    . ARG C  3 29  ? -30.544 -30.830 16.039  1.00 62.03  ? 29   ARG C NE    1 
ATOM   1575  C  CZ    . ARG C  3 29  ? -31.834 -31.062 15.850  1.00 63.63  ? 29   ARG C CZ    1 
ATOM   1576  N  NH1   . ARG C  3 29  ? -32.339 -31.042 14.622  1.00 64.00  ? 29   ARG C NH1   1 
ATOM   1577  N  NH2   . ARG C  3 29  ? -32.615 -31.330 16.891  1.00 64.57  ? 29   ARG C NH2   1 
ATOM   1578  N  N     . VAL C  3 30  ? -24.801 -32.275 15.663  1.00 62.73  ? 30   VAL C N     1 
ATOM   1579  C  CA    . VAL C  3 30  ? -23.765 -32.059 16.661  1.00 62.22  ? 30   VAL C CA    1 
ATOM   1580  C  C     . VAL C  3 30  ? -22.547 -31.476 15.960  1.00 62.77  ? 30   VAL C C     1 
ATOM   1581  O  O     . VAL C  3 30  ? -21.858 -30.619 16.504  1.00 63.07  ? 30   VAL C O     1 
ATOM   1582  C  CB    . VAL C  3 30  ? -23.434 -33.359 17.440  1.00 61.81  ? 30   VAL C CB    1 
ATOM   1583  C  CG1   . VAL C  3 30  ? -22.219 -33.172 18.319  1.00 60.89  ? 30   VAL C CG1   1 
ATOM   1584  C  CG2   . VAL C  3 30  ? -24.623 -33.791 18.276  1.00 60.40  ? 30   VAL C CG2   1 
ATOM   1585  N  N     . HIS C  3 31  ? -22.320 -31.914 14.728  1.00 63.38  ? 31   HIS C N     1 
ATOM   1586  C  CA    . HIS C  3 31  ? -21.220 -31.410 13.917  1.00 64.14  ? 31   HIS C CA    1 
ATOM   1587  C  C     . HIS C  3 31  ? -21.411 -29.950 13.512  1.00 64.47  ? 31   HIS C C     1 
ATOM   1588  O  O     . HIS C  3 31  ? -20.482 -29.144 13.591  1.00 64.35  ? 31   HIS C O     1 
ATOM   1589  C  CB    . HIS C  3 31  ? -21.074 -32.265 12.675  1.00 64.22  ? 31   HIS C CB    1 
ATOM   1590  C  CG    . HIS C  3 31  ? -19.909 -31.889 11.825  1.00 65.73  ? 31   HIS C CG    1 
ATOM   1591  N  ND1   . HIS C  3 31  ? -18.607 -31.950 12.281  1.00 67.07  ? 31   HIS C ND1   1 
ATOM   1592  C  CD2   . HIS C  3 31  ? -19.844 -31.467 10.540  1.00 67.15  ? 31   HIS C CD2   1 
ATOM   1593  C  CE1   . HIS C  3 31  ? -17.790 -31.575 11.314  1.00 67.52  ? 31   HIS C CE1   1 
ATOM   1594  N  NE2   . HIS C  3 31  ? -18.515 -31.285 10.245  1.00 68.12  ? 31   HIS C NE2   1 
ATOM   1595  N  N     . ARG C  3 32  ? -22.618 -29.623 13.057  1.00 65.07  ? 32   ARG C N     1 
ATOM   1596  C  CA    . ARG C  3 32  ? -22.950 -28.252 12.712  1.00 65.31  ? 32   ARG C CA    1 
ATOM   1597  C  C     . ARG C  3 32  ? -22.788 -27.384 13.956  1.00 65.54  ? 32   ARG C C     1 
ATOM   1598  O  O     . ARG C  3 32  ? -22.080 -26.385 13.924  1.00 65.50  ? 32   ARG C O     1 
ATOM   1599  C  CB    . ARG C  3 32  ? -24.374 -28.166 12.169  1.00 65.33  ? 32   ARG C CB    1 
ATOM   1600  C  CG    . ARG C  3 32  ? -24.829 -26.760 11.786  1.00 65.20  ? 32   ARG C CG    1 
ATOM   1601  C  CD    . ARG C  3 32  ? -26.344 -26.725 11.699  1.00 65.39  ? 32   ARG C CD    1 
ATOM   1602  N  NE    . ARG C  3 32  ? -26.958 -26.531 13.010  1.00 64.75  ? 32   ARG C NE    1 
ATOM   1603  C  CZ    . ARG C  3 32  ? -28.180 -26.947 13.351  1.00 65.42  ? 32   ARG C CZ    1 
ATOM   1604  N  NH1   . ARG C  3 32  ? -28.943 -27.616 12.491  1.00 65.61  ? 32   ARG C NH1   1 
ATOM   1605  N  NH2   . ARG C  3 32  ? -28.638 -26.707 14.572  1.00 64.45  ? 32   ARG C NH2   1 
ATOM   1606  N  N     . LEU C  3 33  ? -23.423 -27.795 15.052  1.00 65.85  ? 33   LEU C N     1 
ATOM   1607  C  CA    . LEU C  3 33  ? -23.380 -27.051 16.299  1.00 66.33  ? 33   LEU C CA    1 
ATOM   1608  C  C     . LEU C  3 33  ? -21.959 -26.787 16.803  1.00 66.95  ? 33   LEU C C     1 
ATOM   1609  O  O     . LEU C  3 33  ? -21.714 -25.750 17.408  1.00 67.45  ? 33   LEU C O     1 
ATOM   1610  C  CB    . LEU C  3 33  ? -24.224 -27.734 17.374  1.00 65.93  ? 33   LEU C CB    1 
ATOM   1611  C  CG    . LEU C  3 33  ? -25.745 -27.592 17.267  1.00 66.07  ? 33   LEU C CG    1 
ATOM   1612  C  CD1   . LEU C  3 33  ? -26.416 -28.428 18.337  1.00 66.83  ? 33   LEU C CD1   1 
ATOM   1613  C  CD2   . LEU C  3 33  ? -26.213 -26.151 17.389  1.00 65.56  ? 33   LEU C CD2   1 
ATOM   1614  N  N     . LEU C  3 34  ? -21.031 -27.706 16.543  1.00 67.68  ? 34   LEU C N     1 
ATOM   1615  C  CA    . LEU C  3 34  ? -19.626 -27.500 16.904  1.00 68.34  ? 34   LEU C CA    1 
ATOM   1616  C  C     . LEU C  3 34  ? -18.952 -26.441 16.039  1.00 69.07  ? 34   LEU C C     1 
ATOM   1617  O  O     . LEU C  3 34  ? -18.057 -25.744 16.516  1.00 69.10  ? 34   LEU C O     1 
ATOM   1618  C  CB    . LEU C  3 34  ? -18.828 -28.803 16.805  1.00 68.23  ? 34   LEU C CB    1 
ATOM   1619  C  CG    . LEU C  3 34  ? -18.954 -29.896 17.871  1.00 68.24  ? 34   LEU C CG    1 
ATOM   1620  C  CD1   . LEU C  3 34  ? -18.270 -31.179 17.394  1.00 66.54  ? 34   LEU C CD1   1 
ATOM   1621  C  CD2   . LEU C  3 34  ? -18.389 -29.445 19.218  1.00 67.63  ? 34   LEU C CD2   1 
ATOM   1622  N  N     . ARG C  3 35  ? -19.360 -26.340 14.770  1.00 69.99  ? 35   ARG C N     1 
ATOM   1623  C  CA    . ARG C  3 35  ? -18.772 -25.368 13.825  1.00 70.97  ? 35   ARG C CA    1 
ATOM   1624  C  C     . ARG C  3 35  ? -19.313 -23.960 14.033  1.00 70.49  ? 35   ARG C C     1 
ATOM   1625  O  O     . ARG C  3 35  ? -18.605 -22.989 13.814  1.00 70.38  ? 35   ARG C O     1 
ATOM   1626  C  CB    . ARG C  3 35  ? -18.984 -25.800 12.375  1.00 70.78  ? 35   ARG C CB    1 
ATOM   1627  C  CG    . ARG C  3 35  ? -18.251 -27.077 11.997  1.00 72.66  ? 35   ARG C CG    1 
ATOM   1628  C  CD    . ARG C  3 35  ? -18.417 -27.445 10.518  1.00 73.35  ? 35   ARG C CD    1 
ATOM   1629  N  NE    . ARG C  3 35  ? -17.528 -28.560 10.163  1.00 79.25  ? 35   ARG C NE    1 
ATOM   1630  C  CZ    . ARG C  3 35  ? -17.404 -29.107 8.948   1.00 81.39  ? 35   ARG C CZ    1 
ATOM   1631  N  NH1   . ARG C  3 35  ? -18.108 -28.665 7.905   1.00 82.49  ? 35   ARG C NH1   1 
ATOM   1632  N  NH2   . ARG C  3 35  ? -16.555 -30.116 8.774   1.00 82.63  ? 35   ARG C NH2   1 
ATOM   1633  N  N     . LYS C  3 36  ? -20.567 -23.872 14.465  1.00 70.50  ? 36   LYS C N     1 
ATOM   1634  C  CA    . LYS C  3 36  ? -21.234 -22.604 14.769  1.00 70.92  ? 36   LYS C CA    1 
ATOM   1635  C  C     . LYS C  3 36  ? -20.929 -22.010 16.162  1.00 69.97  ? 36   LYS C C     1 
ATOM   1636  O  O     . LYS C  3 36  ? -21.146 -20.815 16.391  1.00 70.32  ? 36   LYS C O     1 
ATOM   1637  C  CB    . LYS C  3 36  ? -22.748 -22.767 14.623  1.00 70.68  ? 36   LYS C CB    1 
ATOM   1638  C  CG    . LYS C  3 36  ? -23.207 -22.884 13.173  1.00 72.78  ? 36   LYS C CG    1 
ATOM   1639  C  CD    . LYS C  3 36  ? -24.750 -22.828 13.058  1.00 73.25  ? 36   LYS C CD    1 
ATOM   1640  C  CE    . LYS C  3 36  ? -25.201 -22.324 11.671  1.00 76.02  ? 36   LYS C CE    1 
ATOM   1641  N  NZ    . LYS C  3 36  ? -26.698 -22.241 11.572  1.00 78.22  ? 36   LYS C NZ    1 
ATOM   1642  N  N     . GLY C  3 37  ? -20.441 -22.830 17.091  1.00 68.86  ? 37   GLY C N     1 
ATOM   1643  C  CA    . GLY C  3 37  ? -20.214 -22.366 18.460  1.00 66.96  ? 37   GLY C CA    1 
ATOM   1644  C  C     . GLY C  3 37  ? -18.875 -21.688 18.671  1.00 65.84  ? 37   GLY C C     1 
ATOM   1645  O  O     . GLY C  3 37  ? -18.541 -21.324 19.799  1.00 65.50  ? 37   GLY C O     1 
ATOM   1646  N  N     . ASN C  3 38  ? -18.114 -21.515 17.590  1.00 64.71  ? 38   ASN C N     1 
ATOM   1647  C  CA    . ASN C  3 38  ? -16.783 -20.906 17.656  1.00 64.13  ? 38   ASN C CA    1 
ATOM   1648  C  C     . ASN C  3 38  ? -15.879 -21.549 18.695  1.00 62.75  ? 38   ASN C C     1 
ATOM   1649  O  O     . ASN C  3 38  ? -15.179 -20.866 19.453  1.00 63.06  ? 38   ASN C O     1 
ATOM   1650  C  CB    . ASN C  3 38  ? -16.871 -19.389 17.913  1.00 64.86  ? 38   ASN C CB    1 
ATOM   1651  C  CG    . ASN C  3 38  ? -17.205 -18.608 16.659  1.00 66.36  ? 38   ASN C CG    1 
ATOM   1652  O  OD1   . ASN C  3 38  ? -16.421 -18.560 15.692  1.00 64.68  ? 38   ASN C OD1   1 
ATOM   1653  N  ND2   . ASN C  3 38  ? -18.392 -17.996 16.662  1.00 68.08  ? 38   ASN C ND2   1 
ATOM   1654  N  N     . TYR C  3 39  ? -15.885 -22.870 18.728  1.00 60.68  ? 39   TYR C N     1 
ATOM   1655  C  CA    . TYR C  3 39  ? -15.077 -23.573 19.697  1.00 58.48  ? 39   TYR C CA    1 
ATOM   1656  C  C     . TYR C  3 39  ? -13.652 -23.647 19.206  1.00 59.23  ? 39   TYR C C     1 
ATOM   1657  O  O     . TYR C  3 39  ? -12.720 -23.498 19.985  1.00 59.43  ? 39   TYR C O     1 
ATOM   1658  C  CB    . TYR C  3 39  ? -15.670 -24.935 19.946  1.00 56.02  ? 39   TYR C CB    1 
ATOM   1659  C  CG    . TYR C  3 39  ? -17.048 -24.852 20.527  1.00 52.17  ? 39   TYR C CG    1 
ATOM   1660  C  CD1   . TYR C  3 39  ? -18.162 -25.074 19.749  1.00 49.05  ? 39   TYR C CD1   1 
ATOM   1661  C  CD2   . TYR C  3 39  ? -17.235 -24.525 21.857  1.00 48.87  ? 39   TYR C CD2   1 
ATOM   1662  C  CE1   . TYR C  3 39  ? -19.425 -25.002 20.287  1.00 48.59  ? 39   TYR C CE1   1 
ATOM   1663  C  CE2   . TYR C  3 39  ? -18.485 -24.436 22.398  1.00 47.09  ? 39   TYR C CE2   1 
ATOM   1664  C  CZ    . TYR C  3 39  ? -19.571 -24.682 21.613  1.00 49.32  ? 39   TYR C CZ    1 
ATOM   1665  O  OH    . TYR C  3 39  ? -20.816 -24.605 22.163  1.00 51.40  ? 39   TYR C OH    1 
ATOM   1666  N  N     . ALA C  3 40  ? -13.493 -23.847 17.901  1.00 60.26  ? 40   ALA C N     1 
ATOM   1667  C  CA    . ALA C  3 40  ? -12.184 -23.867 17.251  1.00 61.44  ? 40   ALA C CA    1 
ATOM   1668  C  C     . ALA C  3 40  ? -12.338 -23.669 15.762  1.00 62.40  ? 40   ALA C C     1 
ATOM   1669  O  O     . ALA C  3 40  ? -13.421 -23.878 15.186  1.00 62.25  ? 40   ALA C O     1 
ATOM   1670  C  CB    . ALA C  3 40  ? -11.442 -25.172 17.518  1.00 61.36  ? 40   ALA C CB    1 
ATOM   1671  N  N     . GLU C  3 41  ? -11.228 -23.280 15.155  1.00 63.43  ? 41   GLU C N     1 
ATOM   1672  C  CA    . GLU C  3 41  ? -11.134 -23.040 13.729  1.00 65.42  ? 41   GLU C CA    1 
ATOM   1673  C  C     . GLU C  3 41  ? -11.617 -24.245 12.892  1.00 64.80  ? 41   GLU C C     1 
ATOM   1674  O  O     . GLU C  3 41  ? -12.292 -24.074 11.886  1.00 64.86  ? 41   GLU C O     1 
ATOM   1675  C  CB    . GLU C  3 41  ? -9.678  -22.668 13.414  1.00 65.38  ? 41   GLU C CB    1 
ATOM   1676  C  CG    . GLU C  3 41  ? -9.394  -22.150 12.017  1.00 67.64  ? 41   GLU C CG    1 
ATOM   1677  C  CD    . GLU C  3 41  ? -7.899  -21.867 11.820  1.00 68.73  ? 41   GLU C CD    1 
ATOM   1678  O  OE1   . GLU C  3 41  ? -7.356  -20.966 12.521  1.00 73.00  ? 41   GLU C OE1   1 
ATOM   1679  O  OE2   . GLU C  3 41  ? -7.265  -22.555 10.975  1.00 72.61  ? 41   GLU C OE2   1 
ATOM   1680  N  N     . ARG C  3 42  ? -11.289 -25.462 13.320  1.00 64.88  ? 42   ARG C N     1 
ATOM   1681  C  CA    . ARG C  3 42  ? -11.675 -26.669 12.577  1.00 64.71  ? 42   ARG C CA    1 
ATOM   1682  C  C     . ARG C  3 42  ? -12.202 -27.793 13.480  1.00 63.90  ? 42   ARG C C     1 
ATOM   1683  O  O     . ARG C  3 42  ? -11.802 -27.913 14.634  1.00 64.23  ? 42   ARG C O     1 
ATOM   1684  C  CB    . ARG C  3 42  ? -10.494 -27.190 11.752  1.00 65.17  ? 42   ARG C CB    1 
ATOM   1685  C  CG    . ARG C  3 42  ? -9.444  -26.145 11.414  1.00 67.33  ? 42   ARG C CG    1 
ATOM   1686  C  CD    . ARG C  3 42  ? -8.133  -26.798 11.050  1.00 70.54  ? 42   ARG C CD    1 
ATOM   1687  N  NE    . ARG C  3 42  ? -7.959  -26.887 9.604   1.00 73.49  ? 42   ARG C NE    1 
ATOM   1688  C  CZ    . ARG C  3 42  ? -7.419  -27.931 8.985   1.00 75.57  ? 42   ARG C CZ    1 
ATOM   1689  N  NH1   . ARG C  3 42  ? -7.019  -28.996 9.690   1.00 75.52  ? 42   ARG C NH1   1 
ATOM   1690  N  NH2   . ARG C  3 42  ? -7.300  -27.921 7.659   1.00 75.86  ? 42   ARG C NH2   1 
ATOM   1691  N  N     . VAL C  3 43  ? -13.089 -28.623 12.944  1.00 62.98  ? 43   VAL C N     1 
ATOM   1692  C  CA    . VAL C  3 43  ? -13.614 -29.774 13.681  1.00 62.27  ? 43   VAL C CA    1 
ATOM   1693  C  C     . VAL C  3 43  ? -13.316 -31.084 12.956  1.00 61.83  ? 43   VAL C C     1 
ATOM   1694  O  O     . VAL C  3 43  ? -13.859 -31.334 11.882  1.00 62.13  ? 43   VAL C O     1 
ATOM   1695  C  CB    . VAL C  3 43  ? -15.141 -29.659 13.919  1.00 62.20  ? 43   VAL C CB    1 
ATOM   1696  C  CG1   . VAL C  3 43  ? -15.689 -30.915 14.603  1.00 61.29  ? 43   VAL C CG1   1 
ATOM   1697  C  CG2   . VAL C  3 43  ? -15.448 -28.439 14.750  1.00 61.78  ? 43   VAL C CG2   1 
ATOM   1698  N  N     . GLY C  3 44  ? -12.457 -31.914 13.549  1.00 61.22  ? 44   GLY C N     1 
ATOM   1699  C  CA    . GLY C  3 44  ? -12.198 -33.269 13.046  1.00 59.84  ? 44   GLY C CA    1 
ATOM   1700  C  C     . GLY C  3 44  ? -13.463 -34.091 12.842  1.00 59.17  ? 44   GLY C C     1 
ATOM   1701  O  O     . GLY C  3 44  ? -14.511 -33.797 13.405  1.00 58.66  ? 44   GLY C O     1 
ATOM   1702  N  N     . ALA C  3 45  ? -13.351 -35.139 12.031  1.00 59.07  ? 45   ALA C N     1 
ATOM   1703  C  CA    . ALA C  3 45  ? -14.493 -35.979 11.654  1.00 58.08  ? 45   ALA C CA    1 
ATOM   1704  C  C     . ALA C  3 45  ? -14.949 -36.889 12.782  1.00 57.43  ? 45   ALA C C     1 
ATOM   1705  O  O     . ALA C  3 45  ? -16.139 -37.153 12.900  1.00 57.47  ? 45   ALA C O     1 
ATOM   1706  C  CB    . ALA C  3 45  ? -14.162 -36.788 10.425  1.00 58.18  ? 45   ALA C CB    1 
ATOM   1707  N  N     . GLY C  3 46  ? -14.010 -37.350 13.611  1.00 56.47  ? 46   GLY C N     1 
ATOM   1708  C  CA    . GLY C  3 46  ? -14.336 -38.175 14.781  1.00 55.58  ? 46   GLY C CA    1 
ATOM   1709  C  C     . GLY C  3 46  ? -15.076 -37.470 15.921  1.00 55.02  ? 46   GLY C C     1 
ATOM   1710  O  O     . GLY C  3 46  ? -15.872 -38.103 16.646  1.00 55.07  ? 46   GLY C O     1 
ATOM   1711  N  N     . ALA C  3 47  ? -14.839 -36.162 16.072  1.00 54.00  ? 47   ALA C N     1 
ATOM   1712  C  CA    . ALA C  3 47  ? -15.332 -35.400 17.231  1.00 52.64  ? 47   ALA C CA    1 
ATOM   1713  C  C     . ALA C  3 47  ? -16.859 -35.324 17.423  1.00 51.88  ? 47   ALA C C     1 
ATOM   1714  O  O     . ALA C  3 47  ? -17.336 -35.524 18.542  1.00 51.72  ? 47   ALA C O     1 
ATOM   1715  C  CB    . ALA C  3 47  ? -14.703 -34.035 17.280  1.00 52.62  ? 47   ALA C CB    1 
ATOM   1716  N  N     . PRO C  3 48  ? -17.638 -35.070 16.352  1.00 51.46  ? 48   PRO C N     1 
ATOM   1717  C  CA    . PRO C  3 48  ? -19.098 -35.112 16.561  1.00 51.28  ? 48   PRO C CA    1 
ATOM   1718  C  C     . PRO C  3 48  ? -19.625 -36.492 16.958  1.00 51.40  ? 48   PRO C C     1 
ATOM   1719  O  O     . PRO C  3 48  ? -20.577 -36.586 17.757  1.00 51.39  ? 48   PRO C O     1 
ATOM   1720  C  CB    . PRO C  3 48  ? -19.664 -34.717 15.201  1.00 51.12  ? 48   PRO C CB    1 
ATOM   1721  C  CG    . PRO C  3 48  ? -18.574 -34.980 14.241  1.00 51.30  ? 48   PRO C CG    1 
ATOM   1722  C  CD    . PRO C  3 48  ? -17.303 -34.721 14.962  1.00 51.40  ? 48   PRO C CD    1 
ATOM   1723  N  N     . VAL C  3 49  ? -19.010 -37.549 16.408  1.00 51.15  ? 49   VAL C N     1 
ATOM   1724  C  CA    . VAL C  3 49  ? -19.445 -38.922 16.685  1.00 50.43  ? 49   VAL C CA    1 
ATOM   1725  C  C     . VAL C  3 49  ? -19.290 -39.210 18.163  1.00 50.00  ? 49   VAL C C     1 
ATOM   1726  O  O     . VAL C  3 49  ? -20.239 -39.640 18.828  1.00 50.50  ? 49   VAL C O     1 
ATOM   1727  C  CB    . VAL C  3 49  ? -18.669 -39.995 15.864  1.00 50.85  ? 49   VAL C CB    1 
ATOM   1728  C  CG1   . VAL C  3 49  ? -19.029 -41.394 16.373  1.00 49.55  ? 49   VAL C CG1   1 
ATOM   1729  C  CG2   . VAL C  3 49  ? -18.954 -39.863 14.342  1.00 49.39  ? 49   VAL C CG2   1 
ATOM   1730  N  N     . TYR C  3 50  ? -18.097 -38.941 18.676  1.00 49.12  ? 50   TYR C N     1 
ATOM   1731  C  CA    . TYR C  3 50  ? -17.779 -39.202 20.068  1.00 48.33  ? 50   TYR C CA    1 
ATOM   1732  C  C     . TYR C  3 50  ? -18.642 -38.352 20.967  1.00 48.73  ? 50   TYR C C     1 
ATOM   1733  O  O     . TYR C  3 50  ? -19.097 -38.817 22.016  1.00 48.96  ? 50   TYR C O     1 
ATOM   1734  C  CB    . TYR C  3 50  ? -16.327 -38.884 20.301  1.00 47.65  ? 50   TYR C CB    1 
ATOM   1735  C  CG    . TYR C  3 50  ? -15.694 -39.462 21.522  1.00 46.29  ? 50   TYR C CG    1 
ATOM   1736  C  CD1   . TYR C  3 50  ? -14.444 -40.049 21.436  1.00 44.95  ? 50   TYR C CD1   1 
ATOM   1737  C  CD2   . TYR C  3 50  ? -16.299 -39.369 22.773  1.00 46.17  ? 50   TYR C CD2   1 
ATOM   1738  C  CE1   . TYR C  3 50  ? -13.812 -40.550 22.546  1.00 44.61  ? 50   TYR C CE1   1 
ATOM   1739  C  CE2   . TYR C  3 50  ? -15.675 -39.875 23.909  1.00 46.07  ? 50   TYR C CE2   1 
ATOM   1740  C  CZ    . TYR C  3 50  ? -14.423 -40.463 23.778  1.00 46.62  ? 50   TYR C CZ    1 
ATOM   1741  O  OH    . TYR C  3 50  ? -13.768 -40.965 24.878  1.00 47.33  ? 50   TYR C OH    1 
ATOM   1742  N  N     . LEU C  3 51  ? -18.897 -37.110 20.561  1.00 49.04  ? 51   LEU C N     1 
ATOM   1743  C  CA    . LEU C  3 51  ? -19.759 -36.256 21.369  1.00 49.27  ? 51   LEU C CA    1 
ATOM   1744  C  C     . LEU C  3 51  ? -21.205 -36.748 21.345  1.00 49.04  ? 51   LEU C C     1 
ATOM   1745  O  O     . LEU C  3 51  ? -21.839 -36.890 22.391  1.00 49.31  ? 51   LEU C O     1 
ATOM   1746  C  CB    . LEU C  3 51  ? -19.656 -34.787 20.949  1.00 49.60  ? 51   LEU C CB    1 
ATOM   1747  C  CG    . LEU C  3 51  ? -20.357 -33.782 21.874  1.00 50.64  ? 51   LEU C CG    1 
ATOM   1748  C  CD1   . LEU C  3 51  ? -19.862 -33.930 23.321  1.00 51.67  ? 51   LEU C CD1   1 
ATOM   1749  C  CD2   . LEU C  3 51  ? -20.117 -32.378 21.383  1.00 51.42  ? 51   LEU C CD2   1 
ATOM   1750  N  N     . ALA C  3 52  ? -21.722 -37.021 20.156  1.00 48.82  ? 52   ALA C N     1 
ATOM   1751  C  CA    . ALA C  3 52  ? -23.066 -37.548 20.048  1.00 48.80  ? 52   ALA C CA    1 
ATOM   1752  C  C     . ALA C  3 52  ? -23.187 -38.784 20.952  1.00 48.95  ? 52   ALA C C     1 
ATOM   1753  O  O     . ALA C  3 52  ? -24.104 -38.861 21.777  1.00 48.99  ? 52   ALA C O     1 
ATOM   1754  C  CB    . ALA C  3 52  ? -23.389 -37.875 18.607  1.00 48.89  ? 52   ALA C CB    1 
ATOM   1755  N  N     . ALA C  3 53  ? -22.233 -39.719 20.822  1.00 48.57  ? 53   ALA C N     1 
ATOM   1756  C  CA    . ALA C  3 53  ? -22.180 -40.938 21.645  1.00 48.15  ? 53   ALA C CA    1 
ATOM   1757  C  C     . ALA C  3 53  ? -22.264 -40.686 23.149  1.00 48.20  ? 53   ALA C C     1 
ATOM   1758  O  O     . ALA C  3 53  ? -22.995 -41.371 23.857  1.00 48.09  ? 53   ALA C O     1 
ATOM   1759  C  CB    . ALA C  3 53  ? -20.944 -41.714 21.326  1.00 47.86  ? 53   ALA C CB    1 
ATOM   1760  N  N     . VAL C  3 54  ? -21.510 -39.695 23.629  1.00 48.84  ? 54   VAL C N     1 
ATOM   1761  C  CA    . VAL C  3 54  ? -21.505 -39.322 25.057  1.00 49.06  ? 54   VAL C CA    1 
ATOM   1762  C  C     . VAL C  3 54  ? -22.834 -38.681 25.475  1.00 49.49  ? 54   VAL C C     1 
ATOM   1763  O  O     . VAL C  3 54  ? -23.403 -39.035 26.517  1.00 49.40  ? 54   VAL C O     1 
ATOM   1764  C  CB    . VAL C  3 54  ? -20.338 -38.380 25.417  1.00 48.78  ? 54   VAL C CB    1 
ATOM   1765  C  CG1   . VAL C  3 54  ? -20.400 -38.028 26.869  1.00 48.63  ? 54   VAL C CG1   1 
ATOM   1766  C  CG2   . VAL C  3 54  ? -19.001 -39.009 25.083  1.00 47.55  ? 54   VAL C CG2   1 
ATOM   1767  N  N     . LEU C  3 55  ? -23.337 -37.762 24.649  1.00 49.98  ? 55   LEU C N     1 
ATOM   1768  C  CA    . LEU C  3 55  ? -24.657 -37.176 24.900  1.00 50.71  ? 55   LEU C CA    1 
ATOM   1769  C  C     . LEU C  3 55  ? -25.703 -38.254 25.021  1.00 50.78  ? 55   LEU C C     1 
ATOM   1770  O  O     . LEU C  3 55  ? -26.479 -38.234 25.956  1.00 50.63  ? 55   LEU C O     1 
ATOM   1771  C  CB    . LEU C  3 55  ? -25.059 -36.171 23.822  1.00 50.73  ? 55   LEU C CB    1 
ATOM   1772  C  CG    . LEU C  3 55  ? -24.277 -34.861 23.786  1.00 51.44  ? 55   LEU C CG    1 
ATOM   1773  C  CD1   . LEU C  3 55  ? -24.786 -33.991 22.631  1.00 52.49  ? 55   LEU C CD1   1 
ATOM   1774  C  CD2   . LEU C  3 55  ? -24.379 -34.140 25.132  1.00 51.27  ? 55   LEU C CD2   1 
ATOM   1775  N  N     . GLU C  3 56  ? -25.691 -39.203 24.085  1.00 51.92  ? 56   GLU C N     1 
ATOM   1776  C  CA    . GLU C  3 56  ? -26.588 -40.367 24.109  1.00 52.92  ? 56   GLU C CA    1 
ATOM   1777  C  C     . GLU C  3 56  ? -26.448 -41.261 25.347  1.00 52.66  ? 56   GLU C C     1 
ATOM   1778  O  O     . GLU C  3 56  ? -27.457 -41.645 25.954  1.00 51.85  ? 56   GLU C O     1 
ATOM   1779  C  CB    . GLU C  3 56  ? -26.405 -41.207 22.865  1.00 53.41  ? 56   GLU C CB    1 
ATOM   1780  C  CG    . GLU C  3 56  ? -27.530 -42.200 22.694  1.00 57.32  ? 56   GLU C CG    1 
ATOM   1781  C  CD    . GLU C  3 56  ? -27.542 -42.841 21.328  1.00 62.38  ? 56   GLU C CD    1 
ATOM   1782  O  OE1   . GLU C  3 56  ? -27.467 -42.102 20.312  1.00 62.60  ? 56   GLU C OE1   1 
ATOM   1783  O  OE2   . GLU C  3 56  ? -27.629 -44.091 21.283  1.00 65.23  ? 56   GLU C OE2   1 
ATOM   1784  N  N     . TYR C  3 57  ? -25.206 -41.572 25.724  1.00 53.14  ? 57   TYR C N     1 
ATOM   1785  C  CA    . TYR C  3 57  ? -24.957 -42.377 26.919  1.00 53.65  ? 57   TYR C CA    1 
ATOM   1786  C  C     . TYR C  3 57  ? -25.553 -41.744 28.165  1.00 53.30  ? 57   TYR C C     1 
ATOM   1787  O  O     . TYR C  3 57  ? -26.273 -42.414 28.908  1.00 53.44  ? 57   TYR C O     1 
ATOM   1788  C  CB    . TYR C  3 57  ? -23.465 -42.700 27.132  1.00 54.75  ? 57   TYR C CB    1 
ATOM   1789  C  CG    . TYR C  3 57  ? -23.217 -43.153 28.554  1.00 57.25  ? 57   TYR C CG    1 
ATOM   1790  C  CD1   . TYR C  3 57  ? -23.839 -44.303 29.053  1.00 58.77  ? 57   TYR C CD1   1 
ATOM   1791  C  CD2   . TYR C  3 57  ? -22.421 -42.393 29.433  1.00 59.74  ? 57   TYR C CD2   1 
ATOM   1792  C  CE1   . TYR C  3 57  ? -23.673 -44.701 30.385  1.00 59.70  ? 57   TYR C CE1   1 
ATOM   1793  C  CE2   . TYR C  3 57  ? -22.234 -42.792 30.770  1.00 59.96  ? 57   TYR C CE2   1 
ATOM   1794  C  CZ    . TYR C  3 57  ? -22.868 -43.952 31.237  1.00 59.31  ? 57   TYR C CZ    1 
ATOM   1795  O  OH    . TYR C  3 57  ? -22.694 -44.375 32.543  1.00 58.58  ? 57   TYR C OH    1 
ATOM   1796  N  N     . LEU C  3 58  ? -25.262 -40.455 28.388  1.00 52.90  ? 58   LEU C N     1 
ATOM   1797  C  CA    . LEU C  3 58  ? -25.775 -39.734 29.567  1.00 52.09  ? 58   LEU C CA    1 
ATOM   1798  C  C     . LEU C  3 58  ? -27.286 -39.539 29.569  1.00 51.80  ? 58   LEU C C     1 
ATOM   1799  O  O     . LEU C  3 58  ? -27.910 -39.620 30.623  1.00 51.35  ? 58   LEU C O     1 
ATOM   1800  C  CB    . LEU C  3 58  ? -25.093 -38.377 29.747  1.00 51.97  ? 58   LEU C CB    1 
ATOM   1801  C  CG    . LEU C  3 58  ? -23.602 -38.358 30.065  1.00 51.61  ? 58   LEU C CG    1 
ATOM   1802  C  CD1   . LEU C  3 58  ? -23.025 -36.963 29.771  1.00 49.53  ? 58   LEU C CD1   1 
ATOM   1803  C  CD2   . LEU C  3 58  ? -23.298 -38.827 31.506  1.00 49.69  ? 58   LEU C CD2   1 
ATOM   1804  N  N     . THR C  3 59  ? -27.890 -39.263 28.418  1.00 51.72  ? 59   THR C N     1 
ATOM   1805  C  CA    . THR C  3 59  ? -29.341 -39.151 28.434  1.00 52.42  ? 59   THR C CA    1 
ATOM   1806  C  C     . THR C  3 59  ? -29.977 -40.544 28.632  1.00 53.23  ? 59   THR C C     1 
ATOM   1807  O  O     . THR C  3 59  ? -31.020 -40.660 29.300  1.00 53.42  ? 59   THR C O     1 
ATOM   1808  C  CB    . THR C  3 59  ? -29.968 -38.375 27.230  1.00 52.39  ? 59   THR C CB    1 
ATOM   1809  O  OG1   . THR C  3 59  ? -30.954 -39.197 26.577  1.00 54.33  ? 59   THR C OG1   1 
ATOM   1810  C  CG2   . THR C  3 59  ? -28.935 -37.861 26.249  1.00 49.12  ? 59   THR C CG2   1 
ATOM   1811  N  N     . ALA C  3 60  ? -29.335 -41.589 28.087  1.00 53.67  ? 60   ALA C N     1 
ATOM   1812  C  CA    . ALA C  3 60  ? -29.706 -42.982 28.414  1.00 54.21  ? 60   ALA C CA    1 
ATOM   1813  C  C     . ALA C  3 60  ? -29.631 -43.233 29.910  1.00 54.69  ? 60   ALA C C     1 
ATOM   1814  O  O     . ALA C  3 60  ? -30.563 -43.783 30.496  1.00 55.03  ? 60   ALA C O     1 
ATOM   1815  C  CB    . ALA C  3 60  ? -28.841 -43.991 27.675  1.00 53.61  ? 60   ALA C CB    1 
ATOM   1816  N  N     . GLU C  3 61  ? -28.530 -42.824 30.531  1.00 55.32  ? 61   GLU C N     1 
ATOM   1817  C  CA    . GLU C  3 61  ? -28.347 -43.074 31.955  1.00 56.51  ? 61   GLU C CA    1 
ATOM   1818  C  C     . GLU C  3 61  ? -29.363 -42.373 32.874  1.00 56.61  ? 61   GLU C C     1 
ATOM   1819  O  O     . GLU C  3 61  ? -29.740 -42.946 33.892  1.00 56.98  ? 61   GLU C O     1 
ATOM   1820  C  CB    . GLU C  3 61  ? -26.926 -42.752 32.373  1.00 56.89  ? 61   GLU C CB    1 
ATOM   1821  C  CG    . GLU C  3 61  ? -26.635 -43.056 33.827  1.00 60.69  ? 61   GLU C CG    1 
ATOM   1822  C  CD    . GLU C  3 61  ? -26.031 -44.433 34.026  1.00 65.98  ? 61   GLU C CD    1 
ATOM   1823  O  OE1   . GLU C  3 61  ? -25.309 -44.903 33.100  1.00 67.98  ? 61   GLU C OE1   1 
ATOM   1824  O  OE2   . GLU C  3 61  ? -26.278 -45.033 35.110  1.00 66.95  ? 61   GLU C OE2   1 
ATOM   1825  N  N     . ILE C  3 62  ? -29.807 -41.157 32.529  1.00 56.84  ? 62   ILE C N     1 
ATOM   1826  C  CA    . ILE C  3 62  ? -30.801 -40.438 33.354  1.00 57.08  ? 62   ILE C CA    1 
ATOM   1827  C  C     . ILE C  3 62  ? -32.161 -41.107 33.232  1.00 56.95  ? 62   ILE C C     1 
ATOM   1828  O  O     . ILE C  3 62  ? -32.783 -41.419 34.245  1.00 56.50  ? 62   ILE C O     1 
ATOM   1829  C  CB    . ILE C  3 62  ? -31.012 -38.930 32.960  1.00 57.31  ? 62   ILE C CB    1 
ATOM   1830  C  CG1   . ILE C  3 62  ? -29.702 -38.218 32.630  1.00 58.40  ? 62   ILE C CG1   1 
ATOM   1831  C  CG2   . ILE C  3 62  ? -31.812 -38.190 34.031  1.00 55.64  ? 62   ILE C CG2   1 
ATOM   1832  C  CD1   . ILE C  3 62  ? -29.039 -37.538 33.810  1.00 60.40  ? 62   ILE C CD1   1 
ATOM   1833  N  N     . LEU C  3 63  ? -32.614 -41.292 31.985  1.00 57.23  ? 63   LEU C N     1 
ATOM   1834  C  CA    . LEU C  3 63  ? -33.942 -41.861 31.676  1.00 57.89  ? 63   LEU C CA    1 
ATOM   1835  C  C     . LEU C  3 63  ? -34.116 -43.286 32.214  1.00 58.89  ? 63   LEU C C     1 
ATOM   1836  O  O     . LEU C  3 63  ? -35.209 -43.656 32.673  1.00 58.72  ? 63   LEU C O     1 
ATOM   1837  C  CB    . LEU C  3 63  ? -34.218 -41.828 30.173  1.00 57.30  ? 63   LEU C CB    1 
ATOM   1838  C  CG    . LEU C  3 63  ? -34.294 -40.443 29.521  1.00 55.98  ? 63   LEU C CG    1 
ATOM   1839  C  CD1   . LEU C  3 63  ? -34.178 -40.565 28.025  1.00 54.57  ? 63   LEU C CD1   1 
ATOM   1840  C  CD2   . LEU C  3 63  ? -35.560 -39.695 29.900  1.00 53.63  ? 63   LEU C CD2   1 
ATOM   1841  N  N     . GLU C  3 64  ? -33.028 -44.058 32.174  1.00 60.03  ? 64   GLU C N     1 
ATOM   1842  C  CA    . GLU C  3 64  ? -32.949 -45.345 32.846  1.00 61.85  ? 64   GLU C CA    1 
ATOM   1843  C  C     . GLU C  3 64  ? -33.395 -45.271 34.312  1.00 62.13  ? 64   GLU C C     1 
ATOM   1844  O  O     . GLU C  3 64  ? -34.266 -46.022 34.721  1.00 62.54  ? 64   GLU C O     1 
ATOM   1845  C  CB    . GLU C  3 64  ? -31.530 -45.926 32.747  1.00 62.45  ? 64   GLU C CB    1 
ATOM   1846  C  CG    . GLU C  3 64  ? -31.389 -47.348 33.337  1.00 65.30  ? 64   GLU C CG    1 
ATOM   1847  C  CD    . GLU C  3 64  ? -31.744 -48.433 32.328  1.00 69.88  ? 64   GLU C CD    1 
ATOM   1848  O  OE1   . GLU C  3 64  ? -32.824 -49.053 32.477  1.00 72.20  ? 64   GLU C OE1   1 
ATOM   1849  O  OE2   . GLU C  3 64  ? -30.954 -48.657 31.373  1.00 71.79  ? 64   GLU C OE2   1 
ATOM   1850  N  N     . LEU C  3 65  ? -32.802 -44.370 35.091  1.00 62.64  ? 65   LEU C N     1 
ATOM   1851  C  CA    . LEU C  3 65  ? -33.128 -44.233 36.508  1.00 63.12  ? 65   LEU C CA    1 
ATOM   1852  C  C     . LEU C  3 65  ? -34.435 -43.490 36.745  1.00 63.60  ? 65   LEU C C     1 
ATOM   1853  O  O     . LEU C  3 65  ? -35.123 -43.723 37.731  1.00 63.19  ? 65   LEU C O     1 
ATOM   1854  C  CB    . LEU C  3 65  ? -32.007 -43.497 37.229  1.00 63.20  ? 65   LEU C CB    1 
ATOM   1855  C  CG    . LEU C  3 65  ? -30.682 -44.205 37.495  1.00 63.71  ? 65   LEU C CG    1 
ATOM   1856  C  CD1   . LEU C  3 65  ? -29.653 -43.197 37.982  1.00 63.95  ? 65   LEU C CD1   1 
ATOM   1857  C  CD2   . LEU C  3 65  ? -30.858 -45.333 38.524  1.00 65.17  ? 65   LEU C CD2   1 
ATOM   1858  N  N     . ALA C  3 66  ? -34.758 -42.566 35.849  1.00 64.74  ? 66   ALA C N     1 
ATOM   1859  C  CA    . ALA C  3 66  ? -35.974 -41.777 35.977  1.00 66.01  ? 66   ALA C CA    1 
ATOM   1860  C  C     . ALA C  3 66  ? -37.189 -42.662 35.737  1.00 66.84  ? 66   ALA C C     1 
ATOM   1861  O  O     . ALA C  3 66  ? -38.146 -42.596 36.503  1.00 67.00  ? 66   ALA C O     1 
ATOM   1862  C  CB    . ALA C  3 66  ? -35.958 -40.582 35.023  1.00 65.67  ? 66   ALA C CB    1 
ATOM   1863  N  N     . GLY C  3 67  ? -37.134 -43.479 34.677  1.00 67.94  ? 67   GLY C N     1 
ATOM   1864  C  CA    . GLY C  3 67  ? -38.135 -44.521 34.407  1.00 69.26  ? 67   GLY C CA    1 
ATOM   1865  C  C     . GLY C  3 67  ? -38.457 -45.350 35.645  1.00 70.38  ? 67   GLY C C     1 
ATOM   1866  O  O     . GLY C  3 67  ? -39.618 -45.443 36.063  1.00 70.34  ? 67   GLY C O     1 
ATOM   1867  N  N     . ASN C  3 68  ? -37.424 -45.929 36.254  1.00 71.28  ? 68   ASN C N     1 
ATOM   1868  C  CA    . ASN C  3 68  ? -37.599 -46.726 37.465  1.00 72.56  ? 68   ASN C CA    1 
ATOM   1869  C  C     . ASN C  3 68  ? -38.311 -45.954 38.564  1.00 73.34  ? 68   ASN C C     1 
ATOM   1870  O  O     . ASN C  3 68  ? -39.075 -46.521 39.348  1.00 73.33  ? 68   ASN C O     1 
ATOM   1871  C  CB    . ASN C  3 68  ? -36.255 -47.255 37.971  1.00 72.52  ? 68   ASN C CB    1 
ATOM   1872  C  CG    . ASN C  3 68  ? -35.487 -48.025 36.905  1.00 72.96  ? 68   ASN C CG    1 
ATOM   1873  O  OD1   . ASN C  3 68  ? -36.058 -48.487 35.907  1.00 73.15  ? 68   ASN C OD1   1 
ATOM   1874  N  ND2   . ASN C  3 68  ? -34.178 -48.168 37.114  1.00 73.62  ? 68   ASN C ND2   1 
ATOM   1875  N  N     . ALA C  3 69  ? -38.061 -44.649 38.604  1.00 74.67  ? 69   ALA C N     1 
ATOM   1876  C  CA    . ALA C  3 69  ? -38.638 -43.796 39.627  1.00 75.68  ? 69   ALA C CA    1 
ATOM   1877  C  C     . ALA C  3 69  ? -40.113 -43.587 39.331  1.00 76.55  ? 69   ALA C C     1 
ATOM   1878  O  O     . ALA C  3 69  ? -40.915 -43.469 40.253  1.00 76.66  ? 69   ALA C O     1 
ATOM   1879  C  CB    . ALA C  3 69  ? -37.891 -42.477 39.714  1.00 75.60  ? 69   ALA C CB    1 
ATOM   1880  N  N     . ALA C  3 70  ? -40.468 -43.558 38.048  1.00 77.82  ? 70   ALA C N     1 
ATOM   1881  C  CA    . ALA C  3 70  ? -41.870 -43.542 37.646  1.00 79.37  ? 70   ALA C CA    1 
ATOM   1882  C  C     . ALA C  3 70  ? -42.570 -44.851 38.061  1.00 80.54  ? 70   ALA C C     1 
ATOM   1883  O  O     . ALA C  3 70  ? -43.678 -44.813 38.600  1.00 80.77  ? 70   ALA C O     1 
ATOM   1884  C  CB    . ALA C  3 70  ? -42.001 -43.295 36.152  1.00 79.21  ? 70   ALA C CB    1 
ATOM   1885  N  N     . ARG C  3 71  ? -41.917 -45.995 37.832  1.00 81.89  ? 71   ARG C N     1 
ATOM   1886  C  CA    . ARG C  3 71  ? -42.415 -47.276 38.349  1.00 83.42  ? 71   ARG C CA    1 
ATOM   1887  C  C     . ARG C  3 71  ? -42.627 -47.172 39.857  1.00 83.78  ? 71   ARG C C     1 
ATOM   1888  O  O     . ARG C  3 71  ? -43.762 -47.238 40.316  1.00 84.05  ? 71   ARG C O     1 
ATOM   1889  C  CB    . ARG C  3 71  ? -41.473 -48.450 38.038  1.00 83.74  ? 71   ARG C CB    1 
ATOM   1890  C  CG    . ARG C  3 71  ? -41.367 -48.862 36.572  1.00 86.26  ? 71   ARG C CG    1 
ATOM   1891  C  CD    . ARG C  3 71  ? -39.942 -49.331 36.290  1.00 90.82  ? 71   ARG C CD    1 
ATOM   1892  N  NE    . ARG C  3 71  ? -39.772 -50.003 34.999  1.00 94.83  ? 71   ARG C NE    1 
ATOM   1893  C  CZ    . ARG C  3 71  ? -38.655 -50.636 34.627  1.00 96.35  ? 71   ARG C CZ    1 
ATOM   1894  N  NH1   . ARG C  3 71  ? -37.604 -50.681 35.444  1.00 96.75  ? 71   ARG C NH1   1 
ATOM   1895  N  NH2   . ARG C  3 71  ? -38.582 -51.228 33.438  1.00 96.47  ? 71   ARG C NH2   1 
ATOM   1896  N  N     . ASP C  3 72  ? -41.549 -46.985 40.623  1.00 84.23  ? 72   ASP C N     1 
ATOM   1897  C  CA    . ASP C  3 72  ? -41.655 -46.921 42.087  1.00 84.88  ? 72   ASP C CA    1 
ATOM   1898  C  C     . ASP C  3 72  ? -42.811 -46.038 42.547  1.00 84.97  ? 72   ASP C C     1 
ATOM   1899  O  O     . ASP C  3 72  ? -43.444 -46.322 43.555  1.00 85.09  ? 72   ASP C O     1 
ATOM   1900  C  CB    . ASP C  3 72  ? -40.354 -46.430 42.726  1.00 85.18  ? 72   ASP C CB    1 
ATOM   1901  C  CG    . ASP C  3 72  ? -39.180 -47.380 42.502  1.00 86.60  ? 72   ASP C CG    1 
ATOM   1902  O  OD1   . ASP C  3 72  ? -39.391 -48.535 42.054  1.00 87.49  ? 72   ASP C OD1   1 
ATOM   1903  O  OD2   . ASP C  3 72  ? -38.032 -46.960 42.787  1.00 87.76  ? 72   ASP C OD2   1 
ATOM   1904  N  N     . ASN C  3 73  ? -43.083 -44.974 41.793  1.00 85.32  ? 73   ASN C N     1 
ATOM   1905  C  CA    . ASN C  3 73  ? -44.173 -44.046 42.104  1.00 85.67  ? 73   ASN C CA    1 
ATOM   1906  C  C     . ASN C  3 73  ? -45.504 -44.391 41.406  1.00 85.47  ? 73   ASN C C     1 
ATOM   1907  O  O     . ASN C  3 73  ? -46.474 -43.631 41.503  1.00 85.60  ? 73   ASN C O     1 
ATOM   1908  C  CB    . ASN C  3 73  ? -43.749 -42.593 41.812  1.00 85.89  ? 73   ASN C CB    1 
ATOM   1909  C  CG    . ASN C  3 73  ? -42.666 -42.089 42.771  1.00 86.89  ? 73   ASN C CG    1 
ATOM   1910  O  OD1   . ASN C  3 73  ? -42.961 -41.387 43.745  1.00 87.50  ? 73   ASN C OD1   1 
ATOM   1911  N  ND2   . ASN C  3 73  ? -41.410 -42.459 42.507  1.00 86.86  ? 73   ASN C ND2   1 
ATOM   1912  N  N     . LYS C  3 74  ? -45.532 -45.538 40.719  1.00 84.94  ? 74   LYS C N     1 
ATOM   1913  C  CA    . LYS C  3 74  ? -46.724 -46.071 40.032  1.00 84.47  ? 74   LYS C CA    1 
ATOM   1914  C  C     . LYS C  3 74  ? -47.245 -45.171 38.913  1.00 83.63  ? 74   LYS C C     1 
ATOM   1915  O  O     . LYS C  3 74  ? -48.423 -44.787 38.915  1.00 83.87  ? 74   LYS C O     1 
ATOM   1916  C  CB    . LYS C  3 74  ? -47.850 -46.381 41.033  1.00 84.59  ? 74   LYS C CB    1 
ATOM   1917  C  CG    . LYS C  3 74  ? -47.787 -47.760 41.670  1.00 85.27  ? 74   LYS C CG    1 
ATOM   1918  C  CD    . LYS C  3 74  ? -48.897 -47.917 42.706  1.00 85.45  ? 74   LYS C CD    1 
ATOM   1919  C  CE    . LYS C  3 74  ? -48.999 -49.356 43.215  1.00 87.17  ? 74   LYS C CE    1 
ATOM   1920  N  NZ    . LYS C  3 74  ? -50.074 -49.490 44.248  1.00 87.48  ? 74   LYS C NZ    1 
ATOM   1921  N  N     . LYS C  3 75  ? -46.368 -44.831 37.969  1.00 82.37  ? 75   LYS C N     1 
ATOM   1922  C  CA    . LYS C  3 75  ? -46.736 -44.001 36.812  1.00 81.02  ? 75   LYS C CA    1 
ATOM   1923  C  C     . LYS C  3 75  ? -46.090 -44.545 35.544  1.00 80.12  ? 75   LYS C C     1 
ATOM   1924  O  O     . LYS C  3 75  ? -45.079 -45.257 35.609  1.00 80.15  ? 75   LYS C O     1 
ATOM   1925  C  CB    . LYS C  3 75  ? -46.304 -42.543 37.016  1.00 81.08  ? 75   LYS C CB    1 
ATOM   1926  C  CG    . LYS C  3 75  ? -46.810 -41.866 38.290  1.00 81.13  ? 75   LYS C CG    1 
ATOM   1927  C  CD    . LYS C  3 75  ? -48.305 -41.588 38.240  1.00 82.00  ? 75   LYS C CD    1 
ATOM   1928  C  CE    . LYS C  3 75  ? -48.720 -40.567 39.296  1.00 82.51  ? 75   LYS C CE    1 
ATOM   1929  N  NZ    . LYS C  3 75  ? -48.502 -41.077 40.681  1.00 82.75  ? 75   LYS C NZ    1 
ATOM   1930  N  N     . THR C  3 76  ? -46.665 -44.214 34.392  1.00 78.79  ? 76   THR C N     1 
ATOM   1931  C  CA    . THR C  3 76  ? -46.125 -44.682 33.110  1.00 77.73  ? 76   THR C CA    1 
ATOM   1932  C  C     . THR C  3 76  ? -45.471 -43.525 32.346  1.00 76.73  ? 76   THR C C     1 
ATOM   1933  O  O     . THR C  3 76  ? -44.852 -43.723 31.290  1.00 76.60  ? 76   THR C O     1 
ATOM   1934  C  CB    . THR C  3 76  ? -47.211 -45.395 32.215  1.00 78.08  ? 76   THR C CB    1 
ATOM   1935  O  OG1   . THR C  3 76  ? -47.765 -44.470 31.255  1.00 78.21  ? 76   THR C OG1   1 
ATOM   1936  C  CG2   . THR C  3 76  ? -48.343 -46.021 33.075  1.00 77.59  ? 76   THR C CG2   1 
ATOM   1937  N  N     . ARG C  3 77  ? -45.642 -42.317 32.883  1.00 75.38  ? 77   ARG C N     1 
ATOM   1938  C  CA    . ARG C  3 77  ? -45.040 -41.105 32.334  1.00 73.84  ? 77   ARG C CA    1 
ATOM   1939  C  C     . ARG C  3 77  ? -44.035 -40.515 33.296  1.00 72.40  ? 77   ARG C C     1 
ATOM   1940  O  O     . ARG C  3 77  ? -44.341 -40.283 34.474  1.00 72.08  ? 77   ARG C O     1 
ATOM   1941  C  CB    . ARG C  3 77  ? -46.104 -40.064 32.014  1.00 74.04  ? 77   ARG C CB    1 
ATOM   1942  C  CG    . ARG C  3 77  ? -46.191 -39.750 30.547  1.00 75.69  ? 77   ARG C CG    1 
ATOM   1943  C  CD    . ARG C  3 77  ? -47.630 -39.628 30.098  1.00 78.49  ? 77   ARG C CD    1 
ATOM   1944  N  NE    . ARG C  3 77  ? -48.364 -38.558 30.775  1.00 79.80  ? 77   ARG C NE    1 
ATOM   1945  C  CZ    . ARG C  3 77  ? -49.637 -38.257 30.519  1.00 80.96  ? 77   ARG C CZ    1 
ATOM   1946  N  NH1   . ARG C  3 77  ? -50.313 -38.946 29.601  1.00 80.52  ? 77   ARG C NH1   1 
ATOM   1947  N  NH2   . ARG C  3 77  ? -50.238 -37.269 31.178  1.00 80.83  ? 77   ARG C NH2   1 
ATOM   1948  N  N     . ILE C  3 78  ? -42.834 -40.276 32.783  1.00 70.58  ? 78   ILE C N     1 
ATOM   1949  C  CA    . ILE C  3 78  ? -41.801 -39.571 33.528  1.00 69.07  ? 78   ILE C CA    1 
ATOM   1950  C  C     . ILE C  3 78  ? -42.133 -38.081 33.627  1.00 67.84  ? 78   ILE C C     1 
ATOM   1951  O  O     . ILE C  3 78  ? -42.308 -37.411 32.606  1.00 67.94  ? 78   ILE C O     1 
ATOM   1952  C  CB    . ILE C  3 78  ? -40.432 -39.760 32.863  1.00 69.19  ? 78   ILE C CB    1 
ATOM   1953  C  CG1   . ILE C  3 78  ? -40.028 -41.241 32.892  1.00 68.56  ? 78   ILE C CG1   1 
ATOM   1954  C  CG2   . ILE C  3 78  ? -39.382 -38.908 33.560  1.00 70.05  ? 78   ILE C CG2   1 
ATOM   1955  C  CD1   . ILE C  3 78  ? -38.832 -41.572 32.035  1.00 67.95  ? 78   ILE C CD1   1 
ATOM   1956  N  N     . ILE C  3 79  ? -42.254 -37.578 34.854  1.00 66.19  ? 79   ILE C N     1 
ATOM   1957  C  CA    . ILE C  3 79  ? -42.400 -36.136 35.093  1.00 64.51  ? 79   ILE C CA    1 
ATOM   1958  C  C     . ILE C  3 79  ? -41.157 -35.550 35.786  1.00 63.88  ? 79   ILE C C     1 
ATOM   1959  O  O     . ILE C  3 79  ? -40.339 -36.311 36.326  1.00 64.51  ? 79   ILE C O     1 
ATOM   1960  C  CB    . ILE C  3 79  ? -43.682 -35.793 35.902  1.00 64.55  ? 79   ILE C CB    1 
ATOM   1961  C  CG1   . ILE C  3 79  ? -43.673 -36.482 37.277  1.00 63.53  ? 79   ILE C CG1   1 
ATOM   1962  C  CG2   . ILE C  3 79  ? -44.932 -36.060 35.051  1.00 64.08  ? 79   ILE C CG2   1 
ATOM   1963  C  CD1   . ILE C  3 79  ? -44.822 -36.094 38.197  1.00 63.71  ? 79   ILE C CD1   1 
ATOM   1964  N  N     . PRO C  3 80  ? -40.998 -34.205 35.770  1.00 62.52  ? 80   PRO C N     1 
ATOM   1965  C  CA    . PRO C  3 80  ? -39.847 -33.555 36.397  1.00 61.35  ? 80   PRO C CA    1 
ATOM   1966  C  C     . PRO C  3 80  ? -39.425 -34.103 37.768  1.00 60.22  ? 80   PRO C C     1 
ATOM   1967  O  O     . PRO C  3 80  ? -38.221 -34.235 38.019  1.00 59.95  ? 80   PRO C O     1 
ATOM   1968  C  CB    . PRO C  3 80  ? -40.299 -32.101 36.495  1.00 61.22  ? 80   PRO C CB    1 
ATOM   1969  C  CG    . PRO C  3 80  ? -41.075 -31.922 35.263  1.00 61.37  ? 80   PRO C CG    1 
ATOM   1970  C  CD    . PRO C  3 80  ? -41.867 -33.200 35.127  1.00 62.56  ? 80   PRO C CD    1 
ATOM   1971  N  N     . ARG C  3 81  ? -40.384 -34.437 38.630  1.00 58.81  ? 81   ARG C N     1 
ATOM   1972  C  CA    . ARG C  3 81  ? -40.047 -35.007 39.939  1.00 57.89  ? 81   ARG C CA    1 
ATOM   1973  C  C     . ARG C  3 81  ? -39.345 -36.374 39.874  1.00 57.42  ? 81   ARG C C     1 
ATOM   1974  O  O     . ARG C  3 81  ? -38.623 -36.751 40.801  1.00 57.46  ? 81   ARG C O     1 
ATOM   1975  C  CB    . ARG C  3 81  ? -41.270 -35.088 40.845  1.00 57.68  ? 81   ARG C CB    1 
ATOM   1976  C  CG    . ARG C  3 81  ? -41.177 -36.222 41.835  1.00 58.32  ? 81   ARG C CG    1 
ATOM   1977  C  CD    . ARG C  3 81  ? -41.394 -35.785 43.268  1.00 59.15  ? 81   ARG C CD    1 
ATOM   1978  N  NE    . ARG C  3 81  ? -40.259 -35.043 43.794  1.00 59.36  ? 81   ARG C NE    1 
ATOM   1979  C  CZ    . ARG C  3 81  ? -39.937 -34.966 45.085  1.00 59.66  ? 81   ARG C CZ    1 
ATOM   1980  N  NH1   . ARG C  3 81  ? -40.644 -35.596 46.014  1.00 58.17  ? 81   ARG C NH1   1 
ATOM   1981  N  NH2   . ARG C  3 81  ? -38.885 -34.255 45.448  1.00 60.92  ? 81   ARG C NH2   1 
ATOM   1982  N  N     . HIS C  3 82  ? -39.542 -37.120 38.796  1.00 56.49  ? 82   HIS C N     1 
ATOM   1983  C  CA    . HIS C  3 82  ? -38.843 -38.390 38.668  1.00 55.91  ? 82   HIS C CA    1 
ATOM   1984  C  C     . HIS C  3 82  ? -37.430 -38.151 38.201  1.00 55.42  ? 82   HIS C C     1 
ATOM   1985  O  O     . HIS C  3 82  ? -36.523 -38.940 38.515  1.00 55.55  ? 82   HIS C O     1 
ATOM   1986  C  CB    . HIS C  3 82  ? -39.575 -39.354 37.728  1.00 55.86  ? 82   HIS C CB    1 
ATOM   1987  C  CG    . HIS C  3 82  ? -41.017 -39.539 38.075  1.00 55.64  ? 82   HIS C CG    1 
ATOM   1988  N  ND1   . HIS C  3 82  ? -42.023 -39.471 37.135  1.00 55.01  ? 82   HIS C ND1   1 
ATOM   1989  C  CD2   . HIS C  3 82  ? -41.625 -39.741 39.269  1.00 54.79  ? 82   HIS C CD2   1 
ATOM   1990  C  CE1   . HIS C  3 82  ? -43.186 -39.654 37.733  1.00 55.20  ? 82   HIS C CE1   1 
ATOM   1991  N  NE2   . HIS C  3 82  ? -42.973 -39.812 39.027  1.00 55.06  ? 82   HIS C NE2   1 
ATOM   1992  N  N     . LEU C  3 83  ? -37.242 -37.075 37.437  1.00 54.61  ? 83   LEU C N     1 
ATOM   1993  C  CA    . LEU C  3 83  ? -35.895 -36.683 37.008  1.00 53.50  ? 83   LEU C CA    1 
ATOM   1994  C  C     . LEU C  3 83  ? -35.089 -36.239 38.235  1.00 53.38  ? 83   LEU C C     1 
ATOM   1995  O  O     . LEU C  3 83  ? -33.905 -36.542 38.345  1.00 53.57  ? 83   LEU C O     1 
ATOM   1996  C  CB    . LEU C  3 83  ? -35.951 -35.610 35.923  1.00 52.83  ? 83   LEU C CB    1 
ATOM   1997  C  CG    . LEU C  3 83  ? -36.491 -36.099 34.572  1.00 51.24  ? 83   LEU C CG    1 
ATOM   1998  C  CD1   . LEU C  3 83  ? -36.624 -34.981 33.572  1.00 48.43  ? 83   LEU C CD1   1 
ATOM   1999  C  CD2   . LEU C  3 83  ? -35.611 -37.185 33.994  1.00 49.30  ? 83   LEU C CD2   1 
ATOM   2000  N  N     . GLN C  3 84  ? -35.766 -35.585 39.174  1.00 52.72  ? 84   GLN C N     1 
ATOM   2001  C  CA    . GLN C  3 84  ? -35.160 -35.119 40.399  1.00 52.68  ? 84   GLN C CA    1 
ATOM   2002  C  C     . GLN C  3 84  ? -34.797 -36.281 41.319  1.00 52.70  ? 84   GLN C C     1 
ATOM   2003  O  O     . GLN C  3 84  ? -33.723 -36.303 41.903  1.00 52.53  ? 84   GLN C O     1 
ATOM   2004  C  CB    . GLN C  3 84  ? -36.105 -34.124 41.086  1.00 52.94  ? 84   GLN C CB    1 
ATOM   2005  C  CG    . GLN C  3 84  ? -35.725 -33.681 42.499  1.00 53.71  ? 84   GLN C CG    1 
ATOM   2006  C  CD    . GLN C  3 84  ? -34.564 -32.684 42.552  1.00 54.30  ? 84   GLN C CD    1 
ATOM   2007  O  OE1   . GLN C  3 84  ? -33.747 -32.600 41.635  1.00 54.62  ? 84   GLN C OE1   1 
ATOM   2008  N  NE2   . GLN C  3 84  ? -34.483 -31.938 43.649  1.00 53.69  ? 84   GLN C NE2   1 
ATOM   2009  N  N     . LEU C  3 85  ? -35.691 -37.251 41.452  1.00 53.03  ? 85   LEU C N     1 
ATOM   2010  C  CA    . LEU C  3 85  ? -35.380 -38.445 42.231  1.00 52.83  ? 85   LEU C CA    1 
ATOM   2011  C  C     . LEU C  3 85  ? -34.310 -39.262 41.531  1.00 52.74  ? 85   LEU C C     1 
ATOM   2012  O  O     . LEU C  3 85  ? -33.378 -39.718 42.171  1.00 53.15  ? 85   LEU C O     1 
ATOM   2013  C  CB    . LEU C  3 85  ? -36.621 -39.293 42.487  1.00 52.83  ? 85   LEU C CB    1 
ATOM   2014  C  CG    . LEU C  3 85  ? -37.729 -38.616 43.291  1.00 53.56  ? 85   LEU C CG    1 
ATOM   2015  C  CD1   . LEU C  3 85  ? -39.007 -39.416 43.173  1.00 55.32  ? 85   LEU C CD1   1 
ATOM   2016  C  CD2   . LEU C  3 85  ? -37.351 -38.435 44.740  1.00 55.02  ? 85   LEU C CD2   1 
ATOM   2017  N  N     . ALA C  3 86  ? -34.412 -39.435 40.223  1.00 52.61  ? 86   ALA C N     1 
ATOM   2018  C  CA    . ALA C  3 86  ? -33.348 -40.132 39.514  1.00 53.09  ? 86   ALA C CA    1 
ATOM   2019  C  C     . ALA C  3 86  ? -32.018 -39.535 39.934  1.00 53.51  ? 86   ALA C C     1 
ATOM   2020  O  O     . ALA C  3 86  ? -31.153 -40.240 40.442  1.00 54.20  ? 86   ALA C O     1 
ATOM   2021  C  CB    . ALA C  3 86  ? -33.520 -40.023 38.013  1.00 52.66  ? 86   ALA C CB    1 
ATOM   2022  N  N     . VAL C  3 87  ? -31.909 -38.218 39.762  1.00 53.88  ? 87   VAL C N     1 
ATOM   2023  C  CA    . VAL C  3 87  ? -30.672 -37.449 39.880  1.00 53.55  ? 87   VAL C CA    1 
ATOM   2024  C  C     . VAL C  3 87  ? -30.099 -37.397 41.305  1.00 53.94  ? 87   VAL C C     1 
ATOM   2025  O  O     . VAL C  3 87  ? -28.922 -37.714 41.519  1.00 53.69  ? 87   VAL C O     1 
ATOM   2026  C  CB    . VAL C  3 87  ? -30.890 -36.005 39.298  1.00 53.52  ? 87   VAL C CB    1 
ATOM   2027  C  CG1   . VAL C  3 87  ? -29.789 -35.038 39.729  1.00 52.94  ? 87   VAL C CG1   1 
ATOM   2028  C  CG2   . VAL C  3 87  ? -31.031 -36.051 37.766  1.00 52.26  ? 87   VAL C CG2   1 
ATOM   2029  N  N     . ARG C  3 88  ? -30.921 -36.997 42.270  1.00 54.28  ? 88   ARG C N     1 
ATOM   2030  C  CA    . ARG C  3 88  ? -30.445 -36.820 43.638  1.00 54.98  ? 88   ARG C CA    1 
ATOM   2031  C  C     . ARG C  3 88  ? -30.167 -38.149 44.337  1.00 55.79  ? 88   ARG C C     1 
ATOM   2032  O  O     . ARG C  3 88  ? -29.283 -38.230 45.185  1.00 55.97  ? 88   ARG C O     1 
ATOM   2033  C  CB    . ARG C  3 88  ? -31.413 -35.960 44.469  1.00 54.85  ? 88   ARG C CB    1 
ATOM   2034  C  CG    . ARG C  3 88  ? -31.725 -34.560 43.918  1.00 54.69  ? 88   ARG C CG    1 
ATOM   2035  C  CD    . ARG C  3 88  ? -30.461 -33.852 43.439  1.00 54.56  ? 88   ARG C CD    1 
ATOM   2036  N  NE    . ARG C  3 88  ? -30.741 -32.819 42.448  1.00 53.62  ? 88   ARG C NE    1 
ATOM   2037  C  CZ    . ARG C  3 88  ? -29.803 -32.123 41.806  1.00 53.66  ? 88   ARG C CZ    1 
ATOM   2038  N  NH1   . ARG C  3 88  ? -28.510 -32.368 42.037  1.00 53.13  ? 88   ARG C NH1   1 
ATOM   2039  N  NH2   . ARG C  3 88  ? -30.157 -31.188 40.924  1.00 50.74  ? 88   ARG C NH2   1 
ATOM   2040  N  N     . ASN C  3 89  ? -30.911 -39.198 43.989  1.00 56.78  ? 89   ASN C N     1 
ATOM   2041  C  CA    . ASN C  3 89  ? -30.606 -40.529 44.532  1.00 57.57  ? 89   ASN C CA    1 
ATOM   2042  C  C     . ASN C  3 89  ? -29.389 -41.220 43.913  1.00 58.32  ? 89   ASN C C     1 
ATOM   2043  O  O     . ASN C  3 89  ? -28.932 -42.215 44.443  1.00 58.75  ? 89   ASN C O     1 
ATOM   2044  C  CB    . ASN C  3 89  ? -31.834 -41.429 44.540  1.00 57.04  ? 89   ASN C CB    1 
ATOM   2045  C  CG    . ASN C  3 89  ? -32.869 -40.978 45.564  1.00 58.04  ? 89   ASN C CG    1 
ATOM   2046  O  OD1   . ASN C  3 89  ? -32.596 -40.956 46.768  1.00 59.22  ? 89   ASN C OD1   1 
ATOM   2047  N  ND2   . ASN C  3 89  ? -34.059 -40.610 45.095  1.00 56.65  ? 89   ASN C ND2   1 
ATOM   2048  N  N     . ASP C  3 90  ? -28.848 -40.682 42.822  1.00 59.38  ? 90   ASP C N     1 
ATOM   2049  C  CA    . ASP C  3 90  ? -27.646 -41.238 42.215  1.00 60.62  ? 90   ASP C CA    1 
ATOM   2050  C  C     . ASP C  3 90  ? -26.406 -40.382 42.424  1.00 61.13  ? 90   ASP C C     1 
ATOM   2051  O  O     . ASP C  3 90  ? -26.243 -39.321 41.814  1.00 61.59  ? 90   ASP C O     1 
ATOM   2052  C  CB    . ASP C  3 90  ? -27.844 -41.487 40.721  1.00 61.24  ? 90   ASP C CB    1 
ATOM   2053  C  CG    . ASP C  3 90  ? -26.534 -41.897 40.011  1.00 64.08  ? 90   ASP C CG    1 
ATOM   2054  O  OD1   . ASP C  3 90  ? -26.306 -41.432 38.875  1.00 66.11  ? 90   ASP C OD1   1 
ATOM   2055  O  OD2   . ASP C  3 90  ? -25.722 -42.673 40.585  1.00 67.31  ? 90   ASP C OD2   1 
ATOM   2056  N  N     . GLU C  3 91  ? -25.506 -40.901 43.244  1.00 61.72  ? 91   GLU C N     1 
ATOM   2057  C  CA    . GLU C  3 91  ? -24.269 -40.234 43.638  1.00 61.95  ? 91   GLU C CA    1 
ATOM   2058  C  C     . GLU C  3 91  ? -23.566 -39.466 42.521  1.00 61.28  ? 91   GLU C C     1 
ATOM   2059  O  O     . GLU C  3 91  ? -23.158 -38.330 42.710  1.00 61.49  ? 91   GLU C O     1 
ATOM   2060  C  CB    . GLU C  3 91  ? -23.309 -41.273 44.220  1.00 62.36  ? 91   GLU C CB    1 
ATOM   2061  C  CG    . GLU C  3 91  ? -22.388 -40.747 45.297  1.00 66.29  ? 91   GLU C CG    1 
ATOM   2062  C  CD    . GLU C  3 91  ? -21.049 -41.485 45.367  1.00 71.86  ? 91   GLU C CD    1 
ATOM   2063  O  OE1   . GLU C  3 91  ? -20.704 -42.269 44.434  1.00 73.88  ? 91   GLU C OE1   1 
ATOM   2064  O  OE2   . GLU C  3 91  ? -20.331 -41.265 46.369  1.00 73.98  ? 91   GLU C OE2   1 
ATOM   2065  N  N     . GLU C  3 92  ? -23.423 -40.082 41.356  1.00 60.91  ? 92   GLU C N     1 
ATOM   2066  C  CA    . GLU C  3 92  ? -22.550 -39.523 40.327  1.00 60.21  ? 92   GLU C CA    1 
ATOM   2067  C  C     . GLU C  3 92  ? -23.240 -38.457 39.478  1.00 59.35  ? 92   GLU C C     1 
ATOM   2068  O  O     . GLU C  3 92  ? -22.608 -37.508 39.028  1.00 59.38  ? 92   GLU C O     1 
ATOM   2069  C  CB    . GLU C  3 92  ? -21.953 -40.637 39.471  1.00 60.17  ? 92   GLU C CB    1 
ATOM   2070  C  CG    . GLU C  3 92  ? -20.922 -41.458 40.231  1.00 62.45  ? 92   GLU C CG    1 
ATOM   2071  C  CD    . GLU C  3 92  ? -20.022 -42.287 39.325  1.00 66.86  ? 92   GLU C CD    1 
ATOM   2072  O  OE1   . GLU C  3 92  ? -20.508 -42.724 38.248  1.00 68.98  ? 92   GLU C OE1   1 
ATOM   2073  O  OE2   . GLU C  3 92  ? -18.833 -42.507 39.692  1.00 67.46  ? 92   GLU C OE2   1 
ATOM   2074  N  N     . LEU C  3 93  ? -24.541 -38.616 39.270  1.00 58.17  ? 93   LEU C N     1 
ATOM   2075  C  CA    . LEU C  3 93  ? -25.304 -37.633 38.531  1.00 56.79  ? 93   LEU C CA    1 
ATOM   2076  C  C     . LEU C  3 93  ? -25.581 -36.425 39.419  1.00 56.20  ? 93   LEU C C     1 
ATOM   2077  O  O     . LEU C  3 93  ? -25.591 -35.286 38.949  1.00 55.80  ? 93   LEU C O     1 
ATOM   2078  C  CB    . LEU C  3 93  ? -26.610 -38.240 38.019  1.00 56.53  ? 93   LEU C CB    1 
ATOM   2079  C  CG    . LEU C  3 93  ? -26.501 -39.119 36.785  1.00 55.28  ? 93   LEU C CG    1 
ATOM   2080  C  CD1   . LEU C  3 93  ? -27.858 -39.724 36.529  1.00 56.28  ? 93   LEU C CD1   1 
ATOM   2081  C  CD2   . LEU C  3 93  ? -25.995 -38.371 35.556  1.00 53.79  ? 93   LEU C CD2   1 
ATOM   2082  N  N     . ASN C  3 94  ? -25.813 -36.691 40.703  1.00 55.26  ? 94   ASN C N     1 
ATOM   2083  C  CA    . ASN C  3 94  ? -25.934 -35.643 41.698  1.00 54.43  ? 94   ASN C CA    1 
ATOM   2084  C  C     . ASN C  3 94  ? -24.741 -34.713 41.645  1.00 54.01  ? 94   ASN C C     1 
ATOM   2085  O  O     . ASN C  3 94  ? -24.894 -33.501 41.756  1.00 54.58  ? 94   ASN C O     1 
ATOM   2086  C  CB    . ASN C  3 94  ? -26.047 -36.237 43.091  1.00 54.56  ? 94   ASN C CB    1 
ATOM   2087  C  CG    . ASN C  3 94  ? -26.346 -35.202 44.139  1.00 53.89  ? 94   ASN C CG    1 
ATOM   2088  O  OD1   . ASN C  3 94  ? -27.124 -34.281 43.915  1.00 55.48  ? 94   ASN C OD1   1 
ATOM   2089  N  ND2   . ASN C  3 94  ? -25.734 -35.351 45.294  1.00 53.41  ? 94   ASN C ND2   1 
ATOM   2090  N  N     . LYS C  3 95  ? -23.558 -35.278 41.450  1.00 52.98  ? 95   LYS C N     1 
ATOM   2091  C  CA    . LYS C  3 95  ? -22.364 -34.474 41.317  1.00 52.70  ? 95   LYS C CA    1 
ATOM   2092  C  C     . LYS C  3 95  ? -22.427 -33.653 40.040  1.00 51.96  ? 95   LYS C C     1 
ATOM   2093  O  O     . LYS C  3 95  ? -22.270 -32.436 40.088  1.00 52.23  ? 95   LYS C O     1 
ATOM   2094  C  CB    . LYS C  3 95  ? -21.125 -35.356 41.302  1.00 53.05  ? 95   LYS C CB    1 
ATOM   2095  C  CG    . LYS C  3 95  ? -19.959 -34.794 42.091  1.00 55.25  ? 95   LYS C CG    1 
ATOM   2096  C  CD    . LYS C  3 95  ? -18.870 -35.868 42.275  1.00 59.35  ? 95   LYS C CD    1 
ATOM   2097  C  CE    . LYS C  3 95  ? -19.346 -37.017 43.177  1.00 60.25  ? 95   LYS C CE    1 
ATOM   2098  N  NZ    . LYS C  3 95  ? -18.609 -38.278 42.885  1.00 61.68  ? 95   LYS C NZ    1 
ATOM   2099  N  N     . LEU C  3 96  ? -22.660 -34.332 38.913  1.00 50.66  ? 96   LEU C N     1 
ATOM   2100  C  CA    . LEU C  3 96  ? -22.732 -33.718 37.590  1.00 49.09  ? 96   LEU C CA    1 
ATOM   2101  C  C     . LEU C  3 96  ? -23.714 -32.538 37.538  1.00 49.30  ? 96   LEU C C     1 
ATOM   2102  O  O     . LEU C  3 96  ? -23.484 -31.561 36.811  1.00 49.37  ? 96   LEU C O     1 
ATOM   2103  C  CB    . LEU C  3 96  ? -23.132 -34.768 36.550  1.00 48.68  ? 96   LEU C CB    1 
ATOM   2104  C  CG    . LEU C  3 96  ? -23.060 -34.347 35.076  1.00 48.46  ? 96   LEU C CG    1 
ATOM   2105  C  CD1   . LEU C  3 96  ? -21.657 -33.869 34.741  1.00 47.76  ? 96   LEU C CD1   1 
ATOM   2106  C  CD2   . LEU C  3 96  ? -23.505 -35.447 34.123  1.00 47.86  ? 96   LEU C CD2   1 
ATOM   2107  N  N     . LEU C  3 97  ? -24.797 -32.644 38.309  1.00 48.68  ? 97   LEU C N     1 
ATOM   2108  C  CA    . LEU C  3 97  ? -25.844 -31.643 38.336  1.00 48.35  ? 97   LEU C CA    1 
ATOM   2109  C  C     . LEU C  3 97  ? -25.902 -30.967 39.713  1.00 48.84  ? 97   LEU C C     1 
ATOM   2110  O  O     . LEU C  3 97  ? -26.988 -30.575 40.190  1.00 48.61  ? 97   LEU C O     1 
ATOM   2111  C  CB    . LEU C  3 97  ? -27.195 -32.266 37.972  1.00 47.81  ? 97   LEU C CB    1 
ATOM   2112  C  CG    . LEU C  3 97  ? -27.280 -32.944 36.600  1.00 46.80  ? 97   LEU C CG    1 
ATOM   2113  C  CD1   . LEU C  3 97  ? -28.698 -33.332 36.298  1.00 44.53  ? 97   LEU C CD1   1 
ATOM   2114  C  CD2   . LEU C  3 97  ? -26.691 -32.103 35.483  1.00 45.21  ? 97   LEU C CD2   1 
ATOM   2115  N  N     . GLY C  3 98  ? -24.724 -30.829 40.328  1.00 48.38  ? 98   GLY C N     1 
ATOM   2116  C  CA    . GLY C  3 98  ? -24.585 -30.219 41.636  1.00 48.81  ? 98   GLY C CA    1 
ATOM   2117  C  C     . GLY C  3 98  ? -25.112 -28.809 41.683  1.00 49.43  ? 98   GLY C C     1 
ATOM   2118  O  O     . GLY C  3 98  ? -25.771 -28.434 42.650  1.00 49.60  ? 98   GLY C O     1 
ATOM   2119  N  N     . ARG C  3 99  ? -24.849 -28.048 40.618  1.00 50.24  ? 99   ARG C N     1 
ATOM   2120  C  CA    . ARG C  3 99  ? -25.225 -26.631 40.504  1.00 50.68  ? 99   ARG C CA    1 
ATOM   2121  C  C     . ARG C  3 99  ? -26.452 -26.382 39.586  1.00 50.95  ? 99   ARG C C     1 
ATOM   2122  O  O     . ARG C  3 99  ? -26.574 -25.329 38.958  1.00 51.37  ? 99   ARG C O     1 
ATOM   2123  C  CB    . ARG C  3 99  ? -24.020 -25.837 40.000  1.00 50.96  ? 99   ARG C CB    1 
ATOM   2124  C  CG    . ARG C  3 99  ? -22.775 -25.887 40.896  1.00 53.96  ? 99   ARG C CG    1 
ATOM   2125  C  CD    . ARG C  3 99  ? -23.118 -25.442 42.325  1.00 61.91  ? 99   ARG C CD    1 
ATOM   2126  N  NE    . ARG C  3 99  ? -21.943 -25.247 43.184  1.00 67.27  ? 99   ARG C NE    1 
ATOM   2127  C  CZ    . ARG C  3 99  ? -21.971 -24.680 44.397  1.00 69.62  ? 99   ARG C CZ    1 
ATOM   2128  N  NH1   . ARG C  3 99  ? -23.119 -24.225 44.909  1.00 71.63  ? 99   ARG C NH1   1 
ATOM   2129  N  NH2   . ARG C  3 99  ? -20.847 -24.564 45.100  1.00 68.05  ? 99   ARG C NH2   1 
ATOM   2130  N  N     . VAL C  3 100 ? -27.367 -27.351 39.517  1.00 50.92  ? 100  VAL C N     1 
ATOM   2131  C  CA    . VAL C  3 100 ? -28.521 -27.269 38.633  1.00 50.39  ? 100  VAL C CA    1 
ATOM   2132  C  C     . VAL C  3 100 ? -29.775 -27.412 39.440  1.00 50.56  ? 100  VAL C C     1 
ATOM   2133  O  O     . VAL C  3 100 ? -29.801 -28.141 40.407  1.00 50.68  ? 100  VAL C O     1 
ATOM   2134  C  CB    . VAL C  3 100 ? -28.509 -28.360 37.565  1.00 50.17  ? 100  VAL C CB    1 
ATOM   2135  C  CG1   . VAL C  3 100 ? -29.787 -28.339 36.793  1.00 49.80  ? 100  VAL C CG1   1 
ATOM   2136  C  CG2   . VAL C  3 100 ? -27.359 -28.141 36.603  1.00 50.83  ? 100  VAL C CG2   1 
ATOM   2137  N  N     . THR C  3 101 ? -30.812 -26.677 39.072  1.00 51.41  ? 101  THR C N     1 
ATOM   2138  C  CA    . THR C  3 101 ? -32.107 -26.930 39.647  1.00 52.45  ? 101  THR C CA    1 
ATOM   2139  C  C     . THR C  3 101 ? -33.062 -27.365 38.542  1.00 52.99  ? 101  THR C C     1 
ATOM   2140  O  O     . THR C  3 101 ? -33.091 -26.791 37.450  1.00 53.02  ? 101  THR C O     1 
ATOM   2141  C  CB    . THR C  3 101 ? -32.697 -25.737 40.422  1.00 52.56  ? 101  THR C CB    1 
ATOM   2142  O  OG1   . THR C  3 101 ? -33.696 -25.109 39.617  1.00 53.99  ? 101  THR C OG1   1 
ATOM   2143  C  CG2   . THR C  3 101 ? -31.621 -24.731 40.846  1.00 52.19  ? 101  THR C CG2   1 
ATOM   2144  N  N     . ILE C  3 102 ? -33.819 -28.407 38.852  1.00 53.52  ? 102  ILE C N     1 
ATOM   2145  C  CA    . ILE C  3 102 ? -34.767 -28.991 37.946  1.00 53.93  ? 102  ILE C CA    1 
ATOM   2146  C  C     . ILE C  3 102 ? -36.099 -28.387 38.339  1.00 54.60  ? 102  ILE C C     1 
ATOM   2147  O  O     . ILE C  3 102 ? -36.625 -28.676 39.409  1.00 54.56  ? 102  ILE C O     1 
ATOM   2148  C  CB    . ILE C  3 102 ? -34.751 -30.534 38.099  1.00 53.83  ? 102  ILE C CB    1 
ATOM   2149  C  CG1   . ILE C  3 102 ? -33.406 -31.084 37.609  1.00 53.33  ? 102  ILE C CG1   1 
ATOM   2150  C  CG2   . ILE C  3 102 ? -35.913 -31.171 37.364  1.00 53.32  ? 102  ILE C CG2   1 
ATOM   2151  C  CD1   . ILE C  3 102 ? -33.095 -32.509 38.056  1.00 52.22  ? 102  ILE C CD1   1 
ATOM   2152  N  N     . ALA C  3 103 ? -36.630 -27.500 37.504  1.00 55.90  ? 103  ALA C N     1 
ATOM   2153  C  CA    . ALA C  3 103 ? -37.888 -26.846 37.849  1.00 57.17  ? 103  ALA C CA    1 
ATOM   2154  C  C     . ALA C  3 103 ? -38.875 -27.949 38.179  1.00 58.15  ? 103  ALA C C     1 
ATOM   2155  O  O     . ALA C  3 103 ? -38.808 -29.035 37.583  1.00 59.31  ? 103  ALA C O     1 
ATOM   2156  C  CB    . ALA C  3 103 ? -38.399 -25.989 36.708  1.00 56.69  ? 103  ALA C CB    1 
ATOM   2157  N  N     . GLN C  3 104 ? -39.757 -27.692 39.144  1.00 58.47  ? 104  GLN C N     1 
ATOM   2158  C  CA    . GLN C  3 104 ? -40.834 -28.619 39.482  1.00 58.86  ? 104  GLN C CA    1 
ATOM   2159  C  C     . GLN C  3 104 ? -40.334 -29.989 39.950  1.00 58.71  ? 104  GLN C C     1 
ATOM   2160  O  O     . GLN C  3 104 ? -41.026 -30.973 39.827  1.00 59.07  ? 104  GLN C O     1 
ATOM   2161  C  CB    . GLN C  3 104 ? -41.812 -28.761 38.306  1.00 58.71  ? 104  GLN C CB    1 
ATOM   2162  C  CG    . GLN C  3 104 ? -42.792 -27.596 38.166  1.00 61.03  ? 104  GLN C CG    1 
ATOM   2163  C  CD    . GLN C  3 104 ? -43.453 -27.195 39.502  1.00 64.20  ? 104  GLN C CD    1 
ATOM   2164  O  OE1   . GLN C  3 104 ? -44.243 -27.958 40.088  1.00 64.88  ? 104  GLN C OE1   1 
ATOM   2165  N  NE2   . GLN C  3 104 ? -43.120 -25.994 39.989  1.00 64.78  ? 104  GLN C NE2   1 
ATOM   2166  N  N     . GLY C  3 105 ? -39.134 -30.047 40.504  1.00 58.72  ? 105  GLY C N     1 
ATOM   2167  C  CA    . GLY C  3 105 ? -38.604 -31.300 40.999  1.00 58.31  ? 105  GLY C CA    1 
ATOM   2168  C  C     . GLY C  3 105 ? -38.817 -31.546 42.481  1.00 58.22  ? 105  GLY C C     1 
ATOM   2169  O  O     . GLY C  3 105 ? -38.830 -32.706 42.922  1.00 58.68  ? 105  GLY C O     1 
ATOM   2170  N  N     . GLY C  3 106 ? -38.963 -30.474 43.257  1.00 57.57  ? 106  GLY C N     1 
ATOM   2171  C  CA    . GLY C  3 106 ? -38.994 -30.583 44.719  1.00 57.46  ? 106  GLY C CA    1 
ATOM   2172  C  C     . GLY C  3 106 ? -37.699 -31.098 45.332  1.00 57.53  ? 106  GLY C C     1 
ATOM   2173  O  O     . GLY C  3 106 ? -36.645 -31.064 44.708  1.00 57.53  ? 106  GLY C O     1 
ATOM   2174  N  N     . VAL C  3 107 ? -37.775 -31.605 46.555  1.00 58.14  ? 107  VAL C N     1 
ATOM   2175  C  CA    . VAL C  3 107 ? -36.584 -32.126 47.244  1.00 58.50  ? 107  VAL C CA    1 
ATOM   2176  C  C     . VAL C  3 107 ? -36.717 -33.593 47.655  1.00 58.58  ? 107  VAL C C     1 
ATOM   2177  O  O     . VAL C  3 107 ? -37.829 -34.071 47.820  1.00 58.72  ? 107  VAL C O     1 
ATOM   2178  C  CB    . VAL C  3 107 ? -36.279 -31.281 48.506  1.00 58.65  ? 107  VAL C CB    1 
ATOM   2179  C  CG1   . VAL C  3 107 ? -35.855 -29.868 48.119  1.00 58.04  ? 107  VAL C CG1   1 
ATOM   2180  C  CG2   . VAL C  3 107 ? -37.479 -31.246 49.437  1.00 58.25  ? 107  VAL C CG2   1 
ATOM   2181  N  N     . LEU C  3 108 ? -35.599 -34.300 47.836  1.00 59.07  ? 108  LEU C N     1 
ATOM   2182  C  CA    . LEU C  3 108 ? -35.628 -35.633 48.478  1.00 59.54  ? 108  LEU C CA    1 
ATOM   2183  C  C     . LEU C  3 108 ? -36.219 -35.542 49.879  1.00 60.37  ? 108  LEU C C     1 
ATOM   2184  O  O     . LEU C  3 108 ? -35.841 -34.655 50.652  1.00 61.12  ? 108  LEU C O     1 
ATOM   2185  C  CB    . LEU C  3 108 ? -34.233 -36.252 48.606  1.00 58.97  ? 108  LEU C CB    1 
ATOM   2186  C  CG    . LEU C  3 108 ? -33.432 -36.739 47.401  1.00 58.59  ? 108  LEU C CG    1 
ATOM   2187  C  CD1   . LEU C  3 108 ? -32.242 -37.604 47.827  1.00 57.34  ? 108  LEU C CD1   1 
ATOM   2188  C  CD2   . LEU C  3 108 ? -34.296 -37.473 46.399  1.00 58.51  ? 108  LEU C CD2   1 
ATOM   2189  N  N     . PRO C  3 109 ? -37.163 -36.438 50.213  1.00 61.09  ? 109  PRO C N     1 
ATOM   2190  C  CA    . PRO C  3 109 ? -37.578 -36.553 51.608  1.00 61.64  ? 109  PRO C CA    1 
ATOM   2191  C  C     . PRO C  3 109 ? -36.388 -36.837 52.525  1.00 62.12  ? 109  PRO C C     1 
ATOM   2192  O  O     . PRO C  3 109 ? -35.736 -37.860 52.375  1.00 62.49  ? 109  PRO C O     1 
ATOM   2193  C  CB    . PRO C  3 109 ? -38.542 -37.745 51.580  1.00 61.34  ? 109  PRO C CB    1 
ATOM   2194  C  CG    . PRO C  3 109 ? -39.118 -37.705 50.209  1.00 61.06  ? 109  PRO C CG    1 
ATOM   2195  C  CD    . PRO C  3 109 ? -37.937 -37.349 49.346  1.00 61.24  ? 109  PRO C CD    1 
ATOM   2196  N  N     . ASN C  3 110 ? -36.109 -35.909 53.438  1.00 62.83  ? 110  ASN C N     1 
ATOM   2197  C  CA    . ASN C  3 110 ? -35.058 -36.044 54.439  1.00 63.70  ? 110  ASN C CA    1 
ATOM   2198  C  C     . ASN C  3 110 ? -35.455 -35.253 55.694  1.00 63.96  ? 110  ASN C C     1 
ATOM   2199  O  O     . ASN C  3 110 ? -35.784 -34.067 55.594  1.00 64.08  ? 110  ASN C O     1 
ATOM   2200  C  CB    . ASN C  3 110 ? -33.735 -35.522 53.865  1.00 64.07  ? 110  ASN C CB    1 
ATOM   2201  C  CG    . ASN C  3 110 ? -32.505 -36.043 54.615  1.00 65.67  ? 110  ASN C CG    1 
ATOM   2202  O  OD1   . ASN C  3 110 ? -32.456 -37.194 55.056  1.00 68.04  ? 110  ASN C OD1   1 
ATOM   2203  N  ND2   . ASN C  3 110 ? -31.491 -35.192 54.738  1.00 67.10  ? 110  ASN C ND2   1 
ATOM   2204  N  N     . ILE C  3 111 ? -35.485 -35.922 56.852  1.00 64.27  ? 111  ILE C N     1 
ATOM   2205  C  CA    . ILE C  3 111 ? -35.699 -35.261 58.155  1.00 64.80  ? 111  ILE C CA    1 
ATOM   2206  C  C     . ILE C  3 111 ? -34.603 -35.698 59.117  1.00 65.39  ? 111  ILE C C     1 
ATOM   2207  O  O     . ILE C  3 111 ? -34.398 -36.889 59.327  1.00 65.85  ? 111  ILE C O     1 
ATOM   2208  C  CB    . ILE C  3 111 ? -37.070 -35.587 58.833  1.00 64.57  ? 111  ILE C CB    1 
ATOM   2209  C  CG1   . ILE C  3 111 ? -38.259 -35.311 57.918  1.00 65.00  ? 111  ILE C CG1   1 
ATOM   2210  C  CG2   . ILE C  3 111 ? -37.243 -34.783 60.106  1.00 63.62  ? 111  ILE C CG2   1 
ATOM   2211  C  CD1   . ILE C  3 111 ? -38.838 -36.560 57.267  1.00 67.25  ? 111  ILE C CD1   1 
ATOM   2212  N  N     . GLN C  3 112 ? -33.916 -34.736 59.714  1.00 66.18  ? 112  GLN C N     1 
ATOM   2213  C  CA    . GLN C  3 112 ? -32.783 -35.039 60.577  1.00 66.97  ? 112  GLN C CA    1 
ATOM   2214  C  C     . GLN C  3 112 ? -33.222 -35.790 61.832  1.00 67.33  ? 112  GLN C C     1 
ATOM   2215  O  O     . GLN C  3 112 ? -34.236 -35.454 62.447  1.00 67.40  ? 112  GLN C O     1 
ATOM   2216  C  CB    . GLN C  3 112 ? -32.015 -33.760 60.949  1.00 66.77  ? 112  GLN C CB    1 
ATOM   2217  C  CG    . GLN C  3 112 ? -31.634 -32.885 59.761  1.00 67.41  ? 112  GLN C CG    1 
ATOM   2218  C  CD    . GLN C  3 112 ? -30.550 -33.483 58.882  1.00 68.72  ? 112  GLN C CD    1 
ATOM   2219  O  OE1   . GLN C  3 112 ? -29.442 -33.752 59.340  1.00 70.36  ? 112  GLN C OE1   1 
ATOM   2220  N  NE2   . GLN C  3 112 ? -30.859 -33.671 57.600  1.00 68.61  ? 112  GLN C NE2   1 
ATOM   2221  N  N     . SER C  3 113 ? -32.435 -36.803 62.191  1.00 67.77  ? 113  SER C N     1 
ATOM   2222  C  CA    . SER C  3 113 ? -32.626 -37.607 63.399  1.00 68.09  ? 113  SER C CA    1 
ATOM   2223  C  C     . SER C  3 113 ? -33.161 -36.848 64.609  1.00 68.17  ? 113  SER C C     1 
ATOM   2224  O  O     . SER C  3 113 ? -34.204 -37.214 65.147  1.00 68.67  ? 113  SER C O     1 
ATOM   2225  C  CB    . SER C  3 113 ? -31.315 -38.296 63.781  1.00 68.11  ? 113  SER C CB    1 
ATOM   2226  O  OG    . SER C  3 113 ? -30.765 -38.996 62.676  1.00 69.05  ? 113  SER C OG    1 
ATOM   2227  N  N     . VAL C  3 114 ? -32.460 -35.799 65.033  1.00 68.20  ? 114  VAL C N     1 
ATOM   2228  C  CA    . VAL C  3 114 ? -32.808 -35.085 66.280  1.00 68.49  ? 114  VAL C CA    1 
ATOM   2229  C  C     . VAL C  3 114 ? -34.175 -34.384 66.287  1.00 68.64  ? 114  VAL C C     1 
ATOM   2230  O  O     . VAL C  3 114 ? -34.615 -33.900 67.327  1.00 68.43  ? 114  VAL C O     1 
ATOM   2231  C  CB    . VAL C  3 114 ? -31.700 -34.075 66.729  1.00 68.32  ? 114  VAL C CB    1 
ATOM   2232  C  CG1   . VAL C  3 114 ? -30.403 -34.816 67.089  1.00 69.31  ? 114  VAL C CG1   1 
ATOM   2233  C  CG2   . VAL C  3 114 ? -31.450 -33.014 65.663  1.00 67.82  ? 114  VAL C CG2   1 
ATOM   2234  N  N     . LEU C  3 115 ? -34.833 -34.326 65.132  1.00 69.21  ? 115  LEU C N     1 
ATOM   2235  C  CA    . LEU C  3 115 ? -36.114 -33.634 65.007  1.00 69.81  ? 115  LEU C CA    1 
ATOM   2236  C  C     . LEU C  3 115 ? -37.273 -34.586 65.229  1.00 71.16  ? 115  LEU C C     1 
ATOM   2237  O  O     . LEU C  3 115 ? -38.386 -34.163 65.544  1.00 71.03  ? 115  LEU C O     1 
ATOM   2238  C  CB    . LEU C  3 115 ? -36.237 -32.957 63.641  1.00 69.32  ? 115  LEU C CB    1 
ATOM   2239  C  CG    . LEU C  3 115 ? -35.314 -31.784 63.291  1.00 67.81  ? 115  LEU C CG    1 
ATOM   2240  C  CD1   . LEU C  3 115 ? -35.721 -31.223 61.941  1.00 65.62  ? 115  LEU C CD1   1 
ATOM   2241  C  CD2   . LEU C  3 115 ? -35.329 -30.700 64.361  1.00 65.93  ? 115  LEU C CD2   1 
ATOM   2242  N  N     . LEU C  3 116 ? -36.991 -35.875 65.056  1.00 73.00  ? 116  LEU C N     1 
ATOM   2243  C  CA    . LEU C  3 116 ? -37.955 -36.946 65.267  1.00 74.68  ? 116  LEU C CA    1 
ATOM   2244  C  C     . LEU C  3 116 ? -38.168 -37.220 66.752  1.00 76.06  ? 116  LEU C C     1 
ATOM   2245  O  O     . LEU C  3 116 ? -37.238 -37.087 67.545  1.00 76.11  ? 116  LEU C O     1 
ATOM   2246  C  CB    . LEU C  3 116 ? -37.470 -38.222 64.580  1.00 74.50  ? 116  LEU C CB    1 
ATOM   2247  C  CG    . LEU C  3 116 ? -37.134 -38.148 63.096  1.00 74.51  ? 116  LEU C CG    1 
ATOM   2248  C  CD1   . LEU C  3 116 ? -36.329 -39.370 62.698  1.00 75.48  ? 116  LEU C CD1   1 
ATOM   2249  C  CD2   . LEU C  3 116 ? -38.378 -38.038 62.257  1.00 74.73  ? 116  LEU C CD2   1 
ATOM   2250  N  N     . PRO C  3 117 ? -39.393 -37.627 67.131  1.00 77.73  ? 117  PRO C N     1 
ATOM   2251  C  CA    . PRO C  3 117 ? -39.664 -37.930 68.536  1.00 79.04  ? 117  PRO C CA    1 
ATOM   2252  C  C     . PRO C  3 117 ? -39.041 -39.250 68.941  1.00 80.43  ? 117  PRO C C     1 
ATOM   2253  O  O     . PRO C  3 117 ? -38.869 -40.137 68.096  1.00 80.56  ? 117  PRO C O     1 
ATOM   2254  C  CB    . PRO C  3 117 ? -41.188 -38.029 68.592  1.00 79.05  ? 117  PRO C CB    1 
ATOM   2255  C  CG    . PRO C  3 117 ? -41.597 -38.407 67.210  1.00 78.59  ? 117  PRO C CG    1 
ATOM   2256  C  CD    . PRO C  3 117 ? -40.581 -37.827 66.276  1.00 77.91  ? 117  PRO C CD    1 
ATOM   2257  N  N     . LYS C  3 118 ? -38.700 -39.371 70.223  1.00 82.10  ? 118  LYS C N     1 
ATOM   2258  C  CA    . LYS C  3 118 ? -38.113 -40.605 70.757  1.00 83.60  ? 118  LYS C CA    1 
ATOM   2259  C  C     . LYS C  3 118 ? -39.169 -41.698 70.973  1.00 83.68  ? 118  LYS C C     1 
ATOM   2260  O  O     . LYS C  3 118 ? -39.025 -42.818 70.472  1.00 84.07  ? 118  LYS C O     1 
ATOM   2261  C  CB    . LYS C  3 118 ? -37.344 -40.328 72.064  1.00 84.22  ? 118  LYS C CB    1 
ATOM   2262  C  CG    . LYS C  3 118 ? -36.554 -41.534 72.647  1.00 86.02  ? 118  LYS C CG    1 
ATOM   2263  C  CD    . LYS C  3 118 ? -35.376 -41.941 71.753  1.00 88.78  ? 118  LYS C CD    1 
ATOM   2264  C  CE    . LYS C  3 118 ? -35.756 -43.111 70.848  1.00 90.65  ? 118  LYS C CE    1 
ATOM   2265  N  NZ    . LYS C  3 118 ? -35.141 -42.983 69.495  1.00 92.38  ? 118  LYS C NZ    1 
ATOM   2266  N  N     . LYS D  4 24  ? -48.234 -19.686 5.574   1.00 120.52 ? 24   LYS D N     1 
ATOM   2267  C  CA    . LYS D  4 24  ? -47.223 -19.566 4.483   1.00 120.52 ? 24   LYS D CA    1 
ATOM   2268  C  C     . LYS D  4 24  ? -46.769 -18.116 4.277   1.00 120.43 ? 24   LYS D C     1 
ATOM   2269  O  O     . LYS D  4 24  ? -47.345 -17.190 4.869   1.00 120.41 ? 24   LYS D O     1 
ATOM   2270  C  CB    . LYS D  4 24  ? -47.763 -20.165 3.171   1.00 120.67 ? 24   LYS D CB    1 
ATOM   2271  C  CG    . LYS D  4 24  ? -47.854 -21.709 3.130   1.00 120.89 ? 24   LYS D CG    1 
ATOM   2272  C  CD    . LYS D  4 24  ? -46.512 -22.406 3.429   1.00 121.36 ? 24   LYS D CD    1 
ATOM   2273  C  CE    . LYS D  4 24  ? -45.400 -22.011 2.444   1.00 121.33 ? 24   LYS D CE    1 
ATOM   2274  N  NZ    . LYS D  4 24  ? -44.038 -22.348 2.961   1.00 120.96 ? 24   LYS D NZ    1 
ATOM   2275  N  N     . LYS D  4 25  ? -45.740 -17.937 3.441   1.00 120.21 ? 25   LYS D N     1 
ATOM   2276  C  CA    . LYS D  4 25  ? -45.100 -16.631 3.178   1.00 120.00 ? 25   LYS D CA    1 
ATOM   2277  C  C     . LYS D  4 25  ? -44.386 -16.083 4.423   1.00 119.65 ? 25   LYS D C     1 
ATOM   2278  O  O     . LYS D  4 25  ? -43.160 -15.953 4.425   1.00 119.85 ? 25   LYS D O     1 
ATOM   2279  C  CB    . LYS D  4 25  ? -46.093 -15.611 2.575   1.00 120.20 ? 25   LYS D CB    1 
ATOM   2280  C  CG    . LYS D  4 25  ? -45.477 -14.385 1.862   1.00 120.42 ? 25   LYS D CG    1 
ATOM   2281  C  CD    . LYS D  4 25  ? -44.600 -14.758 0.656   1.00 120.76 ? 25   LYS D CD    1 
ATOM   2282  C  CE    . LYS D  4 25  ? -43.112 -14.686 1.018   1.00 121.01 ? 25   LYS D CE    1 
ATOM   2283  N  NZ    . LYS D  4 25  ? -42.289 -15.676 0.245   1.00 121.09 ? 25   LYS D NZ    1 
ATOM   2284  N  N     . ARG D  4 26  ? -45.147 -15.765 5.472   1.00 119.04 ? 26   ARG D N     1 
ATOM   2285  C  CA    . ARG D  4 26  ? -44.562 -15.461 6.779   1.00 118.48 ? 26   ARG D CA    1 
ATOM   2286  C  C     . ARG D  4 26  ? -44.522 -16.727 7.650   1.00 118.00 ? 26   ARG D C     1 
ATOM   2287  O  O     . ARG D  4 26  ? -45.559 -17.176 8.171   1.00 117.92 ? 26   ARG D O     1 
ATOM   2288  C  CB    . ARG D  4 26  ? -45.316 -14.321 7.480   1.00 118.54 ? 26   ARG D CB    1 
ATOM   2289  C  CG    . ARG D  4 26  ? -44.754 -13.962 8.856   1.00 118.59 ? 26   ARG D CG    1 
ATOM   2290  C  CD    . ARG D  4 26  ? -45.190 -12.581 9.323   1.00 118.96 ? 26   ARG D CD    1 
ATOM   2291  N  NE    . ARG D  4 26  ? -44.584 -11.507 8.535   1.00 119.35 ? 26   ARG D NE    1 
ATOM   2292  C  CZ    . ARG D  4 26  ? -44.468 -10.243 8.942   1.00 119.74 ? 26   ARG D CZ    1 
ATOM   2293  N  NH1   . ARG D  4 26  ? -44.902 -9.880  10.142  1.00 119.91 ? 26   ARG D NH1   1 
ATOM   2294  N  NH2   . ARG D  4 26  ? -43.907 -9.338  8.150   1.00 119.82 ? 26   ARG D NH2   1 
ATOM   2295  N  N     . ARG D  4 27  ? -43.318 -17.289 7.793   1.00 117.15 ? 27   ARG D N     1 
ATOM   2296  C  CA    . ARG D  4 27  ? -43.089 -18.533 8.545   1.00 116.22 ? 27   ARG D CA    1 
ATOM   2297  C  C     . ARG D  4 27  ? -42.758 -18.262 10.021  1.00 115.19 ? 27   ARG D C     1 
ATOM   2298  O  O     . ARG D  4 27  ? -41.900 -17.433 10.331  1.00 115.10 ? 27   ARG D O     1 
ATOM   2299  C  CB    . ARG D  4 27  ? -41.986 -19.371 7.863   1.00 116.44 ? 27   ARG D CB    1 
ATOM   2300  C  CG    . ARG D  4 27  ? -41.629 -20.709 8.545   1.00 117.14 ? 27   ARG D CG    1 
ATOM   2301  C  CD    . ARG D  4 27  ? -42.851 -21.606 8.791   1.00 118.17 ? 27   ARG D CD    1 
ATOM   2302  N  NE    . ARG D  4 27  ? -43.439 -22.129 7.556   1.00 118.80 ? 27   ARG D NE    1 
ATOM   2303  C  CZ    . ARG D  4 27  ? -43.496 -23.419 7.227   1.00 119.23 ? 27   ARG D CZ    1 
ATOM   2304  N  NH1   . ARG D  4 27  ? -43.008 -24.351 8.040   1.00 119.29 ? 27   ARG D NH1   1 
ATOM   2305  N  NH2   . ARG D  4 27  ? -44.054 -23.781 6.078   1.00 119.71 ? 27   ARG D NH2   1 
ATOM   2306  N  N     . LYS D  4 28  ? -43.438 -18.979 10.917  1.00 113.97 ? 28   LYS D N     1 
ATOM   2307  C  CA    . LYS D  4 28  ? -43.338 -18.755 12.369  1.00 112.79 ? 28   LYS D CA    1 
ATOM   2308  C  C     . LYS D  4 28  ? -42.036 -19.294 12.996  1.00 111.52 ? 28   LYS D C     1 
ATOM   2309  O  O     . LYS D  4 28  ? -42.063 -19.939 14.051  1.00 111.42 ? 28   LYS D O     1 
ATOM   2310  C  CB    . LYS D  4 28  ? -44.566 -19.347 13.089  1.00 112.99 ? 28   LYS D CB    1 
ATOM   2311  C  CG    . LYS D  4 28  ? -44.783 -18.809 14.508  1.00 113.60 ? 28   LYS D CG    1 
ATOM   2312  C  CD    . LYS D  4 28  ? -44.943 -19.942 15.525  1.00 114.20 ? 28   LYS D CD    1 
ATOM   2313  C  CE    . LYS D  4 28  ? -44.583 -19.468 16.933  1.00 114.16 ? 28   LYS D CE    1 
ATOM   2314  N  NZ    . LYS D  4 28  ? -44.335 -20.597 17.870  1.00 113.85 ? 28   LYS D NZ    1 
ATOM   2315  N  N     . THR D  4 29  ? -40.903 -19.015 12.347  1.00 109.89 ? 29   THR D N     1 
ATOM   2316  C  CA    . THR D  4 29  ? -39.581 -19.498 12.785  1.00 108.25 ? 29   THR D CA    1 
ATOM   2317  C  C     . THR D  4 29  ? -39.538 -21.032 12.975  1.00 106.94 ? 29   THR D C     1 
ATOM   2318  O  O     . THR D  4 29  ? -40.427 -21.757 12.492  1.00 106.81 ? 29   THR D O     1 
ATOM   2319  C  CB    . THR D  4 29  ? -39.059 -18.763 14.063  1.00 108.41 ? 29   THR D CB    1 
ATOM   2320  O  OG1   . THR D  4 29  ? -39.573 -17.423 14.108  1.00 108.13 ? 29   THR D OG1   1 
ATOM   2321  C  CG2   . THR D  4 29  ? -37.522 -18.728 14.072  1.00 108.36 ? 29   THR D CG2   1 
ATOM   2322  N  N     . ARG D  4 30  ? -38.504 -21.513 13.672  1.00 105.00 ? 30   ARG D N     1 
ATOM   2323  C  CA    . ARG D  4 30  ? -38.227 -22.945 13.785  1.00 102.96 ? 30   ARG D CA    1 
ATOM   2324  C  C     . ARG D  4 30  ? -37.290 -23.261 14.962  1.00 101.12 ? 30   ARG D C     1 
ATOM   2325  O  O     . ARG D  4 30  ? -36.066 -23.137 14.850  1.00 100.98 ? 30   ARG D O     1 
ATOM   2326  C  CB    . ARG D  4 30  ? -37.662 -23.480 12.457  1.00 103.09 ? 30   ARG D CB    1 
ATOM   2327  C  CG    . ARG D  4 30  ? -37.320 -24.947 12.466  1.00 104.02 ? 30   ARG D CG    1 
ATOM   2328  C  CD    . ARG D  4 30  ? -37.058 -25.470 11.068  1.00 106.25 ? 30   ARG D CD    1 
ATOM   2329  N  NE    . ARG D  4 30  ? -36.061 -26.545 11.071  1.00 107.48 ? 30   ARG D NE    1 
ATOM   2330  C  CZ    . ARG D  4 30  ? -35.982 -27.513 10.158  1.00 108.13 ? 30   ARG D CZ    1 
ATOM   2331  N  NH1   . ARG D  4 30  ? -36.854 -27.573 9.154   1.00 107.96 ? 30   ARG D NH1   1 
ATOM   2332  N  NH2   . ARG D  4 30  ? -35.030 -28.435 10.257  1.00 108.66 ? 30   ARG D NH2   1 
ATOM   2333  N  N     . LYS D  4 31  ? -37.882 -23.659 16.087  1.00 98.70  ? 31   LYS D N     1 
ATOM   2334  C  CA    . LYS D  4 31  ? -37.126 -24.117 17.260  1.00 96.28  ? 31   LYS D CA    1 
ATOM   2335  C  C     . LYS D  4 31  ? -36.525 -25.506 17.023  1.00 94.17  ? 31   LYS D C     1 
ATOM   2336  O  O     . LYS D  4 31  ? -37.104 -26.343 16.325  1.00 94.29  ? 31   LYS D O     1 
ATOM   2337  C  CB    . LYS D  4 31  ? -38.013 -24.114 18.519  1.00 96.70  ? 31   LYS D CB    1 
ATOM   2338  C  CG    . LYS D  4 31  ? -39.198 -25.106 18.492  1.00 96.92  ? 31   LYS D CG    1 
ATOM   2339  C  CD    . LYS D  4 31  ? -40.138 -24.938 19.696  1.00 96.64  ? 31   LYS D CD    1 
ATOM   2340  C  CE    . LYS D  4 31  ? -41.067 -26.168 19.801  1.00 97.24  ? 31   LYS D CE    1 
ATOM   2341  N  NZ    . LYS D  4 31  ? -42.275 -25.887 20.673  1.00 96.96  ? 31   LYS D NZ    1 
ATOM   2342  N  N     . GLU D  4 32  ? -35.371 -25.759 17.620  1.00 91.33  ? 32   GLU D N     1 
ATOM   2343  C  CA    . GLU D  4 32  ? -34.637 -26.984 17.343  1.00 88.40  ? 32   GLU D CA    1 
ATOM   2344  C  C     . GLU D  4 32  ? -34.251 -27.631 18.656  1.00 86.63  ? 32   GLU D C     1 
ATOM   2345  O  O     . GLU D  4 32  ? -33.526 -27.030 19.444  1.00 86.69  ? 32   GLU D O     1 
ATOM   2346  C  CB    . GLU D  4 32  ? -33.389 -26.625 16.552  1.00 88.31  ? 32   GLU D CB    1 
ATOM   2347  C  CG    . GLU D  4 32  ? -32.784 -27.728 15.739  1.00 87.05  ? 32   GLU D CG    1 
ATOM   2348  C  CD    . GLU D  4 32  ? -31.452 -27.303 15.151  1.00 86.54  ? 32   GLU D CD    1 
ATOM   2349  O  OE1   . GLU D  4 32  ? -30.581 -26.852 15.929  1.00 85.30  ? 32   GLU D OE1   1 
ATOM   2350  O  OE2   . GLU D  4 32  ? -31.270 -27.404 13.914  1.00 86.51  ? 32   GLU D OE2   1 
ATOM   2351  N  N     . SER D  4 33  ? -34.742 -28.840 18.906  1.00 84.10  ? 33   SER D N     1 
ATOM   2352  C  CA    . SER D  4 33  ? -34.416 -29.537 20.146  1.00 81.74  ? 33   SER D CA    1 
ATOM   2353  C  C     . SER D  4 33  ? -33.978 -30.983 19.916  1.00 80.28  ? 33   SER D C     1 
ATOM   2354  O  O     . SER D  4 33  ? -33.923 -31.454 18.781  1.00 79.80  ? 33   SER D O     1 
ATOM   2355  C  CB    . SER D  4 33  ? -35.589 -29.467 21.132  1.00 81.85  ? 33   SER D CB    1 
ATOM   2356  O  OG    . SER D  4 33  ? -36.649 -30.334 20.764  1.00 81.54  ? 33   SER D OG    1 
ATOM   2357  N  N     . TYR D  4 34  ? -33.657 -31.674 21.009  1.00 78.32  ? 34   TYR D N     1 
ATOM   2358  C  CA    . TYR D  4 34  ? -33.265 -33.072 20.958  1.00 76.17  ? 34   TYR D CA    1 
ATOM   2359  C  C     . TYR D  4 34  ? -34.448 -33.954 21.312  1.00 75.23  ? 34   TYR D C     1 
ATOM   2360  O  O     . TYR D  4 34  ? -34.301 -35.168 21.449  1.00 75.32  ? 34   TYR D O     1 
ATOM   2361  C  CB    . TYR D  4 34  ? -32.103 -33.352 21.916  1.00 75.71  ? 34   TYR D CB    1 
ATOM   2362  C  CG    . TYR D  4 34  ? -30.819 -32.617 21.592  1.00 74.71  ? 34   TYR D CG    1 
ATOM   2363  C  CD1   . TYR D  4 34  ? -30.531 -31.396 22.193  1.00 73.69  ? 34   TYR D CD1   1 
ATOM   2364  C  CD2   . TYR D  4 34  ? -29.884 -33.153 20.699  1.00 73.20  ? 34   TYR D CD2   1 
ATOM   2365  C  CE1   . TYR D  4 34  ? -29.355 -30.718 21.909  1.00 73.38  ? 34   TYR D CE1   1 
ATOM   2366  C  CE2   . TYR D  4 34  ? -28.708 -32.480 20.405  1.00 72.17  ? 34   TYR D CE2   1 
ATOM   2367  C  CZ    . TYR D  4 34  ? -28.449 -31.261 21.012  1.00 73.79  ? 34   TYR D CZ    1 
ATOM   2368  O  OH    . TYR D  4 34  ? -27.284 -30.568 20.742  1.00 74.69  ? 34   TYR D OH    1 
ATOM   2369  N  N     . ALA D  4 35  ? -35.625 -33.345 21.429  1.00 73.85  ? 35   ALA D N     1 
ATOM   2370  C  CA    . ALA D  4 35  ? -36.831 -34.035 21.906  1.00 72.67  ? 35   ALA D CA    1 
ATOM   2371  C  C     . ALA D  4 35  ? -37.116 -35.407 21.271  1.00 71.94  ? 35   ALA D C     1 
ATOM   2372  O  O     . ALA D  4 35  ? -37.550 -36.327 21.971  1.00 71.83  ? 35   ALA D O     1 
ATOM   2373  C  CB    . ALA D  4 35  ? -38.045 -33.121 21.788  1.00 72.51  ? 35   ALA D CB    1 
ATOM   2374  N  N     . ILE D  4 36  ? -36.872 -35.545 19.966  1.00 70.84  ? 36   ILE D N     1 
ATOM   2375  C  CA    . ILE D  4 36  ? -37.143 -36.804 19.272  1.00 70.19  ? 36   ILE D CA    1 
ATOM   2376  C  C     . ILE D  4 36  ? -36.054 -37.876 19.419  1.00 69.90  ? 36   ILE D C     1 
ATOM   2377  O  O     . ILE D  4 36  ? -36.360 -39.078 19.379  1.00 69.72  ? 36   ILE D O     1 
ATOM   2378  C  CB    . ILE D  4 36  ? -37.542 -36.637 17.768  1.00 70.14  ? 36   ILE D CB    1 
ATOM   2379  C  CG1   . ILE D  4 36  ? -36.428 -35.980 16.954  1.00 69.82  ? 36   ILE D CG1   1 
ATOM   2380  C  CG2   . ILE D  4 36  ? -38.896 -35.932 17.642  1.00 69.90  ? 36   ILE D CG2   1 
ATOM   2381  C  CD1   . ILE D  4 36  ? -36.425 -36.406 15.511  1.00 69.21  ? 36   ILE D CD1   1 
ATOM   2382  N  N     . TYR D  4 37  ? -34.800 -37.450 19.579  1.00 69.39  ? 37   TYR D N     1 
ATOM   2383  C  CA    . TYR D  4 37  ? -33.722 -38.385 19.902  1.00 68.85  ? 37   TYR D CA    1 
ATOM   2384  C  C     . TYR D  4 37  ? -33.836 -38.853 21.348  1.00 68.55  ? 37   TYR D C     1 
ATOM   2385  O  O     . TYR D  4 37  ? -33.569 -40.007 21.655  1.00 68.41  ? 37   TYR D O     1 
ATOM   2386  C  CB    . TYR D  4 37  ? -32.360 -37.768 19.657  1.00 68.73  ? 37   TYR D CB    1 
ATOM   2387  C  CG    . TYR D  4 37  ? -32.275 -36.954 18.394  1.00 69.66  ? 37   TYR D CG    1 
ATOM   2388  C  CD1   . TYR D  4 37  ? -32.363 -35.562 18.438  1.00 70.80  ? 37   TYR D CD1   1 
ATOM   2389  C  CD2   . TYR D  4 37  ? -32.101 -37.566 17.148  1.00 69.73  ? 37   TYR D CD2   1 
ATOM   2390  C  CE1   . TYR D  4 37  ? -32.288 -34.793 17.267  1.00 70.99  ? 37   TYR D CE1   1 
ATOM   2391  C  CE2   . TYR D  4 37  ? -32.014 -36.808 15.976  1.00 69.70  ? 37   TYR D CE2   1 
ATOM   2392  C  CZ    . TYR D  4 37  ? -32.114 -35.423 16.044  1.00 70.04  ? 37   TYR D CZ    1 
ATOM   2393  O  OH    . TYR D  4 37  ? -32.022 -34.658 14.905  1.00 69.09  ? 37   TYR D OH    1 
ATOM   2394  N  N     . VAL D  4 38  ? -34.254 -37.956 22.233  1.00 68.44  ? 38   VAL D N     1 
ATOM   2395  C  CA    . VAL D  4 38  ? -34.486 -38.322 23.624  1.00 68.48  ? 38   VAL D CA    1 
ATOM   2396  C  C     . VAL D  4 38  ? -35.605 -39.346 23.693  1.00 68.70  ? 38   VAL D C     1 
ATOM   2397  O  O     . VAL D  4 38  ? -35.536 -40.285 24.495  1.00 68.49  ? 38   VAL D O     1 
ATOM   2398  C  CB    . VAL D  4 38  ? -34.812 -37.099 24.523  1.00 68.47  ? 38   VAL D CB    1 
ATOM   2399  C  CG1   . VAL D  4 38  ? -35.144 -37.541 25.951  1.00 67.40  ? 38   VAL D CG1   1 
ATOM   2400  C  CG2   . VAL D  4 38  ? -33.651 -36.107 24.521  1.00 68.07  ? 38   VAL D CG2   1 
ATOM   2401  N  N     . TYR D  4 39  ? -36.615 -39.175 22.836  1.00 68.85  ? 39   TYR D N     1 
ATOM   2402  C  CA    . TYR D  4 39  ? -37.749 -40.096 22.811  1.00 69.12  ? 39   TYR D CA    1 
ATOM   2403  C  C     . TYR D  4 39  ? -37.351 -41.491 22.320  1.00 68.78  ? 39   TYR D C     1 
ATOM   2404  O  O     . TYR D  4 39  ? -37.711 -42.474 22.944  1.00 68.85  ? 39   TYR D O     1 
ATOM   2405  C  CB    . TYR D  4 39  ? -38.953 -39.530 22.046  1.00 69.58  ? 39   TYR D CB    1 
ATOM   2406  C  CG    . TYR D  4 39  ? -40.230 -40.236 22.431  1.00 70.66  ? 39   TYR D CG    1 
ATOM   2407  C  CD1   . TYR D  4 39  ? -40.850 -39.977 23.655  1.00 70.84  ? 39   TYR D CD1   1 
ATOM   2408  C  CD2   . TYR D  4 39  ? -40.801 -41.208 21.587  1.00 72.47  ? 39   TYR D CD2   1 
ATOM   2409  C  CE1   . TYR D  4 39  ? -42.021 -40.659 24.033  1.00 72.30  ? 39   TYR D CE1   1 
ATOM   2410  C  CE2   . TYR D  4 39  ? -41.977 -41.892 21.946  1.00 71.94  ? 39   TYR D CE2   1 
ATOM   2411  C  CZ    . TYR D  4 39  ? -42.580 -41.615 23.170  1.00 71.97  ? 39   TYR D CZ    1 
ATOM   2412  O  OH    . TYR D  4 39  ? -43.734 -42.286 23.534  1.00 71.22  ? 39   TYR D OH    1 
ATOM   2413  N  N     . LYS D  4 40  ? -36.585 -41.560 21.234  1.00 68.74  ? 40   LYS D N     1 
ATOM   2414  C  CA    . LYS D  4 40  ? -35.964 -42.806 20.770  1.00 68.95  ? 40   LYS D CA    1 
ATOM   2415  C  C     . LYS D  4 40  ? -35.187 -43.543 21.870  1.00 69.14  ? 40   LYS D C     1 
ATOM   2416  O  O     . LYS D  4 40  ? -35.439 -44.719 22.133  1.00 69.83  ? 40   LYS D O     1 
ATOM   2417  C  CB    . LYS D  4 40  ? -35.041 -42.541 19.576  1.00 69.01  ? 40   LYS D CB    1 
ATOM   2418  C  CG    . LYS D  4 40  ? -35.795 -42.141 18.330  1.00 69.76  ? 40   LYS D CG    1 
ATOM   2419  C  CD    . LYS D  4 40  ? -34.889 -41.755 17.185  1.00 71.23  ? 40   LYS D CD    1 
ATOM   2420  C  CE    . LYS D  4 40  ? -35.747 -41.289 16.004  1.00 73.26  ? 40   LYS D CE    1 
ATOM   2421  N  NZ    . LYS D  4 40  ? -34.959 -41.020 14.769  1.00 74.32  ? 40   LYS D NZ    1 
ATOM   2422  N  N     . VAL D  4 41  ? -34.248 -42.857 22.515  1.00 68.92  ? 41   VAL D N     1 
ATOM   2423  C  CA    . VAL D  4 41  ? -33.471 -43.453 23.596  1.00 68.01  ? 41   VAL D CA    1 
ATOM   2424  C  C     . VAL D  4 41  ? -34.385 -43.903 24.746  1.00 68.39  ? 41   VAL D C     1 
ATOM   2425  O  O     . VAL D  4 41  ? -34.153 -44.950 25.351  1.00 68.61  ? 41   VAL D O     1 
ATOM   2426  C  CB    . VAL D  4 41  ? -32.356 -42.497 24.092  1.00 67.60  ? 41   VAL D CB    1 
ATOM   2427  C  CG1   . VAL D  4 41  ? -31.719 -43.016 25.364  1.00 67.27  ? 41   VAL D CG1   1 
ATOM   2428  C  CG2   . VAL D  4 41  ? -31.302 -42.312 23.027  1.00 66.39  ? 41   VAL D CG2   1 
ATOM   2429  N  N     . LEU D  4 42  ? -35.434 -43.141 25.047  1.00 68.59  ? 42   LEU D N     1 
ATOM   2430  C  CA    . LEU D  4 42  ? -36.330 -43.554 26.131  1.00 68.95  ? 42   LEU D CA    1 
ATOM   2431  C  C     . LEU D  4 42  ? -37.006 -44.879 25.764  1.00 69.69  ? 42   LEU D C     1 
ATOM   2432  O  O     . LEU D  4 42  ? -37.204 -45.745 26.625  1.00 69.81  ? 42   LEU D O     1 
ATOM   2433  C  CB    . LEU D  4 42  ? -37.357 -42.472 26.487  1.00 68.48  ? 42   LEU D CB    1 
ATOM   2434  C  CG    . LEU D  4 42  ? -38.487 -42.871 27.441  1.00 68.10  ? 42   LEU D CG    1 
ATOM   2435  C  CD1   . LEU D  4 42  ? -37.979 -43.264 28.817  1.00 68.59  ? 42   LEU D CD1   1 
ATOM   2436  C  CD2   . LEU D  4 42  ? -39.520 -41.779 27.566  1.00 68.78  ? 42   LEU D CD2   1 
ATOM   2437  N  N     . LYS D  4 43  ? -37.338 -45.043 24.482  1.00 70.24  ? 43   LYS D N     1 
ATOM   2438  C  CA    . LYS D  4 43  ? -37.917 -46.295 24.012  1.00 70.60  ? 43   LYS D CA    1 
ATOM   2439  C  C     . LYS D  4 43  ? -36.918 -47.423 24.212  1.00 71.00  ? 43   LYS D C     1 
ATOM   2440  O  O     . LYS D  4 43  ? -37.190 -48.346 24.980  1.00 71.78  ? 43   LYS D O     1 
ATOM   2441  C  CB    . LYS D  4 43  ? -38.419 -46.190 22.571  1.00 70.61  ? 43   LYS D CB    1 
ATOM   2442  C  CG    . LYS D  4 43  ? -39.735 -45.409 22.453  1.00 70.49  ? 43   LYS D CG    1 
ATOM   2443  C  CD    . LYS D  4 43  ? -40.527 -45.438 23.777  1.00 70.67  ? 43   LYS D CD    1 
ATOM   2444  C  CE    . LYS D  4 43  ? -41.991 -45.024 23.582  1.00 71.48  ? 43   LYS D CE    1 
ATOM   2445  N  NZ    . LYS D  4 43  ? -42.712 -44.672 24.851  1.00 69.94  ? 43   LYS D NZ    1 
ATOM   2446  N  N     . GLN D  4 44  ? -35.751 -47.323 23.589  1.00 70.92  ? 44   GLN D N     1 
ATOM   2447  C  CA    . GLN D  4 44  ? -34.644 -48.235 23.884  1.00 71.64  ? 44   GLN D CA    1 
ATOM   2448  C  C     . GLN D  4 44  ? -34.516 -48.750 25.342  1.00 71.61  ? 44   GLN D C     1 
ATOM   2449  O  O     . GLN D  4 44  ? -34.132 -49.899 25.547  1.00 72.15  ? 44   GLN D O     1 
ATOM   2450  C  CB    . GLN D  4 44  ? -33.318 -47.614 23.460  1.00 71.33  ? 44   GLN D CB    1 
ATOM   2451  C  CG    . GLN D  4 44  ? -33.024 -47.690 21.973  1.00 72.34  ? 44   GLN D CG    1 
ATOM   2452  C  CD    . GLN D  4 44  ? -31.547 -47.429 21.662  1.00 73.24  ? 44   GLN D CD    1 
ATOM   2453  O  OE1   . GLN D  4 44  ? -30.704 -47.386 22.569  1.00 75.84  ? 44   GLN D OE1   1 
ATOM   2454  N  NE2   . GLN D  4 44  ? -31.230 -47.262 20.378  1.00 75.01  ? 44   GLN D NE2   1 
ATOM   2455  N  N     . VAL D  4 45  ? -34.820 -47.926 26.345  1.00 71.60  ? 45   VAL D N     1 
ATOM   2456  C  CA    . VAL D  4 45  ? -34.585 -48.319 27.744  1.00 71.52  ? 45   VAL D CA    1 
ATOM   2457  C  C     . VAL D  4 45  ? -35.842 -48.539 28.569  1.00 71.74  ? 45   VAL D C     1 
ATOM   2458  O  O     . VAL D  4 45  ? -35.782 -49.173 29.616  1.00 72.09  ? 45   VAL D O     1 
ATOM   2459  C  CB    . VAL D  4 45  ? -33.682 -47.304 28.542  1.00 71.72  ? 45   VAL D CB    1 
ATOM   2460  C  CG1   . VAL D  4 45  ? -32.248 -47.285 28.026  1.00 71.48  ? 45   VAL D CG1   1 
ATOM   2461  C  CG2   . VAL D  4 45  ? -34.296 -45.898 28.577  1.00 71.16  ? 45   VAL D CG2   1 
ATOM   2462  N  N     . HIS D  4 46  ? -36.967 -47.987 28.139  1.00 72.00  ? 46   HIS D N     1 
ATOM   2463  C  CA    . HIS D  4 46  ? -38.210 -48.140 28.888  1.00 72.65  ? 46   HIS D CA    1 
ATOM   2464  C  C     . HIS D  4 46  ? -39.403 -48.119 27.935  1.00 73.20  ? 46   HIS D C     1 
ATOM   2465  O  O     . HIS D  4 46  ? -40.143 -47.125 27.902  1.00 73.66  ? 46   HIS D O     1 
ATOM   2466  C  CB    . HIS D  4 46  ? -38.351 -47.039 29.938  1.00 72.46  ? 46   HIS D CB    1 
ATOM   2467  C  CG    . HIS D  4 46  ? -37.706 -47.357 31.252  1.00 73.21  ? 46   HIS D CG    1 
ATOM   2468  N  ND1   . HIS D  4 46  ? -36.425 -46.958 31.569  1.00 73.43  ? 46   HIS D ND1   1 
ATOM   2469  C  CD2   . HIS D  4 46  ? -38.173 -48.017 32.341  1.00 73.83  ? 46   HIS D CD2   1 
ATOM   2470  C  CE1   . HIS D  4 46  ? -36.127 -47.367 32.790  1.00 73.31  ? 46   HIS D CE1   1 
ATOM   2471  N  NE2   . HIS D  4 46  ? -37.170 -48.011 33.281  1.00 73.59  ? 46   HIS D NE2   1 
ATOM   2472  N  N     . PRO D  4 47  ? -39.615 -49.225 27.178  1.00 73.39  ? 47   PRO D N     1 
ATOM   2473  C  CA    . PRO D  4 47  ? -40.573 -49.233 26.067  1.00 73.47  ? 47   PRO D CA    1 
ATOM   2474  C  C     . PRO D  4 47  ? -42.010 -48.945 26.499  1.00 73.75  ? 47   PRO D C     1 
ATOM   2475  O  O     . PRO D  4 47  ? -42.774 -48.356 25.732  1.00 73.90  ? 47   PRO D O     1 
ATOM   2476  C  CB    . PRO D  4 47  ? -40.451 -50.656 25.516  1.00 73.37  ? 47   PRO D CB    1 
ATOM   2477  C  CG    . PRO D  4 47  ? -39.091 -51.108 25.961  1.00 73.12  ? 47   PRO D CG    1 
ATOM   2478  C  CD    . PRO D  4 47  ? -38.986 -50.549 27.335  1.00 73.22  ? 47   PRO D CD    1 
ATOM   2479  N  N     . ASP D  4 48  ? -42.365 -49.336 27.718  1.00 74.03  ? 48   ASP D N     1 
ATOM   2480  C  CA    . ASP D  4 48  ? -43.716 -49.114 28.222  1.00 74.49  ? 48   ASP D CA    1 
ATOM   2481  C  C     . ASP D  4 48  ? -43.840 -47.786 29.001  1.00 74.09  ? 48   ASP D C     1 
ATOM   2482  O  O     . ASP D  4 48  ? -44.942 -47.415 29.431  1.00 74.34  ? 48   ASP D O     1 
ATOM   2483  C  CB    . ASP D  4 48  ? -44.201 -50.327 29.057  1.00 75.27  ? 48   ASP D CB    1 
ATOM   2484  C  CG    . ASP D  4 48  ? -44.325 -51.645 28.220  1.00 77.19  ? 48   ASP D CG    1 
ATOM   2485  O  OD1   . ASP D  4 48  ? -43.292 -52.165 27.719  1.00 79.65  ? 48   ASP D OD1   1 
ATOM   2486  O  OD2   . ASP D  4 48  ? -45.453 -52.179 28.083  1.00 77.54  ? 48   ASP D OD2   1 
ATOM   2487  N  N     . THR D  4 49  ? -42.719 -47.072 29.164  1.00 73.24  ? 49   THR D N     1 
ATOM   2488  C  CA    . THR D  4 49  ? -42.695 -45.744 29.821  1.00 72.18  ? 49   THR D CA    1 
ATOM   2489  C  C     . THR D  4 49  ? -42.735 -44.602 28.808  1.00 71.10  ? 49   THR D C     1 
ATOM   2490  O  O     . THR D  4 49  ? -42.177 -44.724 27.712  1.00 71.03  ? 49   THR D O     1 
ATOM   2491  C  CB    . THR D  4 49  ? -41.424 -45.549 30.691  1.00 72.46  ? 49   THR D CB    1 
ATOM   2492  O  OG1   . THR D  4 49  ? -41.164 -46.729 31.460  1.00 73.10  ? 49   THR D OG1   1 
ATOM   2493  C  CG2   . THR D  4 49  ? -41.576 -44.370 31.639  1.00 72.30  ? 49   THR D CG2   1 
ATOM   2494  N  N     . GLY D  4 50  ? -43.390 -43.502 29.181  1.00 69.91  ? 50   GLY D N     1 
ATOM   2495  C  CA    . GLY D  4 50  ? -43.439 -42.273 28.360  1.00 68.84  ? 50   GLY D CA    1 
ATOM   2496  C  C     . GLY D  4 50  ? -42.939 -41.045 29.117  1.00 67.93  ? 50   GLY D C     1 
ATOM   2497  O  O     . GLY D  4 50  ? -42.375 -41.181 30.200  1.00 68.11  ? 50   GLY D O     1 
ATOM   2498  N  N     . ILE D  4 51  ? -43.164 -39.844 28.577  1.00 67.03  ? 51   ILE D N     1 
ATOM   2499  C  CA    . ILE D  4 51  ? -42.534 -38.622 29.127  1.00 66.06  ? 51   ILE D CA    1 
ATOM   2500  C  C     . ILE D  4 51  ? -43.340 -37.340 28.919  1.00 65.69  ? 51   ILE D C     1 
ATOM   2501  O  O     . ILE D  4 51  ? -43.728 -37.029 27.801  1.00 65.90  ? 51   ILE D O     1 
ATOM   2502  C  CB    . ILE D  4 51  ? -41.072 -38.460 28.579  1.00 66.15  ? 51   ILE D CB    1 
ATOM   2503  C  CG1   . ILE D  4 51  ? -40.341 -37.292 29.254  1.00 65.72  ? 51   ILE D CG1   1 
ATOM   2504  C  CG2   . ILE D  4 51  ? -41.050 -38.384 27.045  1.00 65.30  ? 51   ILE D CG2   1 
ATOM   2505  C  CD1   . ILE D  4 51  ? -38.828 -37.304 29.035  1.00 65.48  ? 51   ILE D CD1   1 
ATOM   2506  N  N     . SER D  4 52  ? -43.577 -36.580 29.987  1.00 65.19  ? 52   SER D N     1 
ATOM   2507  C  CA    . SER D  4 52  ? -44.351 -35.338 29.859  1.00 64.67  ? 52   SER D CA    1 
ATOM   2508  C  C     . SER D  4 52  ? -43.549 -34.251 29.158  1.00 64.65  ? 52   SER D C     1 
ATOM   2509  O  O     . SER D  4 52  ? -42.325 -34.310 29.127  1.00 65.06  ? 52   SER D O     1 
ATOM   2510  C  CB    . SER D  4 52  ? -44.814 -34.854 31.220  1.00 64.61  ? 52   SER D CB    1 
ATOM   2511  O  OG    . SER D  4 52  ? -43.788 -34.148 31.871  1.00 64.86  ? 52   SER D OG    1 
ATOM   2512  N  N     . SER D  4 53  ? -44.226 -33.261 28.587  1.00 64.73  ? 53   SER D N     1 
ATOM   2513  C  CA    . SER D  4 53  ? -43.530 -32.202 27.841  1.00 64.88  ? 53   SER D CA    1 
ATOM   2514  C  C     . SER D  4 53  ? -42.656 -31.334 28.747  1.00 64.43  ? 53   SER D C     1 
ATOM   2515  O  O     . SER D  4 53  ? -41.601 -30.872 28.330  1.00 64.73  ? 53   SER D O     1 
ATOM   2516  C  CB    . SER D  4 53  ? -44.517 -31.320 27.095  1.00 65.11  ? 53   SER D CB    1 
ATOM   2517  O  OG    . SER D  4 53  ? -45.309 -30.600 28.032  1.00 67.44  ? 53   SER D OG    1 
ATOM   2518  N  N     . LYS D  4 54  ? -43.093 -31.102 29.978  1.00 63.76  ? 54   LYS D N     1 
ATOM   2519  C  CA    . LYS D  4 54  ? -42.222 -30.465 30.946  1.00 63.61  ? 54   LYS D CA    1 
ATOM   2520  C  C     . LYS D  4 54  ? -40.925 -31.252 31.169  1.00 62.55  ? 54   LYS D C     1 
ATOM   2521  O  O     . LYS D  4 54  ? -39.846 -30.675 31.093  1.00 63.01  ? 54   LYS D O     1 
ATOM   2522  C  CB    . LYS D  4 54  ? -42.939 -30.222 32.270  1.00 64.21  ? 54   LYS D CB    1 
ATOM   2523  C  CG    . LYS D  4 54  ? -43.778 -28.952 32.279  1.00 67.37  ? 54   LYS D CG    1 
ATOM   2524  C  CD    . LYS D  4 54  ? -44.332 -28.667 33.681  1.00 72.19  ? 54   LYS D CD    1 
ATOM   2525  C  CE    . LYS D  4 54  ? -45.423 -27.595 33.665  1.00 73.15  ? 54   LYS D CE    1 
ATOM   2526  N  NZ    . LYS D  4 54  ? -45.667 -27.147 35.071  1.00 75.50  ? 54   LYS D NZ    1 
ATOM   2527  N  N     . ALA D  4 55  ? -41.016 -32.556 31.428  1.00 60.88  ? 55   ALA D N     1 
ATOM   2528  C  CA    . ALA D  4 55  ? -39.808 -33.364 31.608  1.00 59.35  ? 55   ALA D CA    1 
ATOM   2529  C  C     . ALA D  4 55  ? -38.985 -33.451 30.333  1.00 58.64  ? 55   ALA D C     1 
ATOM   2530  O  O     . ALA D  4 55  ? -37.770 -33.555 30.386  1.00 58.15  ? 55   ALA D O     1 
ATOM   2531  C  CB    . ALA D  4 55  ? -40.139 -34.741 32.136  1.00 59.12  ? 55   ALA D CB    1 
ATOM   2532  N  N     . MET D  4 56  ? -39.641 -33.389 29.183  1.00 58.31  ? 56   MET D N     1 
ATOM   2533  C  CA    . MET D  4 56  ? -38.924 -33.364 27.915  1.00 58.29  ? 56   MET D CA    1 
ATOM   2534  C  C     . MET D  4 56  ? -38.072 -32.112 27.835  1.00 57.79  ? 56   MET D C     1 
ATOM   2535  O  O     . MET D  4 56  ? -36.901 -32.166 27.457  1.00 58.20  ? 56   MET D O     1 
ATOM   2536  C  CB    . MET D  4 56  ? -39.893 -33.380 26.748  1.00 58.66  ? 56   MET D CB    1 
ATOM   2537  C  CG    . MET D  4 56  ? -39.230 -33.477 25.406  1.00 61.21  ? 56   MET D CG    1 
ATOM   2538  S  SD    . MET D  4 56  ? -38.352 -35.044 25.265  1.00 70.29  ? 56   MET D SD    1 
ATOM   2539  C  CE    . MET D  4 56  ? -36.663 -34.491 25.467  1.00 70.28  ? 56   MET D CE    1 
ATOM   2540  N  N     . SER D  4 57  ? -38.668 -30.983 28.201  1.00 56.51  ? 57   SER D N     1 
ATOM   2541  C  CA    . SER D  4 57  ? -37.966 -29.725 28.231  1.00 55.41  ? 57   SER D CA    1 
ATOM   2542  C  C     . SER D  4 57  ? -36.723 -29.789 29.140  1.00 54.25  ? 57   SER D C     1 
ATOM   2543  O  O     . SER D  4 57  ? -35.630 -29.386 28.735  1.00 54.57  ? 57   SER D O     1 
ATOM   2544  C  CB    . SER D  4 57  ? -38.929 -28.626 28.658  1.00 55.79  ? 57   SER D CB    1 
ATOM   2545  O  OG    . SER D  4 57  ? -38.264 -27.383 28.696  1.00 58.19  ? 57   SER D OG    1 
ATOM   2546  N  N     . ILE D  4 58  ? -36.875 -30.329 30.341  1.00 52.63  ? 58   ILE D N     1 
ATOM   2547  C  CA    . ILE D  4 58  ? -35.729 -30.603 31.220  1.00 51.70  ? 58   ILE D CA    1 
ATOM   2548  C  C     . ILE D  4 58  ? -34.599 -31.441 30.578  1.00 51.91  ? 58   ILE D C     1 
ATOM   2549  O  O     . ILE D  4 58  ? -33.429 -31.134 30.757  1.00 51.56  ? 58   ILE D O     1 
ATOM   2550  C  CB    . ILE D  4 58  ? -36.197 -31.199 32.574  1.00 51.25  ? 58   ILE D CB    1 
ATOM   2551  C  CG1   . ILE D  4 58  ? -37.010 -30.135 33.325  1.00 50.46  ? 58   ILE D CG1   1 
ATOM   2552  C  CG2   . ILE D  4 58  ? -35.020 -31.671 33.414  1.00 49.50  ? 58   ILE D CG2   1 
ATOM   2553  C  CD1   . ILE D  4 58  ? -37.933 -30.659 34.367  1.00 48.91  ? 58   ILE D CD1   1 
ATOM   2554  N  N     . MET D  4 59  ? -34.946 -32.478 29.818  1.00 52.27  ? 59   MET D N     1 
ATOM   2555  C  CA    . MET D  4 59  ? -33.932 -33.297 29.138  1.00 52.63  ? 59   MET D CA    1 
ATOM   2556  C  C     . MET D  4 59  ? -33.283 -32.538 28.008  1.00 52.46  ? 59   MET D C     1 
ATOM   2557  O  O     . MET D  4 59  ? -32.103 -32.733 27.717  1.00 52.57  ? 59   MET D O     1 
ATOM   2558  C  CB    . MET D  4 59  ? -34.517 -34.598 28.584  1.00 52.96  ? 59   MET D CB    1 
ATOM   2559  C  CG    . MET D  4 59  ? -35.002 -35.564 29.641  1.00 53.81  ? 59   MET D CG    1 
ATOM   2560  S  SD    . MET D  4 59  ? -33.708 -36.076 30.767  1.00 56.68  ? 59   MET D SD    1 
ATOM   2561  C  CE    . MET D  4 59  ? -32.511 -36.780 29.619  1.00 54.98  ? 59   MET D CE    1 
ATOM   2562  N  N     . ASN D  4 60  ? -34.058 -31.683 27.353  1.00 52.50  ? 60   ASN D N     1 
ATOM   2563  C  CA    . ASN D  4 60  ? -33.493 -30.828 26.317  1.00 51.97  ? 60   ASN D CA    1 
ATOM   2564  C  C     . ASN D  4 60  ? -32.477 -29.835 26.870  1.00 50.87  ? 60   ASN D C     1 
ATOM   2565  O  O     . ASN D  4 60  ? -31.473 -29.557 26.216  1.00 50.95  ? 60   ASN D O     1 
ATOM   2566  C  CB    . ASN D  4 60  ? -34.568 -30.121 25.510  1.00 52.28  ? 60   ASN D CB    1 
ATOM   2567  C  CG    . ASN D  4 60  ? -33.990 -29.404 24.321  1.00 54.25  ? 60   ASN D CG    1 
ATOM   2568  O  OD1   . ASN D  4 60  ? -33.369 -30.023 23.449  1.00 55.72  ? 60   ASN D OD1   1 
ATOM   2569  N  ND2   . ASN D  4 60  ? -34.132 -28.076 24.302  1.00 56.14  ? 60   ASN D ND2   1 
ATOM   2570  N  N     . SER D  4 61  ? -32.718 -29.330 28.078  1.00 49.68  ? 61   SER D N     1 
ATOM   2571  C  CA    . SER D  4 61  ? -31.771 -28.416 28.732  1.00 48.81  ? 61   SER D CA    1 
ATOM   2572  C  C     . SER D  4 61  ? -30.485 -29.125 29.087  1.00 48.22  ? 61   SER D C     1 
ATOM   2573  O  O     . SER D  4 61  ? -29.404 -28.677 28.706  1.00 48.22  ? 61   SER D O     1 
ATOM   2574  C  CB    . SER D  4 61  ? -32.384 -27.778 29.975  1.00 48.94  ? 61   SER D CB    1 
ATOM   2575  O  OG    . SER D  4 61  ? -33.214 -26.681 29.607  1.00 48.99  ? 61   SER D OG    1 
ATOM   2576  N  N     . PHE D  4 62  ? -30.625 -30.248 29.795  1.00 47.72  ? 62   PHE D N     1 
ATOM   2577  C  CA    . PHE D  4 62  ? -29.531 -31.173 30.120  1.00 46.92  ? 62   PHE D CA    1 
ATOM   2578  C  C     . PHE D  4 62  ? -28.592 -31.455 28.927  1.00 46.70  ? 62   PHE D C     1 
ATOM   2579  O  O     . PHE D  4 62  ? -27.374 -31.336 29.047  1.00 46.53  ? 62   PHE D O     1 
ATOM   2580  C  CB    . PHE D  4 62  ? -30.114 -32.461 30.713  1.00 46.83  ? 62   PHE D CB    1 
ATOM   2581  C  CG    . PHE D  4 62  ? -29.100 -33.547 30.981  1.00 47.64  ? 62   PHE D CG    1 
ATOM   2582  C  CD1   . PHE D  4 62  ? -28.175 -33.431 32.023  1.00 47.85  ? 62   PHE D CD1   1 
ATOM   2583  C  CD2   . PHE D  4 62  ? -29.089 -34.714 30.206  1.00 49.06  ? 62   PHE D CD2   1 
ATOM   2584  C  CE1   . PHE D  4 62  ? -27.238 -34.446 32.282  1.00 47.96  ? 62   PHE D CE1   1 
ATOM   2585  C  CE2   . PHE D  4 62  ? -28.154 -35.751 30.460  1.00 48.86  ? 62   PHE D CE2   1 
ATOM   2586  C  CZ    . PHE D  4 62  ? -27.235 -35.618 31.502  1.00 48.42  ? 62   PHE D CZ    1 
ATOM   2587  N  N     . VAL D  4 63  ? -29.148 -31.791 27.767  1.00 46.40  ? 63   VAL D N     1 
ATOM   2588  C  CA    . VAL D  4 63  ? -28.300 -32.114 26.633  1.00 45.86  ? 63   VAL D CA    1 
ATOM   2589  C  C     . VAL D  4 63  ? -27.513 -30.897 26.165  1.00 46.00  ? 63   VAL D C     1 
ATOM   2590  O  O     . VAL D  4 63  ? -26.293 -30.979 26.013  1.00 46.12  ? 63   VAL D O     1 
ATOM   2591  C  CB    . VAL D  4 63  ? -29.061 -32.784 25.489  1.00 45.94  ? 63   VAL D CB    1 
ATOM   2592  C  CG1   . VAL D  4 63  ? -28.083 -33.188 24.393  1.00 45.14  ? 63   VAL D CG1   1 
ATOM   2593  C  CG2   . VAL D  4 63  ? -29.790 -33.995 26.003  1.00 44.66  ? 63   VAL D CG2   1 
ATOM   2594  N  N     . ASN D  4 64  ? -28.194 -29.765 25.977  1.00 46.03  ? 64   ASN D N     1 
ATOM   2595  C  CA    . ASN D  4 64  ? -27.515 -28.502 25.675  1.00 45.73  ? 64   ASN D CA    1 
ATOM   2596  C  C     . ASN D  4 64  ? -26.474 -28.123 26.743  1.00 45.62  ? 64   ASN D C     1 
ATOM   2597  O  O     . ASN D  4 64  ? -25.335 -27.742 26.431  1.00 45.49  ? 64   ASN D O     1 
ATOM   2598  C  CB    . ASN D  4 64  ? -28.536 -27.389 25.522  1.00 45.90  ? 64   ASN D CB    1 
ATOM   2599  C  CG    . ASN D  4 64  ? -29.358 -27.517 24.258  1.00 47.54  ? 64   ASN D CG    1 
ATOM   2600  O  OD1   . ASN D  4 64  ? -28.822 -27.634 23.148  1.00 48.47  ? 64   ASN D OD1   1 
ATOM   2601  N  ND2   . ASN D  4 64  ? -30.681 -27.475 24.414  1.00 50.35  ? 64   ASN D ND2   1 
ATOM   2602  N  N     . ASP D  4 65  ? -26.860 -28.248 28.007  1.00 45.16  ? 65   ASP D N     1 
ATOM   2603  C  CA    . ASP D  4 65  ? -25.967 -27.923 29.096  1.00 45.34  ? 65   ASP D CA    1 
ATOM   2604  C  C     . ASP D  4 65  ? -24.692 -28.752 28.997  1.00 45.06  ? 65   ASP D C     1 
ATOM   2605  O  O     . ASP D  4 65  ? -23.610 -28.198 28.996  1.00 45.12  ? 65   ASP D O     1 
ATOM   2606  C  CB    . ASP D  4 65  ? -26.703 -28.081 30.438  1.00 46.01  ? 65   ASP D CB    1 
ATOM   2607  C  CG    . ASP D  4 65  ? -25.800 -27.868 31.649  1.00 48.94  ? 65   ASP D CG    1 
ATOM   2608  O  OD1   . ASP D  4 65  ? -24.619 -27.463 31.476  1.00 51.52  ? 65   ASP D OD1   1 
ATOM   2609  O  OD2   . ASP D  4 65  ? -26.272 -28.133 32.786  1.00 51.19  ? 65   ASP D OD2   1 
ATOM   2610  N  N     . VAL D  4 66  ? -24.821 -30.075 28.878  1.00 45.33  ? 66   VAL D N     1 
ATOM   2611  C  CA    . VAL D  4 66  ? -23.666 -30.972 28.747  1.00 45.05  ? 66   VAL D CA    1 
ATOM   2612  C  C     . VAL D  4 66  ? -22.879 -30.740 27.450  1.00 45.29  ? 66   VAL D C     1 
ATOM   2613  O  O     . VAL D  4 66  ? -21.650 -30.703 27.487  1.00 44.87  ? 66   VAL D O     1 
ATOM   2614  C  CB    . VAL D  4 66  ? -24.073 -32.467 28.896  1.00 45.38  ? 66   VAL D CB    1 
ATOM   2615  C  CG1   . VAL D  4 66  ? -22.931 -33.401 28.531  1.00 44.24  ? 66   VAL D CG1   1 
ATOM   2616  C  CG2   . VAL D  4 66  ? -24.556 -32.760 30.328  1.00 46.17  ? 66   VAL D CG2   1 
ATOM   2617  N  N     . PHE D  4 67  ? -23.566 -30.592 26.313  1.00 45.87  ? 67   PHE D N     1 
ATOM   2618  C  CA    . PHE D  4 67  ? -22.887 -30.251 25.066  1.00 46.86  ? 67   PHE D CA    1 
ATOM   2619  C  C     . PHE D  4 67  ? -21.927 -29.073 25.266  1.00 47.40  ? 67   PHE D C     1 
ATOM   2620  O  O     . PHE D  4 67  ? -20.762 -29.169 24.884  1.00 48.00  ? 67   PHE D O     1 
ATOM   2621  C  CB    . PHE D  4 67  ? -23.870 -29.934 23.935  1.00 47.69  ? 67   PHE D CB    1 
ATOM   2622  C  CG    . PHE D  4 67  ? -23.197 -29.464 22.652  1.00 48.89  ? 67   PHE D CG    1 
ATOM   2623  C  CD1   . PHE D  4 67  ? -23.232 -30.246 21.502  1.00 51.54  ? 67   PHE D CD1   1 
ATOM   2624  C  CD2   . PHE D  4 67  ? -22.536 -28.248 22.592  1.00 49.89  ? 67   PHE D CD2   1 
ATOM   2625  C  CE1   . PHE D  4 67  ? -22.598 -29.830 20.314  1.00 50.65  ? 67   PHE D CE1   1 
ATOM   2626  C  CE2   . PHE D  4 67  ? -21.901 -27.832 21.420  1.00 50.69  ? 67   PHE D CE2   1 
ATOM   2627  C  CZ    . PHE D  4 67  ? -21.935 -28.627 20.285  1.00 50.46  ? 67   PHE D CZ    1 
ATOM   2628  N  N     . GLU D  4 68  ? -22.399 -27.976 25.866  1.00 47.63  ? 68   GLU D N     1 
ATOM   2629  C  CA    . GLU D  4 68  ? -21.566 -26.791 26.064  1.00 48.29  ? 68   GLU D CA    1 
ATOM   2630  C  C     . GLU D  4 68  ? -20.437 -27.037 27.021  1.00 47.64  ? 68   GLU D C     1 
ATOM   2631  O  O     . GLU D  4 68  ? -19.293 -26.689 26.717  1.00 47.87  ? 68   GLU D O     1 
ATOM   2632  C  CB    . GLU D  4 68  ? -22.382 -25.591 26.546  1.00 49.67  ? 68   GLU D CB    1 
ATOM   2633  C  CG    . GLU D  4 68  ? -23.009 -24.754 25.404  1.00 54.52  ? 68   GLU D CG    1 
ATOM   2634  C  CD    . GLU D  4 68  ? -24.336 -24.083 25.808  1.00 60.88  ? 68   GLU D CD    1 
ATOM   2635  O  OE1   . GLU D  4 68  ? -24.840 -24.317 26.951  1.00 62.32  ? 68   GLU D OE1   1 
ATOM   2636  O  OE2   . GLU D  4 68  ? -24.873 -23.315 24.965  1.00 64.15  ? 68   GLU D OE2   1 
ATOM   2637  N  N     . ARG D  4 69  ? -20.735 -27.634 28.177  1.00 47.12  ? 69   ARG D N     1 
ATOM   2638  C  CA    . ARG D  4 69  ? -19.676 -27.995 29.116  1.00 47.08  ? 69   ARG D CA    1 
ATOM   2639  C  C     . ARG D  4 69  ? -18.582 -28.776 28.404  1.00 47.22  ? 69   ARG D C     1 
ATOM   2640  O  O     . ARG D  4 69  ? -17.402 -28.468 28.572  1.00 47.86  ? 69   ARG D O     1 
ATOM   2641  C  CB    . ARG D  4 69  ? -20.199 -28.805 30.282  1.00 46.73  ? 69   ARG D CB    1 
ATOM   2642  C  CG    . ARG D  4 69  ? -21.112 -28.035 31.217  1.00 48.45  ? 69   ARG D CG    1 
ATOM   2643  C  CD    . ARG D  4 69  ? -21.250 -28.792 32.542  1.00 49.07  ? 69   ARG D CD    1 
ATOM   2644  N  NE    . ARG D  4 69  ? -22.617 -28.749 33.033  1.00 48.88  ? 69   ARG D NE    1 
ATOM   2645  C  CZ    . ARG D  4 69  ? -23.026 -29.276 34.186  1.00 49.32  ? 69   ARG D CZ    1 
ATOM   2646  N  NH1   . ARG D  4 69  ? -22.159 -29.917 34.984  1.00 46.39  ? 69   ARG D NH1   1 
ATOM   2647  N  NH2   . ARG D  4 69  ? -24.320 -29.174 34.523  1.00 47.76  ? 69   ARG D NH2   1 
ATOM   2648  N  N     . ILE D  4 70  ? -18.957 -29.764 27.583  1.00 46.73  ? 70   ILE D N     1 
ATOM   2649  C  CA    . ILE D  4 70  ? -17.933 -30.530 26.891  1.00 46.38  ? 70   ILE D CA    1 
ATOM   2650  C  C     . ILE D  4 70  ? -17.214 -29.720 25.817  1.00 46.18  ? 70   ILE D C     1 
ATOM   2651  O  O     . ILE D  4 70  ? -15.990 -29.600 25.871  1.00 45.70  ? 70   ILE D O     1 
ATOM   2652  C  CB    . ILE D  4 70  ? -18.405 -31.931 26.393  1.00 46.69  ? 70   ILE D CB    1 
ATOM   2653  C  CG1   . ILE D  4 70  ? -18.692 -32.845 27.589  1.00 45.44  ? 70   ILE D CG1   1 
ATOM   2654  C  CG2   . ILE D  4 70  ? -17.328 -32.571 25.516  1.00 45.31  ? 70   ILE D CG2   1 
ATOM   2655  C  CD1   . ILE D  4 70  ? -19.787 -33.801 27.348  1.00 42.86  ? 70   ILE D CD1   1 
ATOM   2656  N  N     . ALA D  4 71  ? -17.958 -29.165 24.864  1.00 46.19  ? 71   ALA D N     1 
ATOM   2657  C  CA    . ALA D  4 71  ? -17.336 -28.416 23.762  1.00 46.78  ? 71   ALA D CA    1 
ATOM   2658  C  C     . ALA D  4 71  ? -16.478 -27.270 24.282  1.00 47.04  ? 71   ALA D C     1 
ATOM   2659  O  O     . ALA D  4 71  ? -15.413 -26.981 23.720  1.00 47.49  ? 71   ALA D O     1 
ATOM   2660  C  CB    . ALA D  4 71  ? -18.369 -27.896 22.827  1.00 47.22  ? 71   ALA D CB    1 
ATOM   2661  N  N     . GLY D  4 72  ? -16.947 -26.633 25.357  1.00 46.61  ? 72   GLY D N     1 
ATOM   2662  C  CA    . GLY D  4 72  ? -16.170 -25.651 26.085  1.00 46.51  ? 72   GLY D CA    1 
ATOM   2663  C  C     . GLY D  4 72  ? -14.794 -26.110 26.528  1.00 46.71  ? 72   GLY D C     1 
ATOM   2664  O  O     . GLY D  4 72  ? -13.843 -25.403 26.292  1.00 47.06  ? 72   GLY D O     1 
ATOM   2665  N  N     . GLU D  4 73  ? -14.674 -27.275 27.174  1.00 47.32  ? 73   GLU D N     1 
ATOM   2666  C  CA    . GLU D  4 73  ? -13.362 -27.787 27.591  1.00 48.13  ? 73   GLU D CA    1 
ATOM   2667  C  C     . GLU D  4 73  ? -12.495 -28.133 26.413  1.00 48.25  ? 73   GLU D C     1 
ATOM   2668  O  O     . GLU D  4 73  ? -11.315 -27.798 26.400  1.00 48.13  ? 73   GLU D O     1 
ATOM   2669  C  CB    . GLU D  4 73  ? -13.468 -29.043 28.434  1.00 48.35  ? 73   GLU D CB    1 
ATOM   2670  C  CG    . GLU D  4 73  ? -13.612 -28.822 29.899  1.00 51.83  ? 73   GLU D CG    1 
ATOM   2671  C  CD    . GLU D  4 73  ? -12.382 -28.204 30.584  1.00 56.07  ? 73   GLU D CD    1 
ATOM   2672  O  OE1   . GLU D  4 73  ? -11.263 -28.133 29.993  1.00 55.47  ? 73   GLU D OE1   1 
ATOM   2673  O  OE2   . GLU D  4 73  ? -12.567 -27.778 31.755  1.00 59.00  ? 73   GLU D OE2   1 
ATOM   2674  N  N     . ALA D  4 74  ? -13.082 -28.830 25.440  1.00 48.80  ? 74   ALA D N     1 
ATOM   2675  C  CA    . ALA D  4 74  ? -12.363 -29.260 24.244  1.00 49.45  ? 74   ALA D CA    1 
ATOM   2676  C  C     . ALA D  4 74  ? -11.678 -28.053 23.641  1.00 49.80  ? 74   ALA D C     1 
ATOM   2677  O  O     . ALA D  4 74  ? -10.463 -28.080 23.415  1.00 49.56  ? 74   ALA D O     1 
ATOM   2678  C  CB    . ALA D  4 74  ? -13.314 -29.895 23.234  1.00 49.57  ? 74   ALA D CB    1 
ATOM   2679  N  N     . SER D  4 75  ? -12.470 -26.986 23.439  1.00 50.15  ? 75   SER D N     1 
ATOM   2680  C  CA    . SER D  4 75  ? -12.004 -25.693 22.933  1.00 50.12  ? 75   SER D CA    1 
ATOM   2681  C  C     . SER D  4 75  ? -10.798 -25.157 23.679  1.00 50.49  ? 75   SER D C     1 
ATOM   2682  O  O     . SER D  4 75  ? -9.846  -24.713 23.067  1.00 50.37  ? 75   SER D O     1 
ATOM   2683  C  CB    . SER D  4 75  ? -13.135 -24.682 23.003  1.00 50.10  ? 75   SER D CB    1 
ATOM   2684  O  OG    . SER D  4 75  ? -12.679 -23.395 22.644  1.00 50.07  ? 75   SER D OG    1 
ATOM   2685  N  N     . ARG D  4 76  ? -10.841 -25.202 25.004  1.00 51.56  ? 76   ARG D N     1 
ATOM   2686  C  CA    . ARG D  4 76  ? -9.701  -24.790 25.814  1.00 52.84  ? 76   ARG D CA    1 
ATOM   2687  C  C     . ARG D  4 76  ? -8.492  -25.701 25.633  1.00 53.52  ? 76   ARG D C     1 
ATOM   2688  O  O     . ARG D  4 76  ? -7.370  -25.212 25.482  1.00 53.94  ? 76   ARG D O     1 
ATOM   2689  C  CB    . ARG D  4 76  ? -10.078 -24.723 27.291  1.00 53.15  ? 76   ARG D CB    1 
ATOM   2690  C  CG    . ARG D  4 76  ? -10.895 -23.502 27.653  1.00 53.08  ? 76   ARG D CG    1 
ATOM   2691  C  CD    . ARG D  4 76  ? -11.261 -23.482 29.117  1.00 51.58  ? 76   ARG D CD    1 
ATOM   2692  N  NE    . ARG D  4 76  ? -12.691 -23.214 29.215  1.00 52.36  ? 76   ARG D NE    1 
ATOM   2693  C  CZ    . ARG D  4 76  ? -13.587 -24.098 29.638  1.00 54.20  ? 76   ARG D CZ    1 
ATOM   2694  N  NH1   . ARG D  4 76  ? -13.191 -25.308 30.034  1.00 55.04  ? 76   ARG D NH1   1 
ATOM   2695  N  NH2   . ARG D  4 76  ? -14.875 -23.773 29.681  1.00 53.42  ? 76   ARG D NH2   1 
ATOM   2696  N  N     . LEU D  4 77  ? -8.723  -27.017 25.661  1.00 54.09  ? 77   LEU D N     1 
ATOM   2697  C  CA    . LEU D  4 77  ? -7.669  -28.016 25.432  1.00 54.22  ? 77   LEU D CA    1 
ATOM   2698  C  C     . LEU D  4 77  ? -6.942  -27.772 24.113  1.00 54.80  ? 77   LEU D C     1 
ATOM   2699  O  O     . LEU D  4 77  ? -5.717  -27.861 24.061  1.00 54.83  ? 77   LEU D O     1 
ATOM   2700  C  CB    . LEU D  4 77  ? -8.245  -29.436 25.423  1.00 53.96  ? 77   LEU D CB    1 
ATOM   2701  C  CG    . LEU D  4 77  ? -8.294  -30.394 26.618  1.00 52.87  ? 77   LEU D CG    1 
ATOM   2702  C  CD1   . LEU D  4 77  ? -7.257  -30.046 27.688  1.00 52.64  ? 77   LEU D CD1   1 
ATOM   2703  C  CD2   . LEU D  4 77  ? -9.683  -30.533 27.202  1.00 50.22  ? 77   LEU D CD2   1 
ATOM   2704  N  N     . ALA D  4 78  ? -7.697  -27.472 23.057  1.00 55.45  ? 78   ALA D N     1 
ATOM   2705  C  CA    . ALA D  4 78  ? -7.111  -27.157 21.762  1.00 56.83  ? 78   ALA D CA    1 
ATOM   2706  C  C     . ALA D  4 78  ? -6.267  -25.899 21.807  1.00 58.13  ? 78   ALA D C     1 
ATOM   2707  O  O     . ALA D  4 78  ? -5.186  -25.878 21.222  1.00 58.36  ? 78   ALA D O     1 
ATOM   2708  C  CB    . ALA D  4 78  ? -8.171  -27.033 20.710  1.00 56.98  ? 78   ALA D CB    1 
ATOM   2709  N  N     . HIS D  4 79  ? -6.754  -24.858 22.497  1.00 60.00  ? 79   HIS D N     1 
ATOM   2710  C  CA    . HIS D  4 79  ? -5.987  -23.607 22.682  1.00 61.79  ? 79   HIS D CA    1 
ATOM   2711  C  C     . HIS D  4 79  ? -4.708  -23.897 23.466  1.00 62.38  ? 79   HIS D C     1 
ATOM   2712  O  O     . HIS D  4 79  ? -3.617  -23.604 22.998  1.00 62.37  ? 79   HIS D O     1 
ATOM   2713  C  CB    . HIS D  4 79  ? -6.793  -22.510 23.415  1.00 62.31  ? 79   HIS D CB    1 
ATOM   2714  C  CG    . HIS D  4 79  ? -7.928  -21.917 22.623  1.00 65.22  ? 79   HIS D CG    1 
ATOM   2715  N  ND1   . HIS D  4 79  ? -7.759  -21.345 21.372  1.00 67.23  ? 79   HIS D ND1   1 
ATOM   2716  C  CD2   . HIS D  4 79  ? -9.241  -21.758 22.934  1.00 66.54  ? 79   HIS D CD2   1 
ATOM   2717  C  CE1   . HIS D  4 79  ? -8.924  -20.894 20.936  1.00 67.37  ? 79   HIS D CE1   1 
ATOM   2718  N  NE2   . HIS D  4 79  ? -9.840  -21.136 21.861  1.00 67.88  ? 79   HIS D NE2   1 
ATOM   2719  N  N     . TYR D  4 80  ? -4.850  -24.489 24.653  1.00 63.43  ? 80   TYR D N     1 
ATOM   2720  C  CA    . TYR D  4 80  ? -3.710  -24.785 25.516  1.00 64.92  ? 80   TYR D CA    1 
ATOM   2721  C  C     . TYR D  4 80  ? -2.558  -25.468 24.788  1.00 65.55  ? 80   TYR D C     1 
ATOM   2722  O  O     . TYR D  4 80  ? -1.394  -25.247 25.113  1.00 65.83  ? 80   TYR D O     1 
ATOM   2723  C  CB    . TYR D  4 80  ? -4.113  -25.693 26.673  1.00 65.16  ? 80   TYR D CB    1 
ATOM   2724  C  CG    . TYR D  4 80  ? -5.068  -25.095 27.673  1.00 66.72  ? 80   TYR D CG    1 
ATOM   2725  C  CD1   . TYR D  4 80  ? -5.730  -25.920 28.588  1.00 67.64  ? 80   TYR D CD1   1 
ATOM   2726  C  CD2   . TYR D  4 80  ? -5.321  -23.714 27.721  1.00 66.54  ? 80   TYR D CD2   1 
ATOM   2727  C  CE1   . TYR D  4 80  ? -6.611  -25.394 29.532  1.00 67.33  ? 80   TYR D CE1   1 
ATOM   2728  C  CE2   . TYR D  4 80  ? -6.206  -23.183 28.661  1.00 66.30  ? 80   TYR D CE2   1 
ATOM   2729  C  CZ    . TYR D  4 80  ? -6.843  -24.035 29.559  1.00 66.57  ? 80   TYR D CZ    1 
ATOM   2730  O  OH    . TYR D  4 80  ? -7.723  -23.550 30.493  1.00 67.45  ? 80   TYR D OH    1 
ATOM   2731  N  N     . ASN D  4 81  ? -2.875  -26.310 23.816  1.00 66.12  ? 81   ASN D N     1 
ATOM   2732  C  CA    . ASN D  4 81  ? -1.856  -27.155 23.236  1.00 66.98  ? 81   ASN D CA    1 
ATOM   2733  C  C     . ASN D  4 81  ? -1.432  -26.648 21.881  1.00 67.61  ? 81   ASN D C     1 
ATOM   2734  O  O     . ASN D  4 81  ? -0.787  -27.368 21.107  1.00 68.20  ? 81   ASN D O     1 
ATOM   2735  C  CB    . ASN D  4 81  ? -2.333  -28.612 23.202  1.00 66.92  ? 81   ASN D CB    1 
ATOM   2736  C  CG    . ASN D  4 81  ? -2.226  -29.275 24.560  1.00 67.34  ? 81   ASN D CG    1 
ATOM   2737  O  OD1   . ASN D  4 81  ? -1.155  -29.719 24.949  1.00 68.15  ? 81   ASN D OD1   1 
ATOM   2738  N  ND2   . ASN D  4 81  ? -3.331  -29.318 25.301  1.00 68.22  ? 81   ASN D ND2   1 
ATOM   2739  N  N     . LYS D  4 82  ? -1.797  -25.394 21.616  1.00 68.02  ? 82   LYS D N     1 
ATOM   2740  C  CA    . LYS D  4 82  ? -1.507  -24.704 20.356  1.00 68.20  ? 82   LYS D CA    1 
ATOM   2741  C  C     . LYS D  4 82  ? -1.932  -25.500 19.121  1.00 67.66  ? 82   LYS D C     1 
ATOM   2742  O  O     . LYS D  4 82  ? -1.127  -25.735 18.216  1.00 67.91  ? 82   LYS D O     1 
ATOM   2743  C  CB    . LYS D  4 82  ? -0.030  -24.300 20.281  1.00 68.48  ? 82   LYS D CB    1 
ATOM   2744  C  CG    . LYS D  4 82  ? 0.436   -23.473 21.471  1.00 71.52  ? 82   LYS D CG    1 
ATOM   2745  C  CD    . LYS D  4 82  ? 1.237   -22.240 21.034  1.00 76.02  ? 82   LYS D CD    1 
ATOM   2746  C  CE    . LYS D  4 82  ? 1.744   -21.455 22.248  1.00 78.47  ? 82   LYS D CE    1 
ATOM   2747  N  NZ    . LYS D  4 82  ? 2.299   -20.110 21.851  1.00 80.58  ? 82   LYS D NZ    1 
ATOM   2748  N  N     . ARG D  4 83  ? -3.192  -25.919 19.098  1.00 66.93  ? 83   ARG D N     1 
ATOM   2749  C  CA    . ARG D  4 83  ? -3.742  -26.644 17.960  1.00 67.05  ? 83   ARG D CA    1 
ATOM   2750  C  C     . ARG D  4 83  ? -5.036  -25.988 17.488  1.00 66.29  ? 83   ARG D C     1 
ATOM   2751  O  O     . ARG D  4 83  ? -5.742  -25.370 18.282  1.00 66.54  ? 83   ARG D O     1 
ATOM   2752  C  CB    . ARG D  4 83  ? -4.033  -28.101 18.325  1.00 66.96  ? 83   ARG D CB    1 
ATOM   2753  C  CG    . ARG D  4 83  ? -2.844  -28.970 18.708  1.00 67.71  ? 83   ARG D CG    1 
ATOM   2754  C  CD    . ARG D  4 83  ? -3.312  -30.412 18.988  1.00 68.76  ? 83   ARG D CD    1 
ATOM   2755  N  NE    . ARG D  4 83  ? -3.819  -31.052 17.765  1.00 74.16  ? 83   ARG D NE    1 
ATOM   2756  C  CZ    . ARG D  4 83  ? -5.112  -31.171 17.428  1.00 74.91  ? 83   ARG D CZ    1 
ATOM   2757  N  NH1   . ARG D  4 83  ? -6.079  -30.722 18.237  1.00 74.35  ? 83   ARG D NH1   1 
ATOM   2758  N  NH2   . ARG D  4 83  ? -5.439  -31.759 16.275  1.00 73.86  ? 83   ARG D NH2   1 
ATOM   2759  N  N     . SER D  4 84  ? -5.365  -26.167 16.207  1.00 65.47  ? 84   SER D N     1 
ATOM   2760  C  CA    . SER D  4 84  ? -6.491  -25.483 15.571  1.00 64.37  ? 84   SER D CA    1 
ATOM   2761  C  C     . SER D  4 84  ? -7.733  -26.354 15.391  1.00 63.79  ? 84   SER D C     1 
ATOM   2762  O  O     . SER D  4 84  ? -8.713  -25.916 14.774  1.00 64.00  ? 84   SER D O     1 
ATOM   2763  C  CB    . SER D  4 84  ? -6.069  -24.946 14.202  1.00 64.52  ? 84   SER D CB    1 
ATOM   2764  O  OG    . SER D  4 84  ? -4.750  -24.414 14.229  1.00 65.35  ? 84   SER D OG    1 
ATOM   2765  N  N     . THR D  4 85  ? -7.707  -27.577 15.923  1.00 62.71  ? 85   THR D N     1 
ATOM   2766  C  CA    . THR D  4 85  ? -8.792  -28.540 15.682  1.00 61.58  ? 85   THR D CA    1 
ATOM   2767  C  C     . THR D  4 85  ? -9.336  -29.205 16.936  1.00 60.53  ? 85   THR D C     1 
ATOM   2768  O  O     . THR D  4 85  ? -8.571  -29.613 17.813  1.00 60.53  ? 85   THR D O     1 
ATOM   2769  C  CB    . THR D  4 85  ? -8.345  -29.662 14.729  1.00 61.81  ? 85   THR D CB    1 
ATOM   2770  O  OG1   . THR D  4 85  ? -6.943  -29.532 14.448  1.00 62.65  ? 85   THR D OG1   1 
ATOM   2771  C  CG2   . THR D  4 85  ? -9.104  -29.589 13.443  1.00 62.64  ? 85   THR D CG2   1 
ATOM   2772  N  N     . ILE D  4 86  ? -10.659 -29.336 17.007  1.00 59.30  ? 86   ILE D N     1 
ATOM   2773  C  CA    . ILE D  4 86  ? -11.291 -30.124 18.064  1.00 58.18  ? 86   ILE D CA    1 
ATOM   2774  C  C     . ILE D  4 86  ? -11.524 -31.532 17.538  1.00 57.75  ? 86   ILE D C     1 
ATOM   2775  O  O     . ILE D  4 86  ? -12.453 -31.785 16.770  1.00 57.72  ? 86   ILE D O     1 
ATOM   2776  C  CB    . ILE D  4 86  ? -12.575 -29.457 18.582  1.00 58.17  ? 86   ILE D CB    1 
ATOM   2777  C  CG1   . ILE D  4 86  ? -12.193 -28.234 19.422  1.00 58.08  ? 86   ILE D CG1   1 
ATOM   2778  C  CG2   . ILE D  4 86  ? -13.415 -30.424 19.423  1.00 57.99  ? 86   ILE D CG2   1 
ATOM   2779  C  CD1   . ILE D  4 86  ? -13.334 -27.321 19.735  1.00 56.81  ? 86   ILE D CD1   1 
ATOM   2780  N  N     . THR D  4 87  ? -10.630 -32.434 17.929  1.00 57.13  ? 87   THR D N     1 
ATOM   2781  C  CA    . THR D  4 87  ? -10.662 -33.830 17.505  1.00 56.41  ? 87   THR D CA    1 
ATOM   2782  C  C     . THR D  4 87  ? -11.338 -34.688 18.575  1.00 55.98  ? 87   THR D C     1 
ATOM   2783  O  O     . THR D  4 87  ? -11.773 -34.172 19.600  1.00 56.17  ? 87   THR D O     1 
ATOM   2784  C  CB    . THR D  4 87  ? -9.242  -34.338 17.250  1.00 56.50  ? 87   THR D CB    1 
ATOM   2785  O  OG1   . THR D  4 87  ? -8.504  -34.310 18.480  1.00 57.91  ? 87   THR D OG1   1 
ATOM   2786  C  CG2   . THR D  4 87  ? -8.537  -33.467 16.219  1.00 55.29  ? 87   THR D CG2   1 
ATOM   2787  N  N     . SER D  4 88  ? -11.436 -35.994 18.354  1.00 55.46  ? 88   SER D N     1 
ATOM   2788  C  CA    . SER D  4 88  ? -12.095 -36.858 19.336  1.00 55.01  ? 88   SER D CA    1 
ATOM   2789  C  C     . SER D  4 88  ? -11.207 -37.055 20.554  1.00 54.23  ? 88   SER D C     1 
ATOM   2790  O  O     . SER D  4 88  ? -11.665 -37.481 21.603  1.00 54.12  ? 88   SER D O     1 
ATOM   2791  C  CB    . SER D  4 88  ? -12.460 -38.200 18.727  1.00 55.13  ? 88   SER D CB    1 
ATOM   2792  O  OG    . SER D  4 88  ? -11.281 -38.860 18.313  1.00 56.57  ? 88   SER D OG    1 
ATOM   2793  N  N     . ARG D  4 89  ? -9.935  -36.717 20.414  1.00 53.76  ? 89   ARG D N     1 
ATOM   2794  C  CA    . ARG D  4 89  ? -9.025  -36.738 21.534  1.00 53.50  ? 89   ARG D CA    1 
ATOM   2795  C  C     . ARG D  4 89  ? -9.364  -35.660 22.563  1.00 53.61  ? 89   ARG D C     1 
ATOM   2796  O  O     . ARG D  4 89  ? -9.368  -35.941 23.760  1.00 53.79  ? 89   ARG D O     1 
ATOM   2797  C  CB    . ARG D  4 89  ? -7.602  -36.568 21.064  1.00 53.28  ? 89   ARG D CB    1 
ATOM   2798  C  CG    . ARG D  4 89  ? -6.644  -37.081 22.059  1.00 54.99  ? 89   ARG D CG    1 
ATOM   2799  C  CD    . ARG D  4 89  ? -5.323  -37.424 21.424  1.00 59.28  ? 89   ARG D CD    1 
ATOM   2800  N  NE    . ARG D  4 89  ? -4.393  -37.913 22.443  1.00 62.26  ? 89   ARG D NE    1 
ATOM   2801  C  CZ    . ARG D  4 89  ? -3.751  -37.138 23.307  1.00 62.40  ? 89   ARG D CZ    1 
ATOM   2802  N  NH1   . ARG D  4 89  ? -3.917  -35.820 23.286  1.00 62.68  ? 89   ARG D NH1   1 
ATOM   2803  N  NH2   . ARG D  4 89  ? -2.939  -37.687 24.190  1.00 63.40  ? 89   ARG D NH2   1 
ATOM   2804  N  N     . GLU D  4 90  ? -9.650  -34.434 22.107  1.00 53.02  ? 90   GLU D N     1 
ATOM   2805  C  CA    . GLU D  4 90  ? -10.116 -33.388 23.011  1.00 52.23  ? 90   GLU D CA    1 
ATOM   2806  C  C     . GLU D  4 90  ? -11.469 -33.670 23.640  1.00 50.96  ? 90   GLU D C     1 
ATOM   2807  O  O     . GLU D  4 90  ? -11.698 -33.299 24.785  1.00 51.54  ? 90   GLU D O     1 
ATOM   2808  C  CB    . GLU D  4 90  ? -10.180 -32.038 22.330  1.00 52.74  ? 90   GLU D CB    1 
ATOM   2809  C  CG    . GLU D  4 90  ? -8.876  -31.375 22.283  1.00 55.73  ? 90   GLU D CG    1 
ATOM   2810  C  CD    . GLU D  4 90  ? -8.140  -31.768 21.054  1.00 61.31  ? 90   GLU D CD    1 
ATOM   2811  O  OE1   . GLU D  4 90  ? -8.762  -31.706 19.964  1.00 62.61  ? 90   GLU D OE1   1 
ATOM   2812  O  OE2   . GLU D  4 90  ? -6.950  -32.143 21.181  1.00 64.16  ? 90   GLU D OE2   1 
ATOM   2813  N  N     . ILE D  4 91  ? -12.373 -34.288 22.897  1.00 49.20  ? 91   ILE D N     1 
ATOM   2814  C  CA    . ILE D  4 91  ? -13.679 -34.611 23.446  1.00 48.18  ? 91   ILE D CA    1 
ATOM   2815  C  C     . ILE D  4 91  ? -13.492 -35.603 24.587  1.00 48.10  ? 91   ILE D C     1 
ATOM   2816  O  O     . ILE D  4 91  ? -14.187 -35.531 25.613  1.00 47.95  ? 91   ILE D O     1 
ATOM   2817  C  CB    . ILE D  4 91  ? -14.630 -35.212 22.375  1.00 47.93  ? 91   ILE D CB    1 
ATOM   2818  C  CG1   . ILE D  4 91  ? -14.825 -34.236 21.210  1.00 47.88  ? 91   ILE D CG1   1 
ATOM   2819  C  CG2   . ILE D  4 91  ? -15.952 -35.618 22.984  1.00 45.97  ? 91   ILE D CG2   1 
ATOM   2820  C  CD1   . ILE D  4 91  ? -15.451 -32.886 21.579  1.00 47.47  ? 91   ILE D CD1   1 
ATOM   2821  N  N     . GLN D  4 92  ? -12.546 -36.526 24.398  1.00 47.15  ? 92   GLN D N     1 
ATOM   2822  C  CA    . GLN D  4 92  ? -12.332 -37.595 25.349  1.00 46.25  ? 92   GLN D CA    1 
ATOM   2823  C  C     . GLN D  4 92  ? -11.807 -37.065 26.681  1.00 44.84  ? 92   GLN D C     1 
ATOM   2824  O  O     . GLN D  4 92  ? -12.347 -37.375 27.756  1.00 44.39  ? 92   GLN D O     1 
ATOM   2825  C  CB    . GLN D  4 92  ? -11.382 -38.636 24.779  1.00 46.39  ? 92   GLN D CB    1 
ATOM   2826  C  CG    . GLN D  4 92  ? -11.030 -39.699 25.792  1.00 49.49  ? 92   GLN D CG    1 
ATOM   2827  C  CD    . GLN D  4 92  ? -10.652 -41.010 25.158  1.00 52.84  ? 92   GLN D CD    1 
ATOM   2828  O  OE1   . GLN D  4 92  ? -9.490  -41.426 25.199  1.00 53.74  ? 92   GLN D OE1   1 
ATOM   2829  N  NE2   . GLN D  4 92  ? -11.633 -41.678 24.570  1.00 53.49  ? 92   GLN D NE2   1 
ATOM   2830  N  N     . THR D  4 93  ? -10.770 -36.244 26.612  1.00 43.60  ? 93   THR D N     1 
ATOM   2831  C  CA    . THR D  4 93  ? -10.209 -35.683 27.837  1.00 42.59  ? 93   THR D CA    1 
ATOM   2832  C  C     . THR D  4 93  ? -11.097 -34.592 28.472  1.00 42.30  ? 93   THR D C     1 
ATOM   2833  O  O     . THR D  4 93  ? -11.109 -34.438 29.694  1.00 41.44  ? 93   THR D O     1 
ATOM   2834  C  CB    . THR D  4 93  ? -8.788  -35.220 27.676  1.00 41.81  ? 93   THR D CB    1 
ATOM   2835  O  OG1   . THR D  4 93  ? -8.695  -33.929 28.258  1.00 44.02  ? 93   THR D OG1   1 
ATOM   2836  C  CG2   . THR D  4 93  ? -8.400  -35.131 26.247  1.00 39.98  ? 93   THR D CG2   1 
ATOM   2837  N  N     . ALA D  4 94  ? -11.852 -33.873 27.634  1.00 42.19  ? 94   ALA D N     1 
ATOM   2838  C  CA    . ALA D  4 94  ? -12.917 -32.990 28.093  1.00 42.32  ? 94   ALA D CA    1 
ATOM   2839  C  C     . ALA D  4 94  ? -13.867 -33.760 29.000  1.00 42.91  ? 94   ALA D C     1 
ATOM   2840  O  O     . ALA D  4 94  ? -14.110 -33.358 30.143  1.00 42.87  ? 94   ALA D O     1 
ATOM   2841  C  CB    . ALA D  4 94  ? -13.655 -32.422 26.927  1.00 41.84  ? 94   ALA D CB    1 
ATOM   2842  N  N     . VAL D  4 95  ? -14.384 -34.868 28.472  1.00 43.66  ? 95   VAL D N     1 
ATOM   2843  C  CA    . VAL D  4 95  ? -15.220 -35.837 29.190  1.00 44.44  ? 95   VAL D CA    1 
ATOM   2844  C  C     . VAL D  4 95  ? -14.568 -36.356 30.491  1.00 45.18  ? 95   VAL D C     1 
ATOM   2845  O  O     . VAL D  4 95  ? -15.233 -36.471 31.529  1.00 45.06  ? 95   VAL D O     1 
ATOM   2846  C  CB    . VAL D  4 95  ? -15.576 -37.031 28.254  1.00 44.38  ? 95   VAL D CB    1 
ATOM   2847  C  CG1   . VAL D  4 95  ? -16.247 -38.187 29.024  1.00 43.67  ? 95   VAL D CG1   1 
ATOM   2848  C  CG2   . VAL D  4 95  ? -16.459 -36.553 27.104  1.00 44.40  ? 95   VAL D CG2   1 
ATOM   2849  N  N     . ARG D  4 96  ? -13.276 -36.674 30.438  1.00 45.84  ? 96   ARG D N     1 
ATOM   2850  C  CA    . ARG D  4 96  ? -12.587 -37.135 31.636  1.00 46.77  ? 96   ARG D CA    1 
ATOM   2851  C  C     . ARG D  4 96  ? -12.524 -36.035 32.683  1.00 46.60  ? 96   ARG D C     1 
ATOM   2852  O  O     . ARG D  4 96  ? -12.636 -36.321 33.865  1.00 46.97  ? 96   ARG D O     1 
ATOM   2853  C  CB    . ARG D  4 96  ? -11.176 -37.639 31.321  1.00 47.51  ? 96   ARG D CB    1 
ATOM   2854  C  CG    . ARG D  4 96  ? -11.119 -39.057 30.790  1.00 50.75  ? 96   ARG D CG    1 
ATOM   2855  C  CD    . ARG D  4 96  ? -9.738  -39.633 30.943  1.00 57.12  ? 96   ARG D CD    1 
ATOM   2856  N  NE    . ARG D  4 96  ? -9.257  -40.090 29.640  1.00 63.86  ? 96   ARG D NE    1 
ATOM   2857  C  CZ    . ARG D  4 96  ? -8.051  -39.818 29.124  1.00 66.56  ? 96   ARG D CZ    1 
ATOM   2858  N  NH1   . ARG D  4 96  ? -7.146  -39.102 29.829  1.00 65.29  ? 96   ARG D NH1   1 
ATOM   2859  N  NH2   . ARG D  4 96  ? -7.744  -40.288 27.903  1.00 65.69  ? 96   ARG D NH2   1 
ATOM   2860  N  N     . LEU D  4 97  ? -12.350 -34.781 32.256  1.00 46.21  ? 97   LEU D N     1 
ATOM   2861  C  CA    . LEU D  4 97  ? -12.358 -33.663 33.193  1.00 45.63  ? 97   LEU D CA    1 
ATOM   2862  C  C     . LEU D  4 97  ? -13.767 -33.386 33.693  1.00 46.39  ? 97   LEU D C     1 
ATOM   2863  O  O     . LEU D  4 97  ? -13.977 -33.119 34.854  1.00 47.01  ? 97   LEU D O     1 
ATOM   2864  C  CB    . LEU D  4 97  ? -11.742 -32.410 32.573  1.00 44.91  ? 97   LEU D CB    1 
ATOM   2865  C  CG    . LEU D  4 97  ? -10.284 -32.494 32.100  1.00 43.56  ? 97   LEU D CG    1 
ATOM   2866  C  CD1   . LEU D  4 97  ? -10.005 -31.485 31.007  1.00 40.40  ? 97   LEU D CD1   1 
ATOM   2867  C  CD2   . LEU D  4 97  ? -9.270  -32.378 33.244  1.00 41.56  ? 97   LEU D CD2   1 
ATOM   2868  N  N     . LEU D  4 98  ? -14.755 -33.490 32.833  1.00 47.35  ? 98   LEU D N     1 
ATOM   2869  C  CA    . LEU D  4 98  ? -16.068 -33.059 33.222  1.00 48.80  ? 98   LEU D CA    1 
ATOM   2870  C  C     . LEU D  4 98  ? -16.904 -34.007 34.055  1.00 49.21  ? 98   LEU D C     1 
ATOM   2871  O  O     . LEU D  4 98  ? -17.656 -33.551 34.923  1.00 49.26  ? 98   LEU D O     1 
ATOM   2872  C  CB    . LEU D  4 98  ? -16.873 -32.688 31.999  1.00 49.65  ? 98   LEU D CB    1 
ATOM   2873  C  CG    . LEU D  4 98  ? -17.878 -31.656 32.485  1.00 53.13  ? 98   LEU D CG    1 
ATOM   2874  C  CD1   . LEU D  4 98  ? -17.266 -30.235 32.230  1.00 54.88  ? 98   LEU D CD1   1 
ATOM   2875  C  CD2   . LEU D  4 98  ? -19.281 -31.877 31.856  1.00 54.99  ? 98   LEU D CD2   1 
ATOM   2876  N  N     . LEU D  4 99  ? -16.821 -35.307 33.752  1.00 50.10  ? 99   LEU D N     1 
ATOM   2877  C  CA    . LEU D  4 99  ? -17.703 -36.321 34.342  1.00 50.47  ? 99   LEU D CA    1 
ATOM   2878  C  C     . LEU D  4 99  ? -17.011 -37.021 35.490  1.00 51.38  ? 99   LEU D C     1 
ATOM   2879  O  O     . LEU D  4 99  ? -15.811 -37.278 35.421  1.00 51.95  ? 99   LEU D O     1 
ATOM   2880  C  CB    . LEU D  4 99  ? -18.157 -37.350 33.305  1.00 49.81  ? 99   LEU D CB    1 
ATOM   2881  C  CG    . LEU D  4 99  ? -18.985 -36.904 32.097  1.00 50.06  ? 99   LEU D CG    1 
ATOM   2882  C  CD1   . LEU D  4 99  ? -19.391 -38.094 31.233  1.00 49.02  ? 99   LEU D CD1   1 
ATOM   2883  C  CD2   . LEU D  4 99  ? -20.225 -36.105 32.485  1.00 48.57  ? 99   LEU D CD2   1 
ATOM   2884  N  N     . PRO D  4 100 ? -17.763 -37.329 36.554  1.00 52.26  ? 100  PRO D N     1 
ATOM   2885  C  CA    . PRO D  4 100 ? -17.227 -38.000 37.733  1.00 53.45  ? 100  PRO D CA    1 
ATOM   2886  C  C     . PRO D  4 100 ? -16.970 -39.486 37.491  1.00 54.92  ? 100  PRO D C     1 
ATOM   2887  O  O     . PRO D  4 100 ? -17.500 -40.054 36.537  1.00 55.52  ? 100  PRO D O     1 
ATOM   2888  C  CB    . PRO D  4 100 ? -18.335 -37.817 38.766  1.00 53.58  ? 100  PRO D CB    1 
ATOM   2889  C  CG    . PRO D  4 100 ? -19.579 -37.681 37.972  1.00 52.72  ? 100  PRO D CG    1 
ATOM   2890  C  CD    . PRO D  4 100 ? -19.200 -37.033 36.685  1.00 52.24  ? 100  PRO D CD    1 
ATOM   2891  N  N     . GLY D  4 101 ? -16.167 -40.096 38.364  1.00 56.10  ? 101  GLY D N     1 
ATOM   2892  C  CA    . GLY D  4 101 ? -15.723 -41.499 38.263  1.00 57.06  ? 101  GLY D CA    1 
ATOM   2893  C  C     . GLY D  4 101 ? -16.276 -42.415 37.178  1.00 57.99  ? 101  GLY D C     1 
ATOM   2894  O  O     . GLY D  4 101 ? -15.720 -42.494 36.073  1.00 57.67  ? 101  GLY D O     1 
ATOM   2895  N  N     . GLU D  4 102 ? -17.368 -43.107 37.505  1.00 58.66  ? 102  GLU D N     1 
ATOM   2896  C  CA    . GLU D  4 102 ? -17.854 -44.248 36.714  1.00 59.89  ? 102  GLU D CA    1 
ATOM   2897  C  C     . GLU D  4 102 ? -18.521 -43.825 35.396  1.00 59.59  ? 102  GLU D C     1 
ATOM   2898  O  O     . GLU D  4 102 ? -18.339 -44.488 34.364  1.00 60.04  ? 102  GLU D O     1 
ATOM   2899  C  CB    . GLU D  4 102 ? -18.800 -45.122 37.560  1.00 60.53  ? 102  GLU D CB    1 
ATOM   2900  C  CG    . GLU D  4 102 ? -18.958 -46.568 37.082  1.00 64.36  ? 102  GLU D CG    1 
ATOM   2901  C  CD    . GLU D  4 102 ? -17.765 -47.459 37.459  1.00 70.20  ? 102  GLU D CD    1 
ATOM   2902  O  OE1   . GLU D  4 102 ? -17.079 -47.144 38.471  1.00 71.60  ? 102  GLU D OE1   1 
ATOM   2903  O  OE2   . GLU D  4 102 ? -17.521 -48.482 36.749  1.00 71.24  ? 102  GLU D OE2   1 
ATOM   2904  N  N     . LEU D  4 103 ? -19.299 -42.737 35.452  1.00 59.02  ? 103  LEU D N     1 
ATOM   2905  C  CA    . LEU D  4 103 ? -19.834 -42.036 34.279  1.00 57.85  ? 103  LEU D CA    1 
ATOM   2906  C  C     . LEU D  4 103 ? -18.757 -41.705 33.240  1.00 57.67  ? 103  LEU D C     1 
ATOM   2907  O  O     . LEU D  4 103 ? -18.966 -41.877 32.041  1.00 57.45  ? 103  LEU D O     1 
ATOM   2908  C  CB    . LEU D  4 103 ? -20.505 -40.752 34.741  1.00 57.51  ? 103  LEU D CB    1 
ATOM   2909  C  CG    . LEU D  4 103 ? -22.025 -40.573 34.712  1.00 57.43  ? 103  LEU D CG    1 
ATOM   2910  C  CD1   . LEU D  4 103 ? -22.802 -41.874 34.753  1.00 57.40  ? 103  LEU D CD1   1 
ATOM   2911  C  CD2   . LEU D  4 103 ? -22.475 -39.633 35.830  1.00 57.57  ? 103  LEU D CD2   1 
ATOM   2912  N  N     . ALA D  4 104 ? -17.596 -41.254 33.702  1.00 57.67  ? 104  ALA D N     1 
ATOM   2913  C  CA    . ALA D  4 104 ? -16.483 -40.946 32.806  1.00 57.93  ? 104  ALA D CA    1 
ATOM   2914  C  C     . ALA D  4 104 ? -16.014 -42.192 32.063  1.00 58.26  ? 104  ALA D C     1 
ATOM   2915  O  O     . ALA D  4 104 ? -15.838 -42.158 30.853  1.00 58.24  ? 104  ALA D O     1 
ATOM   2916  C  CB    . ALA D  4 104 ? -15.343 -40.312 33.576  1.00 57.66  ? 104  ALA D CB    1 
ATOM   2917  N  N     . LYS D  4 105 ? -15.859 -43.291 32.805  1.00 58.82  ? 105  LYS D N     1 
ATOM   2918  C  CA    . LYS D  4 105 ? -15.423 -44.590 32.292  1.00 59.22  ? 105  LYS D CA    1 
ATOM   2919  C  C     . LYS D  4 105 ? -16.398 -45.173 31.274  1.00 58.54  ? 105  LYS D C     1 
ATOM   2920  O  O     . LYS D  4 105 ? -15.983 -45.637 30.205  1.00 58.31  ? 105  LYS D O     1 
ATOM   2921  C  CB    . LYS D  4 105 ? -15.233 -45.558 33.453  1.00 59.16  ? 105  LYS D CB    1 
ATOM   2922  C  CG    . LYS D  4 105 ? -14.622 -46.919 33.094  1.00 61.32  ? 105  LYS D CG    1 
ATOM   2923  C  CD    . LYS D  4 105 ? -14.895 -47.957 34.210  1.00 61.81  ? 105  LYS D CD    1 
ATOM   2924  C  CE    . LYS D  4 105 ? -14.022 -47.696 35.457  1.00 66.71  ? 105  LYS D CE    1 
ATOM   2925  N  NZ    . LYS D  4 105 ? -14.801 -47.819 36.741  1.00 67.78  ? 105  LYS D NZ    1 
ATOM   2926  N  N     . HIS D  4 106 ? -17.687 -45.149 31.588  1.00 58.17  ? 106  HIS D N     1 
ATOM   2927  C  CA    . HIS D  4 106 ? -18.670 -45.602 30.617  1.00 58.63  ? 106  HIS D CA    1 
ATOM   2928  C  C     . HIS D  4 106 ? -18.715 -44.733 29.361  1.00 58.37  ? 106  HIS D C     1 
ATOM   2929  O  O     . HIS D  4 106 ? -18.733 -45.260 28.246  1.00 58.32  ? 106  HIS D O     1 
ATOM   2930  C  CB    . HIS D  4 106 ? -20.054 -45.720 31.240  1.00 59.06  ? 106  HIS D CB    1 
ATOM   2931  C  CG    . HIS D  4 106 ? -20.172 -46.839 32.224  1.00 62.57  ? 106  HIS D CG    1 
ATOM   2932  N  ND1   . HIS D  4 106 ? -21.065 -46.815 33.276  1.00 65.84  ? 106  HIS D ND1   1 
ATOM   2933  C  CD2   . HIS D  4 106 ? -19.498 -48.011 32.328  1.00 65.01  ? 106  HIS D CD2   1 
ATOM   2934  C  CE1   . HIS D  4 106 ? -20.939 -47.925 33.983  1.00 66.67  ? 106  HIS D CE1   1 
ATOM   2935  N  NE2   . HIS D  4 106 ? -19.994 -48.667 33.430  1.00 67.08  ? 106  HIS D NE2   1 
ATOM   2936  N  N     . ALA D  4 107 ? -18.707 -43.408 29.556  1.00 57.91  ? 107  ALA D N     1 
ATOM   2937  C  CA    . ALA D  4 107 ? -18.810 -42.439 28.473  1.00 56.94  ? 107  ALA D CA    1 
ATOM   2938  C  C     . ALA D  4 107 ? -17.650 -42.555 27.494  1.00 56.45  ? 107  ALA D C     1 
ATOM   2939  O  O     . ALA D  4 107 ? -17.842 -42.412 26.288  1.00 56.24  ? 107  ALA D O     1 
ATOM   2940  C  CB    . ALA D  4 107 ? -18.893 -41.032 29.036  1.00 57.26  ? 107  ALA D CB    1 
ATOM   2941  N  N     . VAL D  4 108 ? -16.454 -42.807 28.018  1.00 55.91  ? 108  VAL D N     1 
ATOM   2942  C  CA    . VAL D  4 108 ? -15.285 -43.069 27.194  1.00 55.85  ? 108  VAL D CA    1 
ATOM   2943  C  C     . VAL D  4 108 ? -15.397 -44.384 26.382  1.00 56.79  ? 108  VAL D C     1 
ATOM   2944  O  O     . VAL D  4 108 ? -14.897 -44.455 25.261  1.00 56.67  ? 108  VAL D O     1 
ATOM   2945  C  CB    . VAL D  4 108 ? -14.001 -43.021 28.037  1.00 55.48  ? 108  VAL D CB    1 
ATOM   2946  C  CG1   . VAL D  4 108 ? -12.776 -43.354 27.197  1.00 54.55  ? 108  VAL D CG1   1 
ATOM   2947  C  CG2   . VAL D  4 108 ? -13.843 -41.646 28.659  1.00 55.04  ? 108  VAL D CG2   1 
ATOM   2948  N  N     . SER D  4 109 ? -16.056 -45.408 26.934  1.00 57.69  ? 109  SER D N     1 
ATOM   2949  C  CA    . SER D  4 109 ? -16.401 -46.595 26.148  1.00 58.82  ? 109  SER D CA    1 
ATOM   2950  C  C     . SER D  4 109 ? -17.309 -46.208 24.998  1.00 59.40  ? 109  SER D C     1 
ATOM   2951  O  O     . SER D  4 109 ? -16.939 -46.373 23.833  1.00 60.26  ? 109  SER D O     1 
ATOM   2952  C  CB    . SER D  4 109 ? -17.156 -47.647 26.962  1.00 58.92  ? 109  SER D CB    1 
ATOM   2953  O  OG    . SER D  4 109 ? -16.559 -47.888 28.206  1.00 60.59  ? 109  SER D OG    1 
ATOM   2954  N  N     . GLU D  4 110 ? -18.502 -45.702 25.319  1.00 59.53  ? 110  GLU D N     1 
ATOM   2955  C  CA    . GLU D  4 110 ? -19.519 -45.500 24.303  1.00 59.92  ? 110  GLU D CA    1 
ATOM   2956  C  C     . GLU D  4 110 ? -19.025 -44.595 23.197  1.00 59.83  ? 110  GLU D C     1 
ATOM   2957  O  O     . GLU D  4 110 ? -19.382 -44.797 22.037  1.00 60.31  ? 110  GLU D O     1 
ATOM   2958  C  CB    . GLU D  4 110 ? -20.816 -45.000 24.900  1.00 60.10  ? 110  GLU D CB    1 
ATOM   2959  C  CG    . GLU D  4 110 ? -21.357 -45.884 26.031  1.00 63.61  ? 110  GLU D CG    1 
ATOM   2960  C  CD    . GLU D  4 110 ? -21.723 -47.301 25.587  1.00 68.19  ? 110  GLU D CD    1 
ATOM   2961  O  OE1   . GLU D  4 110 ? -22.747 -47.477 24.891  1.00 70.03  ? 110  GLU D OE1   1 
ATOM   2962  O  OE2   . GLU D  4 110 ? -20.992 -48.250 25.952  1.00 71.51  ? 110  GLU D OE2   1 
ATOM   2963  N  N     . GLY D  4 111 ? -18.167 -43.637 23.548  1.00 59.54  ? 111  GLY D N     1 
ATOM   2964  C  CA    . GLY D  4 111 ? -17.578 -42.722 22.579  1.00 59.01  ? 111  GLY D CA    1 
ATOM   2965  C  C     . GLY D  4 111 ? -16.522 -43.340 21.678  1.00 58.96  ? 111  GLY D C     1 
ATOM   2966  O  O     . GLY D  4 111 ? -16.555 -43.148 20.465  1.00 58.86  ? 111  GLY D O     1 
ATOM   2967  N  N     . THR D  4 112 ? -15.571 -44.062 22.276  1.00 58.90  ? 112  THR D N     1 
ATOM   2968  C  CA    . THR D  4 112 ? -14.519 -44.796 21.541  1.00 58.55  ? 112  THR D CA    1 
ATOM   2969  C  C     . THR D  4 112 ? -15.119 -45.835 20.605  1.00 58.50  ? 112  THR D C     1 
ATOM   2970  O  O     . THR D  4 112 ? -14.643 -46.043 19.485  1.00 57.69  ? 112  THR D O     1 
ATOM   2971  C  CB    . THR D  4 112 ? -13.598 -45.526 22.516  1.00 58.13  ? 112  THR D CB    1 
ATOM   2972  O  OG1   . THR D  4 112 ? -13.090 -44.578 23.454  1.00 59.61  ? 112  THR D OG1   1 
ATOM   2973  C  CG2   . THR D  4 112 ? -12.438 -46.169 21.805  1.00 56.97  ? 112  THR D CG2   1 
ATOM   2974  N  N     . LYS D  4 113 ? -16.176 -46.472 21.086  1.00 58.84  ? 113  LYS D N     1 
ATOM   2975  C  CA    . LYS D  4 113 ? -16.820 -47.526 20.352  1.00 60.07  ? 113  LYS D CA    1 
ATOM   2976  C  C     . LYS D  4 113 ? -17.537 -47.000 19.108  1.00 60.39  ? 113  LYS D C     1 
ATOM   2977  O  O     . LYS D  4 113 ? -17.407 -47.571 18.023  1.00 60.59  ? 113  LYS D O     1 
ATOM   2978  C  CB    . LYS D  4 113 ? -17.726 -48.336 21.283  1.00 60.00  ? 113  LYS D CB    1 
ATOM   2979  C  CG    . LYS D  4 113 ? -16.950 -49.488 21.929  1.00 61.60  ? 113  LYS D CG    1 
ATOM   2980  C  CD    . LYS D  4 113 ? -17.396 -49.848 23.341  1.00 65.90  ? 113  LYS D CD    1 
ATOM   2981  C  CE    . LYS D  4 113 ? -18.744 -50.538 23.360  1.00 68.66  ? 113  LYS D CE    1 
ATOM   2982  N  NZ    . LYS D  4 113 ? -19.878 -49.638 22.932  1.00 70.55  ? 113  LYS D NZ    1 
ATOM   2983  N  N     . ALA D  4 114 ? -18.238 -45.880 19.269  1.00 60.99  ? 114  ALA D N     1 
ATOM   2984  C  CA    . ALA D  4 114 ? -18.947 -45.209 18.185  1.00 60.85  ? 114  ALA D CA    1 
ATOM   2985  C  C     . ALA D  4 114 ? -18.005 -44.782 17.071  1.00 60.95  ? 114  ALA D C     1 
ATOM   2986  O  O     . ALA D  4 114 ? -18.343 -44.869 15.894  1.00 60.77  ? 114  ALA D O     1 
ATOM   2987  C  CB    . ALA D  4 114 ? -19.694 -44.021 18.729  1.00 60.79  ? 114  ALA D CB    1 
ATOM   2988  N  N     . VAL D  4 115 ? -16.821 -44.331 17.448  1.00 61.50  ? 115  VAL D N     1 
ATOM   2989  C  CA    . VAL D  4 115 ? -15.823 -43.883 16.484  1.00 62.54  ? 115  VAL D CA    1 
ATOM   2990  C  C     . VAL D  4 115 ? -15.157 -45.072 15.773  1.00 63.71  ? 115  VAL D C     1 
ATOM   2991  O  O     . VAL D  4 115 ? -14.913 -45.019 14.562  1.00 63.64  ? 115  VAL D O     1 
ATOM   2992  C  CB    . VAL D  4 115 ? -14.796 -42.950 17.165  1.00 62.13  ? 115  VAL D CB    1 
ATOM   2993  C  CG1   . VAL D  4 115 ? -13.534 -42.793 16.339  1.00 61.97  ? 115  VAL D CG1   1 
ATOM   2994  C  CG2   . VAL D  4 115 ? -15.426 -41.603 17.411  1.00 61.98  ? 115  VAL D CG2   1 
ATOM   2995  N  N     . THR D  4 116 ? -14.867 -46.136 16.530  1.00 65.02  ? 116  THR D N     1 
ATOM   2996  C  CA    . THR D  4 116 ? -14.401 -47.390 15.957  1.00 66.16  ? 116  THR D CA    1 
ATOM   2997  C  C     . THR D  4 116 ? -15.401 -47.806 14.897  1.00 67.22  ? 116  THR D C     1 
ATOM   2998  O  O     . THR D  4 116 ? -15.024 -48.060 13.746  1.00 67.50  ? 116  THR D O     1 
ATOM   2999  C  CB    . THR D  4 116 ? -14.327 -48.506 17.010  1.00 66.08  ? 116  THR D CB    1 
ATOM   3000  O  OG1   . THR D  4 116 ? -13.235 -48.262 17.905  1.00 67.00  ? 116  THR D OG1   1 
ATOM   3001  C  CG2   . THR D  4 116 ? -14.116 -49.851 16.350  1.00 66.06  ? 116  THR D CG2   1 
ATOM   3002  N  N     . LYS D  4 117 ? -16.676 -47.838 15.295  1.00 68.06  ? 117  LYS D N     1 
ATOM   3003  C  CA    . LYS D  4 117 ? -17.756 -48.293 14.436  1.00 69.16  ? 117  LYS D CA    1 
ATOM   3004  C  C     . LYS D  4 117 ? -18.024 -47.361 13.254  1.00 70.17  ? 117  LYS D C     1 
ATOM   3005  O  O     . LYS D  4 117 ? -18.309 -47.816 12.157  1.00 70.51  ? 117  LYS D O     1 
ATOM   3006  C  CB    . LYS D  4 117 ? -19.025 -48.570 15.253  1.00 68.83  ? 117  LYS D CB    1 
ATOM   3007  C  CG    . LYS D  4 117 ? -20.212 -48.923 14.407  1.00 69.69  ? 117  LYS D CG    1 
ATOM   3008  C  CD    . LYS D  4 117 ? -21.282 -49.697 15.175  1.00 73.00  ? 117  LYS D CD    1 
ATOM   3009  C  CE    . LYS D  4 117 ? -22.140 -50.508 14.112  1.00 75.90  ? 117  LYS D CE    1 
ATOM   3010  N  NZ    . LYS D  4 117 ? -23.601 -50.641 14.494  1.00 76.43  ? 117  LYS D NZ    1 
ATOM   3011  N  N     . TYR D  4 118 ? -17.918 -46.058 13.468  1.00 71.79  ? 118  TYR D N     1 
ATOM   3012  C  CA    . TYR D  4 118 ? -18.195 -45.105 12.402  1.00 73.07  ? 118  TYR D CA    1 
ATOM   3013  C  C     . TYR D  4 118 ? -17.149 -45.203 11.308  1.00 74.48  ? 118  TYR D C     1 
ATOM   3014  O  O     . TYR D  4 118 ? -17.472 -45.064 10.131  1.00 74.66  ? 118  TYR D O     1 
ATOM   3015  C  CB    . TYR D  4 118 ? -18.266 -43.676 12.951  1.00 72.74  ? 118  TYR D CB    1 
ATOM   3016  C  CG    . TYR D  4 118 ? -18.251 -42.586 11.899  1.00 71.93  ? 118  TYR D CG    1 
ATOM   3017  C  CD1   . TYR D  4 118 ? -19.417 -42.237 11.213  1.00 71.79  ? 118  TYR D CD1   1 
ATOM   3018  C  CD2   . TYR D  4 118 ? -17.077 -41.894 11.601  1.00 70.81  ? 118  TYR D CD2   1 
ATOM   3019  C  CE1   . TYR D  4 118 ? -19.412 -41.231 10.248  1.00 71.28  ? 118  TYR D CE1   1 
ATOM   3020  C  CE2   . TYR D  4 118 ? -17.058 -40.895 10.639  1.00 70.93  ? 118  TYR D CE2   1 
ATOM   3021  C  CZ    . TYR D  4 118 ? -18.230 -40.568 9.967   1.00 71.77  ? 118  TYR D CZ    1 
ATOM   3022  O  OH    . TYR D  4 118 ? -18.225 -39.571 9.015   1.00 72.43  ? 118  TYR D OH    1 
ATOM   3023  N  N     . THR D  4 119 ? -15.898 -45.436 11.694  1.00 76.43  ? 119  THR D N     1 
ATOM   3024  C  CA    . THR D  4 119 ? -14.802 -45.457 10.725  1.00 78.55  ? 119  THR D CA    1 
ATOM   3025  C  C     . THR D  4 119 ? -14.681 -46.826 10.050  1.00 80.22  ? 119  THR D C     1 
ATOM   3026  O  O     . THR D  4 119 ? -14.057 -46.935 8.985   1.00 80.72  ? 119  THR D O     1 
ATOM   3027  C  CB    . THR D  4 119 ? -13.463 -45.039 11.345  1.00 78.10  ? 119  THR D CB    1 
ATOM   3028  O  OG1   . THR D  4 119 ? -13.140 -45.941 12.404  1.00 79.45  ? 119  THR D OG1   1 
ATOM   3029  C  CG2   . THR D  4 119 ? -13.550 -43.632 11.913  1.00 78.26  ? 119  THR D CG2   1 
ATOM   3030  N  N     . SER D  4 120 ? -15.267 -47.857 10.675  1.00 81.93  ? 120  SER D N     1 
ATOM   3031  C  CA    . SER D  4 120 ? -15.524 -49.144 10.015  1.00 83.61  ? 120  SER D CA    1 
ATOM   3032  C  C     . SER D  4 120 ? -16.384 -48.904 8.788   1.00 84.82  ? 120  SER D C     1 
ATOM   3033  O  O     . SER D  4 120 ? -15.981 -49.224 7.665   1.00 85.09  ? 120  SER D O     1 
ATOM   3034  C  CB    . SER D  4 120 ? -16.288 -50.102 10.933  1.00 83.45  ? 120  SER D CB    1 
ATOM   3035  O  OG    . SER D  4 120 ? -15.471 -50.605 11.968  1.00 84.30  ? 120  SER D OG    1 
ATOM   3036  N  N     . ALA D  4 121 ? -17.568 -48.332 9.022   1.00 86.25  ? 121  ALA D N     1 
ATOM   3037  C  CA    . ALA D  4 121 ? -18.550 -48.075 7.974   1.00 87.77  ? 121  ALA D CA    1 
ATOM   3038  C  C     . ALA D  4 121 ? -18.004 -47.118 6.925   1.00 88.95  ? 121  ALA D C     1 
ATOM   3039  O  O     . ALA D  4 121 ? -17.503 -46.035 7.242   1.00 89.43  ? 121  ALA D O     1 
ATOM   3040  C  CB    . ALA D  4 121 ? -19.841 -47.548 8.569   1.00 87.49  ? 121  ALA D CB    1 
ATOM   3041  N  N     . LYS D  4 122 ? -18.086 -47.544 5.670   1.00 90.37  ? 122  LYS D N     1 
ATOM   3042  C  CA    . LYS D  4 122 ? -17.568 -46.764 4.555   1.00 91.53  ? 122  LYS D CA    1 
ATOM   3043  C  C     . LYS D  4 122 ? -18.452 -47.016 3.339   1.00 91.74  ? 122  LYS D C     1 
ATOM   3044  O  O     . LYS D  4 122 ? -18.868 -46.066 2.677   1.00 92.16  ? 122  LYS D O     1 
ATOM   3045  C  CB    . LYS D  4 122 ? -16.117 -47.156 4.248   1.00 91.83  ? 122  LYS D CB    1 
ATOM   3046  C  CG    . LYS D  4 122 ? -15.372 -46.165 3.352   1.00 93.57  ? 122  LYS D CG    1 
ATOM   3047  C  CD    . LYS D  4 122 ? -14.407 -46.889 2.402   1.00 95.52  ? 122  LYS D CD    1 
ATOM   3048  C  CE    . LYS D  4 122 ? -13.674 -45.894 1.491   1.00 96.06  ? 122  LYS D CE    1 
ATOM   3049  N  NZ    . LYS D  4 122 ? -12.909 -46.577 0.403   1.00 96.39  ? 122  LYS D NZ    1 
ATOM   3050  O  OXT   . LYS D  4 122 ? -18.773 -48.163 3.000   1.00 91.97  ? 122  LYS D OXT   1 
ATOM   3051  N  N     . HIS E  1 39  ? -59.158 -32.549 71.330  1.00 91.65  ? 39   HIS E N     1 
ATOM   3052  C  CA    . HIS E  1 39  ? -57.902 -33.297 71.044  1.00 91.50  ? 39   HIS E CA    1 
ATOM   3053  C  C     . HIS E  1 39  ? -56.815 -32.351 70.567  1.00 91.06  ? 39   HIS E C     1 
ATOM   3054  O  O     . HIS E  1 39  ? -57.050 -31.489 69.708  1.00 91.18  ? 39   HIS E O     1 
ATOM   3055  C  CB    . HIS E  1 39  ? -58.139 -34.389 70.000  1.00 91.82  ? 39   HIS E CB    1 
ATOM   3056  C  CG    . HIS E  1 39  ? -56.912 -35.180 69.662  1.00 92.56  ? 39   HIS E CG    1 
ATOM   3057  N  ND1   . HIS E  1 39  ? -56.123 -34.897 68.566  1.00 93.06  ? 39   HIS E ND1   1 
ATOM   3058  C  CD2   . HIS E  1 39  ? -56.338 -36.243 70.277  1.00 92.97  ? 39   HIS E CD2   1 
ATOM   3059  C  CE1   . HIS E  1 39  ? -55.120 -35.757 68.519  1.00 93.76  ? 39   HIS E CE1   1 
ATOM   3060  N  NE2   . HIS E  1 39  ? -55.226 -36.583 69.545  1.00 93.19  ? 39   HIS E NE2   1 
ATOM   3061  N  N     . ARG E  1 40  ? -55.623 -32.536 71.129  1.00 90.28  ? 40   ARG E N     1 
ATOM   3062  C  CA    . ARG E  1 40  ? -54.481 -31.670 70.869  1.00 89.11  ? 40   ARG E CA    1 
ATOM   3063  C  C     . ARG E  1 40  ? -53.309 -32.503 70.393  1.00 88.37  ? 40   ARG E C     1 
ATOM   3064  O  O     . ARG E  1 40  ? -52.983 -33.532 70.988  1.00 88.62  ? 40   ARG E O     1 
ATOM   3065  C  CB    . ARG E  1 40  ? -54.065 -30.943 72.146  1.00 88.97  ? 40   ARG E CB    1 
ATOM   3066  C  CG    . ARG E  1 40  ? -53.621 -29.525 71.920  1.00 89.29  ? 40   ARG E CG    1 
ATOM   3067  C  CD    . ARG E  1 40  ? -54.752 -28.573 72.243  1.00 90.07  ? 40   ARG E CD    1 
ATOM   3068  N  NE    . ARG E  1 40  ? -54.729 -27.353 71.439  1.00 90.85  ? 40   ARG E NE    1 
ATOM   3069  C  CZ    . ARG E  1 40  ? -53.931 -26.310 71.654  1.00 91.06  ? 40   ARG E CZ    1 
ATOM   3070  N  NH1   . ARG E  1 40  ? -53.047 -26.329 72.646  1.00 90.78  ? 40   ARG E NH1   1 
ATOM   3071  N  NH2   . ARG E  1 40  ? -54.016 -25.244 70.863  1.00 91.20  ? 40   ARG E NH2   1 
ATOM   3072  N  N     . TYR E  1 41  ? -52.677 -32.063 69.316  1.00 87.19  ? 41   TYR E N     1 
ATOM   3073  C  CA    . TYR E  1 41  ? -51.389 -32.609 68.954  1.00 85.98  ? 41   TYR E CA    1 
ATOM   3074  C  C     . TYR E  1 41  ? -50.316 -31.798 69.645  1.00 85.56  ? 41   TYR E C     1 
ATOM   3075  O  O     . TYR E  1 41  ? -50.398 -30.568 69.712  1.00 85.51  ? 41   TYR E O     1 
ATOM   3076  C  CB    . TYR E  1 41  ? -51.196 -32.578 67.453  1.00 85.63  ? 41   TYR E CB    1 
ATOM   3077  C  CG    . TYR E  1 41  ? -51.914 -33.689 66.739  1.00 85.28  ? 41   TYR E CG    1 
ATOM   3078  C  CD1   . TYR E  1 41  ? -53.006 -33.422 65.918  1.00 84.22  ? 41   TYR E CD1   1 
ATOM   3079  C  CD2   . TYR E  1 41  ? -51.503 -35.016 66.889  1.00 84.80  ? 41   TYR E CD2   1 
ATOM   3080  C  CE1   . TYR E  1 41  ? -53.664 -34.441 65.263  1.00 84.30  ? 41   TYR E CE1   1 
ATOM   3081  C  CE2   . TYR E  1 41  ? -52.153 -36.040 66.233  1.00 84.22  ? 41   TYR E CE2   1 
ATOM   3082  C  CZ    . TYR E  1 41  ? -53.231 -35.746 65.423  1.00 84.32  ? 41   TYR E CZ    1 
ATOM   3083  O  OH    . TYR E  1 41  ? -53.875 -36.766 64.767  1.00 84.85  ? 41   TYR E OH    1 
ATOM   3084  N  N     . ARG E  1 42  ? -49.323 -32.502 70.175  1.00 84.97  ? 42   ARG E N     1 
ATOM   3085  C  CA    . ARG E  1 42  ? -48.193 -31.885 70.856  1.00 84.62  ? 42   ARG E CA    1 
ATOM   3086  C  C     . ARG E  1 42  ? -47.453 -30.932 69.911  1.00 83.79  ? 42   ARG E C     1 
ATOM   3087  O  O     . ARG E  1 42  ? -47.396 -31.189 68.703  1.00 84.18  ? 42   ARG E O     1 
ATOM   3088  C  CB    . ARG E  1 42  ? -47.229 -32.970 71.351  1.00 84.98  ? 42   ARG E CB    1 
ATOM   3089  C  CG    . ARG E  1 42  ? -47.876 -34.107 72.141  1.00 86.29  ? 42   ARG E CG    1 
ATOM   3090  C  CD    . ARG E  1 42  ? -47.982 -33.791 73.621  1.00 88.96  ? 42   ARG E CD    1 
ATOM   3091  N  NE    . ARG E  1 42  ? -47.860 -35.003 74.436  1.00 92.25  ? 42   ARG E NE    1 
ATOM   3092  C  CZ    . ARG E  1 42  ? -46.711 -35.645 74.683  1.00 93.97  ? 42   ARG E CZ    1 
ATOM   3093  N  NH1   . ARG E  1 42  ? -45.561 -35.199 74.173  1.00 94.00  ? 42   ARG E NH1   1 
ATOM   3094  N  NH2   . ARG E  1 42  ? -46.710 -36.742 75.442  1.00 93.95  ? 42   ARG E NH2   1 
ATOM   3095  N  N     . PRO E  1 43  ? -46.908 -29.817 70.443  1.00 82.71  ? 43   PRO E N     1 
ATOM   3096  C  CA    . PRO E  1 43  ? -46.044 -28.957 69.635  1.00 81.68  ? 43   PRO E CA    1 
ATOM   3097  C  C     . PRO E  1 43  ? -44.953 -29.761 68.949  1.00 80.42  ? 43   PRO E C     1 
ATOM   3098  O  O     . PRO E  1 43  ? -44.244 -30.516 69.603  1.00 80.39  ? 43   PRO E O     1 
ATOM   3099  C  CB    . PRO E  1 43  ? -45.433 -28.016 70.672  1.00 81.81  ? 43   PRO E CB    1 
ATOM   3100  C  CG    . PRO E  1 43  ? -46.499 -27.885 71.697  1.00 82.40  ? 43   PRO E CG    1 
ATOM   3101  C  CD    . PRO E  1 43  ? -47.090 -29.273 71.800  1.00 82.86  ? 43   PRO E CD    1 
ATOM   3102  N  N     . GLY E  1 44  ? -44.855 -29.620 67.631  1.00 79.22  ? 44   GLY E N     1 
ATOM   3103  C  CA    . GLY E  1 44  ? -43.836 -30.317 66.855  1.00 77.70  ? 44   GLY E CA    1 
ATOM   3104  C  C     . GLY E  1 44  ? -44.387 -31.409 65.962  1.00 76.72  ? 44   GLY E C     1 
ATOM   3105  O  O     . GLY E  1 44  ? -43.716 -31.847 65.026  1.00 76.84  ? 44   GLY E O     1 
ATOM   3106  N  N     . THR E  1 45  ? -45.617 -31.839 66.242  1.00 75.58  ? 45   THR E N     1 
ATOM   3107  C  CA    . THR E  1 45  ? -46.214 -32.978 65.546  1.00 74.05  ? 45   THR E CA    1 
ATOM   3108  C  C     . THR E  1 45  ? -46.865 -32.592 64.223  1.00 73.17  ? 45   THR E C     1 
ATOM   3109  O  O     . THR E  1 45  ? -46.650 -33.265 63.215  1.00 72.80  ? 45   THR E O     1 
ATOM   3110  C  CB    . THR E  1 45  ? -47.191 -33.751 66.456  1.00 73.87  ? 45   THR E CB    1 
ATOM   3111  O  OG1   . THR E  1 45  ? -46.468 -34.250 67.582  1.00 73.34  ? 45   THR E OG1   1 
ATOM   3112  C  CG2   . THR E  1 45  ? -47.798 -34.932 65.718  1.00 73.82  ? 45   THR E CG2   1 
ATOM   3113  N  N     . VAL E  1 46  ? -47.655 -31.522 64.220  1.00 72.12  ? 46   VAL E N     1 
ATOM   3114  C  CA    . VAL E  1 46  ? -48.187 -31.003 62.957  1.00 71.51  ? 46   VAL E CA    1 
ATOM   3115  C  C     . VAL E  1 46  ? -47.041 -30.477 62.078  1.00 71.01  ? 46   VAL E C     1 
ATOM   3116  O  O     . VAL E  1 46  ? -47.064 -30.647 60.862  1.00 71.33  ? 46   VAL E O     1 
ATOM   3117  C  CB    . VAL E  1 46  ? -49.263 -29.919 63.161  1.00 71.54  ? 46   VAL E CB    1 
ATOM   3118  C  CG1   . VAL E  1 46  ? -49.883 -29.526 61.818  1.00 71.65  ? 46   VAL E CG1   1 
ATOM   3119  C  CG2   . VAL E  1 46  ? -50.339 -30.417 64.104  1.00 71.20  ? 46   VAL E CG2   1 
ATOM   3120  N  N     . ALA E  1 47  ? -46.045 -29.853 62.708  1.00 70.08  ? 47   ALA E N     1 
ATOM   3121  C  CA    . ALA E  1 47  ? -44.805 -29.460 62.046  1.00 69.09  ? 47   ALA E CA    1 
ATOM   3122  C  C     . ALA E  1 47  ? -44.176 -30.622 61.255  1.00 68.62  ? 47   ALA E C     1 
ATOM   3123  O  O     . ALA E  1 47  ? -44.025 -30.523 60.030  1.00 68.60  ? 47   ALA E O     1 
ATOM   3124  C  CB    . ALA E  1 47  ? -43.824 -28.891 63.059  1.00 68.80  ? 47   ALA E CB    1 
ATOM   3125  N  N     . LEU E  1 48  ? -43.831 -31.717 61.939  1.00 67.84  ? 48   LEU E N     1 
ATOM   3126  C  CA    . LEU E  1 48  ? -43.280 -32.914 61.282  1.00 67.28  ? 48   LEU E CA    1 
ATOM   3127  C  C     . LEU E  1 48  ? -44.181 -33.455 60.175  1.00 66.86  ? 48   LEU E C     1 
ATOM   3128  O  O     . LEU E  1 48  ? -43.712 -34.066 59.224  1.00 66.64  ? 48   LEU E O     1 
ATOM   3129  C  CB    . LEU E  1 48  ? -43.039 -34.027 62.296  1.00 67.44  ? 48   LEU E CB    1 
ATOM   3130  C  CG    . LEU E  1 48  ? -41.824 -34.007 63.223  1.00 68.29  ? 48   LEU E CG    1 
ATOM   3131  C  CD1   . LEU E  1 48  ? -42.139 -34.808 64.465  1.00 68.26  ? 48   LEU E CD1   1 
ATOM   3132  C  CD2   . LEU E  1 48  ? -40.578 -34.567 62.539  1.00 69.00  ? 48   LEU E CD2   1 
ATOM   3133  N  N     . ARG E  1 49  ? -45.479 -33.232 60.309  1.00 66.75  ? 49   ARG E N     1 
ATOM   3134  C  CA    . ARG E  1 49  ? -46.438 -33.683 59.315  1.00 67.18  ? 49   ARG E CA    1 
ATOM   3135  C  C     . ARG E  1 49  ? -46.309 -32.808 58.078  1.00 67.15  ? 49   ARG E C     1 
ATOM   3136  O  O     . ARG E  1 49  ? -46.220 -33.314 56.950  1.00 67.67  ? 49   ARG E O     1 
ATOM   3137  C  CB    . ARG E  1 49  ? -47.855 -33.582 59.874  1.00 67.53  ? 49   ARG E CB    1 
ATOM   3138  C  CG    . ARG E  1 49  ? -48.806 -34.642 59.372  1.00 68.39  ? 49   ARG E CG    1 
ATOM   3139  C  CD    . ARG E  1 49  ? -50.258 -34.106 59.239  1.00 70.45  ? 49   ARG E CD    1 
ATOM   3140  N  NE    . ARG E  1 49  ? -50.829 -33.430 60.416  1.00 69.87  ? 49   ARG E NE    1 
ATOM   3141  C  CZ    . ARG E  1 49  ? -50.905 -33.955 61.637  1.00 69.77  ? 49   ARG E CZ    1 
ATOM   3142  N  NH1   . ARG E  1 49  ? -50.414 -35.166 61.890  1.00 69.86  ? 49   ARG E NH1   1 
ATOM   3143  N  NH2   . ARG E  1 49  ? -51.455 -33.253 62.617  1.00 69.83  ? 49   ARG E NH2   1 
ATOM   3144  N  N     . GLU E  1 50  ? -46.294 -31.495 58.309  1.00 66.48  ? 50   GLU E N     1 
ATOM   3145  C  CA    . GLU E  1 50  ? -46.030 -30.506 57.276  1.00 66.02  ? 50   GLU E CA    1 
ATOM   3146  C  C     . GLU E  1 50  ? -44.721 -30.793 56.510  1.00 65.07  ? 50   GLU E C     1 
ATOM   3147  O  O     . GLU E  1 50  ? -44.695 -30.733 55.276  1.00 64.87  ? 50   GLU E O     1 
ATOM   3148  C  CB    . GLU E  1 50  ? -46.041 -29.096 57.883  1.00 65.62  ? 50   GLU E CB    1 
ATOM   3149  C  CG    . GLU E  1 50  ? -47.435 -28.580 58.229  1.00 66.47  ? 50   GLU E CG    1 
ATOM   3150  C  CD    . GLU E  1 50  ? -47.447 -27.139 58.745  1.00 67.93  ? 50   GLU E CD    1 
ATOM   3151  O  OE1   . GLU E  1 50  ? -48.342 -26.793 59.559  1.00 70.02  ? 50   GLU E OE1   1 
ATOM   3152  O  OE2   . GLU E  1 50  ? -46.571 -26.338 58.337  1.00 71.40  ? 50   GLU E OE2   1 
ATOM   3153  N  N     . ILE E  1 51  ? -43.648 -31.122 57.230  1.00 64.14  ? 51   ILE E N     1 
ATOM   3154  C  CA    . ILE E  1 51  ? -42.371 -31.393 56.577  1.00 63.37  ? 51   ILE E CA    1 
ATOM   3155  C  C     . ILE E  1 51  ? -42.540 -32.508 55.560  1.00 63.89  ? 51   ILE E C     1 
ATOM   3156  O  O     . ILE E  1 51  ? -42.101 -32.376 54.421  1.00 64.01  ? 51   ILE E O     1 
ATOM   3157  C  CB    . ILE E  1 51  ? -41.251 -31.760 57.568  1.00 63.34  ? 51   ILE E CB    1 
ATOM   3158  C  CG1   . ILE E  1 51  ? -40.913 -30.567 58.472  1.00 62.99  ? 51   ILE E CG1   1 
ATOM   3159  C  CG2   . ILE E  1 51  ? -40.021 -32.236 56.818  1.00 62.00  ? 51   ILE E CG2   1 
ATOM   3160  C  CD1   . ILE E  1 51  ? -39.988 -30.897 59.629  1.00 62.20  ? 51   ILE E CD1   1 
ATOM   3161  N  N     . ARG E  1 52  ? -43.197 -33.593 55.975  1.00 64.25  ? 52   ARG E N     1 
ATOM   3162  C  CA    . ARG E  1 52  ? -43.413 -34.776 55.124  1.00 64.24  ? 52   ARG E CA    1 
ATOM   3163  C  C     . ARG E  1 52  ? -44.252 -34.457 53.901  1.00 63.83  ? 52   ARG E C     1 
ATOM   3164  O  O     . ARG E  1 52  ? -43.974 -34.947 52.807  1.00 63.42  ? 52   ARG E O     1 
ATOM   3165  C  CB    . ARG E  1 52  ? -44.090 -35.894 55.917  1.00 64.50  ? 52   ARG E CB    1 
ATOM   3166  C  CG    . ARG E  1 52  ? -43.249 -36.452 57.035  1.00 65.48  ? 52   ARG E CG    1 
ATOM   3167  C  CD    . ARG E  1 52  ? -43.988 -37.532 57.813  1.00 67.02  ? 52   ARG E CD    1 
ATOM   3168  N  NE    . ARG E  1 52  ? -43.418 -37.669 59.152  1.00 68.77  ? 52   ARG E NE    1 
ATOM   3169  C  CZ    . ARG E  1 52  ? -42.286 -38.320 59.437  1.00 70.41  ? 52   ARG E CZ    1 
ATOM   3170  N  NH1   . ARG E  1 52  ? -41.580 -38.925 58.476  1.00 69.11  ? 52   ARG E NH1   1 
ATOM   3171  N  NH2   . ARG E  1 52  ? -41.859 -38.370 60.699  1.00 71.24  ? 52   ARG E NH2   1 
ATOM   3172  N  N     . ARG E  1 53  ? -45.279 -33.641 54.105  1.00 63.71  ? 53   ARG E N     1 
ATOM   3173  C  CA    . ARG E  1 53  ? -46.150 -33.217 53.032  1.00 64.39  ? 53   ARG E CA    1 
ATOM   3174  C  C     . ARG E  1 53  ? -45.394 -32.474 51.932  1.00 64.77  ? 53   ARG E C     1 
ATOM   3175  O  O     . ARG E  1 53  ? -45.560 -32.776 50.741  1.00 65.18  ? 53   ARG E O     1 
ATOM   3176  C  CB    . ARG E  1 53  ? -47.282 -32.342 53.569  1.00 64.37  ? 53   ARG E CB    1 
ATOM   3177  C  CG    . ARG E  1 53  ? -48.315 -31.987 52.512  1.00 65.99  ? 53   ARG E CG    1 
ATOM   3178  C  CD    . ARG E  1 53  ? -49.263 -30.886 52.967  1.00 68.49  ? 53   ARG E CD    1 
ATOM   3179  N  NE    . ARG E  1 53  ? -50.089 -30.418 51.849  1.00 70.98  ? 53   ARG E NE    1 
ATOM   3180  C  CZ    . ARG E  1 53  ? -50.860 -29.330 51.880  1.00 73.02  ? 53   ARG E CZ    1 
ATOM   3181  N  NH1   . ARG E  1 53  ? -50.910 -28.570 52.971  1.00 73.63  ? 53   ARG E NH1   1 
ATOM   3182  N  NH2   . ARG E  1 53  ? -51.578 -28.991 50.815  1.00 73.26  ? 53   ARG E NH2   1 
ATOM   3183  N  N     . TYR E  1 54  ? -44.568 -31.505 52.331  1.00 64.95  ? 54   TYR E N     1 
ATOM   3184  C  CA    . TYR E  1 54  ? -43.946 -30.595 51.378  1.00 64.55  ? 54   TYR E CA    1 
ATOM   3185  C  C     . TYR E  1 54  ? -42.717 -31.186 50.710  1.00 64.48  ? 54   TYR E C     1 
ATOM   3186  O  O     . TYR E  1 54  ? -42.386 -30.833 49.582  1.00 64.45  ? 54   TYR E O     1 
ATOM   3187  C  CB    . TYR E  1 54  ? -43.657 -29.251 52.032  1.00 64.58  ? 54   TYR E CB    1 
ATOM   3188  C  CG    . TYR E  1 54  ? -44.920 -28.511 52.353  1.00 64.40  ? 54   TYR E CG    1 
ATOM   3189  C  CD1   . TYR E  1 54  ? -45.290 -28.249 53.674  1.00 64.56  ? 54   TYR E CD1   1 
ATOM   3190  C  CD2   . TYR E  1 54  ? -45.770 -28.102 51.335  1.00 63.99  ? 54   TYR E CD2   1 
ATOM   3191  C  CE1   . TYR E  1 54  ? -46.477 -27.576 53.970  1.00 64.57  ? 54   TYR E CE1   1 
ATOM   3192  C  CE2   . TYR E  1 54  ? -46.954 -27.438 51.612  1.00 64.26  ? 54   TYR E CE2   1 
ATOM   3193  C  CZ    . TYR E  1 54  ? -47.305 -27.177 52.925  1.00 64.81  ? 54   TYR E CZ    1 
ATOM   3194  O  OH    . TYR E  1 54  ? -48.489 -26.510 53.171  1.00 65.76  ? 54   TYR E OH    1 
ATOM   3195  N  N     . GLN E  1 55  ? -42.052 -32.099 51.397  1.00 64.50  ? 55   GLN E N     1 
ATOM   3196  C  CA    . GLN E  1 55  ? -40.938 -32.794 50.796  1.00 64.90  ? 55   GLN E CA    1 
ATOM   3197  C  C     . GLN E  1 55  ? -41.439 -33.825 49.774  1.00 65.86  ? 55   GLN E C     1 
ATOM   3198  O  O     . GLN E  1 55  ? -40.649 -34.413 49.042  1.00 66.08  ? 55   GLN E O     1 
ATOM   3199  C  CB    . GLN E  1 55  ? -40.056 -33.419 51.872  1.00 64.45  ? 55   GLN E CB    1 
ATOM   3200  C  CG    . GLN E  1 55  ? -39.449 -32.401 52.815  1.00 64.03  ? 55   GLN E CG    1 
ATOM   3201  C  CD    . GLN E  1 55  ? -38.331 -32.964 53.678  1.00 65.03  ? 55   GLN E CD    1 
ATOM   3202  O  OE1   . GLN E  1 55  ? -38.286 -34.161 53.963  1.00 65.87  ? 55   GLN E OE1   1 
ATOM   3203  N  NE2   . GLN E  1 55  ? -37.420 -32.092 54.105  1.00 64.58  ? 55   GLN E NE2   1 
ATOM   3204  N  N     . LYS E  1 56  ? -42.756 -34.016 49.712  1.00 67.05  ? 56   LYS E N     1 
ATOM   3205  C  CA    . LYS E  1 56  ? -43.373 -34.917 48.748  1.00 68.34  ? 56   LYS E CA    1 
ATOM   3206  C  C     . LYS E  1 56  ? -43.910 -34.184 47.542  1.00 68.94  ? 56   LYS E C     1 
ATOM   3207  O  O     . LYS E  1 56  ? -44.012 -34.778 46.472  1.00 69.69  ? 56   LYS E O     1 
ATOM   3208  C  CB    . LYS E  1 56  ? -44.533 -35.682 49.377  1.00 68.30  ? 56   LYS E CB    1 
ATOM   3209  C  CG    . LYS E  1 56  ? -44.136 -36.941 50.114  1.00 69.72  ? 56   LYS E CG    1 
ATOM   3210  C  CD    . LYS E  1 56  ? -45.361 -37.636 50.735  1.00 69.57  ? 56   LYS E CD    1 
ATOM   3211  C  CE    . LYS E  1 56  ? -44.974 -38.972 51.383  1.00 72.14  ? 56   LYS E CE    1 
ATOM   3212  N  NZ    . LYS E  1 56  ? -43.895 -38.854 52.423  1.00 73.39  ? 56   LYS E NZ    1 
ATOM   3213  N  N     . SER E  1 57  ? -44.288 -32.915 47.699  1.00 69.35  ? 57   SER E N     1 
ATOM   3214  C  CA    . SER E  1 57  ? -44.859 -32.169 46.578  1.00 69.86  ? 57   SER E CA    1 
ATOM   3215  C  C     . SER E  1 57  ? -43.828 -31.336 45.817  1.00 70.44  ? 57   SER E C     1 
ATOM   3216  O  O     . SER E  1 57  ? -42.680 -31.181 46.265  1.00 70.53  ? 57   SER E O     1 
ATOM   3217  C  CB    . SER E  1 57  ? -46.026 -31.301 47.042  1.00 70.13  ? 57   SER E CB    1 
ATOM   3218  O  OG    . SER E  1 57  ? -45.608 -30.338 47.991  1.00 70.11  ? 57   SER E OG    1 
ATOM   3219  N  N     . THR E  1 58  ? -44.242 -30.801 44.666  1.00 70.87  ? 58   THR E N     1 
ATOM   3220  C  CA    . THR E  1 58  ? -43.355 -29.994 43.825  1.00 71.28  ? 58   THR E CA    1 
ATOM   3221  C  C     . THR E  1 58  ? -43.914 -28.606 43.544  1.00 71.51  ? 58   THR E C     1 
ATOM   3222  O  O     . THR E  1 58  ? -43.227 -27.743 43.012  1.00 71.81  ? 58   THR E O     1 
ATOM   3223  C  CB    . THR E  1 58  ? -43.018 -30.708 42.504  1.00 71.34  ? 58   THR E CB    1 
ATOM   3224  O  OG1   . THR E  1 58  ? -44.192 -30.818 41.692  1.00 71.28  ? 58   THR E OG1   1 
ATOM   3225  C  CG2   . THR E  1 58  ? -42.454 -32.103 42.784  1.00 71.71  ? 58   THR E CG2   1 
ATOM   3226  N  N     . GLU E  1 59  ? -45.173 -28.414 43.913  1.00 72.01  ? 59   GLU E N     1 
ATOM   3227  C  CA    . GLU E  1 59  ? -45.875 -27.123 43.839  1.00 72.41  ? 59   GLU E CA    1 
ATOM   3228  C  C     . GLU E  1 59  ? -45.081 -25.961 44.433  1.00 71.94  ? 59   GLU E C     1 
ATOM   3229  O  O     . GLU E  1 59  ? -44.434 -26.108 45.480  1.00 72.00  ? 59   GLU E O     1 
ATOM   3230  C  CB    . GLU E  1 59  ? -47.202 -27.239 44.603  1.00 72.68  ? 59   GLU E CB    1 
ATOM   3231  C  CG    . GLU E  1 59  ? -47.128 -28.286 45.724  1.00 74.31  ? 59   GLU E CG    1 
ATOM   3232  C  CD    . GLU E  1 59  ? -47.888 -27.904 46.978  1.00 76.70  ? 59   GLU E CD    1 
ATOM   3233  O  OE1   . GLU E  1 59  ? -48.864 -27.124 46.879  1.00 78.03  ? 59   GLU E OE1   1 
ATOM   3234  O  OE2   . GLU E  1 59  ? -47.508 -28.399 48.067  1.00 76.92  ? 59   GLU E OE2   1 
ATOM   3235  N  N     . LEU E  1 60  ? -45.147 -24.809 43.767  1.00 71.49  ? 60   LEU E N     1 
ATOM   3236  C  CA    . LEU E  1 60  ? -44.590 -23.568 44.311  1.00 70.93  ? 60   LEU E CA    1 
ATOM   3237  C  C     . LEU E  1 60  ? -45.361 -23.189 45.563  1.00 70.62  ? 60   LEU E C     1 
ATOM   3238  O  O     . LEU E  1 60  ? -46.563 -23.428 45.652  1.00 70.62  ? 60   LEU E O     1 
ATOM   3239  C  CB    . LEU E  1 60  ? -44.611 -22.440 43.280  1.00 70.71  ? 60   LEU E CB    1 
ATOM   3240  C  CG    . LEU E  1 60  ? -43.668 -22.647 42.083  1.00 70.84  ? 60   LEU E CG    1 
ATOM   3241  C  CD1   . LEU E  1 60  ? -43.893 -21.576 41.027  1.00 70.66  ? 60   LEU E CD1   1 
ATOM   3242  C  CD2   . LEU E  1 60  ? -42.174 -22.726 42.494  1.00 70.00  ? 60   LEU E CD2   1 
ATOM   3243  N  N     . LEU E  1 61  ? -44.651 -22.631 46.536  1.00 70.20  ? 61   LEU E N     1 
ATOM   3244  C  CA    . LEU E  1 61  ? -45.199 -22.437 47.870  1.00 69.76  ? 61   LEU E CA    1 
ATOM   3245  C  C     . LEU E  1 61  ? -45.473 -20.976 48.177  1.00 69.64  ? 61   LEU E C     1 
ATOM   3246  O  O     . LEU E  1 61  ? -46.117 -20.668 49.176  1.00 69.71  ? 61   LEU E O     1 
ATOM   3247  C  CB    . LEU E  1 61  ? -44.267 -23.038 48.917  1.00 69.57  ? 61   LEU E CB    1 
ATOM   3248  C  CG    . LEU E  1 61  ? -43.980 -24.533 48.828  1.00 69.17  ? 61   LEU E CG    1 
ATOM   3249  C  CD1   . LEU E  1 61  ? -42.963 -24.928 49.876  1.00 69.25  ? 61   LEU E CD1   1 
ATOM   3250  C  CD2   . LEU E  1 61  ? -45.254 -25.315 49.011  1.00 69.20  ? 61   LEU E CD2   1 
ATOM   3251  N  N     . ILE E  1 62  ? -44.977 -20.097 47.308  1.00 69.44  ? 62   ILE E N     1 
ATOM   3252  C  CA    . ILE E  1 62  ? -45.279 -18.667 47.342  1.00 69.31  ? 62   ILE E CA    1 
ATOM   3253  C  C     . ILE E  1 62  ? -46.456 -18.399 46.390  1.00 69.48  ? 62   ILE E C     1 
ATOM   3254  O  O     . ILE E  1 62  ? -46.482 -18.934 45.281  1.00 69.49  ? 62   ILE E O     1 
ATOM   3255  C  CB    . ILE E  1 62  ? -44.033 -17.830 46.936  1.00 69.11  ? 62   ILE E CB    1 
ATOM   3256  C  CG1   . ILE E  1 62  ? -42.934 -17.981 47.988  1.00 68.99  ? 62   ILE E CG1   1 
ATOM   3257  C  CG2   . ILE E  1 62  ? -44.383 -16.365 46.796  1.00 69.02  ? 62   ILE E CG2   1 
ATOM   3258  C  CD1   . ILE E  1 62  ? -41.568 -17.466 47.574  1.00 69.01  ? 62   ILE E CD1   1 
ATOM   3259  N  N     . ARG E  1 63  ? -47.433 -17.599 46.824  1.00 69.44  ? 63   ARG E N     1 
ATOM   3260  C  CA    . ARG E  1 63  ? -48.590 -17.279 45.980  1.00 69.77  ? 63   ARG E CA    1 
ATOM   3261  C  C     . ARG E  1 63  ? -48.151 -16.467 44.760  1.00 69.10  ? 63   ARG E C     1 
ATOM   3262  O  O     . ARG E  1 63  ? -47.399 -15.505 44.899  1.00 69.17  ? 63   ARG E O     1 
ATOM   3263  C  CB    . ARG E  1 63  ? -49.668 -16.527 46.775  1.00 69.79  ? 63   ARG E CB    1 
ATOM   3264  C  CG    . ARG E  1 63  ? -50.391 -17.372 47.850  1.00 71.16  ? 63   ARG E CG    1 
ATOM   3265  C  CD    . ARG E  1 63  ? -51.426 -16.563 48.691  1.00 71.72  ? 63   ARG E CD    1 
ATOM   3266  N  NE    . ARG E  1 63  ? -51.076 -15.145 48.911  1.00 77.38  ? 63   ARG E NE    1 
ATOM   3267  C  CZ    . ARG E  1 63  ? -50.107 -14.684 49.722  1.00 79.37  ? 63   ARG E CZ    1 
ATOM   3268  N  NH1   . ARG E  1 63  ? -49.327 -15.522 50.424  1.00 79.09  ? 63   ARG E NH1   1 
ATOM   3269  N  NH2   . ARG E  1 63  ? -49.904 -13.366 49.823  1.00 78.62  ? 63   ARG E NH2   1 
ATOM   3270  N  N     . LYS E  1 64  ? -48.632 -16.847 43.578  1.00 68.43  ? 64   LYS E N     1 
ATOM   3271  C  CA    . LYS E  1 64  ? -48.121 -16.317 42.304  1.00 68.38  ? 64   LYS E CA    1 
ATOM   3272  C  C     . LYS E  1 64  ? -48.167 -14.797 42.131  1.00 67.81  ? 64   LYS E C     1 
ATOM   3273  O  O     . LYS E  1 64  ? -47.190 -14.213 41.651  1.00 67.86  ? 64   LYS E O     1 
ATOM   3274  C  CB    . LYS E  1 64  ? -48.781 -17.012 41.104  1.00 68.53  ? 64   LYS E CB    1 
ATOM   3275  C  CG    . LYS E  1 64  ? -48.715 -18.524 41.207  1.00 70.54  ? 64   LYS E CG    1 
ATOM   3276  C  CD    . LYS E  1 64  ? -48.980 -19.234 39.890  1.00 73.82  ? 64   LYS E CD    1 
ATOM   3277  C  CE    . LYS E  1 64  ? -48.974 -20.761 40.100  1.00 74.35  ? 64   LYS E CE    1 
ATOM   3278  N  NZ    . LYS E  1 64  ? -48.552 -21.462 38.850  1.00 75.71  ? 64   LYS E NZ    1 
ATOM   3279  N  N     . LEU E  1 65  ? -49.278 -14.167 42.529  1.00 67.19  ? 65   LEU E N     1 
ATOM   3280  C  CA    . LEU E  1 65  ? -49.497 -12.730 42.289  1.00 66.50  ? 65   LEU E CA    1 
ATOM   3281  C  C     . LEU E  1 65  ? -48.670 -11.781 43.169  1.00 65.86  ? 65   LEU E C     1 
ATOM   3282  O  O     . LEU E  1 65  ? -48.079 -10.834 42.645  1.00 65.60  ? 65   LEU E O     1 
ATOM   3283  C  CB    . LEU E  1 65  ? -50.989 -12.361 42.318  1.00 66.72  ? 65   LEU E CB    1 
ATOM   3284  C  CG    . LEU E  1 65  ? -51.327 -10.915 41.899  1.00 67.47  ? 65   LEU E CG    1 
ATOM   3285  C  CD1   . LEU E  1 65  ? -51.009 -10.634 40.413  1.00 67.09  ? 65   LEU E CD1   1 
ATOM   3286  C  CD2   . LEU E  1 65  ? -52.770 -10.550 42.229  1.00 66.74  ? 65   LEU E CD2   1 
ATOM   3287  N  N     . PRO E  1 66  ? -48.618 -12.018 44.498  1.00 65.38  ? 66   PRO E N     1 
ATOM   3288  C  CA    . PRO E  1 66  ? -47.705 -11.193 45.292  1.00 65.39  ? 66   PRO E CA    1 
ATOM   3289  C  C     . PRO E  1 66  ? -46.265 -11.253 44.747  1.00 65.40  ? 66   PRO E C     1 
ATOM   3290  O  O     . PRO E  1 66  ? -45.613 -10.212 44.591  1.00 65.00  ? 66   PRO E O     1 
ATOM   3291  C  CB    . PRO E  1 66  ? -47.762 -11.836 46.680  1.00 65.42  ? 66   PRO E CB    1 
ATOM   3292  C  CG    . PRO E  1 66  ? -49.025 -12.575 46.721  1.00 64.97  ? 66   PRO E CG    1 
ATOM   3293  C  CD    . PRO E  1 66  ? -49.334 -12.998 45.331  1.00 65.38  ? 66   PRO E CD    1 
ATOM   3294  N  N     . PHE E  1 67  ? -45.795 -12.467 44.441  1.00 65.30  ? 67   PHE E N     1 
ATOM   3295  C  CA    . PHE E  1 67  ? -44.458 -12.657 43.917  1.00 65.10  ? 67   PHE E CA    1 
ATOM   3296  C  C     . PHE E  1 67  ? -44.270 -11.930 42.590  1.00 65.74  ? 67   PHE E C     1 
ATOM   3297  O  O     . PHE E  1 67  ? -43.190 -11.385 42.325  1.00 66.09  ? 67   PHE E O     1 
ATOM   3298  C  CB    . PHE E  1 67  ? -44.105 -14.137 43.746  1.00 64.53  ? 67   PHE E CB    1 
ATOM   3299  C  CG    . PHE E  1 67  ? -42.675 -14.361 43.292  1.00 63.16  ? 67   PHE E CG    1 
ATOM   3300  C  CD1   . PHE E  1 67  ? -41.629 -14.353 44.217  1.00 60.05  ? 67   PHE E CD1   1 
ATOM   3301  C  CD2   . PHE E  1 67  ? -42.378 -14.535 41.939  1.00 61.41  ? 67   PHE E CD2   1 
ATOM   3302  C  CE1   . PHE E  1 67  ? -40.332 -14.528 43.808  1.00 59.78  ? 67   PHE E CE1   1 
ATOM   3303  C  CE2   . PHE E  1 67  ? -41.069 -14.709 41.520  1.00 60.88  ? 67   PHE E CE2   1 
ATOM   3304  C  CZ    . PHE E  1 67  ? -40.044 -14.712 42.455  1.00 61.04  ? 67   PHE E CZ    1 
ATOM   3305  N  N     . GLN E  1 68  ? -45.301 -11.925 41.754  1.00 65.80  ? 68   GLN E N     1 
ATOM   3306  C  CA    . GLN E  1 68  ? -45.187 -11.235 40.480  1.00 66.34  ? 68   GLN E CA    1 
ATOM   3307  C  C     . GLN E  1 68  ? -45.063 -9.717  40.664  1.00 66.19  ? 68   GLN E C     1 
ATOM   3308  O  O     . GLN E  1 68  ? -44.362 -9.045  39.917  1.00 66.18  ? 68   GLN E O     1 
ATOM   3309  C  CB    . GLN E  1 68  ? -46.361 -11.576 39.575  1.00 66.32  ? 68   GLN E CB    1 
ATOM   3310  C  CG    . GLN E  1 68  ? -46.092 -11.252 38.130  1.00 68.25  ? 68   GLN E CG    1 
ATOM   3311  C  CD    . GLN E  1 68  ? -47.189 -11.735 37.243  1.00 71.09  ? 68   GLN E CD    1 
ATOM   3312  O  OE1   . GLN E  1 68  ? -48.365 -11.616 37.592  1.00 73.00  ? 68   GLN E OE1   1 
ATOM   3313  N  NE2   . GLN E  1 68  ? -46.828 -12.290 36.080  1.00 71.53  ? 68   GLN E NE2   1 
ATOM   3314  N  N     . ARG E  1 69  ? -45.745 -9.183  41.664  1.00 66.18  ? 69   ARG E N     1 
ATOM   3315  C  CA    . ARG E  1 69  ? -45.680 -7.762  41.919  1.00 66.54  ? 69   ARG E CA    1 
ATOM   3316  C  C     . ARG E  1 69  ? -44.272 -7.414  42.376  1.00 66.09  ? 69   ARG E C     1 
ATOM   3317  O  O     . ARG E  1 69  ? -43.715 -6.384  41.972  1.00 66.53  ? 69   ARG E O     1 
ATOM   3318  C  CB    . ARG E  1 69  ? -46.737 -7.338  42.947  1.00 66.35  ? 69   ARG E CB    1 
ATOM   3319  C  CG    . ARG E  1 69  ? -48.110 -7.120  42.330  1.00 67.25  ? 69   ARG E CG    1 
ATOM   3320  C  CD    . ARG E  1 69  ? -49.117 -6.500  43.314  1.00 68.15  ? 69   ARG E CD    1 
ATOM   3321  N  NE    . ARG E  1 69  ? -50.020 -7.493  43.900  1.00 69.13  ? 69   ARG E NE    1 
ATOM   3322  C  CZ    . ARG E  1 69  ? -49.892 -7.990  45.127  1.00 70.41  ? 69   ARG E CZ    1 
ATOM   3323  N  NH1   . ARG E  1 69  ? -48.907 -7.592  45.935  1.00 69.59  ? 69   ARG E NH1   1 
ATOM   3324  N  NH2   . ARG E  1 69  ? -50.761 -8.890  45.553  1.00 72.31  ? 69   ARG E NH2   1 
ATOM   3325  N  N     . LEU E  1 70  ? -43.690 -8.291  43.192  1.00 65.27  ? 70   LEU E N     1 
ATOM   3326  C  CA    . LEU E  1 70  ? -42.333 -8.106  43.690  1.00 64.15  ? 70   LEU E CA    1 
ATOM   3327  C  C     . LEU E  1 70  ? -41.313 -8.062  42.557  1.00 63.71  ? 70   LEU E C     1 
ATOM   3328  O  O     . LEU E  1 70  ? -40.431 -7.207  42.559  1.00 64.18  ? 70   LEU E O     1 
ATOM   3329  C  CB    . LEU E  1 70  ? -41.975 -9.203  44.683  1.00 64.05  ? 70   LEU E CB    1 
ATOM   3330  C  CG    . LEU E  1 70  ? -40.689 -9.049  45.485  1.00 63.22  ? 70   LEU E CG    1 
ATOM   3331  C  CD1   . LEU E  1 70  ? -40.779 -7.863  46.407  1.00 63.41  ? 70   LEU E CD1   1 
ATOM   3332  C  CD2   . LEU E  1 70  ? -40.469 -10.307 46.279  1.00 62.76  ? 70   LEU E CD2   1 
ATOM   3333  N  N     . VAL E  1 71  ? -41.431 -8.958  41.585  1.00 62.78  ? 71   VAL E N     1 
ATOM   3334  C  CA    . VAL E  1 71  ? -40.487 -8.959  40.472  1.00 62.22  ? 71   VAL E CA    1 
ATOM   3335  C  C     . VAL E  1 71  ? -40.553 -7.642  39.708  1.00 62.20  ? 71   VAL E C     1 
ATOM   3336  O  O     . VAL E  1 71  ? -39.525 -7.092  39.343  1.00 62.29  ? 71   VAL E O     1 
ATOM   3337  C  CB    . VAL E  1 71  ? -40.682 -10.161 39.508  1.00 62.08  ? 71   VAL E CB    1 
ATOM   3338  C  CG1   . VAL E  1 71  ? -39.910 -9.945  38.237  1.00 61.82  ? 71   VAL E CG1   1 
ATOM   3339  C  CG2   . VAL E  1 71  ? -40.214 -11.444 40.156  1.00 61.19  ? 71   VAL E CG2   1 
ATOM   3340  N  N     . ARG E  1 72  ? -41.761 -7.132  39.489  1.00 62.37  ? 72   ARG E N     1 
ATOM   3341  C  CA    . ARG E  1 72  ? -41.972 -5.897  38.705  1.00 62.19  ? 72   ARG E CA    1 
ATOM   3342  C  C     . ARG E  1 72  ? -41.552 -4.634  39.444  1.00 61.87  ? 72   ARG E C     1 
ATOM   3343  O  O     . ARG E  1 72  ? -41.037 -3.708  38.838  1.00 60.94  ? 72   ARG E O     1 
ATOM   3344  C  CB    . ARG E  1 72  ? -43.423 -5.792  38.262  1.00 62.17  ? 72   ARG E CB    1 
ATOM   3345  C  CG    . ARG E  1 72  ? -43.861 -6.976  37.448  1.00 62.32  ? 72   ARG E CG    1 
ATOM   3346  C  CD    . ARG E  1 72  ? -45.277 -6.797  37.005  1.00 63.98  ? 72   ARG E CD    1 
ATOM   3347  N  NE    . ARG E  1 72  ? -45.739 -7.922  36.205  1.00 64.63  ? 72   ARG E NE    1 
ATOM   3348  C  CZ    . ARG E  1 72  ? -45.664 -7.966  34.884  1.00 64.63  ? 72   ARG E CZ    1 
ATOM   3349  N  NH1   . ARG E  1 72  ? -45.139 -6.952  34.221  1.00 65.03  ? 72   ARG E NH1   1 
ATOM   3350  N  NH2   . ARG E  1 72  ? -46.113 -9.025  34.231  1.00 66.12  ? 72   ARG E NH2   1 
ATOM   3351  N  N     . GLU E  1 73  ? -41.776 -4.619  40.754  1.00 62.24  ? 73   GLU E N     1 
ATOM   3352  C  CA    . GLU E  1 73  ? -41.283 -3.558  41.616  1.00 63.32  ? 73   GLU E CA    1 
ATOM   3353  C  C     . GLU E  1 73  ? -39.772 -3.472  41.470  1.00 63.04  ? 73   GLU E C     1 
ATOM   3354  O  O     . GLU E  1 73  ? -39.234 -2.392  41.250  1.00 63.56  ? 73   GLU E O     1 
ATOM   3355  C  CB    . GLU E  1 73  ? -41.677 -3.813  43.078  1.00 62.95  ? 73   GLU E CB    1 
ATOM   3356  C  CG    . GLU E  1 73  ? -41.185 -2.746  44.043  1.00 64.96  ? 73   GLU E CG    1 
ATOM   3357  C  CD    . GLU E  1 73  ? -41.708 -2.906  45.484  1.00 65.83  ? 73   GLU E CD    1 
ATOM   3358  O  OE1   . GLU E  1 73  ? -42.914 -2.647  45.749  1.00 67.64  ? 73   GLU E OE1   1 
ATOM   3359  O  OE2   . GLU E  1 73  ? -40.888 -3.257  46.369  1.00 70.52  ? 73   GLU E OE2   1 
ATOM   3360  N  N     . ILE E  1 74  ? -39.095 -4.623  41.560  1.00 63.07  ? 74   ILE E N     1 
ATOM   3361  C  CA    . ILE E  1 74  ? -37.625 -4.687  41.546  1.00 62.42  ? 74   ILE E CA    1 
ATOM   3362  C  C     . ILE E  1 74  ? -37.047 -4.338  40.179  1.00 62.68  ? 74   ILE E C     1 
ATOM   3363  O  O     . ILE E  1 74  ? -36.111 -3.555  40.093  1.00 62.65  ? 74   ILE E O     1 
ATOM   3364  C  CB    . ILE E  1 74  ? -37.102 -6.057  42.038  1.00 62.12  ? 74   ILE E CB    1 
ATOM   3365  C  CG1   . ILE E  1 74  ? -37.260 -6.161  43.545  1.00 61.04  ? 74   ILE E CG1   1 
ATOM   3366  C  CG2   . ILE E  1 74  ? -35.637 -6.265  41.667  1.00 61.64  ? 74   ILE E CG2   1 
ATOM   3367  C  CD1   . ILE E  1 74  ? -37.274 -7.568  44.052  1.00 61.63  ? 74   ILE E CD1   1 
ATOM   3368  N  N     . ALA E  1 75  ? -37.602 -4.915  39.119  1.00 62.94  ? 75   ALA E N     1 
ATOM   3369  C  CA    . ALA E  1 75  ? -37.148 -4.614  37.775  1.00 63.60  ? 75   ALA E CA    1 
ATOM   3370  C  C     . ALA E  1 75  ? -37.255 -3.121  37.524  1.00 64.36  ? 75   ALA E C     1 
ATOM   3371  O  O     . ALA E  1 75  ? -36.392 -2.528  36.871  1.00 63.80  ? 75   ALA E O     1 
ATOM   3372  C  CB    . ALA E  1 75  ? -37.959 -5.383  36.757  1.00 63.23  ? 75   ALA E CB    1 
ATOM   3373  N  N     . GLN E  1 76  ? -38.315 -2.527  38.080  1.00 66.03  ? 76   GLN E N     1 
ATOM   3374  C  CA    . GLN E  1 76  ? -38.672 -1.108  37.885  1.00 67.33  ? 76   GLN E CA    1 
ATOM   3375  C  C     . GLN E  1 76  ? -37.572 -0.183  38.390  1.00 67.82  ? 76   GLN E C     1 
ATOM   3376  O  O     . GLN E  1 76  ? -37.276 0.832   37.760  1.00 68.23  ? 76   GLN E O     1 
ATOM   3377  C  CB    . GLN E  1 76  ? -40.007 -0.797  38.575  1.00 67.44  ? 76   GLN E CB    1 
ATOM   3378  C  CG    . GLN E  1 76  ? -40.554 0.599   38.370  1.00 69.19  ? 76   GLN E CG    1 
ATOM   3379  C  CD    . GLN E  1 76  ? -40.908 0.884   36.931  1.00 72.18  ? 76   GLN E CD    1 
ATOM   3380  O  OE1   . GLN E  1 76  ? -40.975 -0.026  36.101  1.00 74.06  ? 76   GLN E OE1   1 
ATOM   3381  N  NE2   . GLN E  1 76  ? -41.146 2.155   36.622  1.00 73.23  ? 76   GLN E NE2   1 
ATOM   3382  N  N     . ASP E  1 77  ? -36.966 -0.555  39.516  1.00 68.23  ? 77   ASP E N     1 
ATOM   3383  C  CA    . ASP E  1 77  ? -35.773 0.110   40.018  1.00 69.02  ? 77   ASP E CA    1 
ATOM   3384  C  C     . ASP E  1 77  ? -34.515 0.001   39.134  1.00 69.19  ? 77   ASP E C     1 
ATOM   3385  O  O     . ASP E  1 77  ? -33.518 0.649   39.433  1.00 69.73  ? 77   ASP E O     1 
ATOM   3386  C  CB    . ASP E  1 77  ? -35.453 -0.386  41.427  1.00 69.29  ? 77   ASP E CB    1 
ATOM   3387  C  CG    . ASP E  1 77  ? -36.350 0.244   42.489  1.00 71.98  ? 77   ASP E CG    1 
ATOM   3388  O  OD1   . ASP E  1 77  ? -37.592 0.017   42.455  1.00 74.42  ? 77   ASP E OD1   1 
ATOM   3389  O  OD2   . ASP E  1 77  ? -35.811 0.968   43.368  1.00 74.72  ? 77   ASP E OD2   1 
ATOM   3390  N  N     . PHE E  1 78  ? -34.536 -0.796  38.062  1.00 69.45  ? 78   PHE E N     1 
ATOM   3391  C  CA    . PHE E  1 78  ? -33.346 -0.932  37.194  1.00 69.44  ? 78   PHE E CA    1 
ATOM   3392  C  C     . PHE E  1 78  ? -33.580 -0.348  35.827  1.00 69.67  ? 78   PHE E C     1 
ATOM   3393  O  O     . PHE E  1 78  ? -32.685 0.255   35.254  1.00 69.87  ? 78   PHE E O     1 
ATOM   3394  C  CB    . PHE E  1 78  ? -32.901 -2.395  37.027  1.00 69.34  ? 78   PHE E CB    1 
ATOM   3395  C  CG    . PHE E  1 78  ? -32.318 -3.004  38.270  1.00 69.25  ? 78   PHE E CG    1 
ATOM   3396  C  CD1   . PHE E  1 78  ? -31.096 -2.578  38.765  1.00 69.29  ? 78   PHE E CD1   1 
ATOM   3397  C  CD2   . PHE E  1 78  ? -32.989 -4.015  38.942  1.00 68.58  ? 78   PHE E CD2   1 
ATOM   3398  C  CE1   . PHE E  1 78  ? -30.565 -3.153  39.911  1.00 69.78  ? 78   PHE E CE1   1 
ATOM   3399  C  CE2   . PHE E  1 78  ? -32.463 -4.587  40.086  1.00 68.07  ? 78   PHE E CE2   1 
ATOM   3400  C  CZ    . PHE E  1 78  ? -31.257 -4.159  40.570  1.00 68.61  ? 78   PHE E CZ    1 
ATOM   3401  N  N     . LYS E  1 79  ? -34.778 -0.566  35.301  1.00 70.17  ? 79   LYS E N     1 
ATOM   3402  C  CA    . LYS E  1 79  ? -35.176 -0.083  33.989  1.00 70.90  ? 79   LYS E CA    1 
ATOM   3403  C  C     . LYS E  1 79  ? -36.675 0.104   34.068  1.00 71.38  ? 79   LYS E C     1 
ATOM   3404  O  O     . LYS E  1 79  ? -37.396 -0.759  34.601  1.00 71.66  ? 79   LYS E O     1 
ATOM   3405  C  CB    . LYS E  1 79  ? -34.856 -1.110  32.904  1.00 70.88  ? 79   LYS E CB    1 
ATOM   3406  C  CG    . LYS E  1 79  ? -34.280 -0.539  31.615  1.00 72.68  ? 79   LYS E CG    1 
ATOM   3407  C  CD    . LYS E  1 79  ? -35.310 0.212   30.761  1.00 76.16  ? 79   LYS E CD    1 
ATOM   3408  C  CE    . LYS E  1 79  ? -34.650 1.346   29.928  1.00 77.23  ? 79   LYS E CE    1 
ATOM   3409  N  NZ    . LYS E  1 79  ? -35.620 2.409   29.481  1.00 76.26  ? 79   LYS E NZ    1 
ATOM   3410  N  N     . THR E  1 80  ? -37.142 1.238   33.553  1.00 71.59  ? 80   THR E N     1 
ATOM   3411  C  CA    . THR E  1 80  ? -38.561 1.564   33.574  1.00 71.72  ? 80   THR E CA    1 
ATOM   3412  C  C     . THR E  1 80  ? -39.188 1.089   32.280  1.00 71.84  ? 80   THR E C     1 
ATOM   3413  O  O     . THR E  1 80  ? -38.477 0.853   31.301  1.00 71.83  ? 80   THR E O     1 
ATOM   3414  C  CB    . THR E  1 80  ? -38.775 3.074   33.718  1.00 71.77  ? 80   THR E CB    1 
ATOM   3415  O  OG1   . THR E  1 80  ? -38.000 3.749   32.721  1.00 72.06  ? 80   THR E OG1   1 
ATOM   3416  C  CG2   . THR E  1 80  ? -38.342 3.556   35.108  1.00 71.62  ? 80   THR E CG2   1 
ATOM   3417  N  N     . ASP E  1 81  ? -40.516 0.948   32.282  1.00 72.15  ? 81   ASP E N     1 
ATOM   3418  C  CA    . ASP E  1 81  ? -41.285 0.583   31.085  1.00 72.41  ? 81   ASP E CA    1 
ATOM   3419  C  C     . ASP E  1 81  ? -40.798 -0.772  30.585  1.00 71.80  ? 81   ASP E C     1 
ATOM   3420  O  O     . ASP E  1 81  ? -40.197 -0.870  29.505  1.00 72.00  ? 81   ASP E O     1 
ATOM   3421  C  CB    . ASP E  1 81  ? -41.182 1.693   30.011  1.00 73.03  ? 81   ASP E CB    1 
ATOM   3422  C  CG    . ASP E  1 81  ? -42.046 1.419   28.772  1.00 76.33  ? 81   ASP E CG    1 
ATOM   3423  O  OD1   . ASP E  1 81  ? -41.431 1.133   27.691  1.00 79.98  ? 81   ASP E OD1   1 
ATOM   3424  O  OD2   . ASP E  1 81  ? -43.328 1.484   28.869  1.00 78.13  ? 81   ASP E OD2   1 
ATOM   3425  N  N     . LEU E  1 82  ? -41.033 -1.801  31.410  1.00 71.06  ? 82   LEU E N     1 
ATOM   3426  C  CA    . LEU E  1 82  ? -40.616 -3.181  31.125  1.00 70.03  ? 82   LEU E CA    1 
ATOM   3427  C  C     . LEU E  1 82  ? -41.755 -4.168  31.242  1.00 69.48  ? 82   LEU E C     1 
ATOM   3428  O  O     . LEU E  1 82  ? -42.565 -4.110  32.158  1.00 69.07  ? 82   LEU E O     1 
ATOM   3429  C  CB    . LEU E  1 82  ? -39.509 -3.646  32.074  1.00 70.01  ? 82   LEU E CB    1 
ATOM   3430  C  CG    . LEU E  1 82  ? -38.035 -3.432  31.737  1.00 69.76  ? 82   LEU E CG    1 
ATOM   3431  C  CD1   . LEU E  1 82  ? -37.202 -3.874  32.917  1.00 69.84  ? 82   LEU E CD1   1 
ATOM   3432  C  CD2   . LEU E  1 82  ? -37.618 -4.170  30.491  1.00 68.71  ? 82   LEU E CD2   1 
ATOM   3433  N  N     . ARG E  1 83  ? -41.777 -5.105  30.315  1.00 69.19  ? 83   ARG E N     1 
ATOM   3434  C  CA    . ARG E  1 83  ? -42.729 -6.195  30.345  1.00 69.11  ? 83   ARG E CA    1 
ATOM   3435  C  C     . ARG E  1 83  ? -42.045 -7.537  30.655  1.00 68.42  ? 83   ARG E C     1 
ATOM   3436  O  O     . ARG E  1 83  ? -40.821 -7.608  30.732  1.00 68.78  ? 83   ARG E O     1 
ATOM   3437  C  CB    . ARG E  1 83  ? -43.455 -6.231  29.016  1.00 69.56  ? 83   ARG E CB    1 
ATOM   3438  C  CG    . ARG E  1 83  ? -44.266 -4.991  28.801  1.00 70.48  ? 83   ARG E CG    1 
ATOM   3439  C  CD    . ARG E  1 83  ? -44.376 -4.648  27.346  1.00 73.86  ? 83   ARG E CD    1 
ATOM   3440  N  NE    . ARG E  1 83  ? -45.653 -3.993  27.120  1.00 76.98  ? 83   ARG E NE    1 
ATOM   3441  C  CZ    . ARG E  1 83  ? -46.752 -4.626  26.722  1.00 78.45  ? 83   ARG E CZ    1 
ATOM   3442  N  NH1   . ARG E  1 83  ? -46.717 -5.931  26.472  1.00 78.06  ? 83   ARG E NH1   1 
ATOM   3443  N  NH2   . ARG E  1 83  ? -47.884 -3.948  26.560  1.00 80.31  ? 83   ARG E NH2   1 
ATOM   3444  N  N     . PHE E  1 84  ? -42.836 -8.585  30.860  1.00 67.33  ? 84   PHE E N     1 
ATOM   3445  C  CA    . PHE E  1 84  ? -42.306 -9.903  31.197  1.00 66.39  ? 84   PHE E CA    1 
ATOM   3446  C  C     . PHE E  1 84  ? -43.085 -10.982 30.497  1.00 65.83  ? 84   PHE E C     1 
ATOM   3447  O  O     . PHE E  1 84  ? -44.307 -11.039 30.619  1.00 66.11  ? 84   PHE E O     1 
ATOM   3448  C  CB    . PHE E  1 84  ? -42.442 -10.174 32.692  1.00 66.29  ? 84   PHE E CB    1 
ATOM   3449  C  CG    . PHE E  1 84  ? -41.377 -9.557  33.528  1.00 66.34  ? 84   PHE E CG    1 
ATOM   3450  C  CD1   . PHE E  1 84  ? -41.490 -8.239  33.961  1.00 65.80  ? 84   PHE E CD1   1 
ATOM   3451  C  CD2   . PHE E  1 84  ? -40.271 -10.302 33.915  1.00 66.25  ? 84   PHE E CD2   1 
ATOM   3452  C  CE1   . PHE E  1 84  ? -40.504 -7.664  34.755  1.00 65.88  ? 84   PHE E CE1   1 
ATOM   3453  C  CE2   . PHE E  1 84  ? -39.276 -9.733  34.708  1.00 66.95  ? 84   PHE E CE2   1 
ATOM   3454  C  CZ    . PHE E  1 84  ? -39.396 -8.404  35.127  1.00 66.12  ? 84   PHE E CZ    1 
ATOM   3455  N  N     . GLN E  1 85  ? -42.390 -11.865 29.797  1.00 65.08  ? 85   GLN E N     1 
ATOM   3456  C  CA    . GLN E  1 85  ? -43.005 -13.112 29.386  1.00 64.50  ? 85   GLN E CA    1 
ATOM   3457  C  C     . GLN E  1 85  ? -43.473 -13.815 30.651  1.00 64.12  ? 85   GLN E C     1 
ATOM   3458  O  O     . GLN E  1 85  ? -42.813 -13.730 31.689  1.00 63.95  ? 85   GLN E O     1 
ATOM   3459  C  CB    . GLN E  1 85  ? -42.009 -13.974 28.626  1.00 64.67  ? 85   GLN E CB    1 
ATOM   3460  C  CG    . GLN E  1 85  ? -41.561 -13.378 27.299  1.00 65.05  ? 85   GLN E CG    1 
ATOM   3461  C  CD    . GLN E  1 85  ? -40.773 -14.364 26.459  1.00 67.01  ? 85   GLN E CD    1 
ATOM   3462  O  OE1   . GLN E  1 85  ? -40.302 -15.400 26.959  1.00 68.57  ? 85   GLN E OE1   1 
ATOM   3463  N  NE2   . GLN E  1 85  ? -40.626 -14.053 25.171  1.00 66.57  ? 85   GLN E NE2   1 
ATOM   3464  N  N     . SER E  1 86  ? -44.625 -14.472 30.592  1.00 63.81  ? 86   SER E N     1 
ATOM   3465  C  CA    . SER E  1 86  ? -45.154 -15.147 31.785  1.00 64.03  ? 86   SER E CA    1 
ATOM   3466  C  C     . SER E  1 86  ? -44.177 -16.183 32.338  1.00 63.21  ? 86   SER E C     1 
ATOM   3467  O  O     . SER E  1 86  ? -44.047 -16.337 33.550  1.00 63.43  ? 86   SER E O     1 
ATOM   3468  C  CB    . SER E  1 86  ? -46.519 -15.791 31.510  1.00 64.44  ? 86   SER E CB    1 
ATOM   3469  O  OG    . SER E  1 86  ? -46.508 -16.484 30.262  1.00 67.33  ? 86   SER E OG    1 
ATOM   3470  N  N     . SER E  1 87  ? -43.479 -16.871 31.442  1.00 62.33  ? 87   SER E N     1 
ATOM   3471  C  CA    . SER E  1 87  ? -42.539 -17.901 31.839  1.00 61.71  ? 87   SER E CA    1 
ATOM   3472  C  C     . SER E  1 87  ? -41.347 -17.347 32.599  1.00 61.24  ? 87   SER E C     1 
ATOM   3473  O  O     . SER E  1 87  ? -40.800 -18.037 33.462  1.00 61.22  ? 87   SER E O     1 
ATOM   3474  C  CB    . SER E  1 87  ? -42.068 -18.714 30.631  1.00 61.72  ? 87   SER E CB    1 
ATOM   3475  O  OG    . SER E  1 87  ? -41.699 -17.870 29.560  1.00 61.97  ? 87   SER E OG    1 
ATOM   3476  N  N     . ALA E  1 88  ? -40.939 -16.118 32.278  1.00 60.59  ? 88   ALA E N     1 
ATOM   3477  C  CA    . ALA E  1 88  ? -39.810 -15.488 32.974  1.00 60.34  ? 88   ALA E CA    1 
ATOM   3478  C  C     . ALA E  1 88  ? -40.089 -15.306 34.477  1.00 60.07  ? 88   ALA E C     1 
ATOM   3479  O  O     . ALA E  1 88  ? -39.255 -15.618 35.316  1.00 59.79  ? 88   ALA E O     1 
ATOM   3480  C  CB    . ALA E  1 88  ? -39.411 -14.178 32.316  1.00 59.82  ? 88   ALA E CB    1 
ATOM   3481  N  N     . VAL E  1 89  ? -41.277 -14.837 34.817  1.00 60.40  ? 89   VAL E N     1 
ATOM   3482  C  CA    . VAL E  1 89  ? -41.643 -14.743 36.219  1.00 60.78  ? 89   VAL E CA    1 
ATOM   3483  C  C     . VAL E  1 89  ? -41.608 -16.143 36.815  1.00 61.11  ? 89   VAL E C     1 
ATOM   3484  O  O     . VAL E  1 89  ? -41.068 -16.351 37.898  1.00 61.49  ? 89   VAL E O     1 
ATOM   3485  C  CB    . VAL E  1 89  ? -43.021 -14.083 36.424  1.00 60.69  ? 89   VAL E CB    1 
ATOM   3486  C  CG1   . VAL E  1 89  ? -43.343 -14.016 37.915  1.00 60.90  ? 89   VAL E CG1   1 
ATOM   3487  C  CG2   . VAL E  1 89  ? -43.044 -12.681 35.812  1.00 59.48  ? 89   VAL E CG2   1 
ATOM   3488  N  N     . MET E  1 90  ? -42.156 -17.101 36.077  1.00 61.62  ? 90   MET E N     1 
ATOM   3489  C  CA    . MET E  1 90  ? -42.086 -18.514 36.435  1.00 61.72  ? 90   MET E CA    1 
ATOM   3490  C  C     . MET E  1 90  ? -40.663 -18.957 36.706  1.00 60.86  ? 90   MET E C     1 
ATOM   3491  O  O     . MET E  1 90  ? -40.372 -19.445 37.804  1.00 61.56  ? 90   MET E O     1 
ATOM   3492  C  CB    . MET E  1 90  ? -42.739 -19.379 35.356  1.00 62.59  ? 90   MET E CB    1 
ATOM   3493  C  CG    . MET E  1 90  ? -44.239 -19.162 35.279  1.00 65.95  ? 90   MET E CG    1 
ATOM   3494  S  SD    . MET E  1 90  ? -44.902 -19.070 36.965  1.00 75.43  ? 90   MET E SD    1 
ATOM   3495  C  CE    . MET E  1 90  ? -45.649 -20.710 37.108  1.00 75.15  ? 90   MET E CE    1 
ATOM   3496  N  N     . ALA E  1 91  ? -39.773 -18.764 35.734  1.00 59.71  ? 91   ALA E N     1 
ATOM   3497  C  CA    . ALA E  1 91  ? -38.343 -19.030 35.940  1.00 58.44  ? 91   ALA E CA    1 
ATOM   3498  C  C     . ALA E  1 91  ? -37.892 -18.454 37.282  1.00 57.91  ? 91   ALA E C     1 
ATOM   3499  O  O     . ALA E  1 91  ? -37.433 -19.195 38.145  1.00 58.26  ? 91   ALA E O     1 
ATOM   3500  C  CB    . ALA E  1 91  ? -37.526 -18.470 34.811  1.00 57.97  ? 91   ALA E CB    1 
ATOM   3501  N  N     . LEU E  1 92  ? -38.090 -17.151 37.479  1.00 57.07  ? 92   LEU E N     1 
ATOM   3502  C  CA    . LEU E  1 92  ? -37.673 -16.472 38.708  1.00 56.43  ? 92   LEU E CA    1 
ATOM   3503  C  C     . LEU E  1 92  ? -38.272 -17.055 39.965  1.00 56.11  ? 92   LEU E C     1 
ATOM   3504  O  O     . LEU E  1 92  ? -37.643 -17.023 41.017  1.00 56.08  ? 92   LEU E O     1 
ATOM   3505  C  CB    . LEU E  1 92  ? -37.981 -14.968 38.665  1.00 56.06  ? 92   LEU E CB    1 
ATOM   3506  C  CG    . LEU E  1 92  ? -37.092 -14.114 37.773  1.00 55.58  ? 92   LEU E CG    1 
ATOM   3507  C  CD1   . LEU E  1 92  ? -37.692 -12.744 37.586  1.00 55.53  ? 92   LEU E CD1   1 
ATOM   3508  C  CD2   . LEU E  1 92  ? -35.683 -14.019 38.341  1.00 56.90  ? 92   LEU E CD2   1 
ATOM   3509  N  N     . GLN E  1 93  ? -39.482 -17.584 39.880  1.00 55.82  ? 93   GLN E N     1 
ATOM   3510  C  CA    . GLN E  1 93  ? -40.054 -18.196 41.074  1.00 55.78  ? 93   GLN E CA    1 
ATOM   3511  C  C     . GLN E  1 93  ? -39.524 -19.593 41.368  1.00 55.39  ? 93   GLN E C     1 
ATOM   3512  O  O     . GLN E  1 93  ? -39.368 -19.949 42.542  1.00 55.02  ? 93   GLN E O     1 
ATOM   3513  C  CB    . GLN E  1 93  ? -41.576 -18.185 41.062  1.00 56.01  ? 93   GLN E CB    1 
ATOM   3514  C  CG    . GLN E  1 93  ? -42.144 -18.428 42.445  1.00 56.11  ? 93   GLN E CG    1 
ATOM   3515  C  CD    . GLN E  1 93  ? -43.627 -18.334 42.474  1.00 57.16  ? 93   GLN E CD    1 
ATOM   3516  O  OE1   . GLN E  1 93  ? -44.244 -17.759 41.580  1.00 58.54  ? 93   GLN E OE1   1 
ATOM   3517  N  NE2   . GLN E  1 93  ? -44.225 -18.889 43.512  1.00 59.11  ? 93   GLN E NE2   1 
ATOM   3518  N  N     . GLU E  1 94  ? -39.253 -20.378 40.322  1.00 55.12  ? 94   GLU E N     1 
ATOM   3519  C  CA    . GLU E  1 94  ? -38.596 -21.677 40.505  1.00 55.53  ? 94   GLU E CA    1 
ATOM   3520  C  C     . GLU E  1 94  ? -37.217 -21.474 41.129  1.00 54.61  ? 94   GLU E C     1 
ATOM   3521  O  O     . GLU E  1 94  ? -36.893 -22.080 42.155  1.00 54.52  ? 94   GLU E O     1 
ATOM   3522  C  CB    . GLU E  1 94  ? -38.440 -22.424 39.181  1.00 56.28  ? 94   GLU E CB    1 
ATOM   3523  C  CG    . GLU E  1 94  ? -39.742 -22.795 38.478  1.00 60.25  ? 94   GLU E CG    1 
ATOM   3524  C  CD    . GLU E  1 94  ? -40.505 -23.888 39.202  1.00 65.06  ? 94   GLU E CD    1 
ATOM   3525  O  OE1   . GLU E  1 94  ? -39.869 -24.883 39.612  1.00 67.48  ? 94   GLU E OE1   1 
ATOM   3526  O  OE2   . GLU E  1 94  ? -41.743 -23.752 39.354  1.00 67.33  ? 94   GLU E OE2   1 
ATOM   3527  N  N     . ALA E  1 95  ? -36.418 -20.605 40.509  1.00 53.44  ? 95   ALA E N     1 
ATOM   3528  C  CA    . ALA E  1 95  ? -35.093 -20.288 41.009  1.00 52.20  ? 95   ALA E CA    1 
ATOM   3529  C  C     . ALA E  1 95  ? -35.137 -19.729 42.426  1.00 51.83  ? 95   ALA E C     1 
ATOM   3530  O  O     . ALA E  1 95  ? -34.332 -20.123 43.256  1.00 52.09  ? 95   ALA E O     1 
ATOM   3531  C  CB    . ALA E  1 95  ? -34.392 -19.346 40.083  1.00 51.65  ? 95   ALA E CB    1 
ATOM   3532  N  N     . SER E  1 96  ? -36.081 -18.840 42.717  1.00 51.30  ? 96   SER E N     1 
ATOM   3533  C  CA    . SER E  1 96  ? -36.143 -18.221 44.031  1.00 51.12  ? 96   SER E CA    1 
ATOM   3534  C  C     . SER E  1 96  ? -36.455 -19.229 45.094  1.00 51.01  ? 96   SER E C     1 
ATOM   3535  O  O     . SER E  1 96  ? -35.923 -19.153 46.199  1.00 51.29  ? 96   SER E O     1 
ATOM   3536  C  CB    . SER E  1 96  ? -37.213 -17.146 44.088  1.00 51.19  ? 96   SER E CB    1 
ATOM   3537  O  OG    . SER E  1 96  ? -36.837 -16.025 43.326  1.00 52.94  ? 96   SER E OG    1 
ATOM   3538  N  N     . GLU E  1 97  ? -37.337 -20.172 44.777  1.00 50.92  ? 97   GLU E N     1 
ATOM   3539  C  CA    . GLU E  1 97  ? -37.792 -21.118 45.797  1.00 50.36  ? 97   GLU E CA    1 
ATOM   3540  C  C     . GLU E  1 97  ? -36.790 -22.245 46.037  1.00 49.13  ? 97   GLU E C     1 
ATOM   3541  O  O     . GLU E  1 97  ? -36.512 -22.595 47.184  1.00 48.33  ? 97   GLU E O     1 
ATOM   3542  C  CB    . GLU E  1 97  ? -39.174 -21.633 45.470  1.00 50.68  ? 97   GLU E CB    1 
ATOM   3543  C  CG    . GLU E  1 97  ? -40.220 -20.577 45.675  1.00 53.25  ? 97   GLU E CG    1 
ATOM   3544  C  CD    . GLU E  1 97  ? -41.625 -21.123 45.631  1.00 58.13  ? 97   GLU E CD    1 
ATOM   3545  O  OE1   . GLU E  1 97  ? -41.844 -22.251 46.130  1.00 62.15  ? 97   GLU E OE1   1 
ATOM   3546  O  OE2   . GLU E  1 97  ? -42.524 -20.422 45.110  1.00 60.30  ? 97   GLU E OE2   1 
ATOM   3547  N  N     . ALA E  1 98  ? -36.225 -22.780 44.958  1.00 47.98  ? 98   ALA E N     1 
ATOM   3548  C  CA    . ALA E  1 98  ? -35.138 -23.733 45.076  1.00 47.11  ? 98   ALA E CA    1 
ATOM   3549  C  C     . ALA E  1 98  ? -34.036 -23.140 45.953  1.00 46.79  ? 98   ALA E C     1 
ATOM   3550  O  O     . ALA E  1 98  ? -33.571 -23.789 46.889  1.00 46.96  ? 98   ALA E O     1 
ATOM   3551  C  CB    . ALA E  1 98  ? -34.618 -24.135 43.712  1.00 46.76  ? 98   ALA E CB    1 
ATOM   3552  N  N     . TYR E  1 99  ? -33.665 -21.892 45.682  1.00 46.62  ? 99   TYR E N     1 
ATOM   3553  C  CA    . TYR E  1 99  ? -32.672 -21.178 46.483  1.00 46.40  ? 99   TYR E CA    1 
ATOM   3554  C  C     . TYR E  1 99  ? -33.025 -21.174 47.964  1.00 46.23  ? 99   TYR E C     1 
ATOM   3555  O  O     . TYR E  1 99  ? -32.196 -21.539 48.795  1.00 45.97  ? 99   TYR E O     1 
ATOM   3556  C  CB    . TYR E  1 99  ? -32.487 -19.729 45.992  1.00 46.87  ? 99   TYR E CB    1 
ATOM   3557  C  CG    . TYR E  1 99  ? -31.603 -18.901 46.897  1.00 47.26  ? 99   TYR E CG    1 
ATOM   3558  C  CD1   . TYR E  1 99  ? -30.216 -19.049 46.870  1.00 47.71  ? 99   TYR E CD1   1 
ATOM   3559  C  CD2   . TYR E  1 99  ? -32.150 -17.998 47.806  1.00 48.28  ? 99   TYR E CD2   1 
ATOM   3560  C  CE1   . TYR E  1 99  ? -29.395 -18.311 47.715  1.00 47.76  ? 99   TYR E CE1   1 
ATOM   3561  C  CE2   . TYR E  1 99  ? -31.337 -17.253 48.657  1.00 48.33  ? 99   TYR E CE2   1 
ATOM   3562  C  CZ    . TYR E  1 99  ? -29.961 -17.414 48.601  1.00 48.27  ? 99   TYR E CZ    1 
ATOM   3563  O  OH    . TYR E  1 99  ? -29.140 -16.676 49.441  1.00 49.55  ? 99   TYR E OH    1 
ATOM   3564  N  N     . LEU E  1 100 ? -34.245 -20.753 48.289  1.00 46.20  ? 100  LEU E N     1 
ATOM   3565  C  CA    . LEU E  1 100 ? -34.635 -20.588 49.679  1.00 46.57  ? 100  LEU E CA    1 
ATOM   3566  C  C     . LEU E  1 100 ? -34.746 -21.911 50.389  1.00 46.60  ? 100  LEU E C     1 
ATOM   3567  O  O     . LEU E  1 100 ? -34.315 -22.042 51.542  1.00 47.26  ? 100  LEU E O     1 
ATOM   3568  C  CB    . LEU E  1 100 ? -35.926 -19.783 49.810  1.00 46.85  ? 100  LEU E CB    1 
ATOM   3569  C  CG    . LEU E  1 100 ? -35.751 -18.256 49.631  1.00 48.45  ? 100  LEU E CG    1 
ATOM   3570  C  CD1   . LEU E  1 100 ? -37.103 -17.531 49.481  1.00 45.84  ? 100  LEU E CD1   1 
ATOM   3571  C  CD2   . LEU E  1 100 ? -34.894 -17.641 50.771  1.00 48.06  ? 100  LEU E CD2   1 
ATOM   3572  N  N     . VAL E  1 101 ? -35.290 -22.905 49.693  1.00 46.26  ? 101  VAL E N     1 
ATOM   3573  C  CA    . VAL E  1 101 ? -35.413 -24.245 50.246  1.00 45.72  ? 101  VAL E CA    1 
ATOM   3574  C  C     . VAL E  1 101 ? -34.021 -24.782 50.575  1.00 45.79  ? 101  VAL E C     1 
ATOM   3575  O  O     . VAL E  1 101 ? -33.772 -25.233 51.696  1.00 45.68  ? 101  VAL E O     1 
ATOM   3576  C  CB    . VAL E  1 101 ? -36.219 -25.177 49.309  1.00 45.81  ? 101  VAL E CB    1 
ATOM   3577  C  CG1   . VAL E  1 101 ? -36.148 -26.585 49.780  1.00 44.42  ? 101  VAL E CG1   1 
ATOM   3578  C  CG2   . VAL E  1 101 ? -37.696 -24.716 49.249  1.00 45.65  ? 101  VAL E CG2   1 
ATOM   3579  N  N     . ALA E  1 102 ? -33.097 -24.669 49.624  1.00 45.73  ? 102  ALA E N     1 
ATOM   3580  C  CA    . ALA E  1 102 ? -31.726 -25.116 49.852  1.00 46.09  ? 102  ALA E CA    1 
ATOM   3581  C  C     . ALA E  1 102 ? -31.064 -24.384 51.017  1.00 46.87  ? 102  ALA E C     1 
ATOM   3582  O  O     . ALA E  1 102 ? -30.262 -24.982 51.748  1.00 47.71  ? 102  ALA E O     1 
ATOM   3583  C  CB    . ALA E  1 102 ? -30.915 -24.966 48.609  1.00 45.72  ? 102  ALA E CB    1 
ATOM   3584  N  N     . LEU E  1 103 ? -31.414 -23.106 51.200  1.00 47.38  ? 103  LEU E N     1 
ATOM   3585  C  CA    . LEU E  1 103 ? -30.878 -22.283 52.294  1.00 47.48  ? 103  LEU E CA    1 
ATOM   3586  C  C     . LEU E  1 103 ? -31.390 -22.704 53.648  1.00 48.35  ? 103  LEU E C     1 
ATOM   3587  O  O     . LEU E  1 103 ? -30.633 -22.668 54.611  1.00 48.46  ? 103  LEU E O     1 
ATOM   3588  C  CB    . LEU E  1 103 ? -31.185 -20.801 52.086  1.00 47.12  ? 103  LEU E CB    1 
ATOM   3589  C  CG    . LEU E  1 103 ? -30.490 -19.792 52.996  1.00 46.09  ? 103  LEU E CG    1 
ATOM   3590  C  CD1   . LEU E  1 103 ? -28.999 -19.909 52.878  1.00 45.93  ? 103  LEU E CD1   1 
ATOM   3591  C  CD2   . LEU E  1 103 ? -30.913 -18.382 52.632  1.00 47.34  ? 103  LEU E CD2   1 
ATOM   3592  N  N     . PHE E  1 104 ? -32.669 -23.084 53.734  1.00 49.33  ? 104  PHE E N     1 
ATOM   3593  C  CA    . PHE E  1 104 ? -33.220 -23.605 54.991  1.00 50.13  ? 104  PHE E CA    1 
ATOM   3594  C  C     . PHE E  1 104 ? -32.608 -24.967 55.360  1.00 51.11  ? 104  PHE E C     1 
ATOM   3595  O  O     . PHE E  1 104 ? -32.418 -25.269 56.537  1.00 51.26  ? 104  PHE E O     1 
ATOM   3596  C  CB    . PHE E  1 104 ? -34.752 -23.659 54.957  1.00 49.89  ? 104  PHE E CB    1 
ATOM   3597  C  CG    . PHE E  1 104 ? -35.417 -22.306 55.138  1.00 50.15  ? 104  PHE E CG    1 
ATOM   3598  C  CD1   . PHE E  1 104 ? -36.278 -21.800 54.163  1.00 49.35  ? 104  PHE E CD1   1 
ATOM   3599  C  CD2   . PHE E  1 104 ? -35.166 -21.529 56.274  1.00 49.11  ? 104  PHE E CD2   1 
ATOM   3600  C  CE1   . PHE E  1 104 ? -36.884 -20.546 54.319  1.00 48.65  ? 104  PHE E CE1   1 
ATOM   3601  C  CE2   . PHE E  1 104 ? -35.760 -20.277 56.432  1.00 47.64  ? 104  PHE E CE2   1 
ATOM   3602  C  CZ    . PHE E  1 104 ? -36.621 -19.786 55.453  1.00 48.28  ? 104  PHE E CZ    1 
ATOM   3603  N  N     . GLU E  1 105 ? -32.266 -25.781 54.367  1.00 51.90  ? 105  GLU E N     1 
ATOM   3604  C  CA    . GLU E  1 105 ? -31.522 -26.987 54.673  1.00 53.53  ? 105  GLU E CA    1 
ATOM   3605  C  C     . GLU E  1 105 ? -30.265 -26.554 55.416  1.00 52.64  ? 105  GLU E C     1 
ATOM   3606  O  O     . GLU E  1 105 ? -30.073 -26.961 56.560  1.00 52.98  ? 105  GLU E O     1 
ATOM   3607  C  CB    . GLU E  1 105 ? -31.211 -27.826 53.423  1.00 53.25  ? 105  GLU E CB    1 
ATOM   3608  C  CG    . GLU E  1 105 ? -32.472 -28.367 52.724  1.00 56.13  ? 105  GLU E CG    1 
ATOM   3609  C  CD    . GLU E  1 105 ? -32.268 -28.805 51.241  1.00 57.56  ? 105  GLU E CD    1 
ATOM   3610  O  OE1   . GLU E  1 105 ? -31.089 -29.025 50.816  1.00 61.76  ? 105  GLU E OE1   1 
ATOM   3611  O  OE2   . GLU E  1 105 ? -33.308 -28.944 50.515  1.00 60.79  ? 105  GLU E OE2   1 
ATOM   3612  N  N     . ASP E  1 106 ? -29.453 -25.683 54.807  1.00 52.16  ? 106  ASP E N     1 
ATOM   3613  C  CA    . ASP E  1 106 ? -28.193 -25.224 55.430  1.00 51.56  ? 106  ASP E CA    1 
ATOM   3614  C  C     . ASP E  1 106 ? -28.389 -24.552 56.781  1.00 50.30  ? 106  ASP E C     1 
ATOM   3615  O  O     . ASP E  1 106 ? -27.672 -24.839 57.723  1.00 50.04  ? 106  ASP E O     1 
ATOM   3616  C  CB    . ASP E  1 106 ? -27.426 -24.292 54.505  1.00 52.11  ? 106  ASP E CB    1 
ATOM   3617  C  CG    . ASP E  1 106 ? -26.949 -24.981 53.242  1.00 56.22  ? 106  ASP E CG    1 
ATOM   3618  O  OD1   . ASP E  1 106 ? -27.210 -26.212 53.097  1.00 61.88  ? 106  ASP E OD1   1 
ATOM   3619  O  OD2   . ASP E  1 106 ? -26.323 -24.297 52.377  1.00 59.13  ? 106  ASP E OD2   1 
ATOM   3620  N  N     . THR E  1 107 ? -29.368 -23.666 56.875  1.00 49.31  ? 107  THR E N     1 
ATOM   3621  C  CA    . THR E  1 107 ? -29.676 -22.976 58.121  1.00 48.44  ? 107  THR E CA    1 
ATOM   3622  C  C     . THR E  1 107 ? -30.075 -23.978 59.202  1.00 48.13  ? 107  THR E C     1 
ATOM   3623  O  O     . THR E  1 107 ? -29.610 -23.893 60.346  1.00 48.02  ? 107  THR E O     1 
ATOM   3624  C  CB    . THR E  1 107 ? -30.811 -21.986 57.889  1.00 48.62  ? 107  THR E CB    1 
ATOM   3625  O  OG1   . THR E  1 107 ? -30.455 -21.126 56.805  1.00 48.40  ? 107  THR E OG1   1 
ATOM   3626  C  CG2   . THR E  1 107 ? -31.091 -21.165 59.120  1.00 47.99  ? 107  THR E CG2   1 
ATOM   3627  N  N     . ASN E  1 108 ? -30.919 -24.943 58.829  1.00 47.66  ? 108  ASN E N     1 
ATOM   3628  C  CA    . ASN E  1 108 ? -31.319 -26.016 59.754  1.00 46.83  ? 108  ASN E CA    1 
ATOM   3629  C  C     . ASN E  1 108 ? -30.164 -26.796 60.378  1.00 46.24  ? 108  ASN E C     1 
ATOM   3630  O  O     . ASN E  1 108 ? -30.186 -27.056 61.580  1.00 46.10  ? 108  ASN E O     1 
ATOM   3631  C  CB    . ASN E  1 108 ? -32.311 -26.971 59.114  1.00 46.46  ? 108  ASN E CB    1 
ATOM   3632  C  CG    . ASN E  1 108 ? -33.072 -27.765 60.133  1.00 46.32  ? 108  ASN E CG    1 
ATOM   3633  O  OD1   . ASN E  1 108 ? -33.401 -27.270 61.196  1.00 47.01  ? 108  ASN E OD1   1 
ATOM   3634  N  ND2   . ASN E  1 108 ? -33.347 -29.009 59.822  1.00 47.56  ? 108  ASN E ND2   1 
ATOM   3635  N  N     . LEU E  1 109 ? -29.163 -27.149 59.568  1.00 45.79  ? 109  LEU E N     1 
ATOM   3636  C  CA    . LEU E  1 109 ? -27.948 -27.809 60.053  1.00 45.54  ? 109  LEU E CA    1 
ATOM   3637  C  C     . LEU E  1 109 ? -27.182 -26.966 61.062  1.00 45.69  ? 109  LEU E C     1 
ATOM   3638  O  O     . LEU E  1 109 ? -26.769 -27.464 62.090  1.00 46.31  ? 109  LEU E O     1 
ATOM   3639  C  CB    . LEU E  1 109 ? -27.019 -28.156 58.897  1.00 45.71  ? 109  LEU E CB    1 
ATOM   3640  C  CG    . LEU E  1 109 ? -27.335 -29.334 57.977  1.00 45.84  ? 109  LEU E CG    1 
ATOM   3641  C  CD1   . LEU E  1 109 ? -26.380 -29.299 56.808  1.00 42.89  ? 109  LEU E CD1   1 
ATOM   3642  C  CD2   . LEU E  1 109 ? -27.202 -30.659 58.733  1.00 45.58  ? 109  LEU E CD2   1 
ATOM   3643  N  N     . CYS E  1 110 ? -26.988 -25.687 60.773  1.00 45.81  ? 110  CYS E N     1 
ATOM   3644  C  CA    . CYS E  1 110 ? -26.332 -24.783 61.708  1.00 45.78  ? 110  CYS E CA    1 
ATOM   3645  C  C     . CYS E  1 110 ? -27.082 -24.753 63.040  1.00 45.79  ? 110  CYS E C     1 
ATOM   3646  O  O     . CYS E  1 110 ? -26.474 -24.877 64.100  1.00 45.68  ? 110  CYS E O     1 
ATOM   3647  C  CB    . CYS E  1 110 ? -26.234 -23.372 61.114  1.00 46.09  ? 110  CYS E CB    1 
ATOM   3648  S  SG    . CYS E  1 110 ? -25.272 -23.214 59.564  1.00 46.81  ? 110  CYS E SG    1 
ATOM   3649  N  N     . ALA E  1 111 ? -28.405 -24.591 62.994  1.00 45.80  ? 111  ALA E N     1 
ATOM   3650  C  CA    . ALA E  1 111 ? -29.212 -24.691 64.214  1.00 45.61  ? 111  ALA E CA    1 
ATOM   3651  C  C     . ALA E  1 111 ? -28.856 -25.961 64.997  1.00 45.57  ? 111  ALA E C     1 
ATOM   3652  O  O     . ALA E  1 111 ? -28.459 -25.882 66.148  1.00 45.61  ? 111  ALA E O     1 
ATOM   3653  C  CB    . ALA E  1 111 ? -30.690 -24.650 63.884  1.00 45.32  ? 111  ALA E CB    1 
ATOM   3654  N  N     . ILE E  1 112 ? -28.961 -27.122 64.355  1.00 45.56  ? 112  ILE E N     1 
ATOM   3655  C  CA    . ILE E  1 112 ? -28.610 -28.391 64.984  1.00 45.91  ? 112  ILE E CA    1 
ATOM   3656  C  C     . ILE E  1 112 ? -27.138 -28.404 65.498  1.00 47.04  ? 112  ILE E C     1 
ATOM   3657  O  O     . ILE E  1 112 ? -26.819 -28.975 66.542  1.00 47.77  ? 112  ILE E O     1 
ATOM   3658  C  CB    . ILE E  1 112 ? -28.885 -29.567 64.004  1.00 45.50  ? 112  ILE E CB    1 
ATOM   3659  C  CG1   . ILE E  1 112 ? -30.381 -29.718 63.763  1.00 45.09  ? 112  ILE E CG1   1 
ATOM   3660  C  CG2   . ILE E  1 112 ? -28.274 -30.871 64.501  1.00 44.37  ? 112  ILE E CG2   1 
ATOM   3661  C  CD1   . ILE E  1 112 ? -30.737 -30.188 62.370  1.00 43.71  ? 112  ILE E CD1   1 
ATOM   3662  N  N     . HIS E  1 113 ? -26.236 -27.772 64.766  1.00 47.58  ? 113  HIS E N     1 
ATOM   3663  C  CA    . HIS E  1 113 ? -24.861 -27.670 65.215  1.00 47.91  ? 113  HIS E CA    1 
ATOM   3664  C  C     . HIS E  1 113 ? -24.737 -27.044 66.606  1.00 48.72  ? 113  HIS E C     1 
ATOM   3665  O  O     . HIS E  1 113 ? -23.784 -27.313 67.328  1.00 48.56  ? 113  HIS E O     1 
ATOM   3666  C  CB    . HIS E  1 113 ? -24.064 -26.839 64.226  1.00 47.48  ? 113  HIS E CB    1 
ATOM   3667  C  CG    . HIS E  1 113 ? -22.600 -26.847 64.496  1.00 45.77  ? 113  HIS E CG    1 
ATOM   3668  N  ND1   . HIS E  1 113 ? -21.796 -27.914 64.173  1.00 43.12  ? 113  HIS E ND1   1 
ATOM   3669  C  CD2   . HIS E  1 113 ? -21.796 -25.930 65.079  1.00 44.38  ? 113  HIS E CD2   1 
ATOM   3670  C  CE1   . HIS E  1 113 ? -20.554 -27.648 64.525  1.00 43.58  ? 113  HIS E CE1   1 
ATOM   3671  N  NE2   . HIS E  1 113 ? -20.526 -26.451 65.080  1.00 43.16  ? 113  HIS E NE2   1 
ATOM   3672  N  N     . ALA E  1 114 ? -25.708 -26.209 66.965  1.00 49.98  ? 114  ALA E N     1 
ATOM   3673  C  CA    . ALA E  1 114 ? -25.682 -25.451 68.211  1.00 51.23  ? 114  ALA E CA    1 
ATOM   3674  C  C     . ALA E  1 114 ? -26.615 -26.076 69.237  1.00 52.62  ? 114  ALA E C     1 
ATOM   3675  O  O     . ALA E  1 114 ? -27.087 -25.397 70.150  1.00 52.93  ? 114  ALA E O     1 
ATOM   3676  C  CB    . ALA E  1 114 ? -26.061 -24.003 67.949  1.00 50.53  ? 114  ALA E CB    1 
ATOM   3677  N  N     . LYS E  1 115 ? -26.864 -27.382 69.083  1.00 54.30  ? 115  LYS E N     1 
ATOM   3678  C  CA    . LYS E  1 115 ? -27.821 -28.151 69.910  1.00 55.51  ? 115  LYS E CA    1 
ATOM   3679  C  C     . LYS E  1 115 ? -29.204 -27.499 70.003  1.00 55.66  ? 115  LYS E C     1 
ATOM   3680  O  O     . LYS E  1 115 ? -29.849 -27.573 71.042  1.00 56.13  ? 115  LYS E O     1 
ATOM   3681  C  CB    . LYS E  1 115 ? -27.289 -28.396 71.324  1.00 55.81  ? 115  LYS E CB    1 
ATOM   3682  C  CG    . LYS E  1 115 ? -25.789 -28.294 71.465  1.00 59.05  ? 115  LYS E CG    1 
ATOM   3683  C  CD    . LYS E  1 115 ? -25.073 -29.626 71.498  1.00 62.76  ? 115  LYS E CD    1 
ATOM   3684  C  CE    . LYS E  1 115 ? -23.653 -29.402 72.065  1.00 66.02  ? 115  LYS E CE    1 
ATOM   3685  N  NZ    . LYS E  1 115 ? -23.001 -30.644 72.603  1.00 69.10  ? 115  LYS E NZ    1 
ATOM   3686  N  N     . ARG E  1 116 ? -29.649 -26.859 68.923  1.00 55.70  ? 116  ARG E N     1 
ATOM   3687  C  CA    . ARG E  1 116 ? -30.973 -26.257 68.870  1.00 55.31  ? 116  ARG E CA    1 
ATOM   3688  C  C     . ARG E  1 116 ? -31.840 -26.977 67.849  1.00 55.51  ? 116  ARG E C     1 
ATOM   3689  O  O     . ARG E  1 116 ? -31.408 -27.908 67.180  1.00 56.35  ? 116  ARG E O     1 
ATOM   3690  C  CB    . ARG E  1 116 ? -30.874 -24.781 68.514  1.00 55.18  ? 116  ARG E CB    1 
ATOM   3691  C  CG    . ARG E  1 116 ? -30.547 -23.874 69.675  1.00 55.23  ? 116  ARG E CG    1 
ATOM   3692  C  CD    . ARG E  1 116 ? -30.702 -22.414 69.271  1.00 55.84  ? 116  ARG E CD    1 
ATOM   3693  N  NE    . ARG E  1 116 ? -29.491 -21.865 68.645  1.00 56.61  ? 116  ARG E NE    1 
ATOM   3694  C  CZ    . ARG E  1 116 ? -29.301 -21.732 67.330  1.00 55.63  ? 116  ARG E CZ    1 
ATOM   3695  N  NH1   . ARG E  1 116 ? -30.228 -22.117 66.467  1.00 54.78  ? 116  ARG E NH1   1 
ATOM   3696  N  NH2   . ARG E  1 116 ? -28.171 -21.214 66.872  1.00 56.08  ? 116  ARG E NH2   1 
ATOM   3697  N  N     . VAL E  1 117 ? -33.074 -26.527 67.723  1.00 55.47  ? 117  VAL E N     1 
ATOM   3698  C  CA    . VAL E  1 117 ? -34.078 -27.196 66.920  1.00 55.00  ? 117  VAL E CA    1 
ATOM   3699  C  C     . VAL E  1 117 ? -34.834 -26.097 66.183  1.00 54.85  ? 117  VAL E C     1 
ATOM   3700  O  O     . VAL E  1 117 ? -35.535 -26.361 65.213  1.00 54.78  ? 117  VAL E O     1 
ATOM   3701  C  CB    . VAL E  1 117 ? -35.005 -28.020 67.864  1.00 55.34  ? 117  VAL E CB    1 
ATOM   3702  C  CG1   . VAL E  1 117 ? -36.395 -28.231 67.275  1.00 55.60  ? 117  VAL E CG1   1 
ATOM   3703  C  CG2   . VAL E  1 117 ? -34.334 -29.342 68.252  1.00 54.21  ? 117  VAL E CG2   1 
ATOM   3704  N  N     . THR E  1 118 ? -34.648 -24.858 66.655  1.00 54.85  ? 118  THR E N     1 
ATOM   3705  C  CA    . THR E  1 118 ? -35.274 -23.652 66.108  1.00 54.53  ? 118  THR E CA    1 
ATOM   3706  C  C     . THR E  1 118 ? -34.273 -22.930 65.236  1.00 54.20  ? 118  THR E C     1 
ATOM   3707  O  O     . THR E  1 118 ? -33.163 -22.645 65.674  1.00 54.50  ? 118  THR E O     1 
ATOM   3708  C  CB    . THR E  1 118 ? -35.672 -22.664 67.232  1.00 54.42  ? 118  THR E CB    1 
ATOM   3709  O  OG1   . THR E  1 118 ? -36.163 -23.378 68.371  1.00 55.73  ? 118  THR E OG1   1 
ATOM   3710  C  CG2   . THR E  1 118 ? -36.743 -21.698 66.758  1.00 54.38  ? 118  THR E CG2   1 
ATOM   3711  N  N     . ILE E  1 119 ? -34.643 -22.631 64.000  1.00 53.79  ? 119  ILE E N     1 
ATOM   3712  C  CA    . ILE E  1 119 ? -33.759 -21.821 63.162  1.00 53.14  ? 119  ILE E CA    1 
ATOM   3713  C  C     . ILE E  1 119 ? -33.903 -20.353 63.558  1.00 54.02  ? 119  ILE E C     1 
ATOM   3714  O  O     . ILE E  1 119 ? -35.013 -19.874 63.833  1.00 53.69  ? 119  ILE E O     1 
ATOM   3715  C  CB    . ILE E  1 119 ? -33.954 -22.057 61.639  1.00 52.29  ? 119  ILE E CB    1 
ATOM   3716  C  CG1   . ILE E  1 119 ? -35.348 -21.633 61.183  1.00 50.71  ? 119  ILE E CG1   1 
ATOM   3717  C  CG2   . ILE E  1 119 ? -33.677 -23.513 61.310  1.00 51.32  ? 119  ILE E CG2   1 
ATOM   3718  C  CD1   . ILE E  1 119 ? -35.521 -21.561 59.708  1.00 47.52  ? 119  ILE E CD1   1 
ATOM   3719  N  N     . MET E  1 120 ? -32.765 -19.663 63.630  1.00 54.71  ? 120  MET E N     1 
ATOM   3720  C  CA    . MET E  1 120 ? -32.713 -18.253 64.027  1.00 55.06  ? 120  MET E CA    1 
ATOM   3721  C  C     . MET E  1 120 ? -31.921 -17.489 62.975  1.00 55.18  ? 120  MET E C     1 
ATOM   3722  O  O     . MET E  1 120 ? -31.225 -18.117 62.175  1.00 55.52  ? 120  MET E O     1 
ATOM   3723  C  CB    . MET E  1 120 ? -32.080 -18.133 65.409  1.00 54.52  ? 120  MET E CB    1 
ATOM   3724  C  CG    . MET E  1 120 ? -32.951 -18.750 66.481  1.00 54.63  ? 120  MET E CG    1 
ATOM   3725  S  SD    . MET E  1 120 ? -32.215 -18.781 68.111  1.00 56.48  ? 120  MET E SD    1 
ATOM   3726  C  CE    . MET E  1 120 ? -33.518 -19.523 69.082  1.00 56.20  ? 120  MET E CE    1 
ATOM   3727  N  N     . PRO E  1 121 ? -32.058 -16.143 62.921  1.00 55.19  ? 121  PRO E N     1 
ATOM   3728  C  CA    . PRO E  1 121 ? -31.223 -15.344 62.007  1.00 54.68  ? 121  PRO E CA    1 
ATOM   3729  C  C     . PRO E  1 121 ? -29.723 -15.665 62.034  1.00 54.25  ? 121  PRO E C     1 
ATOM   3730  O  O     . PRO E  1 121 ? -29.120 -15.798 60.977  1.00 54.73  ? 121  PRO E O     1 
ATOM   3731  C  CB    . PRO E  1 121 ? -31.498 -13.914 62.458  1.00 54.69  ? 121  PRO E CB    1 
ATOM   3732  C  CG    . PRO E  1 121 ? -32.939 -13.967 62.892  1.00 54.41  ? 121  PRO E CG    1 
ATOM   3733  C  CD    . PRO E  1 121 ? -33.027 -15.287 63.639  1.00 55.26  ? 121  PRO E CD    1 
ATOM   3734  N  N     . LYS E  1 122 ? -29.121 -15.811 63.205  1.00 53.86  ? 122  LYS E N     1 
ATOM   3735  C  CA    . LYS E  1 122 ? -27.693 -16.147 63.261  1.00 53.96  ? 122  LYS E CA    1 
ATOM   3736  C  C     . LYS E  1 122 ? -27.363 -17.420 62.476  1.00 53.42  ? 122  LYS E C     1 
ATOM   3737  O  O     . LYS E  1 122 ? -26.248 -17.568 61.975  1.00 53.85  ? 122  LYS E O     1 
ATOM   3738  C  CB    . LYS E  1 122 ? -27.182 -16.254 64.696  1.00 53.59  ? 122  LYS E CB    1 
ATOM   3739  C  CG    . LYS E  1 122 ? -27.945 -17.251 65.558  1.00 55.27  ? 122  LYS E CG    1 
ATOM   3740  C  CD    . LYS E  1 122 ? -27.249 -17.507 66.896  1.00 55.70  ? 122  LYS E CD    1 
ATOM   3741  C  CE    . LYS E  1 122 ? -27.601 -16.453 67.927  1.00 59.21  ? 122  LYS E CE    1 
ATOM   3742  N  NZ    . LYS E  1 122 ? -26.717 -16.609 69.110  1.00 60.05  ? 122  LYS E NZ    1 
ATOM   3743  N  N     . ASP E  1 123 ? -28.334 -18.325 62.356  1.00 52.70  ? 123  ASP E N     1 
ATOM   3744  C  CA    . ASP E  1 123 ? -28.161 -19.538 61.560  1.00 51.42  ? 123  ASP E CA    1 
ATOM   3745  C  C     . ASP E  1 123 ? -28.108 -19.215 60.083  1.00 50.95  ? 123  ASP E C     1 
ATOM   3746  O  O     . ASP E  1 123 ? -27.199 -19.677 59.405  1.00 51.04  ? 123  ASP E O     1 
ATOM   3747  C  CB    . ASP E  1 123 ? -29.246 -20.572 61.854  1.00 51.05  ? 123  ASP E CB    1 
ATOM   3748  C  CG    . ASP E  1 123 ? -29.235 -21.038 63.300  1.00 51.11  ? 123  ASP E CG    1 
ATOM   3749  O  OD1   . ASP E  1 123 ? -28.147 -21.308 63.849  1.00 51.74  ? 123  ASP E OD1   1 
ATOM   3750  O  OD2   . ASP E  1 123 ? -30.321 -21.133 63.899  1.00 51.02  ? 123  ASP E OD2   1 
ATOM   3751  N  N     . ILE E  1 124 ? -29.058 -18.419 59.585  1.00 50.57  ? 124  ILE E N     1 
ATOM   3752  C  CA    . ILE E  1 124 ? -29.029 -17.990 58.177  1.00 50.32  ? 124  ILE E CA    1 
ATOM   3753  C  C     . ILE E  1 124 ? -27.751 -17.212 57.876  1.00 50.08  ? 124  ILE E C     1 
ATOM   3754  O  O     . ILE E  1 124 ? -27.137 -17.389 56.831  1.00 49.71  ? 124  ILE E O     1 
ATOM   3755  C  CB    . ILE E  1 124 ? -30.267 -17.160 57.739  1.00 50.27  ? 124  ILE E CB    1 
ATOM   3756  C  CG1   . ILE E  1 124 ? -31.573 -17.886 58.053  1.00 50.53  ? 124  ILE E CG1   1 
ATOM   3757  C  CG2   . ILE E  1 124 ? -30.263 -16.945 56.228  1.00 50.56  ? 124  ILE E CG2   1 
ATOM   3758  C  CD1   . ILE E  1 124 ? -32.811 -17.222 57.412  1.00 50.49  ? 124  ILE E CD1   1 
ATOM   3759  N  N     . GLN E  1 125 ? -27.330 -16.380 58.821  1.00 50.27  ? 125  GLN E N     1 
ATOM   3760  C  CA    . GLN E  1 125 ? -26.148 -15.550 58.618  1.00 50.20  ? 125  GLN E CA    1 
ATOM   3761  C  C     . GLN E  1 125 ? -24.898 -16.391 58.482  1.00 49.32  ? 125  GLN E C     1 
ATOM   3762  O  O     . GLN E  1 125 ? -24.129 -16.195 57.540  1.00 50.36  ? 125  GLN E O     1 
ATOM   3763  C  CB    . GLN E  1 125 ? -26.034 -14.496 59.706  1.00 50.40  ? 125  GLN E CB    1 
ATOM   3764  C  CG    . GLN E  1 125 ? -27.106 -13.414 59.537  1.00 53.40  ? 125  GLN E CG    1 
ATOM   3765  C  CD    . GLN E  1 125 ? -27.496 -12.755 60.847  1.00 57.94  ? 125  GLN E CD    1 
ATOM   3766  O  OE1   . GLN E  1 125 ? -26.715 -12.749 61.827  1.00 57.96  ? 125  GLN E OE1   1 
ATOM   3767  N  NE2   . GLN E  1 125 ? -28.722 -12.195 60.882  1.00 57.68  ? 125  GLN E NE2   1 
ATOM   3768  N  N     . LEU E  1 126 ? -24.719 -17.358 59.377  1.00 47.90  ? 126  LEU E N     1 
ATOM   3769  C  CA    . LEU E  1 126 ? -23.611 -18.303 59.266  1.00 46.32  ? 126  LEU E CA    1 
ATOM   3770  C  C     . LEU E  1 126 ? -23.680 -19.144 57.999  1.00 46.08  ? 126  LEU E C     1 
ATOM   3771  O  O     . LEU E  1 126 ? -22.667 -19.333 57.333  1.00 46.10  ? 126  LEU E O     1 
ATOM   3772  C  CB    . LEU E  1 126 ? -23.571 -19.206 60.475  1.00 45.86  ? 126  LEU E CB    1 
ATOM   3773  C  CG    . LEU E  1 126 ? -22.434 -20.200 60.451  1.00 45.65  ? 126  LEU E CG    1 
ATOM   3774  C  CD1   . LEU E  1 126 ? -21.101 -19.518 60.623  1.00 44.16  ? 126  LEU E CD1   1 
ATOM   3775  C  CD2   . LEU E  1 126 ? -22.662 -21.228 61.532  1.00 46.41  ? 126  LEU E CD2   1 
ATOM   3776  N  N     . ALA E  1 127 ? -24.869 -19.642 57.658  1.00 45.82  ? 127  ALA E N     1 
ATOM   3777  C  CA    . ALA E  1 127 ? -25.072 -20.396 56.417  1.00 45.49  ? 127  ALA E CA    1 
ATOM   3778  C  C     . ALA E  1 127 ? -24.606 -19.581 55.232  1.00 45.86  ? 127  ALA E C     1 
ATOM   3779  O  O     . ALA E  1 127 ? -23.845 -20.066 54.400  1.00 45.61  ? 127  ALA E O     1 
ATOM   3780  C  CB    . ALA E  1 127 ? -26.525 -20.785 56.242  1.00 44.99  ? 127  ALA E CB    1 
ATOM   3781  N  N     . ARG E  1 128 ? -25.055 -18.331 55.162  1.00 46.54  ? 128  ARG E N     1 
ATOM   3782  C  CA    . ARG E  1 128 ? -24.699 -17.470 54.043  1.00 46.88  ? 128  ARG E CA    1 
ATOM   3783  C  C     . ARG E  1 128 ? -23.215 -17.121 54.041  1.00 47.27  ? 128  ARG E C     1 
ATOM   3784  O  O     . ARG E  1 128 ? -22.618 -17.068 52.974  1.00 47.10  ? 128  ARG E O     1 
ATOM   3785  C  CB    . ARG E  1 128 ? -25.582 -16.235 53.991  1.00 46.49  ? 128  ARG E CB    1 
ATOM   3786  C  CG    . ARG E  1 128 ? -27.061 -16.563 53.840  1.00 47.34  ? 128  ARG E CG    1 
ATOM   3787  C  CD    . ARG E  1 128 ? -27.708 -15.675 52.823  1.00 48.16  ? 128  ARG E CD    1 
ATOM   3788  N  NE    . ARG E  1 128 ? -27.557 -14.295 53.253  1.00 51.55  ? 128  ARG E NE    1 
ATOM   3789  C  CZ    . ARG E  1 128 ? -27.261 -13.270 52.460  1.00 51.13  ? 128  ARG E CZ    1 
ATOM   3790  N  NH1   . ARG E  1 128 ? -27.057 -13.428 51.161  1.00 49.18  ? 128  ARG E NH1   1 
ATOM   3791  N  NH2   . ARG E  1 128 ? -27.158 -12.073 52.993  1.00 53.63  ? 128  ARG E NH2   1 
ATOM   3792  N  N     . ARG E  1 129 ? -22.615 -16.926 55.214  1.00 48.05  ? 129  ARG E N     1 
ATOM   3793  C  CA    . ARG E  1 129 ? -21.176 -16.663 55.289  1.00 50.12  ? 129  ARG E CA    1 
ATOM   3794  C  C     . ARG E  1 129 ? -20.331 -17.841 54.812  1.00 51.12  ? 129  ARG E C     1 
ATOM   3795  O  O     . ARG E  1 129 ? -19.439 -17.671 53.976  1.00 51.34  ? 129  ARG E O     1 
ATOM   3796  C  CB    . ARG E  1 129 ? -20.728 -16.234 56.692  1.00 50.37  ? 129  ARG E CB    1 
ATOM   3797  C  CG    . ARG E  1 129 ? -19.233 -15.929 56.764  1.00 52.92  ? 129  ARG E CG    1 
ATOM   3798  C  CD    . ARG E  1 129 ? -18.945 -14.860 57.816  1.00 61.46  ? 129  ARG E CD    1 
ATOM   3799  N  NE    . ARG E  1 129 ? -17.526 -14.464 57.875  1.00 66.85  ? 129  ARG E NE    1 
ATOM   3800  C  CZ    . ARG E  1 129 ? -16.939 -13.878 58.928  1.00 69.11  ? 129  ARG E CZ    1 
ATOM   3801  N  NH1   . ARG E  1 129 ? -17.629 -13.611 60.039  1.00 68.89  ? 129  ARG E NH1   1 
ATOM   3802  N  NH2   . ARG E  1 129 ? -15.644 -13.568 58.881  1.00 70.71  ? 129  ARG E NH2   1 
ATOM   3803  N  N     . ILE E  1 130 ? -20.606 -19.034 55.334  1.00 52.36  ? 130  ILE E N     1 
ATOM   3804  C  CA    . ILE E  1 130 ? -19.845 -20.204 54.930  1.00 53.71  ? 130  ILE E CA    1 
ATOM   3805  C  C     . ILE E  1 130 ? -20.004 -20.484 53.440  1.00 54.78  ? 130  ILE E C     1 
ATOM   3806  O  O     . ILE E  1 130 ? -19.049 -20.900 52.788  1.00 55.26  ? 130  ILE E O     1 
ATOM   3807  C  CB    . ILE E  1 130 ? -20.120 -21.440 55.814  1.00 53.63  ? 130  ILE E CB    1 
ATOM   3808  C  CG1   . ILE E  1 130 ? -19.604 -21.185 57.231  1.00 53.77  ? 130  ILE E CG1   1 
ATOM   3809  C  CG2   . ILE E  1 130 ? -19.397 -22.659 55.278  1.00 53.42  ? 130  ILE E CG2   1 
ATOM   3810  C  CD1   . ILE E  1 130 ? -20.115 -22.180 58.244  1.00 53.31  ? 130  ILE E CD1   1 
ATOM   3811  N  N     . ARG E  1 131 ? -21.179 -20.213 52.895  1.00 56.38  ? 131  ARG E N     1 
ATOM   3812  C  CA    . ARG E  1 131 ? -21.380 -20.282 51.451  1.00 58.71  ? 131  ARG E CA    1 
ATOM   3813  C  C     . ARG E  1 131 ? -20.572 -19.278 50.626  1.00 60.89  ? 131  ARG E C     1 
ATOM   3814  O  O     . ARG E  1 131 ? -20.484 -19.407 49.421  1.00 60.95  ? 131  ARG E O     1 
ATOM   3815  C  CB    . ARG E  1 131 ? -22.835 -20.038 51.130  1.00 58.43  ? 131  ARG E CB    1 
ATOM   3816  C  CG    . ARG E  1 131 ? -23.689 -21.243 51.115  1.00 57.25  ? 131  ARG E CG    1 
ATOM   3817  C  CD    . ARG E  1 131 ? -25.063 -20.798 51.471  1.00 57.60  ? 131  ARG E CD    1 
ATOM   3818  N  NE    . ARG E  1 131 ? -26.036 -21.846 51.264  1.00 58.42  ? 131  ARG E NE    1 
ATOM   3819  C  CZ    . ARG E  1 131 ? -27.031 -21.759 50.399  1.00 58.91  ? 131  ARG E CZ    1 
ATOM   3820  N  NH1   . ARG E  1 131 ? -27.183 -20.656 49.691  1.00 58.10  ? 131  ARG E NH1   1 
ATOM   3821  N  NH2   . ARG E  1 131 ? -27.881 -22.771 50.260  1.00 60.29  ? 131  ARG E NH2   1 
ATOM   3822  N  N     . GLY E  1 132 ? -20.018 -18.254 51.259  1.00 63.80  ? 132  GLY E N     1 
ATOM   3823  C  CA    . GLY E  1 132 ? -19.320 -17.207 50.517  1.00 67.44  ? 132  GLY E CA    1 
ATOM   3824  C  C     . GLY E  1 132 ? -20.266 -16.292 49.753  1.00 70.01  ? 132  GLY E C     1 
ATOM   3825  O  O     . GLY E  1 132 ? -19.845 -15.575 48.854  1.00 70.31  ? 132  GLY E O     1 
ATOM   3826  N  N     . GLU E  1 133 ? -21.550 -16.337 50.105  1.00 72.62  ? 133  GLU E N     1 
ATOM   3827  C  CA    . GLU E  1 133 ? -22.551 -15.408 49.588  1.00 74.91  ? 133  GLU E CA    1 
ATOM   3828  C  C     . GLU E  1 133 ? -22.331 -14.062 50.242  1.00 77.02  ? 133  GLU E C     1 
ATOM   3829  O  O     . GLU E  1 133 ? -22.596 -13.013 49.648  1.00 77.92  ? 133  GLU E O     1 
ATOM   3830  C  CB    . GLU E  1 133 ? -23.964 -15.886 49.932  1.00 74.40  ? 133  GLU E CB    1 
ATOM   3831  C  CG    . GLU E  1 133 ? -24.439 -17.071 49.134  1.00 73.76  ? 133  GLU E CG    1 
ATOM   3832  C  CD    . GLU E  1 133 ? -25.910 -17.348 49.331  1.00 73.36  ? 133  GLU E CD    1 
ATOM   3833  O  OE1   . GLU E  1 133 ? -26.667 -16.408 49.634  1.00 73.79  ? 133  GLU E OE1   1 
ATOM   3834  O  OE2   . GLU E  1 133 ? -26.319 -18.510 49.180  1.00 73.30  ? 133  GLU E OE2   1 
ATOM   3835  N  N     . ARG E  1 134 ? -21.859 -14.118 51.483  1.00 79.28  ? 134  ARG E N     1 
ATOM   3836  C  CA    . ARG E  1 134 ? -21.673 -12.959 52.331  1.00 81.65  ? 134  ARG E CA    1 
ATOM   3837  C  C     . ARG E  1 134 ? -20.218 -12.997 52.787  1.00 82.78  ? 134  ARG E C     1 
ATOM   3838  O  O     . ARG E  1 134 ? -19.637 -14.084 52.956  1.00 83.04  ? 134  ARG E O     1 
ATOM   3839  C  CB    . ARG E  1 134 ? -22.646 -13.043 53.522  1.00 81.75  ? 134  ARG E CB    1 
ATOM   3840  C  CG    . ARG E  1 134 ? -22.495 -11.979 54.634  1.00 84.56  ? 134  ARG E CG    1 
ATOM   3841  C  CD    . ARG E  1 134 ? -23.040 -10.574 54.251  1.00 87.99  ? 134  ARG E CD    1 
ATOM   3842  N  NE    . ARG E  1 134 ? -24.508 -10.503 54.175  1.00 89.90  ? 134  ARG E NE    1 
ATOM   3843  C  CZ    . ARG E  1 134 ? -25.206 -9.395  53.907  1.00 91.48  ? 134  ARG E CZ    1 
ATOM   3844  N  NH1   . ARG E  1 134 ? -24.585 -8.235  53.690  1.00 92.97  ? 134  ARG E NH1   1 
ATOM   3845  N  NH2   . ARG E  1 134 ? -26.534 -9.437  53.858  1.00 90.98  ? 134  ARG E NH2   1 
ATOM   3846  N  N     . ALA E  1 135 ? -19.619 -11.813 52.950  1.00 84.06  ? 135  ALA E N     1 
ATOM   3847  C  CA    . ALA E  1 135 ? -18.266 -11.694 53.524  1.00 84.91  ? 135  ALA E CA    1 
ATOM   3848  C  C     . ALA E  1 135 ? -18.259 -12.026 55.034  1.00 85.24  ? 135  ALA E C     1 
ATOM   3849  O  O     . ALA E  1 135 ? -17.229 -12.411 55.601  1.00 85.67  ? 135  ALA E O     1 
ATOM   3850  C  CB    . ALA E  1 135 ? -17.682 -10.290 53.259  1.00 84.86  ? 135  ALA E CB    1 
ATOM   3851  O  OXT   . ALA E  1 135 ? -19.279 -11.932 55.735  1.00 85.19  ? 135  ALA E OXT   1 
ATOM   3852  N  N     . ASN F  2 25  ? -44.618 -4.658  49.095  1.00 71.81  ? 25   ASN F N     1 
ATOM   3853  C  CA    . ASN F  2 25  ? -44.649 -5.808  48.135  1.00 72.01  ? 25   ASN F CA    1 
ATOM   3854  C  C     . ASN F  2 25  ? -43.930 -7.039  48.694  1.00 72.11  ? 25   ASN F C     1 
ATOM   3855  O  O     . ASN F  2 25  ? -44.403 -8.178  48.548  1.00 72.12  ? 25   ASN F O     1 
ATOM   3856  C  CB    . ASN F  2 25  ? -44.035 -5.416  46.785  1.00 71.99  ? 25   ASN F CB    1 
ATOM   3857  C  CG    . ASN F  2 25  ? -45.078 -4.995  45.751  1.00 72.04  ? 25   ASN F CG    1 
ATOM   3858  O  OD1   . ASN F  2 25  ? -46.168 -5.563  45.668  1.00 71.32  ? 25   ASN F OD1   1 
ATOM   3859  N  ND2   . ASN F  2 25  ? -44.730 -4.005  44.941  1.00 72.35  ? 25   ASN F ND2   1 
ATOM   3860  N  N     . ILE F  2 26  ? -42.787 -6.780  49.330  1.00 71.89  ? 26   ILE F N     1 
ATOM   3861  C  CA    . ILE F  2 26  ? -41.972 -7.779  49.996  1.00 71.47  ? 26   ILE F CA    1 
ATOM   3862  C  C     . ILE F  2 26  ? -42.739 -8.441  51.152  1.00 71.41  ? 26   ILE F C     1 
ATOM   3863  O  O     . ILE F  2 26  ? -42.378 -9.530  51.590  1.00 71.66  ? 26   ILE F O     1 
ATOM   3864  C  CB    . ILE F  2 26  ? -40.611 -7.137  50.467  1.00 71.35  ? 26   ILE F CB    1 
ATOM   3865  C  CG1   . ILE F  2 26  ? -39.379 -8.007  50.137  1.00 71.35  ? 26   ILE F CG1   1 
ATOM   3866  C  CG2   . ILE F  2 26  ? -40.659 -6.631  51.918  1.00 71.46  ? 26   ILE F CG2   1 
ATOM   3867  C  CD1   . ILE F  2 26  ? -39.416 -9.469  50.523  1.00 70.90  ? 26   ILE F CD1   1 
ATOM   3868  N  N     . GLN F  2 27  ? -43.798 -7.799  51.642  1.00 71.30  ? 27   GLN F N     1 
ATOM   3869  C  CA    . GLN F  2 27  ? -44.675 -8.448  52.630  1.00 71.37  ? 27   GLN F CA    1 
ATOM   3870  C  C     . GLN F  2 27  ? -45.711 -9.362  51.955  1.00 71.06  ? 27   GLN F C     1 
ATOM   3871  O  O     . GLN F  2 27  ? -46.452 -10.072 52.629  1.00 71.10  ? 27   GLN F O     1 
ATOM   3872  C  CB    . GLN F  2 27  ? -45.368 -7.426  53.536  1.00 71.36  ? 27   GLN F CB    1 
ATOM   3873  C  CG    . GLN F  2 27  ? -44.431 -6.490  54.281  1.00 72.77  ? 27   GLN F CG    1 
ATOM   3874  C  CD    . GLN F  2 27  ? -43.583 -7.189  55.335  1.00 74.80  ? 27   GLN F CD    1 
ATOM   3875  O  OE1   . GLN F  2 27  ? -43.972 -8.222  55.882  1.00 76.23  ? 27   GLN F OE1   1 
ATOM   3876  N  NE2   . GLN F  2 27  ? -42.417 -6.616  55.631  1.00 75.18  ? 27   GLN F NE2   1 
ATOM   3877  N  N     . GLY F  2 28  ? -45.763 -9.334  50.626  1.00 70.79  ? 28   GLY F N     1 
ATOM   3878  C  CA    . GLY F  2 28  ? -46.542 -10.305 49.869  1.00 70.67  ? 28   GLY F CA    1 
ATOM   3879  C  C     . GLY F  2 28  ? -46.024 -11.711 50.132  1.00 70.70  ? 28   GLY F C     1 
ATOM   3880  O  O     . GLY F  2 28  ? -46.806 -12.662 50.203  1.00 71.11  ? 28   GLY F O     1 
ATOM   3881  N  N     . ILE F  2 29  ? -44.701 -11.839 50.265  1.00 70.18  ? 29   ILE F N     1 
ATOM   3882  C  CA    . ILE F  2 29  ? -44.071 -13.056 50.763  1.00 69.74  ? 29   ILE F CA    1 
ATOM   3883  C  C     . ILE F  2 29  ? -44.423 -13.205 52.249  1.00 69.42  ? 29   ILE F C     1 
ATOM   3884  O  O     . ILE F  2 29  ? -43.690 -12.780 53.143  1.00 69.50  ? 29   ILE F O     1 
ATOM   3885  C  CB    . ILE F  2 29  ? -42.539 -13.035 50.557  1.00 69.94  ? 29   ILE F CB    1 
ATOM   3886  C  CG1   . ILE F  2 29  ? -42.191 -12.543 49.146  1.00 70.08  ? 29   ILE F CG1   1 
ATOM   3887  C  CG2   . ILE F  2 29  ? -41.926 -14.421 50.845  1.00 69.99  ? 29   ILE F CG2   1 
ATOM   3888  C  CD1   . ILE F  2 29  ? -42.547 -13.520 48.021  1.00 70.44  ? 29   ILE F CD1   1 
ATOM   3889  N  N     . THR F  2 30  ? -45.566 -13.826 52.486  1.00 68.93  ? 30   THR F N     1 
ATOM   3890  C  CA    . THR F  2 30  ? -46.192 -13.862 53.787  1.00 68.64  ? 30   THR F CA    1 
ATOM   3891  C  C     . THR F  2 30  ? -45.559 -14.894 54.724  1.00 68.47  ? 30   THR F C     1 
ATOM   3892  O  O     . THR F  2 30  ? -44.990 -15.889 54.268  1.00 68.77  ? 30   THR F O     1 
ATOM   3893  C  CB    . THR F  2 30  ? -47.673 -14.197 53.605  1.00 68.83  ? 30   THR F CB    1 
ATOM   3894  O  OG1   . THR F  2 30  ? -47.786 -15.402 52.837  1.00 69.32  ? 30   THR F OG1   1 
ATOM   3895  C  CG2   . THR F  2 30  ? -48.391 -13.070 52.863  1.00 68.04  ? 30   THR F CG2   1 
ATOM   3896  N  N     . LYS F  2 31  ? -45.675 -14.646 56.029  1.00 67.84  ? 31   LYS F N     1 
ATOM   3897  C  CA    . LYS F  2 31  ? -45.270 -15.583 57.087  1.00 67.37  ? 31   LYS F CA    1 
ATOM   3898  C  C     . LYS F  2 31  ? -45.609 -17.075 56.824  1.00 67.12  ? 31   LYS F C     1 
ATOM   3899  O  O     . LYS F  2 31  ? -44.711 -17.919 56.875  1.00 67.06  ? 31   LYS F O     1 
ATOM   3900  C  CB    . LYS F  2 31  ? -45.848 -15.113 58.431  1.00 67.47  ? 31   LYS F CB    1 
ATOM   3901  C  CG    . LYS F  2 31  ? -45.759 -16.097 59.582  1.00 68.14  ? 31   LYS F CG    1 
ATOM   3902  C  CD    . LYS F  2 31  ? -46.137 -15.395 60.877  1.00 70.89  ? 31   LYS F CD    1 
ATOM   3903  C  CE    . LYS F  2 31  ? -46.498 -16.384 61.986  1.00 72.93  ? 31   LYS F CE    1 
ATOM   3904  N  NZ    . LYS F  2 31  ? -45.286 -16.915 62.672  1.00 74.83  ? 31   LYS F NZ    1 
ATOM   3905  N  N     . PRO F  2 32  ? -46.899 -17.411 56.566  1.00 66.70  ? 32   PRO F N     1 
ATOM   3906  C  CA    . PRO F  2 32  ? -47.220 -18.800 56.236  1.00 65.94  ? 32   PRO F CA    1 
ATOM   3907  C  C     . PRO F  2 32  ? -46.500 -19.345 55.004  1.00 65.41  ? 32   PRO F C     1 
ATOM   3908  O  O     . PRO F  2 32  ? -46.219 -20.556 54.960  1.00 65.54  ? 32   PRO F O     1 
ATOM   3909  C  CB    . PRO F  2 32  ? -48.730 -18.769 55.988  1.00 65.98  ? 32   PRO F CB    1 
ATOM   3910  C  CG    . PRO F  2 32  ? -49.050 -17.336 55.719  1.00 66.59  ? 32   PRO F CG    1 
ATOM   3911  C  CD    . PRO F  2 32  ? -48.118 -16.579 56.598  1.00 66.73  ? 32   PRO F CD    1 
ATOM   3912  N  N     . ALA F  2 33  ? -46.205 -18.484 54.023  1.00 64.44  ? 33   ALA F N     1 
ATOM   3913  C  CA    . ALA F  2 33  ? -45.482 -18.920 52.814  1.00 63.69  ? 33   ALA F CA    1 
ATOM   3914  C  C     . ALA F  2 33  ? -44.043 -19.305 53.147  1.00 63.33  ? 33   ALA F C     1 
ATOM   3915  O  O     . ALA F  2 33  ? -43.549 -20.334 52.701  1.00 63.53  ? 33   ALA F O     1 
ATOM   3916  C  CB    . ALA F  2 33  ? -45.513 -17.857 51.736  1.00 63.27  ? 33   ALA F CB    1 
ATOM   3917  N  N     . ILE F  2 34  ? -43.388 -18.474 53.952  1.00 62.86  ? 34   ILE F N     1 
ATOM   3918  C  CA    . ILE F  2 34  ? -42.019 -18.699 54.393  1.00 62.12  ? 34   ILE F CA    1 
ATOM   3919  C  C     . ILE F  2 34  ? -41.930 -19.970 55.216  1.00 62.40  ? 34   ILE F C     1 
ATOM   3920  O  O     . ILE F  2 34  ? -40.934 -20.684 55.165  1.00 62.71  ? 34   ILE F O     1 
ATOM   3921  C  CB    . ILE F  2 34  ? -41.516 -17.495 55.198  1.00 61.65  ? 34   ILE F CB    1 
ATOM   3922  C  CG1   . ILE F  2 34  ? -41.248 -16.325 54.250  1.00 60.76  ? 34   ILE F CG1   1 
ATOM   3923  C  CG2   . ILE F  2 34  ? -40.270 -17.847 55.980  1.00 61.57  ? 34   ILE F CG2   1 
ATOM   3924  C  CD1   . ILE F  2 34  ? -41.426 -14.966 54.866  1.00 59.67  ? 34   ILE F CD1   1 
ATOM   3925  N  N     . ARG F  2 35  ? -42.984 -20.252 55.967  1.00 62.77  ? 35   ARG F N     1 
ATOM   3926  C  CA    . ARG F  2 35  ? -43.082 -21.470 56.758  1.00 63.21  ? 35   ARG F CA    1 
ATOM   3927  C  C     . ARG F  2 35  ? -43.127 -22.697 55.849  1.00 62.58  ? 35   ARG F C     1 
ATOM   3928  O  O     . ARG F  2 35  ? -42.441 -23.680 56.106  1.00 62.75  ? 35   ARG F O     1 
ATOM   3929  C  CB    . ARG F  2 35  ? -44.329 -21.410 57.625  1.00 63.88  ? 35   ARG F CB    1 
ATOM   3930  C  CG    . ARG F  2 35  ? -44.221 -22.087 58.974  1.00 67.83  ? 35   ARG F CG    1 
ATOM   3931  C  CD    . ARG F  2 35  ? -45.620 -22.317 59.570  1.00 74.78  ? 35   ARG F CD    1 
ATOM   3932  N  NE    . ARG F  2 35  ? -46.344 -23.357 58.820  1.00 79.71  ? 35   ARG F NE    1 
ATOM   3933  C  CZ    . ARG F  2 35  ? -47.297 -23.137 57.906  1.00 81.34  ? 35   ARG F CZ    1 
ATOM   3934  N  NH1   . ARG F  2 35  ? -47.701 -21.900 57.609  1.00 80.71  ? 35   ARG F NH1   1 
ATOM   3935  N  NH2   . ARG F  2 35  ? -47.858 -24.174 57.290  1.00 82.38  ? 35   ARG F NH2   1 
ATOM   3936  N  N     . ARG F  2 36  ? -43.909 -22.631 54.773  1.00 61.84  ? 36   ARG F N     1 
ATOM   3937  C  CA    . ARG F  2 36  ? -43.999 -23.750 53.828  1.00 61.14  ? 36   ARG F CA    1 
ATOM   3938  C  C     . ARG F  2 36  ? -42.638 -24.010 53.202  1.00 60.40  ? 36   ARG F C     1 
ATOM   3939  O  O     . ARG F  2 36  ? -42.158 -25.150 53.188  1.00 60.62  ? 36   ARG F O     1 
ATOM   3940  C  CB    . ARG F  2 36  ? -45.077 -23.509 52.762  1.00 61.03  ? 36   ARG F CB    1 
ATOM   3941  C  CG    . ARG F  2 36  ? -46.505 -23.424 53.340  1.00 61.55  ? 36   ARG F CG    1 
ATOM   3942  C  CD    . ARG F  2 36  ? -47.606 -23.501 52.278  1.00 62.40  ? 36   ARG F CD    1 
ATOM   3943  N  NE    . ARG F  2 36  ? -47.717 -22.298 51.444  1.00 65.25  ? 36   ARG F NE    1 
ATOM   3944  C  CZ    . ARG F  2 36  ? -48.376 -21.194 51.797  1.00 66.79  ? 36   ARG F CZ    1 
ATOM   3945  N  NH1   . ARG F  2 36  ? -48.989 -21.113 52.978  1.00 66.18  ? 36   ARG F NH1   1 
ATOM   3946  N  NH2   . ARG F  2 36  ? -48.422 -20.159 50.966  1.00 67.90  ? 36   ARG F NH2   1 
ATOM   3947  N  N     . LEU F  2 37  ? -42.003 -22.945 52.711  1.00 59.35  ? 37   LEU F N     1 
ATOM   3948  C  CA    . LEU F  2 37  ? -40.617 -23.019 52.240  1.00 57.96  ? 37   LEU F CA    1 
ATOM   3949  C  C     . LEU F  2 37  ? -39.705 -23.668 53.279  1.00 57.17  ? 37   LEU F C     1 
ATOM   3950  O  O     . LEU F  2 37  ? -38.985 -24.617 52.967  1.00 57.30  ? 37   LEU F O     1 
ATOM   3951  C  CB    . LEU F  2 37  ? -40.083 -21.646 51.817  1.00 57.65  ? 37   LEU F CB    1 
ATOM   3952  C  CG    . LEU F  2 37  ? -40.741 -21.087 50.550  1.00 56.74  ? 37   LEU F CG    1 
ATOM   3953  C  CD1   . LEU F  2 37  ? -40.544 -19.592 50.454  1.00 55.05  ? 37   LEU F CD1   1 
ATOM   3954  C  CD2   . LEU F  2 37  ? -40.266 -21.795 49.279  1.00 56.41  ? 37   LEU F CD2   1 
ATOM   3955  N  N     . ALA F  2 38  ? -39.752 -23.189 54.516  1.00 56.05  ? 38   ALA F N     1 
ATOM   3956  C  CA    . ALA F  2 38  ? -38.888 -23.755 55.553  1.00 55.17  ? 38   ALA F CA    1 
ATOM   3957  C  C     . ALA F  2 38  ? -39.173 -25.242 55.809  1.00 54.73  ? 38   ALA F C     1 
ATOM   3958  O  O     . ALA F  2 38  ? -38.269 -25.988 56.202  1.00 54.66  ? 38   ALA F O     1 
ATOM   3959  C  CB    . ALA F  2 38  ? -38.977 -22.949 56.839  1.00 54.77  ? 38   ALA F CB    1 
ATOM   3960  N  N     . ARG F  2 39  ? -40.417 -25.666 55.569  1.00 54.02  ? 39   ARG F N     1 
ATOM   3961  C  CA    . ARG F  2 39  ? -40.836 -27.044 55.842  1.00 53.23  ? 39   ARG F CA    1 
ATOM   3962  C  C     . ARG F  2 39  ? -40.324 -27.978 54.754  1.00 52.82  ? 39   ARG F C     1 
ATOM   3963  O  O     . ARG F  2 39  ? -39.832 -29.074 55.055  1.00 52.77  ? 39   ARG F O     1 
ATOM   3964  C  CB    . ARG F  2 39  ? -42.370 -27.167 55.976  1.00 53.24  ? 39   ARG F CB    1 
ATOM   3965  C  CG    . ARG F  2 39  ? -42.994 -26.447 57.171  1.00 52.71  ? 39   ARG F CG    1 
ATOM   3966  C  CD    . ARG F  2 39  ? -42.840 -27.173 58.487  1.00 51.76  ? 39   ARG F CD    1 
ATOM   3967  N  NE    . ARG F  2 39  ? -43.563 -26.496 59.570  1.00 51.44  ? 39   ARG F NE    1 
ATOM   3968  C  CZ    . ARG F  2 39  ? -42.991 -25.913 60.624  1.00 51.77  ? 39   ARG F CZ    1 
ATOM   3969  N  NH1   . ARG F  2 39  ? -41.676 -25.913 60.767  1.00 52.12  ? 39   ARG F NH1   1 
ATOM   3970  N  NH2   . ARG F  2 39  ? -43.732 -25.326 61.552  1.00 52.35  ? 39   ARG F NH2   1 
ATOM   3971  N  N     . ARG F  2 40  ? -40.433 -27.552 53.494  1.00 51.98  ? 40   ARG F N     1 
ATOM   3972  C  CA    . ARG F  2 40  ? -39.842 -28.321 52.414  1.00 51.34  ? 40   ARG F CA    1 
ATOM   3973  C  C     . ARG F  2 40  ? -38.374 -28.455 52.744  1.00 51.52  ? 40   ARG F C     1 
ATOM   3974  O  O     . ARG F  2 40  ? -37.783 -29.516 52.545  1.00 52.48  ? 40   ARG F O     1 
ATOM   3975  C  CB    . ARG F  2 40  ? -40.037 -27.645 51.066  1.00 51.02  ? 40   ARG F CB    1 
ATOM   3976  C  CG    . ARG F  2 40  ? -39.448 -28.414 49.899  1.00 49.71  ? 40   ARG F CG    1 
ATOM   3977  C  CD    . ARG F  2 40  ? -40.045 -27.966 48.571  1.00 48.31  ? 40   ARG F CD    1 
ATOM   3978  N  NE    . ARG F  2 40  ? -41.449 -28.331 48.504  1.00 50.38  ? 40   ARG F NE    1 
ATOM   3979  C  CZ    . ARG F  2 40  ? -42.323 -27.875 47.610  1.00 53.47  ? 40   ARG F CZ    1 
ATOM   3980  N  NH1   . ARG F  2 40  ? -41.964 -27.000 46.674  1.00 52.94  ? 40   ARG F NH1   1 
ATOM   3981  N  NH2   . ARG F  2 40  ? -43.585 -28.297 47.659  1.00 54.52  ? 40   ARG F NH2   1 
ATOM   3982  N  N     . GLY F  2 41  ? -37.808 -27.388 53.301  1.00 51.05  ? 41   GLY F N     1 
ATOM   3983  C  CA    . GLY F  2 41  ? -36.434 -27.369 53.771  1.00 50.65  ? 41   GLY F CA    1 
ATOM   3984  C  C     . GLY F  2 41  ? -36.134 -28.255 54.954  1.00 50.82  ? 41   GLY F C     1 
ATOM   3985  O  O     . GLY F  2 41  ? -34.977 -28.443 55.293  1.00 51.67  ? 41   GLY F O     1 
ATOM   3986  N  N     . GLY F  2 42  ? -37.160 -28.816 55.587  1.00 51.10  ? 42   GLY F N     1 
ATOM   3987  C  CA    . GLY F  2 42  ? -36.968 -29.712 56.734  1.00 51.02  ? 42   GLY F CA    1 
ATOM   3988  C  C     . GLY F  2 42  ? -36.882 -29.057 58.102  1.00 51.42  ? 42   GLY F C     1 
ATOM   3989  O  O     . GLY F  2 42  ? -36.263 -29.604 59.004  1.00 51.28  ? 42   GLY F O     1 
ATOM   3990  N  N     . VAL F  2 43  ? -37.529 -27.902 58.262  1.00 52.06  ? 43   VAL F N     1 
ATOM   3991  C  CA    . VAL F  2 43  ? -37.442 -27.127 59.497  1.00 52.57  ? 43   VAL F CA    1 
ATOM   3992  C  C     . VAL F  2 43  ? -38.659 -27.321 60.381  1.00 53.66  ? 43   VAL F C     1 
ATOM   3993  O  O     . VAL F  2 43  ? -39.778 -27.119 59.943  1.00 53.98  ? 43   VAL F O     1 
ATOM   3994  C  CB    . VAL F  2 43  ? -37.262 -25.608 59.240  1.00 51.97  ? 43   VAL F CB    1 
ATOM   3995  C  CG1   . VAL F  2 43  ? -37.069 -24.879 60.565  1.00 50.79  ? 43   VAL F CG1   1 
ATOM   3996  C  CG2   . VAL F  2 43  ? -36.091 -25.356 58.344  1.00 51.07  ? 43   VAL F CG2   1 
ATOM   3997  N  N     . LYS F  2 44  ? -38.416 -27.670 61.638  1.00 55.10  ? 44   LYS F N     1 
ATOM   3998  C  CA    . LYS F  2 44  ? -39.473 -27.984 62.594  1.00 56.60  ? 44   LYS F CA    1 
ATOM   3999  C  C     . LYS F  2 44  ? -39.931 -26.730 63.338  1.00 57.57  ? 44   LYS F C     1 
ATOM   4000  O  O     . LYS F  2 44  ? -41.109 -26.390 63.322  1.00 58.27  ? 44   LYS F O     1 
ATOM   4001  C  CB    . LYS F  2 44  ? -38.953 -29.020 63.583  1.00 56.52  ? 44   LYS F CB    1 
ATOM   4002  C  CG    . LYS F  2 44  ? -39.999 -29.684 64.408  1.00 58.22  ? 44   LYS F CG    1 
ATOM   4003  C  CD    . LYS F  2 44  ? -39.346 -30.638 65.393  1.00 60.05  ? 44   LYS F CD    1 
ATOM   4004  C  CE    . LYS F  2 44  ? -40.392 -31.476 66.107  1.00 59.87  ? 44   LYS F CE    1 
ATOM   4005  N  NZ    . LYS F  2 44  ? -39.710 -32.510 66.919  1.00 61.06  ? 44   LYS F NZ    1 
ATOM   4006  N  N     . ARG F  2 45  ? -38.994 -26.030 63.975  1.00 58.66  ? 45   ARG F N     1 
ATOM   4007  C  CA    . ARG F  2 45  ? -39.316 -24.837 64.764  1.00 59.09  ? 45   ARG F CA    1 
ATOM   4008  C  C     . ARG F  2 45  ? -38.649 -23.564 64.207  1.00 58.78  ? 45   ARG F C     1 
ATOM   4009  O  O     . ARG F  2 45  ? -37.444 -23.555 63.958  1.00 58.72  ? 45   ARG F O     1 
ATOM   4010  C  CB    . ARG F  2 45  ? -38.892 -25.074 66.208  1.00 59.43  ? 45   ARG F CB    1 
ATOM   4011  C  CG    . ARG F  2 45  ? -39.930 -24.701 67.212  1.00 60.79  ? 45   ARG F CG    1 
ATOM   4012  C  CD    . ARG F  2 45  ? -39.460 -25.116 68.567  1.00 65.13  ? 45   ARG F CD    1 
ATOM   4013  N  NE    . ARG F  2 45  ? -40.192 -24.437 69.630  1.00 69.04  ? 45   ARG F NE    1 
ATOM   4014  C  CZ    . ARG F  2 45  ? -39.859 -23.255 70.149  1.00 70.41  ? 45   ARG F CZ    1 
ATOM   4015  N  NH1   . ARG F  2 45  ? -38.798 -22.580 69.708  1.00 69.40  ? 45   ARG F NH1   1 
ATOM   4016  N  NH2   . ARG F  2 45  ? -40.605 -22.746 71.121  1.00 72.07  ? 45   ARG F NH2   1 
ATOM   4017  N  N     . ILE F  2 46  ? -39.436 -22.505 64.032  1.00 58.22  ? 46   ILE F N     1 
ATOM   4018  C  CA    . ILE F  2 46  ? -38.972 -21.272 63.415  1.00 58.37  ? 46   ILE F CA    1 
ATOM   4019  C  C     . ILE F  2 46  ? -39.105 -20.074 64.355  1.00 58.83  ? 46   ILE F C     1 
ATOM   4020  O  O     . ILE F  2 46  ? -40.205 -19.704 64.756  1.00 59.43  ? 46   ILE F O     1 
ATOM   4021  C  CB    . ILE F  2 46  ? -39.787 -20.946 62.151  1.00 58.30  ? 46   ILE F CB    1 
ATOM   4022  C  CG1   . ILE F  2 46  ? -39.564 -21.997 61.062  1.00 58.28  ? 46   ILE F CG1   1 
ATOM   4023  C  CG2   . ILE F  2 46  ? -39.435 -19.561 61.619  1.00 57.92  ? 46   ILE F CG2   1 
ATOM   4024  C  CD1   . ILE F  2 46  ? -40.624 -21.952 59.980  1.00 56.53  ? 46   ILE F CD1   1 
ATOM   4025  N  N     . SER F  2 47  ? -37.987 -19.443 64.677  1.00 59.03  ? 47   SER F N     1 
ATOM   4026  C  CA    . SER F  2 47  ? -38.002 -18.241 65.493  1.00 59.07  ? 47   SER F CA    1 
ATOM   4027  C  C     . SER F  2 47  ? -38.674 -17.092 64.742  1.00 58.88  ? 47   SER F C     1 
ATOM   4028  O  O     . SER F  2 47  ? -38.593 -17.020 63.525  1.00 58.64  ? 47   SER F O     1 
ATOM   4029  C  CB    . SER F  2 47  ? -36.585 -17.869 65.913  1.00 58.92  ? 47   SER F CB    1 
ATOM   4030  O  OG    . SER F  2 47  ? -36.445 -16.464 65.974  1.00 60.61  ? 47   SER F OG    1 
ATOM   4031  N  N     . GLY F  2 48  ? -39.331 -16.199 65.485  1.00 58.94  ? 48   GLY F N     1 
ATOM   4032  C  CA    . GLY F  2 48  ? -40.177 -15.153 64.899  1.00 58.65  ? 48   GLY F CA    1 
ATOM   4033  C  C     . GLY F  2 48  ? -39.437 -14.111 64.089  1.00 58.57  ? 48   GLY F C     1 
ATOM   4034  O  O     . GLY F  2 48  ? -40.012 -13.471 63.214  1.00 58.08  ? 48   GLY F O     1 
ATOM   4035  N  N     . LEU F  2 49  ? -38.151 -13.948 64.380  1.00 58.91  ? 49   LEU F N     1 
ATOM   4036  C  CA    . LEU F  2 49  ? -37.312 -13.021 63.644  1.00 59.04  ? 49   LEU F CA    1 
ATOM   4037  C  C     . LEU F  2 49  ? -36.889 -13.550 62.265  1.00 59.36  ? 49   LEU F C     1 
ATOM   4038  O  O     . LEU F  2 49  ? -36.410 -12.783 61.421  1.00 60.07  ? 49   LEU F O     1 
ATOM   4039  C  CB    . LEU F  2 49  ? -36.094 -12.664 64.478  1.00 59.04  ? 49   LEU F CB    1 
ATOM   4040  C  CG    . LEU F  2 49  ? -36.332 -11.712 65.654  1.00 59.71  ? 49   LEU F CG    1 
ATOM   4041  C  CD1   . LEU F  2 49  ? -35.165 -11.797 66.628  1.00 59.75  ? 49   LEU F CD1   1 
ATOM   4042  C  CD2   . LEU F  2 49  ? -36.531 -10.264 65.174  1.00 59.95  ? 49   LEU F CD2   1 
ATOM   4043  N  N     . ILE F  2 50  ? -37.082 -14.847 62.026  1.00 59.13  ? 50   ILE F N     1 
ATOM   4044  C  CA    . ILE F  2 50  ? -36.707 -15.468 60.755  1.00 58.89  ? 50   ILE F CA    1 
ATOM   4045  C  C     . ILE F  2 50  ? -37.451 -14.875 59.547  1.00 59.53  ? 50   ILE F C     1 
ATOM   4046  O  O     . ILE F  2 50  ? -36.879 -14.779 58.463  1.00 59.79  ? 50   ILE F O     1 
ATOM   4047  C  CB    . ILE F  2 50  ? -36.858 -17.025 60.827  1.00 58.56  ? 50   ILE F CB    1 
ATOM   4048  C  CG1   . ILE F  2 50  ? -35.641 -17.669 61.512  1.00 58.24  ? 50   ILE F CG1   1 
ATOM   4049  C  CG2   . ILE F  2 50  ? -37.140 -17.657 59.464  1.00 58.12  ? 50   ILE F CG2   1 
ATOM   4050  C  CD1   . ILE F  2 50  ? -34.335 -17.619 60.733  1.00 57.73  ? 50   ILE F CD1   1 
ATOM   4051  N  N     . TYR F  2 51  ? -38.710 -14.470 59.733  1.00 60.28  ? 51   TYR F N     1 
ATOM   4052  C  CA    . TYR F  2 51  ? -39.561 -14.024 58.612  1.00 60.79  ? 51   TYR F CA    1 
ATOM   4053  C  C     . TYR F  2 51  ? -39.116 -12.711 57.989  1.00 61.51  ? 51   TYR F C     1 
ATOM   4054  O  O     . TYR F  2 51  ? -39.304 -12.508 56.791  1.00 62.38  ? 51   TYR F O     1 
ATOM   4055  C  CB    . TYR F  2 51  ? -41.041 -13.955 59.006  1.00 60.65  ? 51   TYR F CB    1 
ATOM   4056  C  CG    . TYR F  2 51  ? -41.548 -15.225 59.636  1.00 60.03  ? 51   TYR F CG    1 
ATOM   4057  C  CD1   . TYR F  2 51  ? -41.711 -15.311 61.011  1.00 60.66  ? 51   TYR F CD1   1 
ATOM   4058  C  CD2   . TYR F  2 51  ? -41.831 -16.349 58.864  1.00 58.97  ? 51   TYR F CD2   1 
ATOM   4059  C  CE1   . TYR F  2 51  ? -42.152 -16.483 61.617  1.00 61.22  ? 51   TYR F CE1   1 
ATOM   4060  C  CE2   . TYR F  2 51  ? -42.273 -17.527 59.450  1.00 59.62  ? 51   TYR F CE2   1 
ATOM   4061  C  CZ    . TYR F  2 51  ? -42.436 -17.584 60.832  1.00 61.05  ? 51   TYR F CZ    1 
ATOM   4062  O  OH    . TYR F  2 51  ? -42.877 -18.734 61.448  1.00 61.67  ? 51   TYR F OH    1 
ATOM   4063  N  N     . GLU F  2 52  ? -38.534 -11.818 58.784  1.00 61.73  ? 52   GLU F N     1 
ATOM   4064  C  CA    . GLU F  2 52  ? -37.963 -10.599 58.221  1.00 61.99  ? 52   GLU F CA    1 
ATOM   4065  C  C     . GLU F  2 52  ? -36.679 -10.898 57.460  1.00 61.19  ? 52   GLU F C     1 
ATOM   4066  O  O     . GLU F  2 52  ? -36.534 -10.470 56.318  1.00 61.12  ? 52   GLU F O     1 
ATOM   4067  C  CB    . GLU F  2 52  ? -37.733 -9.524  59.294  1.00 62.81  ? 52   GLU F CB    1 
ATOM   4068  C  CG    . GLU F  2 52  ? -38.920 -8.583  59.485  1.00 65.93  ? 52   GLU F CG    1 
ATOM   4069  C  CD    . GLU F  2 52  ? -39.318 -7.881  58.183  1.00 71.19  ? 52   GLU F CD    1 
ATOM   4070  O  OE1   . GLU F  2 52  ? -38.424 -7.246  57.566  1.00 73.67  ? 52   GLU F OE1   1 
ATOM   4071  O  OE2   . GLU F  2 52  ? -40.510 -7.973  57.772  1.00 72.13  ? 52   GLU F OE2   1 
ATOM   4072  N  N     . GLU F  2 53  ? -35.764 -11.638 58.094  1.00 60.37  ? 53   GLU F N     1 
ATOM   4073  C  CA    . GLU F  2 53  ? -34.483 -12.035 57.494  1.00 59.58  ? 53   GLU F CA    1 
ATOM   4074  C  C     . GLU F  2 53  ? -34.626 -12.667 56.114  1.00 58.96  ? 53   GLU F C     1 
ATOM   4075  O  O     . GLU F  2 53  ? -33.872 -12.349 55.184  1.00 59.40  ? 53   GLU F O     1 
ATOM   4076  C  CB    . GLU F  2 53  ? -33.799 -13.043 58.380  1.00 59.47  ? 53   GLU F CB    1 
ATOM   4077  C  CG    . GLU F  2 53  ? -33.179 -12.448 59.567  1.00 62.67  ? 53   GLU F CG    1 
ATOM   4078  C  CD    . GLU F  2 53  ? -31.791 -11.958 59.279  1.00 67.27  ? 53   GLU F CD    1 
ATOM   4079  O  OE1   . GLU F  2 53  ? -31.320 -11.041 60.008  1.00 68.81  ? 53   GLU F OE1   1 
ATOM   4080  O  OE2   . GLU F  2 53  ? -31.179 -12.490 58.316  1.00 68.43  ? 53   GLU F OE2   1 
ATOM   4081  N  N     . THR F  2 54  ? -35.579 -13.579 55.987  1.00 57.40  ? 54   THR F N     1 
ATOM   4082  C  CA    . THR F  2 54  ? -35.775 -14.262 54.743  1.00 56.31  ? 54   THR F CA    1 
ATOM   4083  C  C     . THR F  2 54  ? -36.231 -13.264 53.717  1.00 55.65  ? 54   THR F C     1 
ATOM   4084  O  O     . THR F  2 54  ? -35.845 -13.337 52.562  1.00 56.10  ? 54   THR F O     1 
ATOM   4085  C  CB    . THR F  2 54  ? -36.787 -15.367 54.902  1.00 56.40  ? 54   THR F CB    1 
ATOM   4086  O  OG1   . THR F  2 54  ? -36.333 -16.239 55.944  1.00 57.07  ? 54   THR F OG1   1 
ATOM   4087  C  CG2   . THR F  2 54  ? -36.934 -16.154 53.621  1.00 56.01  ? 54   THR F CG2   1 
ATOM   4088  N  N     . ARG F  2 55  ? -37.030 -12.300 54.133  1.00 54.93  ? 55   ARG F N     1 
ATOM   4089  C  CA    . ARG F  2 55  ? -37.479 -11.294 53.198  1.00 54.04  ? 55   ARG F CA    1 
ATOM   4090  C  C     . ARG F  2 55  ? -36.291 -10.473 52.702  1.00 53.08  ? 55   ARG F C     1 
ATOM   4091  O  O     . ARG F  2 55  ? -36.218 -10.122 51.531  1.00 52.68  ? 55   ARG F O     1 
ATOM   4092  C  CB    . ARG F  2 55  ? -38.563 -10.427 53.828  1.00 54.52  ? 55   ARG F CB    1 
ATOM   4093  C  CG    . ARG F  2 55  ? -39.894 -11.145 53.992  1.00 55.37  ? 55   ARG F CG    1 
ATOM   4094  C  CD    . ARG F  2 55  ? -41.057 -10.163 54.196  1.00 57.75  ? 55   ARG F CD    1 
ATOM   4095  N  NE    . ARG F  2 55  ? -42.273 -10.877 54.585  1.00 57.68  ? 55   ARG F NE    1 
ATOM   4096  C  CZ    . ARG F  2 55  ? -42.585 -11.182 55.842  1.00 57.77  ? 55   ARG F CZ    1 
ATOM   4097  N  NH1   . ARG F  2 55  ? -41.787 -10.802 56.837  1.00 57.14  ? 55   ARG F NH1   1 
ATOM   4098  N  NH2   . ARG F  2 55  ? -43.700 -11.857 56.103  1.00 57.07  ? 55   ARG F NH2   1 
ATOM   4099  N  N     . GLY F  2 56  ? -35.343 -10.200 53.586  1.00 52.24  ? 56   GLY F N     1 
ATOM   4100  C  CA    . GLY F  2 56  ? -34.146 -9.453  53.204  1.00 51.80  ? 56   GLY F CA    1 
ATOM   4101  C  C     . GLY F  2 56  ? -33.328 -10.196 52.177  1.00 51.34  ? 56   GLY F C     1 
ATOM   4102  O  O     . GLY F  2 56  ? -32.935 -9.640  51.156  1.00 51.32  ? 56   GLY F O     1 
ATOM   4103  N  N     . VAL F  2 57  ? -33.106 -11.473 52.474  1.00 51.26  ? 57   VAL F N     1 
ATOM   4104  C  CA    . VAL F  2 57  ? -32.340 -12.421 51.676  1.00 50.37  ? 57   VAL F CA    1 
ATOM   4105  C  C     . VAL F  2 57  ? -32.941 -12.658 50.290  1.00 50.53  ? 57   VAL F C     1 
ATOM   4106  O  O     . VAL F  2 57  ? -32.205 -12.723 49.297  1.00 50.68  ? 57   VAL F O     1 
ATOM   4107  C  CB    . VAL F  2 57  ? -32.193 -13.745 52.457  1.00 49.83  ? 57   VAL F CB    1 
ATOM   4108  C  CG1   . VAL F  2 57  ? -31.889 -14.893 51.541  1.00 50.99  ? 57   VAL F CG1   1 
ATOM   4109  C  CG2   . VAL F  2 57  ? -31.110 -13.626 53.506  1.00 49.23  ? 57   VAL F CG2   1 
ATOM   4110  N  N     . LEU F  2 58  ? -34.263 -12.789 50.214  1.00 50.78  ? 58   LEU F N     1 
ATOM   4111  C  CA    . LEU F  2 58  ? -34.940 -12.982 48.932  1.00 51.45  ? 58   LEU F CA    1 
ATOM   4112  C  C     . LEU F  2 58  ? -34.807 -11.747 48.055  1.00 51.96  ? 58   LEU F C     1 
ATOM   4113  O  O     . LEU F  2 58  ? -34.554 -11.848 46.855  1.00 52.52  ? 58   LEU F O     1 
ATOM   4114  C  CB    . LEU F  2 58  ? -36.410 -13.335 49.138  1.00 51.29  ? 58   LEU F CB    1 
ATOM   4115  C  CG    . LEU F  2 58  ? -37.262 -13.550 47.879  1.00 52.40  ? 58   LEU F CG    1 
ATOM   4116  C  CD1   . LEU F  2 58  ? -36.686 -14.637 46.968  1.00 54.43  ? 58   LEU F CD1   1 
ATOM   4117  C  CD2   . LEU F  2 58  ? -38.693 -13.887 48.248  1.00 52.15  ? 58   LEU F CD2   1 
ATOM   4118  N  N     . LYS F  2 59  ? -34.964 -10.574 48.661  1.00 52.54  ? 59   LYS F N     1 
ATOM   4119  C  CA    . LYS F  2 59  ? -34.756 -9.311  47.962  1.00 53.13  ? 59   LYS F CA    1 
ATOM   4120  C  C     . LYS F  2 59  ? -33.346 -9.223  47.360  1.00 51.95  ? 59   LYS F C     1 
ATOM   4121  O  O     . LYS F  2 59  ? -33.207 -8.953  46.166  1.00 52.11  ? 59   LYS F O     1 
ATOM   4122  C  CB    . LYS F  2 59  ? -35.036 -8.124  48.893  1.00 53.81  ? 59   LYS F CB    1 
ATOM   4123  C  CG    . LYS F  2 59  ? -35.563 -6.866  48.194  1.00 54.81  ? 59   LYS F CG    1 
ATOM   4124  C  CD    . LYS F  2 59  ? -35.437 -5.637  49.120  1.00 55.66  ? 59   LYS F CD    1 
ATOM   4125  C  CE    . LYS F  2 59  ? -35.914 -4.331  48.447  1.00 58.08  ? 59   LYS F CE    1 
ATOM   4126  N  NZ    . LYS F  2 59  ? -37.367 -4.401  48.004  1.00 60.45  ? 59   LYS F NZ    1 
ATOM   4127  N  N     . VAL F  2 60  ? -32.311 -9.468  48.165  1.00 50.39  ? 60   VAL F N     1 
ATOM   4128  C  CA    . VAL F  2 60  ? -30.941 -9.445  47.641  1.00 49.37  ? 60   VAL F CA    1 
ATOM   4129  C  C     . VAL F  2 60  ? -30.781 -10.405 46.458  1.00 49.36  ? 60   VAL F C     1 
ATOM   4130  O  O     . VAL F  2 60  ? -30.188 -10.038 45.434  1.00 49.85  ? 60   VAL F O     1 
ATOM   4131  C  CB    . VAL F  2 60  ? -29.889 -9.810  48.692  1.00 49.11  ? 60   VAL F CB    1 
ATOM   4132  C  CG1   . VAL F  2 60  ? -28.531 -9.860  48.049  1.00 49.08  ? 60   VAL F CG1   1 
ATOM   4133  C  CG2   . VAL F  2 60  ? -29.875 -8.812  49.824  1.00 48.42  ? 60   VAL F CG2   1 
ATOM   4134  N  N     . PHE F  2 61  ? -31.302 -11.630 46.614  1.00 48.61  ? 61   PHE F N     1 
ATOM   4135  C  CA    . PHE F  2 61  ? -31.283 -12.647 45.575  1.00 47.22  ? 61   PHE F CA    1 
ATOM   4136  C  C     . PHE F  2 61  ? -31.947 -12.162 44.293  1.00 47.05  ? 61   PHE F C     1 
ATOM   4137  O  O     . PHE F  2 61  ? -31.309 -12.127 43.235  1.00 46.54  ? 61   PHE F O     1 
ATOM   4138  C  CB    . PHE F  2 61  ? -31.968 -13.936 46.055  1.00 47.15  ? 61   PHE F CB    1 
ATOM   4139  C  CG    . PHE F  2 61  ? -31.992 -15.016 45.015  1.00 46.33  ? 61   PHE F CG    1 
ATOM   4140  C  CD1   . PHE F  2 61  ? -30.909 -15.876 44.865  1.00 46.91  ? 61   PHE F CD1   1 
ATOM   4141  C  CD2   . PHE F  2 61  ? -33.073 -15.148 44.159  1.00 45.80  ? 61   PHE F CD2   1 
ATOM   4142  C  CE1   . PHE F  2 61  ? -30.904 -16.861 43.877  1.00 46.82  ? 61   PHE F CE1   1 
ATOM   4143  C  CE2   . PHE F  2 61  ? -33.083 -16.117 43.169  1.00 46.44  ? 61   PHE F CE2   1 
ATOM   4144  C  CZ    . PHE F  2 61  ? -31.986 -16.983 43.029  1.00 46.98  ? 61   PHE F CZ    1 
ATOM   4145  N  N     . LEU F  2 62  ? -33.226 -11.797 44.396  1.00 47.00  ? 62   LEU F N     1 
ATOM   4146  C  CA    . LEU F  2 62  ? -34.026 -11.321 43.251  1.00 47.27  ? 62   LEU F CA    1 
ATOM   4147  C  C     . LEU F  2 62  ? -33.429 -10.107 42.543  1.00 47.95  ? 62   LEU F C     1 
ATOM   4148  O  O     . LEU F  2 62  ? -33.401 -10.049 41.317  1.00 47.64  ? 62   LEU F O     1 
ATOM   4149  C  CB    . LEU F  2 62  ? -35.439 -10.991 43.702  1.00 47.23  ? 62   LEU F CB    1 
ATOM   4150  C  CG    . LEU F  2 62  ? -36.441 -12.140 43.686  1.00 46.04  ? 62   LEU F CG    1 
ATOM   4151  C  CD1   . LEU F  2 62  ? -37.669 -11.746 44.456  1.00 44.05  ? 62   LEU F CD1   1 
ATOM   4152  C  CD2   . LEU F  2 62  ? -36.791 -12.499 42.242  1.00 43.87  ? 62   LEU F CD2   1 
ATOM   4153  N  N     . GLU F  2 63  ? -32.938 -9.152  43.328  1.00 48.76  ? 63   GLU F N     1 
ATOM   4154  C  CA    . GLU F  2 63  ? -32.186 -8.031  42.806  1.00 50.24  ? 63   GLU F CA    1 
ATOM   4155  C  C     . GLU F  2 63  ? -31.032 -8.475  41.914  1.00 49.63  ? 63   GLU F C     1 
ATOM   4156  O  O     . GLU F  2 63  ? -30.969 -8.065  40.758  1.00 49.80  ? 63   GLU F O     1 
ATOM   4157  C  CB    . GLU F  2 63  ? -31.673 -7.160  43.944  1.00 50.37  ? 63   GLU F CB    1 
ATOM   4158  C  CG    . GLU F  2 63  ? -32.714 -6.187  44.478  1.00 52.66  ? 63   GLU F CG    1 
ATOM   4159  C  CD    . GLU F  2 63  ? -32.346 -5.571  45.835  1.00 53.99  ? 63   GLU F CD    1 
ATOM   4160  O  OE1   . GLU F  2 63  ? -31.198 -5.762  46.317  1.00 57.78  ? 63   GLU F OE1   1 
ATOM   4161  O  OE2   . GLU F  2 63  ? -33.224 -4.882  46.424  1.00 60.60  ? 63   GLU F OE2   1 
ATOM   4162  N  N     . ASN F  2 64  ? -30.136 -9.318  42.428  1.00 49.45  ? 64   ASN F N     1 
ATOM   4163  C  CA    . ASN F  2 64  ? -28.969 -9.751  41.638  1.00 49.35  ? 64   ASN F CA    1 
ATOM   4164  C  C     . ASN F  2 64  ? -29.305 -10.398 40.298  1.00 48.72  ? 64   ASN F C     1 
ATOM   4165  O  O     . ASN F  2 64  ? -28.669 -10.085 39.276  1.00 48.78  ? 64   ASN F O     1 
ATOM   4166  C  CB    . ASN F  2 64  ? -28.047 -10.672 42.437  1.00 49.88  ? 64   ASN F CB    1 
ATOM   4167  C  CG    . ASN F  2 64  ? -27.407 -9.980  43.605  1.00 51.53  ? 64   ASN F CG    1 
ATOM   4168  O  OD1   . ASN F  2 64  ? -27.455 -8.755  43.723  1.00 57.02  ? 64   ASN F OD1   1 
ATOM   4169  N  ND2   . ASN F  2 64  ? -26.803 -10.755 44.486  1.00 52.91  ? 64   ASN F ND2   1 
ATOM   4170  N  N     . VAL F  2 65  ? -30.304 -11.281 40.311  1.00 47.69  ? 65   VAL F N     1 
ATOM   4171  C  CA    . VAL F  2 65  ? -30.717 -12.004 39.122  1.00 47.04  ? 65   VAL F CA    1 
ATOM   4172  C  C     . VAL F  2 65  ? -31.415 -11.059 38.157  1.00 47.12  ? 65   VAL F C     1 
ATOM   4173  O  O     . VAL F  2 65  ? -31.138 -11.084 36.952  1.00 47.31  ? 65   VAL F O     1 
ATOM   4174  C  CB    . VAL F  2 65  ? -31.680 -13.165 39.444  1.00 46.60  ? 65   VAL F CB    1 
ATOM   4175  C  CG1   . VAL F  2 65  ? -31.977 -13.957 38.200  1.00 46.90  ? 65   VAL F CG1   1 
ATOM   4176  C  CG2   . VAL F  2 65  ? -31.100 -14.070 40.465  1.00 47.42  ? 65   VAL F CG2   1 
ATOM   4177  N  N     . ILE F  2 66  ? -32.335 -10.245 38.672  1.00 47.33  ? 66   ILE F N     1 
ATOM   4178  C  CA    . ILE F  2 66  ? -33.066 -9.304  37.810  1.00 47.86  ? 66   ILE F CA    1 
ATOM   4179  C  C     . ILE F  2 66  ? -32.146 -8.221  37.247  1.00 47.86  ? 66   ILE F C     1 
ATOM   4180  O  O     . ILE F  2 66  ? -32.245 -7.864  36.069  1.00 47.75  ? 66   ILE F O     1 
ATOM   4181  C  CB    . ILE F  2 66  ? -34.289 -8.699  38.499  1.00 48.12  ? 66   ILE F CB    1 
ATOM   4182  C  CG1   . ILE F  2 66  ? -35.292 -9.817  38.814  1.00 48.57  ? 66   ILE F CG1   1 
ATOM   4183  C  CG2   . ILE F  2 66  ? -34.920 -7.633  37.623  1.00 46.85  ? 66   ILE F CG2   1 
ATOM   4184  C  CD1   . ILE F  2 66  ? -36.264 -9.466  39.925  1.00 51.04  ? 66   ILE F CD1   1 
ATOM   4185  N  N     . ARG F  2 67  ? -31.223 -7.736  38.065  1.00 47.64  ? 67   ARG F N     1 
ATOM   4186  C  CA    . ARG F  2 67  ? -30.225 -6.843  37.544  1.00 48.41  ? 67   ARG F CA    1 
ATOM   4187  C  C     . ARG F  2 67  ? -29.619 -7.436  36.272  1.00 47.93  ? 67   ARG F C     1 
ATOM   4188  O  O     . ARG F  2 67  ? -29.645 -6.779  35.231  1.00 47.74  ? 67   ARG F O     1 
ATOM   4189  C  CB    . ARG F  2 67  ? -29.162 -6.518  38.593  1.00 48.66  ? 67   ARG F CB    1 
ATOM   4190  C  CG    . ARG F  2 67  ? -28.207 -5.382  38.201  1.00 49.53  ? 67   ARG F CG    1 
ATOM   4191  C  CD    . ARG F  2 67  ? -27.019 -5.279  39.159  1.00 50.83  ? 67   ARG F CD    1 
ATOM   4192  N  NE    . ARG F  2 67  ? -27.460 -4.985  40.531  1.00 58.46  ? 67   ARG F NE    1 
ATOM   4193  C  CZ    . ARG F  2 67  ? -27.378 -5.845  41.554  1.00 61.23  ? 67   ARG F CZ    1 
ATOM   4194  N  NH1   . ARG F  2 67  ? -26.854 -7.064  41.382  1.00 62.44  ? 67   ARG F NH1   1 
ATOM   4195  N  NH2   . ARG F  2 67  ? -27.806 -5.486  42.762  1.00 62.65  ? 67   ARG F NH2   1 
ATOM   4196  N  N     . ASP F  2 68  ? -29.112 -8.675  36.343  1.00 48.07  ? 68   ASP F N     1 
ATOM   4197  C  CA    . ASP F  2 68  ? -28.485 -9.344  35.177  1.00 48.06  ? 68   ASP F CA    1 
ATOM   4198  C  C     . ASP F  2 68  ? -29.501 -9.677  34.065  1.00 47.75  ? 68   ASP F C     1 
ATOM   4199  O  O     . ASP F  2 68  ? -29.191 -9.539  32.875  1.00 47.39  ? 68   ASP F O     1 
ATOM   4200  C  CB    . ASP F  2 68  ? -27.764 -10.629 35.586  1.00 48.72  ? 68   ASP F CB    1 
ATOM   4201  C  CG    . ASP F  2 68  ? -26.431 -10.390 36.323  1.00 51.52  ? 68   ASP F CG    1 
ATOM   4202  O  OD1   . ASP F  2 68  ? -26.093 -9.261  36.735  1.00 53.85  ? 68   ASP F OD1   1 
ATOM   4203  O  OD2   . ASP F  2 68  ? -25.694 -11.384 36.512  1.00 56.31  ? 68   ASP F OD2   1 
ATOM   4204  N  N     . ALA F  2 69  ? -30.707 -10.112 34.441  1.00 47.38  ? 69   ALA F N     1 
ATOM   4205  C  CA    . ALA F  2 69  ? -31.734 -10.457 33.443  1.00 47.43  ? 69   ALA F CA    1 
ATOM   4206  C  C     . ALA F  2 69  ? -32.014 -9.255  32.587  1.00 47.63  ? 69   ALA F C     1 
ATOM   4207  O  O     . ALA F  2 69  ? -32.069 -9.376  31.364  1.00 47.78  ? 69   ALA F O     1 
ATOM   4208  C  CB    . ALA F  2 69  ? -33.014 -10.955 34.095  1.00 47.09  ? 69   ALA F CB    1 
ATOM   4209  N  N     . VAL F  2 70  ? -32.161 -8.097  33.250  1.00 47.85  ? 70   VAL F N     1 
ATOM   4210  C  CA    . VAL F  2 70  ? -32.446 -6.814  32.605  1.00 47.23  ? 70   VAL F CA    1 
ATOM   4211  C  C     . VAL F  2 70  ? -31.259 -6.337  31.765  1.00 47.13  ? 70   VAL F C     1 
ATOM   4212  O  O     . VAL F  2 70  ? -31.451 -5.835  30.650  1.00 47.30  ? 70   VAL F O     1 
ATOM   4213  C  CB    . VAL F  2 70  ? -32.838 -5.751  33.628  1.00 47.39  ? 70   VAL F CB    1 
ATOM   4214  C  CG1   . VAL F  2 70  ? -33.084 -4.417  32.941  1.00 47.28  ? 70   VAL F CG1   1 
ATOM   4215  C  CG2   . VAL F  2 70  ? -34.091 -6.180  34.383  1.00 48.16  ? 70   VAL F CG2   1 
ATOM   4216  N  N     . THR F  2 71  ? -30.037 -6.524  32.274  1.00 46.14  ? 71   THR F N     1 
ATOM   4217  C  CA    . THR F  2 71  ? -28.857 -6.242  31.476  1.00 45.19  ? 71   THR F CA    1 
ATOM   4218  C  C     . THR F  2 71  ? -28.942 -6.930  30.117  1.00 46.15  ? 71   THR F C     1 
ATOM   4219  O  O     . THR F  2 71  ? -28.833 -6.252  29.101  1.00 46.43  ? 71   THR F O     1 
ATOM   4220  C  CB    . THR F  2 71  ? -27.592 -6.604  32.203  1.00 44.64  ? 71   THR F CB    1 
ATOM   4221  O  OG1   . THR F  2 71  ? -27.582 -5.925  33.457  1.00 43.65  ? 71   THR F OG1   1 
ATOM   4222  C  CG2   . THR F  2 71  ? -26.366 -6.198  31.403  1.00 43.37  ? 71   THR F CG2   1 
ATOM   4223  N  N     . TYR F  2 72  ? -29.177 -8.250  30.106  1.00 46.80  ? 72   TYR F N     1 
ATOM   4224  C  CA    . TYR F  2 72  ? -29.351 -9.028  28.874  1.00 47.38  ? 72   TYR F CA    1 
ATOM   4225  C  C     . TYR F  2 72  ? -30.474 -8.480  28.005  1.00 49.60  ? 72   TYR F C     1 
ATOM   4226  O  O     . TYR F  2 72  ? -30.307 -8.344  26.788  1.00 49.62  ? 72   TYR F O     1 
ATOM   4227  C  CB    . TYR F  2 72  ? -29.590 -10.522 29.174  1.00 46.41  ? 72   TYR F CB    1 
ATOM   4228  C  CG    . TYR F  2 72  ? -28.326 -11.289 29.562  1.00 44.81  ? 72   TYR F CG    1 
ATOM   4229  C  CD1   . TYR F  2 72  ? -28.185 -11.868 30.840  1.00 42.99  ? 72   TYR F CD1   1 
ATOM   4230  C  CD2   . TYR F  2 72  ? -27.269 -11.410 28.665  1.00 41.10  ? 72   TYR F CD2   1 
ATOM   4231  C  CE1   . TYR F  2 72  ? -27.036 -12.551 31.197  1.00 40.27  ? 72   TYR F CE1   1 
ATOM   4232  C  CE2   . TYR F  2 72  ? -26.136 -12.081 29.012  1.00 41.58  ? 72   TYR F CE2   1 
ATOM   4233  C  CZ    . TYR F  2 72  ? -26.014 -12.647 30.277  1.00 41.91  ? 72   TYR F CZ    1 
ATOM   4234  O  OH    . TYR F  2 72  ? -24.845 -13.298 30.586  1.00 42.37  ? 72   TYR F OH    1 
ATOM   4235  N  N     . THR F  2 73  ? -31.612 -8.149  28.625  1.00 52.25  ? 73   THR F N     1 
ATOM   4236  C  CA    . THR F  2 73  ? -32.742 -7.536  27.907  1.00 54.63  ? 73   THR F CA    1 
ATOM   4237  C  C     . THR F  2 73  ? -32.330 -6.256  27.170  1.00 56.38  ? 73   THR F C     1 
ATOM   4238  O  O     . THR F  2 73  ? -32.528 -6.141  25.951  1.00 56.66  ? 73   THR F O     1 
ATOM   4239  C  CB    . THR F  2 73  ? -33.896 -7.194  28.849  1.00 54.42  ? 73   THR F CB    1 
ATOM   4240  O  OG1   . THR F  2 73  ? -34.295 -8.368  29.558  1.00 55.92  ? 73   THR F OG1   1 
ATOM   4241  C  CG2   . THR F  2 73  ? -35.075 -6.672  28.071  1.00 54.10  ? 73   THR F CG2   1 
ATOM   4242  N  N     . GLU F  2 74  ? -31.758 -5.304  27.916  1.00 58.34  ? 74   GLU F N     1 
ATOM   4243  C  CA    . GLU F  2 74  ? -31.322 -4.033  27.348  1.00 60.16  ? 74   GLU F CA    1 
ATOM   4244  C  C     . GLU F  2 74  ? -30.405 -4.322  26.175  1.00 60.33  ? 74   GLU F C     1 
ATOM   4245  O  O     . GLU F  2 74  ? -30.573 -3.748  25.111  1.00 61.04  ? 74   GLU F O     1 
ATOM   4246  C  CB    . GLU F  2 74  ? -30.595 -3.151  28.385  1.00 60.99  ? 74   GLU F CB    1 
ATOM   4247  C  CG    . GLU F  2 74  ? -31.485 -2.400  29.398  1.00 65.32  ? 74   GLU F CG    1 
ATOM   4248  C  CD    . GLU F  2 74  ? -32.187 -1.168  28.782  1.00 74.01  ? 74   GLU F CD    1 
ATOM   4249  O  OE1   . GLU F  2 74  ? -31.504 -0.121  28.573  1.00 76.02  ? 74   GLU F OE1   1 
ATOM   4250  O  OE2   . GLU F  2 74  ? -33.427 -1.246  28.506  1.00 76.74  ? 74   GLU F OE2   1 
ATOM   4251  N  N     . HIS F  2 75  ? -29.452 -5.234  26.343  1.00 60.60  ? 75   HIS F N     1 
ATOM   4252  C  CA    . HIS F  2 75  ? -28.469 -5.468  25.284  1.00 60.75  ? 75   HIS F CA    1 
ATOM   4253  C  C     . HIS F  2 75  ? -29.098 -5.944  23.961  1.00 61.19  ? 75   HIS F C     1 
ATOM   4254  O  O     . HIS F  2 75  ? -28.644 -5.586  22.872  1.00 61.04  ? 75   HIS F O     1 
ATOM   4255  C  CB    . HIS F  2 75  ? -27.360 -6.403  25.749  1.00 60.35  ? 75   HIS F CB    1 
ATOM   4256  C  CG    . HIS F  2 75  ? -26.296 -6.610  24.722  1.00 60.09  ? 75   HIS F CG    1 
ATOM   4257  N  ND1   . HIS F  2 75  ? -26.256 -7.719  23.905  1.00 60.27  ? 75   HIS F ND1   1 
ATOM   4258  C  CD2   . HIS F  2 75  ? -25.257 -5.832  24.348  1.00 59.72  ? 75   HIS F CD2   1 
ATOM   4259  C  CE1   . HIS F  2 75  ? -25.227 -7.624  23.082  1.00 59.53  ? 75   HIS F CE1   1 
ATOM   4260  N  NE2   . HIS F  2 75  ? -24.604 -6.487  23.331  1.00 60.65  ? 75   HIS F NE2   1 
ATOM   4261  N  N     . ALA F  2 76  ? -30.153 -6.745  24.064  1.00 61.83  ? 76   ALA F N     1 
ATOM   4262  C  CA    . ALA F  2 76  ? -30.876 -7.220  22.892  1.00 62.10  ? 76   ALA F CA    1 
ATOM   4263  C  C     . ALA F  2 76  ? -31.769 -6.118  22.291  1.00 62.77  ? 76   ALA F C     1 
ATOM   4264  O  O     . ALA F  2 76  ? -32.532 -6.360  21.350  1.00 63.00  ? 76   ALA F O     1 
ATOM   4265  C  CB    . ALA F  2 76  ? -31.690 -8.421  23.265  1.00 61.88  ? 76   ALA F CB    1 
ATOM   4266  N  N     . LYS F  2 77  ? -31.661 -4.906  22.834  1.00 63.26  ? 77   LYS F N     1 
ATOM   4267  C  CA    . LYS F  2 77  ? -32.515 -3.772  22.440  1.00 63.76  ? 77   LYS F CA    1 
ATOM   4268  C  C     . LYS F  2 77  ? -34.028 -4.080  22.548  1.00 63.85  ? 77   LYS F C     1 
ATOM   4269  O  O     . LYS F  2 77  ? -34.835 -3.550  21.779  1.00 64.33  ? 77   LYS F O     1 
ATOM   4270  C  CB    . LYS F  2 77  ? -32.108 -3.246  21.055  1.00 63.44  ? 77   LYS F CB    1 
ATOM   4271  C  CG    . LYS F  2 77  ? -31.000 -2.202  21.137  1.00 65.01  ? 77   LYS F CG    1 
ATOM   4272  C  CD    . LYS F  2 77  ? -30.255 -1.979  19.820  1.00 65.65  ? 77   LYS F CD    1 
ATOM   4273  C  CE    . LYS F  2 77  ? -29.019 -1.084  20.070  1.00 67.97  ? 77   LYS F CE    1 
ATOM   4274  N  NZ    . LYS F  2 77  ? -28.109 -0.838  18.880  1.00 67.71  ? 77   LYS F NZ    1 
ATOM   4275  N  N     . ARG F  2 78  ? -34.393 -4.939  23.506  1.00 63.47  ? 78   ARG F N     1 
ATOM   4276  C  CA    . ARG F  2 78  ? -35.787 -5.306  23.755  1.00 62.95  ? 78   ARG F CA    1 
ATOM   4277  C  C     . ARG F  2 78  ? -36.392 -4.558  24.946  1.00 63.22  ? 78   ARG F C     1 
ATOM   4278  O  O     . ARG F  2 78  ? -35.694 -3.913  25.718  1.00 62.85  ? 78   ARG F O     1 
ATOM   4279  C  CB    . ARG F  2 78  ? -35.909 -6.816  23.982  1.00 62.80  ? 78   ARG F CB    1 
ATOM   4280  C  CG    . ARG F  2 78  ? -35.764 -7.645  22.716  1.00 62.53  ? 78   ARG F CG    1 
ATOM   4281  C  CD    . ARG F  2 78  ? -35.969 -9.145  22.976  1.00 62.00  ? 78   ARG F CD    1 
ATOM   4282  N  NE    . ARG F  2 78  ? -34.762 -9.779  23.509  1.00 58.60  ? 78   ARG F NE    1 
ATOM   4283  C  CZ    . ARG F  2 78  ? -34.582 -10.102 24.787  1.00 56.36  ? 78   ARG F CZ    1 
ATOM   4284  N  NH1   . ARG F  2 78  ? -35.524 -9.870  25.675  1.00 55.44  ? 78   ARG F NH1   1 
ATOM   4285  N  NH2   . ARG F  2 78  ? -33.455 -10.662 25.177  1.00 56.28  ? 78   ARG F NH2   1 
ATOM   4286  N  N     . LYS F  2 79  ? -37.704 -4.657  25.094  1.00 63.96  ? 79   LYS F N     1 
ATOM   4287  C  CA    . LYS F  2 79  ? -38.387 -4.080  26.242  1.00 64.66  ? 79   LYS F CA    1 
ATOM   4288  C  C     . LYS F  2 79  ? -39.002 -5.181  27.087  1.00 64.48  ? 79   LYS F C     1 
ATOM   4289  O  O     . LYS F  2 79  ? -39.575 -4.911  28.135  1.00 64.98  ? 79   LYS F O     1 
ATOM   4290  C  CB    . LYS F  2 79  ? -39.470 -3.093  25.793  1.00 65.28  ? 79   LYS F CB    1 
ATOM   4291  C  CG    . LYS F  2 79  ? -38.937 -1.767  25.238  1.00 67.21  ? 79   LYS F CG    1 
ATOM   4292  C  CD    . LYS F  2 79  ? -39.995 -0.656  25.348  1.00 71.00  ? 79   LYS F CD    1 
ATOM   4293  C  CE    . LYS F  2 79  ? -39.360 0.725   25.103  1.00 72.93  ? 79   LYS F CE    1 
ATOM   4294  N  NZ    . LYS F  2 79  ? -40.173 1.867   25.636  1.00 74.02  ? 79   LYS F NZ    1 
ATOM   4295  N  N     . THR F  2 80  ? -38.882 -6.422  26.628  1.00 64.24  ? 80   THR F N     1 
ATOM   4296  C  CA    . THR F  2 80  ? -39.442 -7.562  27.341  1.00 64.04  ? 80   THR F CA    1 
ATOM   4297  C  C     . THR F  2 80  ? -38.367 -8.490  27.896  1.00 63.00  ? 80   THR F C     1 
ATOM   4298  O  O     . THR F  2 80  ? -37.543 -9.014  27.146  1.00 63.17  ? 80   THR F O     1 
ATOM   4299  C  CB    . THR F  2 80  ? -40.333 -8.397  26.431  1.00 64.33  ? 80   THR F CB    1 
ATOM   4300  O  OG1   . THR F  2 80  ? -41.196 -7.529  25.685  1.00 66.93  ? 80   THR F OG1   1 
ATOM   4301  C  CG2   . THR F  2 80  ? -41.177 -9.370  27.257  1.00 65.14  ? 80   THR F CG2   1 
ATOM   4302  N  N     . VAL F  2 81  ? -38.404 -8.699  29.211  1.00 61.34  ? 81   VAL F N     1 
ATOM   4303  C  CA    . VAL F  2 81  ? -37.558 -9.670  29.878  1.00 59.56  ? 81   VAL F CA    1 
ATOM   4304  C  C     . VAL F  2 81  ? -38.066 -11.063 29.494  1.00 58.69  ? 81   VAL F C     1 
ATOM   4305  O  O     . VAL F  2 81  ? -39.213 -11.403 29.785  1.00 58.29  ? 81   VAL F O     1 
ATOM   4306  C  CB    . VAL F  2 81  ? -37.641 -9.483  31.419  1.00 59.45  ? 81   VAL F CB    1 
ATOM   4307  C  CG1   . VAL F  2 81  ? -36.771 -10.502 32.144  1.00 59.16  ? 81   VAL F CG1   1 
ATOM   4308  C  CG2   . VAL F  2 81  ? -37.248 -8.082  31.818  1.00 58.42  ? 81   VAL F CG2   1 
ATOM   4309  N  N     . THR F  2 82  ? -37.222 -11.866 28.851  1.00 57.48  ? 82   THR F N     1 
ATOM   4310  C  CA    . THR F  2 82  ? -37.601 -13.235 28.464  1.00 56.84  ? 82   THR F CA    1 
ATOM   4311  C  C     . THR F  2 82  ? -37.185 -14.298 29.467  1.00 56.17  ? 82   THR F C     1 
ATOM   4312  O  O     . THR F  2 82  ? -36.386 -14.037 30.369  1.00 56.48  ? 82   THR F O     1 
ATOM   4313  C  CB    . THR F  2 82  ? -36.954 -13.638 27.147  1.00 56.95  ? 82   THR F CB    1 
ATOM   4314  O  OG1   . THR F  2 82  ? -35.534 -13.428 27.237  1.00 57.89  ? 82   THR F OG1   1 
ATOM   4315  C  CG2   . THR F  2 82  ? -37.531 -12.823 25.988  1.00 57.59  ? 82   THR F CG2   1 
ATOM   4316  N  N     . ALA F  2 83  ? -37.716 -15.508 29.290  1.00 55.56  ? 83   ALA F N     1 
ATOM   4317  C  CA    . ALA F  2 83  ? -37.280 -16.678 30.063  1.00 54.83  ? 83   ALA F CA    1 
ATOM   4318  C  C     . ALA F  2 83  ? -35.793 -16.956 29.878  1.00 54.56  ? 83   ALA F C     1 
ATOM   4319  O  O     . ALA F  2 83  ? -35.112 -17.261 30.849  1.00 54.76  ? 83   ALA F O     1 
ATOM   4320  C  CB    . ALA F  2 83  ? -38.087 -17.900 29.705  1.00 54.48  ? 83   ALA F CB    1 
ATOM   4321  N  N     . MET F  2 84  ? -35.300 -16.838 28.643  1.00 54.43  ? 84   MET F N     1 
ATOM   4322  C  CA    . MET F  2 84  ? -33.880 -17.002 28.329  1.00 54.42  ? 84   MET F CA    1 
ATOM   4323  C  C     . MET F  2 84  ? -32.999 -15.971 29.011  1.00 53.97  ? 84   MET F C     1 
ATOM   4324  O  O     . MET F  2 84  ? -31.956 -16.338 29.563  1.00 54.27  ? 84   MET F O     1 
ATOM   4325  C  CB    . MET F  2 84  ? -33.620 -17.011 26.819  1.00 54.34  ? 84   MET F CB    1 
ATOM   4326  C  CG    . MET F  2 84  ? -33.963 -18.347 26.148  1.00 58.82  ? 84   MET F CG    1 
ATOM   4327  S  SD    . MET F  2 84  ? -33.449 -19.897 27.018  1.00 65.78  ? 84   MET F SD    1 
ATOM   4328  C  CE    . MET F  2 84  ? -31.745 -20.082 26.436  1.00 64.26  ? 84   MET F CE    1 
ATOM   4329  N  N     . ASP F  2 85  ? -33.409 -14.697 28.988  1.00 53.02  ? 85   ASP F N     1 
ATOM   4330  C  CA    . ASP F  2 85  ? -32.687 -13.649 29.726  1.00 51.99  ? 85   ASP F CA    1 
ATOM   4331  C  C     . ASP F  2 85  ? -32.511 -14.027 31.198  1.00 50.80  ? 85   ASP F C     1 
ATOM   4332  O  O     . ASP F  2 85  ? -31.462 -13.772 31.785  1.00 50.05  ? 85   ASP F O     1 
ATOM   4333  C  CB    . ASP F  2 85  ? -33.398 -12.291 29.628  1.00 52.45  ? 85   ASP F CB    1 
ATOM   4334  C  CG    . ASP F  2 85  ? -33.322 -11.666 28.237  1.00 54.12  ? 85   ASP F CG    1 
ATOM   4335  O  OD1   . ASP F  2 85  ? -32.511 -12.115 27.379  1.00 56.48  ? 85   ASP F OD1   1 
ATOM   4336  O  OD2   . ASP F  2 85  ? -34.081 -10.700 28.004  1.00 55.92  ? 85   ASP F OD2   1 
ATOM   4337  N  N     . VAL F  2 86  ? -33.544 -14.625 31.792  1.00 49.68  ? 86   VAL F N     1 
ATOM   4338  C  CA    . VAL F  2 86  ? -33.447 -15.113 33.162  1.00 49.05  ? 86   VAL F CA    1 
ATOM   4339  C  C     . VAL F  2 86  ? -32.514 -16.319 33.283  1.00 49.38  ? 86   VAL F C     1 
ATOM   4340  O  O     . VAL F  2 86  ? -31.663 -16.376 34.198  1.00 49.29  ? 86   VAL F O     1 
ATOM   4341  C  CB    . VAL F  2 86  ? -34.806 -15.484 33.713  1.00 48.95  ? 86   VAL F CB    1 
ATOM   4342  C  CG1   . VAL F  2 86  ? -34.691 -15.897 35.176  1.00 47.19  ? 86   VAL F CG1   1 
ATOM   4343  C  CG2   . VAL F  2 86  ? -35.760 -14.308 33.536  1.00 49.10  ? 86   VAL F CG2   1 
ATOM   4344  N  N     . VAL F  2 87  ? -32.663 -17.274 32.359  1.00 49.20  ? 87   VAL F N     1 
ATOM   4345  C  CA    . VAL F  2 87  ? -31.849 -18.475 32.373  1.00 49.01  ? 87   VAL F CA    1 
ATOM   4346  C  C     . VAL F  2 87  ? -30.409 -18.071 32.200  1.00 49.22  ? 87   VAL F C     1 
ATOM   4347  O  O     . VAL F  2 87  ? -29.548 -18.559 32.912  1.00 49.67  ? 87   VAL F O     1 
ATOM   4348  C  CB    . VAL F  2 87  ? -32.292 -19.528 31.332  1.00 49.16  ? 87   VAL F CB    1 
ATOM   4349  C  CG1   . VAL F  2 87  ? -31.269 -20.623 31.214  1.00 49.18  ? 87   VAL F CG1   1 
ATOM   4350  C  CG2   . VAL F  2 87  ? -33.645 -20.154 31.727  1.00 49.22  ? 87   VAL F CG2   1 
ATOM   4351  N  N     . TYR F  2 88  ? -30.139 -17.143 31.295  1.00 49.55  ? 88   TYR F N     1 
ATOM   4352  C  CA    . TYR F  2 88  ? -28.781 -16.671 31.146  1.00 50.00  ? 88   TYR F CA    1 
ATOM   4353  C  C     . TYR F  2 88  ? -28.281 -16.054 32.434  1.00 49.61  ? 88   TYR F C     1 
ATOM   4354  O  O     . TYR F  2 88  ? -27.120 -16.246 32.803  1.00 50.00  ? 88   TYR F O     1 
ATOM   4355  C  CB    . TYR F  2 88  ? -28.638 -15.699 29.978  1.00 51.26  ? 88   TYR F CB    1 
ATOM   4356  C  CG    . TYR F  2 88  ? -28.913 -16.337 28.645  1.00 53.15  ? 88   TYR F CG    1 
ATOM   4357  C  CD1   . TYR F  2 88  ? -29.758 -15.730 27.719  1.00 54.78  ? 88   TYR F CD1   1 
ATOM   4358  C  CD2   . TYR F  2 88  ? -28.357 -17.576 28.319  1.00 54.88  ? 88   TYR F CD2   1 
ATOM   4359  C  CE1   . TYR F  2 88  ? -30.027 -16.337 26.477  1.00 56.07  ? 88   TYR F CE1   1 
ATOM   4360  C  CE2   . TYR F  2 88  ? -28.618 -18.189 27.097  1.00 56.50  ? 88   TYR F CE2   1 
ATOM   4361  C  CZ    . TYR F  2 88  ? -29.453 -17.563 26.181  1.00 55.80  ? 88   TYR F CZ    1 
ATOM   4362  O  OH    . TYR F  2 88  ? -29.705 -18.179 24.980  1.00 56.04  ? 88   TYR F OH    1 
ATOM   4363  N  N     . ALA F  2 89  ? -29.155 -15.330 33.125  1.00 48.92  ? 89   ALA F N     1 
ATOM   4364  C  CA    . ALA F  2 89  ? -28.738 -14.576 34.294  1.00 48.58  ? 89   ALA F CA    1 
ATOM   4365  C  C     . ALA F  2 89  ? -28.426 -15.519 35.459  1.00 48.45  ? 89   ALA F C     1 
ATOM   4366  O  O     . ALA F  2 89  ? -27.424 -15.337 36.167  1.00 47.58  ? 89   ALA F O     1 
ATOM   4367  C  CB    . ALA F  2 89  ? -29.788 -13.508 34.676  1.00 48.16  ? 89   ALA F CB    1 
ATOM   4368  N  N     . LEU F  2 90  ? -29.277 -16.533 35.641  1.00 48.85  ? 90   LEU F N     1 
ATOM   4369  C  CA    . LEU F  2 90  ? -29.022 -17.592 36.633  1.00 49.03  ? 90   LEU F CA    1 
ATOM   4370  C  C     . LEU F  2 90  ? -27.802 -18.449 36.291  1.00 49.56  ? 90   LEU F C     1 
ATOM   4371  O  O     . LEU F  2 90  ? -27.131 -18.942 37.187  1.00 49.81  ? 90   LEU F O     1 
ATOM   4372  C  CB    . LEU F  2 90  ? -30.237 -18.479 36.800  1.00 48.46  ? 90   LEU F CB    1 
ATOM   4373  C  CG    . LEU F  2 90  ? -31.396 -17.821 37.537  1.00 48.24  ? 90   LEU F CG    1 
ATOM   4374  C  CD1   . LEU F  2 90  ? -32.662 -18.566 37.175  1.00 47.37  ? 90   LEU F CD1   1 
ATOM   4375  C  CD2   . LEU F  2 90  ? -31.179 -17.755 39.054  1.00 45.15  ? 90   LEU F CD2   1 
ATOM   4376  N  N     . LYS F  2 91  ? -27.497 -18.611 35.005  1.00 50.02  ? 91   LYS F N     1 
ATOM   4377  C  CA    . LYS F  2 91  ? -26.277 -19.298 34.624  1.00 50.88  ? 91   LYS F CA    1 
ATOM   4378  C  C     . LYS F  2 91  ? -25.054 -18.524 35.080  1.00 51.41  ? 91   LYS F C     1 
ATOM   4379  O  O     . LYS F  2 91  ? -24.112 -19.115 35.582  1.00 52.01  ? 91   LYS F O     1 
ATOM   4380  C  CB    . LYS F  2 91  ? -26.219 -19.557 33.136  1.00 50.71  ? 91   LYS F CB    1 
ATOM   4381  C  CG    . LYS F  2 91  ? -25.324 -20.721 32.801  1.00 54.37  ? 91   LYS F CG    1 
ATOM   4382  C  CD    . LYS F  2 91  ? -25.250 -20.966 31.296  1.00 60.82  ? 91   LYS F CD    1 
ATOM   4383  C  CE    . LYS F  2 91  ? -25.059 -22.466 31.002  1.00 64.24  ? 91   LYS F CE    1 
ATOM   4384  N  NZ    . LYS F  2 91  ? -25.449 -22.855 29.589  1.00 66.96  ? 91   LYS F NZ    1 
ATOM   4385  N  N     . ARG F  2 92  ? -25.085 -17.204 34.915  1.00 52.06  ? 92   ARG F N     1 
ATOM   4386  C  CA    . ARG F  2 92  ? -24.016 -16.310 35.360  1.00 52.56  ? 92   ARG F CA    1 
ATOM   4387  C  C     . ARG F  2 92  ? -23.760 -16.349 36.857  1.00 52.34  ? 92   ARG F C     1 
ATOM   4388  O  O     . ARG F  2 92  ? -22.620 -16.323 37.266  1.00 52.40  ? 92   ARG F O     1 
ATOM   4389  C  CB    . ARG F  2 92  ? -24.343 -14.864 34.979  1.00 53.13  ? 92   ARG F CB    1 
ATOM   4390  C  CG    . ARG F  2 92  ? -23.946 -14.489 33.588  1.00 55.45  ? 92   ARG F CG    1 
ATOM   4391  C  CD    . ARG F  2 92  ? -23.405 -13.083 33.567  1.00 59.08  ? 92   ARG F CD    1 
ATOM   4392  N  NE    . ARG F  2 92  ? -22.138 -12.967 34.298  1.00 61.50  ? 92   ARG F NE    1 
ATOM   4393  C  CZ    . ARG F  2 92  ? -22.030 -12.512 35.547  1.00 61.97  ? 92   ARG F CZ    1 
ATOM   4394  N  NH1   . ARG F  2 92  ? -23.117 -12.134 36.231  1.00 60.97  ? 92   ARG F NH1   1 
ATOM   4395  N  NH2   . ARG F  2 92  ? -20.832 -12.438 36.116  1.00 61.38  ? 92   ARG F NH2   1 
ATOM   4396  N  N     . GLN F  2 93  ? -24.818 -16.363 37.665  1.00 52.41  ? 93   GLN F N     1 
ATOM   4397  C  CA    . GLN F  2 93  ? -24.693 -16.494 39.110  1.00 52.69  ? 93   GLN F CA    1 
ATOM   4398  C  C     . GLN F  2 93  ? -24.319 -17.937 39.529  1.00 52.12  ? 93   GLN F C     1 
ATOM   4399  O  O     . GLN F  2 93  ? -24.260 -18.238 40.727  1.00 52.43  ? 93   GLN F O     1 
ATOM   4400  C  CB    . GLN F  2 93  ? -26.000 -16.094 39.835  1.00 53.55  ? 93   GLN F CB    1 
ATOM   4401  C  CG    . GLN F  2 93  ? -26.785 -14.873 39.305  1.00 56.13  ? 93   GLN F CG    1 
ATOM   4402  C  CD    . GLN F  2 93  ? -26.080 -13.532 39.535  1.00 61.03  ? 93   GLN F CD    1 
ATOM   4403  O  OE1   . GLN F  2 93  ? -25.612 -13.225 40.642  1.00 62.70  ? 93   GLN F OE1   1 
ATOM   4404  N  NE2   . GLN F  2 93  ? -26.011 -12.722 38.481  1.00 61.30  ? 93   GLN F NE2   1 
ATOM   4405  N  N     . GLY F  2 94  ? -24.094 -18.827 38.560  1.00 51.13  ? 94   GLY F N     1 
ATOM   4406  C  CA    . GLY F  2 94  ? -23.738 -20.220 38.853  1.00 49.88  ? 94   GLY F CA    1 
ATOM   4407  C  C     . GLY F  2 94  ? -24.915 -21.017 39.396  1.00 49.28  ? 94   GLY F C     1 
ATOM   4408  O  O     . GLY F  2 94  ? -24.775 -21.861 40.281  1.00 48.67  ? 94   GLY F O     1 
ATOM   4409  N  N     . ARG F  2 95  ? -26.090 -20.738 38.852  1.00 49.13  ? 95   ARG F N     1 
ATOM   4410  C  CA    . ARG F  2 95  ? -27.309 -21.360 39.312  1.00 48.64  ? 95   ARG F CA    1 
ATOM   4411  C  C     . ARG F  2 95  ? -28.143 -21.801 38.149  1.00 48.42  ? 95   ARG F C     1 
ATOM   4412  O  O     . ARG F  2 95  ? -29.322 -21.501 38.110  1.00 49.34  ? 95   ARG F O     1 
ATOM   4413  C  CB    . ARG F  2 95  ? -28.117 -20.414 40.200  1.00 48.41  ? 95   ARG F CB    1 
ATOM   4414  C  CG    . ARG F  2 95  ? -27.455 -20.148 41.513  1.00 49.13  ? 95   ARG F CG    1 
ATOM   4415  C  CD    . ARG F  2 95  ? -28.455 -19.900 42.594  1.00 52.39  ? 95   ARG F CD    1 
ATOM   4416  N  NE    . ARG F  2 95  ? -28.044 -20.530 43.851  1.00 55.39  ? 95   ARG F NE    1 
ATOM   4417  C  CZ    . ARG F  2 95  ? -28.594 -21.634 44.366  1.00 56.35  ? 95   ARG F CZ    1 
ATOM   4418  N  NH1   . ARG F  2 95  ? -29.607 -22.243 43.743  1.00 54.93  ? 95   ARG F NH1   1 
ATOM   4419  N  NH2   . ARG F  2 95  ? -28.145 -22.121 45.530  1.00 56.41  ? 95   ARG F NH2   1 
ATOM   4420  N  N     . THR F  2 96  ? -27.535 -22.537 37.220  1.00 48.27  ? 96   THR F N     1 
ATOM   4421  C  CA    . THR F  2 96  ? -28.248 -23.199 36.102  1.00 47.94  ? 96   THR F CA    1 
ATOM   4422  C  C     . THR F  2 96  ? -29.614 -23.777 36.464  1.00 47.56  ? 96   THR F C     1 
ATOM   4423  O  O     . THR F  2 96  ? -29.730 -24.524 37.413  1.00 47.51  ? 96   THR F O     1 
ATOM   4424  C  CB    . THR F  2 96  ? -27.380 -24.312 35.511  1.00 47.67  ? 96   THR F CB    1 
ATOM   4425  O  OG1   . THR F  2 96  ? -26.196 -23.723 34.958  1.00 48.49  ? 96   THR F OG1   1 
ATOM   4426  C  CG2   . THR F  2 96  ? -28.113 -25.048 34.425  1.00 46.87  ? 96   THR F CG2   1 
ATOM   4427  N  N     . LEU F  2 97  ? -30.642 -23.403 35.710  1.00 47.80  ? 97   LEU F N     1 
ATOM   4428  C  CA    . LEU F  2 97  ? -32.012 -23.903 35.909  1.00 47.93  ? 97   LEU F CA    1 
ATOM   4429  C  C     . LEU F  2 97  ? -32.468 -24.622 34.656  1.00 48.23  ? 97   LEU F C     1 
ATOM   4430  O  O     . LEU F  2 97  ? -32.263 -24.122 33.559  1.00 48.39  ? 97   LEU F O     1 
ATOM   4431  C  CB    . LEU F  2 97  ? -32.958 -22.744 36.214  1.00 47.62  ? 97   LEU F CB    1 
ATOM   4432  C  CG    . LEU F  2 97  ? -34.480 -22.865 36.135  1.00 47.61  ? 97   LEU F CG    1 
ATOM   4433  C  CD1   . LEU F  2 97  ? -35.037 -23.587 37.326  1.00 45.37  ? 97   LEU F CD1   1 
ATOM   4434  C  CD2   . LEU F  2 97  ? -35.109 -21.477 36.032  1.00 47.89  ? 97   LEU F CD2   1 
ATOM   4435  N  N     . TYR F  2 98  ? -33.051 -25.808 34.819  1.00 49.01  ? 98   TYR F N     1 
ATOM   4436  C  CA    . TYR F  2 98  ? -33.571 -26.572 33.689  1.00 49.73  ? 98   TYR F CA    1 
ATOM   4437  C  C     . TYR F  2 98  ? -35.091 -26.466 33.586  1.00 50.84  ? 98   TYR F C     1 
ATOM   4438  O  O     . TYR F  2 98  ? -35.801 -26.405 34.606  1.00 50.04  ? 98   TYR F O     1 
ATOM   4439  C  CB    . TYR F  2 98  ? -33.230 -28.043 33.822  1.00 49.50  ? 98   TYR F CB    1 
ATOM   4440  C  CG    . TYR F  2 98  ? -31.776 -28.458 33.633  1.00 49.20  ? 98   TYR F CG    1 
ATOM   4441  C  CD1   . TYR F  2 98  ? -30.827 -27.614 33.050  1.00 47.29  ? 98   TYR F CD1   1 
ATOM   4442  C  CD2   . TYR F  2 98  ? -31.377 -29.751 33.999  1.00 48.13  ? 98   TYR F CD2   1 
ATOM   4443  C  CE1   . TYR F  2 98  ? -29.500 -28.039 32.875  1.00 47.82  ? 98   TYR F CE1   1 
ATOM   4444  C  CE2   . TYR F  2 98  ? -30.082 -30.180 33.823  1.00 48.61  ? 98   TYR F CE2   1 
ATOM   4445  C  CZ    . TYR F  2 98  ? -29.144 -29.330 33.267  1.00 49.14  ? 98   TYR F CZ    1 
ATOM   4446  O  OH    . TYR F  2 98  ? -27.862 -29.810 33.124  1.00 48.99  ? 98   TYR F OH    1 
ATOM   4447  N  N     . GLY F  2 99  ? -35.580 -26.444 32.345  1.00 52.03  ? 99   GLY F N     1 
ATOM   4448  C  CA    . GLY F  2 99  ? -37.005 -26.489 32.085  1.00 53.59  ? 99   GLY F CA    1 
ATOM   4449  C  C     . GLY F  2 99  ? -37.612 -25.280 31.404  1.00 55.33  ? 99   GLY F C     1 
ATOM   4450  O  O     . GLY F  2 99  ? -38.832 -25.248 31.217  1.00 56.58  ? 99   GLY F O     1 
ATOM   4451  N  N     . PHE F  2 100 ? -36.810 -24.278 31.032  1.00 55.95  ? 100  PHE F N     1 
ATOM   4452  C  CA    . PHE F  2 100 ? -37.381 -23.071 30.428  1.00 56.46  ? 100  PHE F CA    1 
ATOM   4453  C  C     . PHE F  2 100 ? -36.679 -22.604 29.162  1.00 58.05  ? 100  PHE F C     1 
ATOM   4454  O  O     . PHE F  2 100 ? -36.894 -21.458 28.719  1.00 58.52  ? 100  PHE F O     1 
ATOM   4455  C  CB    . PHE F  2 100 ? -37.408 -21.909 31.421  1.00 55.47  ? 100  PHE F CB    1 
ATOM   4456  C  CG    . PHE F  2 100 ? -38.270 -22.137 32.615  1.00 53.27  ? 100  PHE F CG    1 
ATOM   4457  C  CD1   . PHE F  2 100 ? -37.718 -22.621 33.795  1.00 52.26  ? 100  PHE F CD1   1 
ATOM   4458  C  CD2   . PHE F  2 100 ? -39.623 -21.822 32.581  1.00 51.37  ? 100  PHE F CD2   1 
ATOM   4459  C  CE1   . PHE F  2 100 ? -38.512 -22.817 34.928  1.00 52.55  ? 100  PHE F CE1   1 
ATOM   4460  C  CE2   . PHE F  2 100 ? -40.437 -22.011 33.701  1.00 51.38  ? 100  PHE F CE2   1 
ATOM   4461  C  CZ    . PHE F  2 100 ? -39.883 -22.508 34.881  1.00 52.76  ? 100  PHE F CZ    1 
ATOM   4462  N  N     . GLY F  2 101 ? -35.855 -23.473 28.584  1.00 59.25  ? 101  GLY F N     1 
ATOM   4463  C  CA    . GLY F  2 101 ? -35.051 -23.127 27.420  1.00 61.29  ? 101  GLY F CA    1 
ATOM   4464  C  C     . GLY F  2 101 ? -33.539 -23.279 27.615  1.00 63.09  ? 101  GLY F C     1 
ATOM   4465  O  O     . GLY F  2 101 ? -32.760 -22.967 26.701  1.00 63.25  ? 101  GLY F O     1 
ATOM   4466  N  N     . GLY F  2 102 ? -33.109 -23.754 28.792  1.00 64.51  ? 102  GLY F N     1 
ATOM   4467  C  CA    . GLY F  2 102 ? -31.702 -24.154 29.004  1.00 66.11  ? 102  GLY F CA    1 
ATOM   4468  C  C     . GLY F  2 102 ? -31.025 -24.552 27.688  1.00 67.19  ? 102  GLY F C     1 
ATOM   4469  O  O     . GLY F  2 102 ? -30.058 -23.902 27.252  1.00 67.68  ? 102  GLY F O     1 
ATOM   4470  O  OXT   . GLY F  2 102 ? -31.450 -25.499 26.989  1.00 67.57  ? 102  GLY F OXT   1 
ATOM   4471  N  N     . ALA G  3 14  ? -0.318  10.518  14.692  1.00 75.76  ? 14   ALA G N     1 
ATOM   4472  C  CA    . ALA G  3 14  ? -0.136  9.492   15.774  1.00 75.67  ? 14   ALA G CA    1 
ATOM   4473  C  C     . ALA G  3 14  ? -0.269  8.045   15.260  1.00 75.16  ? 14   ALA G C     1 
ATOM   4474  O  O     . ALA G  3 14  ? -1.358  7.599   14.872  1.00 75.41  ? 14   ALA G O     1 
ATOM   4475  C  CB    . ALA G  3 14  ? -1.106  9.759   16.962  1.00 75.77  ? 14   ALA G CB    1 
ATOM   4476  N  N     . LYS G  3 15  ? 0.856   7.332   15.276  1.00 74.45  ? 15   LYS G N     1 
ATOM   4477  C  CA    . LYS G  3 15  ? 0.973   5.981   14.722  1.00 73.51  ? 15   LYS G CA    1 
ATOM   4478  C  C     . LYS G  3 15  ? 0.068   4.943   15.405  1.00 72.67  ? 15   LYS G C     1 
ATOM   4479  O  O     . LYS G  3 15  ? -0.976  4.579   14.856  1.00 72.56  ? 15   LYS G O     1 
ATOM   4480  C  CB    . LYS G  3 15  ? 2.441   5.511   14.754  1.00 73.80  ? 15   LYS G CB    1 
ATOM   4481  C  CG    . LYS G  3 15  ? 3.439   6.377   13.976  1.00 73.89  ? 15   LYS G CG    1 
ATOM   4482  C  CD    . LYS G  3 15  ? 3.143   6.378   12.470  1.00 75.76  ? 15   LYS G CD    1 
ATOM   4483  C  CE    . LYS G  3 15  ? 3.930   7.479   11.745  1.00 76.02  ? 15   LYS G CE    1 
ATOM   4484  N  NZ    . LYS G  3 15  ? 3.203   7.983   10.550  1.00 76.72  ? 15   LYS G NZ    1 
ATOM   4485  N  N     . THR G  3 16  ? 0.466   4.487   16.598  1.00 71.51  ? 16   THR G N     1 
ATOM   4486  C  CA    . THR G  3 16  ? -0.164  3.322   17.260  1.00 70.03  ? 16   THR G CA    1 
ATOM   4487  C  C     . THR G  3 16  ? -1.547  3.589   17.798  1.00 68.72  ? 16   THR G C     1 
ATOM   4488  O  O     . THR G  3 16  ? -1.843  4.684   18.263  1.00 68.67  ? 16   THR G O     1 
ATOM   4489  C  CB    . THR G  3 16  ? 0.652   2.793   18.453  1.00 69.88  ? 16   THR G CB    1 
ATOM   4490  O  OG1   . THR G  3 16  ? 0.793   3.839   19.424  1.00 70.67  ? 16   THR G OG1   1 
ATOM   4491  C  CG2   . THR G  3 16  ? 2.022   2.269   18.013  1.00 69.73  ? 16   THR G CG2   1 
ATOM   4492  N  N     . ARG G  3 17  ? -2.362  2.546   17.780  1.00 67.47  ? 17   ARG G N     1 
ATOM   4493  C  CA    . ARG G  3 17  ? -3.743  2.606   18.228  1.00 66.45  ? 17   ARG G CA    1 
ATOM   4494  C  C     . ARG G  3 17  ? -3.909  2.908   19.707  1.00 65.71  ? 17   ARG G C     1 
ATOM   4495  O  O     . ARG G  3 17  ? -4.983  3.324   20.140  1.00 65.89  ? 17   ARG G O     1 
ATOM   4496  C  CB    . ARG G  3 17  ? -4.454  1.313   17.871  1.00 66.64  ? 17   ARG G CB    1 
ATOM   4497  C  CG    . ARG G  3 17  ? -4.583  1.107   16.382  1.00 66.58  ? 17   ARG G CG    1 
ATOM   4498  C  CD    . ARG G  3 17  ? -5.641  0.101   16.076  1.00 66.42  ? 17   ARG G CD    1 
ATOM   4499  N  NE    . ARG G  3 17  ? -5.065  -1.232  16.054  1.00 68.36  ? 17   ARG G NE    1 
ATOM   4500  C  CZ    . ARG G  3 17  ? -5.771  -2.352  15.950  1.00 69.65  ? 17   ARG G CZ    1 
ATOM   4501  N  NH1   . ARG G  3 17  ? -7.103  -2.312  15.868  1.00 69.24  ? 17   ARG G NH1   1 
ATOM   4502  N  NH2   . ARG G  3 17  ? -5.136  -3.516  15.931  1.00 69.87  ? 17   ARG G NH2   1 
ATOM   4503  N  N     . SER G  3 18  ? -2.847  2.717   20.480  1.00 64.86  ? 18   SER G N     1 
ATOM   4504  C  CA    . SER G  3 18  ? -2.865  3.073   21.894  1.00 63.96  ? 18   SER G CA    1 
ATOM   4505  C  C     . SER G  3 18  ? -2.795  4.581   22.041  1.00 63.58  ? 18   SER G C     1 
ATOM   4506  O  O     . SER G  3 18  ? -3.646  5.188   22.689  1.00 63.42  ? 18   SER G O     1 
ATOM   4507  C  CB    . SER G  3 18  ? -1.706  2.408   22.635  1.00 63.71  ? 18   SER G CB    1 
ATOM   4508  O  OG    . SER G  3 18  ? -1.996  1.052   22.873  1.00 63.06  ? 18   SER G OG    1 
ATOM   4509  N  N     . SER G  3 19  ? -1.761  5.164   21.433  1.00 63.25  ? 19   SER G N     1 
ATOM   4510  C  CA    . SER G  3 19  ? -1.565  6.610   21.351  1.00 62.61  ? 19   SER G CA    1 
ATOM   4511  C  C     . SER G  3 19  ? -2.848  7.313   20.906  1.00 61.53  ? 19   SER G C     1 
ATOM   4512  O  O     . SER G  3 19  ? -3.317  8.226   21.574  1.00 60.87  ? 19   SER G O     1 
ATOM   4513  C  CB    . SER G  3 19  ? -0.401  6.908   20.396  1.00 63.02  ? 19   SER G CB    1 
ATOM   4514  O  OG    . SER G  3 19  ? -0.480  8.220   19.852  1.00 64.77  ? 19   SER G OG    1 
ATOM   4515  N  N     . ARG G  3 20  ? -3.420  6.853   19.796  1.00 60.78  ? 20   ARG G N     1 
ATOM   4516  C  CA    . ARG G  3 20  ? -4.721  7.325   19.329  1.00 60.63  ? 20   ARG G CA    1 
ATOM   4517  C  C     . ARG G  3 20  ? -5.794  7.296   20.402  1.00 60.10  ? 20   ARG G C     1 
ATOM   4518  O  O     . ARG G  3 20  ? -6.601  8.204   20.507  1.00 60.74  ? 20   ARG G O     1 
ATOM   4519  C  CB    . ARG G  3 20  ? -5.222  6.465   18.183  1.00 60.91  ? 20   ARG G CB    1 
ATOM   4520  C  CG    . ARG G  3 20  ? -4.608  6.749   16.858  1.00 63.00  ? 20   ARG G CG    1 
ATOM   4521  C  CD    . ARG G  3 20  ? -5.359  5.999   15.780  1.00 67.79  ? 20   ARG G CD    1 
ATOM   4522  N  NE    . ARG G  3 20  ? -4.741  6.260   14.487  1.00 73.20  ? 20   ARG G NE    1 
ATOM   4523  C  CZ    . ARG G  3 20  ? -3.901  5.436   13.865  1.00 74.82  ? 20   ARG G CZ    1 
ATOM   4524  N  NH1   . ARG G  3 20  ? -3.591  4.253   14.404  1.00 74.39  ? 20   ARG G NH1   1 
ATOM   4525  N  NH2   . ARG G  3 20  ? -3.385  5.799   12.688  1.00 75.76  ? 20   ARG G NH2   1 
ATOM   4526  N  N     . ALA G  3 21  ? -5.835  6.232   21.185  1.00 59.51  ? 21   ALA G N     1 
ATOM   4527  C  CA    . ALA G  3 21  ? -6.919  6.061   22.128  1.00 58.48  ? 21   ALA G CA    1 
ATOM   4528  C  C     . ALA G  3 21  ? -6.594  6.699   23.469  1.00 57.71  ? 21   ALA G C     1 
ATOM   4529  O  O     . ALA G  3 21  ? -7.468  6.833   24.323  1.00 57.72  ? 21   ALA G O     1 
ATOM   4530  C  CB    . ALA G  3 21  ? -7.211  4.592   22.286  1.00 58.98  ? 21   ALA G CB    1 
ATOM   4531  N  N     . GLY G  3 22  ? -5.334  7.080   23.648  1.00 56.73  ? 22   GLY G N     1 
ATOM   4532  C  CA    . GLY G  3 22  ? -4.877  7.706   24.879  1.00 55.91  ? 22   GLY G CA    1 
ATOM   4533  C  C     . GLY G  3 22  ? -4.499  6.710   25.951  1.00 55.31  ? 22   GLY G C     1 
ATOM   4534  O  O     . GLY G  3 22  ? -4.605  7.015   27.135  1.00 55.44  ? 22   GLY G O     1 
ATOM   4535  N  N     . LEU G  3 23  ? -4.023  5.535   25.536  1.00 54.72  ? 23   LEU G N     1 
ATOM   4536  C  CA    . LEU G  3 23  ? -3.833  4.394   26.442  1.00 53.83  ? 23   LEU G CA    1 
ATOM   4537  C  C     . LEU G  3 23  ? -2.403  3.862   26.545  1.00 53.65  ? 23   LEU G C     1 
ATOM   4538  O  O     . LEU G  3 23  ? -1.657  3.866   25.566  1.00 53.37  ? 23   LEU G O     1 
ATOM   4539  C  CB    . LEU G  3 23  ? -4.733  3.241   26.010  1.00 53.60  ? 23   LEU G CB    1 
ATOM   4540  C  CG    . LEU G  3 23  ? -6.235  3.474   25.926  1.00 53.37  ? 23   LEU G CG    1 
ATOM   4541  C  CD1   . LEU G  3 23  ? -6.806  2.407   25.052  1.00 53.05  ? 23   LEU G CD1   1 
ATOM   4542  C  CD2   . LEU G  3 23  ? -6.889  3.457   27.314  1.00 52.45  ? 23   LEU G CD2   1 
ATOM   4543  N  N     . GLN G  3 24  ? -2.055  3.380   27.740  1.00 53.57  ? 24   GLN G N     1 
ATOM   4544  C  CA    . GLN G  3 24  ? -0.826  2.619   27.984  1.00 53.83  ? 24   GLN G CA    1 
ATOM   4545  C  C     . GLN G  3 24  ? -0.938  1.151   27.545  1.00 53.48  ? 24   GLN G C     1 
ATOM   4546  O  O     . GLN G  3 24  ? 0.003   0.598   26.986  1.00 53.50  ? 24   GLN G O     1 
ATOM   4547  C  CB    . GLN G  3 24  ? -0.454  2.663   29.462  1.00 54.26  ? 24   GLN G CB    1 
ATOM   4548  C  CG    . GLN G  3 24  ? -0.293  4.069   30.044  1.00 56.80  ? 24   GLN G CG    1 
ATOM   4549  C  CD    . GLN G  3 24  ? 0.604   4.942   29.194  1.00 58.17  ? 24   GLN G CD    1 
ATOM   4550  O  OE1   . GLN G  3 24  ? 1.736   4.575   28.878  1.00 60.45  ? 24   GLN G OE1   1 
ATOM   4551  N  NE2   . GLN G  3 24  ? 0.097   6.100   28.814  1.00 57.77  ? 24   GLN G NE2   1 
ATOM   4552  N  N     . PHE G  3 25  ? -2.084  0.519   27.795  1.00 53.05  ? 25   PHE G N     1 
ATOM   4553  C  CA    . PHE G  3 25  ? -2.277  -0.872  27.394  1.00 52.79  ? 25   PHE G CA    1 
ATOM   4554  C  C     . PHE G  3 25  ? -2.341  -0.987  25.880  1.00 52.77  ? 25   PHE G C     1 
ATOM   4555  O  O     . PHE G  3 25  ? -2.713  -0.022  25.237  1.00 53.04  ? 25   PHE G O     1 
ATOM   4556  C  CB    . PHE G  3 25  ? -3.474  -1.503  28.115  1.00 52.18  ? 25   PHE G CB    1 
ATOM   4557  C  CG    . PHE G  3 25  ? -3.084  -2.181  29.394  1.00 51.68  ? 25   PHE G CG    1 
ATOM   4558  C  CD1   . PHE G  3 25  ? -2.329  -1.501  30.353  1.00 49.99  ? 25   PHE G CD1   1 
ATOM   4559  C  CD2   . PHE G  3 25  ? -3.416  -3.510  29.629  1.00 50.86  ? 25   PHE G CD2   1 
ATOM   4560  C  CE1   . PHE G  3 25  ? -1.933  -2.129  31.522  1.00 48.15  ? 25   PHE G CE1   1 
ATOM   4561  C  CE2   . PHE G  3 25  ? -3.021  -4.140  30.810  1.00 48.08  ? 25   PHE G CE2   1 
ATOM   4562  C  CZ    . PHE G  3 25  ? -2.285  -3.447  31.749  1.00 48.43  ? 25   PHE G CZ    1 
ATOM   4563  N  N     . PRO G  3 26  ? -1.950  -2.156  25.311  1.00 52.64  ? 26   PRO G N     1 
ATOM   4564  C  CA    . PRO G  3 26  ? -1.626  -2.219  23.897  1.00 52.05  ? 26   PRO G CA    1 
ATOM   4565  C  C     . PRO G  3 26  ? -2.786  -2.674  23.040  1.00 51.72  ? 26   PRO G C     1 
ATOM   4566  O  O     . PRO G  3 26  ? -3.041  -3.858  22.921  1.00 52.12  ? 26   PRO G O     1 
ATOM   4567  C  CB    . PRO G  3 26  ? -0.480  -3.246  23.856  1.00 51.91  ? 26   PRO G CB    1 
ATOM   4568  C  CG    . PRO G  3 26  ? -0.709  -4.133  25.028  1.00 52.02  ? 26   PRO G CG    1 
ATOM   4569  C  CD    . PRO G  3 26  ? -1.772  -3.482  25.929  1.00 52.71  ? 26   PRO G CD    1 
ATOM   4570  N  N     . VAL G  3 27  ? -3.464  -1.732  22.417  1.00 51.97  ? 27   VAL G N     1 
ATOM   4571  C  CA    . VAL G  3 27  ? -4.605  -2.042  21.560  1.00 52.31  ? 27   VAL G CA    1 
ATOM   4572  C  C     . VAL G  3 27  ? -4.304  -3.096  20.492  1.00 52.36  ? 27   VAL G C     1 
ATOM   4573  O  O     . VAL G  3 27  ? -5.142  -3.938  20.215  1.00 52.83  ? 27   VAL G O     1 
ATOM   4574  C  CB    . VAL G  3 27  ? -5.162  -0.761  20.918  1.00 52.58  ? 27   VAL G CB    1 
ATOM   4575  C  CG1   . VAL G  3 27  ? -6.360  -1.073  20.027  1.00 52.09  ? 27   VAL G CG1   1 
ATOM   4576  C  CG2   . VAL G  3 27  ? -5.510  0.259   22.017  1.00 52.20  ? 27   VAL G CG2   1 
ATOM   4577  N  N     . GLY G  3 28  ? -3.107  -3.054  19.912  1.00 52.50  ? 28   GLY G N     1 
ATOM   4578  C  CA    . GLY G  3 28  ? -2.703  -4.003  18.873  1.00 52.45  ? 28   GLY G CA    1 
ATOM   4579  C  C     . GLY G  3 28  ? -2.682  -5.445  19.338  1.00 52.70  ? 28   GLY G C     1 
ATOM   4580  O  O     . GLY G  3 28  ? -3.187  -6.332  18.638  1.00 52.36  ? 28   GLY G O     1 
ATOM   4581  N  N     . ARG G  3 29  ? -2.096  -5.673  20.520  1.00 52.85  ? 29   ARG G N     1 
ATOM   4582  C  CA    . ARG G  3 29  ? -2.065  -6.994  21.164  1.00 52.71  ? 29   ARG G CA    1 
ATOM   4583  C  C     . ARG G  3 29  ? -3.465  -7.471  21.573  1.00 53.20  ? 29   ARG G C     1 
ATOM   4584  O  O     . ARG G  3 29  ? -3.803  -8.647  21.389  1.00 53.41  ? 29   ARG G O     1 
ATOM   4585  C  CB    . ARG G  3 29  ? -1.146  -6.990  22.386  1.00 52.41  ? 29   ARG G CB    1 
ATOM   4586  C  CG    . ARG G  3 29  ? -0.791  -8.390  22.895  1.00 52.71  ? 29   ARG G CG    1 
ATOM   4587  C  CD    . ARG G  3 29  ? 0.230   -8.384  24.052  1.00 52.53  ? 29   ARG G CD    1 
ATOM   4588  N  NE    . ARG G  3 29  ? 1.591   -8.050  23.624  1.00 51.66  ? 29   ARG G NE    1 
ATOM   4589  C  CZ    . ARG G  3 29  ? 2.670   -8.099  24.404  1.00 51.63  ? 29   ARG G CZ    1 
ATOM   4590  N  NH1   . ARG G  3 29  ? 2.577   -8.491  25.670  1.00 51.62  ? 29   ARG G NH1   1 
ATOM   4591  N  NH2   . ARG G  3 29  ? 3.856   -7.775  23.909  1.00 51.08  ? 29   ARG G NH2   1 
ATOM   4592  N  N     . VAL G  3 30  ? -4.286  -6.569  22.116  1.00 53.25  ? 30   VAL G N     1 
ATOM   4593  C  CA    . VAL G  3 30  ? -5.635  -6.952  22.559  1.00 53.34  ? 30   VAL G CA    1 
ATOM   4594  C  C     . VAL G  3 30  ? -6.516  -7.353  21.360  1.00 54.19  ? 30   VAL G C     1 
ATOM   4595  O  O     . VAL G  3 30  ? -7.366  -8.234  21.474  1.00 54.10  ? 30   VAL G O     1 
ATOM   4596  C  CB    . VAL G  3 30  ? -6.293  -5.860  23.463  1.00 52.87  ? 30   VAL G CB    1 
ATOM   4597  C  CG1   . VAL G  3 30  ? -7.749  -6.177  23.741  1.00 52.54  ? 30   VAL G CG1   1 
ATOM   4598  C  CG2   . VAL G  3 30  ? -5.537  -5.728  24.787  1.00 51.31  ? 30   VAL G CG2   1 
ATOM   4599  N  N     . HIS G  3 31  ? -6.280  -6.720  20.211  1.00 55.01  ? 31   HIS G N     1 
ATOM   4600  C  CA    . HIS G  3 31  ? -7.032  -6.993  18.992  1.00 55.80  ? 31   HIS G CA    1 
ATOM   4601  C  C     . HIS G  3 31  ? -6.715  -8.398  18.534  1.00 56.11  ? 31   HIS G C     1 
ATOM   4602  O  O     . HIS G  3 31  ? -7.608  -9.170  18.183  1.00 56.22  ? 31   HIS G O     1 
ATOM   4603  C  CB    . HIS G  3 31  ? -6.605  -6.016  17.895  1.00 56.13  ? 31   HIS G CB    1 
ATOM   4604  C  CG    . HIS G  3 31  ? -7.527  -5.972  16.715  1.00 57.55  ? 31   HIS G CG    1 
ATOM   4605  N  ND1   . HIS G  3 31  ? -8.616  -6.807  16.582  1.00 59.57  ? 31   HIS G ND1   1 
ATOM   4606  C  CD2   . HIS G  3 31  ? -7.510  -5.199  15.602  1.00 59.01  ? 31   HIS G CD2   1 
ATOM   4607  C  CE1   . HIS G  3 31  ? -9.240  -6.537  15.447  1.00 60.44  ? 31   HIS G CE1   1 
ATOM   4608  N  NE2   . HIS G  3 31  ? -8.588  -5.565  14.833  1.00 60.03  ? 31   HIS G NE2   1 
ATOM   4609  N  N     . ARG G  3 32  ? -5.425  -8.712  18.542  1.00 56.46  ? 32   ARG G N     1 
ATOM   4610  C  CA    . ARG G  3 32  ? -4.916  -9.976  18.043  1.00 57.07  ? 32   ARG G CA    1 
ATOM   4611  C  C     . ARG G  3 32  ? -5.422  -11.137 18.890  1.00 57.35  ? 32   ARG G C     1 
ATOM   4612  O  O     . ARG G  3 32  ? -5.878  -12.138 18.349  1.00 57.29  ? 32   ARG G O     1 
ATOM   4613  C  CB    . ARG G  3 32  ? -3.393  -9.945  18.036  1.00 57.09  ? 32   ARG G CB    1 
ATOM   4614  C  CG    . ARG G  3 32  ? -2.731  -11.127 17.365  1.00 57.60  ? 32   ARG G CG    1 
ATOM   4615  C  CD    . ARG G  3 32  ? -1.256  -11.163 17.749  1.00 56.55  ? 32   ARG G CD    1 
ATOM   4616  N  NE    . ARG G  3 32  ? -1.115  -11.702 19.088  1.00 57.52  ? 32   ARG G NE    1 
ATOM   4617  C  CZ    . ARG G  3 32  ? -0.145  -11.387 19.932  1.00 58.55  ? 32   ARG G CZ    1 
ATOM   4618  N  NH1   . ARG G  3 32  ? 0.794   -10.519 19.589  1.00 58.75  ? 32   ARG G NH1   1 
ATOM   4619  N  NH2   . ARG G  3 32  ? -0.130  -11.938 21.134  1.00 59.82  ? 32   ARG G NH2   1 
ATOM   4620  N  N     . LEU G  3 33  ? -5.353  -10.983 20.211  1.00 57.74  ? 33   LEU G N     1 
ATOM   4621  C  CA    . LEU G  3 33  ? -5.833  -11.998 21.140  1.00 58.18  ? 33   LEU G CA    1 
ATOM   4622  C  C     . LEU G  3 33  ? -7.342  -12.201 21.057  1.00 58.67  ? 33   LEU G C     1 
ATOM   4623  O  O     . LEU G  3 33  ? -7.829  -13.314 21.255  1.00 59.32  ? 33   LEU G O     1 
ATOM   4624  C  CB    . LEU G  3 33  ? -5.423  -11.673 22.580  1.00 58.07  ? 33   LEU G CB    1 
ATOM   4625  C  CG    . LEU G  3 33  ? -3.925  -11.663 22.912  1.00 58.02  ? 33   LEU G CG    1 
ATOM   4626  C  CD1   . LEU G  3 33  ? -3.619  -10.834 24.165  1.00 57.33  ? 33   LEU G CD1   1 
ATOM   4627  C  CD2   . LEU G  3 33  ? -3.391  -13.061 23.065  1.00 57.83  ? 33   LEU G CD2   1 
ATOM   4628  N  N     . LEU G  3 34  ? -8.097  -11.155 20.764  1.00 59.03  ? 34   LEU G N     1 
ATOM   4629  C  CA    . LEU G  3 34  ? -9.527  -11.356 20.583  1.00 59.83  ? 34   LEU G CA    1 
ATOM   4630  C  C     . LEU G  3 34  ? -9.786  -12.212 19.341  1.00 61.09  ? 34   LEU G C     1 
ATOM   4631  O  O     . LEU G  3 34  ? -10.645 -13.098 19.362  1.00 61.49  ? 34   LEU G O     1 
ATOM   4632  C  CB    . LEU G  3 34  ? -10.281 -10.031 20.503  1.00 59.54  ? 34   LEU G CB    1 
ATOM   4633  C  CG    . LEU G  3 34  ? -10.588 -9.283  21.797  1.00 57.51  ? 34   LEU G CG    1 
ATOM   4634  C  CD1   . LEU G  3 34  ? -11.173 -7.941  21.469  1.00 55.66  ? 34   LEU G CD1   1 
ATOM   4635  C  CD2   . LEU G  3 34  ? -11.548 -10.068 22.652  1.00 56.23  ? 34   LEU G CD2   1 
ATOM   4636  N  N     . ARG G  3 35  ? -9.017  -11.962 18.280  1.00 62.29  ? 35   ARG G N     1 
ATOM   4637  C  CA    . ARG G  3 35  ? -9.126  -12.717 17.023  1.00 63.74  ? 35   ARG G CA    1 
ATOM   4638  C  C     . ARG G  3 35  ? -8.669  -14.189 17.135  1.00 63.47  ? 35   ARG G C     1 
ATOM   4639  O  O     . ARG G  3 35  ? -9.362  -15.095 16.687  1.00 63.92  ? 35   ARG G O     1 
ATOM   4640  C  CB    . ARG G  3 35  ? -8.391  -11.983 15.889  1.00 63.42  ? 35   ARG G CB    1 
ATOM   4641  C  CG    . ARG G  3 35  ? -9.139  -10.742 15.398  1.00 65.04  ? 35   ARG G CG    1 
ATOM   4642  C  CD    . ARG G  3 35  ? -8.474  -10.054 14.201  1.00 65.92  ? 35   ARG G CD    1 
ATOM   4643  N  NE    . ARG G  3 35  ? -7.346  -9.185  14.580  1.00 70.71  ? 35   ARG G NE    1 
ATOM   4644  C  CZ    . ARG G  3 35  ? -6.052  -9.487  14.417  1.00 71.75  ? 35   ARG G CZ    1 
ATOM   4645  N  NH1   . ARG G  3 35  ? -5.679  -10.651 13.874  1.00 71.04  ? 35   ARG G NH1   1 
ATOM   4646  N  NH2   . ARG G  3 35  ? -5.120  -8.619  14.806  1.00 72.67  ? 35   ARG G NH2   1 
ATOM   4647  N  N     . LYS G  3 36  ? -7.520  -14.419 17.757  1.00 63.42  ? 36   LYS G N     1 
ATOM   4648  C  CA    . LYS G  3 36  ? -6.933  -15.754 17.860  1.00 63.10  ? 36   LYS G CA    1 
ATOM   4649  C  C     . LYS G  3 36  ? -7.427  -16.520 19.097  1.00 62.24  ? 36   LYS G C     1 
ATOM   4650  O  O     . LYS G  3 36  ? -6.722  -17.381 19.630  1.00 62.71  ? 36   LYS G O     1 
ATOM   4651  C  CB    . LYS G  3 36  ? -5.397  -15.645 17.907  1.00 63.46  ? 36   LYS G CB    1 
ATOM   4652  C  CG    . LYS G  3 36  ? -4.761  -14.853 16.760  1.00 65.88  ? 36   LYS G CG    1 
ATOM   4653  C  CD    . LYS G  3 36  ? -4.658  -15.655 15.464  1.00 70.04  ? 36   LYS G CD    1 
ATOM   4654  C  CE    . LYS G  3 36  ? -3.501  -15.133 14.605  1.00 72.67  ? 36   LYS G CE    1 
ATOM   4655  N  NZ    . LYS G  3 36  ? -3.242  -15.978 13.380  1.00 75.36  ? 36   LYS G NZ    1 
ATOM   4656  N  N     . GLY G  3 37  ? -8.621  -16.201 19.572  1.00 60.98  ? 37   GLY G N     1 
ATOM   4657  C  CA    . GLY G  3 37  ? -9.139  -16.827 20.778  1.00 59.23  ? 37   GLY G CA    1 
ATOM   4658  C  C     . GLY G  3 37  ? -10.528 -17.379 20.545  1.00 58.57  ? 37   GLY G C     1 
ATOM   4659  O  O     . GLY G  3 37  ? -11.193 -17.824 21.483  1.00 58.33  ? 37   GLY G O     1 
ATOM   4660  N  N     . ASN G  3 38  ? -10.977 -17.326 19.289  1.00 57.89  ? 38   ASN G N     1 
ATOM   4661  C  CA    . ASN G  3 38  ? -12.200 -17.986 18.894  1.00 57.38  ? 38   ASN G CA    1 
ATOM   4662  C  C     . ASN G  3 38  ? -13.348 -17.498 19.738  1.00 56.52  ? 38   ASN G C     1 
ATOM   4663  O  O     . ASN G  3 38  ? -14.021 -18.294 20.387  1.00 56.99  ? 38   ASN G O     1 
ATOM   4664  C  CB    . ASN G  3 38  ? -12.054 -19.520 19.067  1.00 57.98  ? 38   ASN G CB    1 
ATOM   4665  C  CG    . ASN G  3 38  ? -11.062 -20.130 18.083  1.00 58.65  ? 38   ASN G CG    1 
ATOM   4666  O  OD1   . ASN G  3 38  ? -11.269 -20.082 16.863  1.00 58.59  ? 38   ASN G OD1   1 
ATOM   4667  N  ND2   . ASN G  3 38  ? -9.978  -20.698 18.608  1.00 57.64  ? 38   ASN G ND2   1 
ATOM   4668  N  N     . TYR G  3 39  ? -13.560 -16.187 19.762  1.00 55.52  ? 39   TYR G N     1 
ATOM   4669  C  CA    . TYR G  3 39  ? -14.654 -15.614 20.562  1.00 53.88  ? 39   TYR G CA    1 
ATOM   4670  C  C     . TYR G  3 39  ? -15.816 -15.319 19.640  1.00 54.17  ? 39   TYR G C     1 
ATOM   4671  O  O     . TYR G  3 39  ? -16.973 -15.434 20.038  1.00 53.95  ? 39   TYR G O     1 
ATOM   4672  C  CB    . TYR G  3 39  ? -14.193 -14.353 21.285  1.00 52.30  ? 39   TYR G CB    1 
ATOM   4673  C  CG    . TYR G  3 39  ? -13.108 -14.604 22.287  1.00 49.79  ? 39   TYR G CG    1 
ATOM   4674  C  CD1   . TYR G  3 39  ? -11.798 -14.247 22.021  1.00 47.52  ? 39   TYR G CD1   1 
ATOM   4675  C  CD2   . TYR G  3 39  ? -13.393 -15.207 23.509  1.00 47.38  ? 39   TYR G CD2   1 
ATOM   4676  C  CE1   . TYR G  3 39  ? -10.799 -14.484 22.960  1.00 48.43  ? 39   TYR G CE1   1 
ATOM   4677  C  CE2   . TYR G  3 39  ? -12.415 -15.443 24.440  1.00 46.12  ? 39   TYR G CE2   1 
ATOM   4678  C  CZ    . TYR G  3 39  ? -11.123 -15.094 24.167  1.00 47.95  ? 39   TYR G CZ    1 
ATOM   4679  O  OH    . TYR G  3 39  ? -10.151 -15.355 25.102  1.00 48.75  ? 39   TYR G OH    1 
ATOM   4680  N  N     . ALA G  3 40  ? -15.483 -14.943 18.404  1.00 54.63  ? 40   ALA G N     1 
ATOM   4681  C  CA    . ALA G  3 40  ? -16.449 -14.748 17.337  1.00 55.63  ? 40   ALA G CA    1 
ATOM   4682  C  C     . ALA G  3 40  ? -15.709 -14.647 16.017  1.00 56.53  ? 40   ALA G C     1 
ATOM   4683  O  O     . ALA G  3 40  ? -14.508 -14.386 15.988  1.00 55.92  ? 40   ALA G O     1 
ATOM   4684  C  CB    . ALA G  3 40  ? -17.271 -13.481 17.573  1.00 55.70  ? 40   ALA G CB    1 
ATOM   4685  N  N     . GLU G  3 41  ? -16.438 -14.844 14.925  1.00 58.14  ? 41   GLU G N     1 
ATOM   4686  C  CA    . GLU G  3 41  ? -15.874 -14.706 13.585  1.00 59.98  ? 41   GLU G CA    1 
ATOM   4687  C  C     . GLU G  3 41  ? -15.093 -13.392 13.469  1.00 60.06  ? 41   GLU G C     1 
ATOM   4688  O  O     . GLU G  3 41  ? -13.901 -13.389 13.159  1.00 60.12  ? 41   GLU G O     1 
ATOM   4689  C  CB    . GLU G  3 41  ? -16.994 -14.742 12.529  1.00 60.67  ? 41   GLU G CB    1 
ATOM   4690  C  CG    . GLU G  3 41  ? -17.904 -15.984 12.570  1.00 64.76  ? 41   GLU G CG    1 
ATOM   4691  C  CD    . GLU G  3 41  ? -17.525 -17.026 11.506  1.00 69.96  ? 41   GLU G CD    1 
ATOM   4692  O  OE1   . GLU G  3 41  ? -17.972 -16.877 10.337  1.00 70.83  ? 41   GLU G OE1   1 
ATOM   4693  O  OE2   . GLU G  3 41  ? -16.782 -17.992 11.845  1.00 71.74  ? 41   GLU G OE2   1 
ATOM   4694  N  N     . ARG G  3 42  ? -15.778 -12.282 13.752  1.00 60.33  ? 42   ARG G N     1 
ATOM   4695  C  CA    . ARG G  3 42  ? -15.260 -10.939 13.481  1.00 60.53  ? 42   ARG G CA    1 
ATOM   4696  C  C     . ARG G  3 42  ? -15.168 -10.100 14.753  1.00 59.95  ? 42   ARG G C     1 
ATOM   4697  O  O     . ARG G  3 42  ? -15.945 -10.298 15.686  1.00 60.45  ? 42   ARG G O     1 
ATOM   4698  C  CB    . ARG G  3 42  ? -16.157 -10.248 12.445  1.00 60.97  ? 42   ARG G CB    1 
ATOM   4699  C  CG    . ARG G  3 42  ? -16.568 -11.190 11.316  1.00 62.95  ? 42   ARG G CG    1 
ATOM   4700  C  CD    . ARG G  3 42  ? -17.821 -10.761 10.607  1.00 66.76  ? 42   ARG G CD    1 
ATOM   4701  N  NE    . ARG G  3 42  ? -17.511 -9.911  9.465   1.00 70.14  ? 42   ARG G NE    1 
ATOM   4702  C  CZ    . ARG G  3 42  ? -17.839 -8.625  9.374   1.00 72.78  ? 42   ARG G CZ    1 
ATOM   4703  N  NH1   . ARG G  3 42  ? -18.507 -8.025  10.361  1.00 73.29  ? 42   ARG G NH1   1 
ATOM   4704  N  NH2   . ARG G  3 42  ? -17.493 -7.935  8.287   1.00 74.30  ? 42   ARG G NH2   1 
ATOM   4705  N  N     . VAL G  3 43  ? -14.221 -9.167  14.776  1.00 59.02  ? 43   VAL G N     1 
ATOM   4706  C  CA    . VAL G  3 43  ? -13.995 -8.286  15.919  1.00 58.25  ? 43   VAL G CA    1 
ATOM   4707  C  C     . VAL G  3 43  ? -14.055 -6.819  15.483  1.00 57.99  ? 43   VAL G C     1 
ATOM   4708  O  O     . VAL G  3 43  ? -13.218 -6.361  14.700  1.00 58.10  ? 43   VAL G O     1 
ATOM   4709  C  CB    . VAL G  3 43  ? -12.607 -8.550  16.546  1.00 58.10  ? 43   VAL G CB    1 
ATOM   4710  C  CG1   . VAL G  3 43  ? -12.338 -7.618  17.708  1.00 56.55  ? 43   VAL G CG1   1 
ATOM   4711  C  CG2   . VAL G  3 43  ? -12.497 -9.987  16.983  1.00 58.70  ? 43   VAL G CG2   1 
ATOM   4712  N  N     . GLY G  3 44  ? -15.032 -6.084  16.002  1.00 57.41  ? 44   GLY G N     1 
ATOM   4713  C  CA    . GLY G  3 44  ? -15.175 -4.654  15.706  1.00 56.48  ? 44   GLY G CA    1 
ATOM   4714  C  C     . GLY G  3 44  ? -13.961 -3.815  16.056  1.00 55.77  ? 44   GLY G C     1 
ATOM   4715  O  O     . GLY G  3 44  ? -13.145 -4.206  16.885  1.00 55.94  ? 44   GLY G O     1 
ATOM   4716  N  N     . ALA G  3 45  ? -13.860 -2.642  15.437  1.00 55.25  ? 45   ALA G N     1 
ATOM   4717  C  CA    . ALA G  3 45  ? -12.712 -1.740  15.619  1.00 54.37  ? 45   ALA G CA    1 
ATOM   4718  C  C     . ALA G  3 45  ? -12.572 -1.164  17.036  1.00 53.43  ? 45   ALA G C     1 
ATOM   4719  O  O     . ALA G  3 45  ? -11.451 -0.951  17.517  1.00 53.63  ? 45   ALA G O     1 
ATOM   4720  C  CB    . ALA G  3 45  ? -12.776 -0.612  14.611  1.00 54.37  ? 45   ALA G CB    1 
ATOM   4721  N  N     . GLY G  3 46  ? -13.702 -0.900  17.686  1.00 51.87  ? 46   GLY G N     1 
ATOM   4722  C  CA    . GLY G  3 46  ? -13.692 -0.280  19.001  1.00 50.17  ? 46   GLY G CA    1 
ATOM   4723  C  C     . GLY G  3 46  ? -13.459 -1.255  20.140  1.00 49.29  ? 46   GLY G C     1 
ATOM   4724  O  O     . GLY G  3 46  ? -13.002 -0.851  21.217  1.00 49.25  ? 46   GLY G O     1 
ATOM   4725  N  N     . ALA G  3 47  ? -13.750 -2.539  19.891  1.00 47.94  ? 47   ALA G N     1 
ATOM   4726  C  CA    . ALA G  3 47  ? -13.728 -3.589  20.913  1.00 46.25  ? 47   ALA G CA    1 
ATOM   4727  C  C     . ALA G  3 47  ? -12.419 -3.743  21.679  1.00 45.40  ? 47   ALA G C     1 
ATOM   4728  O  O     . ALA G  3 47  ? -12.433 -3.679  22.902  1.00 45.16  ? 47   ALA G O     1 
ATOM   4729  C  CB    . ALA G  3 47  ? -14.137 -4.898  20.321  1.00 46.81  ? 47   ALA G CB    1 
ATOM   4730  N  N     . PRO G  3 48  ? -11.283 -3.933  20.976  1.00 44.73  ? 48   PRO G N     1 
ATOM   4731  C  CA    . PRO G  3 48  ? -10.014 -4.003  21.705  1.00 44.01  ? 48   PRO G CA    1 
ATOM   4732  C  C     . PRO G  3 48  ? -9.649  -2.694  22.363  1.00 43.96  ? 48   PRO G C     1 
ATOM   4733  O  O     . PRO G  3 48  ? -8.932  -2.708  23.388  1.00 44.87  ? 48   PRO G O     1 
ATOM   4734  C  CB    . PRO G  3 48  ? -8.985  -4.323  20.622  1.00 43.72  ? 48   PRO G CB    1 
ATOM   4735  C  CG    . PRO G  3 48  ? -9.592  -3.874  19.377  1.00 44.57  ? 48   PRO G CG    1 
ATOM   4736  C  CD    . PRO G  3 48  ? -11.079 -4.097  19.525  1.00 44.67  ? 48   PRO G CD    1 
ATOM   4737  N  N     . VAL G  3 49  ? -10.117 -1.572  21.796  1.00 43.08  ? 49   VAL G N     1 
ATOM   4738  C  CA    . VAL G  3 49  ? -9.905  -0.248  22.420  1.00 41.77  ? 49   VAL G CA    1 
ATOM   4739  C  C     . VAL G  3 49  ? -10.636 -0.220  23.756  1.00 41.14  ? 49   VAL G C     1 
ATOM   4740  O  O     . VAL G  3 49  ? -9.994  -0.026  24.798  1.00 40.56  ? 49   VAL G O     1 
ATOM   4741  C  CB    . VAL G  3 49  ? -10.320 0.949   21.492  1.00 41.80  ? 49   VAL G CB    1 
ATOM   4742  C  CG1   . VAL G  3 49  ? -10.158 2.268   22.202  1.00 40.54  ? 49   VAL G CG1   1 
ATOM   4743  C  CG2   . VAL G  3 49  ? -9.512  0.958   20.187  1.00 40.60  ? 49   VAL G CG2   1 
ATOM   4744  N  N     . TYR G  3 50  ? -11.952 -0.465  23.730  1.00 40.60  ? 50   TYR G N     1 
ATOM   4745  C  CA    . TYR G  3 50  ? -12.753 -0.487  24.956  1.00 40.57  ? 50   TYR G CA    1 
ATOM   4746  C  C     . TYR G  3 50  ? -12.101 -1.464  25.930  1.00 41.57  ? 50   TYR G C     1 
ATOM   4747  O  O     . TYR G  3 50  ? -11.940 -1.160  27.115  1.00 42.32  ? 50   TYR G O     1 
ATOM   4748  C  CB    . TYR G  3 50  ? -14.194 -0.900  24.667  1.00 39.73  ? 50   TYR G CB    1 
ATOM   4749  C  CG    . TYR G  3 50  ? -15.201 -0.538  25.718  1.00 38.88  ? 50   TYR G CG    1 
ATOM   4750  C  CD1   . TYR G  3 50  ? -16.303 0.220   25.387  1.00 38.99  ? 50   TYR G CD1   1 
ATOM   4751  C  CD2   . TYR G  3 50  ? -15.083 -0.977  27.032  1.00 38.73  ? 50   TYR G CD2   1 
ATOM   4752  C  CE1   . TYR G  3 50  ? -17.256 0.543   26.326  1.00 38.32  ? 50   TYR G CE1   1 
ATOM   4753  C  CE2   . TYR G  3 50  ? -16.047 -0.646  27.975  1.00 38.06  ? 50   TYR G CE2   1 
ATOM   4754  C  CZ    . TYR G  3 50  ? -17.129 0.108   27.596  1.00 38.51  ? 50   TYR G CZ    1 
ATOM   4755  O  OH    . TYR G  3 50  ? -18.109 0.454   28.476  1.00 39.28  ? 50   TYR G OH    1 
ATOM   4756  N  N     . LEU G  3 51  ? -11.679 -2.626  25.432  1.00 41.84  ? 51   LEU G N     1 
ATOM   4757  C  CA    . LEU G  3 51  ? -11.175 -3.646  26.327  1.00 41.75  ? 51   LEU G CA    1 
ATOM   4758  C  C     . LEU G  3 51  ? -9.799  -3.317  26.859  1.00 42.04  ? 51   LEU G C     1 
ATOM   4759  O  O     . LEU G  3 51  ? -9.554  -3.522  28.048  1.00 42.73  ? 51   LEU G O     1 
ATOM   4760  C  CB    . LEU G  3 51  ? -11.211 -5.030  25.698  1.00 42.07  ? 51   LEU G CB    1 
ATOM   4761  C  CG    . LEU G  3 51  ? -10.748 -6.247  26.505  1.00 41.86  ? 51   LEU G CG    1 
ATOM   4762  C  CD1   . LEU G  3 51  ? -11.366 -6.257  27.903  1.00 42.03  ? 51   LEU G CD1   1 
ATOM   4763  C  CD2   . LEU G  3 51  ? -11.115 -7.512  25.723  1.00 41.88  ? 51   LEU G CD2   1 
ATOM   4764  N  N     . ALA G  3 52  ? -8.897  -2.794  26.030  1.00 41.59  ? 52   ALA G N     1 
ATOM   4765  C  CA    . ALA G  3 52  ? -7.615  -2.367  26.598  1.00 41.51  ? 52   ALA G CA    1 
ATOM   4766  C  C     . ALA G  3 52  ? -7.807  -1.260  27.646  1.00 41.64  ? 52   ALA G C     1 
ATOM   4767  O  O     . ALA G  3 52  ? -7.086  -1.215  28.654  1.00 41.40  ? 52   ALA G O     1 
ATOM   4768  C  CB    . ALA G  3 52  ? -6.656  -1.944  25.540  1.00 41.75  ? 52   ALA G CB    1 
ATOM   4769  N  N     . ALA G  3 53  ? -8.803  -0.399  27.435  1.00 41.62  ? 53   ALA G N     1 
ATOM   4770  C  CA    . ALA G  3 53  ? -9.087  0.675   28.396  1.00 41.74  ? 53   ALA G CA    1 
ATOM   4771  C  C     . ALA G  3 53  ? -9.524  0.112   29.727  1.00 41.68  ? 53   ALA G C     1 
ATOM   4772  O  O     . ALA G  3 53  ? -9.126  0.603   30.791  1.00 41.13  ? 53   ALA G O     1 
ATOM   4773  C  CB    . ALA G  3 53  ? -10.130 1.636   27.862  1.00 41.69  ? 53   ALA G CB    1 
ATOM   4774  N  N     . VAL G  3 54  ? -10.349 -0.928  29.667  1.00 42.35  ? 54   VAL G N     1 
ATOM   4775  C  CA    . VAL G  3 54  ? -10.841 -1.561  30.902  1.00 42.38  ? 54   VAL G CA    1 
ATOM   4776  C  C     . VAL G  3 54  ? -9.722  -2.310  31.628  1.00 42.34  ? 54   VAL G C     1 
ATOM   4777  O  O     . VAL G  3 54  ? -9.617  -2.217  32.851  1.00 42.81  ? 54   VAL G O     1 
ATOM   4778  C  CB    . VAL G  3 54  ? -12.002 -2.473  30.652  1.00 42.11  ? 54   VAL G CB    1 
ATOM   4779  C  CG1   . VAL G  3 54  ? -12.384 -3.183  31.943  1.00 42.66  ? 54   VAL G CG1   1 
ATOM   4780  C  CG2   . VAL G  3 54  ? -13.163 -1.668  30.074  1.00 41.93  ? 54   VAL G CG2   1 
ATOM   4781  N  N     . LEU G  3 55  ? -8.865  -3.004  30.887  1.00 41.99  ? 55   LEU G N     1 
ATOM   4782  C  CA    . LEU G  3 55  ? -7.766  -3.705  31.518  1.00 42.25  ? 55   LEU G CA    1 
ATOM   4783  C  C     . LEU G  3 55  ? -6.819  -2.741  32.211  1.00 42.76  ? 55   LEU G C     1 
ATOM   4784  O  O     . LEU G  3 55  ? -6.370  -3.021  33.306  1.00 43.30  ? 55   LEU G O     1 
ATOM   4785  C  CB    . LEU G  3 55  ? -7.028  -4.590  30.527  1.00 42.06  ? 55   LEU G CB    1 
ATOM   4786  C  CG    . LEU G  3 55  ? -7.819  -5.778  29.977  1.00 42.21  ? 55   LEU G CG    1 
ATOM   4787  C  CD1   . LEU G  3 55  ? -6.947  -6.509  29.003  1.00 42.55  ? 55   LEU G CD1   1 
ATOM   4788  C  CD2   . LEU G  3 55  ? -8.315  -6.716  31.088  1.00 41.66  ? 55   LEU G CD2   1 
ATOM   4789  N  N     . GLU G  3 56  ? -6.560  -1.592  31.587  1.00 43.42  ? 56   GLU G N     1 
ATOM   4790  C  CA    . GLU G  3 56  ? -5.708  -0.533  32.140  1.00 43.83  ? 56   GLU G CA    1 
ATOM   4791  C  C     . GLU G  3 56  ? -6.310  0.123   33.381  1.00 42.39  ? 56   GLU G C     1 
ATOM   4792  O  O     . GLU G  3 56  ? -5.597  0.415   34.340  1.00 43.43  ? 56   GLU G O     1 
ATOM   4793  C  CB    . GLU G  3 56  ? -5.454  0.536   31.078  1.00 43.76  ? 56   GLU G CB    1 
ATOM   4794  C  CG    . GLU G  3 56  ? -4.360  1.564   31.425  1.00 46.02  ? 56   GLU G CG    1 
ATOM   4795  C  CD    . GLU G  3 56  ? -4.034  2.471   30.223  1.00 47.54  ? 56   GLU G CD    1 
ATOM   4796  O  OE1   . GLU G  3 56  ? -4.077  1.958   29.071  1.00 53.24  ? 56   GLU G OE1   1 
ATOM   4797  O  OE2   . GLU G  3 56  ? -3.753  3.689   30.412  1.00 51.16  ? 56   GLU G OE2   1 
ATOM   4798  N  N     . TYR G  3 57  ? -7.607  0.367   33.375  1.00 40.69  ? 57   TYR G N     1 
ATOM   4799  C  CA    . TYR G  3 57  ? -8.243  0.931   34.544  1.00 39.42  ? 57   TYR G CA    1 
ATOM   4800  C  C     . TYR G  3 57  ? -8.093  0.007   35.733  1.00 38.77  ? 57   TYR G C     1 
ATOM   4801  O  O     . TYR G  3 57  ? -7.627  0.452   36.801  1.00 38.09  ? 57   TYR G O     1 
ATOM   4802  C  CB    . TYR G  3 57  ? -9.709  1.205   34.272  1.00 39.87  ? 57   TYR G CB    1 
ATOM   4803  C  CG    . TYR G  3 57  ? -10.526 1.449   35.498  1.00 40.35  ? 57   TYR G CG    1 
ATOM   4804  C  CD1   . TYR G  3 57  ? -10.334 2.584   36.280  1.00 42.11  ? 57   TYR G CD1   1 
ATOM   4805  C  CD2   . TYR G  3 57  ? -11.520 0.559   35.866  1.00 41.93  ? 57   TYR G CD2   1 
ATOM   4806  C  CE1   . TYR G  3 57  ? -11.110 2.808   37.415  1.00 42.31  ? 57   TYR G CE1   1 
ATOM   4807  C  CE2   . TYR G  3 57  ? -12.296 0.769   36.977  1.00 41.07  ? 57   TYR G CE2   1 
ATOM   4808  C  CZ    . TYR G  3 57  ? -12.090 1.890   37.744  1.00 42.33  ? 57   TYR G CZ    1 
ATOM   4809  O  OH    . TYR G  3 57  ? -12.885 2.078   38.854  1.00 44.04  ? 57   TYR G OH    1 
ATOM   4810  N  N     . LEU G  3 58  ? -8.453  -1.276  35.559  1.00 37.89  ? 58   LEU G N     1 
ATOM   4811  C  CA    . LEU G  3 58  ? -8.406  -2.219  36.704  1.00 37.35  ? 58   LEU G CA    1 
ATOM   4812  C  C     . LEU G  3 58  ? -7.002  -2.446  37.238  1.00 37.74  ? 58   LEU G C     1 
ATOM   4813  O  O     . LEU G  3 58  ? -6.821  -2.524  38.462  1.00 37.17  ? 58   LEU G O     1 
ATOM   4814  C  CB    . LEU G  3 58  ? -9.086  -3.542  36.427  1.00 36.99  ? 58   LEU G CB    1 
ATOM   4815  C  CG    . LEU G  3 58  ? -10.599 -3.431  36.253  1.00 36.01  ? 58   LEU G CG    1 
ATOM   4816  C  CD1   . LEU G  3 58  ? -11.090 -4.639  35.440  1.00 32.77  ? 58   LEU G CD1   1 
ATOM   4817  C  CD2   . LEU G  3 58  ? -11.299 -3.271  37.604  1.00 33.17  ? 58   LEU G CD2   1 
ATOM   4818  N  N     . THR G  3 59  ? -6.001  -2.491  36.353  1.00 37.53  ? 59   THR G N     1 
ATOM   4819  C  CA    . THR G  3 59  ? -4.665  -2.605  36.866  1.00 38.17  ? 59   THR G CA    1 
ATOM   4820  C  C     . THR G  3 59  ? -4.233  -1.342  37.616  1.00 38.82  ? 59   THR G C     1 
ATOM   4821  O  O     . THR G  3 59  ? -3.449  -1.428  38.566  1.00 38.89  ? 59   THR G O     1 
ATOM   4822  C  CB    . THR G  3 59  ? -3.615  -3.071  35.828  1.00 38.22  ? 59   THR G CB    1 
ATOM   4823  O  OG1   . THR G  3 59  ? -2.611  -2.065  35.636  1.00 40.76  ? 59   THR G OG1   1 
ATOM   4824  C  CG2   . THR G  3 59  ? -4.232  -3.434  34.544  1.00 37.17  ? 59   THR G CG2   1 
ATOM   4825  N  N     . ALA G  3 60  ? -4.742  -0.172  37.210  1.00 39.67  ? 60   ALA G N     1 
ATOM   4826  C  CA    . ALA G  3 60  ? -4.365  1.090   37.885  1.00 39.39  ? 60   ALA G CA    1 
ATOM   4827  C  C     . ALA G  3 60  ? -5.010  1.151   39.260  1.00 39.90  ? 60   ALA G C     1 
ATOM   4828  O  O     . ALA G  3 60  ? -4.386  1.597   40.235  1.00 39.67  ? 60   ALA G O     1 
ATOM   4829  C  CB    . ALA G  3 60  ? -4.753  2.252   37.084  1.00 39.20  ? 60   ALA G CB    1 
ATOM   4830  N  N     . GLU G  3 61  ? -6.239  0.661   39.351  1.00 40.27  ? 61   GLU G N     1 
ATOM   4831  C  CA    . GLU G  3 61  ? -6.928  0.607   40.637  1.00 41.47  ? 61   GLU G CA    1 
ATOM   4832  C  C     . GLU G  3 61  ? -6.289  -0.371  41.635  1.00 41.19  ? 61   GLU G C     1 
ATOM   4833  O  O     . GLU G  3 61  ? -6.305  -0.119  42.836  1.00 42.56  ? 61   GLU G O     1 
ATOM   4834  C  CB    . GLU G  3 61  ? -8.405  0.316   40.421  1.00 41.80  ? 61   GLU G CB    1 
ATOM   4835  C  CG    . GLU G  3 61  ? -9.193  0.066   41.657  1.00 47.68  ? 61   GLU G CG    1 
ATOM   4836  C  CD    . GLU G  3 61  ? -9.550  1.331   42.439  1.00 56.67  ? 61   GLU G CD    1 
ATOM   4837  O  OE1   . GLU G  3 61  ? -9.218  2.461   41.989  1.00 60.58  ? 61   GLU G OE1   1 
ATOM   4838  O  OE2   . GLU G  3 61  ? -10.189 1.186   43.517  1.00 60.07  ? 61   GLU G OE2   1 
ATOM   4839  N  N     . ILE G  3 62  ? -5.702  -1.471  41.167  1.00 40.67  ? 62   ILE G N     1 
ATOM   4840  C  CA    . ILE G  3 62  ? -5.039  -2.412  42.091  1.00 39.59  ? 62   ILE G CA    1 
ATOM   4841  C  C     . ILE G  3 62  ? -3.664  -1.895  42.463  1.00 38.57  ? 62   ILE G C     1 
ATOM   4842  O  O     . ILE G  3 62  ? -3.328  -1.862  43.631  1.00 37.88  ? 62   ILE G O     1 
ATOM   4843  C  CB    . ILE G  3 62  ? -4.930  -3.869  41.523  1.00 39.99  ? 62   ILE G CB    1 
ATOM   4844  C  CG1   . ILE G  3 62  ? -6.291  -4.400  41.216  1.00 40.37  ? 62   ILE G CG1   1 
ATOM   4845  C  CG2   . ILE G  3 62  ? -4.368  -4.863  42.539  1.00 39.20  ? 62   ILE G CG2   1 
ATOM   4846  C  CD1   . ILE G  3 62  ? -6.189  -5.714  40.621  1.00 44.92  ? 62   ILE G CD1   1 
ATOM   4847  N  N     . LEU G  3 63  ? -2.864  -1.513  41.469  1.00 38.32  ? 63   LEU G N     1 
ATOM   4848  C  CA    . LEU G  3 63  ? -1.557  -0.911  41.745  1.00 38.62  ? 63   LEU G CA    1 
ATOM   4849  C  C     . LEU G  3 63  ? -1.651  0.319   42.666  1.00 39.59  ? 63   LEU G C     1 
ATOM   4850  O  O     . LEU G  3 63  ? -0.883  0.442   43.589  1.00 39.36  ? 63   LEU G O     1 
ATOM   4851  C  CB    . LEU G  3 63  ? -0.843  -0.556  40.465  1.00 37.34  ? 63   LEU G CB    1 
ATOM   4852  C  CG    . LEU G  3 63  ? -0.532  -1.711  39.549  1.00 37.51  ? 63   LEU G CG    1 
ATOM   4853  C  CD1   . LEU G  3 63  ? -0.014  -1.149  38.258  1.00 38.29  ? 63   LEU G CD1   1 
ATOM   4854  C  CD2   . LEU G  3 63  ? 0.480   -2.718  40.155  1.00 36.28  ? 63   LEU G CD2   1 
ATOM   4855  N  N     . GLU G  3 64  ? -2.598  1.216   42.421  1.00 40.85  ? 64   GLU G N     1 
ATOM   4856  C  CA    . GLU G  3 64  ? -2.876  2.272   43.372  1.00 42.75  ? 64   GLU G CA    1 
ATOM   4857  C  C     . GLU G  3 64  ? -3.038  1.712   44.771  1.00 42.80  ? 64   GLU G C     1 
ATOM   4858  O  O     . GLU G  3 64  ? -2.318  2.093   45.671  1.00 43.72  ? 64   GLU G O     1 
ATOM   4859  C  CB    . GLU G  3 64  ? -4.124  3.059   42.945  1.00 43.75  ? 64   GLU G CB    1 
ATOM   4860  C  CG    . GLU G  3 64  ? -4.682  4.039   43.967  1.00 48.58  ? 64   GLU G CG    1 
ATOM   4861  C  CD    . GLU G  3 64  ? -3.815  5.298   44.179  1.00 54.70  ? 64   GLU G CD    1 
ATOM   4862  O  OE1   . GLU G  3 64  ? -4.310  6.256   44.855  1.00 57.49  ? 64   GLU G OE1   1 
ATOM   4863  O  OE2   . GLU G  3 64  ? -2.656  5.332   43.690  1.00 54.39  ? 64   GLU G OE2   1 
ATOM   4864  N  N     . LEU G  3 65  ? -3.963  0.780   44.963  1.00 43.23  ? 65   LEU G N     1 
ATOM   4865  C  CA    . LEU G  3 65  ? -4.269  0.283   46.314  1.00 42.52  ? 65   LEU G CA    1 
ATOM   4866  C  C     . LEU G  3 65  ? -3.146  -0.558  46.935  1.00 42.21  ? 65   LEU G C     1 
ATOM   4867  O  O     . LEU G  3 65  ? -3.023  -0.624  48.163  1.00 42.87  ? 65   LEU G O     1 
ATOM   4868  C  CB    . LEU G  3 65  ? -5.588  -0.478  46.316  1.00 42.16  ? 65   LEU G CB    1 
ATOM   4869  C  CG    . LEU G  3 65  ? -6.881  0.343   46.275  1.00 42.89  ? 65   LEU G CG    1 
ATOM   4870  C  CD1   . LEU G  3 65  ? -8.128  -0.542  46.148  1.00 44.87  ? 65   LEU G CD1   1 
ATOM   4871  C  CD2   . LEU G  3 65  ? -6.997  1.165   47.507  1.00 41.55  ? 65   LEU G CD2   1 
ATOM   4872  N  N     . ALA G  3 66  ? -2.331  -1.193  46.104  1.00 41.41  ? 66   ALA G N     1 
ATOM   4873  C  CA    . ALA G  3 66  ? -1.239  -2.018  46.609  1.00 41.32  ? 66   ALA G CA    1 
ATOM   4874  C  C     . ALA G  3 66  ? -0.105  -1.136  47.025  1.00 40.97  ? 66   ALA G C     1 
ATOM   4875  O  O     . ALA G  3 66  ? 0.484   -1.370  48.061  1.00 40.91  ? 66   ALA G O     1 
ATOM   4876  C  CB    . ALA G  3 66  ? -0.770  -3.007  45.564  1.00 41.60  ? 66   ALA G CB    1 
ATOM   4877  N  N     . GLY G  3 67  ? 0.192   -0.137  46.187  1.00 41.39  ? 67   GLY G N     1 
ATOM   4878  C  CA    . GLY G  3 67  ? 1.069   1.018   46.479  1.00 40.59  ? 67   GLY G CA    1 
ATOM   4879  C  C     . GLY G  3 67  ? 0.878   1.601   47.865  1.00 40.78  ? 67   GLY G C     1 
ATOM   4880  O  O     . GLY G  3 67  ? 1.848   1.779   48.592  1.00 40.25  ? 67   GLY G O     1 
ATOM   4881  N  N     . ASN G  3 68  ? -0.364  1.885   48.245  1.00 41.40  ? 68   ASN G N     1 
ATOM   4882  C  CA    . ASN G  3 68  ? -0.626  2.441   49.556  1.00 43.11  ? 68   ASN G CA    1 
ATOM   4883  C  C     . ASN G  3 68  ? -0.191  1.479   50.613  1.00 44.90  ? 68   ASN G C     1 
ATOM   4884  O  O     . ASN G  3 68  ? 0.398   1.876   51.629  1.00 46.10  ? 68   ASN G O     1 
ATOM   4885  C  CB    . ASN G  3 68  ? -2.097  2.771   49.745  1.00 42.75  ? 68   ASN G CB    1 
ATOM   4886  C  CG    . ASN G  3 68  ? -2.566  3.876   48.828  1.00 43.62  ? 68   ASN G CG    1 
ATOM   4887  O  OD1   . ASN G  3 68  ? -1.753  4.611   48.254  1.00 44.79  ? 68   ASN G OD1   1 
ATOM   4888  N  ND2   . ASN G  3 68  ? -3.883  3.997   48.669  1.00 44.09  ? 68   ASN G ND2   1 
ATOM   4889  N  N     . ALA G  3 69  ? -0.454  0.199   50.350  1.00 46.54  ? 69   ALA G N     1 
ATOM   4890  C  CA    . ALA G  3 69  ? -0.190  -0.877  51.281  1.00 47.34  ? 69   ALA G CA    1 
ATOM   4891  C  C     . ALA G  3 69  ? 1.304   -1.087  51.479  1.00 48.45  ? 69   ALA G C     1 
ATOM   4892  O  O     . ALA G  3 69  ? 1.736   -1.295  52.601  1.00 48.94  ? 69   ALA G O     1 
ATOM   4893  C  CB    . ALA G  3 69  ? -0.848  -2.137  50.804  1.00 47.56  ? 69   ALA G CB    1 
ATOM   4894  N  N     . ALA G  3 70  ? 2.086   -1.036  50.404  1.00 49.58  ? 70   ALA G N     1 
ATOM   4895  C  CA    . ALA G  3 70  ? 3.528   -1.089  50.514  1.00 51.49  ? 70   ALA G CA    1 
ATOM   4896  C  C     . ALA G  3 70  ? 4.059   0.075   51.372  1.00 53.98  ? 70   ALA G C     1 
ATOM   4897  O  O     . ALA G  3 70  ? 4.940   -0.134  52.213  1.00 54.07  ? 70   ALA G O     1 
ATOM   4898  C  CB    . ALA G  3 70  ? 4.146   -1.072  49.153  1.00 50.88  ? 70   ALA G CB    1 
ATOM   4899  N  N     . ARG G  3 71  ? 3.508   1.285   51.182  1.00 56.75  ? 71   ARG G N     1 
ATOM   4900  C  CA    . ARG G  3 71  ? 3.917   2.466   51.945  1.00 59.31  ? 71   ARG G CA    1 
ATOM   4901  C  C     . ARG G  3 71  ? 3.516   2.387   53.422  1.00 60.56  ? 71   ARG G C     1 
ATOM   4902  O  O     . ARG G  3 71  ? 4.327   2.698   54.294  1.00 60.56  ? 71   ARG G O     1 
ATOM   4903  C  CB    . ARG G  3 71  ? 3.361   3.738   51.319  1.00 60.23  ? 71   ARG G CB    1 
ATOM   4904  C  CG    . ARG G  3 71  ? 4.058   5.028   51.776  1.00 62.98  ? 71   ARG G CG    1 
ATOM   4905  C  CD    . ARG G  3 71  ? 3.103   6.235   51.812  1.00 68.49  ? 71   ARG G CD    1 
ATOM   4906  N  NE    . ARG G  3 71  ? 3.530   7.203   52.840  1.00 73.16  ? 71   ARG G NE    1 
ATOM   4907  C  CZ    . ARG G  3 71  ? 2.949   8.381   53.101  1.00 74.06  ? 71   ARG G CZ    1 
ATOM   4908  N  NH1   . ARG G  3 71  ? 1.875   8.800   52.426  1.00 74.29  ? 71   ARG G NH1   1 
ATOM   4909  N  NH2   . ARG G  3 71  ? 3.446   9.145   54.064  1.00 74.44  ? 71   ARG G NH2   1 
ATOM   4910  N  N     . ASP G  3 72  ? 2.285   1.965   53.707  1.00 62.04  ? 72   ASP G N     1 
ATOM   4911  C  CA    . ASP G  3 72  ? 1.866   1.671   55.096  1.00 63.97  ? 72   ASP G CA    1 
ATOM   4912  C  C     . ASP G  3 72  ? 2.725   0.643   55.841  1.00 64.35  ? 72   ASP G C     1 
ATOM   4913  O  O     . ASP G  3 72  ? 2.679   0.564   57.067  1.00 64.62  ? 72   ASP G O     1 
ATOM   4914  C  CB    . ASP G  3 72  ? 0.430   1.158   55.125  1.00 64.50  ? 72   ASP G CB    1 
ATOM   4915  C  CG    . ASP G  3 72  ? -0.552  2.167   54.609  1.00 67.96  ? 72   ASP G CG    1 
ATOM   4916  O  OD1   . ASP G  3 72  ? -0.105  3.245   54.127  1.00 71.77  ? 72   ASP G OD1   1 
ATOM   4917  O  OD2   . ASP G  3 72  ? -1.771  1.884   54.688  1.00 71.63  ? 72   ASP G OD2   1 
ATOM   4918  N  N     . ASN G  3 73  ? 3.460   -0.173  55.097  1.00 64.86  ? 73   ASN G N     1 
ATOM   4919  C  CA    . ASN G  3 73  ? 4.295   -1.204  55.674  1.00 65.72  ? 73   ASN G CA    1 
ATOM   4920  C  C     . ASN G  3 73  ? 5.740   -0.798  55.472  1.00 65.88  ? 73   ASN G C     1 
ATOM   4921  O  O     . ASN G  3 73  ? 6.632   -1.646  55.340  1.00 66.37  ? 73   ASN G O     1 
ATOM   4922  C  CB    . ASN G  3 73  ? 4.009   -2.557  55.004  1.00 66.13  ? 73   ASN G CB    1 
ATOM   4923  C  CG    . ASN G  3 73  ? 2.629   -3.109  55.360  1.00 68.04  ? 73   ASN G CG    1 
ATOM   4924  O  OD1   . ASN G  3 73  ? 2.433   -3.690  56.438  1.00 70.04  ? 73   ASN G OD1   1 
ATOM   4925  N  ND2   . ASN G  3 73  ? 1.663   -2.928  54.456  1.00 68.47  ? 73   ASN G ND2   1 
ATOM   4926  N  N     . LYS G  3 74  ? 5.953   0.515   55.417  1.00 65.96  ? 74   LYS G N     1 
ATOM   4927  C  CA    . LYS G  3 74  ? 7.283   1.119   55.231  1.00 65.80  ? 74   LYS G CA    1 
ATOM   4928  C  C     . LYS G  3 74  ? 8.098   0.479   54.106  1.00 64.59  ? 74   LYS G C     1 
ATOM   4929  O  O     . LYS G  3 74  ? 9.286   0.245   54.277  1.00 64.76  ? 74   LYS G O     1 
ATOM   4930  C  CB    . LYS G  3 74  ? 8.068   1.063   56.551  1.00 66.06  ? 74   LYS G CB    1 
ATOM   4931  C  CG    . LYS G  3 74  ? 7.537   1.991   57.653  1.00 67.16  ? 74   LYS G CG    1 
ATOM   4932  C  CD    . LYS G  3 74  ? 8.217   1.716   59.014  1.00 67.28  ? 74   LYS G CD    1 
ATOM   4933  C  CE    . LYS G  3 74  ? 8.088   2.925   59.955  1.00 68.84  ? 74   LYS G CE    1 
ATOM   4934  N  NZ    . LYS G  3 74  ? 8.227   2.553   61.393  1.00 68.24  ? 74   LYS G NZ    1 
ATOM   4935  N  N     . LYS G  3 75  ? 7.462   0.193   52.970  1.00 63.60  ? 75   LYS G N     1 
ATOM   4936  C  CA    . LYS G  3 75  ? 8.129   -0.502  51.854  1.00 62.82  ? 75   LYS G CA    1 
ATOM   4937  C  C     . LYS G  3 75  ? 8.023   0.253   50.548  1.00 61.68  ? 75   LYS G C     1 
ATOM   4938  O  O     . LYS G  3 75  ? 7.027   0.921   50.268  1.00 62.06  ? 75   LYS G O     1 
ATOM   4939  C  CB    . LYS G  3 75  ? 7.540   -1.902  51.624  1.00 63.46  ? 75   LYS G CB    1 
ATOM   4940  C  CG    . LYS G  3 75  ? 7.814   -2.921  52.704  1.00 65.01  ? 75   LYS G CG    1 
ATOM   4941  C  CD    . LYS G  3 75  ? 9.224   -3.477  52.599  1.00 68.14  ? 75   LYS G CD    1 
ATOM   4942  C  CE    . LYS G  3 75  ? 9.488   -4.420  53.748  1.00 69.75  ? 75   LYS G CE    1 
ATOM   4943  N  NZ    . LYS G  3 75  ? 9.092   -3.750  55.026  1.00 71.69  ? 75   LYS G NZ    1 
ATOM   4944  N  N     . THR G  3 76  ? 9.033   0.067   49.717  1.00 59.77  ? 76   THR G N     1 
ATOM   4945  C  CA    . THR G  3 76  ? 9.214   0.845   48.518  1.00 57.86  ? 76   THR G CA    1 
ATOM   4946  C  C     . THR G  3 76  ? 8.800   0.038   47.304  1.00 56.55  ? 76   THR G C     1 
ATOM   4947  O  O     . THR G  3 76  ? 8.444   0.581   46.256  1.00 56.64  ? 76   THR G O     1 
ATOM   4948  C  CB    . THR G  3 76  ? 10.718  1.259   48.444  1.00 58.34  ? 76   THR G CB    1 
ATOM   4949  O  OG1   . THR G  3 76  ? 10.912  2.464   49.204  1.00 58.41  ? 76   THR G OG1   1 
ATOM   4950  C  CG2   . THR G  3 76  ? 11.251  1.422   46.989  1.00 57.79  ? 76   THR G CG2   1 
ATOM   4951  N  N     . ARG G  3 77  ? 8.867   -1.276  47.443  1.00 54.72  ? 77   ARG G N     1 
ATOM   4952  C  CA    . ARG G  3 77  ? 8.680   -2.172  46.311  1.00 52.99  ? 77   ARG G CA    1 
ATOM   4953  C  C     . ARG G  3 77  ? 7.475   -3.028  46.603  1.00 50.63  ? 77   ARG G C     1 
ATOM   4954  O  O     . ARG G  3 77  ? 7.305   -3.460  47.735  1.00 50.53  ? 77   ARG G O     1 
ATOM   4955  C  CB    . ARG G  3 77  ? 9.915   -3.023  46.141  1.00 53.49  ? 77   ARG G CB    1 
ATOM   4956  C  CG    . ARG G  3 77  ? 9.969   -3.810  44.889  1.00 56.57  ? 77   ARG G CG    1 
ATOM   4957  C  CD    . ARG G  3 77  ? 11.183  -4.692  44.974  1.00 62.57  ? 77   ARG G CD    1 
ATOM   4958  N  NE    . ARG G  3 77  ? 12.416  -3.928  44.781  1.00 66.96  ? 77   ARG G NE    1 
ATOM   4959  C  CZ    . ARG G  3 77  ? 13.617  -4.314  45.215  1.00 69.38  ? 77   ARG G CZ    1 
ATOM   4960  N  NH1   . ARG G  3 77  ? 13.765  -5.456  45.892  1.00 70.41  ? 77   ARG G NH1   1 
ATOM   4961  N  NH2   . ARG G  3 77  ? 14.675  -3.554  44.968  1.00 70.01  ? 77   ARG G NH2   1 
ATOM   4962  N  N     . ILE G  3 78  ? 6.618   -3.228  45.604  1.00 48.01  ? 78   ILE G N     1 
ATOM   4963  C  CA    . ILE G  3 78  ? 5.377   -3.982  45.802  1.00 45.86  ? 78   ILE G CA    1 
ATOM   4964  C  C     . ILE G  3 78  ? 5.612   -5.499  45.719  1.00 44.83  ? 78   ILE G C     1 
ATOM   4965  O  O     . ILE G  3 78  ? 6.283   -5.991  44.804  1.00 44.85  ? 78   ILE G O     1 
ATOM   4966  C  CB    . ILE G  3 78  ? 4.296   -3.557  44.804  1.00 45.80  ? 78   ILE G CB    1 
ATOM   4967  C  CG1   . ILE G  3 78  ? 3.759   -2.180  45.188  1.00 44.36  ? 78   ILE G CG1   1 
ATOM   4968  C  CG2   . ILE G  3 78  ? 3.173   -4.622  44.701  1.00 44.89  ? 78   ILE G CG2   1 
ATOM   4969  C  CD1   . ILE G  3 78  ? 2.774   -1.626  44.239  1.00 40.81  ? 78   ILE G CD1   1 
ATOM   4970  N  N     . ILE G  3 79  ? 5.090   -6.220  46.704  1.00 42.97  ? 79   ILE G N     1 
ATOM   4971  C  CA    . ILE G  3 79  ? 5.178   -7.676  46.733  1.00 41.39  ? 79   ILE G CA    1 
ATOM   4972  C  C     . ILE G  3 79  ? 3.761   -8.276  46.795  1.00 40.57  ? 79   ILE G C     1 
ATOM   4973  O  O     . ILE G  3 79  ? 2.797   -7.538  47.033  1.00 41.81  ? 79   ILE G O     1 
ATOM   4974  C  CB    . ILE G  3 79  ? 6.074   -8.166  47.926  1.00 41.56  ? 79   ILE G CB    1 
ATOM   4975  C  CG1   . ILE G  3 79  ? 5.372   -7.959  49.272  1.00 39.95  ? 79   ILE G CG1   1 
ATOM   4976  C  CG2   . ILE G  3 79  ? 7.441   -7.499  47.865  1.00 40.93  ? 79   ILE G CG2   1 
ATOM   4977  C  CD1   . ILE G  3 79  ? 6.171   -8.392  50.468  1.00 39.65  ? 79   ILE G CD1   1 
ATOM   4978  N  N     . PRO G  3 80  ? 3.611   -9.606  46.591  1.00 38.85  ? 80   PRO G N     1 
ATOM   4979  C  CA    . PRO G  3 80  ? 2.282   -10.239 46.636  1.00 37.10  ? 80   PRO G CA    1 
ATOM   4980  C  C     . PRO G  3 80  ? 1.463   -9.995  47.904  1.00 35.92  ? 80   PRO G C     1 
ATOM   4981  O  O     . PRO G  3 80  ? 0.261   -9.879  47.812  1.00 35.17  ? 80   PRO G O     1 
ATOM   4982  C  CB    . PRO G  3 80  ? 2.609   -11.710 46.497  1.00 37.16  ? 80   PRO G CB    1 
ATOM   4983  C  CG    . PRO G  3 80  ? 3.870   -11.713 45.725  1.00 37.73  ? 80   PRO G CG    1 
ATOM   4984  C  CD    . PRO G  3 80  ? 4.656   -10.596 46.276  1.00 38.44  ? 80   PRO G CD    1 
ATOM   4985  N  N     . ARG G  3 81  ? 2.081   -9.900  49.072  1.00 35.26  ? 81   ARG G N     1 
ATOM   4986  C  CA    . ARG G  3 81  ? 1.318   -9.539  50.272  1.00 35.16  ? 81   ARG G CA    1 
ATOM   4987  C  C     . ARG G  3 81  ? 0.642   -8.152  50.137  1.00 35.46  ? 81   ARG G C     1 
ATOM   4988  O  O     . ARG G  3 81  ? -0.470  -7.925  50.690  1.00 36.01  ? 81   ARG G O     1 
ATOM   4989  C  CB    . ARG G  3 81  ? 2.179   -9.641  51.538  1.00 34.51  ? 81   ARG G CB    1 
ATOM   4990  C  CG    . ARG G  3 81  ? 1.768   -8.707  52.620  1.00 35.86  ? 81   ARG G CG    1 
ATOM   4991  C  CD    . ARG G  3 81  ? 1.445   -9.374  53.955  1.00 37.22  ? 81   ARG G CD    1 
ATOM   4992  N  NE    . ARG G  3 81  ? 0.230   -10.143 53.815  1.00 39.81  ? 81   ARG G NE    1 
ATOM   4993  C  CZ    . ARG G  3 81  ? -0.586  -10.503 54.805  1.00 40.99  ? 81   ARG G CZ    1 
ATOM   4994  N  NH1   . ARG G  3 81  ? -0.341  -10.152 56.063  1.00 37.14  ? 81   ARG G NH1   1 
ATOM   4995  N  NH2   . ARG G  3 81  ? -1.667  -11.234 54.510  1.00 41.34  ? 81   ARG G NH2   1 
ATOM   4996  N  N     . HIS G  3 82  ? 1.267   -7.232  49.395  1.00 34.44  ? 82   HIS G N     1 
ATOM   4997  C  CA    . HIS G  3 82  ? 0.655   -5.909  49.219  1.00 34.03  ? 82   HIS G CA    1 
ATOM   4998  C  C     . HIS G  3 82  ? -0.554  -5.978  48.318  1.00 34.23  ? 82   HIS G C     1 
ATOM   4999  O  O     . HIS G  3 82  ? -1.573  -5.323  48.590  1.00 33.99  ? 82   HIS G O     1 
ATOM   5000  C  CB    . HIS G  3 82  ? 1.646   -4.855  48.726  1.00 33.50  ? 82   HIS G CB    1 
ATOM   5001  C  CG    . HIS G  3 82  ? 2.857   -4.736  49.589  1.00 31.88  ? 82   HIS G CG    1 
ATOM   5002  N  ND1   . HIS G  3 82  ? 4.136   -4.693  49.073  1.00 30.34  ? 82   HIS G ND1   1 
ATOM   5003  C  CD2   . HIS G  3 82  ? 2.990   -4.714  50.936  1.00 29.92  ? 82   HIS G CD2   1 
ATOM   5004  C  CE1   . HIS G  3 82  ? 5.006   -4.625  50.067  1.00 29.55  ? 82   HIS G CE1   1 
ATOM   5005  N  NE2   . HIS G  3 82  ? 4.337   -4.641  51.205  1.00 29.44  ? 82   HIS G NE2   1 
ATOM   5006  N  N     . LEU G  3 83  ? -0.441  -6.762  47.248  1.00 34.15  ? 83   LEU G N     1 
ATOM   5007  C  CA    . LEU G  3 83  ? -1.607  -7.038  46.407  1.00 34.57  ? 83   LEU G CA    1 
ATOM   5008  C  C     . LEU G  3 83  ? -2.727  -7.740  47.210  1.00 34.91  ? 83   LEU G C     1 
ATOM   5009  O  O     . LEU G  3 83  ? -3.924  -7.455  47.041  1.00 35.39  ? 83   LEU G O     1 
ATOM   5010  C  CB    . LEU G  3 83  ? -1.199  -7.842  45.172  1.00 34.39  ? 83   LEU G CB    1 
ATOM   5011  C  CG    . LEU G  3 83  ? -0.303  -7.067  44.191  1.00 34.52  ? 83   LEU G CG    1 
ATOM   5012  C  CD1   . LEU G  3 83  ? 0.537   -7.974  43.298  1.00 36.66  ? 83   LEU G CD1   1 
ATOM   5013  C  CD2   . LEU G  3 83  ? -1.125  -6.161  43.333  1.00 32.72  ? 83   LEU G CD2   1 
ATOM   5014  N  N     . GLN G  3 84  ? -2.339  -8.619  48.124  1.00 34.66  ? 84   GLN G N     1 
ATOM   5015  C  CA    . GLN G  3 84  ? -3.322  -9.364  48.853  1.00 34.73  ? 84   GLN G CA    1 
ATOM   5016  C  C     . GLN G  3 84  ? -4.047  -8.440  49.812  1.00 34.50  ? 84   GLN G C     1 
ATOM   5017  O  O     . GLN G  3 84  ? -5.275  -8.391  49.775  1.00 33.88  ? 84   GLN G O     1 
ATOM   5018  C  CB    . GLN G  3 84  ? -2.707  -10.591 49.533  1.00 34.80  ? 84   GLN G CB    1 
ATOM   5019  C  CG    . GLN G  3 84  ? -3.591  -11.237 50.580  1.00 36.84  ? 84   GLN G CG    1 
ATOM   5020  C  CD    . GLN G  3 84  ? -4.751  -12.071 50.016  1.00 40.26  ? 84   GLN G CD    1 
ATOM   5021  O  OE1   . GLN G  3 84  ? -5.293  -12.926 50.731  1.00 42.43  ? 84   GLN G OE1   1 
ATOM   5022  N  NE2   . GLN G  3 84  ? -5.146  -11.827 48.754  1.00 38.49  ? 84   GLN G NE2   1 
ATOM   5023  N  N     . LEU G  3 85  ? -3.299  -7.692  50.633  1.00 34.73  ? 85   LEU G N     1 
ATOM   5024  C  CA    . LEU G  3 85  ? -3.885  -6.650  51.508  1.00 35.14  ? 85   LEU G CA    1 
ATOM   5025  C  C     . LEU G  3 85  ? -4.768  -5.656  50.738  1.00 35.71  ? 85   LEU G C     1 
ATOM   5026  O  O     . LEU G  3 85  ? -5.887  -5.343  51.192  1.00 36.03  ? 85   LEU G O     1 
ATOM   5027  C  CB    . LEU G  3 85  ? -2.805  -5.883  52.275  1.00 35.32  ? 85   LEU G CB    1 
ATOM   5028  C  CG    . LEU G  3 85  ? -1.974  -6.656  53.315  1.00 35.39  ? 85   LEU G CG    1 
ATOM   5029  C  CD1   . LEU G  3 85  ? -0.858  -5.773  53.948  1.00 29.63  ? 85   LEU G CD1   1 
ATOM   5030  C  CD2   . LEU G  3 85  ? -2.893  -7.305  54.373  1.00 32.69  ? 85   LEU G CD2   1 
ATOM   5031  N  N     . ALA G  3 86  ? -4.287  -5.195  49.575  1.00 35.47  ? 86   ALA G N     1 
ATOM   5032  C  CA    . ALA G  3 86  ? -5.050  -4.314  48.717  1.00 35.97  ? 86   ALA G CA    1 
ATOM   5033  C  C     . ALA G  3 86  ? -6.375  -4.930  48.355  1.00 37.02  ? 86   ALA G C     1 
ATOM   5034  O  O     . ALA G  3 86  ? -7.418  -4.391  48.705  1.00 37.86  ? 86   ALA G O     1 
ATOM   5035  C  CB    . ALA G  3 86  ? -4.283  -3.994  47.464  1.00 36.38  ? 86   ALA G CB    1 
ATOM   5036  N  N     . VAL G  3 87  ? -6.347  -6.073  47.673  1.00 37.75  ? 87   VAL G N     1 
ATOM   5037  C  CA    . VAL G  3 87  ? -7.572  -6.718  47.201  1.00 37.88  ? 87   VAL G CA    1 
ATOM   5038  C  C     . VAL G  3 87  ? -8.589  -7.005  48.338  1.00 38.74  ? 87   VAL G C     1 
ATOM   5039  O  O     . VAL G  3 87  ? -9.778  -6.744  48.189  1.00 38.65  ? 87   VAL G O     1 
ATOM   5040  C  CB    . VAL G  3 87  ? -7.220  -7.975  46.387  1.00 37.94  ? 87   VAL G CB    1 
ATOM   5041  C  CG1   . VAL G  3 87  ? -8.447  -8.881  46.130  1.00 38.47  ? 87   VAL G CG1   1 
ATOM   5042  C  CG2   . VAL G  3 87  ? -6.542  -7.579  45.084  1.00 37.13  ? 87   VAL G CG2   1 
ATOM   5043  N  N     . ARG G  3 88  ? -8.143  -7.507  49.482  1.00 39.55  ? 88   ARG G N     1 
ATOM   5044  C  CA    . ARG G  3 88  ? -9.119  -7.995  50.456  1.00 40.77  ? 88   ARG G CA    1 
ATOM   5045  C  C     . ARG G  3 88  ? -9.628  -6.885  51.371  1.00 41.68  ? 88   ARG G C     1 
ATOM   5046  O  O     . ARG G  3 88  ? -10.692 -7.004  51.960  1.00 42.08  ? 88   ARG G O     1 
ATOM   5047  C  CB    . ARG G  3 88  ? -8.632  -9.239  51.266  1.00 40.53  ? 88   ARG G CB    1 
ATOM   5048  C  CG    . ARG G  3 88  ? -7.583  -10.125 50.602  1.00 40.24  ? 88   ARG G CG    1 
ATOM   5049  C  CD    . ARG G  3 88  ? -8.029  -11.457 49.906  1.00 39.03  ? 88   ARG G CD    1 
ATOM   5050  N  NE    . ARG G  3 88  ? -9.180  -11.463 48.994  1.00 37.69  ? 88   ARG G NE    1 
ATOM   5051  C  CZ    . ARG G  3 88  ? -9.248  -12.143 47.832  1.00 36.88  ? 88   ARG G CZ    1 
ATOM   5052  N  NH1   . ARG G  3 88  ? -8.198  -12.814 47.355  1.00 30.82  ? 88   ARG G NH1   1 
ATOM   5053  N  NH2   . ARG G  3 88  ? -10.379 -12.116 47.106  1.00 35.68  ? 88   ARG G NH2   1 
ATOM   5054  N  N     . ASN G  3 89  ? -8.884  -5.797  51.509  1.00 43.33  ? 89   ASN G N     1 
ATOM   5055  C  CA    . ASN G  3 89  ? -9.444  -4.634  52.232  1.00 44.35  ? 89   ASN G CA    1 
ATOM   5056  C  C     . ASN G  3 89  ? -10.389 -3.764  51.408  1.00 45.37  ? 89   ASN G C     1 
ATOM   5057  O  O     . ASN G  3 89  ? -10.983 -2.866  51.964  1.00 46.22  ? 89   ASN G O     1 
ATOM   5058  C  CB    . ASN G  3 89  ? -8.347  -3.758  52.802  1.00 44.09  ? 89   ASN G CB    1 
ATOM   5059  C  CG    . ASN G  3 89  ? -7.722  -4.355  54.031  1.00 43.39  ? 89   ASN G CG    1 
ATOM   5060  O  OD1   . ASN G  3 89  ? -8.417  -4.721  54.983  1.00 44.06  ? 89   ASN G OD1   1 
ATOM   5061  N  ND2   . ASN G  3 89  ? -6.408  -4.461  54.024  1.00 40.21  ? 89   ASN G ND2   1 
ATOM   5062  N  N     . ASP G  3 90  ? -10.518 -4.034  50.106  1.00 46.40  ? 90   ASP G N     1 
ATOM   5063  C  CA    . ASP G  3 90  ? -11.402 -3.317  49.209  1.00 47.59  ? 90   ASP G CA    1 
ATOM   5064  C  C     . ASP G  3 90  ? -12.627 -4.134  48.804  1.00 48.51  ? 90   ASP G C     1 
ATOM   5065  O  O     . ASP G  3 90  ? -12.551 -4.971  47.910  1.00 48.79  ? 90   ASP G O     1 
ATOM   5066  C  CB    . ASP G  3 90  ? -10.634 -2.951  47.948  1.00 48.02  ? 90   ASP G CB    1 
ATOM   5067  C  CG    . ASP G  3 90  ? -11.400 -1.965  47.055  1.00 50.66  ? 90   ASP G CG    1 
ATOM   5068  O  OD1   . ASP G  3 90  ? -11.569 -0.785  47.444  1.00 52.62  ? 90   ASP G OD1   1 
ATOM   5069  O  OD2   . ASP G  3 90  ? -11.826 -2.364  45.951  1.00 53.69  ? 90   ASP G OD2   1 
ATOM   5070  N  N     . GLU G  3 91  ? -13.765 -3.864  49.432  1.00 49.63  ? 91   GLU G N     1 
ATOM   5071  C  CA    . GLU G  3 91  ? -15.032 -4.553  49.145  1.00 51.51  ? 91   GLU G CA    1 
ATOM   5072  C  C     . GLU G  3 91  ? -15.260 -4.988  47.685  1.00 50.76  ? 91   GLU G C     1 
ATOM   5073  O  O     . GLU G  3 91  ? -15.795 -6.059  47.438  1.00 51.39  ? 91   GLU G O     1 
ATOM   5074  C  CB    . GLU G  3 91  ? -16.215 -3.691  49.613  1.00 51.21  ? 91   GLU G CB    1 
ATOM   5075  C  CG    . GLU G  3 91  ? -17.320 -4.460  50.358  1.00 54.52  ? 91   GLU G CG    1 
ATOM   5076  C  CD    . GLU G  3 91  ? -18.567 -3.601  50.657  1.00 55.94  ? 91   GLU G CD    1 
ATOM   5077  O  OE1   . GLU G  3 91  ? -19.482 -3.560  49.787  1.00 61.27  ? 91   GLU G OE1   1 
ATOM   5078  O  OE2   . GLU G  3 91  ? -18.640 -2.976  51.760  1.00 60.84  ? 91   GLU G OE2   1 
ATOM   5079  N  N     . GLU G  3 92  ? -14.858 -4.172  46.721  1.00 50.54  ? 92   GLU G N     1 
ATOM   5080  C  CA    . GLU G  3 92  ? -15.190 -4.441  45.327  1.00 50.43  ? 92   GLU G CA    1 
ATOM   5081  C  C     . GLU G  3 92  ? -14.160 -5.290  44.586  1.00 49.09  ? 92   GLU G C     1 
ATOM   5082  O  O     . GLU G  3 92  ? -14.521 -6.180  43.815  1.00 49.27  ? 92   GLU G O     1 
ATOM   5083  C  CB    . GLU G  3 92  ? -15.513 -3.145  44.577  1.00 50.22  ? 92   GLU G CB    1 
ATOM   5084  C  CG    . GLU G  3 92  ? -16.960 -2.653  44.840  1.00 52.39  ? 92   GLU G CG    1 
ATOM   5085  C  CD    . GLU G  3 92  ? -17.457 -1.628  43.822  1.00 53.97  ? 92   GLU G CD    1 
ATOM   5086  O  OE1   . GLU G  3 92  ? -16.609 -1.038  43.099  1.00 59.71  ? 92   GLU G OE1   1 
ATOM   5087  O  OE2   . GLU G  3 92  ? -18.699 -1.411  43.735  1.00 58.32  ? 92   GLU G OE2   1 
ATOM   5088  N  N     . LEU G  3 93  ? -12.877 -5.021  44.800  1.00 48.09  ? 93   LEU G N     1 
ATOM   5089  C  CA    . LEU G  3 93  ? -11.845 -5.877  44.241  1.00 46.63  ? 93   LEU G CA    1 
ATOM   5090  C  C     . LEU G  3 93  ? -11.974 -7.246  44.872  1.00 46.42  ? 93   LEU G C     1 
ATOM   5091  O  O     . LEU G  3 93  ? -11.935 -8.261  44.182  1.00 46.15  ? 93   LEU G O     1 
ATOM   5092  C  CB    . LEU G  3 93  ? -10.477 -5.320  44.544  1.00 46.32  ? 93   LEU G CB    1 
ATOM   5093  C  CG    . LEU G  3 93  ? -9.975  -4.174  43.685  1.00 45.08  ? 93   LEU G CG    1 
ATOM   5094  C  CD1   . LEU G  3 93  ? -8.617  -3.849  44.223  1.00 45.99  ? 93   LEU G CD1   1 
ATOM   5095  C  CD2   . LEU G  3 93  ? -9.896  -4.542  42.220  1.00 43.10  ? 93   LEU G CD2   1 
ATOM   5096  N  N     . ASN G  3 94  ? -12.163 -7.257  46.195  1.00 45.90  ? 94   ASN G N     1 
ATOM   5097  C  CA    . ASN G  3 94  ? -12.361 -8.487  46.926  1.00 45.07  ? 94   ASN G CA    1 
ATOM   5098  C  C     . ASN G  3 94  ? -13.458 -9.351  46.369  1.00 44.94  ? 94   ASN G C     1 
ATOM   5099  O  O     . ASN G  3 94  ? -13.365 -10.573 46.454  1.00 45.88  ? 94   ASN G O     1 
ATOM   5100  C  CB    . ASN G  3 94  ? -12.628 -8.257  48.410  1.00 44.83  ? 94   ASN G CB    1 
ATOM   5101  C  CG    . ASN G  3 94  ? -12.756 -9.583  49.181  1.00 44.09  ? 94   ASN G CG    1 
ATOM   5102  O  OD1   . ASN G  3 94  ? -11.955 -10.506 49.005  1.00 42.81  ? 94   ASN G OD1   1 
ATOM   5103  N  ND2   . ASN G  3 94  ? -13.779 -9.686  49.994  1.00 43.93  ? 94   ASN G ND2   1 
ATOM   5104  N  N     . LYS G  3 95  ? -14.501 -8.738  45.829  1.00 44.34  ? 95   LYS G N     1 
ATOM   5105  C  CA    . LYS G  3 95  ? -15.599 -9.498  45.263  1.00 44.13  ? 95   LYS G CA    1 
ATOM   5106  C  C     . LYS G  3 95  ? -15.237 -9.988  43.883  1.00 43.51  ? 95   LYS G C     1 
ATOM   5107  O  O     . LYS G  3 95  ? -15.440 -11.160 43.555  1.00 44.17  ? 95   LYS G O     1 
ATOM   5108  C  CB    . LYS G  3 95  ? -16.881 -8.704  45.223  1.00 44.26  ? 95   LYS G CB    1 
ATOM   5109  C  CG    . LYS G  3 95  ? -18.068 -9.551  44.873  1.00 47.64  ? 95   LYS G CG    1 
ATOM   5110  C  CD    . LYS G  3 95  ? -19.356 -8.802  45.191  1.00 55.22  ? 95   LYS G CD    1 
ATOM   5111  C  CE    . LYS G  3 95  ? -20.469 -9.127  44.176  1.00 57.35  ? 95   LYS G CE    1 
ATOM   5112  N  NZ    . LYS G  3 95  ? -21.741 -8.395  44.547  1.00 60.34  ? 95   LYS G NZ    1 
ATOM   5113  N  N     . LEU G  3 96  ? -14.670 -9.106  43.080  1.00 42.66  ? 96   LEU G N     1 
ATOM   5114  C  CA    . LEU G  3 96  ? -14.188 -9.492  41.758  1.00 41.36  ? 96   LEU G CA    1 
ATOM   5115  C  C     . LEU G  3 96  ? -13.222 -10.685 41.840  1.00 41.25  ? 96   LEU G C     1 
ATOM   5116  O  O     . LEU G  3 96  ? -13.130 -11.482 40.921  1.00 42.36  ? 96   LEU G O     1 
ATOM   5117  C  CB    . LEU G  3 96  ? -13.527 -8.286  41.059  1.00 40.37  ? 96   LEU G CB    1 
ATOM   5118  C  CG    . LEU G  3 96  ? -12.982 -8.570  39.670  1.00 38.37  ? 96   LEU G CG    1 
ATOM   5119  C  CD1   . LEU G  3 96  ? -14.103 -8.945  38.733  1.00 37.49  ? 96   LEU G CD1   1 
ATOM   5120  C  CD2   . LEU G  3 96  ? -12.228 -7.414  39.151  1.00 37.18  ? 96   LEU G CD2   1 
ATOM   5121  N  N     . LEU G  3 97  ? -12.484 -10.802 42.926  1.00 40.57  ? 97   LEU G N     1 
ATOM   5122  C  CA    . LEU G  3 97  ? -11.511 -11.860 43.024  1.00 40.45  ? 97   LEU G CA    1 
ATOM   5123  C  C     . LEU G  3 97  ? -11.869 -12.717 44.212  1.00 40.81  ? 97   LEU G C     1 
ATOM   5124  O  O     . LEU G  3 97  ? -10.993 -13.142 44.990  1.00 41.19  ? 97   LEU G O     1 
ATOM   5125  C  CB    . LEU G  3 97  ? -10.102 -11.298 43.181  1.00 40.13  ? 97   LEU G CB    1 
ATOM   5126  C  CG    . LEU G  3 97  ? -9.623  -10.337 42.096  1.00 39.99  ? 97   LEU G CG    1 
ATOM   5127  C  CD1   . LEU G  3 97  ? -8.161  -10.009 42.361  1.00 38.99  ? 97   LEU G CD1   1 
ATOM   5128  C  CD2   . LEU G  3 97  ? -9.842  -10.911 40.702  1.00 38.39  ? 97   LEU G CD2   1 
ATOM   5129  N  N     . GLY G  3 98  ? -13.165 -12.940 44.373  1.00 40.57  ? 98   GLY G N     1 
ATOM   5130  C  CA    . GLY G  3 98  ? -13.644 -13.717 45.490  1.00 40.95  ? 98   GLY G CA    1 
ATOM   5131  C  C     . GLY G  3 98  ? -13.186 -15.161 45.432  1.00 40.96  ? 98   GLY G C     1 
ATOM   5132  O  O     . GLY G  3 98  ? -13.065 -15.785 46.452  1.00 41.45  ? 98   GLY G O     1 
ATOM   5133  N  N     . ARG G  3 99  ? -12.922 -15.676 44.235  1.00 40.95  ? 99   ARG G N     1 
ATOM   5134  C  CA    . ARG G  3 99  ? -12.562 -17.075 44.040  1.00 40.44  ? 99   ARG G CA    1 
ATOM   5135  C  C     . ARG G  3 99  ? -11.129 -17.190 43.532  1.00 39.58  ? 99   ARG G C     1 
ATOM   5136  O  O     . ARG G  3 99  ? -10.825 -18.062 42.709  1.00 40.03  ? 99   ARG G O     1 
ATOM   5137  C  CB    . ARG G  3 99  ? -13.523 -17.717 43.031  1.00 41.00  ? 99   ARG G CB    1 
ATOM   5138  C  CG    . ARG G  3 99  ? -14.958 -17.878 43.559  1.00 45.06  ? 99   ARG G CG    1 
ATOM   5139  C  CD    . ARG G  3 99  ? -15.003 -19.105 44.486  1.00 54.43  ? 99   ARG G CD    1 
ATOM   5140  N  NE    . ARG G  3 99  ? -15.693 -18.903 45.763  1.00 58.07  ? 99   ARG G NE    1 
ATOM   5141  C  CZ    . ARG G  3 99  ? -15.463 -19.648 46.847  1.00 61.36  ? 99   ARG G CZ    1 
ATOM   5142  N  NH1   . ARG G  3 99  ? -14.546 -20.614 46.789  1.00 62.91  ? 99   ARG G NH1   1 
ATOM   5143  N  NH2   . ARG G  3 99  ? -16.136 -19.433 47.985  1.00 61.41  ? 99   ARG G NH2   1 
ATOM   5144  N  N     . VAL G  3 100 ? -10.244 -16.315 44.006  1.00 37.62  ? 100  VAL G N     1 
ATOM   5145  C  CA    . VAL G  3 100 ? -8.887  -16.269 43.484  1.00 36.18  ? 100  VAL G CA    1 
ATOM   5146  C  C     . VAL G  3 100 ? -7.878  -16.364 44.621  1.00 35.75  ? 100  VAL G C     1 
ATOM   5147  O  O     . VAL G  3 100 ? -8.164  -15.969 45.756  1.00 35.25  ? 100  VAL G O     1 
ATOM   5148  C  CB    . VAL G  3 100 ? -8.677  -14.997 42.618  1.00 36.55  ? 100  VAL G CB    1 
ATOM   5149  C  CG1   . VAL G  3 100 ? -7.214  -14.802 42.229  1.00 36.20  ? 100  VAL G CG1   1 
ATOM   5150  C  CG2   . VAL G  3 100 ? -9.552  -15.061 41.356  1.00 36.16  ? 100  VAL G CG2   1 
ATOM   5151  N  N     . THR G  3 101 ? -6.714  -16.930 44.327  1.00 35.49  ? 101  THR G N     1 
ATOM   5152  C  CA    . THR G  3 101 ? -5.691  -17.097 45.329  1.00 35.93  ? 101  THR G CA    1 
ATOM   5153  C  C     . THR G  3 101 ? -4.479  -16.384 44.834  1.00 36.86  ? 101  THR G C     1 
ATOM   5154  O  O     . THR G  3 101 ? -3.970  -16.658 43.741  1.00 37.27  ? 101  THR G O     1 
ATOM   5155  C  CB    . THR G  3 101 ? -5.331  -18.584 45.614  1.00 36.00  ? 101  THR G CB    1 
ATOM   5156  O  OG1   . THR G  3 101 ? -6.436  -19.220 46.275  1.00 37.55  ? 101  THR G OG1   1 
ATOM   5157  C  CG2   . THR G  3 101 ? -4.062  -18.716 46.503  1.00 32.57  ? 101  THR G CG2   1 
ATOM   5158  N  N     . ILE G  3 102 ? -4.009  -15.458 45.653  1.00 37.26  ? 102  ILE G N     1 
ATOM   5159  C  CA    . ILE G  3 102 ? -2.820  -14.759 45.303  1.00 37.33  ? 102  ILE G CA    1 
ATOM   5160  C  C     . ILE G  3 102 ? -1.726  -15.503 45.985  1.00 37.33  ? 102  ILE G C     1 
ATOM   5161  O  O     . ILE G  3 102 ? -1.663  -15.541 47.211  1.00 37.09  ? 102  ILE G O     1 
ATOM   5162  C  CB    . ILE G  3 102 ? -2.906  -13.273 45.700  1.00 37.42  ? 102  ILE G CB    1 
ATOM   5163  C  CG1   . ILE G  3 102 ? -4.066  -12.648 44.944  1.00 36.29  ? 102  ILE G CG1   1 
ATOM   5164  C  CG2   . ILE G  3 102 ? -1.578  -12.565 45.405  1.00 37.04  ? 102  ILE G CG2   1 
ATOM   5165  C  CD1   . ILE G  3 102 ? -4.301  -11.253 45.302  1.00 40.33  ? 102  ILE G CD1   1 
ATOM   5166  N  N     . ALA G  3 103 ? -0.891  -16.137 45.178  1.00 38.23  ? 103  ALA G N     1 
ATOM   5167  C  CA    . ALA G  3 103 ? 0.269   -16.858 45.699  1.00 39.95  ? 103  ALA G CA    1 
ATOM   5168  C  C     . ALA G  3 103 ? 1.110   -15.960 46.614  1.00 40.81  ? 103  ALA G C     1 
ATOM   5169  O  O     . ALA G  3 103 ? 1.474   -14.859 46.227  1.00 42.54  ? 103  ALA G O     1 
ATOM   5170  C  CB    . ALA G  3 103 ? 1.109   -17.397 44.547  1.00 39.55  ? 103  ALA G CB    1 
ATOM   5171  N  N     . GLN G  3 104 ? 1.415   -16.421 47.818  1.00 41.47  ? 104  GLN G N     1 
ATOM   5172  C  CA    . GLN G  3 104 ? 2.284   -15.680 48.755  1.00 42.34  ? 104  GLN G CA    1 
ATOM   5173  C  C     . GLN G  3 104 ? 1.676   -14.369 49.276  1.00 42.12  ? 104  GLN G C     1 
ATOM   5174  O  O     . GLN G  3 104 ? 2.400   -13.434 49.544  1.00 43.12  ? 104  GLN G O     1 
ATOM   5175  C  CB    . GLN G  3 104 ? 3.674   -15.419 48.155  1.00 42.42  ? 104  GLN G CB    1 
ATOM   5176  C  CG    . GLN G  3 104 ? 4.673   -16.594 48.253  1.00 46.60  ? 104  GLN G CG    1 
ATOM   5177  C  CD    . GLN G  3 104 ? 5.058   -16.968 49.718  1.00 51.69  ? 104  GLN G CD    1 
ATOM   5178  O  OE1   . GLN G  3 104 ? 5.450   -16.095 50.530  1.00 53.45  ? 104  GLN G OE1   1 
ATOM   5179  N  NE2   . GLN G  3 104 ? 4.934   -18.267 50.054  1.00 50.08  ? 104  GLN G NE2   1 
ATOM   5180  N  N     . GLY G  3 105 ? 0.358   -14.310 49.430  1.00 41.21  ? 105  GLY G N     1 
ATOM   5181  C  CA    . GLY G  3 105 ? -0.275  -13.166 49.994  1.00 40.16  ? 105  GLY G CA    1 
ATOM   5182  C  C     . GLY G  3 105 ? -0.633  -13.245 51.452  1.00 40.18  ? 105  GLY G C     1 
ATOM   5183  O  O     . GLY G  3 105 ? -0.861  -12.210 52.104  1.00 41.04  ? 105  GLY G O     1 
ATOM   5184  N  N     . GLY G  3 106 ? -0.712  -14.451 51.985  1.00 39.58  ? 106  GLY G N     1 
ATOM   5185  C  CA    . GLY G  3 106 ? -1.189  -14.635 53.348  1.00 38.76  ? 106  GLY G CA    1 
ATOM   5186  C  C     . GLY G  3 106 ? -2.673  -14.320 53.459  1.00 38.96  ? 106  GLY G C     1 
ATOM   5187  O  O     . GLY G  3 106 ? -3.403  -14.336 52.462  1.00 38.04  ? 106  GLY G O     1 
ATOM   5188  N  N     . VAL G  3 107 ? -3.104  -14.024 54.685  1.00 39.27  ? 107  VAL G N     1 
ATOM   5189  C  CA    . VAL G  3 107 ? -4.465  -13.625 54.971  1.00 39.28  ? 107  VAL G CA    1 
ATOM   5190  C  C     . VAL G  3 107 ? -4.480  -12.241 55.664  1.00 40.36  ? 107  VAL G C     1 
ATOM   5191  O  O     . VAL G  3 107 ? -3.416  -11.727 56.043  1.00 40.73  ? 107  VAL G O     1 
ATOM   5192  C  CB    . VAL G  3 107 ? -5.151  -14.697 55.854  1.00 39.34  ? 107  VAL G CB    1 
ATOM   5193  C  CG1   . VAL G  3 107 ? -4.986  -16.060 55.241  1.00 37.84  ? 107  VAL G CG1   1 
ATOM   5194  C  CG2   . VAL G  3 107 ? -4.601  -14.690 57.263  1.00 37.92  ? 107  VAL G CG2   1 
ATOM   5195  N  N     . LEU G  3 108 ? -5.662  -11.639 55.834  1.00 40.80  ? 108  LEU G N     1 
ATOM   5196  C  CA    . LEU G  3 108 ? -5.798  -10.431 56.671  1.00 41.30  ? 108  LEU G CA    1 
ATOM   5197  C  C     . LEU G  3 108 ? -5.651  -10.772 58.125  1.00 41.84  ? 108  LEU G C     1 
ATOM   5198  O  O     . LEU G  3 108 ? -6.267  -11.718 58.567  1.00 42.45  ? 108  LEU G O     1 
ATOM   5199  C  CB    . LEU G  3 108 ? -7.187  -9.781  56.497  1.00 40.58  ? 108  LEU G CB    1 
ATOM   5200  C  CG    . LEU G  3 108 ? -7.494  -9.002  55.222  1.00 39.76  ? 108  LEU G CG    1 
ATOM   5201  C  CD1   . LEU G  3 108 ? -8.722  -8.184  55.455  1.00 36.55  ? 108  LEU G CD1   1 
ATOM   5202  C  CD2   . LEU G  3 108 ? -6.317  -8.119  54.815  1.00 38.27  ? 108  LEU G CD2   1 
ATOM   5203  N  N     . PRO G  3 109 ? -4.900  -9.966  58.896  1.00 43.51  ? 109  PRO G N     1 
ATOM   5204  C  CA    . PRO G  3 109 ? -4.913  -10.153 60.367  1.00 44.57  ? 109  PRO G CA    1 
ATOM   5205  C  C     . PRO G  3 109 ? -6.323  -9.982  60.889  1.00 45.98  ? 109  PRO G C     1 
ATOM   5206  O  O     . PRO G  3 109 ? -6.988  -9.053  60.503  1.00 47.55  ? 109  PRO G O     1 
ATOM   5207  C  CB    . PRO G  3 109 ? -4.044  -9.011  60.871  1.00 43.50  ? 109  PRO G CB    1 
ATOM   5208  C  CG    . PRO G  3 109 ? -3.117  -8.729  59.722  1.00 43.45  ? 109  PRO G CG    1 
ATOM   5209  C  CD    . PRO G  3 109 ? -4.015  -8.850  58.509  1.00 43.54  ? 109  PRO G CD    1 
ATOM   5210  N  N     . ASN G  3 110 ? -6.797  -10.887 61.727  1.00 47.63  ? 110  ASN G N     1 
ATOM   5211  C  CA    . ASN G  3 110 ? -8.188  -10.871 62.168  1.00 49.09  ? 110  ASN G CA    1 
ATOM   5212  C  C     . ASN G  3 110 ? -8.414  -12.026 63.148  1.00 49.22  ? 110  ASN G C     1 
ATOM   5213  O  O     . ASN G  3 110 ? -8.150  -13.185 62.839  1.00 49.85  ? 110  ASN G O     1 
ATOM   5214  C  CB    . ASN G  3 110 ? -9.127  -10.931 60.948  1.00 49.61  ? 110  ASN G CB    1 
ATOM   5215  C  CG    . ASN G  3 110 ? -10.611 -11.036 61.317  1.00 52.56  ? 110  ASN G CG    1 
ATOM   5216  O  OD1   . ASN G  3 110 ? -11.021 -10.832 62.465  1.00 58.15  ? 110  ASN G OD1   1 
ATOM   5217  N  ND2   . ASN G  3 110 ? -11.427 -11.349 60.324  1.00 53.37  ? 110  ASN G ND2   1 
ATOM   5218  N  N     . ILE G  3 111 ? -8.860  -11.675 64.343  1.00 49.72  ? 111  ILE G N     1 
ATOM   5219  C  CA    . ILE G  3 111 ? -9.079  -12.604 65.432  1.00 50.50  ? 111  ILE G CA    1 
ATOM   5220  C  C     . ILE G  3 111 ? -10.462 -12.321 65.972  1.00 51.92  ? 111  ILE G C     1 
ATOM   5221  O  O     . ILE G  3 111 ? -10.736 -11.232 66.453  1.00 52.94  ? 111  ILE G O     1 
ATOM   5222  C  CB    . ILE G  3 111 ? -8.072  -12.394 66.591  1.00 50.23  ? 111  ILE G CB    1 
ATOM   5223  C  CG1   . ILE G  3 111 ? -6.627  -12.475 66.089  1.00 49.43  ? 111  ILE G CG1   1 
ATOM   5224  C  CG2   . ILE G  3 111 ? -8.347  -13.378 67.723  1.00 49.82  ? 111  ILE G CG2   1 
ATOM   5225  C  CD1   . ILE G  3 111 ? -5.594  -12.344 67.160  1.00 49.56  ? 111  ILE G CD1   1 
ATOM   5226  N  N     . GLN G  3 112 ? -11.341 -13.301 65.888  1.00 53.63  ? 112  GLN G N     1 
ATOM   5227  C  CA    . GLN G  3 112 ? -12.664 -13.188 66.469  1.00 54.55  ? 112  GLN G CA    1 
ATOM   5228  C  C     . GLN G  3 112 ? -12.543 -12.732 67.911  1.00 55.62  ? 112  GLN G C     1 
ATOM   5229  O  O     . GLN G  3 112 ? -11.580 -13.068 68.593  1.00 55.53  ? 112  GLN G O     1 
ATOM   5230  C  CB    . GLN G  3 112 ? -13.388 -14.530 66.378  1.00 54.04  ? 112  GLN G CB    1 
ATOM   5231  C  CG    . GLN G  3 112 ? -13.432 -15.053 64.970  1.00 53.73  ? 112  GLN G CG    1 
ATOM   5232  C  CD    . GLN G  3 112 ? -14.274 -14.194 64.042  1.00 53.55  ? 112  GLN G CD    1 
ATOM   5233  O  OE1   . GLN G  3 112 ? -15.467 -14.019 64.259  1.00 54.09  ? 112  GLN G OE1   1 
ATOM   5234  N  NE2   . GLN G  3 112 ? -13.655 -13.671 62.991  1.00 53.33  ? 112  GLN G NE2   1 
ATOM   5235  N  N     . SER G  3 113 ? -13.526 -11.951 68.345  1.00 57.35  ? 113  SER G N     1 
ATOM   5236  C  CA    . SER G  3 113 ? -13.564 -11.375 69.679  1.00 59.08  ? 113  SER G CA    1 
ATOM   5237  C  C     . SER G  3 113 ? -13.450 -12.389 70.807  1.00 59.92  ? 113  SER G C     1 
ATOM   5238  O  O     . SER G  3 113 ? -12.535 -12.282 71.622  1.00 60.49  ? 113  SER G O     1 
ATOM   5239  C  CB    . SER G  3 113 ? -14.835 -10.538 69.850  1.00 59.40  ? 113  SER G CB    1 
ATOM   5240  O  OG    . SER G  3 113 ? -14.729 -9.352  69.086  1.00 60.30  ? 113  SER G OG    1 
ATOM   5241  N  N     . VAL G  3 114 ? -14.355 -13.374 70.841  1.00 60.83  ? 114  VAL G N     1 
ATOM   5242  C  CA    . VAL G  3 114 ? -14.427 -14.371 71.943  1.00 61.42  ? 114  VAL G CA    1 
ATOM   5243  C  C     . VAL G  3 114 ? -13.108 -15.062 72.311  1.00 61.96  ? 114  VAL G C     1 
ATOM   5244  O  O     . VAL G  3 114 ? -13.001 -15.690 73.374  1.00 62.16  ? 114  VAL G O     1 
ATOM   5245  C  CB    . VAL G  3 114 ? -15.463 -15.472 71.672  1.00 61.08  ? 114  VAL G CB    1 
ATOM   5246  C  CG1   . VAL G  3 114 ? -16.871 -14.921 71.807  1.00 61.90  ? 114  VAL G CG1   1 
ATOM   5247  C  CG2   . VAL G  3 114 ? -15.243 -16.089 70.300  1.00 61.44  ? 114  VAL G CG2   1 
ATOM   5248  N  N     . LEU G  3 115 ? -12.113 -14.939 71.441  1.00 62.49  ? 115  LEU G N     1 
ATOM   5249  C  CA    . LEU G  3 115 ? -10.859 -15.620 71.640  1.00 63.41  ? 115  LEU G CA    1 
ATOM   5250  C  C     . LEU G  3 115 ? -9.856  -14.723 72.338  1.00 64.71  ? 115  LEU G C     1 
ATOM   5251  O  O     . LEU G  3 115 ? -8.831  -15.216 72.840  1.00 64.96  ? 115  LEU G O     1 
ATOM   5252  C  CB    . LEU G  3 115 ? -10.295 -16.121 70.312  1.00 63.19  ? 115  LEU G CB    1 
ATOM   5253  C  CG    . LEU G  3 115 ? -11.202 -16.785 69.272  1.00 62.13  ? 115  LEU G CG    1 
ATOM   5254  C  CD1   . LEU G  3 115 ? -10.347 -17.195 68.100  1.00 61.26  ? 115  LEU G CD1   1 
ATOM   5255  C  CD2   . LEU G  3 115 ? -11.953 -17.975 69.827  1.00 61.63  ? 115  LEU G CD2   1 
ATOM   5256  N  N     . LEU G  3 116 ? -10.143 -13.416 72.371  1.00 65.91  ? 116  LEU G N     1 
ATOM   5257  C  CA    . LEU G  3 116 ? -9.290  -12.447 73.079  1.00 67.11  ? 116  LEU G CA    1 
ATOM   5258  C  C     . LEU G  3 116 ? -9.316  -12.658 74.591  1.00 68.46  ? 116  LEU G C     1 
ATOM   5259  O  O     . LEU G  3 116 ? -10.355 -13.022 75.150  1.00 68.32  ? 116  LEU G O     1 
ATOM   5260  C  CB    . LEU G  3 116 ? -9.683  -11.015 72.751  1.00 66.72  ? 116  LEU G CB    1 
ATOM   5261  C  CG    . LEU G  3 116 ? -9.367  -10.513 71.346  1.00 66.67  ? 116  LEU G CG    1 
ATOM   5262  C  CD1   . LEU G  3 116 ? -9.918  -9.100  71.165  1.00 65.44  ? 116  LEU G CD1   1 
ATOM   5263  C  CD2   . LEU G  3 116 ? -7.872  -10.570 71.064  1.00 66.19  ? 116  LEU G CD2   1 
ATOM   5264  N  N     . PRO G  3 117 ? -8.171  -12.425 75.264  1.00 70.08  ? 117  PRO G N     1 
ATOM   5265  C  CA    . PRO G  3 117 ? -8.098  -12.741 76.693  1.00 71.43  ? 117  PRO G CA    1 
ATOM   5266  C  C     . PRO G  3 117 ? -9.066  -11.886 77.493  1.00 73.10  ? 117  PRO G C     1 
ATOM   5267  O  O     . PRO G  3 117 ? -9.189  -10.676 77.247  1.00 73.56  ? 117  PRO G O     1 
ATOM   5268  C  CB    . PRO G  3 117 ? -6.656  -12.399 77.059  1.00 71.19  ? 117  PRO G CB    1 
ATOM   5269  C  CG    . PRO G  3 117 ? -6.209  -11.455 76.003  1.00 70.92  ? 117  PRO G CG    1 
ATOM   5270  C  CD    . PRO G  3 117 ? -6.912  -11.851 74.759  1.00 69.89  ? 117  PRO G CD    1 
ATOM   5271  N  N     . LYS G  3 118 ? -9.768  -12.516 78.429  1.00 74.84  ? 118  LYS G N     1 
ATOM   5272  C  CA    . LYS G  3 118 ? -10.753 -11.807 79.233  1.00 76.44  ? 118  LYS G CA    1 
ATOM   5273  C  C     . LYS G  3 118 ? -10.414 -11.932 80.708  1.00 76.58  ? 118  LYS G C     1 
ATOM   5274  O  O     . LYS G  3 118 ? -11.148 -11.431 81.555  1.00 77.41  ? 118  LYS G O     1 
ATOM   5275  C  CB    . LYS G  3 118 ? -12.170 -12.330 78.939  1.00 76.60  ? 118  LYS G CB    1 
ATOM   5276  C  CG    . LYS G  3 118 ? -12.418 -13.799 79.345  1.00 77.78  ? 118  LYS G CG    1 
ATOM   5277  C  CD    . LYS G  3 118 ? -13.805 -14.274 78.886  1.00 77.82  ? 118  LYS G CD    1 
ATOM   5278  C  CE    . LYS G  3 118 ? -14.241 -15.535 79.639  1.00 80.24  ? 118  LYS G CE    1 
ATOM   5279  N  NZ    . LYS G  3 118 ? -15.606 -15.999 79.223  1.00 81.06  ? 118  LYS G NZ    1 
ATOM   5280  N  N     . THR H  4 29  ? 12.451  -19.081 22.758  1.00 83.29  ? 29   THR H N     1 
ATOM   5281  C  CA    . THR H  4 29  ? 11.223  -18.482 22.153  1.00 83.37  ? 29   THR H CA    1 
ATOM   5282  C  C     . THR H  4 29  ? 10.609  -17.371 23.008  1.00 83.26  ? 29   THR H C     1 
ATOM   5283  O  O     . THR H  4 29  ? 10.811  -17.306 24.231  1.00 83.48  ? 29   THR H O     1 
ATOM   5284  C  CB    . THR H  4 29  ? 10.117  -19.535 21.912  1.00 83.60  ? 29   THR H CB    1 
ATOM   5285  O  OG1   . THR H  4 29  ? 9.763   -20.147 23.162  1.00 83.49  ? 29   THR H OG1   1 
ATOM   5286  C  CG2   . THR H  4 29  ? 10.570  -20.593 20.890  1.00 83.32  ? 29   THR H CG2   1 
ATOM   5287  N  N     . ARG H  4 30  ? 9.827   -16.524 22.342  1.00 82.60  ? 30   ARG H N     1 
ATOM   5288  C  CA    . ARG H  4 30  ? 9.233   -15.340 22.945  1.00 81.73  ? 30   ARG H CA    1 
ATOM   5289  C  C     . ARG H  4 30  ? 8.126   -15.717 23.929  1.00 80.41  ? 30   ARG H C     1 
ATOM   5290  O  O     . ARG H  4 30  ? 7.253   -16.526 23.623  1.00 80.35  ? 30   ARG H O     1 
ATOM   5291  C  CB    . ARG H  4 30  ? 8.687   -14.415 21.847  1.00 82.11  ? 30   ARG H CB    1 
ATOM   5292  C  CG    . ARG H  4 30  ? 9.569   -14.363 20.578  1.00 84.52  ? 30   ARG H CG    1 
ATOM   5293  C  CD    . ARG H  4 30  ? 10.476  -13.125 20.518  1.00 88.69  ? 30   ARG H CD    1 
ATOM   5294  N  NE    . ARG H  4 30  ? 9.721   -11.900 20.205  1.00 90.64  ? 30   ARG H NE    1 
ATOM   5295  C  CZ    . ARG H  4 30  ? 10.260  -10.688 20.063  1.00 91.49  ? 30   ARG H CZ    1 
ATOM   5296  N  NH1   . ARG H  4 30  ? 11.576  -10.509 20.201  1.00 91.10  ? 30   ARG H NH1   1 
ATOM   5297  N  NH2   . ARG H  4 30  ? 9.476   -9.648  19.783  1.00 91.57  ? 30   ARG H NH2   1 
ATOM   5298  N  N     . LYS H  4 31  ? 8.204   -15.135 25.122  1.00 78.68  ? 31   LYS H N     1 
ATOM   5299  C  CA    . LYS H  4 31  ? 7.149   -15.194 26.125  1.00 76.64  ? 31   LYS H CA    1 
ATOM   5300  C  C     . LYS H  4 31  ? 6.497   -13.801 26.237  1.00 74.84  ? 31   LYS H C     1 
ATOM   5301  O  O     . LYS H  4 31  ? 7.096   -12.860 26.791  1.00 74.72  ? 31   LYS H O     1 
ATOM   5302  C  CB    . LYS H  4 31  ? 7.753   -15.598 27.481  1.00 77.12  ? 31   LYS H CB    1 
ATOM   5303  C  CG    . LYS H  4 31  ? 7.312   -16.934 28.045  1.00 77.79  ? 31   LYS H CG    1 
ATOM   5304  C  CD    . LYS H  4 31  ? 5.905   -16.831 28.634  1.00 78.89  ? 31   LYS H CD    1 
ATOM   5305  C  CE    . LYS H  4 31  ? 5.394   -18.188 29.103  1.00 78.91  ? 31   LYS H CE    1 
ATOM   5306  N  NZ    . LYS H  4 31  ? 3.935   -18.299 28.832  1.00 78.66  ? 31   LYS H NZ    1 
ATOM   5307  N  N     . GLU H  4 32  ? 5.286   -13.668 25.696  1.00 72.17  ? 32   GLU H N     1 
ATOM   5308  C  CA    . GLU H  4 32  ? 4.500   -12.438 25.863  1.00 69.64  ? 32   GLU H CA    1 
ATOM   5309  C  C     . GLU H  4 32  ? 3.996   -12.202 27.285  1.00 67.43  ? 32   GLU H C     1 
ATOM   5310  O  O     . GLU H  4 32  ? 3.668   -13.137 28.021  1.00 67.49  ? 32   GLU H O     1 
ATOM   5311  C  CB    . GLU H  4 32  ? 3.325   -12.398 24.904  1.00 69.73  ? 32   GLU H CB    1 
ATOM   5312  C  CG    . GLU H  4 32  ? 3.576   -11.524 23.709  1.00 71.39  ? 32   GLU H CG    1 
ATOM   5313  C  CD    . GLU H  4 32  ? 2.378   -11.462 22.778  1.00 74.61  ? 32   GLU H CD    1 
ATOM   5314  O  OE1   . GLU H  4 32  ? 1.315   -12.064 23.115  1.00 75.15  ? 32   GLU H OE1   1 
ATOM   5315  O  OE2   . GLU H  4 32  ? 2.507   -10.816 21.707  1.00 74.81  ? 32   GLU H OE2   1 
ATOM   5316  N  N     . SER H  4 33  ? 3.914   -10.926 27.641  1.00 64.50  ? 33   SER H N     1 
ATOM   5317  C  CA    . SER H  4 33  ? 3.637   -10.501 28.995  1.00 61.28  ? 33   SER H CA    1 
ATOM   5318  C  C     . SER H  4 33  ? 3.129   -9.062  28.958  1.00 59.44  ? 33   SER H C     1 
ATOM   5319  O  O     . SER H  4 33  ? 3.403   -8.317  28.017  1.00 59.01  ? 33   SER H O     1 
ATOM   5320  C  CB    . SER H  4 33  ? 4.927   -10.595 29.808  1.00 61.32  ? 33   SER H CB    1 
ATOM   5321  O  OG    . SER H  4 33  ? 4.821   -9.943  31.052  1.00 60.55  ? 33   SER H OG    1 
ATOM   5322  N  N     . TYR H  4 34  ? 2.373   -8.689  29.981  1.00 56.99  ? 34   TYR H N     1 
ATOM   5323  C  CA    . TYR H  4 34  ? 1.934   -7.323  30.172  1.00 54.45  ? 34   TYR H CA    1 
ATOM   5324  C  C     . TYR H  4 34  ? 2.880   -6.535  31.069  1.00 53.22  ? 34   TYR H C     1 
ATOM   5325  O  O     . TYR H  4 34  ? 2.517   -5.476  31.557  1.00 53.36  ? 34   TYR H O     1 
ATOM   5326  C  CB    . TYR H  4 34  ? 0.552   -7.309  30.809  1.00 53.88  ? 34   TYR H CB    1 
ATOM   5327  C  CG    . TYR H  4 34  ? -0.568  -7.679  29.882  1.00 53.62  ? 34   TYR H CG    1 
ATOM   5328  C  CD1   . TYR H  4 34  ? -1.075  -8.968  29.871  1.00 52.77  ? 34   TYR H CD1   1 
ATOM   5329  C  CD2   . TYR H  4 34  ? -1.132  -6.735  29.012  1.00 53.17  ? 34   TYR H CD2   1 
ATOM   5330  C  CE1   . TYR H  4 34  ? -2.113  -9.323  29.025  1.00 52.76  ? 34   TYR H CE1   1 
ATOM   5331  C  CE2   . TYR H  4 34  ? -2.173  -7.080  28.157  1.00 52.63  ? 34   TYR H CE2   1 
ATOM   5332  C  CZ    . TYR H  4 34  ? -2.663  -8.382  28.177  1.00 53.14  ? 34   TYR H CZ    1 
ATOM   5333  O  OH    . TYR H  4 34  ? -3.703  -8.768  27.354  1.00 53.48  ? 34   TYR H OH    1 
ATOM   5334  N  N     . ALA H  4 35  ? 4.090   -7.017  31.297  1.00 51.50  ? 35   ALA H N     1 
ATOM   5335  C  CA    . ALA H  4 35  ? 4.880   -6.414  32.351  1.00 50.36  ? 35   ALA H CA    1 
ATOM   5336  C  C     . ALA H  4 35  ? 5.240   -4.957  32.078  1.00 50.06  ? 35   ALA H C     1 
ATOM   5337  O  O     . ALA H  4 35  ? 5.236   -4.141  32.997  1.00 49.90  ? 35   ALA H O     1 
ATOM   5338  C  CB    . ALA H  4 35  ? 6.101   -7.238  32.649  1.00 50.23  ? 35   ALA H CB    1 
ATOM   5339  N  N     . ILE H  4 36  ? 5.530   -4.618  30.820  1.00 49.73  ? 36   ILE H N     1 
ATOM   5340  C  CA    . ILE H  4 36  ? 5.905   -3.246  30.477  1.00 48.88  ? 36   ILE H CA    1 
ATOM   5341  C  C     . ILE H  4 36  ? 4.739   -2.301  30.694  1.00 48.79  ? 36   ILE H C     1 
ATOM   5342  O  O     . ILE H  4 36  ? 4.898   -1.254  31.346  1.00 48.98  ? 36   ILE H O     1 
ATOM   5343  C  CB    . ILE H  4 36  ? 6.487   -3.069  29.040  1.00 48.73  ? 36   ILE H CB    1 
ATOM   5344  C  CG1   . ILE H  4 36  ? 5.665   -3.802  27.990  1.00 49.73  ? 36   ILE H CG1   1 
ATOM   5345  C  CG2   . ILE H  4 36  ? 7.919   -3.523  28.966  1.00 48.66  ? 36   ILE H CG2   1 
ATOM   5346  C  CD1   . ILE H  4 36  ? 5.790   -3.179  26.628  1.00 50.46  ? 36   ILE H CD1   1 
ATOM   5347  N  N     . TYR H  4 37  ? 3.565   -2.654  30.172  1.00 48.23  ? 37   TYR H N     1 
ATOM   5348  C  CA    . TYR H  4 37  ? 2.397   -1.805  30.397  1.00 48.12  ? 37   TYR H CA    1 
ATOM   5349  C  C     . TYR H  4 37  ? 2.087   -1.678  31.882  1.00 47.66  ? 37   TYR H C     1 
ATOM   5350  O  O     . TYR H  4 37  ? 1.773   -0.603  32.344  1.00 48.73  ? 37   TYR H O     1 
ATOM   5351  C  CB    . TYR H  4 37  ? 1.198   -2.286  29.610  1.00 48.34  ? 37   TYR H CB    1 
ATOM   5352  C  CG    . TYR H  4 37  ? 1.622   -2.872  28.302  1.00 49.43  ? 37   TYR H CG    1 
ATOM   5353  C  CD1   . TYR H  4 37  ? 1.697   -4.262  28.137  1.00 50.12  ? 37   TYR H CD1   1 
ATOM   5354  C  CD2   . TYR H  4 37  ? 1.988   -2.052  27.232  1.00 48.30  ? 37   TYR H CD2   1 
ATOM   5355  C  CE1   . TYR H  4 37  ? 2.107   -4.818  26.938  1.00 50.35  ? 37   TYR H CE1   1 
ATOM   5356  C  CE2   . TYR H  4 37  ? 2.396   -2.595  26.026  1.00 48.79  ? 37   TYR H CE2   1 
ATOM   5357  C  CZ    . TYR H  4 37  ? 2.460   -3.981  25.889  1.00 50.45  ? 37   TYR H CZ    1 
ATOM   5358  O  OH    . TYR H  4 37  ? 2.869   -4.549  24.706  1.00 51.55  ? 37   TYR H OH    1 
ATOM   5359  N  N     . VAL H  4 38  ? 2.217   -2.752  32.643  1.00 47.07  ? 38   VAL H N     1 
ATOM   5360  C  CA    . VAL H  4 38  ? 1.991   -2.669  34.084  1.00 46.25  ? 38   VAL H CA    1 
ATOM   5361  C  C     . VAL H  4 38  ? 2.981   -1.733  34.790  1.00 46.87  ? 38   VAL H C     1 
ATOM   5362  O  O     . VAL H  4 38  ? 2.568   -0.982  35.669  1.00 46.19  ? 38   VAL H O     1 
ATOM   5363  C  CB    . VAL H  4 38  ? 1.887   -4.062  34.743  1.00 45.45  ? 38   VAL H CB    1 
ATOM   5364  C  CG1   . VAL H  4 38  ? 1.793   -3.947  36.253  1.00 44.31  ? 38   VAL H CG1   1 
ATOM   5365  C  CG2   . VAL H  4 38  ? 0.666   -4.760  34.217  1.00 43.08  ? 38   VAL H CG2   1 
ATOM   5366  N  N     . TYR H  4 39  ? 4.257   -1.743  34.388  1.00 48.13  ? 39   TYR H N     1 
ATOM   5367  C  CA    . TYR H  4 39  ? 5.230   -0.748  34.884  1.00 49.35  ? 39   TYR H CA    1 
ATOM   5368  C  C     . TYR H  4 39  ? 4.791   0.670   34.562  1.00 48.57  ? 39   TYR H C     1 
ATOM   5369  O  O     . TYR H  4 39  ? 4.850   1.546   35.423  1.00 48.64  ? 39   TYR H O     1 
ATOM   5370  C  CB    . TYR H  4 39  ? 6.614   -0.925  34.271  1.00 51.21  ? 39   TYR H CB    1 
ATOM   5371  C  CG    . TYR H  4 39  ? 7.409   -2.009  34.884  1.00 54.78  ? 39   TYR H CG    1 
ATOM   5372  C  CD1   . TYR H  4 39  ? 7.576   -3.250  34.210  1.00 58.10  ? 39   TYR H CD1   1 
ATOM   5373  C  CD2   . TYR H  4 39  ? 8.008   -1.835  36.134  1.00 56.96  ? 39   TYR H CD2   1 
ATOM   5374  C  CE1   . TYR H  4 39  ? 8.326   -4.305  34.773  1.00 58.20  ? 39   TYR H CE1   1 
ATOM   5375  C  CE2   . TYR H  4 39  ? 8.766   -2.886  36.710  1.00 59.94  ? 39   TYR H CE2   1 
ATOM   5376  C  CZ    . TYR H  4 39  ? 8.918   -4.116  36.017  1.00 58.31  ? 39   TYR H CZ    1 
ATOM   5377  O  OH    . TYR H  4 39  ? 9.644   -5.146  36.593  1.00 59.28  ? 39   TYR H OH    1 
ATOM   5378  N  N     . LYS H  4 40  ? 4.380   0.887   33.311  1.00 47.67  ? 40   LYS H N     1 
ATOM   5379  C  CA    . LYS H  4 40  ? 3.973   2.201   32.849  1.00 46.92  ? 40   LYS H CA    1 
ATOM   5380  C  C     . LYS H  4 40  ? 2.858   2.690   33.740  1.00 45.60  ? 40   LYS H C     1 
ATOM   5381  O  O     . LYS H  4 40  ? 2.966   3.749   34.359  1.00 46.10  ? 40   LYS H O     1 
ATOM   5382  C  CB    . LYS H  4 40  ? 3.522   2.167   31.392  1.00 47.13  ? 40   LYS H CB    1 
ATOM   5383  C  CG    . LYS H  4 40  ? 4.678   2.116   30.405  1.00 47.70  ? 40   LYS H CG    1 
ATOM   5384  C  CD    . LYS H  4 40  ? 4.210   2.254   28.933  1.00 48.52  ? 40   LYS H CD    1 
ATOM   5385  C  CE    . LYS H  4 40  ? 5.379   1.937   27.964  1.00 50.86  ? 40   LYS H CE    1 
ATOM   5386  N  NZ    . LYS H  4 40  ? 4.917   1.709   26.555  1.00 53.22  ? 40   LYS H NZ    1 
ATOM   5387  N  N     . VAL H  4 41  ? 1.807   1.896   33.855  1.00 43.78  ? 41   VAL H N     1 
ATOM   5388  C  CA    . VAL H  4 41  ? 0.691   2.280   34.706  1.00 42.11  ? 41   VAL H CA    1 
ATOM   5389  C  C     . VAL H  4 41  ? 1.154   2.448   36.163  1.00 42.08  ? 41   VAL H C     1 
ATOM   5390  O  O     . VAL H  4 41  ? 0.617   3.284   36.889  1.00 42.24  ? 41   VAL H O     1 
ATOM   5391  C  CB    . VAL H  4 41  ? -0.494  1.299   34.567  1.00 41.41  ? 41   VAL H CB    1 
ATOM   5392  C  CG1   . VAL H  4 41  ? -1.634  1.736   35.395  1.00 39.12  ? 41   VAL H CG1   1 
ATOM   5393  C  CG2   . VAL H  4 41  ? -0.908  1.174   33.109  1.00 39.23  ? 41   VAL H CG2   1 
ATOM   5394  N  N     . LEU H  4 42  ? 2.163   1.692   36.591  1.00 41.59  ? 42   LEU H N     1 
ATOM   5395  C  CA    . LEU H  4 42  ? 2.591   1.800   37.990  1.00 41.19  ? 42   LEU H CA    1 
ATOM   5396  C  C     . LEU H  4 42  ? 3.320   3.120   38.197  1.00 41.86  ? 42   LEU H C     1 
ATOM   5397  O  O     . LEU H  4 42  ? 3.216   3.758   39.260  1.00 42.19  ? 42   LEU H O     1 
ATOM   5398  C  CB    . LEU H  4 42  ? 3.432   0.602   38.472  1.00 40.00  ? 42   LEU H CB    1 
ATOM   5399  C  CG    . LEU H  4 42  ? 3.968   0.792   39.908  1.00 38.33  ? 42   LEU H CG    1 
ATOM   5400  C  CD1   . LEU H  4 42  ? 2.919   0.631   40.954  1.00 38.08  ? 42   LEU H CD1   1 
ATOM   5401  C  CD2   . LEU H  4 42  ? 5.145   -0.065  40.231  1.00 38.16  ? 42   LEU H CD2   1 
ATOM   5402  N  N     . LYS H  4 43  ? 4.052   3.543   37.179  1.00 42.54  ? 43   LYS H N     1 
ATOM   5403  C  CA    . LYS H  4 43  ? 4.774   4.797   37.280  1.00 43.15  ? 43   LYS H CA    1 
ATOM   5404  C  C     . LYS H  4 43  ? 3.821   5.996   37.336  1.00 43.14  ? 43   LYS H C     1 
ATOM   5405  O  O     . LYS H  4 43  ? 4.055   6.926   38.102  1.00 43.93  ? 43   LYS H O     1 
ATOM   5406  C  CB    . LYS H  4 43  ? 5.856   4.912   36.201  1.00 43.30  ? 43   LYS H CB    1 
ATOM   5407  C  CG    . LYS H  4 43  ? 7.119   4.110   36.546  1.00 43.77  ? 43   LYS H CG    1 
ATOM   5408  C  CD    . LYS H  4 43  ? 7.289   4.032   38.072  1.00 47.69  ? 43   LYS H CD    1 
ATOM   5409  C  CE    . LYS H  4 43  ? 8.174   2.869   38.519  1.00 48.51  ? 43   LYS H CE    1 
ATOM   5410  N  NZ    . LYS H  4 43  ? 9.424   3.271   39.224  1.00 49.16  ? 43   LYS H NZ    1 
ATOM   5411  N  N     . GLN H  4 44  ? 2.719   5.937   36.596  1.00 42.88  ? 44   GLN H N     1 
ATOM   5412  C  CA    . GLN H  4 44  ? 1.706   6.977   36.660  1.00 42.85  ? 44   GLN H CA    1 
ATOM   5413  C  C     . GLN H  4 44  ? 1.091   7.091   38.025  1.00 43.23  ? 44   GLN H C     1 
ATOM   5414  O  O     . GLN H  4 44  ? 0.792   8.177   38.490  1.00 44.99  ? 44   GLN H O     1 
ATOM   5415  C  CB    . GLN H  4 44  ? 0.606   6.745   35.650  1.00 42.26  ? 44   GLN H CB    1 
ATOM   5416  C  CG    . GLN H  4 44  ? 1.110   6.529   34.254  1.00 44.08  ? 44   GLN H CG    1 
ATOM   5417  C  CD    . GLN H  4 44  ? -0.024  6.451   33.293  1.00 49.21  ? 44   GLN H CD    1 
ATOM   5418  O  OE1   . GLN H  4 44  ? -1.110  5.990   33.642  1.00 53.36  ? 44   GLN H OE1   1 
ATOM   5419  N  NE2   . GLN H  4 44  ? 0.197   6.910   32.069  1.00 52.81  ? 44   GLN H NE2   1 
ATOM   5420  N  N     . VAL H  4 45  ? 0.923   5.976   38.695  1.00 43.39  ? 45   VAL H N     1 
ATOM   5421  C  CA    . VAL H  4 45  ? 0.112   5.937   39.886  1.00 42.99  ? 45   VAL H CA    1 
ATOM   5422  C  C     . VAL H  4 45  ? 0.983   6.066   41.145  1.00 43.71  ? 45   VAL H C     1 
ATOM   5423  O  O     . VAL H  4 45  ? 0.556   6.634   42.136  1.00 44.49  ? 45   VAL H O     1 
ATOM   5424  C  CB    . VAL H  4 45  ? -0.746  4.644   39.856  1.00 42.90  ? 45   VAL H CB    1 
ATOM   5425  C  CG1   . VAL H  4 45  ? -1.172  4.235   41.211  1.00 43.83  ? 45   VAL H CG1   1 
ATOM   5426  C  CG2   . VAL H  4 45  ? -1.945  4.829   38.988  1.00 41.26  ? 45   VAL H CG2   1 
ATOM   5427  N  N     . HIS H  4 46  ? 2.202   5.540   41.125  1.00 44.34  ? 46   HIS H N     1 
ATOM   5428  C  CA    . HIS H  4 46  ? 3.071   5.601   42.308  1.00 44.91  ? 46   HIS H CA    1 
ATOM   5429  C  C     . HIS H  4 46  ? 4.483   5.717   41.803  1.00 46.51  ? 46   HIS H C     1 
ATOM   5430  O  O     . HIS H  4 46  ? 5.181   4.709   41.690  1.00 46.73  ? 46   HIS H O     1 
ATOM   5431  C  CB    . HIS H  4 46  ? 2.943   4.371   43.210  1.00 43.93  ? 46   HIS H CB    1 
ATOM   5432  C  CG    . HIS H  4 46  ? 1.817   4.447   44.187  1.00 42.85  ? 46   HIS H CG    1 
ATOM   5433  N  ND1   . HIS H  4 46  ? 0.574   3.909   43.933  1.00 43.13  ? 46   HIS H ND1   1 
ATOM   5434  C  CD2   . HIS H  4 46  ? 1.745   4.977   45.432  1.00 42.50  ? 46   HIS H CD2   1 
ATOM   5435  C  CE1   . HIS H  4 46  ? -0.220  4.117   44.970  1.00 42.01  ? 46   HIS H CE1   1 
ATOM   5436  N  NE2   . HIS H  4 46  ? 0.466   4.759   45.897  1.00 40.71  ? 46   HIS H NE2   1 
ATOM   5437  N  N     . PRO H  4 47  ? 4.925   6.959   41.516  1.00 47.88  ? 47   PRO H N     1 
ATOM   5438  C  CA    . PRO H  4 47  ? 6.102   7.127   40.677  1.00 48.91  ? 47   PRO H CA    1 
ATOM   5439  C  C     . PRO H  4 47  ? 7.419   6.732   41.361  1.00 50.00  ? 47   PRO H C     1 
ATOM   5440  O  O     . PRO H  4 47  ? 8.403   6.499   40.679  1.00 50.82  ? 47   PRO H O     1 
ATOM   5441  C  CB    . PRO H  4 47  ? 6.064   8.614   40.288  1.00 49.13  ? 47   PRO H CB    1 
ATOM   5442  C  CG    . PRO H  4 47  ? 4.919   9.231   41.006  1.00 47.90  ? 47   PRO H CG    1 
ATOM   5443  C  CD    . PRO H  4 47  ? 4.404   8.245   42.012  1.00 47.78  ? 47   PRO H CD    1 
ATOM   5444  N  N     . ASP H  4 48  ? 7.442   6.614   42.679  1.00 51.05  ? 48   ASP H N     1 
ATOM   5445  C  CA    . ASP H  4 48  ? 8.671   6.158   43.339  1.00 52.53  ? 48   ASP H CA    1 
ATOM   5446  C  C     . ASP H  4 48  ? 8.615   4.703   43.857  1.00 52.11  ? 48   ASP H C     1 
ATOM   5447  O  O     . ASP H  4 48  ? 9.320   4.330   44.807  1.00 52.54  ? 48   ASP H O     1 
ATOM   5448  C  CB    . ASP H  4 48  ? 9.057   7.143   44.445  1.00 53.50  ? 48   ASP H CB    1 
ATOM   5449  C  CG    . ASP H  4 48  ? 9.444   8.520   43.881  1.00 57.01  ? 48   ASP H CG    1 
ATOM   5450  O  OD1   . ASP H  4 48  ? 10.234  8.557   42.894  1.00 59.96  ? 48   ASP H OD1   1 
ATOM   5451  O  OD2   . ASP H  4 48  ? 8.947   9.553   44.410  1.00 58.93  ? 48   ASP H OD2   1 
ATOM   5452  N  N     . THR H  4 49  ? 7.789   3.880   43.212  1.00 50.73  ? 49   THR H N     1 
ATOM   5453  C  CA    . THR H  4 49  ? 7.492   2.558   43.733  1.00 49.08  ? 49   THR H CA    1 
ATOM   5454  C  C     . THR H  4 49  ? 7.820   1.467   42.749  1.00 48.42  ? 49   THR H C     1 
ATOM   5455  O  O     . THR H  4 49  ? 7.567   1.576   41.558  1.00 48.53  ? 49   THR H O     1 
ATOM   5456  C  CB    . THR H  4 49  ? 6.043   2.483   44.186  1.00 48.92  ? 49   THR H CB    1 
ATOM   5457  O  OG1   . THR H  4 49  ? 5.870   3.453   45.219  1.00 49.35  ? 49   THR H OG1   1 
ATOM   5458  C  CG2   . THR H  4 49  ? 5.679   1.106   44.739  1.00 47.62  ? 49   THR H CG2   1 
ATOM   5459  N  N     . GLY H  4 50  ? 8.411   0.406   43.258  1.00 47.64  ? 50   GLY H N     1 
ATOM   5460  C  CA    . GLY H  4 50  ? 8.776   -0.679  42.390  1.00 46.79  ? 50   GLY H CA    1 
ATOM   5461  C  C     . GLY H  4 50  ? 7.882   -1.873  42.578  1.00 45.94  ? 50   GLY H C     1 
ATOM   5462  O  O     . GLY H  4 50  ? 7.006   -1.902  43.447  1.00 45.82  ? 50   GLY H O     1 
ATOM   5463  N  N     . ILE H  4 51  ? 8.124   -2.875  41.753  1.00 45.40  ? 51   ILE H N     1 
ATOM   5464  C  CA    . ILE H  4 51  ? 7.357   -4.101  41.826  1.00 44.60  ? 51   ILE H CA    1 
ATOM   5465  C  C     . ILE H  4 51  ? 8.296   -5.297  41.739  1.00 44.36  ? 51   ILE H C     1 
ATOM   5466  O  O     . ILE H  4 51  ? 9.109   -5.407  40.826  1.00 43.67  ? 51   ILE H O     1 
ATOM   5467  C  CB    . ILE H  4 51  ? 6.209   -4.102  40.773  1.00 44.38  ? 51   ILE H CB    1 
ATOM   5468  C  CG1   . ILE H  4 51  ? 5.251   -5.271  41.014  1.00 44.05  ? 51   ILE H CG1   1 
ATOM   5469  C  CG2   . ILE H  4 51  ? 6.766   -4.031  39.348  1.00 44.27  ? 51   ILE H CG2   1 
ATOM   5470  C  CD1   . ILE H  4 51  ? 3.863   -5.114  40.370  1.00 43.12  ? 51   ILE H CD1   1 
ATOM   5471  N  N     . SER H  4 52  ? 8.193   -6.174  42.726  1.00 44.59  ? 52   SER H N     1 
ATOM   5472  C  CA    . SER H  4 52  ? 8.931   -7.441  42.703  1.00 44.88  ? 52   SER H CA    1 
ATOM   5473  C  C     . SER H  4 52  ? 8.446   -8.327  41.568  1.00 45.28  ? 52   SER H C     1 
ATOM   5474  O  O     . SER H  4 52  ? 7.317   -8.215  41.117  1.00 45.91  ? 52   SER H O     1 
ATOM   5475  C  CB    . SER H  4 52  ? 8.752   -8.184  44.009  1.00 44.48  ? 52   SER H CB    1 
ATOM   5476  O  OG    . SER H  4 52  ? 7.647   -9.056  43.927  1.00 44.00  ? 52   SER H OG    1 
ATOM   5477  N  N     . SER H  4 53  ? 9.312   -9.216  41.123  1.00 46.04  ? 53   SER H N     1 
ATOM   5478  C  CA    . SER H  4 53  ? 9.043   -10.113 40.010  1.00 46.46  ? 53   SER H CA    1 
ATOM   5479  C  C     . SER H  4 53  ? 7.826   -11.054 40.212  1.00 46.56  ? 53   SER H C     1 
ATOM   5480  O  O     . SER H  4 53  ? 7.044   -11.264 39.268  1.00 46.60  ? 53   SER H O     1 
ATOM   5481  C  CB    . SER H  4 53  ? 10.315  -10.881 39.730  1.00 46.24  ? 53   SER H CB    1 
ATOM   5482  O  OG    . SER H  4 53  ? 10.024  -12.151 39.238  1.00 50.51  ? 53   SER H OG    1 
ATOM   5483  N  N     . LYS H  4 54  ? 7.653   -11.616 41.416  1.00 46.46  ? 54   LYS H N     1 
ATOM   5484  C  CA    . LYS H  4 54  ? 6.419   -12.374 41.731  1.00 46.97  ? 54   LYS H CA    1 
ATOM   5485  C  C     . LYS H  4 54  ? 5.196   -11.492 41.644  1.00 45.31  ? 54   LYS H C     1 
ATOM   5486  O  O     . LYS H  4 54  ? 4.221   -11.868 40.989  1.00 45.52  ? 54   LYS H O     1 
ATOM   5487  C  CB    . LYS H  4 54  ? 6.440   -13.048 43.115  1.00 47.09  ? 54   LYS H CB    1 
ATOM   5488  C  CG    . LYS H  4 54  ? 7.445   -14.205 43.291  1.00 50.04  ? 54   LYS H CG    1 
ATOM   5489  C  CD    . LYS H  4 54  ? 7.710   -14.488 44.793  1.00 50.31  ? 54   LYS H CD    1 
ATOM   5490  C  CE    . LYS H  4 54  ? 9.015   -15.285 44.987  1.00 56.70  ? 54   LYS H CE    1 
ATOM   5491  N  NZ    . LYS H  4 54  ? 9.585   -15.176 46.396  1.00 59.96  ? 54   LYS H NZ    1 
ATOM   5492  N  N     . ALA H  4 55  ? 5.250   -10.327 42.303  1.00 43.84  ? 55   ALA H N     1 
ATOM   5493  C  CA    . ALA H  4 55  ? 4.181   -9.317  42.234  1.00 42.11  ? 55   ALA H CA    1 
ATOM   5494  C  C     . ALA H  4 55  ? 3.790   -8.996  40.797  1.00 41.63  ? 55   ALA H C     1 
ATOM   5495  O  O     . ALA H  4 55  ? 2.614   -8.985  40.447  1.00 41.19  ? 55   ALA H O     1 
ATOM   5496  C  CB    . ALA H  4 55  ? 4.591   -8.124  42.923  1.00 41.65  ? 55   ALA H CB    1 
ATOM   5497  N  N     . MET H  4 56  ? 4.780   -8.793  39.946  1.00 41.61  ? 56   MET H N     1 
ATOM   5498  C  CA    . MET H  4 56  ? 4.526   -8.672  38.526  1.00 41.92  ? 56   MET H CA    1 
ATOM   5499  C  C     . MET H  4 56  ? 3.829   -9.889  37.940  1.00 41.45  ? 56   MET H C     1 
ATOM   5500  O  O     . MET H  4 56  ? 2.995   -9.740  37.047  1.00 41.83  ? 56   MET H O     1 
ATOM   5501  C  CB    . MET H  4 56  ? 5.815   -8.416  37.752  1.00 42.32  ? 56   MET H CB    1 
ATOM   5502  C  CG    . MET H  4 56  ? 5.581   -8.078  36.286  1.00 44.55  ? 56   MET H CG    1 
ATOM   5503  S  SD    . MET H  4 56  ? 4.604   -6.552  36.172  1.00 51.35  ? 56   MET H SD    1 
ATOM   5504  C  CE    . MET H  4 56  ? 3.089   -7.233  35.527  1.00 51.24  ? 56   MET H CE    1 
ATOM   5505  N  N     . SER H  4 57  ? 4.164   -11.090 38.423  1.00 40.64  ? 57   SER H N     1 
ATOM   5506  C  CA    . SER H  4 57  ? 3.590   -12.320 37.852  1.00 39.62  ? 57   SER H CA    1 
ATOM   5507  C  C     . SER H  4 57  ? 2.093   -12.441 38.151  1.00 38.38  ? 57   SER H C     1 
ATOM   5508  O  O     . SER H  4 57  ? 1.294   -12.701 37.271  1.00 38.03  ? 57   SER H O     1 
ATOM   5509  C  CB    . SER H  4 57  ? 4.363   -13.532 38.342  1.00 40.27  ? 57   SER H CB    1 
ATOM   5510  O  OG    . SER H  4 57  ? 3.804   -14.740 37.841  1.00 44.32  ? 57   SER H OG    1 
ATOM   5511  N  N     . ILE H  4 58  ? 1.720   -12.212 39.398  1.00 37.62  ? 58   ILE H N     1 
ATOM   5512  C  CA    . ILE H  4 58  ? 0.333   -11.995 39.778  1.00 37.19  ? 58   ILE H CA    1 
ATOM   5513  C  C     . ILE H  4 58  ? -0.405  -10.955 38.912  1.00 38.63  ? 58   ILE H C     1 
ATOM   5514  O  O     . ILE H  4 58  ? -1.520  -11.225 38.439  1.00 38.84  ? 58   ILE H O     1 
ATOM   5515  C  CB    . ILE H  4 58  ? 0.281   -11.588 41.241  1.00 36.70  ? 58   ILE H CB    1 
ATOM   5516  C  CG1   . ILE H  4 58  ? 0.727   -12.786 42.069  1.00 37.01  ? 58   ILE H CG1   1 
ATOM   5517  C  CG2   . ILE H  4 58  ? -1.084  -11.039 41.621  1.00 32.95  ? 58   ILE H CG2   1 
ATOM   5518  C  CD1   . ILE H  4 58  ? 1.236   -12.452 43.404  1.00 40.20  ? 58   ILE H CD1   1 
ATOM   5519  N  N     . MET H  4 59  ? 0.206   -9.778  38.697  1.00 39.25  ? 59   MET H N     1 
ATOM   5520  C  CA    . MET H  4 59  ? -0.434  -8.720  37.899  1.00 39.36  ? 59   MET H CA    1 
ATOM   5521  C  C     . MET H  4 59  ? -0.664  -9.256  36.532  1.00 39.36  ? 59   MET H C     1 
ATOM   5522  O  O     . MET H  4 59  ? -1.748  -9.122  35.992  1.00 39.81  ? 59   MET H O     1 
ATOM   5523  C  CB    . MET H  4 59  ? 0.419   -7.440  37.806  1.00 40.00  ? 59   MET H CB    1 
ATOM   5524  C  CG    . MET H  4 59  ? 0.428   -6.581  39.040  1.00 39.12  ? 59   MET H CG    1 
ATOM   5525  S  SD    . MET H  4 59  ? -1.251  -6.284  39.579  1.00 43.50  ? 59   MET H SD    1 
ATOM   5526  C  CE    . MET H  4 59  ? -2.035  -5.594  38.102  1.00 39.20  ? 59   MET H CE    1 
ATOM   5527  N  N     . ASN H  4 60  ? 0.340   -9.910  35.972  1.00 39.65  ? 60   ASN H N     1 
ATOM   5528  C  CA    . ASN H  4 60  ? 0.125   -10.551 34.674  1.00 40.70  ? 60   ASN H CA    1 
ATOM   5529  C  C     . ASN H  4 60  ? -0.963  -11.648 34.657  1.00 40.25  ? 60   ASN H C     1 
ATOM   5530  O  O     . ASN H  4 60  ? -1.662  -11.799 33.644  1.00 40.53  ? 60   ASN H O     1 
ATOM   5531  C  CB    . ASN H  4 60  ? 1.436   -11.035 34.061  1.00 41.53  ? 60   ASN H CB    1 
ATOM   5532  C  CG    . ASN H  4 60  ? 1.271   -11.424 32.621  1.00 44.34  ? 60   ASN H CG    1 
ATOM   5533  O  OD1   . ASN H  4 60  ? 1.166   -12.605 32.310  1.00 50.68  ? 60   ASN H OD1   1 
ATOM   5534  N  ND2   . ASN H  4 60  ? 1.204   -10.444 31.734  1.00 45.13  ? 60   ASN H ND2   1 
ATOM   5535  N  N     . SER H  4 61  ? -1.138  -12.379 35.771  1.00 39.31  ? 61   SER H N     1 
ATOM   5536  C  CA    . SER H  4 61  ? -2.230  -13.360 35.876  1.00 38.75  ? 61   SER H CA    1 
ATOM   5537  C  C     . SER H  4 61  ? -3.561  -12.649 35.873  1.00 38.57  ? 61   SER H C     1 
ATOM   5538  O  O     . SER H  4 61  ? -4.430  -12.982 35.060  1.00 38.41  ? 61   SER H O     1 
ATOM   5539  C  CB    . SER H  4 61  ? -2.114  -14.263 37.121  1.00 39.22  ? 61   SER H CB    1 
ATOM   5540  O  OG    . SER H  4 61  ? -1.038  -15.193 37.011  1.00 38.38  ? 61   SER H OG    1 
ATOM   5541  N  N     . PHE H  4 62  ? -3.705  -11.668 36.779  1.00 38.84  ? 62   PHE H N     1 
ATOM   5542  C  CA    . PHE H  4 62  ? -4.883  -10.747 36.875  1.00 37.96  ? 62   PHE H CA    1 
ATOM   5543  C  C     . PHE H  4 62  ? -5.339  -10.201 35.515  1.00 37.52  ? 62   PHE H C     1 
ATOM   5544  O  O     . PHE H  4 62  ? -6.528  -10.267 35.170  1.00 37.33  ? 62   PHE H O     1 
ATOM   5545  C  CB    . PHE H  4 62  ? -4.586  -9.599  37.848  1.00 38.12  ? 62   PHE H CB    1 
ATOM   5546  C  CG    . PHE H  4 62  ? -5.701  -8.613  37.986  1.00 38.68  ? 62   PHE H CG    1 
ATOM   5547  C  CD1   . PHE H  4 62  ? -6.887  -8.965  38.623  1.00 39.53  ? 62   PHE H CD1   1 
ATOM   5548  C  CD2   . PHE H  4 62  ? -5.569  -7.320  37.473  1.00 40.13  ? 62   PHE H CD2   1 
ATOM   5549  C  CE1   . PHE H  4 62  ? -7.931  -8.068  38.732  1.00 40.48  ? 62   PHE H CE1   1 
ATOM   5550  C  CE2   . PHE H  4 62  ? -6.603  -6.404  37.568  1.00 39.11  ? 62   PHE H CE2   1 
ATOM   5551  C  CZ    . PHE H  4 62  ? -7.792  -6.773  38.195  1.00 40.73  ? 62   PHE H CZ    1 
ATOM   5552  N  N     . VAL H  4 63  ? -4.405  -9.710  34.711  1.00 36.77  ? 63   VAL H N     1 
ATOM   5553  C  CA    . VAL H  4 63  ? -4.811  -9.167  33.414  1.00 36.90  ? 63   VAL H CA    1 
ATOM   5554  C  C     . VAL H  4 63  ? -5.348  -10.243 32.462  1.00 37.48  ? 63   VAL H C     1 
ATOM   5555  O  O     . VAL H  4 63  ? -6.437  -10.064 31.922  1.00 37.66  ? 63   VAL H O     1 
ATOM   5556  C  CB    . VAL H  4 63  ? -3.713  -8.319  32.728  1.00 36.87  ? 63   VAL H CB    1 
ATOM   5557  C  CG1   . VAL H  4 63  ? -4.229  -7.799  31.411  1.00 35.92  ? 63   VAL H CG1   1 
ATOM   5558  C  CG2   . VAL H  4 63  ? -3.249  -7.163  33.651  1.00 35.91  ? 63   VAL H CG2   1 
ATOM   5559  N  N     . ASN H  4 64  ? -4.608  -11.350 32.256  1.00 37.82  ? 64   ASN H N     1 
ATOM   5560  C  CA    . ASN H  4 64  ? -5.135  -12.501 31.495  1.00 37.49  ? 64   ASN H CA    1 
ATOM   5561  C  C     . ASN H  4 64  ? -6.429  -13.054 32.093  1.00 37.18  ? 64   ASN H C     1 
ATOM   5562  O  O     . ASN H  4 64  ? -7.359  -13.415 31.365  1.00 36.66  ? 64   ASN H O     1 
ATOM   5563  C  CB    . ASN H  4 64  ? -4.113  -13.609 31.433  1.00 38.13  ? 64   ASN H CB    1 
ATOM   5564  C  CG    . ASN H  4 64  ? -2.923  -13.250 30.596  1.00 42.10  ? 64   ASN H CG    1 
ATOM   5565  O  OD1   . ASN H  4 64  ? -3.061  -13.014 29.392  1.00 47.97  ? 64   ASN H OD1   1 
ATOM   5566  N  ND2   . ASN H  4 64  ? -1.737  -13.205 31.210  1.00 43.19  ? 64   ASN H ND2   1 
ATOM   5567  N  N     . ASP H  4 65  ? -6.500  -13.115 33.423  1.00 36.96  ? 65   ASP H N     1 
ATOM   5568  C  CA    . ASP H  4 65  ? -7.706  -13.587 34.049  1.00 37.71  ? 65   ASP H CA    1 
ATOM   5569  C  C     . ASP H  4 65  ? -8.876  -12.723 33.605  1.00 38.55  ? 65   ASP H C     1 
ATOM   5570  O  O     . ASP H  4 65  ? -9.800  -13.243 32.996  1.00 38.94  ? 65   ASP H O     1 
ATOM   5571  C  CB    . ASP H  4 65  ? -7.596  -13.690 35.579  1.00 37.77  ? 65   ASP H CB    1 
ATOM   5572  C  CG    . ASP H  4 65  ? -8.892  -14.192 36.220  1.00 39.51  ? 65   ASP H CG    1 
ATOM   5573  O  OD1   . ASP H  4 65  ? -9.645  -14.883 35.503  1.00 43.57  ? 65   ASP H OD1   1 
ATOM   5574  O  OD2   . ASP H  4 65  ? -9.188  -13.895 37.410  1.00 38.25  ? 65   ASP H OD2   1 
ATOM   5575  N  N     . VAL H  4 66  ? -8.827  -11.410 33.873  1.00 39.44  ? 66   VAL H N     1 
ATOM   5576  C  CA    . VAL H  4 66  ? -9.939  -10.487 33.538  1.00 39.60  ? 66   VAL H CA    1 
ATOM   5577  C  C     . VAL H  4 66  ? -10.238 -10.422 32.042  1.00 39.44  ? 66   VAL H C     1 
ATOM   5578  O  O     . VAL H  4 66  ? -11.405 -10.430 31.645  1.00 39.11  ? 66   VAL H O     1 
ATOM   5579  C  CB    . VAL H  4 66  ? -9.702  -9.037  34.095  1.00 40.02  ? 66   VAL H CB    1 
ATOM   5580  C  CG1   . VAL H  4 66  ? -10.741 -8.070  33.574  1.00 38.91  ? 66   VAL H CG1   1 
ATOM   5581  C  CG2   . VAL H  4 66  ? -9.716  -9.031  35.621  1.00 40.60  ? 66   VAL H CG2   1 
ATOM   5582  N  N     . PHE H  4 67  ? -9.198  -10.340 31.217  1.00 39.67  ? 67   PHE H N     1 
ATOM   5583  C  CA    . PHE H  4 67  ? -9.375  -10.429 29.772  1.00 40.82  ? 67   PHE H CA    1 
ATOM   5584  C  C     . PHE H  4 67  ? -10.276 -11.611 29.409  1.00 41.64  ? 67   PHE H C     1 
ATOM   5585  O  O     . PHE H  4 67  ? -11.241 -11.448 28.686  1.00 42.23  ? 67   PHE H O     1 
ATOM   5586  C  CB    . PHE H  4 67  ? -8.031  -10.596 29.080  1.00 41.12  ? 67   PHE H CB    1 
ATOM   5587  C  CG    . PHE H  4 67  ? -8.119  -10.621 27.588  1.00 42.26  ? 67   PHE H CG    1 
ATOM   5588  C  CD1   . PHE H  4 67  ? -7.547  -9.614  26.836  1.00 43.05  ? 67   PHE H CD1   1 
ATOM   5589  C  CD2   . PHE H  4 67  ? -8.770  -11.654 26.930  1.00 44.96  ? 67   PHE H CD2   1 
ATOM   5590  C  CE1   . PHE H  4 67  ? -7.631  -9.625  25.446  1.00 44.96  ? 67   PHE H CE1   1 
ATOM   5591  C  CE2   . PHE H  4 67  ? -8.854  -11.684 25.528  1.00 45.65  ? 67   PHE H CE2   1 
ATOM   5592  C  CZ    . PHE H  4 67  ? -8.282  -10.669 24.791  1.00 44.09  ? 67   PHE H CZ    1 
ATOM   5593  N  N     . GLU H  4 68  ? -9.954  -12.797 29.923  1.00 42.41  ? 68   GLU H N     1 
ATOM   5594  C  CA    . GLU H  4 68  ? -10.713 -14.012 29.665  1.00 43.10  ? 68   GLU H CA    1 
ATOM   5595  C  C     . GLU H  4 68  ? -12.170 -13.889 30.102  1.00 41.72  ? 68   GLU H C     1 
ATOM   5596  O  O     . GLU H  4 68  ? -13.069 -14.239 29.344  1.00 41.67  ? 68   GLU H O     1 
ATOM   5597  C  CB    . GLU H  4 68  ? -10.074 -15.181 30.413  1.00 44.76  ? 68   GLU H CB    1 
ATOM   5598  C  CG    . GLU H  4 68  ? -9.642  -16.367 29.572  1.00 49.84  ? 68   GLU H CG    1 
ATOM   5599  C  CD    . GLU H  4 68  ? -8.292  -16.949 30.054  1.00 57.37  ? 68   GLU H CD    1 
ATOM   5600  O  OE1   . GLU H  4 68  ? -8.026  -16.965 31.305  1.00 59.27  ? 68   GLU H OE1   1 
ATOM   5601  O  OE2   . GLU H  4 68  ? -7.504  -17.390 29.170  1.00 59.24  ? 68   GLU H OE2   1 
ATOM   5602  N  N     . ARG H  4 69  ? -12.419 -13.406 31.314  1.00 40.19  ? 69   ARG H N     1 
ATOM   5603  C  CA    . ARG H  4 69  ? -13.791 -13.299 31.750  1.00 40.22  ? 69   ARG H CA    1 
ATOM   5604  C  C     . ARG H  4 69  ? -14.587 -12.350 30.854  1.00 41.03  ? 69   ARG H C     1 
ATOM   5605  O  O     . ARG H  4 69  ? -15.749 -12.627 30.531  1.00 41.36  ? 69   ARG H O     1 
ATOM   5606  C  CB    . ARG H  4 69  ? -13.905 -12.877 33.195  1.00 39.64  ? 69   ARG H CB    1 
ATOM   5607  C  CG    . ARG H  4 69  ? -13.125 -13.732 34.149  1.00 39.82  ? 69   ARG H CG    1 
ATOM   5608  C  CD    . ARG H  4 69  ? -13.622 -13.510 35.584  1.00 39.88  ? 69   ARG H CD    1 
ATOM   5609  N  NE    . ARG H  4 69  ? -12.501 -13.501 36.533  1.00 39.70  ? 69   ARG H NE    1 
ATOM   5610  C  CZ    . ARG H  4 69  ? -12.609 -13.155 37.813  1.00 40.33  ? 69   ARG H CZ    1 
ATOM   5611  N  NH1   . ARG H  4 69  ? -13.781 -12.788 38.310  1.00 39.69  ? 69   ARG H NH1   1 
ATOM   5612  N  NH2   . ARG H  4 69  ? -11.546 -13.178 38.603  1.00 41.92  ? 69   ARG H NH2   1 
ATOM   5613  N  N     . ILE H  4 70  ? -13.959 -11.253 30.419  1.00 41.31  ? 70   ILE H N     1 
ATOM   5614  C  CA    . ILE H  4 70  ? -14.673 -10.273 29.617  1.00 41.12  ? 70   ILE H CA    1 
ATOM   5615  C  C     . ILE H  4 70  ? -14.906 -10.774 28.212  1.00 41.43  ? 70   ILE H C     1 
ATOM   5616  O  O     . ILE H  4 70  ? -16.045 -10.731 27.767  1.00 41.96  ? 70   ILE H O     1 
ATOM   5617  C  CB    . ILE H  4 70  ? -14.058 -8.838  29.676  1.00 41.56  ? 70   ILE H CB    1 
ATOM   5618  C  CG1   . ILE H  4 70  ? -14.319 -8.232  31.069  1.00 40.64  ? 70   ILE H CG1   1 
ATOM   5619  C  CG2   . ILE H  4 70  ? -14.660 -7.934  28.582  1.00 38.78  ? 70   ILE H CG2   1 
ATOM   5620  C  CD1   . ILE H  4 70  ? -13.356 -7.168  31.468  1.00 40.31  ? 70   ILE H CD1   1 
ATOM   5621  N  N     . ALA H  4 71  ? -13.871 -11.265 27.533  1.00 41.43  ? 71   ALA H N     1 
ATOM   5622  C  CA    . ALA H  4 71  ? -14.028 -11.777 26.164  1.00 42.52  ? 71   ALA H CA    1 
ATOM   5623  C  C     . ALA H  4 71  ? -14.987 -12.959 26.125  1.00 43.52  ? 71   ALA H C     1 
ATOM   5624  O  O     . ALA H  4 71  ? -15.754 -13.114 25.170  1.00 44.29  ? 71   ALA H O     1 
ATOM   5625  C  CB    . ALA H  4 71  ? -12.697 -12.170 25.576  1.00 42.32  ? 71   ALA H CB    1 
ATOM   5626  N  N     . GLY H  4 72  ? -14.956 -13.775 27.178  1.00 43.71  ? 72   GLY H N     1 
ATOM   5627  C  CA    . GLY H  4 72  ? -15.873 -14.875 27.318  1.00 44.16  ? 72   GLY H CA    1 
ATOM   5628  C  C     . GLY H  4 72  ? -17.323 -14.466 27.319  1.00 44.94  ? 72   GLY H C     1 
ATOM   5629  O  O     . GLY H  4 72  ? -18.096 -14.943 26.513  1.00 44.32  ? 72   GLY H O     1 
ATOM   5630  N  N     . GLU H  4 73  ? -17.700 -13.583 28.238  1.00 46.67  ? 73   GLU H N     1 
ATOM   5631  C  CA    . GLU H  4 73  ? -19.095 -13.156 28.329  1.00 48.34  ? 73   GLU H CA    1 
ATOM   5632  C  C     . GLU H  4 73  ? -19.546 -12.362 27.077  1.00 49.23  ? 73   GLU H C     1 
ATOM   5633  O  O     . GLU H  4 73  ? -20.686 -12.517 26.602  1.00 49.70  ? 73   GLU H O     1 
ATOM   5634  C  CB    . GLU H  4 73  ? -19.363 -12.422 29.634  1.00 47.82  ? 73   GLU H CB    1 
ATOM   5635  C  CG    . GLU H  4 73  ? -20.792 -11.874 29.738  1.00 51.65  ? 73   GLU H CG    1 
ATOM   5636  C  CD    . GLU H  4 73  ? -21.892 -12.950 29.822  1.00 54.54  ? 73   GLU H CD    1 
ATOM   5637  O  OE1   . GLU H  4 73  ? -22.799 -12.973 28.956  1.00 52.09  ? 73   GLU H OE1   1 
ATOM   5638  O  OE2   . GLU H  4 73  ? -21.864 -13.757 30.778  1.00 58.85  ? 73   GLU H OE2   1 
ATOM   5639  N  N     . ALA H  4 74  ? -18.634 -11.567 26.518  1.00 49.73  ? 74   ALA H N     1 
ATOM   5640  C  CA    . ALA H  4 74  ? -18.881 -10.867 25.273  1.00 50.24  ? 74   ALA H CA    1 
ATOM   5641  C  C     . ALA H  4 74  ? -19.183 -11.864 24.180  1.00 50.79  ? 74   ALA H C     1 
ATOM   5642  O  O     . ALA H  4 74  ? -20.046 -11.624 23.336  1.00 51.48  ? 74   ALA H O     1 
ATOM   5643  C  CB    . ALA H  4 74  ? -17.682 -10.030 24.893  1.00 50.44  ? 74   ALA H CB    1 
ATOM   5644  N  N     . SER H  4 75  ? -18.474 -12.987 24.190  1.00 51.23  ? 75   SER H N     1 
ATOM   5645  C  CA    . SER H  4 75  ? -18.708 -14.046 23.204  1.00 51.58  ? 75   SER H CA    1 
ATOM   5646  C  C     . SER H  4 75  ? -20.110 -14.667 23.305  1.00 51.74  ? 75   SER H C     1 
ATOM   5647  O  O     . SER H  4 75  ? -20.776 -14.874 22.297  1.00 51.48  ? 75   SER H O     1 
ATOM   5648  C  CB    . SER H  4 75  ? -17.670 -15.138 23.350  1.00 51.21  ? 75   SER H CB    1 
ATOM   5649  O  OG    . SER H  4 75  ? -17.882 -16.068 22.329  1.00 51.74  ? 75   SER H OG    1 
ATOM   5650  N  N     . ARG H  4 76  ? -20.543 -14.959 24.529  1.00 52.30  ? 76   ARG H N     1 
ATOM   5651  C  CA    . ARG H  4 76  ? -21.881 -15.461 24.769  1.00 52.78  ? 76   ARG H CA    1 
ATOM   5652  C  C     . ARG H  4 76  ? -22.922 -14.490 24.263  1.00 53.03  ? 76   ARG H C     1 
ATOM   5653  O  O     . ARG H  4 76  ? -23.824 -14.892 23.542  1.00 52.68  ? 76   ARG H O     1 
ATOM   5654  C  CB    . ARG H  4 76  ? -22.099 -15.743 26.254  1.00 53.21  ? 76   ARG H CB    1 
ATOM   5655  C  CG    . ARG H  4 76  ? -21.486 -17.051 26.699  1.00 53.09  ? 76   ARG H CG    1 
ATOM   5656  C  CD    . ARG H  4 76  ? -21.439 -17.210 28.199  1.00 52.32  ? 76   ARG H CD    1 
ATOM   5657  N  NE    . ARG H  4 76  ? -20.115 -17.727 28.502  1.00 54.28  ? 76   ARG H NE    1 
ATOM   5658  C  CZ    . ARG H  4 76  ? -19.223 -17.121 29.277  1.00 56.05  ? 76   ARG H CZ    1 
ATOM   5659  N  NH1   . ARG H  4 76  ? -19.534 -15.991 29.906  1.00 57.69  ? 76   ARG H NH1   1 
ATOM   5660  N  NH2   . ARG H  4 76  ? -18.025 -17.665 29.452  1.00 56.09  ? 76   ARG H NH2   1 
ATOM   5661  N  N     . LEU H  4 77  ? -22.775 -13.213 24.631  1.00 53.77  ? 77   LEU H N     1 
ATOM   5662  C  CA    . LEU H  4 77  ? -23.708 -12.136 24.221  1.00 53.98  ? 77   LEU H CA    1 
ATOM   5663  C  C     . LEU H  4 77  ? -23.967 -12.093 22.724  1.00 54.48  ? 77   LEU H C     1 
ATOM   5664  O  O     . LEU H  4 77  ? -25.116 -12.006 22.302  1.00 53.72  ? 77   LEU H O     1 
ATOM   5665  C  CB    . LEU H  4 77  ? -23.220 -10.771 24.694  1.00 53.67  ? 77   LEU H CB    1 
ATOM   5666  C  CG    . LEU H  4 77  ? -23.447 -10.411 26.159  1.00 53.17  ? 77   LEU H CG    1 
ATOM   5667  C  CD1   . LEU H  4 77  ? -22.552 -9.260  26.533  1.00 52.85  ? 77   LEU H CD1   1 
ATOM   5668  C  CD2   . LEU H  4 77  ? -24.875 -10.051 26.402  1.00 53.05  ? 77   LEU H CD2   1 
ATOM   5669  N  N     . ALA H  4 78  ? -22.898 -12.160 21.933  1.00 55.84  ? 78   ALA H N     1 
ATOM   5670  C  CA    . ALA H  4 78  ? -23.022 -12.183 20.479  1.00 57.59  ? 78   ALA H CA    1 
ATOM   5671  C  C     . ALA H  4 78  ? -23.733 -13.444 19.983  1.00 59.32  ? 78   ALA H C     1 
ATOM   5672  O  O     . ALA H  4 78  ? -24.554 -13.359 19.074  1.00 60.04  ? 78   ALA H O     1 
ATOM   5673  C  CB    . ALA H  4 78  ? -21.677 -12.026 19.825  1.00 57.06  ? 78   ALA H CB    1 
ATOM   5674  N  N     . HIS H  4 79  ? -23.433 -14.605 20.577  1.00 61.32  ? 79   HIS H N     1 
ATOM   5675  C  CA    . HIS H  4 79  ? -24.150 -15.839 20.242  1.00 63.03  ? 79   HIS H CA    1 
ATOM   5676  C  C     . HIS H  4 79  ? -25.617 -15.701 20.633  1.00 63.53  ? 79   HIS H C     1 
ATOM   5677  O  O     . HIS H  4 79  ? -26.479 -15.894 19.795  1.00 63.97  ? 79   HIS H O     1 
ATOM   5678  C  CB    . HIS H  4 79  ? -23.515 -17.108 20.865  1.00 63.50  ? 79   HIS H CB    1 
ATOM   5679  C  CG    . HIS H  4 79  ? -22.183 -17.487 20.275  1.00 66.50  ? 79   HIS H CG    1 
ATOM   5680  N  ND1   . HIS H  4 79  ? -21.081 -17.795 21.052  1.00 68.87  ? 79   HIS H ND1   1 
ATOM   5681  C  CD2   . HIS H  4 79  ? -21.775 -17.609 18.984  1.00 68.25  ? 79   HIS H CD2   1 
ATOM   5682  C  CE1   . HIS H  4 79  ? -20.052 -18.075 20.267  1.00 69.14  ? 79   HIS H CE1   1 
ATOM   5683  N  NE2   . HIS H  4 79  ? -20.447 -17.968 19.008  1.00 68.83  ? 79   HIS H NE2   1 
ATOM   5684  N  N     . TYR H  4 80  ? -25.903 -15.334 21.879  1.00 64.58  ? 80   TYR H N     1 
ATOM   5685  C  CA    . TYR H  4 80  ? -27.290 -15.191 22.340  1.00 66.10  ? 80   TYR H CA    1 
ATOM   5686  C  C     . TYR H  4 80  ? -28.142 -14.365 21.397  1.00 66.26  ? 80   TYR H C     1 
ATOM   5687  O  O     . TYR H  4 80  ? -29.339 -14.591 21.304  1.00 66.49  ? 80   TYR H O     1 
ATOM   5688  C  CB    . TYR H  4 80  ? -27.384 -14.538 23.727  1.00 67.26  ? 80   TYR H CB    1 
ATOM   5689  C  CG    . TYR H  4 80  ? -26.754 -15.312 24.863  1.00 69.43  ? 80   TYR H CG    1 
ATOM   5690  C  CD1   . TYR H  4 80  ? -26.373 -16.654 24.704  1.00 70.84  ? 80   TYR H CD1   1 
ATOM   5691  C  CD2   . TYR H  4 80  ? -26.568 -14.712 26.114  1.00 70.07  ? 80   TYR H CD2   1 
ATOM   5692  C  CE1   . TYR H  4 80  ? -25.794 -17.362 25.741  1.00 71.34  ? 80   TYR H CE1   1 
ATOM   5693  C  CE2   . TYR H  4 80  ? -25.999 -15.409 27.164  1.00 70.93  ? 80   TYR H CE2   1 
ATOM   5694  C  CZ    . TYR H  4 80  ? -25.610 -16.737 26.973  1.00 71.48  ? 80   TYR H CZ    1 
ATOM   5695  O  OH    . TYR H  4 80  ? -25.041 -17.452 28.012  1.00 71.75  ? 80   TYR H OH    1 
ATOM   5696  N  N     . ASN H  4 81  ? -27.520 -13.404 20.715  1.00 66.38  ? 81   ASN H N     1 
ATOM   5697  C  CA    . ASN H  4 81  ? -28.226 -12.442 19.885  1.00 66.24  ? 81   ASN H CA    1 
ATOM   5698  C  C     . ASN H  4 81  ? -27.974 -12.645 18.401  1.00 66.24  ? 81   ASN H C     1 
ATOM   5699  O  O     . ASN H  4 81  ? -28.007 -11.694 17.620  1.00 66.46  ? 81   ASN H O     1 
ATOM   5700  C  CB    . ASN H  4 81  ? -27.831 -11.022 20.301  1.00 66.50  ? 81   ASN H CB    1 
ATOM   5701  C  CG    . ASN H  4 81  ? -28.285 -10.685 21.699  1.00 66.73  ? 81   ASN H CG    1 
ATOM   5702  O  OD1   . ASN H  4 81  ? -29.460 -10.437 21.928  1.00 68.38  ? 81   ASN H OD1   1 
ATOM   5703  N  ND2   . ASN H  4 81  ? -27.358 -10.685 22.647  1.00 67.60  ? 81   ASN H ND2   1 
ATOM   5704  N  N     . LYS H  4 82  ? -27.731 -13.895 18.023  1.00 66.47  ? 82   LYS H N     1 
ATOM   5705  C  CA    . LYS H  4 82  ? -27.432 -14.293 16.634  1.00 66.57  ? 82   LYS H CA    1 
ATOM   5706  C  C     . LYS H  4 82  ? -26.545 -13.307 15.869  1.00 65.99  ? 82   LYS H C     1 
ATOM   5707  O  O     . LYS H  4 82  ? -26.906 -12.879 14.777  1.00 65.98  ? 82   LYS H O     1 
ATOM   5708  C  CB    . LYS H  4 82  ? -28.722 -14.589 15.841  1.00 66.77  ? 82   LYS H CB    1 
ATOM   5709  C  CG    . LYS H  4 82  ? -29.516 -15.815 16.331  1.00 68.93  ? 82   LYS H CG    1 
ATOM   5710  C  CD    . LYS H  4 82  ? -30.833 -15.427 17.030  1.00 70.68  ? 82   LYS H CD    1 
ATOM   5711  C  CE    . LYS H  4 82  ? -32.017 -15.354 16.029  1.00 71.62  ? 82   LYS H CE    1 
ATOM   5712  N  NZ    . LYS H  4 82  ? -33.234 -14.609 16.531  1.00 71.54  ? 82   LYS H NZ    1 
ATOM   5713  N  N     . ARG H  4 83  ? -25.388 -12.968 16.435  1.00 65.43  ? 83   ARG H N     1 
ATOM   5714  C  CA    . ARG H  4 83  ? -24.478 -11.992 15.827  1.00 65.55  ? 83   ARG H CA    1 
ATOM   5715  C  C     . ARG H  4 83  ? -23.066 -12.538 15.652  1.00 65.16  ? 83   ARG H C     1 
ATOM   5716  O  O     . ARG H  4 83  ? -22.543 -13.197 16.550  1.00 65.99  ? 83   ARG H O     1 
ATOM   5717  C  CB    . ARG H  4 83  ? -24.434 -10.722 16.676  1.00 65.84  ? 83   ARG H CB    1 
ATOM   5718  C  CG    . ARG H  4 83  ? -24.965 -9.447  16.011  1.00 68.05  ? 83   ARG H CG    1 
ATOM   5719  C  CD    . ARG H  4 83  ? -26.351 -9.564  15.343  1.00 72.10  ? 83   ARG H CD    1 
ATOM   5720  N  NE    . ARG H  4 83  ? -26.856 -8.224  15.058  1.00 75.51  ? 83   ARG H NE    1 
ATOM   5721  C  CZ    . ARG H  4 83  ? -27.679 -7.546  15.861  1.00 78.41  ? 83   ARG H CZ    1 
ATOM   5722  N  NH1   . ARG H  4 83  ? -28.134 -8.103  16.984  1.00 78.83  ? 83   ARG H NH1   1 
ATOM   5723  N  NH2   . ARG H  4 83  ? -28.061 -6.310  15.537  1.00 79.00  ? 83   ARG H NH2   1 
ATOM   5724  N  N     . SER H  4 84  ? -22.445 -12.236 14.512  1.00 64.20  ? 84   SER H N     1 
ATOM   5725  C  CA    . SER H  4 84  ? -21.137 -12.774 14.133  1.00 63.30  ? 84   SER H CA    1 
ATOM   5726  C  C     . SER H  4 84  ? -19.951 -12.018 14.700  1.00 62.77  ? 84   SER H C     1 
ATOM   5727  O  O     . SER H  4 84  ? -18.804 -12.414 14.499  1.00 63.19  ? 84   SER H O     1 
ATOM   5728  C  CB    . SER H  4 84  ? -20.979 -12.732 12.617  1.00 63.44  ? 84   SER H CB    1 
ATOM   5729  O  OG    . SER H  4 84  ? -22.204 -12.974 11.956  1.00 65.02  ? 84   SER H OG    1 
ATOM   5730  N  N     . THR H  4 85  ? -20.192 -10.913 15.386  1.00 62.03  ? 85   THR H N     1 
ATOM   5731  C  CA    . THR H  4 85  ? -19.084 -10.005 15.687  1.00 60.95  ? 85   THR H CA    1 
ATOM   5732  C  C     . THR H  4 85  ? -19.086 -9.533  17.128  1.00 59.75  ? 85   THR H C     1 
ATOM   5733  O  O     . THR H  4 85  ? -20.148 -9.357  17.716  1.00 59.88  ? 85   THR H O     1 
ATOM   5734  C  CB    . THR H  4 85  ? -19.056 -8.805  14.682  1.00 61.21  ? 85   THR H CB    1 
ATOM   5735  O  OG1   . THR H  4 85  ? -18.480 -7.647  15.302  1.00 62.77  ? 85   THR H OG1   1 
ATOM   5736  C  CG2   . THR H  4 85  ? -20.451 -8.450  14.212  1.00 60.80  ? 85   THR H CG2   1 
ATOM   5737  N  N     . ILE H  4 86  ? -17.896 -9.355  17.693  1.00 58.43  ? 86   ILE H N     1 
ATOM   5738  C  CA    . ILE H  4 86  ? -17.737 -8.730  19.017  1.00 57.65  ? 86   ILE H CA    1 
ATOM   5739  C  C     . ILE H  4 86  ? -17.412 -7.231  18.889  1.00 56.78  ? 86   ILE H C     1 
ATOM   5740  O  O     . ILE H  4 86  ? -16.373 -6.840  18.378  1.00 56.79  ? 86   ILE H O     1 
ATOM   5741  C  CB    . ILE H  4 86  ? -16.685 -9.484  19.885  1.00 57.63  ? 86   ILE H CB    1 
ATOM   5742  C  CG1   . ILE H  4 86  ? -17.210 -10.871 20.239  1.00 58.37  ? 86   ILE H CG1   1 
ATOM   5743  C  CG2   . ILE H  4 86  ? -16.387 -8.757  21.189  1.00 57.51  ? 86   ILE H CG2   1 
ATOM   5744  C  CD1   . ILE H  4 86  ? -16.132 -11.838 20.574  1.00 58.63  ? 86   ILE H CD1   1 
ATOM   5745  N  N     . THR H  4 87  ? -18.326 -6.396  19.342  1.00 55.90  ? 87   THR H N     1 
ATOM   5746  C  CA    . THR H  4 87  ? -18.157 -4.950  19.245  1.00 55.21  ? 87   THR H CA    1 
ATOM   5747  C  C     . THR H  4 87  ? -18.024 -4.373  20.650  1.00 54.88  ? 87   THR H C     1 
ATOM   5748  O  O     . THR H  4 87  ? -18.338 -5.051  21.639  1.00 55.33  ? 87   THR H O     1 
ATOM   5749  C  CB    . THR H  4 87  ? -19.379 -4.301  18.586  1.00 54.67  ? 87   THR H CB    1 
ATOM   5750  O  OG1   . THR H  4 87  ? -20.498 -4.432  19.463  1.00 55.08  ? 87   THR H OG1   1 
ATOM   5751  C  CG2   . THR H  4 87  ? -19.717 -4.983  17.282  1.00 54.24  ? 87   THR H CG2   1 
ATOM   5752  N  N     . SER H  4 88  ? -17.610 -3.116  20.742  1.00 53.99  ? 88   SER H N     1 
ATOM   5753  C  CA    . SER H  4 88  ? -17.438 -2.470  22.031  1.00 53.69  ? 88   SER H CA    1 
ATOM   5754  C  C     . SER H  4 88  ? -18.722 -2.499  22.858  1.00 53.32  ? 88   SER H C     1 
ATOM   5755  O  O     . SER H  4 88  ? -18.689 -2.408  24.083  1.00 53.56  ? 88   SER H O     1 
ATOM   5756  C  CB    . SER H  4 88  ? -16.967 -1.039  21.842  1.00 53.68  ? 88   SER H CB    1 
ATOM   5757  O  OG    . SER H  4 88  ? -18.075 -0.241  21.480  1.00 55.09  ? 88   SER H OG    1 
ATOM   5758  N  N     . ARG H  4 89  ? -19.855 -2.642  22.194  1.00 52.86  ? 89   ARG H N     1 
ATOM   5759  C  CA    . ARG H  4 89  ? -21.112 -2.768  22.899  1.00 52.98  ? 89   ARG H CA    1 
ATOM   5760  C  C     . ARG H  4 89  ? -21.145 -4.012  23.798  1.00 52.84  ? 89   ARG H C     1 
ATOM   5761  O  O     . ARG H  4 89  ? -21.409 -3.892  24.980  1.00 52.91  ? 89   ARG H O     1 
ATOM   5762  C  CB    . ARG H  4 89  ? -22.242 -2.794  21.896  1.00 53.40  ? 89   ARG H CB    1 
ATOM   5763  C  CG    . ARG H  4 89  ? -23.570 -2.497  22.492  1.00 56.39  ? 89   ARG H CG    1 
ATOM   5764  C  CD    . ARG H  4 89  ? -24.609 -2.298  21.399  1.00 61.45  ? 89   ARG H CD    1 
ATOM   5765  N  NE    . ARG H  4 89  ? -25.857 -1.807  21.978  1.00 65.08  ? 89   ARG H NE    1 
ATOM   5766  C  CZ    . ARG H  4 89  ? -26.778 -2.591  22.518  1.00 65.63  ? 89   ARG H CZ    1 
ATOM   5767  N  NH1   . ARG H  4 89  ? -26.587 -3.900  22.532  1.00 66.20  ? 89   ARG H NH1   1 
ATOM   5768  N  NH2   . ARG H  4 89  ? -27.880 -2.067  23.038  1.00 66.50  ? 89   ARG H NH2   1 
ATOM   5769  N  N     . GLU H  4 90  ? -20.861 -5.193  23.232  1.00 52.51  ? 90   GLU H N     1 
ATOM   5770  C  CA    . GLU H  4 90  ? -20.706 -6.435  24.000  1.00 51.59  ? 90   GLU H CA    1 
ATOM   5771  C  C     . GLU H  4 90  ? -19.663 -6.320  25.089  1.00 50.23  ? 90   GLU H C     1 
ATOM   5772  O  O     . GLU H  4 90  ? -19.900 -6.799  26.202  1.00 50.54  ? 90   GLU H O     1 
ATOM   5773  C  CB    . GLU H  4 90  ? -20.303 -7.622  23.120  1.00 52.29  ? 90   GLU H CB    1 
ATOM   5774  C  CG    . GLU H  4 90  ? -21.406 -8.187  22.295  1.00 55.13  ? 90   GLU H CG    1 
ATOM   5775  C  CD    . GLU H  4 90  ? -21.719 -7.286  21.128  1.00 61.16  ? 90   GLU H CD    1 
ATOM   5776  O  OE1   . GLU H  4 90  ? -20.745 -6.830  20.476  1.00 61.92  ? 90   GLU H OE1   1 
ATOM   5777  O  OE2   . GLU H  4 90  ? -22.923 -7.017  20.885  1.00 63.68  ? 90   GLU H OE2   1 
ATOM   5778  N  N     . ILE H  4 91  ? -18.506 -5.728  24.791  1.00 47.91  ? 91   ILE H N     1 
ATOM   5779  C  CA    . ILE H  4 91  ? -17.521 -5.537  25.857  1.00 46.25  ? 91   ILE H CA    1 
ATOM   5780  C  C     . ILE H  4 91  ? -18.139 -4.739  27.000  1.00 45.66  ? 91   ILE H C     1 
ATOM   5781  O  O     . ILE H  4 91  ? -17.830 -4.958  28.164  1.00 45.35  ? 91   ILE H O     1 
ATOM   5782  C  CB    . ILE H  4 91  ? -16.247 -4.827  25.393  1.00 46.16  ? 91   ILE H CB    1 
ATOM   5783  C  CG1   . ILE H  4 91  ? -15.582 -5.569  24.216  1.00 45.78  ? 91   ILE H CG1   1 
ATOM   5784  C  CG2   . ILE H  4 91  ? -15.307 -4.633  26.568  1.00 44.08  ? 91   ILE H CG2   1 
ATOM   5785  C  CD1   . ILE H  4 91  ? -15.219 -7.021  24.489  1.00 44.28  ? 91   ILE H CD1   1 
ATOM   5786  N  N     . GLN H  4 92  ? -19.044 -3.836  26.657  1.00 45.25  ? 92   GLN H N     1 
ATOM   5787  C  CA    . GLN H  4 92  ? -19.595 -2.935  27.633  1.00 44.82  ? 92   GLN H CA    1 
ATOM   5788  C  C     . GLN H  4 92  ? -20.552 -3.623  28.557  1.00 44.43  ? 92   GLN H C     1 
ATOM   5789  O  O     . GLN H  4 92  ? -20.497 -3.440  29.770  1.00 44.44  ? 92   GLN H O     1 
ATOM   5790  C  CB    . GLN H  4 92  ? -20.300 -1.773  26.967  1.00 44.86  ? 92   GLN H CB    1 
ATOM   5791  C  CG    . GLN H  4 92  ? -21.010 -0.895  27.980  1.00 45.52  ? 92   GLN H CG    1 
ATOM   5792  C  CD    . GLN H  4 92  ? -21.139 0.526   27.534  1.00 44.58  ? 92   GLN H CD    1 
ATOM   5793  O  OE1   . GLN H  4 92  ? -22.205 1.098   27.631  1.00 44.77  ? 92   GLN H OE1   1 
ATOM   5794  N  NE2   . GLN H  4 92  ? -20.062 1.097   27.030  1.00 43.28  ? 92   GLN H NE2   1 
ATOM   5795  N  N     . THR H  4 93  ? -21.462 -4.388  27.988  1.00 44.35  ? 93   THR H N     1 
ATOM   5796  C  CA    . THR H  4 93  ? -22.412 -5.086  28.823  1.00 44.26  ? 93   THR H CA    1 
ATOM   5797  C  C     . THR H  4 93  ? -21.766 -6.286  29.535  1.00 44.14  ? 93   THR H C     1 
ATOM   5798  O  O     . THR H  4 93  ? -22.141 -6.588  30.670  1.00 44.09  ? 93   THR H O     1 
ATOM   5799  C  CB    . THR H  4 93  ? -23.723 -5.424  28.095  1.00 44.37  ? 93   THR H CB    1 
ATOM   5800  O  OG1   . THR H  4 93  ? -23.963 -6.837  28.192  1.00 46.04  ? 93   THR H OG1   1 
ATOM   5801  C  CG2   . THR H  4 93  ? -23.658 -5.022  26.654  1.00 42.51  ? 93   THR H CG2   1 
ATOM   5802  N  N     . ALA H  4 94  ? -20.773 -6.924  28.912  1.00 43.78  ? 94   ALA H N     1 
ATOM   5803  C  CA    . ALA H  4 94  ? -19.934 -7.888  29.635  1.00 43.95  ? 94   ALA H CA    1 
ATOM   5804  C  C     . ALA H  4 94  ? -19.298 -7.253  30.884  1.00 44.70  ? 94   ALA H C     1 
ATOM   5805  O  O     . ALA H  4 94  ? -19.270 -7.867  31.949  1.00 45.10  ? 94   ALA H O     1 
ATOM   5806  C  CB    . ALA H  4 94  ? -18.877 -8.450  28.744  1.00 43.38  ? 94   ALA H CB    1 
ATOM   5807  N  N     . VAL H  4 95  ? -18.794 -6.021  30.752  1.00 45.35  ? 95   VAL H N     1 
ATOM   5808  C  CA    . VAL H  4 95  ? -18.234 -5.263  31.882  1.00 45.24  ? 95   VAL H CA    1 
ATOM   5809  C  C     . VAL H  4 95  ? -19.298 -5.027  32.959  1.00 45.60  ? 95   VAL H C     1 
ATOM   5810  O  O     . VAL H  4 95  ? -19.065 -5.234  34.154  1.00 45.60  ? 95   VAL H O     1 
ATOM   5811  C  CB    . VAL H  4 95  ? -17.633 -3.924  31.393  1.00 45.09  ? 95   VAL H CB    1 
ATOM   5812  C  CG1   . VAL H  4 95  ? -17.493 -2.926  32.524  1.00 45.38  ? 95   VAL H CG1   1 
ATOM   5813  C  CG2   . VAL H  4 95  ? -16.272 -4.153  30.755  1.00 45.48  ? 95   VAL H CG2   1 
ATOM   5814  N  N     . ARG H  4 96  ? -20.478 -4.607  32.529  1.00 46.16  ? 96   ARG H N     1 
ATOM   5815  C  CA    . ARG H  4 96  ? -21.562 -4.344  33.454  1.00 46.87  ? 96   ARG H CA    1 
ATOM   5816  C  C     . ARG H  4 96  ? -21.947 -5.591  34.218  1.00 46.43  ? 96   ARG H C     1 
ATOM   5817  O  O     . ARG H  4 96  ? -22.288 -5.507  35.385  1.00 46.07  ? 96   ARG H O     1 
ATOM   5818  C  CB    . ARG H  4 96  ? -22.764 -3.733  32.733  1.00 47.35  ? 96   ARG H CB    1 
ATOM   5819  C  CG    . ARG H  4 96  ? -22.554 -2.248  32.387  1.00 51.24  ? 96   ARG H CG    1 
ATOM   5820  C  CD    . ARG H  4 96  ? -23.867 -1.528  32.134  1.00 58.13  ? 96   ARG H CD    1 
ATOM   5821  N  NE    . ARG H  4 96  ? -23.678 -0.079  31.989  1.00 63.63  ? 96   ARG H NE    1 
ATOM   5822  C  CZ    . ARG H  4 96  ? -23.708 0.595   30.830  1.00 66.57  ? 96   ARG H CZ    1 
ATOM   5823  N  NH1   . ARG H  4 96  ? -23.912 -0.030  29.662  1.00 65.70  ? 96   ARG H NH1   1 
ATOM   5824  N  NH2   . ARG H  4 96  ? -23.526 1.917   30.839  1.00 67.60  ? 96   ARG H NH2   1 
ATOM   5825  N  N     . LEU H  4 97  ? -21.849 -6.745  33.557  1.00 46.78  ? 97   LEU H N     1 
ATOM   5826  C  CA    . LEU H  4 97  ? -22.221 -8.038  34.149  1.00 46.64  ? 97   LEU H CA    1 
ATOM   5827  C  C     . LEU H  4 97  ? -21.170 -8.576  35.094  1.00 47.08  ? 97   LEU H C     1 
ATOM   5828  O  O     . LEU H  4 97  ? -21.502 -9.125  36.149  1.00 47.78  ? 97   LEU H O     1 
ATOM   5829  C  CB    . LEU H  4 97  ? -22.492 -9.073  33.075  1.00 46.13  ? 97   LEU H CB    1 
ATOM   5830  C  CG    . LEU H  4 97  ? -23.808 -8.956  32.321  1.00 45.95  ? 97   LEU H CG    1 
ATOM   5831  C  CD1   . LEU H  4 97  ? -23.739 -9.731  30.986  1.00 44.47  ? 97   LEU H CD1   1 
ATOM   5832  C  CD2   . LEU H  4 97  ? -24.931 -9.441  33.203  1.00 44.92  ? 97   LEU H CD2   1 
ATOM   5833  N  N     . LEU H  4 98  ? -19.910 -8.389  34.730  1.00 47.19  ? 98   LEU H N     1 
ATOM   5834  C  CA    . LEU H  4 98  ? -18.794 -8.951  35.477  1.00 47.84  ? 98   LEU H CA    1 
ATOM   5835  C  C     . LEU H  4 98  ? -18.233 -8.126  36.629  1.00 47.75  ? 98   LEU H C     1 
ATOM   5836  O  O     . LEU H  4 98  ? -17.948 -8.674  37.691  1.00 47.79  ? 98   LEU H O     1 
ATOM   5837  C  CB    . LEU H  4 98  ? -17.664 -9.306  34.514  1.00 48.24  ? 98   LEU H CB    1 
ATOM   5838  C  CG    . LEU H  4 98  ? -18.046 -10.448 33.583  1.00 49.28  ? 98   LEU H CG    1 
ATOM   5839  C  CD1   . LEU H  4 98  ? -17.153 -10.401 32.377  1.00 51.16  ? 98   LEU H CD1   1 
ATOM   5840  C  CD2   . LEU H  4 98  ? -17.903 -11.756 34.327  1.00 50.11  ? 98   LEU H CD2   1 
ATOM   5841  N  N     . LEU H  4 99  ? -18.036 -6.825  36.419  1.00 48.05  ? 99   LEU H N     1 
ATOM   5842  C  CA    . LEU H  4 99  ? -17.450 -5.987  37.458  1.00 48.20  ? 99   LEU H CA    1 
ATOM   5843  C  C     . LEU H  4 99  ? -18.493 -5.545  38.484  1.00 48.55  ? 99   LEU H C     1 
ATOM   5844  O  O     . LEU H  4 99  ? -19.629 -5.278  38.132  1.00 48.98  ? 99   LEU H O     1 
ATOM   5845  C  CB    . LEU H  4 99  ? -16.711 -4.812  36.843  1.00 48.04  ? 99   LEU H CB    1 
ATOM   5846  C  CG    . LEU H  4 99  ? -15.584 -5.154  35.849  1.00 48.53  ? 99   LEU H CG    1 
ATOM   5847  C  CD1   . LEU H  4 99  ? -14.790 -3.904  35.459  1.00 47.32  ? 99   LEU H CD1   1 
ATOM   5848  C  CD2   . LEU H  4 99  ? -14.632 -6.206  36.385  1.00 49.25  ? 99   LEU H CD2   1 
ATOM   5849  N  N     . PRO H  4 100 ? -18.128 -5.522  39.770  1.00 49.15  ? 100  PRO H N     1 
ATOM   5850  C  CA    . PRO H  4 100 ? -19.076 -5.038  40.774  1.00 50.03  ? 100  PRO H CA    1 
ATOM   5851  C  C     . PRO H  4 100 ? -19.290 -3.516  40.744  1.00 51.33  ? 100  PRO H C     1 
ATOM   5852  O  O     . PRO H  4 100 ? -18.402 -2.771  40.334  1.00 51.52  ? 100  PRO H O     1 
ATOM   5853  C  CB    . PRO H  4 100 ? -18.451 -5.484  42.095  1.00 49.95  ? 100  PRO H CB    1 
ATOM   5854  C  CG    . PRO H  4 100 ? -16.978 -5.597  41.810  1.00 49.55  ? 100  PRO H CG    1 
ATOM   5855  C  CD    . PRO H  4 100 ? -16.845 -5.953  40.361  1.00 49.36  ? 100  PRO H CD    1 
ATOM   5856  N  N     . GLY H  4 101 ? -20.469 -3.087  41.198  1.00 52.57  ? 101  GLY H N     1 
ATOM   5857  C  CA    . GLY H  4 101 ? -20.974 -1.699  41.128  1.00 53.86  ? 101  GLY H CA    1 
ATOM   5858  C  C     . GLY H  4 101 ? -20.153 -0.503  40.658  1.00 54.72  ? 101  GLY H C     1 
ATOM   5859  O  O     . GLY H  4 101 ? -20.255 -0.071  39.490  1.00 54.61  ? 101  GLY H O     1 
ATOM   5860  N  N     . GLU H  4 102 ? -19.371 0.061   41.575  1.00 55.23  ? 102  GLU H N     1 
ATOM   5861  C  CA    . GLU H  4 102 ? -18.602 1.272   41.282  1.00 55.90  ? 102  GLU H CA    1 
ATOM   5862  C  C     . GLU H  4 102 ? -17.484 1.041   40.276  1.00 55.15  ? 102  GLU H C     1 
ATOM   5863  O  O     . GLU H  4 102 ? -17.061 1.970   39.578  1.00 55.77  ? 102  GLU H O     1 
ATOM   5864  C  CB    . GLU H  4 102 ? -18.001 1.850   42.561  1.00 56.67  ? 102  GLU H CB    1 
ATOM   5865  C  CG    . GLU H  4 102 ? -17.850 3.359   42.559  1.00 60.03  ? 102  GLU H CG    1 
ATOM   5866  C  CD    . GLU H  4 102 ? -19.197 4.069   42.719  1.00 65.08  ? 102  GLU H CD    1 
ATOM   5867  O  OE1   . GLU H  4 102 ? -19.902 4.292   41.692  1.00 65.16  ? 102  GLU H OE1   1 
ATOM   5868  O  OE2   . GLU H  4 102 ? -19.537 4.405   43.883  1.00 67.45  ? 102  GLU H OE2   1 
ATOM   5869  N  N     . LEU H  4 103 ? -16.994 -0.192  40.220  1.00 54.17  ? 103  LEU H N     1 
ATOM   5870  C  CA    . LEU H  4 103 ? -15.908 -0.556  39.316  1.00 53.18  ? 103  LEU H CA    1 
ATOM   5871  C  C     . LEU H  4 103 ? -16.448 -0.663  37.882  1.00 52.94  ? 103  LEU H C     1 
ATOM   5872  O  O     . LEU H  4 103 ? -15.744 -0.332  36.917  1.00 52.26  ? 103  LEU H O     1 
ATOM   5873  C  CB    . LEU H  4 103 ? -15.282 -1.869  39.795  1.00 52.98  ? 103  LEU H CB    1 
ATOM   5874  C  CG    . LEU H  4 103 ? -13.773 -2.102  39.948  1.00 52.35  ? 103  LEU H CG    1 
ATOM   5875  C  CD1   . LEU H  4 103 ? -13.008 -0.914  40.449  1.00 50.92  ? 103  LEU H CD1   1 
ATOM   5876  C  CD2   . LEU H  4 103 ? -13.529 -3.283  40.879  1.00 52.89  ? 103  LEU H CD2   1 
ATOM   5877  N  N     . ALA H  4 104 ? -17.709 -1.093  37.748  1.00 52.64  ? 104  ALA H N     1 
ATOM   5878  C  CA    . ALA H  4 104 ? -18.361 -1.147  36.445  1.00 52.45  ? 104  ALA H CA    1 
ATOM   5879  C  C     . ALA H  4 104 ? -18.600 0.260   35.917  1.00 53.13  ? 104  ALA H C     1 
ATOM   5880  O  O     . ALA H  4 104 ? -18.320 0.527   34.750  1.00 53.74  ? 104  ALA H O     1 
ATOM   5881  C  CB    . ALA H  4 104 ? -19.642 -1.918  36.501  1.00 51.80  ? 104  ALA H CB    1 
ATOM   5882  N  N     . LYS H  4 105 ? -19.083 1.175   36.764  1.00 53.41  ? 105  LYS H N     1 
ATOM   5883  C  CA    . LYS H  4 105 ? -19.267 2.560   36.334  1.00 53.50  ? 105  LYS H CA    1 
ATOM   5884  C  C     . LYS H  4 105 ? -17.971 3.182   35.802  1.00 53.07  ? 105  LYS H C     1 
ATOM   5885  O  O     . LYS H  4 105 ? -17.949 3.686   34.680  1.00 53.38  ? 105  LYS H O     1 
ATOM   5886  C  CB    . LYS H  4 105 ? -19.831 3.424   37.451  1.00 54.25  ? 105  LYS H CB    1 
ATOM   5887  C  CG    . LYS H  4 105 ? -20.049 4.903   37.021  1.00 58.43  ? 105  LYS H CG    1 
ATOM   5888  C  CD    . LYS H  4 105 ? -19.858 5.925   38.161  1.00 62.54  ? 105  LYS H CD    1 
ATOM   5889  C  CE    . LYS H  4 105 ? -21.120 6.035   39.004  1.00 66.14  ? 105  LYS H CE    1 
ATOM   5890  N  NZ    . LYS H  4 105 ? -20.789 6.488   40.386  1.00 70.47  ? 105  LYS H NZ    1 
ATOM   5891  N  N     . HIS H  4 106 ? -16.891 3.150   36.579  1.00 52.24  ? 106  HIS H N     1 
ATOM   5892  C  CA    . HIS H  4 106 ? -15.673 3.794   36.122  1.00 52.09  ? 106  HIS H CA    1 
ATOM   5893  C  C     . HIS H  4 106 ? -15.047 3.185   34.884  1.00 51.70  ? 106  HIS H C     1 
ATOM   5894  O  O     . HIS H  4 106 ? -14.593 3.913   34.014  1.00 51.89  ? 106  HIS H O     1 
ATOM   5895  C  CB    . HIS H  4 106 ? -14.657 3.949   37.239  1.00 52.43  ? 106  HIS H CB    1 
ATOM   5896  C  CG    . HIS H  4 106 ? -15.178 4.729   38.405  1.00 54.87  ? 106  HIS H CG    1 
ATOM   5897  N  ND1   . HIS H  4 106 ? -14.601 4.675   39.658  1.00 56.27  ? 106  HIS H ND1   1 
ATOM   5898  C  CD2   . HIS H  4 106 ? -16.245 5.558   38.515  1.00 55.24  ? 106  HIS H CD2   1 
ATOM   5899  C  CE1   . HIS H  4 106 ? -15.290 5.441   40.487  1.00 56.47  ? 106  HIS H CE1   1 
ATOM   5900  N  NE2   . HIS H  4 106 ? -16.296 5.981   39.819  1.00 56.69  ? 106  HIS H NE2   1 
ATOM   5901  N  N     . ALA H  4 107 ? -15.051 1.857   34.799  1.00 51.72  ? 107  ALA H N     1 
ATOM   5902  C  CA    . ALA H  4 107 ? -14.518 1.120   33.647  1.00 51.04  ? 107  ALA H CA    1 
ATOM   5903  C  C     . ALA H  4 107 ? -15.354 1.351   32.404  1.00 50.49  ? 107  ALA H C     1 
ATOM   5904  O  O     . ALA H  4 107 ? -14.807 1.510   31.323  1.00 50.21  ? 107  ALA H O     1 
ATOM   5905  C  CB    . ALA H  4 107 ? -14.403 -0.384  33.957  1.00 50.89  ? 107  ALA H CB    1 
ATOM   5906  N  N     . VAL H  4 108 ? -16.673 1.385   32.563  1.00 50.56  ? 108  VAL H N     1 
ATOM   5907  C  CA    . VAL H  4 108 ? -17.578 1.774   31.468  1.00 51.01  ? 108  VAL H CA    1 
ATOM   5908  C  C     . VAL H  4 108 ? -17.208 3.159   30.941  1.00 51.88  ? 108  VAL H C     1 
ATOM   5909  O  O     . VAL H  4 108 ? -17.114 3.369   29.723  1.00 52.19  ? 108  VAL H O     1 
ATOM   5910  C  CB    . VAL H  4 108 ? -19.043 1.794   31.930  1.00 50.85  ? 108  VAL H CB    1 
ATOM   5911  C  CG1   . VAL H  4 108 ? -19.959 2.332   30.852  1.00 48.75  ? 108  VAL H CG1   1 
ATOM   5912  C  CG2   . VAL H  4 108 ? -19.475 0.384   32.373  1.00 51.10  ? 108  VAL H CG2   1 
ATOM   5913  N  N     . SER H  4 109 ? -16.968 4.096   31.858  1.00 52.51  ? 109  SER H N     1 
ATOM   5914  C  CA    . SER H  4 109 ? -16.657 5.448   31.454  1.00 53.17  ? 109  SER H CA    1 
ATOM   5915  C  C     . SER H  4 109 ? -15.226 5.607   30.913  1.00 53.74  ? 109  SER H C     1 
ATOM   5916  O  O     . SER H  4 109 ? -15.049 6.316   29.921  1.00 54.20  ? 109  SER H O     1 
ATOM   5917  C  CB    . SER H  4 109 ? -17.040 6.460   32.541  1.00 53.29  ? 109  SER H CB    1 
ATOM   5918  O  OG    . SER H  4 109 ? -15.922 7.022   33.188  1.00 54.55  ? 109  SER H OG    1 
ATOM   5919  N  N     . GLU H  4 110 ? -14.224 4.945   31.512  1.00 54.08  ? 110  GLU H N     1 
ATOM   5920  C  CA    . GLU H  4 110 ? -12.864 4.928   30.928  1.00 54.61  ? 110  GLU H CA    1 
ATOM   5921  C  C     . GLU H  4 110 ? -12.868 4.287   29.541  1.00 54.33  ? 110  GLU H C     1 
ATOM   5922  O  O     . GLU H  4 110 ? -12.075 4.653   28.677  1.00 54.33  ? 110  GLU H O     1 
ATOM   5923  C  CB    . GLU H  4 110 ? -11.835 4.178   31.787  1.00 54.85  ? 110  GLU H CB    1 
ATOM   5924  C  CG    . GLU H  4 110 ? -11.452 4.764   33.166  1.00 59.42  ? 110  GLU H CG    1 
ATOM   5925  C  CD    . GLU H  4 110 ? -11.044 6.247   33.154  1.00 66.05  ? 110  GLU H CD    1 
ATOM   5926  O  OE1   . GLU H  4 110 ? -9.997  6.607   32.539  1.00 66.50  ? 110  GLU H OE1   1 
ATOM   5927  O  OE2   . GLU H  4 110 ? -11.789 7.052   33.785  1.00 68.86  ? 110  GLU H OE2   1 
ATOM   5928  N  N     . GLY H  4 111 ? -13.763 3.329   29.328  1.00 54.24  ? 111  GLY H N     1 
ATOM   5929  C  CA    . GLY H  4 111 ? -13.787 2.571   28.085  1.00 53.96  ? 111  GLY H CA    1 
ATOM   5930  C  C     . GLY H  4 111 ? -14.436 3.284   26.925  1.00 54.16  ? 111  GLY H C     1 
ATOM   5931  O  O     . GLY H  4 111 ? -13.898 3.268   25.825  1.00 53.74  ? 111  GLY H O     1 
ATOM   5932  N  N     . THR H  4 112 ? -15.609 3.882   27.167  1.00 54.84  ? 112  THR H N     1 
ATOM   5933  C  CA    . THR H  4 112 ? -16.328 4.698   26.158  1.00 55.11  ? 112  THR H CA    1 
ATOM   5934  C  C     . THR H  4 112 ? -15.536 5.947   25.785  1.00 54.87  ? 112  THR H C     1 
ATOM   5935  O  O     . THR H  4 112 ? -15.549 6.375   24.639  1.00 54.88  ? 112  THR H O     1 
ATOM   5936  C  CB    . THR H  4 112 ? -17.649 5.208   26.687  1.00 54.74  ? 112  THR H CB    1 
ATOM   5937  O  OG1   . THR H  4 112 ? -17.387 5.889   27.907  1.00 56.87  ? 112  THR H OG1   1 
ATOM   5938  C  CG2   . THR H  4 112 ? -18.596 4.072   26.976  1.00 54.99  ? 112  THR H CG2   1 
ATOM   5939  N  N     . LYS H  4 113 ? -14.844 6.515   26.765  1.00 55.04  ? 113  LYS H N     1 
ATOM   5940  C  CA    . LYS H  4 113 ? -14.027 7.697   26.554  1.00 55.50  ? 113  LYS H CA    1 
ATOM   5941  C  C     . LYS H  4 113 ? -12.810 7.428   25.666  1.00 55.48  ? 113  LYS H C     1 
ATOM   5942  O  O     . LYS H  4 113 ? -12.357 8.312   24.955  1.00 55.41  ? 113  LYS H O     1 
ATOM   5943  C  CB    . LYS H  4 113 ? -13.596 8.271   27.899  1.00 55.65  ? 113  LYS H CB    1 
ATOM   5944  C  CG    . LYS H  4 113 ? -12.457 9.248   27.815  1.00 57.16  ? 113  LYS H CG    1 
ATOM   5945  C  CD    . LYS H  4 113 ? -11.813 9.438   29.150  1.00 60.20  ? 113  LYS H CD    1 
ATOM   5946  C  CE    . LYS H  4 113 ? -10.456 10.067  28.962  1.00 62.97  ? 113  LYS H CE    1 
ATOM   5947  N  NZ    . LYS H  4 113 ? -9.746  10.123  30.275  1.00 66.39  ? 113  LYS H NZ    1 
ATOM   5948  N  N     . ALA H  4 114 ? -12.285 6.208   25.715  1.00 55.89  ? 114  ALA H N     1 
ATOM   5949  C  CA    . ALA H  4 114 ? -11.137 5.832   24.907  1.00 56.13  ? 114  ALA H CA    1 
ATOM   5950  C  C     . ALA H  4 114 ? -11.553 5.548   23.471  1.00 56.52  ? 114  ALA H C     1 
ATOM   5951  O  O     . ALA H  4 114 ? -10.776 5.759   22.545  1.00 56.58  ? 114  ALA H O     1 
ATOM   5952  C  CB    . ALA H  4 114 ? -10.446 4.636   25.502  1.00 56.12  ? 114  ALA H CB    1 
ATOM   5953  N  N     . VAL H  4 115 ? -12.782 5.087   23.295  1.00 57.08  ? 115  VAL H N     1 
ATOM   5954  C  CA    . VAL H  4 115 ? -13.294 4.721   21.978  1.00 58.08  ? 115  VAL H CA    1 
ATOM   5955  C  C     . VAL H  4 115 ? -13.663 5.980   21.215  1.00 58.49  ? 115  VAL H C     1 
ATOM   5956  O  O     . VAL H  4 115 ? -13.385 6.094   20.014  1.00 58.99  ? 115  VAL H O     1 
ATOM   5957  C  CB    . VAL H  4 115 ? -14.516 3.748   22.081  1.00 58.32  ? 115  VAL H CB    1 
ATOM   5958  C  CG1   . VAL H  4 115 ? -15.246 3.616   20.749  1.00 58.13  ? 115  VAL H CG1   1 
ATOM   5959  C  CG2   . VAL H  4 115 ? -14.057 2.377   22.560  1.00 57.86  ? 115  VAL H CG2   1 
ATOM   5960  N  N     . THR H  4 116 ? -14.287 6.918   21.934  1.00 58.85  ? 116  THR H N     1 
ATOM   5961  C  CA    . THR H  4 116 ? -14.617 8.249   21.434  1.00 58.13  ? 116  THR H CA    1 
ATOM   5962  C  C     . THR H  4 116 ? -13.356 8.928   20.916  1.00 58.41  ? 116  THR H C     1 
ATOM   5963  O  O     . THR H  4 116 ? -13.313 9.339   19.766  1.00 58.52  ? 116  THR H O     1 
ATOM   5964  C  CB    . THR H  4 116 ? -15.236 9.090   22.542  1.00 58.06  ? 116  THR H CB    1 
ATOM   5965  O  OG1   . THR H  4 116 ? -16.540 8.590   22.860  1.00 56.94  ? 116  THR H OG1   1 
ATOM   5966  C  CG2   . THR H  4 116 ? -15.366 10.538  22.116  1.00 59.18  ? 116  THR H CG2   1 
ATOM   5967  N  N     . LYS H  4 117 ? -12.326 9.003   21.757  1.00 58.75  ? 117  LYS H N     1 
ATOM   5968  C  CA    . LYS H  4 117 ? -11.043 9.595   21.398  1.00 59.14  ? 117  LYS H CA    1 
ATOM   5969  C  C     . LYS H  4 117 ? -10.413 8.900   20.208  1.00 60.46  ? 117  LYS H C     1 
ATOM   5970  O  O     . LYS H  4 117 ? -9.738  9.520   19.391  1.00 60.86  ? 117  LYS H O     1 
ATOM   5971  C  CB    . LYS H  4 117 ? -10.087 9.560   22.593  1.00 58.42  ? 117  LYS H CB    1 
ATOM   5972  C  CG    . LYS H  4 117 ? -8.669  9.954   22.248  1.00 58.16  ? 117  LYS H CG    1 
ATOM   5973  C  CD    . LYS H  4 117 ? -7.925  10.506  23.442  1.00 60.34  ? 117  LYS H CD    1 
ATOM   5974  C  CE    . LYS H  4 117 ? -6.435  10.783  23.126  1.00 62.81  ? 117  LYS H CE    1 
ATOM   5975  N  NZ    . LYS H  4 117 ? -6.170  11.901  22.139  1.00 63.71  ? 117  LYS H NZ    1 
ATOM   5976  N  N     . TYR H  4 118 ? -10.634 7.600   20.104  1.00 62.36  ? 118  TYR H N     1 
ATOM   5977  C  CA    . TYR H  4 118 ? -9.988  6.818   19.070  1.00 63.73  ? 118  TYR H CA    1 
ATOM   5978  C  C     . TYR H  4 118 ? -10.655 7.088   17.729  1.00 65.46  ? 118  TYR H C     1 
ATOM   5979  O  O     . TYR H  4 118 ? -9.966  7.205   16.735  1.00 65.79  ? 118  TYR H O     1 
ATOM   5980  C  CB    . TYR H  4 118 ? -9.977  5.331   19.458  1.00 62.97  ? 118  TYR H CB    1 
ATOM   5981  C  CG    . TYR H  4 118 ? -9.579  4.379   18.364  1.00 61.63  ? 118  TYR H CG    1 
ATOM   5982  C  CD1   . TYR H  4 118 ? -8.252  3.997   18.191  1.00 60.48  ? 118  TYR H CD1   1 
ATOM   5983  C  CD2   . TYR H  4 118 ? -10.544 3.833   17.515  1.00 59.77  ? 118  TYR H CD2   1 
ATOM   5984  C  CE1   . TYR H  4 118 ? -7.897  3.100   17.171  1.00 59.93  ? 118  TYR H CE1   1 
ATOM   5985  C  CE2   . TYR H  4 118 ? -10.206 2.960   16.513  1.00 59.01  ? 118  TYR H CE2   1 
ATOM   5986  C  CZ    . TYR H  4 118 ? -8.889  2.599   16.340  1.00 60.00  ? 118  TYR H CZ    1 
ATOM   5987  O  OH    . TYR H  4 118 ? -8.584  1.729   15.327  1.00 61.76  ? 118  TYR H OH    1 
ATOM   5988  N  N     . THR H  4 119 ? -11.983 7.208   17.713  1.00 67.89  ? 119  THR H N     1 
ATOM   5989  C  CA    . THR H  4 119 ? -12.745 7.505   16.482  1.00 70.44  ? 119  THR H CA    1 
ATOM   5990  C  C     . THR H  4 119 ? -12.440 8.920   15.953  1.00 72.00  ? 119  THR H C     1 
ATOM   5991  O  O     . THR H  4 119 ? -12.237 9.126   14.751  1.00 71.89  ? 119  THR H O     1 
ATOM   5992  C  CB    . THR H  4 119 ? -14.278 7.391   16.711  1.00 70.48  ? 119  THR H CB    1 
ATOM   5993  O  OG1   . THR H  4 119 ? -14.567 6.330   17.633  1.00 71.10  ? 119  THR H OG1   1 
ATOM   5994  C  CG2   . THR H  4 119 ? -14.995 7.134   15.397  1.00 70.59  ? 119  THR H CG2   1 
ATOM   5995  N  N     . SER H  4 120 ? -12.437 9.878   16.880  1.00 74.21  ? 120  SER H N     1 
ATOM   5996  C  CA    . SER H  4 120 ? -11.985 11.259  16.677  1.00 76.17  ? 120  SER H CA    1 
ATOM   5997  C  C     . SER H  4 120 ? -10.593 11.381  16.036  1.00 77.61  ? 120  SER H C     1 
ATOM   5998  O  O     . SER H  4 120 ? -10.143 12.492  15.731  1.00 77.68  ? 120  SER H O     1 
ATOM   5999  C  CB    . SER H  4 120 ? -12.020 11.998  18.025  1.00 76.14  ? 120  SER H CB    1 
ATOM   6000  O  OG    . SER H  4 120 ? -10.908 12.864  18.200  1.00 76.78  ? 120  SER H OG    1 
ATOM   6001  N  N     . ALA H  4 121 ? -9.925  10.244  15.840  1.00 79.52  ? 121  ALA H N     1 
ATOM   6002  C  CA    . ALA H  4 121 ? -8.630  10.188  15.150  1.00 81.47  ? 121  ALA H CA    1 
ATOM   6003  C  C     . ALA H  4 121 ? -8.663  9.244   13.920  1.00 82.86  ? 121  ALA H C     1 
ATOM   6004  O  O     . ALA H  4 121 ? -9.745  8.810   13.484  1.00 83.06  ? 121  ALA H O     1 
ATOM   6005  C  CB    . ALA H  4 121 ? -7.520  9.784   16.140  1.00 81.24  ? 121  ALA H CB    1 
ATOM   6006  N  N     . LYS H  4 122 ? -7.478  8.947   13.373  1.00 84.38  ? 122  LYS H N     1 
ATOM   6007  C  CA    . LYS H  4 122 ? -7.271  8.047   12.214  1.00 85.69  ? 122  LYS H CA    1 
ATOM   6008  C  C     . LYS H  4 122 ? -6.535  8.751   11.069  1.00 86.16  ? 122  LYS H C     1 
ATOM   6009  O  O     . LYS H  4 122 ? -6.542  9.987   10.953  1.00 86.51  ? 122  LYS H O     1 
ATOM   6010  C  CB    . LYS H  4 122 ? -8.579  7.427   11.679  1.00 86.00  ? 122  LYS H CB    1 
ATOM   6011  C  CG    . LYS H  4 122 ? -8.361  6.178   10.801  1.00 87.20  ? 122  LYS H CG    1 
ATOM   6012  C  CD    . LYS H  4 122 ? -8.937  6.370   9.393   1.00 88.92  ? 122  LYS H CD    1 
ATOM   6013  C  CE    . LYS H  4 122 ? -8.106  5.608   8.350   1.00 89.61  ? 122  LYS H CE    1 
ATOM   6014  N  NZ    . LYS H  4 122 ? -8.703  5.670   6.972   1.00 89.30  ? 122  LYS H NZ    1 
ATOM   6015  O  OXT   . LYS H  4 122 ? -5.927  8.086   10.218  1.00 86.53  ? 122  LYS H OXT   1 
ATOM   6016  O  "O5'" . DA  I  5 1   ? -45.064 -54.074 76.785  1.00 153.38 ? -72  DA  I "O5'" 1 
ATOM   6017  C  "C5'" . DA  I  5 1   ? -45.696 -54.006 78.079  1.00 153.51 ? -72  DA  I "C5'" 1 
ATOM   6018  C  "C4'" . DA  I  5 1   ? -47.130 -53.484 78.023  1.00 153.57 ? -72  DA  I "C4'" 1 
ATOM   6019  O  "O4'" . DA  I  5 1   ? -47.186 -52.058 78.333  1.00 153.28 ? -72  DA  I "O4'" 1 
ATOM   6020  C  "C3'" . DA  I  5 1   ? -47.919 -53.679 76.719  1.00 153.80 ? -72  DA  I "C3'" 1 
ATOM   6021  O  "O3'" . DA  I  5 1   ? -49.181 -54.331 76.979  1.00 154.38 ? -72  DA  I "O3'" 1 
ATOM   6022  C  "C2'" . DA  I  5 1   ? -48.114 -52.239 76.254  1.00 153.48 ? -72  DA  I "C2'" 1 
ATOM   6023  C  "C1'" . DA  I  5 1   ? -48.308 -51.587 77.617  1.00 152.83 ? -72  DA  I "C1'" 1 
ATOM   6024  N  N9    . DA  I  5 1   ? -48.425 -50.127 77.609  1.00 152.62 ? -72  DA  I N9    1 
ATOM   6025  C  C8    . DA  I  5 1   ? -47.490 -49.195 77.239  1.00 152.37 ? -72  DA  I C8    1 
ATOM   6026  N  N7    . DA  I  5 1   ? -47.914 -47.956 77.339  1.00 152.17 ? -72  DA  I N7    1 
ATOM   6027  C  C5    . DA  I  5 1   ? -49.216 -48.089 77.802  1.00 152.36 ? -72  DA  I C5    1 
ATOM   6028  C  C6    . DA  I  5 1   ? -50.224 -47.151 78.120  1.00 152.45 ? -72  DA  I C6    1 
ATOM   6029  N  N6    . DA  I  5 1   ? -50.042 -45.835 78.007  1.00 152.43 ? -72  DA  I N6    1 
ATOM   6030  N  N1    . DA  I  5 1   ? -51.420 -47.614 78.560  1.00 152.40 ? -72  DA  I N1    1 
ATOM   6031  C  C2    . DA  I  5 1   ? -51.598 -48.938 78.676  1.00 152.26 ? -72  DA  I C2    1 
ATOM   6032  N  N3    . DA  I  5 1   ? -50.728 -49.914 78.407  1.00 152.14 ? -72  DA  I N3    1 
ATOM   6033  C  C4    . DA  I  5 1   ? -49.549 -49.420 77.972  1.00 152.36 ? -72  DA  I C4    1 
ATOM   6034  P  P     . DT  I  5 2   ? -50.212 -54.774 75.822  1.00 154.88 ? -71  DT  I P     1 
ATOM   6035  O  OP1   . DT  I  5 2   ? -50.508 -56.214 76.015  1.00 154.81 ? -71  DT  I OP1   1 
ATOM   6036  O  OP2   . DT  I  5 2   ? -49.708 -54.315 74.505  1.00 154.99 ? -71  DT  I OP2   1 
ATOM   6037  O  "O5'" . DT  I  5 2   ? -51.515 -53.903 76.155  1.00 155.19 ? -71  DT  I "O5'" 1 
ATOM   6038  C  "C5'" . DT  I  5 2   ? -52.627 -54.434 76.880  1.00 155.84 ? -71  DT  I "C5'" 1 
ATOM   6039  C  "C4'" . DT  I  5 2   ? -53.794 -53.459 76.849  1.00 156.57 ? -71  DT  I "C4'" 1 
ATOM   6040  O  "O4'" . DT  I  5 2   ? -53.306 -52.092 76.971  1.00 157.03 ? -71  DT  I "O4'" 1 
ATOM   6041  C  "C3'" . DT  I  5 2   ? -54.650 -53.515 75.585  1.00 156.82 ? -71  DT  I "C3'" 1 
ATOM   6042  O  "O3'" . DT  I  5 2   ? -56.037 -53.609 75.944  1.00 156.95 ? -71  DT  I "O3'" 1 
ATOM   6043  C  "C2'" . DT  I  5 2   ? -54.313 -52.216 74.849  1.00 157.01 ? -71  DT  I "C2'" 1 
ATOM   6044  C  "C1'" . DT  I  5 2   ? -53.906 -51.274 75.980  1.00 157.13 ? -71  DT  I "C1'" 1 
ATOM   6045  N  N1    . DT  I  5 2   ? -52.961 -50.164 75.556  1.00 157.18 ? -71  DT  I N1    1 
ATOM   6046  C  C2    . DT  I  5 2   ? -53.323 -48.833 75.736  1.00 157.10 ? -71  DT  I C2    1 
ATOM   6047  O  O2    . DT  I  5 2   ? -54.375 -48.464 76.233  1.00 157.04 ? -71  DT  I O2    1 
ATOM   6048  N  N3    . DT  I  5 2   ? -52.387 -47.919 75.311  1.00 157.02 ? -71  DT  I N3    1 
ATOM   6049  C  C4    . DT  I  5 2   ? -51.155 -48.186 74.734  1.00 157.05 ? -71  DT  I C4    1 
ATOM   6050  O  O4    . DT  I  5 2   ? -50.392 -47.289 74.392  1.00 157.06 ? -71  DT  I O4    1 
ATOM   6051  C  C5    . DT  I  5 2   ? -50.835 -49.586 74.568  1.00 157.10 ? -71  DT  I C5    1 
ATOM   6052  C  C7    . DT  I  5 2   ? -49.528 -50.000 73.951  1.00 157.03 ? -71  DT  I C7    1 
ATOM   6053  C  C6    . DT  I  5 2   ? -51.739 -50.491 74.980  1.00 157.17 ? -71  DT  I C6    1 
ATOM   6054  P  P     . DC  I  5 3   ? -57.239 -53.550 74.876  1.00 157.02 ? -70  DC  I P     1 
ATOM   6055  O  OP1   . DC  I  5 3   ? -58.270 -54.525 75.303  1.00 156.97 ? -70  DC  I OP1   1 
ATOM   6056  O  OP2   . DC  I  5 3   ? -56.677 -53.662 73.508  1.00 157.00 ? -70  DC  I OP2   1 
ATOM   6057  O  "O5'" . DC  I  5 3   ? -57.787 -52.053 75.082  1.00 156.22 ? -70  DC  I "O5'" 1 
ATOM   6058  C  "C5'" . DC  I  5 3   ? -59.187 -51.755 75.171  1.00 155.09 ? -70  DC  I "C5'" 1 
ATOM   6059  C  "C4'" . DC  I  5 3   ? -59.441 -50.252 75.162  1.00 154.47 ? -70  DC  I "C4'" 1 
ATOM   6060  O  "O4'" . DC  I  5 3   ? -58.173 -49.530 75.127  1.00 154.64 ? -70  DC  I "O4'" 1 
ATOM   6061  C  "C3'" . DC  I  5 3   ? -60.263 -49.746 73.973  1.00 153.88 ? -70  DC  I "C3'" 1 
ATOM   6062  O  "O3'" . DC  I  5 3   ? -61.308 -48.845 74.382  1.00 152.55 ? -70  DC  I "O3'" 1 
ATOM   6063  C  "C2'" . DC  I  5 3   ? -59.222 -49.049 73.101  1.00 154.31 ? -70  DC  I "C2'" 1 
ATOM   6064  C  "C1'" . DC  I  5 3   ? -58.245 -48.511 74.143  1.00 154.37 ? -70  DC  I "C1'" 1 
ATOM   6065  N  N1    . DC  I  5 3   ? -56.877 -48.158 73.591  1.00 154.28 ? -70  DC  I N1    1 
ATOM   6066  C  C2    . DC  I  5 3   ? -56.371 -46.848 73.722  1.00 154.00 ? -70  DC  I C2    1 
ATOM   6067  O  O2    . DC  I  5 3   ? -57.036 -45.976 74.297  1.00 153.79 ? -70  DC  I O2    1 
ATOM   6068  N  N3    . DC  I  5 3   ? -55.141 -46.566 73.209  1.00 153.92 ? -70  DC  I N3    1 
ATOM   6069  C  C4    . DC  I  5 3   ? -54.431 -47.514 72.587  1.00 154.00 ? -70  DC  I C4    1 
ATOM   6070  N  N4    . DC  I  5 3   ? -53.230 -47.187 72.102  1.00 153.91 ? -70  DC  I N4    1 
ATOM   6071  C  C5    . DC  I  5 3   ? -54.923 -48.846 72.437  1.00 154.05 ? -70  DC  I C5    1 
ATOM   6072  C  C6    . DC  I  5 3   ? -56.134 -49.117 72.947  1.00 154.30 ? -70  DC  I C6    1 
ATOM   6073  P  P     . DT  I  5 4   ? -62.293 -48.116 73.332  1.00 151.54 ? -69  DT  I P     1 
ATOM   6074  O  OP1   . DT  I  5 4   ? -63.605 -47.944 74.000  1.00 151.70 ? -69  DT  I OP1   1 
ATOM   6075  O  OP2   . DT  I  5 4   ? -62.227 -48.822 72.027  1.00 151.31 ? -69  DT  I OP2   1 
ATOM   6076  O  "O5'" . DT  I  5 4   ? -61.633 -46.667 73.150  1.00 150.16 ? -69  DT  I "O5'" 1 
ATOM   6077  C  "C5'" . DT  I  5 4   ? -62.151 -45.532 73.852  1.00 147.80 ? -69  DT  I "C5'" 1 
ATOM   6078  C  "C4'" . DT  I  5 4   ? -61.554 -44.233 73.330  1.00 146.11 ? -69  DT  I "C4'" 1 
ATOM   6079  O  "O4'" . DT  I  5 4   ? -60.172 -44.406 72.906  1.00 145.54 ? -69  DT  I "O4'" 1 
ATOM   6080  C  "C3'" . DT  I  5 4   ? -62.272 -43.614 72.138  1.00 145.06 ? -69  DT  I "C3'" 1 
ATOM   6081  O  "O3'" . DT  I  5 4   ? -62.330 -42.203 72.363  1.00 143.69 ? -69  DT  I "O3'" 1 
ATOM   6082  C  "C2'" . DT  I  5 4   ? -61.383 -44.018 70.960  1.00 144.67 ? -69  DT  I "C2'" 1 
ATOM   6083  C  "C1'" . DT  I  5 4   ? -60.011 -43.870 71.608  1.00 144.51 ? -69  DT  I "C1'" 1 
ATOM   6084  N  N1    . DT  I  5 4   ? -58.866 -44.567 70.934  1.00 144.30 ? -69  DT  I N1    1 
ATOM   6085  C  C2    . DT  I  5 4   ? -57.760 -43.826 70.551  1.00 144.18 ? -69  DT  I C2    1 
ATOM   6086  O  O2    . DT  I  5 4   ? -57.653 -42.623 70.717  1.00 144.11 ? -69  DT  I O2    1 
ATOM   6087  N  N3    . DT  I  5 4   ? -56.761 -44.553 69.951  1.00 144.12 ? -69  DT  I N3    1 
ATOM   6088  C  C4    . DT  I  5 4   ? -56.749 -45.916 69.703  1.00 144.23 ? -69  DT  I C4    1 
ATOM   6089  O  O4    . DT  I  5 4   ? -55.798 -46.469 69.158  1.00 144.22 ? -69  DT  I O4    1 
ATOM   6090  C  C5    . DT  I  5 4   ? -57.929 -46.635 70.130  1.00 144.27 ? -69  DT  I C5    1 
ATOM   6091  C  C7    . DT  I  5 4   ? -58.033 -48.118 69.910  1.00 144.28 ? -69  DT  I C7    1 
ATOM   6092  C  C6    . DT  I  5 4   ? -58.915 -45.937 70.719  1.00 144.30 ? -69  DT  I C6    1 
ATOM   6093  P  P     . DC  I  5 5   ? -62.896 -41.175 71.271  1.00 142.93 ? -68  DC  I P     1 
ATOM   6094  O  OP1   . DC  I  5 5   ? -63.183 -39.900 71.975  1.00 142.49 ? -68  DC  I OP1   1 
ATOM   6095  O  OP2   . DC  I  5 5   ? -63.958 -41.849 70.478  1.00 142.67 ? -68  DC  I OP2   1 
ATOM   6096  O  "O5'" . DC  I  5 5   ? -61.626 -40.987 70.304  1.00 142.08 ? -68  DC  I "O5'" 1 
ATOM   6097  C  "C5'" . DC  I  5 5   ? -60.537 -40.103 70.624  1.00 139.73 ? -68  DC  I "C5'" 1 
ATOM   6098  C  "C4'" . DC  I  5 5   ? -59.812 -39.658 69.363  1.00 137.63 ? -68  DC  I "C4'" 1 
ATOM   6099  O  "O4'" . DC  I  5 5   ? -58.971 -40.723 68.851  1.00 137.09 ? -68  DC  I "O4'" 1 
ATOM   6100  C  "C3'" . DC  I  5 5   ? -60.715 -39.237 68.212  1.00 136.58 ? -68  DC  I "C3'" 1 
ATOM   6101  O  "O3'" . DC  I  5 5   ? -60.218 -38.040 67.659  1.00 135.35 ? -68  DC  I "O3'" 1 
ATOM   6102  C  "C2'" . DC  I  5 5   ? -60.636 -40.381 67.202  1.00 136.53 ? -68  DC  I "C2'" 1 
ATOM   6103  C  "C1'" . DC  I  5 5   ? -59.274 -41.001 67.498  1.00 136.50 ? -68  DC  I "C1'" 1 
ATOM   6104  N  N1    . DC  I  5 5   ? -59.203 -42.487 67.314  1.00 136.36 ? -68  DC  I N1    1 
ATOM   6105  C  C2    . DC  I  5 5   ? -58.023 -43.079 66.824  1.00 136.34 ? -68  DC  I C2    1 
ATOM   6106  O  O2    . DC  I  5 5   ? -57.049 -42.369 66.541  1.00 136.42 ? -68  DC  I O2    1 
ATOM   6107  N  N3    . DC  I  5 5   ? -57.978 -44.430 66.670  1.00 136.41 ? -68  DC  I N3    1 
ATOM   6108  C  C4    . DC  I  5 5   ? -59.043 -45.181 66.983  1.00 136.46 ? -68  DC  I C4    1 
ATOM   6109  N  N4    . DC  I  5 5   ? -58.952 -46.506 66.814  1.00 136.33 ? -68  DC  I N4    1 
ATOM   6110  C  C5    . DC  I  5 5   ? -60.252 -44.601 67.485  1.00 136.49 ? -68  DC  I C5    1 
ATOM   6111  C  C6    . DC  I  5 5   ? -60.284 -43.268 67.633  1.00 136.40 ? -68  DC  I C6    1 
ATOM   6112  P  P     . DC  I  5 6   ? -61.222 -36.851 67.297  1.00 134.14 ? -67  DC  I P     1 
ATOM   6113  O  OP1   . DC  I  5 6   ? -61.362 -36.030 68.527  1.00 134.07 ? -67  DC  I OP1   1 
ATOM   6114  O  OP2   . DC  I  5 6   ? -62.402 -37.427 66.605  1.00 133.98 ? -67  DC  I OP2   1 
ATOM   6115  O  "O5'" . DC  I  5 6   ? -60.409 -36.025 66.196  1.00 131.89 ? -67  DC  I "O5'" 1 
ATOM   6116  C  "C5'" . DC  I  5 6   ? -60.072 -36.661 64.977  1.00 128.23 ? -67  DC  I "C5'" 1 
ATOM   6117  C  "C4'" . DC  I  5 6   ? -58.590 -36.503 64.698  1.00 125.26 ? -67  DC  I "C4'" 1 
ATOM   6118  O  "O4'" . DC  I  5 6   ? -57.888 -37.757 64.895  1.00 124.36 ? -67  DC  I "O4'" 1 
ATOM   6119  C  "C3'" . DC  I  5 6   ? -58.297 -36.059 63.277  1.00 123.81 ? -67  DC  I "C3'" 1 
ATOM   6120  O  "O3'" . DC  I  5 6   ? -57.301 -35.049 63.318  1.00 122.09 ? -67  DC  I "O3'" 1 
ATOM   6121  C  "C2'" . DC  I  5 6   ? -57.847 -37.338 62.565  1.00 123.51 ? -67  DC  I "C2'" 1 
ATOM   6122  C  "C1'" . DC  I  5 6   ? -57.289 -38.202 63.692  1.00 123.28 ? -67  DC  I "C1'" 1 
ATOM   6123  N  N1    . DC  I  5 6   ? -57.525 -39.685 63.526  1.00 123.07 ? -67  DC  I N1    1 
ATOM   6124  C  C2    . DC  I  5 6   ? -56.492 -40.515 63.043  1.00 123.08 ? -67  DC  I C2    1 
ATOM   6125  O  O2    . DC  I  5 6   ? -55.392 -40.026 62.750  1.00 122.84 ? -67  DC  I O2    1 
ATOM   6126  N  N3    . DC  I  5 6   ? -56.724 -41.852 62.905  1.00 123.07 ? -67  DC  I N3    1 
ATOM   6127  C  C4    . DC  I  5 6   ? -57.915 -42.371 63.224  1.00 122.94 ? -67  DC  I C4    1 
ATOM   6128  N  N4    . DC  I  5 6   ? -58.087 -43.687 63.066  1.00 122.58 ? -67  DC  I N4    1 
ATOM   6129  C  C5    . DC  I  5 6   ? -58.979 -41.550 63.717  1.00 122.98 ? -67  DC  I C5    1 
ATOM   6130  C  C6    . DC  I  5 6   ? -58.742 -40.233 63.849  1.00 123.10 ? -67  DC  I C6    1 
ATOM   6131  P  P     . DA  I  5 7   ? -57.285 -33.850 62.254  1.00 120.87 ? -66  DA  I P     1 
ATOM   6132  O  OP1   . DA  I  5 7   ? -56.683 -32.693 62.955  1.00 120.76 ? -66  DA  I OP1   1 
ATOM   6133  O  OP2   . DA  I  5 7   ? -58.624 -33.704 61.637  1.00 120.47 ? -66  DA  I OP2   1 
ATOM   6134  O  "O5'" . DA  I  5 7   ? -56.293 -34.399 61.113  1.00 119.75 ? -66  DA  I "O5'" 1 
ATOM   6135  C  "C5'" . DA  I  5 7   ? -54.927 -34.718 61.409  1.00 117.99 ? -66  DA  I "C5'" 1 
ATOM   6136  C  "C4'" . DA  I  5 7   ? -54.302 -35.675 60.402  1.00 116.87 ? -66  DA  I "C4'" 1 
ATOM   6137  O  "O4'" . DA  I  5 7   ? -54.893 -37.001 60.505  1.00 117.15 ? -66  DA  I "O4'" 1 
ATOM   6138  C  "C3'" . DA  I  5 7   ? -54.404 -35.271 58.933  1.00 116.14 ? -66  DA  I "C3'" 1 
ATOM   6139  O  "O3'" . DA  I  5 7   ? -53.093 -35.416 58.350  1.00 114.85 ? -66  DA  I "O3'" 1 
ATOM   6140  C  "C2'" . DA  I  5 7   ? -55.456 -36.245 58.380  1.00 116.64 ? -66  DA  I "C2'" 1 
ATOM   6141  C  "C1'" . DA  I  5 7   ? -55.178 -37.499 59.208  1.00 116.67 ? -66  DA  I "C1'" 1 
ATOM   6142  N  N9    . DA  I  5 7   ? -56.250 -38.507 59.299  1.00 116.72 ? -66  DA  I N9    1 
ATOM   6143  C  C8    . DA  I  5 7   ? -57.608 -38.310 59.350  1.00 116.55 ? -66  DA  I C8    1 
ATOM   6144  N  N7    . DA  I  5 7   ? -58.308 -39.418 59.447  1.00 116.57 ? -66  DA  I N7    1 
ATOM   6145  C  C5    . DA  I  5 7   ? -57.352 -40.428 59.454  1.00 116.88 ? -66  DA  I C5    1 
ATOM   6146  C  C6    . DA  I  5 7   ? -57.424 -41.847 59.534  1.00 116.52 ? -66  DA  I C6    1 
ATOM   6147  N  N6    . DA  I  5 7   ? -58.560 -42.544 59.625  1.00 116.62 ? -66  DA  I N6    1 
ATOM   6148  N  N1    . DA  I  5 7   ? -56.274 -42.550 59.521  1.00 116.19 ? -66  DA  I N1    1 
ATOM   6149  C  C2    . DA  I  5 7   ? -55.119 -41.881 59.434  1.00 116.41 ? -66  DA  I C2    1 
ATOM   6150  N  N3    . DA  I  5 7   ? -54.919 -40.564 59.353  1.00 116.64 ? -66  DA  I N3    1 
ATOM   6151  C  C4    . DA  I  5 7   ? -56.080 -39.879 59.367  1.00 116.87 ? -66  DA  I C4    1 
ATOM   6152  P  P     . DA  I  5 8   ? -52.727 -35.113 56.812  1.00 113.75 ? -65  DA  I P     1 
ATOM   6153  O  OP1   . DA  I  5 8   ? -51.569 -34.198 56.770  1.00 112.71 ? -65  DA  I OP1   1 
ATOM   6154  O  OP2   . DA  I  5 8   ? -53.959 -34.769 56.061  1.00 114.04 ? -65  DA  I OP2   1 
ATOM   6155  O  "O5'" . DA  I  5 8   ? -52.253 -36.541 56.290  1.00 112.92 ? -65  DA  I "O5'" 1 
ATOM   6156  C  "C5'" . DA  I  5 8   ? -51.216 -37.239 56.943  1.00 112.75 ? -65  DA  I "C5'" 1 
ATOM   6157  C  "C4'" . DA  I  5 8   ? -51.118 -38.623 56.340  1.00 113.12 ? -65  DA  I "C4'" 1 
ATOM   6158  O  "O4'" . DA  I  5 8   ? -52.366 -39.323 56.571  1.00 113.87 ? -65  DA  I "O4'" 1 
ATOM   6159  C  "C3'" . DA  I  5 8   ? -50.888 -38.669 54.831  1.00 112.93 ? -65  DA  I "C3'" 1 
ATOM   6160  O  "O3'" . DA  I  5 8   ? -50.031 -39.770 54.556  1.00 111.80 ? -65  DA  I "O3'" 1 
ATOM   6161  C  "C2'" . DA  I  5 8   ? -52.295 -38.879 54.270  1.00 113.72 ? -65  DA  I "C2'" 1 
ATOM   6162  C  "C1'" . DA  I  5 8   ? -52.873 -39.803 55.337  1.00 114.48 ? -65  DA  I "C1'" 1 
ATOM   6163  N  N9    . DA  I  5 8   ? -54.329 -39.820 55.429  1.00 114.50 ? -65  DA  I N9    1 
ATOM   6164  C  C8    . DA  I  5 8   ? -55.178 -38.762 55.259  1.00 114.84 ? -65  DA  I C8    1 
ATOM   6165  N  N7    . DA  I  5 8   ? -56.442 -39.068 55.413  1.00 115.19 ? -65  DA  I N7    1 
ATOM   6166  C  C5    . DA  I  5 8   ? -56.417 -40.421 55.710  1.00 114.98 ? -65  DA  I C5    1 
ATOM   6167  C  C6    . DA  I  5 8   ? -57.441 -41.351 55.984  1.00 114.72 ? -65  DA  I C6    1 
ATOM   6168  N  N6    . DA  I  5 8   ? -58.732 -41.017 55.995  1.00 114.69 ? -65  DA  I N6    1 
ATOM   6169  N  N1    . DA  I  5 8   ? -57.089 -42.632 56.235  1.00 114.76 ? -65  DA  I N1    1 
ATOM   6170  C  C2    . DA  I  5 8   ? -55.787 -42.959 56.216  1.00 114.82 ? -65  DA  I C2    1 
ATOM   6171  N  N3    . DA  I  5 8   ? -54.736 -42.170 55.976  1.00 114.76 ? -65  DA  I N3    1 
ATOM   6172  C  C4    . DA  I  5 8   ? -55.121 -40.903 55.726  1.00 114.63 ? -65  DA  I C4    1 
ATOM   6173  P  P     . DA  I  5 9   ? -49.402 -40.045 53.110  1.00 111.14 ? -64  DA  I P     1 
ATOM   6174  O  OP1   . DA  I  5 9   ? -47.941 -39.843 53.235  1.00 111.09 ? -64  DA  I OP1   1 
ATOM   6175  O  OP2   . DA  I  5 9   ? -50.181 -39.314 52.080  1.00 110.79 ? -64  DA  I OP2   1 
ATOM   6176  O  "O5'" . DA  I  5 9   ? -49.669 -41.605 52.895  1.00 111.83 ? -64  DA  I "O5'" 1 
ATOM   6177  C  "C5'" . DA  I  5 9   ? -50.065 -42.474 53.969  1.00 111.87 ? -64  DA  I "C5'" 1 
ATOM   6178  C  "C4'" . DA  I  5 9   ? -50.917 -43.625 53.457  1.00 111.59 ? -64  DA  I "C4'" 1 
ATOM   6179  O  "O4'" . DA  I  5 9   ? -52.319 -43.342 53.668  1.00 111.14 ? -64  DA  I "O4'" 1 
ATOM   6180  C  "C3'" . DA  I  5 9   ? -50.770 -43.941 51.973  1.00 112.11 ? -64  DA  I "C3'" 1 
ATOM   6181  O  "O3'" . DA  I  5 9   ? -50.589 -45.347 51.828  1.00 113.46 ? -64  DA  I "O3'" 1 
ATOM   6182  C  "C2'" . DA  I  5 9   ? -52.060 -43.413 51.336  1.00 111.43 ? -64  DA  I "C2'" 1 
ATOM   6183  C  "C1'" . DA  I  5 9   ? -53.052 -43.567 52.480  1.00 111.04 ? -64  DA  I "C1'" 1 
ATOM   6184  N  N9    . DA  I  5 9   ? -54.171 -42.627 52.479  1.00 110.92 ? -64  DA  I N9    1 
ATOM   6185  C  C8    . DA  I  5 9   ? -54.129 -41.276 52.266  1.00 110.93 ? -64  DA  I C8    1 
ATOM   6186  N  N7    . DA  I  5 9   ? -55.292 -40.679 52.339  1.00 110.68 ? -64  DA  I N7    1 
ATOM   6187  C  C5    . DA  I  5 9   ? -56.164 -41.714 52.626  1.00 110.91 ? -64  DA  I C5    1 
ATOM   6188  C  C6    . DA  I  5 9   ? -57.559 -41.750 52.828  1.00 110.99 ? -64  DA  I C6    1 
ATOM   6189  N  N6    . DA  I  5 9   ? -58.332 -40.664 52.778  1.00 110.96 ? -64  DA  I N6    1 
ATOM   6190  N  N1    . DA  I  5 9   ? -58.129 -42.945 53.103  1.00 111.10 ? -64  DA  I N1    1 
ATOM   6191  C  C2    . DA  I  5 9   ? -57.351 -44.035 53.164  1.00 110.89 ? -64  DA  I C2    1 
ATOM   6192  N  N3    . DA  I  5 9   ? -56.032 -44.128 52.990  1.00 110.83 ? -64  DA  I N3    1 
ATOM   6193  C  C4    . DA  I  5 9   ? -55.493 -42.922 52.722  1.00 110.91 ? -64  DA  I C4    1 
ATOM   6194  P  P     . DT  I  5 10  ? -50.290 -46.016 50.402  1.00 114.64 ? -63  DT  I P     1 
ATOM   6195  O  OP1   . DT  I  5 10  ? -49.333 -47.127 50.615  1.00 114.63 ? -63  DT  I OP1   1 
ATOM   6196  O  OP2   . DT  I  5 10  ? -49.990 -44.972 49.394  1.00 114.36 ? -63  DT  I OP2   1 
ATOM   6197  O  "O5'" . DT  I  5 10  ? -51.729 -46.611 50.046  1.00 115.60 ? -63  DT  I "O5'" 1 
ATOM   6198  C  "C5'" . DT  I  5 10  ? -52.317 -47.635 50.836  1.00 116.45 ? -63  DT  I "C5'" 1 
ATOM   6199  C  "C4'" . DT  I  5 10  ? -53.695 -47.914 50.282  1.00 117.30 ? -63  DT  I "C4'" 1 
ATOM   6200  O  "O4'" . DT  I  5 10  ? -54.518 -46.747 50.527  1.00 117.44 ? -63  DT  I "O4'" 1 
ATOM   6201  C  "C3'" . DT  I  5 10  ? -53.731 -48.177 48.775  1.00 117.77 ? -63  DT  I "C3'" 1 
ATOM   6202  O  "O3'" . DT  I  5 10  ? -54.215 -49.524 48.543  1.00 118.68 ? -63  DT  I "O3'" 1 
ATOM   6203  C  "C2'" . DT  I  5 10  ? -54.595 -47.037 48.215  1.00 117.59 ? -63  DT  I "C2'" 1 
ATOM   6204  C  "C1'" . DT  I  5 10  ? -55.387 -46.562 49.431  1.00 117.60 ? -63  DT  I "C1'" 1 
ATOM   6205  N  N1    . DT  I  5 10  ? -55.825 -45.118 49.430  1.00 117.80 ? -63  DT  I N1    1 
ATOM   6206  C  C2    . DT  I  5 10  ? -57.118 -44.785 49.820  1.00 117.83 ? -63  DT  I C2    1 
ATOM   6207  O  O2    . DT  I  5 10  ? -57.962 -45.597 50.167  1.00 117.87 ? -63  DT  I O2    1 
ATOM   6208  N  N3    . DT  I  5 10  ? -57.405 -43.438 49.789  1.00 117.68 ? -63  DT  I N3    1 
ATOM   6209  C  C4    . DT  I  5 10  ? -56.548 -42.413 49.420  1.00 117.77 ? -63  DT  I C4    1 
ATOM   6210  O  O4    . DT  I  5 10  ? -56.910 -41.242 49.434  1.00 117.76 ? -63  DT  I O4    1 
ATOM   6211  C  C5    . DT  I  5 10  ? -55.213 -42.821 49.029  1.00 117.76 ? -63  DT  I C5    1 
ATOM   6212  C  C7    . DT  I  5 10  ? -54.187 -41.811 48.607  1.00 117.62 ? -63  DT  I C7    1 
ATOM   6213  C  C6    . DT  I  5 10  ? -54.922 -44.131 49.055  1.00 118.01 ? -63  DT  I C6    1 
ATOM   6214  P  P     . DA  I  5 11  ? -54.914 -50.038 47.186  1.00 119.46 ? -62  DA  I P     1 
ATOM   6215  O  OP1   . DA  I  5 11  ? -54.939 -51.518 47.216  1.00 119.25 ? -62  DA  I OP1   1 
ATOM   6216  O  OP2   . DA  I  5 11  ? -54.320 -49.355 46.010  1.00 118.87 ? -62  DA  I OP2   1 
ATOM   6217  O  "O5'" . DA  I  5 11  ? -56.401 -49.478 47.392  1.00 119.84 ? -62  DA  I "O5'" 1 
ATOM   6218  C  "C5'" . DA  I  5 11  ? -57.282 -50.001 48.390  1.00 119.79 ? -62  DA  I "C5'" 1 
ATOM   6219  C  "C4'" . DA  I  5 11  ? -58.715 -49.874 47.896  1.00 120.07 ? -62  DA  I "C4'" 1 
ATOM   6220  O  "O4'" . DA  I  5 11  ? -59.172 -48.503 48.034  1.00 119.93 ? -62  DA  I "O4'" 1 
ATOM   6221  C  "C3'" . DA  I  5 11  ? -58.926 -50.240 46.430  1.00 120.50 ? -62  DA  I "C3'" 1 
ATOM   6222  O  "O3'" . DA  I  5 11  ? -60.143 -50.992 46.308  1.00 121.19 ? -62  DA  I "O3'" 1 
ATOM   6223  C  "C2'" . DA  I  5 11  ? -58.955 -48.888 45.709  1.00 120.14 ? -62  DA  I "C2'" 1 
ATOM   6224  C  "C1'" . DA  I  5 11  ? -59.502 -47.943 46.776  1.00 120.11 ? -62  DA  I "C1'" 1 
ATOM   6225  N  N9    . DA  I  5 11  ? -58.951 -46.585 46.717  1.00 120.30 ? -62  DA  I N9    1 
ATOM   6226  C  C8    . DA  I  5 11  ? -57.640 -46.228 46.522  1.00 120.30 ? -62  DA  I C8    1 
ATOM   6227  N  N7    . DA  I  5 11  ? -57.423 -44.933 46.515  1.00 120.15 ? -62  DA  I N7    1 
ATOM   6228  C  C5    . DA  I  5 11  ? -58.680 -44.395 46.726  1.00 120.19 ? -62  DA  I C5    1 
ATOM   6229  C  C6    . DA  I  5 11  ? -59.132 -43.063 46.827  1.00 120.09 ? -62  DA  I C6    1 
ATOM   6230  N  N6    . DA  I  5 11  ? -58.318 -42.012 46.725  1.00 120.16 ? -62  DA  I N6    1 
ATOM   6231  N  N1    . DA  I  5 11  ? -60.451 -42.854 47.037  1.00 120.10 ? -62  DA  I N1    1 
ATOM   6232  C  C2    . DA  I  5 11  ? -61.264 -43.919 47.136  1.00 120.18 ? -62  DA  I C2    1 
ATOM   6233  N  N3    . DA  I  5 11  ? -60.957 -45.218 47.063  1.00 120.21 ? -62  DA  I N3    1 
ATOM   6234  C  C4    . DA  I  5 11  ? -59.636 -45.394 46.853  1.00 120.36 ? -62  DA  I C4    1 
ATOM   6235  P  P     . DT  I  5 12  ? -60.754 -51.452 44.898  1.00 121.02 ? -61  DT  I P     1 
ATOM   6236  O  OP1   . DT  I  5 12  ? -61.730 -52.524 45.179  1.00 121.23 ? -61  DT  I OP1   1 
ATOM   6237  O  OP2   . DT  I  5 12  ? -59.653 -51.689 43.932  1.00 120.61 ? -61  DT  I OP2   1 
ATOM   6238  O  "O5'" . DT  I  5 12  ? -61.568 -50.156 44.440  1.00 121.83 ? -61  DT  I "O5'" 1 
ATOM   6239  C  "C5'" . DT  I  5 12  ? -62.664 -49.668 45.213  1.00 122.61 ? -61  DT  I "C5'" 1 
ATOM   6240  C  "C4'" . DT  I  5 12  ? -63.378 -48.559 44.462  1.00 123.41 ? -61  DT  I "C4'" 1 
ATOM   6241  O  "O4'" . DT  I  5 12  ? -62.648 -47.320 44.643  1.00 123.44 ? -61  DT  I "O4'" 1 
ATOM   6242  C  "C3'" . DT  I  5 12  ? -63.506 -48.774 42.953  1.00 124.23 ? -61  DT  I "C3'" 1 
ATOM   6243  O  "O3'" . DT  I  5 12  ? -64.856 -48.520 42.552  1.00 125.68 ? -61  DT  I "O3'" 1 
ATOM   6244  C  "C2'" . DT  I  5 12  ? -62.520 -47.767 42.355  1.00 124.20 ? -61  DT  I "C2'" 1 
ATOM   6245  C  "C1'" . DT  I  5 12  ? -62.573 -46.651 43.398  1.00 124.07 ? -61  DT  I "C1'" 1 
ATOM   6246  N  N1    . DT  I  5 12  ? -61.418 -45.672 43.424  1.00 124.07 ? -61  DT  I N1    1 
ATOM   6247  C  C2    . DT  I  5 12  ? -61.674 -44.328 43.661  1.00 123.93 ? -61  DT  I C2    1 
ATOM   6248  O  O2    . DT  I  5 12  ? -62.782 -43.860 43.849  1.00 124.11 ? -61  DT  I O2    1 
ATOM   6249  N  N3    . DT  I  5 12  ? -60.566 -43.521 43.673  1.00 123.68 ? -61  DT  I N3    1 
ATOM   6250  C  C4    . DT  I  5 12  ? -59.252 -43.901 43.476  1.00 124.03 ? -61  DT  I C4    1 
ATOM   6251  O  O4    . DT  I  5 12  ? -58.338 -43.079 43.512  1.00 124.12 ? -61  DT  I O4    1 
ATOM   6252  C  C5    . DT  I  5 12  ? -59.044 -45.315 43.234  1.00 124.22 ? -61  DT  I C5    1 
ATOM   6253  C  C7    . DT  I  5 12  ? -57.661 -45.860 43.003  1.00 124.14 ? -61  DT  I C7    1 
ATOM   6254  C  C6    . DT  I  5 12  ? -60.122 -46.119 43.221  1.00 124.15 ? -61  DT  I C6    1 
ATOM   6255  P  P     . DC  I  5 13  ? -65.531 -49.180 41.251  1.00 126.47 ? -60  DC  I P     1 
ATOM   6256  O  OP1   . DC  I  5 13  ? -66.706 -49.943 41.731  1.00 126.42 ? -60  DC  I OP1   1 
ATOM   6257  O  OP2   . DC  I  5 13  ? -64.495 -49.864 40.446  1.00 126.17 ? -60  DC  I OP2   1 
ATOM   6258  O  "O5'" . DC  I  5 13  ? -66.040 -47.903 40.420  1.00 126.95 ? -60  DC  I "O5'" 1 
ATOM   6259  C  "C5'" . DC  I  5 13  ? -67.067 -47.052 40.950  1.00 127.72 ? -60  DC  I "C5'" 1 
ATOM   6260  C  "C4'" . DC  I  5 13  ? -66.915 -45.622 40.458  1.00 128.51 ? -60  DC  I "C4'" 1 
ATOM   6261  O  "O4'" . DC  I  5 13  ? -65.602 -45.111 40.818  1.00 128.53 ? -60  DC  I "O4'" 1 
ATOM   6262  C  "C3'" . DC  I  5 13  ? -67.037 -45.448 38.943  1.00 129.41 ? -60  DC  I "C3'" 1 
ATOM   6263  O  "O3'" . DC  I  5 13  ? -67.902 -44.352 38.634  1.00 130.31 ? -60  DC  I "O3'" 1 
ATOM   6264  C  "C2'" . DC  I  5 13  ? -65.602 -45.163 38.502  1.00 129.19 ? -60  DC  I "C2'" 1 
ATOM   6265  C  "C1'" . DC  I  5 13  ? -65.080 -44.402 39.715  1.00 128.49 ? -60  DC  I "C1'" 1 
ATOM   6266  N  N1    . DC  I  5 13  ? -63.586 -44.308 39.806  1.00 128.25 ? -60  DC  I N1    1 
ATOM   6267  C  C2    . DC  I  5 13  ? -62.988 -43.140 40.310  1.00 127.99 ? -60  DC  I C2    1 
ATOM   6268  O  O2    . DC  I  5 13  ? -63.697 -42.198 40.685  1.00 127.68 ? -60  DC  I O2    1 
ATOM   6269  N  N3    . DC  I  5 13  ? -61.628 -43.077 40.375  1.00 128.26 ? -60  DC  I N3    1 
ATOM   6270  C  C4    . DC  I  5 13  ? -60.876 -44.108 39.963  1.00 128.37 ? -60  DC  I C4    1 
ATOM   6271  N  N4    . DC  I  5 13  ? -59.546 -43.995 40.049  1.00 127.97 ? -60  DC  I N4    1 
ATOM   6272  C  C5    . DC  I  5 13  ? -61.464 -45.305 39.442  1.00 128.37 ? -60  DC  I C5    1 
ATOM   6273  C  C6    . DC  I  5 13  ? -62.805 -45.357 39.384  1.00 128.47 ? -60  DC  I C6    1 
ATOM   6274  P  P     . DC  I  5 14  ? -68.651 -44.266 37.219  1.00 130.62 ? -59  DC  I P     1 
ATOM   6275  O  OP1   . DC  I  5 14  ? -69.742 -45.265 37.273  1.00 130.66 ? -59  DC  I OP1   1 
ATOM   6276  O  OP2   . DC  I  5 14  ? -67.644 -44.359 36.131  1.00 130.44 ? -59  DC  I OP2   1 
ATOM   6277  O  "O5'" . DC  I  5 14  ? -69.287 -42.787 37.198  1.00 131.19 ? -59  DC  I "O5'" 1 
ATOM   6278  C  "C5'" . DC  I  5 14  ? -68.851 -41.727 38.070  1.00 132.27 ? -59  DC  I "C5'" 1 
ATOM   6279  C  "C4'" . DC  I  5 14  ? -68.191 -40.564 37.332  1.00 133.49 ? -59  DC  I "C4'" 1 
ATOM   6280  O  "O4'" . DC  I  5 14  ? -66.753 -40.581 37.559  1.00 133.56 ? -59  DC  I "O4'" 1 
ATOM   6281  C  "C3'" . DC  I  5 14  ? -68.412 -40.476 35.818  1.00 134.17 ? -59  DC  I "C3'" 1 
ATOM   6282  O  "O3'" . DC  I  5 14  ? -68.953 -39.185 35.474  1.00 135.13 ? -59  DC  I "O3'" 1 
ATOM   6283  C  "C2'" . DC  I  5 14  ? -67.033 -40.748 35.212  1.00 133.94 ? -59  DC  I "C2'" 1 
ATOM   6284  C  "C1'" . DC  I  5 14  ? -66.039 -40.474 36.341  1.00 133.66 ? -59  DC  I "C1'" 1 
ATOM   6285  N  N1    . DC  I  5 14  ? -64.858 -41.431 36.351  1.00 133.61 ? -59  DC  I N1    1 
ATOM   6286  C  C2    . DC  I  5 14  ? -63.661 -41.117 37.033  1.00 133.34 ? -59  DC  I C2    1 
ATOM   6287  O  O2    . DC  I  5 14  ? -63.546 -40.049 37.649  1.00 133.08 ? -59  DC  I O2    1 
ATOM   6288  N  N3    . DC  I  5 14  ? -62.636 -42.014 37.002  1.00 133.51 ? -59  DC  I N3    1 
ATOM   6289  C  C4    . DC  I  5 14  ? -62.757 -43.173 36.335  1.00 133.63 ? -59  DC  I C4    1 
ATOM   6290  N  N4    . DC  I  5 14  ? -61.720 -44.021 36.335  1.00 133.35 ? -59  DC  I N4    1 
ATOM   6291  C  C5    . DC  I  5 14  ? -63.956 -43.509 35.633  1.00 133.44 ? -59  DC  I C5    1 
ATOM   6292  C  C6    . DC  I  5 14  ? -64.959 -42.621 35.671  1.00 133.58 ? -59  DC  I C6    1 
ATOM   6293  P  P     . DC  I  5 15  ? -68.871 -38.526 34.006  1.00 135.99 ? -58  DC  I P     1 
ATOM   6294  O  OP1   . DC  I  5 15  ? -70.045 -37.638 33.822  1.00 135.84 ? -58  DC  I OP1   1 
ATOM   6295  O  OP2   . DC  I  5 15  ? -68.610 -39.583 33.001  1.00 135.90 ? -58  DC  I OP2   1 
ATOM   6296  O  "O5'" . DC  I  5 15  ? -67.563 -37.606 34.146  1.00 136.50 ? -58  DC  I "O5'" 1 
ATOM   6297  C  "C5'" . DC  I  5 15  ? -67.522 -36.517 35.093  1.00 136.30 ? -58  DC  I "C5'" 1 
ATOM   6298  C  "C4'" . DC  I  5 15  ? -66.229 -35.712 34.997  1.00 136.05 ? -58  DC  I "C4'" 1 
ATOM   6299  O  "O4'" . DC  I  5 15  ? -65.076 -36.573 35.197  1.00 135.82 ? -58  DC  I "O4'" 1 
ATOM   6300  C  "C3'" . DC  I  5 15  ? -66.008 -34.972 33.676  1.00 135.75 ? -58  DC  I "C3'" 1 
ATOM   6301  O  "O3'" . DC  I  5 15  ? -65.627 -33.620 33.931  1.00 135.38 ? -58  DC  I "O3'" 1 
ATOM   6302  C  "C2'" . DC  I  5 15  ? -64.895 -35.752 32.973  1.00 135.56 ? -58  DC  I "C2'" 1 
ATOM   6303  C  "C1'" . DC  I  5 15  ? -64.158 -36.424 34.129  1.00 135.36 ? -58  DC  I "C1'" 1 
ATOM   6304  N  N1    . DC  I  5 15  ? -63.605 -37.772 33.786  1.00 135.10 ? -58  DC  I N1    1 
ATOM   6305  C  C2    . DC  I  5 15  ? -62.219 -37.985 33.843  1.00 135.07 ? -58  DC  I C2    1 
ATOM   6306  O  O2    . DC  I  5 15  ? -61.474 -37.053 34.176  1.00 135.07 ? -58  DC  I O2    1 
ATOM   6307  N  N3    . DC  I  5 15  ? -61.731 -39.218 33.529  1.00 135.23 ? -58  DC  I N3    1 
ATOM   6308  C  C4    . DC  I  5 15  ? -62.562 -40.206 33.173  1.00 135.24 ? -58  DC  I C4    1 
ATOM   6309  N  N4    . DC  I  5 15  ? -62.032 -41.396 32.875  1.00 135.02 ? -58  DC  I N4    1 
ATOM   6310  C  C5    . DC  I  5 15  ? -63.978 -40.011 33.107  1.00 135.28 ? -58  DC  I C5    1 
ATOM   6311  C  C6    . DC  I  5 15  ? -64.448 -38.793 33.419  1.00 135.29 ? -58  DC  I C6    1 
ATOM   6312  P  P     . DT  I  5 16  ? -65.632 -32.514 32.763  1.00 135.29 ? -57  DT  I P     1 
ATOM   6313  O  OP1   . DT  I  5 16  ? -66.210 -31.267 33.328  1.00 135.14 ? -57  DT  I OP1   1 
ATOM   6314  O  OP2   . DT  I  5 16  ? -66.228 -33.111 31.540  1.00 135.30 ? -57  DT  I OP2   1 
ATOM   6315  O  "O5'" . DT  I  5 16  ? -64.068 -32.281 32.468  1.00 134.22 ? -57  DT  I "O5'" 1 
ATOM   6316  C  "C5'" . DT  I  5 16  ? -63.149 -31.996 33.523  1.00 132.27 ? -57  DT  I "C5'" 1 
ATOM   6317  C  "C4'" . DT  I  5 16  ? -61.712 -32.210 33.072  1.00 130.91 ? -57  DT  I "C4'" 1 
ATOM   6318  O  "O4'" . DT  I  5 16  ? -61.451 -33.615 32.831  1.00 130.62 ? -57  DT  I "O4'" 1 
ATOM   6319  C  "C3'" . DT  I  5 16  ? -61.284 -31.473 31.802  1.00 130.10 ? -57  DT  I "C3'" 1 
ATOM   6320  O  "O3'" . DT  I  5 16  ? -60.094 -30.734 32.082  1.00 128.82 ? -57  DT  I "O3'" 1 
ATOM   6321  C  "C2'" . DT  I  5 16  ? -61.038 -32.589 30.786  1.00 129.87 ? -57  DT  I "C2'" 1 
ATOM   6322  C  "C1'" . DT  I  5 16  ? -60.592 -33.713 31.715  1.00 129.94 ? -57  DT  I "C1'" 1 
ATOM   6323  N  N1    . DT  I  5 16  ? -60.688 -35.089 31.151  1.00 129.62 ? -57  DT  I N1    1 
ATOM   6324  C  C2    . DT  I  5 16  ? -59.595 -35.932 31.240  1.00 129.57 ? -57  DT  I C2    1 
ATOM   6325  O  O2    . DT  I  5 16  ? -58.535 -35.628 31.756  1.00 129.63 ? -57  DT  I O2    1 
ATOM   6326  N  N3    . DT  I  5 16  ? -59.788 -37.174 30.691  1.00 129.84 ? -57  DT  I N3    1 
ATOM   6327  C  C4    . DT  I  5 16  ? -60.938 -37.648 30.080  1.00 129.97 ? -57  DT  I C4    1 
ATOM   6328  O  O4    . DT  I  5 16  ? -60.997 -38.786 29.626  1.00 130.05 ? -57  DT  I O4    1 
ATOM   6329  C  C5    . DT  I  5 16  ? -62.047 -36.717 30.021  1.00 129.77 ? -57  DT  I C5    1 
ATOM   6330  C  C7    . DT  I  5 16  ? -63.353 -37.101 29.383  1.00 129.69 ? -57  DT  I C7    1 
ATOM   6331  C  C6    . DT  I  5 16  ? -61.868 -35.500 30.554  1.00 129.65 ? -57  DT  I C6    1 
ATOM   6332  P  P     . DT  I  5 17  ? -59.658 -29.470 31.201  1.00 127.43 ? -56  DT  I P     1 
ATOM   6333  O  OP1   . DT  I  5 17  ? -59.726 -28.291 32.098  1.00 126.75 ? -56  DT  I OP1   1 
ATOM   6334  O  OP2   . DT  I  5 17  ? -60.416 -29.500 29.926  1.00 127.29 ? -56  DT  I OP2   1 
ATOM   6335  O  "O5'" . DT  I  5 17  ? -58.124 -29.772 30.821  1.00 126.85 ? -56  DT  I "O5'" 1 
ATOM   6336  C  "C5'" . DT  I  5 17  ? -57.343 -30.827 31.435  1.00 124.95 ? -56  DT  I "C5'" 1 
ATOM   6337  C  "C4'" . DT  I  5 17  ? -56.223 -31.350 30.531  1.00 123.36 ? -56  DT  I "C4'" 1 
ATOM   6338  O  "O4'" . DT  I  5 17  ? -56.579 -32.668 30.032  1.00 123.19 ? -56  DT  I "O4'" 1 
ATOM   6339  C  "C3'" . DT  I  5 17  ? -55.877 -30.508 29.294  1.00 122.23 ? -56  DT  I "C3'" 1 
ATOM   6340  O  "O3'" . DT  I  5 17  ? -54.482 -30.551 29.025  1.00 119.95 ? -56  DT  I "O3'" 1 
ATOM   6341  C  "C2'" . DT  I  5 17  ? -56.621 -31.226 28.174  1.00 122.70 ? -56  DT  I "C2'" 1 
ATOM   6342  C  "C1'" . DT  I  5 17  ? -56.482 -32.684 28.616  1.00 123.50 ? -56  DT  I "C1'" 1 
ATOM   6343  N  N1    . DT  I  5 17  ? -57.518 -33.627 28.050  1.00 123.70 ? -56  DT  I N1    1 
ATOM   6344  C  C2    . DT  I  5 17  ? -57.325 -35.004 28.103  1.00 123.47 ? -56  DT  I C2    1 
ATOM   6345  O  O2    . DT  I  5 17  ? -56.350 -35.553 28.585  1.00 123.62 ? -56  DT  I O2    1 
ATOM   6346  N  N3    . DT  I  5 17  ? -58.339 -35.745 27.558  1.00 123.31 ? -56  DT  I N3    1 
ATOM   6347  C  C4    . DT  I  5 17  ? -59.501 -35.269 26.977  1.00 123.84 ? -56  DT  I C4    1 
ATOM   6348  O  O4    . DT  I  5 17  ? -60.338 -36.040 26.522  1.00 124.14 ? -56  DT  I O4    1 
ATOM   6349  C  C5    . DT  I  5 17  ? -59.648 -33.825 26.947  1.00 123.85 ? -56  DT  I C5    1 
ATOM   6350  C  C7    . DT  I  5 17  ? -60.857 -33.162 26.348  1.00 123.52 ? -56  DT  I C7    1 
ATOM   6351  C  C6    . DT  I  5 17  ? -58.662 -33.091 27.479  1.00 123.80 ? -56  DT  I C6    1 
ATOM   6352  P  P     . DG  I  5 18  ? -53.444 -29.452 29.559  1.00 118.18 ? -55  DG  I P     1 
ATOM   6353  O  OP1   . DG  I  5 18  ? -53.700 -29.168 30.993  1.00 117.76 ? -55  DG  I OP1   1 
ATOM   6354  O  OP2   . DG  I  5 18  ? -53.413 -28.345 28.573  1.00 117.70 ? -55  DG  I OP2   1 
ATOM   6355  O  "O5'" . DG  I  5 18  ? -52.073 -30.276 29.448  1.00 116.23 ? -55  DG  I "O5'" 1 
ATOM   6356  C  "C5'" . DG  I  5 18  ? -51.917 -31.544 30.116  1.00 112.85 ? -55  DG  I "C5'" 1 
ATOM   6357  C  "C4'" . DG  I  5 18  ? -51.389 -32.668 29.219  1.00 110.23 ? -55  DG  I "C4'" 1 
ATOM   6358  O  "O4'" . DG  I  5 18  ? -52.440 -33.214 28.380  1.00 109.78 ? -55  DG  I "O4'" 1 
ATOM   6359  C  "C3'" . DG  I  5 18  ? -50.245 -32.355 28.256  1.00 108.52 ? -55  DG  I "C3'" 1 
ATOM   6360  O  "O3'" . DG  I  5 18  ? -49.425 -33.517 28.255  1.00 105.66 ? -55  DG  I "O3'" 1 
ATOM   6361  C  "C2'" . DG  I  5 18  ? -50.960 -32.141 26.916  1.00 108.77 ? -55  DG  I "C2'" 1 
ATOM   6362  C  "C1'" . DG  I  5 18  ? -52.047 -33.203 27.017  1.00 109.46 ? -55  DG  I "C1'" 1 
ATOM   6363  N  N9    . DG  I  5 18  ? -53.292 -33.010 26.280  1.00 109.49 ? -55  DG  I N9    1 
ATOM   6364  C  C8    . DG  I  5 18  ? -53.881 -31.850 25.832  1.00 109.66 ? -55  DG  I C8    1 
ATOM   6365  N  N7    . DG  I  5 18  ? -55.025 -32.040 25.227  1.00 109.56 ? -55  DG  I N7    1 
ATOM   6366  C  C5    . DG  I  5 18  ? -55.211 -33.415 25.296  1.00 109.68 ? -55  DG  I C5    1 
ATOM   6367  C  C6    . DG  I  5 18  ? -56.274 -34.230 24.826  1.00 109.73 ? -55  DG  I C6    1 
ATOM   6368  O  O6    . DG  I  5 18  ? -57.300 -33.883 24.225  1.00 109.60 ? -55  DG  I O6    1 
ATOM   6369  N  N1    . DG  I  5 18  ? -56.059 -35.586 25.104  1.00 109.74 ? -55  DG  I N1    1 
ATOM   6370  C  C2    . DG  I  5 18  ? -54.960 -36.094 25.762  1.00 109.34 ? -55  DG  I C2    1 
ATOM   6371  N  N2    . DG  I  5 18  ? -54.919 -37.419 25.941  1.00 109.44 ? -55  DG  I N2    1 
ATOM   6372  N  N3    . DG  I  5 18  ? -53.965 -35.344 26.210  1.00 109.41 ? -55  DG  I N3    1 
ATOM   6373  C  C4    . DG  I  5 18  ? -54.155 -34.022 25.944  1.00 109.65 ? -55  DG  I C4    1 
ATOM   6374  P  P     . DC  I  5 19  ? -47.923 -33.543 27.721  1.00 103.40 ? -54  DC  I P     1 
ATOM   6375  O  OP1   . DC  I  5 19  ? -47.049 -33.371 28.896  1.00 103.58 ? -54  DC  I OP1   1 
ATOM   6376  O  OP2   . DC  I  5 19  ? -47.790 -32.643 26.554  1.00 102.82 ? -54  DC  I OP2   1 
ATOM   6377  O  "O5'" . DC  I  5 19  ? -47.785 -35.046 27.183  1.00 104.21 ? -54  DC  I "O5'" 1 
ATOM   6378  C  "C5'" . DC  I  5 19  ? -47.854 -36.181 28.059  1.00 104.40 ? -54  DC  I "C5'" 1 
ATOM   6379  C  "C4'" . DC  I  5 19  ? -48.385 -37.424 27.348  1.00 104.82 ? -54  DC  I "C4'" 1 
ATOM   6380  O  "O4'" . DC  I  5 19  ? -49.620 -37.102 26.669  1.00 104.55 ? -54  DC  I "O4'" 1 
ATOM   6381  C  "C3'" . DC  I  5 19  ? -47.503 -38.100 26.295  1.00 105.22 ? -54  DC  I "C3'" 1 
ATOM   6382  O  "O3'" . DC  I  5 19  ? -47.696 -39.526 26.352  1.00 106.33 ? -54  DC  I "O3'" 1 
ATOM   6383  C  "C2'" . DC  I  5 19  ? -48.035 -37.516 24.990  1.00 104.62 ? -54  DC  I "C2'" 1 
ATOM   6384  C  "C1'" . DC  I  5 19  ? -49.526 -37.453 25.304  1.00 104.43 ? -54  DC  I "C1'" 1 
ATOM   6385  N  N1    . DC  I  5 19  ? -50.349 -36.458 24.535  1.00 104.57 ? -54  DC  I N1    1 
ATOM   6386  C  C2    . DC  I  5 19  ? -51.491 -36.896 23.832  1.00 104.48 ? -54  DC  I C2    1 
ATOM   6387  O  O2    . DC  I  5 19  ? -51.810 -38.100 23.830  1.00 104.05 ? -54  DC  I O2    1 
ATOM   6388  N  N3    . DC  I  5 19  ? -52.224 -35.971 23.155  1.00 104.19 ? -54  DC  I N3    1 
ATOM   6389  C  C4    . DC  I  5 19  ? -51.873 -34.682 23.169  1.00 104.18 ? -54  DC  I C4    1 
ATOM   6390  N  N4    . DC  I  5 19  ? -52.637 -33.828 22.485  1.00 104.46 ? -54  DC  I N4    1 
ATOM   6391  C  C5    . DC  I  5 19  ? -50.725 -34.217 23.877  1.00 104.22 ? -54  DC  I C5    1 
ATOM   6392  C  C6    . DC  I  5 19  ? -50.004 -35.129 24.543  1.00 104.28 ? -54  DC  I C6    1 
ATOM   6393  P  P     . DG  I  5 20  ? -46.520 -40.596 26.087  1.00 107.65 ? -53  DG  I P     1 
ATOM   6394  O  OP1   . DG  I  5 20  ? -46.620 -41.580 27.190  1.00 106.91 ? -53  DG  I OP1   1 
ATOM   6395  O  OP2   . DG  I  5 20  ? -45.248 -39.875 25.836  1.00 106.62 ? -53  DG  I OP2   1 
ATOM   6396  O  "O5'" . DG  I  5 20  ? -46.890 -41.318 24.695  1.00 109.08 ? -53  DG  I "O5'" 1 
ATOM   6397  C  "C5'" . DG  I  5 20  ? -48.211 -41.341 24.124  1.00 111.06 ? -53  DG  I "C5'" 1 
ATOM   6398  C  "C4'" . DG  I  5 20  ? -48.235 -41.068 22.621  1.00 112.81 ? -53  DG  I "C4'" 1 
ATOM   6399  O  "O4'" . DG  I  5 20  ? -48.685 -39.709 22.371  1.00 113.21 ? -53  DG  I "O4'" 1 
ATOM   6400  C  "C3'" . DG  I  5 20  ? -46.916 -41.220 21.856  1.00 114.50 ? -53  DG  I "C3'" 1 
ATOM   6401  O  "O3'" . DG  I  5 20  ? -47.156 -41.913 20.624  1.00 117.28 ? -53  DG  I "O3'" 1 
ATOM   6402  C  "C2'" . DG  I  5 20  ? -46.504 -39.770 21.599  1.00 114.33 ? -53  DG  I "C2'" 1 
ATOM   6403  C  "C1'" . DG  I  5 20  ? -47.879 -39.157 21.350  1.00 114.28 ? -53  DG  I "C1'" 1 
ATOM   6404  N  N9    . DG  I  5 20  ? -47.979 -37.686 21.332  1.00 114.63 ? -53  DG  I N9    1 
ATOM   6405  C  C8    . DG  I  5 20  ? -47.051 -36.729 21.711  1.00 114.99 ? -53  DG  I C8    1 
ATOM   6406  N  N7    . DG  I  5 20  ? -47.450 -35.484 21.564  1.00 114.89 ? -53  DG  I N7    1 
ATOM   6407  C  C5    . DG  I  5 20  ? -48.736 -35.627 21.046  1.00 114.91 ? -53  DG  I C5    1 
ATOM   6408  C  C6    . DG  I  5 20  ? -49.689 -34.644 20.670  1.00 114.74 ? -53  DG  I C6    1 
ATOM   6409  O  O6    . DG  I  5 20  ? -49.580 -33.411 20.728  1.00 114.64 ? -53  DG  I O6    1 
ATOM   6410  N  N1    . DG  I  5 20  ? -50.871 -35.217 20.186  1.00 114.74 ? -53  DG  I N1    1 
ATOM   6411  C  C2    . DG  I  5 20  ? -51.103 -36.573 20.079  1.00 114.60 ? -53  DG  I C2    1 
ATOM   6412  N  N2    . DG  I  5 20  ? -52.292 -36.957 19.596  1.00 114.61 ? -53  DG  I N2    1 
ATOM   6413  N  N3    . DG  I  5 20  ? -50.222 -37.500 20.426  1.00 114.36 ? -53  DG  I N3    1 
ATOM   6414  C  C4    . DG  I  5 20  ? -49.070 -36.965 20.899  1.00 114.61 ? -53  DG  I C4    1 
ATOM   6415  P  P     . DG  I  5 21  ? -46.546 -43.370 20.286  1.00 118.68 ? -52  DG  I P     1 
ATOM   6416  O  OP1   . DG  I  5 21  ? -47.176 -44.348 21.220  1.00 118.05 ? -52  DG  I OP1   1 
ATOM   6417  O  OP2   . DG  I  5 21  ? -45.063 -43.248 20.188  1.00 118.59 ? -52  DG  I OP2   1 
ATOM   6418  O  "O5'" . DG  I  5 21  ? -47.101 -43.609 18.799  1.00 119.81 ? -52  DG  I "O5'" 1 
ATOM   6419  C  "C5'" . DG  I  5 21  ? -48.478 -43.928 18.596  1.00 121.96 ? -52  DG  I "C5'" 1 
ATOM   6420  C  "C4'" . DG  I  5 21  ? -49.119 -43.020 17.558  1.00 123.85 ? -52  DG  I "C4'" 1 
ATOM   6421  O  "O4'" . DG  I  5 21  ? -49.159 -41.646 18.031  1.00 124.11 ? -52  DG  I "O4'" 1 
ATOM   6422  C  "C3'" . DG  I  5 21  ? -48.440 -42.987 16.183  1.00 125.16 ? -52  DG  I "C3'" 1 
ATOM   6423  O  "O3'" . DG  I  5 21  ? -49.435 -43.113 15.157  1.00 127.17 ? -52  DG  I "O3'" 1 
ATOM   6424  C  "C2'" . DG  I  5 21  ? -47.805 -41.601 16.156  1.00 124.79 ? -52  DG  I "C2'" 1 
ATOM   6425  C  "C1'" . DG  I  5 21  ? -48.902 -40.844 16.896  1.00 124.41 ? -52  DG  I "C1'" 1 
ATOM   6426  N  N9    . DG  I  5 21  ? -48.571 -39.474 17.273  1.00 124.45 ? -52  DG  I N9    1 
ATOM   6427  C  C8    . DG  I  5 21  ? -47.491 -39.029 18.001  1.00 124.41 ? -52  DG  I C8    1 
ATOM   6428  N  N7    . DG  I  5 21  ? -47.476 -37.734 18.167  1.00 124.43 ? -52  DG  I N7    1 
ATOM   6429  C  C5    . DG  I  5 21  ? -48.617 -37.290 17.504  1.00 124.46 ? -52  DG  I C5    1 
ATOM   6430  C  C6    . DG  I  5 21  ? -49.139 -35.981 17.335  1.00 124.20 ? -52  DG  I C6    1 
ATOM   6431  O  O6    . DG  I  5 21  ? -48.679 -34.912 17.749  1.00 124.23 ? -52  DG  I O6    1 
ATOM   6432  N  N1    . DG  I  5 21  ? -50.318 -35.978 16.592  1.00 124.26 ? -52  DG  I N1    1 
ATOM   6433  C  C2    . DG  I  5 21  ? -50.924 -37.100 16.075  1.00 124.30 ? -52  DG  I C2    1 
ATOM   6434  N  N2    . DG  I  5 21  ? -52.054 -36.905 15.384  1.00 124.40 ? -52  DG  I N2    1 
ATOM   6435  N  N3    . DG  I  5 21  ? -50.452 -38.332 16.226  1.00 124.21 ? -52  DG  I N3    1 
ATOM   6436  C  C4    . DG  I  5 21  ? -49.300 -38.353 16.948  1.00 124.48 ? -52  DG  I C4    1 
ATOM   6437  P  P     . DA  I  5 22  ? -49.112 -43.711 13.702  1.00 128.45 ? -51  DA  I P     1 
ATOM   6438  O  OP1   . DA  I  5 22  ? -48.889 -45.166 13.878  1.00 128.04 ? -51  DA  I OP1   1 
ATOM   6439  O  OP2   . DA  I  5 22  ? -48.066 -42.871 13.065  1.00 128.15 ? -51  DA  I OP2   1 
ATOM   6440  O  "O5'" . DA  I  5 22  ? -50.487 -43.472 12.902  1.00 128.80 ? -51  DA  I "O5'" 1 
ATOM   6441  C  "C5'" . DA  I  5 22  ? -51.346 -42.348 13.176  1.00 129.62 ? -51  DA  I "C5'" 1 
ATOM   6442  C  "C4'" . DA  I  5 22  ? -51.270 -41.217 12.147  1.00 130.19 ? -51  DA  I "C4'" 1 
ATOM   6443  O  "O4'" . DA  I  5 22  ? -50.867 -39.988 12.814  1.00 129.87 ? -51  DA  I "O4'" 1 
ATOM   6444  C  "C3'" . DA  I  5 22  ? -50.321 -41.406 10.956  1.00 130.91 ? -51  DA  I "C3'" 1 
ATOM   6445  O  "O3'" . DA  I  5 22  ? -51.053 -41.309 9.701   1.00 132.23 ? -51  DA  I "O3'" 1 
ATOM   6446  C  "C2'" . DA  I  5 22  ? -49.239 -40.345 11.170  1.00 130.39 ? -51  DA  I "C2'" 1 
ATOM   6447  C  "C1'" . DA  I  5 22  ? -49.935 -39.288 12.019  1.00 129.63 ? -51  DA  I "C1'" 1 
ATOM   6448  N  N9    . DA  I  5 22  ? -49.017 -38.541 12.884  1.00 129.52 ? -51  DA  I N9    1 
ATOM   6449  C  C8    . DA  I  5 22  ? -48.013 -39.055 13.663  1.00 129.47 ? -51  DA  I C8    1 
ATOM   6450  N  N7    . DA  I  5 22  ? -47.337 -38.155 14.338  1.00 129.49 ? -51  DA  I N7    1 
ATOM   6451  C  C5    . DA  I  5 22  ? -47.938 -36.960 13.979  1.00 129.49 ? -51  DA  I C5    1 
ATOM   6452  C  C6    . DA  I  5 22  ? -47.689 -35.619 14.350  1.00 129.46 ? -51  DA  I C6    1 
ATOM   6453  N  N6    . DA  I  5 22  ? -46.727 -35.260 15.204  1.00 129.31 ? -51  DA  I N6    1 
ATOM   6454  N  N1    . DA  I  5 22  ? -48.471 -34.656 13.810  1.00 129.57 ? -51  DA  I N1    1 
ATOM   6455  C  C2    . DA  I  5 22  ? -49.442 -35.015 12.956  1.00 129.46 ? -51  DA  I C2    1 
ATOM   6456  N  N3    . DA  I  5 22  ? -49.766 -36.239 12.534  1.00 129.25 ? -51  DA  I N3    1 
ATOM   6457  C  C4    . DA  I  5 22  ? -48.974 -37.178 13.083  1.00 129.37 ? -51  DA  I C4    1 
ATOM   6458  P  P     . DT  I  5 23  ? -50.574 -40.514 8.383   1.00 132.87 ? -50  DT  I P     1 
ATOM   6459  O  OP1   . DT  I  5 23  ? -51.521 -40.852 7.295   1.00 132.47 ? -50  DT  I OP1   1 
ATOM   6460  O  OP2   . DT  I  5 23  ? -49.123 -40.726 8.164   1.00 132.71 ? -50  DT  I OP2   1 
ATOM   6461  O  "O5'" . DT  I  5 23  ? -50.792 -38.989 8.830   1.00 133.83 ? -50  DT  I "O5'" 1 
ATOM   6462  C  "C5'" . DT  I  5 23  ? -52.063 -38.329 8.724   1.00 134.48 ? -50  DT  I "C5'" 1 
ATOM   6463  C  "C4'" . DT  I  5 23  ? -51.929 -37.068 7.881   1.00 135.01 ? -50  DT  I "C4'" 1 
ATOM   6464  O  "O4'" . DT  I  5 23  ? -51.185 -36.057 8.612   1.00 135.06 ? -50  DT  I "O4'" 1 
ATOM   6465  C  "C3'" . DT  I  5 23  ? -51.187 -37.252 6.560   1.00 135.43 ? -50  DT  I "C3'" 1 
ATOM   6466  O  "O3'" . DT  I  5 23  ? -51.774 -36.433 5.553   1.00 136.06 ? -50  DT  I "O3'" 1 
ATOM   6467  C  "C2'" . DT  I  5 23  ? -49.757 -36.828 6.892   1.00 135.27 ? -50  DT  I "C2'" 1 
ATOM   6468  C  "C1'" . DT  I  5 23  ? -49.969 -35.752 7.952   1.00 135.25 ? -50  DT  I "C1'" 1 
ATOM   6469  N  N1    . DT  I  5 23  ? -48.846 -35.664 8.956   1.00 135.30 ? -50  DT  I N1    1 
ATOM   6470  C  C2    . DT  I  5 23  ? -48.519 -34.440 9.521   1.00 135.21 ? -50  DT  I C2    1 
ATOM   6471  O  O2    . DT  I  5 23  ? -49.089 -33.392 9.266   1.00 135.18 ? -50  DT  I O2    1 
ATOM   6472  N  N3    . DT  I  5 23  ? -47.479 -34.487 10.418  1.00 135.15 ? -50  DT  I N3    1 
ATOM   6473  C  C4    . DT  I  5 23  ? -46.748 -35.601 10.801  1.00 135.28 ? -50  DT  I C4    1 
ATOM   6474  O  O4    . DT  I  5 23  ? -45.834 -35.529 11.618  1.00 135.36 ? -50  DT  I O4    1 
ATOM   6475  C  C5    . DT  I  5 23  ? -47.138 -36.845 10.175  1.00 135.23 ? -50  DT  I C5    1 
ATOM   6476  C  C7    . DT  I  5 23  ? -46.422 -38.124 10.501  1.00 135.27 ? -50  DT  I C7    1 
ATOM   6477  C  C6    . DT  I  5 23  ? -48.153 -36.817 9.300   1.00 135.19 ? -50  DT  I C6    1 
ATOM   6478  P  P     . DC  I  5 24  ? -51.088 -36.243 4.115   1.00 136.50 ? -49  DC  I P     1 
ATOM   6479  O  OP1   . DC  I  5 24  ? -52.172 -35.941 3.155   1.00 136.97 ? -49  DC  I OP1   1 
ATOM   6480  O  OP2   . DC  I  5 24  ? -50.182 -37.388 3.847   1.00 136.36 ? -49  DC  I OP2   1 
ATOM   6481  O  "O5'" . DC  I  5 24  ? -50.202 -34.922 4.312   1.00 136.77 ? -49  DC  I "O5'" 1 
ATOM   6482  C  "C5'" . DC  I  5 24  ? -50.792 -33.672 4.695   1.00 137.23 ? -49  DC  I "C5'" 1 
ATOM   6483  C  "C4'" . DC  I  5 24  ? -49.739 -32.579 4.801   1.00 137.66 ? -49  DC  I "C4'" 1 
ATOM   6484  O  "O4'" . DC  I  5 24  ? -48.853 -32.853 5.925   1.00 137.99 ? -49  DC  I "O4'" 1 
ATOM   6485  C  "C3'" . DC  I  5 24  ? -48.833 -32.434 3.577   1.00 137.85 ? -49  DC  I "C3'" 1 
ATOM   6486  O  "O3'" . DC  I  5 24  ? -48.576 -31.060 3.292   1.00 138.14 ? -49  DC  I "O3'" 1 
ATOM   6487  C  "C2'" . DC  I  5 24  ? -47.556 -33.137 4.024   1.00 138.20 ? -49  DC  I "C2'" 1 
ATOM   6488  C  "C1'" . DC  I  5 24  ? -47.513 -32.709 5.486   1.00 138.31 ? -49  DC  I "C1'" 1 
ATOM   6489  N  N1    . DC  I  5 24  ? -46.570 -33.510 6.337   1.00 138.32 ? -49  DC  I N1    1 
ATOM   6490  C  C2    . DC  I  5 24  ? -45.539 -32.874 7.053   1.00 138.37 ? -49  DC  I C2    1 
ATOM   6491  O  O2    . DC  I  5 24  ? -45.405 -31.645 6.988   1.00 138.38 ? -49  DC  I O2    1 
ATOM   6492  N  N3    . DC  I  5 24  ? -44.705 -33.636 7.810   1.00 138.45 ? -49  DC  I N3    1 
ATOM   6493  C  C4    . DC  I  5 24  ? -44.867 -34.966 7.867   1.00 138.58 ? -49  DC  I C4    1 
ATOM   6494  N  N4    . DC  I  5 24  ? -44.029 -35.686 8.620   1.00 138.53 ? -49  DC  I N4    1 
ATOM   6495  C  C5    . DC  I  5 24  ? -45.901 -35.628 7.142   1.00 138.53 ? -49  DC  I C5    1 
ATOM   6496  C  C6    . DC  I  5 24  ? -46.717 -34.869 6.403   1.00 138.49 ? -49  DC  I C6    1 
ATOM   6497  P  P     . DG  I  5 25  ? -47.964 -30.633 1.876   1.00 138.44 ? -48  DG  I P     1 
ATOM   6498  O  OP1   . DG  I  5 25  ? -49.137 -30.420 1.006   1.00 138.73 ? -48  DG  I OP1   1 
ATOM   6499  O  OP2   . DG  I  5 25  ? -46.937 -31.621 1.473   1.00 138.62 ? -48  DG  I OP2   1 
ATOM   6500  O  "O5'" . DG  I  5 25  ? -47.197 -29.237 2.104   1.00 138.87 ? -48  DG  I "O5'" 1 
ATOM   6501  C  "C5'" . DG  I  5 25  ? -47.016 -28.610 3.386   1.00 139.25 ? -48  DG  I "C5'" 1 
ATOM   6502  C  "C4'" . DG  I  5 25  ? -45.550 -28.391 3.767   1.00 139.48 ? -48  DG  I "C4'" 1 
ATOM   6503  O  "O4'" . DG  I  5 25  ? -45.052 -29.549 4.492   1.00 139.64 ? -48  DG  I "O4'" 1 
ATOM   6504  C  "C3'" . DG  I  5 25  ? -44.551 -28.138 2.633   1.00 139.52 ? -48  DG  I "C3'" 1 
ATOM   6505  O  "O3'" . DG  I  5 25  ? -43.637 -27.084 2.971   1.00 139.58 ? -48  DG  I "O3'" 1 
ATOM   6506  C  "C2'" . DG  I  5 25  ? -43.817 -29.470 2.524   1.00 139.66 ? -48  DG  I "C2'" 1 
ATOM   6507  C  "C1'" . DG  I  5 25  ? -43.787 -29.918 3.980   1.00 139.95 ? -48  DG  I "C1'" 1 
ATOM   6508  N  N9    . DG  I  5 25  ? -43.606 -31.357 4.187   1.00 140.04 ? -48  DG  I N9    1 
ATOM   6509  C  C8    . DG  I  5 25  ? -44.204 -32.379 3.488   1.00 140.01 ? -48  DG  I C8    1 
ATOM   6510  N  N7    . DG  I  5 25  ? -43.862 -33.568 3.894   1.00 140.01 ? -48  DG  I N7    1 
ATOM   6511  C  C5    . DG  I  5 25  ? -42.977 -33.323 4.934   1.00 140.08 ? -48  DG  I C5    1 
ATOM   6512  C  C6    . DG  I  5 25  ? -42.275 -34.232 5.764   1.00 140.11 ? -48  DG  I C6    1 
ATOM   6513  O  O6    . DG  I  5 25  ? -42.304 -35.471 5.732   1.00 140.11 ? -48  DG  I O6    1 
ATOM   6514  N  N1    . DG  I  5 25  ? -41.474 -33.582 6.704   1.00 139.98 ? -48  DG  I N1    1 
ATOM   6515  C  C2    . DG  I  5 25  ? -41.369 -32.214 6.824   1.00 140.05 ? -48  DG  I C2    1 
ATOM   6516  N  N2    . DG  I  5 25  ? -40.547 -31.764 7.785   1.00 140.04 ? -48  DG  I N2    1 
ATOM   6517  N  N3    . DG  I  5 25  ? -42.025 -31.349 6.052   1.00 140.15 ? -48  DG  I N3    1 
ATOM   6518  C  C4    . DG  I  5 25  ? -42.809 -31.968 5.130   1.00 140.05 ? -48  DG  I C4    1 
ATOM   6519  P  P     . DT  I  5 26  ? -43.013 -26.113 1.852   1.00 139.56 ? -47  DT  I P     1 
ATOM   6520  O  OP1   . DT  I  5 26  ? -43.795 -24.860 1.875   1.00 139.63 ? -47  DT  I OP1   1 
ATOM   6521  O  OP2   . DT  I  5 26  ? -42.873 -26.865 0.584   1.00 139.52 ? -47  DT  I OP2   1 
ATOM   6522  O  "O5'" . DT  I  5 26  ? -41.538 -25.800 2.381   1.00 138.81 ? -47  DT  I "O5'" 1 
ATOM   6523  C  "C5'" . DT  I  5 26  ? -41.331 -24.980 3.527   1.00 138.23 ? -47  DT  I "C5'" 1 
ATOM   6524  C  "C4'" . DT  I  5 26  ? -40.176 -25.519 4.357   1.00 137.88 ? -47  DT  I "C4'" 1 
ATOM   6525  O  "O4'" . DT  I  5 26  ? -40.321 -26.959 4.504   1.00 138.51 ? -47  DT  I "O4'" 1 
ATOM   6526  C  "C3'" . DT  I  5 26  ? -38.781 -25.281 3.769   1.00 137.02 ? -47  DT  I "C3'" 1 
ATOM   6527  O  "O3'" . DT  I  5 26  ? -37.868 -24.875 4.791   1.00 135.03 ? -47  DT  I "O3'" 1 
ATOM   6528  C  "C2'" . DT  I  5 26  ? -38.392 -26.642 3.191   1.00 137.78 ? -47  DT  I "C2'" 1 
ATOM   6529  C  "C1'" . DT  I  5 26  ? -39.106 -27.593 4.152   1.00 138.75 ? -47  DT  I "C1'" 1 
ATOM   6530  N  N1    . DT  I  5 26  ? -39.418 -28.956 3.608   1.00 138.96 ? -47  DT  I N1    1 
ATOM   6531  C  C2    . DT  I  5 26  ? -39.058 -30.068 4.347   1.00 138.96 ? -47  DT  I C2    1 
ATOM   6532  O  O2    . DT  I  5 26  ? -38.493 -30.011 5.425   1.00 138.96 ? -47  DT  I O2    1 
ATOM   6533  N  N3    . DT  I  5 26  ? -39.388 -31.269 3.766   1.00 139.14 ? -47  DT  I N3    1 
ATOM   6534  C  C4    . DT  I  5 26  ? -40.028 -31.470 2.551   1.00 139.18 ? -47  DT  I C4    1 
ATOM   6535  O  O4    . DT  I  5 26  ? -40.275 -32.596 2.126   1.00 139.15 ? -47  DT  I O4    1 
ATOM   6536  C  C5    . DT  I  5 26  ? -40.378 -30.266 1.827   1.00 139.20 ? -47  DT  I C5    1 
ATOM   6537  C  C7    . DT  I  5 26  ? -41.069 -30.346 0.493   1.00 138.94 ? -47  DT  I C7    1 
ATOM   6538  C  C6    . DT  I  5 26  ? -40.062 -29.085 2.386   1.00 139.17 ? -47  DT  I C6    1 
ATOM   6539  P  P     . DA  I  5 27  ? -37.700 -23.333 5.185   1.00 133.42 ? -46  DA  I P     1 
ATOM   6540  O  OP1   . DA  I  5 27  ? -38.885 -22.930 5.983   1.00 133.04 ? -46  DA  I OP1   1 
ATOM   6541  O  OP2   . DA  I  5 27  ? -37.348 -22.600 3.946   1.00 133.68 ? -46  DA  I OP2   1 
ATOM   6542  O  "O5'" . DA  I  5 27  ? -36.394 -23.305 6.120   1.00 131.85 ? -46  DA  I "O5'" 1 
ATOM   6543  C  "C5'" . DA  I  5 27  ? -36.368 -23.898 7.425   1.00 128.81 ? -46  DA  I "C5'" 1 
ATOM   6544  C  "C4'" . DA  I  5 27  ? -35.348 -25.028 7.500   1.00 126.64 ? -46  DA  I "C4'" 1 
ATOM   6545  O  "O4'" . DA  I  5 27  ? -35.678 -26.025 6.496   1.00 126.45 ? -46  DA  I "O4'" 1 
ATOM   6546  C  "C3'" . DA  I  5 27  ? -33.877 -24.648 7.284   1.00 124.75 ? -46  DA  I "C3'" 1 
ATOM   6547  O  "O3'" . DA  I  5 27  ? -33.056 -25.183 8.339   1.00 121.47 ? -46  DA  I "O3'" 1 
ATOM   6548  C  "C2'" . DA  I  5 27  ? -33.548 -25.259 5.922   1.00 125.38 ? -46  DA  I "C2'" 1 
ATOM   6549  C  "C1'" . DA  I  5 27  ? -34.487 -26.463 5.880   1.00 126.81 ? -46  DA  I "C1'" 1 
ATOM   6550  N  N9    . DA  I  5 27  ? -34.778 -26.976 4.537   1.00 127.15 ? -46  DA  I N9    1 
ATOM   6551  C  C8    . DA  I  5 27  ? -34.787 -26.270 3.364   1.00 127.35 ? -46  DA  I C8    1 
ATOM   6552  N  N7    . DA  I  5 27  ? -35.074 -26.987 2.304   1.00 127.56 ? -46  DA  I N7    1 
ATOM   6553  C  C5    . DA  I  5 27  ? -35.268 -28.260 2.810   1.00 127.38 ? -46  DA  I C5    1 
ATOM   6554  C  C6    . DA  I  5 27  ? -35.602 -29.488 2.195   1.00 127.36 ? -46  DA  I C6    1 
ATOM   6555  N  N6    . DA  I  5 27  ? -35.803 -29.625 0.878   1.00 127.27 ? -46  DA  I N6    1 
ATOM   6556  N  N1    . DA  I  5 27  ? -35.721 -30.576 2.987   1.00 127.28 ? -46  DA  I N1    1 
ATOM   6557  C  C2    . DA  I  5 27  ? -35.515 -30.439 4.303   1.00 127.23 ? -46  DA  I C2    1 
ATOM   6558  N  N3    . DA  I  5 27  ? -35.198 -29.342 4.991   1.00 127.34 ? -46  DA  I N3    1 
ATOM   6559  C  C4    . DA  I  5 27  ? -35.088 -28.273 4.184   1.00 127.27 ? -46  DA  I C4    1 
ATOM   6560  P  P     . DG  I  5 28  ? -31.514 -24.770 8.571   1.00 119.28 ? -45  DG  I P     1 
ATOM   6561  O  OP1   . DG  I  5 28  ? -31.491 -23.788 9.678   1.00 118.96 ? -45  DG  I OP1   1 
ATOM   6562  O  OP2   . DG  I  5 28  ? -30.870 -24.438 7.277   1.00 118.91 ? -45  DG  I OP2   1 
ATOM   6563  O  "O5'" . DG  I  5 28  ? -30.819 -26.117 9.087   1.00 116.91 ? -45  DG  I "O5'" 1 
ATOM   6564  C  "C5'" . DG  I  5 28  ? -31.567 -27.302 9.358   1.00 113.62 ? -45  DG  I "C5'" 1 
ATOM   6565  C  "C4'" . DG  I  5 28  ? -30.991 -28.497 8.621   1.00 111.08 ? -45  DG  I "C4'" 1 
ATOM   6566  O  "O4'" . DG  I  5 28  ? -31.549 -28.573 7.283   1.00 111.53 ? -45  DG  I "O4'" 1 
ATOM   6567  C  "C3'" . DG  I  5 28  ? -29.475 -28.493 8.445   1.00 109.17 ? -45  DG  I "C3'" 1 
ATOM   6568  O  "O3'" . DG  I  5 28  ? -28.991 -29.789 8.717   1.00 105.59 ? -45  DG  I "O3'" 1 
ATOM   6569  C  "C2'" . DG  I  5 28  ? -29.281 -28.177 6.969   1.00 110.17 ? -45  DG  I "C2'" 1 
ATOM   6570  C  "C1'" . DG  I  5 28  ? -30.497 -28.892 6.396   1.00 112.12 ? -45  DG  I "C1'" 1 
ATOM   6571  N  N9    . DG  I  5 28  ? -30.843 -28.506 5.033   1.00 112.43 ? -45  DG  I N9    1 
ATOM   6572  C  C8    . DG  I  5 28  ? -30.727 -27.261 4.464   1.00 112.79 ? -45  DG  I C8    1 
ATOM   6573  N  N7    . DG  I  5 28  ? -31.111 -27.214 3.218   1.00 113.20 ? -45  DG  I N7    1 
ATOM   6574  C  C5    . DG  I  5 28  ? -31.505 -28.517 2.944   1.00 113.01 ? -45  DG  I C5    1 
ATOM   6575  C  C6    . DG  I  5 28  ? -32.015 -29.078 1.748   1.00 112.82 ? -45  DG  I C6    1 
ATOM   6576  O  O6    . DG  I  5 28  ? -32.221 -28.509 0.668   1.00 112.77 ? -45  DG  I O6    1 
ATOM   6577  N  N1    . DG  I  5 28  ? -32.293 -30.439 1.886   1.00 112.82 ? -45  DG  I N1    1 
ATOM   6578  C  C2    . DG  I  5 28  ? -32.102 -31.166 3.038   1.00 112.77 ? -45  DG  I C2    1 
ATOM   6579  N  N2    . DG  I  5 28  ? -32.428 -32.463 2.978   1.00 112.75 ? -45  DG  I N2    1 
ATOM   6580  N  N3    . DG  I  5 28  ? -31.625 -30.652 4.167   1.00 113.06 ? -45  DG  I N3    1 
ATOM   6581  C  C4    . DG  I  5 28  ? -31.347 -29.326 4.050   1.00 112.89 ? -45  DG  I C4    1 
ATOM   6582  P  P     . DA  I  5 29  ? -27.737 -30.039 9.671   1.00 102.14 ? -44  DA  I P     1 
ATOM   6583  O  OP1   . DA  I  5 29  ? -28.248 -29.956 11.057  1.00 102.28 ? -44  DA  I OP1   1 
ATOM   6584  O  OP2   . DA  I  5 29  ? -26.597 -29.192 9.247   1.00 100.57 ? -44  DA  I OP2   1 
ATOM   6585  O  "O5'" . DA  I  5 29  ? -27.387 -31.561 9.318   1.00 100.75 ? -44  DA  I "O5'" 1 
ATOM   6586  C  "C5'" . DA  I  5 29  ? -28.368 -32.603 9.375   1.00 98.63  ? -44  DA  I "C5'" 1 
ATOM   6587  C  "C4'" . DA  I  5 29  ? -28.176 -33.570 8.219   1.00 97.76  ? -44  DA  I "C4'" 1 
ATOM   6588  O  "O4'" . DA  I  5 29  ? -28.629 -32.927 6.996   1.00 97.96  ? -44  DA  I "O4'" 1 
ATOM   6589  C  "C3'" . DA  I  5 29  ? -26.729 -34.019 7.969   1.00 96.97  ? -44  DA  I "C3'" 1 
ATOM   6590  O  "O3'" . DA  I  5 29  ? -26.592 -35.462 7.903   1.00 94.53  ? -44  DA  I "O3'" 1 
ATOM   6591  C  "C2'" . DA  I  5 29  ? -26.359 -33.329 6.652   1.00 97.75  ? -44  DA  I "C2'" 1 
ATOM   6592  C  "C1'" . DA  I  5 29  ? -27.708 -33.203 5.957   1.00 98.80  ? -44  DA  I "C1'" 1 
ATOM   6593  N  N9    . DA  I  5 29  ? -27.781 -32.128 4.967   1.00 99.29  ? -44  DA  I N9    1 
ATOM   6594  C  C8    . DA  I  5 29  ? -27.316 -30.851 5.115   1.00 99.54  ? -44  DA  I C8    1 
ATOM   6595  N  N7    . DA  I  5 29  ? -27.515 -30.085 4.072   1.00 99.74  ? -44  DA  I N7    1 
ATOM   6596  C  C5    . DA  I  5 29  ? -28.160 -30.912 3.172   1.00 99.52  ? -44  DA  I C5    1 
ATOM   6597  C  C6    . DA  I  5 29  ? -28.647 -30.692 1.869   1.00 99.36  ? -44  DA  I C6    1 
ATOM   6598  N  N6    . DA  I  5 29  ? -28.538 -29.519 1.240   1.00 99.32  ? -44  DA  I N6    1 
ATOM   6599  N  N1    . DA  I  5 29  ? -29.241 -31.726 1.234   1.00 99.54  ? -44  DA  I N1    1 
ATOM   6600  C  C2    . DA  I  5 29  ? -29.343 -32.906 1.865   1.00 99.50  ? -44  DA  I C2    1 
ATOM   6601  N  N3    . DA  I  5 29  ? -28.924 -33.230 3.091   1.00 99.82  ? -44  DA  I N3    1 
ATOM   6602  C  C4    . DA  I  5 29  ? -28.334 -32.180 3.702   1.00 99.65  ? -44  DA  I C4    1 
ATOM   6603  P  P     . DA  I  5 30  ? -25.159 -36.177 7.750   1.00 92.05  ? -43  DA  I P     1 
ATOM   6604  O  OP1   . DA  I  5 30  ? -25.091 -37.231 8.781   1.00 92.01  ? -43  DA  I OP1   1 
ATOM   6605  O  OP2   . DA  I  5 30  ? -24.084 -35.167 7.601   1.00 90.77  ? -43  DA  I OP2   1 
ATOM   6606  O  "O5'" . DA  I  5 30  ? -25.243 -36.886 6.337   1.00 94.55  ? -43  DA  I "O5'" 1 
ATOM   6607  C  "C5'" . DA  I  5 30  ? -26.419 -37.525 5.865   1.00 97.76  ? -43  DA  I "C5'" 1 
ATOM   6608  C  "C4'" . DA  I  5 30  ? -26.303 -37.620 4.360   1.00 99.91  ? -43  DA  I "C4'" 1 
ATOM   6609  O  "O4'" . DA  I  5 30  ? -26.581 -36.306 3.830   1.00 100.18 ? -43  DA  I "O4'" 1 
ATOM   6610  C  "C3'" . DA  I  5 30  ? -24.904 -38.006 3.866   1.00 101.68 ? -43  DA  I "C3'" 1 
ATOM   6611  O  "O3'" . DA  I  5 30  ? -24.976 -39.103 2.963   1.00 104.30 ? -43  DA  I "O3'" 1 
ATOM   6612  C  "C2'" . DA  I  5 30  ? -24.378 -36.748 3.181   1.00 101.33 ? -43  DA  I "C2'" 1 
ATOM   6613  C  "C1'" . DA  I  5 30  ? -25.682 -36.084 2.772   1.00 102.08 ? -43  DA  I "C1'" 1 
ATOM   6614  N  N9    . DA  I  5 30  ? -25.546 -34.655 2.571   1.00 102.66 ? -43  DA  I N9    1 
ATOM   6615  C  C8    . DA  I  5 30  ? -25.010 -33.745 3.439   1.00 102.97 ? -43  DA  I C8    1 
ATOM   6616  N  N7    . DA  I  5 30  ? -25.012 -32.516 2.986   1.00 103.15 ? -43  DA  I N7    1 
ATOM   6617  C  C5    . DA  I  5 30  ? -25.584 -32.634 1.729   1.00 103.37 ? -43  DA  I C5    1 
ATOM   6618  C  C6    . DA  I  5 30  ? -25.871 -31.689 0.725   1.00 102.96 ? -43  DA  I C6    1 
ATOM   6619  N  N6    . DA  I  5 30  ? -25.597 -30.387 0.860   1.00 102.70 ? -43  DA  I N6    1 
ATOM   6620  N  N1    . DA  I  5 30  ? -26.453 -32.138 -0.414  1.00 103.09 ? -43  DA  I N1    1 
ATOM   6621  C  C2    . DA  I  5 30  ? -26.728 -33.446 -0.549  1.00 102.79 ? -43  DA  I C2    1 
ATOM   6622  N  N3    . DA  I  5 30  ? -26.502 -34.427 0.326   1.00 103.07 ? -43  DA  I N3    1 
ATOM   6623  C  C4    . DA  I  5 30  ? -25.924 -33.950 1.453   1.00 103.36 ? -43  DA  I C4    1 
ATOM   6624  P  P     . DA  I  5 31  ? -23.677 -39.938 2.524   1.00 106.67 ? -42  DA  I P     1 
ATOM   6625  O  OP1   . DA  I  5 31  ? -24.047 -41.373 2.547   1.00 107.16 ? -42  DA  I OP1   1 
ATOM   6626  O  OP2   . DA  I  5 31  ? -22.487 -39.455 3.263   1.00 106.41 ? -42  DA  I OP2   1 
ATOM   6627  O  "O5'" . DA  I  5 31  ? -23.485 -39.516 0.997   1.00 109.57 ? -42  DA  I "O5'" 1 
ATOM   6628  C  "C5'" . DA  I  5 31  ? -24.525 -39.707 0.033   1.00 112.86 ? -42  DA  I "C5'" 1 
ATOM   6629  C  "C4'" . DA  I  5 31  ? -24.080 -39.188 -1.325  1.00 115.35 ? -42  DA  I "C4'" 1 
ATOM   6630  O  "O4'" . DA  I  5 31  ? -24.145 -37.740 -1.344  1.00 115.32 ? -42  DA  I "O4'" 1 
ATOM   6631  C  "C3'" . DA  I  5 31  ? -22.659 -39.569 -1.740  1.00 117.22 ? -42  DA  I "C3'" 1 
ATOM   6632  O  "O3'" . DA  I  5 31  ? -22.704 -40.063 -3.094  1.00 120.64 ? -42  DA  I "O3'" 1 
ATOM   6633  C  "C2'" . DA  I  5 31  ? -21.856 -38.276 -1.537  1.00 116.43 ? -42  DA  I "C2'" 1 
ATOM   6634  C  "C1'" . DA  I  5 31  ? -22.906 -37.186 -1.735  1.00 115.89 ? -42  DA  I "C1'" 1 
ATOM   6635  N  N9    . DA  I  5 31  ? -22.756 -35.978 -0.927  1.00 116.04 ? -42  DA  I N9    1 
ATOM   6636  C  C8    . DA  I  5 31  ? -22.415 -35.884 0.397   1.00 116.32 ? -42  DA  I C8    1 
ATOM   6637  N  N7    . DA  I  5 31  ? -22.381 -34.656 0.864   1.00 116.17 ? -42  DA  I N7    1 
ATOM   6638  C  C5    . DA  I  5 31  ? -22.732 -33.884 -0.229  1.00 116.07 ? -42  DA  I C5    1 
ATOM   6639  C  C6    . DA  I  5 31  ? -22.883 -32.492 -0.407  1.00 115.82 ? -42  DA  I C6    1 
ATOM   6640  N  N6    . DA  I  5 31  ? -22.689 -31.596 0.556   1.00 115.99 ? -42  DA  I N6    1 
ATOM   6641  N  N1    . DA  I  5 31  ? -23.247 -32.046 -1.626  1.00 116.17 ? -42  DA  I N1    1 
ATOM   6642  C  C2    . DA  I  5 31  ? -23.444 -32.937 -2.611  1.00 116.39 ? -42  DA  I C2    1 
ATOM   6643  N  N3    . DA  I  5 31  ? -23.332 -34.269 -2.567  1.00 116.32 ? -42  DA  I N3    1 
ATOM   6644  C  C4    . DA  I  5 31  ? -22.972 -34.684 -1.339  1.00 116.20 ? -42  DA  I C4    1 
ATOM   6645  P  P     . DA  I  5 32  ? -21.423 -40.610 -3.897  1.00 123.31 ? -41  DA  I P     1 
ATOM   6646  O  OP1   . DA  I  5 32  ? -21.906 -41.472 -5.000  1.00 122.86 ? -41  DA  I OP1   1 
ATOM   6647  O  OP2   . DA  I  5 32  ? -20.405 -41.126 -2.948  1.00 122.80 ? -41  DA  I OP2   1 
ATOM   6648  O  "O5'" . DA  I  5 32  ? -20.850 -39.255 -4.515  1.00 126.08 ? -41  DA  I "O5'" 1 
ATOM   6649  C  "C5'" . DA  I  5 32  ? -21.673 -38.382 -5.284  1.00 130.74 ? -41  DA  I "C5'" 1 
ATOM   6650  C  "C4'" . DA  I  5 32  ? -20.797 -37.351 -5.971  1.00 134.35 ? -41  DA  I "C4'" 1 
ATOM   6651  O  "O4'" . DA  I  5 32  ? -20.799 -36.115 -5.209  1.00 135.40 ? -41  DA  I "O4'" 1 
ATOM   6652  C  "C3'" . DA  I  5 32  ? -19.335 -37.771 -6.118  1.00 136.45 ? -41  DA  I "C3'" 1 
ATOM   6653  O  "O3'" . DA  I  5 32  ? -18.883 -37.423 -7.436  1.00 139.14 ? -41  DA  I "O3'" 1 
ATOM   6654  C  "C2'" . DA  I  5 32  ? -18.639 -37.029 -4.973  1.00 136.48 ? -41  DA  I "C2'" 1 
ATOM   6655  C  "C1'" . DA  I  5 32  ? -19.469 -35.752 -4.883  1.00 136.65 ? -41  DA  I "C1'" 1 
ATOM   6656  N  N9    . DA  I  5 32  ? -19.437 -35.106 -3.569  1.00 136.91 ? -41  DA  I N9    1 
ATOM   6657  C  C8    . DA  I  5 32  ? -19.466 -35.717 -2.343  1.00 137.03 ? -41  DA  I C8    1 
ATOM   6658  N  N7    . DA  I  5 32  ? -19.423 -34.884 -1.330  1.00 137.12 ? -41  DA  I N7    1 
ATOM   6659  C  C5    . DA  I  5 32  ? -19.361 -33.637 -1.929  1.00 137.13 ? -41  DA  I C5    1 
ATOM   6660  C  C6    . DA  I  5 32  ? -19.295 -32.328 -1.401  1.00 137.08 ? -41  DA  I C6    1 
ATOM   6661  N  N6    . DA  I  5 32  ? -19.282 -32.070 -0.090  1.00 137.00 ? -41  DA  I N6    1 
ATOM   6662  N  N1    . DA  I  5 32  ? -19.243 -31.294 -2.272  1.00 137.02 ? -41  DA  I N1    1 
ATOM   6663  C  C2    . DA  I  5 32  ? -19.257 -31.557 -3.588  1.00 136.97 ? -41  DA  I C2    1 
ATOM   6664  N  N3    . DA  I  5 32  ? -19.317 -32.742 -4.200  1.00 137.02 ? -41  DA  I N3    1 
ATOM   6665  C  C4    . DA  I  5 32  ? -19.367 -33.753 -3.310  1.00 137.04 ? -41  DA  I C4    1 
ATOM   6666  P  P     . DA  I  5 33  ? -17.337 -37.353 -7.865  1.00 141.14 ? -40  DA  I P     1 
ATOM   6667  O  OP1   . DA  I  5 33  ? -17.288 -37.433 -9.344  1.00 141.18 ? -40  DA  I OP1   1 
ATOM   6668  O  OP2   . DA  I  5 33  ? -16.547 -38.312 -7.055  1.00 140.97 ? -40  DA  I OP2   1 
ATOM   6669  O  "O5'" . DA  I  5 33  ? -16.939 -35.869 -7.414  1.00 142.62 ? -40  DA  I "O5'" 1 
ATOM   6670  C  "C5'" . DA  I  5 33  ? -17.560 -34.716 -7.999  1.00 144.83 ? -40  DA  I "C5'" 1 
ATOM   6671  C  "C4'" . DA  I  5 33  ? -16.674 -33.497 -7.805  1.00 146.56 ? -40  DA  I "C4'" 1 
ATOM   6672  O  "O4'" . DA  I  5 33  ? -16.745 -33.055 -6.423  1.00 147.23 ? -40  DA  I "O4'" 1 
ATOM   6673  C  "C3'" . DA  I  5 33  ? -15.203 -33.762 -8.113  1.00 147.48 ? -40  DA  I "C3'" 1 
ATOM   6674  O  "O3'" . DA  I  5 33  ? -14.657 -32.743 -8.941  1.00 148.19 ? -40  DA  I "O3'" 1 
ATOM   6675  C  "C2'" . DA  I  5 33  ? -14.519 -33.810 -6.748  1.00 147.85 ? -40  DA  I "C2'" 1 
ATOM   6676  C  "C1'" . DA  I  5 33  ? -15.463 -33.042 -5.825  1.00 148.08 ? -40  DA  I "C1'" 1 
ATOM   6677  N  N9    . DA  I  5 33  ? -15.540 -33.620 -4.477  1.00 148.36 ? -40  DA  I N9    1 
ATOM   6678  C  C8    . DA  I  5 33  ? -15.451 -34.950 -4.154  1.00 148.40 ? -40  DA  I C8    1 
ATOM   6679  N  N7    . DA  I  5 33  ? -15.545 -35.203 -2.871  1.00 148.40 ? -40  DA  I N7    1 
ATOM   6680  C  C5    . DA  I  5 33  ? -15.707 -33.951 -2.306  1.00 148.37 ? -40  DA  I C5    1 
ATOM   6681  C  C6    . DA  I  5 33  ? -15.868 -33.538 -0.967  1.00 148.34 ? -40  DA  I C6    1 
ATOM   6682  N  N6    . DA  I  5 33  ? -15.888 -34.398 0.058   1.00 148.33 ? -40  DA  I N6    1 
ATOM   6683  N  N1    . DA  I  5 33  ? -16.004 -32.211 -0.728  1.00 148.39 ? -40  DA  I N1    1 
ATOM   6684  C  C2    . DA  I  5 33  ? -15.984 -31.357 -1.765  1.00 148.32 ? -40  DA  I C2    1 
ATOM   6685  N  N3    . DA  I  5 33  ? -15.840 -31.632 -3.064  1.00 148.39 ? -40  DA  I N3    1 
ATOM   6686  C  C4    . DA  I  5 33  ? -15.706 -32.958 -3.275  1.00 148.39 ? -40  DA  I C4    1 
ATOM   6687  P  P     . DG  I  5 34  ? -13.397 -33.061 -9.878  1.00 148.71 ? -39  DG  I P     1 
ATOM   6688  O  OP1   . DG  I  5 34  ? -13.816 -32.775 -11.272 1.00 148.47 ? -39  DG  I OP1   1 
ATOM   6689  O  OP2   . DG  I  5 34  ? -12.856 -34.399 -9.534  1.00 148.41 ? -39  DG  I OP2   1 
ATOM   6690  O  "O5'" . DG  I  5 34  ? -12.320 -31.975 -9.384  1.00 149.35 ? -39  DG  I "O5'" 1 
ATOM   6691  C  "C5'" . DG  I  5 34  ? -12.382 -30.606 -9.823  1.00 149.89 ? -39  DG  I "C5'" 1 
ATOM   6692  C  "C4'" . DG  I  5 34  ? -12.029 -29.634 -8.705  1.00 150.11 ? -39  DG  I "C4'" 1 
ATOM   6693  O  "O4'" . DG  I  5 34  ? -12.582 -30.104 -7.445  1.00 150.38 ? -39  DG  I "O4'" 1 
ATOM   6694  C  "C3'" . DG  I  5 34  ? -10.536 -29.396 -8.457  1.00 150.12 ? -39  DG  I "C3'" 1 
ATOM   6695  O  "O3'" . DG  I  5 34  ? -10.311 -27.970 -8.360  1.00 149.92 ? -39  DG  I "O3'" 1 
ATOM   6696  C  "C2'" . DG  I  5 34  ? -10.280 -30.166 -7.158  1.00 150.31 ? -39  DG  I "C2'" 1 
ATOM   6697  C  "C1'" . DG  I  5 34  ? -11.604 -29.943 -6.438  1.00 150.71 ? -39  DG  I "C1'" 1 
ATOM   6698  N  N9    . DG  I  5 34  ? -11.894 -30.846 -5.318  1.00 150.91 ? -39  DG  I N9    1 
ATOM   6699  C  C8    . DG  I  5 34  ? -12.000 -32.219 -5.350  1.00 150.88 ? -39  DG  I C8    1 
ATOM   6700  N  N7    . DG  I  5 34  ? -12.274 -32.758 -4.192  1.00 150.86 ? -39  DG  I N7    1 
ATOM   6701  C  C5    . DG  I  5 34  ? -12.352 -31.672 -3.327  1.00 151.03 ? -39  DG  I C5    1 
ATOM   6702  C  C6    . DG  I  5 34  ? -12.619 -31.627 -1.934  1.00 150.93 ? -39  DG  I C6    1 
ATOM   6703  O  O6    . DG  I  5 34  ? -12.848 -32.577 -1.173  1.00 150.85 ? -39  DG  I O6    1 
ATOM   6704  N  N1    . DG  I  5 34  ? -12.609 -30.320 -1.436  1.00 150.92 ? -39  DG  I N1    1 
ATOM   6705  C  C2    . DG  I  5 34  ? -12.365 -29.194 -2.194  1.00 150.78 ? -39  DG  I C2    1 
ATOM   6706  N  N2    . DG  I  5 34  ? -12.391 -28.016 -1.556  1.00 150.77 ? -39  DG  I N2    1 
ATOM   6707  N  N3    . DG  I  5 34  ? -12.114 -29.223 -3.497  1.00 150.91 ? -39  DG  I N3    1 
ATOM   6708  C  C4    . DG  I  5 34  ? -12.122 -30.488 -4.002  1.00 151.06 ? -39  DG  I C4    1 
ATOM   6709  P  P     . DT  I  5 35  ? -9.025  -27.270 -7.668  1.00 149.86 ? -38  DT  I P     1 
ATOM   6710  O  OP1   . DT  I  5 35  ? -8.916  -25.904 -8.235  1.00 149.66 ? -38  DT  I OP1   1 
ATOM   6711  O  OP2   . DT  I  5 35  ? -7.846  -28.176 -7.730  1.00 149.97 ? -38  DT  I OP2   1 
ATOM   6712  O  "O5'" . DT  I  5 35  ? -9.462  -27.184 -6.119  1.00 149.32 ? -38  DT  I "O5'" 1 
ATOM   6713  C  "C5'" . DT  I  5 35  ? -9.626  -25.913 -5.461  1.00 148.00 ? -38  DT  I "C5'" 1 
ATOM   6714  C  "C4'" . DT  I  5 35  ? -8.811  -25.885 -4.174  1.00 146.88 ? -38  DT  I "C4'" 1 
ATOM   6715  O  "O4'" . DT  I  5 35  ? -9.143  -27.039 -3.350  1.00 146.67 ? -38  DT  I "O4'" 1 
ATOM   6716  C  "C3'" . DT  I  5 35  ? -7.299  -25.904 -4.389  1.00 145.98 ? -38  DT  I "C3'" 1 
ATOM   6717  O  "O3'" . DT  I  5 35  ? -6.768  -24.654 -3.925  1.00 144.65 ? -38  DT  I "O3'" 1 
ATOM   6718  C  "C2'" . DT  I  5 35  ? -6.806  -27.139 -3.626  1.00 146.01 ? -38  DT  I "C2'" 1 
ATOM   6719  C  "C1'" . DT  I  5 35  ? -7.973  -27.514 -2.712  1.00 146.21 ? -38  DT  I "C1'" 1 
ATOM   6720  N  N1    . DT  I  5 35  ? -8.132  -28.997 -2.457  1.00 146.26 ? -38  DT  I N1    1 
ATOM   6721  C  C2    . DT  I  5 35  ? -8.857  -29.445 -1.358  1.00 146.12 ? -38  DT  I C2    1 
ATOM   6722  O  O2    . DT  I  5 35  ? -9.397  -28.713 -0.544  1.00 145.98 ? -38  DT  I O2    1 
ATOM   6723  N  N3    . DT  I  5 35  ? -8.928  -30.815 -1.238  1.00 145.95 ? -38  DT  I N3    1 
ATOM   6724  C  C4    . DT  I  5 35  ? -8.366  -31.766 -2.080  1.00 146.01 ? -38  DT  I C4    1 
ATOM   6725  O  O4    . DT  I  5 35  ? -8.498  -32.969 -1.871  1.00 145.98 ? -38  DT  I O4    1 
ATOM   6726  C  C5    . DT  I  5 35  ? -7.623  -31.236 -3.206  1.00 146.07 ? -38  DT  I C5    1 
ATOM   6727  C  C7    . DT  I  5 35  ? -6.958  -32.144 -4.202  1.00 146.13 ? -38  DT  I C7    1 
ATOM   6728  C  C6    . DT  I  5 35  ? -7.547  -29.902 -3.335  1.00 146.21 ? -38  DT  I C6    1 
ATOM   6729  P  P     . DG  I  5 36  ? -5.235  -24.416 -3.499  1.00 143.76 ? -37  DG  I P     1 
ATOM   6730  O  OP1   . DG  I  5 36  ? -4.982  -22.957 -3.606  1.00 143.72 ? -37  DG  I OP1   1 
ATOM   6731  O  OP2   . DG  I  5 36  ? -4.349  -25.364 -4.222  1.00 143.31 ? -37  DG  I OP2   1 
ATOM   6732  O  "O5'" . DG  I  5 36  ? -5.256  -24.838 -1.949  1.00 142.31 ? -37  DG  I "O5'" 1 
ATOM   6733  C  "C5'" . DG  I  5 36  ? -5.693  -23.929 -0.930  1.00 139.40 ? -37  DG  I "C5'" 1 
ATOM   6734  C  "C4'" . DG  I  5 36  ? -5.122  -24.325 0.426   1.00 137.08 ? -37  DG  I "C4'" 1 
ATOM   6735  O  "O4'" . DG  I  5 36  ? -5.400  -25.721 0.707   1.00 136.66 ? -37  DG  I "O4'" 1 
ATOM   6736  C  "C3'" . DG  I  5 36  ? -3.611  -24.174 0.598   1.00 135.52 ? -37  DG  I "C3'" 1 
ATOM   6737  O  "O3'" . DG  I  5 36  ? -3.311  -23.862 1.956   1.00 133.12 ? -37  DG  I "O3'" 1 
ATOM   6738  C  "C2'" . DG  I  5 36  ? -3.097  -25.571 0.254   1.00 136.01 ? -37  DG  I "C2'" 1 
ATOM   6739  C  "C1'" . DG  I  5 36  ? -4.187  -26.426 0.899   1.00 136.50 ? -37  DG  I "C1'" 1 
ATOM   6740  N  N9    . DG  I  5 36  ? -4.407  -27.751 0.332   1.00 136.52 ? -37  DG  I N9    1 
ATOM   6741  C  C8    . DG  I  5 36  ? -4.059  -28.222 -0.912  1.00 136.60 ? -37  DG  I C8    1 
ATOM   6742  N  N7    . DG  I  5 36  ? -4.419  -29.459 -1.120  1.00 136.62 ? -37  DG  I N7    1 
ATOM   6743  C  C5    . DG  I  5 36  ? -5.053  -29.829 0.059   1.00 136.62 ? -37  DG  I C5    1 
ATOM   6744  C  C6    . DG  I  5 36  ? -5.661  -31.055 0.432   1.00 136.63 ? -37  DG  I C6    1 
ATOM   6745  O  O6    . DG  I  5 36  ? -5.754  -32.097 -0.231  1.00 136.60 ? -37  DG  I O6    1 
ATOM   6746  N  N1    . DG  I  5 36  ? -6.190  -31.006 1.723   1.00 136.58 ? -37  DG  I N1    1 
ATOM   6747  C  C2    . DG  I  5 36  ? -6.141  -29.907 2.549   1.00 136.58 ? -37  DG  I C2    1 
ATOM   6748  N  N2    . DG  I  5 36  ? -6.700  -30.042 3.758   1.00 136.52 ? -37  DG  I N2    1 
ATOM   6749  N  N3    . DG  I  5 36  ? -5.578  -28.754 2.208   1.00 136.69 ? -37  DG  I N3    1 
ATOM   6750  C  C4    . DG  I  5 36  ? -5.056  -28.786 0.957   1.00 136.56 ? -37  DG  I C4    1 
ATOM   6751  P  P     . DT  I  5 37  ? -3.481  -22.394 2.581   1.00 131.22 ? -36  DT  I P     1 
ATOM   6752  O  OP1   . DT  I  5 37  ? -4.647  -21.719 1.960   1.00 131.18 ? -36  DT  I OP1   1 
ATOM   6753  O  OP2   . DT  I  5 37  ? -2.143  -21.759 2.534   1.00 131.09 ? -36  DT  I OP2   1 
ATOM   6754  O  "O5'" . DT  I  5 37  ? -3.821  -22.655 4.130   1.00 129.36 ? -36  DT  I "O5'" 1 
ATOM   6755  C  "C5'" . DT  I  5 37  ? -4.694  -23.706 4.558   1.00 126.17 ? -36  DT  I "C5'" 1 
ATOM   6756  C  "C4'" . DT  I  5 37  ? -3.994  -24.685 5.493   1.00 123.94 ? -36  DT  I "C4'" 1 
ATOM   6757  O  "O4'" . DT  I  5 37  ? -3.806  -25.966 4.835   1.00 123.37 ? -36  DT  I "O4'" 1 
ATOM   6758  C  "C3'" . DT  I  5 37  ? -2.609  -24.283 6.001   1.00 122.57 ? -36  DT  I "C3'" 1 
ATOM   6759  O  "O3'" . DT  I  5 37  ? -2.512  -24.603 7.389   1.00 120.50 ? -36  DT  I "O3'" 1 
ATOM   6760  C  "C2'" . DT  I  5 37  ? -1.671  -25.151 5.162   1.00 122.61 ? -36  DT  I "C2'" 1 
ATOM   6761  C  "C1'" . DT  I  5 37  ? -2.503  -26.425 5.123   1.00 123.40 ? -36  DT  I "C1'" 1 
ATOM   6762  N  N1    . DT  I  5 37  ? -2.151  -27.458 4.105   1.00 123.63 ? -36  DT  I N1    1 
ATOM   6763  C  C2    . DT  I  5 37  ? -2.791  -28.683 4.175   1.00 123.99 ? -36  DT  I C2    1 
ATOM   6764  O  O2    . DT  I  5 37  ? -3.622  -28.968 5.023   1.00 124.14 ? -36  DT  I O2    1 
ATOM   6765  N  N3    . DT  I  5 37  ? -2.424  -29.582 3.205   1.00 124.21 ? -36  DT  I N3    1 
ATOM   6766  C  C4    . DT  I  5 37  ? -1.501  -29.388 2.192   1.00 124.10 ? -36  DT  I C4    1 
ATOM   6767  O  O4    . DT  I  5 37  ? -1.261  -30.278 1.382   1.00 124.12 ? -36  DT  I O4    1 
ATOM   6768  C  C5    . DT  I  5 37  ? -0.859  -28.085 2.171   1.00 124.18 ? -36  DT  I C5    1 
ATOM   6769  C  C7    . DT  I  5 37  ? 0.167   -27.732 1.126   1.00 123.94 ? -36  DT  I C7    1 
ATOM   6770  C  C6    . DT  I  5 37  ? -1.214  -27.197 3.118   1.00 123.98 ? -36  DT  I C6    1 
ATOM   6771  P  P     . DG  I  5 38  ? -2.816  -23.533 8.540   1.00 118.59 ? -35  DG  I P     1 
ATOM   6772  O  OP1   . DG  I  5 38  ? -4.071  -22.814 8.206   1.00 118.58 ? -35  DG  I OP1   1 
ATOM   6773  O  OP2   . DG  I  5 38  ? -1.557  -22.787 8.768   1.00 118.46 ? -35  DG  I OP2   1 
ATOM   6774  O  "O5'" . DG  I  5 38  ? -3.068  -24.455 9.831   1.00 117.35 ? -35  DG  I "O5'" 1 
ATOM   6775  C  "C5'" . DG  I  5 38  ? -4.327  -25.116 10.036  1.00 114.85 ? -35  DG  I "C5'" 1 
ATOM   6776  C  "C4'" . DG  I  5 38  ? -4.179  -26.558 10.516  1.00 112.81 ? -35  DG  I "C4'" 1 
ATOM   6777  O  "O4'" . DG  I  5 38  ? -3.541  -27.376 9.500   1.00 112.21 ? -35  DG  I "O4'" 1 
ATOM   6778  C  "C3'" . DG  I  5 38  ? -3.378  -26.790 11.799  1.00 111.94 ? -35  DG  I "C3'" 1 
ATOM   6779  O  "O3'" . DG  I  5 38  ? -4.067  -27.772 12.590  1.00 110.27 ? -35  DG  I "O3'" 1 
ATOM   6780  C  "C2'" . DG  I  5 38  ? -2.015  -27.268 11.296  1.00 111.88 ? -35  DG  I "C2'" 1 
ATOM   6781  C  "C1'" . DG  I  5 38  ? -2.384  -27.999 10.015  1.00 112.08 ? -35  DG  I "C1'" 1 
ATOM   6782  N  N9    . DG  I  5 38  ? -1.393  -27.897 8.959   1.00 112.13 ? -35  DG  I N9    1 
ATOM   6783  C  C8    . DG  I  5 38  ? -0.552  -26.844 8.673   1.00 112.37 ? -35  DG  I C8    1 
ATOM   6784  N  N7    . DG  I  5 38  ? 0.227   -27.048 7.644   1.00 112.19 ? -35  DG  I N7    1 
ATOM   6785  C  C5    . DG  I  5 38  ? -0.132  -28.320 7.218   1.00 112.32 ? -35  DG  I C5    1 
ATOM   6786  C  C6    . DG  I  5 38  ? 0.359   -29.089 6.137   1.00 112.10 ? -35  DG  I C6    1 
ATOM   6787  O  O6    . DG  I  5 38  ? 1.236   -28.780 5.322   1.00 112.12 ? -35  DG  I O6    1 
ATOM   6788  N  N1    . DG  I  5 38  ? -0.279  -30.328 6.049   1.00 112.29 ? -35  DG  I N1    1 
ATOM   6789  C  C2    . DG  I  5 38  ? -1.271  -30.764 6.906   1.00 112.40 ? -35  DG  I C2    1 
ATOM   6790  N  N2    . DG  I  5 38  ? -1.773  -31.985 6.676   1.00 112.42 ? -35  DG  I N2    1 
ATOM   6791  N  N3    . DG  I  5 38  ? -1.742  -30.055 7.925   1.00 112.29 ? -35  DG  I N3    1 
ATOM   6792  C  C4    . DG  I  5 38  ? -1.129  -28.850 8.015   1.00 112.22 ? -35  DG  I C4    1 
ATOM   6793  P  P     . DT  I  5 39  ? -3.524  -28.349 13.979  1.00 108.03 ? -34  DT  I P     1 
ATOM   6794  O  OP1   . DT  I  5 39  ? -4.685  -28.489 14.876  1.00 108.31 ? -34  DT  I OP1   1 
ATOM   6795  O  OP2   . DT  I  5 39  ? -2.353  -27.567 14.420  1.00 107.65 ? -34  DT  I OP2   1 
ATOM   6796  O  "O5'" . DT  I  5 39  ? -3.011  -29.810 13.573  1.00 110.28 ? -34  DT  I "O5'" 1 
ATOM   6797  C  "C5'" . DT  I  5 39  ? -3.786  -30.689 12.728  1.00 112.36 ? -34  DT  I "C5'" 1 
ATOM   6798  C  "C4'" . DT  I  5 39  ? -3.064  -32.003 12.419  1.00 113.52 ? -34  DT  I "C4'" 1 
ATOM   6799  O  "O4'" . DT  I  5 39  ? -2.108  -31.850 11.330  1.00 113.59 ? -34  DT  I "O4'" 1 
ATOM   6800  C  "C3'" . DT  I  5 39  ? -2.270  -32.602 13.578  1.00 114.47 ? -34  DT  I "C3'" 1 
ATOM   6801  O  "O3'" . DT  I  5 39  ? -2.305  -34.030 13.529  1.00 115.28 ? -34  DT  I "O3'" 1 
ATOM   6802  C  "C2'" . DT  I  5 39  ? -0.863  -32.066 13.324  1.00 114.30 ? -34  DT  I "C2'" 1 
ATOM   6803  C  "C1'" . DT  I  5 39  ? -0.811  -32.182 11.803  1.00 114.68 ? -34  DT  I "C1'" 1 
ATOM   6804  N  N1    . DT  I  5 39  ? 0.229   -31.321 11.138  1.00 115.17 ? -34  DT  I N1    1 
ATOM   6805  C  C2    . DT  I  5 39  ? 0.619   -31.640 9.851   1.00 115.10 ? -34  DT  I C2    1 
ATOM   6806  O  O2    . DT  I  5 39  ? 0.157   -32.583 9.229   1.00 115.18 ? -34  DT  I O2    1 
ATOM   6807  N  N3    . DT  I  5 39  ? 1.573   -30.804 9.317   1.00 115.02 ? -34  DT  I N3    1 
ATOM   6808  C  C4    . DT  I  5 39  ? 2.160   -29.706 9.931   1.00 115.01 ? -34  DT  I C4    1 
ATOM   6809  O  O4    . DT  I  5 39  ? 3.004   -29.023 9.356   1.00 115.11 ? -34  DT  I O4    1 
ATOM   6810  C  C5    . DT  I  5 39  ? 1.710   -29.425 11.279  1.00 115.06 ? -34  DT  I C5    1 
ATOM   6811  C  C7    . DT  I  5 39  ? 2.268   -28.266 12.058  1.00 114.94 ? -34  DT  I C7    1 
ATOM   6812  C  C6    . DT  I  5 39  ? 0.780   -30.235 11.808  1.00 115.17 ? -34  DT  I C6    1 
ATOM   6813  P  P     . DC  I  5 40  ? -1.870  -34.895 14.809  1.00 115.99 ? -33  DC  I P     1 
ATOM   6814  O  OP1   . DC  I  5 40  ? -3.082  -34.951 15.653  1.00 115.57 ? -33  DC  I OP1   1 
ATOM   6815  O  OP2   . DC  I  5 40  ? -0.597  -34.390 15.388  1.00 114.84 ? -33  DC  I OP2   1 
ATOM   6816  O  "O5'" . DC  I  5 40  ? -1.562  -36.345 14.190  1.00 117.96 ? -33  DC  I "O5'" 1 
ATOM   6817  C  "C5'" . DC  I  5 40  ? -1.397  -36.532 12.773  1.00 120.90 ? -33  DC  I "C5'" 1 
ATOM   6818  C  "C4'" . DC  I  5 40  ? 0.030   -36.892 12.361  1.00 122.94 ? -33  DC  I "C4'" 1 
ATOM   6819  O  "O4'" . DC  I  5 40  ? 0.747   -35.726 11.853  1.00 123.29 ? -33  DC  I "O4'" 1 
ATOM   6820  C  "C3'" . DC  I  5 40  ? 0.916   -37.495 13.452  1.00 124.19 ? -33  DC  I "C3'" 1 
ATOM   6821  O  "O3'" . DC  I  5 40  ? 1.526   -38.676 12.946  1.00 125.68 ? -33  DC  I "O3'" 1 
ATOM   6822  C  "C2'" . DC  I  5 40  ? 1.950   -36.402 13.719  1.00 124.18 ? -33  DC  I "C2'" 1 
ATOM   6823  C  "C1'" . DC  I  5 40  ? 2.078   -35.785 12.327  1.00 124.02 ? -33  DC  I "C1'" 1 
ATOM   6824  N  N1    . DC  I  5 40  ? 2.747   -34.424 12.257  1.00 124.29 ? -33  DC  I N1    1 
ATOM   6825  C  C2    . DC  I  5 40  ? 3.575   -34.097 11.162  1.00 124.29 ? -33  DC  I C2    1 
ATOM   6826  O  O2    . DC  I  5 40  ? 3.756   -34.913 10.251  1.00 124.32 ? -33  DC  I O2    1 
ATOM   6827  N  N3    . DC  I  5 40  ? 4.167   -32.874 11.120  1.00 124.32 ? -33  DC  I N3    1 
ATOM   6828  C  C4    . DC  I  5 40  ? 3.967   -31.991 12.101  1.00 124.29 ? -33  DC  I C4    1 
ATOM   6829  N  N4    . DC  I  5 40  ? 4.581   -30.807 12.005  1.00 124.14 ? -33  DC  I N4    1 
ATOM   6830  C  C5    . DC  I  5 40  ? 3.139   -32.296 13.227  1.00 124.49 ? -33  DC  I C5    1 
ATOM   6831  C  C6    . DC  I  5 40  ? 2.558   -33.506 13.260  1.00 124.55 ? -33  DC  I C6    1 
ATOM   6832  P  P     . DA  I  5 41  ? 1.793   -39.960 13.867  1.00 126.57 ? -32  DA  I P     1 
ATOM   6833  O  OP1   . DA  I  5 41  ? 0.578   -40.802 13.807  1.00 126.49 ? -32  DA  I OP1   1 
ATOM   6834  O  OP2   . DA  I  5 41  ? 2.318   -39.512 15.179  1.00 126.13 ? -32  DA  I OP2   1 
ATOM   6835  O  "O5'" . DA  I  5 41  ? 2.982   -40.707 13.093  1.00 127.62 ? -32  DA  I "O5'" 1 
ATOM   6836  C  "C5'" . DA  I  5 41  ? 3.267   -40.457 11.712  1.00 129.12 ? -32  DA  I "C5'" 1 
ATOM   6837  C  "C4'" . DA  I  5 41  ? 4.753   -40.227 11.454  1.00 130.49 ? -32  DA  I "C4'" 1 
ATOM   6838  O  "O4'" . DA  I  5 41  ? 5.051   -38.808 11.527  1.00 130.67 ? -32  DA  I "O4'" 1 
ATOM   6839  C  "C3'" . DA  I  5 41  ? 5.751   -40.907 12.395  1.00 131.46 ? -32  DA  I "C3'" 1 
ATOM   6840  O  "O3'" . DA  I  5 41  ? 6.842   -41.395 11.615  1.00 133.01 ? -32  DA  I "O3'" 1 
ATOM   6841  C  "C2'" . DA  I  5 41  ? 6.200   -39.775 13.319  1.00 131.03 ? -32  DA  I "C2'" 1 
ATOM   6842  C  "C1'" . DA  I  5 41  ? 6.189   -38.605 12.342  1.00 131.13 ? -32  DA  I "C1'" 1 
ATOM   6843  N  N9    . DA  I  5 41  ? 6.081   -37.278 12.948  1.00 131.36 ? -32  DA  I N9    1 
ATOM   6844  C  C8    . DA  I  5 41  ? 5.410   -36.932 14.091  1.00 131.39 ? -32  DA  I C8    1 
ATOM   6845  N  N7    . DA  I  5 41  ? 5.480   -35.658 14.389  1.00 131.26 ? -32  DA  I N7    1 
ATOM   6846  C  C5    . DA  I  5 41  ? 6.248   -35.126 13.369  1.00 131.33 ? -32  DA  I C5    1 
ATOM   6847  C  C6    . DA  I  5 41  ? 6.692   -33.815 13.100  1.00 131.40 ? -32  DA  I C6    1 
ATOM   6848  N  N6    . DA  I  5 41  ? 6.406   -32.771 13.886  1.00 131.41 ? -32  DA  I N6    1 
ATOM   6849  N  N1    . DA  I  5 41  ? 7.450   -33.620 11.996  1.00 131.47 ? -32  DA  I N1    1 
ATOM   6850  C  C2    . DA  I  5 41  ? 7.743   -34.668 11.210  1.00 131.22 ? -32  DA  I C2    1 
ATOM   6851  N  N3    . DA  I  5 41  ? 7.380   -35.941 11.362  1.00 131.15 ? -32  DA  I N3    1 
ATOM   6852  C  C4    . DA  I  5 41  ? 6.629   -36.107 12.469  1.00 131.34 ? -32  DA  I C4    1 
ATOM   6853  P  P     . DA  I  5 42  ? 7.804   -42.575 12.113  1.00 133.54 ? -31  DA  I P     1 
ATOM   6854  O  OP1   . DA  I  5 42  ? 7.312   -43.797 11.438  1.00 133.30 ? -31  DA  I OP1   1 
ATOM   6855  O  OP2   . DA  I  5 42  ? 7.904   -42.512 13.593  1.00 133.29 ? -31  DA  I OP2   1 
ATOM   6856  O  "O5'" . DA  I  5 42  ? 9.255   -42.207 11.534  1.00 134.46 ? -31  DA  I "O5'" 1 
ATOM   6857  C  "C5'" . DA  I  5 42  ? 9.470   -41.105 10.649  1.00 136.58 ? -31  DA  I "C5'" 1 
ATOM   6858  C  "C4'" . DA  I  5 42  ? 10.511  -40.123 11.171  1.00 138.18 ? -31  DA  I "C4'" 1 
ATOM   6859  O  "O4'" . DA  I  5 42  ? 9.871   -38.930 11.706  1.00 138.51 ? -31  DA  I "O4'" 1 
ATOM   6860  C  "C3'" . DA  I  5 42  ? 11.455  -40.609 12.273  1.00 139.22 ? -31  DA  I "C3'" 1 
ATOM   6861  O  "O3'" . DA  I  5 42  ? 12.778  -40.258 11.896  1.00 141.42 ? -31  DA  I "O3'" 1 
ATOM   6862  C  "C2'" . DA  I  5 42  ? 11.019  -39.797 13.489  1.00 138.74 ? -31  DA  I "C2'" 1 
ATOM   6863  C  "C1'" . DA  I  5 42  ? 10.677  -38.492 12.780  1.00 138.49 ? -31  DA  I "C1'" 1 
ATOM   6864  N  N9    . DA  I  5 42  ? 10.023  -37.459 13.594  1.00 138.49 ? -31  DA  I N9    1 
ATOM   6865  C  C8    . DA  I  5 42  ? 9.006   -37.617 14.498  1.00 138.43 ? -31  DA  I C8    1 
ATOM   6866  N  N7    . DA  I  5 42  ? 8.633   -36.503 15.082  1.00 138.44 ? -31  DA  I N7    1 
ATOM   6867  C  C5    . DA  I  5 42  ? 9.461   -35.538 14.531  1.00 138.54 ? -31  DA  I C5    1 
ATOM   6868  C  C6    . DA  I  5 42  ? 9.576   -34.139 14.726  1.00 138.46 ? -31  DA  I C6    1 
ATOM   6869  N  N6    . DA  I  5 42  ? 8.815   -33.445 15.580  1.00 138.45 ? -31  DA  I N6    1 
ATOM   6870  N  N1    . DA  I  5 42  ? 10.511  -33.471 14.014  1.00 138.29 ? -31  DA  I N1    1 
ATOM   6871  C  C2    . DA  I  5 42  ? 11.277  -34.157 13.156  1.00 138.41 ? -31  DA  I C2    1 
ATOM   6872  N  N3    . DA  I  5 42  ? 11.262  -35.466 12.888  1.00 138.54 ? -31  DA  I N3    1 
ATOM   6873  C  C4    . DA  I  5 42  ? 10.322  -36.111 13.608  1.00 138.52 ? -31  DA  I C4    1 
ATOM   6874  P  P     . DA  I  5 43  ? 14.046  -41.092 12.400  1.00 143.28 ? -30  DA  I P     1 
ATOM   6875  O  OP1   . DA  I  5 43  ? 14.369  -42.081 11.347  1.00 143.26 ? -30  DA  I OP1   1 
ATOM   6876  O  OP2   . DA  I  5 43  ? 13.796  -41.537 13.793  1.00 143.27 ? -30  DA  I OP2   1 
ATOM   6877  O  "O5'" . DA  I  5 43  ? 15.210  -39.996 12.457  1.00 144.53 ? -30  DA  I "O5'" 1 
ATOM   6878  C  "C5'" . DA  I  5 43  ? 15.541  -39.175 11.337  1.00 146.89 ? -30  DA  I "C5'" 1 
ATOM   6879  C  "C4'" . DA  I  5 43  ? 16.074  -37.835 11.818  1.00 148.85 ? -30  DA  I "C4'" 1 
ATOM   6880  O  "O4'" . DA  I  5 43  ? 14.969  -37.058 12.356  1.00 149.67 ? -30  DA  I "O4'" 1 
ATOM   6881  C  "C3'" . DA  I  5 43  ? 17.139  -37.919 12.917  1.00 149.83 ? -30  DA  I "C3'" 1 
ATOM   6882  O  "O3'" . DA  I  5 43  ? 18.285  -37.103 12.616  1.00 150.70 ? -30  DA  I "O3'" 1 
ATOM   6883  C  "C2'" . DA  I  5 43  ? 16.397  -37.449 14.165  1.00 150.31 ? -30  DA  I "C2'" 1 
ATOM   6884  C  "C1'" . DA  I  5 43  ? 15.346  -36.503 13.601  1.00 150.72 ? -30  DA  I "C1'" 1 
ATOM   6885  N  N9    . DA  I  5 43  ? 14.198  -36.388 14.504  1.00 150.98 ? -30  DA  I N9    1 
ATOM   6886  C  C8    . DA  I  5 43  ? 13.320  -37.381 14.856  1.00 150.98 ? -30  DA  I C8    1 
ATOM   6887  N  N7    . DA  I  5 43  ? 12.392  -37.003 15.702  1.00 150.91 ? -30  DA  I N7    1 
ATOM   6888  C  C5    . DA  I  5 43  ? 12.682  -35.669 15.928  1.00 151.12 ? -30  DA  I C5    1 
ATOM   6889  C  C6    . DA  I  5 43  ? 12.066  -34.687 16.734  1.00 151.10 ? -30  DA  I C6    1 
ATOM   6890  N  N6    . DA  I  5 43  ? 10.986  -34.937 17.483  1.00 150.93 ? -30  DA  I N6    1 
ATOM   6891  N  N1    . DA  I  5 43  ? 12.604  -33.442 16.741  1.00 151.17 ? -30  DA  I N1    1 
ATOM   6892  C  C2    . DA  I  5 43  ? 13.691  -33.198 15.988  1.00 151.04 ? -30  DA  I C2    1 
ATOM   6893  N  N3    . DA  I  5 43  ? 14.356  -34.040 15.191  1.00 151.03 ? -30  DA  I N3    1 
ATOM   6894  C  C4    . DA  I  5 43  ? 13.795  -35.269 15.202  1.00 151.14 ? -30  DA  I C4    1 
ATOM   6895  P  P     . DC  I  5 44  ? 19.364  -36.654 13.727  1.00 151.46 ? -29  DC  I P     1 
ATOM   6896  O  OP1   . DC  I  5 44  ? 20.657  -36.441 13.029  1.00 151.50 ? -29  DC  I OP1   1 
ATOM   6897  O  OP2   . DC  I  5 44  ? 19.315  -37.588 14.880  1.00 151.13 ? -29  DC  I OP2   1 
ATOM   6898  O  "O5'" . DC  I  5 44  ? 18.773  -35.240 14.198  1.00 151.19 ? -29  DC  I "O5'" 1 
ATOM   6899  C  "C5'" . DC  I  5 44  ? 19.496  -34.017 14.013  1.00 150.81 ? -29  DC  I "C5'" 1 
ATOM   6900  C  "C4'" . DC  I  5 44  ? 19.589  -33.266 15.329  1.00 150.45 ? -29  DC  I "C4'" 1 
ATOM   6901  O  "O4'" . DC  I  5 44  ? 18.292  -33.297 15.981  1.00 150.73 ? -29  DC  I "O4'" 1 
ATOM   6902  C  "C3'" . DC  I  5 44  ? 20.589  -33.861 16.319  1.00 150.26 ? -29  DC  I "C3'" 1 
ATOM   6903  O  "O3'" . DC  I  5 44  ? 21.474  -32.818 16.794  1.00 149.71 ? -29  DC  I "O3'" 1 
ATOM   6904  C  "C2'" . DC  I  5 44  ? 19.711  -34.555 17.369  1.00 150.45 ? -29  DC  I "C2'" 1 
ATOM   6905  C  "C1'" . DC  I  5 44  ? 18.425  -33.730 17.324  1.00 150.71 ? -29  DC  I "C1'" 1 
ATOM   6906  N  N1    . DC  I  5 44  ? 17.151  -34.431 17.780  1.00 150.81 ? -29  DC  I N1    1 
ATOM   6907  C  C2    . DC  I  5 44  ? 16.328  -33.847 18.772  1.00 150.71 ? -29  DC  I C2    1 
ATOM   6908  O  O2    . DC  I  5 44  ? 16.639  -32.761 19.283  1.00 150.50 ? -29  DC  I O2    1 
ATOM   6909  N  N3    . DC  I  5 44  ? 15.195  -34.497 19.157  1.00 150.48 ? -29  DC  I N3    1 
ATOM   6910  C  C4    . DC  I  5 44  ? 14.869  -35.668 18.601  1.00 150.48 ? -29  DC  I C4    1 
ATOM   6911  N  N4    . DC  I  5 44  ? 13.748  -36.263 19.014  1.00 150.50 ? -29  DC  I N4    1 
ATOM   6912  C  C5    . DC  I  5 44  ? 15.684  -36.282 17.600  1.00 150.53 ? -29  DC  I C5    1 
ATOM   6913  C  C6    . DC  I  5 44  ? 16.796  -35.634 17.222  1.00 150.73 ? -29  DC  I C6    1 
ATOM   6914  P  P     . DT  I  5 45  ? 21.477  -32.138 18.253  1.00 149.33 ? -28  DT  I P     1 
ATOM   6915  O  OP1   . DT  I  5 45  ? 22.726  -31.347 18.376  1.00 149.42 ? -28  DT  I OP1   1 
ATOM   6916  O  OP2   . DT  I  5 45  ? 21.209  -33.191 19.256  1.00 149.44 ? -28  DT  I OP2   1 
ATOM   6917  O  "O5'" . DT  I  5 45  ? 20.227  -31.130 18.217  1.00 148.50 ? -28  DT  I "O5'" 1 
ATOM   6918  C  "C5'" . DT  I  5 45  ? 20.320  -29.800 18.756  1.00 147.03 ? -28  DT  I "C5'" 1 
ATOM   6919  C  "C4'" . DT  I  5 45  ? 19.986  -29.741 20.245  1.00 145.91 ? -28  DT  I "C4'" 1 
ATOM   6920  O  "O4'" . DT  I  5 45  ? 18.924  -30.677 20.573  1.00 145.81 ? -28  DT  I "O4'" 1 
ATOM   6921  C  "C3'" . DT  I  5 45  ? 21.132  -30.055 21.213  1.00 144.68 ? -28  DT  I "C3'" 1 
ATOM   6922  O  "O3'" . DT  I  5 45  ? 21.190  -29.060 22.231  1.00 142.40 ? -28  DT  I "O3'" 1 
ATOM   6923  C  "C2'" . DT  I  5 45  ? 20.766  -31.415 21.804  1.00 144.94 ? -28  DT  I "C2'" 1 
ATOM   6924  C  "C1'" . DT  I  5 45  ? 19.246  -31.299 21.802  1.00 145.40 ? -28  DT  I "C1'" 1 
ATOM   6925  N  N1    . DT  I  5 45  ? 18.464  -32.569 21.894  1.00 145.50 ? -28  DT  I N1    1 
ATOM   6926  C  C2    . DT  I  5 45  ? 17.260  -32.527 22.565  1.00 145.41 ? -28  DT  I C2    1 
ATOM   6927  O  O2    . DT  I  5 45  ? 16.830  -31.513 23.091  1.00 145.22 ? -28  DT  I O2    1 
ATOM   6928  N  N3    . DT  I  5 45  ? 16.586  -33.727 22.607  1.00 145.28 ? -28  DT  I N3    1 
ATOM   6929  C  C4    . DT  I  5 45  ? 16.986  -34.932 22.050  1.00 145.26 ? -28  DT  I C4    1 
ATOM   6930  O  O4    . DT  I  5 45  ? 16.305  -35.948 22.145  1.00 145.28 ? -28  DT  I O4    1 
ATOM   6931  C  C5    . DT  I  5 45  ? 18.256  -34.903 21.359  1.00 145.37 ? -28  DT  I C5    1 
ATOM   6932  C  C7    . DT  I  5 45  ? 18.805  -36.142 20.714  1.00 145.38 ? -28  DT  I C7    1 
ATOM   6933  C  C6    . DT  I  5 45  ? 18.924  -33.740 21.312  1.00 145.49 ? -28  DT  I C6    1 
ATOM   6934  P  P     . DG  I  5 46  ? 22.385  -28.002 22.206  1.00 140.90 ? -27  DG  I P     1 
ATOM   6935  O  OP1   . DG  I  5 46  ? 22.185  -27.146 21.011  1.00 140.82 ? -27  DG  I OP1   1 
ATOM   6936  O  OP2   . DG  I  5 46  ? 23.639  -28.772 22.387  1.00 140.65 ? -27  DG  I OP2   1 
ATOM   6937  O  "O5'" . DG  I  5 46  ? 22.180  -27.107 23.521  1.00 138.86 ? -27  DG  I "O5'" 1 
ATOM   6938  C  "C5'" . DG  I  5 46  ? 20.894  -26.608 23.900  1.00 135.26 ? -27  DG  I "C5'" 1 
ATOM   6939  C  "C4'" . DG  I  5 46  ? 20.434  -27.197 25.226  1.00 132.49 ? -27  DG  I "C4'" 1 
ATOM   6940  O  "O4'" . DG  I  5 46  ? 19.981  -28.559 25.025  1.00 131.98 ? -27  DG  I "O4'" 1 
ATOM   6941  C  "C3'" . DG  I  5 46  ? 21.483  -27.260 26.340  1.00 130.73 ? -27  DG  I "C3'" 1 
ATOM   6942  O  "O3'" . DG  I  5 46  ? 20.981  -26.662 27.541  1.00 128.47 ? -27  DG  I "O3'" 1 
ATOM   6943  C  "C2'" . DG  I  5 46  ? 21.717  -28.765 26.528  1.00 130.74 ? -27  DG  I "C2'" 1 
ATOM   6944  C  "C1'" . DG  I  5 46  ? 20.349  -29.325 26.150  1.00 131.23 ? -27  DG  I "C1'" 1 
ATOM   6945  N  N9    . DG  I  5 46  ? 20.264  -30.734 25.756  1.00 131.22 ? -27  DG  I N9    1 
ATOM   6946  C  C8    . DG  I  5 46  ? 21.256  -31.531 25.235  1.00 131.31 ? -27  DG  I C8    1 
ATOM   6947  N  N7    . DG  I  5 46  ? 20.872  -32.749 24.964  1.00 131.22 ? -27  DG  I N7    1 
ATOM   6948  C  C5    . DG  I  5 46  ? 19.531  -32.771 25.320  1.00 131.25 ? -27  DG  I C5    1 
ATOM   6949  C  C6    . DG  I  5 46  ? 18.578  -33.825 25.252  1.00 131.13 ? -27  DG  I C6    1 
ATOM   6950  O  O6    . DG  I  5 46  ? 18.735  -34.988 24.854  1.00 131.03 ? -27  DG  I O6    1 
ATOM   6951  N  N1    . DG  I  5 46  ? 17.323  -33.430 25.718  1.00 131.39 ? -27  DG  I N1    1 
ATOM   6952  C  C2    . DG  I  5 46  ? 17.020  -32.167 26.190  1.00 131.52 ? -27  DG  I C2    1 
ATOM   6953  N  N2    . DG  I  5 46  ? 15.754  -31.972 26.595  1.00 131.28 ? -27  DG  I N2    1 
ATOM   6954  N  N3    . DG  I  5 46  ? 17.905  -31.170 26.255  1.00 131.52 ? -27  DG  I N3    1 
ATOM   6955  C  C4    . DG  I  5 46  ? 19.139  -31.536 25.806  1.00 131.40 ? -27  DG  I C4    1 
ATOM   6956  P  P     . DC  I  5 47  ? 20.744  -25.086 27.769  1.00 126.59 ? -26  DC  I P     1 
ATOM   6957  O  OP1   . DC  I  5 47  ? 20.460  -24.428 26.469  1.00 126.33 ? -26  DC  I OP1   1 
ATOM   6958  O  OP2   . DC  I  5 47  ? 21.840  -24.587 28.630  1.00 126.10 ? -26  DC  I OP2   1 
ATOM   6959  O  "O5'" . DC  I  5 47  ? 19.435  -25.088 28.704  1.00 124.59 ? -26  DC  I "O5'" 1 
ATOM   6960  C  "C5'" . DC  I  5 47  ? 18.174  -24.504 28.324  1.00 121.10 ? -26  DC  I "C5'" 1 
ATOM   6961  C  "C4'" . DC  I  5 47  ? 16.998  -25.154 29.052  1.00 117.86 ? -26  DC  I "C4'" 1 
ATOM   6962  O  "O4'" . DC  I  5 47  ? 17.087  -26.592 28.900  1.00 117.36 ? -26  DC  I "O4'" 1 
ATOM   6963  C  "C3'" . DC  I  5 47  ? 16.868  -24.917 30.557  1.00 115.98 ? -26  DC  I "C3'" 1 
ATOM   6964  O  "O3'" . DC  I  5 47  ? 15.463  -24.839 30.883  1.00 113.50 ? -26  DC  I "O3'" 1 
ATOM   6965  C  "C2'" . DC  I  5 47  ? 17.563  -26.147 31.151  1.00 116.01 ? -26  DC  I "C2'" 1 
ATOM   6966  C  "C1'" . DC  I  5 47  ? 17.110  -27.226 30.168  1.00 117.36 ? -26  DC  I "C1'" 1 
ATOM   6967  N  N1    . DC  I  5 47  ? 17.939  -28.497 30.035  1.00 117.79 ? -26  DC  I N1    1 
ATOM   6968  C  C2    . DC  I  5 47  ? 17.347  -29.779 30.191  1.00 118.16 ? -26  DC  I C2    1 
ATOM   6969  O  O2    . DC  I  5 47  ? 16.140  -29.907 30.464  1.00 118.09 ? -26  DC  I O2    1 
ATOM   6970  N  N3    . DC  I  5 47  ? 18.128  -30.885 30.045  1.00 118.09 ? -26  DC  I N3    1 
ATOM   6971  C  C4    . DC  I  5 47  ? 19.427  -30.763 29.746  1.00 117.96 ? -26  DC  I C4    1 
ATOM   6972  N  N4    . DC  I  5 47  ? 20.150  -31.881 29.615  1.00 117.90 ? -26  DC  I N4    1 
ATOM   6973  C  C5    . DC  I  5 47  ? 20.043  -29.485 29.583  1.00 117.98 ? -26  DC  I C5    1 
ATOM   6974  C  C6    . DC  I  5 47  ? 19.270  -28.398 29.725  1.00 117.87 ? -26  DC  I C6    1 
ATOM   6975  P  P     . DG  I  5 48  ? 14.834  -24.233 32.248  1.00 111.45 ? -25  DG  I P     1 
ATOM   6976  O  OP1   . DG  I  5 48  ? 13.562  -23.573 31.874  1.00 110.83 ? -25  DG  I OP1   1 
ATOM   6977  O  OP2   . DG  I  5 48  ? 15.863  -23.455 32.986  1.00 110.19 ? -25  DG  I OP2   1 
ATOM   6978  O  "O5'" . DG  I  5 48  ? 14.467  -25.541 33.119  1.00 109.41 ? -25  DG  I "O5'" 1 
ATOM   6979  C  "C5'" . DG  I  5 48  ? 14.141  -26.817 32.511  1.00 106.22 ? -25  DG  I "C5'" 1 
ATOM   6980  C  "C4'" . DG  I  5 48  ? 14.231  -27.973 33.499  1.00 103.73 ? -25  DG  I "C4'" 1 
ATOM   6981  O  "O4'" . DG  I  5 48  ? 15.347  -28.842 33.152  1.00 104.12 ? -25  DG  I "O4'" 1 
ATOM   6982  C  "C3'" . DG  I  5 48  ? 14.426  -27.569 34.963  1.00 101.83 ? -25  DG  I "C3'" 1 
ATOM   6983  O  "O3'" . DG  I  5 48  ? 13.752  -28.437 35.894  1.00 97.48  ? -25  DG  I "O3'" 1 
ATOM   6984  C  "C2'" . DG  I  5 48  ? 15.936  -27.733 35.133  1.00 103.66 ? -25  DG  I "C2'" 1 
ATOM   6985  C  "C1'" . DG  I  5 48  ? 16.220  -28.966 34.268  1.00 105.58 ? -25  DG  I "C1'" 1 
ATOM   6986  N  N9    . DG  I  5 48  ? 17.630  -29.101 33.851  1.00 106.23 ? -25  DG  I N9    1 
ATOM   6987  C  C8    . DG  I  5 48  ? 18.579  -28.097 33.758  1.00 106.60 ? -25  DG  I C8    1 
ATOM   6988  N  N7    . DG  I  5 48  ? 19.759  -28.496 33.360  1.00 106.57 ? -25  DG  I N7    1 
ATOM   6989  C  C5    . DG  I  5 48  ? 19.594  -29.864 33.179  1.00 106.52 ? -25  DG  I C5    1 
ATOM   6990  C  C6    . DG  I  5 48  ? 20.533  -30.846 32.759  1.00 106.66 ? -25  DG  I C6    1 
ATOM   6991  O  O6    . DG  I  5 48  ? 21.725  -30.689 32.449  1.00 106.49 ? -25  DG  I O6    1 
ATOM   6992  N  N1    . DG  I  5 48  ? 19.969  -32.124 32.705  1.00 106.53 ? -25  DG  I N1    1 
ATOM   6993  C  C2    . DG  I  5 48  ? 18.657  -32.409 33.018  1.00 106.36 ? -25  DG  I C2    1 
ATOM   6994  N  N2    . DG  I  5 48  ? 18.292  -33.693 32.912  1.00 106.19 ? -25  DG  I N2    1 
ATOM   6995  N  N3    . DG  I  5 48  ? 17.767  -31.499 33.414  1.00 106.37 ? -25  DG  I N3    1 
ATOM   6996  C  C4    . DG  I  5 48  ? 18.297  -30.251 33.477  1.00 106.23 ? -25  DG  I C4    1 
ATOM   6997  P  P     . DC  I  5 49  ? 12.167  -28.545 36.144  1.00 93.14  ? -24  DC  I P     1 
ATOM   6998  O  OP1   . DC  I  5 49  ? 11.401  -28.282 34.895  1.00 91.15  ? -24  DC  I OP1   1 
ATOM   6999  O  OP2   . DC  I  5 49  ? 11.886  -27.830 37.410  1.00 92.66  ? -24  DC  I OP2   1 
ATOM   7000  O  "O5'" . DC  I  5 49  ? 12.061  -30.097 36.513  1.00 91.37  ? -24  DC  I "O5'" 1 
ATOM   7001  C  "C5'" . DC  I  5 49  ? 11.746  -31.088 35.530  1.00 87.52  ? -24  DC  I "C5'" 1 
ATOM   7002  C  "C4'" . DC  I  5 49  ? 12.299  -32.428 35.967  1.00 84.32  ? -24  DC  I "C4'" 1 
ATOM   7003  O  "O4'" . DC  I  5 49  ? 13.716  -32.389 35.710  1.00 84.12  ? -24  DC  I "O4'" 1 
ATOM   7004  C  "C3'" . DC  I  5 49  ? 12.137  -32.737 37.455  1.00 82.80  ? -24  DC  I "C3'" 1 
ATOM   7005  O  "O3'" . DC  I  5 49  ? 11.664  -34.068 37.655  1.00 78.74  ? -24  DC  I "O3'" 1 
ATOM   7006  C  "C2'" . DC  I  5 49  ? 13.537  -32.528 38.032  1.00 83.86  ? -24  DC  I "C2'" 1 
ATOM   7007  C  "C1'" . DC  I  5 49  ? 14.392  -32.902 36.833  1.00 85.53  ? -24  DC  I "C1'" 1 
ATOM   7008  N  N1    . DC  I  5 49  ? 15.758  -32.331 36.836  1.00 86.16  ? -24  DC  I N1    1 
ATOM   7009  C  C2    . DC  I  5 49  ? 16.797  -33.063 36.257  1.00 85.72  ? -24  DC  I C2    1 
ATOM   7010  O  O2    . DC  I  5 49  ? 16.561  -34.174 35.762  1.00 85.45  ? -24  DC  I O2    1 
ATOM   7011  N  N3    . DC  I  5 49  ? 18.039  -32.513 36.271  1.00 86.33  ? -24  DC  I N3    1 
ATOM   7012  C  C4    . DC  I  5 49  ? 18.256  -31.302 36.811  1.00 86.65  ? -24  DC  I C4    1 
ATOM   7013  N  N4    . DC  I  5 49  ? 19.497  -30.805 36.794  1.00 86.64  ? -24  DC  I N4    1 
ATOM   7014  C  C5    . DC  I  5 49  ? 17.209  -30.541 37.409  1.00 86.77  ? -24  DC  I C5    1 
ATOM   7015  C  C6    . DC  I  5 49  ? 15.987  -31.096 37.390  1.00 87.33  ? -24  DC  I C6    1 
ATOM   7016  P  P     . DT  I  5 50  ? 11.332  -34.629 39.117  1.00 76.76  ? -23  DT  I P     1 
ATOM   7017  O  OP1   . DT  I  5 50  ? 9.969   -35.196 39.124  1.00 75.63  ? -23  DT  I OP1   1 
ATOM   7018  O  OP2   . DT  I  5 50  ? 11.782  -33.706 40.171  1.00 75.09  ? -23  DT  I OP2   1 
ATOM   7019  O  "O5'" . DT  I  5 50  ? 12.351  -35.830 39.209  1.00 82.50  ? -23  DT  I "O5'" 1 
ATOM   7020  C  "C5'" . DT  I  5 50  ? 12.438  -36.857 38.236  1.00 87.86  ? -23  DT  I "C5'" 1 
ATOM   7021  C  "C4'" . DT  I  5 50  ? 13.700  -37.633 38.540  1.00 92.13  ? -23  DT  I "C4'" 1 
ATOM   7022  O  "O4'" . DT  I  5 50  ? 14.861  -36.789 38.335  1.00 93.07  ? -23  DT  I "O4'" 1 
ATOM   7023  C  "C3'" . DT  I  5 50  ? 13.770  -38.120 39.979  1.00 94.80  ? -23  DT  I "C3'" 1 
ATOM   7024  O  "O3'" . DT  I  5 50  ? 14.096  -39.491 39.903  1.00 99.20  ? -23  DT  I "O3'" 1 
ATOM   7025  C  "C2'" . DT  I  5 50  ? 14.845  -37.253 40.646  1.00 94.39  ? -23  DT  I "C2'" 1 
ATOM   7026  C  "C1'" . DT  I  5 50  ? 15.718  -36.911 39.445  1.00 95.05  ? -23  DT  I "C1'" 1 
ATOM   7027  N  N1    . DT  I  5 50  ? 16.533  -35.668 39.491  1.00 95.49  ? -23  DT  I N1    1 
ATOM   7028  C  C2    . DT  I  5 50  ? 17.690  -35.697 38.751  1.00 96.43  ? -23  DT  I C2    1 
ATOM   7029  O  O2    . DT  I  5 50  ? 18.023  -36.681 38.112  1.00 97.04  ? -23  DT  I O2    1 
ATOM   7030  N  N3    . DT  I  5 50  ? 18.447  -34.549 38.787  1.00 96.53  ? -23  DT  I N3    1 
ATOM   7031  C  C4    . DT  I  5 50  ? 18.153  -33.389 39.480  1.00 96.45  ? -23  DT  I C4    1 
ATOM   7032  O  O4    . DT  I  5 50  ? 18.901  -32.415 39.443  1.00 96.34  ? -23  DT  I O4    1 
ATOM   7033  C  C5    . DT  I  5 50  ? 16.917  -33.414 40.243  1.00 96.96  ? -23  DT  I C5    1 
ATOM   7034  C  C7    . DT  I  5 50  ? 16.504  -32.204 41.042  1.00 96.30  ? -23  DT  I C7    1 
ATOM   7035  C  C6    . DT  I  5 50  ? 16.170  -34.541 40.210  1.00 96.35  ? -23  DT  I C6    1 
ATOM   7036  P  P     . DA  I  5 51  ? 13.973  -40.454 41.168  1.00 101.93 ? -22  DA  I P     1 
ATOM   7037  O  OP1   . DA  I  5 51  ? 13.451  -41.748 40.668  1.00 102.25 ? -22  DA  I OP1   1 
ATOM   7038  O  OP2   . DA  I  5 51  ? 13.257  -39.738 42.254  1.00 101.84 ? -22  DA  I OP2   1 
ATOM   7039  O  "O5'" . DA  I  5 51  ? 15.508  -40.622 41.590  1.00 104.15 ? -22  DA  I "O5'" 1 
ATOM   7040  C  "C5'" . DA  I  5 51  ? 16.522  -40.668 40.587  1.00 108.88 ? -22  DA  I "C5'" 1 
ATOM   7041  C  "C4'" . DA  I  5 51  ? 17.892  -40.568 41.223  1.00 112.65 ? -22  DA  I "C4'" 1 
ATOM   7042  O  "O4'" . DA  I  5 51  ? 18.419  -39.231 41.061  1.00 113.05 ? -22  DA  I "O4'" 1 
ATOM   7043  C  "C3'" . DA  I  5 51  ? 17.901  -40.878 42.720  1.00 115.39 ? -22  DA  I "C3'" 1 
ATOM   7044  O  "O3'" . DA  I  5 51  ? 18.742  -42.022 42.920  1.00 119.13 ? -22  DA  I "O3'" 1 
ATOM   7045  C  "C2'" . DA  I  5 51  ? 18.408  -39.597 43.390  1.00 114.77 ? -22  DA  I "C2'" 1 
ATOM   7046  C  "C1'" . DA  I  5 51  ? 19.082  -38.850 42.247  1.00 114.46 ? -22  DA  I "C1'" 1 
ATOM   7047  N  N9    . DA  I  5 51  ? 18.979  -37.403 42.370  1.00 114.73 ? -22  DA  I N9    1 
ATOM   7048  C  C8    . DA  I  5 51  ? 17.886  -36.686 42.770  1.00 115.11 ? -22  DA  I C8    1 
ATOM   7049  N  N7    . DA  I  5 51  ? 18.077  -35.389 42.790  1.00 115.26 ? -22  DA  I N7    1 
ATOM   7050  C  C5    . DA  I  5 51  ? 19.385  -35.244 42.359  1.00 115.08 ? -22  DA  I C5    1 
ATOM   7051  C  C6    . DA  I  5 51  ? 20.203  -34.111 42.155  1.00 115.01 ? -22  DA  I C6    1 
ATOM   7052  N  N6    . DA  I  5 51  ? 19.794  -32.854 42.366  1.00 115.03 ? -22  DA  I N6    1 
ATOM   7053  N  N1    . DA  I  5 51  ? 21.464  -34.318 41.724  1.00 114.96 ? -22  DA  I N1    1 
ATOM   7054  C  C2    . DA  I  5 51  ? 21.881  -35.572 41.514  1.00 115.02 ? -22  DA  I C2    1 
ATOM   7055  N  N3    . DA  I  5 51  ? 21.204  -36.708 41.669  1.00 115.05 ? -22  DA  I N3    1 
ATOM   7056  C  C4    . DA  I  5 51  ? 19.954  -36.476 42.099  1.00 114.84 ? -22  DA  I C4    1 
ATOM   7057  P  P     . DT  I  5 52  ? 19.062  -42.665 44.353  1.00 121.80 ? -21  DT  I P     1 
ATOM   7058  O  OP1   . DT  I  5 52  ? 19.480  -44.061 44.101  1.00 122.33 ? -21  DT  I OP1   1 
ATOM   7059  O  OP2   . DT  I  5 52  ? 17.937  -42.401 45.280  1.00 121.55 ? -21  DT  I OP2   1 
ATOM   7060  O  "O5'" . DT  I  5 52  ? 20.346  -41.837 44.835  1.00 123.41 ? -21  DT  I "O5'" 1 
ATOM   7061  C  "C5'" . DT  I  5 52  ? 21.476  -41.675 43.965  1.00 126.12 ? -21  DT  I "C5'" 1 
ATOM   7062  C  "C4'" . DT  I  5 52  ? 22.615  -40.958 44.674  1.00 128.77 ? -21  DT  I "C4'" 1 
ATOM   7063  O  "O4'" . DT  I  5 52  ? 22.572  -39.531 44.392  1.00 129.49 ? -21  DT  I "O4'" 1 
ATOM   7064  C  "C3'" . DT  I  5 52  ? 22.640  -41.080 46.201  1.00 130.12 ? -21  DT  I "C3'" 1 
ATOM   7065  O  "O3'" . DT  I  5 52  ? 23.987  -41.215 46.638  1.00 131.52 ? -21  DT  I "O3'" 1 
ATOM   7066  C  "C2'" . DT  I  5 52  ? 22.057  -39.749 46.654  1.00 130.33 ? -21  DT  I "C2'" 1 
ATOM   7067  C  "C1'" . DT  I  5 52  ? 22.673  -38.822 45.613  1.00 130.73 ? -21  DT  I "C1'" 1 
ATOM   7068  N  N1    . DT  I  5 52  ? 21.975  -37.508 45.509  1.00 131.11 ? -21  DT  I N1    1 
ATOM   7069  C  C2    . DT  I  5 52  ? 22.681  -36.366 45.162  1.00 131.40 ? -21  DT  I C2    1 
ATOM   7070  O  O2    . DT  I  5 52  ? 23.878  -36.345 44.917  1.00 131.39 ? -21  DT  I O2    1 
ATOM   7071  N  N3    . DT  I  5 52  ? 21.912  -35.225 45.109  1.00 131.62 ? -21  DT  I N3    1 
ATOM   7072  C  C4    . DT  I  5 52  ? 20.551  -35.116 45.364  1.00 131.45 ? -21  DT  I C4    1 
ATOM   7073  O  O4    . DT  I  5 52  ? 19.959  -34.043 45.285  1.00 131.41 ? -21  DT  I O4    1 
ATOM   7074  C  C5    . DT  I  5 52  ? 19.881  -36.349 45.720  1.00 131.39 ? -21  DT  I C5    1 
ATOM   7075  C  C7    . DT  I  5 52  ? 18.412  -36.382 46.028  1.00 131.48 ? -21  DT  I C7    1 
ATOM   7076  C  C6    . DT  I  5 52  ? 20.615  -37.464 45.776  1.00 131.20 ? -21  DT  I C6    1 
ATOM   7077  P  P     . DC  I  5 53  ? 24.361  -41.593 48.147  1.00 132.16 ? -20  DC  I P     1 
ATOM   7078  O  OP1   . DC  I  5 53  ? 24.159  -43.055 48.283  1.00 132.32 ? -20  DC  I OP1   1 
ATOM   7079  O  OP2   . DC  I  5 53  ? 23.675  -40.671 49.081  1.00 132.00 ? -20  DC  I OP2   1 
ATOM   7080  O  "O5'" . DC  I  5 53  ? 25.930  -41.254 48.184  1.00 133.22 ? -20  DC  I "O5'" 1 
ATOM   7081  C  "C5'" . DC  I  5 53  ? 26.485  -40.170 47.426  1.00 134.29 ? -20  DC  I "C5'" 1 
ATOM   7082  C  "C4'" . DC  I  5 53  ? 26.874  -38.968 48.281  1.00 135.40 ? -20  DC  I "C4'" 1 
ATOM   7083  O  "O4'" . DC  I  5 53  ? 25.955  -37.878 48.008  1.00 135.85 ? -20  DC  I "O4'" 1 
ATOM   7084  C  "C3'" . DC  I  5 53  ? 26.894  -39.136 49.802  1.00 136.03 ? -20  DC  I "C3'" 1 
ATOM   7085  O  "O3'" . DC  I  5 53  ? 28.049  -38.494 50.351  1.00 137.11 ? -20  DC  I "O3'" 1 
ATOM   7086  C  "C2'" . DC  I  5 53  ? 25.614  -38.434 50.246  1.00 136.02 ? -20  DC  I "C2'" 1 
ATOM   7087  C  "C1'" . DC  I  5 53  ? 25.545  -37.297 49.230  1.00 136.47 ? -20  DC  I "C1'" 1 
ATOM   7088  N  N1    . DC  I  5 53  ? 24.194  -36.642 49.047  1.00 136.76 ? -20  DC  I N1    1 
ATOM   7089  C  C2    . DC  I  5 53  ? 24.116  -35.300 48.617  1.00 136.79 ? -20  DC  I C2    1 
ATOM   7090  O  O2    . DC  I  5 53  ? 25.148  -34.653 48.389  1.00 136.61 ? -20  DC  I O2    1 
ATOM   7091  N  N3    . DC  I  5 53  ? 22.890  -34.733 48.456  1.00 136.94 ? -20  DC  I N3    1 
ATOM   7092  C  C4    . DC  I  5 53  ? 21.779  -35.439 48.702  1.00 136.87 ? -20  DC  I C4    1 
ATOM   7093  N  N4    . DC  I  5 53  ? 20.600  -34.829 48.529  1.00 136.65 ? -20  DC  I N4    1 
ATOM   7094  C  C5    . DC  I  5 53  ? 21.833  -36.800 49.139  1.00 136.82 ? -20  DC  I C5    1 
ATOM   7095  C  C6    . DC  I  5 53  ? 23.045  -37.353 49.294  1.00 136.76 ? -20  DC  I C6    1 
ATOM   7096  P  P     . DA  I  5 54  ? 28.678  -38.941 51.762  1.00 137.77 ? -19  DA  I P     1 
ATOM   7097  O  OP1   . DA  I  5 54  ? 29.314  -40.260 51.548  1.00 137.80 ? -19  DA  I OP1   1 
ATOM   7098  O  OP2   . DA  I  5 54  ? 27.648  -38.785 52.819  1.00 137.35 ? -19  DA  I OP2   1 
ATOM   7099  O  "O5'" . DA  I  5 54  ? 29.835  -37.865 52.028  1.00 137.66 ? -19  DA  I "O5'" 1 
ATOM   7100  C  "C5'" . DA  I  5 54  ? 29.790  -36.556 51.449  1.00 137.78 ? -19  DA  I "C5'" 1 
ATOM   7101  C  "C4'" . DA  I  5 54  ? 29.265  -35.500 52.412  1.00 137.42 ? -19  DA  I "C4'" 1 
ATOM   7102  O  "O4'" . DA  I  5 54  ? 27.931  -35.100 51.995  1.00 137.74 ? -19  DA  I "O4'" 1 
ATOM   7103  C  "C3'" . DA  I  5 54  ? 29.165  -35.874 53.896  1.00 136.99 ? -19  DA  I "C3'" 1 
ATOM   7104  O  "O3'" . DA  I  5 54  ? 29.803  -34.840 54.649  1.00 135.94 ? -19  DA  I "O3'" 1 
ATOM   7105  C  "C2'" . DA  I  5 54  ? 27.657  -35.920 54.154  1.00 137.55 ? -19  DA  I "C2'" 1 
ATOM   7106  C  "C1'" . DA  I  5 54  ? 27.157  -34.874 53.158  1.00 138.11 ? -19  DA  I "C1'" 1 
ATOM   7107  N  N9    . DA  I  5 54  ? 25.731  -34.930 52.812  1.00 138.25 ? -19  DA  I N9    1 
ATOM   7108  C  C8    . DA  I  5 54  ? 24.932  -36.040 52.701  1.00 138.34 ? -19  DA  I C8    1 
ATOM   7109  N  N7    . DA  I  5 54  ? 23.690  -35.782 52.368  1.00 138.19 ? -19  DA  I N7    1 
ATOM   7110  C  C5    . DA  I  5 54  ? 23.667  -34.404 52.251  1.00 138.24 ? -19  DA  I C5    1 
ATOM   7111  C  C6    . DA  I  5 54  ? 22.639  -33.495 51.920  1.00 138.28 ? -19  DA  I C6    1 
ATOM   7112  N  N6    . DA  I  5 54  ? 21.388  -33.874 51.638  1.00 138.25 ? -19  DA  I N6    1 
ATOM   7113  N  N1    . DA  I  5 54  ? 22.946  -32.176 51.892  1.00 138.38 ? -19  DA  I N1    1 
ATOM   7114  C  C2    . DA  I  5 54  ? 24.201  -31.794 52.177  1.00 138.29 ? -19  DA  I C2    1 
ATOM   7115  N  N3    . DA  I  5 54  ? 25.250  -32.557 52.498  1.00 138.24 ? -19  DA  I N3    1 
ATOM   7116  C  C4    . DA  I  5 54  ? 24.915  -33.862 52.520  1.00 138.18 ? -19  DA  I C4    1 
ATOM   7117  P  P     . DA  I  5 55  ? 30.297  -34.999 56.173  1.00 134.87 ? -18  DA  I P     1 
ATOM   7118  O  OP1   . DA  I  5 55  ? 31.420  -35.966 56.175  1.00 134.64 ? -18  DA  I OP1   1 
ATOM   7119  O  OP2   . DA  I  5 55  ? 29.113  -35.235 57.040  1.00 134.43 ? -18  DA  I OP2   1 
ATOM   7120  O  "O5'" . DA  I  5 55  ? 30.863  -33.528 56.490  1.00 133.18 ? -18  DA  I "O5'" 1 
ATOM   7121  C  "C5'" . DA  I  5 55  ? 30.403  -32.384 55.751  1.00 130.68 ? -18  DA  I "C5'" 1 
ATOM   7122  C  "C4'" . DA  I  5 55  ? 29.278  -31.635 56.458  1.00 129.08 ? -18  DA  I "C4'" 1 
ATOM   7123  O  "O4'" . DA  I  5 55  ? 27.993  -31.890 55.844  1.00 128.51 ? -18  DA  I "O4'" 1 
ATOM   7124  C  "C3'" . DA  I  5 55  ? 29.091  -31.891 57.954  1.00 128.23 ? -18  DA  I "C3'" 1 
ATOM   7125  O  "O3'" . DA  I  5 55  ? 29.631  -30.735 58.613  1.00 128.04 ? -18  DA  I "O3'" 1 
ATOM   7126  C  "C2'" . DA  I  5 55  ? 27.584  -32.122 58.132  1.00 127.74 ? -18  DA  I "C2'" 1 
ATOM   7127  C  "C1'" . DA  I  5 55  ? 26.988  -31.649 56.810  1.00 127.14 ? -18  DA  I "C1'" 1 
ATOM   7128  N  N9    . DA  I  5 55  ? 25.781  -32.363 56.386  1.00 126.70 ? -18  DA  I N9    1 
ATOM   7129  C  C8    . DA  I  5 55  ? 25.627  -33.719 56.265  1.00 126.54 ? -18  DA  I C8    1 
ATOM   7130  N  N7    . DA  I  5 55  ? 24.444  -34.099 55.852  1.00 126.40 ? -18  DA  I N7    1 
ATOM   7131  C  C5    . DA  I  5 55  ? 23.768  -32.905 55.684  1.00 126.53 ? -18  DA  I C5    1 
ATOM   7132  C  C6    . DA  I  5 55  ? 22.456  -32.617 55.259  1.00 126.37 ? -18  DA  I C6    1 
ATOM   7133  N  N6    . DA  I  5 55  ? 21.584  -33.567 54.923  1.00 126.32 ? -18  DA  I N6    1 
ATOM   7134  N  N1    . DA  I  5 55  ? 22.081  -31.321 55.198  1.00 126.41 ? -18  DA  I N1    1 
ATOM   7135  C  C2    . DA  I  5 55  ? 22.971  -30.373 55.536  1.00 126.41 ? -18  DA  I C2    1 
ATOM   7136  N  N3    . DA  I  5 55  ? 24.231  -30.520 55.953  1.00 126.28 ? -18  DA  I N3    1 
ATOM   7137  C  C4    . DA  I  5 55  ? 24.574  -31.822 56.006  1.00 126.48 ? -18  DA  I C4    1 
ATOM   7138  P  P     . DA  I  5 56  ? 28.994  -29.973 59.872  1.00 127.53 ? -17  DA  I P     1 
ATOM   7139  O  OP1   . DA  I  5 56  ? 29.923  -28.857 60.193  1.00 127.37 ? -17  DA  I OP1   1 
ATOM   7140  O  OP2   . DA  I  5 56  ? 28.633  -30.962 60.926  1.00 126.70 ? -17  DA  I OP2   1 
ATOM   7141  O  "O5'" . DA  I  5 56  ? 27.649  -29.366 59.233  1.00 126.46 ? -17  DA  I "O5'" 1 
ATOM   7142  C  "C5'" . DA  I  5 56  ? 27.556  -27.984 58.841  1.00 123.88 ? -17  DA  I "C5'" 1 
ATOM   7143  C  "C4'" . DA  I  5 56  ? 26.231  -27.385 59.310  1.00 121.47 ? -17  DA  I "C4'" 1 
ATOM   7144  O  "O4'" . DA  I  5 56  ? 25.098  -28.200 58.900  1.00 121.29 ? -17  DA  I "O4'" 1 
ATOM   7145  C  "C3'" . DA  I  5 56  ? 26.047  -27.219 60.811  1.00 120.00 ? -17  DA  I "C3'" 1 
ATOM   7146  O  "O3'" . DA  I  5 56  ? 25.207  -26.106 60.959  1.00 118.23 ? -17  DA  I "O3'" 1 
ATOM   7147  C  "C2'" . DA  I  5 56  ? 25.338  -28.507 61.234  1.00 119.83 ? -17  DA  I "C2'" 1 
ATOM   7148  C  "C1'" . DA  I  5 56  ? 24.402  -28.693 60.039  1.00 120.02 ? -17  DA  I "C1'" 1 
ATOM   7149  N  N9    . DA  I  5 56  ? 23.967  -30.067 59.763  1.00 119.78 ? -17  DA  I N9    1 
ATOM   7150  C  C8    . DA  I  5 56  ? 24.627  -31.236 60.037  1.00 119.52 ? -17  DA  I C8    1 
ATOM   7151  N  N7    . DA  I  5 56  ? 23.976  -32.314 59.661  1.00 119.48 ? -17  DA  I N7    1 
ATOM   7152  C  C5    . DA  I  5 56  ? 22.810  -31.823 59.098  1.00 119.45 ? -17  DA  I C5    1 
ATOM   7153  C  C6    . DA  I  5 56  ? 21.691  -32.453 58.510  1.00 119.42 ? -17  DA  I C6    1 
ATOM   7154  N  N6    . DA  I  5 56  ? 21.565  -33.775 58.386  1.00 119.40 ? -17  DA  I N6    1 
ATOM   7155  N  N1    . DA  I  5 56  ? 20.696  -31.665 58.046  1.00 119.60 ? -17  DA  I N1    1 
ATOM   7156  C  C2    . DA  I  5 56  ? 20.807  -30.331 58.165  1.00 119.45 ? -17  DA  I C2    1 
ATOM   7157  N  N3    . DA  I  5 56  ? 21.806  -29.626 58.698  1.00 119.12 ? -17  DA  I N3    1 
ATOM   7158  C  C4    . DA  I  5 56  ? 22.787  -30.437 59.150  1.00 119.51 ? -17  DA  I C4    1 
ATOM   7159  P  P     . DG  I  5 57  ? 25.174  -25.232 62.297  1.00 117.09 ? -16  DG  I P     1 
ATOM   7160  O  OP1   . DG  I  5 57  ? 26.062  -24.055 62.031  1.00 117.23 ? -16  DG  I OP1   1 
ATOM   7161  O  OP2   . DG  I  5 57  ? 25.405  -26.117 63.484  1.00 116.66 ? -16  DG  I OP2   1 
ATOM   7162  O  "O5'" . DG  I  5 57  ? 23.631  -24.722 62.367  1.00 115.20 ? -16  DG  I "O5'" 1 
ATOM   7163  C  "C5'" . DG  I  5 57  ? 22.695  -25.026 61.302  1.00 111.03 ? -16  DG  I "C5'" 1 
ATOM   7164  C  "C4'" . DG  I  5 57  ? 21.481  -25.776 61.829  1.00 108.04 ? -16  DG  I "C4'" 1 
ATOM   7165  O  "O4'" . DG  I  5 57  ? 21.622  -27.209 61.642  1.00 107.36 ? -16  DG  I "O4'" 1 
ATOM   7166  C  "C3'" . DG  I  5 57  ? 21.177  -25.597 63.316  1.00 106.22 ? -16  DG  I "C3'" 1 
ATOM   7167  O  "O3'" . DG  I  5 57  ? 19.831  -25.184 63.414  1.00 104.57 ? -16  DG  I "O3'" 1 
ATOM   7168  C  "C2'" . DG  I  5 57  ? 21.385  -26.990 63.913  1.00 106.10 ? -16  DG  I "C2'" 1 
ATOM   7169  C  "C1'" . DG  I  5 57  ? 20.932  -27.813 62.715  1.00 106.14 ? -16  DG  I "C1'" 1 
ATOM   7170  N  N9    . DG  I  5 57  ? 21.168  -29.260 62.727  1.00 105.91 ? -16  DG  I N9    1 
ATOM   7171  C  C8    . DG  I  5 57  ? 22.157  -29.974 63.363  1.00 105.87 ? -16  DG  I C8    1 
ATOM   7172  N  N7    . DG  I  5 57  ? 22.077  -31.263 63.164  1.00 105.93 ? -16  DG  I N7    1 
ATOM   7173  C  C5    . DG  I  5 57  ? 20.965  -31.413 62.342  1.00 105.79 ? -16  DG  I C5    1 
ATOM   7174  C  C6    . DG  I  5 57  ? 20.375  -32.573 61.779  1.00 105.69 ? -16  DG  I C6    1 
ATOM   7175  O  O6    . DG  I  5 57  ? 20.733  -33.745 61.908  1.00 105.87 ? -16  DG  I O6    1 
ATOM   7176  N  N1    . DG  I  5 57  ? 19.256  -32.291 60.997  1.00 105.81 ? -16  DG  I N1    1 
ATOM   7177  C  C2    . DG  I  5 57  ? 18.762  -31.027 60.785  1.00 105.88 ? -16  DG  I C2    1 
ATOM   7178  N  N2    . DG  I  5 57  ? 17.675  -30.926 60.005  1.00 106.02 ? -16  DG  I N2    1 
ATOM   7179  N  N3    . DG  I  5 57  ? 19.306  -29.931 61.300  1.00 105.85 ? -16  DG  I N3    1 
ATOM   7180  C  C4    . DG  I  5 57  ? 20.398  -30.191 62.066  1.00 105.79 ? -16  DG  I C4    1 
ATOM   7181  P  P     . DG  I  5 58  ? 19.484  -23.635 63.560  1.00 102.81 ? -15  DG  I P     1 
ATOM   7182  O  OP1   . DG  I  5 58  ? 20.485  -22.869 62.780  1.00 102.82 ? -15  DG  I OP1   1 
ATOM   7183  O  OP2   . DG  I  5 58  ? 19.306  -23.404 65.012  1.00 102.98 ? -15  DG  I OP2   1 
ATOM   7184  O  "O5'" . DG  I  5 58  ? 18.053  -23.449 62.864  1.00 100.90 ? -15  DG  I "O5'" 1 
ATOM   7185  C  "C5'" . DG  I  5 58  ? 17.802  -23.862 61.510  1.00 97.83  ? -15  DG  I "C5'" 1 
ATOM   7186  C  "C4'" . DG  I  5 58  ? 16.484  -24.628 61.401  1.00 95.39  ? -15  DG  I "C4'" 1 
ATOM   7187  O  "O4'" . DG  I  5 58  ? 16.674  -26.024 61.776  1.00 95.33  ? -15  DG  I "O4'" 1 
ATOM   7188  C  "C3'" . DG  I  5 58  ? 15.351  -24.160 62.307  1.00 93.62  ? -15  DG  I "C3'" 1 
ATOM   7189  O  "O3'" . DG  I  5 58  ? 14.111  -24.463 61.652  1.00 90.95  ? -15  DG  I "O3'" 1 
ATOM   7190  C  "C2'" . DG  I  5 58  ? 15.609  -24.989 63.576  1.00 93.32  ? -15  DG  I "C2'" 1 
ATOM   7191  C  "C1'" . DG  I  5 58  ? 15.905  -26.341 62.931  1.00 93.20  ? -15  DG  I "C1'" 1 
ATOM   7192  N  N9    . DG  I  5 58  ? 16.596  -27.346 63.753  1.00 92.64  ? -15  DG  I N9    1 
ATOM   7193  C  C8    . DG  I  5 58  ? 17.445  -27.139 64.819  1.00 92.53  ? -15  DG  I C8    1 
ATOM   7194  N  N7    . DG  I  5 58  ? 17.909  -28.241 65.351  1.00 92.34  ? -15  DG  I N7    1 
ATOM   7195  C  C5    . DG  I  5 58  ? 17.332  -29.251 64.591  1.00 92.48  ? -15  DG  I C5    1 
ATOM   7196  C  C6    . DG  I  5 58  ? 17.457  -30.660 64.690  1.00 92.33  ? -15  DG  I C6    1 
ATOM   7197  O  O6    . DG  I  5 58  ? 18.125  -31.311 65.490  1.00 92.91  ? -15  DG  I O6    1 
ATOM   7198  N  N1    . DG  I  5 58  ? 16.712  -31.349 63.743  1.00 92.01  ? -15  DG  I N1    1 
ATOM   7199  C  C2    . DG  I  5 58  ? 15.933  -30.739 62.796  1.00 92.70  ? -15  DG  I C2    1 
ATOM   7200  N  N2    . DG  I  5 58  ? 15.293  -31.575 61.969  1.00 92.77  ? -15  DG  I N2    1 
ATOM   7201  N  N3    . DG  I  5 58  ? 15.795  -29.410 62.673  1.00 92.93  ? -15  DG  I N3    1 
ATOM   7202  C  C4    . DG  I  5 58  ? 16.521  -28.721 63.604  1.00 92.68  ? -15  DG  I C4    1 
ATOM   7203  P  P     . DG  I  5 59  ? 12.680  -24.206 62.342  1.00 89.80  ? -14  DG  I P     1 
ATOM   7204  O  OP1   . DG  I  5 59  ? 12.231  -22.898 61.817  1.00 90.18  ? -14  DG  I OP1   1 
ATOM   7205  O  OP2   . DG  I  5 59  ? 12.721  -24.451 63.822  1.00 87.42  ? -14  DG  I OP2   1 
ATOM   7206  O  "O5'" . DG  I  5 59  ? 11.713  -25.308 61.677  1.00 87.33  ? -14  DG  I "O5'" 1 
ATOM   7207  C  "C5'" . DG  I  5 59  ? 12.159  -26.578 61.159  1.00 81.99  ? -14  DG  I "C5'" 1 
ATOM   7208  C  "C4'" . DG  I  5 59  ? 11.743  -27.755 62.032  1.00 77.42  ? -14  DG  I "C4'" 1 
ATOM   7209  O  "O4'" . DG  I  5 59  ? 12.774  -28.041 63.018  1.00 76.66  ? -14  DG  I "O4'" 1 
ATOM   7210  C  "C3'" . DG  I  5 59  ? 10.429  -27.631 62.807  1.00 73.99  ? -14  DG  I "C3'" 1 
ATOM   7211  O  "O3'" . DG  I  5 59  ? 9.615   -28.718 62.380  1.00 68.72  ? -14  DG  I "O3'" 1 
ATOM   7212  C  "C2'" . DG  I  5 59  ? 10.858  -27.715 64.281  1.00 74.48  ? -14  DG  I "C2'" 1 
ATOM   7213  C  "C1'" . DG  I  5 59  ? 12.134  -28.541 64.166  1.00 76.13  ? -14  DG  I "C1'" 1 
ATOM   7214  N  N9    . DG  I  5 59  ? 13.074  -28.499 65.284  1.00 76.22  ? -14  DG  I N9    1 
ATOM   7215  C  C8    . DG  I  5 59  ? 13.490  -27.421 66.032  1.00 76.83  ? -14  DG  I C8    1 
ATOM   7216  N  N7    . DG  I  5 59  ? 14.356  -27.709 66.971  1.00 76.87  ? -14  DG  I N7    1 
ATOM   7217  C  C5    . DG  I  5 59  ? 14.520  -29.091 66.828  1.00 76.71  ? -14  DG  I C5    1 
ATOM   7218  C  C6    . DG  I  5 59  ? 15.326  -30.008 67.549  1.00 76.53  ? -14  DG  I C6    1 
ATOM   7219  O  O6    . DG  I  5 59  ? 16.089  -29.795 68.496  1.00 76.74  ? -14  DG  I O6    1 
ATOM   7220  N  N1    . DG  I  5 59  ? 15.202  -31.313 67.089  1.00 76.63  ? -14  DG  I N1    1 
ATOM   7221  C  C2    . DG  I  5 59  ? 14.402  -31.699 66.051  1.00 76.64  ? -14  DG  I C2    1 
ATOM   7222  N  N2    . DG  I  5 59  ? 14.432  -33.006 65.769  1.00 77.07  ? -14  DG  I N2    1 
ATOM   7223  N  N3    . DG  I  5 59  ? 13.636  -30.868 65.356  1.00 76.80  ? -14  DG  I N3    1 
ATOM   7224  C  C4    . DG  I  5 59  ? 13.743  -29.584 65.798  1.00 76.58  ? -14  DG  I C4    1 
ATOM   7225  P  P     . DA  I  5 60  ? 8.045   -28.898 62.672  1.00 64.46  ? -13  DA  I P     1 
ATOM   7226  O  OP1   . DA  I  5 60  ? 7.332   -28.673 61.384  1.00 63.76  ? -13  DA  I OP1   1 
ATOM   7227  O  OP2   . DA  I  5 60  ? 7.680   -28.293 63.984  1.00 61.43  ? -13  DA  I OP2   1 
ATOM   7228  O  "O5'" . DA  I  5 60  ? 7.944   -30.463 62.910  1.00 64.80  ? -13  DA  I "O5'" 1 
ATOM   7229  C  "C5'" . DA  I  5 60  ? 8.658   -31.399 62.103  1.00 63.66  ? -13  DA  I "C5'" 1 
ATOM   7230  C  "C4'" . DA  I  5 60  ? 8.747   -32.684 62.899  1.00 62.27  ? -13  DA  I "C4'" 1 
ATOM   7231  O  "O4'" . DA  I  5 60  ? 9.773   -32.554 63.911  1.00 63.16  ? -13  DA  I "O4'" 1 
ATOM   7232  C  "C3'" . DA  I  5 60  ? 7.464   -33.079 63.624  1.00 60.98  ? -13  DA  I "C3'" 1 
ATOM   7233  O  "O3'" . DA  I  5 60  ? 7.294   -34.439 63.335  1.00 59.18  ? -13  DA  I "O3'" 1 
ATOM   7234  C  "C2'" . DA  I  5 60  ? 7.720   -32.804 65.107  1.00 60.80  ? -13  DA  I "C2'" 1 
ATOM   7235  C  "C1'" . DA  I  5 60  ? 9.238   -32.856 65.190  1.00 63.45  ? -13  DA  I "C1'" 1 
ATOM   7236  N  N9    . DA  I  5 60  ? 9.871   -31.949 66.145  1.00 63.91  ? -13  DA  I N9    1 
ATOM   7237  C  C8    . DA  I  5 60  ? 9.640   -30.623 66.348  1.00 63.56  ? -13  DA  I C8    1 
ATOM   7238  N  N7    . DA  I  5 60  ? 10.389  -30.091 67.282  1.00 63.62  ? -13  DA  I N7    1 
ATOM   7239  C  C5    . DA  I  5 60  ? 11.175  -31.136 67.729  1.00 64.85  ? -13  DA  I C5    1 
ATOM   7240  C  C6    . DA  I  5 60  ? 12.189  -31.249 68.715  1.00 64.46  ? -13  DA  I C6    1 
ATOM   7241  N  N6    . DA  I  5 60  ? 12.629  -30.249 69.482  1.00 63.82  ? -13  DA  I N6    1 
ATOM   7242  N  N1    . DA  I  5 60  ? 12.756  -32.463 68.886  1.00 64.29  ? -13  DA  I N1    1 
ATOM   7243  C  C2    . DA  I  5 60  ? 12.359  -33.498 68.139  1.00 64.28  ? -13  DA  I C2    1 
ATOM   7244  N  N3    . DA  I  5 60  ? 11.431  -33.514 67.185  1.00 65.21  ? -13  DA  I N3    1 
ATOM   7245  C  C4    . DA  I  5 60  ? 10.869  -32.294 67.027  1.00 65.27  ? -13  DA  I C4    1 
ATOM   7246  P  P     . DA  I  5 61  ? 6.065   -35.331 63.832  1.00 59.16  ? -12  DA  I P     1 
ATOM   7247  O  OP1   . DA  I  5 61  ? 5.897   -36.319 62.740  1.00 59.71  ? -12  DA  I OP1   1 
ATOM   7248  O  OP2   . DA  I  5 61  ? 4.905   -34.569 64.356  1.00 58.13  ? -12  DA  I OP2   1 
ATOM   7249  O  "O5'" . DA  I  5 61  ? 6.661   -36.029 65.142  1.00 60.41  ? -12  DA  I "O5'" 1 
ATOM   7250  C  "C5'" . DA  I  5 61  ? 7.831   -36.840 65.101  1.00 63.21  ? -12  DA  I "C5'" 1 
ATOM   7251  C  "C4'" . DA  I  5 61  ? 8.130   -37.405 66.472  1.00 64.42  ? -12  DA  I "C4'" 1 
ATOM   7252  O  "O4'" . DA  I  5 61  ? 8.733   -36.402 67.326  1.00 64.36  ? -12  DA  I "O4'" 1 
ATOM   7253  C  "C3'" . DA  I  5 61  ? 6.923   -37.913 67.235  1.00 66.60  ? -12  DA  I "C3'" 1 
ATOM   7254  O  "O3'" . DA  I  5 61  ? 7.345   -39.162 67.777  1.00 71.29  ? -12  DA  I "O3'" 1 
ATOM   7255  C  "C2'" . DA  I  5 61  ? 6.661   -36.849 68.303  1.00 64.33  ? -12  DA  I "C2'" 1 
ATOM   7256  C  "C1'" . DA  I  5 61  ? 8.069   -36.356 68.565  1.00 64.89  ? -12  DA  I "C1'" 1 
ATOM   7257  N  N9    . DA  I  5 61  ? 8.188   -34.989 69.025  1.00 65.03  ? -12  DA  I N9    1 
ATOM   7258  C  C8    . DA  I  5 61  ? 7.389   -33.937 68.711  1.00 65.29  ? -12  DA  I C8    1 
ATOM   7259  N  N7    . DA  I  5 61  ? 7.754   -32.814 69.271  1.00 65.48  ? -12  DA  I N7    1 
ATOM   7260  C  C5    . DA  I  5 61  ? 8.875   -33.135 70.009  1.00 66.53  ? -12  DA  I C5    1 
ATOM   7261  C  C6    . DA  I  5 61  ? 9.739   -32.380 70.848  1.00 66.17  ? -12  DA  I C6    1 
ATOM   7262  N  N6    . DA  I  5 61  ? 9.602   -31.078 71.091  1.00 65.66  ? -12  DA  I N6    1 
ATOM   7263  N  N1    . DA  I  5 61  ? 10.769  -33.020 71.443  1.00 66.15  ? -12  DA  I N1    1 
ATOM   7264  C  C2    . DA  I  5 61  ? 10.926  -34.333 71.205  1.00 66.69  ? -12  DA  I C2    1 
ATOM   7265  N  N3    . DA  I  5 61  ? 10.180  -35.148 70.439  1.00 67.20  ? -12  DA  I N3    1 
ATOM   7266  C  C4    . DA  I  5 61  ? 9.159   -34.485 69.860  1.00 66.61  ? -12  DA  I C4    1 
ATOM   7267  P  P     . DA  I  5 62  ? 6.372   -40.314 68.323  1.00 73.30  ? -11  DA  I P     1 
ATOM   7268  O  OP1   . DA  I  5 62  ? 6.955   -41.550 67.741  1.00 72.85  ? -11  DA  I OP1   1 
ATOM   7269  O  OP2   . DA  I  5 62  ? 4.941   -39.976 68.115  1.00 74.02  ? -11  DA  I OP2   1 
ATOM   7270  O  "O5'" . DA  I  5 62  ? 6.589   -40.188 69.908  1.00 74.98  ? -11  DA  I "O5'" 1 
ATOM   7271  C  "C5'" . DA  I  5 62  ? 7.893   -40.270 70.462  1.00 78.24  ? -11  DA  I "C5'" 1 
ATOM   7272  C  "C4'" . DA  I  5 62  ? 7.894   -39.795 71.901  1.00 81.79  ? -11  DA  I "C4'" 1 
ATOM   7273  O  "O4'" . DA  I  5 62  ? 8.110   -38.359 71.900  1.00 81.87  ? -11  DA  I "O4'" 1 
ATOM   7274  C  "C3'" . DA  I  5 62  ? 6.624   -40.062 72.722  1.00 83.90  ? -11  DA  I "C3'" 1 
ATOM   7275  O  "O3'" . DA  I  5 62  ? 6.953   -40.601 74.011  1.00 87.50  ? -11  DA  I "O3'" 1 
ATOM   7276  C  "C2'" . DA  I  5 62  ? 6.034   -38.670 72.887  1.00 83.21  ? -11  DA  I "C2'" 1 
ATOM   7277  C  "C1'" . DA  I  5 62  ? 7.287   -37.798 72.895  1.00 82.66  ? -11  DA  I "C1'" 1 
ATOM   7278  N  N9    . DA  I  5 62  ? 7.006   -36.384 72.621  1.00 82.66  ? -11  DA  I N9    1 
ATOM   7279  C  C8    . DA  I  5 62  ? 6.089   -35.887 71.736  1.00 82.54  ? -11  DA  I C8    1 
ATOM   7280  N  N7    . DA  I  5 62  ? 6.022   -34.584 71.709  1.00 82.88  ? -11  DA  I N7    1 
ATOM   7281  C  C5    . DA  I  5 62  ? 6.961   -34.188 72.646  1.00 83.01  ? -11  DA  I C5    1 
ATOM   7282  C  C6    . DA  I  5 62  ? 7.378   -32.917 73.092  1.00 82.84  ? -11  DA  I C6    1 
ATOM   7283  N  N6    . DA  I  5 62  ? 6.886   -31.764 72.627  1.00 82.27  ? -11  DA  I N6    1 
ATOM   7284  N  N1    . DA  I  5 62  ? 8.336   -32.881 74.043  1.00 83.27  ? -11  DA  I N1    1 
ATOM   7285  C  C2    . DA  I  5 62  ? 8.844   -34.027 74.524  1.00 82.85  ? -11  DA  I C2    1 
ATOM   7286  N  N3    . DA  I  5 62  ? 8.531   -35.273 74.180  1.00 82.83  ? -11  DA  I N3    1 
ATOM   7287  C  C4    . DA  I  5 62  ? 7.580   -35.285 73.221  1.00 82.81  ? -11  DA  I C4    1 
ATOM   7288  P  P     . DC  I  5 63  ? 5.900   -41.340 74.989  1.00 89.81  ? -10  DC  I P     1 
ATOM   7289  O  OP1   . DC  I  5 63  ? 6.275   -42.768 74.871  1.00 91.11  ? -10  DC  I OP1   1 
ATOM   7290  O  OP2   . DC  I  5 63  ? 4.494   -40.947 74.702  1.00 88.77  ? -10  DC  I OP2   1 
ATOM   7291  O  "O5'" . DC  I  5 63  ? 6.278   -40.778 76.450  1.00 87.82  ? -10  DC  I "O5'" 1 
ATOM   7292  C  "C5'" . DC  I  5 63  ? 7.566   -40.206 76.708  1.00 87.17  ? -10  DC  I "C5'" 1 
ATOM   7293  C  "C4'" . DC  I  5 63  ? 7.480   -38.918 77.519  1.00 87.42  ? -10  DC  I "C4'" 1 
ATOM   7294  O  "O4'" . DC  I  5 63  ? 7.356   -37.791 76.616  1.00 87.78  ? -10  DC  I "O4'" 1 
ATOM   7295  C  "C3'" . DC  I  5 63  ? 6.301   -38.759 78.485  1.00 87.11  ? -10  DC  I "C3'" 1 
ATOM   7296  O  "O3'" . DC  I  5 63  ? 6.636   -39.197 79.804  1.00 86.76  ? -10  DC  I "O3'" 1 
ATOM   7297  C  "C2'" . DC  I  5 63  ? 6.060   -37.254 78.537  1.00 87.12  ? -10  DC  I "C2'" 1 
ATOM   7298  C  "C1'" . DC  I  5 63  ? 6.860   -36.697 77.370  1.00 87.08  ? -10  DC  I "C1'" 1 
ATOM   7299  N  N1    . DC  I  5 63  ? 6.027   -35.762 76.536  1.00 86.84  ? -10  DC  I N1    1 
ATOM   7300  C  C2    . DC  I  5 63  ? 5.998   -34.398 76.889  1.00 86.59  ? -10  DC  I C2    1 
ATOM   7301  O  O2    . DC  I  5 63  ? 6.653   -34.000 77.863  1.00 86.28  ? -10  DC  I O2    1 
ATOM   7302  N  N3    . DC  I  5 63  ? 5.242   -33.547 76.145  1.00 86.27  ? -10  DC  I N3    1 
ATOM   7303  C  C4    . DC  I  5 63  ? 4.549   -34.015 75.106  1.00 86.14  ? -10  DC  I C4    1 
ATOM   7304  N  N4    . DC  I  5 63  ? 3.836   -33.131 74.416  1.00 86.47  ? -10  DC  I N4    1 
ATOM   7305  C  C5    . DC  I  5 63  ? 4.550   -35.396 74.736  1.00 85.84  ? -10  DC  I C5    1 
ATOM   7306  C  C6    . DC  I  5 63  ? 5.293   -36.229 75.474  1.00 85.83  ? -10  DC  I C6    1 
ATOM   7307  P  P     . DT  I  5 64  ? 5.532   -39.322 80.967  1.00 85.72  ? -9   DT  I P     1 
ATOM   7308  O  OP1   . DT  I  5 64  ? 6.026   -40.396 81.863  1.00 86.00  ? -9   DT  I OP1   1 
ATOM   7309  O  OP2   . DT  I  5 64  ? 4.176   -39.393 80.358  1.00 84.35  ? -9   DT  I OP2   1 
ATOM   7310  O  "O5'" . DT  I  5 64  ? 5.601   -37.930 81.758  1.00 84.98  ? -9   DT  I "O5'" 1 
ATOM   7311  C  "C5'" . DT  I  5 64  ? 6.831   -37.377 82.231  1.00 83.85  ? -9   DT  I "C5'" 1 
ATOM   7312  C  "C4'" . DT  I  5 64  ? 6.592   -35.992 82.826  1.00 83.22  ? -9   DT  I "C4'" 1 
ATOM   7313  O  "O4'" . DT  I  5 64  ? 6.224   -35.037 81.794  1.00 81.84  ? -9   DT  I "O4'" 1 
ATOM   7314  C  "C3'" . DT  I  5 64  ? 5.499   -35.907 83.890  1.00 83.36  ? -9   DT  I "C3'" 1 
ATOM   7315  O  "O3'" . DT  I  5 64  ? 6.031   -35.188 85.002  1.00 85.06  ? -9   DT  I "O3'" 1 
ATOM   7316  C  "C2'" . DT  I  5 64  ? 4.342   -35.166 83.219  1.00 81.70  ? -9   DT  I "C2'" 1 
ATOM   7317  C  "C1'" . DT  I  5 64  ? 5.049   -34.332 82.154  1.00 79.98  ? -9   DT  I "C1'" 1 
ATOM   7318  N  N1    . DT  I  5 64  ? 4.232   -34.082 80.902  1.00 79.56  ? -9   DT  I N1    1 
ATOM   7319  C  C2    . DT  I  5 64  ? 3.958   -32.787 80.491  1.00 78.51  ? -9   DT  I C2    1 
ATOM   7320  O  O2    . DT  I  5 64  ? 4.338   -31.796 81.095  1.00 78.21  ? -9   DT  I O2    1 
ATOM   7321  N  N3    . DT  I  5 64  ? 3.213   -32.698 79.335  1.00 78.01  ? -9   DT  I N3    1 
ATOM   7322  C  C4    . DT  I  5 64  ? 2.716   -33.737 78.562  1.00 78.41  ? -9   DT  I C4    1 
ATOM   7323  O  O4    . DT  I  5 64  ? 2.056   -33.542 77.543  1.00 78.00  ? -9   DT  I O4    1 
ATOM   7324  C  C5    . DT  I  5 64  ? 3.041   -35.064 79.050  1.00 78.63  ? -9   DT  I C5    1 
ATOM   7325  C  C7    . DT  I  5 64  ? 2.581   -36.296 78.333  1.00 78.33  ? -9   DT  I C7    1 
ATOM   7326  C  C6    . DT  I  5 64  ? 3.775   -35.166 80.167  1.00 79.16  ? -9   DT  I C6    1 
ATOM   7327  P  P     . DT  I  5 65  ? 5.217   -35.012 86.371  1.00 85.38  ? -8   DT  I P     1 
ATOM   7328  O  OP1   . DT  I  5 65  ? 6.223   -34.670 87.408  1.00 85.23  ? -8   DT  I OP1   1 
ATOM   7329  O  OP2   . DT  I  5 65  ? 4.300   -36.169 86.510  1.00 84.57  ? -8   DT  I OP2   1 
ATOM   7330  O  "O5'" . DT  I  5 65  ? 4.345   -33.692 86.138  1.00 84.08  ? -8   DT  I "O5'" 1 
ATOM   7331  C  "C5'" . DT  I  5 65  ? 4.991   -32.417 86.098  1.00 81.01  ? -8   DT  I "C5'" 1 
ATOM   7332  C  "C4'" . DT  I  5 65  ? 3.979   -31.325 85.800  1.00 79.26  ? -8   DT  I "C4'" 1 
ATOM   7333  O  "O4'" . DT  I  5 65  ? 3.453   -31.450 84.449  1.00 78.48  ? -8   DT  I "O4'" 1 
ATOM   7334  C  "C3'" . DT  I  5 65  ? 2.777   -31.295 86.735  1.00 77.76  ? -8   DT  I "C3'" 1 
ATOM   7335  O  "O3'" . DT  I  5 65  ? 2.751   -30.002 87.335  1.00 77.15  ? -8   DT  I "O3'" 1 
ATOM   7336  C  "C2'" . DT  I  5 65  ? 1.576   -31.601 85.825  1.00 76.89  ? -8   DT  I "C2'" 1 
ATOM   7337  C  "C1'" . DT  I  5 65  ? 2.075   -31.139 84.464  1.00 77.26  ? -8   DT  I "C1'" 1 
ATOM   7338  N  N1    . DT  I  5 65  ? 1.457   -31.728 83.218  1.00 77.63  ? -8   DT  I N1    1 
ATOM   7339  C  C2    . DT  I  5 65  ? 1.127   -30.877 82.173  1.00 77.23  ? -8   DT  I C2    1 
ATOM   7340  O  O2    . DT  I  5 65  ? 1.282   -29.673 82.191  1.00 77.34  ? -8   DT  I O2    1 
ATOM   7341  N  N3    . DT  I  5 65  ? 0.587   -31.486 81.072  1.00 77.10  ? -8   DT  I N3    1 
ATOM   7342  C  C4    . DT  I  5 65  ? 0.350   -32.834 80.885  1.00 77.35  ? -8   DT  I C4    1 
ATOM   7343  O  O4    . DT  I  5 65  ? -0.143  -33.264 79.844  1.00 76.85  ? -8   DT  I O4    1 
ATOM   7344  C  C5    . DT  I  5 65  ? 0.721   -33.677 82.002  1.00 77.55  ? -8   DT  I C5    1 
ATOM   7345  C  C7    . DT  I  5 65  ? 0.508   -35.160 81.920  1.00 77.38  ? -8   DT  I C7    1 
ATOM   7346  C  C6    . DT  I  5 65  ? 1.253   -33.097 83.096  1.00 77.83  ? -8   DT  I C6    1 
ATOM   7347  P  P     . DC  I  5 66  ? 1.784   -29.670 88.561  1.00 77.40  ? -7   DC  I P     1 
ATOM   7348  O  OP1   . DC  I  5 66  ? 2.504   -28.756 89.468  1.00 78.44  ? -7   DC  I OP1   1 
ATOM   7349  O  OP2   . DC  I  5 66  ? 1.239   -30.933 89.102  1.00 78.39  ? -7   DC  I OP2   1 
ATOM   7350  O  "O5'" . DC  I  5 66  ? 0.550   -28.913 87.880  1.00 76.98  ? -7   DC  I "O5'" 1 
ATOM   7351  C  "C5'" . DC  I  5 66  ? 0.665   -27.680 87.150  1.00 75.65  ? -7   DC  I "C5'" 1 
ATOM   7352  C  "C4'" . DC  I  5 66  ? -0.588  -27.469 86.309  1.00 74.85  ? -7   DC  I "C4'" 1 
ATOM   7353  O  "O4'" . DC  I  5 66  ? -0.686  -28.544 85.338  1.00 74.37  ? -7   DC  I "O4'" 1 
ATOM   7354  C  "C3'" . DC  I  5 66  ? -1.939  -27.485 87.047  1.00 74.57  ? -7   DC  I "C3'" 1 
ATOM   7355  O  "O3'" . DC  I  5 66  ? -2.719  -26.352 86.678  1.00 74.55  ? -7   DC  I "O3'" 1 
ATOM   7356  C  "C2'" . DC  I  5 66  ? -2.626  -28.770 86.576  1.00 73.52  ? -7   DC  I "C2'" 1 
ATOM   7357  C  "C1'" . DC  I  5 66  ? -2.063  -28.816 85.166  1.00 73.27  ? -7   DC  I "C1'" 1 
ATOM   7358  N  N1    . DC  I  5 66  ? -2.185  -30.074 84.390  1.00 73.01  ? -7   DC  I N1    1 
ATOM   7359  C  C2    . DC  I  5 66  ? -2.621  -29.993 83.056  1.00 72.31  ? -7   DC  I C2    1 
ATOM   7360  O  O2    . DC  I  5 66  ? -2.904  -28.897 82.577  1.00 71.89  ? -7   DC  I O2    1 
ATOM   7361  N  N3    . DC  I  5 66  ? -2.732  -31.126 82.318  1.00 72.53  ? -7   DC  I N3    1 
ATOM   7362  C  C4    . DC  I  5 66  ? -2.412  -32.304 82.858  1.00 72.94  ? -7   DC  I C4    1 
ATOM   7363  N  N4    . DC  I  5 66  ? -2.537  -33.387 82.086  1.00 72.48  ? -7   DC  I N4    1 
ATOM   7364  C  C5    . DC  I  5 66  ? -1.959  -32.410 84.218  1.00 72.94  ? -7   DC  I C5    1 
ATOM   7365  C  C6    . DC  I  5 66  ? -1.857  -31.283 84.945  1.00 72.53  ? -7   DC  I C6    1 
ATOM   7366  P  P     . DA  I  5 67  ? -2.826  -25.048 87.602  1.00 74.54  ? -6   DA  I P     1 
ATOM   7367  O  OP1   . DA  I  5 67  ? -1.464  -24.792 88.151  1.00 73.44  ? -6   DA  I OP1   1 
ATOM   7368  O  OP2   . DA  I  5 67  ? -4.019  -25.227 88.466  1.00 73.78  ? -6   DA  I OP2   1 
ATOM   7369  O  "O5'" . DA  I  5 67  ? -3.221  -23.864 86.584  1.00 73.20  ? -6   DA  I "O5'" 1 
ATOM   7370  C  "C5'" . DA  I  5 67  ? -2.544  -23.676 85.318  1.00 71.08  ? -6   DA  I "C5'" 1 
ATOM   7371  C  "C4'" . DA  I  5 67  ? -3.509  -23.358 84.182  1.00 68.67  ? -6   DA  I "C4'" 1 
ATOM   7372  O  "O4'" . DA  I  5 67  ? -4.061  -24.560 83.569  1.00 67.57  ? -6   DA  I "O4'" 1 
ATOM   7373  C  "C3'" . DA  I  5 67  ? -4.727  -22.525 84.568  1.00 68.40  ? -6   DA  I "C3'" 1 
ATOM   7374  O  "O3'" . DA  I  5 67  ? -5.005  -21.668 83.459  1.00 68.48  ? -6   DA  I "O3'" 1 
ATOM   7375  C  "C2'" . DA  I  5 67  ? -5.820  -23.568 84.831  1.00 67.02  ? -6   DA  I "C2'" 1 
ATOM   7376  C  "C1'" . DA  I  5 67  ? -5.457  -24.671 83.841  1.00 66.42  ? -6   DA  I "C1'" 1 
ATOM   7377  N  N9    . DA  I  5 67  ? -5.629  -26.043 84.303  1.00 66.44  ? -6   DA  I N9    1 
ATOM   7378  C  C8    . DA  I  5 67  ? -5.588  -26.513 85.585  1.00 66.27  ? -6   DA  I C8    1 
ATOM   7379  N  N7    . DA  I  5 67  ? -5.737  -27.818 85.671  1.00 66.86  ? -6   DA  I N7    1 
ATOM   7380  C  C5    . DA  I  5 67  ? -5.877  -28.234 84.362  1.00 66.05  ? -6   DA  I C5    1 
ATOM   7381  C  C6    . DA  I  5 67  ? -6.065  -29.494 83.767  1.00 65.88  ? -6   DA  I C6    1 
ATOM   7382  N  N6    . DA  I  5 67  ? -6.154  -30.627 84.443  1.00 65.59  ? -6   DA  I N6    1 
ATOM   7383  N  N1    . DA  I  5 67  ? -6.172  -29.553 82.424  1.00 66.64  ? -6   DA  I N1    1 
ATOM   7384  C  C2    . DA  I  5 67  ? -6.092  -28.426 81.713  1.00 65.71  ? -6   DA  I C2    1 
ATOM   7385  N  N3    . DA  I  5 67  ? -5.904  -27.190 82.160  1.00 65.78  ? -6   DA  I N3    1 
ATOM   7386  C  C4    . DA  I  5 67  ? -5.808  -27.154 83.503  1.00 66.41  ? -6   DA  I C4    1 
ATOM   7387  P  P     . DA  I  5 68  ? -6.150  -20.563 83.468  1.00 68.28  ? -5   DA  I P     1 
ATOM   7388  O  OP1   . DA  I  5 68  ? -5.539  -19.430 82.768  1.00 69.86  ? -5   DA  I OP1   1 
ATOM   7389  O  OP2   . DA  I  5 68  ? -6.753  -20.403 84.813  1.00 68.14  ? -5   DA  I OP2   1 
ATOM   7390  O  "O5'" . DA  I  5 68  ? -7.290  -21.180 82.524  1.00 70.45  ? -5   DA  I "O5'" 1 
ATOM   7391  C  "C5'" . DA  I  5 68  ? -6.991  -21.832 81.277  1.00 71.20  ? -5   DA  I "C5'" 1 
ATOM   7392  C  "C4'" . DA  I  5 68  ? -8.225  -22.533 80.723  1.00 71.90  ? -5   DA  I "C4'" 1 
ATOM   7393  O  "O4'" . DA  I  5 68  ? -8.273  -23.930 81.134  1.00 72.36  ? -5   DA  I "O4'" 1 
ATOM   7394  C  "C3'" . DA  I  5 68  ? -9.562  -21.928 81.145  1.00 71.81  ? -5   DA  I "C3'" 1 
ATOM   7395  O  "O3'" . DA  I  5 68  ? -10.522 -22.075 80.110  1.00 72.42  ? -5   DA  I "O3'" 1 
ATOM   7396  C  "C2'" . DA  I  5 68  ? -9.946  -22.807 82.321  1.00 72.29  ? -5   DA  I "C2'" 1 
ATOM   7397  C  "C1'" . DA  I  5 68  ? -9.510  -24.172 81.794  1.00 73.80  ? -5   DA  I "C1'" 1 
ATOM   7398  N  N9    . DA  I  5 68  ? -9.339  -25.219 82.810  1.00 74.05  ? -5   DA  I N9    1 
ATOM   7399  C  C8    . DA  I  5 68  ? -9.066  -25.041 84.139  1.00 74.64  ? -5   DA  I C8    1 
ATOM   7400  N  N7    . DA  I  5 68  ? -8.941  -26.158 84.815  1.00 75.57  ? -5   DA  I N7    1 
ATOM   7401  C  C5    . DA  I  5 68  ? -9.154  -27.148 83.865  1.00 75.31  ? -5   DA  I C5    1 
ATOM   7402  C  C6    . DA  I  5 68  ? -9.164  -28.565 83.930  1.00 74.75  ? -5   DA  I C6    1 
ATOM   7403  N  N6    . DA  I  5 68  ? -8.943  -29.243 85.050  1.00 74.01  ? -5   DA  I N6    1 
ATOM   7404  N  N1    . DA  I  5 68  ? -9.403  -29.267 82.792  1.00 75.06  ? -5   DA  I N1    1 
ATOM   7405  C  C2    . DA  I  5 68  ? -9.624  -28.601 81.648  1.00 74.90  ? -5   DA  I C2    1 
ATOM   7406  N  N3    . DA  I  5 68  ? -9.640  -27.273 81.477  1.00 75.81  ? -5   DA  I N3    1 
ATOM   7407  C  C4    . DA  I  5 68  ? -9.403  -26.588 82.623  1.00 74.88  ? -5   DA  I C4    1 
ATOM   7408  P  P     . DC  I  5 69  ? -10.666 -21.055 78.874  1.00 72.58  ? -4   DC  I P     1 
ATOM   7409  O  OP1   . DC  I  5 69  ? -9.332  -20.748 78.305  1.00 72.41  ? -4   DC  I OP1   1 
ATOM   7410  O  OP2   . DC  I  5 69  ? -11.559 -19.964 79.337  1.00 72.10  ? -4   DC  I OP2   1 
ATOM   7411  O  "O5'" . DC  I  5 69  ? -11.410 -21.973 77.790  1.00 70.13  ? -4   DC  I "O5'" 1 
ATOM   7412  C  "C5'" . DC  I  5 69  ? -10.653 -23.043 77.231  1.00 67.57  ? -4   DC  I "C5'" 1 
ATOM   7413  C  "C4'" . DC  I  5 69  ? -11.456 -24.325 77.131  1.00 66.31  ? -4   DC  I "C4'" 1 
ATOM   7414  O  "O4'" . DC  I  5 69  ? -11.410 -25.075 78.371  1.00 67.24  ? -4   DC  I "O4'" 1 
ATOM   7415  C  "C3'" . DC  I  5 69  ? -12.926 -24.137 76.782  1.00 65.04  ? -4   DC  I "C3'" 1 
ATOM   7416  O  "O3'" . DC  I  5 69  ? -13.176 -24.962 75.648  1.00 61.69  ? -4   DC  I "O3'" 1 
ATOM   7417  C  "C2'" . DC  I  5 69  ? -13.672 -24.601 78.030  1.00 66.48  ? -4   DC  I "C2'" 1 
ATOM   7418  C  "C1'" . DC  I  5 69  ? -12.695 -25.590 78.664  1.00 68.42  ? -4   DC  I "C1'" 1 
ATOM   7419  N  N1    . DC  I  5 69  ? -12.769 -25.721 80.153  1.00 68.88  ? -4   DC  I N1    1 
ATOM   7420  C  C2    . DC  I  5 69  ? -12.690 -26.979 80.767  1.00 69.75  ? -4   DC  I C2    1 
ATOM   7421  O  O2    . DC  I  5 69  ? -12.571 -28.001 80.073  1.00 70.85  ? -4   DC  I O2    1 
ATOM   7422  N  N3    . DC  I  5 69  ? -12.734 -27.047 82.125  1.00 69.91  ? -4   DC  I N3    1 
ATOM   7423  C  C4    . DC  I  5 69  ? -12.866 -25.929 82.850  1.00 69.86  ? -4   DC  I C4    1 
ATOM   7424  N  N4    . DC  I  5 69  ? -12.922 -26.029 84.180  1.00 70.17  ? -4   DC  I N4    1 
ATOM   7425  C  C5    . DC  I  5 69  ? -12.959 -24.643 82.247  1.00 69.87  ? -4   DC  I C5    1 
ATOM   7426  C  C6    . DC  I  5 69  ? -12.894 -24.591 80.914  1.00 69.19  ? -4   DC  I C6    1 
ATOM   7427  P  P     . DT  I  5 70  ? -14.511 -24.882 74.785  1.00 57.72  ? -3   DT  I P     1 
ATOM   7428  O  OP1   . DT  I  5 70  ? -14.098 -24.624 73.402  1.00 58.02  ? -3   DT  I OP1   1 
ATOM   7429  O  OP2   . DT  I  5 70  ? -15.520 -24.037 75.438  1.00 57.03  ? -3   DT  I OP2   1 
ATOM   7430  O  "O5'" . DT  I  5 70  ? -15.041 -26.379 74.886  1.00 60.49  ? -3   DT  I "O5'" 1 
ATOM   7431  C  "C5'" . DT  I  5 70  ? -14.164 -27.517 74.951  1.00 62.28  ? -3   DT  I "C5'" 1 
ATOM   7432  C  "C4'" . DT  I  5 70  ? -14.917 -28.736 75.463  1.00 65.03  ? -3   DT  I "C4'" 1 
ATOM   7433  O  "O4'" . DT  I  5 70  ? -15.007 -28.649 76.906  1.00 66.03  ? -3   DT  I "O4'" 1 
ATOM   7434  C  "C3'" . DT  I  5 70  ? -16.356 -28.908 74.966  1.00 67.05  ? -3   DT  I "C3'" 1 
ATOM   7435  O  "O3'" . DT  I  5 70  ? -16.552 -30.262 74.562  1.00 69.51  ? -3   DT  I "O3'" 1 
ATOM   7436  C  "C2'" . DT  I  5 70  ? -17.235 -28.473 76.154  1.00 67.16  ? -3   DT  I "C2'" 1 
ATOM   7437  C  "C1'" . DT  I  5 70  ? -16.345 -28.830 77.342  1.00 67.58  ? -3   DT  I "C1'" 1 
ATOM   7438  N  N1    . DT  I  5 70  ? -16.452 -28.029 78.608  1.00 67.84  ? -3   DT  I N1    1 
ATOM   7439  C  C2    . DT  I  5 70  ? -16.381 -28.702 79.814  1.00 67.65  ? -3   DT  I C2    1 
ATOM   7440  O  O2    . DT  I  5 70  ? -16.275 -29.906 79.922  1.00 67.46  ? -3   DT  I O2    1 
ATOM   7441  N  N3    . DT  I  5 70  ? -16.450 -27.907 80.921  1.00 67.78  ? -3   DT  I N3    1 
ATOM   7442  C  C4    . DT  I  5 70  ? -16.569 -26.535 80.959  1.00 67.99  ? -3   DT  I C4    1 
ATOM   7443  O  O4    . DT  I  5 70  ? -16.622 -25.933 82.024  1.00 68.39  ? -3   DT  I O4    1 
ATOM   7444  C  C5    . DT  I  5 70  ? -16.637 -25.873 79.675  1.00 68.55  ? -3   DT  I C5    1 
ATOM   7445  C  C7    . DT  I  5 70  ? -16.776 -24.368 79.600  1.00 67.73  ? -3   DT  I C7    1 
ATOM   7446  C  C6    . DT  I  5 70  ? -16.566 -26.649 78.573  1.00 68.45  ? -3   DT  I C6    1 
ATOM   7447  P  P     . DG  I  5 71  ? -17.963 -30.815 74.048  1.00 71.97  ? -2   DG  I P     1 
ATOM   7448  O  OP1   . DG  I  5 71  ? -17.724 -32.020 73.230  1.00 72.93  ? -2   DG  I OP1   1 
ATOM   7449  O  OP2   . DG  I  5 71  ? -18.740 -29.685 73.499  1.00 71.74  ? -2   DG  I OP2   1 
ATOM   7450  O  "O5'" . DG  I  5 71  ? -18.691 -31.243 75.407  1.00 74.66  ? -2   DG  I "O5'" 1 
ATOM   7451  C  "C5'" . DG  I  5 71  ? -18.495 -32.469 76.140  1.00 76.50  ? -2   DG  I "C5'" 1 
ATOM   7452  C  "C4'" . DG  I  5 71  ? -19.582 -32.546 77.211  1.00 78.45  ? -2   DG  I "C4'" 1 
ATOM   7453  O  "O4'" . DG  I  5 71  ? -19.398 -31.471 78.175  1.00 78.90  ? -2   DG  I "O4'" 1 
ATOM   7454  C  "C3'" . DG  I  5 71  ? -21.029 -32.366 76.729  1.00 80.72  ? -2   DG  I "C3'" 1 
ATOM   7455  O  "O3'" . DG  I  5 71  ? -21.926 -33.072 77.572  1.00 83.98  ? -2   DG  I "O3'" 1 
ATOM   7456  C  "C2'" . DG  I  5 71  ? -21.289 -30.873 76.908  1.00 79.71  ? -2   DG  I "C2'" 1 
ATOM   7457  C  "C1'" . DG  I  5 71  ? -20.594 -30.708 78.253  1.00 78.52  ? -2   DG  I "C1'" 1 
ATOM   7458  N  N9    . DG  I  5 71  ? -20.352 -29.334 78.701  1.00 78.27  ? -2   DG  I N9    1 
ATOM   7459  C  C8    . DG  I  5 71  ? -20.304 -28.155 77.978  1.00 78.27  ? -2   DG  I C8    1 
ATOM   7460  N  N7    . DG  I  5 71  ? -20.084 -27.096 78.719  1.00 78.57  ? -2   DG  I N7    1 
ATOM   7461  C  C5    . DG  I  5 71  ? -19.989 -27.607 80.026  1.00 79.12  ? -2   DG  I C5    1 
ATOM   7462  C  C6    . DG  I  5 71  ? -19.767 -26.970 81.290  1.00 78.31  ? -2   DG  I C6    1 
ATOM   7463  O  O6    . DG  I  5 71  ? -19.590 -25.777 81.547  1.00 78.16  ? -2   DG  I O6    1 
ATOM   7464  N  N1    . DG  I  5 71  ? -19.757 -27.868 82.350  1.00 77.87  ? -2   DG  I N1    1 
ATOM   7465  C  C2    . DG  I  5 71  ? -19.935 -29.224 82.222  1.00 78.18  ? -2   DG  I C2    1 
ATOM   7466  N  N2    . DG  I  5 71  ? -19.894 -29.930 83.356  1.00 78.51  ? -2   DG  I N2    1 
ATOM   7467  N  N3    . DG  I  5 71  ? -20.138 -29.849 81.069  1.00 78.01  ? -2   DG  I N3    1 
ATOM   7468  C  C4    . DG  I  5 71  ? -20.157 -28.984 80.017  1.00 78.66  ? -2   DG  I C4    1 
ATOM   7469  P  P     . DA  I  5 72  ? -22.484 -34.526 77.199  1.00 86.52  ? -1   DA  I P     1 
ATOM   7470  O  OP1   . DA  I  5 72  ? -21.371 -35.407 76.751  1.00 85.37  ? -1   DA  I OP1   1 
ATOM   7471  O  OP2   . DA  I  5 72  ? -23.677 -34.278 76.350  1.00 84.86  ? -1   DA  I OP2   1 
ATOM   7472  O  "O5'" . DA  I  5 72  ? -22.927 -35.072 78.643  1.00 85.58  ? -1   DA  I "O5'" 1 
ATOM   7473  C  "C5'" . DA  I  5 72  ? -21.987 -35.140 79.726  1.00 85.05  ? -1   DA  I "C5'" 1 
ATOM   7474  C  "C4'" . DA  I  5 72  ? -22.689 -34.930 81.060  1.00 84.85  ? -1   DA  I "C4'" 1 
ATOM   7475  O  "O4'" . DA  I  5 72  ? -22.498 -33.575 81.554  1.00 84.60  ? -1   DA  I "O4'" 1 
ATOM   7476  C  "C3'" . DA  I  5 72  ? -24.199 -35.146 81.050  1.00 85.48  ? -1   DA  I "C3'" 1 
ATOM   7477  O  "O3'" . DA  I  5 72  ? -24.524 -35.893 82.234  1.00 87.89  ? -1   DA  I "O3'" 1 
ATOM   7478  C  "C2'" . DA  I  5 72  ? -24.780 -33.729 81.020  1.00 83.83  ? -1   DA  I "C2'" 1 
ATOM   7479  C  "C1'" . DA  I  5 72  ? -23.741 -32.939 81.808  1.00 82.09  ? -1   DA  I "C1'" 1 
ATOM   7480  N  N9    . DA  I  5 72  ? -23.636 -31.524 81.428  1.00 81.29  ? -1   DA  I N9    1 
ATOM   7481  C  C8    . DA  I  5 72  ? -23.752 -30.999 80.173  1.00 80.83  ? -1   DA  I C8    1 
ATOM   7482  N  N7    . DA  I  5 72  ? -23.617 -29.697 80.127  1.00 80.53  ? -1   DA  I N7    1 
ATOM   7483  C  C5    . DA  I  5 72  ? -23.397 -29.332 81.435  1.00 80.08  ? -1   DA  I C5    1 
ATOM   7484  C  C6    . DA  I  5 72  ? -23.171 -28.084 82.048  1.00 80.51  ? -1   DA  I C6    1 
ATOM   7485  N  N6    . DA  I  5 72  ? -23.135 -26.931 81.391  1.00 80.53  ? -1   DA  I N6    1 
ATOM   7486  N  N1    . DA  I  5 72  ? -22.985 -28.062 83.384  1.00 81.37  ? -1   DA  I N1    1 
ATOM   7487  C  C2    . DA  I  5 72  ? -23.025 -29.222 84.061  1.00 81.07  ? -1   DA  I C2    1 
ATOM   7488  N  N3    . DA  I  5 72  ? -23.222 -30.456 83.590  1.00 80.65  ? -1   DA  I N3    1 
ATOM   7489  C  C4    . DA  I  5 72  ? -23.404 -30.446 82.255  1.00 80.53  ? -1   DA  I C4    1 
ATOM   7490  P  P     . DA  I  5 73  ? -26.021 -36.260 82.687  1.00 88.56  ? 0    DA  I P     1 
ATOM   7491  O  OP1   . DA  I  5 73  ? -25.863 -37.464 83.540  1.00 89.10  ? 0    DA  I OP1   1 
ATOM   7492  O  OP2   . DA  I  5 73  ? -26.927 -36.272 81.506  1.00 86.95  ? 0    DA  I OP2   1 
ATOM   7493  O  "O5'" . DA  I  5 73  ? -26.407 -35.015 83.619  1.00 87.67  ? 0    DA  I "O5'" 1 
ATOM   7494  C  "C5'" . DA  I  5 73  ? -25.620 -34.726 84.770  1.00 88.20  ? 0    DA  I "C5'" 1 
ATOM   7495  C  "C4'" . DA  I  5 73  ? -26.297 -33.634 85.569  1.00 89.50  ? 0    DA  I "C4'" 1 
ATOM   7496  O  "O4'" . DA  I  5 73  ? -25.907 -32.332 85.056  1.00 89.30  ? 0    DA  I "O4'" 1 
ATOM   7497  C  "C3'" . DA  I  5 73  ? -27.822 -33.687 85.519  1.00 90.53  ? 0    DA  I "C3'" 1 
ATOM   7498  O  "O3'" . DA  I  5 73  ? -28.341 -33.625 86.847  1.00 92.52  ? 0    DA  I "O3'" 1 
ATOM   7499  C  "C2'" . DA  I  5 73  ? -28.217 -32.464 84.696  1.00 90.20  ? 0    DA  I "C2'" 1 
ATOM   7500  C  "C1'" . DA  I  5 73  ? -27.046 -31.513 84.921  1.00 88.65  ? 0    DA  I "C1'" 1 
ATOM   7501  N  N9    . DA  I  5 73  ? -26.879 -30.633 83.776  1.00 88.50  ? 0    DA  I N9    1 
ATOM   7502  C  C8    . DA  I  5 73  ? -26.897 -31.017 82.463  1.00 88.33  ? 0    DA  I C8    1 
ATOM   7503  N  N7    . DA  I  5 73  ? -26.740 -30.024 81.621  1.00 88.73  ? 0    DA  I N7    1 
ATOM   7504  C  C5    . DA  I  5 73  ? -26.607 -28.907 82.435  1.00 88.60  ? 0    DA  I C5    1 
ATOM   7505  C  C6    . DA  I  5 73  ? -26.409 -27.535 82.150  1.00 88.40  ? 0    DA  I C6    1 
ATOM   7506  N  N6    . DA  I  5 73  ? -26.301 -27.041 80.911  1.00 87.84  ? 0    DA  I N6    1 
ATOM   7507  N  N1    . DA  I  5 73  ? -26.319 -26.687 83.200  1.00 88.46  ? 0    DA  I N1    1 
ATOM   7508  C  C2    . DA  I  5 73  ? -26.422 -27.174 84.445  1.00 88.17  ? 0    DA  I C2    1 
ATOM   7509  N  N3    . DA  I  5 73  ? -26.603 -28.439 84.829  1.00 88.20  ? 0    DA  I N3    1 
ATOM   7510  C  C4    . DA  I  5 73  ? -26.691 -29.266 83.772  1.00 88.45  ? 0    DA  I C4    1 
ATOM   7511  P  P     . DT  I  5 74  ? -29.911 -33.728 87.173  1.00 93.57  ? 1    DT  I P     1 
ATOM   7512  O  OP1   . DT  I  5 74  ? -29.994 -34.394 88.496  1.00 93.89  ? 1    DT  I OP1   1 
ATOM   7513  O  OP2   . DT  I  5 74  ? -30.632 -34.280 85.992  1.00 93.13  ? 1    DT  I OP2   1 
ATOM   7514  O  "O5'" . DT  I  5 74  ? -30.343 -32.199 87.371  1.00 92.87  ? 1    DT  I "O5'" 1 
ATOM   7515  C  "C5'" . DT  I  5 74  ? -29.736 -31.435 88.414  1.00 92.68  ? 1    DT  I "C5'" 1 
ATOM   7516  C  "C4'" . DT  I  5 74  ? -30.192 -29.996 88.324  1.00 92.48  ? 1    DT  I "C4'" 1 
ATOM   7517  O  "O4'" . DT  I  5 74  ? -29.566 -29.393 87.172  1.00 92.42  ? 1    DT  I "O4'" 1 
ATOM   7518  C  "C3'" . DT  I  5 74  ? -31.696 -29.839 88.123  1.00 93.21  ? 1    DT  I "C3'" 1 
ATOM   7519  O  "O3'" . DT  I  5 74  ? -32.262 -29.131 89.217  1.00 94.95  ? 1    DT  I "O3'" 1 
ATOM   7520  C  "C2'" . DT  I  5 74  ? -31.853 -29.047 86.831  1.00 92.09  ? 1    DT  I "C2'" 1 
ATOM   7521  C  "C1'" . DT  I  5 74  ? -30.466 -28.465 86.613  1.00 91.00  ? 1    DT  I "C1'" 1 
ATOM   7522  N  N1    . DT  I  5 74  ? -30.227 -28.257 85.157  1.00 90.31  ? 1    DT  I N1    1 
ATOM   7523  C  C2    . DT  I  5 74  ? -29.947 -26.985 84.688  1.00 89.87  ? 1    DT  I C2    1 
ATOM   7524  O  O2    . DT  I  5 74  ? -29.853 -26.001 85.403  1.00 89.28  ? 1    DT  I O2    1 
ATOM   7525  N  N3    . DT  I  5 74  ? -29.775 -26.912 83.326  1.00 89.89  ? 1    DT  I N3    1 
ATOM   7526  C  C4    . DT  I  5 74  ? -29.863 -27.953 82.418  1.00 89.67  ? 1    DT  I C4    1 
ATOM   7527  O  O4    . DT  I  5 74  ? -29.693 -27.762 81.223  1.00 89.86  ? 1    DT  I O4    1 
ATOM   7528  C  C5    . DT  I  5 74  ? -30.164 -29.254 82.975  1.00 89.65  ? 1    DT  I C5    1 
ATOM   7529  C  C7    . DT  I  5 74  ? -30.289 -30.476 82.110  1.00 90.06  ? 1    DT  I C7    1 
ATOM   7530  C  C6    . DT  I  5 74  ? -30.330 -29.340 84.299  1.00 89.91  ? 1    DT  I C6    1 
ATOM   7531  P  P     . DT  I  5 75  ? -33.846 -28.935 89.340  1.00 95.59  ? 2    DT  I P     1 
ATOM   7532  O  OP1   . DT  I  5 75  ? -34.184 -29.085 90.775  1.00 95.67  ? 2    DT  I OP1   1 
ATOM   7533  O  OP2   . DT  I  5 75  ? -34.532 -29.756 88.308  1.00 95.19  ? 2    DT  I OP2   1 
ATOM   7534  O  "O5'" . DT  I  5 75  ? -34.030 -27.402 88.933  1.00 95.64  ? 2    DT  I "O5'" 1 
ATOM   7535  C  "C5'" . DT  I  5 75  ? -33.192 -26.389 89.470  1.00 96.19  ? 2    DT  I "C5'" 1 
ATOM   7536  C  "C4'" . DT  I  5 75  ? -33.429 -25.139 88.653  1.00 97.37  ? 2    DT  I "C4'" 1 
ATOM   7537  O  "O4'" . DT  I  5 75  ? -32.870 -25.322 87.326  1.00 97.61  ? 2    DT  I "O4'" 1 
ATOM   7538  C  "C3'" . DT  I  5 75  ? -34.908 -24.826 88.441  1.00 98.19  ? 2    DT  I "C3'" 1 
ATOM   7539  O  "O3'" . DT  I  5 75  ? -35.242 -23.549 88.937  1.00 100.19 ? 2    DT  I "O3'" 1 
ATOM   7540  C  "C2'" . DT  I  5 75  ? -35.114 -24.868 86.933  1.00 98.06  ? 2    DT  I "C2'" 1 
ATOM   7541  C  "C1'" . DT  I  5 75  ? -33.704 -24.645 86.408  1.00 97.24  ? 2    DT  I "C1'" 1 
ATOM   7542  N  N1    . DT  I  5 75  ? -33.558 -25.203 85.032  1.00 96.82  ? 2    DT  I N1    1 
ATOM   7543  C  C2    . DT  I  5 75  ? -33.314 -24.350 83.973  1.00 96.61  ? 2    DT  I C2    1 
ATOM   7544  O  O2    . DT  I  5 75  ? -33.187 -23.139 84.097  1.00 96.64  ? 2    DT  I O2    1 
ATOM   7545  N  N3    . DT  I  5 75  ? -33.214 -24.983 82.755  1.00 96.07  ? 2    DT  I N3    1 
ATOM   7546  C  C4    . DT  I  5 75  ? -33.341 -26.342 82.504  1.00 96.68  ? 2    DT  I C4    1 
ATOM   7547  O  O4    . DT  I  5 75  ? -33.236 -26.812 81.375  1.00 97.03  ? 2    DT  I O4    1 
ATOM   7548  C  C5    . DT  I  5 75  ? -33.610 -27.173 83.657  1.00 96.71  ? 2    DT  I C5    1 
ATOM   7549  C  C7    . DT  I  5 75  ? -33.775 -28.662 83.530  1.00 96.73  ? 2    DT  I C7    1 
ATOM   7550  C  C6    . DT  I  5 75  ? -33.702 -26.567 84.845  1.00 96.73  ? 2    DT  I C6    1 
ATOM   7551  P  P     . DC  I  5 76  ? -36.786 -23.126 89.035  1.00 102.10 ? 3    DC  I P     1 
ATOM   7552  O  OP1   . DC  I  5 76  ? -36.883 -22.143 90.144  1.00 102.15 ? 3    DC  I OP1   1 
ATOM   7553  O  OP2   . DC  I  5 76  ? -37.654 -24.332 89.007  1.00 101.45 ? 3    DC  I OP2   1 
ATOM   7554  O  "O5'" . DC  I  5 76  ? -37.019 -22.373 87.649  1.00 102.27 ? 3    DC  I "O5'" 1 
ATOM   7555  C  "C5'" . DC  I  5 76  ? -36.485 -21.072 87.403  1.00 101.56 ? 3    DC  I "C5'" 1 
ATOM   7556  C  "C4'" . DC  I  5 76  ? -36.930 -20.671 86.013  1.00 101.27 ? 3    DC  I "C4'" 1 
ATOM   7557  O  "O4'" . DC  I  5 76  ? -36.432 -21.644 85.057  1.00 101.22 ? 3    DC  I "O4'" 1 
ATOM   7558  C  "C3'" . DC  I  5 76  ? -38.444 -20.657 85.833  1.00 101.00 ? 3    DC  I "C3'" 1 
ATOM   7559  O  "O3'" . DC  I  5 76  ? -38.814 -19.421 85.272  1.00 100.93 ? 3    DC  I "O3'" 1 
ATOM   7560  C  "C2'" . DC  I  5 76  ? -38.739 -21.821 84.891  1.00 100.89 ? 3    DC  I "C2'" 1 
ATOM   7561  C  "C1'" . DC  I  5 76  ? -37.439 -21.873 84.101  1.00 100.45 ? 3    DC  I "C1'" 1 
ATOM   7562  N  N1    . DC  I  5 76  ? -37.163 -23.156 83.381  1.00 100.35 ? 3    DC  I N1    1 
ATOM   7563  C  C2    . DC  I  5 76  ? -36.541 -23.108 82.116  1.00 99.98  ? 3    DC  I C2    1 
ATOM   7564  O  O2    . DC  I  5 76  ? -36.229 -22.012 81.625  1.00 99.47  ? 3    DC  I O2    1 
ATOM   7565  N  N3    . DC  I  5 76  ? -36.300 -24.278 81.466  1.00 99.47  ? 3    DC  I N3    1 
ATOM   7566  C  C4    . DC  I  5 76  ? -36.646 -25.441 82.026  1.00 99.70  ? 3    DC  I C4    1 
ATOM   7567  N  N4    . DC  I  5 76  ? -36.388 -26.561 81.345  1.00 99.81  ? 3    DC  I N4    1 
ATOM   7568  C  C5    . DC  I  5 76  ? -37.277 -25.512 83.307  1.00 99.53  ? 3    DC  I C5    1 
ATOM   7569  C  C6    . DC  I  5 76  ? -37.514 -24.356 83.943  1.00 99.78  ? 3    DC  I C6    1 
ATOM   7570  P  P     . DA  I  5 77  ? -39.608 -18.388 86.188  1.00 100.48 ? 4    DA  I P     1 
ATOM   7571  O  OP1   . DA  I  5 77  ? -38.773 -18.200 87.405  1.00 100.35 ? 4    DA  I OP1   1 
ATOM   7572  O  OP2   . DA  I  5 77  ? -41.007 -18.887 86.246  1.00 99.61  ? 4    DA  I OP2   1 
ATOM   7573  O  "O5'" . DA  I  5 77  ? -39.636 -17.009 85.366  1.00 99.23  ? 4    DA  I "O5'" 1 
ATOM   7574  C  "C5'" . DA  I  5 77  ? -38.441 -16.298 85.054  1.00 97.33  ? 4    DA  I "C5'" 1 
ATOM   7575  C  "C4'" . DA  I  5 77  ? -38.282 -16.126 83.548  1.00 96.18  ? 4    DA  I "C4'" 1 
ATOM   7576  O  "O4'" . DA  I  5 77  ? -38.210 -17.411 82.884  1.00 95.01  ? 4    DA  I "O4'" 1 
ATOM   7577  C  "C3'" . DA  I  5 77  ? -39.378 -15.348 82.824  1.00 96.29  ? 4    DA  I "C3'" 1 
ATOM   7578  O  "O3'" . DA  I  5 77  ? -38.715 -14.466 81.907  1.00 97.77  ? 4    DA  I "O3'" 1 
ATOM   7579  C  "C2'" . DA  I  5 77  ? -40.227 -16.432 82.151  1.00 94.55  ? 4    DA  I "C2'" 1 
ATOM   7580  C  "C1'" . DA  I  5 77  ? -39.177 -17.496 81.854  1.00 93.94  ? 4    DA  I "C1'" 1 
ATOM   7581  N  N9    . DA  I  5 77  ? -39.623 -18.886 81.844  1.00 93.54  ? 4    DA  I N9    1 
ATOM   7582  C  C8    . DA  I  5 77  ? -40.395 -19.517 82.776  1.00 93.49  ? 4    DA  I C8    1 
ATOM   7583  N  N7    . DA  I  5 77  ? -40.620 -20.783 82.520  1.00 93.45  ? 4    DA  I N7    1 
ATOM   7584  C  C5    . DA  I  5 77  ? -39.942 -21.006 81.338  1.00 93.56  ? 4    DA  I C5    1 
ATOM   7585  C  C6    . DA  I  5 77  ? -39.784 -22.152 80.530  1.00 93.64  ? 4    DA  I C6    1 
ATOM   7586  N  N6    . DA  I  5 77  ? -40.334 -23.333 80.819  1.00 93.28  ? 4    DA  I N6    1 
ATOM   7587  N  N1    . DA  I  5 77  ? -39.040 -22.038 79.404  1.00 93.84  ? 4    DA  I N1    1 
ATOM   7588  C  C2    . DA  I  5 77  ? -38.490 -20.854 79.105  1.00 93.58  ? 4    DA  I C2    1 
ATOM   7589  N  N3    . DA  I  5 77  ? -38.568 -19.713 79.791  1.00 93.71  ? 4    DA  I N3    1 
ATOM   7590  C  C4    . DA  I  5 77  ? -39.315 -19.850 80.907  1.00 93.72  ? 4    DA  I C4    1 
ATOM   7591  P  P     . DG  I  5 78  ? -39.483 -13.388 80.996  1.00 99.44  ? 5    DG  I P     1 
ATOM   7592  O  OP1   . DG  I  5 78  ? -38.515 -12.298 80.698  1.00 98.43  ? 5    DG  I OP1   1 
ATOM   7593  O  OP2   . DG  I  5 78  ? -40.828 -13.108 81.570  1.00 99.25  ? 5    DG  I OP2   1 
ATOM   7594  O  "O5'" . DG  I  5 78  ? -39.759 -14.225 79.667  1.00 99.78  ? 5    DG  I "O5'" 1 
ATOM   7595  C  "C5'" . DG  I  5 78  ? -38.700 -14.557 78.774  1.00 99.58  ? 5    DG  I "C5'" 1 
ATOM   7596  C  "C4'" . DG  I  5 78  ? -39.317 -15.434 77.709  1.00 99.73  ? 5    DG  I "C4'" 1 
ATOM   7597  O  "O4'" . DG  I  5 78  ? -39.731 -16.692 78.304  1.00 99.62  ? 5    DG  I "O4'" 1 
ATOM   7598  C  "C3'" . DG  I  5 78  ? -40.581 -14.871 77.061  1.00 99.43  ? 5    DG  I "C3'" 1 
ATOM   7599  O  "O3'" . DG  I  5 78  ? -40.479 -15.107 75.666  1.00 98.61  ? 5    DG  I "O3'" 1 
ATOM   7600  C  "C2'" . DG  I  5 78  ? -41.700 -15.720 77.677  1.00 99.41  ? 5    DG  I "C2'" 1 
ATOM   7601  C  "C1'" . DG  I  5 78  ? -40.963 -17.049 77.712  1.00 99.58  ? 5    DG  I "C1'" 1 
ATOM   7602  N  N9    . DG  I  5 78  ? -41.559 -18.144 78.472  1.00 99.73  ? 5    DG  I N9    1 
ATOM   7603  C  C8    . DG  I  5 78  ? -42.151 -18.077 79.709  1.00 99.88  ? 5    DG  I C8    1 
ATOM   7604  N  N7    . DG  I  5 78  ? -42.580 -19.234 80.138  1.00 100.37 ? 5    DG  I N7    1 
ATOM   7605  C  C5    . DG  I  5 78  ? -42.247 -20.128 79.125  1.00 99.86  ? 5    DG  I C5    1 
ATOM   7606  C  C6    . DG  I  5 78  ? -42.461 -21.528 79.026  1.00 99.59  ? 5    DG  I C6    1 
ATOM   7607  O  O6    . DG  I  5 78  ? -43.000 -22.284 79.837  1.00 99.40  ? 5    DG  I O6    1 
ATOM   7608  N  N1    . DG  I  5 78  ? -41.975 -22.060 77.835  1.00 99.81  ? 5    DG  I N1    1 
ATOM   7609  C  C2    . DG  I  5 78  ? -41.353 -21.326 76.850  1.00 99.95  ? 5    DG  I C2    1 
ATOM   7610  N  N2    . DG  I  5 78  ? -40.956 -22.021 75.771  1.00 99.82  ? 5    DG  I N2    1 
ATOM   7611  N  N3    . DG  I  5 78  ? -41.144 -20.009 76.929  1.00 99.69  ? 5    DG  I N3    1 
ATOM   7612  C  C4    . DG  I  5 78  ? -41.614 -19.472 78.090  1.00 99.78  ? 5    DG  I C4    1 
ATOM   7613  P  P     . DT  I  5 79  ? -40.328 -13.945 74.585  1.00 97.46  ? 6    DT  I P     1 
ATOM   7614  O  OP1   . DT  I  5 79  ? -39.508 -12.841 75.145  1.00 97.09  ? 6    DT  I OP1   1 
ATOM   7615  O  OP2   . DT  I  5 79  ? -41.691 -13.717 74.046  1.00 97.14  ? 6    DT  I OP2   1 
ATOM   7616  O  "O5'" . DT  I  5 79  ? -39.449 -14.641 73.446  1.00 95.93  ? 6    DT  I "O5'" 1 
ATOM   7617  C  "C5'" . DT  I  5 79  ? -38.792 -15.884 73.692  1.00 92.93  ? 6    DT  I "C5'" 1 
ATOM   7618  C  "C4'" . DT  I  5 79  ? -39.318 -16.957 72.753  1.00 90.65  ? 6    DT  I "C4'" 1 
ATOM   7619  O  "O4'" . DT  I  5 79  ? -40.275 -17.809 73.427  1.00 90.46  ? 6    DT  I "O4'" 1 
ATOM   7620  C  "C3'" . DT  I  5 79  ? -40.039 -16.466 71.500  1.00 89.43  ? 6    DT  I "C3'" 1 
ATOM   7621  O  "O3'" . DT  I  5 79  ? -39.684 -17.391 70.497  1.00 86.08  ? 6    DT  I "O3'" 1 
ATOM   7622  C  "C2'" . DT  I  5 79  ? -41.520 -16.541 71.887  1.00 90.26  ? 6    DT  I "C2'" 1 
ATOM   7623  C  "C1'" . DT  I  5 79  ? -41.506 -17.829 72.710  1.00 91.63  ? 6    DT  I "C1'" 1 
ATOM   7624  N  N1    . DT  I  5 79  ? -42.606 -18.082 73.725  1.00 91.94  ? 6    DT  I N1    1 
ATOM   7625  C  C2    . DT  I  5 79  ? -42.848 -19.398 74.088  1.00 92.00  ? 6    DT  I C2    1 
ATOM   7626  O  O2    . DT  I  5 79  ? -42.258 -20.362 73.626  1.00 91.91  ? 6    DT  I O2    1 
ATOM   7627  N  N3    . DT  I  5 79  ? -43.830 -19.564 75.028  1.00 92.26  ? 6    DT  I N3    1 
ATOM   7628  C  C4    . DT  I  5 79  ? -44.579 -18.578 75.640  1.00 92.39  ? 6    DT  I C4    1 
ATOM   7629  O  O4    . DT  I  5 79  ? -45.433 -18.865 76.474  1.00 92.52  ? 6    DT  I O4    1 
ATOM   7630  C  C5    . DT  I  5 79  ? -44.282 -17.221 75.227  1.00 92.17  ? 6    DT  I C5    1 
ATOM   7631  C  C7    . DT  I  5 79  ? -45.032 -16.063 75.821  1.00 91.93  ? 6    DT  I C7    1 
ATOM   7632  C  C6    . DT  I  5 79  ? -43.319 -17.040 74.304  1.00 92.02  ? 6    DT  I C6    1 
ATOM   7633  P  P     . DT  I  5 80  ? -39.736 -17.104 68.933  1.00 84.05  ? 7    DT  I P     1 
ATOM   7634  O  OP1   . DT  I  5 80  ? -38.355 -16.776 68.517  1.00 83.75  ? 7    DT  I OP1   1 
ATOM   7635  O  OP2   . DT  I  5 80  ? -40.899 -16.242 68.571  1.00 83.24  ? 7    DT  I OP2   1 
ATOM   7636  O  "O5'" . DT  I  5 80  ? -40.109 -18.569 68.434  1.00 82.68  ? 7    DT  I "O5'" 1 
ATOM   7637  C  "C5'" . DT  I  5 80  ? -41.344 -18.990 68.909  1.00 80.69  ? 7    DT  I "C5'" 1 
ATOM   7638  C  "C4'" . DT  I  5 80  ? -41.593 -20.458 68.745  1.00 79.09  ? 7    DT  I "C4'" 1 
ATOM   7639  O  "O4'" . DT  I  5 80  ? -42.305 -20.888 69.928  1.00 80.09  ? 7    DT  I "O4'" 1 
ATOM   7640  C  "C3'" . DT  I  5 80  ? -42.530 -20.683 67.575  1.00 77.76  ? 7    DT  I "C3'" 1 
ATOM   7641  O  "O3'" . DT  I  5 80  ? -42.294 -21.909 66.966  1.00 73.34  ? 7    DT  I "O3'" 1 
ATOM   7642  C  "C2'" . DT  I  5 80  ? -43.923 -20.693 68.185  1.00 79.77  ? 7    DT  I "C2'" 1 
ATOM   7643  C  "C1'" . DT  I  5 80  ? -43.693 -21.004 69.660  1.00 81.77  ? 7    DT  I "C1'" 1 
ATOM   7644  N  N1    . DT  I  5 80  ? -44.484 -20.093 70.559  1.00 82.74  ? 7    DT  I N1    1 
ATOM   7645  C  C2    . DT  I  5 80  ? -45.030 -20.630 71.711  1.00 83.25  ? 7    DT  I C2    1 
ATOM   7646  O  O2    . DT  I  5 80  ? -44.898 -21.802 72.049  1.00 83.15  ? 7    DT  I O2    1 
ATOM   7647  N  N3    . DT  I  5 80  ? -45.739 -19.725 72.464  1.00 83.33  ? 7    DT  I N3    1 
ATOM   7648  C  C4    . DT  I  5 80  ? -45.964 -18.386 72.187  1.00 83.11  ? 7    DT  I C4    1 
ATOM   7649  O  O4    . DT  I  5 80  ? -46.623 -17.687 72.953  1.00 83.38  ? 7    DT  I O4    1 
ATOM   7650  C  C5    . DT  I  5 80  ? -45.376 -17.886 70.955  1.00 83.07  ? 7    DT  I C5    1 
ATOM   7651  C  C7    . DT  I  5 80  ? -45.541 -16.449 70.535  1.00 82.53  ? 7    DT  I C7    1 
ATOM   7652  C  C6    . DT  I  5 80  ? -44.678 -18.758 70.212  1.00 82.53  ? 7    DT  I C6    1 
ATOM   7653  P  P     . DG  I  5 81  ? -43.085 -22.259 65.636  1.00 69.87  ? 8    DG  I P     1 
ATOM   7654  O  OP1   . DG  I  5 81  ? -42.130 -22.920 64.725  1.00 71.04  ? 8    DG  I OP1   1 
ATOM   7655  O  OP2   . DG  I  5 81  ? -43.885 -21.108 65.172  1.00 69.11  ? 8    DG  I OP2   1 
ATOM   7656  O  "O5'" . DG  I  5 81  ? -44.093 -23.369 66.159  1.00 71.44  ? 8    DG  I "O5'" 1 
ATOM   7657  C  "C5'" . DG  I  5 81  ? -43.726 -24.431 67.033  1.00 71.77  ? 8    DG  I "C5'" 1 
ATOM   7658  C  "C4'" . DG  I  5 81  ? -45.004 -25.130 67.463  1.00 72.81  ? 8    DG  I "C4'" 1 
ATOM   7659  O  "O4'" . DG  I  5 81  ? -45.791 -24.293 68.351  1.00 73.07  ? 8    DG  I "O4'" 1 
ATOM   7660  C  "C3'" . DG  I  5 81  ? -45.942 -25.477 66.313  1.00 73.52  ? 8    DG  I "C3'" 1 
ATOM   7661  O  "O3'" . DG  I  5 81  ? -46.501 -26.731 66.604  1.00 73.16  ? 8    DG  I "O3'" 1 
ATOM   7662  C  "C2'" . DG  I  5 81  ? -46.989 -24.356 66.307  1.00 73.68  ? 8    DG  I "C2'" 1 
ATOM   7663  C  "C1'" . DG  I  5 81  ? -47.061 -24.003 67.788  1.00 74.43  ? 8    DG  I "C1'" 1 
ATOM   7664  N  N9    . DG  I  5 81  ? -47.326 -22.609 68.111  1.00 74.72  ? 8    DG  I N9    1 
ATOM   7665  C  C8    . DG  I  5 81  ? -46.902 -21.483 67.453  1.00 75.02  ? 8    DG  I C8    1 
ATOM   7666  N  N7    . DG  I  5 81  ? -47.294 -20.371 68.012  1.00 75.22  ? 8    DG  I N7    1 
ATOM   7667  C  C5    . DG  I  5 81  ? -48.024 -20.777 69.119  1.00 75.42  ? 8    DG  I C5    1 
ATOM   7668  C  C6    . DG  I  5 81  ? -48.706 -20.025 70.115  1.00 75.08  ? 8    DG  I C6    1 
ATOM   7669  O  O6    . DG  I  5 81  ? -48.810 -18.800 70.235  1.00 75.16  ? 8    DG  I O6    1 
ATOM   7670  N  N1    . DG  I  5 81  ? -49.330 -20.840 71.059  1.00 75.18  ? 8    DG  I N1    1 
ATOM   7671  C  C2    . DG  I  5 81  ? -49.300 -22.217 71.045  1.00 75.36  ? 8    DG  I C2    1 
ATOM   7672  N  N2    . DG  I  5 81  ? -49.953 -22.832 72.035  1.00 75.30  ? 8    DG  I N2    1 
ATOM   7673  N  N3    . DG  I  5 81  ? -48.672 -22.942 70.122  1.00 76.09  ? 8    DG  I N3    1 
ATOM   7674  C  C4    . DG  I  5 81  ? -48.053 -22.158 69.190  1.00 76.05  ? 8    DG  I C4    1 
ATOM   7675  P  P     . DA  I  5 82  ? -47.237 -27.584 65.485  1.00 73.15  ? 9    DA  I P     1 
ATOM   7676  O  OP1   . DA  I  5 82  ? -46.617 -28.924 65.534  1.00 73.19  ? 9    DA  I OP1   1 
ATOM   7677  O  OP2   . DA  I  5 82  ? -47.366 -26.841 64.223  1.00 73.65  ? 9    DA  I OP2   1 
ATOM   7678  O  "O5'" . DA  I  5 82  ? -48.727 -27.619 66.064  1.00 76.89  ? 9    DA  I "O5'" 1 
ATOM   7679  C  "C5'" . DA  I  5 82  ? -49.027 -28.191 67.352  1.00 78.95  ? 9    DA  I "C5'" 1 
ATOM   7680  C  "C4'" . DA  I  5 82  ? -50.436 -27.829 67.793  1.00 80.30  ? 9    DA  I "C4'" 1 
ATOM   7681  O  "O4'" . DA  I  5 82  ? -50.491 -26.443 68.187  1.00 79.62  ? 9    DA  I "O4'" 1 
ATOM   7682  C  "C3'" . DA  I  5 82  ? -51.528 -28.021 66.745  1.00 82.14  ? 9    DA  I "C3'" 1 
ATOM   7683  O  "O3'" . DA  I  5 82  ? -52.608 -28.735 67.335  1.00 85.60  ? 9    DA  I "O3'" 1 
ATOM   7684  C  "C2'" . DA  I  5 82  ? -51.936 -26.608 66.355  1.00 81.05  ? 9    DA  I "C2'" 1 
ATOM   7685  C  "C1'" . DA  I  5 82  ? -51.642 -25.855 67.639  1.00 80.55  ? 9    DA  I "C1'" 1 
ATOM   7686  N  N9    . DA  I  5 82  ? -51.339 -24.453 67.424  1.00 80.71  ? 9    DA  I N9    1 
ATOM   7687  C  C8    . DA  I  5 82  ? -50.674 -23.890 66.372  1.00 81.03  ? 9    DA  I C8    1 
ATOM   7688  N  N7    . DA  I  5 82  ? -50.546 -22.589 66.457  1.00 80.89  ? 9    DA  I N7    1 
ATOM   7689  C  C5    . DA  I  5 82  ? -51.167 -22.290 67.650  1.00 80.36  ? 9    DA  I C5    1 
ATOM   7690  C  C6    . DA  I  5 82  ? -51.378 -21.083 68.315  1.00 80.42  ? 9    DA  I C6    1 
ATOM   7691  N  N6    . DA  I  5 82  ? -50.962 -19.915 67.837  1.00 80.97  ? 9    DA  I N6    1 
ATOM   7692  N  N1    . DA  I  5 82  ? -52.037 -21.120 69.489  1.00 81.04  ? 9    DA  I N1    1 
ATOM   7693  C  C2    . DA  I  5 82  ? -52.463 -22.297 69.966  1.00 81.09  ? 9    DA  I C2    1 
ATOM   7694  N  N3    . DA  I  5 82  ? -52.320 -23.504 69.423  1.00 81.08  ? 9    DA  I N3    1 
ATOM   7695  C  C4    . DA  I  5 82  ? -51.661 -23.423 68.259  1.00 80.56  ? 9    DA  I C4    1 
ATOM   7696  P  P     . DA  I  5 83  ? -53.804 -29.385 66.487  1.00 87.17  ? 10   DA  I P     1 
ATOM   7697  O  OP1   . DA  I  5 83  ? -54.187 -30.606 67.234  1.00 87.37  ? 10   DA  I OP1   1 
ATOM   7698  O  OP2   . DA  I  5 83  ? -53.452 -29.478 65.046  1.00 86.28  ? 10   DA  I OP2   1 
ATOM   7699  O  "O5'" . DA  I  5 83  ? -54.938 -28.275 66.679  1.00 89.29  ? 10   DA  I "O5'" 1 
ATOM   7700  C  "C5'" . DA  I  5 83  ? -55.333 -27.916 68.000  1.00 92.59  ? 10   DA  I "C5'" 1 
ATOM   7701  C  "C4'" . DA  I  5 83  ? -56.248 -26.711 67.976  1.00 95.78  ? 10   DA  I "C4'" 1 
ATOM   7702  O  "O4'" . DA  I  5 83  ? -55.445 -25.524 67.804  1.00 95.82  ? 10   DA  I "O4'" 1 
ATOM   7703  C  "C3'" . DA  I  5 83  ? -57.302 -26.708 66.865  1.00 98.40  ? 10   DA  I "C3'" 1 
ATOM   7704  O  "O3'" . DA  I  5 83  ? -58.607 -26.710 67.474  1.00 103.07 ? 10   DA  I "O3'" 1 
ATOM   7705  C  "C2'" . DA  I  5 83  ? -57.014 -25.438 66.062  1.00 97.20  ? 10   DA  I "C2'" 1 
ATOM   7706  C  "C1'" . DA  I  5 83  ? -56.166 -24.605 67.018  1.00 95.90  ? 10   DA  I "C1'" 1 
ATOM   7707  N  N9    . DA  I  5 83  ? -55.217 -23.708 66.356  1.00 95.69  ? 10   DA  I N9    1 
ATOM   7708  C  C8    . DA  I  5 83  ? -54.369 -23.985 65.316  1.00 95.65  ? 10   DA  I C8    1 
ATOM   7709  N  N7    . DA  I  5 83  ? -53.639 -22.963 64.933  1.00 95.68  ? 10   DA  I N7    1 
ATOM   7710  C  C5    . DA  I  5 83  ? -54.034 -21.941 65.782  1.00 95.56  ? 10   DA  I C5    1 
ATOM   7711  C  C6    . DA  I  5 83  ? -53.645 -20.591 65.914  1.00 95.42  ? 10   DA  I C6    1 
ATOM   7712  N  N6    . DA  I  5 83  ? -52.727 -19.993 65.155  1.00 95.90  ? 10   DA  I N6    1 
ATOM   7713  N  N1    . DA  I  5 83  ? -54.234 -19.855 66.869  1.00 95.57  ? 10   DA  I N1    1 
ATOM   7714  C  C2    . DA  I  5 83  ? -55.161 -20.424 67.646  1.00 95.77  ? 10   DA  I C2    1 
ATOM   7715  N  N3    . DA  I  5 83  ? -55.611 -21.674 67.620  1.00 95.64  ? 10   DA  I N3    1 
ATOM   7716  C  C4    . DA  I  5 83  ? -55.003 -22.387 66.662  1.00 95.46  ? 10   DA  I C4    1 
ATOM   7717  P  P     . DG  I  5 84  ? -59.996 -26.803 66.664  1.00 106.17 ? 11   DG  I P     1 
ATOM   7718  O  OP1   . DG  I  5 84  ? -60.876 -27.725 67.421  1.00 106.15 ? 11   DG  I OP1   1 
ATOM   7719  O  OP2   . DG  I  5 84  ? -59.733 -27.092 65.230  1.00 105.81 ? 11   DG  I OP2   1 
ATOM   7720  O  "O5'" . DG  I  5 84  ? -60.545 -25.300 66.818  1.00 107.60 ? 11   DG  I "O5'" 1 
ATOM   7721  C  "C5'" . DG  I  5 84  ? -60.942 -24.805 68.103  1.00 110.71 ? 11   DG  I "C5'" 1 
ATOM   7722  C  "C4'" . DG  I  5 84  ? -61.135 -23.298 68.085  1.00 113.49 ? 11   DG  I "C4'" 1 
ATOM   7723  O  "O4'" . DG  I  5 84  ? -59.840 -22.685 67.836  1.00 114.26 ? 11   DG  I "O4'" 1 
ATOM   7724  C  "C3'" . DG  I  5 84  ? -62.105 -22.786 67.012  1.00 115.08 ? 11   DG  I "C3'" 1 
ATOM   7725  O  "O3'" . DG  I  5 84  ? -63.259 -22.108 67.542  1.00 116.80 ? 11   DG  I "O3'" 1 
ATOM   7726  C  "C2'" . DG  I  5 84  ? -61.279 -21.820 66.173  1.00 115.17 ? 11   DG  I "C2'" 1 
ATOM   7727  C  "C1'" . DG  I  5 84  ? -60.004 -21.579 66.976  1.00 114.85 ? 11   DG  I "C1'" 1 
ATOM   7728  N  N9    . DG  I  5 84  ? -58.923 -21.442 66.007  1.00 114.98 ? 11   DG  I N9    1 
ATOM   7729  C  C8    . DG  I  5 84  ? -58.455 -22.407 65.140  1.00 114.96 ? 11   DG  I C8    1 
ATOM   7730  N  N7    . DG  I  5 84  ? -57.506 -21.990 64.352  1.00 114.83 ? 11   DG  I N7    1 
ATOM   7731  C  C5    . DG  I  5 84  ? -57.351 -20.659 64.708  1.00 114.79 ? 11   DG  I C5    1 
ATOM   7732  C  C6    . DG  I  5 84  ? -56.468 -19.686 64.198  1.00 114.82 ? 11   DG  I C6    1 
ATOM   7733  O  O6    . DG  I  5 84  ? -55.625 -19.828 63.307  1.00 114.98 ? 11   DG  I O6    1 
ATOM   7734  N  N1    . DG  I  5 84  ? -56.625 -18.452 64.828  1.00 115.05 ? 11   DG  I N1    1 
ATOM   7735  C  C2    . DG  I  5 84  ? -57.526 -18.195 65.837  1.00 114.84 ? 11   DG  I C2    1 
ATOM   7736  N  N2    . DG  I  5 84  ? -57.540 -16.950 66.323  1.00 114.84 ? 11   DG  I N2    1 
ATOM   7737  N  N3    . DG  I  5 84  ? -58.363 -19.099 66.328  1.00 114.84 ? 11   DG  I N3    1 
ATOM   7738  C  C4    . DG  I  5 84  ? -58.219 -20.302 65.717  1.00 114.84 ? 11   DG  I C4    1 
ATOM   7739  P  P     . DT  I  5 85  ? -64.419 -21.509 66.590  1.00 117.57 ? 12   DT  I P     1 
ATOM   7740  O  OP1   . DT  I  5 85  ? -65.637 -21.471 67.433  1.00 118.00 ? 12   DT  I OP1   1 
ATOM   7741  O  OP2   . DT  I  5 85  ? -64.438 -22.230 65.293  1.00 116.61 ? 12   DT  I OP2   1 
ATOM   7742  O  "O5'" . DT  I  5 85  ? -63.956 -20.005 66.292  1.00 118.28 ? 12   DT  I "O5'" 1 
ATOM   7743  C  "C5'" . DT  I  5 85  ? -63.846 -19.042 67.348  1.00 119.85 ? 12   DT  I "C5'" 1 
ATOM   7744  C  "C4'" . DT  I  5 85  ? -63.655 -17.637 66.797  1.00 120.97 ? 12   DT  I "C4'" 1 
ATOM   7745  O  "O4'" . DT  I  5 85  ? -62.333 -17.509 66.199  1.00 121.40 ? 12   DT  I "O4'" 1 
ATOM   7746  C  "C3'" . DT  I  5 85  ? -64.671 -17.222 65.728  1.00 121.75 ? 12   DT  I "C3'" 1 
ATOM   7747  O  "O3'" . DT  I  5 85  ? -65.195 -15.912 66.023  1.00 122.53 ? 12   DT  I "O3'" 1 
ATOM   7748  C  "C2'" . DT  I  5 85  ? -63.885 -17.300 64.416  1.00 121.61 ? 12   DT  I "C2'" 1 
ATOM   7749  C  "C1'" . DT  I  5 85  ? -62.441 -17.058 64.855  1.00 121.29 ? 12   DT  I "C1'" 1 
ATOM   7750  N  N1    . DT  I  5 85  ? -61.417 -17.731 63.965  1.00 120.95 ? 12   DT  I N1    1 
ATOM   7751  C  C2    . DT  I  5 85  ? -60.378 -16.986 63.434  1.00 120.89 ? 12   DT  I C2    1 
ATOM   7752  O  O2    . DT  I  5 85  ? -60.207 -15.794 63.635  1.00 120.89 ? 12   DT  I O2    1 
ATOM   7753  N  N3    . DT  I  5 85  ? -59.516 -17.702 62.640  1.00 121.00 ? 12   DT  I N3    1 
ATOM   7754  C  C4    . DT  I  5 85  ? -59.574 -19.049 62.323  1.00 121.06 ? 12   DT  I C4    1 
ATOM   7755  O  O4    . DT  I  5 85  ? -58.738 -19.578 61.597  1.00 121.04 ? 12   DT  I O4    1 
ATOM   7756  C  C5    . DT  I  5 85  ? -60.682 -19.774 62.904  1.00 121.06 ? 12   DT  I C5    1 
ATOM   7757  C  C7    . DT  I  5 85  ? -60.859 -21.243 62.633  1.00 120.88 ? 12   DT  I C7    1 
ATOM   7758  C  C6    . DT  I  5 85  ? -61.534 -19.087 63.686  1.00 120.93 ? 12   DT  I C6    1 
ATOM   7759  P  P     . DT  I  5 86  ? -65.970 -14.989 64.955  1.00 122.60 ? 13   DT  I P     1 
ATOM   7760  O  OP1   . DT  I  5 86  ? -66.677 -13.946 65.735  1.00 122.97 ? 13   DT  I OP1   1 
ATOM   7761  O  OP2   . DT  I  5 86  ? -66.717 -15.828 63.987  1.00 122.04 ? 13   DT  I OP2   1 
ATOM   7762  O  "O5'" . DT  I  5 86  ? -64.766 -14.287 64.177  1.00 122.25 ? 13   DT  I "O5'" 1 
ATOM   7763  C  "C5'" . DT  I  5 86  ? -63.824 -13.480 64.889  1.00 121.77 ? 13   DT  I "C5'" 1 
ATOM   7764  C  "C4'" . DT  I  5 86  ? -62.959 -12.708 63.909  1.00 121.16 ? 13   DT  I "C4'" 1 
ATOM   7765  O  "O4'" . DT  I  5 86  ? -62.055 -13.617 63.221  1.00 120.85 ? 13   DT  I "O4'" 1 
ATOM   7766  C  "C3'" . DT  I  5 86  ? -63.760 -11.971 62.839  1.00 120.79 ? 13   DT  I "C3'" 1 
ATOM   7767  O  "O3'" . DT  I  5 86  ? -63.337 -10.616 62.781  1.00 120.78 ? 13   DT  I "O3'" 1 
ATOM   7768  C  "C2'" . DT  I  5 86  ? -63.467 -12.743 61.552  1.00 120.41 ? 13   DT  I "C2'" 1 
ATOM   7769  C  "C1'" . DT  I  5 86  ? -62.109 -13.379 61.830  1.00 119.84 ? 13   DT  I "C1'" 1 
ATOM   7770  N  N1    . DT  I  5 86  ? -61.878 -14.648 61.062  1.00 119.47 ? 13   DT  I N1    1 
ATOM   7771  C  C2    . DT  I  5 86  ? -60.811 -14.696 60.186  1.00 119.28 ? 13   DT  I C2    1 
ATOM   7772  O  O2    . DT  I  5 86  ? -60.048 -13.761 60.020  1.00 118.95 ? 13   DT  I O2    1 
ATOM   7773  N  N3    . DT  I  5 86  ? -60.669 -15.890 59.511  1.00 119.34 ? 13   DT  I N3    1 
ATOM   7774  C  C4    . DT  I  5 86  ? -61.472 -17.016 59.622  1.00 119.22 ? 13   DT  I C4    1 
ATOM   7775  O  O4    . DT  I  5 86  ? -61.257 -18.036 58.972  1.00 118.80 ? 13   DT  I O4    1 
ATOM   7776  C  C5    . DT  I  5 86  ? -62.573 -16.898 60.555  1.00 119.32 ? 13   DT  I C5    1 
ATOM   7777  C  C7    . DT  I  5 86  ? -63.517 -18.045 60.763  1.00 119.40 ? 13   DT  I C7    1 
ATOM   7778  C  C6    . DT  I  5 86  ? -62.723 -15.738 61.220  1.00 119.44 ? 13   DT  I C6    1 
ATOM   7779  P  P     . DT  I  5 87  ? -63.956 -9.587  61.721  1.00 120.78 ? 14   DT  I P     1 
ATOM   7780  O  OP1   . DT  I  5 87  ? -63.982 -8.260  62.382  1.00 120.56 ? 14   DT  I OP1   1 
ATOM   7781  O  OP2   . DT  I  5 87  ? -65.191 -10.173 61.140  1.00 120.12 ? 14   DT  I OP2   1 
ATOM   7782  O  "O5'" . DT  I  5 87  ? -62.848 -9.562  60.559  1.00 120.86 ? 14   DT  I "O5'" 1 
ATOM   7783  C  "C5'" . DT  I  5 87  ? -61.466 -9.243  60.810  1.00 119.73 ? 14   DT  I "C5'" 1 
ATOM   7784  C  "C4'" . DT  I  5 87  ? -60.646 -9.250  59.526  1.00 118.90 ? 14   DT  I "C4'" 1 
ATOM   7785  O  "O4'" . DT  I  5 87  ? -60.481 -10.605 59.037  1.00 119.13 ? 14   DT  I "O4'" 1 
ATOM   7786  C  "C3'" . DT  I  5 87  ? -61.215 -8.438  58.367  1.00 118.64 ? 14   DT  I "C3'" 1 
ATOM   7787  O  "O3'" . DT  I  5 87  ? -60.182 -7.582  57.879  1.00 118.30 ? 14   DT  I "O3'" 1 
ATOM   7788  C  "C2'" . DT  I  5 87  ? -61.699 -9.490  57.361  1.00 118.65 ? 14   DT  I "C2'" 1 
ATOM   7789  C  "C1'" . DT  I  5 87  ? -60.796 -10.678 57.657  1.00 118.83 ? 14   DT  I "C1'" 1 
ATOM   7790  N  N1    . DT  I  5 87  ? -61.380 -12.041 57.347  1.00 118.72 ? 14   DT  I N1    1 
ATOM   7791  C  C2    . DT  I  5 87  ? -60.729 -12.867 56.441  1.00 119.09 ? 14   DT  I C2    1 
ATOM   7792  O  O2    . DT  I  5 87  ? -59.703 -12.572 55.848  1.00 119.30 ? 14   DT  I O2    1 
ATOM   7793  N  N3    . DT  I  5 87  ? -61.327 -14.085 56.230  1.00 119.17 ? 14   DT  I N3    1 
ATOM   7794  C  C4    . DT  I  5 87  ? -62.477 -14.566 56.819  1.00 118.87 ? 14   DT  I C4    1 
ATOM   7795  O  O4    . DT  I  5 87  ? -62.912 -15.679 56.548  1.00 118.66 ? 14   DT  I O4    1 
ATOM   7796  C  C5    . DT  I  5 87  ? -63.110 -13.667 57.761  1.00 119.06 ? 14   DT  I C5    1 
ATOM   7797  C  C7    . DT  I  5 87  ? -64.374 -14.076 58.463  1.00 118.99 ? 14   DT  I C7    1 
ATOM   7798  C  C6    . DT  I  5 87  ? -62.539 -12.468 57.977  1.00 118.81 ? 14   DT  I C6    1 
ATOM   7799  P  P     . DC  I  5 88  ? -60.263 -6.737  56.511  1.00 118.44 ? 15   DC  I P     1 
ATOM   7800  O  OP1   . DC  I  5 88  ? -59.437 -5.518  56.704  1.00 118.34 ? 15   DC  I OP1   1 
ATOM   7801  O  OP2   . DC  I  5 88  ? -61.664 -6.630  56.024  1.00 117.74 ? 15   DC  I OP2   1 
ATOM   7802  O  "O5'" . DC  I  5 88  ? -59.502 -7.712  55.504  1.00 117.98 ? 15   DC  I "O5'" 1 
ATOM   7803  C  "C5'" . DC  I  5 88  ? -58.142 -8.077  55.713  1.00 116.65 ? 15   DC  I "C5'" 1 
ATOM   7804  C  "C4'" . DC  I  5 88  ? -57.646 -8.800  54.475  1.00 115.62 ? 15   DC  I "C4'" 1 
ATOM   7805  O  "O4'" . DC  I  5 88  ? -58.318 -10.078 54.323  1.00 115.62 ? 15   DC  I "O4'" 1 
ATOM   7806  C  "C3'" . DC  I  5 88  ? -57.866 -8.062  53.161  1.00 114.75 ? 15   DC  I "C3'" 1 
ATOM   7807  O  "O3'" . DC  I  5 88  ? -56.730 -8.340  52.378  1.00 113.40 ? 15   DC  I "O3'" 1 
ATOM   7808  C  "C2'" . DC  I  5 88  ? -59.126 -8.710  52.585  1.00 115.08 ? 15   DC  I "C2'" 1 
ATOM   7809  C  "C1'" . DC  I  5 88  ? -58.955 -10.152 53.060  1.00 116.05 ? 15   DC  I "C1'" 1 
ATOM   7810  N  N1    . DC  I  5 88  ? -60.205 -10.983 53.222  1.00 116.61 ? 15   DC  I N1    1 
ATOM   7811  C  C2    . DC  I  5 88  ? -60.238 -12.298 52.704  1.00 116.91 ? 15   DC  I C2    1 
ATOM   7812  O  O2    . DC  I  5 88  ? -59.256 -12.761 52.107  1.00 117.26 ? 15   DC  I O2    1 
ATOM   7813  N  N3    . DC  I  5 88  ? -61.362 -13.044 52.863  1.00 116.63 ? 15   DC  I N3    1 
ATOM   7814  C  C4    . DC  I  5 88  ? -62.413 -12.533 53.510  1.00 116.78 ? 15   DC  I C4    1 
ATOM   7815  N  N4    . DC  I  5 88  ? -63.487 -13.314 53.637  1.00 116.83 ? 15   DC  I N4    1 
ATOM   7816  C  C5    . DC  I  5 88  ? -62.408 -11.204 54.051  1.00 117.01 ? 15   DC  I C5    1 
ATOM   7817  C  C6    . DC  I  5 88  ? -61.294 -10.474 53.887  1.00 116.69 ? 15   DC  I C6    1 
ATOM   7818  P  P     . DC  I  5 89  ? -56.201 -7.360  51.237  1.00 111.62 ? 16   DC  I P     1 
ATOM   7819  O  OP1   . DC  I  5 89  ? -55.580 -6.197  51.912  1.00 111.43 ? 16   DC  I OP1   1 
ATOM   7820  O  OP2   . DC  I  5 89  ? -57.286 -7.158  50.242  1.00 111.00 ? 16   DC  I OP2   1 
ATOM   7821  O  "O5'" . DC  I  5 89  ? -55.052 -8.258  50.560  1.00 110.26 ? 16   DC  I "O5'" 1 
ATOM   7822  C  "C5'" . DC  I  5 89  ? -54.905 -9.652  50.868  1.00 108.15 ? 16   DC  I "C5'" 1 
ATOM   7823  C  "C4'" . DC  I  5 89  ? -55.179 -10.569 49.682  1.00 106.85 ? 16   DC  I "C4'" 1 
ATOM   7824  O  "O4'" . DC  I  5 89  ? -56.491 -11.176 49.806  1.00 106.70 ? 16   DC  I "O4'" 1 
ATOM   7825  C  "C3'" . DC  I  5 89  ? -55.157 -9.954  48.282  1.00 105.97 ? 16   DC  I "C3'" 1 
ATOM   7826  O  "O3'" . DC  I  5 89  ? -54.641 -10.918 47.373  1.00 104.40 ? 16   DC  I "O3'" 1 
ATOM   7827  C  "C2'" . DC  I  5 89  ? -56.635 -9.746  47.995  1.00 106.66 ? 16   DC  I "C2'" 1 
ATOM   7828  C  "C1'" . DC  I  5 89  ? -57.135 -11.074 48.552  1.00 107.47 ? 16   DC  I "C1'" 1 
ATOM   7829  N  N1    . DC  I  5 89  ? -58.620 -11.219 48.723  1.00 108.28 ? 16   DC  I N1    1 
ATOM   7830  C  C2    . DC  I  5 89  ? -59.256 -12.401 48.290  1.00 108.69 ? 16   DC  I C2    1 
ATOM   7831  O  O2    . DC  I  5 89  ? -58.605 -13.319 47.765  1.00 108.46 ? 16   DC  I O2    1 
ATOM   7832  N  N3    . DC  I  5 89  ? -60.597 -12.512 48.464  1.00 108.66 ? 16   DC  I N3    1 
ATOM   7833  C  C4    . DC  I  5 89  ? -61.287 -11.524 49.030  1.00 108.10 ? 16   DC  I C4    1 
ATOM   7834  N  N4    . DC  I  5 89  ? -62.598 -11.706 49.166  1.00 108.38 ? 16   DC  I N4    1 
ATOM   7835  C  C5    . DC  I  5 89  ? -60.670 -10.318 49.477  1.00 108.29 ? 16   DC  I C5    1 
ATOM   7836  C  C6    . DC  I  5 89  ? -59.348 -10.213 49.305  1.00 108.31 ? 16   DC  I C6    1 
ATOM   7837  P  P     . DC  I  5 90  ? -53.194 -10.805 46.703  1.00 102.01 ? 17   DC  I P     1 
ATOM   7838  O  OP1   . DC  I  5 90  ? -52.268 -10.163 47.668  1.00 100.35 ? 17   DC  I OP1   1 
ATOM   7839  O  OP2   . DC  I  5 90  ? -53.396 -10.232 45.352  1.00 102.00 ? 17   DC  I OP2   1 
ATOM   7840  O  "O5'" . DC  I  5 90  ? -52.793 -12.336 46.469  1.00 102.21 ? 17   DC  I "O5'" 1 
ATOM   7841  C  "C5'" . DC  I  5 90  ? -53.213 -13.373 47.356  1.00 103.00 ? 17   DC  I "C5'" 1 
ATOM   7842  C  "C4'" . DC  I  5 90  ? -53.855 -14.542 46.622  1.00 103.40 ? 17   DC  I "C4'" 1 
ATOM   7843  O  "O4'" . DC  I  5 90  ? -55.290 -14.351 46.573  1.00 104.17 ? 17   DC  I "O4'" 1 
ATOM   7844  C  "C3'" . DC  I  5 90  ? -53.416 -14.792 45.182  1.00 103.44 ? 17   DC  I "C3'" 1 
ATOM   7845  O  "O3'" . DC  I  5 90  ? -53.195 -16.173 44.999  1.00 102.59 ? 17   DC  I "O3'" 1 
ATOM   7846  C  "C2'" . DC  I  5 90  ? -54.596 -14.321 44.336  1.00 103.94 ? 17   DC  I "C2'" 1 
ATOM   7847  C  "C1'" . DC  I  5 90  ? -55.779 -14.554 45.262  1.00 104.69 ? 17   DC  I "C1'" 1 
ATOM   7848  N  N1    . DC  I  5 90  ? -56.919 -13.604 45.059  1.00 105.36 ? 17   DC  I N1    1 
ATOM   7849  C  C2    . DC  I  5 90  ? -58.211 -14.098 44.820  1.00 105.26 ? 17   DC  I C2    1 
ATOM   7850  O  O2    . DC  I  5 90  ? -58.389 -15.320 44.772  1.00 105.30 ? 17   DC  I O2    1 
ATOM   7851  N  N3    . DC  I  5 90  ? -59.231 -13.211 44.646  1.00 105.29 ? 17   DC  I N3    1 
ATOM   7852  C  C4    . DC  I  5 90  ? -58.994 -11.893 44.705  1.00 105.20 ? 17   DC  I C4    1 
ATOM   7853  N  N4    . DC  I  5 90  ? -60.014 -11.053 44.530  1.00 105.29 ? 17   DC  I N4    1 
ATOM   7854  C  C5    . DC  I  5 90  ? -57.691 -11.368 44.950  1.00 105.45 ? 17   DC  I C5    1 
ATOM   7855  C  C6    . DC  I  5 90  ? -56.696 -12.249 45.121  1.00 105.63 ? 17   DC  I C6    1 
ATOM   7856  P  P     . DT  I  5 91  ? -52.393 -16.725 43.735  1.00 102.23 ? 18   DT  I P     1 
ATOM   7857  O  OP1   . DT  I  5 91  ? -51.524 -17.800 44.259  1.00 102.16 ? 18   DT  I OP1   1 
ATOM   7858  O  OP2   . DT  I  5 91  ? -51.845 -15.590 42.956  1.00 101.31 ? 18   DT  I OP2   1 
ATOM   7859  O  "O5'" . DT  I  5 91  ? -53.520 -17.416 42.846  1.00 104.25 ? 18   DT  I "O5'" 1 
ATOM   7860  C  "C5'" . DT  I  5 91  ? -54.269 -18.498 43.405  1.00 107.45 ? 18   DT  I "C5'" 1 
ATOM   7861  C  "C4'" . DT  I  5 91  ? -55.542 -18.770 42.627  1.00 109.22 ? 18   DT  I "C4'" 1 
ATOM   7862  O  "O4'" . DT  I  5 91  ? -56.507 -17.694 42.765  1.00 109.38 ? 18   DT  I "O4'" 1 
ATOM   7863  C  "C3'" . DT  I  5 91  ? -55.317 -18.988 41.142  1.00 110.87 ? 18   DT  I "C3'" 1 
ATOM   7864  O  "O3'" . DT  I  5 91  ? -55.820 -20.278 40.882  1.00 114.51 ? 18   DT  I "O3'" 1 
ATOM   7865  C  "C2'" . DT  I  5 91  ? -56.116 -17.878 40.459  1.00 110.10 ? 18   DT  I "C2'" 1 
ATOM   7866  C  "C1'" . DT  I  5 91  ? -57.134 -17.457 41.521  1.00 109.08 ? 18   DT  I "C1'" 1 
ATOM   7867  N  N1    . DT  I  5 91  ? -57.580 -16.011 41.510  1.00 108.76 ? 18   DT  I N1    1 
ATOM   7868  C  C2    . DT  I  5 91  ? -58.921 -15.697 41.659  1.00 108.81 ? 18   DT  I C2    1 
ATOM   7869  O  O2    . DT  I  5 91  ? -59.808 -16.524 41.787  1.00 108.75 ? 18   DT  I O2    1 
ATOM   7870  N  N3    . DT  I  5 91  ? -59.205 -14.350 41.649  1.00 108.70 ? 18   DT  I N3    1 
ATOM   7871  C  C4    . DT  I  5 91  ? -58.309 -13.304 41.514  1.00 108.63 ? 18   DT  I C4    1 
ATOM   7872  O  O4    . DT  I  5 91  ? -58.676 -12.134 41.520  1.00 108.65 ? 18   DT  I O4    1 
ATOM   7873  C  C5    . DT  I  5 91  ? -56.926 -13.696 41.369  1.00 108.60 ? 18   DT  I C5    1 
ATOM   7874  C  C7    . DT  I  5 91  ? -55.845 -12.668 41.212  1.00 108.74 ? 18   DT  I C7    1 
ATOM   7875  C  C6    . DT  I  5 91  ? -56.639 -15.005 41.378  1.00 108.72 ? 18   DT  I C6    1 
ATOM   7876  P  P     . DT  I  5 92  ? -55.493 -21.088 39.545  1.00 117.59 ? 19   DT  I P     1 
ATOM   7877  O  OP1   . DT  I  5 92  ? -55.316 -22.499 39.963  1.00 116.98 ? 19   DT  I OP1   1 
ATOM   7878  O  OP2   . DT  I  5 92  ? -54.420 -20.397 38.786  1.00 117.24 ? 19   DT  I OP2   1 
ATOM   7879  O  "O5'" . DT  I  5 92  ? -56.866 -20.921 38.717  1.00 120.16 ? 19   DT  I "O5'" 1 
ATOM   7880  C  "C5'" . DT  I  5 92  ? -58.138 -21.250 39.313  1.00 123.26 ? 19   DT  I "C5'" 1 
ATOM   7881  C  "C4'" . DT  I  5 92  ? -59.331 -20.553 38.661  1.00 125.30 ? 19   DT  I "C4'" 1 
ATOM   7882  O  "O4'" . DT  I  5 92  ? -59.413 -19.156 39.039  1.00 125.42 ? 19   DT  I "O4'" 1 
ATOM   7883  C  "C3'" . DT  I  5 92  ? -59.425 -20.615 37.138  1.00 127.04 ? 19   DT  I "C3'" 1 
ATOM   7884  O  "O3'" . DT  I  5 92  ? -60.580 -21.384 36.787  1.00 130.11 ? 19   DT  I "O3'" 1 
ATOM   7885  C  "C2'" . DT  I  5 92  ? -59.546 -19.155 36.694  1.00 126.62 ? 19   DT  I "C2'" 1 
ATOM   7886  C  "C1'" . DT  I  5 92  ? -59.973 -18.423 37.965  1.00 125.92 ? 19   DT  I "C1'" 1 
ATOM   7887  N  N1    . DT  I  5 92  ? -59.474 -17.010 38.068  1.00 125.94 ? 19   DT  I N1    1 
ATOM   7888  C  C2    . DT  I  5 92  ? -60.343 -15.969 38.359  1.00 125.98 ? 19   DT  I C2    1 
ATOM   7889  O  O2    . DT  I  5 92  ? -61.541 -16.104 38.538  1.00 126.28 ? 19   DT  I O2    1 
ATOM   7890  N  N3    . DT  I  5 92  ? -59.751 -14.730 38.432  1.00 125.82 ? 19   DT  I N3    1 
ATOM   7891  C  C4    . DT  I  5 92  ? -58.411 -14.427 38.254  1.00 125.99 ? 19   DT  I C4    1 
ATOM   7892  O  O4    . DT  I  5 92  ? -57.994 -13.276 38.345  1.00 126.07 ? 19   DT  I O4    1 
ATOM   7893  C  C5    . DT  I  5 92  ? -57.555 -15.557 37.956  1.00 126.13 ? 19   DT  I C5    1 
ATOM   7894  C  C7    . DT  I  5 92  ? -56.078 -15.391 37.733  1.00 126.02 ? 19   DT  I C7    1 
ATOM   7895  C  C6    . DT  I  5 92  ? -58.124 -16.768 37.880  1.00 126.21 ? 19   DT  I C6    1 
ATOM   7896  P  P     . DT  I  5 93  ? -60.857 -21.929 35.301  1.00 132.22 ? 20   DT  I P     1 
ATOM   7897  O  OP1   . DT  I  5 93  ? -61.738 -23.114 35.429  1.00 131.90 ? 20   DT  I OP1   1 
ATOM   7898  O  OP2   . DT  I  5 93  ? -59.572 -22.049 34.574  1.00 132.11 ? 20   DT  I OP2   1 
ATOM   7899  O  "O5'" . DT  I  5 93  ? -61.671 -20.718 34.637  1.00 134.22 ? 20   DT  I "O5'" 1 
ATOM   7900  C  "C5'" . DT  I  5 93  ? -62.913 -20.252 35.180  1.00 137.04 ? 20   DT  I "C5'" 1 
ATOM   7901  C  "C4'" . DT  I  5 93  ? -63.497 -19.132 34.329  1.00 139.44 ? 20   DT  I "C4'" 1 
ATOM   7902  O  "O4'" . DT  I  5 93  ? -62.926 -17.861 34.733  1.00 139.91 ? 20   DT  I "O4'" 1 
ATOM   7903  C  "C3'" . DT  I  5 93  ? -63.257 -19.250 32.822  1.00 141.05 ? 20   DT  I "C3'" 1 
ATOM   7904  O  "O3'" . DT  I  5 93  ? -64.476 -19.021 32.107  1.00 143.18 ? 20   DT  I "O3'" 1 
ATOM   7905  C  "C2'" . DT  I  5 93  ? -62.205 -18.179 32.522  1.00 140.80 ? 20   DT  I "C2'" 1 
ATOM   7906  C  "C1'" . DT  I  5 93  ? -62.515 -17.132 33.590  1.00 140.36 ? 20   DT  I "C1'" 1 
ATOM   7907  N  N1    . DT  I  5 93  ? -61.366 -16.230 33.973  1.00 140.37 ? 20   DT  I N1    1 
ATOM   7908  C  C2    . DT  I  5 93  ? -61.617 -14.913 34.332  1.00 140.32 ? 20   DT  I C2    1 
ATOM   7909  O  O2    . DT  I  5 93  ? -62.728 -14.410 34.358  1.00 140.30 ? 20   DT  I O2    1 
ATOM   7910  N  N3    . DT  I  5 93  ? -60.501 -14.184 34.667  1.00 140.23 ? 20   DT  I N3    1 
ATOM   7911  C  C4    . DT  I  5 93  ? -59.188 -14.623 34.681  1.00 140.20 ? 20   DT  I C4    1 
ATOM   7912  O  O4    . DT  I  5 93  ? -58.266 -13.878 34.998  1.00 140.18 ? 20   DT  I O4    1 
ATOM   7913  C  C5    . DT  I  5 93  ? -58.991 -16.006 34.298  1.00 140.25 ? 20   DT  I C5    1 
ATOM   7914  C  C7    . DT  I  5 93  ? -57.617 -16.610 34.267  1.00 140.39 ? 20   DT  I C7    1 
ATOM   7915  C  C6    . DT  I  5 93  ? -60.072 -16.730 33.970  1.00 140.27 ? 20   DT  I C6    1 
ATOM   7916  P  P     . DG  I  5 94  ? -64.709 -19.576 30.617  1.00 144.84 ? 21   DG  I P     1 
ATOM   7917  O  OP1   . DG  I  5 94  ? -65.957 -20.374 30.652  1.00 145.12 ? 21   DG  I OP1   1 
ATOM   7918  O  OP2   . DG  I  5 94  ? -63.455 -20.185 30.102  1.00 144.86 ? 21   DG  I OP2   1 
ATOM   7919  O  "O5'" . DG  I  5 94  ? -64.975 -18.245 29.768  1.00 145.94 ? 21   DG  I "O5'" 1 
ATOM   7920  C  "C5'" . DG  I  5 94  ? -65.914 -17.261 30.212  1.00 147.90 ? 21   DG  I "C5'" 1 
ATOM   7921  C  "C4'" . DG  I  5 94  ? -65.542 -15.891 29.668  1.00 149.41 ? 21   DG  I "C4'" 1 
ATOM   7922  O  "O4'" . DG  I  5 94  ? -64.498 -15.302 30.489  1.00 149.82 ? 21   DG  I "O4'" 1 
ATOM   7923  C  "C3'" . DG  I  5 94  ? -65.003 -15.887 28.235  1.00 150.24 ? 21   DG  I "C3'" 1 
ATOM   7924  O  "O3'" . DG  I  5 94  ? -65.671 -14.893 27.458  1.00 150.95 ? 21   DG  I "O3'" 1 
ATOM   7925  C  "C2'" . DG  I  5 94  ? -63.516 -15.576 28.401  1.00 150.33 ? 21   DG  I "C2'" 1 
ATOM   7926  C  "C1'" . DG  I  5 94  ? -63.586 -14.663 29.618  1.00 150.56 ? 21   DG  I "C1'" 1 
ATOM   7927  N  N9    . DG  I  5 94  ? -62.313 -14.405 30.297  1.00 150.78 ? 21   DG  I N9    1 
ATOM   7928  C  C8    . DG  I  5 94  ? -61.305 -15.297 30.590  1.00 150.74 ? 21   DG  I C8    1 
ATOM   7929  N  N7    . DG  I  5 94  ? -60.292 -14.751 31.207  1.00 150.75 ? 21   DG  I N7    1 
ATOM   7930  C  C5    . DG  I  5 94  ? -60.648 -13.413 31.331  1.00 150.75 ? 21   DG  I C5    1 
ATOM   7931  C  C6    . DG  I  5 94  ? -59.950 -12.324 31.915  1.00 150.72 ? 21   DG  I C6    1 
ATOM   7932  O  O6    . DG  I  5 94  ? -58.836 -12.331 32.454  1.00 150.62 ? 21   DG  I O6    1 
ATOM   7933  N  N1    . DG  I  5 94  ? -60.669 -11.128 31.826  1.00 150.78 ? 21   DG  I N1    1 
ATOM   7934  C  C2    . DG  I  5 94  ? -61.912 -11.001 31.247  1.00 150.64 ? 21   DG  I C2    1 
ATOM   7935  N  N2    . DG  I  5 94  ? -62.455 -9.777  31.253  1.00 150.65 ? 21   DG  I N2    1 
ATOM   7936  N  N3    . DG  I  5 94  ? -62.576 -12.010 30.699  1.00 150.56 ? 21   DG  I N3    1 
ATOM   7937  C  C4    . DG  I  5 94  ? -61.889 -13.183 30.774  1.00 150.77 ? 21   DG  I C4    1 
ATOM   7938  P  P     . DA  I  5 95  ? -65.898 -15.104 25.885  1.00 151.60 ? 22   DA  I P     1 
ATOM   7939  O  OP1   . DA  I  5 95  ? -66.771 -13.995 25.425  1.00 151.37 ? 22   DA  I OP1   1 
ATOM   7940  O  OP2   . DA  I  5 95  ? -66.319 -16.508 25.655  1.00 151.25 ? 22   DA  I OP2   1 
ATOM   7941  O  "O5'" . DA  I  5 95  ? -64.414 -14.944 25.290  1.00 151.60 ? 22   DA  I "O5'" 1 
ATOM   7942  C  "C5'" . DA  I  5 95  ? -64.100 -13.984 24.282  1.00 151.59 ? 22   DA  I "C5'" 1 
ATOM   7943  C  "C4'" . DA  I  5 95  ? -63.883 -12.603 24.883  1.00 151.61 ? 22   DA  I "C4'" 1 
ATOM   7944  O  "O4'" . DA  I  5 95  ? -63.215 -12.702 26.171  1.00 152.00 ? 22   DA  I "O4'" 1 
ATOM   7945  C  "C3'" . DA  I  5 95  ? -63.036 -11.678 24.018  1.00 151.48 ? 22   DA  I "C3'" 1 
ATOM   7946  O  "O3'" . DA  I  5 95  ? -63.670 -10.401 23.920  1.00 150.51 ? 22   DA  I "O3'" 1 
ATOM   7947  C  "C2'" . DA  I  5 95  ? -61.705 -11.597 24.766  1.00 151.88 ? 22   DA  I "C2'" 1 
ATOM   7948  C  "C1'" . DA  I  5 95  ? -62.124 -11.801 26.217  1.00 152.10 ? 22   DA  I "C1'" 1 
ATOM   7949  N  N9    . DA  I  5 95  ? -61.040 -12.344 27.040  1.00 152.15 ? 22   DA  I N9    1 
ATOM   7950  C  C8    . DA  I  5 95  ? -60.744 -13.664 27.257  1.00 152.12 ? 22   DA  I C8    1 
ATOM   7951  N  N7    . DA  I  5 95  ? -59.708 -13.863 28.035  1.00 152.04 ? 22   DA  I N7    1 
ATOM   7952  C  C5    . DA  I  5 95  ? -59.287 -12.583 28.350  1.00 152.08 ? 22   DA  I C5    1 
ATOM   7953  C  C6    . DA  I  5 95  ? -58.225 -12.102 29.146  1.00 152.10 ? 22   DA  I C6    1 
ATOM   7954  N  N6    . DA  I  5 95  ? -57.376 -12.909 29.788  1.00 152.08 ? 22   DA  I N6    1 
ATOM   7955  N  N1    . DA  I  5 95  ? -58.074 -10.762 29.261  1.00 152.13 ? 22   DA  I N1    1 
ATOM   7956  C  C2    . DA  I  5 95  ? -58.934 -9.959  28.617  1.00 152.12 ? 22   DA  I C2    1 
ATOM   7957  N  N3    . DA  I  5 95  ? -59.968 -10.295 27.840  1.00 152.12 ? 22   DA  I N3    1 
ATOM   7958  C  C4    . DA  I  5 95  ? -60.094 -11.633 27.746  1.00 152.10 ? 22   DA  I C4    1 
ATOM   7959  P  P     . DT  I  5 96  ? -64.007 -9.769  22.484  1.00 149.47 ? 23   DT  I P     1 
ATOM   7960  O  OP1   . DT  I  5 96  ? -65.136 -10.545 21.918  1.00 149.47 ? 23   DT  I OP1   1 
ATOM   7961  O  OP2   . DT  I  5 96  ? -62.738 -9.656  21.723  1.00 149.13 ? 23   DT  I OP2   1 
ATOM   7962  O  "O5'" . DT  I  5 96  ? -64.526 -8.285  22.824  1.00 148.17 ? 23   DT  I "O5'" 1 
ATOM   7963  C  "C5'" . DT  I  5 96  ? -64.228 -7.614  24.062  1.00 146.07 ? 23   DT  I "C5'" 1 
ATOM   7964  C  "C4'" . DT  I  5 96  ? -62.952 -6.780  24.013  1.00 144.47 ? 23   DT  I "C4'" 1 
ATOM   7965  O  "O4'" . DT  I  5 96  ? -61.872 -7.500  24.660  1.00 144.20 ? 23   DT  I "O4'" 1 
ATOM   7966  C  "C3'" . DT  I  5 96  ? -62.435 -6.387  22.624  1.00 143.38 ? 23   DT  I "C3'" 1 
ATOM   7967  O  "O3'" . DT  I  5 96  ? -62.682 -4.975  22.397  1.00 141.47 ? 23   DT  I "O3'" 1 
ATOM   7968  C  "C2'" . DT  I  5 96  ? -60.966 -6.835  22.617  1.00 143.64 ? 23   DT  I "C2'" 1 
ATOM   7969  C  "C1'" . DT  I  5 96  ? -60.655 -7.070  24.093  1.00 143.99 ? 23   DT  I "C1'" 1 
ATOM   7970  N  N1    . DT  I  5 96  ? -59.581 -8.091  24.395  1.00 143.99 ? 23   DT  I N1    1 
ATOM   7971  C  C2    . DT  I  5 96  ? -58.754 -7.904  25.491  1.00 144.04 ? 23   DT  I C2    1 
ATOM   7972  O  O2    . DT  I  5 96  ? -58.828 -6.953  26.249  1.00 144.11 ? 23   DT  I O2    1 
ATOM   7973  N  N3    . DT  I  5 96  ? -57.812 -8.884  25.681  1.00 144.18 ? 23   DT  I N3    1 
ATOM   7974  C  C4    . DT  I  5 96  ? -57.610 -10.015 24.908  1.00 144.24 ? 23   DT  I C4    1 
ATOM   7975  O  O4    . DT  I  5 96  ? -56.730 -10.827 25.179  1.00 144.14 ? 23   DT  I O4    1 
ATOM   7976  C  C5    . DT  I  5 96  ? -58.502 -10.160 23.775  1.00 144.20 ? 23   DT  I C5    1 
ATOM   7977  C  C7    . DT  I  5 96  ? -58.389 -11.342 22.852  1.00 143.95 ? 23   DT  I C7    1 
ATOM   7978  C  C6    . DT  I  5 96  ? -59.428 -9.204  23.580  1.00 144.14 ? 23   DT  I C6    1 
ATOM   7979  P  P     . DA  I  5 97  ? -61.607 -3.885  21.901  1.00 139.96 ? 24   DA  I P     1 
ATOM   7980  O  OP1   . DA  I  5 97  ? -62.348 -2.652  21.529  1.00 139.85 ? 24   DA  I OP1   1 
ATOM   7981  O  OP2   . DA  I  5 97  ? -60.695 -4.509  20.907  1.00 139.86 ? 24   DA  I OP2   1 
ATOM   7982  O  "O5'" . DA  I  5 97  ? -60.779 -3.607  23.247  1.00 137.83 ? 24   DA  I "O5'" 1 
ATOM   7983  C  "C5'" . DA  I  5 97  ? -60.424 -2.284  23.665  1.00 133.97 ? 24   DA  I "C5'" 1 
ATOM   7984  C  "C4'" . DA  I  5 97  ? -58.912 -2.135  23.762  1.00 131.10 ? 24   DA  I "C4'" 1 
ATOM   7985  O  "O4'" . DA  I  5 97  ? -58.247 -3.395  24.076  1.00 130.48 ? 24   DA  I "O4'" 1 
ATOM   7986  C  "C3'" . DA  I  5 97  ? -58.232 -1.599  22.508  1.00 129.03 ? 24   DA  I "C3'" 1 
ATOM   7987  O  "O3'" . DA  I  5 97  ? -57.281 -0.624  22.933  1.00 125.93 ? 24   DA  I "O3'" 1 
ATOM   7988  C  "C2'" . DA  I  5 97  ? -57.577 -2.845  21.910  1.00 129.36 ? 24   DA  I "C2'" 1 
ATOM   7989  C  "C1'" . DA  I  5 97  ? -57.146 -3.549  23.197  1.00 129.89 ? 24   DA  I "C1'" 1 
ATOM   7990  N  N9    . DA  I  5 97  ? -56.807 -4.969  23.080  1.00 129.80 ? 24   DA  I N9    1 
ATOM   7991  C  C8    . DA  I  5 97  ? -57.510 -5.946  22.430  1.00 129.84 ? 24   DA  I C8    1 
ATOM   7992  N  N7    . DA  I  5 97  ? -56.964 -7.138  22.496  1.00 129.94 ? 24   DA  I N7    1 
ATOM   7993  C  C5    . DA  I  5 97  ? -55.818 -6.934  23.247  1.00 130.05 ? 24   DA  I C5    1 
ATOM   7994  C  C6    . DA  I  5 97  ? -54.794 -7.804  23.686  1.00 129.76 ? 24   DA  I C6    1 
ATOM   7995  N  N6    . DA  I  5 97  ? -54.768 -9.109  23.405  1.00 129.66 ? 24   DA  I N6    1 
ATOM   7996  N  N1    . DA  I  5 97  ? -53.788 -7.278  24.420  1.00 129.73 ? 24   DA  I N1    1 
ATOM   7997  C  C2    . DA  I  5 97  ? -53.803 -5.968  24.701  1.00 129.73 ? 24   DA  I C2    1 
ATOM   7998  N  N3    . DA  I  5 97  ? -54.711 -5.054  24.349  1.00 129.89 ? 24   DA  I N3    1 
ATOM   7999  C  C4    . DA  I  5 97  ? -55.704 -5.601  23.616  1.00 130.02 ? 24   DA  I C4    1 
ATOM   8000  P  P     . DG  I  5 98  ? -56.499 0.328   21.915  1.00 123.37 ? 25   DG  I P     1 
ATOM   8001  O  OP1   . DG  I  5 98  ? -56.301 1.615   22.620  1.00 123.03 ? 25   DG  I OP1   1 
ATOM   8002  O  OP2   . DG  I  5 98  ? -57.167 0.278   20.593  1.00 123.23 ? 25   DG  I OP2   1 
ATOM   8003  O  "O5'" . DG  I  5 98  ? -55.096 -0.419  21.720  1.00 121.86 ? 25   DG  I "O5'" 1 
ATOM   8004  C  "C5'" . DG  I  5 98  ? -53.979 -0.231  22.591  1.00 118.31 ? 25   DG  I "C5'" 1 
ATOM   8005  C  "C4'" . DG  I  5 98  ? -52.849 -1.155  22.175  1.00 115.56 ? 25   DG  I "C4'" 1 
ATOM   8006  O  "O4'" . DG  I  5 98  ? -53.349 -2.509  22.057  1.00 115.10 ? 25   DG  I "O4'" 1 
ATOM   8007  C  "C3'" . DG  I  5 98  ? -52.205 -0.832  20.822  1.00 113.97 ? 25   DG  I "C3'" 1 
ATOM   8008  O  "O3'" . DG  I  5 98  ? -50.788 -0.708  20.959  1.00 110.86 ? 25   DG  I "O3'" 1 
ATOM   8009  C  "C2'" . DG  I  5 98  ? -52.561 -2.037  19.950  1.00 114.73 ? 25   DG  I "C2'" 1 
ATOM   8010  C  "C1'" . DG  I  5 98  ? -52.592 -3.108  21.032  1.00 116.12 ? 25   DG  I "C1'" 1 
ATOM   8011  N  N9    . DG  I  5 98  ? -53.149 -4.416  20.677  1.00 116.58 ? 25   DG  I N9    1 
ATOM   8012  C  C8    . DG  I  5 98  ? -54.219 -4.703  19.859  1.00 116.75 ? 25   DG  I C8    1 
ATOM   8013  N  N7    . DG  I  5 98  ? -54.460 -5.983  19.750  1.00 117.00 ? 25   DG  I N7    1 
ATOM   8014  C  C5    . DG  I  5 98  ? -53.486 -6.586  20.548  1.00 116.97 ? 25   DG  I C5    1 
ATOM   8015  C  C6    . DG  I  5 98  ? -53.228 -7.957  20.835  1.00 116.68 ? 25   DG  I C6    1 
ATOM   8016  O  O6    . DG  I  5 98  ? -53.831 -8.956  20.424  1.00 116.72 ? 25   DG  I O6    1 
ATOM   8017  N  N1    . DG  I  5 98  ? -52.143 -8.137  21.695  1.00 116.57 ? 25   DG  I N1    1 
ATOM   8018  C  C2    . DG  I  5 98  ? -51.386 -7.115  22.220  1.00 116.73 ? 25   DG  I C2    1 
ATOM   8019  N  N2    . DG  I  5 98  ? -50.375 -7.468  23.031  1.00 116.64 ? 25   DG  I N2    1 
ATOM   8020  N  N3    . DG  I  5 98  ? -51.616 -5.829  21.964  1.00 117.05 ? 25   DG  I N3    1 
ATOM   8021  C  C4    . DG  I  5 98  ? -52.673 -5.633  21.124  1.00 116.89 ? 25   DG  I C4    1 
ATOM   8022  P  P     . DC  I  5 99  ? -50.079 0.647   21.430  1.00 108.48 ? 26   DC  I P     1 
ATOM   8023  O  OP1   . DC  I  5 99  ? -50.965 1.316   22.412  1.00 108.17 ? 26   DC  I OP1   1 
ATOM   8024  O  OP2   . DC  I  5 99  ? -49.622 1.342   20.206  1.00 108.15 ? 26   DC  I OP2   1 
ATOM   8025  O  "O5'" . DC  I  5 99  ? -48.768 0.151   22.205  1.00 107.81 ? 26   DC  I "O5'" 1 
ATOM   8026  C  "C5'" . DC  I  5 99  ? -48.851 -0.386  23.540  1.00 106.09 ? 26   DC  I "C5'" 1 
ATOM   8027  C  "C4'" . DC  I  5 99  ? -47.940 -1.596  23.741  1.00 104.37 ? 26   DC  I "C4'" 1 
ATOM   8028  O  "O4'" . DC  I  5 99  ? -48.482 -2.778  23.083  1.00 103.60 ? 26   DC  I "O4'" 1 
ATOM   8029  C  "C3'" . DC  I  5 99  ? -46.509 -1.436  23.225  1.00 103.33 ? 26   DC  I "C3'" 1 
ATOM   8030  O  "O3'" . DC  I  5 99  ? -45.598 -1.981  24.191  1.00 101.64 ? 26   DC  I "O3'" 1 
ATOM   8031  C  "C2'" . DC  I  5 99  ? -46.512 -2.209  21.904  1.00 103.15 ? 26   DC  I "C2'" 1 
ATOM   8032  C  "C1'" . DC  I  5 99  ? -47.493 -3.333  22.235  1.00 103.66 ? 26   DC  I "C1'" 1 
ATOM   8033  N  N1    . DC  I  5 99  ? -48.174 -3.990  21.075  1.00 103.51 ? 26   DC  I N1    1 
ATOM   8034  C  C2    . DC  I  5 99  ? -48.290 -5.393  21.044  1.00 103.73 ? 26   DC  I C2    1 
ATOM   8035  O  O2    . DC  I  5 99  ? -47.835 -6.094  21.956  1.00 103.52 ? 26   DC  I O2    1 
ATOM   8036  N  N3    . DC  I  5 99  ? -48.915 -5.970  19.991  1.00 104.13 ? 26   DC  I N3    1 
ATOM   8037  C  C4    . DC  I  5 99  ? -49.416 -5.220  19.009  1.00 103.96 ? 26   DC  I C4    1 
ATOM   8038  N  N4    . DC  I  5 99  ? -50.018 -5.869  18.008  1.00 103.95 ? 26   DC  I N4    1 
ATOM   8039  C  C5    . DC  I  5 99  ? -49.311 -3.793  19.013  1.00 103.60 ? 26   DC  I C5    1 
ATOM   8040  C  C6    . DC  I  5 99  ? -48.689 -3.230  20.058  1.00 103.46 ? 26   DC  I C6    1 
ATOM   8041  P  P     . DG  I  5 100 ? -44.051 -1.561  24.220  1.00 100.50 ? 27   DG  I P     1 
ATOM   8042  O  OP1   . DG  I  5 100 ? -43.639 -1.541  25.643  1.00 101.47 ? 27   DG  I OP1   1 
ATOM   8043  O  OP2   . DG  I  5 100 ? -43.837 -0.375  23.354  1.00 100.12 ? 27   DG  I OP2   1 
ATOM   8044  O  "O5'" . DG  I  5 100 ? -43.301 -2.769  23.497  1.00 99.38  ? 27   DG  I "O5'" 1 
ATOM   8045  C  "C5'" . DG  I  5 100 ? -43.607 -4.144  23.716  1.00 96.81  ? 27   DG  I "C5'" 1 
ATOM   8046  C  "C4'" . DG  I  5 100 ? -43.094 -4.954  22.537  1.00 94.97  ? 27   DG  I "C4'" 1 
ATOM   8047  O  "O4'" . DG  I  5 100 ? -44.086 -4.937  21.481  1.00 95.36  ? 27   DG  I "O4'" 1 
ATOM   8048  C  "C3'" . DG  I  5 100 ? -41.807 -4.446  21.883  1.00 93.53  ? 27   DG  I "C3'" 1 
ATOM   8049  O  "O3'" . DG  I  5 100 ? -41.046 -5.559  21.463  1.00 90.77  ? 27   DG  I "O3'" 1 
ATOM   8050  C  "C2'" . DG  I  5 100 ? -42.315 -3.687  20.662  1.00 94.76  ? 27   DG  I "C2'" 1 
ATOM   8051  C  "C1'" . DG  I  5 100 ? -43.427 -4.646  20.268  1.00 96.75  ? 27   DG  I "C1'" 1 
ATOM   8052  N  N9    . DG  I  5 100 ? -44.413 -4.203  19.288  1.00 97.28  ? 27   DG  I N9    1 
ATOM   8053  C  C8    . DG  I  5 100 ? -44.724 -2.938  18.838  1.00 97.75  ? 27   DG  I C8    1 
ATOM   8054  N  N7    . DG  I  5 100 ? -45.680 -2.920  17.939  1.00 98.23  ? 27   DG  I N7    1 
ATOM   8055  C  C5    . DG  I  5 100 ? -46.021 -4.269  17.791  1.00 98.24  ? 27   DG  I C5    1 
ATOM   8056  C  C6    . DG  I  5 100 ? -46.988 -4.908  16.962  1.00 98.07  ? 27   DG  I C6    1 
ATOM   8057  O  O6    . DG  I  5 100 ? -47.781 -4.386  16.157  1.00 97.83  ? 27   DG  I O6    1 
ATOM   8058  N  N1    . DG  I  5 100 ? -46.987 -6.299  17.133  1.00 97.76  ? 27   DG  I N1    1 
ATOM   8059  C  C2    . DG  I  5 100 ? -46.163 -6.995  17.996  1.00 97.69  ? 27   DG  I C2    1 
ATOM   8060  N  N2    . DG  I  5 100 ? -46.295 -8.327  18.038  1.00 97.45  ? 27   DG  I N2    1 
ATOM   8061  N  N3    . DG  I  5 100 ? -45.262 -6.412  18.772  1.00 97.98  ? 27   DG  I N3    1 
ATOM   8062  C  C4    . DG  I  5 100 ? -45.246 -5.061  18.617  1.00 97.89  ? 27   DG  I C4    1 
ATOM   8063  P  P     . DC  I  5 101 ? -39.804 -6.104  22.291  1.00 87.85  ? 28   DC  I P     1 
ATOM   8064  O  OP1   . DC  I  5 101 ? -40.091 -5.927  23.729  1.00 87.27  ? 28   DC  I OP1   1 
ATOM   8065  O  OP2   . DC  I  5 101 ? -38.598 -5.529  21.656  1.00 87.59  ? 28   DC  I OP2   1 
ATOM   8066  O  "O5'" . DC  I  5 101 ? -39.752 -7.663  21.963  1.00 89.51  ? 28   DC  I "O5'" 1 
ATOM   8067  C  "C5'" . DC  I  5 101 ? -40.837 -8.555  22.216  1.00 91.81  ? 28   DC  I "C5'" 1 
ATOM   8068  C  "C4'" . DC  I  5 101 ? -40.943 -9.587  21.100  1.00 93.29  ? 28   DC  I "C4'" 1 
ATOM   8069  O  "O4'" . DC  I  5 101 ? -41.747 -9.054  20.011  1.00 93.17  ? 28   DC  I "O4'" 1 
ATOM   8070  C  "C3'" . DC  I  5 101 ? -39.613 -10.034 20.488  1.00 94.57  ? 28   DC  I "C3'" 1 
ATOM   8071  O  "O3'" . DC  I  5 101 ? -39.591 -11.453 20.273  1.00 96.96  ? 28   DC  I "O3'" 1 
ATOM   8072  C  "C2'" . DC  I  5 101 ? -39.533 -9.256  19.174  1.00 94.33  ? 28   DC  I "C2'" 1 
ATOM   8073  C  "C1'" . DC  I  5 101 ? -40.992 -8.989  18.814  1.00 94.09  ? 28   DC  I "C1'" 1 
ATOM   8074  N  N1    . DC  I  5 101 ? -41.227 -7.648  18.173  1.00 94.42  ? 28   DC  I N1    1 
ATOM   8075  C  C2    . DC  I  5 101 ? -42.243 -7.501  17.217  1.00 94.35  ? 28   DC  I C2    1 
ATOM   8076  O  O2    . DC  I  5 101 ? -42.929 -8.482  16.914  1.00 94.40  ? 28   DC  I O2    1 
ATOM   8077  N  N3    . DC  I  5 101 ? -42.445 -6.278  16.654  1.00 94.31  ? 28   DC  I N3    1 
ATOM   8078  C  C4    . DC  I  5 101 ? -41.682 -5.237  17.012  1.00 94.19  ? 28   DC  I C4    1 
ATOM   8079  N  N4    . DC  I  5 101 ? -41.911 -4.054  16.435  1.00 94.53  ? 28   DC  I N4    1 
ATOM   8080  C  C5    . DC  I  5 101 ? -40.641 -5.362  17.978  1.00 94.10  ? 28   DC  I C5    1 
ATOM   8081  C  C6    . DC  I  5 101 ? -40.455 -6.569  18.525  1.00 94.36  ? 28   DC  I C6    1 
ATOM   8082  P  P     . DA  I  5 102 ? -38.270 -12.244 19.805  1.00 98.26  ? 29   DA  I P     1 
ATOM   8083  O  OP1   . DA  I  5 102 ? -37.914 -13.124 20.941  1.00 98.86  ? 29   DA  I OP1   1 
ATOM   8084  O  OP2   . DA  I  5 102 ? -37.250 -11.315 19.258  1.00 97.40  ? 29   DA  I OP2   1 
ATOM   8085  O  "O5'" . DA  I  5 102 ? -38.782 -13.138 18.571  1.00 100.59 ? 29   DA  I "O5'" 1 
ATOM   8086  C  "C5'" . DA  I  5 102 ? -40.101 -13.029 18.012  1.00 102.96 ? 29   DA  I "C5'" 1 
ATOM   8087  C  "C4'" . DA  I  5 102 ? -40.063 -12.773 16.512  1.00 104.87 ? 29   DA  I "C4'" 1 
ATOM   8088  O  "O4'" . DA  I  5 102 ? -40.278 -11.359 16.270  1.00 105.38 ? 29   DA  I "O4'" 1 
ATOM   8089  C  "C3'" . DA  I  5 102 ? -38.771 -13.136 15.769  1.00 106.43 ? 29   DA  I "C3'" 1 
ATOM   8090  O  "O3'" . DA  I  5 102 ? -39.077 -13.822 14.549  1.00 108.82 ? 29   DA  I "O3'" 1 
ATOM   8091  C  "C2'" . DA  I  5 102 ? -38.137 -11.775 15.491  1.00 106.28 ? 29   DA  I "C2'" 1 
ATOM   8092  C  "C1'" . DA  I  5 102 ? -39.405 -10.979 15.228  1.00 106.95 ? 29   DA  I "C1'" 1 
ATOM   8093  N  N9    . DA  I  5 102 ? -39.244 -9.526  15.177  1.00 107.51 ? 29   DA  I N9    1 
ATOM   8094  C  C8    . DA  I  5 102 ? -38.283 -8.747  15.771  1.00 107.73 ? 29   DA  I C8    1 
ATOM   8095  N  N7    . DA  I  5 102 ? -38.406 -7.463  15.523  1.00 107.81 ? 29   DA  I N7    1 
ATOM   8096  C  C5    . DA  I  5 102 ? -39.529 -7.401  14.706  1.00 107.88 ? 29   DA  I C5    1 
ATOM   8097  C  C6    . DA  I  5 102 ? -40.207 -6.330  14.089  1.00 107.64 ? 29   DA  I C6    1 
ATOM   8098  N  N6    . DA  I  5 102 ? -39.823 -5.057  14.210  1.00 107.76 ? 29   DA  I N6    1 
ATOM   8099  N  N1    . DA  I  5 102 ? -41.294 -6.611  13.337  1.00 107.54 ? 29   DA  I N1    1 
ATOM   8100  C  C2    . DA  I  5 102 ? -41.688 -7.884  13.212  1.00 107.51 ? 29   DA  I C2    1 
ATOM   8101  N  N3    . DA  I  5 102 ? -41.134 -8.972  13.740  1.00 107.63 ? 29   DA  I N3    1 
ATOM   8102  C  C4    . DA  I  5 102 ? -40.056 -8.660  14.485  1.00 107.65 ? 29   DA  I C4    1 
ATOM   8103  P  P     . DG  I  5 103 ? -37.945 -14.493 13.622  1.00 109.98 ? 30   DG  I P     1 
ATOM   8104  O  OP1   . DG  I  5 103 ? -37.535 -15.712 14.342  1.00 109.95 ? 30   DG  I OP1   1 
ATOM   8105  O  OP2   . DG  I  5 103 ? -36.935 -13.486 13.213  1.00 108.97 ? 30   DG  I OP2   1 
ATOM   8106  O  "O5'" . DG  I  5 103 ? -38.737 -14.911 12.294  1.00 111.80 ? 30   DG  I "O5'" 1 
ATOM   8107  C  "C5'" . DG  I  5 103 ? -40.164 -14.799 12.179  1.00 113.78 ? 30   DG  I "C5'" 1 
ATOM   8108  C  "C4'" . DG  I  5 103 ? -40.594 -14.256 10.818  1.00 115.15 ? 30   DG  I "C4'" 1 
ATOM   8109  O  "O4'" . DG  I  5 103 ? -40.841 -12.827 10.891  1.00 115.66 ? 30   DG  I "O4'" 1 
ATOM   8110  C  "C3'" . DG  I  5 103 ? -39.618 -14.448 9.664   1.00 115.89 ? 30   DG  I "C3'" 1 
ATOM   8111  O  "O3'" . DG  I  5 103 ? -40.376 -14.756 8.508   1.00 117.56 ? 30   DG  I "O3'" 1 
ATOM   8112  C  "C2'" . DG  I  5 103 ? -38.929 -13.092 9.542   1.00 115.93 ? 30   DG  I "C2'" 1 
ATOM   8113  C  "C1'" . DG  I  5 103 ? -40.049 -12.138 9.943   1.00 116.46 ? 30   DG  I "C1'" 1 
ATOM   8114  N  N9    . DG  I  5 103 ? -39.588 -10.894 10.559  1.00 116.73 ? 30   DG  I N9    1 
ATOM   8115  C  C8    . DG  I  5 103 ? -38.857 -10.766 11.717  1.00 116.80 ? 30   DG  I C8    1 
ATOM   8116  N  N7    . DG  I  5 103 ? -38.580 -9.534  12.036  1.00 116.78 ? 30   DG  I N7    1 
ATOM   8117  C  C5    . DG  I  5 103 ? -39.174 -8.787  11.031  1.00 116.81 ? 30   DG  I C5    1 
ATOM   8118  C  C6    . DG  I  5 103 ? -39.210 -7.382  10.850  1.00 116.84 ? 30   DG  I C6    1 
ATOM   8119  O  O6    . DG  I  5 103 ? -38.707 -6.506  11.570  1.00 116.56 ? 30   DG  I O6    1 
ATOM   8120  N  N1    . DG  I  5 103 ? -39.918 -7.030  9.697   1.00 116.94 ? 30   DG  I N1    1 
ATOM   8121  C  C2    . DG  I  5 103 ? -40.514 -7.928  8.830   1.00 116.79 ? 30   DG  I C2    1 
ATOM   8122  N  N2    . DG  I  5 103 ? -41.152 -7.402  7.772   1.00 116.82 ? 30   DG  I N2    1 
ATOM   8123  N  N3    . DG  I  5 103 ? -40.486 -9.248  8.990   1.00 116.49 ? 30   DG  I N3    1 
ATOM   8124  C  C4    . DG  I  5 103 ? -39.801 -9.607  10.110  1.00 116.81 ? 30   DG  I C4    1 
ATOM   8125  P  P     . DT  I  5 104 ? -39.700 -15.338 7.181   1.00 119.03 ? 31   DT  I P     1 
ATOM   8126  O  OP1   . DT  I  5 104 ? -40.760 -16.086 6.456   1.00 118.96 ? 31   DT  I OP1   1 
ATOM   8127  O  OP2   . DT  I  5 104 ? -38.446 -16.030 7.567   1.00 119.07 ? 31   DT  I OP2   1 
ATOM   8128  O  "O5'" . DT  I  5 104 ? -39.311 -14.017 6.355   1.00 119.58 ? 31   DT  I "O5'" 1 
ATOM   8129  C  "C5'" . DT  I  5 104 ? -40.302 -13.388 5.533   1.00 120.86 ? 31   DT  I "C5'" 1 
ATOM   8130  C  "C4'" . DT  I  5 104 ? -39.853 -12.074 4.909   1.00 121.42 ? 31   DT  I "C4'" 1 
ATOM   8131  O  "O4'" . DT  I  5 104 ? -39.573 -11.085 5.932   1.00 121.45 ? 31   DT  I "O4'" 1 
ATOM   8132  C  "C3'" . DT  I  5 104 ? -38.613 -12.147 4.024   1.00 122.22 ? 31   DT  I "C3'" 1 
ATOM   8133  O  "O3'" . DT  I  5 104 ? -38.956 -11.661 2.735   1.00 124.29 ? 31   DT  I "O3'" 1 
ATOM   8134  C  "C2'" . DT  I  5 104 ? -37.616 -11.214 4.699   1.00 121.69 ? 31   DT  I "C2'" 1 
ATOM   8135  C  "C1'" . DT  I  5 104 ? -38.536 -10.262 5.455   1.00 121.20 ? 31   DT  I "C1'" 1 
ATOM   8136  N  N1    . DT  I  5 104 ? -37.876 -9.544  6.596   1.00 121.20 ? 31   DT  I N1    1 
ATOM   8137  C  C2    . DT  I  5 104 ? -37.879 -8.160  6.612   1.00 121.07 ? 31   DT  I C2    1 
ATOM   8138  O  O2    . DT  I  5 104 ? -38.398 -7.471  5.751   1.00 120.92 ? 31   DT  I O2    1 
ATOM   8139  N  N3    . DT  I  5 104 ? -37.242 -7.597  7.694   1.00 121.38 ? 31   DT  I N3    1 
ATOM   8140  C  C4    . DT  I  5 104 ? -36.615 -8.261  8.739   1.00 121.20 ? 31   DT  I C4    1 
ATOM   8141  O  O4    . DT  I  5 104 ? -36.076 -7.656  9.658   1.00 121.03 ? 31   DT  I O4    1 
ATOM   8142  C  C5    . DT  I  5 104 ? -36.645 -9.705  8.665   1.00 121.14 ? 31   DT  I C5    1 
ATOM   8143  C  C7    . DT  I  5 104 ? -35.998 -10.533 9.737   1.00 121.01 ? 31   DT  I C7    1 
ATOM   8144  C  C6    . DT  I  5 104 ? -37.267 -10.269 7.614   1.00 121.17 ? 31   DT  I C6    1 
ATOM   8145  P  P     . DT  I  5 105 ? -38.098 -12.001 1.420   1.00 125.30 ? 32   DT  I P     1 
ATOM   8146  O  OP1   . DT  I  5 105 ? -39.083 -12.487 0.425   1.00 125.29 ? 32   DT  I OP1   1 
ATOM   8147  O  OP2   . DT  I  5 105 ? -36.932 -12.845 1.782   1.00 124.88 ? 32   DT  I OP2   1 
ATOM   8148  O  "O5'" . DT  I  5 105 ? -37.525 -10.576 0.946   1.00 126.06 ? 32   DT  I "O5'" 1 
ATOM   8149  C  "C5'" . DT  I  5 105 ? -38.287 -9.357  1.081   1.00 127.90 ? 32   DT  I "C5'" 1 
ATOM   8150  C  "C4'" . DT  I  5 105 ? -37.411 -8.136  0.835   1.00 129.52 ? 32   DT  I "C4'" 1 
ATOM   8151  O  "O4'" . DT  I  5 105 ? -36.985 -7.561  2.103   1.00 129.83 ? 32   DT  I "O4'" 1 
ATOM   8152  C  "C3'" . DT  I  5 105 ? -36.136 -8.392  0.027   1.00 130.73 ? 32   DT  I "C3'" 1 
ATOM   8153  O  "O3'" . DT  I  5 105 ? -35.955 -7.353  -0.943  1.00 132.63 ? 32   DT  I "O3'" 1 
ATOM   8154  C  "C2'" . DT  I  5 105 ? -35.037 -8.396  1.090   1.00 130.66 ? 32   DT  I "C2'" 1 
ATOM   8155  C  "C1'" . DT  I  5 105 ? -35.576 -7.393  2.108   1.00 130.03 ? 32   DT  I "C1'" 1 
ATOM   8156  N  N1    . DT  I  5 105 ? -35.026 -7.564  3.508   1.00 130.02 ? 32   DT  I N1    1 
ATOM   8157  C  C2    . DT  I  5 105 ? -34.685 -6.444  4.252   1.00 129.86 ? 32   DT  I C2    1 
ATOM   8158  O  O2    . DT  I  5 105 ? -34.801 -5.297  3.850   1.00 129.65 ? 32   DT  I O2    1 
ATOM   8159  N  N3    . DT  I  5 105 ? -34.197 -6.721  5.509   1.00 129.85 ? 32   DT  I N3    1 
ATOM   8160  C  C4    . DT  I  5 105 ? -34.014 -7.966  6.091   1.00 129.75 ? 32   DT  I C4    1 
ATOM   8161  O  O4    . DT  I  5 105 ? -33.569 -8.087  7.230   1.00 129.64 ? 32   DT  I O4    1 
ATOM   8162  C  C5    . DT  I  5 105 ? -34.382 -9.093  5.262   1.00 129.73 ? 32   DT  I C5    1 
ATOM   8163  C  C7    . DT  I  5 105 ? -34.230 -10.501 5.762   1.00 129.79 ? 32   DT  I C7    1 
ATOM   8164  C  C6    . DT  I  5 105 ? -34.862 -8.840  4.034   1.00 129.88 ? 32   DT  I C6    1 
ATOM   8165  P  P     . DT  I  5 106 ? -34.646 -7.236  -1.868  1.00 133.88 ? 33   DT  I P     1 
ATOM   8166  O  OP1   . DT  I  5 106 ? -35.049 -6.484  -3.081  1.00 133.78 ? 33   DT  I OP1   1 
ATOM   8167  O  OP2   . DT  I  5 106 ? -34.015 -8.573  -1.996  1.00 133.36 ? 33   DT  I OP2   1 
ATOM   8168  O  "O5'" . DT  I  5 106 ? -33.663 -6.318  -0.996  1.00 134.65 ? 33   DT  I "O5'" 1 
ATOM   8169  C  "C5'" . DT  I  5 106 ? -33.987 -4.955  -0.694  1.00 135.69 ? 33   DT  I "C5'" 1 
ATOM   8170  C  "C4'" . DT  I  5 106 ? -32.749 -4.170  -0.285  1.00 136.43 ? 33   DT  I "C4'" 1 
ATOM   8171  O  "O4'" . DT  I  5 106 ? -32.384 -4.489  1.083   1.00 136.82 ? 33   DT  I "O4'" 1 
ATOM   8172  C  "C3'" . DT  I  5 106 ? -31.503 -4.439  -1.122  1.00 136.93 ? 33   DT  I "C3'" 1 
ATOM   8173  O  "O3'" . DT  I  5 106 ? -30.821 -3.222  -1.381  1.00 137.42 ? 33   DT  I "O3'" 1 
ATOM   8174  C  "C2'" . DT  I  5 106 ? -30.659 -5.370  -0.257  1.00 136.93 ? 33   DT  I "C2'" 1 
ATOM   8175  C  "C1'" . DT  I  5 106 ? -31.036 -4.923  1.152   1.00 136.71 ? 33   DT  I "C1'" 1 
ATOM   8176  N  N1    . DT  I  5 106 ? -30.935 -5.991  2.211   1.00 136.79 ? 33   DT  I N1    1 
ATOM   8177  C  C2    . DT  I  5 106 ? -30.941 -5.624  3.550   1.00 136.66 ? 33   DT  I C2    1 
ATOM   8178  O  O2    . DT  I  5 106 ? -31.019 -4.469  3.940   1.00 136.57 ? 33   DT  I O2    1 
ATOM   8179  N  N3    . DT  I  5 106 ? -30.846 -6.675  4.431   1.00 136.49 ? 33   DT  I N3    1 
ATOM   8180  C  C4    . DT  I  5 106 ? -30.752 -8.021  4.118   1.00 136.53 ? 33   DT  I C4    1 
ATOM   8181  O  O4    . DT  I  5 106 ? -30.673 -8.874  4.994   1.00 136.68 ? 33   DT  I O4    1 
ATOM   8182  C  C5    . DT  I  5 106 ? -30.754 -8.341  2.705   1.00 136.50 ? 33   DT  I C5    1 
ATOM   8183  C  C7    . DT  I  5 106 ? -30.655 -9.759  2.223   1.00 136.44 ? 33   DT  I C7    1 
ATOM   8184  C  C6    . DT  I  5 106 ? -30.844 -7.324  1.835   1.00 136.61 ? 33   DT  I C6    1 
ATOM   8185  P  P     . DG  I  5 107 ? -30.408 -2.891  -2.887  1.00 137.37 ? 34   DG  I P     1 
ATOM   8186  O  OP1   . DG  I  5 107 ? -31.620 -2.354  -3.553  1.00 137.51 ? 34   DG  I OP1   1 
ATOM   8187  O  OP2   . DG  I  5 107 ? -29.716 -4.093  -3.418  1.00 136.65 ? 34   DG  I OP2   1 
ATOM   8188  O  "O5'" . DG  I  5 107 ? -29.327 -1.713  -2.766  1.00 137.69 ? 34   DG  I "O5'" 1 
ATOM   8189  C  "C5'" . DG  I  5 107 ? -29.480 -0.618  -1.850  1.00 137.94 ? 34   DG  I "C5'" 1 
ATOM   8190  C  "C4'" . DG  I  5 107 ? -28.300 -0.525  -0.885  1.00 138.00 ? 34   DG  I "C4'" 1 
ATOM   8191  O  "O4'" . DG  I  5 107 ? -28.326 -1.637  0.056   1.00 138.50 ? 34   DG  I "O4'" 1 
ATOM   8192  C  "C3'" . DG  I  5 107 ? -26.902 -0.544  -1.513  1.00 137.40 ? 34   DG  I "C3'" 1 
ATOM   8193  O  "O3'" . DG  I  5 107 ? -26.085 0.405   -0.834  1.00 135.78 ? 34   DG  I "O3'" 1 
ATOM   8194  C  "C2'" . DG  I  5 107 ? -26.413 -1.970  -1.254  1.00 138.10 ? 34   DG  I "C2'" 1 
ATOM   8195  C  "C1'" . DG  I  5 107 ? -27.037 -2.226  0.120   1.00 139.10 ? 34   DG  I "C1'" 1 
ATOM   8196  N  N9    . DG  I  5 107 ? -27.191 -3.624  0.529   1.00 139.32 ? 34   DG  I N9    1 
ATOM   8197  C  C8    . DG  I  5 107 ? -27.200 -4.753  -0.261  1.00 139.49 ? 34   DG  I C8    1 
ATOM   8198  N  N7    . DG  I  5 107 ? -27.363 -5.862  0.411   1.00 139.62 ? 34   DG  I N7    1 
ATOM   8199  C  C5    . DG  I  5 107 ? -27.470 -5.445  1.737   1.00 139.69 ? 34   DG  I C5    1 
ATOM   8200  C  C6    . DG  I  5 107 ? -27.659 -6.192  2.936   1.00 139.56 ? 34   DG  I C6    1 
ATOM   8201  O  O6    . DG  I  5 107 ? -27.778 -7.419  3.073   1.00 139.46 ? 34   DG  I O6    1 
ATOM   8202  N  N1    . DG  I  5 107 ? -27.712 -5.377  4.068   1.00 139.46 ? 34   DG  I N1    1 
ATOM   8203  C  C2    . DG  I  5 107 ? -27.601 -4.005  4.046   1.00 139.51 ? 34   DG  I C2    1 
ATOM   8204  N  N2    . DG  I  5 107 ? -27.672 -3.382  5.232   1.00 139.45 ? 34   DG  I N2    1 
ATOM   8205  N  N3    . DG  I  5 107 ? -27.419 -3.293  2.936   1.00 139.57 ? 34   DG  I N3    1 
ATOM   8206  C  C4    . DG  I  5 107 ? -27.365 -4.070  1.821   1.00 139.53 ? 34   DG  I C4    1 
ATOM   8207  P  P     . DA  I  5 108 ? -25.408 1.651   -1.574  1.00 134.23 ? 35   DA  I P     1 
ATOM   8208  O  OP1   . DA  I  5 108 ? -26.234 1.988   -2.757  1.00 134.36 ? 35   DA  I OP1   1 
ATOM   8209  O  OP2   . DA  I  5 108 ? -23.973 1.332   -1.742  1.00 134.40 ? 35   DA  I OP2   1 
ATOM   8210  O  "O5'" . DA  I  5 108 ? -25.502 2.841   -0.503  1.00 132.12 ? 35   DA  I "O5'" 1 
ATOM   8211  C  "C5'" . DA  I  5 108 ? -26.173 2.668   0.746   1.00 129.30 ? 35   DA  I "C5'" 1 
ATOM   8212  C  "C4'" . DA  I  5 108 ? -25.225 2.392   1.912   1.00 127.23 ? 35   DA  I "C4'" 1 
ATOM   8213  O  "O4'" . DA  I  5 108 ? -25.175 0.972   2.217   1.00 126.72 ? 35   DA  I "O4'" 1 
ATOM   8214  C  "C3'" . DA  I  5 108 ? -23.773 2.858   1.773   1.00 125.78 ? 35   DA  I "C3'" 1 
ATOM   8215  O  "O3'" . DA  I  5 108 ? -23.459 3.569   2.976   1.00 123.38 ? 35   DA  I "O3'" 1 
ATOM   8216  C  "C2'" . DA  I  5 108 ? -22.982 1.559   1.595   1.00 125.80 ? 35   DA  I "C2'" 1 
ATOM   8217  C  "C1'" . DA  I  5 108 ? -23.831 0.562   2.381   1.00 126.44 ? 35   DA  I "C1'" 1 
ATOM   8218  N  N9    . DA  I  5 108 ? -23.748 -0.841  1.961   1.00 126.49 ? 35   DA  I N9    1 
ATOM   8219  C  C8    . DA  I  5 108 ? -23.420 -1.342  0.729   1.00 126.49 ? 35   DA  I C8    1 
ATOM   8220  N  N7    . DA  I  5 108 ? -23.441 -2.655  0.659   1.00 126.52 ? 35   DA  I N7    1 
ATOM   8221  C  C5    . DA  I  5 108 ? -23.815 -3.053  1.933   1.00 126.77 ? 35   DA  I C5    1 
ATOM   8222  C  C6    . DA  I  5 108 ? -24.022 -4.323  2.528   1.00 126.58 ? 35   DA  I C6    1 
ATOM   8223  N  N6    . DA  I  5 108 ? -23.879 -5.483  1.882   1.00 126.46 ? 35   DA  I N6    1 
ATOM   8224  N  N1    . DA  I  5 108 ? -24.391 -4.362  3.827   1.00 126.47 ? 35   DA  I N1    1 
ATOM   8225  C  C2    . DA  I  5 108 ? -24.536 -3.207  4.493   1.00 126.52 ? 35   DA  I C2    1 
ATOM   8226  N  N3    . DA  I  5 108 ? -24.378 -1.960  4.044   1.00 126.78 ? 35   DA  I N3    1 
ATOM   8227  C  C4    . DA  I  5 108 ? -24.010 -1.945  2.747   1.00 126.80 ? 35   DA  I C4    1 
ATOM   8228  P  P     . DC  I  5 109 ? -22.055 4.280   3.292   1.00 121.32 ? 36   DC  I P     1 
ATOM   8229  O  OP1   . DC  I  5 109 ? -22.352 5.480   4.108   1.00 121.15 ? 36   DC  I OP1   1 
ATOM   8230  O  OP2   . DC  I  5 109 ? -21.237 4.395   2.061   1.00 120.92 ? 36   DC  I OP2   1 
ATOM   8231  O  "O5'" . DC  I  5 109 ? -21.366 3.196   4.236   1.00 119.77 ? 36   DC  I "O5'" 1 
ATOM   8232  C  "C5'" . DC  I  5 109 ? -21.987 2.827   5.469   1.00 116.25 ? 36   DC  I "C5'" 1 
ATOM   8233  C  "C4'" . DC  I  5 109 ? -21.237 1.663   6.080   1.00 113.22 ? 36   DC  I "C4'" 1 
ATOM   8234  O  "O4'" . DC  I  5 109 ? -21.350 0.518   5.194   1.00 112.77 ? 36   DC  I "O4'" 1 
ATOM   8235  C  "C3'" . DC  I  5 109 ? -19.744 1.918   6.289   1.00 111.32 ? 36   DC  I "C3'" 1 
ATOM   8236  O  "O3'" . DC  I  5 109 ? -19.373 1.342   7.531   1.00 108.83 ? 36   DC  I "O3'" 1 
ATOM   8237  C  "C2'" . DC  I  5 109 ? -19.101 1.168   5.122   1.00 111.92 ? 36   DC  I "C2'" 1 
ATOM   8238  C  "C1'" . DC  I  5 109 ? -20.057 -0.016  4.995   1.00 112.66 ? 36   DC  I "C1'" 1 
ATOM   8239  N  N1    . DC  I  5 109 ? -20.000 -0.787  3.706   1.00 112.78 ? 36   DC  I N1    1 
ATOM   8240  C  C2    . DC  I  5 109 ? -19.993 -2.192  3.744   1.00 113.04 ? 36   DC  I C2    1 
ATOM   8241  O  O2    . DC  I  5 109 ? -20.034 -2.784  4.828   1.00 113.37 ? 36   DC  I O2    1 
ATOM   8242  N  N3    . DC  I  5 109 ? -19.938 -2.886  2.578   1.00 113.35 ? 36   DC  I N3    1 
ATOM   8243  C  C4    . DC  I  5 109 ? -19.895 -2.244  1.409   1.00 113.10 ? 36   DC  I C4    1 
ATOM   8244  N  N4    . DC  I  5 109 ? -19.845 -2.988  0.301   1.00 112.90 ? 36   DC  I N4    1 
ATOM   8245  C  C5    . DC  I  5 109 ? -19.903 -0.815  1.340   1.00 113.37 ? 36   DC  I C5    1 
ATOM   8246  C  C6    . DC  I  5 109 ? -19.955 -0.137  2.501   1.00 113.29 ? 36   DC  I C6    1 
ATOM   8247  P  P     . DA  I  5 110 ? -18.395 2.038   8.591   1.00 105.95 ? 37   DA  I P     1 
ATOM   8248  O  OP1   . DA  I  5 110 ? -19.082 3.216   9.169   1.00 106.04 ? 37   DA  I OP1   1 
ATOM   8249  O  OP2   . DA  I  5 110 ? -17.069 2.161   7.935   1.00 105.11 ? 37   DA  I OP2   1 
ATOM   8250  O  "O5'" . DA  I  5 110 ? -18.326 0.954   9.769   1.00 103.85 ? 37   DA  I "O5'" 1 
ATOM   8251  C  "C5'" . DA  I  5 110 ? -19.241 -0.149  9.867   1.00 100.06 ? 37   DA  I "C5'" 1 
ATOM   8252  C  "C4'" . DA  I  5 110 ? -18.511 -1.465  9.659   1.00 97.44  ? 37   DA  I "C4'" 1 
ATOM   8253  O  "O4'" . DA  I  5 110 ? -18.387 -1.743  8.241   1.00 97.31  ? 37   DA  I "O4'" 1 
ATOM   8254  C  "C3'" . DA  I  5 110 ? -17.086 -1.522  10.206  1.00 96.15  ? 37   DA  I "C3'" 1 
ATOM   8255  O  "O3'" . DA  I  5 110 ? -16.876 -2.775  10.853  1.00 94.04  ? 37   DA  I "O3'" 1 
ATOM   8256  C  "C2'" . DA  I  5 110 ? -16.210 -1.399  8.962   1.00 96.59  ? 37   DA  I "C2'" 1 
ATOM   8257  C  "C1'" . DA  I  5 110 ? -17.068 -2.185  7.983   1.00 97.74  ? 37   DA  I "C1'" 1 
ATOM   8258  N  N9    . DA  I  5 110 ? -16.752 -1.991  6.569   1.00 97.92  ? 37   DA  I N9    1 
ATOM   8259  C  C8    . DA  I  5 110 ? -16.324 -0.845  5.955   1.00 98.09  ? 37   DA  I C8    1 
ATOM   8260  N  N7    . DA  I  5 110 ? -16.125 -0.981  4.666   1.00 98.26  ? 37   DA  I N7    1 
ATOM   8261  C  C5    . DA  I  5 110 ? -16.446 -2.305  4.415   1.00 98.13  ? 37   DA  I C5    1 
ATOM   8262  C  C6    . DA  I  5 110 ? -16.443 -3.085  3.236   1.00 98.21  ? 37   DA  I C6    1 
ATOM   8263  N  N6    . DA  I  5 110 ? -16.095 -2.606  2.041   1.00 98.00  ? 37   DA  I N6    1 
ATOM   8264  N  N1    . DA  I  5 110 ? -16.815 -4.382  3.330   1.00 98.32  ? 37   DA  I N1    1 
ATOM   8265  C  C2    . DA  I  5 110 ? -17.170 -4.871  4.530   1.00 98.14  ? 37   DA  I C2    1 
ATOM   8266  N  N3    . DA  I  5 110 ? -17.209 -4.236  5.705   1.00 98.26  ? 37   DA  I N3    1 
ATOM   8267  C  C4    . DA  I  5 110 ? -16.832 -2.945  5.580   1.00 97.98  ? 37   DA  I C4    1 
ATOM   8268  P  P     . DC  I  5 111 ? -15.859 -2.930  12.081  1.00 91.50  ? 38   DC  I P     1 
ATOM   8269  O  OP1   . DC  I  5 111 ? -16.718 -2.942  13.294  1.00 90.90  ? 38   DC  I OP1   1 
ATOM   8270  O  OP2   . DC  I  5 111 ? -14.711 -2.004  11.908  1.00 90.23  ? 38   DC  I OP2   1 
ATOM   8271  O  "O5'" . DC  I  5 111 ? -15.218 -4.370  11.862  1.00 89.95  ? 38   DC  I "O5'" 1 
ATOM   8272  C  "C5'" . DC  I  5 111 ? -16.032 -5.513  11.678  1.00 88.45  ? 38   DC  I "C5'" 1 
ATOM   8273  C  "C4'" . DC  I  5 111 ? -15.324 -6.431  10.709  1.00 86.75  ? 38   DC  I "C4'" 1 
ATOM   8274  O  "O4'" . DC  I  5 111 ? -15.378 -5.841  9.384   1.00 87.15  ? 38   DC  I "O4'" 1 
ATOM   8275  C  "C3'" . DC  I  5 111 ? -13.848 -6.657  11.024  1.00 86.17  ? 38   DC  I "C3'" 1 
ATOM   8276  O  "O3'" . DC  I  5 111 ? -13.539 -8.000  10.735  1.00 85.57  ? 38   DC  I "O3'" 1 
ATOM   8277  C  "C2'" . DC  I  5 111 ? -13.149 -5.730  10.040  1.00 86.66  ? 38   DC  I "C2'" 1 
ATOM   8278  C  "C1'" . DC  I  5 111 ? -14.076 -5.932  8.846   1.00 87.16  ? 38   DC  I "C1'" 1 
ATOM   8279  N  N1    . DC  I  5 111 ? -13.867 -5.026  7.667   1.00 87.08  ? 38   DC  I N1    1 
ATOM   8280  C  C2    . DC  I  5 111 ? -14.138 -5.539  6.384   1.00 87.28  ? 38   DC  I C2    1 
ATOM   8281  O  O2    . DC  I  5 111 ? -14.554 -6.703  6.271   1.00 87.24  ? 38   DC  I O2    1 
ATOM   8282  N  N3    . DC  I  5 111 ? -13.939 -4.738  5.299   1.00 87.11  ? 38   DC  I N3    1 
ATOM   8283  C  C4    . DC  I  5 111 ? -13.491 -3.488  5.470   1.00 87.26  ? 38   DC  I C4    1 
ATOM   8284  N  N4    . DC  I  5 111 ? -13.320 -2.744  4.376   1.00 87.21  ? 38   DC  I N4    1 
ATOM   8285  C  C5    . DC  I  5 111 ? -13.203 -2.947  6.768   1.00 87.23  ? 38   DC  I C5    1 
ATOM   8286  C  C6    . DC  I  5 111 ? -13.402 -3.743  7.828   1.00 86.85  ? 38   DC  I C6    1 
ATOM   8287  P  P     . DA  I  5 112 ? -12.293 -8.754  11.369  1.00 84.31  ? 39   DA  I P     1 
ATOM   8288  O  OP1   . DA  I  5 112 ? -12.756 -9.235  12.678  1.00 85.02  ? 39   DA  I OP1   1 
ATOM   8289  O  OP2   . DA  I  5 112 ? -11.059 -7.953  11.246  1.00 83.44  ? 39   DA  I OP2   1 
ATOM   8290  O  "O5'" . DA  I  5 112 ? -12.119 -10.004 10.401  1.00 87.53  ? 39   DA  I "O5'" 1 
ATOM   8291  C  "C5'" . DA  I  5 112 ? -13.189 -10.526 9.613   1.00 92.03  ? 39   DA  I "C5'" 1 
ATOM   8292  C  "C4'" . DA  I  5 112 ? -12.624 -11.123 8.332   1.00 95.93  ? 39   DA  I "C4'" 1 
ATOM   8293  O  "O4'" . DA  I  5 112 ? -12.637 -10.117 7.282   1.00 96.91  ? 39   DA  I "O4'" 1 
ATOM   8294  C  "C3'" . DA  I  5 112 ? -11.184 -11.626 8.446   1.00 98.15  ? 39   DA  I "C3'" 1 
ATOM   8295  O  "O3'" . DA  I  5 112 ? -11.041 -12.913 7.856   1.00 101.85 ? 39   DA  I "O3'" 1 
ATOM   8296  C  "C2'" . DA  I  5 112 ? -10.353 -10.568 7.722   1.00 97.80  ? 39   DA  I "C2'" 1 
ATOM   8297  C  "C1'" . DA  I  5 112 ? -11.337 -9.889  6.775   1.00 97.37  ? 39   DA  I "C1'" 1 
ATOM   8298  N  N9    . DA  I  5 112 ? -11.107 -8.451  6.701   1.00 97.23  ? 39   DA  I N9    1 
ATOM   8299  C  C8    . DA  I  5 112 ? -11.205 -7.568  7.735   1.00 97.66  ? 39   DA  I C8    1 
ATOM   8300  N  N7    . DA  I  5 112 ? -10.940 -6.324  7.417   1.00 97.63  ? 39   DA  I N7    1 
ATOM   8301  C  C5    . DA  I  5 112 ? -10.645 -6.392  6.072   1.00 97.72  ? 39   DA  I C5    1 
ATOM   8302  C  C6    . DA  I  5 112 ? -10.282 -5.404  5.137   1.00 97.63  ? 39   DA  I C6    1 
ATOM   8303  N  N6    . DA  I  5 112 ? -10.158 -4.113  5.457   1.00 97.79  ? 39   DA  I N6    1 
ATOM   8304  N  N1    . DA  I  5 112 ? -10.046 -5.792  3.865   1.00 97.63  ? 39   DA  I N1    1 
ATOM   8305  C  C2    . DA  I  5 112 ? -10.173 -7.089  3.552   1.00 97.63  ? 39   DA  I C2    1 
ATOM   8306  N  N3    . DA  I  5 112 ? -10.516 -8.108  4.345   1.00 98.12  ? 39   DA  I N3    1 
ATOM   8307  C  C4    . DA  I  5 112 ? -10.746 -7.694  5.608   1.00 97.81  ? 39   DA  I C4    1 
ATOM   8308  P  P     . DC  I  5 113 ? -9.703  -13.788 8.055   1.00 105.11 ? 40   DC  I P     1 
ATOM   8309  O  OP1   . DC  I  5 113 ? -10.136 -15.150 8.462   1.00 105.54 ? 40   DC  I OP1   1 
ATOM   8310  O  OP2   . DC  I  5 113 ? -8.727  -13.042 8.894   1.00 104.21 ? 40   DC  I OP2   1 
ATOM   8311  O  "O5'" . DC  I  5 113 ? -9.072  -13.902 6.582   1.00 106.88 ? 40   DC  I "O5'" 1 
ATOM   8312  C  "C5'" . DC  I  5 113 ? -9.799  -13.565 5.390   1.00 109.56 ? 40   DC  I "C5'" 1 
ATOM   8313  C  "C4'" . DC  I  5 113 ? -8.798  -13.017 4.392   1.00 112.17 ? 40   DC  I "C4'" 1 
ATOM   8314  O  "O4'" . DC  I  5 113 ? -8.864  -11.566 4.377   1.00 112.83 ? 40   DC  I "O4'" 1 
ATOM   8315  C  "C3'" . DC  I  5 113 ? -7.351  -13.381 4.731   1.00 113.81 ? 40   DC  I "C3'" 1 
ATOM   8316  O  "O3'" . DC  I  5 113 ? -6.791  -14.282 3.744   1.00 116.37 ? 40   DC  I "O3'" 1 
ATOM   8317  C  "C2'" . DC  I  5 113 ? -6.637  -12.032 4.848   1.00 113.83 ? 40   DC  I "C2'" 1 
ATOM   8318  C  "C1'" . DC  I  5 113 ? -7.567  -11.052 4.150   1.00 113.79 ? 40   DC  I "C1'" 1 
ATOM   8319  N  N1    . DC  I  5 113 ? -7.443  -9.647  4.688   1.00 114.42 ? 40   DC  I N1    1 
ATOM   8320  C  C2    . DC  I  5 113 ? -6.992  -8.586  3.871   1.00 114.61 ? 40   DC  I C2    1 
ATOM   8321  O  O2    . DC  I  5 113 ? -6.696  -8.788  2.687   1.00 114.75 ? 40   DC  I O2    1 
ATOM   8322  N  N3    . DC  I  5 113 ? -6.896  -7.338  4.410   1.00 114.61 ? 40   DC  I N3    1 
ATOM   8323  C  C4    . DC  I  5 113 ? -7.217  -7.122  5.693   1.00 114.36 ? 40   DC  I C4    1 
ATOM   8324  N  N4    . DC  I  5 113 ? -7.101  -5.882  6.170   1.00 114.30 ? 40   DC  I N4    1 
ATOM   8325  C  C5    . DC  I  5 113 ? -7.663  -8.178  6.545   1.00 114.64 ? 40   DC  I C5    1 
ATOM   8326  C  C6    . DC  I  5 113 ? -7.759  -9.402  6.002   1.00 114.71 ? 40   DC  I C6    1 
ATOM   8327  P  P     . DT  I  5 114 ? -5.222  -14.354 3.383   1.00 117.83 ? 41   DT  I P     1 
ATOM   8328  O  OP1   . DT  I  5 114 ? -4.991  -15.556 2.549   1.00 117.62 ? 41   DT  I OP1   1 
ATOM   8329  O  OP2   . DT  I  5 114 ? -4.408  -14.166 4.611   1.00 117.58 ? 41   DT  I OP2   1 
ATOM   8330  O  "O5'" . DT  I  5 114 ? -5.094  -13.029 2.495   1.00 119.23 ? 41   DT  I "O5'" 1 
ATOM   8331  C  "C5'" . DT  I  5 114 ? -4.882  -13.043 1.093   1.00 121.10 ? 41   DT  I "C5'" 1 
ATOM   8332  C  "C4'" . DT  I  5 114 ? -3.675  -12.169 0.804   1.00 122.53 ? 41   DT  I "C4'" 1 
ATOM   8333  O  "O4'" . DT  I  5 114 ? -3.851  -10.855 1.397   1.00 122.90 ? 41   DT  I "O4'" 1 
ATOM   8334  C  "C3'" . DT  I  5 114 ? -2.357  -12.691 1.363   1.00 123.60 ? 41   DT  I "C3'" 1 
ATOM   8335  O  "O3'" . DT  I  5 114 ? -1.368  -12.353 0.409   1.00 125.27 ? 41   DT  I "O3'" 1 
ATOM   8336  C  "C2'" . DT  I  5 114 ? -2.202  -11.909 2.668   1.00 123.34 ? 41   DT  I "C2'" 1 
ATOM   8337  C  "C1'" . DT  I  5 114 ? -2.739  -10.553 2.222   1.00 123.28 ? 41   DT  I "C1'" 1 
ATOM   8338  N  N1    . DT  I  5 114 ? -3.158  -9.601  3.314   1.00 123.50 ? 41   DT  I N1    1 
ATOM   8339  C  C2    . DT  I  5 114 ? -3.143  -8.237  3.061   1.00 123.48 ? 41   DT  I C2    1 
ATOM   8340  O  O2    . DT  I  5 114 ? -2.807  -7.744  1.997   1.00 123.26 ? 41   DT  I O2    1 
ATOM   8341  N  N3    . DT  I  5 114 ? -3.544  -7.452  4.118   1.00 123.56 ? 41   DT  I N3    1 
ATOM   8342  C  C4    . DT  I  5 114 ? -3.946  -7.879  5.375   1.00 123.39 ? 41   DT  I C4    1 
ATOM   8343  O  O4    . DT  I  5 114 ? -4.284  -7.080  6.243   1.00 123.27 ? 41   DT  I O4    1 
ATOM   8344  C  C5    . DT  I  5 114 ? -3.943  -9.313  5.578   1.00 123.38 ? 41   DT  I C5    1 
ATOM   8345  C  C7    . DT  I  5 114 ? -4.355  -9.912  6.895   1.00 123.19 ? 41   DT  I C7    1 
ATOM   8346  C  C6    . DT  I  5 114 ? -3.555  -10.089 4.551   1.00 123.54 ? 41   DT  I C6    1 
ATOM   8347  P  P     . DT  I  5 115 ? 0.135   -12.900 0.449   1.00 126.73 ? 42   DT  I P     1 
ATOM   8348  O  OP1   . DT  I  5 115 ? 0.199   -14.023 -0.520  1.00 126.35 ? 42   DT  I OP1   1 
ATOM   8349  O  OP2   . DT  I  5 115 ? 0.567   -13.119 1.854   1.00 126.20 ? 42   DT  I OP2   1 
ATOM   8350  O  "O5'" . DT  I  5 115 ? 0.943   -11.628 -0.113  1.00 127.17 ? 42   DT  I "O5'" 1 
ATOM   8351  C  "C5'" . DT  I  5 115 ? 0.335   -10.681 -1.003  1.00 128.36 ? 42   DT  I "C5'" 1 
ATOM   8352  C  "C4'" . DT  I  5 115 ? 0.976   -9.304  -0.907  1.00 129.81 ? 42   DT  I "C4'" 1 
ATOM   8353  O  "O4'" . DT  I  5 115 ? 0.350   -8.551  0.166   1.00 130.18 ? 42   DT  I "O4'" 1 
ATOM   8354  C  "C3'" . DT  I  5 115 ? 2.481   -9.288  -0.632  1.00 130.86 ? 42   DT  I "C3'" 1 
ATOM   8355  O  "O3'" . DT  I  5 115 ? 3.164   -8.395  -1.524  1.00 132.07 ? 42   DT  I "O3'" 1 
ATOM   8356  C  "C2'" . DT  I  5 115 ? 2.580   -8.809  0.815   1.00 130.97 ? 42   DT  I "C2'" 1 
ATOM   8357  C  "C1'" . DT  I  5 115 ? 1.352   -7.915  0.939   1.00 130.79 ? 42   DT  I "C1'" 1 
ATOM   8358  N  N1    . DT  I  5 115 ? 0.887   -7.737  2.361   1.00 130.93 ? 42   DT  I N1    1 
ATOM   8359  C  C2    . DT  I  5 115 ? 0.696   -6.465  2.873   1.00 130.81 ? 42   DT  I C2    1 
ATOM   8360  O  O2    . DT  I  5 115 ? 0.879   -5.440  2.236   1.00 130.70 ? 42   DT  I O2    1 
ATOM   8361  N  N3    . DT  I  5 115 ? 0.273   -6.438  4.183   1.00 130.89 ? 42   DT  I N3    1 
ATOM   8362  C  C4    . DT  I  5 115 ? 0.031   -7.523  5.014   1.00 130.85 ? 42   DT  I C4    1 
ATOM   8363  O  O4    . DT  I  5 115 ? -0.346  -7.380  6.174   1.00 130.90 ? 42   DT  I O4    1 
ATOM   8364  C  C5    . DT  I  5 115 ? 0.254   -8.821  4.420   1.00 130.81 ? 42   DT  I C5    1 
ATOM   8365  C  C7    . DT  I  5 115 ? 0.035   -10.086 5.199   1.00 130.86 ? 42   DT  I C7    1 
ATOM   8366  C  C6    . DT  I  5 115 ? 0.664   -8.860  3.145   1.00 130.98 ? 42   DT  I C6    1 
ATOM   8367  P  P     . DT  I  5 116 ? 4.769   -8.247  -1.517  1.00 132.94 ? 43   DT  I P     1 
ATOM   8368  O  OP1   . DT  I  5 116 ? 5.191   -8.015  -2.923  1.00 132.74 ? 43   DT  I OP1   1 
ATOM   8369  O  OP2   . DT  I  5 116 ? 5.359   -9.373  -0.750  1.00 132.78 ? 43   DT  I OP2   1 
ATOM   8370  O  "O5'" . DT  I  5 116 ? 5.008   -6.911  -0.664  1.00 132.41 ? 43   DT  I "O5'" 1 
ATOM   8371  C  "C5'" . DT  I  5 116 ? 4.672   -5.638  -1.213  1.00 132.12 ? 43   DT  I "C5'" 1 
ATOM   8372  C  "C4'" . DT  I  5 116 ? 4.886   -4.527  -0.197  1.00 131.77 ? 43   DT  I "C4'" 1 
ATOM   8373  O  "O4'" . DT  I  5 116 ? 4.196   -4.847  1.042   1.00 131.62 ? 43   DT  I "O4'" 1 
ATOM   8374  C  "C3'" . DT  I  5 116 ? 6.344   -4.243  0.170   1.00 131.30 ? 43   DT  I "C3'" 1 
ATOM   8375  O  "O3'" . DT  I  5 116 ? 6.576   -2.842  -0.035  1.00 130.67 ? 43   DT  I "O3'" 1 
ATOM   8376  C  "C2'" . DT  I  5 116 ? 6.437   -4.676  1.636   1.00 131.31 ? 43   DT  I "C2'" 1 
ATOM   8377  C  "C1'" . DT  I  5 116 ? 5.010   -4.422  2.114   1.00 131.25 ? 43   DT  I "C1'" 1 
ATOM   8378  N  N1    . DT  I  5 116 ? 4.592   -5.161  3.347   1.00 131.11 ? 43   DT  I N1    1 
ATOM   8379  C  C2    . DT  I  5 116 ? 3.945   -4.476  4.364   1.00 130.87 ? 43   DT  I C2    1 
ATOM   8380  O  O2    . DT  I  5 116 ? 3.690   -3.282  4.334   1.00 130.58 ? 43   DT  I O2    1 
ATOM   8381  N  N3    . DT  I  5 116 ? 3.606   -5.261  5.443   1.00 130.99 ? 43   DT  I N3    1 
ATOM   8382  C  C4    . DT  I  5 116 ? 3.838   -6.622  5.606   1.00 131.18 ? 43   DT  I C4    1 
ATOM   8383  O  O4    . DT  I  5 116 ? 3.487   -7.224  6.621   1.00 131.25 ? 43   DT  I O4    1 
ATOM   8384  C  C5    . DT  I  5 116 ? 4.515   -7.276  4.506   1.00 131.03 ? 43   DT  I C5    1 
ATOM   8385  C  C7    . DT  I  5 116 ? 4.829   -8.746  4.551   1.00 130.89 ? 43   DT  I C7    1 
ATOM   8386  C  C6    . DT  I  5 116 ? 4.851   -6.521  3.447   1.00 131.12 ? 43   DT  I C6    1 
ATOM   8387  P  P     . DT  I  5 117 ? 7.888   -2.070  0.475   1.00 130.62 ? 44   DT  I P     1 
ATOM   8388  O  OP1   . DT  I  5 117 ? 8.130   -0.953  -0.463  1.00 130.82 ? 44   DT  I OP1   1 
ATOM   8389  O  OP2   . DT  I  5 117 ? 8.974   -3.041  0.750   1.00 130.55 ? 44   DT  I OP2   1 
ATOM   8390  O  "O5'" . DT  I  5 117 ? 7.392   -1.474  1.873   1.00 129.72 ? 44   DT  I "O5'" 1 
ATOM   8391  C  "C5'" . DT  I  5 117 ? 6.706   -0.225  1.964   1.00 128.01 ? 44   DT  I "C5'" 1 
ATOM   8392  C  "C4'" . DT  I  5 117 ? 6.756   0.265   3.402   1.00 127.02 ? 44   DT  I "C4'" 1 
ATOM   8393  O  "O4'" . DT  I  5 117 ? 6.250   -0.769  4.293   1.00 127.24 ? 44   DT  I "O4'" 1 
ATOM   8394  C  "C3'" . DT  I  5 117 ? 8.154   0.635   3.902   1.00 125.99 ? 44   DT  I "C3'" 1 
ATOM   8395  O  "O3'" . DT  I  5 117 ? 8.096   2.014   4.326   1.00 124.33 ? 44   DT  I "O3'" 1 
ATOM   8396  C  "C2'" . DT  I  5 117 ? 8.482   -0.418  4.973   1.00 126.04 ? 44   DT  I "C2'" 1 
ATOM   8397  C  "C1'" . DT  I  5 117 ? 7.098   -0.900  5.418   1.00 126.69 ? 44   DT  I "C1'" 1 
ATOM   8398  N  N1    . DT  I  5 117 ? 6.997   -2.314  5.964   1.00 126.66 ? 44   DT  I N1    1 
ATOM   8399  C  C2    . DT  I  5 117 ? 6.277   -2.539  7.130   1.00 126.97 ? 44   DT  I C2    1 
ATOM   8400  O  O2    . DT  I  5 117 ? 5.711   -1.659  7.762   1.00 126.92 ? 44   DT  I O2    1 
ATOM   8401  N  N3    . DT  I  5 117 ? 6.238   -3.852  7.549   1.00 126.84 ? 44   DT  I N3    1 
ATOM   8402  C  C4    . DT  I  5 117 ? 6.824   -4.947  6.939   1.00 126.72 ? 44   DT  I C4    1 
ATOM   8403  O  O4    . DT  I  5 117 ? 6.720   -6.081  7.403   1.00 126.57 ? 44   DT  I O4    1 
ATOM   8404  C  C5    . DT  I  5 117 ? 7.558   -4.649  5.727   1.00 126.83 ? 44   DT  I C5    1 
ATOM   8405  C  C7    . DT  I  5 117 ? 8.243   -5.748  4.964   1.00 126.98 ? 44   DT  I C7    1 
ATOM   8406  C  C6    . DT  I  5 117 ? 7.606   -3.371  5.305   1.00 126.62 ? 44   DT  I C6    1 
ATOM   8407  P  P     . DT  I  5 118 ? 8.844   2.651   5.594   1.00 123.10 ? 45   DT  I P     1 
ATOM   8408  O  OP1   . DT  I  5 118 ? 8.547   4.107   5.609   1.00 122.39 ? 45   DT  I OP1   1 
ATOM   8409  O  OP2   . DT  I  5 118 ? 10.251  2.176   5.633   1.00 122.58 ? 45   DT  I OP2   1 
ATOM   8410  O  "O5'" . DT  I  5 118 ? 8.089   1.940   6.819   1.00 122.46 ? 45   DT  I "O5'" 1 
ATOM   8411  C  "C5'" . DT  I  5 118 ? 6.828   2.370   7.375   1.00 118.97 ? 45   DT  I "C5'" 1 
ATOM   8412  C  "C4'" . DT  I  5 118 ? 6.806   2.078   8.873   1.00 116.19 ? 45   DT  I "C4'" 1 
ATOM   8413  O  "O4'" . DT  I  5 118 ? 6.853   0.645   9.109   1.00 115.83 ? 45   DT  I "O4'" 1 
ATOM   8414  C  "C3'" . DT  I  5 118 ? 7.991   2.652   9.653   1.00 114.53 ? 45   DT  I "C3'" 1 
ATOM   8415  O  "O3'" . DT  I  5 118 ? 7.514   3.186   10.879  1.00 111.77 ? 45   DT  I "O3'" 1 
ATOM   8416  C  "C2'" . DT  I  5 118 ? 8.911   1.447   9.860   1.00 114.58 ? 45   DT  I "C2'" 1 
ATOM   8417  C  "C1'" . DT  I  5 118 ? 7.856   0.370   10.074  1.00 115.61 ? 45   DT  I "C1'" 1 
ATOM   8418  N  N1    . DT  I  5 118 ? 8.345   -1.045  9.950   1.00 115.65 ? 45   DT  I N1    1 
ATOM   8419  C  C2    . DT  I  5 118 ? 7.867   -2.017  10.819  1.00 115.76 ? 45   DT  I C2    1 
ATOM   8420  O  O2    . DT  I  5 118 ? 7.054   -1.813  11.707  1.00 115.86 ? 45   DT  I O2    1 
ATOM   8421  N  N3    . DT  I  5 118 ? 8.381   -3.274  10.613  1.00 115.80 ? 45   DT  I N3    1 
ATOM   8422  C  C4    . DT  I  5 118 ? 9.302   -3.654  9.652   1.00 115.84 ? 45   DT  I C4    1 
ATOM   8423  O  O4    . DT  I  5 118 ? 9.692   -4.813  9.565   1.00 115.81 ? 45   DT  I O4    1 
ATOM   8424  C  C5    . DT  I  5 118 ? 9.764   -2.595  8.778   1.00 116.03 ? 45   DT  I C5    1 
ATOM   8425  C  C7    . DT  I  5 118 ? 10.765  -2.868  7.692   1.00 115.78 ? 45   DT  I C7    1 
ATOM   8426  C  C6    . DT  I  5 118 ? 9.269   -1.361  8.969   1.00 115.99 ? 45   DT  I C6    1 
ATOM   8427  P  P     . DC  I  5 119 ? 8.465   3.956   11.910  1.00 109.83 ? 46   DC  I P     1 
ATOM   8428  O  OP1   . DC  I  5 119 ? 7.763   5.214   12.234  1.00 110.19 ? 46   DC  I OP1   1 
ATOM   8429  O  OP2   . DC  I  5 119 ? 9.863   3.992   11.421  1.00 109.57 ? 46   DC  I OP2   1 
ATOM   8430  O  "O5'" . DC  I  5 119 ? 8.441   3.006   13.200  1.00 109.29 ? 46   DC  I "O5'" 1 
ATOM   8431  C  "C5'" . DC  I  5 119 ? 7.212   2.576   13.818  1.00 106.73 ? 46   DC  I "C5'" 1 
ATOM   8432  C  "C4'" . DC  I  5 119 ? 7.478   1.580   14.939  1.00 104.59 ? 46   DC  I "C4'" 1 
ATOM   8433  O  "O4'" . DC  I  5 119 ? 7.894   0.311   14.365  1.00 104.41 ? 46   DC  I "O4'" 1 
ATOM   8434  C  "C3'" . DC  I  5 119 ? 8.567   1.980   15.938  1.00 103.21 ? 46   DC  I "C3'" 1 
ATOM   8435  O  "O3'" . DC  I  5 119 ? 8.226   1.551   17.262  1.00 100.65 ? 46   DC  I "O3'" 1 
ATOM   8436  C  "C2'" . DC  I  5 119 ? 9.779   1.204   15.425  1.00 104.24 ? 46   DC  I "C2'" 1 
ATOM   8437  C  "C1'" . DC  I  5 119 ? 9.107   -0.091  14.973  1.00 105.05 ? 46   DC  I "C1'" 1 
ATOM   8438  N  N1    . DC  I  5 119 ? 9.899   -0.951  14.020  1.00 105.66 ? 46   DC  I N1    1 
ATOM   8439  C  C2    . DC  I  5 119 ? 9.576   -2.317  13.891  1.00 106.00 ? 46   DC  I C2    1 
ATOM   8440  O  O2    . DC  I  5 119 ? 8.647   -2.792  14.558  1.00 106.11 ? 46   DC  I O2    1 
ATOM   8441  N  N3    . DC  I  5 119 ? 10.294  -3.094  13.029  1.00 105.90 ? 46   DC  I N3    1 
ATOM   8442  C  C4    . DC  I  5 119 ? 11.295  -2.561  12.320  1.00 105.80 ? 46   DC  I C4    1 
ATOM   8443  N  N4    . DC  I  5 119 ? 11.969  -3.367  11.493  1.00 105.71 ? 46   DC  I N4    1 
ATOM   8444  C  C5    . DC  I  5 119 ? 11.646  -1.176  12.435  1.00 106.08 ? 46   DC  I C5    1 
ATOM   8445  C  C6    . DC  I  5 119 ? 10.931  -0.418  13.285  1.00 106.00 ? 46   DC  I C6    1 
ATOM   8446  P  P     . DT  I  5 120 ? 7.558   2.511   18.366  1.00 97.68  ? 47   DT  I P     1 
ATOM   8447  O  OP1   . DT  I  5 120 ? 6.711   3.529   17.701  1.00 97.67  ? 47   DT  I OP1   1 
ATOM   8448  O  OP2   . DT  I  5 120 ? 8.618   2.940   19.307  1.00 97.05  ? 47   DT  I OP2   1 
ATOM   8449  O  "O5'" . DT  I  5 120 ? 6.598   1.487   19.140  1.00 96.09  ? 47   DT  I "O5'" 1 
ATOM   8450  C  "C5'" . DT  I  5 120 ? 5.824   0.514   18.420  1.00 92.77  ? 47   DT  I "C5'" 1 
ATOM   8451  C  "C4'" . DT  I  5 120 ? 5.888   -0.873  19.051  1.00 90.19  ? 47   DT  I "C4'" 1 
ATOM   8452  O  "O4'" . DT  I  5 120 ? 6.888   -1.688  18.388  1.00 90.15  ? 47   DT  I "O4'" 1 
ATOM   8453  C  "C3'" . DT  I  5 120 ? 6.197   -0.947  20.547  1.00 88.20  ? 47   DT  I "C3'" 1 
ATOM   8454  O  "O3'" . DT  I  5 120 ? 5.248   -1.848  21.137  1.00 84.60  ? 47   DT  I "O3'" 1 
ATOM   8455  C  "C2'" . DT  I  5 120 ? 7.638   -1.453  20.602  1.00 88.84  ? 47   DT  I "C2'" 1 
ATOM   8456  C  "C1'" . DT  I  5 120 ? 7.690   -2.335  19.357  1.00 90.43  ? 47   DT  I "C1'" 1 
ATOM   8457  N  N1    . DT  I  5 120 ? 9.052   -2.560  18.756  1.00 90.79  ? 47   DT  I N1    1 
ATOM   8458  C  C2    . DT  I  5 120 ? 9.442   -3.847  18.399  1.00 91.15  ? 47   DT  I C2    1 
ATOM   8459  O  O2    . DT  I  5 120 ? 8.747   -4.840  18.552  1.00 91.54  ? 47   DT  I O2    1 
ATOM   8460  N  N3    . DT  I  5 120 ? 10.698  -3.941  17.848  1.00 91.10  ? 47   DT  I N3    1 
ATOM   8461  C  C4    . DT  I  5 120 ? 11.581  -2.896  17.616  1.00 91.38  ? 47   DT  I C4    1 
ATOM   8462  O  O4    . DT  I  5 120 ? 12.687  -3.088  17.120  1.00 91.09  ? 47   DT  I O4    1 
ATOM   8463  C  C5    . DT  I  5 120 ? 11.115  -1.578  18.012  1.00 91.63  ? 47   DT  I C5    1 
ATOM   8464  C  C7    . DT  I  5 120 ? 11.980  -0.364  17.820  1.00 91.23  ? 47   DT  I C7    1 
ATOM   8465  C  C6    . DT  I  5 120 ? 9.889   -1.475  18.551  1.00 91.12  ? 47   DT  I C6    1 
ATOM   8466  P  P     . DA  I  5 121 ? 5.211   -2.243  22.694  1.00 80.71  ? 48   DA  I P     1 
ATOM   8467  O  OP1   . DA  I  5 121 ? 3.828   -2.700  22.980  1.00 79.41  ? 48   DA  I OP1   1 
ATOM   8468  O  OP2   . DA  I  5 121 ? 5.905   -1.213  23.508  1.00 78.88  ? 48   DA  I OP2   1 
ATOM   8469  O  "O5'" . DA  I  5 121 ? 6.155   -3.527  22.722  1.00 79.37  ? 48   DA  I "O5'" 1 
ATOM   8470  C  "C5'" . DA  I  5 121 ? 5.631   -4.793  22.393  1.00 76.86  ? 48   DA  I "C5'" 1 
ATOM   8471  C  "C4'" . DA  I  5 121 ? 6.724   -5.815  22.596  1.00 75.83  ? 48   DA  I "C4'" 1 
ATOM   8472  O  "O4'" . DA  I  5 121 ? 7.927   -5.368  21.933  1.00 75.74  ? 48   DA  I "O4'" 1 
ATOM   8473  C  "C3'" . DA  I  5 121 ? 7.116   -6.045  24.045  1.00 75.48  ? 48   DA  I "C3'" 1 
ATOM   8474  O  "O3'" . DA  I  5 121 ? 7.173   -7.445  24.226  1.00 73.92  ? 48   DA  I "O3'" 1 
ATOM   8475  C  "C2'" . DA  I  5 121 ? 8.493   -5.386  24.188  1.00 75.95  ? 48   DA  I "C2'" 1 
ATOM   8476  C  "C1'" . DA  I  5 121 ? 9.050   -5.529  22.777  1.00 76.71  ? 48   DA  I "C1'" 1 
ATOM   8477  N  N9    . DA  I  5 121 ? 10.041  -4.539  22.342  1.00 76.91  ? 48   DA  I N9    1 
ATOM   8478  C  C8    . DA  I  5 121 ? 10.119  -3.210  22.677  1.00 76.80  ? 48   DA  I C8    1 
ATOM   8479  N  N7    . DA  I  5 121 ? 11.113  -2.569  22.104  1.00 76.58  ? 48   DA  I N7    1 
ATOM   8480  C  C5    . DA  I  5 121 ? 11.720  -3.540  21.332  1.00 77.16  ? 48   DA  I C5    1 
ATOM   8481  C  C6    . DA  I  5 121 ? 12.845  -3.500  20.475  1.00 77.79  ? 48   DA  I C6    1 
ATOM   8482  N  N6    . DA  I  5 121 ? 13.549  -2.376  20.268  1.00 77.27  ? 48   DA  I N6    1 
ATOM   8483  N  N1    . DA  I  5 121 ? 13.202  -4.658  19.843  1.00 77.31  ? 48   DA  I N1    1 
ATOM   8484  C  C2    . DA  I  5 121 ? 12.472  -5.771  20.067  1.00 76.96  ? 48   DA  I C2    1 
ATOM   8485  N  N3    . DA  I  5 121 ? 11.398  -5.924  20.850  1.00 76.78  ? 48   DA  I N3    1 
ATOM   8486  C  C4    . DA  I  5 121 ? 11.073  -4.764  21.460  1.00 76.88  ? 48   DA  I C4    1 
ATOM   8487  P  P     . DC  I  5 122 ? 7.049   -8.094  25.672  1.00 72.15  ? 49   DC  I P     1 
ATOM   8488  O  OP1   . DC  I  5 122 ? 5.616   -8.428  25.841  1.00 70.62  ? 49   DC  I OP1   1 
ATOM   8489  O  OP2   . DC  I  5 122 ? 7.812   -7.258  26.638  1.00 70.18  ? 49   DC  I OP2   1 
ATOM   8490  O  "O5'" . DC  I  5 122 ? 7.856   -9.474  25.518  1.00 77.00  ? 49   DC  I "O5'" 1 
ATOM   8491  C  "C5'" . DC  I  5 122 ? 8.079   -10.120 24.239  1.00 82.03  ? 49   DC  I "C5'" 1 
ATOM   8492  C  "C4'" . DC  I  5 122 ? 9.517   -10.617 24.042  1.00 85.59  ? 49   DC  I "C4'" 1 
ATOM   8493  O  "O4'" . DC  I  5 122 ? 10.341  -9.574  23.445  1.00 86.34  ? 49   DC  I "O4'" 1 
ATOM   8494  C  "C3'" . DC  I  5 122 ? 10.255  -11.070 25.308  1.00 87.34  ? 49   DC  I "C3'" 1 
ATOM   8495  O  "O3'" . DC  I  5 122 ? 10.861  -12.345 25.129  1.00 89.91  ? 49   DC  I "O3'" 1 
ATOM   8496  C  "C2'" . DC  I  5 122 ? 11.315  -10.000 25.527  1.00 86.67  ? 49   DC  I "C2'" 1 
ATOM   8497  C  "C1'" . DC  I  5 122 ? 11.597  -9.552  24.101  1.00 86.99  ? 49   DC  I "C1'" 1 
ATOM   8498  N  N1    . DC  I  5 122 ? 12.202  -8.178  24.010  1.00 87.18  ? 49   DC  I N1    1 
ATOM   8499  C  C2    . DC  I  5 122 ? 13.283  -7.950  23.163  1.00 86.53  ? 49   DC  I C2    1 
ATOM   8500  O  O2    . DC  I  5 122 ? 13.719  -8.892  22.508  1.00 87.18  ? 49   DC  I O2    1 
ATOM   8501  N  N3    . DC  I  5 122 ? 13.821  -6.708  23.089  1.00 86.50  ? 49   DC  I N3    1 
ATOM   8502  C  C4    . DC  I  5 122 ? 13.321  -5.715  23.829  1.00 87.20  ? 49   DC  I C4    1 
ATOM   8503  N  N4    . DC  I  5 122 ? 13.872  -4.499  23.737  1.00 87.33  ? 49   DC  I N4    1 
ATOM   8504  C  C5    . DC  I  5 122 ? 12.218  -5.920  24.708  1.00 87.65  ? 49   DC  I C5    1 
ATOM   8505  C  C6    . DC  I  5 122 ? 11.696  -7.150  24.760  1.00 87.81  ? 49   DC  I C6    1 
ATOM   8506  P  P     . DG  I  5 123 ? 11.215  -13.292 26.375  1.00 91.55  ? 50   DG  I P     1 
ATOM   8507  O  OP1   . DG  I  5 123 ? 10.343  -14.482 26.263  1.00 90.66  ? 50   DG  I OP1   1 
ATOM   8508  O  OP2   . DG  I  5 123 ? 11.278  -12.516 27.634  1.00 91.27  ? 50   DG  I OP2   1 
ATOM   8509  O  "O5'" . DG  I  5 123 ? 12.722  -13.719 26.052  1.00 95.11  ? 50   DG  I "O5'" 1 
ATOM   8510  C  "C5'" . DG  I  5 123 ? 13.110  -14.132 24.735  1.00 100.33 ? 50   DG  I "C5'" 1 
ATOM   8511  C  "C4'" . DG  I  5 123 ? 14.579  -13.817 24.512  1.00 103.74 ? 50   DG  I "C4'" 1 
ATOM   8512  O  "O4'" . DG  I  5 123 ? 14.740  -12.393 24.259  1.00 104.41 ? 50   DG  I "O4'" 1 
ATOM   8513  C  "C3'" . DG  I  5 123 ? 15.448  -14.140 25.722  1.00 106.33 ? 50   DG  I "C3'" 1 
ATOM   8514  O  "O3'" . DG  I  5 123 ? 16.532  -15.001 25.344  1.00 110.16 ? 50   DG  I "O3'" 1 
ATOM   8515  C  "C2'" . DG  I  5 123 ? 15.908  -12.772 26.237  1.00 105.50 ? 50   DG  I "C2'" 1 
ATOM   8516  C  "C1'" . DG  I  5 123 ? 15.829  -11.890 24.999  1.00 104.54 ? 50   DG  I "C1'" 1 
ATOM   8517  N  N9    . DG  I  5 123 ? 15.562  -10.501 25.346  1.00 104.61 ? 50   DG  I N9    1 
ATOM   8518  C  C8    . DG  I  5 123 ? 14.511  -10.057 26.106  1.00 104.62 ? 50   DG  I C8    1 
ATOM   8519  N  N7    . DG  I  5 123 ? 14.495  -8.770  26.288  1.00 104.71 ? 50   DG  I N7    1 
ATOM   8520  C  C5    . DG  I  5 123 ? 15.616  -8.321  25.610  1.00 104.57 ? 50   DG  I C5    1 
ATOM   8521  C  C6    . DG  I  5 123 ? 16.107  -7.004  25.455  1.00 104.39 ? 50   DG  I C6    1 
ATOM   8522  O  O6    . DG  I  5 123 ? 15.626  -5.961  25.914  1.00 104.53 ? 50   DG  I O6    1 
ATOM   8523  N  N1    . DG  I  5 123 ? 17.276  -6.962  24.696  1.00 104.41 ? 50   DG  I N1    1 
ATOM   8524  C  C2    . DG  I  5 123 ? 17.883  -8.069  24.147  1.00 104.56 ? 50   DG  I C2    1 
ATOM   8525  N  N2    . DG  I  5 123 ? 19.001  -7.845  23.440  1.00 104.59 ? 50   DG  I N2    1 
ATOM   8526  N  N3    . DG  I  5 123 ? 17.424  -9.313  24.280  1.00 104.61 ? 50   DG  I N3    1 
ATOM   8527  C  C4    . DG  I  5 123 ? 16.289  -9.372  25.022  1.00 104.68 ? 50   DG  I C4    1 
ATOM   8528  P  P     . DA  I  5 124 ? 17.593  -15.507 26.440  1.00 113.18 ? 51   DA  I P     1 
ATOM   8529  O  OP1   . DA  I  5 124 ? 18.089  -16.817 25.971  1.00 113.19 ? 51   DA  I OP1   1 
ATOM   8530  O  OP2   . DA  I  5 124 ? 16.976  -15.405 27.787  1.00 112.65 ? 51   DA  I OP2   1 
ATOM   8531  O  "O5'" . DA  I  5 124 ? 18.767  -14.411 26.354  1.00 115.66 ? 51   DA  I "O5'" 1 
ATOM   8532  C  "C5'" . DA  I  5 124 ? 19.500  -14.149 25.147  1.00 120.06 ? 51   DA  I "C5'" 1 
ATOM   8533  C  "C4'" . DA  I  5 124 ? 20.632  -13.153 25.384  1.00 124.01 ? 51   DA  I "C4'" 1 
ATOM   8534  O  "O4'" . DA  I  5 124 ? 20.091  -11.804 25.470  1.00 124.54 ? 51   DA  I "O4'" 1 
ATOM   8535  C  "C3'" . DA  I  5 124 ? 21.460  -13.363 26.661  1.00 126.76 ? 51   DA  I "C3'" 1 
ATOM   8536  O  "O3'" . DA  I  5 124 ? 22.881  -13.213 26.419  1.00 130.54 ? 51   DA  I "O3'" 1 
ATOM   8537  C  "C2'" . DA  I  5 124 ? 20.924  -12.297 27.620  1.00 126.14 ? 51   DA  I "C2'" 1 
ATOM   8538  C  "C1'" . DA  I  5 124 ? 20.526  -11.177 26.665  1.00 125.00 ? 51   DA  I "C1'" 1 
ATOM   8539  N  N9    . DA  I  5 124 ? 19.472  -10.321 27.208  1.00 124.75 ? 51   DA  I N9    1 
ATOM   8540  C  C8    . DA  I  5 124 ? 18.310  -10.709 27.819  1.00 124.75 ? 51   DA  I C8    1 
ATOM   8541  N  N7    . DA  I  5 124 ? 17.549  -9.715  28.213  1.00 124.65 ? 51   DA  I N7    1 
ATOM   8542  C  C5    . DA  I  5 124 ? 18.265  -8.590  27.836  1.00 124.84 ? 51   DA  I C5    1 
ATOM   8543  C  C6    . DA  I  5 124 ? 18.013  -7.202  27.968  1.00 124.95 ? 51   DA  I C6    1 
ATOM   8544  N  N6    . DA  I  5 124 ? 16.910  -6.706  28.541  1.00 124.81 ? 51   DA  I N6    1 
ATOM   8545  N  N1    . DA  I  5 124 ? 18.938  -6.337  27.480  1.00 124.94 ? 51   DA  I N1    1 
ATOM   8546  C  C2    . DA  I  5 124 ? 20.046  -6.830  26.905  1.00 124.86 ? 51   DA  I C2    1 
ATOM   8547  N  N3    . DA  I  5 124 ? 20.391  -8.110  26.728  1.00 124.85 ? 51   DA  I N3    1 
ATOM   8548  C  C4    . DA  I  5 124 ? 19.454  -8.946  27.217  1.00 124.78 ? 51   DA  I C4    1 
ATOM   8549  P  P     . DT  I  5 125 ? 23.996  -13.528 27.541  1.00 133.25 ? 52   DT  I P     1 
ATOM   8550  O  OP1   . DT  I  5 125 ? 25.209  -13.972 26.809  1.00 132.76 ? 52   DT  I OP1   1 
ATOM   8551  O  OP2   . DT  I  5 125 ? 23.411  -14.414 28.577  1.00 132.78 ? 52   DT  I OP2   1 
ATOM   8552  O  "O5'" . DT  I  5 125 ? 24.254  -12.101 28.242  1.00 135.01 ? 52   DT  I "O5'" 1 
ATOM   8553  C  "C5'" . DT  I  5 125 ? 24.895  -11.023 27.541  1.00 138.22 ? 52   DT  I "C5'" 1 
ATOM   8554  C  "C4'" . DT  I  5 125 ? 24.771  -9.697  28.279  1.00 140.76 ? 52   DT  I "C4'" 1 
ATOM   8555  O  "O4'" . DT  I  5 125 ? 23.376  -9.387  28.517  1.00 141.31 ? 52   DT  I "O4'" 1 
ATOM   8556  C  "C3'" . DT  I  5 125 ? 25.414  -9.628  29.663  1.00 142.62 ? 52   DT  I "C3'" 1 
ATOM   8557  O  "O3'" . DT  I  5 125 ? 26.719  -9.064  29.566  1.00 145.89 ? 52   DT  I "O3'" 1 
ATOM   8558  C  "C2'" . DT  I  5 125 ? 24.490  -8.712  30.478  1.00 142.16 ? 52   DT  I "C2'" 1 
ATOM   8559  C  "C1'" . DT  I  5 125 ? 23.346  -8.380  29.512  1.00 141.31 ? 52   DT  I "C1'" 1 
ATOM   8560  N  N1    . DT  I  5 125 ? 22.008  -8.353  30.204  1.00 141.20 ? 52   DT  I N1    1 
ATOM   8561  C  C2    . DT  I  5 125 ? 21.453  -7.133  30.560  1.00 141.07 ? 52   DT  I C2    1 
ATOM   8562  O  O2    . DT  I  5 125 ? 21.981  -6.057  30.332  1.00 140.97 ? 52   DT  I O2    1 
ATOM   8563  N  N3    . DT  I  5 125 ? 20.234  -7.216  31.196  1.00 141.04 ? 52   DT  I N3    1 
ATOM   8564  C  C4    . DT  I  5 125 ? 19.530  -8.370  31.513  1.00 141.03 ? 52   DT  I C4    1 
ATOM   8565  O  O4    . DT  I  5 125 ? 18.443  -8.323  32.086  1.00 140.90 ? 52   DT  I O4    1 
ATOM   8566  C  C5    . DT  I  5 125 ? 20.168  -9.613  31.120  1.00 140.93 ? 52   DT  I C5    1 
ATOM   8567  C  C7    . DT  I  5 125 ? 19.523  -10.939 31.397  1.00 141.01 ? 52   DT  I C7    1 
ATOM   8568  C  C6    . DT  I  5 125 ? 21.356  -9.544  30.496  1.00 141.02 ? 52   DT  I C6    1 
ATOM   8569  P  P     . DC  I  5 126 ? 27.744  -9.068  30.803  1.00 148.45 ? 53   DC  I P     1 
ATOM   8570  O  OP1   . DC  I  5 126 ? 29.112  -9.105  30.234  1.00 148.29 ? 53   DC  I OP1   1 
ATOM   8571  O  OP2   . DC  I  5 126 ? 27.327  -10.117 31.763  1.00 147.98 ? 53   DC  I OP2   1 
ATOM   8572  O  "O5'" . DC  I  5 126 ? 27.498  -7.637  31.486  1.00 151.24 ? 53   DC  I "O5'" 1 
ATOM   8573  C  "C5'" . DC  I  5 126 ? 28.257  -6.490  31.089  1.00 155.42 ? 53   DC  I "C5'" 1 
ATOM   8574  C  "C4'" . DC  I  5 126 ? 27.769  -5.229  31.792  1.00 158.59 ? 53   DC  I "C4'" 1 
ATOM   8575  O  "O4'" . DC  I  5 126 ? 26.317  -5.219  31.811  1.00 159.41 ? 53   DC  I "O4'" 1 
ATOM   8576  C  "C3'" . DC  I  5 126 ? 28.248  -5.049  33.244  1.00 160.37 ? 53   DC  I "C3'" 1 
ATOM   8577  O  "O3'" . DC  I  5 126 ? 29.077  -3.847  33.336  1.00 162.46 ? 53   DC  I "O3'" 1 
ATOM   8578  C  "C2'" . DC  I  5 126 ? 26.954  -5.038  34.068  1.00 160.48 ? 53   DC  I "C2'" 1 
ATOM   8579  C  "C1'" . DC  I  5 126 ? 25.888  -4.661  33.036  1.00 160.56 ? 53   DC  I "C1'" 1 
ATOM   8580  N  N1    . DC  I  5 126 ? 24.500  -5.165  33.345  1.00 160.97 ? 53   DC  I N1    1 
ATOM   8581  C  C2    . DC  I  5 126 ? 23.406  -4.276  33.299  1.00 161.12 ? 53   DC  I C2    1 
ATOM   8582  O  O2    . DC  I  5 126 ? 23.580  -3.083  33.005  1.00 161.01 ? 53   DC  I O2    1 
ATOM   8583  N  N3    . DC  I  5 126 ? 22.163  -4.757  33.583  1.00 161.27 ? 53   DC  I N3    1 
ATOM   8584  C  C4    . DC  I  5 126 ? 21.988  -6.047  33.899  1.00 161.10 ? 53   DC  I C4    1 
ATOM   8585  N  N4    . DC  I  5 126 ? 20.743  -6.456  34.170  1.00 161.13 ? 53   DC  I N4    1 
ATOM   8586  C  C5    . DC  I  5 126 ? 23.083  -6.968  33.953  1.00 161.01 ? 53   DC  I C5    1 
ATOM   8587  C  C6    . DC  I  5 126 ? 24.304  -6.487  33.670  1.00 161.06 ? 53   DC  I C6    1 
ATOM   8588  P  P     . DC  I  5 127 ? 29.066  -2.732  34.502  1.00 163.90 ? 54   DC  I P     1 
ATOM   8589  O  OP1   . DC  I  5 127 ? 30.207  -1.829  34.216  1.00 163.63 ? 54   DC  I OP1   1 
ATOM   8590  O  OP2   . DC  I  5 127 ? 28.986  -3.402  35.824  1.00 163.80 ? 54   DC  I OP2   1 
ATOM   8591  O  "O5'" . DC  I  5 127 ? 27.689  -1.940  34.251  1.00 165.33 ? 54   DC  I "O5'" 1 
ATOM   8592  C  "C5'" . DC  I  5 127 ? 27.583  -0.517  34.393  1.00 167.45 ? 54   DC  I "C5'" 1 
ATOM   8593  C  "C4'" . DC  I  5 127 ? 26.756  -0.128  35.613  1.00 169.01 ? 54   DC  I "C4'" 1 
ATOM   8594  O  "O4'" . DC  I  5 127 ? 25.561  -0.950  35.716  1.00 169.46 ? 54   DC  I "O4'" 1 
ATOM   8595  C  "C3'" . DC  I  5 127 ? 27.481  -0.264  36.951  1.00 170.01 ? 54   DC  I "C3'" 1 
ATOM   8596  O  "O3'" . DC  I  5 127 ? 27.298  0.916   37.732  1.00 171.29 ? 54   DC  I "O3'" 1 
ATOM   8597  C  "C2'" . DC  I  5 127 ? 26.830  -1.480  37.609  1.00 169.97 ? 54   DC  I "C2'" 1 
ATOM   8598  C  "C1'" . DC  I  5 127 ? 25.411  -1.390  37.054  1.00 169.86 ? 54   DC  I "C1'" 1 
ATOM   8599  N  N1    . DC  I  5 127 ? 24.596  -2.669  37.090  1.00 169.94 ? 54   DC  I N1    1 
ATOM   8600  C  C2    . DC  I  5 127 ? 23.248  -2.641  36.670  1.00 169.93 ? 54   DC  I C2    1 
ATOM   8601  O  O2    . DC  I  5 127 ? 22.742  -1.578  36.272  1.00 169.87 ? 54   DC  I O2    1 
ATOM   8602  N  N3    . DC  I  5 127 ? 22.524  -3.794  36.709  1.00 169.96 ? 54   DC  I N3    1 
ATOM   8603  C  C4    . DC  I  5 127 ? 23.086  -4.931  37.141  1.00 169.89 ? 54   DC  I C4    1 
ATOM   8604  N  N4    . DC  I  5 127 ? 22.325  -6.031  37.157  1.00 169.93 ? 54   DC  I N4    1 
ATOM   8605  C  C5    . DC  I  5 127 ? 24.453  -4.986  37.573  1.00 169.80 ? 54   DC  I C5    1 
ATOM   8606  C  C6    . DC  I  5 127 ? 25.158  -3.845  37.532  1.00 169.84 ? 54   DC  I C6    1 
ATOM   8607  P  P     . DG  I  5 128 ? 28.443  1.369   38.758  1.00 172.23 ? 55   DG  I P     1 
ATOM   8608  O  OP1   . DG  I  5 128 ? 29.628  1.758   37.952  1.00 172.04 ? 55   DG  I OP1   1 
ATOM   8609  O  OP2   . DG  I  5 128 ? 28.547  0.313   39.794  1.00 172.04 ? 55   DG  I OP2   1 
ATOM   8610  O  "O5'" . DG  I  5 128 ? 27.864  2.677   39.482  1.00 173.02 ? 55   DG  I "O5'" 1 
ATOM   8611  C  "C5'" . DG  I  5 128 ? 27.017  3.622   38.818  1.00 174.06 ? 55   DG  I "C5'" 1 
ATOM   8612  C  "C4'" . DG  I  5 128 ? 25.727  3.843   39.602  1.00 174.73 ? 55   DG  I "C4'" 1 
ATOM   8613  O  "O4'" . DG  I  5 128 ? 24.872  2.680   39.449  1.00 175.05 ? 55   DG  I "O4'" 1 
ATOM   8614  C  "C3'" . DG  I  5 128 ? 25.883  4.075   41.108  1.00 175.06 ? 55   DG  I "C3'" 1 
ATOM   8615  O  "O3'" . DG  I  5 128 ? 24.994  5.124   41.537  1.00 175.36 ? 55   DG  I "O3'" 1 
ATOM   8616  C  "C2'" . DG  I  5 128 ? 25.534  2.720   41.725  1.00 175.13 ? 55   DG  I "C2'" 1 
ATOM   8617  C  "C1'" . DG  I  5 128 ? 24.539  2.144   40.718  1.00 175.42 ? 55   DG  I "C1'" 1 
ATOM   8618  N  N9    . DG  I  5 128 ? 24.530  0.676   40.643  1.00 175.51 ? 55   DG  I N9    1 
ATOM   8619  C  C8    . DG  I  5 128 ? 25.596  -0.189  40.785  1.00 175.46 ? 55   DG  I C8    1 
ATOM   8620  N  N7    . DG  I  5 128 ? 25.273  -1.448  40.670  1.00 175.47 ? 55   DG  I N7    1 
ATOM   8621  C  C5    . DG  I  5 128 ? 23.900  -1.424  40.437  1.00 175.61 ? 55   DG  I C5    1 
ATOM   8622  C  C6    . DG  I  5 128 ? 22.982  -2.492  40.231  1.00 175.66 ? 55   DG  I C6    1 
ATOM   8623  O  O6    . DG  I  5 128 ? 23.217  -3.712  40.215  1.00 175.51 ? 55   DG  I O6    1 
ATOM   8624  N  N1    . DG  I  5 128 ? 21.674  -2.028  40.029  1.00 175.52 ? 55   DG  I N1    1 
ATOM   8625  C  C2    . DG  I  5 128 ? 21.302  -0.697  40.028  1.00 175.44 ? 55   DG  I C2    1 
ATOM   8626  N  N2    . DG  I  5 128 ? 20.003  -0.431  39.821  1.00 175.48 ? 55   DG  I N2    1 
ATOM   8627  N  N3    . DG  I  5 128 ? 22.149  0.308   40.220  1.00 175.40 ? 55   DG  I N3    1 
ATOM   8628  C  C4    . DG  I  5 128 ? 23.427  -0.123  40.418  1.00 175.55 ? 55   DG  I C4    1 
ATOM   8629  P  P     . DC  I  5 129 ? 25.092  5.834   42.980  1.00 175.25 ? 56   DC  I P     1 
ATOM   8630  O  OP1   . DC  I  5 129 ? 24.392  7.136   42.882  1.00 175.28 ? 56   DC  I OP1   1 
ATOM   8631  O  OP2   . DC  I  5 129 ? 26.497  5.796   43.455  1.00 175.13 ? 56   DC  I OP2   1 
ATOM   8632  O  "O5'" . DC  I  5 129 ? 24.228  4.864   43.917  1.00 174.68 ? 56   DC  I "O5'" 1 
ATOM   8633  C  "C5'" . DC  I  5 129 ? 22.863  4.568   43.613  1.00 173.61 ? 56   DC  I "C5'" 1 
ATOM   8634  C  "C4'" . DC  I  5 129 ? 22.337  3.439   44.480  1.00 172.94 ? 56   DC  I "C4'" 1 
ATOM   8635  O  "O4'" . DC  I  5 129 ? 22.672  2.161   43.883  1.00 172.81 ? 56   DC  I "O4'" 1 
ATOM   8636  C  "C3'" . DC  I  5 129 ? 22.894  3.390   45.905  1.00 172.57 ? 56   DC  I "C3'" 1 
ATOM   8637  O  "O3'" . DC  I  5 129 ? 21.848  3.666   46.843  1.00 172.07 ? 56   DC  I "O3'" 1 
ATOM   8638  C  "C2'" . DC  I  5 129 ? 23.450  1.969   46.052  1.00 172.57 ? 56   DC  I "C2'" 1 
ATOM   8639  C  "C1'" . DC  I  5 129 ? 22.704  1.230   44.942  1.00 172.60 ? 56   DC  I "C1'" 1 
ATOM   8640  N  N1    . DC  I  5 129 ? 23.287  -0.089  44.471  1.00 172.56 ? 56   DC  I N1    1 
ATOM   8641  C  C2    . DC  I  5 129 ? 22.420  -1.120  44.053  1.00 172.56 ? 56   DC  I C2    1 
ATOM   8642  O  O2    . DC  I  5 129 ? 21.193  -0.941  44.073  1.00 172.44 ? 56   DC  I O2    1 
ATOM   8643  N  N3    . DC  I  5 129 ? 22.949  -2.303  43.635  1.00 172.44 ? 56   DC  I N3    1 
ATOM   8644  C  C4    . DC  I  5 129 ? 24.274  -2.482  43.621  1.00 172.39 ? 56   DC  I C4    1 
ATOM   8645  N  N4    . DC  I  5 129 ? 24.740  -3.662  43.198  1.00 172.37 ? 56   DC  I N4    1 
ATOM   8646  C  C5    . DC  I  5 129 ? 25.174  -1.451  44.038  1.00 172.35 ? 56   DC  I C5    1 
ATOM   8647  C  C6    . DC  I  5 129 ? 24.645  -0.288  44.449  1.00 172.37 ? 56   DC  I C6    1 
ATOM   8648  P  P     . DA  I  5 130 ? 21.636  5.131   47.470  1.00 171.42 ? 57   DA  I P     1 
ATOM   8649  O  OP1   . DA  I  5 130 ? 21.562  6.121   46.365  1.00 171.40 ? 57   DA  I OP1   1 
ATOM   8650  O  OP2   . DA  I  5 130 ? 22.639  5.303   48.551  1.00 171.41 ? 57   DA  I OP2   1 
ATOM   8651  O  "O5'" . DA  I  5 130 ? 20.190  5.018   48.158  1.00 170.94 ? 57   DA  I "O5'" 1 
ATOM   8652  C  "C5'" . DA  I  5 130 ? 19.024  4.861   47.343  1.00 170.39 ? 57   DA  I "C5'" 1 
ATOM   8653  C  "C4'" . DA  I  5 130 ? 18.226  3.617   47.703  1.00 169.91 ? 57   DA  I "C4'" 1 
ATOM   8654  O  "O4'" . DA  I  5 130 ? 18.929  2.424   47.253  1.00 169.73 ? 57   DA  I "O4'" 1 
ATOM   8655  C  "C3'" . DA  I  5 130 ? 17.938  3.424   49.193  1.00 169.42 ? 57   DA  I "C3'" 1 
ATOM   8656  O  "O3'" . DA  I  5 130 ? 16.500  3.409   49.343  1.00 168.82 ? 57   DA  I "O3'" 1 
ATOM   8657  C  "C2'" . DA  I  5 130 ? 18.696  2.143   49.565  1.00 169.34 ? 57   DA  I "C2'" 1 
ATOM   8658  C  "C1'" . DA  I  5 130 ? 18.803  1.412   48.229  1.00 169.75 ? 57   DA  I "C1'" 1 
ATOM   8659  N  N9    . DA  I  5 130 ? 19.945  0.502   48.100  1.00 169.89 ? 57   DA  I N9    1 
ATOM   8660  C  C8    . DA  I  5 130 ? 21.210  0.679   48.596  1.00 169.96 ? 57   DA  I C8    1 
ATOM   8661  N  N7    . DA  I  5 130 ? 22.037  -0.305  48.324  1.00 170.03 ? 57   DA  I N7    1 
ATOM   8662  C  C5    . DA  I  5 130 ? 21.266  -1.196  47.595  1.00 170.03 ? 57   DA  I C5    1 
ATOM   8663  C  C6    . DA  I  5 130 ? 21.553  -2.452  47.005  1.00 169.97 ? 57   DA  I C6    1 
ATOM   8664  N  N6    . DA  I  5 130 ? 22.754  -3.041  47.063  1.00 169.79 ? 57   DA  I N6    1 
ATOM   8665  N  N1    . DA  I  5 130 ? 20.551  -3.082  46.344  1.00 170.04 ? 57   DA  I N1    1 
ATOM   8666  C  C2    . DA  I  5 130 ? 19.343  -2.496  46.283  1.00 170.00 ? 57   DA  I C2    1 
ATOM   8667  N  N3    . DA  I  5 130 ? 18.958  -1.323  46.796  1.00 169.98 ? 57   DA  I N3    1 
ATOM   8668  C  C4    . DA  I  5 130 ? 19.971  -0.713  47.446  1.00 169.99 ? 57   DA  I C4    1 
ATOM   8669  P  P     . DA  I  5 131 ? 15.642  2.449   50.304  1.00 167.95 ? 58   DA  I P     1 
ATOM   8670  O  OP1   . DA  I  5 131 ? 14.222  2.864   50.194  1.00 167.82 ? 58   DA  I OP1   1 
ATOM   8671  O  OP2   . DA  I  5 131 ? 16.274  2.418   51.645  1.00 167.99 ? 58   DA  I OP2   1 
ATOM   8672  O  "O5'" . DA  I  5 131 ? 15.826  1.005   49.627  1.00 166.29 ? 58   DA  I "O5'" 1 
ATOM   8673  C  "C5'" . DA  I  5 131 ? 15.198  0.636   48.389  1.00 163.45 ? 58   DA  I "C5'" 1 
ATOM   8674  C  "C4'" . DA  I  5 131 ? 15.008  -0.874  48.331  1.00 161.31 ? 58   DA  I "C4'" 1 
ATOM   8675  O  "O4'" . DA  I  5 131 ? 16.296  -1.546  48.316  1.00 160.86 ? 58   DA  I "O4'" 1 
ATOM   8676  C  "C3'" . DA  I  5 131 ? 14.251  -1.460  49.518  1.00 160.10 ? 58   DA  I "C3'" 1 
ATOM   8677  O  "O3'" . DA  I  5 131 ? 13.405  -2.521  49.099  1.00 158.20 ? 58   DA  I "O3'" 1 
ATOM   8678  C  "C2'" . DA  I  5 131 ? 15.359  -1.951  50.448  1.00 160.27 ? 58   DA  I "C2'" 1 
ATOM   8679  C  "C1'" . DA  I  5 131 ? 16.447  -2.366  49.462  1.00 160.59 ? 58   DA  I "C1'" 1 
ATOM   8680  N  N9    . DA  I  5 131 ? 17.806  -2.223  49.992  1.00 160.67 ? 58   DA  I N9    1 
ATOM   8681  C  C8    . DA  I  5 131 ? 18.297  -1.203  50.770  1.00 160.63 ? 58   DA  I C8    1 
ATOM   8682  N  N7    . DA  I  5 131 ? 19.559  -1.338  51.103  1.00 160.59 ? 58   DA  I N7    1 
ATOM   8683  C  C5    . DA  I  5 131 ? 19.929  -2.532  50.502  1.00 160.75 ? 58   DA  I C5    1 
ATOM   8684  C  C6    . DA  I  5 131 ? 21.148  -3.249  50.469  1.00 160.64 ? 58   DA  I C6    1 
ATOM   8685  N  N6    . DA  I  5 131 ? 22.259  -2.829  51.085  1.00 160.60 ? 58   DA  I N6    1 
ATOM   8686  N  N1    . DA  I  5 131 ? 21.183  -4.416  49.780  1.00 160.56 ? 58   DA  I N1    1 
ATOM   8687  C  C2    . DA  I  5 131 ? 20.070  -4.841  49.163  1.00 160.47 ? 58   DA  I C2    1 
ATOM   8688  N  N3    . DA  I  5 131 ? 18.870  -4.254  49.122  1.00 160.54 ? 58   DA  I N3    1 
ATOM   8689  C  C4    . DA  I  5 131 ? 18.861  -3.095  49.815  1.00 160.71 ? 58   DA  I C4    1 
ATOM   8690  P  P     . DG  I  5 132 ? 12.128  -2.935  49.973  1.00 156.89 ? 59   DG  I P     1 
ATOM   8691  O  OP1   . DG  I  5 132 ? 10.972  -2.983  49.060  1.00 157.48 ? 59   DG  I OP1   1 
ATOM   8692  O  OP2   . DG  I  5 132 ? 12.044  -2.091  51.187  1.00 157.08 ? 59   DG  I OP2   1 
ATOM   8693  O  "O5'" . DG  I  5 132 ? 12.476  -4.435  50.401  1.00 155.53 ? 59   DG  I "O5'" 1 
ATOM   8694  C  "C5'" . DG  I  5 132 ? 13.245  -4.693  51.560  1.00 153.33 ? 59   DG  I "C5'" 1 
ATOM   8695  C  "C4'" . DG  I  5 132 ? 14.325  -5.703  51.241  1.00 151.62 ? 59   DG  I "C4'" 1 
ATOM   8696  O  "O4'" . DG  I  5 132 ? 15.621  -5.060  51.278  1.00 151.02 ? 59   DG  I "O4'" 1 
ATOM   8697  C  "C3'" . DG  I  5 132 ? 14.369  -6.853  52.234  1.00 150.94 ? 59   DG  I "C3'" 1 
ATOM   8698  O  "O3'" . DG  I  5 132 ? 14.250  -8.087  51.537  1.00 150.12 ? 59   DG  I "O3'" 1 
ATOM   8699  C  "C2'" . DG  I  5 132 ? 15.724  -6.720  52.925  1.00 150.89 ? 59   DG  I "C2'" 1 
ATOM   8700  C  "C1'" . DG  I  5 132 ? 16.543  -5.895  51.939  1.00 150.48 ? 59   DG  I "C1'" 1 
ATOM   8701  N  N9    . DG  I  5 132 ? 17.566  -5.085  52.605  1.00 150.37 ? 59   DG  I N9    1 
ATOM   8702  C  C8    . DG  I  5 132 ? 17.399  -3.911  53.311  1.00 150.30 ? 59   DG  I C8    1 
ATOM   8703  N  N7    . DG  I  5 132 ? 18.508  -3.426  53.800  1.00 150.11 ? 59   DG  I N7    1 
ATOM   8704  C  C5    . DG  I  5 132 ? 19.473  -4.343  53.397  1.00 150.21 ? 59   DG  I C5    1 
ATOM   8705  C  C6    . DG  I  5 132 ? 20.872  -4.362  53.623  1.00 150.37 ? 59   DG  I C6    1 
ATOM   8706  O  O6    . DG  I  5 132 ? 21.555  -3.540  54.247  1.00 150.37 ? 59   DG  I O6    1 
ATOM   8707  N  N1    . DG  I  5 132 ? 21.489  -5.473  53.038  1.00 150.35 ? 59   DG  I N1    1 
ATOM   8708  C  C2    . DG  I  5 132 ? 20.832  -6.448  52.321  1.00 150.15 ? 59   DG  I C2    1 
ATOM   8709  N  N2    . DG  I  5 132 ? 21.583  -7.443  51.832  1.00 150.12 ? 59   DG  I N2    1 
ATOM   8710  N  N3    . DG  I  5 132 ? 19.523  -6.442  52.101  1.00 150.07 ? 59   DG  I N3    1 
ATOM   8711  C  C4    . DG  I  5 132 ? 18.910  -5.368  52.664  1.00 150.14 ? 59   DG  I C4    1 
ATOM   8712  P  P     . DG  I  5 133 ? 13.485  -9.335  52.190  1.00 149.25 ? 60   DG  I P     1 
ATOM   8713  O  OP1   . DG  I  5 133 ? 12.258  -9.555  51.393  1.00 149.23 ? 60   DG  I OP1   1 
ATOM   8714  O  OP2   . DG  I  5 133 ? 13.387  -9.122  53.655  1.00 149.09 ? 60   DG  I OP2   1 
ATOM   8715  O  "O5'" . DG  I  5 133 ? 14.484  -10.562 51.925  1.00 148.48 ? 60   DG  I "O5'" 1 
ATOM   8716  C  "C5'" . DG  I  5 133 ? 15.891  -10.352 51.754  1.00 147.08 ? 60   DG  I "C5'" 1 
ATOM   8717  C  "C4'" . DG  I  5 133 ? 16.709  -10.890 52.919  1.00 145.82 ? 60   DG  I "C4'" 1 
ATOM   8718  O  "O4'" . DG  I  5 133 ? 17.607  -9.856  53.404  1.00 145.05 ? 60   DG  I "O4'" 1 
ATOM   8719  C  "C3'" . DG  I  5 133 ? 15.921  -11.384 54.138  1.00 145.41 ? 60   DG  I "C3'" 1 
ATOM   8720  O  "O3'" . DG  I  5 133 ? 16.392  -12.703 54.462  1.00 145.01 ? 60   DG  I "O3'" 1 
ATOM   8721  C  "C2'" . DG  I  5 133 ? 16.215  -10.316 55.190  1.00 145.16 ? 60   DG  I "C2'" 1 
ATOM   8722  C  "C1'" . DG  I  5 133 ? 17.643  -9.952  54.810  1.00 144.90 ? 60   DG  I "C1'" 1 
ATOM   8723  N  N9    . DG  I  5 133 ? 18.140  -8.700  55.375  1.00 144.85 ? 60   DG  I N9    1 
ATOM   8724  C  C8    . DG  I  5 133 ? 17.421  -7.691  55.980  1.00 144.83 ? 60   DG  I C8    1 
ATOM   8725  N  N7    . DG  I  5 133 ? 18.157  -6.695  56.387  1.00 144.78 ? 60   DG  I N7    1 
ATOM   8726  C  C5    . DG  I  5 133 ? 19.449  -7.068  56.032  1.00 144.88 ? 60   DG  I C5    1 
ATOM   8727  C  C6    . DG  I  5 133 ? 20.683  -6.393  56.216  1.00 144.83 ? 60   DG  I C6    1 
ATOM   8728  O  O6    . DG  I  5 133 ? 20.876  -5.292  56.746  1.00 144.80 ? 60   DG  I O6    1 
ATOM   8729  N  N1    . DG  I  5 133 ? 21.766  -7.120  55.711  1.00 144.85 ? 60   DG  I N1    1 
ATOM   8730  C  C2    . DG  I  5 133 ? 21.666  -8.353  55.102  1.00 144.83 ? 60   DG  I C2    1 
ATOM   8731  N  N2    . DG  I  5 133 ? 22.811  -8.907  54.676  1.00 144.78 ? 60   DG  I N2    1 
ATOM   8732  N  N3    . DG  I  5 133 ? 20.516  -8.998  54.926  1.00 144.73 ? 60   DG  I N3    1 
ATOM   8733  C  C4    . DG  I  5 133 ? 19.455  -8.301  55.411  1.00 144.82 ? 60   DG  I C4    1 
ATOM   8734  P  P     . DG  I  5 134 ? 16.248  -13.471 55.870  1.00 144.29 ? 61   DG  I P     1 
ATOM   8735  O  OP1   . DG  I  5 134 ? 15.071  -14.364 55.769  1.00 144.11 ? 61   DG  I OP1   1 
ATOM   8736  O  OP2   . DG  I  5 134 ? 16.353  -12.534 57.012  1.00 144.03 ? 61   DG  I OP2   1 
ATOM   8737  O  "O5'" . DG  I  5 134 ? 17.591  -14.350 55.858  1.00 143.84 ? 61   DG  I "O5'" 1 
ATOM   8738  C  "C5'" . DG  I  5 134 ? 18.759  -13.943 55.116  1.00 142.83 ? 61   DG  I "C5'" 1 
ATOM   8739  C  "C4'" . DG  I  5 134 ? 19.996  -13.797 55.995  1.00 142.19 ? 61   DG  I "C4'" 1 
ATOM   8740  O  "O4'" . DG  I  5 134 ? 20.232  -12.391 56.284  1.00 141.99 ? 61   DG  I "O4'" 1 
ATOM   8741  C  "C3'" . DG  I  5 134 ? 19.921  -14.508 57.346  1.00 141.88 ? 61   DG  I "C3'" 1 
ATOM   8742  O  "O3'" . DG  I  5 134 ? 21.062  -15.345 57.538  1.00 141.24 ? 61   DG  I "O3'" 1 
ATOM   8743  C  "C2'" . DG  I  5 134 ? 19.848  -13.380 58.373  1.00 141.80 ? 61   DG  I "C2'" 1 
ATOM   8744  C  "C1'" . DG  I  5 134 ? 20.557  -12.245 57.652  1.00 141.91 ? 61   DG  I "C1'" 1 
ATOM   8745  N  N9    . DG  I  5 134 ? 20.130  -10.929 58.119  1.00 141.88 ? 61   DG  I N9    1 
ATOM   8746  C  C8    . DG  I  5 134 ? 18.837  -10.478 58.260  1.00 141.91 ? 61   DG  I C8    1 
ATOM   8747  N  N7    . DG  I  5 134 ? 18.753  -9.256  58.705  1.00 141.92 ? 61   DG  I N7    1 
ATOM   8748  C  C5    . DG  I  5 134 ? 20.078  -8.873  58.872  1.00 142.03 ? 61   DG  I C5    1 
ATOM   8749  C  C6    . DG  I  5 134 ? 20.621  -7.644  59.325  1.00 142.00 ? 61   DG  I C6    1 
ATOM   8750  O  O6    . DG  I  5 134 ? 20.008  -6.630  59.683  1.00 141.93 ? 61   DG  I O6    1 
ATOM   8751  N  N1    . DG  I  5 134 ? 22.019  -7.658  59.351  1.00 141.96 ? 61   DG  I N1    1 
ATOM   8752  C  C2    . DG  I  5 134 ? 22.798  -8.730  58.976  1.00 141.91 ? 61   DG  I C2    1 
ATOM   8753  N  N2    . DG  I  5 134 ? 24.125  -8.561  59.063  1.00 141.85 ? 61   DG  I N2    1 
ATOM   8754  N  N3    . DG  I  5 134 ? 22.302  -9.888  58.545  1.00 141.98 ? 61   DG  I N3    1 
ATOM   8755  C  C4    . DG  I  5 134 ? 20.940  -9.890  58.516  1.00 142.01 ? 61   DG  I C4    1 
ATOM   8756  P  P     . DA  I  5 135 ? 21.175  -16.314 58.810  1.00 140.60 ? 62   DA  I P     1 
ATOM   8757  O  OP1   . DA  I  5 135 ? 21.780  -17.585 58.352  1.00 140.93 ? 62   DA  I OP1   1 
ATOM   8758  O  OP2   . DA  I  5 135 ? 19.878  -16.357 59.525  1.00 140.39 ? 62   DA  I OP2   1 
ATOM   8759  O  "O5'" . DA  I  5 135 ? 22.219  -15.510 59.719  1.00 140.17 ? 62   DA  I "O5'" 1 
ATOM   8760  C  "C5'" . DA  I  5 135 ? 23.576  -15.321 59.305  1.00 139.43 ? 62   DA  I "C5'" 1 
ATOM   8761  C  "C4'" . DA  I  5 135 ? 24.374  -14.564 60.360  1.00 139.07 ? 62   DA  I "C4'" 1 
ATOM   8762  O  "O4'" . DA  I  5 135 ? 23.901  -13.190 60.432  1.00 139.09 ? 62   DA  I "O4'" 1 
ATOM   8763  C  "C3'" . DA  I  5 135 ? 24.309  -15.090 61.796  1.00 138.57 ? 62   DA  I "C3'" 1 
ATOM   8764  O  "O3'" . DA  I  5 135 ? 25.614  -14.959 62.375  1.00 137.80 ? 62   DA  I "O3'" 1 
ATOM   8765  C  "C2'" . DA  I  5 135 ? 23.261  -14.182 62.444  1.00 138.45 ? 62   DA  I "C2'" 1 
ATOM   8766  C  "C1'" . DA  I  5 135 ? 23.608  -12.857 61.776  1.00 138.63 ? 62   DA  I "C1'" 1 
ATOM   8767  N  N9    . DA  I  5 135 ? 22.542  -11.855 61.797  1.00 138.66 ? 62   DA  I N9    1 
ATOM   8768  C  C8    . DA  I  5 135 ? 21.248  -12.006 61.375  1.00 138.62 ? 62   DA  I C8    1 
ATOM   8769  N  N7    . DA  I  5 135 ? 20.508  -10.931 61.509  1.00 138.49 ? 62   DA  I N7    1 
ATOM   8770  C  C5    . DA  I  5 135 ? 21.381  -10.007 62.056  1.00 138.54 ? 62   DA  I C5    1 
ATOM   8771  C  C6    . DA  I  5 135 ? 21.216  -8.662  62.443  1.00 138.47 ? 62   DA  I C6    1 
ATOM   8772  N  N6    . DA  I  5 135 ? 20.055  -8.014  62.321  1.00 138.59 ? 62   DA  I N6    1 
ATOM   8773  N  N1    . DA  I  5 135 ? 22.284  -8.012  62.960  1.00 138.39 ? 62   DA  I N1    1 
ATOM   8774  C  C2    . DA  I  5 135 ? 23.445  -8.671  63.079  1.00 138.44 ? 62   DA  I C2    1 
ATOM   8775  N  N3    . DA  I  5 135 ? 23.722  -9.935  62.751  1.00 138.61 ? 62   DA  I N3    1 
ATOM   8776  C  C4    . DA  I  5 135 ? 22.639  -10.555 62.241  1.00 138.64 ? 62   DA  I C4    1 
ATOM   8777  P  P     . DT  I  5 136 ? 25.898  -15.021 63.954  1.00 137.39 ? 63   DT  I P     1 
ATOM   8778  O  OP1   . DT  I  5 136 ? 27.335  -15.353 64.122  1.00 137.41 ? 63   DT  I OP1   1 
ATOM   8779  O  OP2   . DT  I  5 136 ? 24.876  -15.906 64.564  1.00 137.51 ? 63   DT  I OP2   1 
ATOM   8780  O  "O5'" . DT  I  5 136 ? 25.620  -13.513 64.440  1.00 135.83 ? 63   DT  I "O5'" 1 
ATOM   8781  C  "C5'" . DT  I  5 136 ? 26.696  -12.599 64.715  1.00 133.80 ? 63   DT  I "C5'" 1 
ATOM   8782  C  "C4'" . DT  I  5 136 ? 26.292  -11.575 65.765  1.00 132.31 ? 63   DT  I "C4'" 1 
ATOM   8783  O  "O4'" . DT  I  5 136 ? 25.053  -10.939 65.353  1.00 131.74 ? 63   DT  I "O4'" 1 
ATOM   8784  C  "C3'" . DT  I  5 136 ? 26.057  -12.104 67.187  1.00 131.51 ? 63   DT  I "C3'" 1 
ATOM   8785  O  "O3'" . DT  I  5 136 ? 26.931  -11.411 68.107  1.00 130.42 ? 63   DT  I "O3'" 1 
ATOM   8786  C  "C2'" . DT  I  5 136 ? 24.566  -11.846 67.433  1.00 131.17 ? 63   DT  I "C2'" 1 
ATOM   8787  C  "C1'" . DT  I  5 136 ? 24.322  -10.645 66.526  1.00 130.83 ? 63   DT  I "C1'" 1 
ATOM   8788  N  N1    . DT  I  5 136 ? 22.885  -10.337 66.186  1.00 130.45 ? 63   DT  I N1    1 
ATOM   8789  C  C2    . DT  I  5 136 ? 22.426  -9.051  66.386  1.00 130.08 ? 63   DT  I C2    1 
ATOM   8790  O  O2    . DT  I  5 136 ? 23.115  -8.155  66.830  1.00 129.98 ? 63   DT  I O2    1 
ATOM   8791  N  N3    . DT  I  5 136 ? 21.110  -8.847  66.050  1.00 130.40 ? 63   DT  I N3    1 
ATOM   8792  C  C4    . DT  I  5 136 ? 20.211  -9.775  65.544  1.00 130.53 ? 63   DT  I C4    1 
ATOM   8793  O  O4    . DT  I  5 136 ? 19.047  -9.467  65.282  1.00 130.16 ? 63   DT  I O4    1 
ATOM   8794  C  C5    . DT  I  5 136 ? 20.752  -11.108 65.351  1.00 130.43 ? 63   DT  I C5    1 
ATOM   8795  C  C7    . DT  I  5 136 ? 19.897  -12.219 64.806  1.00 130.20 ? 63   DT  I C7    1 
ATOM   8796  C  C6    . DT  I  5 136 ? 22.043  -11.317 65.675  1.00 130.51 ? 63   DT  I C6    1 
ATOM   8797  P  P     . DA  I  5 137 ? 26.771  -11.412 69.710  1.00 129.58 ? 64   DA  I P     1 
ATOM   8798  O  OP1   . DA  I  5 137 ? 28.116  -11.209 70.293  1.00 129.79 ? 64   DA  I OP1   1 
ATOM   8799  O  OP2   . DA  I  5 137 ? 25.967  -12.579 70.147  1.00 129.65 ? 64   DA  I OP2   1 
ATOM   8800  O  "O5'" . DA  I  5 137 ? 25.892  -10.099 69.959  1.00 128.55 ? 64   DA  I "O5'" 1 
ATOM   8801  C  "C5'" . DA  I  5 137 ? 26.488  -8.805  69.935  1.00 126.41 ? 64   DA  I "C5'" 1 
ATOM   8802  C  "C4'" . DA  I  5 137 ? 25.499  -7.766  70.431  1.00 124.82 ? 64   DA  I "C4'" 1 
ATOM   8803  O  "O4'" . DA  I  5 137 ? 24.288  -7.859  69.644  1.00 124.09 ? 64   DA  I "O4'" 1 
ATOM   8804  C  "C3'" . DA  I  5 137 ? 25.080  -7.886  71.899  1.00 123.99 ? 64   DA  I "C3'" 1 
ATOM   8805  O  "O3'" . DA  I  5 137 ? 25.488  -6.678  72.579  1.00 123.36 ? 64   DA  I "O3'" 1 
ATOM   8806  C  "C2'" . DA  I  5 137 ? 23.565  -8.121  71.841  1.00 123.54 ? 64   DA  I "C2'" 1 
ATOM   8807  C  "C1'" . DA  I  5 137 ? 23.190  -7.557  70.473  1.00 123.17 ? 64   DA  I "C1'" 1 
ATOM   8808  N  N9    . DA  I  5 137 ? 21.990  -8.135  69.859  1.00 122.90 ? 64   DA  I N9    1 
ATOM   8809  C  C8    . DA  I  5 137 ? 21.788  -9.449  69.536  1.00 122.74 ? 64   DA  I C8    1 
ATOM   8810  N  N7    . DA  I  5 137 ? 20.620  -9.692  68.991  1.00 122.67 ? 64   DA  I N7    1 
ATOM   8811  C  C5    . DA  I  5 137 ? 20.009  -8.452  68.948  1.00 122.59 ? 64   DA  I C5    1 
ATOM   8812  C  C6    . DA  I  5 137 ? 18.748  -8.030  68.475  1.00 122.57 ? 64   DA  I C6    1 
ATOM   8813  N  N6    . DA  I  5 137 ? 17.856  -8.863  67.941  1.00 122.53 ? 64   DA  I N6    1 
ATOM   8814  N  N1    . DA  I  5 137 ? 18.437  -6.719  68.570  1.00 122.70 ? 64   DA  I N1    1 
ATOM   8815  C  C2    . DA  I  5 137 ? 19.341  -5.885  69.105  1.00 122.77 ? 64   DA  I C2    1 
ATOM   8816  N  N3    . DA  I  5 137 ? 20.558  -6.165  69.582  1.00 122.52 ? 64   DA  I N3    1 
ATOM   8817  C  C4    . DA  I  5 137 ? 20.841  -7.477  69.471  1.00 122.57 ? 64   DA  I C4    1 
ATOM   8818  P  P     . DT  I  5 138 ? 24.977  -6.208  74.031  1.00 122.62 ? 65   DT  I P     1 
ATOM   8819  O  OP1   . DT  I  5 138 ? 25.893  -5.154  74.517  1.00 122.47 ? 65   DT  I OP1   1 
ATOM   8820  O  OP2   . DT  I  5 138 ? 24.707  -7.387  74.885  1.00 122.44 ? 65   DT  I OP2   1 
ATOM   8821  O  "O5'" . DT  I  5 138 ? 23.574  -5.536  73.676  1.00 121.94 ? 65   DT  I "O5'" 1 
ATOM   8822  C  "C5'" . DT  I  5 138 ? 23.473  -4.441  72.762  1.00 120.21 ? 65   DT  I "C5'" 1 
ATOM   8823  C  "C4'" . DT  I  5 138 ? 22.132  -3.748  72.945  1.00 118.70 ? 65   DT  I "C4'" 1 
ATOM   8824  O  "O4'" . DT  I  5 138 ? 21.095  -4.484  72.241  1.00 118.40 ? 65   DT  I "O4'" 1 
ATOM   8825  C  "C3'" . DT  I  5 138 ? 21.662  -3.621  74.394  1.00 117.68 ? 65   DT  I "C3'" 1 
ATOM   8826  O  "O3'" . DT  I  5 138 ? 21.150  -2.305  74.574  1.00 116.13 ? 65   DT  I "O3'" 1 
ATOM   8827  C  "C2'" . DT  I  5 138 ? 20.599  -4.721  74.523  1.00 118.00 ? 65   DT  I "C2'" 1 
ATOM   8828  C  "C1'" . DT  I  5 138 ? 20.005  -4.726  73.118  1.00 118.25 ? 65   DT  I "C1'" 1 
ATOM   8829  N  N1    . DT  I  5 138 ? 19.293  -5.978  72.683  1.00 118.11 ? 65   DT  I N1    1 
ATOM   8830  C  C2    . DT  I  5 138 ? 18.001  -5.882  72.194  1.00 118.20 ? 65   DT  I C2    1 
ATOM   8831  O  O2    . DT  I  5 138 ? 17.387  -4.837  72.104  1.00 118.40 ? 65   DT  I O2    1 
ATOM   8832  N  N3    . DT  I  5 138 ? 17.433  -7.070  71.804  1.00 118.28 ? 65   DT  I N3    1 
ATOM   8833  C  C4    . DT  I  5 138 ? 18.014  -8.326  71.848  1.00 118.24 ? 65   DT  I C4    1 
ATOM   8834  O  O4    . DT  I  5 138 ? 17.412  -9.327  71.473  1.00 118.13 ? 65   DT  I O4    1 
ATOM   8835  C  C5    . DT  I  5 138 ? 19.367  -8.363  72.366  1.00 118.36 ? 65   DT  I C5    1 
ATOM   8836  C  C7    . DT  I  5 138 ? 20.111  -9.664  72.468  1.00 118.46 ? 65   DT  I C7    1 
ATOM   8837  C  C6    . DT  I  5 138 ? 19.933  -7.205  72.751  1.00 118.32 ? 65   DT  I C6    1 
ATOM   8838  P  P     . DT  I  5 139 ? 20.644  -1.733  75.984  1.00 115.10 ? 66   DT  I P     1 
ATOM   8839  O  OP1   . DT  I  5 139 ? 21.742  -0.901  76.517  1.00 115.58 ? 66   DT  I OP1   1 
ATOM   8840  O  OP2   . DT  I  5 139 ? 20.074  -2.823  76.807  1.00 114.75 ? 66   DT  I OP2   1 
ATOM   8841  O  "O5'" . DT  I  5 139 ? 19.436  -0.772  75.567  1.00 113.90 ? 66   DT  I "O5'" 1 
ATOM   8842  C  "C5'" . DT  I  5 139 ? 19.043  -0.689  74.197  1.00 112.55 ? 66   DT  I "C5'" 1 
ATOM   8843  C  "C4'" . DT  I  5 139 ? 17.538  -0.814  74.029  1.00 111.49 ? 66   DT  I "C4'" 1 
ATOM   8844  O  "O4'" . DT  I  5 139 ? 17.160  -2.187  73.743  1.00 111.06 ? 66   DT  I "O4'" 1 
ATOM   8845  C  "C3'" . DT  I  5 139 ? 16.713  -0.379  75.235  1.00 110.97 ? 66   DT  I "C3'" 1 
ATOM   8846  O  "O3'" . DT  I  5 139 ? 15.769  0.564   74.746  1.00 110.54 ? 66   DT  I "O3'" 1 
ATOM   8847  C  "C2'" . DT  I  5 139 ? 16.110  -1.686  75.751  1.00 111.13 ? 66   DT  I "C2'" 1 
ATOM   8848  C  "C1'" . DT  I  5 139 ? 15.985  -2.493  74.464  1.00 111.25 ? 66   DT  I "C1'" 1 
ATOM   8849  N  N1    . DT  I  5 139 ? 15.882  -3.986  74.636  1.00 111.10 ? 66   DT  I N1    1 
ATOM   8850  C  C2    . DT  I  5 139 ? 14.850  -4.692  74.034  1.00 110.89 ? 66   DT  I C2    1 
ATOM   8851  O  O2    . DT  I  5 139 ? 13.975  -4.189  73.353  1.00 110.89 ? 66   DT  I O2    1 
ATOM   8852  N  N3    . DT  I  5 139 ? 14.873  -6.046  74.261  1.00 111.07 ? 66   DT  I N3    1 
ATOM   8853  C  C4    . DT  I  5 139 ? 15.801  -6.756  75.012  1.00 111.39 ? 66   DT  I C4    1 
ATOM   8854  O  O4    . DT  I  5 139 ? 15.729  -7.974  75.151  1.00 111.33 ? 66   DT  I O4    1 
ATOM   8855  C  C5    . DT  I  5 139 ? 16.851  -5.964  75.615  1.00 111.44 ? 66   DT  I C5    1 
ATOM   8856  C  C7    . DT  I  5 139 ? 17.920  -6.607  76.453  1.00 111.12 ? 66   DT  I C7    1 
ATOM   8857  C  C6    . DT  I  5 139 ? 16.839  -4.639  75.398  1.00 111.48 ? 66   DT  I C6    1 
ATOM   8858  P  P     . DT  I  5 140 ? 14.426  0.975   75.502  1.00 110.36 ? 67   DT  I P     1 
ATOM   8859  O  OP1   . DT  I  5 140 ? 13.950  2.241   74.892  1.00 110.11 ? 67   DT  I OP1   1 
ATOM   8860  O  OP2   . DT  I  5 140 ? 14.647  0.871   76.964  1.00 110.32 ? 67   DT  I OP2   1 
ATOM   8861  O  "O5'" . DT  I  5 140 ? 13.434  -0.203  75.072  1.00 110.76 ? 67   DT  I "O5'" 1 
ATOM   8862  C  "C5'" . DT  I  5 140 ? 12.785  -0.231  73.794  1.00 110.04 ? 67   DT  I "C5'" 1 
ATOM   8863  C  "C4'" . DT  I  5 140 ? 11.452  -0.963  73.891  1.00 109.25 ? 67   DT  I "C4'" 1 
ATOM   8864  O  "O4'" . DT  I  5 140 ? 11.681  -2.383  74.101  1.00 108.85 ? 67   DT  I "O4'" 1 
ATOM   8865  C  "C3'" . DT  I  5 140 ? 10.532  -0.509  75.022  1.00 108.67 ? 67   DT  I "C3'" 1 
ATOM   8866  O  "O3'" . DT  I  5 140 ? 9.204   -0.545  74.549  1.00 108.84 ? 67   DT  I "O3'" 1 
ATOM   8867  C  "C2'" . DT  I  5 140 ? 10.745  -1.561  76.108  1.00 108.67 ? 67   DT  I "C2'" 1 
ATOM   8868  C  "C1'" . DT  I  5 140 ? 11.014  -2.813  75.276  1.00 108.80 ? 67   DT  I "C1'" 1 
ATOM   8869  N  N1    . DT  I  5 140 ? 11.826  -3.892  75.954  1.00 108.91 ? 67   DT  I N1    1 
ATOM   8870  C  C2    . DT  I  5 140 ? 11.551  -5.217  75.671  1.00 108.93 ? 67   DT  I C2    1 
ATOM   8871  O  O2    . DT  I  5 140 ? 10.679  -5.575  74.900  1.00 108.91 ? 67   DT  I O2    1 
ATOM   8872  N  N3    . DT  I  5 140 ? 12.340  -6.127  76.332  1.00 108.91 ? 67   DT  I N3    1 
ATOM   8873  C  C4    . DT  I  5 140 ? 13.356  -5.859  77.228  1.00 108.61 ? 67   DT  I C4    1 
ATOM   8874  O  O4    . DT  I  5 140 ? 14.000  -6.757  77.756  1.00 108.51 ? 67   DT  I O4    1 
ATOM   8875  C  C5    . DT  I  5 140 ? 13.599  -4.458  77.482  1.00 108.83 ? 67   DT  I C5    1 
ATOM   8876  C  C7    . DT  I  5 140 ? 14.677  -4.023  78.432  1.00 109.06 ? 67   DT  I C7    1 
ATOM   8877  C  C6    . DT  I  5 140 ? 12.836  -3.557  76.843  1.00 109.02 ? 67   DT  I C6    1 
ATOM   8878  P  P     . DG  I  5 141 ? 8.047   0.371   75.169  1.00 108.96 ? 68   DG  I P     1 
ATOM   8879  O  OP1   . DG  I  5 141 ? 7.945   1.536   74.263  1.00 109.21 ? 68   DG  I OP1   1 
ATOM   8880  O  OP2   . DG  I  5 141 ? 8.251   0.542   76.630  1.00 108.42 ? 68   DG  I OP2   1 
ATOM   8881  O  "O5'" . DG  I  5 141 ? 6.722   -0.519  74.999  1.00 109.40 ? 68   DG  I "O5'" 1 
ATOM   8882  C  "C5'" . DG  I  5 141 ? 6.563   -1.488  73.929  1.00 109.22 ? 68   DG  I "C5'" 1 
ATOM   8883  C  "C4'" . DG  I  5 141 ? 5.549   -2.578  74.285  1.00 108.48 ? 68   DG  I "C4'" 1 
ATOM   8884  O  "O4'" . DG  I  5 141 ? 6.195   -3.657  75.017  1.00 108.19 ? 68   DG  I "O4'" 1 
ATOM   8885  C  "C3'" . DG  I  5 141 ? 4.370   -2.162  75.163  1.00 108.21 ? 68   DG  I "C3'" 1 
ATOM   8886  O  "O3'" . DG  I  5 141 ? 3.217   -2.906  74.737  1.00 108.32 ? 68   DG  I "O3'" 1 
ATOM   8887  C  "C2'" . DG  I  5 141 ? 4.844   -2.491  76.581  1.00 107.67 ? 68   DG  I "C2'" 1 
ATOM   8888  C  "C1'" . DG  I  5 141 ? 5.679   -3.746  76.336  1.00 107.66 ? 68   DG  I "C1'" 1 
ATOM   8889  N  N9    . DG  I  5 141 ? 6.826   -3.942  77.224  1.00 107.61 ? 68   DG  I N9    1 
ATOM   8890  C  C8    . DG  I  5 141 ? 7.436   -3.041  78.068  1.00 107.55 ? 68   DG  I C8    1 
ATOM   8891  N  N7    . DG  I  5 141 ? 8.449   -3.542  78.722  1.00 107.61 ? 68   DG  I N7    1 
ATOM   8892  C  C5    . DG  I  5 141 ? 8.519   -4.859  78.285  1.00 107.55 ? 68   DG  I C5    1 
ATOM   8893  C  C6    . DG  I  5 141 ? 9.413   -5.905  78.633  1.00 107.34 ? 68   DG  I C6    1 
ATOM   8894  O  O6    . DG  I  5 141 ? 10.363  -5.883  79.422  1.00 107.10 ? 68   DG  I O6    1 
ATOM   8895  N  N1    . DG  I  5 141 ? 9.119   -7.084  77.949  1.00 107.83 ? 68   DG  I N1    1 
ATOM   8896  C  C2    . DG  I  5 141 ? 8.095   -7.238  77.041  1.00 107.48 ? 68   DG  I C2    1 
ATOM   8897  N  N2    . DG  I  5 141 ? 7.960   -8.443  76.481  1.00 107.30 ? 68   DG  I N2    1 
ATOM   8898  N  N3    . DG  I  5 141 ? 7.257   -6.270  76.705  1.00 107.47 ? 68   DG  I N3    1 
ATOM   8899  C  C4    . DG  I  5 141 ? 7.527   -5.115  77.361  1.00 107.62 ? 68   DG  I C4    1 
ATOM   8900  P  P     . DG  I  5 142 ? 1.860   -3.000  75.594  1.00 108.15 ? 69   DG  I P     1 
ATOM   8901  O  OP1   . DG  I  5 142 ? 0.742   -3.271  74.654  1.00 107.81 ? 69   DG  I OP1   1 
ATOM   8902  O  OP2   . DG  I  5 142 ? 1.781   -1.844  76.523  1.00 108.04 ? 69   DG  I OP2   1 
ATOM   8903  O  "O5'" . DG  I  5 142 ? 2.141   -4.300  76.482  1.00 106.67 ? 69   DG  I "O5'" 1 
ATOM   8904  C  "C5'" . DG  I  5 142 ? 1.982   -5.630  75.992  1.00 103.46 ? 69   DG  I "C5'" 1 
ATOM   8905  C  "C4'" . DG  I  5 142 ? 2.197   -6.564  77.164  1.00 101.64 ? 69   DG  I "C4'" 1 
ATOM   8906  O  "O4'" . DG  I  5 142 ? 3.489   -6.271  77.762  1.00 102.09 ? 69   DG  I "O4'" 1 
ATOM   8907  C  "C3'" . DG  I  5 142 ? 1.176   -6.411  78.301  1.00 99.93  ? 69   DG  I "C3'" 1 
ATOM   8908  O  "O3'" . DG  I  5 142 ? 0.732   -7.682  78.773  1.00 95.92  ? 69   DG  I "O3'" 1 
ATOM   8909  C  "C2'" . DG  I  5 142 ? 1.964   -5.702  79.399  1.00 101.13 ? 69   DG  I "C2'" 1 
ATOM   8910  C  "C1'" . DG  I  5 142 ? 3.292   -6.398  79.154  1.00 103.35 ? 69   DG  I "C1'" 1 
ATOM   8911  N  N9    . DG  I  5 142 ? 4.432   -5.930  79.934  1.00 103.91 ? 69   DG  I N9    1 
ATOM   8912  C  C8    . DG  I  5 142 ? 4.677   -4.680  80.465  1.00 104.56 ? 69   DG  I C8    1 
ATOM   8913  N  N7    . DG  I  5 142 ? 5.798   -4.600  81.134  1.00 104.86 ? 69   DG  I N7    1 
ATOM   8914  C  C5    . DG  I  5 142 ? 6.318   -5.889  81.041  1.00 104.73 ? 69   DG  I C5    1 
ATOM   8915  C  C6    . DG  I  5 142 ? 7.514   -6.432  81.562  1.00 104.39 ? 69   DG  I C6    1 
ATOM   8916  O  O6    . DG  I  5 142 ? 8.373   -5.848  82.232  1.00 104.46 ? 69   DG  I O6    1 
ATOM   8917  N  N1    . DG  I  5 142 ? 7.670   -7.783  81.240  1.00 104.16 ? 69   DG  I N1    1 
ATOM   8918  C  C2    . DG  I  5 142 ? 6.775   -8.521  80.501  1.00 104.29 ? 69   DG  I C2    1 
ATOM   8919  N  N2    . DG  I  5 142 ? 7.080   -9.807  80.282  1.00 104.43 ? 69   DG  I N2    1 
ATOM   8920  N  N3    . DG  I  5 142 ? 5.651   -8.028  80.007  1.00 104.42 ? 69   DG  I N3    1 
ATOM   8921  C  C4    . DG  I  5 142 ? 5.490   -6.715  80.312  1.00 104.44 ? 69   DG  I C4    1 
ATOM   8922  P  P     . DA  I  5 143 ? -0.724  -8.248  78.444  1.00 92.23  ? 70   DA  I P     1 
ATOM   8923  O  OP1   . DA  I  5 143 ? -0.967  -8.051  76.997  1.00 91.97  ? 70   DA  I OP1   1 
ATOM   8924  O  OP2   . DA  I  5 143 ? -1.674  -7.724  79.456  1.00 90.81  ? 70   DA  I OP2   1 
ATOM   8925  O  "O5'" . DA  I  5 143 ? -0.537  -9.819  78.691  1.00 90.74  ? 70   DA  I "O5'" 1 
ATOM   8926  C  "C5'" . DA  I  5 143 ? 0.372   -10.597 77.912  1.00 87.83  ? 70   DA  I "C5'" 1 
ATOM   8927  C  "C4'" . DA  I  5 143 ? 1.120   -11.584 78.798  1.00 86.50  ? 70   DA  I "C4'" 1 
ATOM   8928  O  "O4'" . DA  I  5 143 ? 2.222   -10.912 79.463  1.00 86.46  ? 70   DA  I "O4'" 1 
ATOM   8929  C  "C3'" . DA  I  5 143 ? 0.282   -12.236 79.899  1.00 85.27  ? 70   DA  I "C3'" 1 
ATOM   8930  O  "O3'" . DA  I  5 143 ? 0.552   -13.645 79.959  1.00 82.55  ? 70   DA  I "O3'" 1 
ATOM   8931  C  "C2'" . DA  I  5 143 ? 0.701   -11.504 81.173  1.00 85.53  ? 70   DA  I "C2'" 1 
ATOM   8932  C  "C1'" . DA  I  5 143 ? 2.144   -11.124 80.858  1.00 87.18  ? 70   DA  I "C1'" 1 
ATOM   8933  N  N9    . DA  I  5 143 ? 2.564   -9.907  81.541  1.00 87.77  ? 70   DA  I N9    1 
ATOM   8934  C  C8    . DA  I  5 143 ? 1.912   -8.704  81.539  1.00 87.73  ? 70   DA  I C8    1 
ATOM   8935  N  N7    . DA  I  5 143 ? 2.512   -7.781  82.247  1.00 87.88  ? 70   DA  I N7    1 
ATOM   8936  C  C5    . DA  I  5 143 ? 3.634   -8.420  82.750  1.00 88.16  ? 70   DA  I C5    1 
ATOM   8937  C  C6    . DA  I  5 143 ? 4.689   -7.984  83.581  1.00 88.16  ? 70   DA  I C6    1 
ATOM   8938  N  N6    . DA  I  5 143 ? 4.771   -6.739  84.065  1.00 88.10  ? 70   DA  I N6    1 
ATOM   8939  N  N1    . DA  I  5 143 ? 5.657   -8.876  83.898  1.00 87.93  ? 70   DA  I N1    1 
ATOM   8940  C  C2    . DA  I  5 143 ? 5.572   -10.122 83.415  1.00 87.64  ? 70   DA  I C2    1 
ATOM   8941  N  N3    . DA  I  5 143 ? 4.630   -10.640 82.628  1.00 87.96  ? 70   DA  I N3    1 
ATOM   8942  C  C4    . DA  I  5 143 ? 3.683   -9.734  82.326  1.00 87.93  ? 70   DA  I C4    1 
ATOM   8943  P  P     . DG  I  5 144 ? -0.322  -14.617 80.877  1.00 80.26  ? 71   DG  I P     1 
ATOM   8944  O  OP1   . DG  I  5 144 ? -0.315  -15.920 80.205  1.00 81.25  ? 71   DG  I OP1   1 
ATOM   8945  O  OP2   . DG  I  5 144 ? -1.597  -13.976 81.253  1.00 79.25  ? 71   DG  I OP2   1 
ATOM   8946  O  "O5'" . DG  I  5 144 ? 0.534   -14.760 82.201  1.00 83.50  ? 71   DG  I "O5'" 1 
ATOM   8947  C  "C5'" . DG  I  5 144 ? 1.912   -15.075 82.095  1.00 88.11  ? 71   DG  I "C5'" 1 
ATOM   8948  C  "C4'" . DG  I  5 144 ? 2.622   -14.845 83.416  1.00 91.36  ? 71   DG  I "C4'" 1 
ATOM   8949  O  "O4'" . DG  I  5 144 ? 2.760   -13.423 83.674  1.00 92.19  ? 71   DG  I "O4'" 1 
ATOM   8950  C  "C3'" . DG  I  5 144 ? 1.924   -15.439 84.641  1.00 93.31  ? 71   DG  I "C3'" 1 
ATOM   8951  O  "O3'" . DG  I  5 144 ? 2.946   -16.140 85.367  1.00 96.61  ? 71   DG  I "O3'" 1 
ATOM   8952  C  "C2'" . DG  I  5 144 ? 1.358   -14.210 85.357  1.00 92.45  ? 71   DG  I "C2'" 1 
ATOM   8953  C  "C1'" . DG  I  5 144 ? 2.482   -13.226 85.042  1.00 92.85  ? 71   DG  I "C1'" 1 
ATOM   8954  N  N9    . DG  I  5 144 ? 2.235   -11.806 85.296  1.00 93.00  ? 71   DG  I N9    1 
ATOM   8955  C  C8    . DG  I  5 144 ? 1.128   -11.048 84.994  1.00 92.91  ? 71   DG  I C8    1 
ATOM   8956  N  N7    . DG  I  5 144 ? 1.230   -9.803  85.374  1.00 93.06  ? 71   DG  I N7    1 
ATOM   8957  C  C5    . DG  I  5 144 ? 2.490   -9.733  85.960  1.00 93.18  ? 71   DG  I C5    1 
ATOM   8958  C  C6    . DG  I  5 144 ? 3.177   -8.643  86.553  1.00 93.04  ? 71   DG  I C6    1 
ATOM   8959  O  O6    . DG  I  5 144 ? 2.787   -7.477  86.678  1.00 93.26  ? 71   DG  I O6    1 
ATOM   8960  N  N1    . DG  I  5 144 ? 4.437   -8.998  87.034  1.00 92.80  ? 71   DG  I N1    1 
ATOM   8961  C  C2    . DG  I  5 144 ? 4.976   -10.257 86.954  1.00 92.85  ? 71   DG  I C2    1 
ATOM   8962  N  N2    . DG  I  5 144 ? 6.197   -10.414 87.472  1.00 92.96  ? 71   DG  I N2    1 
ATOM   8963  N  N3    . DG  I  5 144 ? 4.355   -11.291 86.398  1.00 93.31  ? 71   DG  I N3    1 
ATOM   8964  C  C4    . DG  I  5 144 ? 3.120   -10.957 85.921  1.00 93.38  ? 71   DG  I C4    1 
ATOM   8965  P  P     . DA  I  5 145 ? 2.700   -16.966 86.721  1.00 98.87  ? 72   DA  I P     1 
ATOM   8966  O  OP1   . DA  I  5 145 ? 3.423   -18.256 86.554  1.00 97.87  ? 72   DA  I OP1   1 
ATOM   8967  O  OP2   . DA  I  5 145 ? 1.256   -16.900 87.104  1.00 97.26  ? 72   DA  I OP2   1 
ATOM   8968  O  "O5'" . DA  I  5 145 ? 3.503   -16.078 87.782  1.00 99.16  ? 72   DA  I "O5'" 1 
ATOM   8969  C  "C5'" . DA  I  5 145 ? 4.905   -15.854 87.628  1.00 100.41 ? 72   DA  I "C5'" 1 
ATOM   8970  C  "C4'" . DA  I  5 145 ? 5.427   -15.069 88.818  1.00 100.95 ? 72   DA  I "C4'" 1 
ATOM   8971  O  "O4'" . DA  I  5 145 ? 4.948   -13.706 88.736  1.00 100.86 ? 72   DA  I "O4'" 1 
ATOM   8972  C  "C3'" . DA  I  5 145 ? 4.994   -15.595 90.185  1.00 101.84 ? 72   DA  I "C3'" 1 
ATOM   8973  O  "O3'" . DA  I  5 145 ? 6.148   -15.631 91.018  1.00 103.11 ? 72   DA  I "O3'" 1 
ATOM   8974  C  "C2'" . DA  I  5 145 ? 3.924   -14.610 90.666  1.00 101.03 ? 72   DA  I "C2'" 1 
ATOM   8975  C  "C1'" . DA  I  5 145 ? 4.311   -13.327 89.938  1.00 100.42 ? 72   DA  I "C1'" 1 
ATOM   8976  N  N9    . DA  I  5 145 ? 3.198   -12.458 89.568  1.00 100.20 ? 72   DA  I N9    1 
ATOM   8977  C  C8    . DA  I  5 145 ? 2.021   -12.824 88.973  1.00 100.10 ? 72   DA  I C8    1 
ATOM   8978  N  N7    . DA  I  5 145 ? 1.203   -11.821 88.748  1.00 100.06 ? 72   DA  I N7    1 
ATOM   8979  C  C5    . DA  I  5 145 ? 1.895   -10.723 89.226  1.00 100.09 ? 72   DA  I C5    1 
ATOM   8980  C  C6    . DA  I  5 145 ? 1.573   -9.355  89.285  1.00 100.06 ? 72   DA  I C6    1 
ATOM   8981  N  N6    . DA  I  5 145 ? 0.417   -8.871  88.823  1.00 100.19 ? 72   DA  I N6    1 
ATOM   8982  N  N1    . DA  I  5 145 ? 2.482   -8.510  89.824  1.00 100.14 ? 72   DA  I N1    1 
ATOM   8983  C  C2    . DA  I  5 145 ? 3.643   -9.003  90.282  1.00 100.10 ? 72   DA  I C2    1 
ATOM   8984  N  N3    . DA  I  5 145 ? 4.058   -10.271 90.281  1.00 100.30 ? 72   DA  I N3    1 
ATOM   8985  C  C4    . DA  I  5 145 ? 3.130   -11.090 89.736  1.00 100.37 ? 72   DA  I C4    1 
ATOM   8986  P  P     . DT  I  5 146 ? 6.210   -16.395 92.426  1.00 103.61 ? 73   DT  I P     1 
ATOM   8987  O  OP1   . DT  I  5 146 ? 7.403   -17.276 92.375  1.00 102.63 ? 73   DT  I OP1   1 
ATOM   8988  O  OP2   . DT  I  5 146 ? 4.872   -16.919 92.800  1.00 102.54 ? 73   DT  I OP2   1 
ATOM   8989  O  "O5'" . DT  I  5 146 ? 6.523   -15.162 93.390  1.00 104.57 ? 73   DT  I "O5'" 1 
ATOM   8990  C  "C5'" . DT  I  5 146 ? 7.468   -14.161 92.979  1.00 106.11 ? 73   DT  I "C5'" 1 
ATOM   8991  C  "C4'" . DT  I  5 146 ? 7.365   -12.934 93.866  1.00 106.91 ? 73   DT  I "C4'" 1 
ATOM   8992  O  "O4'" . DT  I  5 146 ? 6.318   -12.057 93.364  1.00 107.14 ? 73   DT  I "O4'" 1 
ATOM   8993  C  "C3'" . DT  I  5 146 ? 7.024   -13.266 95.321  1.00 107.44 ? 73   DT  I "C3'" 1 
ATOM   8994  O  "O3'" . DT  I  5 146 ? 8.017   -12.709 96.199  1.00 107.10 ? 73   DT  I "O3'" 1 
ATOM   8995  C  "C2'" . DT  I  5 146 ? 5.602   -12.713 95.520  1.00 107.21 ? 73   DT  I "C2'" 1 
ATOM   8996  C  "C1'" . DT  I  5 146 ? 5.521   -11.619 94.450  1.00 107.11 ? 73   DT  I "C1'" 1 
ATOM   8997  N  N1    . DT  I  5 146 ? 4.136   -11.266 93.954  1.00 106.92 ? 73   DT  I N1    1 
ATOM   8998  C  C2    . DT  I  5 146 ? 3.752   -9.931  93.903  1.00 107.11 ? 73   DT  I C2    1 
ATOM   8999  O  O2    . DT  I  5 146 ? 4.467   -9.003  94.241  1.00 107.02 ? 73   DT  I O2    1 
ATOM   9000  N  N3    . DT  I  5 146 ? 2.477   -9.704  93.436  1.00 106.95 ? 73   DT  I N3    1 
ATOM   9001  C  C4    . DT  I  5 146 ? 1.564   -10.657 93.018  1.00 106.86 ? 73   DT  I C4    1 
ATOM   9002  O  O4    . DT  I  5 146 ? 0.446   -10.349 92.616  1.00 106.62 ? 73   DT  I O4    1 
ATOM   9003  C  C5    . DT  I  5 146 ? 2.023   -12.029 93.092  1.00 107.04 ? 73   DT  I C5    1 
ATOM   9004  C  C7    . DT  I  5 146 ? 1.120   -13.151 92.663  1.00 107.23 ? 73   DT  I C7    1 
ATOM   9005  C  C6    . DT  I  5 146 ? 3.267   -12.267 93.548  1.00 106.79 ? 73   DT  I C6    1 
ATOM   9006  O  "O5'" . DA  J  5 1   ? -3.094  -0.189  92.731  1.00 143.18 ? -73  DA  J "O5'" 1 
ATOM   9007  C  "C5'" . DA  J  5 1   ? -2.414  0.713   93.647  1.00 143.11 ? -73  DA  J "C5'" 1 
ATOM   9008  C  "C4'" . DA  J  5 1   ? -1.186  0.049   94.264  1.00 142.82 ? -73  DA  J "C4'" 1 
ATOM   9009  O  "O4'" . DA  J  5 1   ? -1.463  -1.361  94.517  1.00 143.01 ? -73  DA  J "O4'" 1 
ATOM   9010  C  "C3'" . DA  J  5 1   ? 0.064   0.107   93.387  1.00 142.40 ? -73  DA  J "C3'" 1 
ATOM   9011  O  "O3'" . DA  J  5 1   ? 1.170   0.596   94.148  1.00 141.41 ? -73  DA  J "O3'" 1 
ATOM   9012  C  "C2'" . DA  J  5 1   ? 0.280   -1.336  92.927  1.00 142.74 ? -73  DA  J "C2'" 1 
ATOM   9013  C  "C1'" . DA  J  5 1   ? -0.413  -2.161  94.005  1.00 143.00 ? -73  DA  J "C1'" 1 
ATOM   9014  N  N9    . DA  J  5 1   ? -0.952  -3.415  93.471  1.00 143.06 ? -73  DA  J N9    1 
ATOM   9015  C  C8    . DA  J  5 1   ? -2.216  -3.664  92.993  1.00 142.98 ? -73  DA  J C8    1 
ATOM   9016  N  N7    . DA  J  5 1   ? -2.401  -4.894  92.570  1.00 142.68 ? -73  DA  J N7    1 
ATOM   9017  C  C5    . DA  J  5 1   ? -1.168  -5.492  92.783  1.00 143.09 ? -73  DA  J C5    1 
ATOM   9018  C  C6    . DA  J  5 1   ? -0.689  -6.800  92.548  1.00 143.13 ? -73  DA  J C6    1 
ATOM   9019  N  N6    . DA  J  5 1   ? -1.448  -7.768  92.022  1.00 143.03 ? -73  DA  J N6    1 
ATOM   9020  N  N1    . DA  J  5 1   ? 0.600   -7.075  92.875  1.00 143.12 ? -73  DA  J N1    1 
ATOM   9021  C  C2    . DA  J  5 1   ? 1.361   -6.102  93.406  1.00 142.97 ? -73  DA  J C2    1 
ATOM   9022  N  N3    . DA  J  5 1   ? 1.025   -4.836  93.670  1.00 142.97 ? -73  DA  J N3    1 
ATOM   9023  C  C4    . DA  J  5 1   ? -0.261  -4.596  93.335  1.00 143.15 ? -73  DA  J C4    1 
ATOM   9024  P  P     . DT  J  5 2   ? 2.521   1.106   93.440  1.00 140.93 ? -72  DT  J P     1 
ATOM   9025  O  OP1   . DT  J  5 2   ? 3.193   2.037   94.378  1.00 140.95 ? -72  DT  J OP1   1 
ATOM   9026  O  OP2   . DT  J  5 2   ? 2.205   1.567   92.066  1.00 140.82 ? -72  DT  J OP2   1 
ATOM   9027  O  "O5'" . DT  J  5 2   ? 3.377   -0.249  93.315  1.00 139.93 ? -72  DT  J "O5'" 1 
ATOM   9028  C  "C5'" . DT  J  5 2   ? 4.352   -0.608  94.291  1.00 137.97 ? -72  DT  J "C5'" 1 
ATOM   9029  C  "C4'" . DT  J  5 2   ? 5.314   -1.658  93.753  1.00 136.29 ? -72  DT  J "C4'" 1 
ATOM   9030  O  "O4'" . DT  J  5 2   ? 4.558   -2.823  93.324  1.00 136.17 ? -72  DT  J "O4'" 1 
ATOM   9031  C  "C3'" . DT  J  5 2   ? 6.181   -1.200  92.579  1.00 134.95 ? -72  DT  J "C3'" 1 
ATOM   9032  O  "O3'" . DT  J  5 2   ? 7.568   -1.202  92.968  1.00 133.01 ? -72  DT  J "O3'" 1 
ATOM   9033  C  "C2'" . DT  J  5 2   ? 5.830   -2.155  91.434  1.00 135.54 ? -72  DT  J "C2'" 1 
ATOM   9034  C  "C1'" . DT  J  5 2   ? 5.089   -3.315  92.106  1.00 135.93 ? -72  DT  J "C1'" 1 
ATOM   9035  N  N1    . DT  J  5 2   ? 3.969   -3.899  91.279  1.00 136.06 ? -72  DT  J N1    1 
ATOM   9036  C  C2    . DT  J  5 2   ? 3.799   -5.275  91.218  1.00 136.06 ? -72  DT  J C2    1 
ATOM   9037  O  O2    . DT  J  5 2   ? 4.507   -6.080  91.803  1.00 135.96 ? -72  DT  J O2    1 
ATOM   9038  N  N3    . DT  J  5 2   ? 2.745   -5.687  90.433  1.00 135.97 ? -72  DT  J N3    1 
ATOM   9039  C  C4    . DT  J  5 2   ? 1.866   -4.888  89.718  1.00 135.89 ? -72  DT  J C4    1 
ATOM   9040  O  O4    . DT  J  5 2   ? 0.960   -5.369  89.048  1.00 135.84 ? -72  DT  J O4    1 
ATOM   9041  C  C5    . DT  J  5 2   ? 2.097   -3.463  89.818  1.00 135.97 ? -72  DT  J C5    1 
ATOM   9042  C  C7    . DT  J  5 2   ? 1.220   -2.482  89.092  1.00 135.86 ? -72  DT  J C7    1 
ATOM   9043  C  C6    . DT  J  5 2   ? 3.120   -3.048  90.583  1.00 136.07 ? -72  DT  J C6    1 
ATOM   9044  P  P     . DC  J  5 3   ? 8.817   -1.260  91.954  1.00 130.94 ? -71  DC  J P     1 
ATOM   9045  O  OP1   . DC  J  5 3   ? 10.012  -0.739  92.651  1.00 130.78 ? -71  DC  J OP1   1 
ATOM   9046  O  OP2   . DC  J  5 3   ? 8.425   -0.650  90.664  1.00 130.53 ? -71  DC  J OP2   1 
ATOM   9047  O  "O5'" . DC  J  5 3   ? 9.016   -2.837  91.770  1.00 129.81 ? -71  DC  J "O5'" 1 
ATOM   9048  C  "C5'" . DC  J  5 3   ? 9.110   -3.707  92.909  1.00 127.73 ? -71  DC  J "C5'" 1 
ATOM   9049  C  "C4'" . DC  J  5 3   ? 9.418   -5.143  92.497  1.00 126.42 ? -71  DC  J "C4'" 1 
ATOM   9050  O  "O4'" . DC  J  5 3   ? 8.244   -5.746  91.882  1.00 126.66 ? -71  DC  J "O4'" 1 
ATOM   9051  C  "C3'" . DC  J  5 3   ? 10.570  -5.313  91.506  1.00 124.85 ? -71  DC  J "C3'" 1 
ATOM   9052  O  "O3'" . DC  J  5 3   ? 11.440  -6.373  91.906  1.00 122.51 ? -71  DC  J "O3'" 1 
ATOM   9053  C  "C2'" . DC  J  5 3   ? 9.868   -5.592  90.181  1.00 125.27 ? -71  DC  J "C2'" 1 
ATOM   9054  C  "C1'" . DC  J  5 3   ? 8.557   -6.255  90.596  1.00 126.01 ? -71  DC  J "C1'" 1 
ATOM   9055  N  N1    . DC  J  5 3   ? 7.417   -5.988  89.632  1.00 126.00 ? -71  DC  J N1    1 
ATOM   9056  C  C2    . DC  J  5 3   ? 6.603   -7.037  89.161  1.00 125.62 ? -71  DC  J C2    1 
ATOM   9057  O  O2    . DC  J  5 3   ? 6.798   -8.202  89.532  1.00 125.47 ? -71  DC  J O2    1 
ATOM   9058  N  N3    . DC  J  5 3   ? 5.600   -6.735  88.294  1.00 125.70 ? -71  DC  J N3    1 
ATOM   9059  C  C4    . DC  J  5 3   ? 5.393   -5.474  87.898  1.00 125.65 ? -71  DC  J C4    1 
ATOM   9060  N  N4    . DC  J  5 3   ? 4.392   -5.238  87.049  1.00 125.67 ? -71  DC  J N4    1 
ATOM   9061  C  C5    . DC  J  5 3   ? 6.201   -4.395  88.357  1.00 125.65 ? -71  DC  J C5    1 
ATOM   9062  C  C6    . DC  J  5 3   ? 7.186   -4.700  89.210  1.00 126.04 ? -71  DC  J C6    1 
ATOM   9063  P  P     . DT  J  5 4   ? 12.564  -6.956  90.918  1.00 120.80 ? -70  DT  J P     1 
ATOM   9064  O  OP1   . DT  J  5 4   ? 13.616  -7.606  91.734  1.00 121.23 ? -70  DT  J OP1   1 
ATOM   9065  O  OP2   . DT  J  5 4   ? 12.949  -5.915  89.936  1.00 120.36 ? -70  DT  J OP2   1 
ATOM   9066  O  "O5'" . DT  J  5 4   ? 11.742  -8.089  90.142  1.00 119.47 ? -70  DT  J "O5'" 1 
ATOM   9067  C  "C5'" . DT  J  5 4   ? 11.500  -9.387  90.702  1.00 116.02 ? -70  DT  J "C5'" 1 
ATOM   9068  C  "C4'" . DT  J  5 4   ? 11.193  -10.379 89.587  1.00 113.46 ? -70  DT  J "C4'" 1 
ATOM   9069  O  "O4'" . DT  J  5 4   ? 10.068  -9.911  88.787  1.00 113.04 ? -70  DT  J "O4'" 1 
ATOM   9070  C  "C3'" . DT  J  5 4   ? 12.338  -10.643 88.610  1.00 111.45 ? -70  DT  J "C3'" 1 
ATOM   9071  O  "O3'" . DT  J  5 4   ? 12.423  -12.049 88.392  1.00 108.86 ? -70  DT  J "O3'" 1 
ATOM   9072  C  "C2'" . DT  J  5 4   ? 11.944  -9.846  87.361  1.00 111.66 ? -70  DT  J "C2'" 1 
ATOM   9073  C  "C1'" . DT  J  5 4   ? 10.416  -9.879  87.412  1.00 112.20 ? -70  DT  J "C1'" 1 
ATOM   9074  N  N1    . DT  J  5 4   ? 9.678   -8.723  86.783  1.00 112.11 ? -70  DT  J N1    1 
ATOM   9075  C  C2    . DT  J  5 4   ? 8.572   -8.972  85.985  1.00 111.94 ? -70  DT  J C2    1 
ATOM   9076  O  O2    . DT  J  5 4   ? 8.150   -10.083 85.733  1.00 111.85 ? -70  DT  J O2    1 
ATOM   9077  N  N3    . DT  J  5 4   ? 7.959   -7.857  85.472  1.00 111.83 ? -70  DT  J N3    1 
ATOM   9078  C  C4    . DT  J  5 4   ? 8.325   -6.538  85.672  1.00 111.97 ? -70  DT  J C4    1 
ATOM   9079  O  O4    . DT  J  5 4   ? 7.701   -5.612  85.163  1.00 112.07 ? -70  DT  J O4    1 
ATOM   9080  C  C5    . DT  J  5 4   ? 9.483   -6.337  86.515  1.00 111.99 ? -70  DT  J C5    1 
ATOM   9081  C  C7    . DT  J  5 4   ? 9.981   -4.949  86.802  1.00 112.16 ? -70  DT  J C7    1 
ATOM   9082  C  C6    . DT  J  5 4   ? 10.091  -7.421  87.023  1.00 112.08 ? -70  DT  J C6    1 
ATOM   9083  P  P     . DC  J  5 5   ? 13.502  -12.734 87.428  1.00 107.62 ? -69  DC  J P     1 
ATOM   9084  O  OP1   . DC  J  5 5   ? 13.767  -14.095 87.940  1.00 107.65 ? -69  DC  J OP1   1 
ATOM   9085  O  OP2   . DC  J  5 5   ? 14.623  -11.802 87.191  1.00 108.01 ? -69  DC  J OP2   1 
ATOM   9086  O  "O5'" . DC  J  5 5   ? 12.714  -12.828 86.044  1.00 107.23 ? -69  DC  J "O5'" 1 
ATOM   9087  C  "C5'" . DC  J  5 5   ? 11.597  -13.701 85.820  1.00 105.26 ? -69  DC  J "C5'" 1 
ATOM   9088  C  "C4'" . DC  J  5 5   ? 11.211  -13.646 84.348  1.00 103.64 ? -69  DC  J "C4'" 1 
ATOM   9089  O  "O4'" . DC  J  5 5   ? 10.538  -12.395 84.050  1.00 103.22 ? -69  DC  J "O4'" 1 
ATOM   9090  C  "C3'" . DC  J  5 5   ? 12.382  -13.716 83.372  1.00 102.87 ? -69  DC  J "C3'" 1 
ATOM   9091  O  "O3'" . DC  J  5 5   ? 11.996  -14.421 82.234  1.00 101.44 ? -69  DC  J "O3'" 1 
ATOM   9092  C  "C2'" . DC  J  5 5   ? 12.622  -12.266 82.978  1.00 103.32 ? -69  DC  J "C2'" 1 
ATOM   9093  C  "C1'" . DC  J  5 5   ? 11.190  -11.747 82.971  1.00 103.33 ? -69  DC  J "C1'" 1 
ATOM   9094  N  N1    . DC  J  5 5   ? 11.087  -10.272 83.154  1.00 103.41 ? -69  DC  J N1    1 
ATOM   9095  C  C2    . DC  J  5 5   ? 9.988   -9.579  82.619  1.00 103.43 ? -69  DC  J C2    1 
ATOM   9096  O  O2    . DC  J  5 5   ? 9.113   -10.194 81.998  1.00 103.38 ? -69  DC  J O2    1 
ATOM   9097  N  N3    . DC  J  5 5   ? 9.911   -8.234  82.802  1.00 103.30 ? -69  DC  J N3    1 
ATOM   9098  C  C4    . DC  J  5 5   ? 10.869  -7.589  83.476  1.00 103.41 ? -69  DC  J C4    1 
ATOM   9099  N  N4    . DC  J  5 5   ? 10.749  -6.267  83.627  1.00 103.29 ? -69  DC  J N4    1 
ATOM   9100  C  C5    . DC  J  5 5   ? 11.996  -8.277  84.026  1.00 103.58 ? -69  DC  J C5    1 
ATOM   9101  C  C6    . DC  J  5 5   ? 12.063  -9.602  83.843  1.00 103.23 ? -69  DC  J C6    1 
ATOM   9102  P  P     . DC  J  5 6   ? 12.511  -15.900 81.990  1.00 100.40 ? -68  DC  J P     1 
ATOM   9103  O  OP1   . DC  J  5 6   ? 11.970  -16.758 83.067  1.00 100.01 ? -68  DC  J OP1   1 
ATOM   9104  O  OP2   . DC  J  5 6   ? 13.960  -15.828 81.694  1.00 100.65 ? -68  DC  J OP2   1 
ATOM   9105  O  "O5'" . DC  J  5 6   ? 11.749  -16.268 80.633  1.00 99.87  ? -68  DC  J "O5'" 1 
ATOM   9106  C  "C5'" . DC  J  5 6   ? 10.337  -16.039 80.550  1.00 97.85  ? -68  DC  J "C5'" 1 
ATOM   9107  C  "C4'" . DC  J  5 6   ? 9.900   -15.422 79.231  1.00 95.95  ? -68  DC  J "C4'" 1 
ATOM   9108  O  "O4'" . DC  J  5 6   ? 9.736   -13.986 79.343  1.00 95.77  ? -68  DC  J "O4'" 1 
ATOM   9109  C  "C3'" . DC  J  5 6   ? 10.838  -15.657 78.056  1.00 94.90  ? -68  DC  J "C3'" 1 
ATOM   9110  O  "O3'" . DC  J  5 6   ? 10.028  -15.970 76.962  1.00 93.30  ? -68  DC  J "O3'" 1 
ATOM   9111  C  "C2'" . DC  J  5 6   ? 11.523  -14.308 77.860  1.00 95.58  ? -68  DC  J "C2'" 1 
ATOM   9112  C  "C1'" . DC  J  5 6   ? 10.388  -13.366 78.247  1.00 95.86  ? -68  DC  J "C1'" 1 
ATOM   9113  N  N1    . DC  J  5 6   ? 10.803  -11.978 78.638  1.00 96.04  ? -68  DC  J N1    1 
ATOM   9114  C  C2    . DC  J  5 6   ? 9.974   -10.900 78.277  1.00 96.01  ? -68  DC  J C2    1 
ATOM   9115  O  O2    . DC  J  5 6   ? 8.931   -11.111 77.644  1.00 95.81  ? -68  DC  J O2    1 
ATOM   9116  N  N3    . DC  J  5 6   ? 10.343  -9.643  78.636  1.00 95.78  ? -68  DC  J N3    1 
ATOM   9117  C  C4    . DC  J  5 6   ? 11.473  -9.446  79.321  1.00 95.80  ? -68  DC  J C4    1 
ATOM   9118  N  N4    . DC  J  5 6   ? 11.776  -8.188  79.641  1.00 95.96  ? -68  DC  J N4    1 
ATOM   9119  C  C5    . DC  J  5 6   ? 12.333  -10.521 79.706  1.00 95.74  ? -68  DC  J C5    1 
ATOM   9120  C  C6    . DC  J  5 6   ? 11.961  -11.759 79.346  1.00 96.01  ? -68  DC  J C6    1 
ATOM   9121  P  P     . DA  J  5 7   ? 10.579  -16.802 75.721  1.00 92.28  ? -67  DA  J P     1 
ATOM   9122  O  OP1   . DA  J  5 7   ? 10.102  -18.185 75.947  1.00 91.59  ? -67  DA  J OP1   1 
ATOM   9123  O  OP2   . DA  J  5 7   ? 12.018  -16.519 75.479  1.00 91.15  ? -67  DA  J OP2   1 
ATOM   9124  O  "O5'" . DA  J  5 7   ? 9.759   -16.131 74.520  1.00 91.16  ? -67  DA  J "O5'" 1 
ATOM   9125  C  "C5'" . DA  J  5 7   ? 8.539   -15.438 74.782  1.00 89.74  ? -67  DA  J "C5'" 1 
ATOM   9126  C  "C4'" . DA  J  5 7   ? 8.212   -14.424 73.693  1.00 89.62  ? -67  DA  J "C4'" 1 
ATOM   9127  O  "O4'" . DA  J  5 7   ? 8.776   -13.119 73.992  1.00 89.72  ? -67  DA  J "O4'" 1 
ATOM   9128  C  "C3'" . DA  J  5 7   ? 8.683   -14.724 72.277  1.00 89.26  ? -67  DA  J "C3'" 1 
ATOM   9129  O  "O3'" . DA  J  5 7   ? 7.709   -14.129 71.447  1.00 89.88  ? -67  DA  J "O3'" 1 
ATOM   9130  C  "C2'" . DA  J  5 7   ? 10.038  -14.020 72.190  1.00 88.75  ? -67  DA  J "C2'" 1 
ATOM   9131  C  "C1'" . DA  J  5 7   ? 9.805   -12.791 73.071  1.00 89.20  ? -67  DA  J "C1'" 1 
ATOM   9132  N  N9    . DA  J  5 7   ? 10.923  -12.341 73.900  1.00 89.06  ? -67  DA  J N9    1 
ATOM   9133  C  C8    . DA  J  5 7   ? 12.046  -13.028 74.279  1.00 88.95  ? -67  DA  J C8    1 
ATOM   9134  N  N7    . DA  J  5 7   ? 12.851  -12.345 75.060  1.00 89.07  ? -67  DA  J N7    1 
ATOM   9135  C  C5    . DA  J  5 7   ? 12.216  -11.118 75.203  1.00 89.54  ? -67  DA  J C5    1 
ATOM   9136  C  C6    . DA  J  5 7   ? 12.547  -9.930  75.909  1.00 89.19  ? -67  DA  J C6    1 
ATOM   9137  N  N6    . DA  J  5 7   ? 13.654  -9.769  76.638  1.00 89.03  ? -67  DA  J N6    1 
ATOM   9138  N  N1    . DA  J  5 7   ? 11.685  -8.898  75.840  1.00 88.83  ? -67  DA  J N1    1 
ATOM   9139  C  C2    . DA  J  5 7   ? 10.567  -9.039  75.114  1.00 88.85  ? -67  DA  J C2    1 
ATOM   9140  N  N3    . DA  J  5 7   ? 10.142  -10.091 74.411  1.00 88.83  ? -67  DA  J N3    1 
ATOM   9141  C  C4    . DA  J  5 7   ? 11.020  -11.107 74.498  1.00 89.17  ? -67  DA  J C4    1 
ATOM   9142  P  P     . DA  J  5 8   ? 7.687   -14.309 69.858  1.00 91.35  ? -66  DA  J P     1 
ATOM   9143  O  OP1   . DA  J  5 8   ? 6.441   -15.012 69.466  1.00 90.75  ? -66  DA  J OP1   1 
ATOM   9144  O  OP2   . DA  J  5 8   ? 9.025   -14.790 69.424  1.00 90.94  ? -66  DA  J OP2   1 
ATOM   9145  O  "O5'" . DA  J  5 8   ? 7.511   -12.808 69.362  1.00 90.60  ? -66  DA  J "O5'" 1 
ATOM   9146  C  "C5'" . DA  J  5 8   ? 6.517   -11.987 69.950  1.00 90.25  ? -66  DA  J "C5'" 1 
ATOM   9147  C  "C4'" . DA  J  5 8   ? 6.922   -10.539 69.788  1.00 89.63  ? -66  DA  J "C4'" 1 
ATOM   9148  O  "O4'" . DA  J  5 8   ? 8.072   -10.256 70.622  1.00 88.80  ? -66  DA  J "O4'" 1 
ATOM   9149  C  "C3'" . DA  J  5 8   ? 7.302   -10.155 68.363  1.00 89.91  ? -66  DA  J "C3'" 1 
ATOM   9150  O  "O3'" . DA  J  5 8   ? 6.489   -9.021  68.038  1.00 91.49  ? -66  DA  J "O3'" 1 
ATOM   9151  C  "C2'" . DA  J  5 8   ? 8.816   -9.915  68.441  1.00 89.02  ? -66  DA  J "C2'" 1 
ATOM   9152  C  "C1'" . DA  J  5 8   ? 9.004   -9.494  69.894  1.00 88.39  ? -66  DA  J "C1'" 1 
ATOM   9153  N  N9    . DA  J  5 8   ? 10.317  -9.758  70.473  1.00 88.06  ? -66  DA  J N9    1 
ATOM   9154  C  C8    . DA  J  5 8   ? 11.055  -10.896 70.341  1.00 88.17  ? -66  DA  J C8    1 
ATOM   9155  N  N7    . DA  J  5 8   ? 12.197  -10.871 70.980  1.00 88.13  ? -66  DA  J N7    1 
ATOM   9156  C  C5    . DA  J  5 8   ? 12.213  -9.625  71.575  1.00 88.03  ? -66  DA  J C5    1 
ATOM   9157  C  C6    . DA  J  5 8   ? 13.166  -8.985  72.395  1.00 88.13  ? -66  DA  J C6    1 
ATOM   9158  N  N6    . DA  J  5 8   ? 14.321  -9.561  72.746  1.00 87.98  ? -66  DA  J N6    1 
ATOM   9159  N  N1    . DA  J  5 8   ? 12.884  -7.736  72.834  1.00 88.29  ? -66  DA  J N1    1 
ATOM   9160  C  C2    . DA  J  5 8   ? 11.722  -7.169  72.463  1.00 88.43  ? -66  DA  J C2    1 
ATOM   9161  N  N3    . DA  J  5 8   ? 10.749  -7.674  71.694  1.00 88.37  ? -66  DA  J N3    1 
ATOM   9162  C  C4    . DA  J  5 8   ? 11.059  -8.921  71.278  1.00 88.10  ? -66  DA  J C4    1 
ATOM   9163  P  P     . DA  J  5 9   ? 6.766   -7.989  66.844  1.00 92.77  ? -65  DA  J P     1 
ATOM   9164  O  OP1   . DA  J  5 9   ? 5.450   -7.382  66.534  1.00 92.21  ? -65  DA  J OP1   1 
ATOM   9165  O  OP2   . DA  J  5 9   ? 7.583   -8.631  65.784  1.00 92.40  ? -65  DA  J OP2   1 
ATOM   9166  O  "O5'" . DA  J  5 9   ? 7.732   -6.906  67.520  1.00 93.05  ? -65  DA  J "O5'" 1 
ATOM   9167  C  "C5'" . DA  J  5 9   ? 7.241   -5.903  68.414  1.00 93.03  ? -65  DA  J "C5'" 1 
ATOM   9168  C  "C4'" . DA  J  5 9   ? 8.335   -4.868  68.614  1.00 92.81  ? -65  DA  J "C4'" 1 
ATOM   9169  O  "O4'" . DA  J  5 9   ? 9.522   -5.487  69.188  1.00 92.47  ? -65  DA  J "O4'" 1 
ATOM   9170  C  "C3'" . DA  J  5 9   ? 8.787   -4.183  67.326  1.00 93.04  ? -65  DA  J "C3'" 1 
ATOM   9171  O  "O3'" . DA  J  5 9   ? 8.859   -2.766  67.580  1.00 94.31  ? -65  DA  J "O3'" 1 
ATOM   9172  C  "C2'" . DA  J  5 9   ? 10.137  -4.841  67.020  1.00 92.20  ? -65  DA  J "C2'" 1 
ATOM   9173  C  "C1'" . DA  J  5 9   ? 10.662  -5.150  68.417  1.00 91.50  ? -65  DA  J "C1'" 1 
ATOM   9174  N  N9    . DA  J  5 9   ? 11.648  -6.236  68.477  1.00 91.25  ? -65  DA  J N9    1 
ATOM   9175  C  C8    . DA  J  5 9   ? 11.599  -7.436  67.823  1.00 91.08  ? -65  DA  J C8    1 
ATOM   9176  N  N7    . DA  J  5 9   ? 12.620  -8.226  68.059  1.00 90.47  ? -65  DA  J N7    1 
ATOM   9177  C  C5    . DA  J  5 9   ? 13.393  -7.498  68.935  1.00 90.58  ? -65  DA  J C5    1 
ATOM   9178  C  C6    . DA  J  5 9   ? 14.620  -7.779  69.566  1.00 91.19  ? -65  DA  J C6    1 
ATOM   9179  N  N6    . DA  J  5 9   ? 15.275  -8.928  69.384  1.00 90.92  ? -65  DA  J N6    1 
ATOM   9180  N  N1    . DA  J  5 9   ? 15.144  -6.839  70.390  1.00 91.09  ? -65  DA  J N1    1 
ATOM   9181  C  C2    . DA  J  5 9   ? 14.474  -5.695  70.563  1.00 90.56  ? -65  DA  J C2    1 
ATOM   9182  N  N3    . DA  J  5 9   ? 13.316  -5.320  70.020  1.00 90.34  ? -65  DA  J N3    1 
ATOM   9183  C  C4    . DA  J  5 9   ? 12.818  -6.270  69.208  1.00 90.68  ? -65  DA  J C4    1 
ATOM   9184  P  P     . DT  J  5 10  ? 9.187   -1.637  66.480  1.00 93.82  ? -64  DT  J P     1 
ATOM   9185  O  OP1   . DT  J  5 10  ? 8.349   -0.468  66.855  1.00 92.75  ? -64  DT  J OP1   1 
ATOM   9186  O  OP2   . DT  J  5 10  ? 9.131   -2.223  65.110  1.00 92.34  ? -64  DT  J OP2   1 
ATOM   9187  O  "O5'" . DT  J  5 10  ? 10.724  -1.314  66.795  1.00 93.43  ? -64  DT  J "O5'" 1 
ATOM   9188  C  "C5'" . DT  J  5 10  ? 11.113  -0.695  68.019  1.00 94.16  ? -64  DT  J "C5'" 1 
ATOM   9189  C  "C4'" . DT  J  5 10  ? 12.618  -0.786  68.185  1.00 95.22  ? -64  DT  J "C4'" 1 
ATOM   9190  O  "O4'" . DT  J  5 10  ? 13.031  -2.172  68.166  1.00 95.02  ? -64  DT  J "O4'" 1 
ATOM   9191  C  "C3'" . DT  J  5 10  ? 13.445  -0.104  67.095  1.00 96.72  ? -64  DT  J "C3'" 1 
ATOM   9192  O  "O3'" . DT  J  5 10  ? 14.334  0.827   67.711  1.00 99.64  ? -64  DT  J "O3'" 1 
ATOM   9193  C  "C2'" . DT  J  5 10  ? 14.201  -1.246  66.415  1.00 95.57  ? -64  DT  J "C2'" 1 
ATOM   9194  C  "C1'" . DT  J  5 10  ? 14.307  -2.218  67.575  1.00 94.76  ? -64  DT  J "C1'" 1 
ATOM   9195  N  N1    . DT  J  5 10  ? 14.662  -3.622  67.191  1.00 95.12  ? -64  DT  J N1    1 
ATOM   9196  C  C2    . DT  J  5 10  ? 15.850  -4.149  67.670  1.00 94.49  ? -64  DT  J C2    1 
ATOM   9197  O  O2    . DT  J  5 10  ? 16.630  -3.545  68.385  1.00 94.13  ? -64  DT  J O2    1 
ATOM   9198  N  N3    . DT  J  5 10  ? 16.098  -5.435  67.265  1.00 94.48  ? -64  DT  J N3    1 
ATOM   9199  C  C4    . DT  J  5 10  ? 15.301  -6.227  66.453  1.00 94.49  ? -64  DT  J C4    1 
ATOM   9200  O  O4    . DT  J  5 10  ? 15.624  -7.371  66.158  1.00 94.74  ? -64  DT  J O4    1 
ATOM   9201  C  C5    . DT  J  5 10  ? 14.074  -5.627  65.988  1.00 94.31  ? -64  DT  J C5    1 
ATOM   9202  C  C7    . DT  J  5 10  ? 13.143  -6.405  65.103  1.00 94.29  ? -64  DT  J C7    1 
ATOM   9203  C  C6    . DT  J  5 10  ? 13.815  -4.367  66.373  1.00 94.82  ? -64  DT  J C6    1 
ATOM   9204  P  P     . DA  J  5 11  ? 15.200  1.890   66.879  1.00 100.83 ? -63  DA  J P     1 
ATOM   9205  O  OP1   . DA  J  5 11  ? 15.128  3.158   67.645  1.00 101.06 ? -63  DA  J OP1   1 
ATOM   9206  O  OP2   . DA  J  5 11  ? 14.814  1.826   65.444  1.00 100.30 ? -63  DA  J OP2   1 
ATOM   9207  O  "O5'" . DA  J  5 11  ? 16.682  1.310   66.990  1.00 102.31 ? -63  DA  J "O5'" 1 
ATOM   9208  C  "C5'" . DA  J  5 11  ? 17.395  1.267   68.220  1.00 105.27 ? -63  DA  J "C5'" 1 
ATOM   9209  C  "C4'" . DA  J  5 11  ? 18.799  0.767   67.932  1.00 107.91 ? -63  DA  J "C4'" 1 
ATOM   9210  O  "O4'" . DA  J  5 11  ? 18.795  -0.674  67.774  1.00 108.63 ? -63  DA  J "O4'" 1 
ATOM   9211  C  "C3'" . DA  J  5 11  ? 19.409  1.332   66.655  1.00 109.51 ? -63  DA  J "C3'" 1 
ATOM   9212  O  "O3'" . DA  J  5 11  ? 20.730  1.762   66.946  1.00 112.28 ? -63  DA  J "O3'" 1 
ATOM   9213  C  "C2'" . DA  J  5 11  ? 19.337  0.175   65.660  1.00 109.08 ? -63  DA  J "C2'" 1 
ATOM   9214  C  "C1'" . DA  J  5 11  ? 19.449  -1.036  66.574  1.00 109.27 ? -63  DA  J "C1'" 1 
ATOM   9215  N  N9    . DA  J  5 11  ? 18.867  -2.252  65.989  1.00 109.57 ? -63  DA  J N9    1 
ATOM   9216  C  C8    . DA  J  5 11  ? 17.633  -2.378  65.409  1.00 109.58 ? -63  DA  J C8    1 
ATOM   9217  N  N7    . DA  J  5 11  ? 17.379  -3.582  64.949  1.00 109.80 ? -63  DA  J N7    1 
ATOM   9218  C  C5    . DA  J  5 11  ? 18.523  -4.307  65.242  1.00 109.66 ? -63  DA  J C5    1 
ATOM   9219  C  C6    . DA  J  5 11  ? 18.885  -5.658  65.016  1.00 109.54 ? -63  DA  J C6    1 
ATOM   9220  N  N6    . DA  J  5 11  ? 18.092  -6.555  64.415  1.00 109.42 ? -63  DA  J N6    1 
ATOM   9221  N  N1    . DA  J  5 11  ? 20.106  -6.057  65.435  1.00 109.39 ? -63  DA  J N1    1 
ATOM   9222  C  C2    . DA  J  5 11  ? 20.905  -5.168  66.041  1.00 109.46 ? -63  DA  J C2    1 
ATOM   9223  N  N3    . DA  J  5 11  ? 20.675  -3.881  66.310  1.00 109.45 ? -63  DA  J N3    1 
ATOM   9224  C  C4    . DA  J  5 11  ? 19.453  -3.502  65.884  1.00 109.57 ? -63  DA  J C4    1 
ATOM   9225  P  P     . DT  J  5 12  ? 21.752  2.254   65.821  1.00 114.76 ? -62  DT  J P     1 
ATOM   9226  O  OP1   . DT  J  5 12  ? 22.581  3.319   66.437  1.00 114.88 ? -62  DT  J OP1   1 
ATOM   9227  O  OP2   . DT  J  5 12  ? 21.065  2.480   64.526  1.00 114.60 ? -62  DT  J OP2   1 
ATOM   9228  O  "O5'" . DT  J  5 12  ? 22.608  0.926   65.612  1.00 117.36 ? -62  DT  J "O5'" 1 
ATOM   9229  C  "C5'" . DT  J  5 12  ? 23.609  0.509   66.531  1.00 120.54 ? -62  DT  J "C5'" 1 
ATOM   9230  C  "C4'" . DT  J  5 12  ? 24.428  -0.557  65.835  1.00 122.76 ? -62  DT  J "C4'" 1 
ATOM   9231  O  "O4'" . DT  J  5 12  ? 23.578  -1.709  65.611  1.00 122.71 ? -62  DT  J "O4'" 1 
ATOM   9232  C  "C3'" . DT  J  5 12  ? 24.926  -0.114  64.463  1.00 124.50 ? -62  DT  J "C3'" 1 
ATOM   9233  O  "O3'" . DT  J  5 12  ? 26.325  0.161   64.503  1.00 127.69 ? -62  DT  J "O3'" 1 
ATOM   9234  C  "C2'" . DT  J  5 12  ? 24.577  -1.257  63.512  1.00 123.67 ? -62  DT  J "C2'" 1 
ATOM   9235  C  "C1'" . DT  J  5 12  ? 23.952  -2.331  64.399  1.00 123.01 ? -62  DT  J "C1'" 1 
ATOM   9236  N  N1    . DT  J  5 12  ? 22.768  -2.994  63.749  1.00 122.86 ? -62  DT  J N1    1 
ATOM   9237  C  C2    . DT  J  5 12  ? 22.826  -4.343  63.432  1.00 122.80 ? -62  DT  J C2    1 
ATOM   9238  O  O2    . DT  J  5 12  ? 23.786  -5.059  63.661  1.00 122.77 ? -62  DT  J O2    1 
ATOM   9239  N  N3    . DT  J  5 12  ? 21.692  -4.841  62.832  1.00 122.74 ? -62  DT  J N3    1 
ATOM   9240  C  C4    . DT  J  5 12  ? 20.537  -4.144  62.521  1.00 122.78 ? -62  DT  J C4    1 
ATOM   9241  O  O4    . DT  J  5 12  ? 19.578  -4.686  61.981  1.00 122.66 ? -62  DT  J O4    1 
ATOM   9242  C  C5    . DT  J  5 12  ? 20.543  -2.740  62.869  1.00 122.81 ? -62  DT  J C5    1 
ATOM   9243  C  C7    . DT  J  5 12  ? 19.349  -1.876  62.577  1.00 122.88 ? -62  DT  J C7    1 
ATOM   9244  C  C6    . DT  J  5 12  ? 21.642  -2.241  63.457  1.00 122.65 ? -62  DT  J C6    1 
ATOM   9245  P  P     . DC  J  5 13  ? 27.096  0.779   63.237  1.00 130.06 ? -61  DC  J P     1 
ATOM   9246  O  OP1   . DC  J  5 13  ? 28.242  1.551   63.769  1.00 129.91 ? -61  DC  J OP1   1 
ATOM   9247  O  OP2   . DC  J  5 13  ? 26.116  1.434   62.337  1.00 129.78 ? -61  DC  J OP2   1 
ATOM   9248  O  "O5'" . DC  J  5 13  ? 27.638  -0.517  62.468  1.00 131.84 ? -61  DC  J "O5'" 1 
ATOM   9249  C  "C5'" . DC  J  5 13  ? 28.303  -1.577  63.158  1.00 134.63 ? -61  DC  J "C5'" 1 
ATOM   9250  C  "C4'" . DC  J  5 13  ? 28.303  -2.843  62.315  1.00 136.88 ? -61  DC  J "C4'" 1 
ATOM   9251  O  "O4'" . DC  J  5 13  ? 26.949  -3.332  62.129  1.00 137.43 ? -61  DC  J "O4'" 1 
ATOM   9252  C  "C3'" . DC  J  5 13  ? 28.876  -2.688  60.910  1.00 138.49 ? -61  DC  J "C3'" 1 
ATOM   9253  O  "O3'" . DC  J  5 13  ? 29.790  -3.748  60.683  1.00 141.03 ? -61  DC  J "O3'" 1 
ATOM   9254  C  "C2'" . DC  J  5 13  ? 27.659  -2.773  59.987  1.00 138.04 ? -61  DC  J "C2'" 1 
ATOM   9255  C  "C1'" . DC  J  5 13  ? 26.793  -3.743  60.784  1.00 137.58 ? -61  DC  J "C1'" 1 
ATOM   9256  N  N1    . DC  J  5 13  ? 25.327  -3.787  60.450  1.00 137.42 ? -61  DC  J N1    1 
ATOM   9257  C  C2    . DC  J  5 13  ? 24.716  -5.020  60.157  1.00 137.39 ? -61  DC  J C2    1 
ATOM   9258  O  O2    . DC  J  5 13  ? 25.389  -6.060  60.162  1.00 137.36 ? -61  DC  J O2    1 
ATOM   9259  N  N3    . DC  J  5 13  ? 23.387  -5.043  59.868  1.00 137.42 ? -61  DC  J N3    1 
ATOM   9260  C  C4    . DC  J  5 13  ? 22.675  -3.911  59.864  1.00 137.37 ? -61  DC  J C4    1 
ATOM   9261  N  N4    . DC  J  5 13  ? 21.373  -3.991  59.570  1.00 137.27 ? -61  DC  J N4    1 
ATOM   9262  C  C5    . DC  J  5 13  ? 23.273  -2.647  60.162  1.00 137.39 ? -61  DC  J C5    1 
ATOM   9263  C  C6    . DC  J  5 13  ? 24.584  -2.636  60.445  1.00 137.46 ? -61  DC  J C6    1 
ATOM   9264  P  P     . DC  J  5 14  ? 31.004  -3.580  59.657  1.00 143.02 ? -60  DC  J P     1 
ATOM   9265  O  OP1   . DC  J  5 14  ? 32.230  -4.038  60.359  1.00 142.97 ? -60  DC  J OP1   1 
ATOM   9266  O  OP2   . DC  J  5 14  ? 30.945  -2.217  59.074  1.00 142.93 ? -60  DC  J OP2   1 
ATOM   9267  O  "O5'" . DC  J  5 14  ? 30.636  -4.616  58.490  1.00 144.00 ? -60  DC  J "O5'" 1 
ATOM   9268  C  "C5'" . DC  J  5 14  ? 30.481  -6.014  58.760  1.00 145.40 ? -60  DC  J "C5'" 1 
ATOM   9269  C  "C4'" . DC  J  5 14  ? 29.678  -6.687  57.660  1.00 146.44 ? -60  DC  J "C4'" 1 
ATOM   9270  O  "O4'" . DC  J  5 14  ? 28.283  -6.308  57.782  1.00 146.65 ? -60  DC  J "O4'" 1 
ATOM   9271  C  "C3'" . DC  J  5 14  ? 30.110  -6.346  56.230  1.00 147.13 ? -60  DC  J "C3'" 1 
ATOM   9272  O  "O3'" . DC  J  5 14  ? 30.751  -7.495  55.615  1.00 148.00 ? -60  DC  J "O3'" 1 
ATOM   9273  C  "C2'" . DC  J  5 14  ? 28.834  -5.831  55.549  1.00 147.06 ? -60  DC  J "C2'" 1 
ATOM   9274  C  "C1'" . DC  J  5 14  ? 27.714  -6.279  56.488  1.00 146.92 ? -60  DC  J "C1'" 1 
ATOM   9275  N  N1    . DC  J  5 14  ? 26.496  -5.379  56.467  1.00 146.97 ? -60  DC  J N1    1 
ATOM   9276  C  C2    . DC  J  5 14  ? 25.219  -5.903  56.167  1.00 146.84 ? -60  DC  J C2    1 
ATOM   9277  O  O2    . DC  J  5 14  ? 25.079  -7.110  55.922  1.00 146.88 ? -60  DC  J O2    1 
ATOM   9278  N  N3    . DC  J  5 14  ? 24.150  -5.061  56.153  1.00 146.61 ? -60  DC  J N3    1 
ATOM   9279  C  C4    . DC  J  5 14  ? 24.311  -3.761  56.419  1.00 146.67 ? -60  DC  J C4    1 
ATOM   9280  N  N4    . DC  J  5 14  ? 23.230  -2.978  56.392  1.00 146.72 ? -60  DC  J N4    1 
ATOM   9281  C  C5    . DC  J  5 14  ? 25.590  -3.204  56.725  1.00 146.88 ? -60  DC  J C5    1 
ATOM   9282  C  C6    . DC  J  5 14  ? 26.638  -4.041  56.736  1.00 147.07 ? -60  DC  J C6    1 
ATOM   9283  P  P     . DC  J  5 15  ? 30.383  -8.143  54.187  1.00 148.50 ? -59  DC  J P     1 
ATOM   9284  O  OP1   . DC  J  5 15  ? 31.390  -9.195  53.901  1.00 148.28 ? -59  DC  J OP1   1 
ATOM   9285  O  OP2   . DC  J  5 15  ? 30.200  -7.054  53.199  1.00 148.43 ? -59  DC  J OP2   1 
ATOM   9286  O  "O5'" . DC  J  5 15  ? 28.960  -8.828  54.486  1.00 148.81 ? -59  DC  J "O5'" 1 
ATOM   9287  C  "C5'" . DC  J  5 15  ? 28.634  -10.141 54.020  1.00 148.93 ? -59  DC  J "C5'" 1 
ATOM   9288  C  "C4'" . DC  J  5 15  ? 27.686  -10.073 52.832  1.00 148.90 ? -59  DC  J "C4'" 1 
ATOM   9289  O  "O4'" . DC  J  5 15  ? 26.747  -8.979  53.011  1.00 149.18 ? -59  DC  J "O4'" 1 
ATOM   9290  C  "C3'" . DC  J  5 15  ? 28.344  -9.855  51.469  1.00 148.62 ? -59  DC  J "C3'" 1 
ATOM   9291  O  "O3'" . DC  J  5 15  ? 27.718  -10.698 50.503  1.00 148.00 ? -59  DC  J "O3'" 1 
ATOM   9292  C  "C2'" . DC  J  5 15  ? 28.072  -8.381  51.172  1.00 148.90 ? -59  DC  J "C2'" 1 
ATOM   9293  C  "C1'" . DC  J  5 15  ? 26.704  -8.200  51.830  1.00 149.54 ? -59  DC  J "C1'" 1 
ATOM   9294  N  N1    . DC  J  5 15  ? 26.291  -6.797  52.209  1.00 149.86 ? -59  DC  J N1    1 
ATOM   9295  C  C2    . DC  J  5 15  ? 24.951  -6.559  52.577  1.00 150.07 ? -59  DC  J C2    1 
ATOM   9296  O  O2    . DC  J  5 15  ? 24.133  -7.493  52.584  1.00 149.92 ? -59  DC  J O2    1 
ATOM   9297  N  N3    . DC  J  5 15  ? 24.578  -5.295  52.921  1.00 150.10 ? -59  DC  J N3    1 
ATOM   9298  C  C4    . DC  J  5 15  ? 25.472  -4.299  52.910  1.00 149.94 ? -59  DC  J C4    1 
ATOM   9299  N  N4    . DC  J  5 15  ? 25.043  -3.082  53.260  1.00 149.91 ? -59  DC  J N4    1 
ATOM   9300  C  C5    . DC  J  5 15  ? 26.838  -4.514  52.543  1.00 149.89 ? -59  DC  J C5    1 
ATOM   9301  C  C6    . DC  J  5 15  ? 27.196  -5.763  52.205  1.00 149.95 ? -59  DC  J C6    1 
ATOM   9302  P  P     . DT  J  5 16  ? 28.396  -12.053 49.977  1.00 147.34 ? -58  DT  J P     1 
ATOM   9303  O  OP1   . DT  J  5 16  ? 28.889  -12.834 51.137  1.00 147.25 ? -58  DT  J OP1   1 
ATOM   9304  O  OP2   . DT  J  5 16  ? 29.323  -11.680 48.886  1.00 147.32 ? -58  DT  J OP2   1 
ATOM   9305  O  "O5'" . DT  J  5 16  ? 27.166  -12.840 49.316  1.00 146.71 ? -58  DT  J "O5'" 1 
ATOM   9306  C  "C5'" . DT  J  5 16  ? 25.970  -13.129 50.061  1.00 145.43 ? -58  DT  J "C5'" 1 
ATOM   9307  C  "C4'" . DT  J  5 16  ? 24.722  -12.584 49.374  1.00 144.25 ? -58  DT  J "C4'" 1 
ATOM   9308  O  "O4'" . DT  J  5 16  ? 24.587  -11.160 49.633  1.00 143.78 ? -58  DT  J "O4'" 1 
ATOM   9309  C  "C3'" . DT  J  5 16  ? 24.661  -12.758 47.851  1.00 143.38 ? -58  DT  J "C3'" 1 
ATOM   9310  O  "O3'" . DT  J  5 16  ? 23.457  -13.434 47.469  1.00 142.04 ? -58  DT  J "O3'" 1 
ATOM   9311  C  "C2'" . DT  J  5 16  ? 24.707  -11.326 47.313  1.00 143.30 ? -58  DT  J "C2'" 1 
ATOM   9312  C  "C1'" . DT  J  5 16  ? 24.065  -10.560 48.465  1.00 143.30 ? -58  DT  J "C1'" 1 
ATOM   9313  N  N1    . DT  J  5 16  ? 24.332  -9.080  48.492  1.00 143.27 ? -58  DT  J N1    1 
ATOM   9314  C  C2    . DT  J  5 16  ? 23.308  -8.214  48.853  1.00 143.16 ? -58  DT  J C2    1 
ATOM   9315  O  O2    . DT  J  5 16  ? 22.179  -8.569  49.157  1.00 143.05 ? -58  DT  J O2    1 
ATOM   9316  N  N3    . DT  J  5 16  ? 23.659  -6.886  48.842  1.00 142.89 ? -58  DT  J N3    1 
ATOM   9317  C  C4    . DT  J  5 16  ? 24.892  -6.349  48.521  1.00 142.88 ? -58  DT  J C4    1 
ATOM   9318  O  O4    . DT  J  5 16  ? 25.079  -5.138  48.553  1.00 143.09 ? -58  DT  J O4    1 
ATOM   9319  C  C5    . DT  J  5 16  ? 25.915  -7.305  48.154  1.00 142.87 ? -58  DT  J C5    1 
ATOM   9320  C  C7    . DT  J  5 16  ? 27.299  -6.861  47.779  1.00 143.04 ? -58  DT  J C7    1 
ATOM   9321  C  C6    . DT  J  5 16  ? 25.589  -8.604  48.158  1.00 142.98 ? -58  DT  J C6    1 
ATOM   9322  P  P     . DT  J  5 17  ? 23.352  -14.288 46.111  1.00 141.15 ? -57  DT  J P     1 
ATOM   9323  O  OP1   . DT  J  5 17  ? 23.509  -15.709 46.486  1.00 141.26 ? -57  DT  J OP1   1 
ATOM   9324  O  OP2   . DT  J  5 17  ? 24.244  -13.702 45.081  1.00 141.10 ? -57  DT  J OP2   1 
ATOM   9325  O  "O5'" . DT  J  5 17  ? 21.843  -14.052 45.622  1.00 140.44 ? -57  DT  J "O5'" 1 
ATOM   9326  C  "C5'" . DT  J  5 17  ? 20.864  -13.399 46.441  1.00 138.89 ? -57  DT  J "C5'" 1 
ATOM   9327  C  "C4'" . DT  J  5 17  ? 20.110  -12.296 45.703  1.00 137.63 ? -57  DT  J "C4'" 1 
ATOM   9328  O  "O4'" . DT  J  5 17  ? 20.647  -10.993 46.056  1.00 137.74 ? -57  DT  J "O4'" 1 
ATOM   9329  C  "C3'" . DT  J  5 17  ? 20.112  -12.354 44.169  1.00 136.64 ? -57  DT  J "C3'" 1 
ATOM   9330  O  "O3'" . DT  J  5 17  ? 18.780  -12.161 43.648  1.00 135.09 ? -57  DT  J "O3'" 1 
ATOM   9331  C  "C2'" . DT  J  5 17  ? 21.030  -11.186 43.795  1.00 136.95 ? -57  DT  J "C2'" 1 
ATOM   9332  C  "C1'" . DT  J  5 17  ? 20.595  -10.205 44.883  1.00 137.78 ? -57  DT  J "C1'" 1 
ATOM   9333  N  N1    . DT  J  5 17  ? 21.361  -8.908  45.075  1.00 137.87 ? -57  DT  J N1    1 
ATOM   9334  C  C2    . DT  J  5 17  ? 20.854  -7.970  45.968  1.00 138.01 ? -57  DT  J C2    1 
ATOM   9335  O  O2    . DT  J  5 17  ? 19.831  -8.116  46.621  1.00 137.94 ? -57  DT  J O2    1 
ATOM   9336  N  N3    . DT  J  5 17  ? 21.599  -6.821  46.085  1.00 138.22 ? -57  DT  J N3    1 
ATOM   9337  C  C4    . DT  J  5 17  ? 22.772  -6.508  45.420  1.00 138.16 ? -57  DT  J C4    1 
ATOM   9338  O  O4    . DT  J  5 17  ? 23.343  -5.434  45.617  1.00 138.05 ? -57  DT  J O4    1 
ATOM   9339  C  C5    . DT  J  5 17  ? 23.252  -7.527  44.499  1.00 138.09 ? -57  DT  J C5    1 
ATOM   9340  C  C7    . DT  J  5 17  ? 24.516  -7.323  43.710  1.00 137.97 ? -57  DT  J C7    1 
ATOM   9341  C  C6    . DT  J  5 17  ? 22.532  -8.659  44.372  1.00 137.82 ? -57  DT  J C6    1 
ATOM   9342  P  P     . DG  J  5 18  ? 17.615  -13.275 43.665  1.00 133.69 ? -56  DG  J P     1 
ATOM   9343  O  OP1   . DG  J  5 18  ? 17.691  -14.040 44.931  1.00 133.85 ? -56  DG  J OP1   1 
ATOM   9344  O  OP2   . DG  J  5 18  ? 17.663  -13.975 42.361  1.00 133.57 ? -56  DG  J OP2   1 
ATOM   9345  O  "O5'" . DG  J  5 18  ? 16.254  -12.427 43.693  1.00 131.91 ? -56  DG  J "O5'" 1 
ATOM   9346  C  "C5'" . DG  J  5 18  ? 16.046  -11.366 44.634  1.00 128.67 ? -56  DG  J "C5'" 1 
ATOM   9347  C  "C4'" . DG  J  5 18  ? 15.832  -10.024 43.943  1.00 126.33 ? -56  DG  J "C4'" 1 
ATOM   9348  O  "O4'" . DG  J  5 18  ? 17.103  -9.345  43.735  1.00 125.82 ? -56  DG  J "O4'" 1 
ATOM   9349  C  "C3'" . DG  J  5 18  ? 15.157  -10.054 42.570  1.00 125.03 ? -56  DG  J "C3'" 1 
ATOM   9350  O  "O3'" . DG  J  5 18  ? 14.291  -8.923  42.495  1.00 123.29 ? -56  DG  J "O3'" 1 
ATOM   9351  C  "C2'" . DG  J  5 18  ? 16.338  -9.903  41.616  1.00 124.98 ? -56  DG  J "C2'" 1 
ATOM   9352  C  "C1'" . DG  J  5 18  ? 17.118  -8.856  42.407  1.00 125.13 ? -56  DG  J "C1'" 1 
ATOM   9353  N  N9    . DG  J  5 18  ? 18.486  -8.571  41.967  1.00 124.90 ? -56  DG  J N9    1 
ATOM   9354  C  C8    . DG  J  5 18  ? 19.355  -9.388  41.281  1.00 124.84 ? -56  DG  J C8    1 
ATOM   9355  N  N7    . DG  J  5 18  ? 20.508  -8.830  41.032  1.00 124.85 ? -56  DG  J N7    1 
ATOM   9356  C  C5    . DG  J  5 18  ? 20.400  -7.559  41.584  1.00 124.97 ? -56  DG  J C5    1 
ATOM   9357  C  C6    . DG  J  5 18  ? 21.332  -6.485  41.629  1.00 125.19 ? -56  DG  J C6    1 
ATOM   9358  O  O6    . DG  J  5 18  ? 22.485  -6.449  41.170  1.00 125.16 ? -56  DG  J O6    1 
ATOM   9359  N  N1    . DG  J  5 18  ? 20.816  -5.362  42.286  1.00 125.09 ? -56  DG  J N1    1 
ATOM   9360  C  C2    . DG  J  5 18  ? 19.552  -5.286  42.834  1.00 124.99 ? -56  DG  J C2    1 
ATOM   9361  N  N2    . DG  J  5 18  ? 19.218  -4.131  43.429  1.00 124.97 ? -56  DG  J N2    1 
ATOM   9362  N  N3    . DG  J  5 18  ? 18.673  -6.283  42.794  1.00 125.05 ? -56  DG  J N3    1 
ATOM   9363  C  C4    . DG  J  5 18  ? 19.159  -7.385  42.160  1.00 124.90 ? -56  DG  J C4    1 
ATOM   9364  P  P     . DC  J  5 19  ? 13.026  -8.834  41.526  1.00 121.12 ? -55  DC  J P     1 
ATOM   9365  O  OP1   . DC  J  5 19  ? 11.844  -9.244  42.310  1.00 121.01 ? -55  DC  J OP1   1 
ATOM   9366  O  OP2   . DC  J  5 19  ? 13.357  -9.500  40.248  1.00 121.54 ? -55  DC  J OP2   1 
ATOM   9367  O  "O5'" . DC  J  5 19  ? 12.931  -7.271  41.216  1.00 122.13 ? -55  DC  J "O5'" 1 
ATOM   9368  C  "C5'" . DC  J  5 19  ? 12.997  -6.307  42.267  1.00 123.09 ? -55  DC  J "C5'" 1 
ATOM   9369  C  "C4'" . DC  J  5 19  ? 13.788  -5.084  41.837  1.00 123.87 ? -55  DC  J "C4'" 1 
ATOM   9370  O  "O4'" . DC  J  5 19  ? 15.154  -5.500  41.578  1.00 123.77 ? -55  DC  J "O4'" 1 
ATOM   9371  C  "C3'" . DC  J  5 19  ? 13.274  -4.400  40.568  1.00 124.77 ? -55  DC  J "C3'" 1 
ATOM   9372  O  "O3'" . DC  J  5 19  ? 12.776  -3.060  40.785  1.00 126.36 ? -55  DC  J "O3'" 1 
ATOM   9373  C  "C2'" . DC  J  5 19  ? 14.465  -4.419  39.611  1.00 124.29 ? -55  DC  J "C2'" 1 
ATOM   9374  C  "C1'" . DC  J  5 19  ? 15.664  -4.767  40.485  1.00 123.68 ? -55  DC  J "C1'" 1 
ATOM   9375  N  N1    . DC  J  5 19  ? 16.721  -5.556  39.749  1.00 123.38 ? -55  DC  J N1    1 
ATOM   9376  C  C2    . DC  J  5 19  ? 18.046  -5.077  39.677  1.00 123.04 ? -55  DC  J C2    1 
ATOM   9377  O  O2    . DC  J  5 19  ? 18.345  -4.009  40.229  1.00 122.88 ? -55  DC  J O2    1 
ATOM   9378  N  N3    . DC  J  5 19  ? 18.973  -5.810  38.996  1.00 123.09 ? -55  DC  J N3    1 
ATOM   9379  C  C4    . DC  J  5 19  ? 18.627  -6.964  38.405  1.00 123.42 ? -55  DC  J C4    1 
ATOM   9380  N  N4    . DC  J  5 19  ? 19.567  -7.653  37.748  1.00 123.29 ? -55  DC  J N4    1 
ATOM   9381  C  C5    . DC  J  5 19  ? 17.289  -7.465  38.462  1.00 123.33 ? -55  DC  J C5    1 
ATOM   9382  C  C6    . DC  J  5 19  ? 16.383  -6.736  39.133  1.00 123.49 ? -55  DC  J C6    1 
ATOM   9383  P  P     . DG  J  5 20  ? 11.527  -2.505  39.919  1.00 127.96 ? -54  DG  J P     1 
ATOM   9384  O  OP1   . DG  J  5 20  ? 10.336  -2.569  40.785  1.00 127.56 ? -54  DG  J OP1   1 
ATOM   9385  O  OP2   . DG  J  5 20  ? 11.497  -3.184  38.593  1.00 127.50 ? -54  DG  J OP2   1 
ATOM   9386  O  "O5'" . DG  J  5 20  ? 11.835  -0.950  39.661  1.00 130.16 ? -54  DG  J "O5'" 1 
ATOM   9387  C  "C5'" . DG  J  5 20  ? 12.918  -0.255  40.346  1.00 132.58 ? -54  DG  J "C5'" 1 
ATOM   9388  C  "C4'" . DG  J  5 20  ? 13.912  0.301   39.324  1.00 134.51 ? -54  DG  J "C4'" 1 
ATOM   9389  O  "O4'" . DG  J  5 20  ? 14.827  -0.754  38.925  1.00 134.10 ? -54  DG  J "O4'" 1 
ATOM   9390  C  "C3'" . DG  J  5 20  ? 13.350  0.901   38.027  1.00 136.02 ? -54  DG  J "C3'" 1 
ATOM   9391  O  "O3'" . DG  J  5 20  ? 13.988  2.166   37.759  1.00 138.93 ? -54  DG  J "O3'" 1 
ATOM   9392  C  "C2'" . DG  J  5 20  ? 13.699  -0.157  36.971  1.00 135.00 ? -54  DG  J "C2'" 1 
ATOM   9393  C  "C1'" . DG  J  5 20  ? 15.026  -0.665  37.533  1.00 133.78 ? -54  DG  J "C1'" 1 
ATOM   9394  N  N9    . DG  J  5 20  ? 15.487  -1.964  37.059  1.00 133.48 ? -54  DG  J N9    1 
ATOM   9395  C  C8    . DG  J  5 20  ? 14.750  -3.075  36.716  1.00 133.48 ? -54  DG  J C8    1 
ATOM   9396  N  N7    . DG  J  5 20  ? 15.482  -4.088  36.328  1.00 133.53 ? -54  DG  J N7    1 
ATOM   9397  C  C5    . DG  J  5 20  ? 16.793  -3.615  36.415  1.00 133.71 ? -54  DG  J C5    1 
ATOM   9398  C  C6    . DG  J  5 20  ? 18.037  -4.251  36.123  1.00 133.56 ? -54  DG  J C6    1 
ATOM   9399  O  O6    . DG  J  5 20  ? 18.237  -5.405  35.714  1.00 133.31 ? -54  DG  J O6    1 
ATOM   9400  N  N1    . DG  J  5 20  ? 19.126  -3.400  36.353  1.00 133.54 ? -54  DG  J N1    1 
ATOM   9401  C  C2    . DG  J  5 20  ? 19.025  -2.094  36.807  1.00 133.64 ? -54  DG  J C2    1 
ATOM   9402  N  N2    . DG  J  5 20  ? 20.169  -1.413  36.972  1.00 133.62 ? -54  DG  J N2    1 
ATOM   9403  N  N3    . DG  J  5 20  ? 17.872  -1.492  37.084  1.00 133.39 ? -54  DG  J N3    1 
ATOM   9404  C  C4    . DG  J  5 20  ? 16.804  -2.307  36.868  1.00 133.56 ? -54  DG  J C4    1 
ATOM   9405  P  P     . DG  J  5 21  ? 13.311  3.326   36.866  1.00 141.12 ? -53  DG  J P     1 
ATOM   9406  O  OP1   . DG  J  5 21  ? 12.174  3.886   37.645  1.00 140.77 ? -53  DG  J OP1   1 
ATOM   9407  O  OP2   . DG  J  5 21  ? 13.086  2.772   35.505  1.00 140.60 ? -53  DG  J OP2   1 
ATOM   9408  O  "O5'" . DG  J  5 21  ? 14.467  4.450   36.753  1.00 142.11 ? -53  DG  J "O5'" 1 
ATOM   9409  C  "C5'" . DG  J  5 21  ? 15.860  4.164   37.012  1.00 143.57 ? -53  DG  J "C5'" 1 
ATOM   9410  C  "C4'" . DG  J  5 21  ? 16.683  3.822   35.767  1.00 144.75 ? -53  DG  J "C4'" 1 
ATOM   9411  O  "O4'" . DG  J  5 21  ? 17.064  2.415   35.743  1.00 144.29 ? -53  DG  J "O4'" 1 
ATOM   9412  C  "C3'" . DG  J  5 21  ? 16.064  4.119   34.392  1.00 146.11 ? -53  DG  J "C3'" 1 
ATOM   9413  O  "O3'" . DG  J  5 21  ? 16.804  5.167   33.716  1.00 148.53 ? -53  DG  J "O3'" 1 
ATOM   9414  C  "C2'" . DG  J  5 21  ? 16.164  2.774   33.668  1.00 145.33 ? -53  DG  J "C2'" 1 
ATOM   9415  C  "C1'" . DG  J  5 21  ? 17.338  2.126   34.390  1.00 143.98 ? -53  DG  J "C1'" 1 
ATOM   9416  N  N9    . DG  J  5 21  ? 17.460  0.693   34.119  1.00 143.61 ? -53  DG  J N9    1 
ATOM   9417  C  C8    . DG  J  5 21  ? 16.439  -0.226  34.076  1.00 143.61 ? -53  DG  J C8    1 
ATOM   9418  N  N7    . DG  J  5 21  ? 16.830  -1.436  33.792  1.00 143.53 ? -53  DG  J N7    1 
ATOM   9419  C  C5    . DG  J  5 21  ? 18.201  -1.320  33.631  1.00 143.46 ? -53  DG  J C5    1 
ATOM   9420  C  C6    . DG  J  5 21  ? 19.164  -2.313  33.316  1.00 143.57 ? -53  DG  J C6    1 
ATOM   9421  O  O6    . DG  J  5 21  ? 18.972  -3.523  33.113  1.00 143.43 ? -53  DG  J O6    1 
ATOM   9422  N  N1    . DG  J  5 21  ? 20.455  -1.779  33.241  1.00 143.70 ? -53  DG  J N1    1 
ATOM   9423  C  C2    . DG  J  5 21  ? 20.771  -0.450  33.449  1.00 143.64 ? -53  DG  J C2    1 
ATOM   9424  N  N2    . DG  J  5 21  ? 22.065  -0.114  33.333  1.00 143.48 ? -53  DG  J N2    1 
ATOM   9425  N  N3    . DG  J  5 21  ? 19.870  0.484   33.747  1.00 143.57 ? -53  DG  J N3    1 
ATOM   9426  C  C4    . DG  J  5 21  ? 18.607  -0.014  33.824  1.00 143.43 ? -53  DG  J C4    1 
ATOM   9427  P  P     . DA  J  5 22  ? 16.481  5.727   32.235  1.00 150.16 ? -52  DA  J P     1 
ATOM   9428  O  OP1   . DA  J  5 22  ? 16.281  7.190   32.383  1.00 149.97 ? -52  DA  J OP1   1 
ATOM   9429  O  OP2   . DA  J  5 22  ? 15.408  4.913   31.606  1.00 150.00 ? -52  DA  J OP2   1 
ATOM   9430  O  "O5'" . DA  J  5 22  ? 17.862  5.483   31.439  1.00 150.87 ? -52  DA  J "O5'" 1 
ATOM   9431  C  "C5'" . DA  J  5 22  ? 18.148  4.276   30.727  1.00 152.46 ? -52  DA  J "C5'" 1 
ATOM   9432  C  "C4'" . DA  J  5 22  ? 19.643  3.977   30.719  1.00 153.99 ? -52  DA  J "C4'" 1 
ATOM   9433  O  "O4'" . DA  J  5 22  ? 19.917  2.750   31.441  1.00 154.59 ? -52  DA  J "O4'" 1 
ATOM   9434  C  "C3'" . DA  J  5 22  ? 20.267  3.815   29.336  1.00 155.00 ? -52  DA  J "C3'" 1 
ATOM   9435  O  "O3'" . DA  J  5 22  ? 21.392  4.686   29.205  1.00 156.08 ? -52  DA  J "O3'" 1 
ATOM   9436  C  "C2'" . DA  J  5 22  ? 20.711  2.356   29.231  1.00 155.09 ? -52  DA  J "C2'" 1 
ATOM   9437  C  "C1'" . DA  J  5 22  ? 20.411  1.735   30.585  1.00 155.34 ? -52  DA  J "C1'" 1 
ATOM   9438  N  N9    . DA  J  5 22  ? 19.426  0.654   30.495  1.00 155.64 ? -52  DA  J N9    1 
ATOM   9439  C  C8    . DA  J  5 22  ? 18.064  0.768   30.579  1.00 155.71 ? -52  DA  J C8    1 
ATOM   9440  N  N7    . DA  J  5 22  ? 17.421  -0.369  30.464  1.00 155.86 ? -52  DA  J N7    1 
ATOM   9441  C  C5    . DA  J  5 22  ? 18.426  -1.304  30.283  1.00 155.78 ? -52  DA  J C5    1 
ATOM   9442  C  C6    . DA  J  5 22  ? 18.402  -2.707  30.103  1.00 155.61 ? -52  DA  J C6    1 
ATOM   9443  N  N6    . DA  J  5 22  ? 17.276  -3.427  30.066  1.00 155.62 ? -52  DA  J N6    1 
ATOM   9444  N  N1    . DA  J  5 22  ? 19.585  -3.345  29.955  1.00 155.63 ? -52  DA  J N1    1 
ATOM   9445  C  C2    . DA  J  5 22  ? 20.715  -2.623  29.990  1.00 155.80 ? -52  DA  J C2    1 
ATOM   9446  N  N3    . DA  J  5 22  ? 20.863  -1.303  30.157  1.00 155.92 ? -52  DA  J N3    1 
ATOM   9447  C  C4    . DA  J  5 22  ? 19.670  -0.691  30.298  1.00 155.82 ? -52  DA  J C4    1 
ATOM   9448  P  P     . DT  J  5 23  ? 21.756  5.403   27.813  1.00 156.67 ? -51  DT  J P     1 
ATOM   9449  O  OP1   . DT  J  5 23  ? 22.895  6.312   28.079  1.00 156.62 ? -51  DT  J OP1   1 
ATOM   9450  O  OP2   . DT  J  5 23  ? 20.514  5.957   27.220  1.00 156.54 ? -51  DT  J OP2   1 
ATOM   9451  O  "O5'" . DT  J  5 23  ? 22.247  4.194   26.881  1.00 157.09 ? -51  DT  J "O5'" 1 
ATOM   9452  C  "C5'" . DT  J  5 23  ? 23.443  3.463   27.168  1.00 157.71 ? -51  DT  J "C5'" 1 
ATOM   9453  C  "C4'" . DT  J  5 23  ? 23.531  2.197   26.329  1.00 158.18 ? -51  DT  J "C4'" 1 
ATOM   9454  O  "O4'" . DT  J  5 23  ? 22.726  1.137   26.918  1.00 158.35 ? -51  DT  J "O4'" 1 
ATOM   9455  C  "C3'" . DT  J  5 23  ? 23.065  2.338   24.873  1.00 158.40 ? -51  DT  J "C3'" 1 
ATOM   9456  O  "O3'" . DT  J  5 23  ? 24.122  1.909   23.978  1.00 158.50 ? -51  DT  J "O3'" 1 
ATOM   9457  C  "C2'" . DT  J  5 23  ? 21.806  1.471   24.840  1.00 158.51 ? -51  DT  J "C2'" 1 
ATOM   9458  C  "C1'" . DT  J  5 23  ? 22.232  0.392   25.828  1.00 158.86 ? -51  DT  J "C1'" 1 
ATOM   9459  N  N1    . DT  J  5 23  ? 21.159  -0.593  26.208  1.00 159.15 ? -51  DT  J N1    1 
ATOM   9460  C  C2    . DT  J  5 23  ? 21.482  -1.941  26.287  1.00 159.27 ? -51  DT  J C2    1 
ATOM   9461  O  O2    . DT  J  5 23  ? 22.603  -2.384  26.082  1.00 159.15 ? -51  DT  J O2    1 
ATOM   9462  N  N3    . DT  J  5 23  ? 20.432  -2.766  26.628  1.00 159.29 ? -51  DT  J N3    1 
ATOM   9463  C  C4    . DT  J  5 23  ? 19.121  -2.388  26.885  1.00 159.14 ? -51  DT  J C4    1 
ATOM   9464  O  O4    . DT  J  5 23  ? 18.258  -3.211  27.180  1.00 159.04 ? -51  DT  J O4    1 
ATOM   9465  C  C5    . DT  J  5 23  ? 18.848  -0.969  26.779  1.00 159.18 ? -51  DT  J C5    1 
ATOM   9466  C  C7    . DT  J  5 23  ? 17.468  -0.429  27.027  1.00 159.15 ? -51  DT  J C7    1 
ATOM   9467  C  C6    . DT  J  5 23  ? 19.864  -0.154  26.448  1.00 159.21 ? -51  DT  J C6    1 
ATOM   9468  P  P     . DC  J  5 24  ? 23.897  1.338   22.488  1.00 158.33 ? -50  DC  J P     1 
ATOM   9469  O  OP1   . DC  J  5 24  ? 25.209  1.291   21.799  1.00 158.03 ? -50  DC  J OP1   1 
ATOM   9470  O  OP2   . DC  J  5 24  ? 22.782  2.080   21.854  1.00 158.32 ? -50  DC  J OP2   1 
ATOM   9471  O  "O5'" . DC  J  5 24  ? 23.407  -0.156  22.786  1.00 158.03 ? -50  DC  J "O5'" 1 
ATOM   9472  C  "C5'" . DC  J  5 24  ? 24.325  -1.187  23.140  1.00 157.56 ? -50  DC  J "C5'" 1 
ATOM   9473  C  "C4'" . DC  J  5 24  ? 23.909  -2.481  22.466  1.00 157.23 ? -50  DC  J "C4'" 1 
ATOM   9474  O  "O4'" . DC  J  5 24  ? 22.753  -3.031  23.153  1.00 157.43 ? -50  DC  J "O4'" 1 
ATOM   9475  C  "C3'" . DC  J  5 24  ? 23.509  -2.316  21.001  1.00 156.77 ? -50  DC  J "C3'" 1 
ATOM   9476  O  "O3'" . DC  J  5 24  ? 24.137  -3.304  20.210  1.00 155.96 ? -50  DC  J "O3'" 1 
ATOM   9477  C  "C2'" . DC  J  5 24  ? 21.997  -2.507  21.008  1.00 157.20 ? -50  DC  J "C2'" 1 
ATOM   9478  C  "C1'" . DC  J  5 24  ? 21.803  -3.446  22.193  1.00 157.40 ? -50  DC  J "C1'" 1 
ATOM   9479  N  N1    . DC  J  5 24  ? 20.418  -3.418  22.786  1.00 157.52 ? -50  DC  J N1    1 
ATOM   9480  C  C2    . DC  J  5 24  ? 19.769  -4.627  23.093  1.00 157.46 ? -50  DC  J C2    1 
ATOM   9481  O  O2    . DC  J  5 24  ? 20.346  -5.701  22.874  1.00 157.46 ? -50  DC  J O2    1 
ATOM   9482  N  N3    . DC  J  5 24  ? 18.518  -4.586  23.625  1.00 157.34 ? -50  DC  J N3    1 
ATOM   9483  C  C4    . DC  J  5 24  ? 17.921  -3.410  23.846  1.00 157.34 ? -50  DC  J C4    1 
ATOM   9484  N  N4    . DC  J  5 24  ? 16.694  -3.424  24.371  1.00 157.42 ? -50  DC  J N4    1 
ATOM   9485  C  C5    . DC  J  5 24  ? 18.555  -2.167  23.539  1.00 157.42 ? -50  DC  J C5    1 
ATOM   9486  C  C6    . DC  J  5 24  ? 19.790  -2.219  23.020  1.00 157.54 ? -50  DC  J C6    1 
ATOM   9487  P  P     . DG  J  5 25  ? 24.363  -3.071  18.640  1.00 155.27 ? -49  DG  J P     1 
ATOM   9488  O  OP1   . DG  J  5 25  ? 25.490  -2.121  18.483  1.00 154.93 ? -49  DG  J OP1   1 
ATOM   9489  O  OP2   . DG  J  5 25  ? 23.057  -2.762  18.009  1.00 155.02 ? -49  DG  J OP2   1 
ATOM   9490  O  "O5'" . DG  J  5 25  ? 24.827  -4.530  18.141  1.00 154.17 ? -49  DG  J "O5'" 1 
ATOM   9491  C  "C5'" . DG  J  5 25  ? 24.472  -5.742  18.840  1.00 151.85 ? -49  DG  J "C5'" 1 
ATOM   9492  C  "C4'" . DG  J  5 25  ? 23.132  -6.314  18.395  1.00 150.17 ? -49  DG  J "C4'" 1 
ATOM   9493  O  "O4'" . DG  J  5 25  ? 22.066  -5.838  19.257  1.00 149.88 ? -49  DG  J "O4'" 1 
ATOM   9494  C  "C3'" . DG  J  5 25  ? 22.690  -5.980  16.968  1.00 149.19 ? -49  DG  J "C3'" 1 
ATOM   9495  O  "O3'" . DG  J  5 25  ? 22.862  -7.153  16.144  1.00 148.40 ? -49  DG  J "O3'" 1 
ATOM   9496  C  "C2'" . DG  J  5 25  ? 21.258  -5.452  17.120  1.00 149.14 ? -49  DG  J "C2'" 1 
ATOM   9497  C  "C1'" . DG  J  5 25  ? 20.875  -5.960  18.509  1.00 149.18 ? -49  DG  J "C1'" 1 
ATOM   9498  N  N9    . DG  J  5 25  ? 19.753  -5.271  19.161  1.00 149.12 ? -49  DG  J N9    1 
ATOM   9499  C  C8    . DG  J  5 25  ? 19.542  -3.913  19.257  1.00 148.98 ? -49  DG  J C8    1 
ATOM   9500  N  N7    . DG  J  5 25  ? 18.451  -3.587  19.893  1.00 148.91 ? -49  DG  J N7    1 
ATOM   9501  C  C5    . DG  J  5 25  ? 17.888  -4.808  20.241  1.00 149.09 ? -49  DG  J C5    1 
ATOM   9502  C  C6    . DG  J  5 25  ? 16.690  -5.093  20.947  1.00 149.05 ? -49  DG  J C6    1 
ATOM   9503  O  O6    . DG  J  5 25  ? 15.876  -4.285  21.411  1.00 148.99 ? -49  DG  J O6    1 
ATOM   9504  N  N1    . DG  J  5 25  ? 16.473  -6.465  21.096  1.00 148.88 ? -49  DG  J N1    1 
ATOM   9505  C  C2    . DG  J  5 25  ? 17.317  -7.442  20.618  1.00 148.84 ? -49  DG  J C2    1 
ATOM   9506  N  N2    . DG  J  5 25  ? 16.951  -8.709  20.851  1.00 148.90 ? -49  DG  J N2    1 
ATOM   9507  N  N3    . DG  J  5 25  ? 18.443  -7.190  19.955  1.00 148.96 ? -49  DG  J N3    1 
ATOM   9508  C  C4    . DG  J  5 25  ? 18.673  -5.857  19.799  1.00 149.14 ? -49  DG  J C4    1 
ATOM   9509  P  P     . DT  J  5 26  ? 21.697  -8.055  15.496  1.00 147.91 ? -48  DT  J P     1 
ATOM   9510  O  OP1   . DT  J  5 26  ? 22.345  -9.217  14.835  1.00 147.78 ? -48  DT  J OP1   1 
ATOM   9511  O  OP2   . DT  J  5 26  ? 20.812  -7.176  14.689  1.00 147.71 ? -48  DT  J OP2   1 
ATOM   9512  O  "O5'" . DT  J  5 26  ? 20.890  -8.581  16.782  1.00 146.74 ? -48  DT  J "O5'" 1 
ATOM   9513  C  "C5'" . DT  J  5 26  ? 20.488  -9.940  16.938  1.00 144.57 ? -48  DT  J "C5'" 1 
ATOM   9514  C  "C4'" . DT  J  5 26  ? 18.980  -10.041 16.817  1.00 142.94 ? -48  DT  J "C4'" 1 
ATOM   9515  O  "O4'" . DT  J  5 26  ? 18.360  -8.843  17.360  1.00 142.75 ? -48  DT  J "O4'" 1 
ATOM   9516  C  "C3'" . DT  J  5 26  ? 18.471  -10.151 15.383  1.00 141.94 ? -48  DT  J "C3'" 1 
ATOM   9517  O  "O3'" . DT  J  5 26  ? 17.481  -11.164 15.306  1.00 140.29 ? -48  DT  J "O3'" 1 
ATOM   9518  C  "C2'" . DT  J  5 26  ? 17.869  -8.771  15.115  1.00 142.26 ? -48  DT  J "C2'" 1 
ATOM   9519  C  "C1'" . DT  J  5 26  ? 17.302  -8.479  16.496  1.00 142.57 ? -48  DT  J "C1'" 1 
ATOM   9520  N  N1    . DT  J  5 26  ? 16.857  -7.068  16.772  1.00 142.52 ? -48  DT  J N1    1 
ATOM   9521  C  C2    . DT  J  5 26  ? 15.794  -6.863  17.635  1.00 142.32 ? -48  DT  J C2    1 
ATOM   9522  O  O2    . DT  J  5 26  ? 15.187  -7.759  18.192  1.00 142.44 ? -48  DT  J O2    1 
ATOM   9523  N  N3    . DT  J  5 26  ? 15.458  -5.549  17.832  1.00 142.36 ? -48  DT  J N3    1 
ATOM   9524  C  C4    . DT  J  5 26  ? 16.062  -4.440  17.266  1.00 142.55 ? -48  DT  J C4    1 
ATOM   9525  O  O4    . DT  J  5 26  ? 15.675  -3.303  17.517  1.00 142.81 ? -48  DT  J O4    1 
ATOM   9526  C  C5    . DT  J  5 26  ? 17.165  -4.716  16.371  1.00 142.50 ? -48  DT  J C5    1 
ATOM   9527  C  C7    . DT  J  5 26  ? 17.905  -3.598  15.692  1.00 142.37 ? -48  DT  J C7    1 
ATOM   9528  C  C6    . DT  J  5 26  ? 17.504  -6.000  16.172  1.00 142.59 ? -48  DT  J C6    1 
ATOM   9529  P  P     . DA  J  5 27  ? 17.113  -11.822 13.895  1.00 139.74 ? -47  DA  J P     1 
ATOM   9530  O  OP1   . DA  J  5 27  ? 18.163  -12.837 13.640  1.00 139.56 ? -47  DA  J OP1   1 
ATOM   9531  O  OP2   . DA  J  5 27  ? 16.847  -10.750 12.900  1.00 139.06 ? -47  DA  J OP2   1 
ATOM   9532  O  "O5'" . DA  J  5 27  ? 15.706  -12.552 14.167  1.00 138.69 ? -47  DA  J "O5'" 1 
ATOM   9533  C  "C5'" . DA  J  5 27  ? 15.540  -13.588 15.148  1.00 136.54 ? -47  DA  J "C5'" 1 
ATOM   9534  C  "C4'" . DA  J  5 27  ? 14.159  -13.529 15.795  1.00 134.75 ? -47  DA  J "C4'" 1 
ATOM   9535  O  "O4'" . DA  J  5 27  ? 13.852  -12.169 16.205  1.00 134.67 ? -47  DA  J "O4'" 1 
ATOM   9536  C  "C3'" . DA  J  5 27  ? 12.989  -13.982 14.926  1.00 133.39 ? -47  DA  J "C3'" 1 
ATOM   9537  O  "O3'" . DA  J  5 27  ? 12.065  -14.736 15.718  1.00 131.01 ? -47  DA  J "O3'" 1 
ATOM   9538  C  "C2'" . DA  J  5 27  ? 12.379  -12.673 14.423  1.00 133.91 ? -47  DA  J "C2'" 1 
ATOM   9539  C  "C1'" . DA  J  5 27  ? 12.673  -11.711 15.573  1.00 134.84 ? -47  DA  J "C1'" 1 
ATOM   9540  N  N9    . DA  J  5 27  ? 12.891  -10.318 15.177  1.00 134.96 ? -47  DA  J N9    1 
ATOM   9541  C  C8    . DA  J  5 27  ? 13.611  -9.858  14.109  1.00 135.08 ? -47  DA  J C8    1 
ATOM   9542  N  N7    . DA  J  5 27  ? 13.638  -8.550  14.005  1.00 135.14 ? -47  DA  J N7    1 
ATOM   9543  C  C5    . DA  J  5 27  ? 12.886  -8.116  15.081  1.00 135.05 ? -47  DA  J C5    1 
ATOM   9544  C  C6    . DA  J  5 27  ? 12.529  -6.829  15.538  1.00 135.14 ? -47  DA  J C6    1 
ATOM   9545  N  N6    . DA  J  5 27  ? 12.904  -5.697  14.934  1.00 135.10 ? -47  DA  J N6    1 
ATOM   9546  N  N1    . DA  J  5 27  ? 11.762  -6.745  16.649  1.00 135.19 ? -47  DA  J N1    1 
ATOM   9547  C  C2    . DA  J  5 27  ? 11.382  -7.877  17.261  1.00 135.10 ? -47  DA  J C2    1 
ATOM   9548  N  N3    . DA  J  5 27  ? 11.656  -9.138  16.923  1.00 135.06 ? -47  DA  J N3    1 
ATOM   9549  C  C4    . DA  J  5 27  ? 12.418  -9.193  15.815  1.00 135.03 ? -47  DA  J C4    1 
ATOM   9550  P  P     . DG  J  5 28  ? 10.904  -15.631 15.051  1.00 129.75 ? -46  DG  J P     1 
ATOM   9551  O  OP1   . DG  J  5 28  ? 10.741  -16.840 15.898  1.00 129.59 ? -46  DG  J OP1   1 
ATOM   9552  O  OP2   . DG  J  5 28  ? 11.165  -15.763 13.595  1.00 129.61 ? -46  DG  J OP2   1 
ATOM   9553  O  "O5'" . DG  J  5 28  ? 9.595   -14.718 15.187  1.00 127.71 ? -46  DG  J "O5'" 1 
ATOM   9554  C  "C5'" . DG  J  5 28  ? 9.097   -14.325 16.477  1.00 123.70 ? -46  DG  J "C5'" 1 
ATOM   9555  C  "C4'" . DG  J  5 28  ? 8.356   -13.000 16.394  1.00 119.76 ? -46  DG  J "C4'" 1 
ATOM   9556  O  "O4'" . DG  J  5 28  ? 9.165   -12.006 15.706  1.00 119.12 ? -46  DG  J "O4'" 1 
ATOM   9557  C  "C3'" . DG  J  5 28  ? 7.026   -13.054 15.647  1.00 116.93 ? -46  DG  J "C3'" 1 
ATOM   9558  O  "O3'" . DG  J  5 28  ? 5.998   -12.648 16.540  1.00 113.17 ? -46  DG  J "O3'" 1 
ATOM   9559  C  "C2'" . DG  J  5 28  ? 7.231   -12.064 14.501  1.00 117.49 ? -46  DG  J "C2'" 1 
ATOM   9560  C  "C1'" . DG  J  5 28  ? 8.269   -11.119 15.093  1.00 118.08 ? -46  DG  J "C1'" 1 
ATOM   9561  N  N9    . DG  J  5 28  ? 8.984   -10.296 14.127  1.00 117.91 ? -46  DG  J N9    1 
ATOM   9562  C  C8    . DG  J  5 28  ? 9.595   -10.735 12.982  1.00 118.22 ? -46  DG  J C8    1 
ATOM   9563  N  N7    . DG  J  5 28  ? 10.158  -9.782  12.292  1.00 118.53 ? -46  DG  J N7    1 
ATOM   9564  C  C5    . DG  J  5 28  ? 9.904   -8.636  13.028  1.00 118.07 ? -46  DG  J C5    1 
ATOM   9565  C  C6    . DG  J  5 28  ? 10.275  -7.295  12.768  1.00 118.07 ? -46  DG  J C6    1 
ATOM   9566  O  O6    . DG  J  5 28  ? 10.920  -6.859  11.807  1.00 118.33 ? -46  DG  J O6    1 
ATOM   9567  N  N1    . DG  J  5 28  ? 9.826   -6.420  13.753  1.00 118.04 ? -46  DG  J N1    1 
ATOM   9568  C  C2    . DG  J  5 28  ? 9.105   -6.804  14.857  1.00 118.10 ? -46  DG  J C2    1 
ATOM   9569  N  N2    . DG  J  5 28  ? 8.758   -5.823  15.699  1.00 118.05 ? -46  DG  J N2    1 
ATOM   9570  N  N3    . DG  J  5 28  ? 8.754   -8.062  15.115  1.00 118.36 ? -46  DG  J N3    1 
ATOM   9571  C  C4    . DG  J  5 28  ? 9.183   -8.931  14.161  1.00 118.04 ? -46  DG  J C4    1 
ATOM   9572  P  P     . DA  J  5 29  ? 4.436   -12.854 16.235  1.00 110.37 ? -45  DA  J P     1 
ATOM   9573  O  OP1   . DA  J  5 29  ? 4.061   -14.218 16.665  1.00 110.31 ? -45  DA  J OP1   1 
ATOM   9574  O  OP2   . DA  J  5 29  ? 4.162   -12.426 14.847  1.00 110.48 ? -45  DA  J OP2   1 
ATOM   9575  O  "O5'" . DA  J  5 29  ? 3.731   -11.807 17.220  1.00 107.25 ? -45  DA  J "O5'" 1 
ATOM   9576  C  "C5'" . DA  J  5 29  ? 4.466   -10.731 17.809  1.00 102.84 ? -45  DA  J "C5'" 1 
ATOM   9577  C  "C4'" . DA  J  5 29  ? 4.113   -9.386  17.192  1.00 99.57  ? -45  DA  J "C4'" 1 
ATOM   9578  O  "O4'" . DA  J  5 29  ? 5.077   -9.017  16.170  1.00 99.03  ? -45  DA  J "O4'" 1 
ATOM   9579  C  "C3'" . DA  J  5 29  ? 2.753   -9.293  16.507  1.00 97.49  ? -45  DA  J "C3'" 1 
ATOM   9580  O  "O3'" . DA  J  5 29  ? 2.249   -8.014  16.755  1.00 94.52  ? -45  DA  J "O3'" 1 
ATOM   9581  C  "C2'" . DA  J  5 29  ? 3.101   -9.357  15.030  1.00 97.87  ? -45  DA  J "C2'" 1 
ATOM   9582  C  "C1'" . DA  J  5 29  ? 4.341   -8.485  15.093  1.00 98.17  ? -45  DA  J "C1'" 1 
ATOM   9583  N  N9    . DA  J  5 29  ? 5.131   -8.485  13.878  1.00 98.26  ? -45  DA  J N9    1 
ATOM   9584  C  C8    . DA  J  5 29  ? 5.364   -9.533  13.028  1.00 98.52  ? -45  DA  J C8    1 
ATOM   9585  N  N7    . DA  J  5 29  ? 6.119   -9.220  11.999  1.00 98.78  ? -45  DA  J N7    1 
ATOM   9586  C  C5    . DA  J  5 29  ? 6.388   -7.874  12.197  1.00 98.27  ? -45  DA  J C5    1 
ATOM   9587  C  C6    . DA  J  5 29  ? 7.134   -6.945  11.460  1.00 97.97  ? -45  DA  J C6    1 
ATOM   9588  N  N6    . DA  J  5 29  ? 7.764   -7.267  10.332  1.00 98.21  ? -45  DA  J N6    1 
ATOM   9589  N  N1    . DA  J  5 29  ? 7.207   -5.681  11.928  1.00 98.31  ? -45  DA  J N1    1 
ATOM   9590  C  C2    . DA  J  5 29  ? 6.569   -5.365  13.064  1.00 98.27  ? -45  DA  J C2    1 
ATOM   9591  N  N3    . DA  J  5 29  ? 5.832   -6.151  13.844  1.00 98.01  ? -45  DA  J N3    1 
ATOM   9592  C  C4    . DA  J  5 29  ? 5.785   -7.401  13.349  1.00 98.27  ? -45  DA  J C4    1 
ATOM   9593  P  P     . DA  J  5 30  ? 0.760   -7.788  17.260  1.00 92.08  ? -44  DA  J P     1 
ATOM   9594  O  OP1   . DA  J  5 30  ? 0.826   -7.961  18.735  1.00 91.94  ? -44  DA  J OP1   1 
ATOM   9595  O  OP2   . DA  J  5 30  ? -0.163  -8.581  16.421  1.00 91.81  ? -44  DA  J OP2   1 
ATOM   9596  O  "O5'" . DA  J  5 30  ? 0.494   -6.251  16.884  1.00 91.34  ? -44  DA  J "O5'" 1 
ATOM   9597  C  "C5'" . DA  J  5 30  ? 1.267   -5.210  17.504  1.00 91.16  ? -44  DA  J "C5'" 1 
ATOM   9598  C  "C4'" . DA  J  5 30  ? 1.388   -3.962  16.641  1.00 90.49  ? -44  DA  J "C4'" 1 
ATOM   9599  O  "O4'" . DA  J  5 30  ? 2.279   -4.218  15.535  1.00 90.72  ? -44  DA  J "O4'" 1 
ATOM   9600  C  "C3'" . DA  J  5 30  ? 0.087   -3.434  16.038  1.00 89.86  ? -44  DA  J "C3'" 1 
ATOM   9601  O  "O3'" . DA  J  5 30  ? -0.041  -2.044  16.303  1.00 88.10  ? -44  DA  J "O3'" 1 
ATOM   9602  C  "C2'" . DA  J  5 30  ? 0.180   -3.754  14.548  1.00 89.83  ? -44  DA  J "C2'" 1 
ATOM   9603  C  "C1'" . DA  J  5 30  ? 1.680   -3.838  14.320  1.00 91.52  ? -44  DA  J "C1'" 1 
ATOM   9604  N  N9    . DA  J  5 30  ? 2.081   -4.843  13.345  1.00 92.44  ? -44  DA  J N9    1 
ATOM   9605  C  C8    . DA  J  5 30  ? 1.652   -6.143  13.244  1.00 92.41  ? -44  DA  J C8    1 
ATOM   9606  N  N7    . DA  J  5 30  ? 2.210   -6.808  12.257  1.00 92.77  ? -44  DA  J N7    1 
ATOM   9607  C  C5    . DA  J  5 30  ? 3.065   -5.880  11.675  1.00 93.07  ? -44  DA  J C5    1 
ATOM   9608  C  C6    . DA  J  5 30  ? 3.951   -5.949  10.575  1.00 92.51  ? -44  DA  J C6    1 
ATOM   9609  N  N6    . DA  J  5 30  ? 4.120   -7.045  9.835   1.00 92.20  ? -44  DA  J N6    1 
ATOM   9610  N  N1    . DA  J  5 30  ? 4.652   -4.835  10.258  1.00 92.51  ? -44  DA  J N1    1 
ATOM   9611  C  C2    . DA  J  5 30  ? 4.480   -3.718  10.993  1.00 92.59  ? -44  DA  J C2    1 
ATOM   9612  N  N3    . DA  J  5 30  ? 3.685   -3.526  12.050  1.00 92.45  ? -44  DA  J N3    1 
ATOM   9613  C  C4    . DA  J  5 30  ? 3.002   -4.659  12.339  1.00 93.02  ? -44  DA  J C4    1 
ATOM   9614  P  P     . DA  J  5 31  ? -1.385  -1.273  15.903  1.00 87.66  ? -43  DA  J P     1 
ATOM   9615  O  OP1   . DA  J  5 31  ? -1.635  -0.262  16.950  1.00 87.69  ? -43  DA  J OP1   1 
ATOM   9616  O  OP2   . DA  J  5 31  ? -2.463  -2.228  15.542  1.00 87.12  ? -43  DA  J OP2   1 
ATOM   9617  O  "O5'" . DA  J  5 31  ? -0.913  -0.539  14.564  1.00 88.85  ? -43  DA  J "O5'" 1 
ATOM   9618  C  "C5'" . DA  J  5 31  ? 0.371   0.110   14.494  1.00 89.18  ? -43  DA  J "C5'" 1 
ATOM   9619  C  "C4'" . DA  J  5 31  ? 0.721   0.519   13.070  1.00 89.29  ? -43  DA  J "C4'" 1 
ATOM   9620  O  "O4'" . DA  J  5 31  ? 1.237   -0.598  12.296  1.00 88.16  ? -43  DA  J "O4'" 1 
ATOM   9621  C  "C3'" . DA  J  5 31  ? -0.424  1.098   12.248  1.00 90.27  ? -43  DA  J "C3'" 1 
ATOM   9622  O  "O3'" . DA  J  5 31  ? 0.116   2.188   11.504  1.00 92.94  ? -43  DA  J "O3'" 1 
ATOM   9623  C  "C2'" . DA  J  5 31  ? -0.848  -0.084  11.370  1.00 88.69  ? -43  DA  J "C2'" 1 
ATOM   9624  C  "C1'" . DA  J  5 31  ? 0.505   -0.731  11.093  1.00 87.20  ? -43  DA  J "C1'" 1 
ATOM   9625  N  N9    . DA  J  5 31  ? 0.492   -2.144  10.697  1.00 87.01  ? -43  DA  J N9    1 
ATOM   9626  C  C8    . DA  J  5 31  ? -0.242  -3.173  11.226  1.00 86.46  ? -43  DA  J C8    1 
ATOM   9627  N  N7    . DA  J  5 31  ? -0.032  -4.337  10.658  1.00 85.86  ? -43  DA  J N7    1 
ATOM   9628  C  C5    . DA  J  5 31  ? 0.909   -4.061  9.678   1.00 86.79  ? -43  DA  J C5    1 
ATOM   9629  C  C6    . DA  J  5 31  ? 1.562   -4.862  8.710   1.00 86.63  ? -43  DA  J C6    1 
ATOM   9630  N  N6    . DA  J  5 31  ? 1.361   -6.174  8.564   1.00 86.63  ? -43  DA  J N6    1 
ATOM   9631  N  N1    . DA  J  5 31  ? 2.447   -4.261  7.886   1.00 86.69  ? -43  DA  J N1    1 
ATOM   9632  C  C2    . DA  J  5 31  ? 2.674   -2.949  8.005   1.00 86.47  ? -43  DA  J C2    1 
ATOM   9633  N  N3    . DA  J  5 31  ? 2.125   -2.095  8.867   1.00 87.23  ? -43  DA  J N3    1 
ATOM   9634  C  C4    . DA  J  5 31  ? 1.245   -2.714  9.687   1.00 87.32  ? -43  DA  J C4    1 
ATOM   9635  P  P     . DA  J  5 32  ? -0.707  3.521   11.178  1.00 94.53  ? -42  DA  J P     1 
ATOM   9636  O  OP1   . DA  J  5 32  ? -0.040  4.640   11.892  1.00 94.64  ? -42  DA  J OP1   1 
ATOM   9637  O  OP2   . DA  J  5 32  ? -2.158  3.285   11.345  1.00 94.17  ? -42  DA  J OP2   1 
ATOM   9638  O  "O5'" . DA  J  5 32  ? -0.437  3.639   9.604   1.00 97.58  ? -42  DA  J "O5'" 1 
ATOM   9639  C  "C5'" . DA  J  5 32  ? 0.883   3.442   9.072   1.00 101.32 ? -42  DA  J "C5'" 1 
ATOM   9640  C  "C4'" . DA  J  5 32  ? 0.830   2.981   7.626   1.00 103.80 ? -42  DA  J "C4'" 1 
ATOM   9641  O  "O4'" . DA  J  5 32  ? 0.746   1.536   7.590   1.00 103.84 ? -42  DA  J "O4'" 1 
ATOM   9642  C  "C3'" . DA  J  5 32  ? -0.347  3.509   6.799   1.00 106.16 ? -42  DA  J "C3'" 1 
ATOM   9643  O  "O3'" . DA  J  5 32  ? 0.177   4.163   5.627   1.00 110.19 ? -42  DA  J "O3'" 1 
ATOM   9644  C  "C2'" . DA  J  5 32  ? -1.193  2.268   6.493   1.00 104.92 ? -42  DA  J "C2'" 1 
ATOM   9645  C  "C1'" . DA  J  5 32  ? -0.160  1.149   6.578   1.00 103.65 ? -42  DA  J "C1'" 1 
ATOM   9646  N  N9    . DA  J  5 32  ? -0.679  -0.159  6.958   1.00 103.21 ? -42  DA  J N9    1 
ATOM   9647  C  C8    . DA  J  5 32  ? -1.579  -0.431  7.946   1.00 103.29 ? -42  DA  J C8    1 
ATOM   9648  N  N7    . DA  J  5 32  ? -1.853  -1.707  8.069   1.00 103.52 ? -42  DA  J N7    1 
ATOM   9649  C  C5    . DA  J  5 32  ? -1.073  -2.320  7.100   1.00 103.48 ? -42  DA  J C5    1 
ATOM   9650  C  C6    . DA  J  5 32  ? -0.900  -3.672  6.705   1.00 103.41 ? -42  DA  J C6    1 
ATOM   9651  N  N6    . DA  J  5 32  ? -1.534  -4.699  7.271   1.00 103.34 ? -42  DA  J N6    1 
ATOM   9652  N  N1    . DA  J  5 32  ? -0.043  -3.942  5.696   1.00 103.41 ? -42  DA  J N1    1 
ATOM   9653  C  C2    . DA  J  5 32  ? 0.600   -2.920  5.115   1.00 103.48 ? -42  DA  J C2    1 
ATOM   9654  N  N3    . DA  J  5 32  ? 0.519   -1.617  5.399   1.00 103.49 ? -42  DA  J N3    1 
ATOM   9655  C  C4    . DA  J  5 32  ? -0.339  -1.375  6.408   1.00 103.27 ? -42  DA  J C4    1 
ATOM   9656  P  P     . DA  J  5 33  ? -0.692  5.062   4.613   1.00 112.67 ? -41  DA  J P     1 
ATOM   9657  O  OP1   . DA  J  5 33  ? 0.254   6.025   4.004   1.00 112.35 ? -41  DA  J OP1   1 
ATOM   9658  O  OP2   . DA  J  5 33  ? -1.918  5.577   5.277   1.00 111.72 ? -41  DA  J OP2   1 
ATOM   9659  O  "O5'" . DA  J  5 33  ? -1.112  3.967   3.521   1.00 114.42 ? -41  DA  J "O5'" 1 
ATOM   9660  C  "C5'" . DA  J  5 33  ? -0.128  3.100   2.941   1.00 117.48 ? -41  DA  J "C5'" 1 
ATOM   9661  C  "C4'" . DA  J  5 33  ? -0.758  2.082   2.003   1.00 120.31 ? -41  DA  J "C4'" 1 
ATOM   9662  O  "O4'" . DA  J  5 33  ? -1.037  0.844   2.713   1.00 120.87 ? -41  DA  J "O4'" 1 
ATOM   9663  C  "C3'" . DA  J  5 33  ? -2.079  2.516   1.362   1.00 122.19 ? -41  DA  J "C3'" 1 
ATOM   9664  O  "O3'" . DA  J  5 33  ? -2.103  2.182   -0.035  1.00 124.05 ? -41  DA  J "O3'" 1 
ATOM   9665  C  "C2'" . DA  J  5 33  ? -3.119  1.723   2.149   1.00 122.19 ? -41  DA  J "C2'" 1 
ATOM   9666  C  "C1'" . DA  J  5 33  ? -2.349  0.431   2.392   1.00 121.87 ? -41  DA  J "C1'" 1 
ATOM   9667  N  N9    . DA  J  5 33  ? -2.921  -0.373  3.466   1.00 122.01 ? -41  DA  J N9    1 
ATOM   9668  C  C8    . DA  J  5 33  ? -3.533  0.090   4.600   1.00 122.23 ? -41  DA  J C8    1 
ATOM   9669  N  N7    . DA  J  5 33  ? -3.969  -0.860  5.390   1.00 122.47 ? -41  DA  J N7    1 
ATOM   9670  C  C5    . DA  J  5 33  ? -3.620  -2.026  4.727   1.00 122.18 ? -41  DA  J C5    1 
ATOM   9671  C  C6    . DA  J  5 33  ? -3.801  -3.389  5.042   1.00 122.10 ? -41  DA  J C6    1 
ATOM   9672  N  N6    . DA  J  5 33  ? -4.407  -3.795  6.160   1.00 122.13 ? -41  DA  J N6    1 
ATOM   9673  N  N1    . DA  J  5 33  ? -3.343  -4.314  4.168   1.00 122.13 ? -41  DA  J N1    1 
ATOM   9674  C  C2    . DA  J  5 33  ? -2.739  -3.896  3.048   1.00 122.16 ? -41  DA  J C2    1 
ATOM   9675  N  N3    . DA  J  5 33  ? -2.509  -2.643  2.646   1.00 122.13 ? -41  DA  J N3    1 
ATOM   9676  C  C4    . DA  J  5 33  ? -2.976  -1.747  3.536   1.00 122.02 ? -41  DA  J C4    1 
ATOM   9677  P  P     . DG  J  5 34  ? -3.145  2.854   -1.052  1.00 124.70 ? -40  DG  J P     1 
ATOM   9678  O  OP1   . DG  J  5 34  ? -2.344  3.602   -2.041  1.00 124.85 ? -40  DG  J OP1   1 
ATOM   9679  O  OP2   . DG  J  5 34  ? -4.219  3.552   -0.303  1.00 124.32 ? -40  DG  J OP2   1 
ATOM   9680  O  "O5'" . DG  J  5 34  ? -3.794  1.577   -1.766  1.00 126.39 ? -40  DG  J "O5'" 1 
ATOM   9681  C  "C5'" . DG  J  5 34  ? -2.970  0.556   -2.321  1.00 128.82 ? -40  DG  J "C5'" 1 
ATOM   9682  C  "C4'" . DG  J  5 34  ? -3.747  -0.739  -2.519  1.00 130.87 ? -40  DG  J "C4'" 1 
ATOM   9683  O  "O4'" . DG  J  5 34  ? -3.896  -1.448  -1.258  1.00 131.63 ? -40  DG  J "O4'" 1 
ATOM   9684  C  "C3'" . DG  J  5 34  ? -5.152  -0.589  -3.098  1.00 131.65 ? -40  DG  J "C3'" 1 
ATOM   9685  O  "O3'" . DG  J  5 34  ? -5.249  -1.470  -4.211  1.00 132.85 ? -40  DG  J "O3'" 1 
ATOM   9686  C  "C2'" . DG  J  5 34  ? -6.075  -0.984  -1.943  1.00 131.78 ? -40  DG  J "C2'" 1 
ATOM   9687  C  "C1'" . DG  J  5 34  ? -5.209  -1.962  -1.157  1.00 131.83 ? -40  DG  J "C1'" 1 
ATOM   9688  N  N9    . DG  J  5 34  ? -5.562  -2.091  0.261   1.00 131.95 ? -40  DG  J N9    1 
ATOM   9689  C  C8    . DG  J  5 34  ? -5.569  -1.091  1.206   1.00 131.86 ? -40  DG  J C8    1 
ATOM   9690  N  N7    . DG  J  5 34  ? -5.926  -1.495  2.394   1.00 131.95 ? -40  DG  J N7    1 
ATOM   9691  C  C5    . DG  J  5 34  ? -6.168  -2.856  2.236   1.00 131.93 ? -40  DG  J C5    1 
ATOM   9692  C  C6    . DG  J  5 34  ? -6.588  -3.832  3.180   1.00 131.78 ? -40  DG  J C6    1 
ATOM   9693  O  O6    . DG  J  5 34  ? -6.834  -3.685  4.384   1.00 131.84 ? -40  DG  J O6    1 
ATOM   9694  N  N1    . DG  J  5 34  ? -6.721  -5.097  2.613   1.00 131.86 ? -40  DG  J N1    1 
ATOM   9695  C  C2    . DG  J  5 34  ? -6.479  -5.388  1.290   1.00 131.92 ? -40  DG  J C2    1 
ATOM   9696  N  N2    . DG  J  5 34  ? -6.665  -6.665  0.925   1.00 131.88 ? -40  DG  J N2    1 
ATOM   9697  N  N3    . DG  J  5 34  ? -6.087  -4.484  0.392   1.00 131.95 ? -40  DG  J N3    1 
ATOM   9698  C  C4    . DG  J  5 34  ? -5.949  -3.240  0.928   1.00 132.00 ? -40  DG  J C4    1 
ATOM   9699  P  P     . DT  J  5 35  ? -6.553  -1.585  -5.135  1.00 133.81 ? -39  DT  J P     1 
ATOM   9700  O  OP1   . DT  J  5 35  ? -6.085  -1.934  -6.500  1.00 133.78 ? -39  DT  J OP1   1 
ATOM   9701  O  OP2   . DT  J  5 35  ? -7.445  -0.417  -4.926  1.00 133.85 ? -39  DT  J OP2   1 
ATOM   9702  O  "O5'" . DT  J  5 35  ? -7.282  -2.842  -4.480  1.00 133.98 ? -39  DT  J "O5'" 1 
ATOM   9703  C  "C5'" . DT  J  5 35  ? -6.825  -4.165  -4.733  1.00 134.44 ? -39  DT  J "C5'" 1 
ATOM   9704  C  "C4'" . DT  J  5 35  ? -7.825  -5.142  -4.146  1.00 134.69 ? -39  DT  J "C4'" 1 
ATOM   9705  O  "O4'" . DT  J  5 35  ? -7.843  -4.979  -2.702  1.00 134.74 ? -39  DT  J "O4'" 1 
ATOM   9706  C  "C3'" . DT  J  5 35  ? -9.263  -4.948  -4.629  1.00 134.94 ? -39  DT  J "C3'" 1 
ATOM   9707  O  "O3'" . DT  J  5 35  ? -9.801  -6.224  -4.946  1.00 135.61 ? -39  DT  J "O3'" 1 
ATOM   9708  C  "C2'" . DT  J  5 35  ? -9.952  -4.299  -3.428  1.00 134.81 ? -39  DT  J "C2'" 1 
ATOM   9709  C  "C1'" . DT  J  5 35  ? -9.189  -4.952  -2.276  1.00 134.41 ? -39  DT  J "C1'" 1 
ATOM   9710  N  N1    . DT  J  5 35  ? -9.304  -4.283  -0.932  1.00 134.16 ? -39  DT  J N1    1 
ATOM   9711  C  C2    . DT  J  5 35  ? -9.567  -5.074  0.173   1.00 134.03 ? -39  DT  J C2    1 
ATOM   9712  O  O2    . DT  J  5 35  ? -9.704  -6.285  0.120   1.00 133.90 ? -39  DT  J O2    1 
ATOM   9713  N  N3    . DT  J  5 35  ? -9.660  -4.387  1.363   1.00 134.06 ? -39  DT  J N3    1 
ATOM   9714  C  C4    . DT  J  5 35  ? -9.523  -3.019  1.557   1.00 134.18 ? -39  DT  J C4    1 
ATOM   9715  O  O4    . DT  J  5 35  ? -9.625  -2.514  2.673   1.00 133.93 ? -39  DT  J O4    1 
ATOM   9716  C  C5    . DT  J  5 35  ? -9.248  -2.248  0.358   1.00 134.18 ? -39  DT  J C5    1 
ATOM   9717  C  C7    . DT  J  5 35  ? -9.076  -0.756  0.424   1.00 134.02 ? -39  DT  J C7    1 
ATOM   9718  C  C6    . DT  J  5 35  ? -9.153  -2.909  -0.811  1.00 134.17 ? -39  DT  J C6    1 
ATOM   9719  P  P     . DG  J  5 36  ? -11.171 -6.438  -5.755  1.00 136.17 ? -38  DG  J P     1 
ATOM   9720  O  OP1   . DG  J  5 36  ? -10.947 -6.006  -7.154  1.00 136.02 ? -38  DG  J OP1   1 
ATOM   9721  O  OP2   . DG  J  5 36  ? -12.300 -5.853  -4.990  1.00 136.03 ? -38  DG  J OP2   1 
ATOM   9722  O  "O5'" . DG  J  5 36  ? -11.325 -8.039  -5.705  1.00 135.88 ? -38  DG  J "O5'" 1 
ATOM   9723  C  "C5'" . DG  J  5 36  ? -10.515 -8.868  -4.840  1.00 135.00 ? -38  DG  J "C5'" 1 
ATOM   9724  C  "C4'" . DG  J  5 36  ? -11.284 -9.437  -3.649  1.00 134.22 ? -38  DG  J "C4'" 1 
ATOM   9725  O  "O4'" . DG  J  5 36  ? -11.218 -8.505  -2.529  1.00 134.11 ? -38  DG  J "O4'" 1 
ATOM   9726  C  "C3'" . DG  J  5 36  ? -12.770 -9.731  -3.892  1.00 133.70 ? -38  DG  J "C3'" 1 
ATOM   9727  O  "O3'" . DG  J  5 36  ? -13.113 -11.055 -3.433  1.00 132.77 ? -38  DG  J "O3'" 1 
ATOM   9728  C  "C2'" . DG  J  5 36  ? -13.477 -8.621  -3.112  1.00 133.78 ? -38  DG  J "C2'" 1 
ATOM   9729  C  "C1'" . DG  J  5 36  ? -12.508 -8.403  -1.952  1.00 133.80 ? -38  DG  J "C1'" 1 
ATOM   9730  N  N9    . DG  J  5 36  ? -12.689 -7.122  -1.262  1.00 133.69 ? -38  DG  J N9    1 
ATOM   9731  C  C8    . DG  J  5 36  ? -12.667 -5.868  -1.827  1.00 133.61 ? -38  DG  J C8    1 
ATOM   9732  N  N7    . DG  J  5 36  ? -12.869 -4.899  -0.979  1.00 133.52 ? -38  DG  J N7    1 
ATOM   9733  C  C5    . DG  J  5 36  ? -13.038 -5.549  0.236   1.00 133.65 ? -38  DG  J C5    1 
ATOM   9734  C  C6    . DG  J  5 36  ? -13.287 -5.013  1.527   1.00 133.72 ? -38  DG  J C6    1 
ATOM   9735  O  O6    . DG  J  5 36  ? -13.408 -3.822  1.847   1.00 133.61 ? -38  DG  J O6    1 
ATOM   9736  N  N1    . DG  J  5 36  ? -13.396 -6.011  2.501   1.00 133.72 ? -38  DG  J N1    1 
ATOM   9737  C  C2    . DG  J  5 36  ? -13.280 -7.361  2.253   1.00 133.52 ? -38  DG  J C2    1 
ATOM   9738  N  N2    . DG  J  5 36  ? -13.411 -8.168  3.312   1.00 133.48 ? -38  DG  J N2    1 
ATOM   9739  N  N3    . DG  J  5 36  ? -13.045 -7.877  1.047   1.00 133.58 ? -38  DG  J N3    1 
ATOM   9740  C  C4    . DG  J  5 36  ? -12.934 -6.919  0.083   1.00 133.68 ? -38  DG  J C4    1 
ATOM   9741  P  P     . DT  J  5 37  ? -14.608 -11.660 -3.524  1.00 132.44 ? -37  DT  J P     1 
ATOM   9742  O  OP1   . DT  J  5 37  ? -14.501 -13.139 -3.579  1.00 132.22 ? -37  DT  J OP1   1 
ATOM   9743  O  OP2   . DT  J  5 37  ? -15.380 -10.946 -4.575  1.00 132.27 ? -37  DT  J OP2   1 
ATOM   9744  O  "O5'" . DT  J  5 37  ? -15.237 -11.243 -2.110  1.00 131.19 ? -37  DT  J "O5'" 1 
ATOM   9745  C  "C5'" . DT  J  5 37  ? -15.087 -12.074 -0.951  1.00 128.87 ? -37  DT  J "C5'" 1 
ATOM   9746  C  "C4'" . DT  J  5 37  ? -16.047 -11.605 0.126   1.00 127.34 ? -37  DT  J "C4'" 1 
ATOM   9747  O  "O4'" . DT  J  5 37  ? -15.825 -10.193 0.388   1.00 127.29 ? -37  DT  J "O4'" 1 
ATOM   9748  C  "C3'" . DT  J  5 37  ? -17.530 -11.733 -0.230  1.00 126.24 ? -37  DT  J "C3'" 1 
ATOM   9749  O  "O3'" . DT  J  5 37  ? -18.240 -12.229 0.890   1.00 124.42 ? -37  DT  J "O3'" 1 
ATOM   9750  C  "C2'" . DT  J  5 37  ? -17.962 -10.304 -0.534  1.00 126.57 ? -37  DT  J "C2'" 1 
ATOM   9751  C  "C1'" . DT  J  5 37  ? -17.099 -9.590  0.502   1.00 127.16 ? -37  DT  J "C1'" 1 
ATOM   9752  N  N1    . DT  J  5 37  ? -17.031 -8.109  0.340   1.00 127.12 ? -37  DT  J N1    1 
ATOM   9753  C  C2    . DT  J  5 37  ? -17.453 -7.320  1.391   1.00 127.16 ? -37  DT  J C2    1 
ATOM   9754  O  O2    . DT  J  5 37  ? -17.863 -7.764  2.446   1.00 127.41 ? -37  DT  J O2    1 
ATOM   9755  N  N3    . DT  J  5 37  ? -17.372 -5.970  1.164   1.00 127.19 ? -37  DT  J N3    1 
ATOM   9756  C  C4    . DT  J  5 37  ? -16.925 -5.349  0.014   1.00 127.24 ? -37  DT  J C4    1 
ATOM   9757  O  O4    . DT  J  5 37  ? -16.902 -4.128  -0.071  1.00 127.45 ? -37  DT  J O4    1 
ATOM   9758  C  C5    . DT  J  5 37  ? -16.500 -6.232  -1.054  1.00 127.24 ? -37  DT  J C5    1 
ATOM   9759  C  C7    . DT  J  5 37  ? -15.997 -5.688  -2.359  1.00 127.22 ? -37  DT  J C7    1 
ATOM   9760  C  C6    . DT  J  5 37  ? -16.573 -7.554  -0.843  1.00 127.15 ? -37  DT  J C6    1 
ATOM   9761  P  P     . DG  J  5 38  ? -19.136 -13.534 0.709   1.00 122.94 ? -36  DG  J P     1 
ATOM   9762  O  OP1   . DG  J  5 38  ? -18.199 -14.624 0.362   1.00 122.64 ? -36  DG  J OP1   1 
ATOM   9763  O  OP2   . DG  J  5 38  ? -20.260 -13.165 -0.181  1.00 122.88 ? -36  DG  J OP2   1 
ATOM   9764  O  "O5'" . DG  J  5 38  ? -19.743 -13.817 2.161   1.00 122.29 ? -36  DG  J "O5'" 1 
ATOM   9765  C  "C5'" . DG  J  5 38  ? -18.957 -13.697 3.349   1.00 120.60 ? -36  DG  J "C5'" 1 
ATOM   9766  C  "C4'" . DG  J  5 38  ? -19.541 -12.653 4.293   1.00 119.06 ? -36  DG  J "C4'" 1 
ATOM   9767  O  "O4'" . DG  J  5 38  ? -19.449 -11.329 3.697   1.00 118.76 ? -36  DG  J "O4'" 1 
ATOM   9768  C  "C3'" . DG  J  5 38  ? -21.009 -12.836 4.673   1.00 117.88 ? -36  DG  J "C3'" 1 
ATOM   9769  O  "O3'" . DG  J  5 38  ? -21.174 -12.500 6.041   1.00 116.42 ? -36  DG  J "O3'" 1 
ATOM   9770  C  "C2'" . DG  J  5 38  ? -21.713 -11.820 3.778   1.00 118.26 ? -36  DG  J "C2'" 1 
ATOM   9771  C  "C1'" . DG  J  5 38  ? -20.700 -10.686 3.828   1.00 118.93 ? -36  DG  J "C1'" 1 
ATOM   9772  N  N9    . DG  J  5 38  ? -20.812 -9.662  2.791   1.00 119.00 ? -36  DG  J N9    1 
ATOM   9773  C  C8    . DG  J  5 38  ? -20.880 -9.837  1.428   1.00 119.26 ? -36  DG  J C8    1 
ATOM   9774  N  N7    . DG  J  5 38  ? -20.962 -8.719  0.756   1.00 119.17 ? -36  DG  J N7    1 
ATOM   9775  C  C5    . DG  J  5 38  ? -20.946 -7.735  1.736   1.00 119.17 ? -36  DG  J C5    1 
ATOM   9776  C  C6    . DG  J  5 38  ? -21.007 -6.319  1.624   1.00 119.31 ? -36  DG  J C6    1 
ATOM   9777  O  O6    . DG  J  5 38  ? -21.099 -5.619  0.602   1.00 119.08 ? -36  DG  J O6    1 
ATOM   9778  N  N1    . DG  J  5 38  ? -20.962 -5.696  2.875   1.00 119.47 ? -36  DG  J N1    1 
ATOM   9779  C  C2    . DG  J  5 38  ? -20.867 -6.352  4.084   1.00 119.23 ? -36  DG  J C2    1 
ATOM   9780  N  N2    . DG  J  5 38  ? -20.835 -5.580  5.181   1.00 119.10 ? -36  DG  J N2    1 
ATOM   9781  N  N3    . DG  J  5 38  ? -20.807 -7.675  4.199   1.00 119.01 ? -36  DG  J N3    1 
ATOM   9782  C  C4    . DG  J  5 38  ? -20.852 -8.301  2.994   1.00 119.00 ? -36  DG  J C4    1 
ATOM   9783  P  P     . DT  J  5 39  ? -22.014 -13.420 7.048   1.00 115.37 ? -35  DT  J P     1 
ATOM   9784  O  OP1   . DT  J  5 39  ? -21.152 -14.565 7.426   1.00 115.44 ? -35  DT  J OP1   1 
ATOM   9785  O  OP2   . DT  J  5 39  ? -23.359 -13.638 6.470   1.00 114.95 ? -35  DT  J OP2   1 
ATOM   9786  O  "O5'" . DT  J  5 39  ? -22.187 -12.494 8.339   1.00 113.95 ? -35  DT  J "O5'" 1 
ATOM   9787  C  "C5'" . DT  J  5 39  ? -21.051 -11.846 8.911   1.00 112.03 ? -35  DT  J "C5'" 1 
ATOM   9788  C  "C4'" . DT  J  5 39  ? -21.380 -10.400 9.209   1.00 110.17 ? -35  DT  J "C4'" 1 
ATOM   9789  O  "O4'" . DT  J  5 39  ? -21.610 -9.709  7.958   1.00 110.09 ? -35  DT  J "O4'" 1 
ATOM   9790  C  "C3'" . DT  J  5 39  ? -22.647 -10.235 10.041  1.00 109.23 ? -35  DT  J "C3'" 1 
ATOM   9791  O  "O3'" . DT  J  5 39  ? -22.409 -9.374  11.145  1.00 107.74 ? -35  DT  J "O3'" 1 
ATOM   9792  C  "C2'" . DT  J  5 39  ? -23.665 -9.653  9.063   1.00 109.74 ? -35  DT  J "C2'" 1 
ATOM   9793  C  "C1'" . DT  J  5 39  ? -22.774 -8.918  8.078   1.00 110.25 ? -35  DT  J "C1'" 1 
ATOM   9794  N  N1    . DT  J  5 39  ? -23.397 -8.676  6.729   1.00 110.43 ? -35  DT  J N1    1 
ATOM   9795  C  C2    . DT  J  5 39  ? -23.547 -7.368  6.306   1.00 110.47 ? -35  DT  J C2    1 
ATOM   9796  O  O2    . DT  J  5 39  ? -23.208 -6.402  6.963   1.00 110.59 ? -35  DT  J O2    1 
ATOM   9797  N  N3    . DT  J  5 39  ? -24.120 -7.220  5.068   1.00 110.71 ? -35  DT  J N3    1 
ATOM   9798  C  C4    . DT  J  5 39  ? -24.550 -8.230  4.223   1.00 110.80 ? -35  DT  J C4    1 
ATOM   9799  O  O4    . DT  J  5 39  ? -25.043 -7.979  3.127   1.00 110.68 ? -35  DT  J O4    1 
ATOM   9800  C  C5    . DT  J  5 39  ? -24.372 -9.583  4.717   1.00 110.77 ? -35  DT  J C5    1 
ATOM   9801  C  C7    . DT  J  5 39  ? -24.812 -10.758 3.887   1.00 110.39 ? -35  DT  J C7    1 
ATOM   9802  C  C6    . DT  J  5 39  ? -23.812 -9.738  5.933   1.00 110.65 ? -35  DT  J C6    1 
ATOM   9803  P  P     . DC  J  5 40  ? -23.441 -9.295  12.367  1.00 106.60 ? -34  DC  J P     1 
ATOM   9804  O  OP1   . DC  J  5 40  ? -22.726 -9.756  13.562  1.00 107.13 ? -34  DC  J OP1   1 
ATOM   9805  O  OP2   . DC  J  5 40  ? -24.717 -9.958  12.034  1.00 106.83 ? -34  DC  J OP2   1 
ATOM   9806  O  "O5'" . DC  J  5 40  ? -23.715 -7.726  12.515  1.00 107.81 ? -34  DC  J "O5'" 1 
ATOM   9807  C  "C5'" . DC  J  5 40  ? -23.378 -6.766  11.493  1.00 108.33 ? -34  DC  J "C5'" 1 
ATOM   9808  C  "C4'" . DC  J  5 40  ? -24.447 -5.689  11.327  1.00 108.87 ? -34  DC  J "C4'" 1 
ATOM   9809  O  "O4'" . DC  J  5 40  ? -24.966 -5.738  9.974   1.00 109.43 ? -34  DC  J "O4'" 1 
ATOM   9810  C  "C3'" . DC  J  5 40  ? -25.689 -5.799  12.211  1.00 109.49 ? -34  DC  J "C3'" 1 
ATOM   9811  O  "O3'" . DC  J  5 40  ? -26.303 -4.531  12.335  1.00 109.78 ? -34  DC  J "O3'" 1 
ATOM   9812  C  "C2'" . DC  J  5 40  ? -26.591 -6.702  11.382  1.00 109.77 ? -34  DC  J "C2'" 1 
ATOM   9813  C  "C1'" . DC  J  5 40  ? -26.342 -6.087  10.004  1.00 109.91 ? -34  DC  J "C1'" 1 
ATOM   9814  N  N1    . DC  J  5 40  ? -26.632 -6.966  8.831   1.00 110.11 ? -34  DC  J N1    1 
ATOM   9815  C  C2    . DC  J  5 40  ? -26.575 -6.416  7.540   1.00 110.13 ? -34  DC  J C2    1 
ATOM   9816  O  O2    . DC  J  5 40  ? -26.295 -5.219  7.394   1.00 109.82 ? -34  DC  J O2    1 
ATOM   9817  N  N3    . DC  J  5 40  ? -26.833 -7.228  6.479   1.00 110.17 ? -34  DC  J N3    1 
ATOM   9818  C  C4    . DC  J  5 40  ? -27.137 -8.517  6.680   1.00 110.03 ? -34  DC  J C4    1 
ATOM   9819  N  N4    . DC  J  5 40  ? -27.386 -9.268  5.608   1.00 110.37 ? -34  DC  J N4    1 
ATOM   9820  C  C5    . DC  J  5 40  ? -27.200 -9.100  7.981   1.00 109.86 ? -34  DC  J C5    1 
ATOM   9821  C  C6    . DC  J  5 40  ? -26.944 -8.291  9.016   1.00 110.08 ? -34  DC  J C6    1 
ATOM   9822  P  P     . DA  J  5 41  ? -26.002 -3.549  13.552  1.00 110.08 ? -33  DA  J P     1 
ATOM   9823  O  OP1   . DA  J  5 41  ? -24.530 -3.446  13.715  1.00 108.92 ? -33  DA  J OP1   1 
ATOM   9824  O  OP2   . DA  J  5 41  ? -26.889 -3.951  14.668  1.00 109.71 ? -33  DA  J OP2   1 
ATOM   9825  O  "O5'" . DA  J  5 41  ? -26.560 -2.153  13.001  1.00 112.33 ? -33  DA  J "O5'" 1 
ATOM   9826  C  "C5'" . DA  J  5 41  ? -26.038 -1.566  11.788  1.00 114.25 ? -33  DA  J "C5'" 1 
ATOM   9827  C  "C4'" . DA  J  5 41  ? -27.029 -0.613  11.124  1.00 115.66 ? -33  DA  J "C4'" 1 
ATOM   9828  O  "O4'" . DA  J  5 41  ? -27.662 -1.263  9.989   1.00 115.84 ? -33  DA  J "O4'" 1 
ATOM   9829  C  "C3'" . DA  J  5 41  ? -28.162 -0.086  12.003  1.00 116.61 ? -33  DA  J "C3'" 1 
ATOM   9830  O  "O3'" . DA  J  5 41  ? -28.380 1.306   11.758  1.00 117.96 ? -33  DA  J "O3'" 1 
ATOM   9831  C  "C2'" . DA  J  5 41  ? -29.370 -0.945  11.620  1.00 116.48 ? -33  DA  J "C2'" 1 
ATOM   9832  C  "C1'" . DA  J  5 41  ? -29.040 -1.481  10.228  1.00 116.52 ? -33  DA  J "C1'" 1 
ATOM   9833  N  N9    . DA  J  5 41  ? -29.273 -2.920  10.123  1.00 116.84 ? -33  DA  J N9    1 
ATOM   9834  C  C8    . DA  J  5 41  ? -29.206 -3.821  11.152  1.00