data_3RFM
# 
_entry.id   3RFM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3RFM         
RCSB  RCSB064870   
WWPDB D_1000064870 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3PWH 'The same protein complexed with ZM241385' unspecified 
PDB 3REY 'The same protein complexed with XAC'      unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3RFM 
_pdbx_database_status.recvd_initial_deposition_date   2011-04-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dore, A.S.'      1  
'Robertson, N.'   2  
'Errey, J.C.'     3  
'Ng, I.'          4  
'Hollenstein, K.' 5  
'Tehan, B.'       6  
'Hurrell, E.'     7  
'Bennett, K.'     8  
'Congreve, M.'    9  
'Magnani, F.'     10 
'Tate, C.G.'      11 
'Weir, M.'        12 
'Marshall, F.H.'  13 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the adenosine A(2A) receptor in complex with ZM241385 and the xanthines XAC and caffeine' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            19 
_citation.page_first                1283 
_citation.page_last                 1293 
_citation.year                      2011 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   21885291 
_citation.pdbx_database_id_DOI      10.1016/j.str.2011.06.014 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dore, A.S.'      1  
primary 'Robertson, N.'   2  
primary 'Errey, J.C.'     3  
primary 'Ng, I.'          4  
primary 'Hollenstein, K.' 5  
primary 'Tehan, B.'       6  
primary 'Hurrell, E.'     7  
primary 'Bennett, K.'     8  
primary 'Congreve, M.'    9  
primary 'Magnani, F.'     10 
primary 'Tate, C.G.'      11 
primary 'Weir, M.'        12 
primary 'Marshall, F.H.'  13 
# 
_cell.entry_id           3RFM 
_cell.length_a           112.327 
_cell.length_b           113.328 
_cell.length_c           129.300 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3RFM 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Adenosine receptor A2a' 36479.102 1 ? 'A54L, T88A, R107A, K122A, L202A, L235A, V239A, S277A' 'residues 1-317' ? 
2 non-polymer syn CAFFEINE                 194.191   1 ? ?                                                      ?                ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAITISTGFCAACHGCLFI
ACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCG
EGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLKQMESQPLPGERARSTLQKEVHAAKSAAIIAG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAAAH
HHHHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLAIPFAITISTGFCAACHGCLFI
ACFVLVLAQSSIFSLLAIAIDRYIAIAIPLRYNGLVTGTRAAGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCG
EGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLKQMESQPLPGERARSTLQKEVHAAKSAAIIAG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLAHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAAAH
HHHHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   ILE n 
1 4   MET n 
1 5   GLY n 
1 6   SER n 
1 7   SER n 
1 8   VAL n 
1 9   TYR n 
1 10  ILE n 
1 11  THR n 
1 12  VAL n 
1 13  GLU n 
1 14  LEU n 
1 15  ALA n 
1 16  ILE n 
1 17  ALA n 
1 18  VAL n 
1 19  LEU n 
1 20  ALA n 
1 21  ILE n 
1 22  LEU n 
1 23  GLY n 
1 24  ASN n 
1 25  VAL n 
1 26  LEU n 
1 27  VAL n 
1 28  CYS n 
1 29  TRP n 
1 30  ALA n 
1 31  VAL n 
1 32  TRP n 
1 33  LEU n 
1 34  ASN n 
1 35  SER n 
1 36  ASN n 
1 37  LEU n 
1 38  GLN n 
1 39  ASN n 
1 40  VAL n 
1 41  THR n 
1 42  ASN n 
1 43  TYR n 
1 44  PHE n 
1 45  VAL n 
1 46  VAL n 
1 47  SER n 
1 48  LEU n 
1 49  ALA n 
1 50  ALA n 
1 51  ALA n 
1 52  ASP n 
1 53  ILE n 
1 54  LEU n 
1 55  VAL n 
1 56  GLY n 
1 57  VAL n 
1 58  LEU n 
1 59  ALA n 
1 60  ILE n 
1 61  PRO n 
1 62  PHE n 
1 63  ALA n 
1 64  ILE n 
1 65  THR n 
1 66  ILE n 
1 67  SER n 
1 68  THR n 
1 69  GLY n 
1 70  PHE n 
1 71  CYS n 
1 72  ALA n 
1 73  ALA n 
1 74  CYS n 
1 75  HIS n 
1 76  GLY n 
1 77  CYS n 
1 78  LEU n 
1 79  PHE n 
1 80  ILE n 
1 81  ALA n 
1 82  CYS n 
1 83  PHE n 
1 84  VAL n 
1 85  LEU n 
1 86  VAL n 
1 87  LEU n 
1 88  ALA n 
1 89  GLN n 
1 90  SER n 
1 91  SER n 
1 92  ILE n 
1 93  PHE n 
1 94  SER n 
1 95  LEU n 
1 96  LEU n 
1 97  ALA n 
1 98  ILE n 
1 99  ALA n 
1 100 ILE n 
1 101 ASP n 
1 102 ARG n 
1 103 TYR n 
1 104 ILE n 
1 105 ALA n 
1 106 ILE n 
1 107 ALA n 
1 108 ILE n 
1 109 PRO n 
1 110 LEU n 
1 111 ARG n 
1 112 TYR n 
1 113 ASN n 
1 114 GLY n 
1 115 LEU n 
1 116 VAL n 
1 117 THR n 
1 118 GLY n 
1 119 THR n 
1 120 ARG n 
1 121 ALA n 
1 122 ALA n 
1 123 GLY n 
1 124 ILE n 
1 125 ILE n 
1 126 ALA n 
1 127 ILE n 
1 128 CYS n 
1 129 TRP n 
1 130 VAL n 
1 131 LEU n 
1 132 SER n 
1 133 PHE n 
1 134 ALA n 
1 135 ILE n 
1 136 GLY n 
1 137 LEU n 
1 138 THR n 
1 139 PRO n 
1 140 MET n 
1 141 LEU n 
1 142 GLY n 
1 143 TRP n 
1 144 ASN n 
1 145 ASN n 
1 146 CYS n 
1 147 GLY n 
1 148 GLN n 
1 149 PRO n 
1 150 LYS n 
1 151 GLU n 
1 152 GLY n 
1 153 LYS n 
1 154 ASN n 
1 155 HIS n 
1 156 SER n 
1 157 GLN n 
1 158 GLY n 
1 159 CYS n 
1 160 GLY n 
1 161 GLU n 
1 162 GLY n 
1 163 GLN n 
1 164 VAL n 
1 165 ALA n 
1 166 CYS n 
1 167 LEU n 
1 168 PHE n 
1 169 GLU n 
1 170 ASP n 
1 171 VAL n 
1 172 VAL n 
1 173 PRO n 
1 174 MET n 
1 175 ASN n 
1 176 TYR n 
1 177 MET n 
1 178 VAL n 
1 179 TYR n 
1 180 PHE n 
1 181 ASN n 
1 182 PHE n 
1 183 PHE n 
1 184 ALA n 
1 185 CYS n 
1 186 VAL n 
1 187 LEU n 
1 188 VAL n 
1 189 PRO n 
1 190 LEU n 
1 191 LEU n 
1 192 LEU n 
1 193 MET n 
1 194 LEU n 
1 195 GLY n 
1 196 VAL n 
1 197 TYR n 
1 198 LEU n 
1 199 ARG n 
1 200 ILE n 
1 201 PHE n 
1 202 ALA n 
1 203 ALA n 
1 204 ALA n 
1 205 ARG n 
1 206 ARG n 
1 207 GLN n 
1 208 LEU n 
1 209 LYS n 
1 210 GLN n 
1 211 MET n 
1 212 GLU n 
1 213 SER n 
1 214 GLN n 
1 215 PRO n 
1 216 LEU n 
1 217 PRO n 
1 218 GLY n 
1 219 GLU n 
1 220 ARG n 
1 221 ALA n 
1 222 ARG n 
1 223 SER n 
1 224 THR n 
1 225 LEU n 
1 226 GLN n 
1 227 LYS n 
1 228 GLU n 
1 229 VAL n 
1 230 HIS n 
1 231 ALA n 
1 232 ALA n 
1 233 LYS n 
1 234 SER n 
1 235 ALA n 
1 236 ALA n 
1 237 ILE n 
1 238 ILE n 
1 239 ALA n 
1 240 GLY n 
1 241 LEU n 
1 242 PHE n 
1 243 ALA n 
1 244 LEU n 
1 245 CYS n 
1 246 TRP n 
1 247 LEU n 
1 248 PRO n 
1 249 LEU n 
1 250 HIS n 
1 251 ILE n 
1 252 ILE n 
1 253 ASN n 
1 254 CYS n 
1 255 PHE n 
1 256 THR n 
1 257 PHE n 
1 258 PHE n 
1 259 CYS n 
1 260 PRO n 
1 261 ASP n 
1 262 CYS n 
1 263 SER n 
1 264 HIS n 
1 265 ALA n 
1 266 PRO n 
1 267 LEU n 
1 268 TRP n 
1 269 LEU n 
1 270 MET n 
1 271 TYR n 
1 272 LEU n 
1 273 ALA n 
1 274 ILE n 
1 275 VAL n 
1 276 LEU n 
1 277 ALA n 
1 278 HIS n 
1 279 THR n 
1 280 ASN n 
1 281 SER n 
1 282 VAL n 
1 283 VAL n 
1 284 ASN n 
1 285 PRO n 
1 286 PHE n 
1 287 ILE n 
1 288 TYR n 
1 289 ALA n 
1 290 TYR n 
1 291 ARG n 
1 292 ILE n 
1 293 ARG n 
1 294 GLU n 
1 295 PHE n 
1 296 ARG n 
1 297 GLN n 
1 298 THR n 
1 299 PHE n 
1 300 ARG n 
1 301 LYS n 
1 302 ILE n 
1 303 ILE n 
1 304 ARG n 
1 305 SER n 
1 306 HIS n 
1 307 VAL n 
1 308 LEU n 
1 309 ARG n 
1 310 GLN n 
1 311 GLN n 
1 312 GLU n 
1 313 PRO n 
1 314 PHE n 
1 315 LYS n 
1 316 ALA n 
1 317 ALA n 
1 318 ALA n 
1 319 ALA n 
1 320 HIS n 
1 321 HIS n 
1 322 HIS n 
1 323 HIS n 
1 324 HIS n 
1 325 HIS n 
1 326 HIS n 
1 327 HIS n 
1 328 HIS n 
1 329 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ADORA2A 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AA2AR_HUMAN 
_struct_ref.pdbx_db_accession          P29274 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFI
ACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCG
EGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3RFM 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 317 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P29274 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  317 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       317 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3RFM LEU A 54  ? UNP P29274 ALA 54  'ENGINEERED MUTATION' 54  1  
1 3RFM ALA A 88  ? UNP P29274 THR 88  'ENGINEERED MUTATION' 88  2  
1 3RFM ALA A 107 ? UNP P29274 ARG 107 'ENGINEERED MUTATION' 107 3  
1 3RFM ALA A 122 ? UNP P29274 LYS 122 'ENGINEERED MUTATION' 122 4  
1 3RFM ALA A 202 ? UNP P29274 LEU 202 'ENGINEERED MUTATION' 202 5  
1 3RFM ALA A 235 ? UNP P29274 LEU 235 'ENGINEERED MUTATION' 235 6  
1 3RFM ALA A 239 ? UNP P29274 VAL 239 'ENGINEERED MUTATION' 239 7  
1 3RFM ALA A 277 ? UNP P29274 SER 277 'ENGINEERED MUTATION' 277 8  
1 3RFM ALA A 318 ? UNP P29274 ?   ?   'EXPRESSION TAG'      318 9  
1 3RFM ALA A 319 ? UNP P29274 ?   ?   'EXPRESSION TAG'      319 10 
1 3RFM HIS A 320 ? UNP P29274 ?   ?   'EXPRESSION TAG'      320 11 
1 3RFM HIS A 321 ? UNP P29274 ?   ?   'EXPRESSION TAG'      321 12 
1 3RFM HIS A 322 ? UNP P29274 ?   ?   'EXPRESSION TAG'      322 13 
1 3RFM HIS A 323 ? UNP P29274 ?   ?   'EXPRESSION TAG'      323 14 
1 3RFM HIS A 324 ? UNP P29274 ?   ?   'EXPRESSION TAG'      324 15 
1 3RFM HIS A 325 ? UNP P29274 ?   ?   'EXPRESSION TAG'      325 16 
1 3RFM HIS A 326 ? UNP P29274 ?   ?   'EXPRESSION TAG'      326 17 
1 3RFM HIS A 327 ? UNP P29274 ?   ?   'EXPRESSION TAG'      327 18 
1 3RFM HIS A 328 ? UNP P29274 ?   ?   'EXPRESSION TAG'      328 19 
1 3RFM HIS A 329 ? UNP P29274 ?   ?   'EXPRESSION TAG'      329 20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                                               'C4 H7 N O4'     133.103 
CFF non-polymer         . CAFFEINE        3,7-DIHYDRO-1,3,7-TRIMETHYL-1H-PURINE-2,6-DIONE 'C8 H10 N4 O2'   194.191 
CYS 'L-peptide linking' y CYSTEINE        ?                                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                                               'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?                                               'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ?                                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                                               'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3RFM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      5.64 
_exptl_crystal.density_percent_sol   78.19 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.2 
_exptl_crystal_grow.pdbx_details    
;32-42% PEG1000, 0.25M MGCL2, 0.3% NG, 0.1%(W/V) 1-BUTANOL, 0.05% CYMAL-6, 0.1M TRIS-HCL,, pH 8.2, VAPOR DIFFUSION, SITTING DROP, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           200 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2010-05-06 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'ACCEL FIXED EXIT DOUBLE CRYSTAL SI (111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9777 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I24' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I24 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9777 
# 
_reflns.entry_id                     3RFM 
_reflns.observed_criterion_sigma_I   1.5 
_reflns.observed_criterion_sigma_F   1.5 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            3.59 
_reflns.number_obs                   8939 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         91.9 
_reflns.pdbx_Rmerge_I_obs            0.139 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        6.8 
_reflns.B_iso_Wilson_estimate        108.360 
_reflns.pdbx_redundancy              6.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high                  3.6 
_reflns_shell.d_res_low                   3.79 
_reflns_shell.percent_possible_all        93.5 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.pdbx_redundancy             6.8 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.number_unique_all           1328 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.number_possible             ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
# 
_refine.entry_id                                 3RFM 
_refine.ls_number_reflns_obs                     8775 
_refine.ls_number_reflns_all                     8939 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             19.971 
_refine.ls_d_res_high                            3.598 
_refine.ls_percent_reflns_obs                    89.25 
_refine.ls_R_factor_obs                          0.2975 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2969 
_refine.ls_R_factor_R_free                       0.3106 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.81 
_refine.ls_number_reflns_R_free                  422 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               148.8877 
_refine.aniso_B[1][1]                            -81.7557 
_refine.aniso_B[2][2]                            7.2617 
_refine.aniso_B[3][3]                            74.4940 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.218 
_refine.solvent_model_param_bsol                 71.443 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      3PWH 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.39 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_max                                353.130 
_refine.B_iso_min                                78.920 
_refine.pdbx_overall_phase_error                 42.9600 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2250 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         14 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               2264 
_refine_hist.d_res_high                       3.598 
_refine_hist.d_res_low                        19.971 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' f_bond_d           2325 0.002  ? ? ? 
'X-RAY DIFFRACTION' f_angle_d          3171 0.389  ? ? ? 
'X-RAY DIFFRACTION' f_chiral_restr     377  0.027  ? ? ? 
'X-RAY DIFFRACTION' f_plane_restr      388  0.002  ? ? ? 
'X-RAY DIFFRACTION' f_dihedral_angle_d 781  10.516 ? ? ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.redundancy_reflns_obs 
3.5980 4.1146  3 89.0000 2747 . 0.4149 0.4433 . 145 . 2892 . 'X-RAY DIFFRACTION' . 
4.1146 5.1691  3 90.0000 2777 . 0.2609 0.2582 . 138 . 2915 . 'X-RAY DIFFRACTION' . 
5.1691 19.9717 3 88.0000 2829 . 0.2742 0.2939 . 139 . 2968 . 'X-RAY DIFFRACTION' . 
# 
_struct.entry_id                  3RFM 
_struct.title                     'Thermostabilised adenosine A2A receptor in complex with caffeine' 
_struct.pdbx_descriptor           'Adenosine receptor A2a' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3RFM 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'INVERSE AGONIST, 7TM, GPCR, SIGNALING PROTEIN, G-PROTEIN, MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 7   ? ASN A 34  ? SER A 7   ASN A 34  1 ? 28 
HELX_P HELX_P2  2  SER A 35  ? GLN A 38  ? SER A 35  GLN A 38  5 ? 4  
HELX_P HELX_P3  3  ASN A 39  ? VAL A 40  ? ASN A 39  VAL A 40  5 ? 2  
HELX_P HELX_P4  4  THR A 41  ? LEU A 58  ? THR A 41  LEU A 58  1 ? 18 
HELX_P HELX_P5  5  LEU A 58  ? GLY A 69  ? LEU A 58  GLY A 69  1 ? 12 
HELX_P HELX_P6  6  ALA A 73  ? ILE A 108 ? ALA A 73  ILE A 108 1 ? 36 
HELX_P HELX_P7  7  ILE A 108 ? VAL A 116 ? ILE A 108 VAL A 116 1 ? 9  
HELX_P HELX_P8  8  THR A 117 ? LEU A 137 ? THR A 117 LEU A 137 1 ? 21 
HELX_P HELX_P9  9  THR A 138 ? GLY A 142 ? THR A 138 GLY A 142 5 ? 5  
HELX_P HELX_P10 10 LEU A 167 ? VAL A 172 ? LEU A 167 VAL A 172 1 ? 6  
HELX_P HELX_P11 11 PRO A 173 ? TYR A 179 ? PRO A 173 TYR A 179 1 ? 7  
HELX_P HELX_P12 12 ASN A 181 ? VAL A 186 ? ASN A 181 VAL A 186 1 ? 6  
HELX_P HELX_P13 13 VAL A 186 ? MET A 211 ? VAL A 186 MET A 211 1 ? 26 
HELX_P HELX_P14 14 GLU A 212 ? GLN A 214 ? GLU A 212 GLN A 214 5 ? 3  
HELX_P HELX_P15 15 GLY A 218 ? CYS A 259 ? GLY A 218 CYS A 259 1 ? 42 
HELX_P HELX_P16 16 PRO A 266 ? ILE A 292 ? PRO A 266 ILE A 292 1 ? 27 
HELX_P HELX_P17 17 ILE A 292 ? SER A 305 ? ILE A 292 SER A 305 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 71  SG ? ? ? 1_555 A CYS 159 SG ? ? A CYS 71  A CYS 159 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf2 disulf ? ? A CYS 74  SG ? ? ? 1_555 A CYS 146 SG ? ? A CYS 74  A CYS 146 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf3 disulf ? ? A CYS 77  SG ? ? ? 1_555 A CYS 166 SG ? ? A CYS 77  A CYS 166 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf4 disulf ? ? A CYS 259 SG ? ? ? 1_555 A CYS 262 SG ? ? A CYS 259 A CYS 262 1_555 ? ? ? ? ? ? ? 2.031 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 70  ? ALA A 72  ? PHE A 70  ALA A 72  
A 2 VAL A 164 ? CYS A 166 ? VAL A 164 CYS A 166 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ALA 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    72 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ALA 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     72 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   VAL 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    164 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    VAL 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     164 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    6 
_struct_site.details              'BINDING SITE FOR RESIDUE CFF A 330' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 6 PHE A 168 ? PHE A 168 . ? 1_555 ? 
2 AC1 6 MET A 177 ? MET A 177 . ? 1_555 ? 
3 AC1 6 LEU A 249 ? LEU A 249 . ? 1_555 ? 
4 AC1 6 ASN A 253 ? ASN A 253 . ? 1_555 ? 
5 AC1 6 MET A 270 ? MET A 270 . ? 1_555 ? 
6 AC1 6 ILE A 274 ? ILE A 274 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3RFM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3RFM 
_atom_sites.fract_transf_matrix[1][1]   0.008903 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008824 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007734 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 7   ? 6.159   -34.006 -51.651 1.00 173.70 ? 7   SER A N   1 
ATOM   2    C CA  . SER A 1 7   ? 7.411   -34.717 -51.420 1.00 167.91 ? 7   SER A CA  1 
ATOM   3    C C   . SER A 1 7   ? 8.576   -33.748 -51.253 1.00 160.56 ? 7   SER A C   1 
ATOM   4    O O   . SER A 1 7   ? 9.732   -34.120 -51.446 1.00 158.67 ? 7   SER A O   1 
ATOM   5    C CB  . SER A 1 7   ? 7.696   -35.690 -52.566 1.00 169.28 ? 7   SER A CB  1 
ATOM   6    O OG  . SER A 1 7   ? 6.695   -36.690 -52.648 1.00 172.73 ? 7   SER A OG  1 
ATOM   7    N N   . VAL A 1 8   ? 8.265   -32.506 -50.893 1.00 157.19 ? 8   VAL A N   1 
ATOM   8    C CA  . VAL A 1 8   ? 9.290   -31.489 -50.680 1.00 151.82 ? 8   VAL A CA  1 
ATOM   9    C C   . VAL A 1 8   ? 9.910   -31.630 -49.294 1.00 150.82 ? 8   VAL A C   1 
ATOM   10   O O   . VAL A 1 8   ? 11.132  -31.650 -49.150 1.00 148.50 ? 8   VAL A O   1 
ATOM   11   C CB  . VAL A 1 8   ? 8.720   -30.068 -50.840 1.00 145.24 ? 8   VAL A CB  1 
ATOM   12   C CG1 . VAL A 1 8   ? 9.794   -29.031 -50.552 1.00 136.41 ? 8   VAL A CG1 1 
ATOM   13   C CG2 . VAL A 1 8   ? 8.149   -29.883 -52.238 1.00 148.00 ? 8   VAL A CG2 1 
ATOM   14   N N   . TYR A 1 9   ? 9.056   -31.725 -48.278 1.00 151.15 ? 9   TYR A N   1 
ATOM   15   C CA  . TYR A 1 9   ? 9.508   -31.947 -46.909 1.00 149.91 ? 9   TYR A CA  1 
ATOM   16   C C   . TYR A 1 9   ? 10.413  -33.169 -46.848 1.00 154.47 ? 9   TYR A C   1 
ATOM   17   O O   . TYR A 1 9   ? 11.458  -33.153 -46.195 1.00 156.43 ? 9   TYR A O   1 
ATOM   18   C CB  . TYR A 1 9   ? 8.310   -32.138 -45.979 1.00 148.92 ? 9   TYR A CB  1 
ATOM   19   C CG  . TYR A 1 9   ? 8.679   -32.569 -44.577 1.00 144.59 ? 9   TYR A CG  1 
ATOM   20   C CD1 . TYR A 1 9   ? 9.042   -31.636 -43.615 1.00 142.24 ? 9   TYR A CD1 1 
ATOM   21   C CD2 . TYR A 1 9   ? 8.656   -33.909 -44.214 1.00 141.93 ? 9   TYR A CD2 1 
ATOM   22   C CE1 . TYR A 1 9   ? 9.377   -32.026 -42.332 1.00 142.43 ? 9   TYR A CE1 1 
ATOM   23   C CE2 . TYR A 1 9   ? 8.988   -34.309 -42.932 1.00 139.75 ? 9   TYR A CE2 1 
ATOM   24   C CZ  . TYR A 1 9   ? 9.348   -33.363 -41.995 1.00 142.63 ? 9   TYR A CZ  1 
ATOM   25   O OH  . TYR A 1 9   ? 9.681   -33.753 -40.717 1.00 144.26 ? 9   TYR A OH  1 
ATOM   26   N N   . ILE A 1 10  ? 10.002  -34.228 -47.536 1.00 156.61 ? 10  ILE A N   1 
ATOM   27   C CA  . ILE A 1 10  ? 10.781  -35.456 -47.597 1.00 156.24 ? 10  ILE A CA  1 
ATOM   28   C C   . ILE A 1 10  ? 12.152  -35.192 -48.207 1.00 149.52 ? 10  ILE A C   1 
ATOM   29   O O   . ILE A 1 10  ? 13.175  -35.623 -47.676 1.00 142.61 ? 10  ILE A O   1 
ATOM   30   C CB  . ILE A 1 10  ? 10.063  -36.532 -48.431 1.00 161.19 ? 10  ILE A CB  1 
ATOM   31   C CG1 . ILE A 1 10  ? 8.636   -36.741 -47.919 1.00 163.62 ? 10  ILE A CG1 1 
ATOM   32   C CG2 . ILE A 1 10  ? 10.848  -37.837 -48.407 1.00 161.26 ? 10  ILE A CG2 1 
ATOM   33   C CD1 . ILE A 1 10  ? 7.834   -37.733 -48.732 1.00 166.05 ? 10  ILE A CD1 1 
ATOM   34   N N   . THR A 1 11  ? 12.162  -34.476 -49.327 1.00 147.83 ? 11  THR A N   1 
ATOM   35   C CA  . THR A 1 11  ? 13.403  -34.156 -50.022 1.00 140.47 ? 11  THR A CA  1 
ATOM   36   C C   . THR A 1 11  ? 14.377  -33.410 -49.114 1.00 132.13 ? 11  THR A C   1 
ATOM   37   O O   . THR A 1 11  ? 15.554  -33.762 -49.029 1.00 134.91 ? 11  THR A O   1 
ATOM   38   C CB  . THR A 1 11  ? 13.141  -33.316 -51.288 1.00 139.69 ? 11  THR A CB  1 
ATOM   39   O OG1 . THR A 1 11  ? 12.335  -34.068 -52.202 1.00 140.35 ? 11  THR A OG1 1 
ATOM   40   C CG2 . THR A 1 11  ? 14.452  -32.947 -51.965 1.00 140.83 ? 11  THR A CG2 1 
ATOM   41   N N   . VAL A 1 12  ? 13.881  -32.381 -48.434 1.00 119.14 ? 12  VAL A N   1 
ATOM   42   C CA  . VAL A 1 12  ? 14.713  -31.582 -47.542 1.00 107.31 ? 12  VAL A CA  1 
ATOM   43   C C   . VAL A 1 12  ? 15.232  -32.406 -46.368 1.00 110.40 ? 12  VAL A C   1 
ATOM   44   O O   . VAL A 1 12  ? 16.387  -32.265 -45.965 1.00 112.51 ? 12  VAL A O   1 
ATOM   45   C CB  . VAL A 1 12  ? 13.955  -30.352 -47.009 1.00 92.97  ? 12  VAL A CB  1 
ATOM   46   C CG1 . VAL A 1 12  ? 14.767  -29.652 -45.930 1.00 81.16  ? 12  VAL A CG1 1 
ATOM   47   C CG2 . VAL A 1 12  ? 13.636  -29.397 -48.148 1.00 89.40  ? 12  VAL A CG2 1 
ATOM   48   N N   . GLU A 1 13  ? 14.378  -33.265 -45.822 1.00 114.94 ? 13  GLU A N   1 
ATOM   49   C CA  . GLU A 1 13  ? 14.773  -34.127 -44.713 1.00 125.71 ? 13  GLU A CA  1 
ATOM   50   C C   . GLU A 1 13  ? 15.880  -35.093 -45.121 1.00 127.84 ? 13  GLU A C   1 
ATOM   51   O O   . GLU A 1 13  ? 16.773  -35.399 -44.330 1.00 122.27 ? 13  GLU A O   1 
ATOM   52   C CB  . GLU A 1 13  ? 13.569  -34.895 -44.170 1.00 131.35 ? 13  GLU A CB  1 
ATOM   53   C CG  . GLU A 1 13  ? 12.656  -34.059 -43.294 1.00 139.19 ? 13  GLU A CG  1 
ATOM   54   C CD  . GLU A 1 13  ? 13.364  -33.534 -42.060 1.00 145.57 ? 13  GLU A CD  1 
ATOM   55   O OE1 . GLU A 1 13  ? 14.400  -34.116 -41.672 1.00 147.93 ? 13  GLU A OE1 1 
ATOM   56   O OE2 . GLU A 1 13  ? 12.884  -32.542 -41.472 1.00 148.44 ? 13  GLU A OE2 1 
ATOM   57   N N   . LEU A 1 14  ? 15.815  -35.572 -46.358 1.00 130.65 ? 14  LEU A N   1 
ATOM   58   C CA  . LEU A 1 14  ? 16.850  -36.449 -46.889 1.00 130.90 ? 14  LEU A CA  1 
ATOM   59   C C   . LEU A 1 14  ? 18.137  -35.671 -47.130 1.00 125.06 ? 14  LEU A C   1 
ATOM   60   O O   . LEU A 1 14  ? 19.233  -36.170 -46.875 1.00 128.59 ? 14  LEU A O   1 
ATOM   61   C CB  . LEU A 1 14  ? 16.383  -37.118 -48.184 1.00 140.02 ? 14  LEU A CB  1 
ATOM   62   C CG  . LEU A 1 14  ? 15.620  -38.437 -48.039 1.00 148.44 ? 14  LEU A CG  1 
ATOM   63   C CD1 . LEU A 1 14  ? 14.510  -38.324 -47.007 1.00 151.00 ? 14  LEU A CD1 1 
ATOM   64   C CD2 . LEU A 1 14  ? 15.065  -38.887 -49.383 1.00 154.12 ? 14  LEU A CD2 1 
ATOM   65   N N   . ALA A 1 15  ? 17.997  -34.444 -47.622 1.00 116.38 ? 15  ALA A N   1 
ATOM   66   C CA  . ALA A 1 15  ? 19.147  -33.583 -47.873 1.00 110.10 ? 15  ALA A CA  1 
ATOM   67   C C   . ALA A 1 15  ? 19.958  -33.383 -46.597 1.00 116.10 ? 15  ALA A C   1 
ATOM   68   O O   . ALA A 1 15  ? 21.187  -33.464 -46.612 1.00 121.52 ? 15  ALA A O   1 
ATOM   69   C CB  . ALA A 1 15  ? 18.698  -32.244 -48.433 1.00 100.75 ? 15  ALA A CB  1 
ATOM   70   N N   . ILE A 1 16  ? 19.261  -33.127 -45.494 1.00 116.69 ? 16  ILE A N   1 
ATOM   71   C CA  . ILE A 1 16  ? 19.911  -32.941 -44.202 1.00 120.69 ? 16  ILE A CA  1 
ATOM   72   C C   . ILE A 1 16  ? 20.579  -34.226 -43.723 1.00 129.26 ? 16  ILE A C   1 
ATOM   73   O O   . ILE A 1 16  ? 21.723  -34.207 -43.266 1.00 131.46 ? 16  ILE A O   1 
ATOM   74   C CB  . ILE A 1 16  ? 18.912  -32.467 -43.132 1.00 118.58 ? 16  ILE A CB  1 
ATOM   75   C CG1 . ILE A 1 16  ? 18.409  -31.061 -43.459 1.00 121.75 ? 16  ILE A CG1 1 
ATOM   76   C CG2 . ILE A 1 16  ? 19.555  -32.485 -41.754 1.00 116.24 ? 16  ILE A CG2 1 
ATOM   77   C CD1 . ILE A 1 16  ? 17.482  -30.488 -42.412 1.00 125.04 ? 16  ILE A CD1 1 
ATOM   78   N N   . ALA A 1 17  ? 19.860  -35.340 -43.829 1.00 133.13 ? 17  ALA A N   1 
ATOM   79   C CA  . ALA A 1 17  ? 20.381  -36.630 -43.393 1.00 136.45 ? 17  ALA A CA  1 
ATOM   80   C C   . ALA A 1 17  ? 21.747  -36.917 -44.008 1.00 136.47 ? 17  ALA A C   1 
ATOM   81   O O   . ALA A 1 17  ? 22.643  -37.428 -43.336 1.00 137.56 ? 17  ALA A O   1 
ATOM   82   C CB  . ALA A 1 17  ? 19.399  -37.742 -43.729 1.00 138.35 ? 17  ALA A CB  1 
ATOM   83   N N   . VAL A 1 18  ? 21.902  -36.584 -45.285 1.00 133.07 ? 18  VAL A N   1 
ATOM   84   C CA  . VAL A 1 18  ? 23.168  -36.787 -45.980 1.00 128.65 ? 18  VAL A CA  1 
ATOM   85   C C   . VAL A 1 18  ? 24.285  -35.958 -45.353 1.00 122.68 ? 18  VAL A C   1 
ATOM   86   O O   . VAL A 1 18  ? 25.352  -36.483 -45.025 1.00 118.63 ? 18  VAL A O   1 
ATOM   87   C CB  . VAL A 1 18  ? 23.060  -36.424 -47.472 1.00 128.38 ? 18  VAL A CB  1 
ATOM   88   C CG1 . VAL A 1 18  ? 24.411  -36.588 -48.154 1.00 135.34 ? 18  VAL A CG1 1 
ATOM   89   C CG2 . VAL A 1 18  ? 22.007  -37.282 -48.153 1.00 124.62 ? 18  VAL A CG2 1 
ATOM   90   N N   . LEU A 1 19  ? 24.034  -34.663 -45.193 1.00 116.83 ? 19  LEU A N   1 
ATOM   91   C CA  . LEU A 1 19  ? 25.022  -33.755 -44.620 1.00 111.68 ? 19  LEU A CA  1 
ATOM   92   C C   . LEU A 1 19  ? 25.363  -34.134 -43.184 1.00 120.45 ? 19  LEU A C   1 
ATOM   93   O O   . LEU A 1 19  ? 26.534  -34.184 -42.807 1.00 122.22 ? 19  LEU A O   1 
ATOM   94   C CB  . LEU A 1 19  ? 24.523  -32.309 -44.678 1.00 97.38  ? 19  LEU A CB  1 
ATOM   95   C CG  . LEU A 1 19  ? 24.659  -31.567 -46.010 1.00 87.80  ? 19  LEU A CG  1 
ATOM   96   C CD1 . LEU A 1 19  ? 23.998  -32.332 -47.147 1.00 79.69  ? 19  LEU A CD1 1 
ATOM   97   C CD2 . LEU A 1 19  ? 24.085  -30.164 -45.896 1.00 85.62  ? 19  LEU A CD2 1 
ATOM   98   N N   . ALA A 1 20  ? 24.332  -34.398 -42.388 1.00 126.84 ? 20  ALA A N   1 
ATOM   99   C CA  . ALA A 1 20  ? 24.513  -34.779 -40.992 1.00 131.85 ? 20  ALA A CA  1 
ATOM   100  C C   . ALA A 1 20  ? 25.474  -35.955 -40.867 1.00 127.21 ? 20  ALA A C   1 
ATOM   101  O O   . ALA A 1 20  ? 26.329  -35.979 -39.980 1.00 122.07 ? 20  ALA A O   1 
ATOM   102  C CB  . ALA A 1 20  ? 23.174  -35.116 -40.357 1.00 137.98 ? 20  ALA A CB  1 
ATOM   103  N N   . ILE A 1 21  ? 25.330  -36.928 -41.761 1.00 128.31 ? 21  ILE A N   1 
ATOM   104  C CA  . ILE A 1 21  ? 26.211  -38.087 -41.773 1.00 131.69 ? 21  ILE A CA  1 
ATOM   105  C C   . ILE A 1 21  ? 27.606  -37.700 -42.247 1.00 134.55 ? 21  ILE A C   1 
ATOM   106  O O   . ILE A 1 21  ? 28.569  -37.781 -41.488 1.00 138.23 ? 21  ILE A O   1 
ATOM   107  C CB  . ILE A 1 21  ? 25.660  -39.209 -42.670 1.00 131.84 ? 21  ILE A CB  1 
ATOM   108  C CG1 . ILE A 1 21  ? 24.320  -39.714 -42.132 1.00 127.89 ? 21  ILE A CG1 1 
ATOM   109  C CG2 . ILE A 1 21  ? 26.659  -40.352 -42.765 1.00 132.24 ? 21  ILE A CG2 1 
ATOM   110  C CD1 . ILE A 1 21  ? 23.698  -40.810 -42.972 1.00 126.56 ? 21  ILE A CD1 1 
ATOM   111  N N   . LEU A 1 22  ? 27.705  -37.269 -43.501 1.00 131.26 ? 22  LEU A N   1 
ATOM   112  C CA  . LEU A 1 22  ? 28.988  -36.902 -44.094 1.00 125.89 ? 22  LEU A CA  1 
ATOM   113  C C   . LEU A 1 22  ? 29.803  -35.981 -43.190 1.00 119.24 ? 22  LEU A C   1 
ATOM   114  O O   . LEU A 1 22  ? 30.995  -36.200 -42.983 1.00 114.61 ? 22  LEU A O   1 
ATOM   115  C CB  . LEU A 1 22  ? 28.777  -36.238 -45.457 1.00 121.81 ? 22  LEU A CB  1 
ATOM   116  C CG  . LEU A 1 22  ? 28.067  -37.065 -46.531 1.00 115.50 ? 22  LEU A CG  1 
ATOM   117  C CD1 . LEU A 1 22  ? 27.938  -36.267 -47.818 1.00 112.78 ? 22  LEU A CD1 1 
ATOM   118  C CD2 . LEU A 1 22  ? 28.806  -38.372 -46.782 1.00 113.66 ? 22  LEU A CD2 1 
ATOM   119  N N   . GLY A 1 23  ? 29.152  -34.953 -42.656 1.00 118.77 ? 23  GLY A N   1 
ATOM   120  C CA  . GLY A 1 23  ? 29.817  -33.975 -41.815 1.00 116.68 ? 23  GLY A CA  1 
ATOM   121  C C   . GLY A 1 23  ? 30.421  -34.563 -40.555 1.00 117.89 ? 23  GLY A C   1 
ATOM   122  O O   . GLY A 1 23  ? 31.639  -34.555 -40.382 1.00 120.71 ? 23  GLY A O   1 
ATOM   123  N N   . ASN A 1 24  ? 29.569  -35.072 -39.671 1.00 121.17 ? 24  ASN A N   1 
ATOM   124  C CA  . ASN A 1 24  ? 30.025  -35.628 -38.401 1.00 125.28 ? 24  ASN A CA  1 
ATOM   125  C C   . ASN A 1 24  ? 30.939  -36.840 -38.563 1.00 126.14 ? 24  ASN A C   1 
ATOM   126  O O   . ASN A 1 24  ? 31.843  -37.054 -37.758 1.00 127.36 ? 24  ASN A O   1 
ATOM   127  C CB  . ASN A 1 24  ? 28.835  -35.974 -37.505 1.00 127.40 ? 24  ASN A CB  1 
ATOM   128  C CG  . ASN A 1 24  ? 28.144  -34.743 -36.955 1.00 133.56 ? 24  ASN A CG  1 
ATOM   129  O OD1 . ASN A 1 24  ? 28.776  -33.889 -36.332 1.00 130.31 ? 24  ASN A OD1 1 
ATOM   130  N ND2 . ASN A 1 24  ? 26.838  -34.647 -37.178 1.00 140.40 ? 24  ASN A ND2 1 
ATOM   131  N N   . VAL A 1 25  ? 30.698  -37.633 -39.602 1.00 124.96 ? 25  VAL A N   1 
ATOM   132  C CA  . VAL A 1 25  ? 31.566  -38.766 -39.907 1.00 125.17 ? 25  VAL A CA  1 
ATOM   133  C C   . VAL A 1 25  ? 32.949  -38.263 -40.300 1.00 126.72 ? 25  VAL A C   1 
ATOM   134  O O   . VAL A 1 25  ? 33.967  -38.841 -39.919 1.00 127.60 ? 25  VAL A O   1 
ATOM   135  C CB  . VAL A 1 25  ? 30.995  -39.636 -41.042 1.00 127.71 ? 25  VAL A CB  1 
ATOM   136  C CG1 . VAL A 1 25  ? 32.053  -40.596 -41.563 1.00 123.80 ? 25  VAL A CG1 1 
ATOM   137  C CG2 . VAL A 1 25  ? 29.767  -40.394 -40.561 1.00 135.59 ? 25  VAL A CG2 1 
ATOM   138  N N   . LEU A 1 26  ? 32.975  -37.175 -41.063 1.00 124.53 ? 26  LEU A N   1 
ATOM   139  C CA  . LEU A 1 26  ? 34.227  -36.545 -41.460 1.00 115.55 ? 26  LEU A CA  1 
ATOM   140  C C   . LEU A 1 26  ? 34.979  -36.050 -40.231 1.00 118.41 ? 26  LEU A C   1 
ATOM   141  O O   . LEU A 1 26  ? 36.208  -36.089 -40.185 1.00 125.64 ? 26  LEU A O   1 
ATOM   142  C CB  . LEU A 1 26  ? 33.957  -35.384 -42.417 1.00 108.42 ? 26  LEU A CB  1 
ATOM   143  C CG  . LEU A 1 26  ? 35.181  -34.685 -43.005 1.00 110.79 ? 26  LEU A CG  1 
ATOM   144  C CD1 . LEU A 1 26  ? 36.027  -35.668 -43.799 1.00 122.38 ? 26  LEU A CD1 1 
ATOM   145  C CD2 . LEU A 1 26  ? 34.762  -33.512 -43.876 1.00 105.34 ? 26  LEU A CD2 1 
ATOM   146  N N   . VAL A 1 27  ? 34.231  -35.586 -39.235 1.00 120.24 ? 27  VAL A N   1 
ATOM   147  C CA  . VAL A 1 27  ? 34.819  -35.101 -37.992 1.00 126.63 ? 27  VAL A CA  1 
ATOM   148  C C   . VAL A 1 27  ? 35.469  -36.235 -37.204 1.00 128.66 ? 27  VAL A C   1 
ATOM   149  O O   . VAL A 1 27  ? 36.592  -36.102 -36.719 1.00 125.02 ? 27  VAL A O   1 
ATOM   150  C CB  . VAL A 1 27  ? 33.770  -34.402 -37.106 1.00 128.99 ? 27  VAL A CB  1 
ATOM   151  C CG1 . VAL A 1 27  ? 34.365  -34.046 -35.751 1.00 128.99 ? 27  VAL A CG1 1 
ATOM   152  C CG2 . VAL A 1 27  ? 33.229  -33.162 -37.801 1.00 130.62 ? 27  VAL A CG2 1 
ATOM   153  N N   . CYS A 1 28  ? 34.757  -37.351 -37.081 1.00 135.29 ? 28  CYS A N   1 
ATOM   154  C CA  . CYS A 1 28  ? 35.267  -38.507 -36.352 1.00 140.71 ? 28  CYS A CA  1 
ATOM   155  C C   . CYS A 1 28  ? 36.508  -39.084 -37.027 1.00 140.42 ? 28  CYS A C   1 
ATOM   156  O O   . CYS A 1 28  ? 37.442  -39.528 -36.359 1.00 138.32 ? 28  CYS A O   1 
ATOM   157  C CB  . CYS A 1 28  ? 34.186  -39.582 -36.225 1.00 144.65 ? 28  CYS A CB  1 
ATOM   158  S SG  . CYS A 1 28  ? 32.728  -39.069 -35.290 1.00 125.20 ? 28  CYS A SG  1 
ATOM   159  N N   . TRP A 1 29  ? 36.508  -39.073 -38.355 1.00 143.82 ? 29  TRP A N   1 
ATOM   160  C CA  . TRP A 1 29  ? 37.635  -39.574 -39.130 1.00 149.69 ? 29  TRP A CA  1 
ATOM   161  C C   . TRP A 1 29  ? 38.843  -38.658 -38.964 1.00 150.77 ? 29  TRP A C   1 
ATOM   162  O O   . TRP A 1 29  ? 39.973  -39.120 -38.805 1.00 152.69 ? 29  TRP A O   1 
ATOM   163  C CB  . TRP A 1 29  ? 37.252  -39.679 -40.606 1.00 154.66 ? 29  TRP A CB  1 
ATOM   164  C CG  . TRP A 1 29  ? 38.282  -40.356 -41.457 1.00 163.99 ? 29  TRP A CG  1 
ATOM   165  C CD1 . TRP A 1 29  ? 39.480  -40.868 -41.048 1.00 170.36 ? 29  TRP A CD1 1 
ATOM   166  C CD2 . TRP A 1 29  ? 38.203  -40.601 -42.866 1.00 169.09 ? 29  TRP A CD2 1 
ATOM   167  N NE1 . TRP A 1 29  ? 40.152  -41.413 -42.115 1.00 174.50 ? 29  TRP A NE1 1 
ATOM   168  C CE2 . TRP A 1 29  ? 39.389  -41.261 -43.243 1.00 174.41 ? 29  TRP A CE2 1 
ATOM   169  C CE3 . TRP A 1 29  ? 37.243  -40.324 -43.844 1.00 169.34 ? 29  TRP A CE3 1 
ATOM   170  C CZ2 . TRP A 1 29  ? 39.641  -41.649 -44.558 1.00 176.45 ? 29  TRP A CZ2 1 
ATOM   171  C CZ3 . TRP A 1 29  ? 37.495  -40.709 -45.148 1.00 173.54 ? 29  TRP A CZ3 1 
ATOM   172  C CH2 . TRP A 1 29  ? 38.684  -41.364 -45.494 1.00 177.06 ? 29  TRP A CH2 1 
ATOM   173  N N   . ALA A 1 30  ? 38.593  -37.354 -39.001 1.00 148.52 ? 30  ALA A N   1 
ATOM   174  C CA  . ALA A 1 30  ? 39.651  -36.360 -38.859 1.00 145.00 ? 30  ALA A CA  1 
ATOM   175  C C   . ALA A 1 30  ? 40.344  -36.474 -37.504 1.00 137.47 ? 30  ALA A C   1 
ATOM   176  O O   . ALA A 1 30  ? 41.548  -36.244 -37.390 1.00 135.65 ? 30  ALA A O   1 
ATOM   177  C CB  . ALA A 1 30  ? 39.090  -34.960 -39.052 1.00 148.81 ? 30  ALA A CB  1 
ATOM   178  N N   . VAL A 1 31  ? 39.576  -36.828 -36.479 1.00 136.90 ? 31  VAL A N   1 
ATOM   179  C CA  . VAL A 1 31  ? 40.121  -36.997 -35.137 1.00 139.81 ? 31  VAL A CA  1 
ATOM   180  C C   . VAL A 1 31  ? 40.926  -38.287 -35.033 1.00 141.84 ? 31  VAL A C   1 
ATOM   181  O O   . VAL A 1 31  ? 41.974  -38.326 -34.391 1.00 146.96 ? 31  VAL A O   1 
ATOM   182  C CB  . VAL A 1 31  ? 39.009  -37.014 -34.071 1.00 145.59 ? 31  VAL A CB  1 
ATOM   183  C CG1 . VAL A 1 31  ? 39.583  -37.371 -32.707 1.00 145.09 ? 31  VAL A CG1 1 
ATOM   184  C CG2 . VAL A 1 31  ? 38.298  -35.669 -34.023 1.00 151.24 ? 31  VAL A CG2 1 
ATOM   185  N N   . TRP A 1 32  ? 40.427  -39.340 -35.671 1.00 139.95 ? 32  TRP A N   1 
ATOM   186  C CA  . TRP A 1 32  ? 41.080  -40.642 -35.622 1.00 143.66 ? 32  TRP A CA  1 
ATOM   187  C C   . TRP A 1 32  ? 42.339  -40.665 -36.482 1.00 148.45 ? 32  TRP A C   1 
ATOM   188  O O   . TRP A 1 32  ? 43.169  -41.565 -36.359 1.00 154.03 ? 32  TRP A O   1 
ATOM   189  C CB  . TRP A 1 32  ? 40.113  -41.741 -36.066 1.00 143.57 ? 32  TRP A CB  1 
ATOM   190  C CG  . TRP A 1 32  ? 40.671  -43.123 -35.921 1.00 142.65 ? 32  TRP A CG  1 
ATOM   191  C CD1 . TRP A 1 32  ? 41.032  -43.743 -34.760 1.00 138.49 ? 32  TRP A CD1 1 
ATOM   192  C CD2 . TRP A 1 32  ? 40.917  -44.063 -36.973 1.00 144.41 ? 32  TRP A CD2 1 
ATOM   193  N NE1 . TRP A 1 32  ? 41.495  -45.009 -35.024 1.00 138.59 ? 32  TRP A NE1 1 
ATOM   194  C CE2 . TRP A 1 32  ? 41.434  -45.231 -36.375 1.00 145.37 ? 32  TRP A CE2 1 
ATOM   195  C CE3 . TRP A 1 32  ? 40.755  -44.032 -38.361 1.00 146.11 ? 32  TRP A CE3 1 
ATOM   196  C CZ2 . TRP A 1 32  ? 41.789  -46.355 -37.117 1.00 152.51 ? 32  TRP A CZ2 1 
ATOM   197  C CZ3 . TRP A 1 32  ? 41.106  -45.150 -39.096 1.00 151.43 ? 32  TRP A CZ3 1 
ATOM   198  C CH2 . TRP A 1 32  ? 41.618  -46.296 -38.472 1.00 155.00 ? 32  TRP A CH2 1 
ATOM   199  N N   . LEU A 1 33  ? 42.474  -39.668 -37.350 1.00 149.25 ? 33  LEU A N   1 
ATOM   200  C CA  . LEU A 1 33  ? 43.643  -39.560 -38.216 1.00 153.10 ? 33  LEU A CA  1 
ATOM   201  C C   . LEU A 1 33  ? 44.706  -38.652 -37.601 1.00 152.42 ? 33  LEU A C   1 
ATOM   202  O O   . LEU A 1 33  ? 45.852  -39.061 -37.410 1.00 155.59 ? 33  LEU A O   1 
ATOM   203  C CB  . LEU A 1 33  ? 43.236  -39.042 -39.597 1.00 157.75 ? 33  LEU A CB  1 
ATOM   204  C CG  . LEU A 1 33  ? 44.368  -38.750 -40.585 1.00 169.42 ? 33  LEU A CG  1 
ATOM   205  C CD1 . LEU A 1 33  ? 45.323  -39.931 -40.693 1.00 175.12 ? 33  LEU A CD1 1 
ATOM   206  C CD2 . LEU A 1 33  ? 43.804  -38.381 -41.950 1.00 169.73 ? 33  LEU A CD2 1 
ATOM   207  N N   . ASN A 1 34  ? 44.318  -37.419 -37.291 1.00 145.67 ? 34  ASN A N   1 
ATOM   208  C CA  . ASN A 1 34  ? 45.232  -36.454 -36.694 1.00 137.77 ? 34  ASN A CA  1 
ATOM   209  C C   . ASN A 1 34  ? 45.246  -36.564 -35.172 1.00 137.47 ? 34  ASN A C   1 
ATOM   210  O O   . ASN A 1 34  ? 44.245  -36.288 -34.510 1.00 137.37 ? 34  ASN A O   1 
ATOM   211  C CB  . ASN A 1 34  ? 44.862  -35.034 -37.125 1.00 133.20 ? 34  ASN A CB  1 
ATOM   212  C CG  . ASN A 1 34  ? 45.915  -34.013 -36.740 1.00 133.54 ? 34  ASN A CG  1 
ATOM   213  O OD1 . ASN A 1 34  ? 46.807  -34.295 -35.941 1.00 136.80 ? 34  ASN A OD1 1 
ATOM   214  N ND2 . ASN A 1 34  ? 45.817  -32.818 -37.311 1.00 133.85 ? 34  ASN A ND2 1 
ATOM   215  N N   . SER A 1 35  ? 46.387  -36.970 -34.624 1.00 141.14 ? 35  SER A N   1 
ATOM   216  C CA  . SER A 1 35  ? 46.523  -37.163 -33.184 1.00 141.62 ? 35  SER A CA  1 
ATOM   217  C C   . SER A 1 35  ? 46.544  -35.837 -32.427 1.00 135.39 ? 35  SER A C   1 
ATOM   218  O O   . SER A 1 35  ? 46.411  -35.810 -31.204 1.00 130.48 ? 35  SER A O   1 
ATOM   219  C CB  . SER A 1 35  ? 47.785  -37.970 -32.869 1.00 150.41 ? 35  SER A CB  1 
ATOM   220  O OG  . SER A 1 35  ? 48.945  -37.305 -33.341 1.00 159.82 ? 35  SER A OG  1 
ATOM   221  N N   . ASN A 1 36  ? 46.711  -34.740 -33.158 1.00 135.99 ? 36  ASN A N   1 
ATOM   222  C CA  . ASN A 1 36  ? 46.716  -33.412 -32.556 1.00 140.14 ? 36  ASN A CA  1 
ATOM   223  C C   . ASN A 1 36  ? 45.313  -32.962 -32.167 1.00 144.76 ? 36  ASN A C   1 
ATOM   224  O O   . ASN A 1 36  ? 45.137  -31.904 -31.565 1.00 153.10 ? 36  ASN A O   1 
ATOM   225  C CB  . ASN A 1 36  ? 47.349  -32.394 -33.506 1.00 143.94 ? 36  ASN A CB  1 
ATOM   226  C CG  . ASN A 1 36  ? 48.825  -32.657 -33.745 1.00 147.21 ? 36  ASN A CG  1 
ATOM   227  O OD1 . ASN A 1 36  ? 49.573  -32.950 -32.813 1.00 148.31 ? 36  ASN A OD1 1 
ATOM   228  N ND2 . ASN A 1 36  ? 49.252  -32.546 -34.999 1.00 145.98 ? 36  ASN A ND2 1 
ATOM   229  N N   . LEU A 1 37  ? 44.319  -33.772 -32.519 1.00 137.90 ? 37  LEU A N   1 
ATOM   230  C CA  . LEU A 1 37  ? 42.928  -33.472 -32.205 1.00 123.12 ? 37  LEU A CA  1 
ATOM   231  C C   . LEU A 1 37  ? 42.365  -34.483 -31.213 1.00 121.35 ? 37  LEU A C   1 
ATOM   232  O O   . LEU A 1 37  ? 41.188  -34.428 -30.861 1.00 125.21 ? 37  LEU A O   1 
ATOM   233  C CB  . LEU A 1 37  ? 42.081  -33.470 -33.481 1.00 108.93 ? 37  LEU A CB  1 
ATOM   234  C CG  . LEU A 1 37  ? 42.388  -32.385 -34.515 1.00 97.93  ? 37  LEU A CG  1 
ATOM   235  C CD1 . LEU A 1 37  ? 41.695  -32.683 -35.836 1.00 84.48  ? 37  LEU A CD1 1 
ATOM   236  C CD2 . LEU A 1 37  ? 41.989  -31.014 -33.989 1.00 93.59  ? 37  LEU A CD2 1 
ATOM   237  N N   . GLN A 1 38  ? 43.210  -35.406 -30.765 1.00 121.96 ? 38  GLN A N   1 
ATOM   238  C CA  . GLN A 1 38  ? 42.773  -36.472 -29.869 1.00 121.90 ? 38  GLN A CA  1 
ATOM   239  C C   . GLN A 1 38  ? 42.934  -36.107 -28.396 1.00 124.32 ? 38  GLN A C   1 
ATOM   240  O O   . GLN A 1 38  ? 43.215  -36.967 -27.561 1.00 123.59 ? 38  GLN A O   1 
ATOM   241  C CB  . GLN A 1 38  ? 43.525  -37.769 -30.174 1.00 120.73 ? 38  GLN A CB  1 
ATOM   242  C CG  . GLN A 1 38  ? 43.279  -38.307 -31.573 1.00 121.93 ? 38  GLN A CG  1 
ATOM   243  C CD  . GLN A 1 38  ? 43.970  -39.631 -31.818 1.00 130.67 ? 38  GLN A CD  1 
ATOM   244  O OE1 . GLN A 1 38  ? 44.674  -40.145 -30.950 1.00 140.09 ? 38  GLN A OE1 1 
ATOM   245  N NE2 . GLN A 1 38  ? 43.772  -40.192 -33.005 1.00 130.18 ? 38  GLN A NE2 1 
ATOM   246  N N   . ASN A 1 39  ? 42.757  -34.828 -28.082 1.00 126.05 ? 39  ASN A N   1 
ATOM   247  C CA  . ASN A 1 39  ? 42.801  -34.374 -26.698 1.00 132.12 ? 39  ASN A CA  1 
ATOM   248  C C   . ASN A 1 39  ? 41.548  -34.792 -25.931 1.00 139.81 ? 39  ASN A C   1 
ATOM   249  O O   . ASN A 1 39  ? 40.523  -35.115 -26.533 1.00 142.42 ? 39  ASN A O   1 
ATOM   250  C CB  . ASN A 1 39  ? 42.997  -32.856 -26.632 1.00 132.51 ? 39  ASN A CB  1 
ATOM   251  C CG  . ASN A 1 39  ? 42.046  -32.104 -27.543 1.00 131.04 ? 39  ASN A CG  1 
ATOM   252  O OD1 . ASN A 1 39  ? 40.937  -32.561 -27.815 1.00 135.36 ? 39  ASN A OD1 1 
ATOM   253  N ND2 . ASN A 1 39  ? 42.477  -30.940 -28.016 1.00 128.73 ? 39  ASN A ND2 1 
ATOM   254  N N   . VAL A 1 40  ? 41.637  -34.790 -24.605 1.00 143.41 ? 40  VAL A N   1 
ATOM   255  C CA  . VAL A 1 40  ? 40.522  -35.208 -23.760 1.00 143.62 ? 40  VAL A CA  1 
ATOM   256  C C   . VAL A 1 40  ? 39.243  -34.446 -24.094 1.00 136.46 ? 40  VAL A C   1 
ATOM   257  O O   . VAL A 1 40  ? 38.142  -34.990 -24.010 1.00 121.43 ? 40  VAL A O   1 
ATOM   258  C CB  . VAL A 1 40  ? 40.844  -35.018 -22.266 1.00 145.06 ? 40  VAL A CB  1 
ATOM   259  C CG1 . VAL A 1 40  ? 39.686  -35.507 -21.409 1.00 140.32 ? 40  VAL A CG1 1 
ATOM   260  C CG2 . VAL A 1 40  ? 42.128  -35.749 -21.903 1.00 147.59 ? 40  VAL A CG2 1 
ATOM   261  N N   . THR A 1 41  ? 39.400  -33.183 -24.478 1.00 143.24 ? 41  THR A N   1 
ATOM   262  C CA  . THR A 1 41  ? 38.264  -32.328 -24.800 1.00 140.93 ? 41  THR A CA  1 
ATOM   263  C C   . THR A 1 41  ? 37.419  -32.901 -25.932 1.00 129.89 ? 41  THR A C   1 
ATOM   264  O O   . THR A 1 41  ? 36.192  -32.940 -25.844 1.00 130.05 ? 41  THR A O   1 
ATOM   265  C CB  . THR A 1 41  ? 38.724  -30.914 -25.202 1.00 150.73 ? 41  THR A CB  1 
ATOM   266  O OG1 . THR A 1 41  ? 39.519  -30.348 -24.152 1.00 158.92 ? 41  THR A OG1 1 
ATOM   267  C CG2 . THR A 1 41  ? 37.524  -30.016 -25.471 1.00 148.23 ? 41  THR A CG2 1 
ATOM   268  N N   . ASN A 1 42  ? 38.083  -33.344 -26.995 1.00 125.30 ? 42  ASN A N   1 
ATOM   269  C CA  . ASN A 1 42  ? 37.386  -33.821 -28.185 1.00 129.40 ? 42  ASN A CA  1 
ATOM   270  C C   . ASN A 1 42  ? 36.751  -35.200 -28.032 1.00 132.56 ? 42  ASN A C   1 
ATOM   271  O O   . ASN A 1 42  ? 36.083  -35.684 -28.946 1.00 130.34 ? 42  ASN A O   1 
ATOM   272  C CB  . ASN A 1 42  ? 38.310  -33.787 -29.404 1.00 135.29 ? 42  ASN A CB  1 
ATOM   273  C CG  . ASN A 1 42  ? 38.569  -32.376 -29.896 1.00 143.08 ? 42  ASN A CG  1 
ATOM   274  O OD1 . ASN A 1 42  ? 38.052  -31.406 -29.340 1.00 144.40 ? 42  ASN A OD1 1 
ATOM   275  N ND2 . ASN A 1 42  ? 39.369  -32.255 -30.947 1.00 148.26 ? 42  ASN A ND2 1 
ATOM   276  N N   . TYR A 1 43  ? 36.955  -35.830 -26.880 1.00 137.76 ? 43  TYR A N   1 
ATOM   277  C CA  . TYR A 1 43  ? 36.283  -37.090 -26.587 1.00 138.39 ? 43  TYR A CA  1 
ATOM   278  C C   . TYR A 1 43  ? 34.777  -36.865 -26.530 1.00 132.46 ? 43  TYR A C   1 
ATOM   279  O O   . TYR A 1 43  ? 33.992  -37.713 -26.956 1.00 129.86 ? 43  TYR A O   1 
ATOM   280  C CB  . TYR A 1 43  ? 36.784  -37.683 -25.269 1.00 142.43 ? 43  TYR A CB  1 
ATOM   281  C CG  . TYR A 1 43  ? 38.069  -38.468 -25.400 1.00 146.61 ? 43  TYR A CG  1 
ATOM   282  C CD1 . TYR A 1 43  ? 38.055  -39.856 -25.466 1.00 148.55 ? 43  TYR A CD1 1 
ATOM   283  C CD2 . TYR A 1 43  ? 39.295  -37.823 -25.462 1.00 150.49 ? 43  TYR A CD2 1 
ATOM   284  C CE1 . TYR A 1 43  ? 39.226  -40.578 -25.587 1.00 152.82 ? 43  TYR A CE1 1 
ATOM   285  C CE2 . TYR A 1 43  ? 40.474  -38.537 -25.584 1.00 154.99 ? 43  TYR A CE2 1 
ATOM   286  C CZ  . TYR A 1 43  ? 40.434  -39.914 -25.646 1.00 157.20 ? 43  TYR A CZ  1 
ATOM   287  O OH  . TYR A 1 43  ? 41.605  -40.628 -25.767 1.00 162.08 ? 43  TYR A OH  1 
ATOM   288  N N   . PHE A 1 44  ? 34.382  -35.708 -26.008 1.00 125.28 ? 44  PHE A N   1 
ATOM   289  C CA  . PHE A 1 44  ? 32.976  -35.339 -25.936 1.00 117.65 ? 44  PHE A CA  1 
ATOM   290  C C   . PHE A 1 44  ? 32.455  -34.920 -27.305 1.00 118.69 ? 44  PHE A C   1 
ATOM   291  O O   . PHE A 1 44  ? 31.306  -35.191 -27.653 1.00 125.61 ? 44  PHE A O   1 
ATOM   292  C CB  . PHE A 1 44  ? 32.770  -34.211 -24.924 1.00 119.06 ? 44  PHE A CB  1 
ATOM   293  C CG  . PHE A 1 44  ? 33.205  -34.562 -23.532 1.00 128.46 ? 44  PHE A CG  1 
ATOM   294  C CD1 . PHE A 1 44  ? 34.438  -34.154 -23.054 1.00 135.78 ? 44  PHE A CD1 1 
ATOM   295  C CD2 . PHE A 1 44  ? 32.384  -35.309 -22.704 1.00 134.67 ? 44  PHE A CD2 1 
ATOM   296  C CE1 . PHE A 1 44  ? 34.843  -34.479 -21.773 1.00 140.80 ? 44  PHE A CE1 1 
ATOM   297  C CE2 . PHE A 1 44  ? 32.782  -35.639 -21.423 1.00 139.05 ? 44  PHE A CE2 1 
ATOM   298  C CZ  . PHE A 1 44  ? 34.013  -35.223 -20.957 1.00 141.43 ? 44  PHE A CZ  1 
ATOM   299  N N   . VAL A 1 45  ? 33.307  -34.256 -28.080 1.00 116.11 ? 45  VAL A N   1 
ATOM   300  C CA  . VAL A 1 45  ? 32.944  -33.848 -29.431 1.00 113.92 ? 45  VAL A CA  1 
ATOM   301  C C   . VAL A 1 45  ? 32.600  -35.069 -30.277 1.00 116.51 ? 45  VAL A C   1 
ATOM   302  O O   . VAL A 1 45  ? 31.736  -35.010 -31.150 1.00 115.01 ? 45  VAL A O   1 
ATOM   303  C CB  . VAL A 1 45  ? 34.075  -33.053 -30.110 1.00 108.21 ? 45  VAL A CB  1 
ATOM   304  C CG1 . VAL A 1 45  ? 33.688  -32.690 -31.537 1.00 95.59  ? 45  VAL A CG1 1 
ATOM   305  C CG2 . VAL A 1 45  ? 34.397  -31.804 -29.307 1.00 111.63 ? 45  VAL A CG2 1 
ATOM   306  N N   . VAL A 1 46  ? 33.283  -36.177 -30.008 1.00 121.42 ? 46  VAL A N   1 
ATOM   307  C CA  . VAL A 1 46  ? 33.000  -37.431 -30.694 1.00 125.34 ? 46  VAL A CA  1 
ATOM   308  C C   . VAL A 1 46  ? 31.610  -37.928 -30.321 1.00 132.20 ? 46  VAL A C   1 
ATOM   309  O O   . VAL A 1 46  ? 30.870  -38.431 -31.167 1.00 136.11 ? 46  VAL A O   1 
ATOM   310  C CB  . VAL A 1 46  ? 34.036  -38.516 -30.350 1.00 126.67 ? 46  VAL A CB  1 
ATOM   311  C CG1 . VAL A 1 46  ? 33.649  -39.840 -30.991 1.00 126.97 ? 46  VAL A CG1 1 
ATOM   312  C CG2 . VAL A 1 46  ? 35.422  -38.087 -30.798 1.00 127.52 ? 46  VAL A CG2 1 
ATOM   313  N N   . SER A 1 47  ? 31.261  -37.784 -29.046 1.00 135.50 ? 47  SER A N   1 
ATOM   314  C CA  . SER A 1 47  ? 29.933  -38.146 -28.568 1.00 137.61 ? 47  SER A CA  1 
ATOM   315  C C   . SER A 1 47  ? 28.877  -37.284 -29.250 1.00 129.94 ? 47  SER A C   1 
ATOM   316  O O   . SER A 1 47  ? 27.794  -37.760 -29.591 1.00 122.04 ? 47  SER A O   1 
ATOM   317  C CB  . SER A 1 47  ? 29.845  -37.983 -27.049 1.00 143.10 ? 47  SER A CB  1 
ATOM   318  O OG  . SER A 1 47  ? 28.537  -38.262 -26.579 1.00 143.66 ? 47  SER A OG  1 
ATOM   319  N N   . LEU A 1 48  ? 29.203  -36.010 -29.445 1.00 130.95 ? 48  LEU A N   1 
ATOM   320  C CA  . LEU A 1 48  ? 28.323  -35.087 -30.149 1.00 131.87 ? 48  LEU A CA  1 
ATOM   321  C C   . LEU A 1 48  ? 28.143  -35.527 -31.596 1.00 131.69 ? 48  LEU A C   1 
ATOM   322  O O   . LEU A 1 48  ? 27.032  -35.522 -32.124 1.00 137.22 ? 48  LEU A O   1 
ATOM   323  C CB  . LEU A 1 48  ? 28.893  -33.667 -30.106 1.00 134.26 ? 48  LEU A CB  1 
ATOM   324  C CG  . LEU A 1 48  ? 28.163  -32.619 -30.951 1.00 137.24 ? 48  LEU A CG  1 
ATOM   325  C CD1 . LEU A 1 48  ? 26.719  -32.466 -30.494 1.00 137.40 ? 48  LEU A CD1 1 
ATOM   326  C CD2 . LEU A 1 48  ? 28.891  -31.284 -30.899 1.00 139.00 ? 48  LEU A CD2 1 
ATOM   327  N N   . ALA A 1 49  ? 29.246  -35.908 -32.231 1.00 127.56 ? 49  ALA A N   1 
ATOM   328  C CA  . ALA A 1 49  ? 29.216  -36.357 -33.617 1.00 125.91 ? 49  ALA A CA  1 
ATOM   329  C C   . ALA A 1 49  ? 28.370  -37.616 -33.769 1.00 123.45 ? 49  ALA A C   1 
ATOM   330  O O   . ALA A 1 49  ? 27.410  -37.638 -34.537 1.00 128.45 ? 49  ALA A O   1 
ATOM   331  C CB  . ALA A 1 49  ? 30.627  -36.597 -34.128 1.00 130.95 ? 49  ALA A CB  1 
ATOM   332  N N   . ALA A 1 50  ? 28.730  -38.662 -33.031 1.00 118.82 ? 50  ALA A N   1 
ATOM   333  C CA  . ALA A 1 50  ? 28.003  -39.927 -33.081 1.00 118.60 ? 50  ALA A CA  1 
ATOM   334  C C   . ALA A 1 50  ? 26.511  -39.713 -32.856 1.00 122.29 ? 50  ALA A C   1 
ATOM   335  O O   . ALA A 1 50  ? 25.676  -40.288 -33.555 1.00 121.61 ? 50  ALA A O   1 
ATOM   336  C CB  . ALA A 1 50  ? 28.560  -40.899 -32.055 1.00 120.02 ? 50  ALA A CB  1 
ATOM   337  N N   . ALA A 1 51  ? 26.183  -38.885 -31.870 1.00 124.95 ? 51  ALA A N   1 
ATOM   338  C CA  . ALA A 1 51  ? 24.794  -38.567 -31.570 1.00 124.91 ? 51  ALA A CA  1 
ATOM   339  C C   . ALA A 1 51  ? 24.132  -37.886 -32.761 1.00 130.49 ? 51  ALA A C   1 
ATOM   340  O O   . ALA A 1 51  ? 23.017  -38.233 -33.149 1.00 139.10 ? 51  ALA A O   1 
ATOM   341  C CB  . ALA A 1 51  ? 24.707  -37.681 -30.336 1.00 120.94 ? 51  ALA A CB  1 
ATOM   342  N N   . ASP A 1 52  ? 24.830  -36.914 -33.339 1.00 128.38 ? 52  ASP A N   1 
ATOM   343  C CA  . ASP A 1 52  ? 24.300  -36.160 -34.469 1.00 128.50 ? 52  ASP A CA  1 
ATOM   344  C C   . ASP A 1 52  ? 24.404  -36.933 -35.782 1.00 116.02 ? 52  ASP A C   1 
ATOM   345  O O   . ASP A 1 52  ? 23.907  -36.486 -36.815 1.00 110.56 ? 52  ASP A O   1 
ATOM   346  C CB  . ASP A 1 52  ? 24.997  -34.802 -34.584 1.00 141.21 ? 52  ASP A CB  1 
ATOM   347  C CG  . ASP A 1 52  ? 24.585  -33.840 -33.483 1.00 149.08 ? 52  ASP A CG  1 
ATOM   348  O OD1 . ASP A 1 52  ? 23.748  -34.223 -32.638 1.00 151.89 ? 52  ASP A OD1 1 
ATOM   349  O OD2 . ASP A 1 52  ? 25.096  -32.700 -33.464 1.00 149.26 ? 52  ASP A OD2 1 
ATOM   350  N N   . ILE A 1 53  ? 25.053  -38.092 -35.736 1.00 114.25 ? 53  ILE A N   1 
ATOM   351  C CA  . ILE A 1 53  ? 25.123  -38.972 -36.897 1.00 114.50 ? 53  ILE A CA  1 
ATOM   352  C C   . ILE A 1 53  ? 23.885  -39.854 -36.950 1.00 113.23 ? 53  ILE A C   1 
ATOM   353  O O   . ILE A 1 53  ? 23.257  -39.998 -37.998 1.00 114.45 ? 53  ILE A O   1 
ATOM   354  C CB  . ILE A 1 53  ? 26.371  -39.869 -36.866 1.00 114.69 ? 53  ILE A CB  1 
ATOM   355  C CG1 . ILE A 1 53  ? 27.632  -39.037 -37.090 1.00 107.84 ? 53  ILE A CG1 1 
ATOM   356  C CG2 . ILE A 1 53  ? 26.273  -40.949 -37.931 1.00 117.04 ? 53  ILE A CG2 1 
ATOM   357  C CD1 . ILE A 1 53  ? 28.907  -39.840 -37.043 1.00 104.69 ? 53  ILE A CD1 1 
ATOM   358  N N   . LEU A 1 54  ? 23.540  -40.441 -35.809 1.00 110.66 ? 54  LEU A N   1 
ATOM   359  C CA  . LEU A 1 54  ? 22.343  -41.264 -35.705 1.00 106.05 ? 54  LEU A CA  1 
ATOM   360  C C   . LEU A 1 54  ? 21.098  -40.451 -36.050 1.00 97.11  ? 54  LEU A C   1 
ATOM   361  O O   . LEU A 1 54  ? 20.024  -41.010 -36.271 1.00 91.21  ? 54  LEU A O   1 
ATOM   362  C CB  . LEU A 1 54  ? 22.219  -41.864 -34.303 1.00 107.73 ? 54  LEU A CB  1 
ATOM   363  C CG  . LEU A 1 54  ? 23.346  -42.811 -33.886 1.00 107.35 ? 54  LEU A CG  1 
ATOM   364  C CD1 . LEU A 1 54  ? 23.155  -43.289 -32.453 1.00 105.53 ? 54  LEU A CD1 1 
ATOM   365  C CD2 . LEU A 1 54  ? 23.436  -43.989 -34.843 1.00 106.53 ? 54  LEU A CD2 1 
ATOM   366  N N   . VAL A 1 55  ? 21.248  -39.131 -36.095 1.00 96.99  ? 55  VAL A N   1 
ATOM   367  C CA  . VAL A 1 55  ? 20.154  -38.252 -36.492 1.00 104.02 ? 55  VAL A CA  1 
ATOM   368  C C   . VAL A 1 55  ? 19.800  -38.490 -37.954 1.00 112.36 ? 55  VAL A C   1 
ATOM   369  O O   . VAL A 1 55  ? 18.681  -38.886 -38.276 1.00 124.12 ? 55  VAL A O   1 
ATOM   370  C CB  . VAL A 1 55  ? 20.511  -36.769 -36.296 1.00 108.37 ? 55  VAL A CB  1 
ATOM   371  C CG1 . VAL A 1 55  ? 19.418  -35.879 -36.870 1.00 112.95 ? 55  VAL A CG1 1 
ATOM   372  C CG2 . VAL A 1 55  ? 20.732  -36.467 -34.822 1.00 105.44 ? 55  VAL A CG2 1 
ATOM   373  N N   . GLY A 1 56  ? 20.763  -38.250 -38.837 1.00 109.43 ? 56  GLY A N   1 
ATOM   374  C CA  . GLY A 1 56  ? 20.574  -38.503 -40.251 1.00 109.35 ? 56  GLY A CA  1 
ATOM   375  C C   . GLY A 1 56  ? 20.516  -39.988 -40.559 1.00 109.77 ? 56  GLY A C   1 
ATOM   376  O O   . GLY A 1 56  ? 20.234  -40.381 -41.693 1.00 106.31 ? 56  GLY A O   1 
ATOM   377  N N   . VAL A 1 57  ? 20.783  -40.819 -39.555 1.00 113.02 ? 57  VAL A N   1 
ATOM   378  C CA  . VAL A 1 57  ? 20.749  -42.265 -39.751 1.00 114.90 ? 57  VAL A CA  1 
ATOM   379  C C   . VAL A 1 57  ? 19.415  -42.881 -39.328 1.00 119.64 ? 57  VAL A C   1 
ATOM   380  O O   . VAL A 1 57  ? 18.853  -43.710 -40.045 1.00 125.54 ? 57  VAL A O   1 
ATOM   381  C CB  . VAL A 1 57  ? 21.909  -42.978 -39.024 1.00 109.32 ? 57  VAL A CB  1 
ATOM   382  C CG1 . VAL A 1 57  ? 21.725  -44.488 -39.090 1.00 108.60 ? 57  VAL A CG1 1 
ATOM   383  C CG2 . VAL A 1 57  ? 23.243  -42.579 -39.635 1.00 105.34 ? 57  VAL A CG2 1 
ATOM   384  N N   . LEU A 1 58  ? 18.910  -42.473 -38.168 1.00 112.67 ? 58  LEU A N   1 
ATOM   385  C CA  . LEU A 1 58  ? 17.681  -43.045 -37.632 1.00 102.52 ? 58  LEU A CA  1 
ATOM   386  C C   . LEU A 1 58  ? 16.651  -41.983 -37.303 1.00 101.56 ? 58  LEU A C   1 
ATOM   387  O O   . LEU A 1 58  ? 15.491  -42.089 -37.695 1.00 110.04 ? 58  LEU A O   1 
ATOM   388  C CB  . LEU A 1 58  ? 17.980  -43.853 -36.375 1.00 95.69  ? 58  LEU A CB  1 
ATOM   389  C CG  . LEU A 1 58  ? 18.868  -45.070 -36.606 1.00 94.41  ? 58  LEU A CG  1 
ATOM   390  C CD1 . LEU A 1 58  ? 19.124  -45.789 -35.296 1.00 94.22  ? 58  LEU A CD1 1 
ATOM   391  C CD2 . LEU A 1 58  ? 18.213  -45.990 -37.617 1.00 94.42  ? 58  LEU A CD2 1 
ATOM   392  N N   . ALA A 1 59  ? 17.084  -40.965 -36.570 1.00 100.07 ? 59  ALA A N   1 
ATOM   393  C CA  . ALA A 1 59  ? 16.180  -39.925 -36.101 1.00 106.90 ? 59  ALA A CA  1 
ATOM   394  C C   . ALA A 1 59  ? 15.368  -39.324 -37.241 1.00 113.23 ? 59  ALA A C   1 
ATOM   395  O O   . ALA A 1 59  ? 14.140  -39.284 -37.177 1.00 122.62 ? 59  ALA A O   1 
ATOM   396  C CB  . ALA A 1 59  ? 16.949  -38.847 -35.367 1.00 109.94 ? 59  ALA A CB  1 
ATOM   397  N N   . ILE A 1 60  ? 16.049  -38.863 -38.285 1.00 110.94 ? 60  ILE A N   1 
ATOM   398  C CA  . ILE A 1 60  ? 15.354  -38.291 -39.433 1.00 115.19 ? 60  ILE A CA  1 
ATOM   399  C C   . ILE A 1 60  ? 14.433  -39.307 -40.110 1.00 122.00 ? 60  ILE A C   1 
ATOM   400  O O   . ILE A 1 60  ? 13.258  -39.020 -40.330 1.00 129.54 ? 60  ILE A O   1 
ATOM   401  C CB  . ILE A 1 60  ? 16.326  -37.680 -40.463 1.00 116.06 ? 60  ILE A CB  1 
ATOM   402  C CG1 . ILE A 1 60  ? 17.010  -36.445 -39.878 1.00 120.30 ? 60  ILE A CG1 1 
ATOM   403  C CG2 . ILE A 1 60  ? 15.581  -37.308 -41.737 1.00 111.09 ? 60  ILE A CG2 1 
ATOM   404  C CD1 . ILE A 1 60  ? 17.947  -35.745 -40.846 1.00 122.41 ? 60  ILE A CD1 1 
ATOM   405  N N   . PRO A 1 61  ? 14.962  -40.500 -40.441 1.00 115.40 ? 61  PRO A N   1 
ATOM   406  C CA  . PRO A 1 61  ? 14.108  -41.557 -40.998 1.00 114.71 ? 61  PRO A CA  1 
ATOM   407  C C   . PRO A 1 61  ? 12.852  -41.784 -40.161 1.00 110.43 ? 61  PRO A C   1 
ATOM   408  O O   . PRO A 1 61  ? 11.753  -41.873 -40.710 1.00 107.49 ? 61  PRO A O   1 
ATOM   409  C CB  . PRO A 1 61  ? 15.008  -42.793 -40.945 1.00 110.57 ? 61  PRO A CB  1 
ATOM   410  C CG  . PRO A 1 61  ? 16.373  -42.255 -41.058 1.00 104.00 ? 61  PRO A CG  1 
ATOM   411  C CD  . PRO A 1 61  ? 16.372  -40.921 -40.368 1.00 104.82 ? 61  PRO A CD  1 
ATOM   412  N N   . PHE A 1 62  ? 13.018  -41.870 -38.846 1.00 108.39 ? 62  PHE A N   1 
ATOM   413  C CA  . PHE A 1 62  ? 11.884  -42.057 -37.950 1.00 112.17 ? 62  PHE A CA  1 
ATOM   414  C C   . PHE A 1 62  ? 10.931  -40.873 -38.020 1.00 127.49 ? 62  PHE A C   1 
ATOM   415  O O   . PHE A 1 62  ? 9.714   -41.048 -38.032 1.00 135.64 ? 62  PHE A O   1 
ATOM   416  C CB  . PHE A 1 62  ? 12.345  -42.261 -36.504 1.00 103.93 ? 62  PHE A CB  1 
ATOM   417  C CG  . PHE A 1 62  ? 13.018  -43.582 -36.254 1.00 107.40 ? 62  PHE A CG  1 
ATOM   418  C CD1 . PHE A 1 62  ? 12.439  -44.765 -36.678 1.00 114.47 ? 62  PHE A CD1 1 
ATOM   419  C CD2 . PHE A 1 62  ? 14.216  -43.641 -35.566 1.00 109.18 ? 62  PHE A CD2 1 
ATOM   420  C CE1 . PHE A 1 62  ? 13.054  -45.979 -36.438 1.00 114.76 ? 62  PHE A CE1 1 
ATOM   421  C CE2 . PHE A 1 62  ? 14.833  -44.851 -35.322 1.00 110.16 ? 62  PHE A CE2 1 
ATOM   422  C CZ  . PHE A 1 62  ? 14.251  -46.022 -35.758 1.00 111.11 ? 62  PHE A CZ  1 
ATOM   423  N N   . ALA A 1 63  ? 11.488  -39.668 -38.065 1.00 132.55 ? 63  ALA A N   1 
ATOM   424  C CA  . ALA A 1 63  ? 10.673  -38.461 -38.108 1.00 140.81 ? 63  ALA A CA  1 
ATOM   425  C C   . ALA A 1 63  ? 9.836   -38.401 -39.383 1.00 148.62 ? 63  ALA A C   1 
ATOM   426  O O   . ALA A 1 63  ? 8.700   -37.930 -39.366 1.00 150.17 ? 63  ALA A O   1 
ATOM   427  C CB  . ALA A 1 63  ? 11.544  -37.218 -37.977 1.00 140.06 ? 63  ALA A CB  1 
ATOM   428  N N   . ILE A 1 64  ? 10.396  -38.891 -40.484 1.00 155.17 ? 64  ILE A N   1 
ATOM   429  C CA  . ILE A 1 64  ? 9.699   -38.877 -41.766 1.00 162.45 ? 64  ILE A CA  1 
ATOM   430  C C   . ILE A 1 64  ? 8.594   -39.927 -41.799 1.00 163.02 ? 64  ILE A C   1 
ATOM   431  O O   . ILE A 1 64  ? 7.587   -39.767 -42.489 1.00 165.77 ? 64  ILE A O   1 
ATOM   432  C CB  . ILE A 1 64  ? 10.668  -39.121 -42.939 1.00 170.58 ? 64  ILE A CB  1 
ATOM   433  C CG1 . ILE A 1 64  ? 11.828  -38.125 -42.885 1.00 179.74 ? 64  ILE A CG1 1 
ATOM   434  C CG2 . ILE A 1 64  ? 9.936   -39.018 -44.270 1.00 168.96 ? 64  ILE A CG2 1 
ATOM   435  C CD1 . ILE A 1 64  ? 12.908  -38.389 -43.910 1.00 183.69 ? 64  ILE A CD1 1 
ATOM   436  N N   . THR A 1 65  ? 8.794   -41.001 -41.043 1.00 161.69 ? 65  THR A N   1 
ATOM   437  C CA  . THR A 1 65  ? 7.829   -42.091 -40.974 1.00 165.31 ? 65  THR A CA  1 
ATOM   438  C C   . THR A 1 65  ? 6.661   -41.737 -40.060 1.00 167.15 ? 65  THR A C   1 
ATOM   439  O O   . THR A 1 65  ? 5.498   -41.925 -40.417 1.00 169.06 ? 65  THR A O   1 
ATOM   440  C CB  . THR A 1 65  ? 8.489   -43.383 -40.458 1.00 167.63 ? 65  THR A CB  1 
ATOM   441  O OG1 . THR A 1 65  ? 9.576   -43.742 -41.320 1.00 171.27 ? 65  THR A OG1 1 
ATOM   442  C CG2 . THR A 1 65  ? 7.481   -44.518 -40.413 1.00 170.08 ? 65  THR A CG2 1 
ATOM   443  N N   . ILE A 1 66  ? 6.982   -41.217 -38.881 1.00 168.23 ? 66  ILE A N   1 
ATOM   444  C CA  . ILE A 1 66  ? 5.968   -40.888 -37.886 1.00 171.96 ? 66  ILE A CA  1 
ATOM   445  C C   . ILE A 1 66  ? 5.121   -39.686 -38.306 1.00 172.74 ? 66  ILE A C   1 
ATOM   446  O O   . ILE A 1 66  ? 4.016   -39.488 -37.799 1.00 176.40 ? 66  ILE A O   1 
ATOM   447  C CB  . ILE A 1 66  ? 6.601   -40.611 -36.506 1.00 175.09 ? 66  ILE A CB  1 
ATOM   448  C CG1 . ILE A 1 66  ? 5.519   -40.538 -35.426 1.00 181.01 ? 66  ILE A CG1 1 
ATOM   449  C CG2 . ILE A 1 66  ? 7.430   -39.336 -36.540 1.00 173.71 ? 66  ILE A CG2 1 
ATOM   450  C CD1 . ILE A 1 66  ? 6.062   -40.291 -34.038 1.00 182.56 ? 66  ILE A CD1 1 
ATOM   451  N N   . SER A 1 67  ? 5.641   -38.890 -39.236 1.00 169.70 ? 67  SER A N   1 
ATOM   452  C CA  . SER A 1 67  ? 4.929   -37.709 -39.714 1.00 169.15 ? 67  SER A CA  1 
ATOM   453  C C   . SER A 1 67  ? 3.614   -38.093 -40.382 1.00 169.76 ? 67  SER A C   1 
ATOM   454  O O   . SER A 1 67  ? 2.604   -37.407 -40.224 1.00 173.89 ? 67  SER A O   1 
ATOM   455  C CB  . SER A 1 67  ? 5.798   -36.914 -40.690 1.00 170.14 ? 67  SER A CB  1 
ATOM   456  O OG  . SER A 1 67  ? 6.015   -37.642 -41.886 1.00 172.73 ? 67  SER A OG  1 
ATOM   457  N N   . THR A 1 68  ? 3.634   -39.191 -41.131 1.00 165.39 ? 68  THR A N   1 
ATOM   458  C CA  . THR A 1 68  ? 2.440   -39.677 -41.811 1.00 160.50 ? 68  THR A CA  1 
ATOM   459  C C   . THR A 1 68  ? 1.654   -40.628 -40.914 1.00 156.68 ? 68  THR A C   1 
ATOM   460  O O   . THR A 1 68  ? 0.465   -40.864 -41.133 1.00 161.91 ? 68  THR A O   1 
ATOM   461  C CB  . THR A 1 68  ? 2.789   -40.397 -43.126 1.00 156.47 ? 68  THR A CB  1 
ATOM   462  O OG1 . THR A 1 68  ? 3.605   -41.541 -42.845 1.00 156.01 ? 68  THR A OG1 1 
ATOM   463  C CG2 . THR A 1 68  ? 3.539   -39.463 -44.065 1.00 152.38 ? 68  THR A CG2 1 
ATOM   464  N N   . GLY A 1 69  ? 2.327   -41.171 -39.905 1.00 145.97 ? 69  GLY A N   1 
ATOM   465  C CA  . GLY A 1 69  ? 1.696   -42.080 -38.968 1.00 138.57 ? 69  GLY A CA  1 
ATOM   466  C C   . GLY A 1 69  ? 1.622   -43.501 -39.492 1.00 135.70 ? 69  GLY A C   1 
ATOM   467  O O   . GLY A 1 69  ? 1.447   -43.724 -40.690 1.00 134.57 ? 69  GLY A O   1 
ATOM   468  N N   . PHE A 1 70  ? 1.760   -44.465 -38.589 1.00 137.29 ? 70  PHE A N   1 
ATOM   469  C CA  . PHE A 1 70  ? 1.690   -45.873 -38.955 1.00 144.57 ? 70  PHE A CA  1 
ATOM   470  C C   . PHE A 1 70  ? 1.050   -46.693 -37.840 1.00 143.54 ? 70  PHE A C   1 
ATOM   471  O O   . PHE A 1 70  ? 0.528   -46.140 -36.874 1.00 145.60 ? 70  PHE A O   1 
ATOM   472  C CB  . PHE A 1 70  ? 3.083   -46.416 -39.280 1.00 152.89 ? 70  PHE A CB  1 
ATOM   473  C CG  . PHE A 1 70  ? 4.056   -46.314 -38.140 1.00 154.39 ? 70  PHE A CG  1 
ATOM   474  C CD1 . PHE A 1 70  ? 4.827   -45.176 -37.969 1.00 152.95 ? 70  PHE A CD1 1 
ATOM   475  C CD2 . PHE A 1 70  ? 4.204   -47.358 -37.242 1.00 155.11 ? 70  PHE A CD2 1 
ATOM   476  C CE1 . PHE A 1 70  ? 5.724   -45.080 -36.923 1.00 152.70 ? 70  PHE A CE1 1 
ATOM   477  C CE2 . PHE A 1 70  ? 5.099   -47.268 -36.193 1.00 153.38 ? 70  PHE A CE2 1 
ATOM   478  C CZ  . PHE A 1 70  ? 5.860   -46.127 -36.035 1.00 153.10 ? 70  PHE A CZ  1 
ATOM   479  N N   . CYS A 1 71  ? 1.095   -48.013 -37.979 1.00 142.49 ? 71  CYS A N   1 
ATOM   480  C CA  . CYS A 1 71  ? 0.483   -48.905 -37.001 1.00 147.51 ? 71  CYS A CA  1 
ATOM   481  C C   . CYS A 1 71  ? 1.491   -49.894 -36.429 1.00 146.30 ? 71  CYS A C   1 
ATOM   482  O O   . CYS A 1 71  ? 2.123   -50.646 -37.169 1.00 144.31 ? 71  CYS A O   1 
ATOM   483  C CB  . CYS A 1 71  ? -0.689  -49.659 -37.630 1.00 154.30 ? 71  CYS A CB  1 
ATOM   484  S SG  . CYS A 1 71  ? -2.010  -48.594 -38.255 1.00 239.28 ? 71  CYS A SG  1 
ATOM   485  N N   . ALA A 1 72  ? 1.632   -49.888 -35.107 1.00 150.93 ? 72  ALA A N   1 
ATOM   486  C CA  . ALA A 1 72  ? 2.553   -50.792 -34.427 1.00 155.54 ? 72  ALA A CA  1 
ATOM   487  C C   . ALA A 1 72  ? 2.280   -50.829 -32.926 1.00 156.16 ? 72  ALA A C   1 
ATOM   488  O O   . ALA A 1 72  ? 1.550   -49.989 -32.400 1.00 158.68 ? 72  ALA A O   1 
ATOM   489  C CB  . ALA A 1 72  ? 3.994   -50.383 -34.695 1.00 156.39 ? 72  ALA A CB  1 
ATOM   490  N N   . ALA A 1 73  ? 2.871   -51.804 -32.242 1.00 154.53 ? 73  ALA A N   1 
ATOM   491  C CA  . ALA A 1 73  ? 2.707   -51.937 -30.799 1.00 156.24 ? 73  ALA A CA  1 
ATOM   492  C C   . ALA A 1 73  ? 3.183   -50.678 -30.082 1.00 162.70 ? 73  ALA A C   1 
ATOM   493  O O   . ALA A 1 73  ? 3.740   -49.776 -30.704 1.00 160.19 ? 73  ALA A O   1 
ATOM   494  C CB  . ALA A 1 73  ? 3.455   -53.158 -30.289 1.00 154.46 ? 73  ALA A CB  1 
ATOM   495  N N   . CYS A 1 74  ? 2.964   -50.620 -28.773 1.00 173.25 ? 74  CYS A N   1 
ATOM   496  C CA  . CYS A 1 74  ? 3.318   -49.435 -27.998 1.00 182.16 ? 74  CYS A CA  1 
ATOM   497  C C   . CYS A 1 74  ? 4.831   -49.286 -27.850 1.00 192.73 ? 74  CYS A C   1 
ATOM   498  O O   . CYS A 1 74  ? 5.369   -48.188 -27.988 1.00 198.93 ? 74  CYS A O   1 
ATOM   499  C CB  . CYS A 1 74  ? 2.644   -49.464 -26.624 1.00 183.70 ? 74  CYS A CB  1 
ATOM   500  S SG  . CYS A 1 74  ? 2.552   -47.850 -25.804 1.00 353.13 ? 74  CYS A SG  1 
ATOM   501  N N   . HIS A 1 75  ? 5.512   -50.393 -27.570 1.00 193.76 ? 75  HIS A N   1 
ATOM   502  C CA  . HIS A 1 75  ? 6.964   -50.383 -27.418 1.00 188.48 ? 75  HIS A CA  1 
ATOM   503  C C   . HIS A 1 75  ? 7.663   -49.922 -28.694 1.00 179.56 ? 75  HIS A C   1 
ATOM   504  O O   . HIS A 1 75  ? 8.566   -49.087 -28.651 1.00 178.53 ? 75  HIS A O   1 
ATOM   505  C CB  . HIS A 1 75  ? 7.472   -51.768 -27.012 1.00 192.91 ? 75  HIS A CB  1 
ATOM   506  C CG  . HIS A 1 75  ? 7.182   -52.126 -25.587 1.00 198.16 ? 75  HIS A CG  1 
ATOM   507  N ND1 . HIS A 1 75  ? 5.998   -52.717 -25.192 1.00 201.37 ? 75  HIS A ND1 1 
ATOM   508  C CD2 . HIS A 1 75  ? 7.920   -51.980 -24.464 1.00 197.88 ? 75  HIS A CD2 1 
ATOM   509  C CE1 . HIS A 1 75  ? 6.023   -52.916 -23.890 1.00 202.26 ? 75  HIS A CE1 1 
ATOM   510  N NE2 . HIS A 1 75  ? 7.178   -52.478 -23.419 1.00 200.77 ? 75  HIS A NE2 1 
ATOM   511  N N   . GLY A 1 76  ? 7.241   -50.473 -29.827 1.00 174.16 ? 76  GLY A N   1 
ATOM   512  C CA  . GLY A 1 76  ? 7.826   -50.127 -31.108 1.00 171.51 ? 76  GLY A CA  1 
ATOM   513  C C   . GLY A 1 76  ? 7.467   -48.725 -31.560 1.00 173.13 ? 76  GLY A C   1 
ATOM   514  O O   . GLY A 1 76  ? 8.267   -48.049 -32.205 1.00 172.80 ? 76  GLY A O   1 
ATOM   515  N N   . CYS A 1 77  ? 6.259   -48.288 -31.218 1.00 176.17 ? 77  CYS A N   1 
ATOM   516  C CA  . CYS A 1 77  ? 5.783   -46.963 -31.604 1.00 175.52 ? 77  CYS A CA  1 
ATOM   517  C C   . CYS A 1 77  ? 6.403   -45.873 -30.733 1.00 170.66 ? 77  CYS A C   1 
ATOM   518  O O   . CYS A 1 77  ? 6.604   -44.744 -31.184 1.00 169.34 ? 77  CYS A O   1 
ATOM   519  C CB  . CYS A 1 77  ? 4.255   -46.897 -31.527 1.00 177.85 ? 77  CYS A CB  1 
ATOM   520  S SG  . CYS A 1 77  ? 3.534   -45.358 -32.149 1.00 209.01 ? 77  CYS A SG  1 
ATOM   521  N N   . LEU A 1 78  ? 6.702   -46.216 -29.484 1.00 167.07 ? 78  LEU A N   1 
ATOM   522  C CA  . LEU A 1 78  ? 7.327   -45.273 -28.561 1.00 163.21 ? 78  LEU A CA  1 
ATOM   523  C C   . LEU A 1 78  ? 8.803   -45.070 -28.884 1.00 160.90 ? 78  LEU A C   1 
ATOM   524  O O   . LEU A 1 78  ? 9.290   -43.941 -28.918 1.00 161.04 ? 78  LEU A O   1 
ATOM   525  C CB  . LEU A 1 78  ? 7.172   -45.742 -27.113 1.00 161.38 ? 78  LEU A CB  1 
ATOM   526  C CG  . LEU A 1 78  ? 5.812   -45.519 -26.450 1.00 165.69 ? 78  LEU A CG  1 
ATOM   527  C CD1 . LEU A 1 78  ? 5.812   -46.095 -25.044 1.00 169.02 ? 78  LEU A CD1 1 
ATOM   528  C CD2 . LEU A 1 78  ? 5.467   -44.038 -26.428 1.00 166.06 ? 78  LEU A CD2 1 
ATOM   529  N N   . PHE A 1 79  ? 9.510   -46.170 -29.116 1.00 154.61 ? 79  PHE A N   1 
ATOM   530  C CA  . PHE A 1 79  ? 10.923  -46.102 -29.461 1.00 148.40 ? 79  PHE A CA  1 
ATOM   531  C C   . PHE A 1 79  ? 11.151  -45.206 -30.673 1.00 143.68 ? 79  PHE A C   1 
ATOM   532  O O   . PHE A 1 79  ? 12.058  -44.375 -30.681 1.00 149.13 ? 79  PHE A O   1 
ATOM   533  C CB  . PHE A 1 79  ? 11.484  -47.496 -29.740 1.00 152.51 ? 79  PHE A CB  1 
ATOM   534  C CG  . PHE A 1 79  ? 12.882  -47.484 -30.287 1.00 157.37 ? 79  PHE A CG  1 
ATOM   535  C CD1 . PHE A 1 79  ? 13.971  -47.406 -29.438 1.00 153.16 ? 79  PHE A CD1 1 
ATOM   536  C CD2 . PHE A 1 79  ? 13.108  -47.544 -31.653 1.00 158.89 ? 79  PHE A CD2 1 
ATOM   537  C CE1 . PHE A 1 79  ? 15.258  -47.392 -29.938 1.00 148.09 ? 79  PHE A CE1 1 
ATOM   538  C CE2 . PHE A 1 79  ? 14.393  -47.528 -32.158 1.00 154.63 ? 79  PHE A CE2 1 
ATOM   539  C CZ  . PHE A 1 79  ? 15.469  -47.453 -31.300 1.00 149.31 ? 79  PHE A CZ  1 
ATOM   540  N N   . ILE A 1 80  ? 10.324  -45.386 -31.697 1.00 132.76 ? 80  ILE A N   1 
ATOM   541  C CA  . ILE A 1 80  ? 10.447  -44.606 -32.922 1.00 127.56 ? 80  ILE A CA  1 
ATOM   542  C C   . ILE A 1 80  ? 10.167  -43.126 -32.678 1.00 138.37 ? 80  ILE A C   1 
ATOM   543  O O   . ILE A 1 80  ? 10.760  -42.258 -33.319 1.00 140.60 ? 80  ILE A O   1 
ATOM   544  C CB  . ILE A 1 80  ? 9.512   -45.138 -34.028 1.00 111.08 ? 80  ILE A CB  1 
ATOM   545  C CG1 . ILE A 1 80  ? 9.990   -46.509 -34.511 1.00 102.17 ? 80  ILE A CG1 1 
ATOM   546  C CG2 . ILE A 1 80  ? 9.448   -44.162 -35.194 1.00 105.15 ? 80  ILE A CG2 1 
ATOM   547  C CD1 . ILE A 1 80  ? 9.199   -47.055 -35.679 1.00 100.37 ? 80  ILE A CD1 1 
ATOM   548  N N   . ALA A 1 81  ? 9.272   -42.844 -31.737 1.00 145.80 ? 81  ALA A N   1 
ATOM   549  C CA  . ALA A 1 81  ? 8.877   -41.470 -31.447 1.00 150.87 ? 81  ALA A CA  1 
ATOM   550  C C   . ALA A 1 81  ? 9.773   -40.811 -30.400 1.00 149.68 ? 81  ALA A C   1 
ATOM   551  O O   . ALA A 1 81  ? 9.918   -39.589 -30.378 1.00 150.76 ? 81  ALA A O   1 
ATOM   552  C CB  . ALA A 1 81  ? 7.422   -41.422 -31.005 1.00 155.95 ? 81  ALA A CB  1 
ATOM   553  N N   . CYS A 1 82  ? 10.376  -41.623 -29.538 1.00 149.47 ? 82  CYS A N   1 
ATOM   554  C CA  . CYS A 1 82  ? 11.171  -41.102 -28.430 1.00 156.12 ? 82  CYS A CA  1 
ATOM   555  C C   . CYS A 1 82  ? 12.671  -41.253 -28.664 1.00 158.71 ? 82  CYS A C   1 
ATOM   556  O O   . CYS A 1 82  ? 13.479  -40.865 -27.820 1.00 156.77 ? 82  CYS A O   1 
ATOM   557  C CB  . CYS A 1 82  ? 10.776  -41.789 -27.121 1.00 158.99 ? 82  CYS A CB  1 
ATOM   558  S SG  . CYS A 1 82  ? 9.028   -41.622 -26.688 1.00 185.41 ? 82  CYS A SG  1 
ATOM   559  N N   . PHE A 1 83  ? 13.039  -41.820 -29.807 1.00 159.25 ? 83  PHE A N   1 
ATOM   560  C CA  . PHE A 1 83  ? 14.447  -42.009 -30.139 1.00 154.60 ? 83  PHE A CA  1 
ATOM   561  C C   . PHE A 1 83  ? 15.144  -40.666 -30.332 1.00 147.95 ? 83  PHE A C   1 
ATOM   562  O O   . PHE A 1 83  ? 16.338  -40.530 -30.066 1.00 146.23 ? 83  PHE A O   1 
ATOM   563  C CB  . PHE A 1 83  ? 14.596  -42.871 -31.394 1.00 154.83 ? 83  PHE A CB  1 
ATOM   564  C CG  . PHE A 1 83  ? 16.024  -43.124 -31.790 1.00 154.05 ? 83  PHE A CG  1 
ATOM   565  C CD1 . PHE A 1 83  ? 16.760  -44.126 -31.179 1.00 150.78 ? 83  PHE A CD1 1 
ATOM   566  C CD2 . PHE A 1 83  ? 16.630  -42.361 -32.774 1.00 149.45 ? 83  PHE A CD2 1 
ATOM   567  C CE1 . PHE A 1 83  ? 18.072  -44.360 -31.540 1.00 142.46 ? 83  PHE A CE1 1 
ATOM   568  C CE2 . PHE A 1 83  ? 17.942  -42.590 -33.140 1.00 141.87 ? 83  PHE A CE2 1 
ATOM   569  C CZ  . PHE A 1 83  ? 18.663  -43.592 -32.525 1.00 139.24 ? 83  PHE A CZ  1 
ATOM   570  N N   . VAL A 1 84  ? 14.388  -39.676 -30.797 1.00 141.86 ? 84  VAL A N   1 
ATOM   571  C CA  . VAL A 1 84  ? 14.923  -38.337 -31.015 1.00 136.52 ? 84  VAL A CA  1 
ATOM   572  C C   . VAL A 1 84  ? 15.221  -37.648 -29.687 1.00 126.16 ? 84  VAL A C   1 
ATOM   573  O O   . VAL A 1 84  ? 16.104  -36.794 -29.603 1.00 122.48 ? 84  VAL A O   1 
ATOM   574  C CB  . VAL A 1 84  ? 13.949  -37.469 -31.840 1.00 144.34 ? 84  VAL A CB  1 
ATOM   575  C CG1 . VAL A 1 84  ? 12.597  -37.374 -31.146 1.00 144.25 ? 84  VAL A CG1 1 
ATOM   576  C CG2 . VAL A 1 84  ? 14.534  -36.085 -32.079 1.00 149.54 ? 84  VAL A CG2 1 
ATOM   577  N N   . LEU A 1 85  ? 14.482  -38.027 -28.650 1.00 123.61 ? 85  LEU A N   1 
ATOM   578  C CA  . LEU A 1 85  ? 14.679  -37.460 -27.322 1.00 124.39 ? 85  LEU A CA  1 
ATOM   579  C C   . LEU A 1 85  ? 15.999  -37.932 -26.725 1.00 121.52 ? 85  LEU A C   1 
ATOM   580  O O   . LEU A 1 85  ? 16.586  -37.258 -25.880 1.00 113.94 ? 85  LEU A O   1 
ATOM   581  C CB  . LEU A 1 85  ? 13.520  -37.841 -26.401 1.00 126.89 ? 85  LEU A CB  1 
ATOM   582  C CG  . LEU A 1 85  ? 12.124  -37.450 -26.885 1.00 127.08 ? 85  LEU A CG  1 
ATOM   583  C CD1 . LEU A 1 85  ? 11.064  -37.928 -25.907 1.00 130.93 ? 85  LEU A CD1 1 
ATOM   584  C CD2 . LEU A 1 85  ? 12.028  -35.946 -27.091 1.00 125.19 ? 85  LEU A CD2 1 
ATOM   585  N N   . VAL A 1 86  ? 16.459  -39.096 -27.172 1.00 128.19 ? 86  VAL A N   1 
ATOM   586  C CA  . VAL A 1 86  ? 17.719  -39.658 -26.700 1.00 129.76 ? 86  VAL A CA  1 
ATOM   587  C C   . VAL A 1 86  ? 18.909  -38.908 -27.292 1.00 125.76 ? 86  VAL A C   1 
ATOM   588  O O   . VAL A 1 86  ? 19.843  -38.543 -26.577 1.00 122.75 ? 86  VAL A O   1 
ATOM   589  C CB  . VAL A 1 86  ? 17.837  -41.155 -27.049 1.00 129.97 ? 86  VAL A CB  1 
ATOM   590  C CG1 . VAL A 1 86  ? 19.171  -41.707 -26.569 1.00 137.29 ? 86  VAL A CG1 1 
ATOM   591  C CG2 . VAL A 1 86  ? 16.684  -41.934 -26.440 1.00 127.87 ? 86  VAL A CG2 1 
ATOM   592  N N   . LEU A 1 87  ? 18.868  -38.681 -28.602 1.00 121.93 ? 87  LEU A N   1 
ATOM   593  C CA  . LEU A 1 87  ? 19.931  -37.955 -29.286 1.00 113.12 ? 87  LEU A CA  1 
ATOM   594  C C   . LEU A 1 87  ? 19.981  -36.504 -28.824 1.00 118.67 ? 87  LEU A C   1 
ATOM   595  O O   . LEU A 1 87  ? 21.058  -35.935 -28.648 1.00 128.31 ? 87  LEU A O   1 
ATOM   596  C CB  . LEU A 1 87  ? 19.739  -38.015 -30.803 1.00 100.13 ? 87  LEU A CB  1 
ATOM   597  C CG  . LEU A 1 87  ? 19.739  -39.407 -31.437 1.00 96.81  ? 87  LEU A CG  1 
ATOM   598  C CD1 . LEU A 1 87  ? 19.642  -39.302 -32.950 1.00 91.75  ? 87  LEU A CD1 1 
ATOM   599  C CD2 . LEU A 1 87  ? 20.983  -40.182 -31.035 1.00 100.31 ? 87  LEU A CD2 1 
ATOM   600  N N   . ALA A 1 88  ? 18.809  -35.912 -28.628 1.00 118.02 ? 88  ALA A N   1 
ATOM   601  C CA  . ALA A 1 88  ? 18.718  -34.529 -28.178 1.00 121.14 ? 88  ALA A CA  1 
ATOM   602  C C   . ALA A 1 88  ? 19.201  -34.386 -26.739 1.00 121.69 ? 88  ALA A C   1 
ATOM   603  O O   . ALA A 1 88  ? 19.760  -33.356 -26.362 1.00 119.60 ? 88  ALA A O   1 
ATOM   604  C CB  . ALA A 1 88  ? 17.292  -34.020 -28.313 1.00 125.52 ? 88  ALA A CB  1 
ATOM   605  N N   . GLN A 1 89  ? 18.985  -35.425 -25.938 1.00 125.37 ? 89  GLN A N   1 
ATOM   606  C CA  . GLN A 1 89  ? 19.380  -35.400 -24.534 1.00 133.20 ? 89  GLN A CA  1 
ATOM   607  C C   . GLN A 1 89  ? 20.875  -35.652 -24.367 1.00 137.24 ? 89  GLN A C   1 
ATOM   608  O O   . GLN A 1 89  ? 21.523  -35.045 -23.514 1.00 137.31 ? 89  GLN A O   1 
ATOM   609  C CB  . GLN A 1 89  ? 18.580  -36.427 -23.730 1.00 137.86 ? 89  GLN A CB  1 
ATOM   610  C CG  . GLN A 1 89  ? 18.851  -36.390 -22.234 1.00 141.56 ? 89  GLN A CG  1 
ATOM   611  C CD  . GLN A 1 89  ? 18.444  -35.074 -21.598 1.00 142.35 ? 89  GLN A CD  1 
ATOM   612  O OE1 . GLN A 1 89  ? 17.785  -34.244 -22.226 1.00 142.06 ? 89  GLN A OE1 1 
ATOM   613  N NE2 . GLN A 1 89  ? 18.833  -34.878 -20.344 1.00 141.97 ? 89  GLN A NE2 1 
ATOM   614  N N   . SER A 1 90  ? 21.416  -36.552 -25.182 1.00 141.37 ? 90  SER A N   1 
ATOM   615  C CA  . SER A 1 90  ? 22.843  -36.853 -25.142 1.00 139.61 ? 90  SER A CA  1 
ATOM   616  C C   . SER A 1 90  ? 23.657  -35.620 -25.511 1.00 126.87 ? 90  SER A C   1 
ATOM   617  O O   . SER A 1 90  ? 24.702  -35.352 -24.919 1.00 117.24 ? 90  SER A O   1 
ATOM   618  C CB  . SER A 1 90  ? 23.178  -38.010 -26.085 1.00 140.47 ? 90  SER A CB  1 
ATOM   619  O OG  . SER A 1 90  ? 24.557  -38.329 -26.030 1.00 138.00 ? 90  SER A OG  1 
ATOM   620  N N   . SER A 1 91  ? 23.166  -34.872 -26.494 1.00 122.65 ? 91  SER A N   1 
ATOM   621  C CA  . SER A 1 91  ? 23.813  -33.636 -26.914 1.00 115.11 ? 91  SER A CA  1 
ATOM   622  C C   . SER A 1 91  ? 23.881  -32.653 -25.752 1.00 116.36 ? 91  SER A C   1 
ATOM   623  O O   . SER A 1 91  ? 24.815  -31.859 -25.653 1.00 113.09 ? 91  SER A O   1 
ATOM   624  C CB  . SER A 1 91  ? 23.062  -33.009 -28.091 1.00 105.46 ? 91  SER A CB  1 
ATOM   625  O OG  . SER A 1 91  ? 23.068  -33.869 -29.217 1.00 97.18  ? 91  SER A OG  1 
ATOM   626  N N   . ILE A 1 92  ? 22.885  -32.716 -24.875 1.00 123.00 ? 92  ILE A N   1 
ATOM   627  C CA  . ILE A 1 92  ? 22.844  -31.857 -23.699 1.00 130.55 ? 92  ILE A CA  1 
ATOM   628  C C   . ILE A 1 92  ? 24.032  -32.127 -22.783 1.00 132.61 ? 92  ILE A C   1 
ATOM   629  O O   . ILE A 1 92  ? 24.731  -31.203 -22.369 1.00 131.87 ? 92  ILE A O   1 
ATOM   630  C CB  . ILE A 1 92  ? 21.539  -32.049 -22.906 1.00 131.82 ? 92  ILE A CB  1 
ATOM   631  C CG1 . ILE A 1 92  ? 20.341  -31.581 -23.733 1.00 128.96 ? 92  ILE A CG1 1 
ATOM   632  C CG2 . ILE A 1 92  ? 21.599  -31.294 -21.588 1.00 133.65 ? 92  ILE A CG2 1 
ATOM   633  C CD1 . ILE A 1 92  ? 20.383  -30.111 -24.082 1.00 125.12 ? 92  ILE A CD1 1 
ATOM   634  N N   . PHE A 1 93  ? 24.255  -33.400 -22.472 1.00 134.37 ? 93  PHE A N   1 
ATOM   635  C CA  . PHE A 1 93  ? 25.351  -33.792 -21.594 1.00 139.61 ? 93  PHE A CA  1 
ATOM   636  C C   . PHE A 1 93  ? 26.711  -33.495 -22.219 1.00 136.58 ? 93  PHE A C   1 
ATOM   637  O O   . PHE A 1 93  ? 27.643  -33.081 -21.529 1.00 131.17 ? 93  PHE A O   1 
ATOM   638  C CB  . PHE A 1 93  ? 25.250  -35.276 -21.241 1.00 142.69 ? 93  PHE A CB  1 
ATOM   639  C CG  . PHE A 1 93  ? 24.000  -35.638 -20.494 1.00 141.52 ? 93  PHE A CG  1 
ATOM   640  C CD1 . PHE A 1 93  ? 23.871  -35.339 -19.148 1.00 141.20 ? 93  PHE A CD1 1 
ATOM   641  C CD2 . PHE A 1 93  ? 22.957  -36.284 -21.135 1.00 138.20 ? 93  PHE A CD2 1 
ATOM   642  C CE1 . PHE A 1 93  ? 22.722  -35.673 -18.458 1.00 139.97 ? 93  PHE A CE1 1 
ATOM   643  C CE2 . PHE A 1 93  ? 21.806  -36.621 -20.450 1.00 139.05 ? 93  PHE A CE2 1 
ATOM   644  C CZ  . PHE A 1 93  ? 21.688  -36.316 -19.110 1.00 141.06 ? 93  PHE A CZ  1 
ATOM   645  N N   . SER A 1 94  ? 26.818  -33.712 -23.526 1.00 136.82 ? 94  SER A N   1 
ATOM   646  C CA  . SER A 1 94  ? 28.058  -33.449 -24.247 1.00 128.46 ? 94  SER A CA  1 
ATOM   647  C C   . SER A 1 94  ? 28.388  -31.959 -24.254 1.00 132.67 ? 94  SER A C   1 
ATOM   648  O O   . SER A 1 94  ? 29.519  -31.563 -23.970 1.00 133.56 ? 94  SER A O   1 
ATOM   649  C CB  . SER A 1 94  ? 27.973  -33.977 -25.681 1.00 114.62 ? 94  SER A CB  1 
ATOM   650  O OG  . SER A 1 94  ? 27.813  -35.385 -25.699 1.00 107.37 ? 94  SER A OG  1 
ATOM   651  N N   . LEU A 1 95  ? 27.394  -31.137 -24.577 1.00 133.24 ? 95  LEU A N   1 
ATOM   652  C CA  . LEU A 1 95  ? 27.577  -29.691 -24.603 1.00 130.49 ? 95  LEU A CA  1 
ATOM   653  C C   . LEU A 1 95  ? 27.866  -29.143 -23.209 1.00 127.82 ? 95  LEU A C   1 
ATOM   654  O O   . LEU A 1 95  ? 28.638  -28.198 -23.052 1.00 124.24 ? 95  LEU A O   1 
ATOM   655  C CB  . LEU A 1 95  ? 26.347  -29.000 -25.200 1.00 127.02 ? 95  LEU A CB  1 
ATOM   656  C CG  . LEU A 1 95  ? 26.065  -29.249 -26.683 1.00 123.99 ? 95  LEU A CG  1 
ATOM   657  C CD1 . LEU A 1 95  ? 24.783  -28.548 -27.111 1.00 123.05 ? 95  LEU A CD1 1 
ATOM   658  C CD2 . LEU A 1 95  ? 27.238  -28.798 -27.539 1.00 125.90 ? 95  LEU A CD2 1 
ATOM   659  N N   . LEU A 1 96  ? 27.242  -29.744 -22.200 1.00 127.52 ? 96  LEU A N   1 
ATOM   660  C CA  . LEU A 1 96  ? 27.443  -29.326 -20.818 1.00 131.00 ? 96  LEU A CA  1 
ATOM   661  C C   . LEU A 1 96  ? 28.842  -29.695 -20.336 1.00 127.88 ? 96  LEU A C   1 
ATOM   662  O O   . LEU A 1 96  ? 29.483  -28.927 -19.619 1.00 127.75 ? 96  LEU A O   1 
ATOM   663  C CB  . LEU A 1 96  ? 26.388  -29.956 -19.908 1.00 138.16 ? 96  LEU A CB  1 
ATOM   664  C CG  . LEU A 1 96  ? 26.478  -29.626 -18.417 1.00 145.42 ? 96  LEU A CG  1 
ATOM   665  C CD1 . LEU A 1 96  ? 26.475  -28.122 -18.188 1.00 146.65 ? 96  LEU A CD1 1 
ATOM   666  C CD2 . LEU A 1 96  ? 25.341  -30.287 -17.650 1.00 147.50 ? 96  LEU A CD2 1 
ATOM   667  N N   . ALA A 1 97  ? 29.310  -30.873 -20.736 1.00 126.74 ? 97  ALA A N   1 
ATOM   668  C CA  . ALA A 1 97  ? 30.643  -31.334 -20.366 1.00 125.12 ? 97  ALA A CA  1 
ATOM   669  C C   . ALA A 1 97  ? 31.718  -30.452 -20.990 1.00 121.27 ? 97  ALA A C   1 
ATOM   670  O O   . ALA A 1 97  ? 32.683  -30.072 -20.329 1.00 118.16 ? 97  ALA A O   1 
ATOM   671  C CB  . ALA A 1 97  ? 30.835  -32.783 -20.780 1.00 124.04 ? 97  ALA A CB  1 
ATOM   672  N N   . ILE A 1 98  ? 31.545  -30.131 -22.268 1.00 119.49 ? 98  ILE A N   1 
ATOM   673  C CA  . ILE A 1 98  ? 32.483  -29.264 -22.972 1.00 118.00 ? 98  ILE A CA  1 
ATOM   674  C C   . ILE A 1 98  ? 32.567  -27.895 -22.305 1.00 120.90 ? 98  ILE A C   1 
ATOM   675  O O   . ILE A 1 98  ? 33.649  -27.325 -22.170 1.00 120.75 ? 98  ILE A O   1 
ATOM   676  C CB  . ILE A 1 98  ? 32.094  -29.091 -24.453 1.00 115.02 ? 98  ILE A CB  1 
ATOM   677  C CG1 . ILE A 1 98  ? 32.214  -30.425 -25.193 1.00 112.11 ? 98  ILE A CG1 1 
ATOM   678  C CG2 . ILE A 1 98  ? 32.967  -28.040 -25.116 1.00 114.50 ? 98  ILE A CG2 1 
ATOM   679  C CD1 . ILE A 1 98  ? 31.926  -30.331 -26.674 1.00 109.95 ? 98  ILE A CD1 1 
ATOM   680  N N   . ALA A 1 99  ? 31.418  -27.373 -21.886 1.00 129.76 ? 99  ALA A N   1 
ATOM   681  C CA  . ALA A 1 99  ? 31.371  -26.092 -21.194 1.00 139.34 ? 99  ALA A CA  1 
ATOM   682  C C   . ALA A 1 99  ? 32.165  -26.160 -19.894 1.00 145.45 ? 99  ALA A C   1 
ATOM   683  O O   . ALA A 1 99  ? 33.000  -25.299 -19.617 1.00 149.99 ? 99  ALA A O   1 
ATOM   684  C CB  . ALA A 1 99  ? 29.931  -25.690 -20.918 1.00 139.76 ? 99  ALA A CB  1 
ATOM   685  N N   . ILE A 1 100 ? 31.893  -27.190 -19.099 1.00 143.77 ? 100 ILE A N   1 
ATOM   686  C CA  . ILE A 1 100 ? 32.605  -27.402 -17.845 1.00 143.26 ? 100 ILE A CA  1 
ATOM   687  C C   . ILE A 1 100 ? 34.099  -27.553 -18.100 1.00 141.07 ? 100 ILE A C   1 
ATOM   688  O O   . ILE A 1 100 ? 34.924  -26.976 -17.392 1.00 142.71 ? 100 ILE A O   1 
ATOM   689  C CB  . ILE A 1 100 ? 32.096  -28.660 -17.115 1.00 139.97 ? 100 ILE A CB  1 
ATOM   690  C CG1 . ILE A 1 100 ? 30.610  -28.519 -16.778 1.00 131.56 ? 100 ILE A CG1 1 
ATOM   691  C CG2 . ILE A 1 100 ? 32.913  -28.914 -15.857 1.00 142.62 ? 100 ILE A CG2 1 
ATOM   692  C CD1 . ILE A 1 100 ? 30.009  -29.742 -16.123 1.00 123.81 ? 100 ILE A CD1 1 
ATOM   693  N N   . ASP A 1 101 ? 34.436  -28.338 -19.119 1.00 136.72 ? 101 ASP A N   1 
ATOM   694  C CA  . ASP A 1 101 ? 35.825  -28.572 -19.496 1.00 131.28 ? 101 ASP A CA  1 
ATOM   695  C C   . ASP A 1 101 ? 36.550  -27.267 -19.808 1.00 123.36 ? 101 ASP A C   1 
ATOM   696  O O   . ASP A 1 101 ? 37.605  -26.980 -19.241 1.00 112.13 ? 101 ASP A O   1 
ATOM   697  C CB  . ASP A 1 101 ? 35.894  -29.505 -20.705 1.00 128.47 ? 101 ASP A CB  1 
ATOM   698  C CG  . ASP A 1 101 ? 37.306  -29.691 -21.214 1.00 128.70 ? 101 ASP A CG  1 
ATOM   699  O OD1 . ASP A 1 101 ? 38.207  -29.953 -20.389 1.00 137.00 ? 101 ASP A OD1 1 
ATOM   700  O OD2 . ASP A 1 101 ? 37.512  -29.579 -22.440 1.00 122.53 ? 101 ASP A OD2 1 
ATOM   701  N N   . ARG A 1 102 ? 35.980  -26.480 -20.714 1.00 128.42 ? 102 ARG A N   1 
ATOM   702  C CA  . ARG A 1 102 ? 36.576  -25.208 -21.108 1.00 132.31 ? 102 ARG A CA  1 
ATOM   703  C C   . ARG A 1 102 ? 36.663  -24.245 -19.930 1.00 133.59 ? 102 ARG A C   1 
ATOM   704  O O   . ARG A 1 102 ? 37.409  -23.267 -19.971 1.00 136.98 ? 102 ARG A O   1 
ATOM   705  C CB  . ARG A 1 102 ? 35.791  -24.577 -22.260 1.00 136.42 ? 102 ARG A CB  1 
ATOM   706  C CG  . ARG A 1 102 ? 35.817  -25.380 -23.554 1.00 140.64 ? 102 ARG A CG  1 
ATOM   707  C CD  . ARG A 1 102 ? 37.209  -25.416 -24.174 1.00 147.34 ? 102 ARG A CD  1 
ATOM   708  N NE  . ARG A 1 102 ? 38.148  -26.223 -23.400 1.00 154.53 ? 102 ARG A NE  1 
ATOM   709  C CZ  . ARG A 1 102 ? 39.439  -26.353 -23.690 1.00 160.93 ? 102 ARG A CZ  1 
ATOM   710  N NH1 . ARG A 1 102 ? 39.949  -25.725 -24.740 1.00 163.51 ? 102 ARG A NH1 1 
ATOM   711  N NH2 . ARG A 1 102 ? 40.220  -27.108 -22.929 1.00 162.09 ? 102 ARG A NH2 1 
ATOM   712  N N   . TYR A 1 103 ? 35.897  -24.527 -18.882 1.00 134.14 ? 103 TYR A N   1 
ATOM   713  C CA  . TYR A 1 103 ? 35.950  -23.728 -17.665 1.00 140.93 ? 103 TYR A CA  1 
ATOM   714  C C   . TYR A 1 103 ? 37.099  -24.181 -16.773 1.00 147.43 ? 103 TYR A C   1 
ATOM   715  O O   . TYR A 1 103 ? 37.843  -23.360 -16.239 1.00 150.64 ? 103 TYR A O   1 
ATOM   716  C CB  . TYR A 1 103 ? 34.629  -23.815 -16.899 1.00 141.26 ? 103 TYR A CB  1 
ATOM   717  C CG  . TYR A 1 103 ? 34.656  -23.095 -15.570 1.00 150.07 ? 103 TYR A CG  1 
ATOM   718  C CD1 . TYR A 1 103 ? 34.424  -21.728 -15.496 1.00 155.78 ? 103 TYR A CD1 1 
ATOM   719  C CD2 . TYR A 1 103 ? 34.922  -23.780 -14.390 1.00 154.53 ? 103 TYR A CD2 1 
ATOM   720  C CE1 . TYR A 1 103 ? 34.451  -21.063 -14.285 1.00 162.98 ? 103 TYR A CE1 1 
ATOM   721  C CE2 . TYR A 1 103 ? 34.951  -23.123 -13.174 1.00 161.46 ? 103 TYR A CE2 1 
ATOM   722  C CZ  . TYR A 1 103 ? 34.716  -21.765 -13.127 1.00 166.40 ? 103 TYR A CZ  1 
ATOM   723  O OH  . TYR A 1 103 ? 34.743  -21.106 -11.919 1.00 171.46 ? 103 TYR A OH  1 
ATOM   724  N N   . ILE A 1 104 ? 37.236  -25.494 -16.617 1.00 150.05 ? 104 ILE A N   1 
ATOM   725  C CA  . ILE A 1 104 ? 38.290  -26.067 -15.787 1.00 152.69 ? 104 ILE A CA  1 
ATOM   726  C C   . ILE A 1 104 ? 39.673  -25.647 -16.276 1.00 148.14 ? 104 ILE A C   1 
ATOM   727  O O   . ILE A 1 104 ? 40.572  -25.382 -15.477 1.00 144.29 ? 104 ILE A O   1 
ATOM   728  C CB  . ILE A 1 104 ? 38.211  -27.606 -15.763 1.00 155.56 ? 104 ILE A CB  1 
ATOM   729  C CG1 . ILE A 1 104 ? 36.838  -28.062 -15.262 1.00 158.39 ? 104 ILE A CG1 1 
ATOM   730  C CG2 . ILE A 1 104 ? 39.321  -28.186 -14.898 1.00 156.07 ? 104 ILE A CG2 1 
ATOM   731  C CD1 . ILE A 1 104 ? 36.650  -29.563 -15.268 1.00 158.65 ? 104 ILE A CD1 1 
ATOM   732  N N   . ALA A 1 105 ? 39.834  -25.586 -17.594 1.00 144.07 ? 105 ALA A N   1 
ATOM   733  C CA  . ALA A 1 105 ? 41.109  -25.219 -18.199 1.00 136.53 ? 105 ALA A CA  1 
ATOM   734  C C   . ALA A 1 105 ? 41.518  -23.796 -17.836 1.00 143.26 ? 105 ALA A C   1 
ATOM   735  O O   . ALA A 1 105 ? 42.633  -23.561 -17.370 1.00 156.86 ? 105 ALA A O   1 
ATOM   736  C CB  . ALA A 1 105 ? 41.045  -25.385 -19.710 1.00 124.85 ? 105 ALA A CB  1 
ATOM   737  N N   . ILE A 1 106 ? 40.612  -22.848 -18.050 1.00 137.23 ? 106 ILE A N   1 
ATOM   738  C CA  . ILE A 1 106 ? 40.899  -21.444 -17.779 1.00 142.83 ? 106 ILE A CA  1 
ATOM   739  C C   . ILE A 1 106 ? 40.896  -21.135 -16.283 1.00 151.07 ? 106 ILE A C   1 
ATOM   740  O O   . ILE A 1 106 ? 41.718  -20.355 -15.800 1.00 154.96 ? 106 ILE A O   1 
ATOM   741  C CB  . ILE A 1 106 ? 39.905  -20.516 -18.505 1.00 139.93 ? 106 ILE A CB  1 
ATOM   742  C CG1 . ILE A 1 106 ? 40.049  -20.674 -20.020 1.00 136.34 ? 106 ILE A CG1 1 
ATOM   743  C CG2 . ILE A 1 106 ? 40.129  -19.068 -18.098 1.00 144.89 ? 106 ILE A CG2 1 
ATOM   744  C CD1 . ILE A 1 106 ? 39.194  -19.715 -20.818 1.00 137.00 ? 106 ILE A CD1 1 
ATOM   745  N N   . ALA A 1 107 ? 39.973  -21.753 -15.553 1.00 155.17 ? 107 ALA A N   1 
ATOM   746  C CA  . ALA A 1 107 ? 39.875  -21.544 -14.113 1.00 164.42 ? 107 ALA A CA  1 
ATOM   747  C C   . ALA A 1 107 ? 41.093  -22.109 -13.391 1.00 170.03 ? 107 ALA A C   1 
ATOM   748  O O   . ALA A 1 107 ? 41.833  -21.375 -12.734 1.00 172.52 ? 107 ALA A O   1 
ATOM   749  C CB  . ALA A 1 107 ? 38.597  -22.166 -13.569 1.00 165.19 ? 107 ALA A CB  1 
ATOM   750  N N   . ILE A 1 108 ? 41.298  -23.416 -13.518 1.00 173.34 ? 108 ILE A N   1 
ATOM   751  C CA  . ILE A 1 108 ? 42.428  -24.077 -12.877 1.00 180.49 ? 108 ILE A CA  1 
ATOM   752  C C   . ILE A 1 108 ? 43.242  -24.869 -13.897 1.00 181.24 ? 108 ILE A C   1 
ATOM   753  O O   . ILE A 1 108 ? 43.088  -26.085 -14.013 1.00 182.09 ? 108 ILE A O   1 
ATOM   754  C CB  . ILE A 1 108 ? 41.963  -25.027 -11.758 1.00 182.22 ? 108 ILE A CB  1 
ATOM   755  C CG1 . ILE A 1 108 ? 40.849  -24.378 -10.933 1.00 179.36 ? 108 ILE A CG1 1 
ATOM   756  C CG2 . ILE A 1 108 ? 43.137  -25.424 -10.875 1.00 185.04 ? 108 ILE A CG2 1 
ATOM   757  C CD1 . ILE A 1 108 ? 40.282  -25.275 -9.857  1.00 176.88 ? 108 ILE A CD1 1 
ATOM   758  N N   . PRO A 1 109 ? 44.116  -24.174 -14.641 1.00 176.55 ? 109 PRO A N   1 
ATOM   759  C CA  . PRO A 1 109 ? 44.925  -24.787 -15.702 1.00 175.78 ? 109 PRO A CA  1 
ATOM   760  C C   . PRO A 1 109 ? 45.794  -25.930 -15.187 1.00 181.61 ? 109 PRO A C   1 
ATOM   761  O O   . PRO A 1 109 ? 45.988  -26.920 -15.893 1.00 178.05 ? 109 PRO A O   1 
ATOM   762  C CB  . PRO A 1 109 ? 45.810  -23.629 -16.186 1.00 172.12 ? 109 PRO A CB  1 
ATOM   763  C CG  . PRO A 1 109 ? 45.729  -22.588 -15.111 1.00 172.60 ? 109 PRO A CG  1 
ATOM   764  C CD  . PRO A 1 109 ? 44.371  -22.731 -14.518 1.00 172.81 ? 109 PRO A CD  1 
ATOM   765  N N   . LEU A 1 110 ? 46.305  -25.792 -13.969 1.00 191.21 ? 110 LEU A N   1 
ATOM   766  C CA  . LEU A 1 110 ? 47.183  -26.801 -13.387 1.00 197.61 ? 110 LEU A CA  1 
ATOM   767  C C   . LEU A 1 110 ? 46.440  -28.101 -13.104 1.00 197.63 ? 110 LEU A C   1 
ATOM   768  O O   . LEU A 1 110 ? 46.804  -29.162 -13.612 1.00 196.44 ? 110 LEU A O   1 
ATOM   769  C CB  . LEU A 1 110 ? 47.823  -26.272 -12.102 1.00 201.92 ? 110 LEU A CB  1 
ATOM   770  C CG  . LEU A 1 110 ? 48.711  -25.038 -12.267 1.00 206.25 ? 110 LEU A CG  1 
ATOM   771  C CD1 . LEU A 1 110 ? 49.224  -24.559 -10.919 1.00 210.74 ? 110 LEU A CD1 1 
ATOM   772  C CD2 . LEU A 1 110 ? 49.865  -25.335 -13.212 1.00 207.82 ? 110 LEU A CD2 1 
ATOM   773  N N   . ARG A 1 111 ? 45.397  -28.012 -12.287 1.00 197.64 ? 111 ARG A N   1 
ATOM   774  C CA  . ARG A 1 111 ? 44.610  -29.185 -11.926 1.00 197.87 ? 111 ARG A CA  1 
ATOM   775  C C   . ARG A 1 111 ? 43.825  -29.722 -13.119 1.00 194.40 ? 111 ARG A C   1 
ATOM   776  O O   . ARG A 1 111 ? 43.229  -30.797 -13.044 1.00 198.14 ? 111 ARG A O   1 
ATOM   777  C CB  . ARG A 1 111 ? 43.656  -28.859 -10.776 1.00 203.15 ? 111 ARG A CB  1 
ATOM   778  C CG  . ARG A 1 111 ? 44.352  -28.515 -9.469  1.00 210.39 ? 111 ARG A CG  1 
ATOM   779  C CD  . ARG A 1 111 ? 45.190  -29.684 -8.972  1.00 216.52 ? 111 ARG A CD  1 
ATOM   780  N NE  . ARG A 1 111 ? 44.406  -30.914 -8.874  1.00 219.64 ? 111 ARG A NE  1 
ATOM   781  C CZ  . ARG A 1 111 ? 43.632  -31.230 -7.840  1.00 223.95 ? 111 ARG A CZ  1 
ATOM   782  N NH1 . ARG A 1 111 ? 43.531  -30.404 -6.807  1.00 228.61 ? 111 ARG A NH1 1 
ATOM   783  N NH2 . ARG A 1 111 ? 42.954  -32.369 -7.838  1.00 221.89 ? 111 ARG A NH2 1 
ATOM   784  N N   . TYR A 1 112 ? 43.824  -28.971 -14.217 1.00 188.64 ? 112 TYR A N   1 
ATOM   785  C CA  . TYR A 1 112 ? 43.106  -29.378 -15.421 1.00 182.83 ? 112 TYR A CA  1 
ATOM   786  C C   . TYR A 1 112 ? 43.533  -30.765 -15.886 1.00 179.27 ? 112 TYR A C   1 
ATOM   787  O O   . TYR A 1 112 ? 42.696  -31.634 -16.124 1.00 176.46 ? 112 TYR A O   1 
ATOM   788  C CB  . TYR A 1 112 ? 43.312  -28.361 -16.546 1.00 181.27 ? 112 TYR A CB  1 
ATOM   789  C CG  . TYR A 1 112 ? 42.765  -28.809 -17.884 1.00 176.95 ? 112 TYR A CG  1 
ATOM   790  C CD1 . TYR A 1 112 ? 43.580  -29.442 -18.815 1.00 176.19 ? 112 TYR A CD1 1 
ATOM   791  C CD2 . TYR A 1 112 ? 41.433  -28.601 -18.216 1.00 172.08 ? 112 TYR A CD2 1 
ATOM   792  C CE1 . TYR A 1 112 ? 43.084  -29.853 -20.039 1.00 171.37 ? 112 TYR A CE1 1 
ATOM   793  C CE2 . TYR A 1 112 ? 40.928  -29.008 -19.439 1.00 167.14 ? 112 TYR A CE2 1 
ATOM   794  C CZ  . TYR A 1 112 ? 41.758  -29.634 -20.345 1.00 165.02 ? 112 TYR A CZ  1 
ATOM   795  O OH  . TYR A 1 112 ? 41.263  -30.044 -21.562 1.00 158.21 ? 112 TYR A OH  1 
ATOM   796  N N   . ASN A 1 113 ? 44.839  -30.967 -16.011 1.00 177.75 ? 113 ASN A N   1 
ATOM   797  C CA  . ASN A 1 113 ? 45.370  -32.246 -16.461 1.00 172.87 ? 113 ASN A CA  1 
ATOM   798  C C   . ASN A 1 113 ? 45.246  -33.327 -15.392 1.00 164.03 ? 113 ASN A C   1 
ATOM   799  O O   . ASN A 1 113 ? 45.255  -34.520 -15.697 1.00 155.62 ? 113 ASN A O   1 
ATOM   800  C CB  . ASN A 1 113 ? 46.826  -32.091 -16.901 1.00 178.16 ? 113 ASN A CB  1 
ATOM   801  C CG  . ASN A 1 113 ? 47.000  -31.028 -17.969 1.00 179.20 ? 113 ASN A CG  1 
ATOM   802  O OD1 . ASN A 1 113 ? 46.769  -31.276 -19.153 1.00 177.66 ? 113 ASN A OD1 1 
ATOM   803  N ND2 . ASN A 1 113 ? 47.407  -29.833 -17.554 1.00 180.88 ? 113 ASN A ND2 1 
ATOM   804  N N   . GLY A 1 114 ? 45.127  -32.900 -14.138 1.00 163.59 ? 114 GLY A N   1 
ATOM   805  C CA  . GLY A 1 114 ? 44.984  -33.824 -13.029 1.00 164.50 ? 114 GLY A CA  1 
ATOM   806  C C   . GLY A 1 114 ? 43.561  -34.320 -12.866 1.00 167.89 ? 114 GLY A C   1 
ATOM   807  O O   . GLY A 1 114 ? 43.333  -35.451 -12.439 1.00 169.33 ? 114 GLY A O   1 
ATOM   808  N N   . LEU A 1 115 ? 42.601  -33.467 -13.209 1.00 169.04 ? 115 LEU A N   1 
ATOM   809  C CA  . LEU A 1 115 ? 41.188  -33.815 -13.113 1.00 159.05 ? 115 LEU A CA  1 
ATOM   810  C C   . LEU A 1 115 ? 40.656  -34.302 -14.457 1.00 154.66 ? 115 LEU A C   1 
ATOM   811  O O   . LEU A 1 115 ? 40.211  -35.442 -14.583 1.00 153.09 ? 115 LEU A O   1 
ATOM   812  C CB  . LEU A 1 115 ? 40.372  -32.614 -12.631 1.00 151.96 ? 115 LEU A CB  1 
ATOM   813  C CG  . LEU A 1 115 ? 40.749  -32.043 -11.263 1.00 152.32 ? 115 LEU A CG  1 
ATOM   814  C CD1 . LEU A 1 115 ? 39.976  -30.764 -10.981 1.00 147.78 ? 115 LEU A CD1 1 
ATOM   815  C CD2 . LEU A 1 115 ? 40.515  -33.071 -10.165 1.00 155.09 ? 115 LEU A CD2 1 
ATOM   816  N N   . VAL A 1 116 ? 40.706  -33.428 -15.456 1.00 154.75 ? 116 VAL A N   1 
ATOM   817  C CA  . VAL A 1 116 ? 40.259  -33.768 -16.801 1.00 154.03 ? 116 VAL A CA  1 
ATOM   818  C C   . VAL A 1 116 ? 41.178  -34.812 -17.425 1.00 157.31 ? 116 VAL A C   1 
ATOM   819  O O   . VAL A 1 116 ? 42.188  -34.474 -18.043 1.00 162.71 ? 116 VAL A O   1 
ATOM   820  C CB  . VAL A 1 116 ? 40.212  -32.524 -17.710 1.00 149.00 ? 116 VAL A CB  1 
ATOM   821  C CG1 . VAL A 1 116 ? 39.674  -32.890 -19.084 1.00 142.09 ? 116 VAL A CG1 1 
ATOM   822  C CG2 . VAL A 1 116 ? 39.364  -31.434 -17.074 1.00 146.96 ? 116 VAL A CG2 1 
ATOM   823  N N   . THR A 1 117 ? 40.825  -36.082 -17.254 1.00 152.71 ? 117 THR A N   1 
ATOM   824  C CA  . THR A 1 117 ? 41.632  -37.179 -17.775 1.00 150.51 ? 117 THR A CA  1 
ATOM   825  C C   . THR A 1 117 ? 40.959  -37.840 -18.972 1.00 150.50 ? 117 THR A C   1 
ATOM   826  O O   . THR A 1 117 ? 39.745  -37.732 -19.150 1.00 150.93 ? 117 THR A O   1 
ATOM   827  C CB  . THR A 1 117 ? 41.891  -38.249 -16.698 1.00 147.87 ? 117 THR A CB  1 
ATOM   828  O OG1 . THR A 1 117 ? 40.658  -38.895 -16.356 1.00 145.02 ? 117 THR A OG1 1 
ATOM   829  C CG2 . THR A 1 117 ? 42.489  -37.615 -15.451 1.00 150.70 ? 117 THR A CG2 1 
ATOM   830  N N   . GLY A 1 118 ? 41.753  -38.524 -19.790 1.00 152.72 ? 118 GLY A N   1 
ATOM   831  C CA  . GLY A 1 118 ? 41.232  -39.218 -20.952 1.00 158.10 ? 118 GLY A CA  1 
ATOM   832  C C   . GLY A 1 118 ? 40.329  -40.372 -20.567 1.00 165.59 ? 118 GLY A C   1 
ATOM   833  O O   . GLY A 1 118 ? 39.472  -40.789 -21.346 1.00 165.26 ? 118 GLY A O   1 
ATOM   834  N N   . THR A 1 119 ? 40.523  -40.889 -19.357 1.00 172.99 ? 119 THR A N   1 
ATOM   835  C CA  . THR A 1 119 ? 39.725  -42.005 -18.861 1.00 174.30 ? 119 THR A CA  1 
ATOM   836  C C   . THR A 1 119 ? 38.360  -41.541 -18.364 1.00 172.79 ? 119 THR A C   1 
ATOM   837  O O   . THR A 1 119 ? 37.328  -42.069 -18.778 1.00 172.26 ? 119 THR A O   1 
ATOM   838  C CB  . THR A 1 119 ? 40.447  -42.757 -17.728 1.00 177.29 ? 119 THR A CB  1 
ATOM   839  O OG1 . THR A 1 119 ? 41.711  -43.239 -18.201 1.00 180.01 ? 119 THR A OG1 1 
ATOM   840  C CG2 . THR A 1 119 ? 39.605  -43.931 -17.248 1.00 174.66 ? 119 THR A CG2 1 
ATOM   841  N N   . ARG A 1 120 ? 38.361  -40.552 -17.475 1.00 171.71 ? 120 ARG A N   1 
ATOM   842  C CA  . ARG A 1 120 ? 37.119  -40.004 -16.938 1.00 169.15 ? 120 ARG A CA  1 
ATOM   843  C C   . ARG A 1 120 ? 36.198  -39.531 -18.057 1.00 165.25 ? 120 ARG A C   1 
ATOM   844  O O   . ARG A 1 120 ? 34.974  -39.599 -17.938 1.00 163.84 ? 120 ARG A O   1 
ATOM   845  C CB  . ARG A 1 120 ? 37.402  -38.851 -15.972 1.00 171.27 ? 120 ARG A CB  1 
ATOM   846  C CG  . ARG A 1 120 ? 38.081  -39.266 -14.675 1.00 175.43 ? 120 ARG A CG  1 
ATOM   847  C CD  . ARG A 1 120 ? 38.228  -38.081 -13.731 1.00 180.30 ? 120 ARG A CD  1 
ATOM   848  N NE  . ARG A 1 120 ? 38.884  -38.448 -12.479 1.00 184.50 ? 120 ARG A NE  1 
ATOM   849  C CZ  . ARG A 1 120 ? 39.099  -37.607 -11.473 1.00 186.56 ? 120 ARG A CZ  1 
ATOM   850  N NH1 . ARG A 1 120 ? 39.704  -38.029 -10.371 1.00 188.12 ? 120 ARG A NH1 1 
ATOM   851  N NH2 . ARG A 1 120 ? 38.709  -36.343 -11.568 1.00 185.93 ? 120 ARG A NH2 1 
ATOM   852  N N   . ALA A 1 121 ? 36.795  -39.048 -19.143 1.00 165.65 ? 121 ALA A N   1 
ATOM   853  C CA  . ALA A 1 121 ? 36.033  -38.596 -20.300 1.00 164.98 ? 121 ALA A CA  1 
ATOM   854  C C   . ALA A 1 121 ? 35.159  -39.721 -20.841 1.00 165.60 ? 121 ALA A C   1 
ATOM   855  O O   . ALA A 1 121 ? 33.945  -39.567 -20.975 1.00 165.97 ? 121 ALA A O   1 
ATOM   856  C CB  . ALA A 1 121 ? 36.969  -38.081 -21.383 1.00 164.79 ? 121 ALA A CB  1 
ATOM   857  N N   . ALA A 1 122 ? 35.787  -40.853 -21.145 1.00 164.75 ? 122 ALA A N   1 
ATOM   858  C CA  . ALA A 1 122 ? 35.069  -42.016 -21.652 1.00 162.47 ? 122 ALA A CA  1 
ATOM   859  C C   . ALA A 1 122 ? 34.014  -42.486 -20.656 1.00 159.95 ? 122 ALA A C   1 
ATOM   860  O O   . ALA A 1 122 ? 32.938  -42.942 -21.044 1.00 161.86 ? 122 ALA A O   1 
ATOM   861  C CB  . ALA A 1 122 ? 36.042  -43.142 -21.968 1.00 162.24 ? 122 ALA A CB  1 
ATOM   862  N N   . GLY A 1 123 ? 34.330  -42.370 -19.369 1.00 153.93 ? 123 GLY A N   1 
ATOM   863  C CA  . GLY A 1 123 ? 33.408  -42.760 -18.319 1.00 147.34 ? 123 GLY A CA  1 
ATOM   864  C C   . GLY A 1 123 ? 32.173  -41.882 -18.288 1.00 140.57 ? 123 GLY A C   1 
ATOM   865  O O   . GLY A 1 123 ? 31.048  -42.376 -18.354 1.00 139.57 ? 123 GLY A O   1 
ATOM   866  N N   . ILE A 1 124 ? 32.386  -40.573 -18.188 1.00 134.13 ? 124 ILE A N   1 
ATOM   867  C CA  . ILE A 1 124 ? 31.285  -39.617 -18.166 1.00 125.32 ? 124 ILE A CA  1 
ATOM   868  C C   . ILE A 1 124 ? 30.386  -39.796 -19.383 1.00 122.94 ? 124 ILE A C   1 
ATOM   869  O O   . ILE A 1 124 ? 29.164  -39.858 -19.257 1.00 126.98 ? 124 ILE A O   1 
ATOM   870  C CB  . ILE A 1 124 ? 31.796  -38.166 -18.125 1.00 123.84 ? 124 ILE A CB  1 
ATOM   871  C CG1 . ILE A 1 124 ? 32.596  -37.920 -16.845 1.00 127.43 ? 124 ILE A CG1 1 
ATOM   872  C CG2 . ILE A 1 124 ? 30.635  -37.190 -18.221 1.00 121.56 ? 124 ILE A CG2 1 
ATOM   873  C CD1 . ILE A 1 124 ? 33.150  -36.518 -16.730 1.00 128.86 ? 124 ILE A CD1 1 
ATOM   874  N N   . ILE A 1 125 ? 31.000  -39.880 -20.560 1.00 121.57 ? 125 ILE A N   1 
ATOM   875  C CA  . ILE A 1 125 ? 30.258  -40.081 -21.799 1.00 127.24 ? 125 ILE A CA  1 
ATOM   876  C C   . ILE A 1 125 ? 29.320  -41.279 -21.692 1.00 133.38 ? 125 ILE A C   1 
ATOM   877  O O   . ILE A 1 125 ? 28.127  -41.173 -21.977 1.00 136.77 ? 125 ILE A O   1 
ATOM   878  C CB  . ILE A 1 125 ? 31.203  -40.285 -22.997 1.00 127.10 ? 125 ILE A CB  1 
ATOM   879  C CG1 . ILE A 1 125 ? 32.014  -39.015 -23.256 1.00 129.74 ? 125 ILE A CG1 1 
ATOM   880  C CG2 . ILE A 1 125 ? 30.415  -40.669 -24.238 1.00 123.98 ? 125 ILE A CG2 1 
ATOM   881  C CD1 . ILE A 1 125 ? 32.981  -39.136 -24.409 1.00 130.87 ? 125 ILE A CD1 1 
ATOM   882  N N   . ALA A 1 126 ? 29.868  -42.417 -21.277 1.00 131.18 ? 126 ALA A N   1 
ATOM   883  C CA  . ALA A 1 126 ? 29.077  -43.629 -21.104 1.00 129.58 ? 126 ALA A CA  1 
ATOM   884  C C   . ALA A 1 126 ? 27.889  -43.373 -20.183 1.00 127.38 ? 126 ALA A C   1 
ATOM   885  O O   . ALA A 1 126 ? 26.757  -43.744 -20.495 1.00 123.19 ? 126 ALA A O   1 
ATOM   886  C CB  . ALA A 1 126 ? 29.943  -44.755 -20.558 1.00 129.67 ? 126 ALA A CB  1 
ATOM   887  N N   . ILE A 1 127 ? 28.155  -42.736 -19.047 1.00 129.18 ? 127 ILE A N   1 
ATOM   888  C CA  . ILE A 1 127 ? 27.107  -42.400 -18.092 1.00 130.49 ? 127 ILE A CA  1 
ATOM   889  C C   . ILE A 1 127 ? 26.049  -41.509 -18.733 1.00 129.62 ? 127 ILE A C   1 
ATOM   890  O O   . ILE A 1 127 ? 24.849  -41.743 -18.584 1.00 132.62 ? 127 ILE A O   1 
ATOM   891  C CB  . ILE A 1 127 ? 27.680  -41.680 -16.858 1.00 133.28 ? 127 ILE A CB  1 
ATOM   892  C CG1 . ILE A 1 127 ? 28.713  -42.562 -16.156 1.00 138.80 ? 127 ILE A CG1 1 
ATOM   893  C CG2 . ILE A 1 127 ? 26.563  -41.296 -15.898 1.00 132.36 ? 127 ILE A CG2 1 
ATOM   894  C CD1 . ILE A 1 127 ? 29.361  -41.904 -14.957 1.00 144.24 ? 127 ILE A CD1 1 
ATOM   895  N N   . CYS A 1 128 ? 26.505  -40.486 -19.449 1.00 125.24 ? 128 CYS A N   1 
ATOM   896  C CA  . CYS A 1 128 ? 25.607  -39.546 -20.108 1.00 124.58 ? 128 CYS A CA  1 
ATOM   897  C C   . CYS A 1 128 ? 24.631  -40.260 -21.033 1.00 124.87 ? 128 CYS A C   1 
ATOM   898  O O   . CYS A 1 128 ? 23.435  -39.971 -21.025 1.00 127.56 ? 128 CYS A O   1 
ATOM   899  C CB  . CYS A 1 128 ? 26.406  -38.502 -20.889 1.00 125.55 ? 128 CYS A CB  1 
ATOM   900  S SG  . CYS A 1 128 ? 27.432  -37.429 -19.859 1.00 136.11 ? 128 CYS A SG  1 
ATOM   901  N N   . TRP A 1 129 ? 25.145  -41.193 -21.828 1.00 124.63 ? 129 TRP A N   1 
ATOM   902  C CA  . TRP A 1 129 ? 24.308  -41.958 -22.746 1.00 131.27 ? 129 TRP A CA  1 
ATOM   903  C C   . TRP A 1 129 ? 23.271  -42.794 -22.005 1.00 135.76 ? 129 TRP A C   1 
ATOM   904  O O   . TRP A 1 129 ? 22.101  -42.828 -22.388 1.00 134.78 ? 129 TRP A O   1 
ATOM   905  C CB  . TRP A 1 129 ? 25.166  -42.851 -23.644 1.00 131.13 ? 129 TRP A CB  1 
ATOM   906  C CG  . TRP A 1 129 ? 25.829  -42.107 -24.758 1.00 134.38 ? 129 TRP A CG  1 
ATOM   907  C CD1 . TRP A 1 129 ? 27.101  -41.617 -24.774 1.00 137.08 ? 129 TRP A CD1 1 
ATOM   908  C CD2 . TRP A 1 129 ? 25.250  -41.763 -26.022 1.00 139.12 ? 129 TRP A CD2 1 
ATOM   909  N NE1 . TRP A 1 129 ? 27.352  -40.991 -25.971 1.00 139.11 ? 129 TRP A NE1 1 
ATOM   910  C CE2 . TRP A 1 129 ? 26.231  -41.067 -26.755 1.00 139.16 ? 129 TRP A CE2 1 
ATOM   911  C CE3 . TRP A 1 129 ? 23.997  -41.977 -26.605 1.00 143.38 ? 129 TRP A CE3 1 
ATOM   912  C CZ2 . TRP A 1 129 ? 26.000  -40.582 -28.040 1.00 141.46 ? 129 TRP A CZ2 1 
ATOM   913  C CZ3 . TRP A 1 129 ? 23.768  -41.496 -27.882 1.00 145.56 ? 129 TRP A CZ3 1 
ATOM   914  C CH2 . TRP A 1 129 ? 24.765  -40.806 -28.585 1.00 145.62 ? 129 TRP A CH2 1 
ATOM   915  N N   . VAL A 1 130 ? 23.705  -43.471 -20.948 1.00 136.51 ? 130 VAL A N   1 
ATOM   916  C CA  . VAL A 1 130 ? 22.798  -44.262 -20.127 1.00 135.18 ? 130 VAL A CA  1 
ATOM   917  C C   . VAL A 1 130 ? 21.671  -43.385 -19.595 1.00 135.60 ? 130 VAL A C   1 
ATOM   918  O O   . VAL A 1 130 ? 20.498  -43.752 -19.663 1.00 134.05 ? 130 VAL A O   1 
ATOM   919  C CB  . VAL A 1 130 ? 23.533  -44.924 -18.947 1.00 133.17 ? 130 VAL A CB  1 
ATOM   920  C CG1 . VAL A 1 130 ? 22.542  -45.601 -18.015 1.00 131.23 ? 130 VAL A CG1 1 
ATOM   921  C CG2 . VAL A 1 130 ? 24.561  -45.921 -19.457 1.00 136.05 ? 130 VAL A CG2 1 
ATOM   922  N N   . LEU A 1 131 ? 22.038  -42.221 -19.070 1.00 136.14 ? 131 LEU A N   1 
ATOM   923  C CA  . LEU A 1 131 ? 21.060  -41.265 -18.566 1.00 139.98 ? 131 LEU A CA  1 
ATOM   924  C C   . LEU A 1 131 ? 20.208  -40.719 -19.704 1.00 145.12 ? 131 LEU A C   1 
ATOM   925  O O   . LEU A 1 131 ? 19.061  -40.323 -19.498 1.00 150.28 ? 131 LEU A O   1 
ATOM   926  C CB  . LEU A 1 131 ? 21.760  -40.117 -17.838 1.00 141.92 ? 131 LEU A CB  1 
ATOM   927  C CG  . LEU A 1 131 ? 22.600  -40.509 -16.622 1.00 147.59 ? 131 LEU A CG  1 
ATOM   928  C CD1 . LEU A 1 131 ? 23.353  -39.305 -16.077 1.00 152.22 ? 131 LEU A CD1 1 
ATOM   929  C CD2 . LEU A 1 131 ? 21.726  -41.135 -15.546 1.00 147.46 ? 131 LEU A CD2 1 
ATOM   930  N N   . SER A 1 132 ? 20.776  -40.699 -20.905 1.00 146.24 ? 132 SER A N   1 
ATOM   931  C CA  . SER A 1 132 ? 20.063  -40.218 -22.082 1.00 148.60 ? 132 SER A CA  1 
ATOM   932  C C   . SER A 1 132 ? 18.955  -41.184 -22.484 1.00 145.28 ? 132 SER A C   1 
ATOM   933  O O   . SER A 1 132 ? 17.876  -40.764 -22.901 1.00 145.38 ? 132 SER A O   1 
ATOM   934  C CB  . SER A 1 132 ? 21.028  -40.007 -23.250 1.00 154.29 ? 132 SER A CB  1 
ATOM   935  O OG  . SER A 1 132 ? 21.958  -38.978 -22.961 1.00 159.97 ? 132 SER A OG  1 
ATOM   936  N N   . PHE A 1 133 ? 19.228  -42.479 -22.360 1.00 140.98 ? 133 PHE A N   1 
ATOM   937  C CA  . PHE A 1 133 ? 18.225  -43.496 -22.651 1.00 139.20 ? 133 PHE A CA  1 
ATOM   938  C C   . PHE A 1 133 ? 17.184  -43.565 -21.540 1.00 142.60 ? 133 PHE A C   1 
ATOM   939  O O   . PHE A 1 133 ? 15.994  -43.738 -21.802 1.00 144.05 ? 133 PHE A O   1 
ATOM   940  C CB  . PHE A 1 133 ? 18.879  -44.864 -22.855 1.00 135.21 ? 133 PHE A CB  1 
ATOM   941  C CG  . PHE A 1 133 ? 19.497  -45.042 -24.212 1.00 135.41 ? 133 PHE A CG  1 
ATOM   942  C CD1 . PHE A 1 133 ? 18.741  -45.508 -25.274 1.00 131.03 ? 133 PHE A CD1 1 
ATOM   943  C CD2 . PHE A 1 133 ? 20.832  -44.744 -24.427 1.00 141.02 ? 133 PHE A CD2 1 
ATOM   944  C CE1 . PHE A 1 133 ? 19.303  -45.674 -26.526 1.00 129.84 ? 133 PHE A CE1 1 
ATOM   945  C CE2 . PHE A 1 133 ? 21.400  -44.908 -25.677 1.00 141.23 ? 133 PHE A CE2 1 
ATOM   946  C CZ  . PHE A 1 133 ? 20.633  -45.374 -26.728 1.00 135.54 ? 133 PHE A CZ  1 
ATOM   947  N N   . ALA A 1 134 ? 17.641  -43.428 -20.300 1.00 141.04 ? 134 ALA A N   1 
ATOM   948  C CA  . ALA A 1 134 ? 16.744  -43.425 -19.152 1.00 137.82 ? 134 ALA A CA  1 
ATOM   949  C C   . ALA A 1 134 ? 15.727  -42.296 -19.273 1.00 138.89 ? 134 ALA A C   1 
ATOM   950  O O   . ALA A 1 134 ? 14.525  -42.510 -19.115 1.00 144.29 ? 134 ALA A O   1 
ATOM   951  C CB  . ALA A 1 134 ? 17.536  -43.295 -17.860 1.00 132.47 ? 134 ALA A CB  1 
ATOM   952  N N   . ILE A 1 135 ? 16.220  -41.096 -19.560 1.00 134.97 ? 135 ILE A N   1 
ATOM   953  C CA  . ILE A 1 135 ? 15.363  -39.926 -19.707 1.00 136.55 ? 135 ILE A CA  1 
ATOM   954  C C   . ILE A 1 135 ? 14.605  -39.938 -21.032 1.00 135.94 ? 135 ILE A C   1 
ATOM   955  O O   . ILE A 1 135 ? 13.380  -39.840 -21.057 1.00 135.70 ? 135 ILE A O   1 
ATOM   956  C CB  . ILE A 1 135 ? 16.173  -38.619 -19.602 1.00 137.40 ? 135 ILE A CB  1 
ATOM   957  C CG1 . ILE A 1 135 ? 16.755  -38.464 -18.196 1.00 136.86 ? 135 ILE A CG1 1 
ATOM   958  C CG2 . ILE A 1 135 ? 15.303  -37.424 -19.952 1.00 139.70 ? 135 ILE A CG2 1 
ATOM   959  C CD1 . ILE A 1 135 ? 17.535  -37.183 -17.997 1.00 136.59 ? 135 ILE A CD1 1 
ATOM   960  N N   . GLY A 1 136 ? 15.344  -40.060 -22.130 1.00 134.74 ? 136 GLY A N   1 
ATOM   961  C CA  . GLY A 1 136 ? 14.761  -40.025 -23.459 1.00 130.89 ? 136 GLY A CA  1 
ATOM   962  C C   . GLY A 1 136 ? 13.651  -41.037 -23.675 1.00 125.34 ? 136 GLY A C   1 
ATOM   963  O O   . GLY A 1 136 ? 12.707  -40.783 -24.426 1.00 114.94 ? 136 GLY A O   1 
ATOM   964  N N   . LEU A 1 137 ? 13.766  -42.189 -23.022 1.00 133.47 ? 137 LEU A N   1 
ATOM   965  C CA  . LEU A 1 137 ? 12.770  -43.246 -23.161 1.00 140.33 ? 137 LEU A CA  1 
ATOM   966  C C   . LEU A 1 137 ? 11.953  -43.432 -21.886 1.00 149.82 ? 137 LEU A C   1 
ATOM   967  O O   . LEU A 1 137 ? 11.502  -44.537 -21.582 1.00 149.14 ? 137 LEU A O   1 
ATOM   968  C CB  . LEU A 1 137 ? 13.434  -44.565 -23.562 1.00 134.84 ? 137 LEU A CB  1 
ATOM   969  C CG  . LEU A 1 137 ? 14.132  -44.583 -24.923 1.00 125.12 ? 137 LEU A CG  1 
ATOM   970  C CD1 . LEU A 1 137 ? 14.756  -45.943 -25.188 1.00 120.11 ? 137 LEU A CD1 1 
ATOM   971  C CD2 . LEU A 1 137 ? 13.156  -44.214 -26.031 1.00 118.75 ? 137 LEU A CD2 1 
ATOM   972  N N   . THR A 1 138 ? 11.768  -42.346 -21.141 1.00 158.30 ? 138 THR A N   1 
ATOM   973  C CA  . THR A 1 138 ? 10.938  -42.371 -19.940 1.00 162.61 ? 138 THR A CA  1 
ATOM   974  C C   . THR A 1 138 ? 9.474   -42.686 -20.258 1.00 163.22 ? 138 THR A C   1 
ATOM   975  O O   . THR A 1 138 ? 8.824   -43.424 -19.516 1.00 162.30 ? 138 THR A O   1 
ATOM   976  C CB  . THR A 1 138 ? 11.025  -41.045 -19.152 1.00 162.04 ? 138 THR A CB  1 
ATOM   977  O OG1 . THR A 1 138 ? 12.369  -40.841 -18.700 1.00 157.88 ? 138 THR A OG1 1 
ATOM   978  C CG2 . THR A 1 138 ? 10.093  -41.079 -17.950 1.00 164.54 ? 138 THR A CG2 1 
ATOM   979  N N   . PRO A 1 139 ? 8.945   -42.122 -21.358 1.00 162.08 ? 139 PRO A N   1 
ATOM   980  C CA  . PRO A 1 139 ? 7.572   -42.450 -21.757 1.00 165.56 ? 139 PRO A CA  1 
ATOM   981  C C   . PRO A 1 139 ? 7.367   -43.949 -21.969 1.00 166.33 ? 139 PRO A C   1 
ATOM   982  O O   . PRO A 1 139 ? 6.234   -44.424 -21.910 1.00 170.77 ? 139 PRO A O   1 
ATOM   983  C CB  . PRO A 1 139 ? 7.408   -41.702 -23.082 1.00 164.22 ? 139 PRO A CB  1 
ATOM   984  C CG  . PRO A 1 139 ? 8.339   -40.552 -22.973 1.00 160.37 ? 139 PRO A CG  1 
ATOM   985  C CD  . PRO A 1 139 ? 9.523   -41.064 -22.205 1.00 159.47 ? 139 PRO A CD  1 
ATOM   986  N N   . MET A 1 140 ? 8.450   -44.680 -22.213 1.00 165.37 ? 140 MET A N   1 
ATOM   987  C CA  . MET A 1 140 ? 8.366   -46.125 -22.394 1.00 168.93 ? 140 MET A CA  1 
ATOM   988  C C   . MET A 1 140 ? 8.337   -46.850 -21.054 1.00 169.00 ? 140 MET A C   1 
ATOM   989  O O   . MET A 1 140 ? 8.205   -48.072 -21.000 1.00 166.59 ? 140 MET A O   1 
ATOM   990  C CB  . MET A 1 140 ? 9.530   -46.637 -23.245 1.00 173.55 ? 140 MET A CB  1 
ATOM   991  C CG  . MET A 1 140 ? 9.552   -46.091 -24.660 1.00 176.87 ? 140 MET A CG  1 
ATOM   992  S SD  . MET A 1 140 ? 10.667  -47.010 -25.737 1.00 150.42 ? 140 MET A SD  1 
ATOM   993  C CE  . MET A 1 140 ? 9.940   -48.645 -25.654 1.00 124.41 ? 140 MET A CE  1 
ATOM   994  N N   . LEU A 1 141 ? 8.464   -46.086 -19.974 1.00 172.67 ? 141 LEU A N   1 
ATOM   995  C CA  . LEU A 1 141 ? 8.427   -46.647 -18.630 1.00 179.17 ? 141 LEU A CA  1 
ATOM   996  C C   . LEU A 1 141 ? 6.996   -46.700 -18.104 1.00 182.62 ? 141 LEU A C   1 
ATOM   997  O O   . LEU A 1 141 ? 6.742   -47.229 -17.023 1.00 183.11 ? 141 LEU A O   1 
ATOM   998  C CB  . LEU A 1 141 ? 9.310   -45.830 -17.682 1.00 181.82 ? 141 LEU A CB  1 
ATOM   999  C CG  . LEU A 1 141 ? 10.779  -45.674 -18.085 1.00 180.60 ? 141 LEU A CG  1 
ATOM   1000 C CD1 . LEU A 1 141 ? 11.512  -44.755 -17.118 1.00 179.81 ? 141 LEU A CD1 1 
ATOM   1001 C CD2 . LEU A 1 141 ? 11.465  -47.031 -18.168 1.00 180.52 ? 141 LEU A CD2 1 
ATOM   1002 N N   . GLY A 1 142 ? 6.065   -46.147 -18.877 1.00 186.41 ? 142 GLY A N   1 
ATOM   1003 C CA  . GLY A 1 142 ? 4.660   -46.152 -18.508 1.00 188.77 ? 142 GLY A CA  1 
ATOM   1004 C C   . GLY A 1 142 ? 3.996   -44.798 -18.674 1.00 183.22 ? 142 GLY A C   1 
ATOM   1005 O O   . GLY A 1 142 ? 2.770   -44.692 -18.665 1.00 183.17 ? 142 GLY A O   1 
ATOM   1006 N N   . TRP A 1 143 ? 4.813   -43.761 -18.827 1.00 177.36 ? 143 TRP A N   1 
ATOM   1007 C CA  . TRP A 1 143 ? 4.317   -42.397 -18.972 1.00 172.20 ? 143 TRP A CA  1 
ATOM   1008 C C   . TRP A 1 143 ? 3.944   -42.113 -20.424 1.00 165.20 ? 143 TRP A C   1 
ATOM   1009 O O   . TRP A 1 143 ? 4.629   -41.356 -21.112 1.00 162.76 ? 143 TRP A O   1 
ATOM   1010 C CB  . TRP A 1 143 ? 5.384   -41.403 -18.506 1.00 177.18 ? 143 TRP A CB  1 
ATOM   1011 C CG  . TRP A 1 143 ? 4.873   -40.016 -18.254 1.00 182.81 ? 143 TRP A CG  1 
ATOM   1012 C CD1 . TRP A 1 143 ? 4.275   -39.185 -19.155 1.00 184.68 ? 143 TRP A CD1 1 
ATOM   1013 C CD2 . TRP A 1 143 ? 4.938   -39.291 -17.020 1.00 185.93 ? 143 TRP A CD2 1 
ATOM   1014 N NE1 . TRP A 1 143 ? 3.951   -37.991 -18.556 1.00 186.72 ? 143 TRP A NE1 1 
ATOM   1015 C CE2 . TRP A 1 143 ? 4.350   -38.030 -17.246 1.00 187.70 ? 143 TRP A CE2 1 
ATOM   1016 C CE3 . TRP A 1 143 ? 5.431   -39.585 -15.745 1.00 186.24 ? 143 TRP A CE3 1 
ATOM   1017 C CZ2 . TRP A 1 143 ? 4.240   -37.067 -16.244 1.00 187.36 ? 143 TRP A CZ2 1 
ATOM   1018 C CZ3 . TRP A 1 143 ? 5.322   -38.628 -14.753 1.00 186.52 ? 143 TRP A CZ3 1 
ATOM   1019 C CH2 . TRP A 1 143 ? 4.733   -37.383 -15.008 1.00 186.61 ? 143 TRP A CH2 1 
ATOM   1020 N N   . ASN A 1 144 ? 2.856   -42.720 -20.889 1.00 164.88 ? 144 ASN A N   1 
ATOM   1021 C CA  . ASN A 1 144 ? 2.435   -42.565 -22.278 1.00 164.12 ? 144 ASN A CA  1 
ATOM   1022 C C   . ASN A 1 144 ? 0.918   -42.518 -22.456 1.00 169.41 ? 144 ASN A C   1 
ATOM   1023 O O   . ASN A 1 144 ? 0.162   -42.809 -21.528 1.00 171.73 ? 144 ASN A O   1 
ATOM   1024 C CB  . ASN A 1 144 ? 3.036   -43.677 -23.143 1.00 159.58 ? 144 ASN A CB  1 
ATOM   1025 C CG  . ASN A 1 144 ? 2.680   -45.063 -22.640 1.00 161.17 ? 144 ASN A CG  1 
ATOM   1026 O OD1 . ASN A 1 144 ? 1.513   -45.368 -22.398 1.00 170.98 ? 144 ASN A OD1 1 
ATOM   1027 N ND2 . ASN A 1 144 ? 3.688   -45.913 -22.484 1.00 155.67 ? 144 ASN A ND2 1 
ATOM   1028 N N   . ASN A 1 145 ? 0.483   -42.146 -23.656 1.00 165.30 ? 145 ASN A N   1 
ATOM   1029 C CA  . ASN A 1 145 ? -0.939  -42.075 -23.976 1.00 158.66 ? 145 ASN A CA  1 
ATOM   1030 C C   . ASN A 1 145 ? -1.353  -43.106 -25.021 1.00 156.95 ? 145 ASN A C   1 
ATOM   1031 O O   . ASN A 1 145 ? -2.074  -42.789 -25.966 1.00 159.85 ? 145 ASN A O   1 
ATOM   1032 C CB  . ASN A 1 145 ? -1.318  -40.671 -24.453 1.00 153.61 ? 145 ASN A CB  1 
ATOM   1033 C CG  . ASN A 1 145 ? -1.305  -39.650 -23.333 1.00 149.59 ? 145 ASN A CG  1 
ATOM   1034 O OD1 . ASN A 1 145 ? -1.282  -40.004 -22.154 1.00 150.45 ? 145 ASN A OD1 1 
ATOM   1035 N ND2 . ASN A 1 145 ? -1.327  -38.373 -23.697 1.00 145.45 ? 145 ASN A ND2 1 
ATOM   1036 N N   . CYS A 1 146 ? -0.894  -44.341 -24.844 1.00 153.99 ? 146 CYS A N   1 
ATOM   1037 C CA  . CYS A 1 146 ? -1.223  -45.417 -25.771 1.00 157.17 ? 146 CYS A CA  1 
ATOM   1038 C C   . CYS A 1 146 ? -2.640  -45.932 -25.538 1.00 164.18 ? 146 CYS A C   1 
ATOM   1039 O O   . CYS A 1 146 ? -2.911  -46.596 -24.538 1.00 165.98 ? 146 CYS A O   1 
ATOM   1040 C CB  . CYS A 1 146 ? -0.223  -46.568 -25.639 1.00 158.99 ? 146 CYS A CB  1 
ATOM   1041 S SG  . CYS A 1 146 ? 1.487   -46.135 -26.042 1.00 198.11 ? 146 CYS A SG  1 
ATOM   1042 N N   . GLY A 1 147 ? -3.540  -45.619 -26.465 1.00 168.10 ? 147 GLY A N   1 
ATOM   1043 C CA  . GLY A 1 147 ? -4.911  -46.089 -26.386 1.00 169.47 ? 147 GLY A CA  1 
ATOM   1044 C C   . GLY A 1 147 ? -5.823  -45.163 -25.605 1.00 170.66 ? 147 GLY A C   1 
ATOM   1045 O O   . GLY A 1 147 ? -6.930  -45.549 -25.225 1.00 172.26 ? 147 GLY A O   1 
ATOM   1046 N N   . GLN A 1 148 ? -5.363  -43.940 -25.363 1.00 171.41 ? 148 GLN A N   1 
ATOM   1047 C CA  . GLN A 1 148 ? -6.164  -42.962 -24.635 1.00 179.62 ? 148 GLN A CA  1 
ATOM   1048 C C   . GLN A 1 148 ? -7.307  -42.434 -25.494 1.00 191.10 ? 148 GLN A C   1 
ATOM   1049 O O   . GLN A 1 148 ? -7.114  -42.124 -26.670 1.00 196.57 ? 148 GLN A O   1 
ATOM   1050 C CB  . GLN A 1 148 ? -5.292  -41.807 -24.141 1.00 175.47 ? 148 GLN A CB  1 
ATOM   1051 C CG  . GLN A 1 148 ? -4.292  -42.207 -23.070 1.00 178.28 ? 148 GLN A CG  1 
ATOM   1052 C CD  . GLN A 1 148 ? -4.960  -42.777 -21.833 1.00 184.46 ? 148 GLN A CD  1 
ATOM   1053 O OE1 . GLN A 1 148 ? -6.119  -42.478 -21.544 1.00 184.70 ? 148 GLN A OE1 1 
ATOM   1054 N NE2 . GLN A 1 148 ? -4.227  -43.601 -21.092 1.00 189.72 ? 148 GLN A NE2 1 
ATOM   1055 N N   . PRO A 1 149 ? -8.506  -42.332 -24.900 1.00 189.92 ? 149 PRO A N   1 
ATOM   1056 C CA  . PRO A 1 149 ? -9.713  -41.858 -25.586 1.00 184.71 ? 149 PRO A CA  1 
ATOM   1057 C C   . PRO A 1 149 ? -9.471  -40.547 -26.328 1.00 176.64 ? 149 PRO A C   1 
ATOM   1058 O O   . PRO A 1 149 ? -9.381  -40.570 -27.556 1.00 172.91 ? 149 PRO A O   1 
ATOM   1059 C CB  . PRO A 1 149 ? -10.698 -41.636 -24.437 1.00 187.13 ? 149 PRO A CB  1 
ATOM   1060 C CG  . PRO A 1 149 ? -10.261 -42.590 -23.386 1.00 188.56 ? 149 PRO A CG  1 
ATOM   1061 C CD  . PRO A 1 149 ? -8.764  -42.655 -23.486 1.00 189.25 ? 149 PRO A CD  1 
ATOM   1062 N N   . GLY A 1 158 ? -9.196  -49.093 -37.587 1.00 248.94 ? 158 GLY A N   1 
ATOM   1063 C CA  . GLY A 1 158 ? -7.999  -48.294 -37.771 1.00 246.44 ? 158 GLY A CA  1 
ATOM   1064 C C   . GLY A 1 158 ? -6.758  -49.141 -37.978 1.00 247.45 ? 158 GLY A C   1 
ATOM   1065 O O   . GLY A 1 158 ? -6.352  -49.398 -39.110 1.00 248.13 ? 158 GLY A O   1 
ATOM   1066 N N   . CYS A 1 159 ? -6.154  -49.578 -36.877 1.00 245.48 ? 159 CYS A N   1 
ATOM   1067 C CA  . CYS A 1 159 ? -4.945  -50.392 -36.936 1.00 241.35 ? 159 CYS A CA  1 
ATOM   1068 C C   . CYS A 1 159 ? -5.188  -51.783 -36.357 1.00 235.95 ? 159 CYS A C   1 
ATOM   1069 O O   . CYS A 1 159 ? -4.371  -52.688 -36.529 1.00 235.77 ? 159 CYS A O   1 
ATOM   1070 C CB  . CYS A 1 159 ? -3.800  -49.704 -36.188 1.00 239.63 ? 159 CYS A CB  1 
ATOM   1071 S SG  . CYS A 1 159 ? -3.360  -48.070 -36.830 1.00 230.22 ? 159 CYS A SG  1 
ATOM   1072 N N   . GLY A 1 160 ? -6.314  -51.944 -35.670 1.00 231.08 ? 160 GLY A N   1 
ATOM   1073 C CA  . GLY A 1 160 ? -6.666  -53.216 -35.067 1.00 228.20 ? 160 GLY A CA  1 
ATOM   1074 C C   . GLY A 1 160 ? -6.128  -53.359 -33.657 1.00 221.68 ? 160 GLY A C   1 
ATOM   1075 O O   . GLY A 1 160 ? -5.324  -52.543 -33.204 1.00 215.35 ? 160 GLY A O   1 
ATOM   1076 N N   . GLU A 1 161 ? -6.575  -54.398 -32.960 1.00 223.52 ? 161 GLU A N   1 
ATOM   1077 C CA  . GLU A 1 161 ? -6.131  -54.651 -31.594 1.00 221.08 ? 161 GLU A CA  1 
ATOM   1078 C C   . GLU A 1 161 ? -4.660  -55.052 -31.565 1.00 211.53 ? 161 GLU A C   1 
ATOM   1079 O O   . GLU A 1 161 ? -4.203  -55.834 -32.400 1.00 210.82 ? 161 GLU A O   1 
ATOM   1080 C CB  . GLU A 1 161 ? -6.994  -55.732 -30.938 1.00 228.96 ? 161 GLU A CB  1 
ATOM   1081 C CG  . GLU A 1 161 ? -6.941  -57.084 -31.633 1.00 236.40 ? 161 GLU A CG  1 
ATOM   1082 C CD  . GLU A 1 161 ? -7.870  -58.101 -30.998 1.00 246.71 ? 161 GLU A CD  1 
ATOM   1083 O OE1 . GLU A 1 161 ? -7.752  -59.300 -31.328 1.00 250.26 ? 161 GLU A OE1 1 
ATOM   1084 O OE2 . GLU A 1 161 ? -8.714  -57.701 -30.167 1.00 251.57 ? 161 GLU A OE2 1 
ATOM   1085 N N   . GLY A 1 162 ? -3.924  -54.510 -30.600 1.00 204.18 ? 162 GLY A N   1 
ATOM   1086 C CA  . GLY A 1 162 ? -2.501  -54.766 -30.489 1.00 195.64 ? 162 GLY A CA  1 
ATOM   1087 C C   . GLY A 1 162 ? -1.679  -53.616 -31.039 1.00 189.37 ? 162 GLY A C   1 
ATOM   1088 O O   . GLY A 1 162 ? -0.764  -53.124 -30.378 1.00 187.27 ? 162 GLY A O   1 
ATOM   1089 N N   . GLN A 1 163 ? -2.009  -53.186 -32.254 1.00 185.74 ? 163 GLN A N   1 
ATOM   1090 C CA  . GLN A 1 163 ? -1.310  -52.077 -32.898 1.00 177.91 ? 163 GLN A CA  1 
ATOM   1091 C C   . GLN A 1 163 ? -1.990  -50.745 -32.585 1.00 172.47 ? 163 GLN A C   1 
ATOM   1092 O O   . GLN A 1 163 ? -3.220  -50.662 -32.555 1.00 178.24 ? 163 GLN A O   1 
ATOM   1093 C CB  . GLN A 1 163 ? -1.243  -52.293 -34.413 1.00 178.05 ? 163 GLN A CB  1 
ATOM   1094 C CG  . GLN A 1 163 ? -0.453  -53.525 -34.840 1.00 178.28 ? 163 GLN A CG  1 
ATOM   1095 C CD  . GLN A 1 163 ? -0.426  -53.711 -36.346 1.00 180.33 ? 163 GLN A CD  1 
ATOM   1096 O OE1 . GLN A 1 163 ? -1.143  -53.031 -37.081 1.00 184.66 ? 163 GLN A OE1 1 
ATOM   1097 N NE2 . GLN A 1 163 ? 0.404   -54.637 -36.814 1.00 177.94 ? 163 GLN A NE2 1 
ATOM   1098 N N   . VAL A 1 164 ? -1.189  -49.709 -32.351 1.00 159.39 ? 164 VAL A N   1 
ATOM   1099 C CA  . VAL A 1 164 ? -1.718  -48.386 -32.036 1.00 147.45 ? 164 VAL A CA  1 
ATOM   1100 C C   . VAL A 1 164 ? -1.293  -47.363 -33.086 1.00 144.25 ? 164 VAL A C   1 
ATOM   1101 O O   . VAL A 1 164 ? -0.163  -47.397 -33.572 1.00 144.45 ? 164 VAL A O   1 
ATOM   1102 C CB  . VAL A 1 164 ? -1.247  -47.909 -30.643 1.00 132.94 ? 164 VAL A CB  1 
ATOM   1103 C CG1 . VAL A 1 164 ? -1.780  -46.514 -30.346 1.00 122.53 ? 164 VAL A CG1 1 
ATOM   1104 C CG2 . VAL A 1 164 ? -1.690  -48.892 -29.569 1.00 134.15 ? 164 VAL A CG2 1 
ATOM   1105 N N   . ALA A 1 165 ? -2.205  -46.463 -33.443 1.00 142.80 ? 165 ALA A N   1 
ATOM   1106 C CA  . ALA A 1 165 ? -1.891  -45.408 -34.396 1.00 142.40 ? 165 ALA A CA  1 
ATOM   1107 C C   . ALA A 1 165 ? -0.732  -44.577 -33.870 1.00 146.35 ? 165 ALA A C   1 
ATOM   1108 O O   . ALA A 1 165 ? -0.916  -43.717 -33.007 1.00 144.39 ? 165 ALA A O   1 
ATOM   1109 C CB  . ALA A 1 165 ? -3.107  -44.538 -34.650 1.00 144.04 ? 165 ALA A CB  1 
ATOM   1110 N N   . CYS A 1 166 ? 0.460   -44.841 -34.397 1.00 150.91 ? 166 CYS A N   1 
ATOM   1111 C CA  . CYS A 1 166 ? 1.668   -44.182 -33.923 1.00 147.48 ? 166 CYS A CA  1 
ATOM   1112 C C   . CYS A 1 166 ? 1.721   -42.726 -34.367 1.00 140.70 ? 166 CYS A C   1 
ATOM   1113 O O   . CYS A 1 166 ? 2.271   -42.403 -35.420 1.00 137.26 ? 166 CYS A O   1 
ATOM   1114 C CB  . CYS A 1 166 ? 2.911   -44.928 -34.405 1.00 147.86 ? 166 CYS A CB  1 
ATOM   1115 S SG  . CYS A 1 166 ? 4.455   -44.356 -33.658 1.00 221.62 ? 166 CYS A SG  1 
ATOM   1116 N N   . LEU A 1 167 ? 1.141   -41.854 -33.552 1.00 138.74 ? 167 LEU A N   1 
ATOM   1117 C CA  . LEU A 1 167 ? 1.173   -40.423 -33.808 1.00 137.00 ? 167 LEU A CA  1 
ATOM   1118 C C   . LEU A 1 167 ? 1.840   -39.735 -32.629 1.00 128.41 ? 167 LEU A C   1 
ATOM   1119 O O   . LEU A 1 167 ? 1.418   -39.898 -31.486 1.00 120.32 ? 167 LEU A O   1 
ATOM   1120 C CB  . LEU A 1 167 ? -0.241  -39.880 -34.014 1.00 150.79 ? 167 LEU A CB  1 
ATOM   1121 C CG  . LEU A 1 167 ? -1.100  -40.646 -35.023 1.00 159.63 ? 167 LEU A CG  1 
ATOM   1122 C CD1 . LEU A 1 167 ? -2.457  -39.985 -35.187 1.00 160.09 ? 167 LEU A CD1 1 
ATOM   1123 C CD2 . LEU A 1 167 ? -0.388  -40.758 -36.362 1.00 161.25 ? 167 LEU A CD2 1 
ATOM   1124 N N   . PHE A 1 168 ? 2.887   -38.970 -32.915 1.00 135.40 ? 168 PHE A N   1 
ATOM   1125 C CA  . PHE A 1 168 ? 3.709   -38.368 -31.871 1.00 146.73 ? 168 PHE A CA  1 
ATOM   1126 C C   . PHE A 1 168 ? 2.894   -37.701 -30.763 1.00 153.04 ? 168 PHE A C   1 
ATOM   1127 O O   . PHE A 1 168 ? 3.057   -38.020 -29.586 1.00 152.45 ? 168 PHE A O   1 
ATOM   1128 C CB  . PHE A 1 168 ? 4.693   -37.367 -32.475 1.00 152.16 ? 168 PHE A CB  1 
ATOM   1129 C CG  . PHE A 1 168 ? 5.696   -36.841 -31.493 1.00 154.95 ? 168 PHE A CG  1 
ATOM   1130 C CD1 . PHE A 1 168 ? 6.779   -37.616 -31.109 1.00 154.57 ? 168 PHE A CD1 1 
ATOM   1131 C CD2 . PHE A 1 168 ? 5.556   -35.571 -30.953 1.00 157.29 ? 168 PHE A CD2 1 
ATOM   1132 C CE1 . PHE A 1 168 ? 7.705   -37.137 -30.206 1.00 156.63 ? 168 PHE A CE1 1 
ATOM   1133 C CE2 . PHE A 1 168 ? 6.476   -35.082 -30.051 1.00 156.77 ? 168 PHE A CE2 1 
ATOM   1134 C CZ  . PHE A 1 168 ? 7.554   -35.869 -29.673 1.00 157.84 ? 168 PHE A CZ  1 
ATOM   1135 N N   . GLU A 1 169 ? 2.018   -36.777 -31.145 1.00 158.56 ? 169 GLU A N   1 
ATOM   1136 C CA  . GLU A 1 169 ? 1.238   -36.017 -30.172 1.00 162.21 ? 169 GLU A CA  1 
ATOM   1137 C C   . GLU A 1 169 ? 0.206   -36.878 -29.447 1.00 160.45 ? 169 GLU A C   1 
ATOM   1138 O O   . GLU A 1 169 ? -0.231  -36.540 -28.346 1.00 156.81 ? 169 GLU A O   1 
ATOM   1139 C CB  . GLU A 1 169 ? 0.548   -34.826 -30.844 1.00 167.85 ? 169 GLU A CB  1 
ATOM   1140 C CG  . GLU A 1 169 ? -0.510  -35.208 -31.869 1.00 174.46 ? 169 GLU A CG  1 
ATOM   1141 C CD  . GLU A 1 169 ? 0.080   -35.814 -33.128 1.00 177.40 ? 169 GLU A CD  1 
ATOM   1142 O OE1 . GLU A 1 169 ? 1.268   -35.553 -33.417 1.00 176.48 ? 169 GLU A OE1 1 
ATOM   1143 O OE2 . GLU A 1 169 ? -0.647  -36.544 -33.834 1.00 178.52 ? 169 GLU A OE2 1 
ATOM   1144 N N   . ASP A 1 170 ? -0.178  -37.991 -30.065 1.00 162.70 ? 170 ASP A N   1 
ATOM   1145 C CA  . ASP A 1 170 ? -1.219  -38.854 -29.513 1.00 164.87 ? 170 ASP A CA  1 
ATOM   1146 C C   . ASP A 1 170 ? -0.665  -39.949 -28.605 1.00 159.49 ? 170 ASP A C   1 
ATOM   1147 O O   . ASP A 1 170 ? -1.335  -40.384 -27.668 1.00 162.57 ? 170 ASP A O   1 
ATOM   1148 C CB  . ASP A 1 170 ? -2.047  -39.480 -30.638 1.00 170.32 ? 170 ASP A CB  1 
ATOM   1149 C CG  . ASP A 1 170 ? -2.818  -38.447 -31.436 1.00 175.61 ? 170 ASP A CG  1 
ATOM   1150 O OD1 . ASP A 1 170 ? -2.825  -37.265 -31.031 1.00 177.90 ? 170 ASP A OD1 1 
ATOM   1151 O OD2 . ASP A 1 170 ? -3.419  -38.820 -32.466 1.00 177.45 ? 170 ASP A OD2 1 
ATOM   1152 N N   . VAL A 1 171 ? 0.555   -40.395 -28.888 1.00 148.60 ? 171 VAL A N   1 
ATOM   1153 C CA  . VAL A 1 171 ? 1.168   -41.467 -28.113 1.00 139.70 ? 171 VAL A CA  1 
ATOM   1154 C C   . VAL A 1 171 ? 2.087   -40.919 -27.026 1.00 134.90 ? 171 VAL A C   1 
ATOM   1155 O O   . VAL A 1 171 ? 2.391   -41.609 -26.052 1.00 126.13 ? 171 VAL A O   1 
ATOM   1156 C CB  . VAL A 1 171 ? 1.965   -42.432 -29.011 1.00 135.00 ? 171 VAL A CB  1 
ATOM   1157 C CG1 . VAL A 1 171 ? 1.047   -43.086 -30.030 1.00 137.99 ? 171 VAL A CG1 1 
ATOM   1158 C CG2 . VAL A 1 171 ? 3.100   -41.696 -29.703 1.00 133.90 ? 171 VAL A CG2 1 
ATOM   1159 N N   . VAL A 1 172 ? 2.523   -39.675 -27.196 1.00 140.81 ? 172 VAL A N   1 
ATOM   1160 C CA  . VAL A 1 172 ? 3.422   -39.040 -26.240 1.00 143.07 ? 172 VAL A CA  1 
ATOM   1161 C C   . VAL A 1 172 ? 2.712   -37.944 -25.451 1.00 146.44 ? 172 VAL A C   1 
ATOM   1162 O O   . VAL A 1 172 ? 2.161   -37.009 -26.034 1.00 148.09 ? 172 VAL A O   1 
ATOM   1163 C CB  . VAL A 1 172 ? 4.662   -38.444 -26.938 1.00 139.89 ? 172 VAL A CB  1 
ATOM   1164 C CG1 . VAL A 1 172 ? 5.571   -37.770 -25.922 1.00 138.82 ? 172 VAL A CG1 1 
ATOM   1165 C CG2 . VAL A 1 172 ? 5.414   -39.524 -27.699 1.00 138.02 ? 172 VAL A CG2 1 
ATOM   1166 N N   . PRO A 1 173 ? 2.721   -38.062 -24.115 1.00 142.76 ? 173 PRO A N   1 
ATOM   1167 C CA  . PRO A 1 173 ? 2.100   -37.086 -23.212 1.00 144.93 ? 173 PRO A CA  1 
ATOM   1168 C C   . PRO A 1 173 ? 2.711   -35.697 -23.366 1.00 147.06 ? 173 PRO A C   1 
ATOM   1169 O O   . PRO A 1 173 ? 3.889   -35.575 -23.701 1.00 142.84 ? 173 PRO A O   1 
ATOM   1170 C CB  . PRO A 1 173 ? 2.422   -37.644 -21.822 1.00 138.14 ? 173 PRO A CB  1 
ATOM   1171 C CG  . PRO A 1 173 ? 2.645   -39.097 -22.039 1.00 134.36 ? 173 PRO A CG  1 
ATOM   1172 C CD  . PRO A 1 173 ? 3.292   -39.204 -23.382 1.00 134.93 ? 173 PRO A CD  1 
ATOM   1173 N N   . MET A 1 174 ? 1.913   -34.663 -23.122 1.00 153.77 ? 174 MET A N   1 
ATOM   1174 C CA  . MET A 1 174 ? 2.391   -33.289 -23.215 1.00 155.44 ? 174 MET A CA  1 
ATOM   1175 C C   . MET A 1 174 ? 3.023   -32.832 -21.905 1.00 155.27 ? 174 MET A C   1 
ATOM   1176 O O   . MET A 1 174 ? 3.997   -32.080 -21.906 1.00 154.08 ? 174 MET A O   1 
ATOM   1177 C CB  . MET A 1 174 ? 1.252   -32.347 -23.611 1.00 159.36 ? 174 MET A CB  1 
ATOM   1178 C CG  . MET A 1 174 ? 0.722   -32.574 -25.016 1.00 160.59 ? 174 MET A CG  1 
ATOM   1179 S SD  . MET A 1 174 ? 1.991   -32.351 -26.278 1.00 241.72 ? 174 MET A SD  1 
ATOM   1180 C CE  . MET A 1 174 ? 2.478   -30.654 -25.971 1.00 78.92  ? 174 MET A CE  1 
ATOM   1181 N N   . ASN A 1 175 ? 2.464   -33.291 -20.790 1.00 158.09 ? 175 ASN A N   1 
ATOM   1182 C CA  . ASN A 1 175 ? 2.995   -32.957 -19.474 1.00 162.12 ? 175 ASN A CA  1 
ATOM   1183 C C   . ASN A 1 175 ? 4.436   -33.427 -19.301 1.00 164.83 ? 175 ASN A C   1 
ATOM   1184 O O   . ASN A 1 175 ? 5.189   -32.873 -18.498 1.00 167.90 ? 175 ASN A O   1 
ATOM   1185 C CB  . ASN A 1 175 ? 2.108   -33.537 -18.370 1.00 163.60 ? 175 ASN A CB  1 
ATOM   1186 C CG  . ASN A 1 175 ? 1.994   -35.048 -18.443 1.00 164.84 ? 175 ASN A CG  1 
ATOM   1187 O OD1 . ASN A 1 175 ? 2.470   -35.673 -19.390 1.00 160.85 ? 175 ASN A OD1 1 
ATOM   1188 N ND2 . ASN A 1 175 ? 1.361   -35.643 -17.437 1.00 169.64 ? 175 ASN A ND2 1 
ATOM   1189 N N   . TYR A 1 176 ? 4.812   -34.449 -20.064 1.00 160.91 ? 176 TYR A N   1 
ATOM   1190 C CA  . TYR A 1 176 ? 6.177   -34.963 -20.038 1.00 155.56 ? 176 TYR A CA  1 
ATOM   1191 C C   . TYR A 1 176 ? 7.134   -34.026 -20.755 1.00 142.74 ? 176 TYR A C   1 
ATOM   1192 O O   . TYR A 1 176 ? 8.075   -33.504 -20.158 1.00 144.61 ? 176 TYR A O   1 
ATOM   1193 C CB  . TYR A 1 176 ? 6.241   -36.354 -20.675 1.00 163.53 ? 176 TYR A CB  1 
ATOM   1194 C CG  . TYR A 1 176 ? 7.644   -36.829 -20.977 1.00 169.53 ? 176 TYR A CG  1 
ATOM   1195 C CD1 . TYR A 1 176 ? 8.391   -37.504 -20.021 1.00 173.93 ? 176 TYR A CD1 1 
ATOM   1196 C CD2 . TYR A 1 176 ? 8.225   -36.596 -22.218 1.00 170.45 ? 176 TYR A CD2 1 
ATOM   1197 C CE1 . TYR A 1 176 ? 9.678   -37.937 -20.293 1.00 175.36 ? 176 TYR A CE1 1 
ATOM   1198 C CE2 . TYR A 1 176 ? 9.511   -37.024 -22.499 1.00 173.62 ? 176 TYR A CE2 1 
ATOM   1199 C CZ  . TYR A 1 176 ? 10.232  -37.694 -21.533 1.00 175.52 ? 176 TYR A CZ  1 
ATOM   1200 O OH  . TYR A 1 176 ? 11.511  -38.122 -21.807 1.00 175.18 ? 176 TYR A OH  1 
ATOM   1201 N N   . MET A 1 177 ? 6.880   -33.815 -22.041 1.00 129.91 ? 177 MET A N   1 
ATOM   1202 C CA  . MET A 1 177 ? 7.763   -33.006 -22.875 1.00 118.84 ? 177 MET A CA  1 
ATOM   1203 C C   . MET A 1 177 ? 7.858   -31.559 -22.405 1.00 120.96 ? 177 MET A C   1 
ATOM   1204 O O   . MET A 1 177 ? 8.778   -30.838 -22.777 1.00 130.46 ? 177 MET A O   1 
ATOM   1205 C CB  . MET A 1 177 ? 7.305   -33.036 -24.332 1.00 107.93 ? 177 MET A CB  1 
ATOM   1206 C CG  . MET A 1 177 ? 7.419   -34.409 -24.996 1.00 98.26  ? 177 MET A CG  1 
ATOM   1207 S SD  . MET A 1 177 ? 6.966   -34.350 -26.723 1.00 286.90 ? 177 MET A SD  1 
ATOM   1208 C CE  . MET A 1 177 ? 8.147   -33.148 -27.346 1.00 201.38 ? 177 MET A CE  1 
ATOM   1209 N N   . VAL A 1 178 ? 6.914   -31.137 -21.572 1.00 113.47 ? 178 VAL A N   1 
ATOM   1210 C CA  . VAL A 1 178 ? 6.926   -29.773 -21.051 1.00 115.42 ? 178 VAL A CA  1 
ATOM   1211 C C   . VAL A 1 178 ? 7.663   -29.687 -19.719 1.00 127.94 ? 178 VAL A C   1 
ATOM   1212 O O   . VAL A 1 178 ? 8.726   -29.075 -19.628 1.00 135.03 ? 178 VAL A O   1 
ATOM   1213 C CB  . VAL A 1 178 ? 5.510   -29.197 -20.887 1.00 111.49 ? 178 VAL A CB  1 
ATOM   1214 C CG1 . VAL A 1 178 ? 5.568   -27.880 -20.138 1.00 106.25 ? 178 VAL A CG1 1 
ATOM   1215 C CG2 . VAL A 1 178 ? 4.855   -29.016 -22.246 1.00 111.02 ? 178 VAL A CG2 1 
ATOM   1216 N N   . TYR A 1 179 ? 7.096   -30.300 -18.686 1.00 134.23 ? 179 TYR A N   1 
ATOM   1217 C CA  . TYR A 1 179 ? 7.680   -30.235 -17.349 1.00 146.93 ? 179 TYR A CA  1 
ATOM   1218 C C   . TYR A 1 179 ? 8.979   -31.030 -17.254 1.00 150.41 ? 179 TYR A C   1 
ATOM   1219 O O   . TYR A 1 179 ? 10.048  -30.469 -17.015 1.00 151.37 ? 179 TYR A O   1 
ATOM   1220 C CB  . TYR A 1 179 ? 6.683   -30.731 -16.299 1.00 154.77 ? 179 TYR A CB  1 
ATOM   1221 C CG  . TYR A 1 179 ? 5.461   -29.852 -16.150 1.00 160.27 ? 179 TYR A CG  1 
ATOM   1222 C CD1 . TYR A 1 179 ? 5.453   -28.784 -15.262 1.00 162.81 ? 179 TYR A CD1 1 
ATOM   1223 C CD2 . TYR A 1 179 ? 4.312   -30.097 -16.891 1.00 162.69 ? 179 TYR A CD2 1 
ATOM   1224 C CE1 . TYR A 1 179 ? 4.337   -27.981 -15.120 1.00 165.73 ? 179 TYR A CE1 1 
ATOM   1225 C CE2 . TYR A 1 179 ? 3.191   -29.300 -16.756 1.00 164.44 ? 179 TYR A CE2 1 
ATOM   1226 C CZ  . TYR A 1 179 ? 3.207   -28.245 -15.868 1.00 165.89 ? 179 TYR A CZ  1 
ATOM   1227 O OH  . TYR A 1 179 ? 2.092   -27.449 -15.732 1.00 165.43 ? 179 TYR A OH  1 
ATOM   1228 N N   . PHE A 1 180 ? 8.878   -32.341 -17.444 1.00 150.27 ? 180 PHE A N   1 
ATOM   1229 C CA  . PHE A 1 180 ? 10.024  -33.234 -17.301 1.00 146.99 ? 180 PHE A CA  1 
ATOM   1230 C C   . PHE A 1 180 ? 11.106  -32.963 -18.346 1.00 145.78 ? 180 PHE A C   1 
ATOM   1231 O O   . PHE A 1 180 ? 12.233  -32.602 -18.005 1.00 151.00 ? 180 PHE A O   1 
ATOM   1232 C CB  . PHE A 1 180 ? 9.573   -34.695 -17.378 1.00 147.74 ? 180 PHE A CB  1 
ATOM   1233 C CG  . PHE A 1 180 ? 10.674  -35.686 -17.130 1.00 151.16 ? 180 PHE A CG  1 
ATOM   1234 C CD1 . PHE A 1 180 ? 10.953  -36.126 -15.847 1.00 153.78 ? 180 PHE A CD1 1 
ATOM   1235 C CD2 . PHE A 1 180 ? 11.426  -36.181 -18.181 1.00 152.78 ? 180 PHE A CD2 1 
ATOM   1236 C CE1 . PHE A 1 180 ? 11.963  -37.040 -15.617 1.00 154.52 ? 180 PHE A CE1 1 
ATOM   1237 C CE2 . PHE A 1 180 ? 12.439  -37.094 -17.960 1.00 153.85 ? 180 PHE A CE2 1 
ATOM   1238 C CZ  . PHE A 1 180 ? 12.708  -37.526 -16.675 1.00 154.11 ? 180 PHE A CZ  1 
ATOM   1239 N N   . ASN A 1 181 ? 10.757  -33.138 -19.616 1.00 138.75 ? 181 ASN A N   1 
ATOM   1240 C CA  . ASN A 1 181 ? 11.725  -33.008 -20.701 1.00 132.24 ? 181 ASN A CA  1 
ATOM   1241 C C   . ASN A 1 181 ? 12.263  -31.590 -20.876 1.00 124.93 ? 181 ASN A C   1 
ATOM   1242 O O   . ASN A 1 181 ? 13.435  -31.329 -20.610 1.00 130.97 ? 181 ASN A O   1 
ATOM   1243 C CB  . ASN A 1 181 ? 11.126  -33.513 -22.017 1.00 132.95 ? 181 ASN A CB  1 
ATOM   1244 C CG  . ASN A 1 181 ? 12.142  -33.550 -23.144 1.00 131.27 ? 181 ASN A CG  1 
ATOM   1245 O OD1 . ASN A 1 181 ? 13.306  -33.195 -22.961 1.00 131.97 ? 181 ASN A OD1 1 
ATOM   1246 N ND2 . ASN A 1 181 ? 11.705  -33.987 -24.319 1.00 132.35 ? 181 ASN A ND2 1 
ATOM   1247 N N   . PHE A 1 182 ? 11.407  -30.679 -21.327 1.00 114.11 ? 182 PHE A N   1 
ATOM   1248 C CA  . PHE A 1 182 ? 11.833  -29.315 -21.626 1.00 117.20 ? 182 PHE A CA  1 
ATOM   1249 C C   . PHE A 1 182 ? 12.456  -28.538 -20.467 1.00 120.69 ? 182 PHE A C   1 
ATOM   1250 O O   . PHE A 1 182 ? 13.639  -28.206 -20.502 1.00 124.29 ? 182 PHE A O   1 
ATOM   1251 C CB  . PHE A 1 182 ? 10.669  -28.490 -22.177 1.00 128.32 ? 182 PHE A CB  1 
ATOM   1252 C CG  . PHE A 1 182 ? 11.018  -27.053 -22.436 1.00 138.41 ? 182 PHE A CG  1 
ATOM   1253 C CD1 . PHE A 1 182 ? 12.058  -26.722 -23.290 1.00 140.47 ? 182 PHE A CD1 1 
ATOM   1254 C CD2 . PHE A 1 182 ? 10.306  -26.031 -21.830 1.00 144.57 ? 182 PHE A CD2 1 
ATOM   1255 C CE1 . PHE A 1 182 ? 12.384  -25.400 -23.531 1.00 144.74 ? 182 PHE A CE1 1 
ATOM   1256 C CE2 . PHE A 1 182 ? 10.628  -24.708 -22.069 1.00 148.14 ? 182 PHE A CE2 1 
ATOM   1257 C CZ  . PHE A 1 182 ? 11.667  -24.393 -22.921 1.00 148.80 ? 182 PHE A CZ  1 
ATOM   1258 N N   . PHE A 1 183 ? 11.658  -28.244 -19.445 1.00 124.27 ? 183 PHE A N   1 
ATOM   1259 C CA  . PHE A 1 183 ? 12.114  -27.412 -18.334 1.00 131.96 ? 183 PHE A CA  1 
ATOM   1260 C C   . PHE A 1 183 ? 13.308  -28.039 -17.609 1.00 133.04 ? 183 PHE A C   1 
ATOM   1261 O O   . PHE A 1 183 ? 14.345  -27.397 -17.442 1.00 137.45 ? 183 PHE A O   1 
ATOM   1262 C CB  . PHE A 1 183 ? 10.976  -27.145 -17.340 1.00 144.19 ? 183 PHE A CB  1 
ATOM   1263 C CG  . PHE A 1 183 ? 9.965   -26.140 -17.824 1.00 154.69 ? 183 PHE A CG  1 
ATOM   1264 C CD1 . PHE A 1 183 ? 10.302  -24.802 -17.949 1.00 159.68 ? 183 PHE A CD1 1 
ATOM   1265 C CD2 . PHE A 1 183 ? 8.672   -26.532 -18.137 1.00 158.12 ? 183 PHE A CD2 1 
ATOM   1266 C CE1 . PHE A 1 183 ? 9.372   -23.875 -18.389 1.00 161.84 ? 183 PHE A CE1 1 
ATOM   1267 C CE2 . PHE A 1 183 ? 7.737   -25.610 -18.576 1.00 160.32 ? 183 PHE A CE2 1 
ATOM   1268 C CZ  . PHE A 1 183 ? 8.088   -24.281 -18.701 1.00 161.84 ? 183 PHE A CZ  1 
ATOM   1269 N N   . ALA A 1 184 ? 13.162  -29.289 -17.183 1.00 131.04 ? 184 ALA A N   1 
ATOM   1270 C CA  . ALA A 1 184 ? 14.187  -29.942 -16.369 1.00 131.09 ? 184 ALA A CA  1 
ATOM   1271 C C   . ALA A 1 184 ? 15.381  -30.448 -17.177 1.00 133.55 ? 184 ALA A C   1 
ATOM   1272 O O   . ALA A 1 184 ? 16.532  -30.185 -16.827 1.00 131.62 ? 184 ALA A O   1 
ATOM   1273 C CB  . ALA A 1 184 ? 13.577  -31.080 -15.559 1.00 128.05 ? 184 ALA A CB  1 
ATOM   1274 N N   . CYS A 1 185 ? 15.104  -31.174 -18.255 1.00 136.47 ? 185 CYS A N   1 
ATOM   1275 C CA  . CYS A 1 185 ? 16.157  -31.831 -19.026 1.00 136.66 ? 185 CYS A CA  1 
ATOM   1276 C C   . CYS A 1 185 ? 16.651  -31.010 -20.216 1.00 127.92 ? 185 CYS A C   1 
ATOM   1277 O O   . CYS A 1 185 ? 17.411  -31.511 -21.046 1.00 127.35 ? 185 CYS A O   1 
ATOM   1278 C CB  . CYS A 1 185 ? 15.689  -33.209 -19.504 1.00 139.50 ? 185 CYS A CB  1 
ATOM   1279 S SG  . CYS A 1 185 ? 15.274  -34.363 -18.176 1.00 147.42 ? 185 CYS A SG  1 
ATOM   1280 N N   . VAL A 1 186 ? 16.221  -29.754 -20.301 1.00 118.15 ? 186 VAL A N   1 
ATOM   1281 C CA  . VAL A 1 186 ? 16.668  -28.877 -21.381 1.00 112.06 ? 186 VAL A CA  1 
ATOM   1282 C C   . VAL A 1 186 ? 16.893  -27.441 -20.914 1.00 118.08 ? 186 VAL A C   1 
ATOM   1283 O O   . VAL A 1 186 ? 17.985  -26.896 -21.070 1.00 122.62 ? 186 VAL A O   1 
ATOM   1284 C CB  . VAL A 1 186 ? 15.686  -28.881 -22.572 1.00 102.90 ? 186 VAL A CB  1 
ATOM   1285 C CG1 . VAL A 1 186 ? 16.016  -27.750 -23.535 1.00 100.84 ? 186 VAL A CG1 1 
ATOM   1286 C CG2 . VAL A 1 186 ? 15.717  -30.225 -23.286 1.00 94.39  ? 186 VAL A CG2 1 
ATOM   1287 N N   . LEU A 1 187 ? 15.861  -26.832 -20.343 1.00 121.21 ? 187 LEU A N   1 
ATOM   1288 C CA  . LEU A 1 187 ? 15.953  -25.447 -19.894 1.00 121.60 ? 187 LEU A CA  1 
ATOM   1289 C C   . LEU A 1 187 ? 16.960  -25.296 -18.758 1.00 114.34 ? 187 LEU A C   1 
ATOM   1290 O O   . LEU A 1 187 ? 17.780  -24.380 -18.768 1.00 109.66 ? 187 LEU A O   1 
ATOM   1291 C CB  . LEU A 1 187 ? 14.583  -24.919 -19.464 1.00 129.38 ? 187 LEU A CB  1 
ATOM   1292 C CG  . LEU A 1 187 ? 14.521  -23.429 -19.125 1.00 132.91 ? 187 LEU A CG  1 
ATOM   1293 C CD1 . LEU A 1 187 ? 14.949  -22.588 -20.319 1.00 131.89 ? 187 LEU A CD1 1 
ATOM   1294 C CD2 . LEU A 1 187 ? 13.126  -23.036 -18.664 1.00 134.52 ? 187 LEU A CD2 1 
ATOM   1295 N N   . VAL A 1 188 ? 16.897  -26.199 -17.784 1.00 116.57 ? 188 VAL A N   1 
ATOM   1296 C CA  . VAL A 1 188 ? 17.818  -26.166 -16.650 1.00 123.99 ? 188 VAL A CA  1 
ATOM   1297 C C   . VAL A 1 188 ? 19.280  -26.320 -17.079 1.00 128.21 ? 188 VAL A C   1 
ATOM   1298 O O   . VAL A 1 188 ? 20.129  -25.519 -16.685 1.00 127.63 ? 188 VAL A O   1 
ATOM   1299 C CB  . VAL A 1 188 ? 17.466  -27.231 -15.588 1.00 122.86 ? 188 VAL A CB  1 
ATOM   1300 C CG1 . VAL A 1 188 ? 18.577  -27.337 -14.552 1.00 121.45 ? 188 VAL A CG1 1 
ATOM   1301 C CG2 . VAL A 1 188 ? 16.136  -26.902 -14.929 1.00 126.01 ? 188 VAL A CG2 1 
ATOM   1302 N N   . PRO A 1 189 ? 19.581  -27.354 -17.883 1.00 125.85 ? 189 PRO A N   1 
ATOM   1303 C CA  . PRO A 1 189 ? 20.950  -27.523 -18.381 1.00 118.86 ? 189 PRO A CA  1 
ATOM   1304 C C   . PRO A 1 189 ? 21.453  -26.279 -19.106 1.00 114.49 ? 189 PRO A C   1 
ATOM   1305 O O   . PRO A 1 189 ? 22.540  -25.794 -18.802 1.00 120.39 ? 189 PRO A O   1 
ATOM   1306 C CB  . PRO A 1 189 ? 20.821  -28.688 -19.364 1.00 116.23 ? 189 PRO A CB  1 
ATOM   1307 C CG  . PRO A 1 189 ? 19.662  -29.469 -18.860 1.00 118.55 ? 189 PRO A CG  1 
ATOM   1308 C CD  . PRO A 1 189 ? 18.701  -28.455 -18.315 1.00 122.50 ? 189 PRO A CD  1 
ATOM   1309 N N   . LEU A 1 190 ? 20.667  -25.773 -20.051 1.00 107.53 ? 190 LEU A N   1 
ATOM   1310 C CA  . LEU A 1 190 ? 21.052  -24.582 -20.803 1.00 108.11 ? 190 LEU A CA  1 
ATOM   1311 C C   . LEU A 1 190 ? 21.288  -23.388 -19.883 1.00 107.54 ? 190 LEU A C   1 
ATOM   1312 O O   . LEU A 1 190 ? 22.118  -22.527 -20.173 1.00 108.09 ? 190 LEU A O   1 
ATOM   1313 C CB  . LEU A 1 190 ? 19.997  -24.238 -21.858 1.00 116.66 ? 190 LEU A CB  1 
ATOM   1314 C CG  . LEU A 1 190 ? 19.870  -25.205 -23.037 1.00 123.69 ? 190 LEU A CG  1 
ATOM   1315 C CD1 . LEU A 1 190 ? 18.723  -24.795 -23.947 1.00 133.84 ? 190 LEU A CD1 1 
ATOM   1316 C CD2 . LEU A 1 190 ? 21.173  -25.278 -23.817 1.00 118.87 ? 190 LEU A CD2 1 
ATOM   1317 N N   . LEU A 1 191 ? 20.554  -23.338 -18.777 1.00 112.13 ? 191 LEU A N   1 
ATOM   1318 C CA  . LEU A 1 191 ? 20.728  -22.271 -17.799 1.00 120.46 ? 191 LEU A CA  1 
ATOM   1319 C C   . LEU A 1 191 ? 22.016  -22.470 -17.009 1.00 119.98 ? 191 LEU A C   1 
ATOM   1320 O O   . LEU A 1 191 ? 22.662  -21.503 -16.606 1.00 120.48 ? 191 LEU A O   1 
ATOM   1321 C CB  . LEU A 1 191 ? 19.525  -22.193 -16.857 1.00 127.74 ? 191 LEU A CB  1 
ATOM   1322 C CG  . LEU A 1 191 ? 18.213  -21.720 -17.486 1.00 127.30 ? 191 LEU A CG  1 
ATOM   1323 C CD1 . LEU A 1 191 ? 17.073  -21.792 -16.479 1.00 130.32 ? 191 LEU A CD1 1 
ATOM   1324 C CD2 . LEU A 1 191 ? 18.356  -20.310 -18.044 1.00 123.52 ? 191 LEU A CD2 1 
ATOM   1325 N N   . LEU A 1 192 ? 22.383  -23.729 -16.790 1.00 121.81 ? 192 LEU A N   1 
ATOM   1326 C CA  . LEU A 1 192 ? 23.645  -24.053 -16.138 1.00 125.27 ? 192 LEU A CA  1 
ATOM   1327 C C   . LEU A 1 192 ? 24.809  -23.737 -17.068 1.00 118.27 ? 192 LEU A C   1 
ATOM   1328 O O   . LEU A 1 192 ? 25.783  -23.103 -16.666 1.00 113.81 ? 192 LEU A O   1 
ATOM   1329 C CB  . LEU A 1 192 ? 23.684  -25.528 -15.735 1.00 128.78 ? 192 LEU A CB  1 
ATOM   1330 C CG  . LEU A 1 192 ? 22.721  -25.966 -14.632 1.00 130.55 ? 192 LEU A CG  1 
ATOM   1331 C CD1 . LEU A 1 192 ? 22.819  -27.466 -14.402 1.00 131.80 ? 192 LEU A CD1 1 
ATOM   1332 C CD2 . LEU A 1 192 ? 22.999  -25.205 -13.346 1.00 129.49 ? 192 LEU A CD2 1 
ATOM   1333 N N   . MET A 1 193 ? 24.697  -24.185 -18.315 1.00 116.25 ? 193 MET A N   1 
ATOM   1334 C CA  . MET A 1 193 ? 25.721  -23.933 -19.322 1.00 115.73 ? 193 MET A CA  1 
ATOM   1335 C C   . MET A 1 193 ? 25.955  -22.439 -19.504 1.00 124.10 ? 193 MET A C   1 
ATOM   1336 O O   . MET A 1 193 ? 27.094  -21.973 -19.480 1.00 135.08 ? 193 MET A O   1 
ATOM   1337 C CB  . MET A 1 193 ? 25.326  -24.562 -20.658 1.00 106.67 ? 193 MET A CB  1 
ATOM   1338 C CG  . MET A 1 193 ? 25.216  -26.075 -20.625 1.00 101.19 ? 193 MET A CG  1 
ATOM   1339 S SD  . MET A 1 193 ? 24.906  -26.772 -22.256 1.00 174.37 ? 193 MET A SD  1 
ATOM   1340 C CE  . MET A 1 193 ? 26.288  -26.095 -23.171 1.00 236.45 ? 193 MET A CE  1 
ATOM   1341 N N   . LEU A 1 194 ? 24.872  -21.692 -19.691 1.00 120.67 ? 194 LEU A N   1 
ATOM   1342 C CA  . LEU A 1 194 ? 24.966  -20.247 -19.841 1.00 125.30 ? 194 LEU A CA  1 
ATOM   1343 C C   . LEU A 1 194 ? 25.658  -19.636 -18.629 1.00 120.61 ? 194 LEU A C   1 
ATOM   1344 O O   . LEU A 1 194 ? 26.477  -18.727 -18.761 1.00 117.96 ? 194 LEU A O   1 
ATOM   1345 C CB  . LEU A 1 194 ? 23.578  -19.630 -20.025 1.00 132.79 ? 194 LEU A CB  1 
ATOM   1346 C CG  . LEU A 1 194 ? 23.545  -18.122 -20.276 1.00 137.68 ? 194 LEU A CG  1 
ATOM   1347 C CD1 . LEU A 1 194 ? 24.388  -17.765 -21.492 1.00 143.72 ? 194 LEU A CD1 1 
ATOM   1348 C CD2 . LEU A 1 194 ? 22.116  -17.633 -20.447 1.00 133.53 ? 194 LEU A CD2 1 
ATOM   1349 N N   . GLY A 1 195 ? 25.326  -20.148 -17.447 1.00 118.32 ? 195 GLY A N   1 
ATOM   1350 C CA  . GLY A 1 195 ? 25.936  -19.683 -16.215 1.00 120.39 ? 195 GLY A CA  1 
ATOM   1351 C C   . GLY A 1 195 ? 27.420  -19.990 -16.158 1.00 125.08 ? 195 GLY A C   1 
ATOM   1352 O O   . GLY A 1 195 ? 28.201  -19.229 -15.588 1.00 128.38 ? 195 GLY A O   1 
ATOM   1353 N N   . VAL A 1 196 ? 27.809  -21.116 -16.750 1.00 124.44 ? 196 VAL A N   1 
ATOM   1354 C CA  . VAL A 1 196 ? 29.212  -21.508 -16.804 1.00 117.14 ? 196 VAL A CA  1 
ATOM   1355 C C   . VAL A 1 196 ? 30.022  -20.513 -17.625 1.00 114.67 ? 196 VAL A C   1 
ATOM   1356 O O   . VAL A 1 196 ? 31.003  -19.950 -17.142 1.00 115.24 ? 196 VAL A O   1 
ATOM   1357 C CB  . VAL A 1 196 ? 29.390  -22.919 -17.398 1.00 107.02 ? 196 VAL A CB  1 
ATOM   1358 C CG1 . VAL A 1 196 ? 30.844  -23.161 -17.769 1.00 108.06 ? 196 VAL A CG1 1 
ATOM   1359 C CG2 . VAL A 1 196 ? 28.901  -23.974 -16.419 1.00 102.50 ? 196 VAL A CG2 1 
ATOM   1360 N N   . TYR A 1 197 ? 29.602  -20.296 -18.868 1.00 112.84 ? 197 TYR A N   1 
ATOM   1361 C CA  . TYR A 1 197 ? 30.291  -19.367 -19.756 1.00 117.80 ? 197 TYR A CA  1 
ATOM   1362 C C   . TYR A 1 197 ? 30.351  -17.962 -19.164 1.00 121.04 ? 197 TYR A C   1 
ATOM   1363 O O   . TYR A 1 197 ? 31.216  -17.163 -19.525 1.00 121.55 ? 197 TYR A O   1 
ATOM   1364 C CB  . TYR A 1 197 ? 29.628  -19.340 -21.136 1.00 121.16 ? 197 TYR A CB  1 
ATOM   1365 C CG  . TYR A 1 197 ? 29.857  -20.598 -21.944 1.00 122.95 ? 197 TYR A CG  1 
ATOM   1366 C CD1 . TYR A 1 197 ? 31.015  -20.765 -22.692 1.00 124.23 ? 197 TYR A CD1 1 
ATOM   1367 C CD2 . TYR A 1 197 ? 28.915  -21.617 -21.962 1.00 126.30 ? 197 TYR A CD2 1 
ATOM   1368 C CE1 . TYR A 1 197 ? 31.229  -21.912 -23.433 1.00 125.47 ? 197 TYR A CE1 1 
ATOM   1369 C CE2 . TYR A 1 197 ? 29.121  -22.769 -22.699 1.00 127.31 ? 197 TYR A CE2 1 
ATOM   1370 C CZ  . TYR A 1 197 ? 30.279  -22.910 -23.434 1.00 125.40 ? 197 TYR A CZ  1 
ATOM   1371 O OH  . TYR A 1 197 ? 30.492  -24.053 -24.171 1.00 122.38 ? 197 TYR A OH  1 
ATOM   1372 N N   . LEU A 1 198 ? 29.429  -17.664 -18.254 1.00 125.54 ? 198 LEU A N   1 
ATOM   1373 C CA  . LEU A 1 198 ? 29.450  -16.392 -17.544 1.00 134.46 ? 198 LEU A CA  1 
ATOM   1374 C C   . LEU A 1 198 ? 30.717  -16.289 -16.706 1.00 136.38 ? 198 LEU A C   1 
ATOM   1375 O O   . LEU A 1 198 ? 31.409  -15.272 -16.731 1.00 134.19 ? 198 LEU A O   1 
ATOM   1376 C CB  . LEU A 1 198 ? 28.219  -16.249 -16.648 1.00 137.92 ? 198 LEU A CB  1 
ATOM   1377 C CG  . LEU A 1 198 ? 26.869  -16.074 -17.344 1.00 134.53 ? 198 LEU A CG  1 
ATOM   1378 C CD1 . LEU A 1 198 ? 25.743  -16.053 -16.324 1.00 135.22 ? 198 LEU A CD1 1 
ATOM   1379 C CD2 . LEU A 1 198 ? 26.862  -14.806 -18.185 1.00 133.61 ? 198 LEU A CD2 1 
ATOM   1380 N N   . ARG A 1 199 ? 31.015  -17.351 -15.965 1.00 140.93 ? 199 ARG A N   1 
ATOM   1381 C CA  . ARG A 1 199 ? 32.202  -17.392 -15.123 1.00 149.35 ? 199 ARG A CA  1 
ATOM   1382 C C   . ARG A 1 199 ? 33.464  -17.537 -15.967 1.00 149.93 ? 199 ARG A C   1 
ATOM   1383 O O   . ARG A 1 199 ? 34.516  -17.001 -15.621 1.00 155.36 ? 199 ARG A O   1 
ATOM   1384 C CB  . ARG A 1 199 ? 32.107  -18.542 -14.118 1.00 153.13 ? 199 ARG A CB  1 
ATOM   1385 C CG  . ARG A 1 199 ? 30.809  -18.582 -13.327 1.00 158.54 ? 199 ARG A CG  1 
ATOM   1386 C CD  . ARG A 1 199 ? 30.571  -17.288 -12.568 1.00 170.49 ? 199 ARG A CD  1 
ATOM   1387 N NE  . ARG A 1 199 ? 29.359  -17.350 -11.753 1.00 180.20 ? 199 ARG A NE  1 
ATOM   1388 C CZ  . ARG A 1 199 ? 28.145  -17.030 -12.191 1.00 181.81 ? 199 ARG A CZ  1 
ATOM   1389 N NH1 . ARG A 1 199 ? 27.972  -16.625 -13.442 1.00 182.22 ? 199 ARG A NH1 1 
ATOM   1390 N NH2 . ARG A 1 199 ? 27.100  -17.117 -11.379 1.00 179.69 ? 199 ARG A NH2 1 
ATOM   1391 N N   . ILE A 1 200 ? 33.352  -18.266 -17.074 1.00 139.79 ? 200 ILE A N   1 
ATOM   1392 C CA  . ILE A 1 200 ? 34.487  -18.493 -17.962 1.00 130.08 ? 200 ILE A CA  1 
ATOM   1393 C C   . ILE A 1 200 ? 35.068  -17.187 -18.491 1.00 138.51 ? 200 ILE A C   1 
ATOM   1394 O O   . ILE A 1 200 ? 36.232  -16.873 -18.244 1.00 145.63 ? 200 ILE A O   1 
ATOM   1395 C CB  . ILE A 1 200 ? 34.108  -19.391 -19.157 1.00 113.28 ? 200 ILE A CB  1 
ATOM   1396 C CG1 . ILE A 1 200 ? 33.866  -20.825 -18.689 1.00 105.55 ? 200 ILE A CG1 1 
ATOM   1397 C CG2 . ILE A 1 200 ? 35.202  -19.366 -20.213 1.00 111.07 ? 200 ILE A CG2 1 
ATOM   1398 C CD1 . ILE A 1 200 ? 33.647  -21.805 -19.820 1.00 104.27 ? 200 ILE A CD1 1 
ATOM   1399 N N   . PHE A 1 201 ? 34.251  -16.427 -19.213 1.00 139.84 ? 201 PHE A N   1 
ATOM   1400 C CA  . PHE A 1 201 ? 34.708  -15.186 -19.828 1.00 147.80 ? 201 PHE A CA  1 
ATOM   1401 C C   . PHE A 1 201 ? 34.938  -14.077 -18.803 1.00 158.16 ? 201 PHE A C   1 
ATOM   1402 O O   . PHE A 1 201 ? 35.759  -13.186 -19.019 1.00 163.14 ? 201 PHE A O   1 
ATOM   1403 C CB  . PHE A 1 201 ? 33.728  -14.729 -20.910 1.00 148.94 ? 201 PHE A CB  1 
ATOM   1404 C CG  . PHE A 1 201 ? 33.634  -15.673 -22.075 1.00 151.19 ? 201 PHE A CG  1 
ATOM   1405 C CD1 . PHE A 1 201 ? 34.520  -15.576 -23.136 1.00 151.16 ? 201 PHE A CD1 1 
ATOM   1406 C CD2 . PHE A 1 201 ? 32.662  -16.660 -22.109 1.00 153.24 ? 201 PHE A CD2 1 
ATOM   1407 C CE1 . PHE A 1 201 ? 34.440  -16.443 -24.209 1.00 150.30 ? 201 PHE A CE1 1 
ATOM   1408 C CE2 . PHE A 1 201 ? 32.575  -17.531 -23.179 1.00 151.76 ? 201 PHE A CE2 1 
ATOM   1409 C CZ  . PHE A 1 201 ? 33.465  -17.421 -24.232 1.00 151.08 ? 201 PHE A CZ  1 
ATOM   1410 N N   . ALA A 1 202 ? 34.217  -14.136 -17.688 1.00 161.64 ? 202 ALA A N   1 
ATOM   1411 C CA  . ALA A 1 202 ? 34.390  -13.156 -16.622 1.00 166.71 ? 202 ALA A CA  1 
ATOM   1412 C C   . ALA A 1 202 ? 35.761  -13.307 -15.972 1.00 169.10 ? 202 ALA A C   1 
ATOM   1413 O O   . ALA A 1 202 ? 36.418  -12.318 -15.645 1.00 170.51 ? 202 ALA A O   1 
ATOM   1414 C CB  . ALA A 1 202 ? 33.290  -13.296 -15.583 1.00 166.06 ? 202 ALA A CB  1 
ATOM   1415 N N   . ALA A 1 203 ? 36.185  -14.554 -15.792 1.00 168.48 ? 203 ALA A N   1 
ATOM   1416 C CA  . ALA A 1 203 ? 37.478  -14.850 -15.187 1.00 171.57 ? 203 ALA A CA  1 
ATOM   1417 C C   . ALA A 1 203 ? 38.603  -14.744 -16.210 1.00 170.35 ? 203 ALA A C   1 
ATOM   1418 O O   . ALA A 1 203 ? 39.716  -14.336 -15.881 1.00 171.40 ? 203 ALA A O   1 
ATOM   1419 C CB  . ALA A 1 203 ? 37.462  -16.235 -14.558 1.00 168.83 ? 203 ALA A CB  1 
ATOM   1420 N N   . ALA A 1 204 ? 38.303  -15.114 -17.451 1.00 164.21 ? 204 ALA A N   1 
ATOM   1421 C CA  . ALA A 1 204 ? 39.289  -15.072 -18.526 1.00 161.18 ? 204 ALA A CA  1 
ATOM   1422 C C   . ALA A 1 204 ? 39.817  -13.658 -18.744 1.00 168.28 ? 204 ALA A C   1 
ATOM   1423 O O   . ALA A 1 204 ? 41.007  -13.463 -18.992 1.00 174.25 ? 204 ALA A O   1 
ATOM   1424 C CB  . ALA A 1 204 ? 38.696  -15.624 -19.813 1.00 155.09 ? 204 ALA A CB  1 
ATOM   1425 N N   . ARG A 1 205 ? 38.928  -12.675 -18.647 1.00 170.48 ? 205 ARG A N   1 
ATOM   1426 C CA  . ARG A 1 205 ? 39.312  -11.278 -18.819 1.00 178.87 ? 205 ARG A CA  1 
ATOM   1427 C C   . ARG A 1 205 ? 40.037  -10.741 -17.588 1.00 186.56 ? 205 ARG A C   1 
ATOM   1428 O O   . ARG A 1 205 ? 40.764  -9.751  -17.671 1.00 193.44 ? 205 ARG A O   1 
ATOM   1429 C CB  . ARG A 1 205 ? 38.091  -10.412 -19.141 1.00 183.83 ? 205 ARG A CB  1 
ATOM   1430 C CG  . ARG A 1 205 ? 37.709  -10.395 -20.616 1.00 189.63 ? 205 ARG A CG  1 
ATOM   1431 C CD  . ARG A 1 205 ? 37.455  -11.799 -21.146 1.00 191.94 ? 205 ARG A CD  1 
ATOM   1432 N NE  . ARG A 1 205 ? 37.040  -11.795 -22.546 1.00 193.15 ? 205 ARG A NE  1 
ATOM   1433 C CZ  . ARG A 1 205 ? 35.775  -11.757 -22.952 1.00 190.76 ? 205 ARG A CZ  1 
ATOM   1434 N NH1 . ARG A 1 205 ? 34.791  -11.718 -22.062 1.00 189.39 ? 205 ARG A NH1 1 
ATOM   1435 N NH2 . ARG A 1 205 ? 35.492  -11.756 -24.247 1.00 188.66 ? 205 ARG A NH2 1 
ATOM   1436 N N   . ARG A 1 206 ? 39.833  -11.394 -16.448 1.00 185.81 ? 206 ARG A N   1 
ATOM   1437 C CA  . ARG A 1 206 ? 40.561  -11.042 -15.233 1.00 189.38 ? 206 ARG A CA  1 
ATOM   1438 C C   . ARG A 1 206 ? 41.983  -11.589 -15.299 1.00 185.69 ? 206 ARG A C   1 
ATOM   1439 O O   . ARG A 1 206 ? 42.919  -10.980 -14.779 1.00 187.39 ? 206 ARG A O   1 
ATOM   1440 C CB  . ARG A 1 206 ? 39.843  -11.566 -13.986 1.00 192.14 ? 206 ARG A CB  1 
ATOM   1441 C CG  . ARG A 1 206 ? 38.514  -10.884 -13.702 1.00 195.89 ? 206 ARG A CG  1 
ATOM   1442 C CD  . ARG A 1 206 ? 38.028  -11.175 -12.286 1.00 199.35 ? 206 ARG A CD  1 
ATOM   1443 N NE  . ARG A 1 206 ? 37.762  -12.595 -12.067 1.00 200.02 ? 206 ARG A NE  1 
ATOM   1444 C CZ  . ARG A 1 206 ? 36.567  -13.162 -12.208 1.00 200.51 ? 206 ARG A CZ  1 
ATOM   1445 N NH1 . ARG A 1 206 ? 35.522  -12.429 -12.566 1.00 201.34 ? 206 ARG A NH1 1 
ATOM   1446 N NH2 . ARG A 1 206 ? 36.416  -14.462 -11.989 1.00 199.39 ? 206 ARG A NH2 1 
ATOM   1447 N N   . GLN A 1 207 ? 42.137  -12.741 -15.945 1.00 177.61 ? 207 GLN A N   1 
ATOM   1448 C CA  . GLN A 1 207 ? 43.454  -13.321 -16.168 1.00 168.33 ? 207 GLN A CA  1 
ATOM   1449 C C   . GLN A 1 207 ? 44.294  -12.358 -16.993 1.00 160.84 ? 207 GLN A C   1 
ATOM   1450 O O   . GLN A 1 207 ? 45.478  -12.160 -16.724 1.00 165.93 ? 207 GLN A O   1 
ATOM   1451 C CB  . GLN A 1 207 ? 43.340  -14.663 -16.894 1.00 166.79 ? 207 GLN A CB  1 
ATOM   1452 C CG  . GLN A 1 207 ? 42.497  -15.702 -16.174 1.00 169.76 ? 207 GLN A CG  1 
ATOM   1453 C CD  . GLN A 1 207 ? 43.125  -16.174 -14.876 1.00 176.94 ? 207 GLN A CD  1 
ATOM   1454 O OE1 . GLN A 1 207 ? 44.288  -15.888 -14.595 1.00 184.93 ? 207 GLN A OE1 1 
ATOM   1455 N NE2 . GLN A 1 207 ? 42.354  -16.906 -14.078 1.00 173.55 ? 207 GLN A NE2 1 
ATOM   1456 N N   . LEU A 1 208 ? 43.666  -11.758 -18.000 1.00 153.23 ? 208 LEU A N   1 
ATOM   1457 C CA  . LEU A 1 208 ? 44.345  -10.810 -18.873 1.00 155.69 ? 208 LEU A CA  1 
ATOM   1458 C C   . LEU A 1 208 ? 44.662  -9.507  -18.147 1.00 169.60 ? 208 LEU A C   1 
ATOM   1459 O O   . LEU A 1 208 ? 45.605  -8.803  -18.506 1.00 178.16 ? 208 LEU A O   1 
ATOM   1460 C CB  . LEU A 1 208 ? 43.502  -10.523 -20.117 1.00 149.53 ? 208 LEU A CB  1 
ATOM   1461 C CG  . LEU A 1 208 ? 43.221  -11.713 -21.036 1.00 148.87 ? 208 LEU A CG  1 
ATOM   1462 C CD1 . LEU A 1 208 ? 42.356  -11.287 -22.211 1.00 151.19 ? 208 LEU A CD1 1 
ATOM   1463 C CD2 . LEU A 1 208 ? 44.520  -12.335 -21.523 1.00 150.10 ? 208 LEU A CD2 1 
ATOM   1464 N N   . LYS A 1 209 ? 43.872  -9.189  -17.127 1.00 176.59 ? 209 LYS A N   1 
ATOM   1465 C CA  . LYS A 1 209 ? 44.089  -7.973  -16.353 1.00 193.93 ? 209 LYS A CA  1 
ATOM   1466 C C   . LYS A 1 209 ? 45.258  -8.137  -15.387 1.00 203.91 ? 209 LYS A C   1 
ATOM   1467 O O   . LYS A 1 209 ? 46.040  -7.209  -15.184 1.00 208.73 ? 209 LYS A O   1 
ATOM   1468 C CB  . LYS A 1 209 ? 42.824  -7.576  -15.593 1.00 200.92 ? 209 LYS A CB  1 
ATOM   1469 C CG  . LYS A 1 209 ? 42.952  -6.262  -14.839 1.00 212.20 ? 209 LYS A CG  1 
ATOM   1470 C CD  . LYS A 1 209 ? 41.651  -5.896  -14.145 1.00 217.28 ? 209 LYS A CD  1 
ATOM   1471 C CE  . LYS A 1 209 ? 41.773  -4.572  -13.409 1.00 223.99 ? 209 LYS A CE  1 
ATOM   1472 N NZ  . LYS A 1 209 ? 40.502  -4.202  -12.728 1.00 224.34 ? 209 LYS A NZ  1 
ATOM   1473 N N   . GLN A 1 210 ? 45.370  -9.320  -14.790 1.00 207.00 ? 210 GLN A N   1 
ATOM   1474 C CA  . GLN A 1 210 ? 46.493  -9.623  -13.912 1.00 212.60 ? 210 GLN A CA  1 
ATOM   1475 C C   . GLN A 1 210 ? 47.778  -9.702  -14.725 1.00 210.93 ? 210 GLN A C   1 
ATOM   1476 O O   . GLN A 1 210 ? 48.851  -9.327  -14.251 1.00 214.63 ? 210 GLN A O   1 
ATOM   1477 C CB  . GLN A 1 210 ? 46.261  -10.938 -13.168 1.00 215.73 ? 210 GLN A CB  1 
ATOM   1478 C CG  . GLN A 1 210 ? 45.036  -10.937 -12.269 1.00 220.60 ? 210 GLN A CG  1 
ATOM   1479 C CD  . GLN A 1 210 ? 44.885  -12.231 -11.494 1.00 223.56 ? 210 GLN A CD  1 
ATOM   1480 O OE1 . GLN A 1 210 ? 45.777  -13.080 -11.503 1.00 223.56 ? 210 GLN A OE1 1 
ATOM   1481 N NE2 . GLN A 1 210 ? 43.754  -12.387 -10.817 1.00 224.92 ? 210 GLN A NE2 1 
ATOM   1482 N N   . MET A 1 211 ? 47.659  -10.195 -15.953 1.00 205.57 ? 211 MET A N   1 
ATOM   1483 C CA  . MET A 1 211 ? 48.791  -10.261 -16.867 1.00 205.89 ? 211 MET A CA  1 
ATOM   1484 C C   . MET A 1 211 ? 49.007  -8.909  -17.534 1.00 215.65 ? 211 MET A C   1 
ATOM   1485 O O   . MET A 1 211 ? 49.984  -8.707  -18.254 1.00 224.12 ? 211 MET A O   1 
ATOM   1486 C CB  . MET A 1 211 ? 48.563  -11.340 -17.925 1.00 196.55 ? 211 MET A CB  1 
ATOM   1487 C CG  . MET A 1 211 ? 48.400  -12.739 -17.357 1.00 192.38 ? 211 MET A CG  1 
ATOM   1488 S SD  . MET A 1 211 ? 48.158  -13.975 -18.646 1.00 183.31 ? 211 MET A SD  1 
ATOM   1489 C CE  . MET A 1 211 ? 49.663  -13.761 -19.589 1.00 265.58 ? 211 MET A CE  1 
ATOM   1490 N N   . GLU A 1 212 ? 48.082  -7.986  -17.291 1.00 216.20 ? 212 GLU A N   1 
ATOM   1491 C CA  . GLU A 1 212 ? 48.199  -6.627  -17.803 1.00 221.22 ? 212 GLU A CA  1 
ATOM   1492 C C   . GLU A 1 212 ? 49.033  -5.789  -16.842 1.00 224.07 ? 212 GLU A C   1 
ATOM   1493 O O   . GLU A 1 212 ? 49.537  -4.724  -17.201 1.00 225.68 ? 212 GLU A O   1 
ATOM   1494 C CB  . GLU A 1 212 ? 46.813  -6.005  -17.985 1.00 224.58 ? 212 GLU A CB  1 
ATOM   1495 C CG  . GLU A 1 212 ? 46.822  -4.610  -18.586 1.00 231.43 ? 212 GLU A CG  1 
ATOM   1496 C CD  . GLU A 1 212 ? 45.427  -4.030  -18.730 1.00 232.26 ? 212 GLU A CD  1 
ATOM   1497 O OE1 . GLU A 1 212 ? 44.450  -4.731  -18.386 1.00 228.40 ? 212 GLU A OE1 1 
ATOM   1498 O OE2 . GLU A 1 212 ? 45.306  -2.874  -19.187 1.00 235.60 ? 212 GLU A OE2 1 
ATOM   1499 N N   . SER A 1 213 ? 49.178  -6.286  -15.617 1.00 225.25 ? 213 SER A N   1 
ATOM   1500 C CA  . SER A 1 213 ? 49.958  -5.602  -14.594 1.00 232.97 ? 213 SER A CA  1 
ATOM   1501 C C   . SER A 1 213 ? 51.131  -6.462  -14.136 1.00 241.11 ? 213 SER A C   1 
ATOM   1502 O O   . SER A 1 213 ? 51.470  -6.486  -12.953 1.00 245.10 ? 213 SER A O   1 
ATOM   1503 C CB  . SER A 1 213 ? 49.073  -5.244  -13.398 1.00 229.71 ? 213 SER A CB  1 
ATOM   1504 O OG  . SER A 1 213 ? 47.991  -4.418  -13.791 1.00 227.01 ? 213 SER A OG  1 
ATOM   1505 N N   . GLN A 1 214 ? 51.747  -7.167  -15.080 1.00 244.18 ? 214 GLN A N   1 
ATOM   1506 C CA  . GLN A 1 214 ? 52.878  -8.036  -14.772 1.00 247.39 ? 214 GLN A CA  1 
ATOM   1507 C C   . GLN A 1 214 ? 54.197  -7.416  -15.224 1.00 259.45 ? 214 GLN A C   1 
ATOM   1508 O O   . GLN A 1 214 ? 54.279  -6.841  -16.310 1.00 261.64 ? 214 GLN A O   1 
ATOM   1509 C CB  . GLN A 1 214 ? 52.690  -9.413  -15.413 1.00 239.09 ? 214 GLN A CB  1 
ATOM   1510 C CG  . GLN A 1 214 ? 52.573  -9.379  -16.927 1.00 234.86 ? 214 GLN A CG  1 
ATOM   1511 C CD  . GLN A 1 214 ? 52.334  -10.752 -17.525 1.00 231.22 ? 214 GLN A CD  1 
ATOM   1512 O OE1 . GLN A 1 214 ? 52.233  -11.746 -16.806 1.00 231.95 ? 214 GLN A OE1 1 
ATOM   1513 N NE2 . GLN A 1 214 ? 52.236  -10.813 -18.848 1.00 227.81 ? 214 GLN A NE2 1 
ATOM   1514 N N   . PRO A 1 215 ? 55.235  -7.530  -14.381 1.00 265.02 ? 215 PRO A N   1 
ATOM   1515 C CA  . PRO A 1 215 ? 56.572  -6.984  -14.649 1.00 271.50 ? 215 PRO A CA  1 
ATOM   1516 C C   . PRO A 1 215 ? 57.331  -7.766  -15.720 1.00 274.54 ? 215 PRO A C   1 
ATOM   1517 O O   . PRO A 1 215 ? 58.551  -7.636  -15.818 1.00 275.88 ? 215 PRO A O   1 
ATOM   1518 C CB  . PRO A 1 215 ? 57.288  -7.130  -13.299 1.00 272.17 ? 215 PRO A CB  1 
ATOM   1519 C CG  . PRO A 1 215 ? 56.200  -7.345  -12.290 1.00 269.52 ? 215 PRO A CG  1 
ATOM   1520 C CD  . PRO A 1 215 ? 55.135  -8.087  -13.024 1.00 265.25 ? 215 PRO A CD  1 
ATOM   1521 N N   . LEU A 1 216 ? 56.620  -8.566  -16.508 1.00 278.63 ? 216 LEU A N   1 
ATOM   1522 C CA  . LEU A 1 216 ? 57.252  -9.362  -17.557 1.00 280.42 ? 216 LEU A CA  1 
ATOM   1523 C C   . LEU A 1 216 ? 56.322  -9.591  -18.747 1.00 275.68 ? 216 LEU A C   1 
ATOM   1524 O O   . LEU A 1 216 ? 55.101  -9.613  -18.591 1.00 278.27 ? 216 LEU A O   1 
ATOM   1525 C CB  . LEU A 1 216 ? 57.752  -10.699 -16.992 1.00 278.81 ? 216 LEU A CB  1 
ATOM   1526 C CG  . LEU A 1 216 ? 56.796  -11.544 -16.143 1.00 273.40 ? 216 LEU A CG  1 
ATOM   1527 C CD1 . LEU A 1 216 ? 55.691  -12.160 -16.990 1.00 266.66 ? 216 LEU A CD1 1 
ATOM   1528 C CD2 . LEU A 1 216 ? 57.565  -12.631 -15.407 1.00 273.28 ? 216 LEU A CD2 1 
ATOM   1529 N N   . PRO A 1 217 ? 56.902  -9.754  -19.946 1.00 261.97 ? 217 PRO A N   1 
ATOM   1530 C CA  . PRO A 1 217 ? 56.131  -10.013 -21.167 1.00 249.78 ? 217 PRO A CA  1 
ATOM   1531 C C   . PRO A 1 217 ? 55.255  -11.257 -21.036 1.00 232.75 ? 217 PRO A C   1 
ATOM   1532 O O   . PRO A 1 217 ? 54.028  -11.147 -21.026 1.00 230.63 ? 217 PRO A O   1 
ATOM   1533 C CB  . PRO A 1 217 ? 57.217  -10.243 -22.221 1.00 250.32 ? 217 PRO A CB  1 
ATOM   1534 C CG  . PRO A 1 217 ? 58.399  -9.498  -21.710 1.00 258.00 ? 217 PRO A CG  1 
ATOM   1535 C CD  . PRO A 1 217 ? 58.345  -9.636  -20.219 1.00 262.19 ? 217 PRO A CD  1 
ATOM   1536 N N   . GLY A 1 218 ? 55.886  -12.423 -20.935 1.00 219.22 ? 218 GLY A N   1 
ATOM   1537 C CA  . GLY A 1 218 ? 55.167  -13.675 -20.790 1.00 202.71 ? 218 GLY A CA  1 
ATOM   1538 C C   . GLY A 1 218 ? 54.067  -13.844 -21.820 1.00 186.86 ? 218 GLY A C   1 
ATOM   1539 O O   . GLY A 1 218 ? 52.899  -14.023 -21.472 1.00 179.49 ? 218 GLY A O   1 
ATOM   1540 N N   . GLU A 1 219 ? 54.441  -13.782 -23.094 1.00 181.76 ? 219 GLU A N   1 
ATOM   1541 C CA  . GLU A 1 219 ? 53.477  -13.921 -24.179 1.00 175.61 ? 219 GLU A CA  1 
ATOM   1542 C C   . GLU A 1 219 ? 53.064  -15.376 -24.371 1.00 175.98 ? 219 GLU A C   1 
ATOM   1543 O O   . GLU A 1 219 ? 52.084  -15.667 -25.057 1.00 176.69 ? 219 GLU A O   1 
ATOM   1544 C CB  . GLU A 1 219 ? 54.039  -13.347 -25.481 1.00 174.35 ? 219 GLU A CB  1 
ATOM   1545 C CG  . GLU A 1 219 ? 54.323  -11.858 -25.413 1.00 179.25 ? 219 GLU A CG  1 
ATOM   1546 C CD  . GLU A 1 219 ? 53.109  -11.059 -24.981 1.00 180.49 ? 219 GLU A CD  1 
ATOM   1547 O OE1 . GLU A 1 219 ? 53.273  -10.094 -24.207 1.00 179.83 ? 219 GLU A OE1 1 
ATOM   1548 O OE2 . GLU A 1 219 ? 51.985  -11.403 -25.404 1.00 184.11 ? 219 GLU A OE2 1 
ATOM   1549 N N   . ARG A 1 220 ? 53.818  -16.287 -23.766 1.00 178.23 ? 220 ARG A N   1 
ATOM   1550 C CA  . ARG A 1 220 ? 53.463  -17.701 -23.783 1.00 179.63 ? 220 ARG A CA  1 
ATOM   1551 C C   . ARG A 1 220 ? 52.138  -17.916 -23.064 1.00 174.07 ? 220 ARG A C   1 
ATOM   1552 O O   . ARG A 1 220 ? 51.248  -18.601 -23.568 1.00 164.85 ? 220 ARG A O   1 
ATOM   1553 C CB  . ARG A 1 220 ? 54.560  -18.538 -23.125 1.00 185.63 ? 220 ARG A CB  1 
ATOM   1554 C CG  . ARG A 1 220 ? 55.739  -18.831 -24.032 1.00 192.90 ? 220 ARG A CG  1 
ATOM   1555 C CD  . ARG A 1 220 ? 55.395  -19.911 -25.047 1.00 197.28 ? 220 ARG A CD  1 
ATOM   1556 N NE  . ARG A 1 220 ? 56.450  -20.077 -26.042 1.00 206.84 ? 220 ARG A NE  1 
ATOM   1557 C CZ  . ARG A 1 220 ? 56.392  -19.593 -27.278 1.00 212.14 ? 220 ARG A CZ  1 
ATOM   1558 N NH1 . ARG A 1 220 ? 55.323  -18.917 -27.677 1.00 213.47 ? 220 ARG A NH1 1 
ATOM   1559 N NH2 . ARG A 1 220 ? 57.400  -19.789 -28.119 1.00 213.96 ? 220 ARG A NH2 1 
ATOM   1560 N N   . ALA A 1 221 ? 52.014  -17.320 -21.883 1.00 176.64 ? 221 ALA A N   1 
ATOM   1561 C CA  . ALA A 1 221 ? 50.795  -17.435 -21.094 1.00 169.20 ? 221 ALA A CA  1 
ATOM   1562 C C   . ALA A 1 221 ? 49.640  -16.692 -21.755 1.00 162.46 ? 221 ALA A C   1 
ATOM   1563 O O   . ALA A 1 221 ? 48.493  -17.129 -21.685 1.00 160.36 ? 221 ALA A O   1 
ATOM   1564 C CB  . ALA A 1 221 ? 51.025  -16.920 -19.681 1.00 172.63 ? 221 ALA A CB  1 
ATOM   1565 N N   . ARG A 1 222 ? 49.944  -15.566 -22.395 1.00 160.48 ? 222 ARG A N   1 
ATOM   1566 C CA  . ARG A 1 222 ? 48.921  -14.787 -23.084 1.00 156.88 ? 222 ARG A CA  1 
ATOM   1567 C C   . ARG A 1 222 ? 48.401  -15.515 -24.317 1.00 160.92 ? 222 ARG A C   1 
ATOM   1568 O O   . ARG A 1 222 ? 47.192  -15.650 -24.503 1.00 166.98 ? 222 ARG A O   1 
ATOM   1569 C CB  . ARG A 1 222 ? 49.449  -13.406 -23.478 1.00 153.80 ? 222 ARG A CB  1 
ATOM   1570 C CG  . ARG A 1 222 ? 48.911  -12.274 -22.619 1.00 157.21 ? 222 ARG A CG  1 
ATOM   1571 C CD  . ARG A 1 222 ? 49.128  -10.926 -23.280 1.00 169.66 ? 222 ARG A CD  1 
ATOM   1572 N NE  . ARG A 1 222 ? 48.645  -9.829  -22.446 1.00 184.20 ? 222 ARG A NE  1 
ATOM   1573 C CZ  . ARG A 1 222 ? 49.415  -9.119  -21.628 1.00 201.52 ? 222 ARG A CZ  1 
ATOM   1574 N NH1 . ARG A 1 222 ? 50.711  -9.389  -21.533 1.00 208.81 ? 222 ARG A NH1 1 
ATOM   1575 N NH2 . ARG A 1 222 ? 48.888  -8.137  -20.908 1.00 206.23 ? 222 ARG A NH2 1 
ATOM   1576 N N   . SER A 1 223 ? 49.318  -15.979 -25.159 1.00 157.74 ? 223 SER A N   1 
ATOM   1577 C CA  . SER A 1 223 ? 48.942  -16.711 -26.361 1.00 157.43 ? 223 SER A CA  1 
ATOM   1578 C C   . SER A 1 223 ? 48.116  -17.943 -26.008 1.00 162.07 ? 223 SER A C   1 
ATOM   1579 O O   . SER A 1 223 ? 47.082  -18.205 -26.622 1.00 163.48 ? 223 SER A O   1 
ATOM   1580 C CB  . SER A 1 223 ? 50.183  -17.120 -27.156 1.00 157.27 ? 223 SER A CB  1 
ATOM   1581 O OG  . SER A 1 223 ? 49.821  -17.783 -28.354 1.00 153.17 ? 223 SER A OG  1 
ATOM   1582 N N   . THR A 1 224 ? 48.577  -18.693 -25.013 1.00 164.69 ? 224 THR A N   1 
ATOM   1583 C CA  . THR A 1 224 ? 47.870  -19.886 -24.561 1.00 162.54 ? 224 THR A CA  1 
ATOM   1584 C C   . THR A 1 224 ? 46.495  -19.530 -24.003 1.00 157.27 ? 224 THR A C   1 
ATOM   1585 O O   . THR A 1 224 ? 45.499  -20.185 -24.308 1.00 152.44 ? 224 THR A O   1 
ATOM   1586 C CB  . THR A 1 224 ? 48.670  -20.643 -23.483 1.00 164.60 ? 224 THR A CB  1 
ATOM   1587 O OG1 . THR A 1 224 ? 49.952  -21.011 -24.007 1.00 164.86 ? 224 THR A OG1 1 
ATOM   1588 C CG2 . THR A 1 224 ? 47.928  -21.897 -23.047 1.00 162.76 ? 224 THR A CG2 1 
ATOM   1589 N N   . LEU A 1 225 ? 46.453  -18.487 -23.181 1.00 153.99 ? 225 LEU A N   1 
ATOM   1590 C CA  . LEU A 1 225 ? 45.204  -18.022 -22.594 1.00 145.66 ? 225 LEU A CA  1 
ATOM   1591 C C   . LEU A 1 225 ? 44.222  -17.632 -23.692 1.00 143.19 ? 225 LEU A C   1 
ATOM   1592 O O   . LEU A 1 225 ? 43.047  -17.991 -23.640 1.00 143.81 ? 225 LEU A O   1 
ATOM   1593 C CB  . LEU A 1 225 ? 45.467  -16.836 -21.661 1.00 145.49 ? 225 LEU A CB  1 
ATOM   1594 C CG  . LEU A 1 225 ? 44.365  -16.391 -20.694 1.00 144.16 ? 225 LEU A CG  1 
ATOM   1595 C CD1 . LEU A 1 225 ? 43.226  -15.697 -21.427 1.00 145.59 ? 225 LEU A CD1 1 
ATOM   1596 C CD2 . LEU A 1 225 ? 43.848  -17.572 -19.884 1.00 139.98 ? 225 LEU A CD2 1 
ATOM   1597 N N   . GLN A 1 226 ? 44.711  -16.903 -24.690 1.00 144.73 ? 226 GLN A N   1 
ATOM   1598 C CA  . GLN A 1 226 ? 43.868  -16.454 -25.793 1.00 150.75 ? 226 GLN A CA  1 
ATOM   1599 C C   . GLN A 1 226 ? 43.369  -17.618 -26.645 1.00 156.35 ? 226 GLN A C   1 
ATOM   1600 O O   . GLN A 1 226 ? 42.288  -17.547 -27.232 1.00 157.44 ? 226 GLN A O   1 
ATOM   1601 C CB  . GLN A 1 226 ? 44.612  -15.442 -26.668 1.00 153.91 ? 226 GLN A CB  1 
ATOM   1602 C CG  . GLN A 1 226 ? 44.969  -14.150 -25.958 1.00 162.37 ? 226 GLN A CG  1 
ATOM   1603 C CD  . GLN A 1 226 ? 45.612  -13.137 -26.884 1.00 175.76 ? 226 GLN A CD  1 
ATOM   1604 O OE1 . GLN A 1 226 ? 45.465  -13.213 -28.103 1.00 176.67 ? 226 GLN A OE1 1 
ATOM   1605 N NE2 . GLN A 1 226 ? 46.330  -12.179 -26.308 1.00 186.50 ? 226 GLN A NE2 1 
ATOM   1606 N N   . LYS A 1 227 ? 44.158  -18.685 -26.712 1.00 162.27 ? 227 LYS A N   1 
ATOM   1607 C CA  . LYS A 1 227 ? 43.776  -19.863 -27.481 1.00 169.80 ? 227 LYS A CA  1 
ATOM   1608 C C   . LYS A 1 227 ? 42.774  -20.727 -26.720 1.00 170.34 ? 227 LYS A C   1 
ATOM   1609 O O   . LYS A 1 227 ? 41.910  -21.365 -27.322 1.00 170.03 ? 227 LYS A O   1 
ATOM   1610 C CB  . LYS A 1 227 ? 45.009  -20.680 -27.871 1.00 177.20 ? 227 LYS A CB  1 
ATOM   1611 C CG  . LYS A 1 227 ? 45.924  -19.974 -28.857 1.00 184.20 ? 227 LYS A CG  1 
ATOM   1612 C CD  . LYS A 1 227 ? 47.140  -20.819 -29.198 1.00 190.14 ? 227 LYS A CD  1 
ATOM   1613 C CE  . LYS A 1 227 ? 48.062  -20.091 -30.163 1.00 197.10 ? 227 LYS A CE  1 
ATOM   1614 N NZ  . LYS A 1 227 ? 49.278  -20.887 -30.485 1.00 199.97 ? 227 LYS A NZ  1 
ATOM   1615 N N   . GLU A 1 228 ? 42.895  -20.741 -25.397 1.00 171.71 ? 228 GLU A N   1 
ATOM   1616 C CA  . GLU A 1 228 ? 41.942  -21.450 -24.550 1.00 169.94 ? 228 GLU A CA  1 
ATOM   1617 C C   . GLU A 1 228 ? 40.602  -20.723 -24.543 1.00 163.30 ? 228 GLU A C   1 
ATOM   1618 O O   . GLU A 1 228 ? 39.544  -21.346 -24.441 1.00 158.07 ? 228 GLU A O   1 
ATOM   1619 C CB  . GLU A 1 228 ? 42.482  -21.584 -23.125 1.00 173.19 ? 228 GLU A CB  1 
ATOM   1620 C CG  . GLU A 1 228 ? 43.675  -22.519 -22.999 1.00 174.00 ? 228 GLU A CG  1 
ATOM   1621 C CD  . GLU A 1 228 ? 43.308  -23.969 -23.252 1.00 170.69 ? 228 GLU A CD  1 
ATOM   1622 O OE1 . GLU A 1 228 ? 42.112  -24.310 -23.131 1.00 170.63 ? 228 GLU A OE1 1 
ATOM   1623 O OE2 . GLU A 1 228 ? 44.215  -24.768 -23.566 1.00 166.85 ? 228 GLU A OE2 1 
ATOM   1624 N N   . VAL A 1 229 ? 40.658  -19.399 -24.652 1.00 158.82 ? 229 VAL A N   1 
ATOM   1625 C CA  . VAL A 1 229 ? 39.454  -18.584 -24.741 1.00 149.27 ? 229 VAL A CA  1 
ATOM   1626 C C   . VAL A 1 229 ? 38.812  -18.745 -26.114 1.00 147.58 ? 229 VAL A C   1 
ATOM   1627 O O   . VAL A 1 229 ? 37.588  -18.733 -26.243 1.00 149.54 ? 229 VAL A O   1 
ATOM   1628 C CB  . VAL A 1 229 ? 39.758  -17.097 -24.486 1.00 143.84 ? 229 VAL A CB  1 
ATOM   1629 C CG1 . VAL A 1 229 ? 38.553  -16.237 -24.833 1.00 145.66 ? 229 VAL A CG1 1 
ATOM   1630 C CG2 . VAL A 1 229 ? 40.170  -16.883 -23.038 1.00 140.74 ? 229 VAL A CG2 1 
ATOM   1631 N N   . HIS A 1 230 ? 39.645  -18.904 -27.137 1.00 145.51 ? 230 HIS A N   1 
ATOM   1632 C CA  . HIS A 1 230 ? 39.154  -19.113 -28.493 1.00 143.09 ? 230 HIS A CA  1 
ATOM   1633 C C   . HIS A 1 230 ? 38.407  -20.439 -28.590 1.00 135.90 ? 230 HIS A C   1 
ATOM   1634 O O   . HIS A 1 230 ? 37.441  -20.565 -29.342 1.00 135.73 ? 230 HIS A O   1 
ATOM   1635 C CB  . HIS A 1 230 ? 40.307  -19.086 -29.496 1.00 149.25 ? 230 HIS A CB  1 
ATOM   1636 C CG  . HIS A 1 230 ? 39.873  -19.248 -30.917 1.00 153.68 ? 230 HIS A CG  1 
ATOM   1637 N ND1 . HIS A 1 230 ? 39.590  -18.175 -31.738 1.00 154.82 ? 230 HIS A ND1 1 
ATOM   1638 C CD2 . HIS A 1 230 ? 39.666  -20.355 -31.669 1.00 156.04 ? 230 HIS A CD2 1 
ATOM   1639 C CE1 . HIS A 1 230 ? 39.233  -18.615 -32.929 1.00 155.17 ? 230 HIS A CE1 1 
ATOM   1640 N NE2 . HIS A 1 230 ? 39.270  -19.937 -32.914 1.00 156.18 ? 230 HIS A NE2 1 
ATOM   1641 N N   . ALA A 1 231 ? 38.863  -21.425 -27.826 1.00 129.91 ? 231 ALA A N   1 
ATOM   1642 C CA  . ALA A 1 231 ? 38.215  -22.730 -27.795 1.00 127.53 ? 231 ALA A CA  1 
ATOM   1643 C C   . ALA A 1 231 ? 36.929  -22.672 -26.976 1.00 129.01 ? 231 ALA A C   1 
ATOM   1644 O O   . ALA A 1 231 ? 35.908  -23.239 -27.363 1.00 126.49 ? 231 ALA A O   1 
ATOM   1645 C CB  . ALA A 1 231 ? 39.160  -23.778 -27.229 1.00 128.18 ? 231 ALA A CB  1 
ATOM   1646 N N   . ALA A 1 232 ? 36.989  -21.985 -25.840 1.00 131.65 ? 232 ALA A N   1 
ATOM   1647 C CA  . ALA A 1 232 ? 35.817  -21.812 -24.989 1.00 131.42 ? 232 ALA A CA  1 
ATOM   1648 C C   . ALA A 1 232 ? 34.750  -21.001 -25.716 1.00 130.68 ? 232 ALA A C   1 
ATOM   1649 O O   . ALA A 1 232 ? 33.553  -21.228 -25.539 1.00 127.52 ? 232 ALA A O   1 
ATOM   1650 C CB  . ALA A 1 232 ? 36.200  -21.137 -23.682 1.00 130.84 ? 232 ALA A CB  1 
ATOM   1651 N N   . LYS A 1 233 ? 35.195  -20.053 -26.535 1.00 130.99 ? 233 LYS A N   1 
ATOM   1652 C CA  . LYS A 1 233 ? 34.283  -19.238 -27.328 1.00 128.05 ? 233 LYS A CA  1 
ATOM   1653 C C   . LYS A 1 233 ? 33.645  -20.077 -28.429 1.00 121.92 ? 233 LYS A C   1 
ATOM   1654 O O   . LYS A 1 233 ? 32.436  -20.013 -28.650 1.00 120.99 ? 233 LYS A O   1 
ATOM   1655 C CB  . LYS A 1 233 ? 35.017  -18.039 -27.932 1.00 132.81 ? 233 LYS A CB  1 
ATOM   1656 C CG  . LYS A 1 233 ? 34.119  -17.101 -28.724 1.00 142.80 ? 233 LYS A CG  1 
ATOM   1657 C CD  . LYS A 1 233 ? 34.885  -15.882 -29.215 1.00 154.59 ? 233 LYS A CD  1 
ATOM   1658 C CE  . LYS A 1 233 ? 33.969  -14.916 -29.950 1.00 162.76 ? 233 LYS A CE  1 
ATOM   1659 N NZ  . LYS A 1 233 ? 34.693  -13.699 -30.411 1.00 167.58 ? 233 LYS A NZ  1 
ATOM   1660 N N   . SER A 1 234 ? 34.467  -20.863 -29.115 1.00 120.23 ? 234 SER A N   1 
ATOM   1661 C CA  . SER A 1 234 ? 33.979  -21.757 -30.158 1.00 121.16 ? 234 SER A CA  1 
ATOM   1662 C C   . SER A 1 234 ? 32.949  -22.728 -29.593 1.00 108.52 ? 234 SER A C   1 
ATOM   1663 O O   . SER A 1 234 ? 31.977  -23.077 -30.262 1.00 98.77  ? 234 SER A O   1 
ATOM   1664 C CB  . SER A 1 234 ? 35.137  -22.535 -30.786 1.00 134.90 ? 234 SER A CB  1 
ATOM   1665 O OG  . SER A 1 234 ? 36.072  -21.662 -31.396 1.00 142.10 ? 234 SER A OG  1 
ATOM   1666 N N   . ALA A 1 235 ? 33.172  -23.159 -28.355 1.00 110.62 ? 235 ALA A N   1 
ATOM   1667 C CA  . ALA A 1 235 ? 32.258  -24.071 -27.682 1.00 113.36 ? 235 ALA A CA  1 
ATOM   1668 C C   . ALA A 1 235 ? 30.961  -23.361 -27.318 1.00 112.43 ? 235 ALA A C   1 
ATOM   1669 O O   . ALA A 1 235 ? 29.885  -23.958 -27.344 1.00 110.93 ? 235 ALA A O   1 
ATOM   1670 C CB  . ALA A 1 235 ? 32.910  -24.654 -26.441 1.00 118.62 ? 235 ALA A CB  1 
ATOM   1671 N N   . ALA A 1 236 ? 31.072  -22.082 -26.977 1.00 112.10 ? 236 ALA A N   1 
ATOM   1672 C CA  . ALA A 1 236 ? 29.908  -21.277 -26.635 1.00 108.80 ? 236 ALA A CA  1 
ATOM   1673 C C   . ALA A 1 236 ? 28.990  -21.121 -27.841 1.00 108.63 ? 236 ALA A C   1 
ATOM   1674 O O   . ALA A 1 236 ? 27.770  -21.054 -27.700 1.00 102.57 ? 236 ALA A O   1 
ATOM   1675 C CB  . ALA A 1 236 ? 30.341  -19.915 -26.117 1.00 102.83 ? 236 ALA A CB  1 
ATOM   1676 N N   . ILE A 1 237 ? 29.588  -21.065 -29.027 1.00 112.06 ? 237 ILE A N   1 
ATOM   1677 C CA  . ILE A 1 237 ? 28.830  -20.904 -30.261 1.00 111.55 ? 237 ILE A CA  1 
ATOM   1678 C C   . ILE A 1 237 ? 28.099  -22.189 -30.634 1.00 107.43 ? 237 ILE A C   1 
ATOM   1679 O O   . ILE A 1 237 ? 27.006  -22.150 -31.197 1.00 103.70 ? 237 ILE A O   1 
ATOM   1680 C CB  . ILE A 1 237 ? 29.741  -20.482 -31.430 1.00 115.39 ? 237 ILE A CB  1 
ATOM   1681 C CG1 . ILE A 1 237 ? 30.582  -19.267 -31.038 1.00 116.70 ? 237 ILE A CG1 1 
ATOM   1682 C CG2 . ILE A 1 237 ? 28.913  -20.183 -32.669 1.00 117.32 ? 237 ILE A CG2 1 
ATOM   1683 C CD1 . ILE A 1 237 ? 31.501  -18.780 -32.136 1.00 118.01 ? 237 ILE A CD1 1 
ATOM   1684 N N   . ILE A 1 238 ? 28.706  -23.328 -30.317 1.00 115.54 ? 238 ILE A N   1 
ATOM   1685 C CA  . ILE A 1 238 ? 28.095  -24.621 -30.599 1.00 128.08 ? 238 ILE A CA  1 
ATOM   1686 C C   . ILE A 1 238 ? 26.854  -24.824 -29.739 1.00 139.89 ? 238 ILE A C   1 
ATOM   1687 O O   . ILE A 1 238 ? 25.832  -25.324 -30.210 1.00 143.95 ? 238 ILE A O   1 
ATOM   1688 C CB  . ILE A 1 238 ? 29.076  -25.779 -30.347 1.00 132.13 ? 238 ILE A CB  1 
ATOM   1689 C CG1 . ILE A 1 238 ? 30.362  -25.573 -31.150 1.00 144.57 ? 238 ILE A CG1 1 
ATOM   1690 C CG2 . ILE A 1 238 ? 28.429  -27.112 -30.699 1.00 123.28 ? 238 ILE A CG2 1 
ATOM   1691 C CD1 . ILE A 1 238 ? 31.430  -26.611 -30.875 1.00 149.32 ? 238 ILE A CD1 1 
ATOM   1692 N N   . ALA A 1 239 ? 26.952  -24.431 -28.474 1.00 143.84 ? 239 ALA A N   1 
ATOM   1693 C CA  . ALA A 1 239 ? 25.835  -24.555 -27.545 1.00 145.53 ? 239 ALA A CA  1 
ATOM   1694 C C   . ALA A 1 239 ? 24.712  -23.587 -27.900 1.00 148.77 ? 239 ALA A C   1 
ATOM   1695 O O   . ALA A 1 239 ? 23.537  -23.947 -27.871 1.00 151.48 ? 239 ALA A O   1 
ATOM   1696 C CB  . ALA A 1 239 ? 26.305  -24.322 -26.120 1.00 144.54 ? 239 ALA A CB  1 
ATOM   1697 N N   . GLY A 1 240 ? 25.085  -22.356 -28.235 1.00 146.10 ? 240 GLY A N   1 
ATOM   1698 C CA  . GLY A 1 240 ? 24.117  -21.331 -28.580 1.00 136.52 ? 240 GLY A CA  1 
ATOM   1699 C C   . GLY A 1 240 ? 23.223  -21.737 -29.734 1.00 126.37 ? 240 GLY A C   1 
ATOM   1700 O O   . GLY A 1 240 ? 22.022  -21.473 -29.721 1.00 124.61 ? 240 GLY A O   1 
ATOM   1701 N N   . LEU A 1 241 ? 23.812  -22.381 -30.736 1.00 125.18 ? 241 LEU A N   1 
ATOM   1702 C CA  . LEU A 1 241 ? 23.063  -22.823 -31.906 1.00 129.34 ? 241 LEU A CA  1 
ATOM   1703 C C   . LEU A 1 241 ? 22.112  -23.964 -31.562 1.00 125.53 ? 241 LEU A C   1 
ATOM   1704 O O   . LEU A 1 241 ? 21.124  -24.187 -32.259 1.00 123.35 ? 241 LEU A O   1 
ATOM   1705 C CB  . LEU A 1 241 ? 24.016  -23.247 -33.026 1.00 140.88 ? 241 LEU A CB  1 
ATOM   1706 C CG  . LEU A 1 241 ? 24.900  -22.139 -33.603 1.00 152.61 ? 241 LEU A CG  1 
ATOM   1707 C CD1 . LEU A 1 241 ? 25.860  -22.697 -34.644 1.00 156.51 ? 241 LEU A CD1 1 
ATOM   1708 C CD2 . LEU A 1 241 ? 24.046  -21.027 -34.194 1.00 153.96 ? 241 LEU A CD2 1 
ATOM   1709 N N   . PHE A 1 242 ? 22.413  -24.684 -30.487 1.00 124.15 ? 242 PHE A N   1 
ATOM   1710 C CA  . PHE A 1 242 ? 21.542  -25.758 -30.026 1.00 122.01 ? 242 PHE A CA  1 
ATOM   1711 C C   . PHE A 1 242 ? 20.234  -25.178 -29.500 1.00 116.45 ? 242 PHE A C   1 
ATOM   1712 O O   . PHE A 1 242 ? 19.153  -25.537 -29.962 1.00 112.10 ? 242 PHE A O   1 
ATOM   1713 C CB  . PHE A 1 242 ? 22.231  -26.586 -28.939 1.00 124.47 ? 242 PHE A CB  1 
ATOM   1714 C CG  . PHE A 1 242 ? 21.440  -27.787 -28.495 1.00 123.93 ? 242 PHE A CG  1 
ATOM   1715 C CD1 . PHE A 1 242 ? 21.686  -29.036 -29.042 1.00 123.54 ? 242 PHE A CD1 1 
ATOM   1716 C CD2 . PHE A 1 242 ? 20.453  -27.667 -27.529 1.00 122.87 ? 242 PHE A CD2 1 
ATOM   1717 C CE1 . PHE A 1 242 ? 20.960  -30.141 -28.637 1.00 120.81 ? 242 PHE A CE1 1 
ATOM   1718 C CE2 . PHE A 1 242 ? 19.726  -28.769 -27.119 1.00 125.28 ? 242 PHE A CE2 1 
ATOM   1719 C CZ  . PHE A 1 242 ? 19.981  -30.007 -27.673 1.00 122.63 ? 242 PHE A CZ  1 
ATOM   1720 N N   . ALA A 1 243 ? 20.345  -24.273 -28.533 1.00 114.93 ? 243 ALA A N   1 
ATOM   1721 C CA  . ALA A 1 243 ? 19.177  -23.615 -27.963 1.00 112.17 ? 243 ALA A CA  1 
ATOM   1722 C C   . ALA A 1 243 ? 18.428  -22.823 -29.029 1.00 108.92 ? 243 ALA A C   1 
ATOM   1723 O O   . ALA A 1 243 ? 17.203  -22.719 -28.995 1.00 110.27 ? 243 ALA A O   1 
ATOM   1724 C CB  . ALA A 1 243 ? 19.591  -22.705 -26.817 1.00 111.15 ? 243 ALA A CB  1 
ATOM   1725 N N   . LEU A 1 244 ? 19.173  -22.270 -29.979 1.00 104.56 ? 244 LEU A N   1 
ATOM   1726 C CA  . LEU A 1 244 ? 18.586  -21.466 -31.043 1.00 101.82 ? 244 LEU A CA  1 
ATOM   1727 C C   . LEU A 1 244 ? 17.797  -22.332 -32.022 1.00 99.89  ? 244 LEU A C   1 
ATOM   1728 O O   . LEU A 1 244 ? 16.918  -21.840 -32.729 1.00 92.49  ? 244 LEU A O   1 
ATOM   1729 C CB  . LEU A 1 244 ? 19.678  -20.694 -31.786 1.00 102.56 ? 244 LEU A CB  1 
ATOM   1730 C CG  . LEU A 1 244 ? 19.225  -19.614 -32.769 1.00 99.45  ? 244 LEU A CG  1 
ATOM   1731 C CD1 . LEU A 1 244 ? 18.561  -18.465 -32.029 1.00 97.81  ? 244 LEU A CD1 1 
ATOM   1732 C CD2 . LEU A 1 244 ? 20.402  -19.111 -33.587 1.00 98.68  ? 244 LEU A CD2 1 
ATOM   1733 N N   . CYS A 1 245 ? 18.113  -23.623 -32.055 1.00 110.20 ? 245 CYS A N   1 
ATOM   1734 C CA  . CYS A 1 245 ? 17.476  -24.544 -32.993 1.00 122.25 ? 245 CYS A CA  1 
ATOM   1735 C C   . CYS A 1 245 ? 16.468  -25.474 -32.320 1.00 126.58 ? 245 CYS A C   1 
ATOM   1736 O O   . CYS A 1 245 ? 15.812  -26.271 -32.991 1.00 124.33 ? 245 CYS A O   1 
ATOM   1737 C CB  . CYS A 1 245 ? 18.530  -25.374 -33.732 1.00 127.44 ? 245 CYS A CB  1 
ATOM   1738 S SG  . CYS A 1 245 ? 19.625  -24.427 -34.819 1.00 156.35 ? 245 CYS A SG  1 
ATOM   1739 N N   . TRP A 1 246 ? 16.349  -25.376 -31.000 1.00 132.00 ? 246 TRP A N   1 
ATOM   1740 C CA  . TRP A 1 246 ? 15.422  -26.229 -30.261 1.00 133.52 ? 246 TRP A CA  1 
ATOM   1741 C C   . TRP A 1 246 ? 14.368  -25.433 -29.497 1.00 129.03 ? 246 TRP A C   1 
ATOM   1742 O O   . TRP A 1 246 ? 13.248  -25.905 -29.308 1.00 127.50 ? 246 TRP A O   1 
ATOM   1743 C CB  . TRP A 1 246 ? 16.177  -27.163 -29.313 1.00 139.28 ? 246 TRP A CB  1 
ATOM   1744 C CG  . TRP A 1 246 ? 16.884  -28.279 -30.016 1.00 147.21 ? 246 TRP A CG  1 
ATOM   1745 C CD1 . TRP A 1 246 ? 18.139  -28.247 -30.552 1.00 152.70 ? 246 TRP A CD1 1 
ATOM   1746 C CD2 . TRP A 1 246 ? 16.378  -29.597 -30.260 1.00 148.97 ? 246 TRP A CD2 1 
ATOM   1747 N NE1 . TRP A 1 246 ? 18.446  -29.463 -31.115 1.00 153.31 ? 246 TRP A NE1 1 
ATOM   1748 C CE2 . TRP A 1 246 ? 17.381  -30.309 -30.949 1.00 151.26 ? 246 TRP A CE2 1 
ATOM   1749 C CE3 . TRP A 1 246 ? 15.174  -30.244 -29.963 1.00 147.32 ? 246 TRP A CE3 1 
ATOM   1750 C CZ2 . TRP A 1 246 ? 17.217  -31.635 -31.346 1.00 150.71 ? 246 TRP A CZ2 1 
ATOM   1751 C CZ3 . TRP A 1 246 ? 15.012  -31.560 -30.360 1.00 148.70 ? 246 TRP A CZ3 1 
ATOM   1752 C CH2 . TRP A 1 246 ? 16.028  -32.241 -31.043 1.00 151.41 ? 246 TRP A CH2 1 
ATOM   1753 N N   . LEU A 1 247 ? 14.727  -24.230 -29.061 1.00 128.12 ? 247 LEU A N   1 
ATOM   1754 C CA  . LEU A 1 247 ? 13.778  -23.370 -28.361 1.00 127.81 ? 247 LEU A CA  1 
ATOM   1755 C C   . LEU A 1 247 ? 12.486  -23.168 -29.150 1.00 130.11 ? 247 LEU A C   1 
ATOM   1756 O O   . LEU A 1 247 ? 11.400  -23.327 -28.600 1.00 133.35 ? 247 LEU A O   1 
ATOM   1757 C CB  . LEU A 1 247 ? 14.406  -22.020 -28.004 1.00 128.24 ? 247 LEU A CB  1 
ATOM   1758 C CG  . LEU A 1 247 ? 15.278  -21.976 -26.749 1.00 130.44 ? 247 LEU A CG  1 
ATOM   1759 C CD1 . LEU A 1 247 ? 15.776  -20.561 -26.503 1.00 132.80 ? 247 LEU A CD1 1 
ATOM   1760 C CD2 . LEU A 1 247 ? 14.510  -22.492 -25.541 1.00 130.10 ? 247 LEU A CD2 1 
ATOM   1761 N N   . PRO A 1 248 ? 12.595  -22.816 -30.442 1.00 127.16 ? 248 PRO A N   1 
ATOM   1762 C CA  . PRO A 1 248 ? 11.383  -22.622 -31.247 1.00 124.54 ? 248 PRO A CA  1 
ATOM   1763 C C   . PRO A 1 248 ? 10.426  -23.810 -31.170 1.00 125.33 ? 248 PRO A C   1 
ATOM   1764 O O   . PRO A 1 248 ? 9.216   -23.620 -31.045 1.00 126.75 ? 248 PRO A O   1 
ATOM   1765 C CB  . PRO A 1 248 ? 11.931  -22.475 -32.668 1.00 120.06 ? 248 PRO A CB  1 
ATOM   1766 C CG  . PRO A 1 248 ? 13.297  -21.922 -32.481 1.00 123.09 ? 248 PRO A CG  1 
ATOM   1767 C CD  . PRO A 1 248 ? 13.819  -22.533 -31.213 1.00 124.69 ? 248 PRO A CD  1 
ATOM   1768 N N   . LEU A 1 249 ? 10.971  -25.020 -31.241 1.00 121.73 ? 249 LEU A N   1 
ATOM   1769 C CA  . LEU A 1 249 ? 10.163  -26.234 -31.223 1.00 112.66 ? 249 LEU A CA  1 
ATOM   1770 C C   . LEU A 1 249 ? 9.515   -26.455 -29.859 1.00 114.96 ? 249 LEU A C   1 
ATOM   1771 O O   . LEU A 1 249 ? 8.389   -26.942 -29.767 1.00 112.47 ? 249 LEU A O   1 
ATOM   1772 C CB  . LEU A 1 249 ? 11.013  -27.446 -31.605 1.00 103.68 ? 249 LEU A CB  1 
ATOM   1773 C CG  . LEU A 1 249 ? 10.288  -28.791 -31.658 1.00 97.77  ? 249 LEU A CG  1 
ATOM   1774 C CD1 . LEU A 1 249 ? 9.040   -28.680 -32.504 1.00 104.03 ? 249 LEU A CD1 1 
ATOM   1775 C CD2 . LEU A 1 249 ? 11.203  -29.866 -32.206 1.00 95.04  ? 249 LEU A CD2 1 
ATOM   1776 N N   . HIS A 1 250 ? 10.232  -26.089 -28.802 1.00 126.23 ? 250 HIS A N   1 
ATOM   1777 C CA  . HIS A 1 250 ? 9.712   -26.214 -27.447 1.00 133.77 ? 250 HIS A CA  1 
ATOM   1778 C C   . HIS A 1 250 ? 8.728   -25.091 -27.144 1.00 131.63 ? 250 HIS A C   1 
ATOM   1779 O O   . HIS A 1 250 ? 7.713   -25.306 -26.484 1.00 132.35 ? 250 HIS A O   1 
ATOM   1780 C CB  . HIS A 1 250 ? 10.852  -26.210 -26.428 1.00 144.35 ? 250 HIS A CB  1 
ATOM   1781 C CG  . HIS A 1 250 ? 11.800  -27.359 -26.575 1.00 148.57 ? 250 HIS A CG  1 
ATOM   1782 N ND1 . HIS A 1 250 ? 13.137  -27.190 -26.865 1.00 150.02 ? 250 HIS A ND1 1 
ATOM   1783 C CD2 . HIS A 1 250 ? 11.603  -28.695 -26.470 1.00 148.28 ? 250 HIS A CD2 1 
ATOM   1784 C CE1 . HIS A 1 250 ? 13.724  -28.371 -26.930 1.00 150.93 ? 250 HIS A CE1 1 
ATOM   1785 N NE2 . HIS A 1 250 ? 12.816  -29.302 -26.698 1.00 150.58 ? 250 HIS A NE2 1 
ATOM   1786 N N   . ILE A 1 251 ? 9.037   -23.892 -27.629 1.00 131.17 ? 251 ILE A N   1 
ATOM   1787 C CA  . ILE A 1 251 ? 8.165   -22.739 -27.435 1.00 134.48 ? 251 ILE A CA  1 
ATOM   1788 C C   . ILE A 1 251 ? 6.777   -23.011 -28.003 1.00 127.98 ? 251 ILE A C   1 
ATOM   1789 O O   . ILE A 1 251 ? 5.769   -22.615 -27.420 1.00 116.22 ? 251 ILE A O   1 
ATOM   1790 C CB  . ILE A 1 251 ? 8.752   -21.465 -28.076 1.00 136.66 ? 251 ILE A CB  1 
ATOM   1791 C CG1 . ILE A 1 251 ? 10.011  -21.025 -27.327 1.00 134.83 ? 251 ILE A CG1 1 
ATOM   1792 C CG2 . ILE A 1 251 ? 7.724   -20.346 -28.073 1.00 141.18 ? 251 ILE A CG2 1 
ATOM   1793 C CD1 . ILE A 1 251 ? 10.677  -19.797 -27.915 1.00 136.79 ? 251 ILE A CD1 1 
ATOM   1794 N N   . ILE A 1 252 ? 6.734   -23.697 -29.140 1.00 130.31 ? 252 ILE A N   1 
ATOM   1795 C CA  . ILE A 1 252 ? 5.470   -24.099 -29.745 1.00 131.09 ? 252 ILE A CA  1 
ATOM   1796 C C   . ILE A 1 252 ? 4.686   -25.009 -28.807 1.00 133.94 ? 252 ILE A C   1 
ATOM   1797 O O   . ILE A 1 252 ? 3.481   -24.838 -28.622 1.00 138.33 ? 252 ILE A O   1 
ATOM   1798 C CB  . ILE A 1 252 ? 5.692   -24.824 -31.086 1.00 130.12 ? 252 ILE A CB  1 
ATOM   1799 C CG1 . ILE A 1 252 ? 6.024   -23.814 -32.187 1.00 128.66 ? 252 ILE A CG1 1 
ATOM   1800 C CG2 . ILE A 1 252 ? 4.464   -25.635 -31.466 1.00 129.50 ? 252 ILE A CG2 1 
ATOM   1801 C CD1 . ILE A 1 252 ? 6.127   -24.430 -33.567 1.00 124.90 ? 252 ILE A CD1 1 
ATOM   1802 N N   . ASN A 1 253 ? 5.378   -25.976 -28.213 1.00 134.99 ? 253 ASN A N   1 
ATOM   1803 C CA  . ASN A 1 253 ? 4.743   -26.915 -27.295 1.00 139.70 ? 253 ASN A CA  1 
ATOM   1804 C C   . ASN A 1 253 ? 4.326   -26.262 -25.981 1.00 142.41 ? 253 ASN A C   1 
ATOM   1805 O O   . ASN A 1 253 ? 3.450   -26.767 -25.279 1.00 144.52 ? 253 ASN A O   1 
ATOM   1806 C CB  . ASN A 1 253 ? 5.655   -28.113 -27.029 1.00 141.00 ? 253 ASN A CB  1 
ATOM   1807 C CG  . ASN A 1 253 ? 5.825   -28.997 -28.251 1.00 139.19 ? 253 ASN A CG  1 
ATOM   1808 O OD1 . ASN A 1 253 ? 5.304   -28.698 -29.326 1.00 139.87 ? 253 ASN A OD1 1 
ATOM   1809 N ND2 . ASN A 1 253 ? 6.558   -30.093 -28.090 1.00 135.58 ? 253 ASN A ND2 1 
ATOM   1810 N N   . CYS A 1 254 ? 4.956   -25.140 -25.650 1.00 144.30 ? 254 CYS A N   1 
ATOM   1811 C CA  . CYS A 1 254 ? 4.592   -24.390 -24.453 1.00 146.52 ? 254 CYS A CA  1 
ATOM   1812 C C   . CYS A 1 254 ? 3.270   -23.659 -24.662 1.00 149.97 ? 254 CYS A C   1 
ATOM   1813 O O   . CYS A 1 254 ? 2.450   -23.562 -23.749 1.00 149.99 ? 254 CYS A O   1 
ATOM   1814 C CB  . CYS A 1 254 ? 5.697   -23.401 -24.075 1.00 142.33 ? 254 CYS A CB  1 
ATOM   1815 S SG  . CYS A 1 254 ? 7.253   -24.178 -23.583 1.00 231.87 ? 254 CYS A SG  1 
ATOM   1816 N N   . PHE A 1 255 ? 3.069   -23.150 -25.873 1.00 148.01 ? 255 PHE A N   1 
ATOM   1817 C CA  . PHE A 1 255 ? 1.823   -22.484 -26.229 1.00 143.31 ? 255 PHE A CA  1 
ATOM   1818 C C   . PHE A 1 255 ? 0.666   -23.473 -26.263 1.00 141.88 ? 255 PHE A C   1 
ATOM   1819 O O   . PHE A 1 255 ? -0.406  -23.207 -25.721 1.00 146.61 ? 255 PHE A O   1 
ATOM   1820 C CB  . PHE A 1 255 ? 1.955   -21.788 -27.585 1.00 142.89 ? 255 PHE A CB  1 
ATOM   1821 C CG  . PHE A 1 255 ? 2.614   -20.440 -27.515 1.00 146.58 ? 255 PHE A CG  1 
ATOM   1822 C CD1 . PHE A 1 255 ? 3.855   -20.291 -26.920 1.00 150.62 ? 255 PHE A CD1 1 
ATOM   1823 C CD2 . PHE A 1 255 ? 1.998   -19.324 -28.052 1.00 146.84 ? 255 PHE A CD2 1 
ATOM   1824 C CE1 . PHE A 1 255 ? 4.463   -19.052 -26.854 1.00 152.46 ? 255 PHE A CE1 1 
ATOM   1825 C CE2 . PHE A 1 255 ? 2.604   -18.083 -27.990 1.00 147.65 ? 255 PHE A CE2 1 
ATOM   1826 C CZ  . PHE A 1 255 ? 3.837   -17.948 -27.390 1.00 150.14 ? 255 PHE A CZ  1 
ATOM   1827 N N   . THR A 1 256 ? 0.890   -24.616 -26.903 1.00 136.79 ? 256 THR A N   1 
ATOM   1828 C CA  . THR A 1 256 ? -0.137  -25.643 -27.021 1.00 133.32 ? 256 THR A CA  1 
ATOM   1829 C C   . THR A 1 256 ? -0.568  -26.170 -25.655 1.00 131.16 ? 256 THR A C   1 
ATOM   1830 O O   . THR A 1 256 ? -1.761  -26.275 -25.371 1.00 141.66 ? 256 THR A O   1 
ATOM   1831 C CB  . THR A 1 256 ? 0.341   -26.819 -27.897 1.00 128.70 ? 256 THR A CB  1 
ATOM   1832 O OG1 . THR A 1 256 ? 0.516   -26.369 -29.246 1.00 128.05 ? 256 THR A OG1 1 
ATOM   1833 C CG2 . THR A 1 256 ? -0.677  -27.946 -27.877 1.00 128.49 ? 256 THR A CG2 1 
ATOM   1834 N N   . PHE A 1 257 ? 0.406   -26.494 -24.811 1.00 119.64 ? 257 PHE A N   1 
ATOM   1835 C CA  . PHE A 1 257 ? 0.123   -27.054 -23.494 1.00 121.85 ? 257 PHE A CA  1 
ATOM   1836 C C   . PHE A 1 257 ? -0.454  -26.014 -22.538 1.00 131.03 ? 257 PHE A C   1 
ATOM   1837 O O   . PHE A 1 257 ? -1.631  -26.072 -22.183 1.00 138.79 ? 257 PHE A O   1 
ATOM   1838 C CB  . PHE A 1 257 ? 1.388   -27.670 -22.893 1.00 126.26 ? 257 PHE A CB  1 
ATOM   1839 C CG  . PHE A 1 257 ? 1.175   -28.304 -21.547 1.00 127.55 ? 257 PHE A CG  1 
ATOM   1840 C CD1 . PHE A 1 257 ? 0.917   -29.660 -21.438 1.00 125.66 ? 257 PHE A CD1 1 
ATOM   1841 C CD2 . PHE A 1 257 ? 1.237   -27.544 -20.389 1.00 129.95 ? 257 PHE A CD2 1 
ATOM   1842 C CE1 . PHE A 1 257 ? 0.725   -30.246 -20.200 1.00 129.62 ? 257 PHE A CE1 1 
ATOM   1843 C CE2 . PHE A 1 257 ? 1.044   -28.124 -19.151 1.00 132.85 ? 257 PHE A CE2 1 
ATOM   1844 C CZ  . PHE A 1 257 ? 0.787   -29.476 -19.057 1.00 133.76 ? 257 PHE A CZ  1 
ATOM   1845 N N   . PHE A 1 258 ? 0.383   -25.069 -22.120 1.00 136.17 ? 258 PHE A N   1 
ATOM   1846 C CA  . PHE A 1 258 ? -0.023  -24.061 -21.143 1.00 146.08 ? 258 PHE A CA  1 
ATOM   1847 C C   . PHE A 1 258 ? -1.234  -23.248 -21.593 1.00 146.54 ? 258 PHE A C   1 
ATOM   1848 O O   . PHE A 1 258 ? -2.026  -22.791 -20.769 1.00 142.42 ? 258 PHE A O   1 
ATOM   1849 C CB  . PHE A 1 258 ? 1.142   -23.124 -20.815 1.00 147.53 ? 258 PHE A CB  1 
ATOM   1850 C CG  . PHE A 1 258 ? 2.237   -23.775 -20.021 1.00 151.38 ? 258 PHE A CG  1 
ATOM   1851 C CD1 . PHE A 1 258 ? 3.408   -24.183 -20.635 1.00 158.92 ? 258 PHE A CD1 1 
ATOM   1852 C CD2 . PHE A 1 258 ? 2.091   -23.983 -18.660 1.00 153.05 ? 258 PHE A CD2 1 
ATOM   1853 C CE1 . PHE A 1 258 ? 4.417   -24.782 -19.906 1.00 163.12 ? 258 PHE A CE1 1 
ATOM   1854 C CE2 . PHE A 1 258 ? 3.094   -24.583 -17.924 1.00 160.04 ? 258 PHE A CE2 1 
ATOM   1855 C CZ  . PHE A 1 258 ? 4.260   -24.982 -18.547 1.00 164.73 ? 258 PHE A CZ  1 
ATOM   1856 N N   . CYS A 1 259 ? -1.375  -23.070 -22.902 1.00 147.99 ? 259 CYS A N   1 
ATOM   1857 C CA  . CYS A 1 259 ? -2.485  -22.295 -23.439 1.00 152.61 ? 259 CYS A CA  1 
ATOM   1858 C C   . CYS A 1 259 ? -3.284  -23.097 -24.463 1.00 158.35 ? 259 CYS A C   1 
ATOM   1859 O O   . CYS A 1 259 ? -3.023  -23.014 -25.665 1.00 156.53 ? 259 CYS A O   1 
ATOM   1860 C CB  . CYS A 1 259 ? -1.978  -20.992 -24.061 1.00 147.83 ? 259 CYS A CB  1 
ATOM   1861 S SG  . CYS A 1 259 ? -3.282  -19.812 -24.489 1.00 250.51 ? 259 CYS A SG  1 
ATOM   1862 N N   . PRO A 1 260 ? -4.261  -23.883 -23.985 1.00 159.92 ? 260 PRO A N   1 
ATOM   1863 C CA  . PRO A 1 260 ? -5.131  -24.669 -24.864 1.00 151.88 ? 260 PRO A CA  1 
ATOM   1864 C C   . PRO A 1 260 ? -5.916  -23.767 -25.808 1.00 142.53 ? 260 PRO A C   1 
ATOM   1865 O O   . PRO A 1 260 ? -6.233  -24.172 -26.926 1.00 140.84 ? 260 PRO A O   1 
ATOM   1866 C CB  . PRO A 1 260 ? -6.083  -25.363 -23.884 1.00 155.53 ? 260 PRO A CB  1 
ATOM   1867 C CG  . PRO A 1 260 ? -5.350  -25.381 -22.586 1.00 157.10 ? 260 PRO A CG  1 
ATOM   1868 C CD  . PRO A 1 260 ? -4.566  -24.107 -22.562 1.00 160.52 ? 260 PRO A CD  1 
ATOM   1869 N N   . ASP A 1 261 ? -6.223  -22.555 -25.356 1.00 136.40 ? 261 ASP A N   1 
ATOM   1870 C CA  . ASP A 1 261 ? -6.932  -21.586 -26.183 1.00 144.94 ? 261 ASP A CA  1 
ATOM   1871 C C   . ASP A 1 261 ? -6.079  -21.132 -27.360 1.00 147.99 ? 261 ASP A C   1 
ATOM   1872 O O   . ASP A 1 261 ? -6.563  -21.036 -28.488 1.00 144.77 ? 261 ASP A O   1 
ATOM   1873 C CB  . ASP A 1 261 ? -7.358  -20.375 -25.351 1.00 154.57 ? 261 ASP A CB  1 
ATOM   1874 C CG  . ASP A 1 261 ? -8.577  -20.654 -24.495 1.00 162.38 ? 261 ASP A CG  1 
ATOM   1875 O OD1 . ASP A 1 261 ? -9.130  -21.770 -24.593 1.00 168.21 ? 261 ASP A OD1 1 
ATOM   1876 O OD2 . ASP A 1 261 ? -8.986  -19.754 -23.731 1.00 158.15 ? 261 ASP A OD2 1 
ATOM   1877 N N   . CYS A 1 262 ? -4.809  -20.850 -27.087 1.00 158.26 ? 262 CYS A N   1 
ATOM   1878 C CA  . CYS A 1 262 ? -3.882  -20.411 -28.123 1.00 162.33 ? 262 CYS A CA  1 
ATOM   1879 C C   . CYS A 1 262 ? -3.913  -21.363 -29.312 1.00 161.85 ? 262 CYS A C   1 
ATOM   1880 O O   . CYS A 1 262 ? -3.591  -22.544 -29.181 1.00 161.67 ? 262 CYS A O   1 
ATOM   1881 C CB  . CYS A 1 262 ? -2.462  -20.308 -27.563 1.00 161.75 ? 262 CYS A CB  1 
ATOM   1882 S SG  . CYS A 1 262 ? -2.300  -19.185 -26.153 1.00 143.28 ? 262 CYS A SG  1 
ATOM   1883 N N   . SER A 1 263 ? -4.307  -20.838 -30.468 1.00 158.81 ? 263 SER A N   1 
ATOM   1884 C CA  . SER A 1 263 ? -4.430  -21.637 -31.683 1.00 157.77 ? 263 SER A CA  1 
ATOM   1885 C C   . SER A 1 263 ? -3.279  -22.626 -31.836 1.00 163.58 ? 263 SER A C   1 
ATOM   1886 O O   . SER A 1 263 ? -2.127  -22.231 -32.019 1.00 164.28 ? 263 SER A O   1 
ATOM   1887 C CB  . SER A 1 263 ? -4.520  -20.732 -32.915 1.00 152.44 ? 263 SER A CB  1 
ATOM   1888 O OG  . SER A 1 263 ? -3.402  -19.867 -32.995 1.00 155.06 ? 263 SER A OG  1 
ATOM   1889 N N   . HIS A 1 264 ? -3.602  -23.913 -31.752 1.00 168.05 ? 264 HIS A N   1 
ATOM   1890 C CA  . HIS A 1 264 ? -2.602  -24.967 -31.888 1.00 166.38 ? 264 HIS A CA  1 
ATOM   1891 C C   . HIS A 1 264 ? -1.771  -24.752 -33.145 1.00 165.19 ? 264 HIS A C   1 
ATOM   1892 O O   . HIS A 1 264 ? -2.315  -24.549 -34.230 1.00 169.11 ? 264 HIS A O   1 
ATOM   1893 C CB  . HIS A 1 264 ? -3.269  -26.343 -31.932 1.00 162.40 ? 264 HIS A CB  1 
ATOM   1894 C CG  . HIS A 1 264 ? -4.142  -26.632 -30.749 1.00 151.04 ? 264 HIS A CG  1 
ATOM   1895 N ND1 . HIS A 1 264 ? -3.634  -27.016 -29.526 1.00 148.39 ? 264 HIS A ND1 1 
ATOM   1896 C CD2 . HIS A 1 264 ? -5.486  -26.601 -30.607 1.00 138.71 ? 264 HIS A CD2 1 
ATOM   1897 C CE1 . HIS A 1 264 ? -4.631  -27.203 -28.680 1.00 138.53 ? 264 HIS A CE1 1 
ATOM   1898 N NE2 . HIS A 1 264 ? -5.765  -26.959 -29.308 1.00 134.41 ? 264 HIS A NE2 1 
ATOM   1899 N N   . ALA A 1 265 ? -0.452  -24.794 -32.990 1.00 160.32 ? 265 ALA A N   1 
ATOM   1900 C CA  . ALA A 1 265 ? 0.457   -24.550 -34.101 1.00 159.49 ? 265 ALA A CA  1 
ATOM   1901 C C   . ALA A 1 265 ? 0.102   -25.384 -35.326 1.00 148.97 ? 265 ALA A C   1 
ATOM   1902 O O   . ALA A 1 265 ? -0.100  -26.596 -35.226 1.00 146.13 ? 265 ALA A O   1 
ATOM   1903 C CB  . ALA A 1 265 ? 1.892   -24.810 -33.679 1.00 166.03 ? 265 ALA A CB  1 
ATOM   1904 N N   . PRO A 1 266 ? 0.016   -24.724 -36.490 1.00 138.18 ? 266 PRO A N   1 
ATOM   1905 C CA  . PRO A 1 266 ? -0.285  -25.372 -37.771 1.00 138.64 ? 266 PRO A CA  1 
ATOM   1906 C C   . PRO A 1 266 ? 0.772   -26.411 -38.115 1.00 148.80 ? 266 PRO A C   1 
ATOM   1907 O O   . PRO A 1 266 ? 1.863   -26.386 -37.542 1.00 156.25 ? 266 PRO A O   1 
ATOM   1908 C CB  . PRO A 1 266 ? -0.219  -24.219 -38.779 1.00 130.55 ? 266 PRO A CB  1 
ATOM   1909 C CG  . PRO A 1 266 ? 0.477   -23.101 -38.077 1.00 125.10 ? 266 PRO A CG  1 
ATOM   1910 C CD  . PRO A 1 266 ? 0.198   -23.270 -36.625 1.00 128.73 ? 266 PRO A CD  1 
ATOM   1911 N N   . LEU A 1 267 ? 0.453   -27.318 -39.031 1.00 151.57 ? 267 LEU A N   1 
ATOM   1912 C CA  . LEU A 1 267 ? 1.408   -28.337 -39.445 1.00 155.28 ? 267 LEU A CA  1 
ATOM   1913 C C   . LEU A 1 267 ? 2.567   -27.749 -40.242 1.00 158.30 ? 267 LEU A C   1 
ATOM   1914 O O   . LEU A 1 267 ? 3.710   -28.181 -40.096 1.00 161.52 ? 267 LEU A O   1 
ATOM   1915 C CB  . LEU A 1 267 ? 0.715   -29.430 -40.255 1.00 156.13 ? 267 LEU A CB  1 
ATOM   1916 C CG  . LEU A 1 267 ? -0.280  -30.286 -39.475 1.00 160.23 ? 267 LEU A CG  1 
ATOM   1917 C CD1 . LEU A 1 267 ? -0.930  -31.311 -40.389 1.00 163.28 ? 267 LEU A CD1 1 
ATOM   1918 C CD2 . LEU A 1 267 ? 0.413   -30.964 -38.306 1.00 157.10 ? 267 LEU A CD2 1 
ATOM   1919 N N   . TRP A 1 268 ? 2.272   -26.769 -41.090 1.00 153.33 ? 268 TRP A N   1 
ATOM   1920 C CA  . TRP A 1 268 ? 3.305   -26.178 -41.934 1.00 146.82 ? 268 TRP A CA  1 
ATOM   1921 C C   . TRP A 1 268 ? 4.368   -25.515 -41.070 1.00 142.59 ? 268 TRP A C   1 
ATOM   1922 O O   . TRP A 1 268 ? 5.543   -25.466 -41.430 1.00 144.00 ? 268 TRP A O   1 
ATOM   1923 C CB  . TRP A 1 268 ? 2.702   -25.153 -42.894 1.00 145.01 ? 268 TRP A CB  1 
ATOM   1924 C CG  . TRP A 1 268 ? 2.338   -23.872 -42.225 1.00 141.13 ? 268 TRP A CG  1 
ATOM   1925 C CD1 . TRP A 1 268 ? 1.116   -23.525 -41.733 1.00 139.40 ? 268 TRP A CD1 1 
ATOM   1926 C CD2 . TRP A 1 268 ? 3.209   -22.766 -41.957 1.00 137.79 ? 268 TRP A CD2 1 
ATOM   1927 N NE1 . TRP A 1 268 ? 1.169   -22.269 -41.179 1.00 137.84 ? 268 TRP A NE1 1 
ATOM   1928 C CE2 . TRP A 1 268 ? 2.443   -21.781 -41.304 1.00 136.51 ? 268 TRP A CE2 1 
ATOM   1929 C CE3 . TRP A 1 268 ? 4.561   -22.512 -42.207 1.00 131.88 ? 268 TRP A CE3 1 
ATOM   1930 C CZ2 . TRP A 1 268 ? 2.983   -20.563 -40.899 1.00 133.63 ? 268 TRP A CZ2 1 
ATOM   1931 C CZ3 . TRP A 1 268 ? 5.096   -21.303 -41.803 1.00 126.75 ? 268 TRP A CZ3 1 
ATOM   1932 C CH2 . TRP A 1 268 ? 4.309   -20.344 -41.156 1.00 128.41 ? 268 TRP A CH2 1 
ATOM   1933 N N   . LEU A 1 269 ? 3.939   -24.997 -39.925 1.00 135.98 ? 269 LEU A N   1 
ATOM   1934 C CA  . LEU A 1 269 ? 4.848   -24.367 -38.982 1.00 125.29 ? 269 LEU A CA  1 
ATOM   1935 C C   . LEU A 1 269 ? 5.470   -25.421 -38.082 1.00 125.07 ? 269 LEU A C   1 
ATOM   1936 O O   . LEU A 1 269 ? 6.582   -25.255 -37.586 1.00 127.68 ? 269 LEU A O   1 
ATOM   1937 C CB  . LEU A 1 269 ? 4.101   -23.344 -38.128 1.00 118.99 ? 269 LEU A CB  1 
ATOM   1938 C CG  . LEU A 1 269 ? 4.966   -22.529 -37.169 1.00 106.01 ? 269 LEU A CG  1 
ATOM   1939 C CD1 . LEU A 1 269 ? 5.940   -21.672 -37.957 1.00 99.55  ? 269 LEU A CD1 1 
ATOM   1940 C CD2 . LEU A 1 269 ? 4.096   -21.670 -36.271 1.00 106.52 ? 269 LEU A CD2 1 
ATOM   1941 N N   . MET A 1 270 ? 4.739   -26.508 -37.868 1.00 127.15 ? 270 MET A N   1 
ATOM   1942 C CA  . MET A 1 270 ? 5.208   -27.575 -36.997 1.00 136.95 ? 270 MET A CA  1 
ATOM   1943 C C   . MET A 1 270 ? 6.465   -28.225 -37.560 1.00 147.27 ? 270 MET A C   1 
ATOM   1944 O O   . MET A 1 270 ? 7.445   -28.419 -36.841 1.00 152.91 ? 270 MET A O   1 
ATOM   1945 C CB  . MET A 1 270 ? 4.115   -28.625 -36.784 1.00 139.34 ? 270 MET A CB  1 
ATOM   1946 C CG  . MET A 1 270 ? 4.514   -29.737 -35.820 1.00 141.31 ? 270 MET A CG  1 
ATOM   1947 S SD  . MET A 1 270 ? 4.892   -29.129 -34.167 1.00 168.31 ? 270 MET A SD  1 
ATOM   1948 C CE  . MET A 1 270 ? 3.317   -28.411 -33.701 1.00 179.66 ? 270 MET A CE  1 
ATOM   1949 N N   . TYR A 1 271 ? 6.435   -28.555 -38.847 1.00 149.28 ? 271 TYR A N   1 
ATOM   1950 C CA  . TYR A 1 271 ? 7.574   -29.206 -39.485 1.00 152.08 ? 271 TYR A CA  1 
ATOM   1951 C C   . TYR A 1 271 ? 8.801   -28.299 -39.502 1.00 144.67 ? 271 TYR A C   1 
ATOM   1952 O O   . TYR A 1 271 ? 9.924   -28.764 -39.343 1.00 146.23 ? 271 TYR A O   1 
ATOM   1953 C CB  . TYR A 1 271 ? 7.226   -29.665 -40.908 1.00 162.72 ? 271 TYR A CB  1 
ATOM   1954 C CG  . TYR A 1 271 ? 7.543   -28.655 -41.994 1.00 176.61 ? 271 TYR A CG  1 
ATOM   1955 C CD1 . TYR A 1 271 ? 8.843   -28.492 -42.459 1.00 180.36 ? 271 TYR A CD1 1 
ATOM   1956 C CD2 . TYR A 1 271 ? 6.541   -27.879 -42.566 1.00 186.16 ? 271 TYR A CD2 1 
ATOM   1957 C CE1 . TYR A 1 271 ? 9.141   -27.573 -43.449 1.00 184.75 ? 271 TYR A CE1 1 
ATOM   1958 C CE2 . TYR A 1 271 ? 6.828   -26.961 -43.559 1.00 192.21 ? 271 TYR A CE2 1 
ATOM   1959 C CZ  . TYR A 1 271 ? 8.130   -26.813 -43.996 1.00 192.12 ? 271 TYR A CZ  1 
ATOM   1960 O OH  . TYR A 1 271 ? 8.422   -25.902 -44.985 1.00 197.17 ? 271 TYR A OH  1 
ATOM   1961 N N   . LEU A 1 272 ? 8.581   -27.003 -39.700 1.00 133.13 ? 272 LEU A N   1 
ATOM   1962 C CA  . LEU A 1 272 ? 9.678   -26.043 -39.744 1.00 122.35 ? 272 LEU A CA  1 
ATOM   1963 C C   . LEU A 1 272 ? 10.471  -26.079 -38.442 1.00 122.97 ? 272 LEU A C   1 
ATOM   1964 O O   . LEU A 1 272 ? 11.700  -26.016 -38.451 1.00 129.96 ? 272 LEU A O   1 
ATOM   1965 C CB  . LEU A 1 272 ? 9.153   -24.630 -40.021 1.00 119.40 ? 272 LEU A CB  1 
ATOM   1966 C CG  . LEU A 1 272 ? 10.184  -23.510 -40.199 1.00 119.62 ? 272 LEU A CG  1 
ATOM   1967 C CD1 . LEU A 1 272 ? 9.633   -22.402 -41.085 1.00 118.74 ? 272 LEU A CD1 1 
ATOM   1968 C CD2 . LEU A 1 272 ? 10.640  -22.952 -38.857 1.00 118.89 ? 272 LEU A CD2 1 
ATOM   1969 N N   . ALA A 1 273 ? 9.760   -26.186 -37.325 1.00 116.74 ? 273 ALA A N   1 
ATOM   1970 C CA  . ALA A 1 273 ? 10.399  -26.278 -36.017 1.00 116.30 ? 273 ALA A CA  1 
ATOM   1971 C C   . ALA A 1 273 ? 11.111  -27.617 -35.864 1.00 122.50 ? 273 ALA A C   1 
ATOM   1972 O O   . ALA A 1 273 ? 12.144  -27.712 -35.203 1.00 122.09 ? 273 ALA A O   1 
ATOM   1973 C CB  . ALA A 1 273 ? 9.373   -26.090 -34.912 1.00 110.20 ? 273 ALA A CB  1 
ATOM   1974 N N   . ILE A 1 274 ? 10.548  -28.649 -36.484 1.00 124.86 ? 274 ILE A N   1 
ATOM   1975 C CA  . ILE A 1 274 ? 11.132  -29.985 -36.447 1.00 125.91 ? 274 ILE A CA  1 
ATOM   1976 C C   . ILE A 1 274 ? 12.367  -30.060 -37.339 1.00 125.86 ? 274 ILE A C   1 
ATOM   1977 O O   . ILE A 1 274 ? 13.380  -30.652 -36.966 1.00 126.92 ? 274 ILE A O   1 
ATOM   1978 C CB  . ILE A 1 274 ? 10.117  -31.053 -36.896 1.00 128.03 ? 274 ILE A CB  1 
ATOM   1979 C CG1 . ILE A 1 274 ? 8.844   -30.965 -36.051 1.00 134.71 ? 274 ILE A CG1 1 
ATOM   1980 C CG2 . ILE A 1 274 ? 10.723  -32.440 -36.800 1.00 127.80 ? 274 ILE A CG2 1 
ATOM   1981 C CD1 . ILE A 1 274 ? 7.752   -31.909 -36.499 1.00 142.19 ? 274 ILE A CD1 1 
ATOM   1982 N N   . VAL A 1 275 ? 12.275  -29.458 -38.520 1.00 123.52 ? 275 VAL A N   1 
ATOM   1983 C CA  . VAL A 1 275 ? 13.399  -29.418 -39.448 1.00 121.34 ? 275 VAL A CA  1 
ATOM   1984 C C   . VAL A 1 275 ? 14.543  -28.610 -38.853 1.00 129.49 ? 275 VAL A C   1 
ATOM   1985 O O   . VAL A 1 275 ? 15.714  -28.949 -39.022 1.00 138.36 ? 275 VAL A O   1 
ATOM   1986 C CB  . VAL A 1 275 ? 12.998  -28.802 -40.803 1.00 111.53 ? 275 VAL A CB  1 
ATOM   1987 C CG1 . VAL A 1 275 ? 14.212  -28.679 -41.710 1.00 109.32 ? 275 VAL A CG1 1 
ATOM   1988 C CG2 . VAL A 1 275 ? 11.917  -29.636 -41.467 1.00 108.79 ? 275 VAL A CG2 1 
ATOM   1989 N N   . LEU A 1 276 ? 14.194  -27.541 -38.146 1.00 125.71 ? 276 LEU A N   1 
ATOM   1990 C CA  . LEU A 1 276 ? 15.186  -26.675 -37.520 1.00 127.28 ? 276 LEU A CA  1 
ATOM   1991 C C   . LEU A 1 276 ? 16.022  -27.439 -36.495 1.00 134.58 ? 276 LEU A C   1 
ATOM   1992 O O   . LEU A 1 276 ? 17.199  -27.138 -36.291 1.00 135.18 ? 276 LEU A O   1 
ATOM   1993 C CB  . LEU A 1 276 ? 14.506  -25.474 -36.858 1.00 123.01 ? 276 LEU A CB  1 
ATOM   1994 C CG  . LEU A 1 276 ? 15.428  -24.430 -36.226 1.00 121.24 ? 276 LEU A CG  1 
ATOM   1995 C CD1 . LEU A 1 276 ? 16.389  -23.861 -37.259 1.00 119.31 ? 276 LEU A CD1 1 
ATOM   1996 C CD2 . LEU A 1 276 ? 14.611  -23.323 -35.581 1.00 124.28 ? 276 LEU A CD2 1 
ATOM   1997 N N   . ALA A 1 277 ? 15.408  -28.429 -35.856 1.00 138.39 ? 277 ALA A N   1 
ATOM   1998 C CA  . ALA A 1 277 ? 16.095  -29.237 -34.853 1.00 134.82 ? 277 ALA A CA  1 
ATOM   1999 C C   . ALA A 1 277 ? 17.047  -30.242 -35.495 1.00 125.67 ? 277 ALA A C   1 
ATOM   2000 O O   . ALA A 1 277 ? 18.133  -30.497 -34.976 1.00 121.39 ? 277 ALA A O   1 
ATOM   2001 C CB  . ALA A 1 277 ? 15.089  -29.949 -33.964 1.00 141.61 ? 277 ALA A CB  1 
ATOM   2002 N N   . HIS A 1 278 ? 16.635  -30.809 -36.624 1.00 129.33 ? 278 HIS A N   1 
ATOM   2003 C CA  . HIS A 1 278 ? 17.464  -31.772 -37.340 1.00 135.50 ? 278 HIS A CA  1 
ATOM   2004 C C   . HIS A 1 278 ? 18.630  -31.081 -38.036 1.00 134.98 ? 278 HIS A C   1 
ATOM   2005 O O   . HIS A 1 278 ? 19.616  -31.722 -38.397 1.00 138.67 ? 278 HIS A O   1 
ATOM   2006 C CB  . HIS A 1 278 ? 16.636  -32.557 -38.360 1.00 142.91 ? 278 HIS A CB  1 
ATOM   2007 C CG  . HIS A 1 278 ? 15.507  -33.332 -37.756 1.00 148.60 ? 278 HIS A CG  1 
ATOM   2008 N ND1 . HIS A 1 278 ? 15.492  -34.282 -36.791 1.00 147.23 ? 278 HIS A ND1 1 
ATOM   2009 C CD2 . HIS A 1 278 ? 14.195  -33.159 -38.143 1.00 150.86 ? 278 HIS A CD2 1 
ATOM   2010 C CE1 . HIS A 1 278 ? 14.184  -34.664 -36.617 1.00 146.05 ? 278 HIS A CE1 1 
ATOM   2011 N NE2 . HIS A 1 278 ? 13.421  -33.972 -37.445 1.00 148.41 ? 278 HIS A NE2 1 
ATOM   2012 N N   . THR A 1 279 ? 18.510  -29.770 -38.218 1.00 129.80 ? 279 THR A N   1 
ATOM   2013 C CA  . THR A 1 279 ? 19.559  -28.982 -38.853 1.00 129.85 ? 279 THR A CA  1 
ATOM   2014 C C   . THR A 1 279 ? 20.735  -28.775 -37.904 1.00 136.78 ? 279 THR A C   1 
ATOM   2015 O O   . THR A 1 279 ? 21.875  -28.596 -38.335 1.00 140.86 ? 279 THR A O   1 
ATOM   2016 C CB  . THR A 1 279 ? 19.026  -27.609 -39.306 1.00 125.07 ? 279 THR A CB  1 
ATOM   2017 O OG1 . THR A 1 279 ? 17.992  -27.796 -40.279 1.00 125.44 ? 279 THR A OG1 1 
ATOM   2018 C CG2 . THR A 1 279 ? 20.141  -26.774 -39.916 1.00 123.72 ? 279 THR A CG2 1 
ATOM   2019 N N   . ASN A 1 280 ? 20.448  -28.809 -36.608 1.00 139.28 ? 280 ASN A N   1 
ATOM   2020 C CA  . ASN A 1 280 ? 21.461  -28.593 -35.583 1.00 142.08 ? 280 ASN A CA  1 
ATOM   2021 C C   . ASN A 1 280 ? 22.631  -29.569 -35.694 1.00 150.61 ? 280 ASN A C   1 
ATOM   2022 O O   . ASN A 1 280 ? 23.771  -29.230 -35.375 1.00 158.74 ? 280 ASN A O   1 
ATOM   2023 C CB  . ASN A 1 280 ? 20.829  -28.685 -34.194 1.00 138.78 ? 280 ASN A CB  1 
ATOM   2024 C CG  . ASN A 1 280 ? 21.760  -28.213 -33.097 1.00 135.86 ? 280 ASN A CG  1 
ATOM   2025 O OD1 . ASN A 1 280 ? 21.355  -28.422 -31.853 1.00 139.58 ? 280 ASN A OD1 1 
ATOM   2026 N ND2 . ASN A 1 280 ? 22.827  -27.660 -33.364 1.00 132.67 ? 280 ASN A ND2 1 
ATOM   2027 N N   . SER A 1 281 ? 22.342  -30.782 -36.153 1.00 147.84 ? 281 SER A N   1 
ATOM   2028 C CA  . SER A 1 281 ? 23.361  -31.820 -36.270 1.00 145.27 ? 281 SER A CA  1 
ATOM   2029 C C   . SER A 1 281 ? 24.342  -31.548 -37.409 1.00 136.17 ? 281 SER A C   1 
ATOM   2030 O O   . SER A 1 281 ? 25.406  -32.164 -37.485 1.00 126.79 ? 281 SER A O   1 
ATOM   2031 C CB  . SER A 1 281 ? 22.703  -33.189 -36.458 1.00 144.89 ? 281 SER A CB  1 
ATOM   2032 O OG  . SER A 1 281 ? 21.885  -33.207 -37.613 1.00 144.40 ? 281 SER A OG  1 
ATOM   2033 N N   . VAL A 1 282 ? 23.981  -30.619 -38.288 1.00 134.77 ? 282 VAL A N   1 
ATOM   2034 C CA  . VAL A 1 282 ? 24.781  -30.330 -39.475 1.00 130.03 ? 282 VAL A CA  1 
ATOM   2035 C C   . VAL A 1 282 ? 25.722  -29.140 -39.281 1.00 134.46 ? 282 VAL A C   1 
ATOM   2036 O O   . VAL A 1 282 ? 26.795  -29.081 -39.884 1.00 136.91 ? 282 VAL A O   1 
ATOM   2037 C CB  . VAL A 1 282 ? 23.879  -30.076 -40.704 1.00 116.69 ? 282 VAL A CB  1 
ATOM   2038 C CG1 . VAL A 1 282 ? 24.707  -29.626 -41.899 1.00 118.31 ? 282 VAL A CG1 1 
ATOM   2039 C CG2 . VAL A 1 282 ? 23.086  -31.327 -41.043 1.00 108.29 ? 282 VAL A CG2 1 
ATOM   2040 N N   . VAL A 1 283 ? 25.320  -28.199 -38.434 1.00 131.70 ? 283 VAL A N   1 
ATOM   2041 C CA  . VAL A 1 283 ? 26.088  -26.974 -38.235 1.00 133.31 ? 283 VAL A CA  1 
ATOM   2042 C C   . VAL A 1 283 ? 27.448  -27.222 -37.585 1.00 137.07 ? 283 VAL A C   1 
ATOM   2043 O O   . VAL A 1 283 ? 28.391  -26.457 -37.791 1.00 136.00 ? 283 VAL A O   1 
ATOM   2044 C CB  . VAL A 1 283 ? 25.304  -25.950 -37.389 1.00 131.10 ? 283 VAL A CB  1 
ATOM   2045 C CG1 . VAL A 1 283 ? 23.998  -25.585 -38.075 1.00 132.62 ? 283 VAL A CG1 1 
ATOM   2046 C CG2 . VAL A 1 283 ? 25.046  -26.499 -35.994 1.00 128.79 ? 283 VAL A CG2 1 
ATOM   2047 N N   . ASN A 1 284 ? 27.545  -28.291 -36.801 1.00 138.51 ? 284 ASN A N   1 
ATOM   2048 C CA  . ASN A 1 284 ? 28.774  -28.594 -36.071 1.00 137.35 ? 284 ASN A CA  1 
ATOM   2049 C C   . ASN A 1 284 ? 29.991  -28.820 -36.971 1.00 130.15 ? 284 ASN A C   1 
ATOM   2050 O O   . ASN A 1 284 ? 31.010  -28.151 -36.811 1.00 121.24 ? 284 ASN A O   1 
ATOM   2051 C CB  . ASN A 1 284 ? 28.568  -29.784 -35.130 1.00 142.02 ? 284 ASN A CB  1 
ATOM   2052 C CG  . ASN A 1 284 ? 27.479  -29.533 -34.107 1.00 147.18 ? 284 ASN A CG  1 
ATOM   2053 O OD1 . ASN A 1 284 ? 27.109  -28.389 -33.845 1.00 147.45 ? 284 ASN A OD1 1 
ATOM   2054 N ND2 . ASN A 1 284 ? 26.958  -30.605 -33.521 1.00 149.62 ? 284 ASN A ND2 1 
ATOM   2055 N N   . PRO A 1 285 ? 29.891  -29.762 -37.922 1.00 134.38 ? 285 PRO A N   1 
ATOM   2056 C CA  . PRO A 1 285 ? 31.024  -30.022 -38.816 1.00 131.96 ? 285 PRO A CA  1 
ATOM   2057 C C   . PRO A 1 285 ? 31.539  -28.748 -39.483 1.00 125.61 ? 285 PRO A C   1 
ATOM   2058 O O   . PRO A 1 285 ? 32.743  -28.611 -39.696 1.00 125.56 ? 285 PRO A O   1 
ATOM   2059 C CB  . PRO A 1 285 ? 30.429  -30.962 -39.865 1.00 134.33 ? 285 PRO A CB  1 
ATOM   2060 C CG  . PRO A 1 285 ? 29.325  -31.659 -39.153 1.00 135.16 ? 285 PRO A CG  1 
ATOM   2061 C CD  . PRO A 1 285 ? 28.746  -30.643 -38.212 1.00 135.78 ? 285 PRO A CD  1 
ATOM   2062 N N   . PHE A 1 286 ? 30.634  -27.830 -39.802 1.00 122.61 ? 286 PHE A N   1 
ATOM   2063 C CA  . PHE A 1 286 ? 31.009  -26.587 -40.465 1.00 122.44 ? 286 PHE A CA  1 
ATOM   2064 C C   . PHE A 1 286 ? 31.547  -25.549 -39.484 1.00 120.53 ? 286 PHE A C   1 
ATOM   2065 O O   . PHE A 1 286 ? 32.323  -24.672 -39.864 1.00 115.23 ? 286 PHE A O   1 
ATOM   2066 C CB  . PHE A 1 286 ? 29.821  -26.009 -41.238 1.00 129.43 ? 286 PHE A CB  1 
ATOM   2067 C CG  . PHE A 1 286 ? 29.391  -26.848 -42.406 1.00 137.18 ? 286 PHE A CG  1 
ATOM   2068 C CD1 . PHE A 1 286 ? 28.371  -27.774 -42.273 1.00 142.93 ? 286 PHE A CD1 1 
ATOM   2069 C CD2 . PHE A 1 286 ? 30.011  -26.712 -43.638 1.00 138.34 ? 286 PHE A CD2 1 
ATOM   2070 C CE1 . PHE A 1 286 ? 27.975  -28.548 -43.348 1.00 145.47 ? 286 PHE A CE1 1 
ATOM   2071 C CE2 . PHE A 1 286 ? 29.619  -27.484 -44.715 1.00 141.49 ? 286 PHE A CE2 1 
ATOM   2072 C CZ  . PHE A 1 286 ? 28.599  -28.404 -44.569 1.00 144.99 ? 286 PHE A CZ  1 
ATOM   2073 N N   . ILE A 1 287 ? 31.133  -25.647 -38.225 1.00 127.05 ? 287 ILE A N   1 
ATOM   2074 C CA  . ILE A 1 287 ? 31.571  -24.692 -37.214 1.00 135.55 ? 287 ILE A CA  1 
ATOM   2075 C C   . ILE A 1 287 ? 32.991  -24.998 -36.744 1.00 135.79 ? 287 ILE A C   1 
ATOM   2076 O O   . ILE A 1 287 ? 33.679  -24.126 -36.216 1.00 138.32 ? 287 ILE A O   1 
ATOM   2077 C CB  . ILE A 1 287 ? 30.619  -24.654 -36.001 1.00 143.58 ? 287 ILE A CB  1 
ATOM   2078 C CG1 . ILE A 1 287 ? 30.809  -23.357 -35.213 1.00 150.26 ? 287 ILE A CG1 1 
ATOM   2079 C CG2 . ILE A 1 287 ? 30.836  -25.861 -35.103 1.00 144.55 ? 287 ILE A CG2 1 
ATOM   2080 C CD1 . ILE A 1 287 ? 29.924  -23.254 -33.993 1.00 153.58 ? 287 ILE A CD1 1 
ATOM   2081 N N   . TYR A 1 288 ? 33.425  -26.240 -36.938 1.00 130.53 ? 288 TYR A N   1 
ATOM   2082 C CA  . TYR A 1 288 ? 34.789  -26.629 -36.602 1.00 119.75 ? 288 TYR A CA  1 
ATOM   2083 C C   . TYR A 1 288 ? 35.740  -26.210 -37.713 1.00 114.25 ? 288 TYR A C   1 
ATOM   2084 O O   . TYR A 1 288 ? 36.833  -25.709 -37.452 1.00 119.49 ? 288 TYR A O   1 
ATOM   2085 C CB  . TYR A 1 288 ? 34.886  -28.137 -36.373 1.00 117.19 ? 288 TYR A CB  1 
ATOM   2086 C CG  . TYR A 1 288 ? 34.032  -28.643 -35.234 1.00 121.43 ? 288 TYR A CG  1 
ATOM   2087 C CD1 . TYR A 1 288 ? 34.227  -28.185 -33.938 1.00 124.57 ? 288 TYR A CD1 1 
ATOM   2088 C CD2 . TYR A 1 288 ? 33.039  -29.588 -35.452 1.00 122.01 ? 288 TYR A CD2 1 
ATOM   2089 C CE1 . TYR A 1 288 ? 33.450  -28.646 -32.893 1.00 125.93 ? 288 TYR A CE1 1 
ATOM   2090 C CE2 . TYR A 1 288 ? 32.257  -30.055 -34.413 1.00 124.25 ? 288 TYR A CE2 1 
ATOM   2091 C CZ  . TYR A 1 288 ? 32.468  -29.581 -33.136 1.00 126.72 ? 288 TYR A CZ  1 
ATOM   2092 O OH  . TYR A 1 288 ? 31.693  -30.044 -32.098 1.00 128.60 ? 288 TYR A OH  1 
ATOM   2093 N N   . ALA A 1 289 ? 35.313  -26.419 -38.954 1.00 106.65 ? 289 ALA A N   1 
ATOM   2094 C CA  . ALA A 1 289 ? 36.122  -26.069 -40.115 1.00 106.51 ? 289 ALA A CA  1 
ATOM   2095 C C   . ALA A 1 289 ? 36.358  -24.564 -40.209 1.00 126.83 ? 289 ALA A C   1 
ATOM   2096 O O   . ALA A 1 289 ? 37.308  -24.115 -40.847 1.00 140.01 ? 289 ALA A O   1 
ATOM   2097 C CB  . ALA A 1 289 ? 35.470  -26.588 -41.389 1.00 90.52  ? 289 ALA A CB  1 
ATOM   2098 N N   . TYR A 1 290 ? 35.490  -23.786 -39.574 1.00 134.99 ? 290 TYR A N   1 
ATOM   2099 C CA  . TYR A 1 290 ? 35.617  -22.333 -39.601 1.00 148.86 ? 290 TYR A CA  1 
ATOM   2100 C C   . TYR A 1 290 ? 36.334  -21.800 -38.364 1.00 149.54 ? 290 TYR A C   1 
ATOM   2101 O O   . TYR A 1 290 ? 37.321  -21.071 -38.474 1.00 149.48 ? 290 TYR A O   1 
ATOM   2102 C CB  . TYR A 1 290 ? 34.242  -21.673 -39.733 1.00 159.72 ? 290 TYR A CB  1 
ATOM   2103 C CG  . TYR A 1 290 ? 34.279  -20.163 -39.632 1.00 170.94 ? 290 TYR A CG  1 
ATOM   2104 C CD1 . TYR A 1 290 ? 34.472  -19.376 -40.759 1.00 175.12 ? 290 TYR A CD1 1 
ATOM   2105 C CD2 . TYR A 1 290 ? 34.120  -19.526 -38.408 1.00 174.66 ? 290 TYR A CD2 1 
ATOM   2106 C CE1 . TYR A 1 290 ? 34.507  -17.996 -40.670 1.00 177.59 ? 290 TYR A CE1 1 
ATOM   2107 C CE2 . TYR A 1 290 ? 34.154  -18.147 -38.309 1.00 176.86 ? 290 TYR A CE2 1 
ATOM   2108 C CZ  . TYR A 1 290 ? 34.347  -17.388 -39.443 1.00 178.20 ? 290 TYR A CZ  1 
ATOM   2109 O OH  . TYR A 1 290 ? 34.380  -16.016 -39.348 1.00 180.15 ? 290 TYR A OH  1 
ATOM   2110 N N   . ARG A 1 291 ? 35.830  -22.164 -37.189 1.00 151.08 ? 291 ARG A N   1 
ATOM   2111 C CA  . ARG A 1 291 ? 36.386  -21.681 -35.930 1.00 153.22 ? 291 ARG A CA  1 
ATOM   2112 C C   . ARG A 1 291 ? 37.787  -22.220 -35.671 1.00 154.61 ? 291 ARG A C   1 
ATOM   2113 O O   . ARG A 1 291 ? 38.702  -21.463 -35.349 1.00 161.87 ? 291 ARG A O   1 
ATOM   2114 C CB  . ARG A 1 291 ? 35.465  -22.044 -34.764 1.00 153.53 ? 291 ARG A CB  1 
ATOM   2115 C CG  . ARG A 1 291 ? 34.179  -21.239 -34.718 1.00 150.78 ? 291 ARG A CG  1 
ATOM   2116 C CD  . ARG A 1 291 ? 34.465  -19.776 -34.425 1.00 147.31 ? 291 ARG A CD  1 
ATOM   2117 N NE  . ARG A 1 291 ? 35.105  -19.600 -33.125 1.00 144.89 ? 291 ARG A NE  1 
ATOM   2118 C CZ  . ARG A 1 291 ? 35.487  -18.427 -32.633 1.00 147.92 ? 291 ARG A CZ  1 
ATOM   2119 N NH1 . ARG A 1 291 ? 35.297  -17.317 -33.335 1.00 148.48 ? 291 ARG A NH1 1 
ATOM   2120 N NH2 . ARG A 1 291 ? 36.060  -18.361 -31.439 1.00 151.59 ? 291 ARG A NH2 1 
ATOM   2121 N N   . ILE A 1 292 ? 37.951  -23.531 -35.810 1.00 147.17 ? 292 ILE A N   1 
ATOM   2122 C CA  . ILE A 1 292 ? 39.236  -24.162 -35.538 1.00 142.50 ? 292 ILE A CA  1 
ATOM   2123 C C   . ILE A 1 292 ? 40.072  -24.325 -36.803 1.00 138.19 ? 292 ILE A C   1 
ATOM   2124 O O   . ILE A 1 292 ? 39.707  -25.064 -37.718 1.00 120.74 ? 292 ILE A O   1 
ATOM   2125 C CB  . ILE A 1 292 ? 39.062  -25.521 -34.843 1.00 139.34 ? 292 ILE A CB  1 
ATOM   2126 C CG1 . ILE A 1 292 ? 38.298  -25.340 -33.529 1.00 140.66 ? 292 ILE A CG1 1 
ATOM   2127 C CG2 . ILE A 1 292 ? 40.415  -26.166 -34.592 1.00 142.00 ? 292 ILE A CG2 1 
ATOM   2128 C CD1 . ILE A 1 292 ? 38.111  -26.619 -32.744 1.00 141.57 ? 292 ILE A CD1 1 
ATOM   2129 N N   . ARG A 1 293 ? 41.200  -23.623 -36.840 1.00 153.21 ? 293 ARG A N   1 
ATOM   2130 C CA  . ARG A 1 293 ? 42.100  -23.655 -37.987 1.00 163.24 ? 293 ARG A CA  1 
ATOM   2131 C C   . ARG A 1 293 ? 42.824  -24.994 -38.097 1.00 152.51 ? 293 ARG A C   1 
ATOM   2132 O O   . ARG A 1 293 ? 43.392  -25.321 -39.139 1.00 148.47 ? 293 ARG A O   1 
ATOM   2133 C CB  . ARG A 1 293 ? 43.115  -22.515 -37.893 1.00 178.13 ? 293 ARG A CB  1 
ATOM   2134 C CG  . ARG A 1 293 ? 42.488  -21.130 -37.839 1.00 187.52 ? 293 ARG A CG  1 
ATOM   2135 C CD  . ARG A 1 293 ? 43.540  -20.060 -37.598 1.00 199.15 ? 293 ARG A CD  1 
ATOM   2136 N NE  . ARG A 1 293 ? 44.177  -20.204 -36.291 1.00 207.20 ? 293 ARG A NE  1 
ATOM   2137 C CZ  . ARG A 1 293 ? 45.204  -19.469 -35.875 1.00 213.34 ? 293 ARG A CZ  1 
ATOM   2138 N NH1 . ARG A 1 293 ? 45.719  -18.538 -36.666 1.00 216.44 ? 293 ARG A NH1 1 
ATOM   2139 N NH2 . ARG A 1 293 ? 45.719  -19.669 -34.670 1.00 214.25 ? 293 ARG A NH2 1 
ATOM   2140 N N   . GLU A 1 294 ? 42.804  -25.764 -37.015 1.00 143.87 ? 294 GLU A N   1 
ATOM   2141 C CA  . GLU A 1 294 ? 43.417  -27.085 -37.007 1.00 138.36 ? 294 GLU A CA  1 
ATOM   2142 C C   . GLU A 1 294 ? 42.510  -28.104 -37.685 1.00 132.12 ? 294 GLU A C   1 
ATOM   2143 O O   . GLU A 1 294 ? 42.979  -29.000 -38.386 1.00 129.08 ? 294 GLU A O   1 
ATOM   2144 C CB  . GLU A 1 294 ? 43.727  -27.527 -35.576 1.00 145.43 ? 294 GLU A CB  1 
ATOM   2145 C CG  . GLU A 1 294 ? 44.288  -28.937 -35.466 1.00 154.06 ? 294 GLU A CG  1 
ATOM   2146 C CD  . GLU A 1 294 ? 45.659  -29.080 -36.099 1.00 161.39 ? 294 GLU A CD  1 
ATOM   2147 O OE1 . GLU A 1 294 ? 46.131  -30.228 -36.242 1.00 157.41 ? 294 GLU A OE1 1 
ATOM   2148 O OE2 . GLU A 1 294 ? 46.267  -28.047 -36.451 1.00 169.73 ? 294 GLU A OE2 1 
ATOM   2149 N N   . PHE A 1 295 ? 41.206  -27.959 -37.470 1.00 130.72 ? 295 PHE A N   1 
ATOM   2150 C CA  . PHE A 1 295 ? 40.227  -28.864 -38.058 1.00 122.24 ? 295 PHE A CA  1 
ATOM   2151 C C   . PHE A 1 295 ? 40.150  -28.730 -39.575 1.00 112.66 ? 295 PHE A C   1 
ATOM   2152 O O   . PHE A 1 295 ? 40.242  -29.722 -40.296 1.00 108.20 ? 295 PHE A O   1 
ATOM   2153 C CB  . PHE A 1 295 ? 38.842  -28.631 -37.448 1.00 125.67 ? 295 PHE A CB  1 
ATOM   2154 C CG  . PHE A 1 295 ? 38.531  -29.528 -36.282 1.00 128.50 ? 295 PHE A CG  1 
ATOM   2155 C CD1 . PHE A 1 295 ? 38.111  -30.831 -36.488 1.00 125.91 ? 295 PHE A CD1 1 
ATOM   2156 C CD2 . PHE A 1 295 ? 38.649  -29.067 -34.983 1.00 128.60 ? 295 PHE A CD2 1 
ATOM   2157 C CE1 . PHE A 1 295 ? 37.822  -31.659 -35.419 1.00 119.91 ? 295 PHE A CE1 1 
ATOM   2158 C CE2 . PHE A 1 295 ? 38.360  -29.890 -33.910 1.00 123.56 ? 295 PHE A CE2 1 
ATOM   2159 C CZ  . PHE A 1 295 ? 37.946  -31.186 -34.130 1.00 118.13 ? 295 PHE A CZ  1 
ATOM   2160 N N   . ARG A 1 296 ? 39.981  -27.501 -40.054 1.00 108.89 ? 296 ARG A N   1 
ATOM   2161 C CA  . ARG A 1 296 ? 39.797  -27.262 -41.481 1.00 112.25 ? 296 ARG A CA  1 
ATOM   2162 C C   . ARG A 1 296 ? 40.957  -27.792 -42.318 1.00 125.27 ? 296 ARG A C   1 
ATOM   2163 O O   . ARG A 1 296 ? 40.758  -28.272 -43.434 1.00 126.60 ? 296 ARG A O   1 
ATOM   2164 C CB  . ARG A 1 296 ? 39.564  -25.774 -41.764 1.00 106.81 ? 296 ARG A CB  1 
ATOM   2165 C CG  . ARG A 1 296 ? 40.700  -24.858 -41.349 1.00 109.75 ? 296 ARG A CG  1 
ATOM   2166 C CD  . ARG A 1 296 ? 40.389  -23.414 -41.713 1.00 121.94 ? 296 ARG A CD  1 
ATOM   2167 N NE  . ARG A 1 296 ? 41.532  -22.534 -41.494 1.00 147.05 ? 296 ARG A NE  1 
ATOM   2168 C CZ  . ARG A 1 296 ? 41.546  -21.238 -41.790 1.00 161.78 ? 296 ARG A CZ  1 
ATOM   2169 N NH1 . ARG A 1 296 ? 42.633  -20.515 -41.557 1.00 168.54 ? 296 ARG A NH1 1 
ATOM   2170 N NH2 . ARG A 1 296 ? 40.474  -20.666 -42.320 1.00 163.13 ? 296 ARG A NH2 1 
ATOM   2171 N N   . GLN A 1 297 ? 42.167  -27.706 -41.777 1.00 134.60 ? 297 GLN A N   1 
ATOM   2172 C CA  . GLN A 1 297 ? 43.346  -28.204 -42.474 1.00 142.26 ? 297 GLN A CA  1 
ATOM   2173 C C   . GLN A 1 297 ? 43.374  -29.728 -42.464 1.00 142.46 ? 297 GLN A C   1 
ATOM   2174 O O   . GLN A 1 297 ? 43.981  -30.353 -43.334 1.00 146.58 ? 297 GLN A O   1 
ATOM   2175 C CB  . GLN A 1 297 ? 44.619  -27.643 -41.843 1.00 154.50 ? 297 GLN A CB  1 
ATOM   2176 C CG  . GLN A 1 297 ? 44.696  -26.129 -41.864 1.00 170.09 ? 297 GLN A CG  1 
ATOM   2177 C CD  . GLN A 1 297 ? 45.986  -25.602 -41.268 1.00 188.37 ? 297 GLN A CD  1 
ATOM   2178 O OE1 . GLN A 1 297 ? 46.925  -26.360 -41.018 1.00 192.08 ? 297 GLN A OE1 1 
ATOM   2179 N NE2 . GLN A 1 297 ? 46.040  -24.294 -41.039 1.00 195.53 ? 297 GLN A NE2 1 
ATOM   2180 N N   . THR A 1 298 ? 42.710  -30.319 -41.476 1.00 138.77 ? 298 THR A N   1 
ATOM   2181 C CA  . THR A 1 298 ? 42.617  -31.769 -41.379 1.00 135.42 ? 298 THR A CA  1 
ATOM   2182 C C   . THR A 1 298 ? 41.650  -32.306 -42.428 1.00 138.93 ? 298 THR A C   1 
ATOM   2183 O O   . THR A 1 298 ? 41.959  -33.263 -43.139 1.00 136.47 ? 298 THR A O   1 
ATOM   2184 C CB  . THR A 1 298 ? 42.148  -32.218 -39.982 1.00 127.52 ? 298 THR A CB  1 
ATOM   2185 O OG1 . THR A 1 298 ? 42.992  -31.636 -38.981 1.00 129.73 ? 298 THR A OG1 1 
ATOM   2186 C CG2 . THR A 1 298 ? 42.202  -33.732 -39.865 1.00 122.17 ? 298 THR A CG2 1 
ATOM   2187 N N   . PHE A 1 299 ? 40.479  -31.683 -42.521 1.00 147.83 ? 299 PHE A N   1 
ATOM   2188 C CA  . PHE A 1 299 ? 39.479  -32.078 -43.506 1.00 154.90 ? 299 PHE A CA  1 
ATOM   2189 C C   . PHE A 1 299 ? 40.013  -31.875 -44.919 1.00 154.99 ? 299 PHE A C   1 
ATOM   2190 O O   . PHE A 1 299 ? 39.948  -32.776 -45.757 1.00 156.99 ? 299 PHE A O   1 
ATOM   2191 C CB  . PHE A 1 299 ? 38.190  -31.271 -43.328 1.00 159.99 ? 299 PHE A CB  1 
ATOM   2192 C CG  . PHE A 1 299 ? 37.609  -31.340 -41.943 1.00 161.64 ? 299 PHE A CG  1 
ATOM   2193 C CD1 . PHE A 1 299 ? 37.205  -32.552 -41.405 1.00 161.67 ? 299 PHE A CD1 1 
ATOM   2194 C CD2 . PHE A 1 299 ? 37.445  -30.190 -41.189 1.00 161.32 ? 299 PHE A CD2 1 
ATOM   2195 C CE1 . PHE A 1 299 ? 36.665  -32.619 -40.135 1.00 160.32 ? 299 PHE A CE1 1 
ATOM   2196 C CE2 . PHE A 1 299 ? 36.904  -30.250 -39.918 1.00 159.75 ? 299 PHE A CE2 1 
ATOM   2197 C CZ  . PHE A 1 299 ? 36.514  -31.467 -39.392 1.00 159.66 ? 299 PHE A CZ  1 
ATOM   2198 N N   . ARG A 1 300 ? 40.539  -30.680 -45.172 1.00 150.74 ? 300 ARG A N   1 
ATOM   2199 C CA  . ARG A 1 300 ? 41.066  -30.312 -46.481 1.00 151.18 ? 300 ARG A CA  1 
ATOM   2200 C C   . ARG A 1 300 ? 41.988  -31.391 -47.040 1.00 151.88 ? 300 ARG A C   1 
ATOM   2201 O O   . ARG A 1 300 ? 42.007  -31.643 -48.244 1.00 149.29 ? 300 ARG A O   1 
ATOM   2202 C CB  . ARG A 1 300 ? 41.809  -28.978 -46.384 1.00 158.20 ? 300 ARG A CB  1 
ATOM   2203 C CG  . ARG A 1 300 ? 42.340  -28.443 -47.702 1.00 170.24 ? 300 ARG A CG  1 
ATOM   2204 C CD  . ARG A 1 300 ? 42.972  -27.073 -47.501 1.00 185.34 ? 300 ARG A CD  1 
ATOM   2205 N NE  . ARG A 1 300 ? 43.551  -26.540 -48.730 1.00 201.62 ? 300 ARG A NE  1 
ATOM   2206 C CZ  . ARG A 1 300 ? 44.151  -25.356 -48.819 1.00 213.41 ? 300 ARG A CZ  1 
ATOM   2207 N NH1 . ARG A 1 300 ? 44.250  -24.581 -47.748 1.00 216.79 ? 300 ARG A NH1 1 
ATOM   2208 N NH2 . ARG A 1 300 ? 44.653  -24.947 -49.977 1.00 218.00 ? 300 ARG A NH2 1 
ATOM   2209 N N   . LYS A 1 301 ? 42.745  -32.028 -46.153 1.00 156.56 ? 301 LYS A N   1 
ATOM   2210 C CA  . LYS A 1 301 ? 43.677  -33.077 -46.546 1.00 159.28 ? 301 LYS A CA  1 
ATOM   2211 C C   . LYS A 1 301 ? 42.961  -34.388 -46.862 1.00 163.03 ? 301 LYS A C   1 
ATOM   2212 O O   . LYS A 1 301 ? 43.257  -35.040 -47.864 1.00 163.37 ? 301 LYS A O   1 
ATOM   2213 C CB  . LYS A 1 301 ? 44.717  -33.293 -45.447 1.00 156.65 ? 301 LYS A CB  1 
ATOM   2214 C CG  . LYS A 1 301 ? 45.497  -34.590 -45.564 1.00 157.15 ? 301 LYS A CG  1 
ATOM   2215 C CD  . LYS A 1 301 ? 45.273  -35.455 -44.337 1.00 156.72 ? 301 LYS A CD  1 
ATOM   2216 C CE  . LYS A 1 301 ? 45.546  -34.669 -43.064 1.00 157.54 ? 301 LYS A CE  1 
ATOM   2217 N NZ  . LYS A 1 301 ? 45.090  -35.398 -41.849 1.00 157.20 ? 301 LYS A NZ  1 
ATOM   2218 N N   . ILE A 1 302 ? 42.021  -34.769 -46.002 1.00 164.50 ? 302 ILE A N   1 
ATOM   2219 C CA  . ILE A 1 302 ? 41.271  -36.008 -46.183 1.00 162.17 ? 302 ILE A CA  1 
ATOM   2220 C C   . ILE A 1 302 ? 40.541  -36.028 -47.522 1.00 162.21 ? 302 ILE A C   1 
ATOM   2221 O O   . ILE A 1 302 ? 40.573  -37.026 -48.244 1.00 160.43 ? 302 ILE A O   1 
ATOM   2222 C CB  . ILE A 1 302 ? 40.241  -36.216 -45.056 1.00 156.93 ? 302 ILE A CB  1 
ATOM   2223 C CG1 . ILE A 1 302 ? 40.931  -36.219 -43.691 1.00 153.78 ? 302 ILE A CG1 1 
ATOM   2224 C CG2 . ILE A 1 302 ? 39.474  -37.511 -45.270 1.00 156.49 ? 302 ILE A CG2 1 
ATOM   2225 C CD1 . ILE A 1 302 ? 39.981  -36.420 -42.531 1.00 148.36 ? 302 ILE A CD1 1 
ATOM   2226 N N   . ILE A 1 303 ? 39.882  -34.920 -47.845 1.00 164.45 ? 303 ILE A N   1 
ATOM   2227 C CA  . ILE A 1 303 ? 39.118  -34.811 -49.083 1.00 166.92 ? 303 ILE A CA  1 
ATOM   2228 C C   . ILE A 1 303 ? 40.010  -34.992 -50.308 1.00 172.03 ? 303 ILE A C   1 
ATOM   2229 O O   . ILE A 1 303 ? 39.716  -35.802 -51.188 1.00 171.01 ? 303 ILE A O   1 
ATOM   2230 C CB  . ILE A 1 303 ? 38.393  -33.453 -49.181 1.00 161.52 ? 303 ILE A CB  1 
ATOM   2231 C CG1 . ILE A 1 303 ? 37.461  -33.257 -47.982 1.00 150.60 ? 303 ILE A CG1 1 
ATOM   2232 C CG2 . ILE A 1 303 ? 37.616  -33.356 -50.485 1.00 160.31 ? 303 ILE A CG2 1 
ATOM   2233 C CD1 . ILE A 1 303 ? 36.746  -31.925 -47.977 1.00 143.22 ? 303 ILE A CD1 1 
ATOM   2234 N N   . ARG A 1 304 ? 41.098  -34.232 -50.357 1.00 176.11 ? 304 ARG A N   1 
ATOM   2235 C CA  . ARG A 1 304 ? 42.038  -34.308 -51.471 1.00 181.14 ? 304 ARG A CA  1 
ATOM   2236 C C   . ARG A 1 304 ? 42.583  -35.722 -51.640 1.00 180.93 ? 304 ARG A C   1 
ATOM   2237 O O   . ARG A 1 304 ? 42.664  -36.239 -52.755 1.00 180.49 ? 304 ARG A O   1 
ATOM   2238 C CB  . ARG A 1 304 ? 43.189  -33.320 -51.272 1.00 188.05 ? 304 ARG A CB  1 
ATOM   2239 C CG  . ARG A 1 304 ? 42.767  -31.862 -51.332 1.00 196.93 ? 304 ARG A CG  1 
ATOM   2240 C CD  . ARG A 1 304 ? 43.959  -30.936 -51.159 1.00 207.84 ? 304 ARG A CD  1 
ATOM   2241 N NE  . ARG A 1 304 ? 43.606  -29.542 -51.408 1.00 216.13 ? 304 ARG A NE  1 
ATOM   2242 C CZ  . ARG A 1 304 ? 44.467  -28.531 -51.356 1.00 221.80 ? 304 ARG A CZ  1 
ATOM   2243 N NH1 . ARG A 1 304 ? 44.055  -27.294 -51.601 1.00 224.94 ? 304 ARG A NH1 1 
ATOM   2244 N NH2 . ARG A 1 304 ? 45.741  -28.755 -51.061 1.00 222.46 ? 304 ARG A NH2 1 
ATOM   2245 N N   . SER A 1 305 ? 42.955  -36.343 -50.526 1.00 181.58 ? 305 SER A N   1 
ATOM   2246 C CA  . SER A 1 305 ? 43.481  -37.702 -50.544 1.00 183.09 ? 305 SER A CA  1 
ATOM   2247 C C   . SER A 1 305 ? 42.410  -38.712 -50.148 1.00 179.79 ? 305 SER A C   1 
ATOM   2248 O O   . SER A 1 305 ? 41.595  -39.124 -50.973 1.00 177.94 ? 305 SER A O   1 
ATOM   2249 C CB  . SER A 1 305 ? 44.687  -37.820 -49.610 1.00 186.65 ? 305 SER A CB  1 
ATOM   2250 O OG  . SER A 1 305 ? 45.216  -39.135 -49.623 1.00 188.52 ? 305 SER A OG  1 
HETATM 2251 N N1  . CFF B 2 .   ? 9.174   -33.156 -31.881 1.00 147.73 ? 330 CFF A N1  1 
HETATM 2252 C C2  . CFF B 2 .   ? 9.511   -33.973 -32.948 1.00 148.15 ? 330 CFF A C2  1 
HETATM 2253 C C10 . CFF B 2 .   ? 10.180  -32.790 -30.862 1.00 138.32 ? 330 CFF A C10 1 
HETATM 2254 C C6  . CFF B 2 .   ? 7.880   -32.698 -31.748 1.00 147.40 ? 330 CFF A C6  1 
HETATM 2255 N N3  . CFF B 2 .   ? 8.560   -34.329 -33.882 1.00 149.30 ? 330 CFF A N3  1 
HETATM 2256 O O11 . CFF B 2 .   ? 10.781  -34.432 -33.079 1.00 142.40 ? 330 CFF A O11 1 
HETATM 2257 C C12 . CFF B 2 .   ? 8.923   -35.204 -35.004 1.00 147.42 ? 330 CFF A C12 1 
HETATM 2258 C C4  . CFF B 2 .   ? 7.287   -33.864 -33.735 1.00 146.85 ? 330 CFF A C4  1 
HETATM 2259 C C5  . CFF B 2 .   ? 6.925   -33.068 -32.699 1.00 145.81 ? 330 CFF A C5  1 
HETATM 2260 N N9  . CFF B 2 .   ? 6.240   -34.112 -34.550 1.00 147.23 ? 330 CFF A N9  1 
HETATM 2261 O O13 . CFF B 2 .   ? 7.552   -31.908 -30.705 1.00 147.52 ? 330 CFF A O13 1 
HETATM 2262 N N7  . CFF B 2 .   ? 5.617   -32.775 -32.828 1.00 147.22 ? 330 CFF A N7  1 
HETATM 2263 C C8  . CFF B 2 .   ? 5.235   -33.422 -33.954 1.00 148.06 ? 330 CFF A C8  1 
HETATM 2264 C C14 . CFF B 2 .   ? 4.727   -31.975 -31.994 1.00 145.92 ? 330 CFF A C14 1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 7   ? 2.3082 1.9588 2.3328 0.2203  -0.4205 -0.0175 7   SER A N   
2    C CA  . SER A 7   ? 2.2499 1.8893 2.2408 0.2150  -0.4109 -0.0100 7   SER A CA  
3    C C   . SER A 7   ? 2.1632 1.8016 2.1357 0.2188  -0.3781 -0.0008 7   SER A C   
4    O O   . SER A 7   ? 2.1567 1.7796 2.0924 0.2246  -0.3704 0.0072  7   SER A O   
5    C CB  . SER A 7   ? 2.2958 1.8973 2.2387 0.2373  -0.4378 -0.0086 7   SER A CB  
6    O OG  . SER A 7   ? 2.3336 1.9350 2.2946 0.2304  -0.4694 -0.0177 7   SER A OG  
7    N N   . VAL A 8   ? 2.1060 1.7609 2.1054 0.2155  -0.3592 -0.0020 8   VAL A N   
8    C CA  . VAL A 8   ? 2.0419 1.6965 2.0302 0.2165  -0.3282 0.0058  8   VAL A CA  
9    C C   . VAL A 8   ? 2.0132 1.6953 2.0218 0.1876  -0.3071 0.0061  8   VAL A C   
10   O O   . VAL A 8   ? 1.9927 1.6705 1.9790 0.1860  -0.2910 0.0135  8   VAL A O   
11   C CB  . VAL A 8   ? 1.9515 1.6089 1.9579 0.2251  -0.3165 0.0041  8   VAL A CB  
12   C CG1 . VAL A 8   ? 1.8429 1.4991 1.8410 0.2228  -0.2844 0.0119  8   VAL A CG1 
13   C CG2 . VAL A 8   ? 2.0042 1.6326 1.9865 0.2567  -0.3371 0.0040  8   VAL A CG2 
14   N N   . TYR A 9   ? 1.9937 1.7047 2.0447 0.1658  -0.3072 -0.0018 9   TYR A N   
15   C CA  . TYR A 9   ? 1.9633 1.6999 2.0328 0.1394  -0.2897 -0.0027 9   TYR A CA  
16   C C   . TYR A 9   ? 2.0336 1.7613 2.0741 0.1355  -0.2955 0.0019  9   TYR A C   
17   O O   . TYR A 9   ? 2.0588 1.7942 2.0906 0.1255  -0.2773 0.0057  9   TYR A O   
18   C CB  . TYR A 9   ? 1.9258 1.6912 2.0413 0.1202  -0.2937 -0.0109 9   TYR A CB  
19   C CG  . TYR A 9   ? 1.8580 1.6472 1.9886 0.0947  -0.2787 -0.0118 9   TYR A CG  
20   C CD1 . TYR A 9   ? 1.8173 1.6242 1.9628 0.0834  -0.2529 -0.0131 9   TYR A CD1 
21   C CD2 . TYR A 9   ? 1.8244 1.6158 1.9524 0.0829  -0.2909 -0.0116 9   TYR A CD2 
22   C CE1 . TYR A 9   ? 1.8095 1.6366 1.9655 0.0624  -0.2401 -0.0145 9   TYR A CE1 
23   C CE2 . TYR A 9   ? 1.7867 1.5979 1.9252 0.0616  -0.2767 -0.0119 9   TYR A CE2 
24   C CZ  . TYR A 9   ? 1.8126 1.6420 1.9645 0.0522  -0.2516 -0.0136 9   TYR A CZ  
25   O OH  . TYR A 9   ? 1.8249 1.6725 1.9840 0.0333  -0.2383 -0.0145 9   TYR A OH  
26   N N   . ILE A 10  ? 2.0714 1.7823 2.0968 0.1440  -0.3220 0.0010  10  ILE A N   
27   C CA  . ILE A 10  ? 2.0818 1.7792 2.0753 0.1435  -0.3307 0.0052  10  ILE A CA  
28   C C   . ILE A 10  ? 2.0171 1.6957 1.9684 0.1605  -0.3183 0.0147  10  ILE A C   
29   O O   . ILE A 10  ? 1.9327 1.6163 1.8694 0.1526  -0.3068 0.0191  10  ILE A O   
30   C CB  . ILE A 10  ? 2.1561 1.8318 2.1366 0.1538  -0.3641 0.0019  10  ILE A CB  
31   C CG1 . ILE A 10  ? 2.1641 1.8604 2.1922 0.1373  -0.3769 -0.0069 10  ILE A CG1 
32   C CG2 . ILE A 10  ? 2.1736 1.8337 2.1200 0.1526  -0.3728 0.0058  10  ILE A CG2 
33   C CD1 . ILE A 10  ? 2.2034 1.8798 2.2258 0.1455  -0.4119 -0.0115 10  ILE A CD1 
34   N N   . THR A 11  ? 2.0089 1.6664 1.9413 0.1848  -0.3201 0.0183  11  THR A N   
35   C CA  . THR A 11  ? 1.9349 1.5737 1.8286 0.2033  -0.3070 0.0290  11  THR A CA  
36   C C   . THR A 11  ? 1.8173 1.4783 1.7250 0.1875  -0.2760 0.0330  11  THR A C   
37   O O   . THR A 11  ? 1.8601 1.5201 1.7456 0.1882  -0.2659 0.0401  11  THR A O   
38   C CB  . THR A 11  ? 1.9395 1.5531 1.8148 0.2315  -0.3102 0.0327  11  THR A CB  
39   O OG1 . THR A 11  ? 1.9617 1.5521 1.8189 0.2489  -0.3417 0.0284  11  THR A OG1 
40   C CG2 . THR A 11  ? 1.9725 1.5682 1.8101 0.2499  -0.2927 0.0459  11  THR A CG2 
41   N N   . VAL A 12  ? 1.6337 1.3146 1.5783 0.1738  -0.2618 0.0278  12  VAL A N   
42   C CA  . VAL A 12  ? 1.4719 1.1727 1.4325 0.1582  -0.2343 0.0294  12  VAL A CA  
43   C C   . VAL A 12  ? 1.5014 1.2240 1.4692 0.1362  -0.2304 0.0267  12  VAL A C   
44   O O   . VAL A 12  ? 1.5277 1.2586 1.4886 0.1306  -0.2139 0.0312  12  VAL A O   
45   C CB  . VAL A 12  ? 1.2733 0.9885 1.2706 0.1487  -0.2223 0.0228  12  VAL A CB  
46   C CG1 . VAL A 12  ? 1.1110 0.8469 1.1258 0.1297  -0.1972 0.0219  12  VAL A CG1 
47   C CG2 . VAL A 12  ? 1.2394 0.9314 1.2259 0.1718  -0.2219 0.0267  12  VAL A CG2 
48   N N   . GLU A 13  ? 1.5509 1.2830 1.5333 0.1242  -0.2455 0.0197  13  GLU A N   
49   C CA  . GLU A 13  ? 1.6801 1.4298 1.6664 0.1049  -0.2428 0.0175  13  GLU A CA  
50   C C   . GLU A 13  ? 1.7252 1.4606 1.6718 0.1145  -0.2477 0.0250  13  GLU A C   
51   O O   . GLU A 13  ? 1.6513 1.4006 1.5938 0.1037  -0.2366 0.0261  13  GLU A O   
52   C CB  . GLU A 13  ? 1.7410 1.4999 1.7500 0.0918  -0.2582 0.0103  13  GLU A CB  
53   C CG  . GLU A 13  ? 1.8178 1.6009 1.8698 0.0767  -0.2475 0.0029  13  GLU A CG  
54   C CD  . GLU A 13  ? 1.8874 1.6925 1.9511 0.0603  -0.2238 0.0009  13  GLU A CD  
55   O OE1 . GLU A 13  ? 1.9234 1.7300 1.9672 0.0559  -0.2189 0.0040  13  GLU A OE1 
56   O OE2 . GLU A 13  ? 1.9092 1.7296 2.0011 0.0527  -0.2109 -0.0043 13  GLU A OE2 
57   N N   . LEU A 14  ? 1.7803 1.4877 1.6963 0.1365  -0.2649 0.0297  14  LEU A N   
58   C CA  . LEU A 14  ? 1.8032 1.4935 1.6770 0.1502  -0.2698 0.0376  14  LEU A CA  
59   C C   . LEU A 14  ? 1.7325 1.4254 1.5937 0.1588  -0.2474 0.0466  14  LEU A C   
60   O O   . LEU A 14  ? 1.7815 1.4796 1.6247 0.1585  -0.2402 0.0518  14  LEU A O   
61   C CB  . LEU A 14  ? 1.9404 1.5970 1.7825 0.1738  -0.2952 0.0395  14  LEU A CB  
62   C CG  . LEU A 14  ? 2.0513 1.6989 1.8899 0.1674  -0.3208 0.0335  14  LEU A CG  
63   C CD1 . LEU A 14  ? 2.0595 1.7319 1.9460 0.1419  -0.3213 0.0241  14  LEU A CD1 
64   C CD2 . LEU A 14  ? 2.1443 1.7572 1.9545 0.1919  -0.3475 0.0334  14  LEU A CD2 
65   N N   . ALA A 15  ? 1.6201 1.3097 1.4922 0.1665  -0.2362 0.0487  15  ALA A N   
66   C CA  . ALA A 15  ? 1.5418 1.2337 1.4077 0.1730  -0.2134 0.0580  15  ALA A CA  
67   C C   . ALA A 15  ? 1.6000 1.3227 1.4884 0.1497  -0.1951 0.0554  15  ALA A C   
68   O O   . ALA A 15  ? 1.6712 1.3997 1.5465 0.1527  -0.1832 0.0630  15  ALA A O   
69   C CB  . ALA A 15  ? 1.4219 1.1051 1.3010 0.1811  -0.2037 0.0593  15  ALA A CB  
70   N N   . ILE A 16  ? 1.5893 1.3325 1.5117 0.1276  -0.1932 0.0445  16  ILE A N   
71   C CA  . ILE A 16  ? 1.6239 1.3952 1.5667 0.1060  -0.1782 0.0399  16  ILE A CA  
72   C C   . ILE A 16  ? 1.7367 1.5148 1.6598 0.1024  -0.1849 0.0409  16  ILE A C   
73   O O   . ILE A 16  ? 1.7604 1.5534 1.6810 0.0976  -0.1728 0.0435  16  ILE A O   
74   C CB  . ILE A 16  ? 1.5792 1.3680 1.5581 0.0861  -0.1758 0.0280  16  ILE A CB  
75   C CG1 . ILE A 16  ? 1.6142 1.3985 1.6133 0.0888  -0.1657 0.0266  16  ILE A CG1 
76   C CG2 . ILE A 16  ? 1.5360 1.3512 1.5294 0.0658  -0.1639 0.0222  16  ILE A CG2 
77   C CD1 . ILE A 16  ? 1.6387 1.4403 1.6721 0.0715  -0.1612 0.0154  16  ILE A CD1 
78   N N   . ALA A 17  ? 1.7940 1.5607 1.7036 0.1047  -0.2047 0.0386  17  ALA A N   
79   C CA  . ALA A 17  ? 1.8427 1.6111 1.7305 0.1022  -0.2126 0.0395  17  ALA A CA  
80   C C   . ALA A 17  ? 1.8557 1.6179 1.7115 0.1185  -0.2074 0.0499  17  ALA A C   
81   O O   . ALA A 17  ? 1.8673 1.6440 1.7154 0.1127  -0.2021 0.0506  17  ALA A O   
82   C CB  . ALA A 17  ? 1.8778 1.6266 1.7523 0.1061  -0.2364 0.0373  17  ALA A CB  
83   N N   . VAL A 18  ? 1.8261 1.5672 1.6629 0.1402  -0.2086 0.0583  18  VAL A N   
84   C CA  . VAL A 18  ? 1.7821 1.5171 1.5890 0.1585  -0.2017 0.0701  18  VAL A CA  
85   C C   . VAL A 18  ? 1.6898 1.4531 1.5183 0.1476  -0.1779 0.0724  18  VAL A C   
86   O O   . VAL A 18  ? 1.6381 1.4146 1.4549 0.1482  -0.1728 0.0763  18  VAL A O   
87   C CB  . VAL A 18  ? 1.7961 1.5022 1.5795 0.1852  -0.2047 0.0794  18  VAL A CB  
88   C CG1 . VAL A 18  ? 1.8955 1.5976 1.6493 0.2048  -0.1940 0.0931  18  VAL A CG1 
89   C CG2 . VAL A 18  ? 1.7662 1.4427 1.5262 0.1977  -0.2314 0.0760  18  VAL A CG2 
90   N N   . LEU A 19  ? 1.6022 1.3743 1.4626 0.1380  -0.1642 0.0698  19  LEU A N   
91   C CA  . LEU A 19  ? 1.5203 1.3174 1.4055 0.1260  -0.1426 0.0708  19  LEU A CA  
92   C C   . LEU A 19  ? 1.6167 1.4420 1.5179 0.1045  -0.1412 0.0610  19  LEU A C   
93   O O   . LEU A 19  ? 1.6321 1.4768 1.5349 0.1015  -0.1316 0.0638  19  LEU A O   
94   C CB  . LEU A 19  ? 1.3295 1.1257 1.2447 0.1190  -0.1304 0.0682  19  LEU A CB  
95   C CG  . LEU A 19  ? 1.2197 0.9932 1.1232 0.1395  -0.1222 0.0805  19  LEU A CG  
96   C CD1 . LEU A 19  ? 1.1394 0.8820 1.0065 0.1638  -0.1405 0.0855  19  LEU A CD1 
97   C CD2 . LEU A 19  ? 1.1825 0.9545 1.1161 0.1304  -0.1108 0.0761  19  LEU A CD2 
98   N N   . ALA A 20  ? 1.6927 1.5207 1.6060 0.0907  -0.1507 0.0498  20  ALA A N   
99   C CA  . ALA A 20  ? 1.7444 1.5958 1.6695 0.0719  -0.1497 0.0402  20  ALA A CA  
100  C C   . ALA A 20  ? 1.6935 1.5495 1.5903 0.0787  -0.1549 0.0447  20  ALA A C   
101  O O   . ALA A 20  ? 1.6181 1.4976 1.5223 0.0691  -0.1474 0.0412  20  ALA A O   
102  C CB  . ALA A 20  ? 1.8195 1.6680 1.7549 0.0607  -0.1602 0.0307  20  ALA A CB  
103  N N   . ILE A 21  ? 1.7266 1.5591 1.5895 0.0965  -0.1686 0.0520  21  ILE A N   
104  C CA  . ILE A 21  ? 1.7803 1.6125 1.6110 0.1067  -0.1744 0.0573  21  ILE A CA  
105  C C   . ILE A 21  ? 1.8140 1.6583 1.6401 0.1179  -0.1606 0.0671  21  ILE A C   
106  O O   . ILE A 21  ? 1.8500 1.7196 1.6827 0.1109  -0.1529 0.0655  21  ILE A O   
107  C CB  . ILE A 21  ? 1.8056 1.6049 1.5988 0.1242  -0.1941 0.0621  21  ILE A CB  
108  C CG1 . ILE A 21  ? 1.7559 1.5461 1.5572 0.1111  -0.2082 0.0528  21  ILE A CG1 
109  C CG2 . ILE A 21  ? 1.8240 1.6203 1.5801 0.1378  -0.1990 0.0684  21  ILE A CG2 
110  C CD1 . ILE A 21  ? 1.7611 1.5179 1.5296 0.1257  -0.2300 0.0558  21  ILE A CD1 
111  N N   . LEU A 22  ? 1.7815 1.6084 1.5972 0.1358  -0.1571 0.0776  22  LEU A N   
112  C CA  . LEU A 22  ? 1.7117 1.5484 1.5233 0.1485  -0.1422 0.0897  22  LEU A CA  
113  C C   . LEU A 22  ? 1.6025 1.4747 1.4533 0.1293  -0.1245 0.0856  22  LEU A C   
114  O O   . LEU A 22  ? 1.5370 1.4307 1.3869 0.1318  -0.1171 0.0902  22  LEU A O   
115  C CB  . LEU A 22  ? 1.6708 1.4835 1.4737 0.1671  -0.1372 0.1005  22  LEU A CB  
116  C CG  . LEU A 22  ? 1.6174 1.3923 1.3787 0.1903  -0.1556 0.1051  22  LEU A CG  
117  C CD1 . LEU A 22  ? 1.5930 1.3458 1.3461 0.2097  -0.1483 0.1157  22  LEU A CD1 
118  C CD2 . LEU A 22  ? 1.6100 1.3784 1.3301 0.2077  -0.1645 0.1115  22  LEU A CD2 
119  N N   . GLY A 23  ? 1.5832 1.4613 1.4683 0.1108  -0.1188 0.0764  23  GLY A N   
120  C CA  . GLY A 23  ? 1.5342 1.4416 1.4573 0.0919  -0.1038 0.0708  23  GLY A CA  
121  C C   . GLY A 23  ? 1.5390 1.4737 1.4666 0.0792  -0.1070 0.0615  23  GLY A C   
122  O O   . GLY A 23  ? 1.5648 1.5226 1.4989 0.0797  -0.0992 0.0652  23  GLY A O   
123  N N   . ASN A 24  ? 1.5822 1.5148 1.5069 0.0686  -0.1182 0.0499  24  ASN A N   
124  C CA  . ASN A 24  ? 1.6264 1.5816 1.5521 0.0574  -0.1214 0.0403  24  ASN A CA  
125  C C   . ASN A 24  ? 1.6465 1.6060 1.5401 0.0722  -0.1275 0.0475  24  ASN A C   
126  O O   . ASN A 24  ? 1.6521 1.6369 1.5499 0.0673  -0.1255 0.0432  24  ASN A O   
127  C CB  . ASN A 24  ? 1.6556 1.6038 1.5814 0.0453  -0.1306 0.0287  24  ASN A CB  
128  C CG  . ASN A 24  ? 1.7203 1.6734 1.6809 0.0286  -0.1229 0.0187  24  ASN A CG  
129  O OD1 . ASN A 24  ? 1.6639 1.6376 1.6496 0.0172  -0.1132 0.0125  24  ASN A OD1 
130  N ND2 . ASN A 24  ? 1.8126 1.7468 1.7753 0.0274  -0.1280 0.0168  24  ASN A ND2 
131  N N   . VAL A 25  ? 1.6514 1.5850 1.5113 0.0916  -0.1360 0.0578  25  VAL A N   
132  C CA  . VAL A 25  ? 1.6658 1.5991 1.4909 0.1093  -0.1415 0.0659  25  VAL A CA  
133  C C   . VAL A 25  ? 1.6737 1.6306 1.5105 0.1168  -0.1271 0.0750  25  VAL A C   
134  O O   . VAL A 25  ? 1.6811 1.6584 1.5089 0.1218  -0.1268 0.0764  25  VAL A O   
135  C CB  . VAL A 25  ? 1.7237 1.6200 1.5087 0.1302  -0.1542 0.0748  25  VAL A CB  
136  C CG1 . VAL A 25  ? 1.6867 1.5818 1.4354 0.1525  -0.1566 0.0854  25  VAL A CG1 
137  C CG2 . VAL A 25  ? 1.8343 1.7104 1.6071 0.1224  -0.1702 0.0662  25  VAL A CG2 
138  N N   . LEU A 26  ? 1.6398 1.5942 1.4977 0.1178  -0.1148 0.0817  26  LEU A N   
139  C CA  . LEU A 26  ? 1.5122 1.4896 1.3887 0.1224  -0.0985 0.0916  26  LEU A CA  
140  C C   . LEU A 26  ? 1.5232 1.5394 1.4363 0.1016  -0.0923 0.0808  26  LEU A C   
141  O O   . LEU A 26  ? 1.6026 1.6463 1.5249 0.1054  -0.0849 0.0862  26  LEU A O   
142  C CB  . LEU A 26  ? 1.4206 1.3843 1.3147 0.1247  -0.0855 0.1000  26  LEU A CB  
143  C CG  . LEU A 26  ? 1.4375 1.4206 1.3515 0.1304  -0.0660 0.1135  26  LEU A CG  
144  C CD1 . LEU A 26  ? 1.5964 1.5785 1.4748 0.1572  -0.0660 0.1284  26  LEU A CD1 
145  C CD2 . LEU A 26  ? 1.3695 1.3338 1.2990 0.1316  -0.0531 0.1212  26  LEU A CD2 
146  N N   . VAL A 27  ? 1.5387 1.5573 1.4724 0.0805  -0.0960 0.0654  27  VAL A N   
147  C CA  . VAL A 27  ? 1.5982 1.6496 1.5637 0.0610  -0.0929 0.0526  27  VAL A CA  
148  C C   . VAL A 27  ? 1.6248 1.6941 1.5695 0.0654  -0.1025 0.0480  27  VAL A C   
149  O O   . VAL A 27  ? 1.5621 1.6636 1.5246 0.0618  -0.0985 0.0458  27  VAL A O   
150  C CB  . VAL A 27  ? 1.6233 1.6688 1.6091 0.0406  -0.0951 0.0370  27  VAL A CB  
151  C CG1 . VAL A 27  ? 1.6046 1.6808 1.6155 0.0231  -0.0950 0.0221  27  VAL A CG1 
152  C CG2 . VAL A 27  ? 1.6412 1.6715 1.6503 0.0359  -0.0847 0.0406  27  VAL A CG2 
153  N N   . CYS A 28  ? 1.7284 1.7761 1.6360 0.0732  -0.1156 0.0466  28  CYS A N   
154  C CA  . CYS A 28  ? 1.8022 1.8605 1.6838 0.0791  -0.1251 0.0429  28  CYS A CA  
155  C C   . CYS A 28  ? 1.7995 1.8709 1.6647 0.0992  -0.1225 0.0557  28  CYS A C   
156  O O   . CYS A 28  ? 1.7650 1.8625 1.6281 0.1013  -0.1245 0.0523  28  CYS A O   
157  C CB  . CYS A 28  ? 1.8748 1.9019 1.7195 0.0836  -0.1387 0.0409  28  CYS A CB  
158  S SG  . CYS A 28  ? 1.6258 1.6419 1.4891 0.0613  -0.1412 0.0263  28  CYS A SG  
159  N N   . TRP A 29  ? 1.8531 1.9062 1.7054 0.1156  -0.1179 0.0706  29  TRP A N   
160  C CA  . TRP A 29  ? 1.9298 1.9929 1.7648 0.1376  -0.1133 0.0850  29  TRP A CA  
161  C C   . TRP A 29  ? 1.9150 2.0198 1.7938 0.1300  -0.0985 0.0870  29  TRP A C   
162  O O   . TRP A 29  ? 1.9309 2.0632 1.8076 0.1394  -0.0970 0.0907  29  TRP A O   
163  C CB  . TRP A 29  ? 2.0123 2.0423 1.8219 0.1579  -0.1112 0.1003  29  TRP A CB  
164  C CG  . TRP A 29  ? 2.1383 2.1722 1.9205 0.1849  -0.1074 0.1160  29  TRP A CG  
165  C CD1 . TRP A 29  ? 2.2091 2.2744 1.9894 0.1923  -0.1055 0.1180  29  TRP A CD1 
166  C CD2 . TRP A 29  ? 2.2230 2.2279 1.9736 0.2103  -0.1051 0.1319  29  TRP A CD2 
167  N NE1 . TRP A 29  ? 2.2736 2.3324 2.0241 0.2206  -0.1010 0.1348  29  TRP A NE1 
168  C CE2 . TRP A 29  ? 2.2919 2.3125 2.0222 0.2325  -0.1006 0.1436  29  TRP A CE2 
169  C CE3 . TRP A 29  ? 2.2436 2.2107 1.9798 0.2179  -0.1069 0.1371  29  TRP A CE3 
170  C CZ2 . TRP A 29  ? 2.3372 2.3354 2.0315 0.2625  -0.0969 0.1607  29  TRP A CZ2 
171  C CZ3 . TRP A 29  ? 2.3165 2.2607 2.0165 0.2476  -0.1046 0.1533  29  TRP A CZ3 
172  C CH2 . TRP A 29  ? 2.3633 2.3223 2.0417 0.2698  -0.0992 0.1651  29  TRP A CH2 
173  N N   . ALA A 30  ? 1.8714 1.9807 1.7911 0.1128  -0.0879 0.0843  30  ALA A N   
174  C CA  . ALA A 30  ? 1.7987 1.9449 1.7658 0.1019  -0.0738 0.0858  30  ALA A CA  
175  C C   . ALA A 30  ? 1.6846 1.8673 1.6712 0.0883  -0.0802 0.0707  30  ALA A C   
176  O O   . ALA A 30  ? 1.6404 1.8598 1.6537 0.0877  -0.0735 0.0736  30  ALA A O   
177  C CB  . ALA A 30  ? 1.8378 1.9750 1.8414 0.0845  -0.0632 0.0837  30  ALA A CB  
178  N N   . VAL A 31  ? 1.6850 1.8580 1.6586 0.0781  -0.0933 0.0548  31  VAL A N   
179  C CA  . VAL A 31  ? 1.7081 1.9109 1.6929 0.0675  -0.1011 0.0392  31  VAL A CA  
180  C C   . VAL A 31  ? 1.7408 1.9564 1.6921 0.0872  -0.1088 0.0437  31  VAL A C   
181  O O   . VAL A 31  ? 1.7877 2.0401 1.7560 0.0858  -0.1103 0.0383  31  VAL A O   
182  C CB  . VAL A 31  ? 1.7897 1.9754 1.7664 0.0530  -0.1111 0.0222  31  VAL A CB  
183  C CG1 . VAL A 31  ? 1.7743 1.9867 1.7517 0.0474  -0.1204 0.0070  31  VAL A CG1 
184  C CG2 . VAL A 31  ? 1.8525 2.0295 1.8645 0.0334  -0.1037 0.0158  31  VAL A CG2 
185  N N   . TRP A 32  ? 1.7432 1.9276 1.6467 0.1062  -0.1146 0.0531  32  TRP A N   
186  C CA  . TRP A 32  ? 1.8016 1.9907 1.6660 0.1272  -0.1226 0.0578  32  TRP A CA  
187  C C   . TRP A 32  ? 1.8514 2.0655 1.7234 0.1445  -0.1125 0.0733  32  TRP A C   
188  O O   . TRP A 32  ? 1.9245 2.1541 1.7740 0.1616  -0.1170 0.0767  32  TRP A O   
189  C CB  . TRP A 32  ? 1.8335 1.9772 1.6443 0.1413  -0.1328 0.0628  32  TRP A CB  
190  C CG  . TRP A 32  ? 1.8374 1.9794 1.6031 0.1623  -0.1423 0.0662  32  TRP A CG  
191  C CD1 . TRP A 32  ? 1.7837 1.9410 1.5374 0.1609  -0.1510 0.0553  32  TRP A CD1 
192  C CD2 . TRP A 32  ? 1.8811 2.0020 1.6038 0.1895  -0.1445 0.0813  32  TRP A CD2 
193  N NE1 . TRP A 32  ? 1.8039 1.9513 1.5107 0.1851  -0.1580 0.0630  32  TRP A NE1 
194  C CE2 . TRP A 32  ? 1.9040 2.0286 1.5908 0.2029  -0.1545 0.0788  32  TRP A CE2 
195  C CE3 . TRP A 32  ? 1.9154 2.0127 1.6235 0.2055  -0.1393 0.0966  32  TRP A CE3 
196  C CZ2 . TRP A 32  ? 2.0172 2.1224 1.6549 0.2311  -0.1594 0.0909  32  TRP A CZ2 
197  C CZ3 . TRP A 32  ? 2.0056 2.0837 1.6643 0.2340  -0.1446 0.1082  32  TRP A CZ3 
198  C CH2 . TRP A 32  ? 2.0610 2.1429 1.6853 0.2462  -0.1546 0.1052  32  TRP A CH2 
199  N N   . LEU A 33  ? 1.8499 2.0675 1.7534 0.1411  -0.0978 0.0834  33  LEU A N   
200  C CA  . LEU A 33  ? 1.8863 2.1287 1.8023 0.1566  -0.0846 0.1001  33  LEU A CA  
201  C C   . LEU A 33  ? 1.8409 2.1343 1.8160 0.1396  -0.0765 0.0945  33  LEU A C   
202  O O   . LEU A 33  ? 1.8668 2.1965 1.8486 0.1494  -0.0761 0.0974  33  LEU A O   
203  C CB  . LEU A 33  ? 1.9550 2.1703 1.8685 0.1655  -0.0716 0.1167  33  LEU A CB  
204  C CG  . LEU A 33  ? 2.0895 2.3280 2.0197 0.1811  -0.0534 0.1365  33  LEU A CG  
205  C CD1 . LEU A 33  ? 2.1665 2.4222 2.0652 0.2069  -0.0572 0.1444  33  LEU A CD1 
206  C CD2 . LEU A 33  ? 2.1105 2.3129 2.0255 0.1939  -0.0423 0.1527  33  LEU A CD2 
207  N N   . ASN A 34  ? 1.7403 2.0360 1.7585 0.1143  -0.0710 0.0860  34  ASN A N   
208  C CA  . ASN A 34  ? 1.6057 1.9457 1.6832 0.0948  -0.0649 0.0788  34  ASN A CA  
209  C C   . ASN A 34  ? 1.5934 1.9513 1.6784 0.0794  -0.0810 0.0555  34  ASN A C   
210  O O   . ASN A 34  ? 1.6016 1.9367 1.6814 0.0648  -0.0886 0.0412  34  ASN A O   
211  C CB  . ASN A 34  ? 1.5369 1.8679 1.6562 0.0758  -0.0509 0.0812  34  ASN A CB  
212  C CG  . ASN A 34  ? 1.5052 1.8803 1.6886 0.0567  -0.0426 0.0775  34  ASN A CG  
213  O OD1 . ASN A 34  ? 1.5280 1.9420 1.7280 0.0541  -0.0506 0.0685  34  ASN A OD1 
214  N ND2 . ASN A 34  ? 1.4989 1.8677 1.7190 0.0435  -0.0271 0.0843  34  ASN A ND2 
215  N N   . SER A 35  ? 1.6223 2.0216 1.7187 0.0844  -0.0860 0.0518  35  SER A N   
216  C CA  . SER A 35  ? 1.6214 2.0392 1.7203 0.0741  -0.1023 0.0300  35  SER A CA  
217  C C   . SER A 35  ? 1.5189 1.9534 1.6720 0.0449  -0.1022 0.0137  35  SER A C   
218  O O   . SER A 35  ? 1.4542 1.8954 1.6079 0.0342  -0.1158 -0.0066 35  SER A O   
219  C CB  . SER A 35  ? 1.7203 2.1789 1.8157 0.0901  -0.1084 0.0309  35  SER A CB  
220  O OG  . SER A 35  ? 1.8079 2.3089 1.9555 0.0870  -0.0964 0.0401  35  SER A OG  
221  N N   . ASN A 36  ? 1.5107 1.9495 1.7069 0.0330  -0.0869 0.0227  36  ASN A N   
222  C CA  . ASN A 36  ? 1.5423 1.9920 1.7905 0.0050  -0.0860 0.0084  36  ASN A CA  
223  C C   . ASN A 36  ? 1.6201 2.0277 1.8523 -0.0077 -0.0898 -0.0032 36  ASN A C   
224  O O   . ASN A 36  ? 1.7139 2.1230 1.9804 -0.0298 -0.0910 -0.0174 36  ASN A O   
225  C CB  . ASN A 36  ? 1.5685 2.0334 1.8671 -0.0034 -0.0667 0.0235  36  ASN A CB  
226  C CG  . ASN A 36  ? 1.5836 2.0985 1.9111 0.0051  -0.0620 0.0333  36  ASN A CG  
227  O OD1 . ASN A 36  ? 1.5810 2.1320 1.9218 0.0028  -0.0756 0.0196  36  ASN A OD1 
228  N ND2 . ASN A 36  ? 1.5637 2.0816 1.9011 0.0162  -0.0426 0.0575  36  ASN A ND2 
229  N N   . LEU A 37  ? 1.5630 1.9331 1.7435 0.0068  -0.0920 0.0028  37  LEU A N   
230  C CA  . LEU A 37  ? 1.3944 1.7258 1.5579 -0.0026 -0.0952 -0.0064 37  LEU A CA  
231  C C   . LEU A 37  ? 1.3901 1.7102 1.5103 0.0036  -0.1109 -0.0190 37  LEU A C   
232  O O   . LEU A 37  ? 1.4552 1.7450 1.5573 -0.0021 -0.1142 -0.0263 37  LEU A O   
233  C CB  . LEU A 37  ? 1.2339 1.5279 1.3772 0.0071  -0.0844 0.0111  37  LEU A CB  
234  C CG  . LEU A 37  ? 1.0819 1.3766 1.2623 0.0015  -0.0666 0.0248  37  LEU A CG  
235  C CD1 . LEU A 37  ? 0.9339 1.1929 1.0830 0.0189  -0.0582 0.0436  37  LEU A CD1 
236  C CD2 . LEU A 37  ? 1.0152 1.3055 1.2350 -0.0238 -0.0637 0.0114  37  LEU A CD2 
237  N N   . GLN A 38  ? 1.3951 1.7398 1.4991 0.0160  -0.1197 -0.0208 38  GLN A N   
238  C CA  . GLN A 38  ? 1.4132 1.7462 1.4721 0.0247  -0.1333 -0.0304 38  GLN A CA  
239  C C   . GLN A 38  ? 1.4334 1.7842 1.5060 0.0113  -0.1443 -0.0534 38  GLN A C   
240  O O   . GLN A 38  ? 1.4305 1.7900 1.4752 0.0209  -0.1557 -0.0615 38  GLN A O   
241  C CB  . GLN A 38  ? 1.4060 1.7501 1.4310 0.0488  -0.1376 -0.0197 38  GLN A CB  
242  C CG  . GLN A 38  ? 1.4376 1.7577 1.4373 0.0660  -0.1292 0.0020  38  GLN A CG  
243  C CD  . GLN A 38  ? 1.5592 1.8860 1.5197 0.0915  -0.1344 0.0115  38  GLN A CD  
244  O OE1 . GLN A 38  ? 1.6725 2.0241 1.6263 0.0964  -0.1438 0.0024  38  GLN A OE1 
245  N NE2 . GLN A 38  ? 1.5704 1.8734 1.5025 0.1092  -0.1291 0.0295  38  GLN A NE2 
246  N N   . ASN A 39  ? 1.4407 1.7947 1.5537 -0.0096 -0.1412 -0.0641 39  ASN A N   
247  C CA  . ASN A 39  ? 1.5101 1.8756 1.6343 -0.0222 -0.1522 -0.0873 39  ASN A CA  
248  C C   . ASN A 39  ? 1.6320 1.9640 1.7161 -0.0212 -0.1573 -0.0962 39  ASN A C   
249  O O   . ASN A 39  ? 1.6839 1.9833 1.7442 -0.0169 -0.1510 -0.0854 39  ASN A O   
250  C CB  . ASN A 39  ? 1.4934 1.8691 1.6721 -0.0446 -0.1476 -0.0960 39  ASN A CB  
251  C CG  . ASN A 39  ? 1.4822 1.8261 1.6706 -0.0526 -0.1336 -0.0856 39  ASN A CG  
252  O OD1 . ASN A 39  ? 1.5595 1.8701 1.7136 -0.0457 -0.1310 -0.0796 39  ASN A OD1 
253  N ND2 . ASN A 39  ? 1.4337 1.7876 1.6698 -0.0672 -0.1248 -0.0835 39  ASN A ND2 
254  N N   . VAL A 40  ? 1.6770 2.0177 1.7541 -0.0244 -0.1687 -0.1156 40  VAL A N   
255  C CA  . VAL A 40  ? 1.7020 2.0138 1.7410 -0.0223 -0.1722 -0.1238 40  VAL A CA  
256  C C   . VAL A 40  ? 1.6191 1.8994 1.6663 -0.0342 -0.1624 -0.1220 40  VAL A C   
257  O O   . VAL A 40  ? 1.4489 1.7004 1.4644 -0.0297 -0.1601 -0.1182 40  VAL A O   
258  C CB  . VAL A 40  ? 1.7165 2.0425 1.7526 -0.0253 -0.1847 -0.1467 40  VAL A CB  
259  C CG1 . VAL A 40  ? 1.6806 1.9761 1.6747 -0.0210 -0.1857 -0.1528 40  VAL A CG1 
260  C CG2 . VAL A 40  ? 1.7398 2.0991 1.7687 -0.0124 -0.1959 -0.1498 40  VAL A CG2 
261  N N   . THR A 41  ? 1.6884 1.9745 1.7796 -0.0494 -0.1565 -0.1243 41  THR A N   
262  C CA  . THR A 41  ? 1.6648 1.9227 1.7670 -0.0603 -0.1473 -0.1234 41  THR A CA  
263  C C   . THR A 41  ? 1.5406 1.7723 1.6221 -0.0514 -0.1388 -0.1038 41  THR A C   
264  O O   . THR A 41  ? 1.5573 1.7617 1.6224 -0.0523 -0.1359 -0.1037 41  THR A O   
265  C CB  . THR A 41  ? 1.7687 2.0365 1.9216 -0.0766 -0.1414 -0.1262 41  THR A CB  
266  O OG1 . THR A 41  ? 1.8573 2.1488 2.0320 -0.0860 -0.1517 -0.1459 41  THR A OG1 
267  C CG2 . THR A 41  ? 1.7448 1.9816 1.9057 -0.0862 -0.1324 -0.1263 41  THR A CG2 
268  N N   . ASN A 42  ? 1.4792 1.7198 1.5619 -0.0419 -0.1351 -0.0874 42  ASN A N   
269  C CA  . ASN A 42  ? 1.5458 1.7610 1.6097 -0.0322 -0.1284 -0.0690 42  ASN A CA  
270  C C   . ASN A 42  ? 1.6082 1.8046 1.6239 -0.0183 -0.1347 -0.0644 42  ASN A C   
271  O O   . ASN A 42  ? 1.5943 1.7667 1.5913 -0.0100 -0.1319 -0.0509 42  ASN A O   
272  C CB  . ASN A 42  ? 1.6110 1.8395 1.6901 -0.0248 -0.1214 -0.0525 42  ASN A CB  
273  C CG  . ASN A 42  ? 1.6922 1.9266 1.8177 -0.0390 -0.1109 -0.0516 42  ASN A CG  
274  O OD1 . ASN A 42  ? 1.7047 1.9316 1.8503 -0.0544 -0.1099 -0.0641 42  ASN A OD1 
275  N ND2 . ASN A 42  ? 1.7486 1.9948 1.8900 -0.0331 -0.1021 -0.0362 42  ASN A ND2 
276  N N   . TYR A 43  ? 1.6780 1.8833 1.6728 -0.0154 -0.1436 -0.0756 43  TYR A N   
277  C CA  . TYR A 43  ? 1.7080 1.8926 1.6576 -0.0043 -0.1487 -0.0721 43  TYR A CA  
278  C C   . TYR A 43  ? 1.6444 1.7989 1.5895 -0.0118 -0.1445 -0.0728 43  TYR A C   
279  O O   . TYR A 43  ? 1.6284 1.7588 1.5468 -0.0046 -0.1453 -0.0630 43  TYR A O   
280  C CB  . TYR A 43  ? 1.7614 1.9604 1.6898 0.0002  -0.1577 -0.0849 43  TYR A CB  
281  C CG  . TYR A 43  ? 1.8109 2.0330 1.7266 0.0146  -0.1639 -0.0803 43  TYR A CG  
282  C CD1 . TYR A 43  ? 1.8547 2.0638 1.7255 0.0313  -0.1688 -0.0718 43  TYR A CD1 
283  C CD2 . TYR A 43  ? 1.8370 2.0941 1.7867 0.0115  -0.1649 -0.0844 43  TYR A CD2 
284  C CE1 . TYR A 43  ? 1.9064 2.1364 1.7636 0.0465  -0.1743 -0.0675 43  TYR A CE1 
285  C CE2 . TYR A 43  ? 1.8890 2.1706 1.8294 0.0258  -0.1702 -0.0799 43  TYR A CE2 
286  C CZ  . TYR A 43  ? 1.9374 2.2052 1.8301 0.0441  -0.1749 -0.0715 43  TYR A CZ  
287  O OH  . TYR A 43  ? 1.9949 2.2869 1.8764 0.0603  -0.1800 -0.0670 43  TYR A OH  
288  N N   . PHE A 44  ? 1.5437 1.6999 1.5164 -0.0261 -0.1405 -0.0846 44  PHE A N   
289  C CA  . PHE A 44  ? 1.4548 1.5865 1.4288 -0.0332 -0.1354 -0.0859 44  PHE A CA  
290  C C   . PHE A 44  ? 1.4683 1.5842 1.4571 -0.0336 -0.1290 -0.0727 44  PHE A C   
291  O O   . PHE A 44  ? 1.5671 1.6599 1.5456 -0.0325 -0.1275 -0.0668 44  PHE A O   
292  C CB  . PHE A 44  ? 1.4633 1.6011 1.4593 -0.0461 -0.1333 -0.1033 44  PHE A CB  
293  C CG  . PHE A 44  ? 1.5839 1.7344 1.5625 -0.0440 -0.1403 -0.1176 44  PHE A CG  
294  C CD1 . PHE A 44  ? 1.6627 1.8397 1.6564 -0.0462 -0.1464 -0.1284 44  PHE A CD1 
295  C CD2 . PHE A 44  ? 1.6778 1.8138 1.6251 -0.0393 -0.1408 -0.1200 44  PHE A CD2 
296  C CE1 . PHE A 44  ? 1.7289 1.9168 1.7041 -0.0423 -0.1545 -0.1425 44  PHE A CE1 
297  C CE2 . PHE A 44  ? 1.7370 1.8823 1.6640 -0.0351 -0.1466 -0.1326 44  PHE A CE2 
298  C CZ  . PHE A 44  ? 1.7544 1.9253 1.6940 -0.0357 -0.1543 -0.1445 44  PHE A CZ  
299  N N   . VAL A 45  ? 1.4231 1.5518 1.4367 -0.0348 -0.1252 -0.0678 45  VAL A N   
300  C CA  . VAL A 45  ? 1.3969 1.5101 1.4215 -0.0325 -0.1184 -0.0544 45  VAL A CA  
301  C C   . VAL A 45  ? 1.4468 1.5420 1.4380 -0.0171 -0.1227 -0.0397 45  VAL A C   
302  O O   . VAL A 45  ? 1.4362 1.5087 1.4247 -0.0139 -0.1207 -0.0311 45  VAL A O   
303  C CB  . VAL A 45  ? 1.3086 1.4400 1.3629 -0.0345 -0.1121 -0.0494 45  VAL A CB  
304  C CG1 . VAL A 45  ? 1.1533 1.2655 1.2132 -0.0290 -0.1042 -0.0341 45  VAL A CG1 
305  C CG2 . VAL A 45  ? 1.3353 1.4815 1.4247 -0.0513 -0.1093 -0.0647 45  VAL A CG2 
306  N N   . VAL A 46  ? 1.5149 1.6191 1.4795 -0.0068 -0.1296 -0.0375 46  VAL A N   
307  C CA  . VAL A 46  ? 1.5831 1.6677 1.5115 0.0083  -0.1355 -0.0250 46  VAL A CA  
308  C C   . VAL A 46  ? 1.6839 1.7435 1.5955 0.0050  -0.1393 -0.0274 46  VAL A C   
309  O O   . VAL A 46  ? 1.7465 1.7819 1.6432 0.0117  -0.1424 -0.0177 46  VAL A O   
310  C CB  . VAL A 46  ? 1.6042 1.7030 1.5056 0.0206  -0.1422 -0.0234 46  VAL A CB  
311  C CG1 . VAL A 46  ? 1.6304 1.7033 1.4906 0.0359  -0.1493 -0.0117 46  VAL A CG1 
312  C CG2 . VAL A 46  ? 1.5993 1.7259 1.5201 0.0249  -0.1381 -0.0194 46  VAL A CG2 
313  N N   . SER A 47  ? 1.7228 1.7885 1.6372 -0.0049 -0.1391 -0.0403 47  SER A N   
314  C CA  . SER A 47  ? 1.7594 1.8054 1.6636 -0.0097 -0.1400 -0.0425 47  SER A CA  
315  C C   . SER A 47  ? 1.6590 1.6909 1.5873 -0.0164 -0.1350 -0.0402 47  SER A C   
316  O O   . SER A 47  ? 1.5685 1.5798 1.4884 -0.0154 -0.1376 -0.0349 47  SER A O   
317  C CB  . SER A 47  ? 1.8254 1.8825 1.7294 -0.0176 -0.1382 -0.0568 47  SER A CB  
318  O OG  . SER A 47  ? 1.8403 1.8801 1.7380 -0.0223 -0.1363 -0.0576 47  SER A OG  
319  N N   . LEU A 48  ? 1.6578 1.7007 1.6170 -0.0231 -0.1281 -0.0445 48  LEU A N   
320  C CA  . LEU A 48  ? 1.6664 1.6961 1.6481 -0.0277 -0.1228 -0.0422 48  LEU A CA  
321  C C   . LEU A 48  ? 1.6738 1.6855 1.6443 -0.0158 -0.1263 -0.0273 48  LEU A C   
322  O O   . LEU A 48  ? 1.7498 1.7424 1.7214 -0.0150 -0.1279 -0.0235 48  LEU A O   
323  C CB  . LEU A 48  ? 1.6813 1.7245 1.6955 -0.0364 -0.1147 -0.0489 48  LEU A CB  
324  C CG  . LEU A 48  ? 1.7165 1.7450 1.7529 -0.0391 -0.1081 -0.0453 48  LEU A CG  
325  C CD1 . LEU A 48  ? 1.7219 1.7373 1.7613 -0.0442 -0.1076 -0.0508 48  LEU A CD1 
326  C CD2 . LEU A 48  ? 1.7248 1.7651 1.7915 -0.0479 -0.1000 -0.0511 48  LEU A CD2 
327  N N   . ALA A 49  ? 1.6230 1.6412 1.5823 -0.0055 -0.1278 -0.0191 49  ALA A N   
328  C CA  . ALA A 49  ? 1.6134 1.6136 1.5568 0.0090  -0.1312 -0.0048 49  ALA A CA  
329  C C   . ALA A 49  ? 1.6000 1.5777 1.5129 0.0161  -0.1425 -0.0005 49  ALA A C   
330  O O   . ALA A 49  ? 1.6709 1.6271 1.5824 0.0195  -0.1464 0.0043  49  ALA A O   
331  C CB  . ALA A 49  ? 1.6753 1.6895 1.6106 0.0201  -0.1294 0.0032  49  ALA A CB  
332  N N   . ALA A 50  ? 1.5478 1.5300 1.4368 0.0183  -0.1483 -0.0025 50  ALA A N   
333  C CA  . ALA A 50  ? 1.5625 1.5221 1.4218 0.0236  -0.1590 0.0015  50  ALA A CA  
334  C C   . ALA A 50  ? 1.6086 1.5550 1.4829 0.0128  -0.1597 -0.0024 50  ALA A C   
335  O O   . ALA A 50  ? 1.6111 1.5345 1.4749 0.0174  -0.1683 0.0035  50  ALA A O   
336  C CB  . ALA A 50  ? 1.5859 1.5535 1.4208 0.0248  -0.1623 -0.0021 50  ALA A CB  
337  N N   . ALA A 51  ? 1.6289 1.5903 1.5282 -0.0010 -0.1511 -0.0128 51  ALA A N   
338  C CA  . ALA A 51  ? 1.6251 1.5786 1.5423 -0.0109 -0.1494 -0.0167 51  ALA A CA  
339  C C   . ALA A 51  ? 1.6943 1.6351 1.6285 -0.0078 -0.1505 -0.0118 51  ALA A C   
340  O O   . ALA A 51  ? 1.8082 1.7329 1.7439 -0.0080 -0.1569 -0.0089 51  ALA A O   
341  C CB  . ALA A 51  ? 1.5615 1.5336 1.5002 -0.0233 -0.1390 -0.0289 51  ALA A CB  
342  N N   . ASP A 52  ? 1.6609 1.6087 1.6084 -0.0048 -0.1442 -0.0108 52  ASP A N   
343  C CA  . ASP A 52  ? 1.6621 1.5969 1.6235 0.0000  -0.1436 -0.0059 52  ASP A CA  
344  C C   . ASP A 52  ? 1.5195 1.4334 1.4554 0.0167  -0.1541 0.0060  52  ASP A C   
345  O O   . ASP A 52  ? 1.4537 1.3526 1.3945 0.0241  -0.1560 0.0109  52  ASP A O   
346  C CB  . ASP A 52  ? 1.8112 1.7584 1.7958 -0.0032 -0.1314 -0.0084 52  ASP A CB  
347  C CG  . ASP A 52  ? 1.8977 1.8578 1.9089 -0.0183 -0.1227 -0.0209 52  ASP A CG  
348  O OD1 . ASP A 52  ? 1.9331 1.8939 1.9443 -0.0251 -0.1247 -0.0269 52  ASP A OD1 
349  O OD2 . ASP A 52  ? 1.8904 1.8587 1.9219 -0.0231 -0.1134 -0.0245 52  ASP A OD2 
350  N N   . ILE A 53  ? 1.5078 1.4192 1.4141 0.0242  -0.1612 0.0103  53  ILE A N   
351  C CA  . ILE A 53  ? 1.5286 1.4170 1.4048 0.0414  -0.1729 0.0207  53  ILE A CA  
352  C C   . ILE A 53  ? 1.5226 1.3900 1.3895 0.0397  -0.1867 0.0203  53  ILE A C   
353  O O   . ILE A 53  ? 1.5476 1.3932 1.4078 0.0492  -0.1967 0.0251  53  ILE A O   
354  C CB  . ILE A 53  ? 1.5397 1.4325 1.3855 0.0521  -0.1752 0.0258  53  ILE A CB  
355  C CG1 . ILE A 53  ? 1.4423 1.3557 1.2994 0.0561  -0.1627 0.0287  53  ILE A CG1 
356  C CG2 . ILE A 53  ? 1.5911 1.4553 1.4005 0.0702  -0.1895 0.0352  53  ILE A CG2 
357  C CD1 . ILE A 53  ? 1.4078 1.3307 1.2392 0.0675  -0.1639 0.0338  53  ILE A CD1 
358  N N   . LEU A 54  ? 1.4879 1.3617 1.3548 0.0278  -0.1872 0.0146  54  LEU A N   
359  C CA  . LEU A 54  ? 1.4362 1.2931 1.3003 0.0227  -0.1982 0.0143  54  LEU A CA  
360  C C   . LEU A 54  ? 1.3131 1.1675 1.2091 0.0166  -0.1983 0.0115  54  LEU A C   
361  O O   . LEU A 54  ? 1.2421 1.0820 1.1413 0.0140  -0.2094 0.0122  54  LEU A O   
362  C CB  . LEU A 54  ? 1.4548 1.3217 1.3169 0.0102  -0.1940 0.0093  54  LEU A CB  
363  C CG  . LEU A 54  ? 1.4613 1.3287 1.2888 0.0172  -0.1956 0.0118  54  LEU A CG  
364  C CD1 . LEU A 54  ? 1.4360 1.3122 1.2613 0.0057  -0.1900 0.0066  54  LEU A CD1 
365  C CD2 . LEU A 54  ? 1.4721 1.3110 1.2645 0.0313  -0.2116 0.0202  54  LEU A CD2 
366  N N   . VAL A 55  ? 1.2988 1.1673 1.2191 0.0144  -0.1865 0.0082  55  VAL A N   
367  C CA  . VAL A 55  ? 1.3792 1.2452 1.3279 0.0114  -0.1858 0.0057  55  VAL A CA  
368  C C   . VAL A 55  ? 1.4974 1.3388 1.4331 0.0269  -0.2000 0.0125  55  VAL A C   
369  O O   . VAL A 55  ? 1.6482 1.4774 1.5904 0.0262  -0.2121 0.0121  55  VAL A O   
370  C CB  . VAL A 55  ? 1.4208 1.3029 1.3938 0.0075  -0.1701 0.0012  55  VAL A CB  
371  C CG1 . VAL A 55  ? 1.4729 1.3486 1.4702 0.0084  -0.1703 -0.0003 55  VAL A CG1 
372  C CG2 . VAL A 55  ? 1.3719 1.2764 1.3580 -0.0071 -0.1580 -0.0076 55  VAL A CG2 
373  N N   . GLY A 56  ? 1.4687 1.3030 1.3861 0.0417  -0.1985 0.0189  56  GLY A N   
374  C CA  . GLY A 56  ? 1.4830 1.2914 1.3805 0.0602  -0.2116 0.0260  56  GLY A CA  
375  C C   . GLY A 56  ? 1.5060 1.2938 1.3708 0.0677  -0.2297 0.0296  56  GLY A C   
376  O O   . GLY A 56  ? 1.4775 1.2399 1.3221 0.0836  -0.2446 0.0341  56  GLY A O   
377  N N   . VAL A 57  ? 1.5471 1.3432 1.4041 0.0575  -0.2292 0.0274  57  VAL A N   
378  C CA  . VAL A 57  ? 1.5890 1.3632 1.4135 0.0636  -0.2459 0.0307  57  VAL A CA  
379  C C   . VAL A 57  ? 1.6463 1.4132 1.4863 0.0499  -0.2570 0.0263  57  VAL A C   
380  O O   . VAL A 57  ? 1.7350 1.4759 1.5592 0.0567  -0.2762 0.0283  57  VAL A O   
381  C CB  . VAL A 57  ? 1.5240 1.3064 1.3234 0.0641  -0.2402 0.0326  57  VAL A CB  
382  C CG1 . VAL A 57  ? 1.5341 1.2913 1.3008 0.0682  -0.2572 0.0353  57  VAL A CG1 
383  C CG2 . VAL A 57  ? 1.4775 1.2652 1.2596 0.0802  -0.2322 0.0388  57  VAL A CG2 
384  N N   . LEU A 58  ? 1.5401 1.3296 1.4114 0.0310  -0.2450 0.0205  58  LEU A N   
385  C CA  . LEU A 58  ? 1.4061 1.1931 1.2961 0.0165  -0.2518 0.0177  58  LEU A CA  
386  C C   . LEU A 58  ? 1.3727 1.1785 1.3075 0.0052  -0.2432 0.0122  58  LEU A C   
387  O O   . LEU A 58  ? 1.4758 1.2748 1.4305 0.0021  -0.2544 0.0112  58  LEU A O   
388  C CB  . LEU A 58  ? 1.3206 1.1148 1.2004 0.0052  -0.2449 0.0173  58  LEU A CB  
389  C CG  . LEU A 58  ? 1.3266 1.1000 1.1606 0.0161  -0.2547 0.0227  58  LEU A CG  
390  C CD1 . LEU A 58  ? 1.3252 1.1057 1.1492 0.0056  -0.2464 0.0222  58  LEU A CD1 
391  C CD2 . LEU A 58  ? 1.3426 1.0835 1.1614 0.0231  -0.2777 0.0260  58  LEU A CD2 
392  N N   . ALA A 59  ? 1.3407 1.1702 1.2914 -0.0004 -0.2241 0.0082  59  ALA A N   
393  C CA  . ALA A 59  ? 1.4079 1.2557 1.3983 -0.0105 -0.2137 0.0026  59  ALA A CA  
394  C C   . ALA A 59  ? 1.4858 1.3241 1.4924 -0.0022 -0.2234 0.0027  59  ALA A C   
395  O O   . ALA A 59  ? 1.5941 1.4362 1.6285 -0.0090 -0.2281 0.0004  59  ALA A O   
396  C CB  . ALA A 59  ? 1.4367 1.3053 1.4352 -0.0140 -0.1943 -0.0021 59  ALA A CB  
397  N N   . ILE A 60  ? 1.4664 1.2929 1.4560 0.0135  -0.2261 0.0059  60  ILE A N   
398  C CA  . ILE A 60  ? 1.5212 1.3355 1.5202 0.0249  -0.2357 0.0064  60  ILE A CA  
399  C C   . ILE A 60  ? 1.6153 1.4102 1.6099 0.0285  -0.2593 0.0076  60  ILE A C   
400  O O   . ILE A 60  ? 1.7007 1.4981 1.7232 0.0259  -0.2665 0.0042  60  ILE A O   
401  C CB  . ILE A 60  ? 1.5437 1.3458 1.5202 0.0431  -0.2330 0.0115  60  ILE A CB  
402  C CG1 . ILE A 60  ? 1.5860 1.4076 1.5774 0.0376  -0.2105 0.0092  60  ILE A CG1 
403  C CG2 . ILE A 60  ? 1.4866 1.2701 1.4644 0.0583  -0.2461 0.0128  60  ILE A CG2 
404  C CD1 . ILE A 60  ? 1.6215 1.4330 1.5965 0.0536  -0.2045 0.0154  60  ILE A CD1 
405  N N   . PRO A 61  ? 1.5498 1.3249 1.5099 0.0348  -0.2722 0.0120  61  PRO A N   
406  C CA  . PRO A 61  ? 1.5497 1.3038 1.5049 0.0363  -0.2964 0.0122  61  PRO A CA  
407  C C   . PRO A 61  ? 1.4771 1.2469 1.4721 0.0161  -0.2971 0.0079  61  PRO A C   
408  O O   . PRO A 61  ? 1.4348 1.1990 1.4504 0.0161  -0.3130 0.0055  61  PRO A O   
409  C CB  . PRO A 61  ? 1.5170 1.2534 1.4307 0.0404  -0.3030 0.0168  61  PRO A CB  
410  C CG  . PRO A 61  ? 1.4401 1.1811 1.3303 0.0518  -0.2883 0.0206  61  PRO A CG  
411  C CD  . PRO A 61  ? 1.4296 1.1998 1.3532 0.0420  -0.2664 0.0168  61  PRO A CD  
412  N N   . PHE A 62  ? 1.4408 1.2308 1.4468 -0.0001 -0.2798 0.0073  62  PHE A N   
413  C CA  . PHE A 62  ? 1.4705 1.2775 1.5141 -0.0188 -0.2761 0.0050  62  PHE A CA  
414  C C   . PHE A 62  ? 1.6443 1.4705 1.7294 -0.0206 -0.2702 0.0004  62  PHE A C   
415  O O   . PHE A 62  ? 1.7346 1.5670 1.8523 -0.0284 -0.2786 -0.0011 62  PHE A O   
416  C CB  . PHE A 62  ? 1.3610 1.1848 1.4030 -0.0324 -0.2561 0.0055  62  PHE A CB  
417  C CG  . PHE A 62  ? 1.4230 1.2288 1.4288 -0.0332 -0.2622 0.0100  62  PHE A CG  
418  C CD1 . PHE A 62  ? 1.5220 1.3057 1.5216 -0.0357 -0.2820 0.0130  62  PHE A CD1 
419  C CD2 . PHE A 62  ? 1.4529 1.2637 1.4315 -0.0314 -0.2488 0.0109  62  PHE A CD2 
420  C CE1 . PHE A 62  ? 1.5441 1.3082 1.5080 -0.0357 -0.2874 0.0173  62  PHE A CE1 
421  C CE2 . PHE A 62  ? 1.4826 1.2766 1.4262 -0.0304 -0.2542 0.0151  62  PHE A CE2 
422  C CZ  . PHE A 62  ? 1.5058 1.2752 1.4407 -0.0323 -0.2730 0.0186  62  PHE A CZ  
423  N N   . ALA A 63  ? 1.7053 1.5411 1.7901 -0.0134 -0.2558 -0.0017 63  ALA A N   
424  C CA  . ALA A 63  ? 1.7927 1.6447 1.9128 -0.0132 -0.2486 -0.0061 63  ALA A CA  
425  C C   . ALA A 63  ? 1.8934 1.7314 2.0221 -0.0013 -0.2698 -0.0068 63  ALA A C   
426  O O   . ALA A 63  ? 1.8963 1.7480 2.0615 -0.0047 -0.2715 -0.0103 63  ALA A O   
427  C CB  . ALA A 63  ? 1.7830 1.6423 1.8965 -0.0072 -0.2302 -0.0079 63  ALA A CB  
428  N N   . ILE A 64  ? 1.9970 1.8078 2.0910 0.0141  -0.2864 -0.0036 64  ILE A N   
429  C CA  . ILE A 64  ? 2.0948 1.8880 2.1895 0.0288  -0.3088 -0.0048 64  ILE A CA  
430  C C   . ILE A 64  ? 2.0963 1.8868 2.2111 0.0192  -0.3299 -0.0067 64  ILE A C   
431  O O   . ILE A 64  ? 2.1244 1.9132 2.2608 0.0246  -0.3465 -0.0103 64  ILE A O   
432  C CB  . ILE A 64  ? 2.2241 1.9863 2.2707 0.0506  -0.3199 -0.0005 64  ILE A CB  
433  C CG1 . ILE A 64  ? 2.3442 2.1107 2.3742 0.0582  -0.2977 0.0027  64  ILE A CG1 
434  C CG2 . ILE A 64  ? 2.2110 1.9534 2.2553 0.0686  -0.3432 -0.0025 64  ILE A CG2 
435  C CD1 . ILE A 64  ? 2.4189 2.1585 2.4020 0.0791  -0.3037 0.0091  64  ILE A CD1 
436  N N   . THR A 65  ? 2.0818 1.8717 2.1900 0.0048  -0.3292 -0.0041 65  THR A N   
437  C CA  . THR A 65  ? 2.1226 1.9084 2.2502 -0.0073 -0.3475 -0.0047 65  THR A CA  
438  C C   . THR A 65  ? 2.1163 1.9351 2.2994 -0.0257 -0.3363 -0.0068 65  THR A C   
439  O O   . THR A 65  ? 2.1275 1.9512 2.3446 -0.0297 -0.3525 -0.0095 65  THR A O   
440  C CB  . THR A 65  ? 2.1669 1.9373 2.2650 -0.0158 -0.3490 -0.0001 65  THR A CB  
441  O OG1 . THR A 65  ? 2.2404 1.9808 2.2861 0.0031  -0.3592 0.0024  65  THR A OG1 
442  C CG2 . THR A 65  ? 2.1933 1.9564 2.3125 -0.0297 -0.3681 -0.0001 65  THR A CG2 
443  N N   . ILE A 66  ? 2.1193 1.9612 2.3115 -0.0358 -0.3089 -0.0057 66  ILE A N   
444  C CA  . ILE A 66  ? 2.1399 2.0134 2.3804 -0.0518 -0.2943 -0.0065 66  ILE A CA  
445  C C   . ILE A 66  ? 2.1325 2.0234 2.4073 -0.0443 -0.2936 -0.0115 66  ILE A C   
446  O O   . ILE A 66  ? 2.1554 2.0715 2.4757 -0.0545 -0.2885 -0.0124 66  ILE A O   
447  C CB  . ILE A 66  ? 2.1758 2.0664 2.4105 -0.0615 -0.2652 -0.0048 66  ILE A CB  
448  C CG1 . ILE A 66  ? 2.2257 2.1456 2.5061 -0.0778 -0.2505 -0.0039 66  ILE A CG1 
449  C CG2 . ILE A 66  ? 2.1621 2.0569 2.3812 -0.0497 -0.2501 -0.0081 66  ILE A CG2 
450  C CD1 . ILE A 66  ? 2.2430 2.1779 2.5156 -0.0855 -0.2229 -0.0027 66  ILE A CD1 
451  N N   . SER A 67  ? 2.1060 1.9832 2.3586 -0.0254 -0.2980 -0.0139 67  SER A N   
452  C CA  . SER A 67  ? 2.0865 1.9755 2.3650 -0.0152 -0.2976 -0.0184 67  SER A CA  
453  C C   . SER A 67  ? 2.0818 1.9741 2.3941 -0.0149 -0.3217 -0.0211 67  SER A C   
454  O O   . SER A 67  ? 2.1124 2.0286 2.4660 -0.0161 -0.3180 -0.0243 67  SER A O   
455  C CB  . SER A 67  ? 2.1180 1.9857 2.3609 0.0061  -0.2989 -0.0189 67  SER A CB  
456  O OG  . SER A 67  ? 2.1705 2.0083 2.3841 0.0194  -0.3244 -0.0177 67  SER A OG  
457  N N   . THR A 68  ? 2.0404 1.9086 2.3352 -0.0126 -0.3473 -0.0204 68  THR A N   
458  C CA  . THR A 68  ? 1.9679 1.8365 2.2937 -0.0130 -0.3744 -0.0240 68  THR A CA  
459  C C   . THR A 68  ? 1.9006 1.7876 2.2650 -0.0378 -0.3740 -0.0214 68  THR A C   
460  O O   . THR A 68  ? 1.9476 1.8485 2.3558 -0.0440 -0.3898 -0.0242 68  THR A O   
461  C CB  . THR A 68  ? 1.9428 1.7727 2.2298 0.0029  -0.4053 -0.0255 68  THR A CB  
462  O OG1 . THR A 68  ? 1.9553 1.7643 2.2081 -0.0048 -0.4072 -0.0209 68  THR A OG1 
463  C CG2 . THR A 68  ? 1.9102 1.7208 2.1586 0.0290  -0.4043 -0.0264 68  THR A CG2 
464  N N   . GLY A 69  ? 1.7701 1.6575 2.1186 -0.0515 -0.3557 -0.0158 69  GLY A N   
465  C CA  . GLY A 69  ? 1.6610 1.5631 2.0409 -0.0747 -0.3509 -0.0114 69  GLY A CA  
466  C C   . GLY A 69  ? 1.6382 1.5124 2.0056 -0.0808 -0.3779 -0.0101 69  GLY A C   
467  O O   . GLY A 69  ? 1.6345 1.4869 1.9917 -0.0683 -0.4069 -0.0149 69  GLY A O   
468  N N   . PHE A 70  ? 1.6594 1.5318 2.0252 -0.0988 -0.3686 -0.0036 70  PHE A N   
469  C CA  . PHE A 70  ? 1.7653 1.6089 2.1190 -0.1068 -0.3923 -0.0018 70  PHE A CA  
470  C C   . PHE A 70  ? 1.7357 1.5942 2.1241 -0.1327 -0.3801 0.0055  70  PHE A C   
471  O O   . PHE A 70  ? 1.7374 1.6310 2.1635 -0.1430 -0.3550 0.0088  70  PHE A O   
472  C CB  . PHE A 70  ? 1.9062 1.7120 2.1909 -0.0946 -0.3967 -0.0002 70  PHE A CB  
473  C CG  . PHE A 70  ? 1.9316 1.7444 2.1902 -0.0987 -0.3660 0.0054  70  PHE A CG  
474  C CD1 . PHE A 70  ? 1.9152 1.7401 2.1562 -0.0861 -0.3462 0.0037  70  PHE A CD1 
475  C CD2 . PHE A 70  ? 1.9455 1.7513 2.1966 -0.1148 -0.3575 0.0122  70  PHE A CD2 
476  C CE1 . PHE A 70  ? 1.9174 1.7491 2.1355 -0.0896 -0.3205 0.0075  70  PHE A CE1 
477  C CE2 . PHE A 70  ? 1.9303 1.7421 2.1555 -0.1167 -0.3308 0.0166  70  PHE A CE2 
478  C CZ  . PHE A 70  ? 1.9274 1.7530 2.1367 -0.1041 -0.3132 0.0136  70  PHE A CZ  
479  N N   . CYS A 71  ? 1.7367 1.5666 2.1106 -0.1423 -0.3972 0.0086  71  CYS A N   
480  C CA  . CYS A 71  ? 1.7870 1.6256 2.1923 -0.1674 -0.3869 0.0168  71  CYS A CA  
481  C C   . CYS A 71  ? 1.7988 1.6074 2.1525 -0.1713 -0.3787 0.0236  71  CYS A C   
482  O O   . CYS A 71  ? 1.8017 1.5709 2.1106 -0.1626 -0.4010 0.0216  71  CYS A O   
483  C CB  . CYS A 71  ? 1.8595 1.6938 2.3094 -0.1802 -0.4164 0.0148  71  CYS A CB  
484  S SG  . CYS A 71  ? 2.9004 2.7736 3.4176 -0.1764 -0.4278 0.0068  71  CYS A SG  
485  N N   . ALA A 72  ? 1.8500 1.6767 2.2082 -0.1825 -0.3469 0.0316  72  ALA A N   
486  C CA  . ALA A 72  ? 1.9327 1.7339 2.2432 -0.1857 -0.3363 0.0385  72  ALA A CA  
487  C C   . ALA A 72  ? 1.9254 1.7510 2.2569 -0.2013 -0.3023 0.0479  72  ALA A C   
488  O O   . ALA A 72  ? 1.9295 1.7932 2.3063 -0.2062 -0.2841 0.0485  72  ALA A O   
489  C CB  . ALA A 72  ? 1.9699 1.7545 2.2176 -0.1639 -0.3336 0.0345  72  ALA A CB  
490  N N   . ALA A 73  ? 1.9244 1.7268 2.2202 -0.2072 -0.2934 0.0555  73  ALA A N   
491  C CA  . ALA A 73  ? 1.9366 1.7565 2.2431 -0.2195 -0.2607 0.0654  73  ALA A CA  
492  C C   . ALA A 73  ? 2.0108 1.8607 2.3104 -0.2080 -0.2337 0.0622  73  ALA A C   
493  O O   . ALA A 73  ? 1.9829 1.8369 2.2665 -0.1916 -0.2402 0.0530  73  ALA A O   
494  C CB  . ALA A 73  ? 1.9425 1.7266 2.1997 -0.2227 -0.2576 0.0729  73  ALA A CB  
495  N N   . CYS A 74  ? 2.1343 2.0033 2.4450 -0.2161 -0.2032 0.0699  74  CYS A N   
496  C CA  . CYS A 74  ? 2.2393 2.1362 2.5456 -0.2060 -0.1776 0.0663  74  CYS A CA  
497  C C   . CYS A 74  ? 2.4006 2.2798 2.6423 -0.1897 -0.1747 0.0613  74  CYS A C   
498  O O   . CYS A 74  ? 2.4779 2.3705 2.7100 -0.1764 -0.1708 0.0528  74  CYS A O   
499  C CB  . CYS A 74  ? 2.2423 2.1623 2.5752 -0.2173 -0.1460 0.0763  74  CYS A CB  
500  S SG  . CYS A 74  ? 4.3695 4.3299 4.7180 -0.2066 -0.1176 0.0708  74  CYS A SG  
501  N N   . HIS A 75  ? 2.4379 2.2871 2.6368 -0.1908 -0.1768 0.0669  75  HIS A N   
502  C CA  . HIS A 75  ? 2.3966 2.2297 2.5349 -0.1754 -0.1752 0.0628  75  HIS A CA  
503  C C   . HIS A 75  ? 2.2936 2.1166 2.4123 -0.1605 -0.1982 0.0532  75  HIS A C   
504  O O   . HIS A 75  ? 2.2852 2.1171 2.3812 -0.1470 -0.1920 0.0465  75  HIS A O   
505  C CB  . HIS A 75  ? 2.4778 2.2776 2.5744 -0.1786 -0.1764 0.0709  75  HIS A CB  
506  C CG  . HIS A 75  ? 2.5413 2.3483 2.6394 -0.1874 -0.1485 0.0804  75  HIS A CG  
507  N ND1 . HIS A 75  ? 2.5676 2.3776 2.7059 -0.2058 -0.1406 0.0910  75  HIS A ND1 
508  C CD2 . HIS A 75  ? 2.5479 2.3590 2.6118 -0.1794 -0.1265 0.0813  75  HIS A CD2 
509  C CE1 . HIS A 75  ? 2.5811 2.3959 2.7078 -0.2080 -0.1133 0.0990  75  HIS A CE1 
510  N NE2 . HIS A 75  ? 2.5778 2.3926 2.6579 -0.1915 -0.1050 0.0927  75  HIS A NE2 
511  N N   . GLY A 76  ? 2.2287 2.0322 2.3564 -0.1627 -0.2247 0.0528  76  GLY A N   
512  C CA  . GLY A 76  ? 2.2063 1.9967 2.3137 -0.1471 -0.2471 0.0451  76  GLY A CA  
513  C C   . GLY A 76  ? 2.2066 2.0250 2.3467 -0.1407 -0.2453 0.0376  76  GLY A C   
514  O O   . GLY A 76  ? 2.2109 2.0268 2.3280 -0.1249 -0.2507 0.0316  76  GLY A O   
515  N N   . CYS A 77  ? 2.2182 2.0631 2.4123 -0.1525 -0.2367 0.0387  77  CYS A N   
516  C CA  . CYS A 77  ? 2.1899 2.0613 2.4176 -0.1465 -0.2344 0.0319  77  CYS A CA  
517  C C   . CYS A 77  ? 2.1244 2.0176 2.3423 -0.1397 -0.2085 0.0284  77  CYS A C   
518  O O   . CYS A 77  ? 2.1026 2.0068 2.3246 -0.1287 -0.2081 0.0215  77  CYS A O   
519  C CB  . CYS A 77  ? 2.1911 2.0851 2.4814 -0.1605 -0.2344 0.0343  77  CYS A CB  
520  S SG  . CYS A 77  ? 2.5618 2.4855 2.8943 -0.1514 -0.2358 0.0259  77  CYS A SG  
521  N N   . LEU A 78  ? 2.0823 1.9796 2.2860 -0.1457 -0.1873 0.0332  78  LEU A N   
522  C CA  . LEU A 78  ? 2.0317 1.9471 2.2226 -0.1392 -0.1641 0.0291  78  LEU A CA  
523  C C   . LEU A 78  ? 2.0236 1.9242 2.1655 -0.1250 -0.1692 0.0237  78  LEU A C   
524  O O   . LEU A 78  ? 2.0219 1.9351 2.1617 -0.1161 -0.1625 0.0165  78  LEU A O   
525  C CB  . LEU A 78  ? 2.0070 1.9297 2.1949 -0.1481 -0.1406 0.0358  78  LEU A CB  
526  C CG  . LEU A 78  ? 2.0362 1.9845 2.2750 -0.1596 -0.1244 0.0409  78  LEU A CG  
527  C CD1 . LEU A 78  ? 2.0820 2.0318 2.3080 -0.1657 -0.1006 0.0490  78  LEU A CD1 
528  C CD2 . LEU A 78  ? 2.0225 1.9983 2.2885 -0.1527 -0.1147 0.0330  78  LEU A CD2 
529  N N   . PHE A 79  ? 1.9656 1.8395 2.0693 -0.1230 -0.1808 0.0275  79  PHE A N   
530  C CA  . PHE A 79  ? 1.9065 1.7673 1.9646 -0.1089 -0.1863 0.0238  79  PHE A CA  
531  C C   . PHE A 79  ? 1.8448 1.7063 1.9082 -0.0975 -0.1990 0.0177  79  PHE A C   
532  O O   . PHE A 79  ? 1.9163 1.7855 1.9646 -0.0878 -0.1924 0.0126  79  PHE A O   
533  C CB  . PHE A 79  ? 1.9824 1.8116 2.0008 -0.1070 -0.2004 0.0294  79  PHE A CB  
534  C CG  . PHE A 79  ? 2.0630 1.8793 2.0371 -0.0908 -0.2084 0.0265  79  PHE A CG  
535  C CD1 . PHE A 79  ? 2.0178 1.8402 1.9612 -0.0850 -0.1949 0.0248  79  PHE A CD1 
536  C CD2 . PHE A 79  ? 2.0916 1.8904 2.0550 -0.0802 -0.2295 0.0254  79  PHE A CD2 
537  C CE1 . PHE A 79  ? 1.9685 1.7827 1.8755 -0.0703 -0.2017 0.0227  79  PHE A CE1 
538  C CE2 . PHE A 79  ? 2.0541 1.8428 1.9782 -0.0644 -0.2348 0.0242  79  PHE A CE2 
539  C CZ  . PHE A 79  ? 1.9924 1.7903 1.8904 -0.0601 -0.2206 0.0230  79  PHE A CZ  
540  N N   . ILE A 80  ? 1.7023 1.5550 1.7871 -0.0984 -0.2174 0.0186  80  ILE A N   
541  C CA  . ILE A 80  ? 1.6366 1.4861 1.7241 -0.0858 -0.2305 0.0138  80  ILE A CA  
542  C C   . ILE A 80  ? 1.7546 1.6313 1.8716 -0.0844 -0.2152 0.0081  80  ILE A C   
543  O O   . ILE A 80  ? 1.7860 1.6624 1.8938 -0.0723 -0.2165 0.0040  80  ILE A O   
544  C CB  . ILE A 80  ? 1.4272 1.2611 1.5321 -0.0864 -0.2552 0.0150  80  ILE A CB  
545  C CG1 . ILE A 80  ? 1.3385 1.1384 1.4050 -0.0835 -0.2739 0.0193  80  ILE A CG1 
546  C CG2 . ILE A 80  ? 1.3496 1.1836 1.4620 -0.0725 -0.2657 0.0099  80  ILE A CG2 
547  C CD1 . ILE A 80  ? 1.3190 1.0985 1.3962 -0.0819 -0.3018 0.0188  80  ILE A CD1 
548  N N   . ALA A 81  ? 1.8298 1.7288 1.9812 -0.0960 -0.1998 0.0083  81  ALA A N   
549  C CA  . ALA A 81  ? 1.8763 1.7997 2.0564 -0.0944 -0.1853 0.0027  81  ALA A CA  
550  C C   . ALA A 81  ? 1.8636 1.7983 2.0254 -0.0926 -0.1641 -0.0013 81  ALA A C   
551  O O   . ALA A 81  ? 1.8702 1.8168 2.0411 -0.0871 -0.1552 -0.0075 81  ALA A O   
552  C CB  . ALA A 81  ? 1.9181 1.8613 2.1459 -0.1056 -0.1792 0.0048  81  ALA A CB  
553  N N   . CYS A 82  ? 1.8717 1.8011 2.0066 -0.0967 -0.1570 0.0018  82  CYS A N   
554  C CA  . CYS A 82  ? 1.9579 1.8984 2.0754 -0.0951 -0.1383 -0.0028 82  CYS A CA  
555  C C   . CYS A 82  ? 2.0089 1.9369 2.0845 -0.0860 -0.1437 -0.0049 82  CYS A C   
556  O O   . CYS A 82  ? 1.9871 1.9234 2.0460 -0.0838 -0.1315 -0.0098 82  CYS A O   
557  C CB  . CYS A 82  ? 1.9926 1.9389 2.1093 -0.1043 -0.1234 0.0018  82  CYS A CB  
558  S SG  . CYS A 82  ? 2.3032 2.2691 2.4723 -0.1152 -0.1127 0.0060  82  CYS A SG  
559  N N   . PHE A 83  ? 2.0276 1.9363 2.0867 -0.0797 -0.1623 -0.0015 83  PHE A N   
560  C CA  . PHE A 83  ? 1.9850 1.8831 2.0060 -0.0695 -0.1675 -0.0021 83  PHE A CA  
561  C C   . PHE A 83  ? 1.8952 1.8056 1.9207 -0.0627 -0.1605 -0.0090 83  PHE A C   
562  O O   . PHE A 83  ? 1.8803 1.7933 1.8825 -0.0576 -0.1565 -0.0116 83  PHE A O   
563  C CB  . PHE A 83  ? 2.0026 1.8757 2.0046 -0.0620 -0.1889 0.0034  83  PHE A CB  
564  C CG  . PHE A 83  ? 2.0093 1.8721 1.9720 -0.0497 -0.1937 0.0043  83  PHE A CG  
565  C CD1 . PHE A 83  ? 1.9817 1.8364 1.9108 -0.0487 -0.1932 0.0071  83  PHE A CD1 
566  C CD2 . PHE A 83  ? 1.9525 1.8141 1.9119 -0.0382 -0.1979 0.0029  83  PHE A CD2 
567  C CE1 . PHE A 83  ? 1.8900 1.7382 1.7847 -0.0362 -0.1974 0.0081  83  PHE A CE1 
568  C CE2 . PHE A 83  ? 1.8697 1.7247 1.7960 -0.0265 -0.2008 0.0049  83  PHE A CE2 
569  C CZ  . PHE A 83  ? 1.8487 1.6983 1.7434 -0.0254 -0.2010 0.0072  83  PHE A CZ  
570  N N   . VAL A 84  ? 1.8053 1.7230 1.8619 -0.0628 -0.1592 -0.0119 84  VAL A N   
571  C CA  . VAL A 84  ? 1.7323 1.6588 1.7961 -0.0574 -0.1520 -0.0180 84  VAL A CA  
572  C C   . VAL A 84  ? 1.5938 1.5383 1.6616 -0.0630 -0.1340 -0.0254 84  VAL A C   
573  O O   . VAL A 84  ? 1.5469 1.4970 1.6099 -0.0597 -0.1281 -0.0310 84  VAL A O   
574  C CB  . VAL A 84  ? 1.8209 1.7482 1.9152 -0.0548 -0.1554 -0.0190 84  VAL A CB  
575  C CG1 . VAL A 84  ? 1.8045 1.7452 1.9309 -0.0641 -0.1483 -0.0201 84  VAL A CG1 
576  C CG2 . VAL A 84  ? 1.8834 1.8157 1.9828 -0.0493 -0.1471 -0.0244 84  VAL A CG2 
577  N N   . LEU A 85  ? 1.5559 1.5086 1.6324 -0.0711 -0.1254 -0.0254 85  LEU A N   
578  C CA  . LEU A 85  ? 1.5609 1.5282 1.6372 -0.0745 -0.1088 -0.0326 85  LEU A CA  
579  C C   . LEU A 85  ? 1.5365 1.5024 1.5782 -0.0718 -0.1080 -0.0349 85  LEU A C   
580  O O   . LEU A 85  ? 1.4388 1.4150 1.4753 -0.0714 -0.0984 -0.0433 85  LEU A O   
581  C CB  . LEU A 85  ? 1.5846 1.5599 1.6767 -0.0819 -0.0986 -0.0300 85  LEU A CB  
582  C CG  . LEU A 85  ? 1.5722 1.5534 1.7029 -0.0848 -0.0990 -0.0275 85  LEU A CG  
583  C CD1 . LEU A 85  ? 1.6121 1.6035 1.7590 -0.0924 -0.0870 -0.0232 85  LEU A CD1 
584  C CD2 . LEU A 85  ? 1.5393 1.5288 1.6887 -0.0803 -0.0932 -0.0356 85  LEU A CD2 
585  N N   . VAL A 86  ? 1.6335 1.5861 1.6510 -0.0691 -0.1193 -0.0278 86  VAL A N   
586  C CA  . VAL A 86  ? 1.6654 1.6164 1.6485 -0.0646 -0.1203 -0.0290 86  VAL A CA  
587  C C   . VAL A 86  ? 1.6151 1.5704 1.5929 -0.0579 -0.1237 -0.0335 86  VAL A C   
588  O O   . VAL A 86  ? 1.5769 1.5431 1.5441 -0.0566 -0.1183 -0.0406 86  VAL A O   
589  C CB  . VAL A 86  ? 1.6829 1.6158 1.6397 -0.0623 -0.1316 -0.0195 86  VAL A CB  
590  C CG1 . VAL A 86  ? 1.7879 1.7203 1.7081 -0.0555 -0.1326 -0.0210 86  VAL A CG1 
591  C CG2 . VAL A 86  ? 1.6555 1.5834 1.6197 -0.0707 -0.1272 -0.0140 86  VAL A CG2 
592  N N   . LEU A 87  ? 1.5668 1.5133 1.5526 -0.0533 -0.1328 -0.0291 87  LEU A N   
593  C CA  . LEU A 87  ? 1.4549 1.4045 1.4386 -0.0467 -0.1343 -0.0309 87  LEU A CA  
594  C C   . LEU A 87  ? 1.5125 1.4765 1.5200 -0.0513 -0.1228 -0.0406 87  LEU A C   
595  O O   . LEU A 87  ? 1.6326 1.6058 1.6370 -0.0501 -0.1195 -0.0457 87  LEU A O   
596  C CB  . LEU A 87  ? 1.2949 1.2292 1.2803 -0.0390 -0.1453 -0.0231 87  LEU A CB  
597  C CG  . LEU A 87  ? 1.2679 1.1833 1.2271 -0.0325 -0.1594 -0.0141 87  LEU A CG  
598  C CD1 . LEU A 87  ? 1.2094 1.1089 1.1678 -0.0221 -0.1703 -0.0079 87  LEU A CD1 
599  C CD2 . LEU A 87  ? 1.3226 1.2395 1.2494 -0.0273 -0.1607 -0.0129 87  LEU A CD2 
600  N N   . ALA A 88  ? 1.4955 1.4613 1.5276 -0.0564 -0.1170 -0.0432 88  ALA A N   
601  C CA  . ALA A 88  ? 1.5246 1.5003 1.5779 -0.0600 -0.1063 -0.0527 88  ALA A CA  
602  C C   . ALA A 88  ? 1.5306 1.5185 1.5748 -0.0640 -0.0977 -0.0623 88  ALA A C   
603  O O   . ALA A 88  ? 1.4992 1.4943 1.5507 -0.0657 -0.0921 -0.0717 88  ALA A O   
604  C CB  . ALA A 88  ? 1.5715 1.5462 1.6514 -0.0623 -0.1026 -0.0525 88  ALA A CB  
605  N N   . GLN A 89  ? 1.5827 1.5711 1.6098 -0.0652 -0.0970 -0.0602 89  GLN A N   
606  C CA  . GLN A 89  ? 1.6833 1.6810 1.6967 -0.0666 -0.0892 -0.0689 89  GLN A CA  
607  C C   . GLN A 89  ? 1.7404 1.7430 1.7312 -0.0628 -0.0948 -0.0726 89  GLN A C   
608  O O   . GLN A 89  ? 1.7390 1.7515 1.7265 -0.0633 -0.0909 -0.0838 89  GLN A O   
609  C CB  . GLN A 89  ? 1.7469 1.7419 1.7490 -0.0681 -0.0846 -0.0638 89  GLN A CB  
610  C CG  . GLN A 89  ? 1.7971 1.7994 1.7820 -0.0670 -0.0751 -0.0724 89  GLN A CG  
611  C CD  . GLN A 89  ? 1.7984 1.8086 1.8016 -0.0684 -0.0647 -0.0834 89  GLN A CD  
612  O OE1 . GLN A 89  ? 1.7857 1.7958 1.8161 -0.0707 -0.0630 -0.0835 89  GLN A OE1 
613  N NE2 . GLN A 89  ? 1.7978 1.8130 1.7836 -0.0654 -0.0583 -0.0932 89  GLN A NE2 
614  N N   . SER A 90  ? 1.8002 1.7960 1.7753 -0.0582 -0.1047 -0.0636 90  SER A N   
615  C CA  . SER A 90  ? 1.7824 1.7848 1.7374 -0.0530 -0.1103 -0.0655 90  SER A CA  
616  C C   . SER A 90  ? 1.6111 1.6241 1.5854 -0.0545 -0.1092 -0.0723 90  SER A C   
617  O O   . SER A 90  ? 1.4865 1.5125 1.4555 -0.0541 -0.1097 -0.0806 90  SER A O   
618  C CB  . SER A 90  ? 1.8038 1.7947 1.7386 -0.0459 -0.1208 -0.0534 90  SER A CB  
619  O OG  . SER A 90  ? 1.7761 1.7757 1.6917 -0.0394 -0.1255 -0.0547 90  SER A OG  
620  N N   . SER A 91  ? 1.5521 1.5587 1.5492 -0.0559 -0.1081 -0.0687 91  SER A N   
621  C CA  . SER A 91  ? 1.4477 1.4606 1.4654 -0.0582 -0.1053 -0.0736 91  SER A CA  
622  C C   . SER A 91  ? 1.4564 1.4791 1.4854 -0.0650 -0.0983 -0.0885 91  SER A C   
623  O O   . SER A 91  ? 1.4086 1.4405 1.4479 -0.0680 -0.0978 -0.0959 91  SER A O   
624  C CB  . SER A 91  ? 1.3230 1.3235 1.3604 -0.0573 -0.1041 -0.0669 91  SER A CB  
625  O OG  . SER A 91  ? 1.2261 1.2155 1.2508 -0.0492 -0.1122 -0.0541 91  SER A OG  
626  N N   . ILE A 92  ? 1.5420 1.5623 1.5693 -0.0670 -0.0931 -0.0929 92  ILE A N   
627  C CA  . ILE A 92  ? 1.6339 1.6603 1.6662 -0.0709 -0.0866 -0.1074 92  ILE A CA  
628  C C   . ILE A 92  ? 1.6620 1.7005 1.6760 -0.0697 -0.0909 -0.1166 92  ILE A C   
629  O O   . ILE A 92  ? 1.6471 1.6928 1.6707 -0.0733 -0.0914 -0.1287 92  ILE A O   
630  C CB  . ILE A 92  ? 1.6522 1.6743 1.6822 -0.0708 -0.0788 -0.1081 92  ILE A CB  
631  C CG1 . ILE A 92  ? 1.6109 1.6245 1.6644 -0.0720 -0.0749 -0.1015 92  ILE A CG1 
632  C CG2 . ILE A 92  ? 1.6748 1.7017 1.7017 -0.0716 -0.0727 -0.1235 92  ILE A CG2 
633  C CD1 . ILE A 92  ? 1.5555 1.5667 1.6319 -0.0746 -0.0714 -0.1087 92  ILE A CD1 
634  N N   . PHE A 93  ? 1.6929 1.7325 1.6802 -0.0644 -0.0950 -0.1112 93  PHE A N   
635  C CA  . PHE A 93  ? 1.7624 1.8134 1.7287 -0.0607 -0.1002 -0.1194 93  PHE A CA  
636  C C   . PHE A 93  ? 1.7168 1.7803 1.6924 -0.0612 -0.1076 -0.1206 93  PHE A C   
637  O O   . PHE A 93  ? 1.6438 1.7206 1.6195 -0.0621 -0.1115 -0.1329 93  PHE A O   
638  C CB  . PHE A 93  ? 1.8139 1.8601 1.7476 -0.0536 -0.1025 -0.1112 93  PHE A CB  
639  C CG  . PHE A 93  ? 1.8054 1.8415 1.7302 -0.0535 -0.0936 -0.1093 93  PHE A CG  
640  C CD1 . PHE A 93  ? 1.8043 1.8432 1.7174 -0.0515 -0.0877 -0.1208 93  PHE A CD1 
641  C CD2 . PHE A 93  ? 1.7662 1.7901 1.6946 -0.0549 -0.0912 -0.0958 93  PHE A CD2 
642  C CE1 . PHE A 93  ? 1.7941 1.8247 1.6996 -0.0504 -0.0771 -0.1173 93  PHE A CE1 
643  C CE2 . PHE A 93  ? 1.7804 1.7976 1.7053 -0.0558 -0.0818 -0.0928 93  PHE A CE2 
644  C CZ  . PHE A 93  ? 1.8084 1.8294 1.7219 -0.0533 -0.0735 -0.1028 93  PHE A CZ  
645  N N   . SER A 94  ? 1.7186 1.7779 1.7022 -0.0599 -0.1097 -0.1078 94  SER A N   
646  C CA  . SER A 94  ? 1.6050 1.6764 1.5994 -0.0594 -0.1143 -0.1058 94  SER A CA  
647  C C   . SER A 94  ? 1.6456 1.7233 1.6718 -0.0686 -0.1106 -0.1158 94  SER A C   
648  O O   . SER A 94  ? 1.6483 1.7426 1.6838 -0.0714 -0.1144 -0.1237 94  SER A O   
649  C CB  . SER A 94  ? 1.4334 1.4951 1.4264 -0.0538 -0.1159 -0.0889 94  SER A CB  
650  O OG  . SER A 94  ? 1.3544 1.4086 1.3167 -0.0453 -0.1211 -0.0803 94  SER A OG  
651  N N   . LEU A 95  ? 1.6516 1.7157 1.6954 -0.0734 -0.1037 -0.1155 95  LEU A N   
652  C CA  . LEU A 95  ? 1.6071 1.6717 1.6794 -0.0820 -0.0995 -0.1245 95  LEU A CA  
653  C C   . LEU A 95  ? 1.5710 1.6433 1.6424 -0.0866 -0.1013 -0.1434 95  LEU A C   
654  O O   . LEU A 95  ? 1.5167 1.5962 1.6078 -0.0939 -0.1029 -0.1533 95  LEU A O   
655  C CB  . LEU A 95  ? 1.5645 1.6107 1.6511 -0.0836 -0.0919 -0.1201 95  LEU A CB  
656  C CG  . LEU A 95  ? 1.5281 1.5639 1.6189 -0.0785 -0.0910 -0.1032 95  LEU A CG  
657  C CD1 . LEU A 95  ? 1.5175 1.5364 1.6215 -0.0789 -0.0848 -0.1012 95  LEU A CD1 
658  C CD2 . LEU A 95  ? 1.5454 1.5876 1.6507 -0.0797 -0.0908 -0.0981 95  LEU A CD2 
659  N N   . LEU A 96  ? 1.5758 1.6454 1.6239 -0.0821 -0.1011 -0.1482 96  LEU A N   
660  C CA  . LEU A 96  ? 1.6210 1.6952 1.6611 -0.0830 -0.1032 -0.1663 96  LEU A CA  
661  C C   . LEU A 96  ? 1.5780 1.6712 1.6098 -0.0816 -0.1138 -0.1738 96  LEU A C   
662  O O   . LEU A 96  ? 1.5710 1.6717 1.6113 -0.0859 -0.1189 -0.1900 96  LEU A O   
663  C CB  . LEU A 96  ? 1.7231 1.7886 1.7376 -0.0763 -0.0981 -0.1669 96  LEU A CB  
664  C CG  . LEU A 96  ? 1.8199 1.8869 1.8184 -0.0735 -0.0993 -0.1847 96  LEU A CG  
665  C CD1 . LEU A 96  ? 1.8299 1.8917 1.8504 -0.0804 -0.0983 -0.1992 96  LEU A CD1 
666  C CD2 . LEU A 96  ? 1.8576 1.9150 1.8318 -0.0659 -0.0907 -0.1813 96  LEU A CD2 
667  N N   . ALA A 97  ? 1.5665 1.6673 1.5817 -0.0748 -0.1179 -0.1625 97  ALA A N   
668  C CA  . ALA A 97  ? 1.5420 1.6631 1.5489 -0.0712 -0.1281 -0.1679 97  ALA A CA  
669  C C   . ALA A 97  ? 1.4767 1.6130 1.5180 -0.0798 -0.1315 -0.1707 97  ALA A C   
670  O O   . ALA A 97  ? 1.4290 1.5821 1.4784 -0.0827 -0.1398 -0.1846 97  ALA A O   
671  C CB  . ALA A 97  ? 1.5366 1.6593 1.5171 -0.0608 -0.1308 -0.1535 97  ALA A CB  
672  N N   . ILE A 98  ? 1.4494 1.5794 1.5113 -0.0835 -0.1251 -0.1571 98  ILE A N   
673  C CA  . ILE A 98  ? 1.4150 1.5570 1.5116 -0.0919 -0.1249 -0.1566 98  ILE A CA  
674  C C   . ILE A 98  ? 1.4441 1.5847 1.5649 -0.1039 -0.1256 -0.1743 98  ILE A C   
675  O O   . ILE A 98  ? 1.4285 1.5866 1.5730 -0.1115 -0.1312 -0.1826 98  ILE A O   
676  C CB  . ILE A 98  ? 1.3769 1.5064 1.4870 -0.0918 -0.1158 -0.1383 98  ILE A CB  
677  C CG1 . ILE A 98  ? 1.3475 1.4782 1.4338 -0.0792 -0.1174 -0.1215 98  ILE A CG1 
678  C CG2 . ILE A 98  ? 1.3549 1.4935 1.5023 -0.1014 -0.1125 -0.1374 98  ILE A CG2 
679  C CD1 . ILE A 98  ? 1.3216 1.4395 1.4166 -0.0761 -0.1103 -0.1038 98  ILE A CD1 
680  N N   . ALA A 99  ? 1.5649 1.6848 1.6805 -0.1055 -0.1202 -0.1802 99  ALA A N   
681  C CA  . ALA A 99  ? 1.6827 1.7960 1.8155 -0.1149 -0.1212 -0.1979 99  ALA A CA  
682  C C   . ALA A 99  ? 1.7584 1.8868 1.8812 -0.1144 -0.1337 -0.2172 99  ALA A C   
683  O O   . ALA A 99  ? 1.8050 1.9422 1.9519 -0.1241 -0.1406 -0.2303 99  ALA A O   
684  C CB  . ALA A 99  ? 1.6994 1.7885 1.8222 -0.1128 -0.1128 -0.1999 99  ALA A CB  
685  N N   . ILE A 100 ? 1.7484 1.8786 1.8355 -0.1028 -0.1370 -0.2189 100 ILE A N   
686  C CA  . ILE A 100 ? 1.7432 1.8864 1.8136 -0.0984 -0.1495 -0.2365 100 ILE A CA  
687  C C   . ILE A 100 ? 1.6998 1.8711 1.7890 -0.1018 -0.1603 -0.2381 100 ILE A C   
688  O O   . ILE A 100 ? 1.7123 1.8960 1.8139 -0.1068 -0.1720 -0.2561 100 ILE A O   
689  C CB  . ILE A 100 ? 1.7177 1.8572 1.7435 -0.0835 -0.1491 -0.2334 100 ILE A CB  
690  C CG1 . ILE A 100 ? 1.6244 1.7395 1.6346 -0.0801 -0.1373 -0.2316 100 ILE A CG1 
691  C CG2 . ILE A 100 ? 1.7537 1.9063 1.7590 -0.0764 -0.1627 -0.2513 100 ILE A CG2 
692  C CD1 . ILE A 100 ? 1.5418 1.6512 1.5112 -0.0668 -0.1339 -0.2259 100 ILE A CD1 
693  N N   . ASP A 101 ? 1.6406 1.8220 1.7321 -0.0984 -0.1569 -0.2194 101 ASP A N   
694  C CA  . ASP A 101 ? 1.5559 1.7662 1.6661 -0.0997 -0.1647 -0.2173 101 ASP A CA  
695  C C   . ASP A 101 ? 1.4364 1.6566 1.5942 -0.1161 -0.1664 -0.2248 101 ASP A C   
696  O O   . ASP A 101 ? 1.2811 1.5236 1.4558 -0.1207 -0.1787 -0.2389 101 ASP A O   
697  C CB  . ASP A 101 ? 1.5211 1.7347 1.6255 -0.0924 -0.1578 -0.1938 101 ASP A CB  
698  C CG  . ASP A 101 ? 1.5064 1.7509 1.6328 -0.0926 -0.1632 -0.1892 101 ASP A CG  
699  O OD1 . ASP A 101 ? 1.6050 1.8722 1.7281 -0.0894 -0.1758 -0.2018 101 ASP A OD1 
700  O OD2 . ASP A 101 ? 1.4208 1.6673 1.5673 -0.0948 -0.1547 -0.1727 101 ASP A OD2 
701  N N   . ARG A 102 ? 1.4990 1.7016 1.6788 -0.1248 -0.1543 -0.2153 102 ARG A N   
702  C CA  . ARG A 102 ? 1.5318 1.7385 1.7569 -0.1411 -0.1532 -0.2199 102 ARG A CA  
703  C C   . ARG A 102 ? 1.5469 1.7487 1.7801 -0.1500 -0.1636 -0.2454 102 ARG A C   
704  O O   . ARG A 102 ? 1.5746 1.7843 1.8456 -0.1645 -0.1678 -0.2541 102 ARG A O   
705  C CB  . ARG A 102 ? 1.5870 1.7700 1.8265 -0.1459 -0.1373 -0.2046 102 ARG A CB  
706  C CG  . ARG A 102 ? 1.6408 1.8271 1.8757 -0.1373 -0.1280 -0.1798 102 ARG A CG  
707  C CD  . ARG A 102 ? 1.7062 1.9215 1.9706 -0.1411 -0.1289 -0.1721 102 ARG A CD  
708  N NE  . ARG A 102 ? 1.7905 2.0354 2.0454 -0.1354 -0.1424 -0.1807 102 ARG A NE  
709  C CZ  . ARG A 102 ? 1.8525 2.1293 2.1326 -0.1374 -0.1459 -0.1771 102 ARG A CZ  
710  N NH1 . ARG A 102 ? 1.8711 2.1537 2.1879 -0.1456 -0.1353 -0.1641 102 ARG A NH1 
711  N NH2 . ARG A 102 ? 1.8623 2.1655 2.1310 -0.1303 -0.1592 -0.1860 102 ARG A NH2 
712  N N   . TYR A 103 ? 1.5706 1.7583 1.7678 -0.1409 -0.1676 -0.2571 103 TYR A N   
713  C CA  . TYR A 103 ? 1.6594 1.8401 1.8552 -0.1452 -0.1789 -0.2824 103 TYR A CA  
714  C C   . TYR A 103 ? 1.7339 1.9424 1.9254 -0.1415 -0.1975 -0.2975 103 TYR A C   
715  O O   . TYR A 103 ? 1.7637 1.9804 1.9794 -0.1517 -0.2104 -0.3162 103 TYR A O   
716  C CB  . TYR A 103 ? 1.6854 1.8390 1.8428 -0.1347 -0.1739 -0.2879 103 TYR A CB  
717  C CG  . TYR A 103 ? 1.8035 1.9476 1.9507 -0.1348 -0.1859 -0.3143 103 TYR A CG  
718  C CD1 . TYR A 103 ? 1.8752 1.9995 2.0441 -0.1464 -0.1856 -0.3262 103 TYR A CD1 
719  C CD2 . TYR A 103 ? 1.8686 2.0211 1.9818 -0.1219 -0.1979 -0.3276 103 TYR A CD2 
720  C CE1 . TYR A 103 ? 1.9743 2.0870 2.1310 -0.1451 -0.1978 -0.3513 103 TYR A CE1 
721  C CE2 . TYR A 103 ? 1.9643 2.1060 2.0644 -0.1197 -0.2099 -0.3525 103 TYR A CE2 
722  C CZ  . TYR A 103 ? 2.0263 2.1480 2.1482 -0.1313 -0.2102 -0.3646 103 TYR A CZ  
723  O OH  . TYR A 103 ? 2.1001 2.2082 2.2061 -0.1278 -0.2233 -0.3902 103 TYR A OH  
724  N N   . ILE A 104 ? 1.7729 1.9949 1.9335 -0.1266 -0.1995 -0.2898 104 ILE A N   
725  C CA  . ILE A 104 ? 1.8007 2.0493 1.9516 -0.1194 -0.2170 -0.3027 104 ILE A CA  
726  C C   . ILE A 104 ? 1.7162 1.9969 1.9157 -0.1320 -0.2256 -0.3045 104 ILE A C   
727  O O   . ILE A 104 ? 1.6571 1.9571 1.8681 -0.1345 -0.2435 -0.3241 104 ILE A O   
728  C CB  . ILE A 104 ? 1.8482 2.1042 1.9583 -0.1008 -0.2152 -0.2897 104 ILE A CB  
729  C CG1 . ILE A 104 ? 1.9091 2.1347 1.9744 -0.0895 -0.2056 -0.2867 104 ILE A CG1 
730  C CG2 . ILE A 104 ? 1.8494 2.1327 1.9478 -0.0915 -0.2338 -0.3034 104 ILE A CG2 
731  C CD1 . ILE A 104 ? 1.9254 2.1525 1.9502 -0.0727 -0.2024 -0.2726 104 ILE A CD1 
732  N N   . ALA A 105 ? 1.6530 1.9398 1.8813 -0.1393 -0.2127 -0.2837 105 ALA A N   
733  C CA  . ALA A 105 ? 1.5306 1.8490 1.8080 -0.1511 -0.2166 -0.2809 105 ALA A CA  
734  C C   . ALA A 105 ? 1.6022 1.9193 1.9216 -0.1709 -0.2247 -0.2997 105 ALA A C   
735  O O   . ALA A 105 ? 1.7558 2.1012 2.1028 -0.1777 -0.2406 -0.3138 105 ALA A O   
736  C CB  . ALA A 105 ? 1.3768 1.6954 1.6715 -0.1529 -0.1982 -0.2534 105 ALA A CB  
737  N N   . ILE A 106 ? 1.5353 1.8189 1.8599 -0.1801 -0.2146 -0.3001 106 ILE A N   
738  C CA  . ILE A 106 ? 1.5964 1.8716 1.9588 -0.1994 -0.2210 -0.3169 106 ILE A CA  
739  C C   . ILE A 106 ? 1.7098 1.9779 2.0524 -0.1968 -0.2412 -0.3469 106 ILE A C   
740  O O   . ILE A 106 ? 1.7445 2.0236 2.1196 -0.2101 -0.2569 -0.3658 106 ILE A O   
741  C CB  . ILE A 106 ? 1.5692 1.8078 1.9400 -0.2080 -0.2033 -0.3075 106 ILE A CB  
742  C CG1 . ILE A 106 ? 1.5136 1.7589 1.9078 -0.2110 -0.1847 -0.2792 106 ILE A CG1 
743  C CG2 . ILE A 106 ? 1.6260 1.8498 2.0294 -0.2268 -0.2111 -0.3269 106 ILE A CG2 
744  C CD1 . ILE A 106 ? 1.5298 1.7406 1.9352 -0.2191 -0.1678 -0.2694 106 ILE A CD1 
745  N N   . ALA A 107 ? 1.7857 2.0351 2.0750 -0.1791 -0.2409 -0.3510 107 ALA A N   
746  C CA  . ALA A 107 ? 1.9155 2.1547 2.1769 -0.1722 -0.2584 -0.3781 107 ALA A CA  
747  C C   . ALA A 107 ? 1.9743 2.2488 2.2372 -0.1669 -0.2802 -0.3922 107 ALA A C   
748  O O   . ALA A 107 ? 1.9955 2.2781 2.2814 -0.1763 -0.2995 -0.4151 107 ALA A O   
749  C CB  . ALA A 107 ? 1.9533 2.1660 2.1573 -0.1531 -0.2495 -0.3754 107 ALA A CB  
750  N N   . ILE A 108 ? 2.0177 2.3125 2.2558 -0.1513 -0.2781 -0.3791 108 ILE A N   
751  C CA  . ILE A 108 ? 2.0976 2.4270 2.3330 -0.1429 -0.2980 -0.3905 108 ILE A CA  
752  C C   . ILE A 108 ? 2.0877 2.4522 2.3462 -0.1425 -0.2920 -0.3690 108 ILE A C   
753  O O   . ILE A 108 ? 2.1088 2.4786 2.3312 -0.1249 -0.2865 -0.3553 108 ILE A O   
754  C CB  . ILE A 108 ? 2.1447 2.4636 2.3154 -0.1184 -0.3045 -0.3990 108 ILE A CB  
755  C CG1 . ILE A 108 ? 2.1323 2.4106 2.2718 -0.1149 -0.3024 -0.4130 108 ILE A CG1 
756  C CG2 . ILE A 108 ? 2.1709 2.5212 2.3386 -0.1097 -0.3296 -0.4180 108 ILE A CG2 
757  C CD1 . ILE A 108 ? 2.1272 2.3916 2.2018 -0.0903 -0.3046 -0.4187 108 ILE A CD1 
758  N N   . PRO A 109 ? 2.0008 2.3882 2.3192 -0.1615 -0.2924 -0.3655 109 PRO A N   
759  C CA  . PRO A 109 ? 1.9706 2.3918 2.3162 -0.1617 -0.2844 -0.3437 109 PRO A CA  
760  C C   . PRO A 109 ? 2.0394 2.4953 2.3656 -0.1440 -0.2991 -0.3474 109 PRO A C   
761  O O   . PRO A 109 ? 1.9931 2.4639 2.3081 -0.1324 -0.2895 -0.3266 109 PRO A O   
762  C CB  . PRO A 109 ? 1.8945 2.3348 2.3105 -0.1865 -0.2871 -0.3474 109 PRO A CB  
763  C CG  . PRO A 109 ? 1.9040 2.3276 2.3266 -0.1971 -0.3047 -0.3770 109 PRO A CG  
764  C CD  . PRO A 109 ? 1.9406 2.3209 2.3046 -0.1840 -0.2994 -0.3815 109 PRO A CD  
765  N N   . LEU A 110 ? 2.1593 2.6263 2.4794 -0.1407 -0.3228 -0.3741 110 LEU A N   
766  C CA  . LEU A 110 ? 2.2353 2.7357 2.5371 -0.1229 -0.3393 -0.3805 110 LEU A CA  
767  C C   . LEU A 110 ? 2.2654 2.7469 2.4969 -0.0972 -0.3322 -0.3704 110 LEU A C   
768  O O   . LEU A 110 ? 2.2484 2.7486 2.4668 -0.0840 -0.3269 -0.3533 110 LEU A O   
769  C CB  . LEU A 110 ? 2.2836 2.7959 2.5924 -0.1243 -0.3680 -0.4135 110 LEU A CB  
770  C CG  . LEU A 110 ? 2.3067 2.8415 2.6885 -0.1506 -0.3794 -0.4264 110 LEU A CG  
771  C CD1 . LEU A 110 ? 2.3617 2.9024 2.7430 -0.1499 -0.4105 -0.4613 110 LEU A CD1 
772  C CD2 . LEU A 110 ? 2.2927 2.8766 2.7268 -0.1570 -0.3759 -0.4098 110 LEU A CD2 
773  N N   . ARG A 111 ? 2.2933 2.7367 2.4796 -0.0899 -0.3316 -0.3807 111 ARG A N   
774  C CA  . ARG A 111 ? 2.3253 2.7474 2.4455 -0.0670 -0.3239 -0.3717 111 ARG A CA  
775  C C   . ARG A 111 ? 2.2894 2.6951 2.4016 -0.0669 -0.2989 -0.3418 111 ARG A C   
776  O O   . ARG A 111 ? 2.3584 2.7486 2.4216 -0.0498 -0.2909 -0.3300 111 ARG A O   
777  C CB  . ARG A 111 ? 2.4184 2.8039 2.4963 -0.0601 -0.3271 -0.3891 111 ARG A CB  
778  C CG  . ARG A 111 ? 2.5088 2.9052 2.5797 -0.0540 -0.3537 -0.4198 111 ARG A CG  
779  C CD  . ARG A 111 ? 2.5872 3.0104 2.6292 -0.0325 -0.3674 -0.4222 111 ARG A CD  
780  N NE  . ARG A 111 ? 2.6543 3.0559 2.6351 -0.0115 -0.3531 -0.4057 111 ARG A NE  
781  C CZ  . ARG A 111 ? 2.7381 3.1093 2.6615 0.0053  -0.3526 -0.4140 111 ARG A CZ  
782  N NH1 . ARG A 111 ? 2.8041 3.1621 2.7199 0.0057  -0.3663 -0.4393 111 ARG A NH1 
783  N NH2 . ARG A 111 ? 2.7349 3.0876 2.6081 0.0222  -0.3382 -0.3966 111 ARG A NH2 
784  N N   . TYR A 112 ? 2.2001 2.6077 2.3596 -0.0856 -0.2871 -0.3297 112 TYR A N   
785  C CA  . TYR A 112 ? 2.1335 2.5251 2.2881 -0.0856 -0.2649 -0.3024 112 TYR A CA  
786  C C   . TYR A 112 ? 2.0909 2.4994 2.2211 -0.0681 -0.2624 -0.2848 112 TYR A C   
787  O O   . TYR A 112 ? 2.0768 2.4621 2.1659 -0.0562 -0.2514 -0.2702 112 TYR A O   
788  C CB  . TYR A 112 ? 2.0930 2.4896 2.3048 -0.1065 -0.2544 -0.2926 112 TYR A CB  
789  C CG  . TYR A 112 ? 2.0435 2.4279 2.2521 -0.1044 -0.2337 -0.2642 112 TYR A CG  
790  C CD1 . TYR A 112 ? 2.0201 2.4311 2.2431 -0.0992 -0.2294 -0.2463 112 TYR A CD1 
791  C CD2 . TYR A 112 ? 2.0005 2.3468 2.1909 -0.1060 -0.2191 -0.2557 112 TYR A CD2 
792  C CE1 . TYR A 112 ? 1.9659 2.3631 2.1823 -0.0953 -0.2118 -0.2213 112 TYR A CE1 
793  C CE2 . TYR A 112 ? 1.9431 2.2775 2.1298 -0.1031 -0.2025 -0.2312 112 TYR A CE2 
794  C CZ  . TYR A 112 ? 1.9045 2.2630 2.1026 -0.0974 -0.1993 -0.2144 112 TYR A CZ  
795  O OH  . TYR A 112 ? 1.8255 2.1696 2.0162 -0.0925 -0.1842 -0.1909 112 TYR A OH  
796  N N   . ASN A 113 ? 2.0496 2.4983 2.2060 -0.0665 -0.2731 -0.2865 113 ASN A N   
797  C CA  . ASN A 113 ? 1.9889 2.4559 2.1235 -0.0486 -0.2718 -0.2705 113 ASN A CA  
798  C C   . ASN A 113 ? 1.8993 2.3592 1.9740 -0.0263 -0.2822 -0.2789 113 ASN A C   
799  O O   . ASN A 113 ? 1.8051 2.2635 1.8444 -0.0090 -0.2779 -0.2640 113 ASN A O   
800  C CB  . ASN A 113 ? 2.0234 2.5388 2.2072 -0.0529 -0.2794 -0.2697 113 ASN A CB  
801  C CG  . ASN A 113 ? 2.0143 2.5365 2.2578 -0.0747 -0.2671 -0.2596 113 ASN A CG  
802  O OD1 . ASN A 113 ? 1.9959 2.5113 2.2430 -0.0736 -0.2497 -0.2360 113 ASN A OD1 
803  N ND2 . ASN A 113 ? 2.0166 2.5502 2.3059 -0.0939 -0.2765 -0.2776 113 ASN A ND2 
804  N N   . GLY A 114 ? 1.9005 2.3534 1.9618 -0.0258 -0.2958 -0.3028 114 GLY A N   
805  C CA  . GLY A 114 ? 1.9349 2.3779 1.9373 -0.0039 -0.3052 -0.3120 114 GLY A CA  
806  C C   . GLY A 114 ? 2.0095 2.4076 1.9619 0.0034  -0.2899 -0.3022 114 GLY A C   
807  O O   . GLY A 114 ? 2.0490 2.4353 1.9494 0.0229  -0.2893 -0.2970 114 GLY A O   
808  N N   . LEU A 115 ? 2.0268 2.3999 1.9962 -0.0124 -0.2774 -0.2995 115 LEU A N   
809  C CA  . LEU A 115 ? 1.9264 2.2596 1.8571 -0.0080 -0.2620 -0.2899 115 LEU A CA  
810  C C   . LEU A 115 ? 1.8728 2.1953 1.8083 -0.0112 -0.2445 -0.2631 115 LEU A C   
811  O O   . LEU A 115 ? 1.8711 2.1788 1.7668 0.0022  -0.2379 -0.2489 115 LEU A O   
812  C CB  . LEU A 115 ? 1.8401 2.1511 1.7827 -0.0207 -0.2589 -0.3034 115 LEU A CB  
813  C CG  . LEU A 115 ? 1.8466 2.1609 1.7801 -0.0168 -0.2766 -0.3316 115 LEU A CG  
814  C CD1 . LEU A 115 ? 1.7913 2.0826 1.7410 -0.0303 -0.2727 -0.3435 115 LEU A CD1 
815  C CD2 . LEU A 115 ? 1.9067 2.2086 1.7774 0.0068  -0.2804 -0.3362 115 LEU A CD2 
816  N N   . VAL A 116 ? 1.8562 2.1842 1.8395 -0.0285 -0.2376 -0.2564 116 VAL A N   
817  C CA  . VAL A 116 ? 1.8480 2.1660 1.8383 -0.0310 -0.2224 -0.2321 116 VAL A CA  
818  C C   . VAL A 116 ? 1.8847 2.2249 1.8675 -0.0185 -0.2253 -0.2185 116 VAL A C   
819  O O   . VAL A 116 ? 1.9305 2.3001 1.9515 -0.0238 -0.2281 -0.2158 116 VAL A O   
820  C CB  . VAL A 116 ? 1.7664 2.0858 1.8091 -0.0509 -0.2146 -0.2286 116 VAL A CB  
821  C CG1 . VAL A 116 ? 1.6830 1.9885 1.7273 -0.0507 -0.1994 -0.2039 116 VAL A CG1 
822  C CG2 . VAL A 116 ? 1.7455 2.0427 1.7955 -0.0623 -0.2127 -0.2433 116 VAL A CG2 
823  N N   . THR A 117 ? 1.8477 2.1733 1.7812 -0.0015 -0.2238 -0.2094 117 THR A N   
824  C CA  . THR A 117 ? 1.8197 2.1617 1.7374 0.0137  -0.2269 -0.1966 117 THR A CA  
825  C C   . THR A 117 ? 1.8317 2.1509 1.7357 0.0170  -0.2137 -0.1728 117 THR A C   
826  O O   . THR A 117 ? 1.8507 2.1386 1.7453 0.0110  -0.2038 -0.1671 117 THR A O   
827  C CB  . THR A 117 ? 1.8034 2.1447 1.6704 0.0335  -0.2371 -0.2040 117 THR A CB  
828  O OG1 . THR A 117 ? 1.7949 2.0976 1.6175 0.0392  -0.2286 -0.1979 117 THR A OG1 
829  C CG2 . THR A 117 ? 1.8300 2.1906 1.7052 0.0325  -0.2521 -0.2293 117 THR A CG2 
830  N N   . GLY A 118 ? 1.8549 2.1902 1.7576 0.0275  -0.2143 -0.1593 118 GLY A N   
831  C CA  . GLY A 118 ? 1.9359 2.2492 1.8220 0.0335  -0.2044 -0.1375 118 GLY A CA  
832  C C   . GLY A 118 ? 2.0605 2.3397 1.8914 0.0452  -0.2033 -0.1319 118 GLY A C   
833  O O   . GLY A 118 ? 2.0703 2.3214 1.8873 0.0455  -0.1953 -0.1172 118 GLY A O   
834  N N   . THR A 119 ? 2.1642 2.4451 1.9635 0.0549  -0.2117 -0.1438 119 THR A N   
835  C CA  . THR A 119 ? 2.2094 2.4578 1.9552 0.0662  -0.2099 -0.1386 119 THR A CA  
836  C C   . THR A 119 ? 2.2004 2.4207 1.9442 0.0541  -0.2015 -0.1426 119 THR A C   
837  O O   . THR A 119 ? 2.2098 2.3997 1.9356 0.0532  -0.1932 -0.1300 119 THR A O   
838  C CB  . THR A 119 ? 2.2562 2.5150 1.9649 0.0836  -0.2209 -0.1489 119 THR A CB  
839  O OG1 . THR A 119 ? 2.2808 2.5675 1.9911 0.0966  -0.2287 -0.1445 119 THR A OG1 
840  C CG2 . THR A 119 ? 2.2540 2.4758 1.9065 0.0949  -0.2169 -0.1415 119 THR A CG2 
841  N N   . ARG A 120 ? 2.1768 2.4077 1.9397 0.0453  -0.2040 -0.1605 120 ARG A N   
842  C CA  . ARG A 120 ? 2.1523 2.3595 1.9150 0.0351  -0.1955 -0.1655 120 ARG A CA  
843  C C   . ARG A 120 ? 2.0993 2.2905 1.8888 0.0216  -0.1843 -0.1528 120 ARG A C   
844  O O   . ARG A 120 ? 2.0934 2.2587 1.8728 0.0174  -0.1752 -0.1483 120 ARG A O   
845  C CB  . ARG A 120 ? 2.1670 2.3895 1.9511 0.0278  -0.2014 -0.1875 120 ARG A CB  
846  C CG  . ARG A 120 ? 2.2269 2.4596 1.9790 0.0424  -0.2131 -0.2027 120 ARG A CG  
847  C CD  . ARG A 120 ? 2.2788 2.5214 2.0502 0.0351  -0.2199 -0.2255 120 ARG A CD  
848  N NE  . ARG A 120 ? 2.3399 2.5915 2.0789 0.0509  -0.2329 -0.2415 120 ARG A NE  
849  C CZ  . ARG A 120 ? 2.3620 2.6200 2.1063 0.0496  -0.2424 -0.2636 120 ARG A CZ  
850  N NH1 . ARG A 120 ? 2.3907 2.6556 2.1013 0.0666  -0.2553 -0.2776 120 ARG A NH1 
851  N NH2 . ARG A 120 ? 2.3426 2.5983 2.1238 0.0325  -0.2397 -0.2722 120 ARG A NH2 
852  N N   . ALA A 121 ? 2.0873 2.2950 1.9117 0.0157  -0.1846 -0.1468 121 ALA A N   
853  C CA  . ALA A 121 ? 2.0757 2.2688 1.9241 0.0053  -0.1749 -0.1344 121 ALA A CA  
854  C C   . ALA A 121 ? 2.1039 2.2680 1.9201 0.0126  -0.1702 -0.1176 121 ALA A C   
855  O O   . ALA A 121 ? 2.1157 2.2569 1.9335 0.0054  -0.1625 -0.1134 121 ALA A O   
856  C CB  . ALA A 121 ? 2.0541 2.2693 1.9380 0.0020  -0.1755 -0.1284 121 ALA A CB  
857  N N   . ALA A 122 ? 2.1022 2.2675 1.8899 0.0272  -0.1756 -0.1085 122 ALA A N   
858  C CA  . ALA A 122 ? 2.0944 2.2303 1.8486 0.0349  -0.1735 -0.0932 122 ALA A CA  
859  C C   . ALA A 122 ? 2.0794 2.1916 1.8062 0.0340  -0.1695 -0.0960 122 ALA A C   
860  O O   . ALA A 122 ? 2.1157 2.2012 1.8332 0.0310  -0.1644 -0.0856 122 ALA A O   
861  C CB  . ALA A 122 ? 2.0997 2.2409 1.8236 0.0527  -0.1810 -0.0853 122 ALA A CB  
862  N N   . GLY A 123 ? 2.0039 2.1263 1.7184 0.0371  -0.1719 -0.1100 123 GLY A N   
863  C CA  . GLY A 123 ? 1.9364 2.0380 1.6237 0.0381  -0.1662 -0.1127 123 GLY A CA  
864  C C   . GLY A 123 ? 1.8457 1.9361 1.5592 0.0231  -0.1560 -0.1144 123 GLY A C   
865  O O   . GLY A 123 ? 1.8446 1.9108 1.5474 0.0203  -0.1483 -0.1048 123 GLY A O   
866  N N   . ILE A 124 ? 1.7464 1.8544 1.4956 0.0134  -0.1560 -0.1266 124 ILE A N   
867  C CA  . ILE A 124 ? 1.6291 1.7280 1.4044 0.0005  -0.1465 -0.1294 124 ILE A CA  
868  C C   . ILE A 124 ? 1.6000 1.6820 1.3891 -0.0058 -0.1410 -0.1134 124 ILE A C   
869  O O   . ILE A 124 ? 1.6571 1.7214 1.4461 -0.0107 -0.1325 -0.1087 124 ILE A O   
870  C CB  . ILE A 124 ? 1.5911 1.7098 1.4046 -0.0090 -0.1489 -0.1437 124 ILE A CB  
871  C CG1 . ILE A 124 ? 1.6357 1.7697 1.4365 -0.0032 -0.1565 -0.1620 124 ILE A CG1 
872  C CG2 . ILE A 124 ? 1.5578 1.6645 1.3966 -0.0209 -0.1390 -0.1452 124 ILE A CG2 
873  C CD1 . ILE A 124 ? 1.6353 1.7873 1.4734 -0.0133 -0.1610 -0.1777 124 ILE A CD1 
874  N N   . ILE A 125 ? 1.5766 1.6648 1.3778 -0.0048 -0.1459 -0.1049 125 ILE A N   
875  C CA  . ILE A 125 ? 1.6506 1.7221 1.4617 -0.0081 -0.1432 -0.0903 125 ILE A CA  
876  C C   . ILE A 125 ? 1.7468 1.7929 1.5281 -0.0043 -0.1413 -0.0797 125 ILE A C   
877  O O   . ILE A 125 ? 1.7911 1.8216 1.5841 -0.0117 -0.1355 -0.0743 125 ILE A O   
878  C CB  . ILE A 125 ? 1.6446 1.7243 1.4603 -0.0020 -0.1494 -0.0814 125 ILE A CB  
879  C CG1 . ILE A 125 ? 1.6577 1.7614 1.5105 -0.0086 -0.1490 -0.0894 125 ILE A CG1 
880  C CG2 . ILE A 125 ? 1.6120 1.6698 1.4287 -0.0019 -0.1486 -0.0664 125 ILE A CG2 
881  C CD1 . ILE A 125 ? 1.6660 1.7804 1.5260 -0.0020 -0.1524 -0.0796 125 ILE A CD1 
882  N N   . ALA A 126 ? 1.7328 1.7747 1.4766 0.0073  -0.1463 -0.0768 126 ALA A N   
883  C CA  . ALA A 126 ? 1.7316 1.7473 1.4446 0.0108  -0.1446 -0.0666 126 ALA A CA  
884  C C   . ALA A 126 ? 1.7053 1.7118 1.4229 0.0025  -0.1337 -0.0699 126 ALA A C   
885  O O   . ALA A 126 ? 1.6571 1.6448 1.3789 -0.0036 -0.1291 -0.0605 126 ALA A O   
886  C CB  . ALA A 126 ? 1.7480 1.7614 1.4176 0.0255  -0.1506 -0.0655 126 ALA A CB  
887  N N   . ILE A 127 ? 1.7234 1.7439 1.4409 0.0030  -0.1299 -0.0835 127 ILE A N   
888  C CA  . ILE A 127 ? 1.7414 1.7550 1.4615 -0.0022 -0.1182 -0.0874 127 ILE A CA  
889  C C   . ILE A 127 ? 1.7176 1.7296 1.4778 -0.0152 -0.1117 -0.0852 127 ILE A C   
890  O O   . ILE A 127 ? 1.7587 1.7572 1.5229 -0.0203 -0.1027 -0.0783 127 ILE A O   
891  C CB  . ILE A 127 ? 1.7736 1.8028 1.4877 0.0021  -0.1173 -0.1047 127 ILE A CB  
892  C CG1 . ILE A 127 ? 1.8564 1.8881 1.5293 0.0169  -0.1246 -0.1078 127 ILE A CG1 
893  C CG2 . ILE A 127 ? 1.7644 1.7853 1.4794 -0.0012 -0.1038 -0.1081 127 ILE A CG2 
894  C CD1 . ILE A 127 ? 1.9230 1.9699 1.5875 0.0230  -0.1270 -0.1262 127 ILE A CD1 
895  N N   . CYS A 128 ? 1.6473 1.6734 1.4379 -0.0201 -0.1160 -0.0907 128 CYS A N   
896  C CA  . CYS A 128 ? 1.6271 1.6517 1.4547 -0.0306 -0.1107 -0.0894 128 CYS A CA  
897  C C   . CYS A 128 ? 1.6354 1.6421 1.4668 -0.0336 -0.1105 -0.0742 128 CYS A C   
898  O O   . CYS A 128 ? 1.6655 1.6657 1.5153 -0.0405 -0.1028 -0.0715 128 CYS A O   
899  C CB  . CYS A 128 ? 1.6253 1.6646 1.4805 -0.0339 -0.1159 -0.0950 128 CYS A CB  
900  S SG  . CYS A 128 ? 1.7499 1.8104 1.6114 -0.0342 -0.1176 -0.1150 128 CYS A SG  
901  N N   . TRP A 129 ? 1.6408 1.6396 1.4550 -0.0278 -0.1197 -0.0646 129 TRP A N   
902  C CA  . TRP A 129 ? 1.7314 1.7105 1.5458 -0.0296 -0.1229 -0.0511 129 TRP A CA  
903  C C   . TRP A 129 ? 1.7975 1.7617 1.5988 -0.0326 -0.1160 -0.0454 129 TRP A C   
904  O O   . TRP A 129 ? 1.7818 1.7367 1.6027 -0.0402 -0.1132 -0.0390 129 TRP A O   
905  C CB  . TRP A 129 ? 1.7399 1.7111 1.5314 -0.0201 -0.1347 -0.0430 129 TRP A CB  
906  C CG  . TRP A 129 ? 1.7715 1.7523 1.5822 -0.0181 -0.1399 -0.0430 129 TRP A CG  
907  C CD1 . TRP A 129 ? 1.7987 1.7989 1.6107 -0.0131 -0.1421 -0.0490 129 TRP A CD1 
908  C CD2 . TRP A 129 ? 1.8276 1.7991 1.6594 -0.0206 -0.1429 -0.0362 129 TRP A CD2 
909  N NE1 . TRP A 129 ? 1.8166 1.8196 1.6494 -0.0127 -0.1444 -0.0450 129 TRP A NE1 
910  C CE2 . TRP A 129 ? 1.8200 1.8044 1.6629 -0.0162 -0.1451 -0.0374 129 TRP A CE2 
911  C CE3 . TRP A 129 ? 1.8835 1.8376 1.7266 -0.0255 -0.1443 -0.0293 129 TRP A CE3 
912  C CZ2 . TRP A 129 ? 1.8456 1.8233 1.7061 -0.0152 -0.1475 -0.0313 129 TRP A CZ2 
913  C CZ3 . TRP A 129 ? 1.9071 1.8555 1.7681 -0.0242 -0.1489 -0.0247 129 TRP A CZ3 
914  C CH2 . TRP A 129 ? 1.9021 1.8610 1.7696 -0.0184 -0.1499 -0.0254 129 TRP A CH2 
915  N N   . VAL A 130 ? 1.8186 1.7809 1.5874 -0.0262 -0.1133 -0.0473 130 VAL A N   
916  C CA  . VAL A 130 ? 1.8115 1.7593 1.5656 -0.0284 -0.1041 -0.0411 130 VAL A CA  
917  C C   . VAL A 130 ? 1.8044 1.7594 1.5885 -0.0373 -0.0907 -0.0446 130 VAL A C   
918  O O   . VAL A 130 ? 1.7837 1.7285 1.5808 -0.0446 -0.0845 -0.0356 130 VAL A O   
919  C CB  . VAL A 130 ? 1.8005 1.7465 1.5129 -0.0177 -0.1016 -0.0445 130 VAL A CB  
920  C CG1 . VAL A 130 ? 1.7855 1.7164 1.4843 -0.0199 -0.0884 -0.0374 130 VAL A CG1 
921  C CG2 . VAL A 130 ? 1.8506 1.7878 1.5308 -0.0074 -0.1143 -0.0395 130 VAL A CG2 
922  N N   . LEU A 131 ? 1.8014 1.7740 1.5972 -0.0365 -0.0867 -0.0578 131 LEU A N   
923  C CA  . LEU A 131 ? 1.8388 1.8185 1.6612 -0.0426 -0.0742 -0.0626 131 LEU A CA  
924  C C   . LEU A 131 ? 1.8908 1.8707 1.7525 -0.0517 -0.0759 -0.0577 131 LEU A C   
925  O O   . LEU A 131 ? 1.9479 1.9292 1.8327 -0.0573 -0.0657 -0.0559 131 LEU A O   
926  C CB  . LEU A 131 ? 1.8577 1.8531 1.6815 -0.0390 -0.0725 -0.0793 131 LEU A CB  
927  C CG  . LEU A 131 ? 1.9418 1.9388 1.7272 -0.0283 -0.0721 -0.0870 131 LEU A CG  
928  C CD1 . LEU A 131 ? 1.9933 2.0057 1.7846 -0.0258 -0.0747 -0.1051 131 LEU A CD1 
929  C CD2 . LEU A 131 ? 1.9506 1.9364 1.7159 -0.0251 -0.0576 -0.0813 131 LEU A CD2 
930  N N   . SER A 132 ? 1.9032 1.8820 1.7715 -0.0514 -0.0886 -0.0554 132 SER A N   
931  C CA  . SER A 132 ? 1.9229 1.8996 1.8238 -0.0573 -0.0923 -0.0507 132 SER A CA  
932  C C   . SER A 132 ? 1.8840 1.8461 1.7897 -0.0621 -0.0934 -0.0380 132 SER A C   
933  O O   . SER A 132 ? 1.8747 1.8378 1.8112 -0.0683 -0.0907 -0.0353 132 SER A O   
934  C CB  . SER A 132 ? 1.9945 1.9718 1.8960 -0.0534 -0.1047 -0.0505 132 SER A CB  
935  O OG  . SER A 132 ? 2.0596 2.0522 1.9663 -0.0517 -0.1033 -0.0621 132 SER A OG  
936  N N   . PHE A 133 ? 1.8443 1.7924 1.7199 -0.0590 -0.0980 -0.0304 133 PHE A N   
937  C CA  . PHE A 133 ? 1.8262 1.7578 1.7048 -0.0648 -0.0998 -0.0184 133 PHE A CA  
938  C C   . PHE A 133 ? 1.8649 1.8000 1.7534 -0.0710 -0.0831 -0.0161 133 PHE A C   
939  O O   . PHE A 133 ? 1.8752 1.8076 1.7905 -0.0795 -0.0805 -0.0089 133 PHE A O   
940  C CB  . PHE A 133 ? 1.7950 1.7069 1.6354 -0.0590 -0.1099 -0.0110 133 PHE A CB  
941  C CG  . PHE A 133 ? 1.8023 1.7055 1.6372 -0.0535 -0.1270 -0.0086 133 PHE A CG  
942  C CD1 . PHE A 133 ? 1.7479 1.6352 1.5955 -0.0573 -0.1378 -0.0008 133 PHE A CD1 
943  C CD2 . PHE A 133 ? 1.8767 1.7878 1.6938 -0.0435 -0.1323 -0.0142 133 PHE A CD2 
944  C CE1 . PHE A 133 ? 1.7395 1.6163 1.5776 -0.0496 -0.1532 0.0015  133 PHE A CE1 
945  C CE2 . PHE A 133 ? 1.8841 1.7872 1.6948 -0.0365 -0.1459 -0.0106 133 PHE A CE2 
946  C CZ  . PHE A 133 ? 1.8154 1.7001 1.6344 -0.0387 -0.1561 -0.0027 133 PHE A CZ  
947  N N   . ALA A 134 ? 1.8500 1.7916 1.7171 -0.0658 -0.0720 -0.0220 134 ALA A N   
948  C CA  . ALA A 134 ? 1.8065 1.7515 1.6783 -0.0686 -0.0536 -0.0198 134 ALA A CA  
949  C C   . ALA A 134 ? 1.8006 1.7608 1.7156 -0.0747 -0.0454 -0.0231 134 ALA A C   
950  O O   . ALA A 134 ? 1.8610 1.8221 1.7990 -0.0817 -0.0359 -0.0148 134 ALA A O   
951  C CB  . ALA A 134 ? 1.7488 1.6978 1.5868 -0.0586 -0.0450 -0.0282 134 ALA A CB  
952  N N   . ILE A 135 ? 1.7430 1.7153 1.6699 -0.0718 -0.0491 -0.0347 135 ILE A N   
953  C CA  . ILE A 135 ? 1.7462 1.7312 1.7107 -0.0755 -0.0421 -0.0391 135 ILE A CA  
954  C C   . ILE A 135 ? 1.7284 1.7112 1.7257 -0.0823 -0.0519 -0.0320 135 ILE A C   
955  O O   . ILE A 135 ? 1.7136 1.7018 1.7407 -0.0879 -0.0449 -0.0267 135 ILE A O   
956  C CB  . ILE A 135 ? 1.7534 1.7485 1.7187 -0.0706 -0.0434 -0.0540 135 ILE A CB  
957  C CG1 . ILE A 135 ? 1.7551 1.7534 1.6914 -0.0633 -0.0341 -0.0632 135 ILE A CG1 
958  C CG2 . ILE A 135 ? 1.7670 1.7713 1.7699 -0.0736 -0.0382 -0.0578 135 ILE A CG2 
959  C CD1 . ILE A 135 ? 1.7482 1.7552 1.6863 -0.0596 -0.0364 -0.0792 135 ILE A CD1 
960  N N   . GLY A 136 ? 1.7177 1.6930 1.7089 -0.0804 -0.0683 -0.0320 136 GLY A N   
961  C CA  . GLY A 136 ? 1.6619 1.6326 1.6786 -0.0838 -0.0800 -0.0268 136 GLY A CA  
962  C C   . GLY A 136 ? 1.5897 1.5526 1.6199 -0.0912 -0.0821 -0.0152 136 GLY A C   
963  O O   . GLY A 136 ? 1.4463 1.4117 1.5091 -0.0953 -0.0868 -0.0124 136 GLY A O   
964  N N   . LEU A 137 ? 1.7044 1.6570 1.7100 -0.0928 -0.0791 -0.0086 137 LEU A N   
965  C CA  . LEU A 137 ? 1.7904 1.7332 1.8082 -0.1015 -0.0809 0.0031  137 LEU A CA  
966  C C   . LEU A 137 ? 1.9051 1.8563 1.9313 -0.1066 -0.0600 0.0078  137 LEU A C   
967  O O   . LEU A 137 ? 1.9018 1.8417 1.9230 -0.1129 -0.0572 0.0183  137 LEU A O   
968  C CB  . LEU A 137 ? 1.7404 1.6592 1.7236 -0.0998 -0.0947 0.0096  137 LEU A CB  
969  C CG  . LEU A 137 ? 1.6244 1.5317 1.5978 -0.0935 -0.1157 0.0077  137 LEU A CG  
970  C CD1 . LEU A 137 ? 1.5821 1.4642 1.5175 -0.0902 -0.1277 0.0143  137 LEU A CD1 
971  C CD2 . LEU A 137 ? 1.5305 1.4392 1.5422 -0.0981 -0.1262 0.0091  137 LEU A CD2 
972  N N   . THR A 138 ? 2.0024 1.9719 2.0402 -0.1034 -0.0448 0.0005  138 THR A N   
973  C CA  . THR A 138 ? 2.0507 2.0300 2.0976 -0.1057 -0.0228 0.0050  138 THR A CA  
974  C C   . THR A 138 ? 2.0414 2.0275 2.1327 -0.1168 -0.0193 0.0157  138 THR A C   
975  O O   . THR A 138 ? 2.0290 2.0141 2.1234 -0.1223 -0.0055 0.0262  138 THR A O   
976  C CB  . THR A 138 ? 2.0371 2.0330 2.0865 -0.0979 -0.0086 -0.0064 138 THR A CB  
977  O OG1 . THR A 138 ? 1.9997 1.9901 2.0089 -0.0886 -0.0116 -0.0164 138 THR A OG1 
978  C CG2 . THR A 138 ? 2.0628 2.0682 2.1207 -0.0981 0.0152  -0.0005 138 THR A CG2 
979  N N   . PRO A 139 ? 2.0127 2.0062 2.1393 -0.1199 -0.0316 0.0134  139 PRO A N   
980  C CA  . PRO A 139 ? 2.0389 2.0407 2.2110 -0.1306 -0.0320 0.0226  139 PRO A CA  
981  C C   . PRO A 139 ? 2.0567 2.0399 2.2232 -0.1406 -0.0403 0.0346  139 PRO A C   
982  O O   . PRO A 139 ? 2.0989 2.0890 2.3008 -0.1515 -0.0354 0.0442  139 PRO A O   
983  C CB  . PRO A 139 ? 2.0122 2.0180 2.2094 -0.1288 -0.0503 0.0162  139 PRO A CB  
984  C CG  . PRO A 139 ? 1.9690 1.9781 2.1460 -0.1175 -0.0479 0.0037  139 PRO A CG  
985  C CD  . PRO A 139 ? 1.9780 1.9744 2.1067 -0.1130 -0.0438 0.0021  139 PRO A CD  
986  N N   . MET A 140 ? 2.0667 2.0265 2.1903 -0.1369 -0.0526 0.0340  140 MET A N   
987  C CA  . MET A 140 ? 2.1234 2.0604 2.2346 -0.1450 -0.0613 0.0447  140 MET A CA  
988  C C   . MET A 140 ? 2.1333 2.0649 2.2231 -0.1470 -0.0400 0.0534  140 MET A C   
989  O O   . MET A 140 ? 2.1133 2.0246 2.1918 -0.1544 -0.0428 0.0637  140 MET A O   
990  C CB  . MET A 140 ? 2.2033 2.1159 2.2747 -0.1379 -0.0833 0.0411  140 MET A CB  
991  C CG  . MET A 140 ? 2.2398 2.1524 2.3280 -0.1348 -0.1049 0.0347  140 MET A CG  
992  S SD  . MET A 140 ? 1.9305 1.8104 1.9744 -0.1272 -0.1308 0.0347  140 MET A SD  
993  C CE  . MET A 140 ? 1.6092 1.4646 1.6531 -0.1404 -0.1366 0.0477  140 MET A CE  
994  N N   . LEU A 141 ? 2.1770 2.1247 2.2590 -0.1395 -0.0189 0.0491  141 LEU A N   
995  C CA  . LEU A 141 ? 2.2685 2.2116 2.3273 -0.1382 0.0035  0.0570  141 LEU A CA  
996  C C   . LEU A 141 ? 2.2921 2.2515 2.3952 -0.1484 0.0234  0.0684  141 LEU A C   
997  O O   . LEU A 141 ? 2.3037 2.2596 2.3940 -0.1485 0.0446  0.0782  141 LEU A O   
998  C CB  . LEU A 141 ? 2.3114 2.2616 2.3355 -0.1229 0.0155  0.0460  141 LEU A CB  
999  C CG  . LEU A 141 ? 2.3128 2.2523 2.2967 -0.1125 -0.0018 0.0343  141 LEU A CG  
1000 C CD1 . LEU A 141 ? 2.3078 2.2578 2.2664 -0.0991 0.0094  0.0223  141 LEU A CD1 
1001 C CD2 . LEU A 141 ? 2.3343 2.2463 2.2782 -0.1120 -0.0114 0.0414  141 LEU A CD2 
1002 N N   . GLY A 142 ? 2.3164 2.2944 2.4718 -0.1558 0.0168  0.0676  142 GLY A N   
1003 C CA  . GLY A 142 ? 2.3229 2.3211 2.5282 -0.1659 0.0339  0.0784  142 GLY A CA  
1004 C C   . GLY A 142 ? 2.2292 2.2578 2.4747 -0.1616 0.0390  0.0708  142 GLY A C   
1005 O O   . GLY A 142 ? 2.2046 2.2544 2.5007 -0.1698 0.0481  0.0783  142 GLY A O   
1006 N N   . TRP A 143 ? 2.1614 2.1923 2.3851 -0.1488 0.0330  0.0559  143 TRP A N   
1007 C CA  . TRP A 143 ? 2.0777 2.1329 2.3321 -0.1426 0.0375  0.0473  143 TRP A CA  
1008 C C   . TRP A 143 ? 1.9761 2.0353 2.2653 -0.1475 0.0134  0.0433  143 TRP A C   
1009 O O   . TRP A 143 ? 1.9509 2.0058 2.2275 -0.1397 -0.0008 0.0315  143 TRP A O   
1010 C CB  . TRP A 143 ? 2.1546 2.2072 2.3701 -0.1275 0.0409  0.0328  143 TRP A CB  
1011 C CG  . TRP A 143 ? 2.2111 2.2854 2.4495 -0.1192 0.0524  0.0248  143 TRP A CG  
1012 C CD1 . TRP A 143 ? 2.2173 2.3054 2.4942 -0.1196 0.0430  0.0201  143 TRP A CD1 
1013 C CD2 . TRP A 143 ? 2.2541 2.3360 2.4746 -0.1076 0.0748  0.0200  143 TRP A CD2 
1014 N NE1 . TRP A 143 ? 2.2353 2.3391 2.5201 -0.1094 0.0588  0.0130  143 TRP A NE1 
1015 C CE2 . TRP A 143 ? 2.2606 2.3604 2.5109 -0.1019 0.0780  0.0125  143 TRP A CE2 
1016 C CE3 . TRP A 143 ? 2.2744 2.3480 2.4540 -0.0999 0.0917  0.0208  143 TRP A CE3 
1017 C CZ2 . TRP A 143 ? 2.2566 2.3652 2.4970 -0.0891 0.0974  0.0058  143 TRP A CZ2 
1018 C CZ3 . TRP A 143 ? 2.2782 2.3609 2.4477 -0.0868 0.1104  0.0139  143 TRP A CZ3 
1019 C CH2 . TRP A 143 ? 2.2636 2.3633 2.4633 -0.0817 0.1130  0.0063  143 TRP A CH2 
1020 N N   . ASN A 144 ? 1.9547 2.0218 2.2880 -0.1602 0.0087  0.0532  144 ASN A N   
1021 C CA  . ASN A 144 ? 1.9337 2.0029 2.2993 -0.1641 -0.0163 0.0496  144 ASN A CA  
1022 C C   . ASN A 144 ? 1.9704 2.0661 2.4004 -0.1734 -0.0125 0.0569  144 ASN A C   
1023 O O   . ASN A 144 ? 1.9872 2.0986 2.4391 -0.1794 0.0099  0.0675  144 ASN A O   
1024 C CB  . ASN A 144 ? 1.8936 1.9334 2.2362 -0.1701 -0.0413 0.0516  144 ASN A CB  
1025 C CG  . ASN A 144 ? 1.9173 1.9456 2.2607 -0.1836 -0.0356 0.0655  144 ASN A CG  
1026 O OD1 . ASN A 144 ? 2.0209 2.0659 2.4099 -0.1951 -0.0264 0.0752  144 ASN A OD1 
1027 N ND2 . ASN A 144 ? 1.8739 1.8735 2.1674 -0.1823 -0.0406 0.0671  144 ASN A ND2 
1028 N N   . ASN A 145 ? 1.9062 2.0076 2.3666 -0.1735 -0.0343 0.0515  145 ASN A N   
1029 C CA  . ASN A 145 ? 1.7919 1.9202 2.3165 -0.1815 -0.0354 0.0567  145 ASN A CA  
1030 C C   . ASN A 145 ? 1.7665 1.8829 2.3139 -0.1945 -0.0628 0.0607  145 ASN A C   
1031 O O   . ASN A 145 ? 1.7862 1.9148 2.3727 -0.1948 -0.0807 0.0568  145 ASN A O   
1032 C CB  . ASN A 145 ? 1.7133 1.8621 2.2610 -0.1690 -0.0374 0.0465  145 ASN A CB  
1033 C CG  . ASN A 145 ? 1.6594 1.8253 2.1991 -0.1579 -0.0084 0.0440  145 ASN A CG  
1034 O OD1 . ASN A 145 ? 1.6734 1.8422 2.2008 -0.1602 0.0152  0.0515  145 ASN A OD1 
1035 N ND2 . ASN A 145 ? 1.6022 1.7774 2.1467 -0.1448 -0.0101 0.0335  145 ASN A ND2 
1036 N N   . CYS A 146 ? 1.7463 1.8371 2.2674 -0.2042 -0.0668 0.0679  146 CYS A N   
1037 C CA  . CYS A 146 ? 1.7869 1.8607 2.3240 -0.2169 -0.0936 0.0714  146 CYS A CA  
1038 C C   . CYS A 146 ? 1.8459 1.9438 2.4483 -0.2344 -0.0874 0.0827  146 CYS A C   
1039 O O   . CYS A 146 ? 1.8660 1.9666 2.4738 -0.2450 -0.0654 0.0953  146 CYS A O   
1040 C CB  . CYS A 146 ? 1.8407 1.8760 2.3243 -0.2204 -0.0997 0.0753  146 CYS A CB  
1041 S SG  . CYS A 146 ? 2.3699 2.3773 2.7802 -0.2010 -0.1104 0.0630  146 CYS A SG  
1042 N N   . GLY A 147 ? 1.8729 1.9888 2.5255 -0.2368 -0.1066 0.0784  147 GLY A N   
1043 C CA  . GLY A 147 ? 1.8584 2.0003 2.5802 -0.2540 -0.1047 0.0881  147 GLY A CA  
1044 C C   . GLY A 147 ? 1.8433 2.0303 2.6107 -0.2508 -0.0763 0.0922  147 GLY A C   
1045 O O   . GLY A 147 ? 1.8355 2.0491 2.6604 -0.2651 -0.0654 0.1034  147 GLY A O   
1046 N N   . GLN A 148 ? 1.8583 2.0538 2.6008 -0.2317 -0.0641 0.0835  148 GLN A N   
1047 C CA  . GLN A 148 ? 1.9368 2.1723 2.7157 -0.2249 -0.0374 0.0859  148 GLN A CA  
1048 C C   . GLN A 148 ? 2.0504 2.3172 2.8934 -0.2247 -0.0533 0.0819  148 GLN A C   
1049 O O   . GLN A 148 ? 2.1252 2.3805 2.9630 -0.2176 -0.0827 0.0703  148 GLN A O   
1050 C CB  . GLN A 148 ? 1.9020 2.1329 2.6322 -0.2044 -0.0217 0.0765  148 GLN A CB  
1051 C CG  . GLN A 148 ? 1.9644 2.1725 2.6371 -0.2029 -0.0014 0.0806  148 GLN A CG  
1052 C CD  . GLN A 148 ? 2.0299 2.2548 2.7240 -0.2123 0.0297  0.0968  148 GLN A CD  
1053 O OE1 . GLN A 148 ? 2.0027 2.2629 2.7520 -0.2151 0.0443  0.1038  148 GLN A OE1 
1054 N NE2 . GLN A 148 ? 2.1198 2.3194 2.7694 -0.2161 0.0408  0.1035  148 GLN A NE2 
1055 N N   . PRO A 149 ? 2.0020 2.3089 2.9052 -0.2311 -0.0333 0.0919  149 PRO A N   
1056 C CA  . PRO A 149 ? 1.9011 2.2443 2.8727 -0.2310 -0.0458 0.0894  149 PRO A CA  
1057 C C   . PRO A 149 ? 1.8038 2.1482 2.7597 -0.2089 -0.0588 0.0734  149 PRO A C   
1058 O O   . PRO A 149 ? 1.7611 2.0915 2.7170 -0.2064 -0.0922 0.0637  149 PRO A O   
1059 C CB  . PRO A 149 ? 1.9020 2.2875 2.9204 -0.2338 -0.0094 0.1028  149 PRO A CB  
1060 C CG  . PRO A 149 ? 1.9354 2.3031 2.9259 -0.2456 0.0136  0.1163  149 PRO A CG  
1061 C CD  . PRO A 149 ? 1.9873 2.3079 2.8955 -0.2371 0.0044  0.1069  149 PRO A CD  
1062 N N   . GLY A 158 ? 2.8269 2.8820 3.7497 -0.2656 -0.4547 0.0140  158 GLY A N   
1063 C CA  . GLY A 158 ? 2.8262 2.8606 3.6769 -0.2398 -0.4448 0.0093  158 GLY A CA  
1064 C C   . GLY A 158 ? 2.8826 2.8620 3.6573 -0.2360 -0.4534 0.0098  158 GLY A C   
1065 O O   . GLY A 158 ? 2.9159 2.8590 3.6530 -0.2219 -0.4863 0.0002  158 GLY A O   
1066 N N   . CYS A 159 ? 2.8681 2.8408 3.6184 -0.2470 -0.4236 0.0211  159 CYS A N   
1067 C CA  . CYS A 159 ? 2.8564 2.7797 3.5343 -0.2432 -0.4280 0.0227  159 CYS A CA  
1068 C C   . CYS A 159 ? 2.7896 2.6958 3.4796 -0.2691 -0.4277 0.0329  159 CYS A C   
1069 O O   . CYS A 159 ? 2.8204 2.6815 3.4564 -0.2683 -0.4384 0.0339  159 CYS A O   
1070 C CB  . CYS A 159 ? 2.8519 2.7754 3.4774 -0.2299 -0.3947 0.0262  159 CYS A CB  
1071 S SG  . CYS A 159 ? 2.7351 2.6723 3.3399 -0.2000 -0.3926 0.0155  159 CYS A SG  
1072 N N   . GLY A 160 ? 2.6924 2.6344 3.4533 -0.2915 -0.4143 0.0410  160 GLY A N   
1073 C CA  . GLY A 160 ? 2.6536 2.5825 3.4344 -0.3181 -0.4109 0.0524  160 GLY A CA  
1074 C C   . GLY A 160 ? 2.5778 2.5101 3.3351 -0.3249 -0.3679 0.0667  160 GLY A C   
1075 O O   . GLY A 160 ? 2.5089 2.4479 3.2257 -0.3077 -0.3445 0.0660  160 GLY A O   
1076 N N   . GLU A 161 ? 2.5944 2.5212 3.3771 -0.3496 -0.3580 0.0795  161 GLU A N   
1077 C CA  . GLU A 161 ? 2.5711 2.4981 3.3310 -0.3561 -0.3175 0.0941  161 GLU A CA  
1078 C C   . GLU A 161 ? 2.4964 2.3756 3.1651 -0.3413 -0.3177 0.0925  161 GLU A C   
1079 O O   . GLU A 161 ? 2.5144 2.3493 3.1466 -0.3388 -0.3487 0.0866  161 GLU A O   
1080 C CB  . GLU A 161 ? 2.6539 2.5825 3.4630 -0.3863 -0.3080 0.1093  161 GLU A CB  
1081 C CG  . GLU A 161 ? 2.7694 2.6480 3.5646 -0.3998 -0.3421 0.1080  161 GLU A CG  
1082 C CD  . GLU A 161 ? 2.8803 2.7621 3.7315 -0.4317 -0.3321 0.1236  161 GLU A CD  
1083 O OE1 . GLU A 161 ? 2.9460 2.7822 3.7804 -0.4447 -0.3537 0.1253  161 GLU A OE1 
1084 O OE2 . GLU A 161 ? 2.9059 2.8350 3.8176 -0.4434 -0.3020 0.1347  161 GLU A OE2 
1085 N N   . GLY A 162 ? 2.4124 2.3011 3.0445 -0.3304 -0.2837 0.0972  162 GLY A N   
1086 C CA  . GLY A 162 ? 2.3447 2.1954 2.8935 -0.3147 -0.2812 0.0954  162 GLY A CA  
1087 C C   . GLY A 162 ? 2.2754 2.1320 2.7876 -0.2883 -0.2858 0.0825  162 GLY A C   
1088 O O   . GLY A 162 ? 2.2627 2.1211 2.7316 -0.2753 -0.2631 0.0830  162 GLY A O   
1089 N N   . GLN A 163 ? 2.2229 2.0817 2.7526 -0.2803 -0.3158 0.0709  163 GLN A N   
1090 C CA  . GLN A 163 ? 2.1327 1.9957 2.6315 -0.2554 -0.3215 0.0592  163 GLN A CA  
1091 C C   . GLN A 163 ? 2.0313 1.9441 2.5777 -0.2517 -0.3028 0.0569  163 GLN A C   
1092 O O   . GLN A 163 ? 2.0725 2.0147 2.6851 -0.2649 -0.3039 0.0592  163 GLN A O   
1093 C CB  . GLN A 163 ? 2.1487 1.9834 2.6332 -0.2447 -0.3633 0.0480  163 GLN A CB  
1094 C CG  . GLN A 163 ? 2.1882 1.9696 2.6162 -0.2432 -0.3838 0.0486  163 GLN A CG  
1095 C CD  . GLN A 163 ? 2.2291 1.9815 2.6410 -0.2302 -0.4254 0.0372  163 GLN A CD  
1096 O OE1 . GLN A 163 ? 2.2648 2.0370 2.7143 -0.2251 -0.4412 0.0292  163 GLN A OE1 
1097 N NE2 . GLN A 163 ? 2.2345 1.9386 2.5879 -0.2228 -0.4435 0.0363  163 GLN A NE2 
1098 N N   . VAL A 164 ? 1.8735 1.7956 2.3871 -0.2336 -0.2859 0.0524  164 VAL A N   
1099 C CA  . VAL A 164 ? 1.6958 1.6605 2.2461 -0.2275 -0.2675 0.0496  164 VAL A CA  
1100 C C   . VAL A 164 ? 1.6626 1.6245 2.1937 -0.2054 -0.2838 0.0371  164 VAL A C   
1101 O O   . VAL A 164 ? 1.6941 1.6263 2.1681 -0.1914 -0.2929 0.0327  164 VAL A O   
1102 C CB  . VAL A 164 ? 1.5121 1.4935 2.0454 -0.2262 -0.2283 0.0556  164 VAL A CB  
1103 C CG1 . VAL A 164 ? 1.3554 1.3772 1.9228 -0.2181 -0.2104 0.0517  164 VAL A CG1 
1104 C CG2 . VAL A 164 ? 1.5210 1.5045 2.0714 -0.2462 -0.2094 0.0694  164 VAL A CG2 
1105 N N   . ALA A 165 ? 1.6179 1.6108 2.1969 -0.2017 -0.2867 0.0323  165 ALA A N   
1106 C CA  . ALA A 165 ? 1.6188 1.6099 2.1819 -0.1801 -0.2993 0.0215  165 ALA A CA  
1107 C C   . ALA A 165 ? 1.6855 1.6738 2.2013 -0.1664 -0.2759 0.0199  165 ALA A C   
1108 O O   . ALA A 165 ? 1.6457 1.6624 2.1781 -0.1658 -0.2490 0.0211  165 ALA A O   
1109 C CB  . ALA A 165 ? 1.6069 1.6351 2.2308 -0.1784 -0.3011 0.0176  165 ALA A CB  
1110 N N   . CYS A 166 ? 1.7742 1.7282 2.2315 -0.1551 -0.2867 0.0171  166 CYS A N   
1111 C CA  . CYS A 166 ? 1.7474 1.6969 2.1591 -0.1437 -0.2669 0.0157  166 CYS A CA  
1112 C C   . CYS A 166 ? 1.6554 1.6190 2.0716 -0.1272 -0.2629 0.0081  166 CYS A C   
1113 O O   . CYS A 166 ? 1.6276 1.5715 2.0163 -0.1115 -0.2795 0.0027  166 CYS A O   
1114 C CB  . CYS A 166 ? 1.7854 1.6960 2.1365 -0.1359 -0.2801 0.0157  166 CYS A CB  
1115 S SG  . CYS A 166 ? 2.7385 2.6456 3.0366 -0.1256 -0.2555 0.0151  166 CYS A SG  
1116 N N   . LEU A 167 ? 1.6087 1.6049 2.0580 -0.1300 -0.2399 0.0082  167 LEU A N   
1117 C CA  . LEU A 167 ? 1.5809 1.5901 2.0343 -0.1152 -0.2326 0.0013  167 LEU A CA  
1118 C C   . LEU A 167 ? 1.4746 1.4947 1.9097 -0.1144 -0.2021 0.0014  167 LEU A C   
1119 O O   . LEU A 167 ? 1.3594 1.3987 1.8134 -0.1254 -0.1817 0.0062  167 LEU A O   
1120 C CB  . LEU A 167 ? 1.7263 1.7648 2.2383 -0.1162 -0.2357 -0.0004 167 LEU A CB  
1121 C CG  . LEU A 167 ? 1.8307 1.8637 2.3709 -0.1200 -0.2666 -0.0009 167 LEU A CG  
1122 C CD1 . LEU A 167 ? 1.8055 1.8719 2.4053 -0.1191 -0.2685 -0.0034 167 LEU A CD1 
1123 C CD2 . LEU A 167 ? 1.8765 1.8746 2.3758 -0.1045 -0.2936 -0.0064 167 LEU A CD2 
1124 N N   . PHE A 168 ? 1.5800 1.5868 1.9780 -0.1010 -0.1993 -0.0039 168 PHE A N   
1125 C CA  . PHE A 168 ? 1.7294 1.7415 2.1041 -0.0998 -0.1745 -0.0054 168 PHE A CA  
1126 C C   . PHE A 168 ? 1.7880 1.8305 2.1964 -0.1045 -0.1505 -0.0053 168 PHE A C   
1127 O O   . PHE A 168 ? 1.7804 1.8300 2.1818 -0.1123 -0.1317 -0.0018 168 PHE A O   
1128 C CB  . PHE A 168 ? 1.8126 1.8116 2.1572 -0.0847 -0.1756 -0.0120 168 PHE A CB  
1129 C CG  . PHE A 168 ? 1.8564 1.8572 2.1740 -0.0841 -0.1546 -0.0147 168 PHE A CG  
1130 C CD1 . PHE A 168 ? 1.8689 1.8553 2.1486 -0.0871 -0.1534 -0.0124 168 PHE A CD1 
1131 C CD2 . PHE A 168 ? 1.8769 1.8930 2.2064 -0.0796 -0.1371 -0.0204 168 PHE A CD2 
1132 C CE1 . PHE A 168 ? 1.9019 1.8912 2.1582 -0.0861 -0.1363 -0.0161 168 PHE A CE1 
1133 C CE2 . PHE A 168 ? 1.8783 1.8947 2.1833 -0.0791 -0.1201 -0.0244 168 PHE A CE2 
1134 C CZ  . PHE A 168 ? 1.9080 1.9120 2.1773 -0.0825 -0.1202 -0.0225 168 PHE A CZ  
1135 N N   . GLU A 169 ? 1.8409 1.9002 2.2834 -0.0980 -0.1510 -0.0090 169 GLU A N   
1136 C CA  . GLU A 169 ? 1.8674 1.9553 2.3405 -0.0990 -0.1282 -0.0093 169 GLU A CA  
1137 C C   . GLU A 169 ? 1.8258 1.9347 2.3360 -0.1134 -0.1203 -0.0005 169 GLU A C   
1138 O O   . GLU A 169 ? 1.7674 1.8975 2.2931 -0.1156 -0.0964 0.0018  169 GLU A O   
1139 C CB  . GLU A 169 ? 1.9263 2.0257 2.4256 -0.0865 -0.1320 -0.0153 169 GLU A CB  
1140 C CG  . GLU A 169 ? 1.9951 2.1015 2.5322 -0.0868 -0.1547 -0.0138 169 GLU A CG  
1141 C CD  . GLU A 169 ? 2.0510 2.1276 2.5617 -0.0827 -0.1826 -0.0150 169 GLU A CD  
1142 O OE1 . GLU A 169 ? 2.0622 2.1150 2.5282 -0.0749 -0.1834 -0.0179 169 GLU A OE1 
1143 O OE2 . GLU A 169 ? 2.0569 2.1341 2.5921 -0.0868 -0.2039 -0.0131 169 GLU A OE2 
1144 N N   . ASP A 170 ? 1.8520 1.9538 2.3760 -0.1227 -0.1401 0.0045  170 ASP A N   
1145 C CA  . ASP A 170 ? 1.8594 1.9805 2.4247 -0.1382 -0.1348 0.0138  170 ASP A CA  
1146 C C   . ASP A 170 ? 1.8040 1.9125 2.3432 -0.1503 -0.1235 0.0218  170 ASP A C   
1147 O O   . ASP A 170 ? 1.8285 1.9550 2.3933 -0.1612 -0.1056 0.0305  170 ASP A O   
1148 C CB  . ASP A 170 ? 1.9169 2.0376 2.5168 -0.1433 -0.1634 0.0145  170 ASP A CB  
1149 C CG  . ASP A 170 ? 1.9673 2.1052 2.6000 -0.1312 -0.1734 0.0076  170 ASP A CG  
1150 O OD1 . ASP A 170 ? 1.9914 2.1435 2.6245 -0.1203 -0.1555 0.0034  170 ASP A OD1 
1151 O OD2 . ASP A 170 ? 1.9832 2.1191 2.6400 -0.1317 -0.1999 0.0058  170 ASP A OD2 
1152 N N   . VAL A 171 ? 1.6937 1.7712 2.1814 -0.1472 -0.1333 0.0196  171 VAL A N   
1153 C CA  . VAL A 171 ? 1.5963 1.6581 2.0535 -0.1564 -0.1251 0.0267  171 VAL A CA  
1154 C C   . VAL A 171 ? 1.5481 1.6097 1.9677 -0.1495 -0.1012 0.0241  171 VAL A C   
1155 O O   . VAL A 171 ? 1.4453 1.5019 1.8453 -0.1556 -0.0867 0.0304  171 VAL A O   
1156 C CB  . VAL A 171 ? 1.5603 1.5875 1.9816 -0.1566 -0.1505 0.0264  171 VAL A CB  
1157 C CG1 . VAL A 171 ? 1.5877 1.6116 2.0438 -0.1638 -0.1762 0.0283  171 VAL A CG1 
1158 C CG2 . VAL A 171 ? 1.5653 1.5761 1.9463 -0.1404 -0.1594 0.0173  171 VAL A CG2 
1159 N N   . VAL A 172 ? 1.6251 1.6909 2.0341 -0.1364 -0.0978 0.0145  172 VAL A N   
1160 C CA  . VAL A 172 ? 1.6654 1.7305 2.0402 -0.1293 -0.0784 0.0097  172 VAL A CA  
1161 C C   . VAL A 172 ? 1.6908 1.7820 2.0914 -0.1246 -0.0564 0.0070  172 VAL A C   
1162 O O   . VAL A 172 ? 1.6992 1.8019 2.1258 -0.1180 -0.0605 0.0020  172 VAL A O   
1163 C CB  . VAL A 172 ? 1.6439 1.6901 1.9812 -0.1181 -0.0901 0.0005  172 VAL A CB  
1164 C CG1 . VAL A 172 ? 1.6404 1.6874 1.9467 -0.1120 -0.0717 -0.0057 172 VAL A CG1 
1165 C CG2 . VAL A 172 ? 1.6387 1.6587 1.9466 -0.1200 -0.1106 0.0035  172 VAL A CG2 
1166 N N   . PRO A 173 ? 1.6447 1.7439 2.0355 -0.1263 -0.0329 0.0105  173 PRO A N   
1167 C CA  . PRO A 173 ? 1.6588 1.7804 2.0673 -0.1200 -0.0096 0.0084  173 PRO A CA  
1168 C C   . PRO A 173 ? 1.6926 1.8109 2.0841 -0.1067 -0.0092 -0.0049 173 PRO A C   
1169 O O   . PRO A 173 ? 1.6580 1.7563 2.0131 -0.1031 -0.0194 -0.0116 173 PRO A O   
1170 C CB  . PRO A 173 ? 1.5824 1.7020 1.9642 -0.1219 0.0118  0.0137  173 PRO A CB  
1171 C CG  . PRO A 173 ? 1.5434 1.6470 1.9146 -0.1336 0.0011  0.0230  173 PRO A CG  
1172 C CD  . PRO A 173 ? 1.5607 1.6457 1.9203 -0.1331 -0.0270 0.0174  173 PRO A CD  
1173 N N   . MET A 174 ? 1.7623 1.8997 2.1805 -0.0995 0.0029  -0.0081 174 MET A N   
1174 C CA  . MET A 174 ? 1.7899 1.9225 2.1938 -0.0871 0.0047  -0.0205 174 MET A CA  
1175 C C   . MET A 174 ? 1.7999 1.9290 2.1705 -0.0811 0.0243  -0.0264 174 MET A C   
1176 O O   . MET A 174 ? 1.7994 1.9141 2.1408 -0.0747 0.0215  -0.0372 174 MET A O   
1177 C CB  . MET A 174 ? 1.8194 1.9712 2.2644 -0.0800 0.0071  -0.0222 174 MET A CB  
1178 C CG  . MET A 174 ? 1.8248 1.9776 2.2991 -0.0824 -0.0156 -0.0197 174 MET A CG  
1179 S SD  . MET A 174 ? 2.8743 2.9961 3.3139 -0.0782 -0.0395 -0.0273 174 MET A SD  
1180 C CE  . MET A 174 ? 0.8202 0.9363 1.2421 -0.0643 -0.0274 -0.0398 174 MET A CE  
1181 N N   . ASN A 175 ? 1.8298 1.9718 2.2051 -0.0827 0.0440  -0.0191 175 ASN A N   
1182 C CA  . ASN A 175 ? 1.8937 2.0314 2.2346 -0.0752 0.0626  -0.0243 175 ASN A CA  
1183 C C   . ASN A 175 ? 1.9516 2.0665 2.2447 -0.0771 0.0539  -0.0293 175 ASN A C   
1184 O O   . ASN A 175 ? 2.0042 2.1109 2.2643 -0.0692 0.0614  -0.0390 175 ASN A O   
1185 C CB  . ASN A 175 ? 1.9029 2.0571 2.2562 -0.0761 0.0858  -0.0128 175 ASN A CB  
1186 C CG  . ASN A 175 ? 1.9178 2.0697 2.2755 -0.0899 0.0822  0.0011  175 ASN A CG  
1187 O OD1 . ASN A 175 ? 1.8728 2.0116 2.2271 -0.0983 0.0608  0.0019  175 ASN A OD1 
1188 N ND2 . ASN A 175 ? 1.9731 2.1357 2.3368 -0.0914 0.1038  0.0125  175 ASN A ND2 
1189 N N   . TYR A 176 ? 1.9064 2.0113 2.1963 -0.0867 0.0371  -0.0232 176 TYR A N   
1190 C CA  . TYR A 176 ? 1.8596 1.9445 2.1065 -0.0878 0.0271  -0.0271 176 TYR A CA  
1191 C C   . TYR A 176 ? 1.7055 1.7795 1.9386 -0.0826 0.0134  -0.0395 176 TYR A C   
1192 O O   . TYR A 176 ? 1.7416 1.8083 1.9447 -0.0770 0.0167  -0.0496 176 TYR A O   
1193 C CB  . TYR A 176 ? 1.9636 2.0394 2.2103 -0.0983 0.0132  -0.0163 176 TYR A CB  
1194 C CG  . TYR A 176 ? 2.0600 2.1155 2.2661 -0.0979 -0.0011 -0.0203 176 TYR A CG  
1195 C CD1 . TYR A 176 ? 2.1312 2.1778 2.2994 -0.0966 0.0060  -0.0194 176 TYR A CD1 
1196 C CD2 . TYR A 176 ? 2.0753 2.1209 2.2802 -0.0972 -0.0212 -0.0245 176 TYR A CD2 
1197 C CE1 . TYR A 176 ? 2.1665 2.1972 2.2990 -0.0950 -0.0073 -0.0231 176 TYR A CE1 
1198 C CE2 . TYR A 176 ? 2.1326 2.1622 2.3021 -0.0957 -0.0330 -0.0272 176 TYR A CE2 
1199 C CZ  . TYR A 176 ? 2.1704 2.1937 2.3050 -0.0948 -0.0263 -0.0267 176 TYR A CZ  
1200 O OH  . TYR A 176 ? 2.1818 2.1917 2.2826 -0.0922 -0.0382 -0.0294 176 TYR A OH  
1201 N N   . MET A 177 ? 1.5359 1.6085 1.7917 -0.0844 -0.0020 -0.0387 177 MET A N   
1202 C CA  . MET A 177 ? 1.4034 1.4641 1.6480 -0.0799 -0.0147 -0.0478 177 MET A CA  
1203 C C   . MET A 177 ? 1.4298 1.4928 1.6735 -0.0716 -0.0042 -0.0595 177 MET A C   
1204 O O   . MET A 177 ? 1.5587 1.6105 1.7876 -0.0686 -0.0109 -0.0681 177 MET A O   
1205 C CB  . MET A 177 ? 1.2579 1.3160 1.5270 -0.0809 -0.0317 -0.0436 177 MET A CB  
1206 C CG  . MET A 177 ? 1.1399 1.1892 1.4041 -0.0880 -0.0471 -0.0341 177 MET A CG  
1207 S SD  . MET A 177 ? 3.5238 3.5665 3.8107 -0.0857 -0.0692 -0.0315 177 MET A SD  
1208 C CE  . MET A 177 ? 2.4528 2.4815 2.7174 -0.0760 -0.0735 -0.0413 177 MET A CE  
1209 N N   . VAL A 178 ? 1.3251 1.4018 1.5844 -0.0678 0.0126  -0.0596 178 VAL A N   
1210 C CA  . VAL A 178 ? 1.3509 1.4274 1.6071 -0.0586 0.0229  -0.0711 178 VAL A CA  
1211 C C   . VAL A 178 ? 1.5227 1.5942 1.7441 -0.0550 0.0340  -0.0789 178 VAL A C   
1212 O O   . VAL A 178 ? 1.6245 1.6834 1.8227 -0.0529 0.0288  -0.0901 178 VAL A O   
1213 C CB  . VAL A 178 ? 1.2843 1.3777 1.5742 -0.0528 0.0354  -0.0684 178 VAL A CB  
1214 C CG1 . VAL A 178 ? 1.2227 1.3126 1.5017 -0.0418 0.0477  -0.0807 178 VAL A CG1 
1215 C CG2 . VAL A 178 ? 1.2661 1.3631 1.5890 -0.0535 0.0222  -0.0642 178 VAL A CG2 
1216 N N   . TYR A 179 ? 1.6003 1.6814 1.8184 -0.0538 0.0491  -0.0728 179 TYR A N   
1217 C CA  . TYR A 179 ? 1.7747 1.8505 1.9573 -0.0475 0.0605  -0.0800 179 TYR A CA  
1218 C C   . TYR A 179 ? 1.8343 1.8978 1.9828 -0.0521 0.0494  -0.0818 179 TYR A C   
1219 O O   . TYR A 179 ? 1.8582 1.9114 1.9820 -0.0490 0.0434  -0.0945 179 TYR A O   
1220 C CB  . TYR A 179 ? 1.8683 1.9569 2.0554 -0.0434 0.0815  -0.0707 179 TYR A CB  
1221 C CG  . TYR A 179 ? 1.9234 2.0262 2.1401 -0.0355 0.0956  -0.0702 179 TYR A CG  
1222 C CD1 . TYR A 179 ? 1.9623 2.0614 2.1623 -0.0221 0.1077  -0.0816 179 TYR A CD1 
1223 C CD2 . TYR A 179 ? 1.9335 2.0533 2.1946 -0.0406 0.0958  -0.0587 179 TYR A CD2 
1224 C CE1 . TYR A 179 ? 1.9867 2.0984 2.2118 -0.0129 0.1211  -0.0810 179 TYR A CE1 
1225 C CE2 . TYR A 179 ? 1.9411 2.0763 2.2305 -0.0320 0.1086  -0.0580 179 TYR A CE2 
1226 C CZ  . TYR A 179 ? 1.9672 2.0983 2.2378 -0.0178 0.1220  -0.0688 179 TYR A CZ  
1227 O OH  . TYR A 179 ? 1.9475 2.0935 2.2444 -0.0074 0.1352  -0.0679 179 TYR A OH  
1228 N N   . PHE A 180 ? 1.8322 1.8970 1.9805 -0.0594 0.0464  -0.0691 180 PHE A N   
1229 C CA  . PHE A 180 ? 1.8057 1.8593 1.9200 -0.0622 0.0372  -0.0691 180 PHE A CA  
1230 C C   . PHE A 180 ? 1.7951 1.8396 1.9044 -0.0654 0.0173  -0.0756 180 PHE A C   
1231 O O   . PHE A 180 ? 1.8720 1.9098 1.9555 -0.0622 0.0124  -0.0865 180 PHE A O   
1232 C CB  . PHE A 180 ? 1.8141 1.8682 1.9312 -0.0695 0.0381  -0.0531 180 PHE A CB  
1233 C CG  . PHE A 180 ? 1.8743 1.9157 1.9532 -0.0703 0.0304  -0.0521 180 PHE A CG  
1234 C CD1 . PHE A 180 ? 1.9197 1.9575 1.9657 -0.0639 0.0429  -0.0525 180 PHE A CD1 
1235 C CD2 . PHE A 180 ? 1.8995 1.9320 1.9735 -0.0755 0.0111  -0.0506 180 PHE A CD2 
1236 C CE1 . PHE A 180 ? 1.9452 1.9712 1.9547 -0.0630 0.0354  -0.0517 180 PHE A CE1 
1237 C CE2 . PHE A 180 ? 1.9285 1.9502 1.9669 -0.0746 0.0042  -0.0496 180 PHE A CE2 
1238 C CZ  . PHE A 180 ? 1.9434 1.9620 1.9499 -0.0685 0.0160  -0.0503 180 PHE A CZ  
1239 N N   . ASN A 181 ? 1.6977 1.7422 1.8320 -0.0712 0.0059  -0.0686 181 ASN A N   
1240 C CA  . ASN A 181 ? 1.6201 1.6553 1.7492 -0.0732 -0.0117 -0.0716 181 ASN A CA  
1241 C C   . ASN A 181 ? 1.5277 1.5601 1.6591 -0.0692 -0.0131 -0.0846 181 ASN A C   
1242 O O   . ASN A 181 ? 1.6133 1.6405 1.7226 -0.0680 -0.0175 -0.0934 181 ASN A O   
1243 C CB  . ASN A 181 ? 1.6215 1.6552 1.7748 -0.0779 -0.0235 -0.0611 181 ASN A CB  
1244 C CG  . ASN A 181 ? 1.6075 1.6298 1.7504 -0.0780 -0.0406 -0.0620 181 ASN A CG  
1245 O OD1 . ASN A 181 ? 1.6249 1.6429 1.7466 -0.0757 -0.0431 -0.0698 181 ASN A OD1 
1246 N ND2 . ASN A 181 ? 1.6175 1.6353 1.7759 -0.0798 -0.0527 -0.0539 181 ASN A ND2 
1247 N N   . PHE A 182 ? 1.3802 1.4160 1.5394 -0.0671 -0.0097 -0.0858 182 PHE A N   
1248 C CA  . PHE A 182 ? 1.4201 1.4496 1.5833 -0.0637 -0.0112 -0.0968 182 PHE A CA  
1249 C C   . PHE A 182 ? 1.4723 1.4993 1.6143 -0.0598 -0.0034 -0.1106 182 PHE A C   
1250 O O   . PHE A 182 ? 1.5260 1.5465 1.6501 -0.0615 -0.0107 -0.1183 182 PHE A O   
1251 C CB  . PHE A 182 ? 1.5494 1.5824 1.7438 -0.0599 -0.0071 -0.0954 182 PHE A CB  
1252 C CG  . PHE A 182 ? 1.6794 1.7027 1.8767 -0.0558 -0.0069 -0.1063 182 PHE A CG  
1253 C CD1 . PHE A 182 ? 1.7116 1.7230 1.9026 -0.0583 -0.0180 -0.1087 182 PHE A CD1 
1254 C CD2 . PHE A 182 ? 1.7541 1.7789 1.9600 -0.0490 0.0050  -0.1134 182 PHE A CD2 
1255 C CE1 . PHE A 182 ? 1.7681 1.7685 1.9628 -0.0557 -0.0169 -0.1177 182 PHE A CE1 
1256 C CE2 . PHE A 182 ? 1.8033 1.8154 2.0102 -0.0455 0.0049  -0.1235 182 PHE A CE2 
1257 C CZ  . PHE A 182 ? 1.8173 1.8168 2.0195 -0.0496 -0.0060 -0.1254 182 PHE A CZ  
1258 N N   . PHE A 183 ? 1.5150 1.5474 1.6593 -0.0540 0.0110  -0.1139 183 PHE A N   
1259 C CA  . PHE A 183 ? 1.6212 1.6483 1.7443 -0.0481 0.0178  -0.1285 183 PHE A CA  
1260 C C   . PHE A 183 ? 1.6470 1.6711 1.7369 -0.0492 0.0126  -0.1339 183 PHE A C   
1261 O O   . PHE A 183 ? 1.7096 1.7264 1.7866 -0.0495 0.0055  -0.1466 183 PHE A O   
1262 C CB  . PHE A 183 ? 1.7730 1.8068 1.8988 -0.0393 0.0356  -0.1286 183 PHE A CB  
1263 C CG  . PHE A 183 ? 1.8959 1.9316 2.0502 -0.0348 0.0412  -0.1288 183 PHE A CG  
1264 C CD1 . PHE A 183 ? 1.9635 1.9865 2.1171 -0.0311 0.0389  -0.1419 183 PHE A CD1 
1265 C CD2 . PHE A 183 ? 1.9252 1.9750 2.1075 -0.0340 0.0486  -0.1162 183 PHE A CD2 
1266 C CE1 . PHE A 183 ? 1.9832 2.0060 2.1601 -0.0252 0.0441  -0.1420 183 PHE A CE1 
1267 C CE2 . PHE A 183 ? 1.9433 1.9964 2.1517 -0.0281 0.0532  -0.1167 183 PHE A CE2 
1268 C CZ  . PHE A 183 ? 1.9689 2.0077 2.1727 -0.0229 0.0512  -0.1296 183 PHE A CZ  
1269 N N   . ALA A 184 ? 1.6241 1.6537 1.7011 -0.0497 0.0158  -0.1242 184 ALA A N   
1270 C CA  . ALA A 184 ? 1.6372 1.6641 1.6794 -0.0479 0.0124  -0.1290 184 ALA A CA  
1271 C C   . ALA A 184 ? 1.6715 1.6959 1.7069 -0.0544 -0.0044 -0.1279 184 ALA A C   
1272 O O   . ALA A 184 ? 1.6541 1.6760 1.6711 -0.0534 -0.0121 -0.1391 184 ALA A O   
1273 C CB  . ALA A 184 ? 1.6022 1.6330 1.6300 -0.0447 0.0239  -0.1183 184 ALA A CB  
1274 N N   . CYS A 185 ? 1.7031 1.7285 1.7537 -0.0602 -0.0106 -0.1145 185 CYS A N   
1275 C CA  . CYS A 185 ? 1.7096 1.7323 1.7506 -0.0642 -0.0251 -0.1109 185 CYS A CA  
1276 C C   . CYS A 185 ? 1.5936 1.6133 1.6534 -0.0676 -0.0348 -0.1134 185 CYS A C   
1277 O O   . CYS A 185 ? 1.5885 1.6061 1.6441 -0.0698 -0.0459 -0.1083 185 CYS A O   
1278 C CB  . CYS A 185 ? 1.7462 1.7677 1.7863 -0.0671 -0.0277 -0.0950 185 CYS A CB  
1279 S SG  . CYS A 185 ? 1.8549 1.8768 1.8694 -0.0638 -0.0159 -0.0890 185 CYS A SG  
1280 N N   . VAL A 186 ? 1.4641 1.4821 1.5429 -0.0669 -0.0299 -0.1206 186 VAL A N   
1281 C CA  . VAL A 186 ? 1.3832 1.3957 1.4789 -0.0695 -0.0369 -0.1227 186 VAL A CA  
1282 C C   . VAL A 186 ? 1.4593 1.4671 1.5601 -0.0686 -0.0326 -0.1374 186 VAL A C   
1283 O O   . VAL A 186 ? 1.5185 1.5234 1.6172 -0.0718 -0.0390 -0.1451 186 VAL A O   
1284 C CB  . VAL A 186 ? 1.2599 1.2697 1.3801 -0.0696 -0.0382 -0.1114 186 VAL A CB  
1285 C CG1 . VAL A 186 ? 1.2314 1.2328 1.3672 -0.0698 -0.0417 -0.1145 186 VAL A CG1 
1286 C CG2 . VAL A 186 ? 1.1540 1.1639 1.2685 -0.0711 -0.0470 -0.0980 186 VAL A CG2 
1287 N N   . LEU A 187 ? 1.4967 1.5037 1.6051 -0.0642 -0.0218 -0.1412 187 LEU A N   
1288 C CA  . LEU A 187 ? 1.5034 1.5022 1.6148 -0.0621 -0.0178 -0.1555 187 LEU A CA  
1289 C C   . LEU A 187 ? 1.4198 1.4177 1.5071 -0.0617 -0.0205 -0.1701 187 LEU A C   
1290 O O   . LEU A 187 ? 1.3624 1.3529 1.4514 -0.0650 -0.0259 -0.1817 187 LEU A O   
1291 C CB  . LEU A 187 ? 1.5986 1.5972 1.7202 -0.0549 -0.0049 -0.1559 187 LEU A CB  
1292 C CG  . LEU A 187 ? 1.6465 1.6326 1.7710 -0.0510 -0.0007 -0.1700 187 LEU A CG  
1293 C CD1 . LEU A 187 ? 1.6314 1.6064 1.7736 -0.0559 -0.0076 -0.1700 187 LEU A CD1 
1294 C CD2 . LEU A 187 ? 1.6633 1.6516 1.7960 -0.0415 0.0130  -0.1689 187 LEU A CD2 
1295 N N   . VAL A 188 ? 1.4532 1.4578 1.5181 -0.0574 -0.0170 -0.1694 188 VAL A N   
1296 C CA  . VAL A 188 ? 1.5564 1.5603 1.5945 -0.0545 -0.0208 -0.1834 188 VAL A CA  
1297 C C   . VAL A 188 ? 1.6097 1.6167 1.6452 -0.0616 -0.0353 -0.1872 188 VAL A C   
1298 O O   . VAL A 188 ? 1.6044 1.6078 1.6370 -0.0634 -0.0419 -0.2023 188 VAL A O   
1299 C CB  . VAL A 188 ? 1.5492 1.5583 1.5606 -0.0470 -0.0135 -0.1795 188 VAL A CB  
1300 C CG1 . VAL A 188 ? 1.5417 1.5502 1.5226 -0.0429 -0.0207 -0.1935 188 VAL A CG1 
1301 C CG2 . VAL A 188 ? 1.5892 1.5965 1.6022 -0.0385 0.0028  -0.1782 188 VAL A CG2 
1302 N N   . PRO A 189 ? 1.5770 1.5909 1.6140 -0.0652 -0.0408 -0.1736 189 PRO A N   
1303 C CA  . PRO A 189 ? 1.4868 1.5059 1.5233 -0.0705 -0.0534 -0.1753 189 PRO A CA  
1304 C C   . PRO A 189 ? 1.4251 1.4390 1.4860 -0.0774 -0.0571 -0.1814 189 PRO A C   
1305 O O   . PRO A 189 ? 1.4991 1.5158 1.5595 -0.0812 -0.0647 -0.1933 189 PRO A O   
1306 C CB  . PRO A 189 ? 1.4519 1.4747 1.4897 -0.0715 -0.0561 -0.1572 189 PRO A CB  
1307 C CG  . PRO A 189 ? 1.4849 1.5068 1.5129 -0.0667 -0.0470 -0.1492 189 PRO A CG  
1308 C CD  . PRO A 189 ? 1.5331 1.5501 1.5713 -0.0640 -0.0362 -0.1565 189 PRO A CD  
1309 N N   . LEU A 190 ? 1.3324 1.3386 1.4149 -0.0789 -0.0520 -0.1734 190 LEU A N   
1310 C CA  . LEU A 190 ? 1.3351 1.3328 1.4397 -0.0846 -0.0535 -0.1772 190 LEU A CA  
1311 C C   . LEU A 190 ? 1.3308 1.3203 1.4349 -0.0859 -0.0528 -0.1960 190 LEU A C   
1312 O O   . LEU A 190 ? 1.3349 1.3196 1.4524 -0.0931 -0.0574 -0.2032 190 LEU A O   
1313 C CB  . LEU A 190 ? 1.4402 1.4287 1.5637 -0.0828 -0.0474 -0.1659 190 LEU A CB  
1314 C CG  . LEU A 190 ? 1.5268 1.5190 1.6540 -0.0819 -0.0510 -0.1482 190 LEU A CG  
1315 C CD1 . LEU A 190 ? 1.6526 1.6355 1.7973 -0.0782 -0.0462 -0.1397 190 LEU A CD1 
1316 C CD2 . LEU A 190 ? 1.4638 1.4586 1.5940 -0.0864 -0.0586 -0.1447 190 LEU A CD2 
1317 N N   . LEU A 191 ? 1.3951 1.3819 1.4836 -0.0787 -0.0467 -0.2038 191 LEU A N   
1318 C CA  . LEU A 191 ? 1.5062 1.4825 1.5882 -0.0774 -0.0471 -0.2230 191 LEU A CA  
1319 C C   . LEU A 191 ? 1.5027 1.4864 1.5696 -0.0801 -0.0588 -0.2361 191 LEU A C   
1320 O O   . LEU A 191 ? 1.5106 1.4863 1.5810 -0.0842 -0.0652 -0.2522 191 LEU A O   
1321 C CB  . LEU A 191 ? 1.6052 1.5762 1.6721 -0.0661 -0.0359 -0.2263 191 LEU A CB  
1322 C CG  . LEU A 191 ? 1.5961 1.5601 1.6808 -0.0623 -0.0247 -0.2172 191 LEU A CG  
1323 C CD1 . LEU A 191 ? 1.6392 1.6029 1.7094 -0.0501 -0.0124 -0.2189 191 LEU A CD1 
1324 C CD2 . LEU A 191 ? 1.5478 1.4947 1.6507 -0.0666 -0.0259 -0.2246 191 LEU A CD2 
1325 N N   . LEU A 192 ? 1.5266 1.5248 1.5767 -0.0773 -0.0624 -0.2295 192 LEU A N   
1326 C CA  . LEU A 192 ? 1.5719 1.5801 1.6079 -0.0785 -0.0747 -0.2405 192 LEU A CA  
1327 C C   . LEU A 192 ? 1.4724 1.4880 1.5333 -0.0902 -0.0841 -0.2394 192 LEU A C   
1328 O O   . LEU A 192 ? 1.4134 1.4310 1.4799 -0.0957 -0.0940 -0.2545 192 LEU A O   
1329 C CB  . LEU A 192 ? 1.6210 1.6411 1.6309 -0.0710 -0.0750 -0.2318 192 LEU A CB  
1330 C CG  . LEU A 192 ? 1.6546 1.6693 1.6365 -0.0589 -0.0651 -0.2329 192 LEU A CG  
1331 C CD1 . LEU A 192 ? 1.6753 1.6993 1.6332 -0.0531 -0.0650 -0.2217 192 LEU A CD1 
1332 C CD2 . LEU A 192 ? 1.6500 1.6569 1.6130 -0.0524 -0.0689 -0.2545 192 LEU A CD2 
1333 N N   . MET A 193 ? 1.4405 1.4599 1.5165 -0.0935 -0.0810 -0.2214 193 MET A N   
1334 C CA  . MET A 193 ? 1.4238 1.4500 1.5234 -0.1028 -0.0867 -0.2166 193 MET A CA  
1335 C C   . MET A 193 ? 1.5259 1.5396 1.6499 -0.1118 -0.0865 -0.2270 193 MET A C   
1336 O O   . MET A 193 ? 1.6577 1.6783 1.7962 -0.1204 -0.0947 -0.2354 193 MET A O   
1337 C CB  . MET A 193 ? 1.3061 1.3327 1.4141 -0.1017 -0.0817 -0.1952 193 MET A CB  
1338 C CG  . MET A 193 ? 1.2409 1.2776 1.3262 -0.0944 -0.0835 -0.1840 193 MET A CG  
1339 S SD  . MET A 193 ? 2.1655 2.2000 2.2596 -0.0927 -0.0813 -0.1609 193 MET A SD  
1340 C CE  . MET A 193 ? 2.9417 2.9827 3.0597 -0.1004 -0.0856 -0.1597 193 MET A CE  
1341 N N   . LEU A 194 ? 1.4867 1.4820 1.6164 -0.1098 -0.0772 -0.2261 194 LEU A N   
1342 C CA  . LEU A 194 ? 1.5443 1.5226 1.6938 -0.1171 -0.0759 -0.2358 194 LEU A CA  
1343 C C   . LEU A 194 ? 1.4878 1.4642 1.6307 -0.1204 -0.0855 -0.2586 194 LEU A C   
1344 O O   . LEU A 194 ? 1.4491 1.4206 1.6123 -0.1314 -0.0911 -0.2676 194 LEU A O   
1345 C CB  . LEU A 194 ? 1.6456 1.6044 1.7956 -0.1107 -0.0645 -0.2328 194 LEU A CB  
1346 C CG  . LEU A 194 ? 1.7091 1.6454 1.8768 -0.1166 -0.0618 -0.2411 194 LEU A CG  
1347 C CD1 . LEU A 194 ? 1.7770 1.7128 1.9709 -0.1272 -0.0625 -0.2314 194 LEU A CD1 
1348 C CD2 . LEU A 194 ? 1.6629 1.5823 1.8285 -0.1073 -0.0505 -0.2372 194 LEU A CD2 
1349 N N   . GLY A 195 ? 1.4673 1.4468 1.5815 -0.1106 -0.0874 -0.2677 195 GLY A N   
1350 C CA  . GLY A 195 ? 1.4986 1.4754 1.6001 -0.1104 -0.0982 -0.2903 195 GLY A CA  
1351 C C   . GLY A 195 ? 1.5484 1.5449 1.6591 -0.1188 -0.1128 -0.2962 195 GLY A C   
1352 O O   . GLY A 195 ? 1.5888 1.5823 1.7068 -0.1254 -0.1243 -0.3147 195 GLY A O   
1353 N N   . VAL A 196 ? 1.5334 1.5503 1.6444 -0.1181 -0.1130 -0.2807 196 VAL A N   
1354 C CA  . VAL A 196 ? 1.4300 1.4695 1.5513 -0.1245 -0.1256 -0.2835 196 VAL A CA  
1355 C C   . VAL A 196 ? 1.3854 1.4249 1.5467 -0.1404 -0.1280 -0.2841 196 VAL A C   
1356 O O   . VAL A 196 ? 1.3858 1.4317 1.5611 -0.1489 -0.1404 -0.3001 196 VAL A O   
1357 C CB  . VAL A 196 ? 1.2987 1.3571 1.4105 -0.1188 -0.1237 -0.2646 196 VAL A CB  
1358 C CG1 . VAL A 196 ? 1.2976 1.3799 1.4283 -0.1261 -0.1343 -0.2642 196 VAL A CG1 
1359 C CG2 . VAL A 196 ? 1.2539 1.3146 1.3260 -0.1045 -0.1239 -0.2661 196 VAL A CG2 
1360 N N   . TYR A 197 ? 1.3585 1.3902 1.5385 -0.1442 -0.1163 -0.2665 197 TYR A N   
1361 C CA  . TYR A 197 ? 1.4099 1.4389 1.6271 -0.1584 -0.1150 -0.2634 197 TYR A CA  
1362 C C   . TYR A 197 ? 1.4535 1.4622 1.6832 -0.1674 -0.1192 -0.2831 197 TYR A C   
1363 O O   . TYR A 197 ? 1.4492 1.4583 1.7106 -0.1817 -0.1226 -0.2867 197 TYR A O   
1364 C CB  . TYR A 197 ? 1.4526 1.4707 1.6801 -0.1570 -0.1006 -0.2414 197 TYR A CB  
1365 C CG  . TYR A 197 ? 1.4710 1.5079 1.6926 -0.1506 -0.0985 -0.2217 197 TYR A CG  
1366 C CD1 . TYR A 197 ? 1.4739 1.5289 1.7172 -0.1571 -0.1003 -0.2127 197 TYR A CD1 
1367 C CD2 . TYR A 197 ? 1.5228 1.5588 1.7174 -0.1379 -0.0945 -0.2119 197 TYR A CD2 
1368 C CE1 . TYR A 197 ? 1.4876 1.5575 1.7220 -0.1492 -0.0986 -0.1951 197 TYR A CE1 
1369 C CE2 . TYR A 197 ? 1.5336 1.5831 1.7205 -0.1318 -0.0940 -0.1948 197 TYR A CE2 
1370 C CZ  . TYR A 197 ? 1.4981 1.5636 1.7029 -0.1365 -0.0963 -0.1867 197 TYR A CZ  
1371 O OH  . TYR A 197 ? 1.4599 1.5365 1.6536 -0.1284 -0.0960 -0.1700 197 TYR A OH  
1372 N N   . LEU A 198 ? 1.5250 1.5151 1.7299 -0.1588 -0.1185 -0.2955 198 LEU A N   
1373 C CA  . LEU A 198 ? 1.6438 1.6118 1.8533 -0.1646 -0.1243 -0.3165 198 LEU A CA  
1374 C C   . LEU A 198 ? 1.6608 1.6436 1.8773 -0.1724 -0.1432 -0.3360 198 LEU A C   
1375 O O   . LEU A 198 ? 1.6268 1.6016 1.8704 -0.1869 -0.1503 -0.3474 198 LEU A O   
1376 C CB  . LEU A 198 ? 1.7056 1.6533 1.8815 -0.1500 -0.1197 -0.3255 198 LEU A CB  
1377 C CG  . LEU A 198 ? 1.6696 1.5999 1.8421 -0.1424 -0.1024 -0.3104 198 LEU A CG  
1378 C CD1 . LEU A 198 ? 1.6938 1.6104 1.8336 -0.1268 -0.0979 -0.3194 198 LEU A CD1 
1379 C CD2 . LEU A 198 ? 1.6562 1.5638 1.8565 -0.1531 -0.0970 -0.3086 198 LEU A CD2 
1380 N N   . ARG A 199 ? 1.7195 1.7234 1.9118 -0.1628 -0.1516 -0.3400 199 ARG A N   
1381 C CA  . ARG A 199 ? 1.8193 1.8404 2.0149 -0.1672 -0.1713 -0.3589 199 ARG A CA  
1382 C C   . ARG A 199 ? 1.8044 1.8526 2.0396 -0.1816 -0.1759 -0.3502 199 ARG A C   
1383 O O   . ARG A 199 ? 1.8619 1.9198 2.1212 -0.1935 -0.1908 -0.3656 199 ARG A O   
1384 C CB  . ARG A 199 ? 1.8765 1.9109 2.0308 -0.1499 -0.1776 -0.3640 199 ARG A CB  
1385 C CG  . ARG A 199 ? 1.9662 1.9775 2.0802 -0.1335 -0.1694 -0.3682 199 ARG A CG  
1386 C CD  . ARG A 199 ? 2.1282 2.1112 2.2386 -0.1349 -0.1754 -0.3907 199 ARG A CD  
1387 N NE  . ARG A 199 ? 2.2713 2.2340 2.3414 -0.1167 -0.1666 -0.3945 199 ARG A NE  
1388 C CZ  . ARG A 199 ? 2.2987 2.2429 2.3663 -0.1123 -0.1490 -0.3831 199 ARG A CZ  
1389 N NH1 . ARG A 199 ? 2.2941 2.2351 2.3941 -0.1238 -0.1392 -0.3677 199 ARG A NH1 
1390 N NH2 . ARG A 199 ? 2.2885 2.2180 2.3210 -0.0950 -0.1408 -0.3866 199 ARG A NH2 
1391 N N   . ILE A 200 ? 1.6695 1.7301 1.9116 -0.1800 -0.1633 -0.3254 200 ILE A N   
1392 C CA  . ILE A 200 ? 1.5262 1.6131 1.8030 -0.1906 -0.1644 -0.3136 200 ILE A CA  
1393 C C   . ILE A 200 ? 1.6209 1.6991 1.9425 -0.2102 -0.1639 -0.3171 200 ILE A C   
1394 O O   . ILE A 200 ? 1.6954 1.7922 2.0457 -0.2224 -0.1767 -0.3280 200 ILE A O   
1395 C CB  . ILE A 200 ? 1.3126 1.4065 1.5851 -0.1834 -0.1493 -0.2856 200 ILE A CB  
1396 C CG1 . ILE A 200 ? 1.2227 1.3310 1.4568 -0.1666 -0.1521 -0.2812 200 ILE A CG1 
1397 C CG2 . ILE A 200 ? 1.2646 1.3800 1.5756 -0.1942 -0.1468 -0.2719 200 ILE A CG2 
1398 C CD1 . ILE A 200 ? 1.2055 1.3217 1.4346 -0.1595 -0.1410 -0.2556 200 ILE A CD1 
1399 N N   . PHE A 201 ? 1.6451 1.6949 1.9734 -0.2132 -0.1492 -0.3077 201 PHE A N   
1400 C CA  . PHE A 201 ? 1.7369 1.7732 2.1057 -0.2313 -0.1454 -0.3077 201 PHE A CA  
1401 C C   . PHE A 201 ? 1.8716 1.8900 2.2477 -0.2414 -0.1595 -0.3351 201 PHE A C   
1402 O O   . PHE A 201 ? 1.9222 1.9392 2.3373 -0.2598 -0.1636 -0.3406 201 PHE A O   
1403 C CB  . PHE A 201 ? 1.7605 1.7692 2.1295 -0.2287 -0.1255 -0.2892 201 PHE A CB  
1404 C CG  . PHE A 201 ? 1.7845 1.8083 2.1518 -0.2206 -0.1128 -0.2623 201 PHE A CG  
1405 C CD1 . PHE A 201 ? 1.7683 1.8057 2.1693 -0.2300 -0.1059 -0.2463 201 PHE A CD1 
1406 C CD2 . PHE A 201 ? 1.8224 1.8458 2.1540 -0.2031 -0.1079 -0.2530 201 PHE A CD2 
1407 C CE1 . PHE A 201 ? 1.7557 1.8042 2.1509 -0.2203 -0.0950 -0.2222 201 PHE A CE1 
1408 C CE2 . PHE A 201 ? 1.8012 1.8355 2.1293 -0.1952 -0.0985 -0.2296 201 PHE A CE2 
1409 C CZ  . PHE A 201 ? 1.7789 1.8248 2.1368 -0.2028 -0.0924 -0.2145 201 PHE A CZ  
1410 N N   . ALA A 202 ? 1.9331 1.9368 2.2715 -0.2291 -0.1668 -0.3521 202 ALA A N   
1411 C CA  . ALA A 202 ? 2.0043 1.9883 2.3417 -0.2352 -0.1823 -0.3800 202 ALA A CA  
1412 C C   . ALA A 202 ? 2.0183 2.0311 2.3757 -0.2447 -0.2041 -0.3967 202 ALA A C   
1413 O O   . ALA A 202 ? 2.0301 2.0340 2.4146 -0.2605 -0.2168 -0.4142 202 ALA A O   
1414 C CB  . ALA A 202 ? 2.0194 1.9827 2.3074 -0.2161 -0.1835 -0.3925 202 ALA A CB  
1415 N N   . ALA A 203 ? 2.0033 2.0503 2.3477 -0.2349 -0.2090 -0.3912 203 ALA A N   
1416 C CA  . ALA A 203 ? 2.0262 2.1053 2.3874 -0.2408 -0.2301 -0.4059 203 ALA A CA  
1417 C C   . ALA A 203 ? 1.9832 2.0901 2.3992 -0.2591 -0.2274 -0.3921 203 ALA A C   
1418 O O   . ALA A 203 ? 1.9789 2.1041 2.4295 -0.2735 -0.2441 -0.4066 203 ALA A O   
1419 C CB  . ALA A 203 ? 1.9969 2.0994 2.3185 -0.2208 -0.2360 -0.4054 203 ALA A CB  
1420 N N   . ALA A 204 ? 1.9017 2.0120 2.3257 -0.2579 -0.2063 -0.3640 204 ALA A N   
1421 C CA  . ALA A 204 ? 1.8388 1.9744 2.3110 -0.2721 -0.1994 -0.3468 204 ALA A CA  
1422 C C   . ALA A 204 ? 1.9176 2.0387 2.4377 -0.2960 -0.2011 -0.3548 204 ALA A C   
1423 O O   . ALA A 204 ? 1.9685 2.1172 2.5351 -0.3118 -0.2070 -0.3546 204 ALA A O   
1424 C CB  . ALA A 204 ? 1.7651 1.8978 2.2297 -0.2636 -0.1759 -0.3160 204 ALA A CB  
1425 N N   . ARG A 205 ? 1.9635 2.0412 2.4729 -0.2986 -0.1955 -0.3616 205 ARG A N   
1426 C CA  . ARG A 205 ? 2.0635 2.1193 2.6135 -0.3208 -0.1967 -0.3698 205 ARG A CA  
1427 C C   . ARG A 205 ? 2.1558 2.2147 2.7181 -0.3315 -0.2241 -0.4020 205 ARG A C   
1428 O O   . ARG A 205 ? 2.2296 2.2833 2.8369 -0.3539 -0.2304 -0.4104 205 ARG A O   
1429 C CB  . ARG A 205 ? 2.1494 2.1553 2.6802 -0.3178 -0.1817 -0.3662 205 ARG A CB  
1430 C CG  . ARG A 205 ? 2.2217 2.2196 2.7636 -0.3172 -0.1554 -0.3352 205 ARG A CG  
1431 C CD  . ARG A 205 ? 2.2498 2.2749 2.7680 -0.2989 -0.1461 -0.3142 205 ARG A CD  
1432 N NE  . ARG A 205 ? 2.2667 2.2814 2.7906 -0.2957 -0.1226 -0.2858 205 ARG A NE  
1433 C CZ  . ARG A 205 ? 2.2564 2.2420 2.7495 -0.2820 -0.1094 -0.2762 205 ARG A CZ  
1434 N NH1 . ARG A 205 ? 2.2581 2.2235 2.7144 -0.2708 -0.1155 -0.2916 205 ARG A NH1 
1435 N NH2 . ARG A 205 ? 2.2308 2.2079 2.7297 -0.2784 -0.0900 -0.2511 205 ARG A NH2 
1436 N N   . ARG A 206 ? 2.1574 2.2232 2.6791 -0.3152 -0.2405 -0.4200 206 ARG A N   
1437 C CA  . ARG A 206 ? 2.1987 2.2704 2.7265 -0.3215 -0.2693 -0.4515 206 ARG A CA  
1438 C C   . ARG A 206 ? 2.1210 2.2445 2.6898 -0.3313 -0.2822 -0.4513 206 ARG A C   
1439 O O   . ARG A 206 ? 2.1274 2.2607 2.7317 -0.3478 -0.3033 -0.4719 206 ARG A O   
1440 C CB  . ARG A 206 ? 2.2581 2.3179 2.7242 -0.2978 -0.2813 -0.4699 206 ARG A CB  
1441 C CG  . ARG A 206 ? 2.3353 2.3445 2.7633 -0.2882 -0.2722 -0.4755 206 ARG A CG  
1442 C CD  . ARG A 206 ? 2.4014 2.3983 2.7748 -0.2673 -0.2878 -0.4990 206 ARG A CD  
1443 N NE  . ARG A 206 ? 2.4137 2.4362 2.7498 -0.2459 -0.2834 -0.4883 206 ARG A NE  
1444 C CZ  . ARG A 206 ? 2.4378 2.4471 2.7337 -0.2276 -0.2646 -0.4731 206 ARG A CZ  
1445 N NH1 . ARG A 206 ? 2.4630 2.4362 2.7509 -0.2268 -0.2487 -0.4673 206 ARG A NH1 
1446 N NH2 . ARG A 206 ? 2.4262 2.4585 2.6911 -0.2101 -0.2618 -0.4638 206 ARG A NH2 
1447 N N   . GLN A 207 ? 2.0092 2.1657 2.5734 -0.3207 -0.2702 -0.4283 207 GLN A N   
1448 C CA  . GLN A 207 ? 1.8614 2.0693 2.4649 -0.3278 -0.2786 -0.4236 207 GLN A CA  
1449 C C   . GLN A 207 ? 1.7413 1.9562 2.4138 -0.3556 -0.2728 -0.4161 207 GLN A C   
1450 O O   . GLN A 207 ? 1.7798 2.0265 2.4981 -0.3708 -0.2898 -0.4276 207 GLN A O   
1451 C CB  . GLN A 207 ? 1.8399 2.0743 2.4232 -0.3104 -0.2625 -0.3966 207 GLN A CB  
1452 C CG  . GLN A 207 ? 1.9019 2.1296 2.4186 -0.2837 -0.2653 -0.4002 207 GLN A CG  
1453 C CD  . GLN A 207 ? 1.9910 2.2407 2.4911 -0.2752 -0.2927 -0.4257 207 GLN A CD  
1454 O OE1 . GLN A 207 ? 2.0692 2.3471 2.6102 -0.2883 -0.3108 -0.4391 207 GLN A OE1 
1455 N NE2 . GLN A 207 ? 1.9723 2.2093 2.4124 -0.2525 -0.2959 -0.4322 207 GLN A NE2 
1456 N N   . LEU A 208 ? 1.6522 1.8373 2.3326 -0.3618 -0.2485 -0.3963 208 LEU A N   
1457 C CA  . LEU A 208 ? 1.6626 1.8480 2.4051 -0.3873 -0.2382 -0.3855 208 LEU A CA  
1458 C C   . LEU A 208 ? 1.8373 1.9985 2.6081 -0.4088 -0.2568 -0.4130 208 LEU A C   
1459 O O   . LEU A 208 ? 1.9212 2.0949 2.7531 -0.4335 -0.2583 -0.4122 208 LEU A O   
1460 C CB  . LEU A 208 ? 1.5971 1.7518 2.3325 -0.3848 -0.2072 -0.3574 208 LEU A CB  
1461 C CG  . LEU A 208 ? 1.5896 1.7646 2.3023 -0.3654 -0.1877 -0.3281 208 LEU A CG  
1462 C CD1 . LEU A 208 ? 1.6332 1.7731 2.3383 -0.3628 -0.1600 -0.3037 208 LEU A CD1 
1463 C CD2 . LEU A 208 ? 1.5732 1.8017 2.3281 -0.3711 -0.1874 -0.3150 208 LEU A CD2 
1464 N N   . LYS A 209 ? 1.9525 2.0784 2.6789 -0.3993 -0.2706 -0.4369 209 LYS A N   
1465 C CA  . LYS A 209 ? 2.1756 2.2728 2.9201 -0.4167 -0.2907 -0.4655 209 LYS A CA  
1466 C C   . LYS A 209 ? 2.2811 2.4149 3.0516 -0.4248 -0.3230 -0.4914 209 LYS A C   
1467 O O   . LYS A 209 ? 2.3263 2.4584 3.1461 -0.4493 -0.3381 -0.5070 209 LYS A O   
1468 C CB  . LYS A 209 ? 2.3013 2.3469 2.9859 -0.4009 -0.2939 -0.4821 209 LYS A CB  
1469 C CG  . LYS A 209 ? 2.4524 2.4604 3.1497 -0.4170 -0.3138 -0.5115 209 LYS A CG  
1470 C CD  . LYS A 209 ? 2.5548 2.5114 3.1894 -0.3980 -0.3140 -0.5255 209 LYS A CD  
1471 C CE  . LYS A 209 ? 2.6507 2.5657 3.2942 -0.4126 -0.3344 -0.5553 209 LYS A CE  
1472 N NZ  . LYS A 209 ? 2.6929 2.5577 3.2735 -0.3918 -0.3337 -0.5686 209 LYS A NZ  
1473 N N   . GLN A 210 ? 2.3206 2.4866 3.0578 -0.4038 -0.3341 -0.4960 210 GLN A N   
1474 C CA  . GLN A 210 ? 2.3713 2.5768 3.1299 -0.4075 -0.3648 -0.5190 210 GLN A CA  
1475 C C   . GLN A 210 ? 2.3090 2.5643 3.1411 -0.4282 -0.3613 -0.5036 210 GLN A C   
1476 O O   . GLN A 210 ? 2.3315 2.6123 3.2111 -0.4455 -0.3853 -0.5228 210 GLN A O   
1477 C CB  . GLN A 210 ? 2.4230 2.6495 3.1242 -0.3776 -0.3741 -0.5239 210 GLN A CB  
1478 C CG  . GLN A 210 ? 2.5239 2.7056 3.1524 -0.3554 -0.3775 -0.5391 210 GLN A CG  
1479 C CD  . GLN A 210 ? 2.5727 2.7751 3.1465 -0.3267 -0.3864 -0.5438 210 GLN A CD  
1480 O OE1 . GLN A 210 ? 2.5515 2.8013 3.1413 -0.3235 -0.3949 -0.5402 210 GLN A OE1 
1481 N NE2 . GLN A 210 ? 2.6234 2.7903 3.1324 -0.3051 -0.3838 -0.5511 210 GLN A NE2 
1482 N N   . MET A 211 ? 2.2333 2.5027 3.0747 -0.4254 -0.3314 -0.4690 211 MET A N   
1483 C CA  . MET A 211 ? 2.1998 2.5141 3.1090 -0.4428 -0.3220 -0.4494 211 MET A CA  
1484 C C   . MET A 211 ? 2.3128 2.6027 3.2781 -0.4728 -0.3107 -0.4438 211 MET A C   
1485 O O   . MET A 211 ? 2.3876 2.7101 3.4178 -0.4920 -0.3026 -0.4292 211 MET A O   
1486 C CB  . MET A 211 ? 2.0803 2.4159 2.9717 -0.4252 -0.2943 -0.4144 211 MET A CB  
1487 C CG  . MET A 211 ? 2.0372 2.3971 2.8751 -0.3964 -0.3035 -0.4170 211 MET A CG  
1488 S SD  . MET A 211 ? 1.9221 2.3029 2.7400 -0.3767 -0.2725 -0.3765 211 MET A SD  
1489 C CE  . MET A 211 ? 2.9182 3.3505 3.8220 -0.3985 -0.2645 -0.3586 211 MET A CE  
1490 N N   . GLU A 212 ? 2.3480 2.5794 3.2871 -0.4757 -0.3092 -0.4547 212 GLU A N   
1491 C CA  . GLU A 212 ? 2.4069 2.6060 3.3923 -0.5033 -0.3003 -0.4524 212 GLU A CA  
1492 C C   . GLU A 212 ? 2.4288 2.6294 3.4555 -0.5263 -0.3332 -0.4860 212 GLU A C   
1493 O O   . GLU A 212 ? 2.4345 2.6224 3.5178 -0.5549 -0.3312 -0.4861 212 GLU A O   
1494 C CB  . GLU A 212 ? 2.4874 2.6213 3.4241 -0.4945 -0.2841 -0.4491 212 GLU A CB  
1495 C CG  . GLU A 212 ? 2.5742 2.6679 3.5511 -0.5202 -0.2719 -0.4442 212 GLU A CG  
1496 C CD  . GLU A 212 ? 2.6232 2.6533 3.5482 -0.5083 -0.2569 -0.4418 212 GLU A CD  
1497 O OE1 . GLU A 212 ? 2.5988 2.6193 3.4600 -0.4808 -0.2553 -0.4429 212 GLU A OE1 
1498 O OE2 . GLU A 212 ? 2.6710 2.6610 3.6198 -0.5263 -0.2464 -0.4384 212 GLU A OE2 
1499 N N   . SER A 213 ? 2.4487 2.6639 3.4461 -0.5131 -0.3641 -0.5146 213 SER A N   
1500 C CA  . SER A 213 ? 2.5347 2.7526 3.5646 -0.5310 -0.4002 -0.5501 213 SER A CA  
1501 C C   . SER A 213 ? 2.6056 2.8906 3.6649 -0.5293 -0.4229 -0.5592 213 SER A C   
1502 O O   . SER A 213 ? 2.6578 2.9490 3.7058 -0.5252 -0.4578 -0.5922 213 SER A O   
1503 C CB  . SER A 213 ? 2.5319 2.6993 3.4968 -0.5156 -0.4213 -0.5816 213 SER A CB  
1504 O OG  . SER A 213 ? 2.5270 2.6330 3.4652 -0.5162 -0.4012 -0.5742 213 SER A OG  
1505 N N   . GLN A 214 ? 2.6161 2.9506 3.7111 -0.5306 -0.4033 -0.5299 214 GLN A N   
1506 C CA  . GLN A 214 ? 2.6242 3.0262 3.7492 -0.5273 -0.4214 -0.5346 214 GLN A CA  
1507 C C   . GLN A 214 ? 2.7312 3.1725 3.9543 -0.5611 -0.4255 -0.5315 214 GLN A C   
1508 O O   . GLN A 214 ? 2.7470 3.1808 4.0133 -0.5801 -0.3977 -0.5060 214 GLN A O   
1509 C CB  . GLN A 214 ? 2.5193 2.9538 3.6110 -0.5009 -0.3989 -0.5053 214 GLN A CB  
1510 C CG  . GLN A 214 ? 2.4568 2.8924 3.5743 -0.5076 -0.3588 -0.4649 214 GLN A CG  
1511 C CD  . GLN A 214 ? 2.4148 2.8773 3.4933 -0.4797 -0.3390 -0.4380 214 GLN A CD  
1512 O OE1 . GLN A 214 ? 2.4339 2.9133 3.4656 -0.4558 -0.3541 -0.4488 214 GLN A OE1 
1513 N NE2 . GLN A 214 ? 2.3656 2.8294 3.4608 -0.4818 -0.3050 -0.4028 214 GLN A NE2 
1514 N N   . PRO A 215 ? 2.7756 3.2594 4.0346 -0.5682 -0.4603 -0.5574 215 PRO A N   
1515 C CA  . PRO A 215 ? 2.8099 3.3383 4.1675 -0.6008 -0.4694 -0.5585 215 PRO A CA  
1516 C C   . PRO A 215 ? 2.8128 3.4033 4.2151 -0.6000 -0.4440 -0.5232 215 PRO A C   
1517 O O   . PRO A 215 ? 2.7857 3.4293 4.2670 -0.6204 -0.4543 -0.5244 215 PRO A O   
1518 C CB  . PRO A 215 ? 2.8070 3.3632 4.1710 -0.5988 -0.5171 -0.5989 215 PRO A CB  
1519 C CG  . PRO A 215 ? 2.8218 3.3283 4.0905 -0.5707 -0.5323 -0.6221 215 PRO A CG  
1520 C CD  . PRO A 215 ? 2.7956 3.2820 4.0009 -0.5454 -0.4953 -0.5905 215 PRO A CD  
1521 N N   . LEU A 216 ? 2.8832 3.4672 4.2361 -0.5761 -0.4118 -0.4925 216 LEU A N   
1522 C CA  . LEU A 216 ? 2.8773 3.5149 4.2623 -0.5708 -0.3861 -0.4578 216 LEU A CA  
1523 C C   . LEU A 216 ? 2.8410 3.4465 4.1871 -0.5576 -0.3436 -0.4209 216 LEU A C   
1524 O O   . LEU A 216 ? 2.9152 3.4674 4.1904 -0.5412 -0.3375 -0.4232 216 LEU A O   
1525 C CB  . LEU A 216 ? 2.8472 3.5389 4.2075 -0.5443 -0.4044 -0.4648 216 LEU A CB  
1526 C CG  . LEU A 216 ? 2.8201 3.4849 4.0828 -0.5100 -0.4170 -0.4798 216 LEU A CG  
1527 C CD1 . LEU A 216 ? 2.7662 3.3998 3.9660 -0.4874 -0.3819 -0.4492 216 LEU A CD1 
1528 C CD2 . LEU A 216 ? 2.8026 3.5236 4.0572 -0.4904 -0.4427 -0.4935 216 LEU A CD2 
1529 N N   . PRO A 217 ? 2.6406 3.2790 4.0339 -0.5640 -0.3143 -0.3867 217 PRO A N   
1530 C CA  . PRO A 217 ? 2.5062 3.1185 3.8660 -0.5502 -0.2742 -0.3501 217 PRO A CA  
1531 C C   . PRO A 217 ? 2.3228 2.9263 3.5944 -0.5123 -0.2714 -0.3452 217 PRO A C   
1532 O O   . PRO A 217 ? 2.3347 2.8834 3.5450 -0.5003 -0.2631 -0.3453 217 PRO A O   
1533 C CB  . PRO A 217 ? 2.4721 3.1396 3.8995 -0.5588 -0.2518 -0.3194 217 PRO A CB  
1534 C CG  . PRO A 217 ? 2.5286 3.2321 4.0420 -0.5906 -0.2742 -0.3386 217 PRO A CG  
1535 C CD  . PRO A 217 ? 2.5917 3.2941 4.0763 -0.5854 -0.3176 -0.3808 217 PRO A CD  
1536 N N   . GLY A 218 ? 2.1349 2.7923 3.4020 -0.4939 -0.2781 -0.3408 218 GLY A N   
1537 C CA  . GLY A 218 ? 1.9541 2.6066 3.1412 -0.4588 -0.2766 -0.3360 218 GLY A CA  
1538 C C   . GLY A 218 ? 1.7834 2.3931 2.9232 -0.4446 -0.2432 -0.3073 218 GLY A C   
1539 O O   . GLY A 218 ? 1.7275 2.2923 2.8001 -0.4290 -0.2442 -0.3143 218 GLY A O   
1540 N N   . GLU A 219 ? 1.7021 2.3260 2.8778 -0.4494 -0.2135 -0.2746 219 GLU A N   
1541 C CA  . GLU A 219 ? 1.6510 2.2360 2.7856 -0.4355 -0.1817 -0.2460 219 GLU A CA  
1542 C C   . GLU A 219 ? 1.6735 2.2689 2.7441 -0.4012 -0.1770 -0.2332 219 GLU A C   
1543 O O   . GLU A 219 ? 1.7106 2.2703 2.7326 -0.3850 -0.1572 -0.2151 219 GLU A O   
1544 C CB  . GLU A 219 ? 1.6127 2.2071 2.8047 -0.4504 -0.1511 -0.2150 219 GLU A CB  
1545 C CG  . GLU A 219 ? 1.6611 2.2359 2.9136 -0.4852 -0.1515 -0.2242 219 GLU A CG  
1546 C CD  . GLU A 219 ? 1.7135 2.2201 2.9242 -0.4891 -0.1562 -0.2409 219 GLU A CD  
1547 O OE1 . GLU A 219 ? 1.7003 2.1920 2.9404 -0.5124 -0.1757 -0.2666 219 GLU A OE1 
1548 O OE2 . GLU A 219 ? 1.7930 2.2612 2.9411 -0.4683 -0.1414 -0.2290 219 GLU A OE2 
1549 N N   . ARG A 220 ? 1.6857 2.3296 2.7568 -0.3900 -0.1961 -0.2430 220 ARG A N   
1550 C CA  . ARG A 220 ? 1.7215 2.3740 2.7295 -0.3576 -0.1957 -0.2346 220 ARG A CA  
1551 C C   . ARG A 220 ? 1.6923 2.2952 2.6263 -0.3436 -0.2053 -0.2507 220 ARG A C   
1552 O O   . ARG A 220 ? 1.6025 2.1800 2.4812 -0.3229 -0.1906 -0.2345 220 ARG A O   
1553 C CB  . ARG A 220 ? 1.7724 2.4847 2.7961 -0.3491 -0.2175 -0.2460 220 ARG A CB  
1554 C CG  . ARG A 220 ? 1.8283 2.5947 2.9065 -0.3502 -0.2023 -0.2215 220 ARG A CG  
1555 C CD  . ARG A 220 ? 1.8999 2.6639 2.9318 -0.3220 -0.1785 -0.1907 220 ARG A CD  
1556 N NE  . ARG A 220 ? 1.9886 2.7987 3.0716 -0.3221 -0.1592 -0.1641 220 ARG A NE  
1557 C CZ  . ARG A 220 ? 2.0526 2.8495 3.1581 -0.3279 -0.1282 -0.1355 220 ARG A CZ  
1558 N NH1 . ARG A 220 ? 2.0972 2.8357 3.1781 -0.3338 -0.1142 -0.1305 220 ARG A NH1 
1559 N NH2 . ARG A 220 ? 2.0456 2.8873 3.1967 -0.3260 -0.1105 -0.1114 220 ARG A NH2 
1560 N N   . ALA A 221 ? 1.7294 2.3187 2.6634 -0.3548 -0.2302 -0.2826 221 ALA A N   
1561 C CA  . ALA A 221 ? 1.6727 2.2164 2.5399 -0.3422 -0.2396 -0.2994 221 ALA A CA  
1562 C C   . ALA A 221 ? 1.6119 2.0997 2.4613 -0.3470 -0.2179 -0.2875 221 ALA A C   
1563 O O   . ALA A 221 ? 1.6168 2.0703 2.4057 -0.3294 -0.2124 -0.2851 221 ALA A O   
1564 C CB  . ALA A 221 ? 1.7145 2.2575 2.5873 -0.3519 -0.2717 -0.3366 221 ALA A CB  
1565 N N   . ARG A 222 ? 1.5718 2.0508 2.4749 -0.3708 -0.2054 -0.2798 222 ARG A N   
1566 C CA  . ARG A 222 ? 1.5483 1.9746 2.4378 -0.3753 -0.1842 -0.2677 222 ARG A CA  
1567 C C   . ARG A 222 ? 1.6117 2.0309 2.4716 -0.3561 -0.1568 -0.2346 222 ARG A C   
1568 O O   . ARG A 222 ? 1.7188 2.0977 2.5280 -0.3425 -0.1477 -0.2295 222 ARG A O   
1569 C CB  . ARG A 222 ? 1.4903 1.9080 2.4454 -0.4056 -0.1771 -0.2667 222 ARG A CB  
1570 C CG  . ARG A 222 ? 1.5487 1.9233 2.5011 -0.4209 -0.1921 -0.2941 222 ARG A CG  
1571 C CD  . ARG A 222 ? 1.6965 2.0479 2.7017 -0.4476 -0.1774 -0.2862 222 ARG A CD  
1572 N NE  . ARG A 222 ? 1.8965 2.2044 2.8979 -0.4619 -0.1929 -0.3134 222 ARG A NE  
1573 C CZ  . ARG A 222 ? 2.0981 2.4159 3.1430 -0.4841 -0.2168 -0.3390 222 ARG A CZ  
1574 N NH1 . ARG A 222 ? 2.1538 2.5270 3.2531 -0.4955 -0.2278 -0.3408 222 ARG A NH1 
1575 N NH2 . ARG A 222 ? 2.1765 2.4488 3.2106 -0.4943 -0.2303 -0.3633 222 ARG A NH2 
1576 N N   . SER A 223 ? 1.5475 2.0063 2.4395 -0.3543 -0.1441 -0.2123 223 SER A N   
1577 C CA  . SER A 223 ? 1.5545 2.0084 2.4185 -0.3344 -0.1194 -0.1808 223 SER A CA  
1578 C C   . SER A 223 ? 1.6401 2.0851 2.4327 -0.3067 -0.1267 -0.1831 223 SER A C   
1579 O O   . SER A 223 ? 1.6837 2.0944 2.4334 -0.2924 -0.1123 -0.1689 223 SER A O   
1580 C CB  . SER A 223 ? 1.5213 2.0250 2.4293 -0.3340 -0.1077 -0.1592 223 SER A CB  
1581 O OG  . SER A 223 ? 1.4821 1.9772 2.3603 -0.3134 -0.0839 -0.1289 223 SER A OG  
1582 N N   . THR A 224 ? 1.6670 2.1427 2.4478 -0.2993 -0.1493 -0.2011 224 THR A N   
1583 C CA  . THR A 224 ? 1.6643 2.1326 2.3787 -0.2742 -0.1573 -0.2044 224 THR A CA  
1584 C C   . THR A 224 ? 1.6293 2.0469 2.2994 -0.2719 -0.1605 -0.2180 224 THR A C   
1585 O O   . THR A 224 ? 1.5931 1.9859 2.2130 -0.2541 -0.1519 -0.2075 224 THR A O   
1586 C CB  . THR A 224 ? 1.6781 2.1869 2.3891 -0.2673 -0.1823 -0.2236 224 THR A CB  
1587 O OG1 . THR A 224 ? 1.6505 2.2098 2.4036 -0.2677 -0.1791 -0.2105 224 THR A OG1 
1588 C CG2 . THR A 224 ? 1.6818 2.1796 2.3225 -0.2411 -0.1883 -0.2250 224 THR A CG2 
1589 N N   . LEU A 225 ? 1.5860 1.9889 2.2759 -0.2899 -0.1734 -0.2417 225 LEU A N   
1590 C CA  . LEU A 225 ? 1.5090 1.8649 2.1608 -0.2882 -0.1764 -0.2559 225 LEU A CA  
1591 C C   . LEU A 225 ? 1.4945 1.8117 2.1344 -0.2862 -0.1518 -0.2345 225 LEU A C   
1592 O O   . LEU A 225 ? 1.5285 1.8159 2.1198 -0.2716 -0.1473 -0.2325 225 LEU A O   
1593 C CB  . LEU A 225 ? 1.5002 1.8461 2.1816 -0.3091 -0.1935 -0.2837 225 LEU A CB  
1594 C CG  . LEU A 225 ? 1.5110 1.8147 2.1516 -0.3056 -0.2033 -0.3056 225 LEU A CG  
1595 C CD1 . LEU A 225 ? 1.5491 1.8058 2.1769 -0.3069 -0.1825 -0.2928 225 LEU A CD1 
1596 C CD2 . LEU A 225 ? 1.4765 1.7839 2.0581 -0.2817 -0.2137 -0.3133 225 LEU A CD2 
1597 N N   . GLN A 226 ? 1.4986 1.8170 2.1836 -0.3002 -0.1355 -0.2180 226 GLN A N   
1598 C CA  . GLN A 226 ? 1.5902 1.8716 2.2661 -0.2977 -0.1119 -0.1971 226 GLN A CA  
1599 C C   . GLN A 226 ? 1.6744 1.9565 2.3099 -0.2735 -0.0989 -0.1735 226 GLN A C   
1600 O O   . GLN A 226 ? 1.7099 1.9564 2.3156 -0.2641 -0.0861 -0.1625 226 GLN A O   
1601 C CB  . GLN A 226 ? 1.6102 1.8939 2.3438 -0.3174 -0.0964 -0.1834 226 GLN A CB  
1602 C CG  . GLN A 226 ? 1.7073 1.9805 2.4815 -0.3433 -0.1075 -0.2055 226 GLN A CG  
1603 C CD  . GLN A 226 ? 1.8592 2.1295 2.6895 -0.3633 -0.0893 -0.1895 226 GLN A CD  
1604 O OE1 . GLN A 226 ? 1.8738 2.1358 2.7030 -0.3558 -0.0652 -0.1616 226 GLN A OE1 
1605 N NE2 . GLN A 226 ? 1.9771 2.2528 2.8562 -0.3886 -0.1009 -0.2070 226 GLN A NE2 
1606 N N   . LYS A 227 ? 1.7365 2.0583 2.3707 -0.2629 -0.1032 -0.1664 227 LYS A N   
1607 C CA  . LYS A 227 ? 1.8449 2.1675 2.4393 -0.2393 -0.0934 -0.1452 227 LYS A CA  
1608 C C   . LYS A 227 ? 1.8763 2.1831 2.4128 -0.2229 -0.1051 -0.1564 227 LYS A C   
1609 O O   . LYS A 227 ? 1.8919 2.1784 2.3900 -0.2065 -0.0962 -0.1421 227 LYS A O   
1610 C CB  . LYS A 227 ? 1.9167 2.2862 2.5299 -0.2325 -0.0927 -0.1325 227 LYS A CB  
1611 C CG  . LYS A 227 ? 1.9820 2.3673 2.6496 -0.2449 -0.0754 -0.1143 227 LYS A CG  
1612 C CD  . LYS A 227 ? 2.0346 2.4694 2.7205 -0.2362 -0.0744 -0.1016 227 LYS A CD  
1613 C CE  . LYS A 227 ? 2.0978 2.5502 2.8411 -0.2488 -0.0549 -0.0823 227 LYS A CE  
1614 N NZ  . LYS A 227 ? 2.1100 2.6139 2.8740 -0.2395 -0.0529 -0.0694 227 LYS A NZ  
1615 N N   . GLU A 228 ? 1.8925 2.2083 2.4235 -0.2272 -0.1252 -0.1819 228 GLU A N   
1616 C CA  . GLU A 228 ? 1.8932 2.1925 2.3713 -0.2130 -0.1353 -0.1936 228 GLU A CA  
1617 C C   . GLU A 228 ? 1.8304 2.0843 2.2902 -0.2152 -0.1280 -0.1970 228 GLU A C   
1618 O O   . GLU A 228 ? 1.7853 2.0191 2.2016 -0.2009 -0.1262 -0.1944 228 GLU A O   
1619 C CB  . GLU A 228 ? 1.9281 2.2480 2.4045 -0.2157 -0.1583 -0.2201 228 GLU A CB  
1620 C CG  . GLU A 228 ? 1.9205 2.2860 2.4046 -0.2084 -0.1678 -0.2181 228 GLU A CG  
1621 C CD  . GLU A 228 ? 1.8942 2.2618 2.3296 -0.1847 -0.1648 -0.2040 228 GLU A CD  
1622 O OE1 . GLU A 228 ? 1.9182 2.2542 2.3108 -0.1748 -0.1611 -0.2027 228 GLU A OE1 
1623 O OE2 . GLU A 228 ? 1.8327 2.2336 2.2733 -0.1760 -0.1664 -0.1943 228 GLU A OE2 
1624 N N   . VAL A 229 ? 1.7674 2.0053 2.2618 -0.2331 -0.1238 -0.2027 229 VAL A N   
1625 C CA  . VAL A 229 ? 1.6654 1.8599 2.1464 -0.2351 -0.1156 -0.2049 229 VAL A CA  
1626 C C   . VAL A 229 ? 1.6536 1.8294 2.1243 -0.2255 -0.0953 -0.1784 229 VAL A C   
1627 O O   . VAL A 229 ? 1.6984 1.8440 2.1393 -0.2166 -0.0896 -0.1759 229 VAL A O   
1628 C CB  . VAL A 229 ? 1.5883 1.7684 2.1087 -0.2570 -0.1172 -0.2186 229 VAL A CB  
1629 C CG1 . VAL A 229 ? 1.6308 1.7651 2.1385 -0.2572 -0.1052 -0.2161 229 VAL A CG1 
1630 C CG2 . VAL A 229 ? 1.5449 1.7353 2.0675 -0.2643 -0.1399 -0.2482 229 VAL A CG2 
1631 N N   . HIS A 230 ? 1.6128 1.8075 2.1083 -0.2263 -0.0847 -0.1587 230 HIS A N   
1632 C CA  . HIS A 230 ? 1.5917 1.7696 2.0753 -0.2146 -0.0663 -0.1329 230 HIS A CA  
1633 C C   . HIS A 230 ? 1.5176 1.6935 1.9523 -0.1928 -0.0690 -0.1256 230 HIS A C   
1634 O O   . HIS A 230 ? 1.5321 1.6817 1.9434 -0.1817 -0.0593 -0.1127 230 HIS A O   
1635 C CB  . HIS A 230 ? 1.6503 1.8519 2.1687 -0.2178 -0.0544 -0.1133 230 HIS A CB  
1636 C CG  . HIS A 230 ? 1.7174 1.8999 2.2220 -0.2042 -0.0353 -0.0867 230 HIS A CG  
1637 N ND1 . HIS A 230 ? 1.7355 1.8894 2.2575 -0.2106 -0.0188 -0.0760 230 HIS A ND1 
1638 C CD2 . HIS A 230 ? 1.7570 1.9423 2.2295 -0.1831 -0.0309 -0.0691 230 HIS A CD2 
1639 C CE1 . HIS A 230 ? 1.7513 1.8924 2.2519 -0.1932 -0.0052 -0.0531 230 HIS A CE1 
1640 N NE2 . HIS A 230 ? 1.7680 1.9275 2.2386 -0.1765 -0.0128 -0.0489 230 HIS A NE2 
1641 N N   . ALA A 231 ? 1.4377 1.6408 1.8574 -0.1866 -0.0828 -0.1340 231 ALA A N   
1642 C CA  . ALA A 231 ? 1.4238 1.6246 1.7971 -0.1673 -0.0867 -0.1284 231 ALA A CA  
1643 C C   . ALA A 231 ? 1.4613 1.6357 1.8047 -0.1648 -0.0922 -0.1425 231 ALA A C   
1644 O O   . ALA A 231 ? 1.4462 1.6012 1.7586 -0.1523 -0.0879 -0.1332 231 ALA A O   
1645 C CB  . ALA A 231 ? 1.4225 1.6593 1.7885 -0.1608 -0.0990 -0.1326 231 ALA A CB  
1646 N N   . ALA A 232 ? 1.4916 1.6656 1.8449 -0.1763 -0.1019 -0.1649 232 ALA A N   
1647 C CA  . ALA A 232 ? 1.5056 1.6552 1.8326 -0.1737 -0.1058 -0.1789 232 ALA A CA  
1648 C C   . ALA A 232 ? 1.5071 1.6225 1.8357 -0.1746 -0.0925 -0.1709 232 ALA A C   
1649 O O   . ALA A 232 ? 1.4829 1.5783 1.7840 -0.1658 -0.0905 -0.1713 232 ALA A O   
1650 C CB  . ALA A 232 ? 1.4931 1.6474 1.8307 -0.1847 -0.1191 -0.2047 232 ALA A CB  
1651 N N   . LYS A 233 ? 1.5020 1.6112 1.8637 -0.1849 -0.0829 -0.1630 233 LYS A N   
1652 C CA  . LYS A 233 ? 1.4752 1.5512 1.8389 -0.1846 -0.0696 -0.1541 233 LYS A CA  
1653 C C   . LYS A 233 ? 1.4079 1.4764 1.7483 -0.1680 -0.0609 -0.1323 233 LYS A C   
1654 O O   . LYS A 233 ? 1.4107 1.4547 1.7318 -0.1599 -0.0566 -0.1295 233 LYS A O   
1655 C CB  . LYS A 233 ? 1.5236 1.5941 1.9283 -0.1997 -0.0607 -0.1501 233 LYS A CB  
1656 C CG  . LYS A 233 ? 1.6623 1.6956 2.0679 -0.1989 -0.0467 -0.1415 233 LYS A CG  
1657 C CD  . LYS A 233 ? 1.8007 1.8262 2.2467 -0.2152 -0.0375 -0.1382 233 LYS A CD  
1658 C CE  . LYS A 233 ? 1.9185 1.9037 2.3618 -0.2129 -0.0237 -0.1305 233 LYS A CE  
1659 N NZ  . LYS A 233 ? 1.9708 1.9442 2.4524 -0.2293 -0.0134 -0.1266 233 LYS A NZ  
1660 N N   . SER A 234 ? 1.3786 1.4684 1.7210 -0.1621 -0.0592 -0.1174 234 SER A N   
1661 C CA  . SER A 234 ? 1.4011 1.4839 1.7187 -0.1449 -0.0534 -0.0974 234 SER A CA  
1662 C C   . SER A 234 ? 1.2553 1.3324 1.5356 -0.1337 -0.0619 -0.1025 234 SER A C   
1663 O O   . SER A 234 ? 1.1448 1.2029 1.4051 -0.1223 -0.0580 -0.0919 234 SER A O   
1664 C CB  . SER A 234 ? 1.5646 1.6740 1.8870 -0.1390 -0.0521 -0.0831 234 SER A CB  
1665 O OG  . SER A 234 ? 1.6413 1.7571 2.0008 -0.1490 -0.0417 -0.0755 234 SER A OG  
1666 N N   . ALA A 235 ? 1.2793 1.3728 1.5510 -0.1367 -0.0736 -0.1186 235 ALA A N   
1667 C CA  . ALA A 235 ? 1.3268 1.4158 1.5646 -0.1273 -0.0804 -0.1237 235 ALA A CA  
1668 C C   . ALA A 235 ? 1.3251 1.3885 1.5583 -0.1290 -0.0770 -0.1319 235 ALA A C   
1669 O O   . ALA A 235 ? 1.3175 1.3693 1.5278 -0.1197 -0.0767 -0.1278 235 ALA A O   
1670 C CB  . ALA A 235 ? 1.3888 1.5008 1.6173 -0.1288 -0.0927 -0.1384 235 ALA A CB  
1671 N N   . ALA A 236 ? 1.3162 1.3708 1.5724 -0.1410 -0.0745 -0.1435 236 ALA A N   
1672 C CA  . ALA A 236 ? 1.2838 1.3135 1.5368 -0.1418 -0.0706 -0.1518 236 ALA A CA  
1673 C C   . ALA A 236 ? 1.2896 1.2977 1.5402 -0.1338 -0.0604 -0.1354 236 ALA A C   
1674 O O   . ALA A 236 ? 1.2223 1.2146 1.4603 -0.1277 -0.0582 -0.1371 236 ALA A O   
1675 C CB  . ALA A 236 ? 1.2024 1.2245 1.4801 -0.1560 -0.0707 -0.1671 236 ALA A CB  
1676 N N   . ILE A 237 ? 1.3289 1.3373 1.5917 -0.1326 -0.0542 -0.1195 237 ILE A N   
1677 C CA  . ILE A 237 ? 1.3309 1.3179 1.5897 -0.1230 -0.0453 -0.1036 237 ILE A CA  
1678 C C   . ILE A 237 ? 1.2875 1.2757 1.5187 -0.1083 -0.0498 -0.0934 237 ILE A C   
1679 O O   . ILE A 237 ? 1.2493 1.2190 1.4717 -0.0996 -0.0470 -0.0872 237 ILE A O   
1680 C CB  . ILE A 237 ? 1.3738 1.3595 1.6510 -0.1241 -0.0362 -0.0884 237 ILE A CB  
1681 C CG1 . ILE A 237 ? 1.3796 1.3660 1.6884 -0.1413 -0.0324 -0.0980 237 ILE A CG1 
1682 C CG2 . ILE A 237 ? 1.4093 1.3686 1.6795 -0.1125 -0.0271 -0.0733 237 ILE A CG2 
1683 C CD1 . ILE A 237 ? 1.3891 1.3748 1.7200 -0.1440 -0.0209 -0.0822 237 ILE A CD1 
1684 N N   . ILE A 238 ? 1.3875 1.3969 1.6055 -0.1055 -0.0575 -0.0922 238 ILE A N   
1685 C CA  . ILE A 238 ? 1.5554 1.5648 1.7464 -0.0929 -0.0630 -0.0834 238 ILE A CA  
1686 C C   . ILE A 238 ? 1.7114 1.7140 1.8900 -0.0920 -0.0663 -0.0931 238 ILE A C   
1687 O O   . ILE A 238 ? 1.7707 1.7619 1.9369 -0.0833 -0.0672 -0.0856 238 ILE A O   
1688 C CB  . ILE A 238 ? 1.6035 1.6358 1.7812 -0.0898 -0.0705 -0.0809 238 ILE A CB  
1689 C CG1 . ILE A 238 ? 1.7522 1.7955 1.9452 -0.0902 -0.0660 -0.0708 238 ILE A CG1 
1690 C CG2 . ILE A 238 ? 1.5028 1.5302 1.6513 -0.0770 -0.0765 -0.0713 238 ILE A CG2 
1691 C CD1 . ILE A 238 ? 1.8074 1.8759 1.9900 -0.0866 -0.0730 -0.0691 238 ILE A CD1 
1692 N N   . ALA A 239 ? 1.7576 1.7676 1.9401 -0.1006 -0.0683 -0.1099 239 ALA A N   
1693 C CA  . ALA A 239 ? 1.7844 1.7894 1.9555 -0.0993 -0.0692 -0.1192 239 ALA A CA  
1694 C C   . ALA A 239 ? 1.8290 1.8132 2.0106 -0.0981 -0.0619 -0.1194 239 ALA A C   
1695 O O   . ALA A 239 ? 1.8682 1.8460 2.0414 -0.0917 -0.0612 -0.1168 239 ALA A O   
1696 C CB  . ALA A 239 ? 1.7688 1.7849 1.9382 -0.1064 -0.0731 -0.1374 239 ALA A CB  
1697 N N   . GLY A 240 ? 1.7920 1.7659 1.9933 -0.1041 -0.0563 -0.1222 240 GLY A N   
1698 C CA  . GLY A 240 ? 1.6748 1.6271 1.8853 -0.1021 -0.0490 -0.1229 240 GLY A CA  
1699 C C   . GLY A 240 ? 1.5518 1.4932 1.7565 -0.0904 -0.0474 -0.1075 240 GLY A C   
1700 O O   . GLY A 240 ? 1.5331 1.4639 1.7374 -0.0849 -0.0450 -0.1087 240 GLY A O   
1701 N N   . LEU A 241 ? 1.5372 1.4817 1.7374 -0.0855 -0.0494 -0.0934 241 LEU A N   
1702 C CA  . LEU A 241 ? 1.5965 1.5291 1.7885 -0.0729 -0.0503 -0.0791 241 LEU A CA  
1703 C C   . LEU A 241 ? 1.5510 1.4903 1.7283 -0.0673 -0.0579 -0.0785 241 LEU A C   
1704 O O   . LEU A 241 ? 1.5278 1.4567 1.7020 -0.0581 -0.0601 -0.0713 241 LEU A O   
1705 C CB  . LEU A 241 ? 1.7441 1.6772 1.9314 -0.0673 -0.0505 -0.0644 241 LEU A CB  
1706 C CG  . LEU A 241 ? 1.8897 1.8146 2.0940 -0.0717 -0.0406 -0.0606 241 LEU A CG  
1707 C CD1 . LEU A 241 ? 1.9401 1.8688 2.1379 -0.0645 -0.0396 -0.0448 241 LEU A CD1 
1708 C CD2 . LEU A 241 ? 1.9128 1.8122 2.1248 -0.0672 -0.0331 -0.0589 241 LEU A CD2 
1709 N N   . PHE A 242 ? 1.5309 1.4870 1.6994 -0.0727 -0.0622 -0.0859 242 PHE A N   
1710 C CA  . PHE A 242 ? 1.5062 1.4680 1.6617 -0.0692 -0.0677 -0.0853 242 PHE A CA  
1711 C C   . PHE A 242 ? 1.4344 1.3908 1.5992 -0.0691 -0.0629 -0.0923 242 PHE A C   
1712 O O   . PHE A 242 ? 1.3807 1.3321 1.5467 -0.0627 -0.0650 -0.0860 242 PHE A O   
1713 C CB  . PHE A 242 ? 1.5362 1.5152 1.6779 -0.0741 -0.0717 -0.0917 242 PHE A CB  
1714 C CG  . PHE A 242 ? 1.5330 1.5162 1.6596 -0.0708 -0.0762 -0.0889 242 PHE A CG  
1715 C CD1 . PHE A 242 ? 1.5334 1.5176 1.6431 -0.0655 -0.0841 -0.0782 242 PHE A CD1 
1716 C CD2 . PHE A 242 ? 1.5182 1.5033 1.6472 -0.0727 -0.0718 -0.0965 242 PHE A CD2 
1717 C CE1 . PHE A 242 ? 1.5025 1.4881 1.5995 -0.0639 -0.0880 -0.0753 242 PHE A CE1 
1718 C CE2 . PHE A 242 ? 1.5511 1.5401 1.6689 -0.0708 -0.0742 -0.0925 242 PHE A CE2 
1719 C CZ  . PHE A 242 ? 1.5227 1.5114 1.6252 -0.0673 -0.0825 -0.0820 242 PHE A CZ  
1720 N N   . ALA A 243 ? 1.4124 1.3700 1.5844 -0.0755 -0.0571 -0.1056 243 ALA A N   
1721 C CA  . ALA A 243 ? 1.3766 1.3290 1.5563 -0.0739 -0.0510 -0.1130 243 ALA A CA  
1722 C C   . ALA A 243 ? 1.3367 1.2727 1.5293 -0.0672 -0.0478 -0.1068 243 ALA A C   
1723 O O   . ALA A 243 ? 1.3524 1.2863 1.5511 -0.0616 -0.0455 -0.1066 243 ALA A O   
1724 C CB  . ALA A 243 ? 1.3631 1.3155 1.5446 -0.0805 -0.0465 -0.1291 243 ALA A CB  
1725 N N   . LEU A 244 ? 1.2836 1.2085 1.4807 -0.0670 -0.0469 -0.1014 244 LEU A N   
1726 C CA  . LEU A 244 ? 1.2522 1.1583 1.4580 -0.0591 -0.0434 -0.0951 244 LEU A CA  
1727 C C   . LEU A 244 ? 1.2299 1.1347 1.4309 -0.0482 -0.0504 -0.0826 244 LEU A C   
1728 O O   . LEU A 244 ? 1.1382 1.0305 1.3455 -0.0391 -0.0495 -0.0789 244 LEU A O   
1729 C CB  . LEU A 244 ? 1.2641 1.1579 1.4746 -0.0617 -0.0390 -0.0910 244 LEU A CB  
1730 C CG  . LEU A 244 ? 1.2303 1.1002 1.4480 -0.0539 -0.0326 -0.0858 244 LEU A CG  
1731 C CD1 . LEU A 244 ? 1.2099 1.0697 1.4365 -0.0559 -0.0260 -0.0983 244 LEU A CD1 
1732 C CD2 . LEU A 244 ? 1.2230 1.0824 1.4438 -0.0562 -0.0275 -0.0779 244 LEU A CD2 
1733 N N   . CYS A 245 ? 1.3605 1.2770 1.5495 -0.0485 -0.0585 -0.0769 245 CYS A N   
1734 C CA  . CYS A 245 ? 1.5163 1.4297 1.6988 -0.0389 -0.0678 -0.0658 245 CYS A CA  
1735 C C   . CYS A 245 ? 1.5667 1.4928 1.7500 -0.0402 -0.0728 -0.0676 245 CYS A C   
1736 O O   . CYS A 245 ? 1.5396 1.4637 1.7206 -0.0338 -0.0821 -0.0599 245 CYS A O   
1737 C CB  . CYS A 245 ? 1.5878 1.5003 1.7539 -0.0360 -0.0741 -0.0559 245 CYS A CB  
1738 S SG  . CYS A 245 ? 1.9591 1.8562 2.1254 -0.0316 -0.0672 -0.0485 245 CYS A SG  
1739 N N   . TRP A 246 ? 1.6302 1.5685 1.8167 -0.0483 -0.0668 -0.0776 246 TRP A N   
1740 C CA  . TRP A 246 ? 1.6446 1.5956 1.8327 -0.0501 -0.0684 -0.0783 246 TRP A CA  
1741 C C   . TRP A 246 ? 1.5812 1.5363 1.7851 -0.0498 -0.0591 -0.0862 246 TRP A C   
1742 O O   . TRP A 246 ? 1.5557 1.5192 1.7697 -0.0480 -0.0595 -0.0837 246 TRP A O   
1743 C CB  . TRP A 246 ? 1.7192 1.6820 1.8907 -0.0571 -0.0694 -0.0806 246 TRP A CB  
1744 C CG  . TRP A 246 ? 1.8259 1.7867 1.9808 -0.0553 -0.0798 -0.0711 246 TRP A CG  
1745 C CD1 . TRP A 246 ? 1.9004 1.8573 2.0443 -0.0543 -0.0824 -0.0683 246 TRP A CD1 
1746 C CD2 . TRP A 246 ? 1.8504 1.8123 1.9975 -0.0535 -0.0889 -0.0629 246 TRP A CD2 
1747 N NE1 . TRP A 246 ? 1.9143 1.8694 2.0414 -0.0503 -0.0923 -0.0590 246 TRP A NE1 
1748 C CE2 . TRP A 246 ? 1.8876 1.8440 2.0154 -0.0502 -0.0972 -0.0560 246 TRP A CE2 
1749 C CE3 . TRP A 246 ? 1.8250 1.7918 1.9807 -0.0547 -0.0905 -0.0605 246 TRP A CE3 
1750 C CZ2 . TRP A 246 ? 1.8868 1.8391 2.0004 -0.0473 -0.1081 -0.0477 246 TRP A CZ2 
1751 C CZ3 . TRP A 246 ? 1.8471 1.8107 1.9921 -0.0539 -0.1015 -0.0520 246 TRP A CZ3 
1752 C CH2 . TRP A 246 ? 1.8919 1.8467 2.0143 -0.0500 -0.1107 -0.0462 246 TRP A CH2 
1753 N N   . LEU A 247 ? 1.5707 1.5198 1.7776 -0.0514 -0.0506 -0.0956 247 LEU A N   
1754 C CA  . LEU A 247 ? 1.5624 1.5125 1.7811 -0.0488 -0.0413 -0.1037 247 LEU A CA  
1755 C C   . LEU A 247 ? 1.5867 1.5345 1.8225 -0.0396 -0.0426 -0.0977 247 LEU A C   
1756 O O   . LEU A 247 ? 1.6199 1.5796 1.8671 -0.0373 -0.0386 -0.0986 247 LEU A O   
1757 C CB  . LEU A 247 ? 1.5724 1.5100 1.7903 -0.0509 -0.0341 -0.1145 247 LEU A CB  
1758 C CG  . LEU A 247 ? 1.6025 1.5457 1.8080 -0.0589 -0.0313 -0.1259 247 LEU A CG  
1759 C CD1 . LEU A 247 ? 1.6367 1.5644 1.8447 -0.0611 -0.0260 -0.1372 247 LEU A CD1 
1760 C CD2 . LEU A 247 ? 1.5949 1.5521 1.7961 -0.0577 -0.0263 -0.1303 247 LEU A CD2 
1761 N N   . PRO A 248 ? 1.5534 1.4867 1.7914 -0.0332 -0.0480 -0.0913 248 PRO A N   
1762 C CA  . PRO A 248 ? 1.5160 1.4468 1.7691 -0.0226 -0.0514 -0.0863 248 PRO A CA  
1763 C C   . PRO A 248 ? 1.5168 1.4652 1.7800 -0.0228 -0.0586 -0.0807 248 PRO A C   
1764 O O   . PRO A 248 ? 1.5254 1.4830 1.8076 -0.0178 -0.0565 -0.0813 248 PRO A O   
1765 C CB  . PRO A 248 ? 1.4680 1.3802 1.7133 -0.0158 -0.0587 -0.0783 248 PRO A CB  
1766 C CG  . PRO A 248 ? 1.5138 1.4160 1.7469 -0.0225 -0.0527 -0.0817 248 PRO A CG  
1767 C CD  . PRO A 248 ? 1.5307 1.4494 1.7576 -0.0342 -0.0504 -0.0881 248 PRO A CD  
1768 N N   . LEU A 249 ? 1.4737 1.4266 1.7249 -0.0286 -0.0668 -0.0751 249 LEU A N   
1769 C CA  . LEU A 249 ? 1.3515 1.3177 1.6114 -0.0306 -0.0747 -0.0691 249 LEU A CA  
1770 C C   . LEU A 249 ? 1.3709 1.3561 1.6409 -0.0369 -0.0640 -0.0732 249 LEU A C   
1771 O O   . LEU A 249 ? 1.3283 1.3268 1.6182 -0.0367 -0.0654 -0.0695 249 LEU A O   
1772 C CB  . LEU A 249 ? 1.2459 1.2078 1.4857 -0.0346 -0.0856 -0.0624 249 LEU A CB  
1773 C CG  . LEU A 249 ? 1.1661 1.1368 1.4120 -0.0378 -0.0957 -0.0557 249 LEU A CG  
1774 C CD1 . LEU A 249 ? 1.2372 1.2087 1.5066 -0.0303 -0.1044 -0.0526 249 LEU A CD1 
1775 C CD2 . LEU A 249 ? 1.1429 1.1035 1.3645 -0.0387 -0.1075 -0.0494 249 LEU A CD2 
1776 N N   . HIS A 250 ? 1.5177 1.5041 1.7743 -0.0419 -0.0534 -0.0808 250 HIS A N   
1777 C CA  . HIS A 250 ? 1.6069 1.6085 1.8674 -0.0453 -0.0414 -0.0851 250 HIS A CA  
1778 C C   . HIS A 250 ? 1.5723 1.5776 1.8514 -0.0380 -0.0309 -0.0906 250 HIS A C   
1779 O O   . HIS A 250 ? 1.5710 1.5923 1.8653 -0.0370 -0.0231 -0.0892 250 HIS A O   
1780 C CB  . HIS A 250 ? 1.7496 1.7493 1.9857 -0.0510 -0.0357 -0.0926 250 HIS A CB  
1781 C CG  . HIS A 250 ? 1.8100 1.8085 2.0267 -0.0568 -0.0448 -0.0874 250 HIS A CG  
1782 N ND1 . HIS A 250 ? 1.8374 1.8263 2.0366 -0.0588 -0.0497 -0.0902 250 HIS A ND1 
1783 C CD2 . HIS A 250 ? 1.8055 1.8109 2.0176 -0.0607 -0.0497 -0.0794 250 HIS A CD2 
1784 C CE1 . HIS A 250 ? 1.8535 1.8443 2.0368 -0.0622 -0.0572 -0.0843 250 HIS A CE1 
1785 N NE2 . HIS A 250 ? 1.8445 1.8433 2.0337 -0.0634 -0.0576 -0.0778 250 HIS A NE2 
1786 N N   . ILE A 251 ? 1.5721 1.5619 1.8497 -0.0324 -0.0299 -0.0961 251 ILE A N   
1787 C CA  . ILE A 251 ? 1.6095 1.5986 1.9013 -0.0236 -0.0206 -0.1017 251 ILE A CA  
1788 C C   . ILE A 251 ? 1.5136 1.5162 1.8328 -0.0169 -0.0240 -0.0944 251 ILE A C   
1789 O O   . ILE A 251 ? 1.3550 1.3703 1.6904 -0.0112 -0.0142 -0.0965 251 ILE A O   
1790 C CB  . ILE A 251 ? 1.6473 1.6130 1.9322 -0.0186 -0.0206 -0.1070 251 ILE A CB  
1791 C CG1 . ILE A 251 ? 1.6347 1.5897 1.8986 -0.0259 -0.0160 -0.1164 251 ILE A CG1 
1792 C CG2 . ILE A 251 ? 1.7007 1.6635 2.0000 -0.0071 -0.0128 -0.1112 251 ILE A CG2 
1793 C CD1 . ILE A 251 ? 1.6692 1.6001 1.9281 -0.0238 -0.0152 -0.1210 251 ILE A CD1 
1794 N N   . ILE A 252 ? 1.5422 1.5425 1.8664 -0.0168 -0.0386 -0.0860 252 ILE A N   
1795 C CA  . ILE A 252 ? 1.5384 1.5523 1.8900 -0.0116 -0.0459 -0.0795 252 ILE A CA  
1796 C C   . ILE A 252 ? 1.5605 1.5997 1.9289 -0.0185 -0.0399 -0.0759 252 ILE A C   
1797 O O   . ILE A 252 ? 1.6008 1.6579 1.9971 -0.0136 -0.0350 -0.0746 252 ILE A O   
1798 C CB  . ILE A 252 ? 1.5306 1.5345 1.8790 -0.0105 -0.0649 -0.0719 252 ILE A CB  
1799 C CG1 . ILE A 252 ? 1.5226 1.5037 1.8622 0.0010  -0.0695 -0.0732 252 ILE A CG1 
1800 C CG2 . ILE A 252 ? 1.5072 1.5290 1.8843 -0.0098 -0.0751 -0.0657 252 ILE A CG2 
1801 C CD1 . ILE A 252 ? 1.4805 1.4500 1.8150 0.0064  -0.0881 -0.0659 252 ILE A CD1 
1802 N N   . ASN A 253 ? 1.5788 1.6196 1.9305 -0.0293 -0.0396 -0.0737 253 ASN A N   
1803 C CA  . ASN A 253 ? 1.6276 1.6891 1.9914 -0.0365 -0.0324 -0.0687 253 ASN A CA  
1804 C C   . ASN A 253 ? 1.6572 1.7302 2.0235 -0.0332 -0.0119 -0.0743 253 ASN A C   
1805 O O   . ASN A 253 ? 1.6710 1.7644 2.0558 -0.0353 -0.0024 -0.0692 253 ASN A O   
1806 C CB  . ASN A 253 ? 1.6536 1.7099 1.9939 -0.0471 -0.0375 -0.0648 253 ASN A CB  
1807 C CG  . ASN A 253 ? 1.6338 1.6811 1.9738 -0.0496 -0.0577 -0.0576 253 ASN A CG  
1808 O OD1 . ASN A 253 ? 1.6381 1.6822 1.9941 -0.0430 -0.0688 -0.0561 253 ASN A OD1 
1809 N ND2 . ASN A 253 ? 1.5969 1.6386 1.9161 -0.0575 -0.0630 -0.0535 253 ASN A ND2 
1810 N N   . CYS A 254 ? 1.6921 1.7512 2.0396 -0.0276 -0.0049 -0.0844 254 CYS A N   
1811 C CA  . CYS A 254 ? 1.7189 1.7842 2.0641 -0.0217 0.0133  -0.0913 254 CYS A CA  
1812 C C   . CYS A 254 ? 1.7483 1.8261 2.1237 -0.0106 0.0193  -0.0905 254 CYS A C   
1813 O O   . CYS A 254 ? 1.7390 1.8339 2.1260 -0.0059 0.0344  -0.0900 254 CYS A O   
1814 C CB  . CYS A 254 ? 1.6829 1.7264 1.9986 -0.0196 0.0164  -0.1036 254 CYS A CB  
1815 S SG  . CYS A 254 ? 2.8316 2.8653 3.1129 -0.0310 0.0113  -0.1062 254 CYS A SG  
1816 N N   . PHE A 255 ? 1.7224 1.7917 2.1095 -0.0049 0.0078  -0.0901 255 PHE A N   
1817 C CA  . PHE A 255 ? 1.6491 1.7306 2.0656 0.0071  0.0105  -0.0892 255 PHE A CA  
1818 C C   . PHE A 255 ? 1.6091 1.7204 2.0614 0.0037  0.0090  -0.0789 255 PHE A C   
1819 O O   . PHE A 255 ? 1.6535 1.7866 2.1304 0.0106  0.0212  -0.0775 255 PHE A O   
1820 C CB  . PHE A 255 ? 1.6500 1.7126 2.0666 0.0149  -0.0030 -0.0907 255 PHE A CB  
1821 C CG  . PHE A 255 ? 1.7132 1.7497 2.1065 0.0222  0.0032  -0.1007 255 PHE A CG  
1822 C CD1 . PHE A 255 ? 1.7802 1.7996 2.1432 0.0145  0.0071  -0.1071 255 PHE A CD1 
1823 C CD2 . PHE A 255 ? 1.7161 1.7447 2.1183 0.0369  0.0044  -0.1039 255 PHE A CD2 
1824 C CE1 . PHE A 255 ? 1.8179 1.8124 2.1623 0.0194  0.0118  -0.1167 255 PHE A CE1 
1825 C CE2 . PHE A 255 ? 1.7428 1.7441 2.1231 0.0428  0.0102  -0.1128 255 PHE A CE2 
1826 C CZ  . PHE A 255 ? 1.7893 1.7734 2.1419 0.0331  0.0138  -0.1192 255 PHE A CZ  
1827 N N   . THR A 256 ? 1.5430 1.6552 1.9991 -0.0067 -0.0061 -0.0717 256 THR A N   
1828 C CA  . THR A 256 ? 1.4787 1.6167 1.9703 -0.0127 -0.0105 -0.0619 256 THR A CA  
1829 C C   . THR A 256 ? 1.4416 1.6008 1.9412 -0.0185 0.0089  -0.0574 256 THR A C   
1830 O O   . THR A 256 ? 1.5532 1.7397 2.0894 -0.0163 0.0170  -0.0519 256 THR A O   
1831 C CB  . THR A 256 ? 1.4248 1.5536 1.9116 -0.0233 -0.0311 -0.0559 256 THR A CB  
1832 O OG1 . THR A 256 ? 1.4234 1.5351 1.9069 -0.0151 -0.0489 -0.0583 256 THR A OG1 
1833 C CG2 . THR A 256 ? 1.4017 1.5553 1.9252 -0.0321 -0.0353 -0.0462 256 THR A CG2 
1834 N N   . PHE A 257 ? 1.3109 1.4582 1.7766 -0.0249 0.0167  -0.0595 257 PHE A N   
1835 C CA  . PHE A 257 ? 1.3338 1.4966 1.7993 -0.0291 0.0355  -0.0548 257 PHE A CA  
1836 C C   . PHE A 257 ? 1.4459 1.6186 1.9140 -0.0160 0.0569  -0.0598 257 PHE A C   
1837 O O   . PHE A 257 ? 1.5242 1.7233 2.0258 -0.0122 0.0688  -0.0532 257 PHE A O   
1838 C CB  . PHE A 257 ? 1.4094 1.5544 1.8334 -0.0372 0.0361  -0.0566 257 PHE A CB  
1839 C CG  . PHE A 257 ? 1.4239 1.5809 1.8416 -0.0401 0.0553  -0.0512 257 PHE A CG  
1840 C CD1 . PHE A 257 ? 1.3932 1.5595 1.8218 -0.0520 0.0542  -0.0392 257 PHE A CD1 
1841 C CD2 . PHE A 257 ? 1.4609 1.6173 1.8595 -0.0301 0.0744  -0.0580 257 PHE A CD2 
1842 C CE1 . PHE A 257 ? 1.4430 1.6182 1.8637 -0.0537 0.0736  -0.0329 257 PHE A CE1 
1843 C CE2 . PHE A 257 ? 1.4978 1.6633 1.8868 -0.0303 0.0930  -0.0525 257 PHE A CE2 
1844 C CZ  . PHE A 257 ? 1.5023 1.6775 1.9025 -0.0421 0.0934  -0.0393 257 PHE A CZ  
1845 N N   . PHE A 258 ? 1.5297 1.6812 1.9630 -0.0088 0.0617  -0.0715 258 PHE A N   
1846 C CA  . PHE A 258 ? 1.6563 1.8109 2.0833 0.0050  0.0811  -0.0781 258 PHE A CA  
1847 C C   . PHE A 258 ? 1.6452 1.8157 2.1069 0.0176  0.0845  -0.0773 258 PHE A C   
1848 O O   . PHE A 258 ? 1.5850 1.7706 2.0558 0.0288  0.1031  -0.0770 258 PHE A O   
1849 C CB  . PHE A 258 ? 1.6986 1.8234 2.0835 0.0095  0.0806  -0.0926 258 PHE A CB  
1850 C CG  . PHE A 258 ? 1.7630 1.8764 2.1124 0.0012  0.0818  -0.0951 258 PHE A CG  
1851 C CD1 . PHE A 258 ? 1.8704 1.9666 2.2012 -0.0094 0.0651  -0.0971 258 PHE A CD1 
1852 C CD2 . PHE A 258 ? 1.7871 1.9073 2.1208 0.0058  0.0998  -0.0951 258 PHE A CD2 
1853 C CE1 . PHE A 258 ? 1.9372 2.0247 2.2360 -0.0157 0.0655  -0.0998 258 PHE A CE1 
1854 C CE2 . PHE A 258 ? 1.8909 2.0001 2.1900 0.0000  0.0999  -0.0980 258 PHE A CE2 
1855 C CZ  . PHE A 258 ? 1.9609 2.0545 2.2434 -0.0109 0.0822  -0.1007 258 PHE A CZ  
1856 N N   . CYS A 259 ? 1.6591 1.8257 2.1383 0.0175  0.0667  -0.0769 259 CYS A N   
1857 C CA  . CYS A 259 ? 1.7022 1.8828 2.2133 0.0308  0.0671  -0.0768 259 CYS A CA  
1858 C C   . CYS A 259 ? 1.7540 1.9556 2.3069 0.0250  0.0517  -0.0670 259 CYS A C   
1859 O O   . CYS A 259 ? 1.7356 1.9232 2.2887 0.0249  0.0320  -0.0686 259 CYS A O   
1860 C CB  . CYS A 259 ? 1.6584 1.8102 2.1483 0.0418  0.0605  -0.0880 259 CYS A CB  
1861 S SG  . CYS A 259 ? 2.9451 3.1091 3.4641 0.0631  0.0649  -0.0900 259 CYS A SG  
1862 N N   . PRO A 260 ? 1.7511 1.9857 2.3395 0.0203  0.0605  -0.0567 260 PRO A N   
1863 C CA  . PRO A 260 ? 1.6264 1.8840 2.2602 0.0137  0.0456  -0.0479 260 PRO A CA  
1864 C C   . PRO A 260 ? 1.4973 1.7618 2.1565 0.0288  0.0358  -0.0517 260 PRO A C   
1865 O O   . PRO A 260 ? 1.4671 1.7354 2.1489 0.0261  0.0144  -0.0493 260 PRO A O   
1866 C CB  . PRO A 260 ? 1.6496 1.9426 2.3171 0.0086  0.0644  -0.0369 260 PRO A CB  
1867 C CG  . PRO A 260 ? 1.6870 1.9675 2.3147 0.0076  0.0847  -0.0385 260 PRO A CG  
1868 C CD  . PRO A 260 ? 1.7538 2.0047 2.3407 0.0207  0.0855  -0.0525 260 PRO A CD  
1869 N N   . ASP A 261 ? 1.4218 1.6861 2.0747 0.0460  0.0507  -0.0581 261 ASP A N   
1870 C CA  . ASP A 261 ? 1.5227 1.7904 2.1942 0.0633  0.0432  -0.0624 261 ASP A CA  
1871 C C   . ASP A 261 ? 1.5829 1.8142 2.2256 0.0662  0.0228  -0.0694 261 ASP A C   
1872 O O   . ASP A 261 ? 1.5346 1.7686 2.1974 0.0728  0.0050  -0.0691 261 ASP A O   
1873 C CB  . ASP A 261 ? 1.6460 1.9166 2.3102 0.0821  0.0652  -0.0679 261 ASP A CB  
1874 C CG  . ASP A 261 ? 1.7169 2.0308 2.4220 0.0858  0.0842  -0.0593 261 ASP A CG  
1875 O OD1 . ASP A 261 ? 1.7684 2.1110 2.5118 0.0725  0.0799  -0.0488 261 ASP A OD1 
1876 O OD2 . ASP A 261 ? 1.6637 1.9822 2.3629 0.1025  0.1039  -0.0628 261 ASP A OD2 
1877 N N   . CYS A 262 ? 1.7399 1.9374 2.3359 0.0619  0.0255  -0.0756 262 CYS A N   
1878 C CA  . CYS A 262 ? 1.8131 1.9750 2.3798 0.0638  0.0096  -0.0810 262 CYS A CA  
1879 C C   . CYS A 262 ? 1.8014 1.9652 2.3831 0.0563  -0.0143 -0.0749 262 CYS A C   
1880 O O   . CYS A 262 ? 1.7967 1.9663 2.3798 0.0403  -0.0199 -0.0692 262 CYS A O   
1881 C CB  . CYS A 262 ? 1.8307 1.9630 2.3519 0.0549  0.0153  -0.0865 262 CYS A CB  
1882 S SG  . CYS A 262 ? 1.6077 1.7314 2.1048 0.0641  0.0402  -0.0960 262 CYS A SG  
1883 N N   . SER A 263 ? 1.7623 1.9190 2.3527 0.0694  -0.0288 -0.0765 263 SER A N   
1884 C CA  . SER A 263 ? 1.7451 1.9014 2.3481 0.0665  -0.0536 -0.0721 263 SER A CA  
1885 C C   . SER A 263 ? 1.8339 1.9714 2.4098 0.0499  -0.0626 -0.0691 263 SER A C   
1886 O O   . SER A 263 ? 1.8662 1.9725 2.4032 0.0498  -0.0619 -0.0726 263 SER A O   
1887 C CB  . SER A 263 ? 1.6876 1.8227 2.2818 0.0852  -0.0667 -0.0761 263 SER A CB  
1888 O OG  . SER A 263 ? 1.7478 1.8453 2.2984 0.0892  -0.0602 -0.0811 263 SER A OG  
1889 N N   . HIS A 264 ? 1.8768 2.0338 2.4746 0.0360  -0.0707 -0.0624 264 HIS A N   
1890 C CA  . HIS A 264 ? 1.8692 2.0099 2.4425 0.0212  -0.0800 -0.0590 264 HIS A CA  
1891 C C   . HIS A 264 ? 1.8755 1.9827 2.4182 0.0286  -0.0975 -0.0611 264 HIS A C   
1892 O O   . HIS A 264 ? 1.9221 2.0265 2.4767 0.0405  -0.1140 -0.0615 264 HIS A O   
1893 C CB  . HIS A 264 ? 1.8005 1.9638 2.4060 0.0080  -0.0913 -0.0514 264 HIS A CB  
1894 C CG  . HIS A 264 ? 1.6339 1.8317 2.2731 0.0005  -0.0728 -0.0470 264 HIS A CG  
1895 N ND1 . HIS A 264 ? 1.6053 1.8049 2.2282 -0.0105 -0.0538 -0.0445 264 HIS A ND1 
1896 C CD2 . HIS A 264 ? 1.4500 1.6822 2.1383 0.0036  -0.0699 -0.0439 264 HIS A CD2 
1897 C CE1 . HIS A 264 ? 1.4575 1.6896 2.1162 -0.0135 -0.0386 -0.0393 264 HIS A CE1 
1898 N NE2 . HIS A 264 ? 1.3842 1.6380 2.0849 -0.0057 -0.0475 -0.0386 264 HIS A NE2 
1899 N N   . ALA A 265 ? 1.8352 1.9177 2.3384 0.0226  -0.0937 -0.0622 265 ALA A N   
1900 C CA  . ALA A 265 ? 1.8459 1.8963 2.3178 0.0297  -0.1063 -0.0628 265 ALA A CA  
1901 C C   . ALA A 265 ? 1.7110 1.7580 2.1910 0.0331  -0.1317 -0.0585 265 ALA A C   
1902 O O   . ALA A 265 ? 1.6673 1.7258 2.1592 0.0213  -0.1412 -0.0541 265 ALA A O   
1903 C CB  . ALA A 265 ? 1.9471 1.9790 2.3823 0.0193  -0.0998 -0.0629 265 ALA A CB  
1904 N N   . PRO A 266 ? 1.5832 1.6120 2.0550 0.0502  -0.1432 -0.0599 266 PRO A N   
1905 C CA  . PRO A 266 ? 1.5913 1.6115 2.0647 0.0579  -0.1692 -0.0572 266 PRO A CA  
1906 C C   . PRO A 266 ? 1.7367 1.7375 2.1797 0.0492  -0.1795 -0.0529 266 PRO A C   
1907 O O   . PRO A 266 ? 1.8431 1.8335 2.2601 0.0408  -0.1661 -0.0522 266 PRO A O   
1908 C CB  . PRO A 266 ? 1.5026 1.4989 1.9587 0.0797  -0.1725 -0.0596 266 PRO A CB  
1909 C CG  . PRO A 266 ? 1.4434 1.4288 1.8810 0.0797  -0.1484 -0.0626 266 PRO A CG  
1910 C CD  . PRO A 266 ? 1.4735 1.4862 1.9316 0.0644  -0.1313 -0.0644 266 PRO A CD  
1911 N N   . LEU A 267 ? 1.7723 1.7684 2.2185 0.0521  -0.2038 -0.0505 267 LEU A N   
1912 C CA  . LEU A 267 ? 1.8364 1.8120 2.2514 0.0466  -0.2153 -0.0463 267 LEU A CA  
1913 C C   . LEU A 267 ? 1.9004 1.8425 2.2716 0.0599  -0.2138 -0.0448 267 LEU A C   
1914 O O   . LEU A 267 ? 1.9557 1.8840 2.2973 0.0533  -0.2094 -0.0415 267 LEU A O   
1915 C CB  . LEU A 267 ? 1.8426 1.8187 2.2711 0.0477  -0.2435 -0.0451 267 LEU A CB  
1916 C CG  . LEU A 267 ? 1.8694 1.8772 2.3414 0.0304  -0.2457 -0.0444 267 LEU A CG  
1917 C CD1 . LEU A 267 ? 1.9047 1.9092 2.3900 0.0317  -0.2766 -0.0443 267 LEU A CD1 
1918 C CD2 . LEU A 267 ? 1.8311 1.8445 2.2935 0.0105  -0.2293 -0.0407 267 LEU A CD2 
1919 N N   . TRP A 268 ? 1.8432 1.7723 2.2104 0.0793  -0.2170 -0.0465 268 TRP A N   
1920 C CA  . TRP A 268 ? 1.7851 1.6812 2.1122 0.0933  -0.2147 -0.0435 268 TRP A CA  
1921 C C   . TRP A 268 ? 1.7377 1.6303 2.0497 0.0835  -0.1893 -0.0433 268 TRP A C   
1922 O O   . TRP A 268 ? 1.7735 1.6445 2.0534 0.0855  -0.1851 -0.0391 268 TRP A O   
1923 C CB  . TRP A 268 ? 1.7667 1.6496 2.0934 0.1165  -0.2200 -0.0452 268 TRP A CB  
1924 C CG  . TRP A 268 ? 1.7090 1.6015 2.0520 0.1179  -0.1996 -0.0494 268 TRP A CG  
1925 C CD1 . TRP A 268 ? 1.6658 1.5845 2.0461 0.1184  -0.1981 -0.0545 268 TRP A CD1 
1926 C CD2 . TRP A 268 ? 1.6793 1.5544 2.0017 0.1193  -0.1779 -0.0491 268 TRP A CD2 
1927 N NE1 . TRP A 268 ? 1.6465 1.5634 2.0272 0.1215  -0.1769 -0.0576 268 TRP A NE1 
1928 C CE2 . TRP A 268 ? 1.6506 1.5397 1.9963 0.1213  -0.1648 -0.0548 268 TRP A CE2 
1929 C CE3 . TRP A 268 ? 1.6245 1.4740 1.9125 0.1188  -0.1682 -0.0444 268 TRP A CE3 
1930 C CZ2 . TRP A 268 ? 1.6229 1.4979 1.9564 0.1226  -0.1439 -0.0568 268 TRP A CZ2 
1931 C CZ3 . TRP A 268 ? 1.5658 1.4039 1.8461 0.1185  -0.1472 -0.0460 268 TRP A CZ3 
1932 C CH2 . TRP A 268 ? 1.5761 1.4252 1.8778 0.1202  -0.1358 -0.0526 268 TRP A CH2 
1933 N N   . LEU A 269 ? 1.6387 1.5532 1.9748 0.0734  -0.1728 -0.0482 269 LEU A N   
1934 C CA  . LEU A 269 ? 1.5077 1.4204 1.8323 0.0634  -0.1505 -0.0502 269 LEU A CA  
1935 C C   . LEU A 269 ? 1.5024 1.4272 1.8225 0.0443  -0.1475 -0.0489 269 LEU A C   
1936 O O   . LEU A 269 ? 1.5443 1.4622 1.8449 0.0367  -0.1355 -0.0492 269 LEU A O   
1937 C CB  . LEU A 269 ? 1.4150 1.3430 1.7631 0.0634  -0.1347 -0.0566 269 LEU A CB  
1938 C CG  . LEU A 269 ? 1.2563 1.1793 1.5922 0.0550  -0.1131 -0.0607 269 LEU A CG  
1939 C CD1 . LEU A 269 ? 1.1942 1.0857 1.5026 0.0641  -0.1091 -0.0587 269 LEU A CD1 
1940 C CD2 . LEU A 269 ? 1.2501 1.1888 1.6085 0.0562  -0.0994 -0.0675 269 LEU A CD2 
1941 N N   . MET A 270 ? 1.5163 1.4593 1.8555 0.0368  -0.1587 -0.0476 270 MET A N   
1942 C CA  . MET A 270 ? 1.6384 1.5919 1.9732 0.0197  -0.1559 -0.0458 270 MET A CA  
1943 C C   . MET A 270 ? 1.7882 1.7203 2.0871 0.0198  -0.1633 -0.0411 270 MET A C   
1944 O O   . MET A 270 ? 1.8653 1.7974 2.1473 0.0100  -0.1528 -0.0411 270 MET A O   
1945 C CB  . MET A 270 ? 1.6521 1.6263 2.0160 0.0119  -0.1672 -0.0441 270 MET A CB  
1946 C CG  . MET A 270 ? 1.6754 1.6592 2.0346 -0.0055 -0.1627 -0.0414 270 MET A CG  
1947 S SD  . MET A 270 ? 2.0122 2.0113 2.3714 -0.0160 -0.1345 -0.0457 270 MET A SD  
1948 C CE  . MET A 270 ? 2.1322 2.1579 2.5360 -0.0128 -0.1258 -0.0488 270 MET A CE  
1949 N N   . TYR A 271 ? 1.8240 1.7379 2.1102 0.0325  -0.1818 -0.0372 271 TYR A N   
1950 C CA  . TYR A 271 ? 1.8783 1.7711 2.1289 0.0358  -0.1895 -0.0318 271 TYR A CA  
1951 C C   . TYR A 271 ? 1.7966 1.6760 2.0243 0.0392  -0.1735 -0.0308 271 TYR A C   
1952 O O   . TYR A 271 ? 1.8258 1.6997 2.0306 0.0342  -0.1702 -0.0277 271 TYR A O   
1953 C CB  . TYR A 271 ? 2.0233 1.8967 2.2626 0.0521  -0.2130 -0.0283 271 TYR A CB  
1954 C CG  . TYR A 271 ? 2.2131 2.0634 2.4337 0.0723  -0.2122 -0.0263 271 TYR A CG  
1955 C CD1 . TYR A 271 ? 2.2788 2.1086 2.4653 0.0787  -0.2056 -0.0206 271 TYR A CD1 
1956 C CD2 . TYR A 271 ? 2.3290 2.1780 2.5662 0.0858  -0.2175 -0.0292 271 TYR A CD2 
1957 C CE1 . TYR A 271 ? 2.3477 2.1550 2.5168 0.0972  -0.2026 -0.0171 271 TYR A CE1 
1958 C CE2 . TYR A 271 ? 2.4203 2.2454 2.6375 0.1054  -0.2158 -0.0265 271 TYR A CE2 
1959 C CZ  . TYR A 271 ? 2.4378 2.2412 2.6207 0.1108  -0.2077 -0.0200 271 TYR A CZ  
1960 O OH  . TYR A 271 ? 2.5170 2.2951 2.6796 0.1305  -0.2038 -0.0156 271 TYR A OH  
1961 N N   . LEU A 272 ? 1.6497 1.5240 1.8845 0.0477  -0.1637 -0.0335 272 LEU A N   
1962 C CA  . LEU A 272 ? 1.5236 1.3840 1.7411 0.0498  -0.1482 -0.0325 272 LEU A CA  
1963 C C   . LEU A 272 ? 1.5266 1.4012 1.7443 0.0320  -0.1332 -0.0364 272 LEU A C   
1964 O O   . LEU A 272 ? 1.6241 1.4909 1.8228 0.0292  -0.1266 -0.0337 272 LEU A O   
1965 C CB  . LEU A 272 ? 1.4855 1.3377 1.7134 0.0604  -0.1395 -0.0355 272 LEU A CB  
1966 C CG  . LEU A 272 ? 1.4996 1.3333 1.7122 0.0634  -0.1235 -0.0339 272 LEU A CG  
1967 C CD1 . LEU A 272 ? 1.4950 1.3093 1.7073 0.0815  -0.1222 -0.0329 272 LEU A CD1 
1968 C CD2 . LEU A 272 ? 1.4828 1.3293 1.7052 0.0468  -0.1060 -0.0413 272 LEU A CD2 
1969 N N   . ALA A 273 ? 1.4332 1.3296 1.6728 0.0209  -0.1279 -0.0425 273 ALA A N   
1970 C CA  . ALA A 273 ? 1.4236 1.3335 1.6619 0.0057  -0.1151 -0.0471 273 ALA A CA  
1971 C C   . ALA A 273 ? 1.5070 1.4197 1.7277 -0.0017 -0.1228 -0.0427 273 ALA A C   
1972 O O   . ALA A 273 ? 1.5053 1.4209 1.7127 -0.0099 -0.1149 -0.0444 273 ALA A O   
1973 C CB  . ALA A 273 ? 1.3310 1.2618 1.5944 -0.0012 -0.1070 -0.0536 273 ALA A CB  
1974 N N   . ILE A 274 ? 1.5376 1.4485 1.7580 0.0018  -0.1391 -0.0376 274 ILE A N   
1975 C CA  . ILE A 274 ? 1.5577 1.4672 1.7592 -0.0033 -0.1483 -0.0329 274 ILE A CA  
1976 C C   . ILE A 274 ? 1.5734 1.4639 1.7448 0.0056  -0.1520 -0.0272 274 ILE A C   
1977 O O   . ILE A 274 ? 1.5928 1.4844 1.7452 0.0002  -0.1499 -0.0254 274 ILE A O   
1978 C CB  . ILE A 274 ? 1.5812 1.4913 1.7921 -0.0023 -0.1664 -0.0296 274 ILE A CB  
1979 C CG1 . ILE A 274 ? 1.6468 1.5790 1.8925 -0.0108 -0.1613 -0.0337 274 ILE A CG1 
1980 C CG2 . ILE A 274 ? 1.5872 1.4925 1.7759 -0.0077 -0.1755 -0.0250 274 ILE A CG2 
1981 C CD1 . ILE A 274 ? 1.7347 1.6700 1.9978 -0.0113 -0.1792 -0.0309 274 ILE A CD1 
1982 N N   . VAL A 275 ? 1.5511 1.4243 1.7175 0.0204  -0.1569 -0.0239 275 VAL A N   
1983 C CA  . VAL A 275 ? 1.5391 1.3935 1.6777 0.0313  -0.1579 -0.0169 275 VAL A CA  
1984 C C   . VAL A 275 ? 1.6417 1.5008 1.7775 0.0242  -0.1395 -0.0186 275 VAL A C   
1985 O O   . VAL A 275 ? 1.7618 1.6173 1.8778 0.0250  -0.1375 -0.0137 275 VAL A O   
1986 C CB  . VAL A 275 ? 1.4237 1.2570 1.5568 0.0505  -0.1645 -0.0126 275 VAL A CB  
1987 C CG1 . VAL A 275 ? 1.4118 1.2259 1.5158 0.0625  -0.1615 -0.0039 275 VAL A CG1 
1988 C CG2 . VAL A 275 ? 1.3901 1.2179 1.5254 0.0586  -0.1862 -0.0119 275 VAL A CG2 
1989 N N   . LEU A 276 ? 1.5841 1.4516 1.7408 0.0175  -0.1265 -0.0259 276 LEU A N   
1990 C CA  . LEU A 276 ? 1.6023 1.4734 1.7602 0.0094  -0.1104 -0.0296 276 LEU A CA  
1991 C C   . LEU A 276 ? 1.6920 1.5791 1.8424 -0.0036 -0.1082 -0.0325 276 LEU A C   
1992 O O   . LEU A 276 ? 1.7012 1.5900 1.8449 -0.0079 -0.1004 -0.0326 276 LEU A O   
1993 C CB  . LEU A 276 ? 1.5394 1.4148 1.7196 0.0051  -0.0991 -0.0385 276 LEU A CB  
1994 C CG  . LEU A 276 ? 1.5160 1.3914 1.6993 -0.0034 -0.0839 -0.0442 276 LEU A CG  
1995 C CD1 . LEU A 276 ? 1.5013 1.3583 1.6736 0.0041  -0.0796 -0.0362 276 LEU A CD1 
1996 C CD2 . LEU A 276 ? 1.5479 1.4243 1.7499 -0.0055 -0.0747 -0.0535 276 LEU A CD2 
1997 N N   . ALA A 277 ? 1.7355 1.6345 1.8881 -0.0096 -0.1151 -0.0345 277 ALA A N   
1998 C CA  . ALA A 277 ? 1.6892 1.6018 1.8317 -0.0201 -0.1136 -0.0370 277 ALA A CA  
1999 C C   . ALA A 277 ? 1.5843 1.4899 1.7009 -0.0146 -0.1226 -0.0286 277 ALA A C   
2000 O O   . ALA A 277 ? 1.5313 1.4447 1.6362 -0.0195 -0.1186 -0.0296 277 ALA A O   
2001 C CB  . ALA A 277 ? 1.7676 1.6929 1.9201 -0.0276 -0.1160 -0.0404 277 ALA A CB  
2002 N N   . HIS A 278 ? 1.6389 1.5296 1.7456 -0.0031 -0.1356 -0.0210 278 HIS A N   
2003 C CA  . HIS A 278 ? 1.7298 1.6102 1.8085 0.0053  -0.1450 -0.0126 278 HIS A CA  
2004 C C   . HIS A 278 ? 1.7290 1.6023 1.7975 0.0133  -0.1371 -0.0073 278 HIS A C   
2005 O O   . HIS A 278 ? 1.7841 1.6545 1.8304 0.0192  -0.1398 -0.0008 278 HIS A O   
2006 C CB  . HIS A 278 ? 1.8323 1.6958 1.9017 0.0166  -0.1628 -0.0070 278 HIS A CB  
2007 C CG  . HIS A 278 ? 1.8977 1.7684 1.9800 0.0077  -0.1712 -0.0107 278 HIS A CG  
2008 N ND1 . HIS A 278 ? 1.8746 1.7425 1.9769 0.0102  -0.1792 -0.0123 278 HIS A ND1 
2009 C CD2 . HIS A 278 ? 1.9239 1.8048 2.0032 -0.0036 -0.1722 -0.0124 278 HIS A CD2 
2010 C CE1 . HIS A 278 ? 1.8525 1.7302 1.9667 -0.0004 -0.1843 -0.0144 278 HIS A CE1 
2011 N NE2 . HIS A 278 ? 1.8852 1.7694 1.9844 -0.0087 -0.1795 -0.0141 278 HIS A NE2 
2012 N N   . THR A 279 ? 1.6587 1.5292 1.7440 0.0139  -0.1265 -0.0094 279 THR A N   
2013 C CA  . THR A 279 ? 1.6633 1.5266 1.7439 0.0198  -0.1163 -0.0036 279 THR A CA  
2014 C C   . THR A 279 ? 1.7433 1.6250 1.8289 0.0070  -0.1056 -0.0080 279 THR A C   
2015 O O   . THR A 279 ? 1.7972 1.6788 1.8761 0.0105  -0.0995 -0.0015 279 THR A O   
2016 C CB  . THR A 279 ? 1.6012 1.4529 1.6981 0.0239  -0.1078 -0.0046 279 THR A CB  
2017 O OG1 . THR A 279 ? 1.6135 1.4482 1.7044 0.0384  -0.1193 -0.0005 279 THR A OG1 
2018 C CG2 . THR A 279 ? 1.5877 1.4313 1.6817 0.0283  -0.0951 0.0025  279 THR A CG2 
2019 N N   . ASN A 280 ? 1.7654 1.6634 1.8632 -0.0072 -0.1035 -0.0189 280 ASN A N   
2020 C CA  . ASN A 280 ? 1.7933 1.7090 1.8962 -0.0193 -0.0956 -0.0257 280 ASN A CA  
2021 C C   . ASN A 280 ? 1.9054 1.8288 1.9883 -0.0161 -0.0998 -0.0196 280 ASN A C   
2022 O O   . ASN A 280 ? 2.0028 1.9383 2.0901 -0.0213 -0.0930 -0.0212 280 ASN A O   
2023 C CB  . ASN A 280 ? 1.7438 1.6730 1.8561 -0.0312 -0.0947 -0.0378 280 ASN A CB  
2024 C CG  . ASN A 280 ? 1.6994 1.6444 1.8184 -0.0427 -0.0871 -0.0476 280 ASN A CG  
2025 O OD1 . ASN A 280 ? 1.7443 1.6915 1.8676 -0.0441 -0.0819 -0.0462 280 ASN A OD1 
2026 N ND2 . ASN A 280 ? 1.6547 1.6108 1.7753 -0.0507 -0.0865 -0.0576 280 ASN A ND2 
2027 N N   . SER A 281 ? 1.8799 1.7960 1.9413 -0.0073 -0.1116 -0.0129 281 SER A N   
2028 C CA  . SER A 281 ? 1.8535 1.7746 1.8916 -0.0019 -0.1167 -0.0069 281 SER A CA  
2029 C C   . SER A 281 ? 1.7432 1.6576 1.7731 0.0102  -0.1125 0.0044  281 SER A C   
2030 O O   . SER A 281 ? 1.6266 1.5492 1.6415 0.0149  -0.1131 0.0096  281 SER A O   
2031 C CB  . SER A 281 ? 1.8596 1.7702 1.8754 0.0045  -0.1313 -0.0031 281 SER A CB  
2032 O OG  . SER A 281 ? 1.8620 1.7513 1.8732 0.0162  -0.1390 0.0033  281 SER A OG  
2033 N N   . VAL A 282 ? 1.7272 1.6268 1.7666 0.0164  -0.1072 0.0089  282 VAL A N   
2034 C CA  . VAL A 282 ? 1.6736 1.5631 1.7037 0.0302  -0.1014 0.0217  282 VAL A CA  
2035 C C   . VAL A 282 ? 1.7180 1.6191 1.7719 0.0213  -0.0848 0.0212  282 VAL A C   
2036 O O   . VAL A 282 ? 1.7494 1.6535 1.7990 0.0283  -0.0776 0.0314  282 VAL A O   
2037 C CB  . VAL A 282 ? 1.5167 1.3789 1.5379 0.0458  -0.1056 0.0288  282 VAL A CB  
2038 C CG1 . VAL A 282 ? 1.5446 1.3948 1.5559 0.0611  -0.0963 0.0428  282 VAL A CG1 
2039 C CG2 . VAL A 282 ? 1.4225 1.2721 1.4199 0.0556  -0.1242 0.0301  282 VAL A CG2 
2040 N N   . VAL A 283 ? 1.6724 1.5797 1.7519 0.0061  -0.0788 0.0096  283 VAL A N   
2041 C CA  . VAL A 283 ? 1.6821 1.5964 1.7865 -0.0040 -0.0644 0.0076  283 VAL A CA  
2042 C C   . VAL A 283 ? 1.7189 1.6590 1.8300 -0.0129 -0.0614 0.0055  283 VAL A C   
2043 O O   . VAL A 283 ? 1.6973 1.6438 1.8261 -0.0174 -0.0502 0.0093  283 VAL A O   
2044 C CB  . VAL A 283 ? 1.6471 1.5600 1.7742 -0.0176 -0.0604 -0.0062 283 VAL A CB  
2045 C CG1 . VAL A 283 ? 1.6752 1.5647 1.7991 -0.0078 -0.0624 -0.0039 283 VAL A CG1 
2046 C CG2 . VAL A 283 ? 1.6115 1.5423 1.7397 -0.0293 -0.0675 -0.0202 283 VAL A CG2 
2047 N N   . ASN A 284 ? 1.7367 1.6916 1.8345 -0.0152 -0.0715 -0.0003 284 ASN A N   
2048 C CA  . ASN A 284 ? 1.7116 1.6928 1.8145 -0.0226 -0.0710 -0.0042 284 ASN A CA  
2049 C C   . ASN A 284 ? 1.6195 1.6076 1.7179 -0.0124 -0.0656 0.0103  284 ASN A C   
2050 O O   . ASN A 284 ? 1.4933 1.4982 1.6151 -0.0207 -0.0566 0.0101  284 ASN A O   
2051 C CB  . ASN A 284 ? 1.7736 1.7652 1.8572 -0.0238 -0.0830 -0.0117 284 ASN A CB  
2052 C CG  . ASN A 284 ? 1.8377 1.8265 1.9280 -0.0344 -0.0857 -0.0256 284 ASN A CG  
2053 O OD1 . ASN A 284 ? 1.8350 1.8199 1.9473 -0.0432 -0.0787 -0.0329 284 ASN A OD1 
2054 N ND2 . ASN A 284 ? 1.8748 1.8646 1.9455 -0.0328 -0.0949 -0.0288 284 ASN A ND2 
2055 N N   . PRO A 285 ? 1.6872 1.6624 1.7561 0.0061  -0.0710 0.0230  285 PRO A N   
2056 C CA  . PRO A 285 ? 1.6573 1.6383 1.7184 0.0190  -0.0647 0.0381  285 PRO A CA  
2057 C C   . PRO A 285 ? 1.5690 1.5477 1.6561 0.0167  -0.0478 0.0462  285 PRO A C   
2058 O O   . PRO A 285 ? 1.5581 1.5551 1.6573 0.0172  -0.0386 0.0539  285 PRO A O   
2059 C CB  . PRO A 285 ? 1.7081 1.6638 1.7318 0.0406  -0.0735 0.0493  285 PRO A CB  
2060 C CG  . PRO A 285 ? 1.7252 1.6738 1.7364 0.0358  -0.0880 0.0381  285 PRO A CG  
2061 C CD  . PRO A 285 ? 1.7209 1.6755 1.7626 0.0162  -0.0836 0.0240  285 PRO A CD  
2062 N N   . PHE A 286 ? 1.5352 1.4920 1.6315 0.0143  -0.0433 0.0448  286 PHE A N   
2063 C CA  . PHE A 286 ? 1.5283 1.4770 1.6467 0.0126  -0.0265 0.0530  286 PHE A CA  
2064 C C   . PHE A 286 ? 1.4849 1.4522 1.6426 -0.0110 -0.0189 0.0412  286 PHE A C   
2065 O O   . PHE A 286 ? 1.4088 1.3792 1.5902 -0.0159 -0.0043 0.0486  286 PHE A O   
2066 C CB  . PHE A 286 ? 1.6310 1.5463 1.7405 0.0218  -0.0251 0.0564  286 PHE A CB  
2067 C CG  . PHE A 286 ? 1.7488 1.6422 1.8212 0.0468  -0.0319 0.0693  286 PHE A CG  
2068 C CD1 . PHE A 286 ? 1.8325 1.7164 1.8816 0.0530  -0.0495 0.0631  286 PHE A CD1 
2069 C CD2 . PHE A 286 ? 1.7715 1.6530 1.8319 0.0644  -0.0208 0.0877  286 PHE A CD2 
2070 C CE1 . PHE A 286 ? 1.8836 1.7455 1.8984 0.0758  -0.0583 0.0734  286 PHE A CE1 
2071 C CE2 . PHE A 286 ? 1.8315 1.6904 1.8540 0.0895  -0.0285 0.0986  286 PHE A CE2 
2072 C CZ  . PHE A 286 ? 1.8869 1.7354 1.8865 0.0949  -0.0485 0.0906  286 PHE A CZ  
2073 N N   . ILE A 287 ? 1.5616 1.5399 1.7258 -0.0251 -0.0288 0.0231  287 ILE A N   
2074 C CA  . ILE A 287 ? 1.6531 1.6463 1.8509 -0.0466 -0.0247 0.0092  287 ILE A CA  
2075 C C   . ILE A 287 ? 1.6400 1.6665 1.8531 -0.0537 -0.0245 0.0083  287 ILE A C   
2076 O O   . ILE A 287 ? 1.6566 1.6967 1.9024 -0.0702 -0.0192 0.0009  287 ILE A O   
2077 C CB  . ILE A 287 ? 1.7555 1.7475 1.9523 -0.0570 -0.0347 -0.0102 287 ILE A CB  
2078 C CG1 . ILE A 287 ? 1.8287 1.8230 2.0575 -0.0762 -0.0292 -0.0239 287 ILE A CG1 
2079 C CG2 . ILE A 287 ? 1.7663 1.7795 1.9465 -0.0570 -0.0476 -0.0180 287 ILE A CG2 
2080 C CD1 . ILE A 287 ? 1.8722 1.8649 2.0984 -0.0846 -0.0375 -0.0428 287 ILE A CD1 
2081 N N   . TYR A 288 ? 1.5769 1.6162 1.7665 -0.0409 -0.0312 0.0154  288 TYR A N   
2082 C CA  . TYR A 288 ? 1.4251 1.4978 1.6270 -0.0440 -0.0313 0.0163  288 TYR A CA  
2083 C C   . TYR A 288 ? 1.3488 1.4259 1.5664 -0.0377 -0.0155 0.0351  288 TYR A C   
2084 O O   . TYR A 288 ? 1.3955 1.4981 1.6465 -0.0493 -0.0090 0.0346  288 TYR A O   
2085 C CB  . TYR A 288 ? 1.4006 1.4835 1.5685 -0.0309 -0.0441 0.0170  288 TYR A CB  
2086 C CG  . TYR A 288 ? 1.4605 1.5407 1.6126 -0.0367 -0.0580 0.0001  288 TYR A CG  
2087 C CD1 . TYR A 288 ? 1.4879 1.5851 1.6601 -0.0540 -0.0622 -0.0182 288 TYR A CD1 
2088 C CD2 . TYR A 288 ? 1.4862 1.5463 1.6031 -0.0245 -0.0668 0.0028  288 TYR A CD2 
2089 C CE1 . TYR A 288 ? 1.5118 1.6056 1.6674 -0.0574 -0.0728 -0.0323 288 TYR A CE1 
2090 C CE2 . TYR A 288 ? 1.5195 1.5776 1.6238 -0.0301 -0.0771 -0.0108 288 TYR A CE2 
2091 C CZ  . TYR A 288 ? 1.5391 1.6140 1.6618 -0.0458 -0.0791 -0.0277 288 TYR A CZ  
2092 O OH  . TYR A 288 ? 1.5687 1.6408 1.6768 -0.0495 -0.0875 -0.0399 288 TYR A OH  
2093 N N   . ALA A 289 ? 1.2688 1.3211 1.4624 -0.0188 -0.0096 0.0519  289 ALA A N   
2094 C CA  . ALA A 289 ? 1.2642 1.3162 1.4664 -0.0088 0.0074  0.0724  289 ALA A CA  
2095 C C   . ALA A 289 ? 1.5095 1.5571 1.7522 -0.0253 0.0232  0.0732  289 ALA A C   
2096 O O   . ALA A 289 ? 1.6661 1.7235 1.9301 -0.0245 0.0392  0.0878  289 ALA A O   
2097 C CB  . ALA A 289 ? 1.0855 1.1062 1.2477 0.0169  0.0086  0.0884  289 ALA A CB  
2098 N N   . TYR A 290 ? 1.6147 1.6465 1.8678 -0.0397 0.0193  0.0580  290 TYR A N   
2099 C CA  . TYR A 290 ? 1.7817 1.8039 2.0704 -0.0557 0.0329  0.0570  290 TYR A CA  
2100 C C   . TYR A 290 ? 1.7682 1.8179 2.0959 -0.0812 0.0288  0.0395  290 TYR A C   
2101 O O   . TYR A 290 ? 1.7503 1.8142 2.1149 -0.0933 0.0405  0.0445  290 TYR A O   
2102 C CB  . TYR A 290 ? 1.9357 1.9207 2.2121 -0.0544 0.0322  0.0515  290 TYR A CB  
2103 C CG  . TYR A 290 ? 2.0714 2.0424 2.3811 -0.0714 0.0445  0.0479  290 TYR A CG  
2104 C CD1 . TYR A 290 ? 2.1292 2.0788 2.4457 -0.0650 0.0635  0.0661  290 TYR A CD1 
2105 C CD2 . TYR A 290 ? 2.1094 2.0858 2.4413 -0.0927 0.0372  0.0264  290 TYR A CD2 
2106 C CE1 . TYR A 290 ? 2.1561 2.0895 2.5019 -0.0808 0.0752  0.0633  290 TYR A CE1 
2107 C CE2 . TYR A 290 ? 2.1330 2.0933 2.4935 -0.1081 0.0475  0.0224  290 TYR A CE2 
2108 C CZ  . TYR A 290 ? 2.1547 2.0932 2.5227 -0.1027 0.0665  0.0410  290 TYR A CZ  
2109 O OH  . TYR A 290 ? 2.1769 2.0959 2.5722 -0.1183 0.0770  0.0375  290 TYR A OH  
2110 N N   . ARG A 291 ? 1.7881 1.8448 2.1075 -0.0888 0.0120  0.0191  291 ARG A N   
2111 C CA  . ARG A 291 ? 1.7974 1.8766 2.1479 -0.1109 0.0049  -0.0004 291 ARG A CA  
2112 C C   . ARG A 291 ? 1.7950 1.9152 2.1643 -0.1142 0.0026  0.0015  291 ARG A C   
2113 O O   . ARG A 291 ? 1.8671 2.0057 2.2774 -0.1314 0.0068  -0.0028 291 ARG A O   
2114 C CB  . ARG A 291 ? 1.8093 1.8844 2.1398 -0.1140 -0.0117 -0.0213 291 ARG A CB  
2115 C CG  . ARG A 291 ? 1.7881 1.8287 2.1120 -0.1162 -0.0098 -0.0280 291 ARG A CG  
2116 C CD  . ARG A 291 ? 1.7347 1.7672 2.0951 -0.1354 -0.0023 -0.0362 291 ARG A CD  
2117 N NE  . ARG A 291 ? 1.6894 1.7454 2.0704 -0.1525 -0.0132 -0.0565 291 ARG A NE  
2118 C CZ  . ARG A 291 ? 1.7179 1.7706 2.1317 -0.1715 -0.0113 -0.0679 291 ARG A CZ  
2119 N NH1 . ARG A 291 ? 1.7285 1.7546 2.1584 -0.1763 0.0027  -0.0601 291 ARG A NH1 
2120 N NH2 . ARG A 291 ? 1.7522 1.8263 2.1813 -0.1850 -0.0241 -0.0876 291 ARG A NH2 
2121 N N   . ILE A 292 ? 1.7059 1.8400 2.0457 -0.0975 -0.0046 0.0076  292 ILE A N   
2122 C CA  . ILE A 292 ? 1.6290 1.8033 1.9822 -0.0974 -0.0080 0.0092  292 ILE A CA  
2123 C C   . ILE A 292 ? 1.5694 1.7524 1.9286 -0.0844 0.0080  0.0342  292 ILE A C   
2124 O O   . ILE A 292 ? 1.3657 1.5327 1.6890 -0.0624 0.0113  0.0496  292 ILE A O   
2125 C CB  . ILE A 292 ? 1.5969 1.7832 1.9140 -0.0864 -0.0253 0.0007  292 ILE A CB  
2126 C CG1 . ILE A 292 ? 1.6177 1.7971 1.9295 -0.0987 -0.0393 -0.0234 292 ILE A CG1 
2127 C CG2 . ILE A 292 ? 1.6125 1.8407 1.9423 -0.0841 -0.0290 0.0026  292 ILE A CG2 
2128 C CD1 . ILE A 292 ? 1.6375 1.8269 1.9145 -0.0891 -0.0550 -0.0321 292 ILE A CD1 
2129 N N   . ARG A 293 ? 1.7357 1.9441 2.1413 -0.0978 0.0179  0.0380  293 ARG A N   
2130 C CA  . ARG A 293 ? 1.8544 2.0750 2.2728 -0.0871 0.0363  0.0627  293 ARG A CA  
2131 C C   . ARG A 293 ? 1.7158 1.9658 2.1131 -0.0683 0.0306  0.0704  293 ARG A C   
2132 O O   . ARG A 293 ? 1.6644 1.9201 2.0565 -0.0514 0.0446  0.0926  293 ARG A O   
2133 C CB  . ARG A 293 ? 2.0152 2.2577 2.4951 -0.1095 0.0483  0.0638  293 ARG A CB  
2134 C CG  . ARG A 293 ? 2.1377 2.3483 2.6389 -0.1279 0.0553  0.0574  293 ARG A CG  
2135 C CD  . ARG A 293 ? 2.2563 2.4897 2.8207 -0.1529 0.0642  0.0558  293 ARG A CD  
2136 N NE  . ARG A 293 ? 2.3376 2.6075 2.9277 -0.1697 0.0449  0.0330  293 ARG A NE  
2137 C CZ  . ARG A 293 ? 2.3867 2.6851 3.0341 -0.1924 0.0462  0.0273  293 ARG A CZ  
2138 N NH1 . ARG A 293 ? 2.4141 2.7087 3.1008 -0.2023 0.0678  0.0441  293 ARG A NH1 
2139 N NH2 . ARG A 293 ? 2.3817 2.7117 3.0471 -0.2048 0.0258  0.0049  293 ARG A NH2 
2140 N N   . GLU A 294 ? 1.6054 1.8726 1.9885 -0.0699 0.0105  0.0524  294 GLU A N   
2141 C CA  . GLU A 294 ? 1.5357 1.8277 1.8938 -0.0514 0.0030  0.0575  294 GLU A CA  
2142 C C   . GLU A 294 ? 1.4873 1.7469 1.7856 -0.0263 -0.0005 0.0671  294 GLU A C   
2143 O O   . GLU A 294 ? 1.4547 1.7211 1.7288 -0.0045 0.0027  0.0827  294 GLU A O   
2144 C CB  . GLU A 294 ? 1.6146 1.9344 1.9769 -0.0614 -0.0172 0.0345  294 GLU A CB  
2145 C CG  . GLU A 294 ? 1.7265 2.0689 2.0580 -0.0412 -0.0267 0.0381  294 GLU A CG  
2146 C CD  . GLU A 294 ? 1.7981 2.1780 2.1560 -0.0332 -0.0150 0.0550  294 GLU A CD  
2147 O OE1 . GLU A 294 ? 1.7521 2.1474 2.0816 -0.0126 -0.0196 0.0620  294 GLU A OE1 
2148 O OE2 . GLU A 294 ? 1.8826 2.2765 2.2898 -0.0472 -0.0005 0.0618  294 GLU A OE2 
2149 N N   . PHE A 295 ? 1.4891 1.7133 1.7644 -0.0292 -0.0076 0.0575  295 PHE A N   
2150 C CA  . PHE A 295 ? 1.4103 1.6019 1.6326 -0.0083 -0.0132 0.0644  295 PHE A CA  
2151 C C   . PHE A 295 ? 1.3011 1.4697 1.5099 0.0100  0.0025  0.0878  295 PHE A C   
2152 O O   . PHE A 295 ? 1.2591 1.4210 1.4311 0.0337  0.0012  0.1008  295 PHE A O   
2153 C CB  . PHE A 295 ? 1.4680 1.6305 1.6765 -0.0176 -0.0235 0.0485  295 PHE A CB  
2154 C CG  . PHE A 295 ? 1.5083 1.6789 1.6951 -0.0195 -0.0420 0.0316  295 PHE A CG  
2155 C CD1 . PHE A 295 ? 1.4950 1.6532 1.6357 -0.0009 -0.0519 0.0361  295 PHE A CD1 
2156 C CD2 . PHE A 295 ? 1.4960 1.6839 1.7064 -0.0392 -0.0495 0.0113  295 PHE A CD2 
2157 C CE1 . PHE A 295 ? 1.4242 1.5875 1.5441 -0.0026 -0.0671 0.0220  295 PHE A CE1 
2158 C CE2 . PHE A 295 ? 1.4380 1.6314 1.6254 -0.0391 -0.0650 -0.0032 295 PHE A CE2 
2159 C CZ  . PHE A 295 ? 1.3882 1.5693 1.5308 -0.0211 -0.0729 0.0028  295 PHE A CZ  
2160 N N   . ARG A 296 ? 1.2491 1.4032 1.4850 0.0004  0.0172  0.0931  296 ARG A N   
2161 C CA  . ARG A 296 ? 1.3058 1.4330 1.5264 0.0185  0.0329  0.1148  296 ARG A CA  
2162 C C   . ARG A 296 ? 1.4650 1.6125 1.6822 0.0372  0.0449  0.1358  296 ARG A C   
2163 O O   . ARG A 296 ? 1.5015 1.6264 1.6824 0.0626  0.0504  0.1528  296 ARG A O   
2164 C CB  . ARG A 296 ? 1.2313 1.3417 1.4854 0.0035  0.0483  0.1170  296 ARG A CB  
2165 C CG  . ARG A 296 ? 1.2388 1.3813 1.5499 -0.0185 0.0601  0.1161  296 ARG A CG  
2166 C CD  . ARG A 296 ? 1.3919 1.5104 1.7308 -0.0318 0.0758  0.1196  296 ARG A CD  
2167 N NE  . ARG A 296 ? 1.6817 1.8286 2.0771 -0.0522 0.0890  0.1220  296 ARG A NE  
2168 C CZ  . ARG A 296 ? 1.8630 1.9936 2.2903 -0.0664 0.1050  0.1268  296 ARG A CZ  
2169 N NH1 . ARG A 296 ? 1.9214 2.0797 2.4027 -0.0864 0.1157  0.1287  296 ARG A NH1 
2170 N NH2 . ARG A 296 ? 1.9020 1.9883 2.3079 -0.0606 0.1100  0.1295  296 ARG A NH2 
2171 N N   . GLN A 297 ? 1.5562 1.7469 1.8111 0.0257  0.0486  0.1342  297 GLN A N   
2172 C CA  . GLN A 297 ? 1.6440 1.8606 1.9008 0.0430  0.0608  0.1538  297 GLN A CA  
2173 C C   . GLN A 297 ? 1.6618 1.8814 1.8694 0.0664  0.0459  0.1544  297 GLN A C   
2174 O O   . GLN A 297 ? 1.7194 1.9438 1.9062 0.0907  0.0546  0.1732  297 GLN A O   
2175 C CB  . GLN A 297 ? 1.7627 2.0281 2.0796 0.0224  0.0676  0.1507  297 GLN A CB  
2176 C CG  . GLN A 297 ? 1.9441 2.2061 2.3123 -0.0020 0.0827  0.1508  297 GLN A CG  
2177 C CD  . GLN A 297 ? 2.1385 2.4496 2.5693 -0.0232 0.0879  0.1476  297 GLN A CD  
2178 O OE1 . GLN A 297 ? 2.1701 2.5208 2.6071 -0.0162 0.0836  0.1492  297 GLN A OE1 
2179 N NE2 . GLN A 297 ? 2.2143 2.5227 2.6925 -0.0490 0.0965  0.1426  297 GLN A NE2 
2180 N N   . THR A 298 ? 1.6233 1.8383 1.8110 0.0597  0.0242  0.1341  298 THR A N   
2181 C CA  . THR A 298 ? 1.5980 1.8103 1.7369 0.0799  0.0087  0.1330  298 THR A CA  
2182 C C   . THR A 298 ? 1.6755 1.8414 1.7618 0.1035  0.0065  0.1438  298 THR A C   
2183 O O   . THR A 298 ? 1.6589 1.8190 1.7074 0.1297  0.0059  0.1569  298 THR A O   
2184 C CB  . THR A 298 ? 1.4980 1.7164 1.6309 0.0653  -0.0126 0.1088  298 THR A CB  
2185 O OG1 . THR A 298 ? 1.4963 1.7553 1.6776 0.0434  -0.0128 0.0965  298 THR A OG1 
2186 C CG2 . THR A 298 ? 1.4469 1.6640 1.5311 0.0860  -0.0271 0.1090  298 THR A CG2 
2187 N N   . PHE A 299 ? 1.8002 1.9327 1.8839 0.0949  0.0045  0.1377  299 PHE A N   
2188 C CA  . PHE A 299 ? 1.9198 2.0078 1.9580 0.1157  0.0007  0.1460  299 PHE A CA  
2189 C C   . PHE A 299 ? 1.9276 2.0055 1.9559 0.1385  0.0194  0.1704  299 PHE A C   
2190 O O   . PHE A 299 ? 1.9750 2.0331 1.9570 0.1662  0.0156  0.1819  299 PHE A O   
2191 C CB  . PHE A 299 ? 1.9913 2.0506 2.0370 0.1010  -0.0030 0.1350  299 PHE A CB  
2192 C CG  . PHE A 299 ? 2.0057 2.0735 2.0625 0.0789  -0.0185 0.1120  299 PHE A CG  
2193 C CD1 . PHE A 299 ? 2.0184 2.0827 2.0417 0.0847  -0.0371 0.1032  299 PHE A CD1 
2194 C CD2 . PHE A 299 ? 1.9848 2.0614 2.0833 0.0533  -0.0140 0.0995  299 PHE A CD2 
2195 C CE1 . PHE A 299 ? 1.9963 2.0673 2.0279 0.0660  -0.0494 0.0835  299 PHE A CE1 
2196 C CE2 . PHE A 299 ? 1.9606 2.0435 2.0658 0.0355  -0.0274 0.0787  299 PHE A CE2 
2197 C CZ  . PHE A 299 ? 1.9712 2.0521 2.0431 0.0422  -0.0443 0.0713  299 PHE A CZ  
2198 N N   . ARG A 300 ? 1.8556 1.9452 1.9265 0.1271  0.0399  0.1785  300 ARG A N   
2199 C CA  . ARG A 300 ? 1.8657 1.9461 1.9325 0.1469  0.0619  0.2030  300 ARG A CA  
2200 C C   . ARG A 300 ? 1.8792 1.9743 1.9172 0.1742  0.0645  0.2183  300 ARG A C   
2201 O O   . ARG A 300 ? 1.8659 1.9371 1.8691 0.2026  0.0737  0.2371  300 ARG A O   
2202 C CB  . ARG A 300 ? 1.9269 2.0304 2.0537 0.1256  0.0839  0.2084  300 ARG A CB  
2203 C CG  . ARG A 300 ? 2.0824 2.1757 2.2102 0.1437  0.1105  0.2352  300 ARG A CG  
2204 C CD  . ARG A 300 ? 2.2458 2.3592 2.4370 0.1180  0.1313  0.2388  300 ARG A CD  
2205 N NE  . ARG A 300 ? 2.4533 2.5587 2.6486 0.1344  0.1597  0.2663  300 ARG A NE  
2206 C CZ  . ARG A 300 ? 2.5811 2.6989 2.8285 0.1162  0.1823  0.2753  300 ARG A CZ  
2207 N NH1 . ARG A 300 ? 2.6001 2.7379 2.8990 0.0810  0.1777  0.2574  300 ARG A NH1 
2208 N NH2 . ARG A 300 ? 2.6426 2.7509 2.8895 0.1336  0.2097  0.3023  300 ARG A NH2 
2209 N N   . LYS A 301 ? 1.9216 2.0551 1.9720 0.1671  0.0560  0.2097  301 LYS A N   
2210 C CA  . LYS A 301 ? 1.9585 2.1101 1.9834 0.1925  0.0575  0.2226  301 LYS A CA  
2211 C C   . LYS A 301 ? 2.0400 2.1573 1.9971 0.2176  0.0376  0.2205  301 LYS A C   
2212 O O   . LYS A 301 ? 2.0625 2.1652 1.9794 0.2490  0.0424  0.2375  301 LYS A O   
2213 C CB  . LYS A 301 ? 1.8953 2.1000 1.9568 0.1768  0.0538  0.2129  301 LYS A CB  
2214 C CG  . LYS A 301 ? 1.9067 2.1291 1.9350 0.2022  0.0482  0.2200  301 LYS A CG  
2215 C CD  . LYS A 301 ? 1.9029 2.1349 1.9169 0.1932  0.0233  0.1983  301 LYS A CD  
2216 C CE  . LYS A 301 ? 1.8820 2.1498 1.9539 0.1586  0.0203  0.1798  301 LYS A CE  
2217 N NZ  . LYS A 301 ? 1.8836 2.1520 1.9374 0.1493  -0.0037 0.1576  301 LYS A NZ  
2218 N N   . ILE A 302 ? 2.0675 2.1709 2.0120 0.2039  0.0155  0.1999  302 ILE A N   
2219 C CA  . ILE A 302 ? 2.0689 2.1391 1.9539 0.2231  -0.0052 0.1959  302 ILE A CA  
2220 C C   . ILE A 302 ? 2.0986 2.1215 1.9431 0.2475  -0.0034 0.2088  302 ILE A C   
2221 O O   . ILE A 302 ? 2.1004 2.1016 1.8938 0.2766  -0.0105 0.2177  302 ILE A O   
2222 C CB  . ILE A 302 ? 2.0054 2.0665 1.8906 0.2010  -0.0262 0.1726  302 ILE A CB  
2223 C CG1 . ILE A 302 ? 1.9393 2.0443 1.8593 0.1790  -0.0296 0.1585  302 ILE A CG1 
2224 C CG2 . ILE A 302 ? 2.0311 2.0571 1.8576 0.2194  -0.0471 0.1695  302 ILE A CG2 
2225 C CD1 . ILE A 302 ? 1.8735 1.9708 1.7928 0.1588  -0.0479 0.1367  302 ILE A CD1 
2226 N N   . ILE A 303 ? 2.1257 2.1311 1.9913 0.2366  0.0052  0.2091  303 ILE A N   
2227 C CA  . ILE A 303 ? 2.1844 2.1440 2.0137 0.2591  0.0063  0.2198  303 ILE A CA  
2228 C C   . ILE A 303 ? 2.2584 2.2144 2.0634 0.2914  0.0237  0.2443  303 ILE A C   
2229 O O   . ILE A 303 ? 2.2751 2.1978 2.0248 0.3217  0.0149  0.2520  303 ILE A O   
2230 C CB  . ILE A 303 ? 2.1100 2.0558 1.9712 0.2416  0.0157  0.2170  303 ILE A CB  
2231 C CG1 . ILE A 303 ? 1.9635 1.9118 1.8468 0.2119  -0.0007 0.1932  303 ILE A CG1 
2232 C CG2 . ILE A 303 ? 2.1240 2.0221 1.9450 0.2676  0.0159  0.2279  303 ILE A CG2 
2233 C CD1 . ILE A 303 ? 1.8639 1.7995 1.7784 0.1945  0.0078  0.1889  303 ILE A CD1 
2234 N N   . ARG A 304 ? 2.2849 2.2749 2.1316 0.2850  0.0484  0.2566  304 ARG A N   
2235 C CA  . ARG A 304 ? 2.3533 2.3455 2.1837 0.3145  0.0695  0.2819  304 ARG A CA  
2236 C C   . ARG A 304 ? 2.3648 2.3605 2.1491 0.3416  0.0589  0.2864  304 ARG A C   
2237 O O   . ARG A 304 ? 2.3849 2.3532 2.1198 0.3769  0.0623  0.3023  304 ARG A O   
2238 C CB  . ARG A 304 ? 2.4052 2.4420 2.2979 0.2976  0.0969  0.2925  304 ARG A CB  
2239 C CG  . ARG A 304 ? 2.5070 2.5346 2.4408 0.2756  0.1116  0.2926  304 ARG A CG  
2240 C CD  . ARG A 304 ? 2.6098 2.6808 2.6065 0.2584  0.1382  0.3038  304 ARG A CD  
2241 N NE  . ARG A 304 ? 2.7088 2.7642 2.7388 0.2418  0.1551  0.3076  304 ARG A NE  
2242 C CZ  . ARG A 304 ? 2.7521 2.8360 2.8392 0.2241  0.1796  0.3179  304 ARG A CZ  
2243 N NH1 . ARG A 304 ? 2.7907 2.8537 2.9024 0.2102  0.1937  0.3209  304 ARG A NH1 
2244 N NH2 . ARG A 304 ? 2.7329 2.8660 2.8536 0.2204  0.1897  0.3250  304 ARG A NH2 
2245 N N   . SER A 305 ? 2.3579 2.3856 2.1559 0.3264  0.0458  0.2723  305 SER A N   
2246 C CA  . SER A 305 ? 2.3897 2.4218 2.1450 0.3503  0.0346  0.2748  305 SER A CA  
2247 C C   . SER A 305 ? 2.3744 2.3721 2.0846 0.3515  0.0037  0.2571  305 SER A C   
2248 O O   . SER A 305 ? 2.3830 2.3335 2.0444 0.3723  -0.0070 0.2598  305 SER A O   
2249 C CB  . SER A 305 ? 2.4018 2.4921 2.1980 0.3367  0.0404  0.2721  305 SER A CB  
2250 O OG  . SER A 305 ? 2.4386 2.5327 2.1916 0.3614  0.0299  0.2748  305 SER A OG  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   PRO 2   2   ?   ?   ?   A . n 
A 1 3   ILE 3   3   ?   ?   ?   A . n 
A 1 4   MET 4   4   ?   ?   ?   A . n 
A 1 5   GLY 5   5   ?   ?   ?   A . n 
A 1 6   SER 6   6   ?   ?   ?   A . n 
A 1 7   SER 7   7   7   SER SER A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   TYR 9   9   9   TYR TYR A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  THR 11  11  11  THR THR A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  ALA 15  15  15  ALA ALA A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  ALA 17  17  17  ALA ALA A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  ILE 21  21  21  ILE ILE A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  ASN 24  24  24  ASN ASN A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  CYS 28  28  28  CYS CYS A . n 
A 1 29  TRP 29  29  29  TRP TRP A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  TRP 32  32  32  TRP TRP A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  ASN 34  34  34  ASN ASN A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  ASN 36  36  36  ASN ASN A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  GLN 38  38  38  GLN GLN A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  TYR 43  43  43  TYR TYR A . n 
A 1 44  PHE 44  44  44  PHE PHE A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  VAL 46  46  46  VAL VAL A . n 
A 1 47  SER 47  47  47  SER SER A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  ALA 51  51  51  ALA ALA A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  ILE 53  53  53  ILE ILE A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  THR 65  65  65  THR THR A . n 
A 1 66  ILE 66  66  66  ILE ILE A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  PHE 70  70  70  PHE PHE A . n 
A 1 71  CYS 71  71  71  CYS CYS A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  CYS 74  74  74  CYS CYS A . n 
A 1 75  HIS 75  75  75  HIS HIS A . n 
A 1 76  GLY 76  76  76  GLY GLY A . n 
A 1 77  CYS 77  77  77  CYS CYS A . n 
A 1 78  LEU 78  78  78  LEU LEU A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  ILE 80  80  80  ILE ILE A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  CYS 82  82  82  CYS CYS A . n 
A 1 83  PHE 83  83  83  PHE PHE A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  VAL 86  86  86  VAL VAL A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 ASP 101 101 101 ASP ASP A . n 
A 1 102 ARG 102 102 102 ARG ARG A . n 
A 1 103 TYR 103 103 103 TYR TYR A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 ALA 107 107 107 ALA ALA A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 PRO 109 109 109 PRO PRO A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 TYR 112 112 112 TYR TYR A . n 
A 1 113 ASN 113 113 113 ASN ASN A . n 
A 1 114 GLY 114 114 114 GLY GLY A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 VAL 116 116 116 VAL VAL A . n 
A 1 117 THR 117 117 117 THR THR A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 THR 119 119 119 THR THR A . n 
A 1 120 ARG 120 120 120 ARG ARG A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 ILE 125 125 125 ILE ILE A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 ILE 127 127 127 ILE ILE A . n 
A 1 128 CYS 128 128 128 CYS CYS A . n 
A 1 129 TRP 129 129 129 TRP TRP A . n 
A 1 130 VAL 130 130 130 VAL VAL A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 SER 132 132 132 SER SER A . n 
A 1 133 PHE 133 133 133 PHE PHE A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 ILE 135 135 135 ILE ILE A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 PRO 139 139 139 PRO PRO A . n 
A 1 140 MET 140 140 140 MET MET A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 TRP 143 143 143 TRP TRP A . n 
A 1 144 ASN 144 144 144 ASN ASN A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 CYS 146 146 146 CYS CYS A . n 
A 1 147 GLY 147 147 147 GLY GLY A . n 
A 1 148 GLN 148 148 148 GLN GLN A . n 
A 1 149 PRO 149 149 149 PRO PRO A . n 
A 1 150 LYS 150 150 ?   ?   ?   A . n 
A 1 151 GLU 151 151 ?   ?   ?   A . n 
A 1 152 GLY 152 152 ?   ?   ?   A . n 
A 1 153 LYS 153 153 ?   ?   ?   A . n 
A 1 154 ASN 154 154 ?   ?   ?   A . n 
A 1 155 HIS 155 155 ?   ?   ?   A . n 
A 1 156 SER 156 156 ?   ?   ?   A . n 
A 1 157 GLN 157 157 ?   ?   ?   A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 CYS 159 159 159 CYS CYS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 GLN 163 163 163 GLN GLN A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 ALA 165 165 165 ALA ALA A . n 
A 1 166 CYS 166 166 166 CYS CYS A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 PHE 168 168 168 PHE PHE A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 ASP 170 170 170 ASP ASP A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 PRO 173 173 173 PRO PRO A . n 
A 1 174 MET 174 174 174 MET MET A . n 
A 1 175 ASN 175 175 175 ASN ASN A . n 
A 1 176 TYR 176 176 176 TYR TYR A . n 
A 1 177 MET 177 177 177 MET MET A . n 
A 1 178 VAL 178 178 178 VAL VAL A . n 
A 1 179 TYR 179 179 179 TYR TYR A . n 
A 1 180 PHE 180 180 180 PHE PHE A . n 
A 1 181 ASN 181 181 181 ASN ASN A . n 
A 1 182 PHE 182 182 182 PHE PHE A . n 
A 1 183 PHE 183 183 183 PHE PHE A . n 
A 1 184 ALA 184 184 184 ALA ALA A . n 
A 1 185 CYS 185 185 185 CYS CYS A . n 
A 1 186 VAL 186 186 186 VAL VAL A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 VAL 188 188 188 VAL VAL A . n 
A 1 189 PRO 189 189 189 PRO PRO A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 LEU 191 191 191 LEU LEU A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 MET 193 193 193 MET MET A . n 
A 1 194 LEU 194 194 194 LEU LEU A . n 
A 1 195 GLY 195 195 195 GLY GLY A . n 
A 1 196 VAL 196 196 196 VAL VAL A . n 
A 1 197 TYR 197 197 197 TYR TYR A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 ARG 199 199 199 ARG ARG A . n 
A 1 200 ILE 200 200 200 ILE ILE A . n 
A 1 201 PHE 201 201 201 PHE PHE A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 ALA 203 203 203 ALA ALA A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 ARG 205 205 205 ARG ARG A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 GLN 207 207 207 GLN GLN A . n 
A 1 208 LEU 208 208 208 LEU LEU A . n 
A 1 209 LYS 209 209 209 LYS LYS A . n 
A 1 210 GLN 210 210 210 GLN GLN A . n 
A 1 211 MET 211 211 211 MET MET A . n 
A 1 212 GLU 212 212 212 GLU GLU A . n 
A 1 213 SER 213 213 213 SER SER A . n 
A 1 214 GLN 214 214 214 GLN GLN A . n 
A 1 215 PRO 215 215 215 PRO PRO A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 GLY 218 218 218 GLY GLY A . n 
A 1 219 GLU 219 219 219 GLU GLU A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ALA 221 221 221 ALA ALA A . n 
A 1 222 ARG 222 222 222 ARG ARG A . n 
A 1 223 SER 223 223 223 SER SER A . n 
A 1 224 THR 224 224 224 THR THR A . n 
A 1 225 LEU 225 225 225 LEU LEU A . n 
A 1 226 GLN 226 226 226 GLN GLN A . n 
A 1 227 LYS 227 227 227 LYS LYS A . n 
A 1 228 GLU 228 228 228 GLU GLU A . n 
A 1 229 VAL 229 229 229 VAL VAL A . n 
A 1 230 HIS 230 230 230 HIS HIS A . n 
A 1 231 ALA 231 231 231 ALA ALA A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 LYS 233 233 233 LYS LYS A . n 
A 1 234 SER 234 234 234 SER SER A . n 
A 1 235 ALA 235 235 235 ALA ALA A . n 
A 1 236 ALA 236 236 236 ALA ALA A . n 
A 1 237 ILE 237 237 237 ILE ILE A . n 
A 1 238 ILE 238 238 238 ILE ILE A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLY 240 240 240 GLY GLY A . n 
A 1 241 LEU 241 241 241 LEU LEU A . n 
A 1 242 PHE 242 242 242 PHE PHE A . n 
A 1 243 ALA 243 243 243 ALA ALA A . n 
A 1 244 LEU 244 244 244 LEU LEU A . n 
A 1 245 CYS 245 245 245 CYS CYS A . n 
A 1 246 TRP 246 246 246 TRP TRP A . n 
A 1 247 LEU 247 247 247 LEU LEU A . n 
A 1 248 PRO 248 248 248 PRO PRO A . n 
A 1 249 LEU 249 249 249 LEU LEU A . n 
A 1 250 HIS 250 250 250 HIS HIS A . n 
A 1 251 ILE 251 251 251 ILE ILE A . n 
A 1 252 ILE 252 252 252 ILE ILE A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 PHE 255 255 255 PHE PHE A . n 
A 1 256 THR 256 256 256 THR THR A . n 
A 1 257 PHE 257 257 257 PHE PHE A . n 
A 1 258 PHE 258 258 258 PHE PHE A . n 
A 1 259 CYS 259 259 259 CYS CYS A . n 
A 1 260 PRO 260 260 260 PRO PRO A . n 
A 1 261 ASP 261 261 261 ASP ASP A . n 
A 1 262 CYS 262 262 262 CYS CYS A . n 
A 1 263 SER 263 263 263 SER SER A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 ALA 265 265 265 ALA ALA A . n 
A 1 266 PRO 266 266 266 PRO PRO A . n 
A 1 267 LEU 267 267 267 LEU LEU A . n 
A 1 268 TRP 268 268 268 TRP TRP A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 MET 270 270 270 MET MET A . n 
A 1 271 TYR 271 271 271 TYR TYR A . n 
A 1 272 LEU 272 272 272 LEU LEU A . n 
A 1 273 ALA 273 273 273 ALA ALA A . n 
A 1 274 ILE 274 274 274 ILE ILE A . n 
A 1 275 VAL 275 275 275 VAL VAL A . n 
A 1 276 LEU 276 276 276 LEU LEU A . n 
A 1 277 ALA 277 277 277 ALA ALA A . n 
A 1 278 HIS 278 278 278 HIS HIS A . n 
A 1 279 THR 279 279 279 THR THR A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 VAL 283 283 283 VAL VAL A . n 
A 1 284 ASN 284 284 284 ASN ASN A . n 
A 1 285 PRO 285 285 285 PRO PRO A . n 
A 1 286 PHE 286 286 286 PHE PHE A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 TYR 288 288 288 TYR TYR A . n 
A 1 289 ALA 289 289 289 ALA ALA A . n 
A 1 290 TYR 290 290 290 TYR TYR A . n 
A 1 291 ARG 291 291 291 ARG ARG A . n 
A 1 292 ILE 292 292 292 ILE ILE A . n 
A 1 293 ARG 293 293 293 ARG ARG A . n 
A 1 294 GLU 294 294 294 GLU GLU A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 ARG 296 296 296 ARG ARG A . n 
A 1 297 GLN 297 297 297 GLN GLN A . n 
A 1 298 THR 298 298 298 THR THR A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 ARG 300 300 300 ARG ARG A . n 
A 1 301 LYS 301 301 301 LYS LYS A . n 
A 1 302 ILE 302 302 302 ILE ILE A . n 
A 1 303 ILE 303 303 303 ILE ILE A . n 
A 1 304 ARG 304 304 304 ARG ARG A . n 
A 1 305 SER 305 305 305 SER SER A . n 
A 1 306 HIS 306 306 ?   ?   ?   A . n 
A 1 307 VAL 307 307 ?   ?   ?   A . n 
A 1 308 LEU 308 308 ?   ?   ?   A . n 
A 1 309 ARG 309 309 ?   ?   ?   A . n 
A 1 310 GLN 310 310 ?   ?   ?   A . n 
A 1 311 GLN 311 311 ?   ?   ?   A . n 
A 1 312 GLU 312 312 ?   ?   ?   A . n 
A 1 313 PRO 313 313 ?   ?   ?   A . n 
A 1 314 PHE 314 314 ?   ?   ?   A . n 
A 1 315 LYS 315 315 ?   ?   ?   A . n 
A 1 316 ALA 316 316 ?   ?   ?   A . n 
A 1 317 ALA 317 317 ?   ?   ?   A . n 
A 1 318 ALA 318 318 ?   ?   ?   A . n 
A 1 319 ALA 319 319 ?   ?   ?   A . n 
A 1 320 HIS 320 320 ?   ?   ?   A . n 
A 1 321 HIS 321 321 ?   ?   ?   A . n 
A 1 322 HIS 322 322 ?   ?   ?   A . n 
A 1 323 HIS 323 323 ?   ?   ?   A . n 
A 1 324 HIS 324 324 ?   ?   ?   A . n 
A 1 325 HIS 325 325 ?   ?   ?   A . n 
A 1 326 HIS 326 326 ?   ?   ?   A . n 
A 1 327 HIS 327 327 ?   ?   ?   A . n 
A 1 328 HIS 328 328 ?   ?   ?   A . n 
A 1 329 HIS 329 329 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-09-07 
2 'Structure model' 1 1 2012-06-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         23.5394 
_pdbx_refine_tls.origin_y         -31.1724 
_pdbx_refine_tls.origin_z         -28.8621 
_pdbx_refine_tls.T[1][1]          0.8085 
_pdbx_refine_tls.T[2][2]          0.8086 
_pdbx_refine_tls.T[3][3]          0.8771 
_pdbx_refine_tls.T[1][2]          -0.0604 
_pdbx_refine_tls.T[1][3]          -0.0970 
_pdbx_refine_tls.T[2][3]          -0.0705 
_pdbx_refine_tls.L[1][1]          0.9860 
_pdbx_refine_tls.L[2][2]          2.1254 
_pdbx_refine_tls.L[3][3]          1.8727 
_pdbx_refine_tls.L[1][2]          -1.3229 
_pdbx_refine_tls.L[1][3]          0.0883 
_pdbx_refine_tls.L[2][3]          -0.1383 
_pdbx_refine_tls.S[1][1]          0.1886 
_pdbx_refine_tls.S[2][2]          -0.0739 
_pdbx_refine_tls.S[3][3]          0.0000 
_pdbx_refine_tls.S[1][2]          -0.2845 
_pdbx_refine_tls.S[1][3]          0.4812 
_pdbx_refine_tls.S[2][3]          0.1058 
_pdbx_refine_tls.S[2][1]          0.0605 
_pdbx_refine_tls.S[3][1]          0.0025 
_pdbx_refine_tls.S[3][2]          0.2174 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     7 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     1 
_pdbx_refine_tls_group.selection_details   'chain A' 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC   'data collection' Quantum                   ? 1 
PHASER phasing           .                         ? 2 
PHENIX refinement        '(phenix.refine: 1.4_84)' ? 3 
XDS    'data reduction'  .                         ? 4 
SCALA  'data scaling'    .                         ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLN A 38  ? ? -91.75  33.43  
2 1 ALA A 73  ? ? -58.85  173.54 
3 1 LEU A 115 ? ? -96.21  -61.58 
4 1 VAL A 116 ? ? -67.29  92.04  
5 1 ALA A 165 ? ? -58.70  101.06 
6 1 VAL A 178 ? ? -92.35  -67.24 
7 1 VAL A 186 ? ? -141.95 -56.76 
8 1 PHE A 257 ? ? -72.01  -70.41 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A PRO 2   ? A PRO 2   
3  1 Y 1 A ILE 3   ? A ILE 3   
4  1 Y 1 A MET 4   ? A MET 4   
5  1 Y 1 A GLY 5   ? A GLY 5   
6  1 Y 1 A SER 6   ? A SER 6   
7  1 Y 1 A LYS 150 ? A LYS 150 
8  1 Y 1 A GLU 151 ? A GLU 151 
9  1 Y 1 A GLY 152 ? A GLY 152 
10 1 Y 1 A LYS 153 ? A LYS 153 
11 1 Y 1 A ASN 154 ? A ASN 154 
12 1 Y 1 A HIS 155 ? A HIS 155 
13 1 Y 1 A SER 156 ? A SER 156 
14 1 Y 1 A GLN 157 ? A GLN 157 
15 1 Y 1 A HIS 306 ? A HIS 306 
16 1 Y 1 A VAL 307 ? A VAL 307 
17 1 Y 1 A LEU 308 ? A LEU 308 
18 1 Y 1 A ARG 309 ? A ARG 309 
19 1 Y 1 A GLN 310 ? A GLN 310 
20 1 Y 1 A GLN 311 ? A GLN 311 
21 1 Y 1 A GLU 312 ? A GLU 312 
22 1 Y 1 A PRO 313 ? A PRO 313 
23 1 Y 1 A PHE 314 ? A PHE 314 
24 1 Y 1 A LYS 315 ? A LYS 315 
25 1 Y 1 A ALA 316 ? A ALA 316 
26 1 Y 1 A ALA 317 ? A ALA 317 
27 1 Y 1 A ALA 318 ? A ALA 318 
28 1 Y 1 A ALA 319 ? A ALA 319 
29 1 Y 1 A HIS 320 ? A HIS 320 
30 1 Y 1 A HIS 321 ? A HIS 321 
31 1 Y 1 A HIS 322 ? A HIS 322 
32 1 Y 1 A HIS 323 ? A HIS 323 
33 1 Y 1 A HIS 324 ? A HIS 324 
34 1 Y 1 A HIS 325 ? A HIS 325 
35 1 Y 1 A HIS 326 ? A HIS 326 
36 1 Y 1 A HIS 327 ? A HIS 327 
37 1 Y 1 A HIS 328 ? A HIS 328 
38 1 Y 1 A HIS 329 ? A HIS 329 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        CAFFEINE 
_pdbx_entity_nonpoly.comp_id     CFF 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          CFF 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     330 
_pdbx_nonpoly_scheme.auth_seq_num    1 
_pdbx_nonpoly_scheme.pdb_mon_id      CFF 
_pdbx_nonpoly_scheme.auth_mon_id     CAF 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
#