data_3RKQ
# 
_entry.id   3RKQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3RKQ         
NDB   NA1097       
RCSB  RCSB065052   
WWPDB D_1000065052 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3RKQ 
_pdbx_database_status.recvd_initial_deposition_date   2011-04-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Genis, C.'    1 
'Scone, P.'    2 
'Kasahara, H.' 3 
'Nam, H.-J.'   4 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the human NKX2.5 homeodomain in complex with DNA target.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            51 
_citation.page_first                6312 
_citation.page_last                 6319 
_citation.year                      2012 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22849347 
_citation.pdbx_database_id_DOI      10.1021/bi300849c 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pradhan, L.'    1 
primary 'Genis, C.'      2 
primary 'Scone, P.'      3 
primary 'Weinberg, E.O.' 4 
primary 'Kasahara, H.'   5 
primary 'Nam, H.J.'      6 
# 
_cell.entry_id           3RKQ 
_cell.length_a           71.450 
_cell.length_b           71.450 
_cell.length_c           94.330 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3RKQ 
_symmetry.space_group_name_H-M             'P 65' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                170 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Homeobox protein Nkx-2.5' 7129.262 2   ? C193S 'Homeodomain, UNP residues 138-194' ? 
2 polymer     syn 'ANF-242 DNA'              5916.819 1   ? ?     ?                                   ? 
3 polymer     syn 'ANF-242 DNA'              5734.727 1   ? ?     ?                                   ? 
4 non-polymer syn 'MAGNESIUM ION'            24.305   1   ? ?     ?                                   ? 
5 water       nat water                      18.015   170 ? ?     ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Cardiac-specific homeobox, Homeobox protein CSX, Homeobox protein NK-2 homolog E' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no GRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKSK                     
GRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKSK A,B ? 
2 polydeoxyribonucleotide no no '(DT)(DG)(DA)(DA)(DG)(DT)(DG)(DG)(DG)(DG)(DG)(DC)(DC)(DT)(DC)(DT)(DT)(DG)(DA)' TGAAGTGGGGGCCTCTTGA 
C   ? 
3 polydeoxyribonucleotide no no '(DT)(DC)(DA)(DA)(DG)(DA)(DG)(DG)(DC)(DC)(DC)(DC)(DC)(DA)(DC)(DT)(DT)(DC)(DA)' TCAAGAGGCCCCCACTTCA 
D   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  ARG n 
1 3  ARG n 
1 4  LYS n 
1 5  PRO n 
1 6  ARG n 
1 7  VAL n 
1 8  LEU n 
1 9  PHE n 
1 10 SER n 
1 11 GLN n 
1 12 ALA n 
1 13 GLN n 
1 14 VAL n 
1 15 TYR n 
1 16 GLU n 
1 17 LEU n 
1 18 GLU n 
1 19 ARG n 
1 20 ARG n 
1 21 PHE n 
1 22 LYS n 
1 23 GLN n 
1 24 GLN n 
1 25 ARG n 
1 26 TYR n 
1 27 LEU n 
1 28 SER n 
1 29 ALA n 
1 30 PRO n 
1 31 GLU n 
1 32 ARG n 
1 33 ASP n 
1 34 GLN n 
1 35 LEU n 
1 36 ALA n 
1 37 SER n 
1 38 VAL n 
1 39 LEU n 
1 40 LYS n 
1 41 LEU n 
1 42 THR n 
1 43 SER n 
1 44 THR n 
1 45 GLN n 
1 46 VAL n 
1 47 LYS n 
1 48 ILE n 
1 49 TRP n 
1 50 PHE n 
1 51 GLN n 
1 52 ASN n 
1 53 ARG n 
1 54 ARG n 
1 55 TYR n 
1 56 LYS n 
1 57 SER n 
1 58 LYS n 
2 1  DT  n 
2 2  DG  n 
2 3  DA  n 
2 4  DA  n 
2 5  DG  n 
2 6  DT  n 
2 7  DG  n 
2 8  DG  n 
2 9  DG  n 
2 10 DG  n 
2 11 DG  n 
2 12 DC  n 
2 13 DC  n 
2 14 DT  n 
2 15 DC  n 
2 16 DT  n 
2 17 DT  n 
2 18 DG  n 
2 19 DA  n 
3 1  DT  n 
3 2  DC  n 
3 3  DA  n 
3 4  DA  n 
3 5  DG  n 
3 6  DA  n 
3 7  DG  n 
3 8  DG  n 
3 9  DC  n 
3 10 DC  n 
3 11 DC  n 
3 12 DC  n 
3 13 DC  n 
3 14 DA  n 
3 15 DC  n 
3 16 DT  n 
3 17 DT  n 
3 18 DC  n 
3 19 DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'NKX2-5, CSX, NKX2.5, NKX2E' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP NKX25_HUMAN P52952 1 RRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCK 138 ? 
2 PDB 3RKQ        3RKQ   2 TGAAGTGGGGGCCTCTTGA                                       ?   ? 
3 PDB 3RKQ        3RKQ   3 TCAAGAGGCCCCCACTTCA                                       ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3RKQ A 2 ? 58 ? P52952 138 ? 194 ? 138 194 
2 1 3RKQ B 2 ? 58 ? P52952 138 ? 194 ? 138 194 
3 2 3RKQ C 1 ? 19 ? 3RKQ   1   ? 19  ? 1   19  
4 3 3RKQ D 1 ? 19 ? 3RKQ   1   ? 19  ? 1   19  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3RKQ GLY A 1  ? UNP P52952 ?   ?   'EXPRESSION TAG'      137 1 
1 3RKQ SER A 57 ? UNP P52952 CYS 193 'ENGINEERED MUTATION' 193 2 
2 3RKQ GLY B 1  ? UNP P52952 ?   ?   'EXPRESSION TAG'      137 3 
2 3RKQ SER B 57 ? UNP P52952 CYS 193 'ENGINEERED MUTATION' 193 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3RKQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.68 
_exptl_crystal.density_percent_sol   54.15 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'50mM Tris pH 7.0, 5mM MgCl2, 15% polyethylene glycol monomethyl ether 550 , VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           113 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2008-01-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si (III)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00 
# 
_reflns.entry_id                     3RKQ 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   1 
_reflns.d_resolution_low             40 
_reflns.d_resolution_high            1.7 
_reflns.number_obs                   29800 
_reflns.number_all                   30032 
_reflns.percent_possible_obs         98.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.76 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            1.7000 
_refine.ls_d_res_low                             30.94 
_refine.pdbx_ls_sigma_F                          103.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    98.4000 
_refine.ls_number_reflns_obs                     29538 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.ls_matrix_type                           ? 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.2109 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2570 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.2000 
_refine.ls_number_reflns_R_free                  1266 
_refine.ls_number_reflns_R_work                  28272 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               22.9407 
_refine.solvent_model_param_bsol                 40.8257 
_refine.solvent_model_param_ksol                 ? 
_refine.aniso_B[1][1]                            -1.2270 
_refine.aniso_B[2][2]                            -1.2270 
_refine.aniso_B[3][3]                            2.4530 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                50.870 
_refine.B_iso_min                                3.240 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            1.000 
_refine.entry_id                                 3RKQ 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        998 
_refine_hist.pdbx_number_atoms_nucleic_acid   773 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             170 
_refine_hist.number_atoms_total               1942 
_refine_hist.d_res_high                       1.7000 
_refine_hist.d_res_low                        30.94 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' c_mcbond_it  ? 1.023 1.500 ? ? 
'X-RAY DIFFRACTION' c_scbond_it  ? 1.784 2.000 ? ? 
'X-RAY DIFFRACTION' c_mcangle_it ? 1.572 2.000 ? ? 
'X-RAY DIFFRACTION' c_scangle_it ? 2.655 2.500 ? ? 
# 
_struct.entry_id                  3RKQ 
_struct.title                     'NKX2.5 Homeodomain dimer bound to ANF-242 DNA' 
_struct.pdbx_descriptor           'Homeobox protein Nkx-2.5/DNA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3RKQ 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            'Helix-turn-Helix, DNA binding, Nucleus, TRANSCRIPTION-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 10 ? LYS A 22 ? SER A 146 LYS A 158 1 ? 13 
HELX_P HELX_P2 2 SER A 28 ? LYS A 40 ? SER A 164 LYS A 176 1 ? 13 
HELX_P HELX_P3 3 THR A 42 ? LYS A 58 ? THR A 178 LYS A 194 1 ? 17 
HELX_P HELX_P4 4 SER B 10 ? LYS B 22 ? SER B 146 LYS B 158 1 ? 13 
HELX_P HELX_P5 5 SER B 28 ? LYS B 40 ? SER B 164 LYS B 176 1 ? 13 
HELX_P HELX_P6 6 THR B 42 ? SER B 57 ? THR B 178 SER B 193 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? C DT 1  N3 ? ? ? 1_555 D DA 19 N1 ? ? C DT 1  D DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? C DT 1  O4 ? ? ? 1_555 D DA 19 N6 ? ? C DT 1  D DA 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? C DG 2  N1 ? ? ? 1_555 D DC 18 N3 ? ? C DG 2  D DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? C DG 2  N2 ? ? ? 1_555 D DC 18 O2 ? ? C DG 2  D DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? C DG 2  O6 ? ? ? 1_555 D DC 18 N4 ? ? C DG 2  D DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? C DA 3  N1 ? ? ? 1_555 D DT 17 N3 ? ? C DA 3  D DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? C DA 3  N6 ? ? ? 1_555 D DT 17 O4 ? ? C DA 3  D DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? C DA 4  N1 ? ? ? 1_555 D DT 16 N3 ? ? C DA 4  D DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? C DA 4  N6 ? ? ? 1_555 D DT 16 O4 ? ? C DA 4  D DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? C DG 5  N1 ? ? ? 1_555 D DC 15 N3 ? ? C DG 5  D DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? C DG 5  N2 ? ? ? 1_555 D DC 15 O2 ? ? C DG 5  D DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? C DG 5  O6 ? ? ? 1_555 D DC 15 N4 ? ? C DG 5  D DC 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? C DT 6  N3 ? ? ? 1_555 D DA 14 N1 ? ? C DT 6  D DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? C DT 6  O4 ? ? ? 1_555 D DA 14 N6 ? ? C DT 6  D DA 14 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? C DG 7  N1 ? ? ? 1_555 D DC 13 N3 ? ? C DG 7  D DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? C DG 7  N2 ? ? ? 1_555 D DC 13 O2 ? ? C DG 7  D DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? C DG 7  O6 ? ? ? 1_555 D DC 13 N4 ? ? C DG 7  D DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? C DG 8  N1 ? ? ? 1_555 D DC 12 N3 ? ? C DG 8  D DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? C DG 8  N2 ? ? ? 1_555 D DC 12 O2 ? ? C DG 8  D DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? C DG 8  O6 ? ? ? 1_555 D DC 12 N4 ? ? C DG 8  D DC 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? C DG 9  N1 ? ? ? 1_555 D DC 11 N3 ? ? C DG 9  D DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? C DG 9  N2 ? ? ? 1_555 D DC 11 O2 ? ? C DG 9  D DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? C DG 9  O6 ? ? ? 1_555 D DC 11 N4 ? ? C DG 9  D DC 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? C DG 10 N1 ? ? ? 1_555 D DC 10 N3 ? ? C DG 10 D DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? C DG 10 N2 ? ? ? 1_555 D DC 10 O2 ? ? C DG 10 D DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? C DG 10 O6 ? ? ? 1_555 D DC 10 N4 ? ? C DG 10 D DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? C DG 11 N1 ? ? ? 1_555 D DC 9  N3 ? ? C DG 11 D DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? C DG 11 N2 ? ? ? 1_555 D DC 9  O2 ? ? C DG 11 D DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? C DG 11 O6 ? ? ? 1_555 D DC 9  N4 ? ? C DG 11 D DC 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? C DC 12 N3 ? ? ? 1_555 D DG 8  N1 ? ? C DC 12 D DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? C DC 12 N4 ? ? ? 1_555 D DG 8  O6 ? ? C DC 12 D DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? C DC 12 O2 ? ? ? 1_555 D DG 8  N2 ? ? C DC 12 D DG 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? C DC 13 N3 ? ? ? 1_555 D DG 7  N1 ? ? C DC 13 D DG 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? C DC 13 N4 ? ? ? 1_555 D DG 7  O6 ? ? C DC 13 D DG 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? C DC 13 O2 ? ? ? 1_555 D DG 7  N2 ? ? C DC 13 D DG 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? C DT 14 N3 ? ? ? 1_555 D DA 6  N1 ? ? C DT 14 D DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? C DT 14 O4 ? ? ? 1_555 D DA 6  N6 ? ? C DT 14 D DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? C DC 15 N3 ? ? ? 1_555 D DG 5  N1 ? ? C DC 15 D DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? C DC 15 N4 ? ? ? 1_555 D DG 5  O6 ? ? C DC 15 D DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? C DC 15 O2 ? ? ? 1_555 D DG 5  N2 ? ? C DC 15 D DG 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? C DT 16 N3 ? ? ? 1_555 D DA 4  N1 ? ? C DT 16 D DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? C DT 16 O4 ? ? ? 1_555 D DA 4  N6 ? ? C DT 16 D DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? C DT 17 N3 ? ? ? 1_555 D DA 3  N1 ? ? C DT 17 D DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? C DT 17 O4 ? ? ? 1_555 D DA 3  N6 ? ? C DT 17 D DA 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? C DG 18 N1 ? ? ? 1_555 D DC 2  N3 ? ? C DG 18 D DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? C DG 18 N2 ? ? ? 1_555 D DC 2  O2 ? ? C DG 18 D DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? C DG 18 O6 ? ? ? 1_555 D DC 2  N4 ? ? C DG 18 D DC 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48 hydrog ? ? C DA 19 N1 ? ? ? 1_555 D DT 1  N3 ? ? C DA 19 D DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49 hydrog ? ? C DA 19 N6 ? ? ? 1_555 D DT 1  O4 ? ? C DA 19 D DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE MG B 1' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 ARG B 6  ? ARG B 142 . ? 1_555 ? 
2 AC1 4 ARG B 25 ? ARG B 161 . ? 5_555 ? 
3 AC1 4 TYR B 26 ? TYR B 162 . ? 5_555 ? 
4 AC1 4 HOH H .  ? HOH C 32  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3RKQ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3RKQ 
_atom_sites.fract_transf_matrix[1][1]   0.013996 
_atom_sites.fract_transf_matrix[1][2]   0.008080 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016161 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010601 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1  ? -48.536 35.649 -10.355 1.00 19.62 ? 137 GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1  ? -48.037 35.102 -11.644 1.00 22.36 ? 137 GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1  ? -48.553 33.702 -11.925 1.00 23.44 ? 137 GLY A C     1 
ATOM   4    O  O     . GLY A 1 1  ? -49.158 33.069 -11.061 1.00 23.73 ? 137 GLY A O     1 
ATOM   5    N  N     . ARG A 1 2  ? -48.325 33.213 -13.139 1.00 24.30 ? 138 ARG A N     1 
ATOM   6    C  CA    . ARG A 1 2  ? -48.767 31.872 -13.500 1.00 25.49 ? 138 ARG A CA    1 
ATOM   7    C  C     . ARG A 1 2  ? -47.903 30.844 -12.764 1.00 25.21 ? 138 ARG A C     1 
ATOM   8    O  O     . ARG A 1 2  ? -46.699 31.034 -12.605 1.00 25.19 ? 138 ARG A O     1 
ATOM   9    C  CB    . ARG A 1 2  ? -48.632 31.664 -15.006 1.00 28.08 ? 138 ARG A CB    1 
ATOM   10   C  CG    . ARG A 1 2  ? -47.193 31.608 -15.471 1.00 32.07 ? 138 ARG A CG    1 
ATOM   11   C  CD    . ARG A 1 2  ? -47.087 31.549 -16.981 1.00 35.64 ? 138 ARG A CD    1 
ATOM   12   N  NE    . ARG A 1 2  ? -47.461 32.816 -17.601 1.00 37.61 ? 138 ARG A NE    1 
ATOM   13   C  CZ    . ARG A 1 2  ? -47.441 33.035 -18.909 1.00 39.00 ? 138 ARG A CZ    1 
ATOM   14   N  NH1   . ARG A 1 2  ? -47.061 32.071 -19.741 1.00 42.09 ? 138 ARG A NH1   1 
ATOM   15   N  NH2   . ARG A 1 2  ? -47.815 34.209 -19.387 1.00 40.24 ? 138 ARG A NH2   1 
ATOM   16   N  N     . ARG A 1 3  ? -48.521 29.764 -12.302 1.00 25.11 ? 139 ARG A N     1 
ATOM   17   C  CA    . ARG A 1 3  ? -47.787 28.714 -11.606 1.00 24.75 ? 139 ARG A CA    1 
ATOM   18   C  C     . ARG A 1 3  ? -48.220 27.368 -12.174 1.00 24.12 ? 139 ARG A C     1 
ATOM   19   O  O     . ARG A 1 3  ? -49.332 27.241 -12.676 1.00 24.37 ? 139 ARG A O     1 
ATOM   20   C  CB    . ARG A 1 3  ? -48.043 28.807 -10.098 1.00 26.99 ? 139 ARG A CB    1 
ATOM   21   C  CG    . ARG A 1 3  ? -47.362 30.026 -9.452  1.00 27.08 ? 139 ARG A CG    1 
ATOM   22   C  CD    . ARG A 1 3  ? -47.708 30.195 -7.981  1.00 25.80 ? 139 ARG A CD    1 
ATOM   23   N  NE    . ARG A 1 3  ? -49.114 30.537 -7.765  1.00 25.92 ? 139 ARG A NE    1 
ATOM   24   C  CZ    . ARG A 1 3  ? -49.655 30.753 -6.568  1.00 26.14 ? 139 ARG A CZ    1 
ATOM   25   N  NH1   . ARG A 1 3  ? -48.908 30.663 -5.469  1.00 26.50 ? 139 ARG A NH1   1 
ATOM   26   N  NH2   . ARG A 1 3  ? -50.940 31.063 -6.466  1.00 24.88 ? 139 ARG A NH2   1 
ATOM   27   N  N     . LYS A 1 4  ? -47.339 26.374 -12.118 1.00 23.52 ? 140 LYS A N     1 
ATOM   28   C  CA    . LYS A 1 4  ? -47.647 25.061 -12.680 1.00 24.38 ? 140 LYS A CA    1 
ATOM   29   C  C     . LYS A 1 4  ? -48.943 24.472 -12.126 1.00 22.88 ? 140 LYS A C     1 
ATOM   30   O  O     . LYS A 1 4  ? -49.210 24.556 -10.928 1.00 23.25 ? 140 LYS A O     1 
ATOM   31   C  CB    . LYS A 1 4  ? -46.494 24.088 -12.427 1.00 25.99 ? 140 LYS A CB    1 
ATOM   32   C  CG    . LYS A 1 4  ? -46.527 22.860 -13.323 1.00 29.63 ? 140 LYS A CG    1 
ATOM   33   C  CD    . LYS A 1 4  ? -45.443 21.854 -12.950 1.00 34.13 ? 140 LYS A CD    1 
ATOM   34   C  CE    . LYS A 1 4  ? -44.058 22.487 -12.937 1.00 36.11 ? 140 LYS A CE    1 
ATOM   35   N  NZ    . LYS A 1 4  ? -43.728 23.165 -14.228 1.00 38.44 ? 140 LYS A NZ    1 
ATOM   36   N  N     . PRO A 1 5  ? -49.770 23.868 -13.000 1.00 21.91 ? 141 PRO A N     1 
ATOM   37   C  CA    . PRO A 1 5  ? -51.040 23.270 -12.575 1.00 21.20 ? 141 PRO A CA    1 
ATOM   38   C  C     . PRO A 1 5  ? -50.926 21.864 -11.976 1.00 20.99 ? 141 PRO A C     1 
ATOM   39   O  O     . PRO A 1 5  ? -50.039 21.081 -12.330 1.00 20.14 ? 141 PRO A O     1 
ATOM   40   C  CB    . PRO A 1 5  ? -51.852 23.255 -13.861 1.00 19.98 ? 141 PRO A CB    1 
ATOM   41   C  CG    . PRO A 1 5  ? -50.799 22.918 -14.875 1.00 21.10 ? 141 PRO A CG    1 
ATOM   42   C  CD    . PRO A 1 5  ? -49.648 23.835 -14.470 1.00 21.31 ? 141 PRO A CD    1 
ATOM   43   N  N     . ARG A 1 6  ? -51.839 21.564 -11.061 1.00 20.87 ? 142 ARG A N     1 
ATOM   44   C  CA    . ARG A 1 6  ? -51.900 20.252 -10.441 1.00 20.08 ? 142 ARG A CA    1 
ATOM   45   C  C     . ARG A 1 6  ? -52.557 19.372 -11.498 1.00 20.27 ? 142 ARG A C     1 
ATOM   46   O  O     . ARG A 1 6  ? -53.614 19.719 -12.012 1.00 21.64 ? 142 ARG A O     1 
ATOM   47   C  CB    . ARG A 1 6  ? -52.779 20.308 -9.184  1.00 18.84 ? 142 ARG A CB    1 
ATOM   48   C  CG    . ARG A 1 6  ? -52.998 18.968 -8.478  1.00 17.85 ? 142 ARG A CG    1 
ATOM   49   C  CD    . ARG A 1 6  ? -54.097 18.133 -9.134  1.00 17.42 ? 142 ARG A CD    1 
ATOM   50   N  NE    . ARG A 1 6  ? -55.434 18.702 -8.968  1.00 16.42 ? 142 ARG A NE    1 
ATOM   51   C  CZ    . ARG A 1 6  ? -56.177 18.579 -7.872  1.00 16.33 ? 142 ARG A CZ    1 
ATOM   52   N  NH1   . ARG A 1 6  ? -55.710 17.900 -6.829  1.00 14.48 ? 142 ARG A NH1   1 
ATOM   53   N  NH2   . ARG A 1 6  ? -57.393 19.125 -7.821  1.00 14.82 ? 142 ARG A NH2   1 
ATOM   54   N  N     . VAL A 1 7  ? -51.924 18.257 -11.848 1.00 19.65 ? 143 VAL A N     1 
ATOM   55   C  CA    . VAL A 1 7  ? -52.497 17.349 -12.829 1.00 19.67 ? 143 VAL A CA    1 
ATOM   56   C  C     . VAL A 1 7  ? -52.986 16.077 -12.135 1.00 18.96 ? 143 VAL A C     1 
ATOM   57   O  O     . VAL A 1 7  ? -52.270 15.458 -11.353 1.00 15.93 ? 143 VAL A O     1 
ATOM   58   C  CB    . VAL A 1 7  ? -51.474 16.994 -13.922 1.00 21.26 ? 143 VAL A CB    1 
ATOM   59   C  CG1   . VAL A 1 7  ? -52.056 15.956 -14.894 1.00 21.33 ? 143 VAL A CG1   1 
ATOM   60   C  CG2   . VAL A 1 7  ? -51.089 18.264 -14.660 1.00 21.15 ? 143 VAL A CG2   1 
ATOM   61   N  N     . LEU A 1 8  ? -54.231 15.712 -12.419 1.00 18.61 ? 144 LEU A N     1 
ATOM   62   C  CA    . LEU A 1 8  ? -54.838 14.532 -11.834 1.00 17.53 ? 144 LEU A CA    1 
ATOM   63   C  C     . LEU A 1 8  ? -54.184 13.276 -12.393 1.00 16.68 ? 144 LEU A C     1 
ATOM   64   O  O     . LEU A 1 8  ? -53.592 13.294 -13.479 1.00 15.72 ? 144 LEU A O     1 
ATOM   65   C  CB    . LEU A 1 8  ? -56.338 14.514 -12.140 1.00 17.82 ? 144 LEU A CB    1 
ATOM   66   C  CG    . LEU A 1 8  ? -57.128 15.771 -11.757 1.00 18.36 ? 144 LEU A CG    1 
ATOM   67   C  CD1   . LEU A 1 8  ? -58.523 15.675 -12.348 1.00 20.05 ? 144 LEU A CD1   1 
ATOM   68   C  CD2   . LEU A 1 8  ? -57.191 15.923 -10.248 1.00 17.80 ? 144 LEU A CD2   1 
ATOM   69   N  N     . PHE A 1 9  ? -54.273 12.189 -11.631 1.00 15.45 ? 145 PHE A N     1 
ATOM   70   C  CA    . PHE A 1 9  ? -53.720 10.921 -12.072 1.00 15.05 ? 145 PHE A CA    1 
ATOM   71   C  C     . PHE A 1 9  ? -54.840 10.193 -12.813 1.00 13.53 ? 145 PHE A C     1 
ATOM   72   O  O     . PHE A 1 9  ? -56.011 10.305 -12.448 1.00 15.07 ? 145 PHE A O     1 
ATOM   73   C  CB    . PHE A 1 9  ? -53.212 10.104 -10.874 1.00 14.82 ? 145 PHE A CB    1 
ATOM   74   C  CG    . PHE A 1 9  ? -52.112 10.787 -10.098 1.00 16.04 ? 145 PHE A CG    1 
ATOM   75   C  CD1   . PHE A 1 9  ? -51.231 11.660 -10.733 1.00 15.85 ? 145 PHE A CD1   1 
ATOM   76   C  CD2   . PHE A 1 9  ? -51.948 10.552 -8.741  1.00 16.85 ? 145 PHE A CD2   1 
ATOM   77   C  CE1   . PHE A 1 9  ? -50.198 12.293 -10.027 1.00 16.80 ? 145 PHE A CE1   1 
ATOM   78   C  CE2   . PHE A 1 9  ? -50.913 11.182 -8.025  1.00 18.51 ? 145 PHE A CE2   1 
ATOM   79   C  CZ    . PHE A 1 9  ? -50.037 12.054 -8.675  1.00 15.28 ? 145 PHE A CZ    1 
ATOM   80   N  N     . SER A 1 10 ? -54.478 9.469  -13.864 1.00 13.99 ? 146 SER A N     1 
ATOM   81   C  CA    . SER A 1 10 ? -55.460 8.754  -14.670 1.00 14.16 ? 146 SER A CA    1 
ATOM   82   C  C     . SER A 1 10 ? -56.119 7.618  -13.908 1.00 15.17 ? 146 SER A C     1 
ATOM   83   O  O     . SER A 1 10 ? -55.615 7.144  -12.884 1.00 14.81 ? 146 SER A O     1 
ATOM   84   C  CB    . SER A 1 10 ? -54.809 8.203  -15.937 1.00 13.65 ? 146 SER A CB    1 
ATOM   85   O  OG    . SER A 1 10 ? -53.853 7.209  -15.626 1.00 14.08 ? 146 SER A OG    1 
ATOM   86   N  N     . GLN A 1 11 ? -57.259 7.180  -14.414 1.00 14.94 ? 147 GLN A N     1 
ATOM   87   C  CA    . GLN A 1 11 ? -57.966 6.099  -13.769 1.00 16.97 ? 147 GLN A CA    1 
ATOM   88   C  C     . GLN A 1 11 ? -57.019 4.909  -13.681 1.00 15.47 ? 147 GLN A C     1 
ATOM   89   O  O     . GLN A 1 11 ? -56.947 4.239  -12.656 1.00 16.32 ? 147 GLN A O     1 
ATOM   90   C  CB    . GLN A 1 11 ? -59.217 5.752  -14.571 1.00 18.75 ? 147 GLN A CB    1 
ATOM   91   C  CG    . GLN A 1 11 ? -60.166 4.832  -13.847 1.00 24.99 ? 147 GLN A CG    1 
ATOM   92   C  CD    . GLN A 1 11 ? -61.586 4.942  -14.377 1.00 29.37 ? 147 GLN A CD    1 
ATOM   93   O  OE1   . GLN A 1 11 ? -62.487 4.229  -13.930 1.00 31.02 ? 147 GLN A OE1   1 
ATOM   94   N  NE2   . GLN A 1 11 ? -61.795 5.849  -15.333 1.00 30.96 ? 147 GLN A NE2   1 
ATOM   95   N  N     . ALA A 1 12 ? -56.274 4.668  -14.754 1.00 16.05 ? 148 ALA A N     1 
ATOM   96   C  CA    . ALA A 1 12 ? -55.330 3.555  -14.801 1.00 15.08 ? 148 ALA A CA    1 
ATOM   97   C  C     . ALA A 1 12 ? -54.224 3.689  -13.746 1.00 15.07 ? 148 ALA A C     1 
ATOM   98   O  O     . ALA A 1 12 ? -53.872 2.706  -13.097 1.00 14.14 ? 148 ALA A O     1 
ATOM   99   C  CB    . ALA A 1 12 ? -54.720 3.447  -16.197 1.00 15.80 ? 148 ALA A CB    1 
ATOM   100  N  N     . GLN A 1 13 ? -53.680 4.895  -13.575 1.00 14.23 ? 149 GLN A N     1 
ATOM   101  C  CA    . GLN A 1 13 ? -52.629 5.120  -12.576 1.00 14.28 ? 149 GLN A CA    1 
ATOM   102  C  C     . GLN A 1 13 ? -53.159 4.910  -11.153 1.00 13.62 ? 149 GLN A C     1 
ATOM   103  O  O     . GLN A 1 13 ? -52.539 4.223  -10.346 1.00 14.49 ? 149 GLN A O     1 
ATOM   104  C  CB    . GLN A 1 13 ? -52.053 6.539  -12.699 1.00 14.22 ? 149 GLN A CB    1 
ATOM   105  C  CG    . GLN A 1 13 ? -51.267 6.798  -13.979 1.00 14.34 ? 149 GLN A CG    1 
ATOM   106  C  CD    . GLN A 1 13 ? -50.854 8.249  -14.137 1.00 14.96 ? 149 GLN A CD    1 
ATOM   107  O  OE1   . GLN A 1 13 ? -51.621 9.158  -13.837 1.00 15.80 ? 149 GLN A OE1   1 
ATOM   108  N  NE2   . GLN A 1 13 ? -49.642 8.473  -14.631 1.00 15.43 ? 149 GLN A NE2   1 
ATOM   109  N  N     . VAL A 1 14 ? -54.306 5.510  -10.845 1.00 15.11 ? 150 VAL A N     1 
ATOM   110  C  CA    . VAL A 1 14 ? -54.904 5.389  -9.517  1.00 13.58 ? 150 VAL A CA    1 
ATOM   111  C  C     . VAL A 1 14 ? -55.258 3.937  -9.223  1.00 14.93 ? 150 VAL A C     1 
ATOM   112  O  O     . VAL A 1 14 ? -55.139 3.481  -8.087  1.00 14.88 ? 150 VAL A O     1 
ATOM   113  C  CB    . VAL A 1 14 ? -56.178 6.260  -9.392  1.00 13.07 ? 150 VAL A CB    1 
ATOM   114  C  CG1   . VAL A 1 14 ? -56.820 6.065  -8.036  1.00 13.01 ? 150 VAL A CG1   1 
ATOM   115  C  CG2   . VAL A 1 14 ? -55.828 7.727  -9.589  1.00 12.38 ? 150 VAL A CG2   1 
ATOM   116  N  N     . TYR A 1 15 ? -55.694 3.212  -10.251 1.00 15.38 ? 151 TYR A N     1 
ATOM   117  C  CA    . TYR A 1 15 ? -56.057 1.811  -10.082 1.00 16.04 ? 151 TYR A CA    1 
ATOM   118  C  C     . TYR A 1 15 ? -54.825 1.011  -9.648  1.00 14.84 ? 151 TYR A C     1 
ATOM   119  O  O     . TYR A 1 15 ? -54.895 0.185  -8.742  1.00 13.70 ? 151 TYR A O     1 
ATOM   120  C  CB    . TYR A 1 15 ? -56.600 1.243  -11.389 1.00 16.98 ? 151 TYR A CB    1 
ATOM   121  C  CG    . TYR A 1 15 ? -57.317 -0.068 -11.203 1.00 20.24 ? 151 TYR A CG    1 
ATOM   122  C  CD1   . TYR A 1 15 ? -58.610 -0.103 -10.683 1.00 22.28 ? 151 TYR A CD1   1 
ATOM   123  C  CD2   . TYR A 1 15 ? -56.695 -1.275 -11.508 1.00 21.01 ? 151 TYR A CD2   1 
ATOM   124  C  CE1   . TYR A 1 15 ? -59.267 -1.306 -10.471 1.00 23.77 ? 151 TYR A CE1   1 
ATOM   125  C  CE2   . TYR A 1 15 ? -57.342 -2.488 -11.297 1.00 24.02 ? 151 TYR A CE2   1 
ATOM   126  C  CZ    . TYR A 1 15 ? -58.629 -2.495 -10.778 1.00 25.26 ? 151 TYR A CZ    1 
ATOM   127  O  OH    . TYR A 1 15 ? -59.285 -3.688 -10.565 1.00 29.46 ? 151 TYR A OH    1 
ATOM   128  N  N     . GLU A 1 16 ? -53.695 1.269  -10.297 1.00 14.05 ? 152 GLU A N     1 
ATOM   129  C  CA    . GLU A 1 16 ? -52.453 0.578  -9.971  1.00 14.43 ? 152 GLU A CA    1 
ATOM   130  C  C     . GLU A 1 16 ? -51.927 0.998  -8.592  1.00 14.36 ? 152 GLU A C     1 
ATOM   131  O  O     . GLU A 1 16 ? -51.360 0.183  -7.859  1.00 13.58 ? 152 GLU A O     1 
ATOM   132  C  CB    . GLU A 1 16 ? -51.399 0.863  -11.048 1.00 15.41 ? 152 GLU A CB    1 
ATOM   133  C  CG    . GLU A 1 16 ? -50.063 0.188  -10.796 1.00 20.57 ? 152 GLU A CG    1 
ATOM   134  C  CD    . GLU A 1 16 ? -50.173 -1.330 -10.701 1.00 23.71 ? 152 GLU A CD    1 
ATOM   135  O  OE1   . GLU A 1 16 ? -49.172 -1.975 -10.300 1.00 24.80 ? 152 GLU A OE1   1 
ATOM   136  O  OE2   . GLU A 1 16 ? -51.257 -1.872 -11.029 1.00 24.16 ? 152 GLU A OE2   1 
ATOM   137  N  N     . LEU A 1 17 ? -52.112 2.270  -8.242  1.00 13.70 ? 153 LEU A N     1 
ATOM   138  C  CA    . LEU A 1 17 ? -51.672 2.773  -6.944  1.00 12.26 ? 153 LEU A CA    1 
ATOM   139  C  C     . LEU A 1 17 ? -52.491 2.113  -5.835  1.00 13.22 ? 153 LEU A C     1 
ATOM   140  O  O     . LEU A 1 17 ? -51.940 1.671  -4.832  1.00 13.70 ? 153 LEU A O     1 
ATOM   141  C  CB    . LEU A 1 17 ? -51.839 4.295  -6.884  1.00 11.32 ? 153 LEU A CB    1 
ATOM   142  C  CG    . LEU A 1 17 ? -50.807 5.107  -7.665  1.00 11.34 ? 153 LEU A CG    1 
ATOM   143  C  CD1   . LEU A 1 17 ? -51.304 6.542  -7.861  1.00 10.87 ? 153 LEU A CD1   1 
ATOM   144  C  CD2   . LEU A 1 17 ? -49.471 5.084  -6.914  1.00 11.59 ? 153 LEU A CD2   1 
ATOM   145  N  N     . GLU A 1 18 ? -53.810 2.049  -6.027  1.00 13.34 ? 154 GLU A N     1 
ATOM   146  C  CA    . GLU A 1 18 ? -54.711 1.433  -5.053  1.00 13.82 ? 154 GLU A CA    1 
ATOM   147  C  C     . GLU A 1 18 ? -54.447 -0.074 -4.957  1.00 12.99 ? 154 GLU A C     1 
ATOM   148  O  O     . GLU A 1 18 ? -54.685 -0.683 -3.922  1.00 13.01 ? 154 GLU A O     1 
ATOM   149  C  CB    . GLU A 1 18 ? -56.172 1.662  -5.453  1.00 16.42 ? 154 GLU A CB    1 
ATOM   150  C  CG    . GLU A 1 18 ? -56.664 3.102  -5.374  1.00 19.07 ? 154 GLU A CG    1 
ATOM   151  C  CD    . GLU A 1 18 ? -57.060 3.525  -3.963  1.00 23.33 ? 154 GLU A CD    1 
ATOM   152  O  OE1   . GLU A 1 18 ? -57.758 4.556  -3.827  1.00 24.30 ? 154 GLU A OE1   1 
ATOM   153  O  OE2   . GLU A 1 18 ? -56.671 2.840  -2.991  1.00 24.92 ? 154 GLU A OE2   1 
ATOM   154  N  N     . ARG A 1 19 ? -53.974 -0.675 -6.044  1.00 14.53 ? 155 ARG A N     1 
ATOM   155  C  CA    . ARG A 1 19 ? -53.674 -2.106 -6.046  1.00 14.02 ? 155 ARG A CA    1 
ATOM   156  C  C     . ARG A 1 19 ? -52.469 -2.359 -5.148  1.00 15.05 ? 155 ARG A C     1 
ATOM   157  O  O     . ARG A 1 19 ? -52.500 -3.244 -4.301  1.00 14.15 ? 155 ARG A O     1 
ATOM   158  C  CB    . ARG A 1 19 ? -53.357 -2.600 -7.460  1.00 14.83 ? 155 ARG A CB    1 
ATOM   159  C  CG    . ARG A 1 19 ? -53.157 -4.111 -7.537  1.00 16.84 ? 155 ARG A CG    1 
ATOM   160  C  CD    . ARG A 1 19 ? -52.940 -4.598 -8.965  1.00 18.37 ? 155 ARG A CD    1 
ATOM   161  N  NE    . ARG A 1 19 ? -51.566 -4.402 -9.422  1.00 22.61 ? 155 ARG A NE    1 
ATOM   162  C  CZ    . ARG A 1 19 ? -50.525 -5.140 -9.035  1.00 23.89 ? 155 ARG A CZ    1 
ATOM   163  N  NH1   . ARG A 1 19 ? -50.687 -6.141 -8.176  1.00 23.99 ? 155 ARG A NH1   1 
ATOM   164  N  NH2   . ARG A 1 19 ? -49.318 -4.874 -9.507  1.00 23.66 ? 155 ARG A NH2   1 
ATOM   165  N  N     . ARG A 1 20 ? -51.407 -1.577 -5.343  1.00 15.45 ? 156 ARG A N     1 
ATOM   166  C  CA    . ARG A 1 20 ? -50.190 -1.710 -4.542  1.00 17.00 ? 156 ARG A CA    1 
ATOM   167  C  C     . ARG A 1 20 ? -50.474 -1.376 -3.068  1.00 16.24 ? 156 ARG A C     1 
ATOM   168  O  O     . ARG A 1 20 ? -49.915 -2.003 -2.172  1.00 15.80 ? 156 ARG A O     1 
ATOM   169  C  CB    . ARG A 1 20 ? -49.075 -0.775 -5.062  1.00 18.28 ? 156 ARG A CB    1 
ATOM   170  C  CG    . ARG A 1 20 ? -48.696 -0.935 -6.541  1.00 22.58 ? 156 ARG A CG    1 
ATOM   171  C  CD    . ARG A 1 20 ? -47.770 -2.132 -6.848  1.00 25.34 ? 156 ARG A CD    1 
ATOM   172  N  NE    . ARG A 1 20 ? -46.382 -1.972 -6.386  1.00 24.25 ? 156 ARG A NE    1 
ATOM   173  C  CZ    . ARG A 1 20 ? -45.947 -2.318 -5.177  1.00 23.27 ? 156 ARG A CZ    1 
ATOM   174  N  NH1   . ARG A 1 20 ? -46.787 -2.846 -4.294  1.00 21.25 ? 156 ARG A NH1   1 
ATOM   175  N  NH2   . ARG A 1 20 ? -44.670 -2.151 -4.853  1.00 22.06 ? 156 ARG A NH2   1 
ATOM   176  N  N     . PHE A 1 21 ? -51.339 -0.393 -2.823  1.00 14.93 ? 157 PHE A N     1 
ATOM   177  C  CA    . PHE A 1 21 ? -51.674 0.022  -1.461  1.00 14.83 ? 157 PHE A CA    1 
ATOM   178  C  C     . PHE A 1 21 ? -52.357 -1.098 -0.664  1.00 15.95 ? 157 PHE A C     1 
ATOM   179  O  O     . PHE A 1 21 ? -52.230 -1.166 0.561   1.00 15.89 ? 157 PHE A O     1 
ATOM   180  C  CB    . PHE A 1 21 ? -52.577 1.256  -1.483  1.00 14.91 ? 157 PHE A CB    1 
ATOM   181  C  CG    . PHE A 1 21 ? -52.738 1.911  -0.133  1.00 15.43 ? 157 PHE A CG    1 
ATOM   182  C  CD1   . PHE A 1 21 ? -51.725 2.705  0.396   1.00 16.06 ? 157 PHE A CD1   1 
ATOM   183  C  CD2   . PHE A 1 21 ? -53.895 1.716  0.617   1.00 15.07 ? 157 PHE A CD2   1 
ATOM   184  C  CE1   . PHE A 1 21 ? -51.867 3.300  1.660   1.00 16.05 ? 157 PHE A CE1   1 
ATOM   185  C  CE2   . PHE A 1 21 ? -54.044 2.301  1.873   1.00 15.45 ? 157 PHE A CE2   1 
ATOM   186  C  CZ    . PHE A 1 21 ? -53.029 3.095  2.395   1.00 13.67 ? 157 PHE A CZ    1 
ATOM   187  N  N     . LYS A 1 22 ? -53.083 -1.967 -1.360  1.00 15.49 ? 158 LYS A N     1 
ATOM   188  C  CA    . LYS A 1 22 ? -53.750 -3.090 -0.712  1.00 16.66 ? 158 LYS A CA    1 
ATOM   189  C  C     . LYS A 1 22 ? -52.710 -4.154 -0.385  1.00 17.10 ? 158 LYS A C     1 
ATOM   190  O  O     . LYS A 1 22 ? -52.982 -5.073 0.386   1.00 18.51 ? 158 LYS A O     1 
ATOM   191  C  CB    . LYS A 1 22 ? -54.824 -3.680 -1.626  1.00 16.80 ? 158 LYS A CB    1 
ATOM   192  C  CG    . LYS A 1 22 ? -56.001 -2.752 -1.857  1.00 18.10 ? 158 LYS A CG    1 
ATOM   193  C  CD    . LYS A 1 22 ? -56.926 -3.318 -2.904  1.00 21.81 ? 158 LYS A CD    1 
ATOM   194  C  CE    . LYS A 1 22 ? -58.036 -2.336 -3.224  1.00 24.23 ? 158 LYS A CE    1 
ATOM   195  N  NZ    . LYS A 1 22 ? -58.867 -2.802 -4.367  1.00 25.12 ? 158 LYS A NZ    1 
ATOM   196  N  N     . GLN A 1 23 ? -51.523 -4.025 -0.978  1.00 16.34 ? 159 GLN A N     1 
ATOM   197  C  CA    . GLN A 1 23 ? -50.427 -4.960 -0.731  1.00 16.97 ? 159 GLN A CA    1 
ATOM   198  C  C     . GLN A 1 23 ? -49.465 -4.411 0.316   1.00 16.74 ? 159 GLN A C     1 
ATOM   199  O  O     . GLN A 1 23 ? -48.907 -5.167 1.105   1.00 17.64 ? 159 GLN A O     1 
ATOM   200  C  CB    . GLN A 1 23 ? -49.604 -5.205 -1.992  1.00 16.68 ? 159 GLN A CB    1 
ATOM   201  C  CG    . GLN A 1 23 ? -50.305 -5.853 -3.147  1.00 19.51 ? 159 GLN A CG    1 
ATOM   202  C  CD    . GLN A 1 23 ? -49.341 -6.072 -4.291  1.00 20.35 ? 159 GLN A CD    1 
ATOM   203  O  OE1   . GLN A 1 23 ? -48.581 -5.171 -4.650  1.00 20.32 ? 159 GLN A OE1   1 
ATOM   204  N  NE2   . GLN A 1 23 ? -49.359 -7.266 -4.868  1.00 21.09 ? 159 GLN A NE2   1 
ATOM   205  N  N     . GLN A 1 24 ? -49.257 -3.095 0.292   1.00 16.94 ? 160 GLN A N     1 
ATOM   206  C  CA    . GLN A 1 24 ? -48.334 -2.417 1.205   1.00 15.87 ? 160 GLN A CA    1 
ATOM   207  C  C     . GLN A 1 24 ? -48.780 -0.991 1.512   1.00 15.94 ? 160 GLN A C     1 
ATOM   208  O  O     . GLN A 1 24 ? -49.031 -0.201 0.597   1.00 15.11 ? 160 GLN A O     1 
ATOM   209  C  CB    . GLN A 1 24 ? -46.941 -2.341 0.579   1.00 15.46 ? 160 GLN A CB    1 
ATOM   210  C  CG    . GLN A 1 24 ? -46.308 -3.672 0.237   1.00 16.13 ? 160 GLN A CG    1 
ATOM   211  C  CD    . GLN A 1 24 ? -44.998 -3.501 -0.507  1.00 17.02 ? 160 GLN A CD    1 
ATOM   212  O  OE1   . GLN A 1 24 ? -44.986 -3.247 -1.705  1.00 17.75 ? 160 GLN A OE1   1 
ATOM   213  N  NE2   . GLN A 1 24 ? -43.884 -3.623 0.210   1.00 18.49 ? 160 GLN A NE2   1 
ATOM   214  N  N     . ARG A 1 25 ? -48.860 -0.659 2.797   1.00 16.32 ? 161 ARG A N     1 
ATOM   215  C  CA    . ARG A 1 25 ? -49.248 0.684  3.217   1.00 15.72 ? 161 ARG A CA    1 
ATOM   216  C  C     . ARG A 1 25 ? -48.071 1.637  3.084   1.00 13.95 ? 161 ARG A C     1 
ATOM   217  O  O     . ARG A 1 25 ? -48.255 2.850  3.008   1.00 12.59 ? 161 ARG A O     1 
ATOM   218  C  CB    . ARG A 1 25 ? -49.724 0.687  4.666   1.00 16.38 ? 161 ARG A CB    1 
ATOM   219  C  CG    . ARG A 1 25 ? -51.170 0.311  4.855   1.00 19.61 ? 161 ARG A CG    1 
ATOM   220  C  CD    . ARG A 1 25 ? -51.534 0.365  6.333   1.00 21.91 ? 161 ARG A CD    1 
ATOM   221  N  NE    . ARG A 1 25 ? -51.567 1.722  6.885   1.00 21.83 ? 161 ARG A NE    1 
ATOM   222  C  CZ    . ARG A 1 25 ? -52.545 2.598  6.665   1.00 22.42 ? 161 ARG A CZ    1 
ATOM   223  N  NH1   . ARG A 1 25 ? -53.575 2.268  5.896   1.00 22.43 ? 161 ARG A NH1   1 
ATOM   224  N  NH2   . ARG A 1 25 ? -52.513 3.794  7.241   1.00 22.88 ? 161 ARG A NH2   1 
ATOM   225  N  N     . TYR A 1 26 ? -46.866 1.072  3.066   1.00 14.17 ? 162 TYR A N     1 
ATOM   226  C  CA    . TYR A 1 26 ? -45.633 1.840  2.944   1.00 14.69 ? 162 TYR A CA    1 
ATOM   227  C  C     . TYR A 1 26 ? -44.704 1.151  1.954   1.00 16.72 ? 162 TYR A C     1 
ATOM   228  O  O     . TYR A 1 26 ? -44.711 -0.078 1.842   1.00 15.70 ? 162 TYR A O     1 
ATOM   229  C  CB    . TYR A 1 26 ? -44.904 1.931  4.285   1.00 14.08 ? 162 TYR A CB    1 
ATOM   230  C  CG    . TYR A 1 26 ? -45.699 2.538  5.418   1.00 12.41 ? 162 TYR A CG    1 
ATOM   231  C  CD1   . TYR A 1 26 ? -46.687 1.810  6.075   1.00 13.02 ? 162 TYR A CD1   1 
ATOM   232  C  CD2   . TYR A 1 26 ? -45.451 3.842  5.841   1.00 13.27 ? 162 TYR A CD2   1 
ATOM   233  C  CE1   . TYR A 1 26 ? -47.408 2.369  7.123   1.00 13.33 ? 162 TYR A CE1   1 
ATOM   234  C  CE2   . TYR A 1 26 ? -46.164 4.407  6.883   1.00 11.82 ? 162 TYR A CE2   1 
ATOM   235  C  CZ    . TYR A 1 26 ? -47.139 3.668  7.517   1.00 11.71 ? 162 TYR A CZ    1 
ATOM   236  O  OH    . TYR A 1 26 ? -47.852 4.237  8.538   1.00 17.23 ? 162 TYR A OH    1 
ATOM   237  N  N     . LEU A 1 27 ? -43.898 1.950  1.256   1.00 16.73 ? 163 LEU A N     1 
ATOM   238  C  CA    . LEU A 1 27 ? -42.944 1.444  0.271   1.00 16.59 ? 163 LEU A CA    1 
ATOM   239  C  C     . LEU A 1 27 ? -41.542 1.960  0.582   1.00 17.13 ? 163 LEU A C     1 
ATOM   240  O  O     . LEU A 1 27 ? -41.379 3.008  1.200   1.00 18.02 ? 163 LEU A O     1 
ATOM   241  C  CB    . LEU A 1 27 ? -43.311 1.914  -1.146  1.00 15.67 ? 163 LEU A CB    1 
ATOM   242  C  CG    . LEU A 1 27 ? -44.640 1.566  -1.824  1.00 16.28 ? 163 LEU A CG    1 
ATOM   243  C  CD1   . LEU A 1 27 ? -44.575 2.075  -3.266  1.00 16.02 ? 163 LEU A CD1   1 
ATOM   244  C  CD2   . LEU A 1 27 ? -44.902 0.055  -1.803  1.00 12.06 ? 163 LEU A CD2   1 
ATOM   245  N  N     . SER A 1 28 ? -40.531 1.215  0.149   1.00 18.28 ? 164 SER A N     1 
ATOM   246  C  CA    . SER A 1 28 ? -39.149 1.631  0.334   1.00 19.28 ? 164 SER A CA    1 
ATOM   247  C  C     . SER A 1 28 ? -38.816 2.476  -0.895  1.00 19.53 ? 164 SER A C     1 
ATOM   248  O  O     . SER A 1 28 ? -39.612 2.538  -1.831  1.00 19.70 ? 164 SER A O     1 
ATOM   249  C  CB    . SER A 1 28 ? -38.227 0.421  0.376   1.00 17.98 ? 164 SER A CB    1 
ATOM   250  O  OG    . SER A 1 28 ? -38.188 -0.197 -0.892  1.00 17.32 ? 164 SER A OG    1 
ATOM   251  N  N     . ALA A 1 29 ? -37.653 3.124  -0.894  1.00 19.98 ? 165 ALA A N     1 
ATOM   252  C  CA    . ALA A 1 29 ? -37.244 3.962  -2.024  1.00 19.42 ? 165 ALA A CA    1 
ATOM   253  C  C     . ALA A 1 29 ? -37.178 3.161  -3.329  1.00 19.05 ? 165 ALA A C     1 
ATOM   254  O  O     . ALA A 1 29 ? -37.613 3.636  -4.373  1.00 18.38 ? 165 ALA A O     1 
ATOM   255  C  CB    . ALA A 1 29 ? -35.887 4.617  -1.735  1.00 20.01 ? 165 ALA A CB    1 
ATOM   256  N  N     . PRO A 1 30 ? -36.622 1.938  -3.288  1.00 18.70 ? 166 PRO A N     1 
ATOM   257  C  CA    . PRO A 1 30 ? -36.540 1.137  -4.509  1.00 18.65 ? 166 PRO A CA    1 
ATOM   258  C  C     . PRO A 1 30 ? -37.929 0.772  -5.023  1.00 18.67 ? 166 PRO A C     1 
ATOM   259  O  O     . PRO A 1 30 ? -38.160 0.734  -6.230  1.00 19.74 ? 166 PRO A O     1 
ATOM   260  C  CB    . PRO A 1 30 ? -35.753 -0.092 -4.056  1.00 17.88 ? 166 PRO A CB    1 
ATOM   261  C  CG    . PRO A 1 30 ? -34.903 0.436  -2.972  1.00 18.11 ? 166 PRO A CG    1 
ATOM   262  C  CD    . PRO A 1 30 ? -35.867 1.289  -2.204  1.00 18.56 ? 166 PRO A CD    1 
ATOM   263  N  N     . GLU A 1 31 ? -38.845 0.499  -4.094  1.00 18.95 ? 167 GLU A N     1 
ATOM   264  C  CA    . GLU A 1 31 ? -40.219 0.136  -4.433  1.00 18.76 ? 167 GLU A CA    1 
ATOM   265  C  C     . GLU A 1 31 ? -40.970 1.351  -4.985  1.00 18.40 ? 167 GLU A C     1 
ATOM   266  O  O     . GLU A 1 31 ? -41.782 1.222  -5.909  1.00 18.03 ? 167 GLU A O     1 
ATOM   267  C  CB    . GLU A 1 31 ? -40.943 -0.402 -3.194  1.00 18.10 ? 167 GLU A CB    1 
ATOM   268  C  CG    . GLU A 1 31 ? -40.250 -1.591 -2.532  1.00 20.68 ? 167 GLU A CG    1 
ATOM   269  C  CD    . GLU A 1 31 ? -40.939 -2.059 -1.257  1.00 18.82 ? 167 GLU A CD    1 
ATOM   270  O  OE1   . GLU A 1 31 ? -41.303 -1.214 -0.417  1.00 20.52 ? 167 GLU A OE1   1 
ATOM   271  O  OE2   . GLU A 1 31 ? -41.104 -3.280 -1.083  1.00 21.09 ? 167 GLU A OE2   1 
ATOM   272  N  N     . ARG A 1 32 ? -40.694 2.522  -4.416  1.00 17.49 ? 168 ARG A N     1 
ATOM   273  C  CA    . ARG A 1 32 ? -41.332 3.765  -4.852  1.00 19.50 ? 168 ARG A CA    1 
ATOM   274  C  C     . ARG A 1 32 ? -40.849 4.229  -6.228  1.00 19.23 ? 168 ARG A C     1 
ATOM   275  O  O     . ARG A 1 32 ? -41.616 4.799  -7.007  1.00 17.28 ? 168 ARG A O     1 
ATOM   276  C  CB    . ARG A 1 32 ? -41.083 4.885  -3.835  1.00 19.38 ? 168 ARG A CB    1 
ATOM   277  C  CG    . ARG A 1 32 ? -41.838 4.724  -2.526  1.00 22.78 ? 168 ARG A CG    1 
ATOM   278  C  CD    . ARG A 1 32 ? -42.030 6.068  -1.823  1.00 24.36 ? 168 ARG A CD    1 
ATOM   279  N  NE    . ARG A 1 32 ? -40.765 6.653  -1.385  1.00 26.07 ? 168 ARG A NE    1 
ATOM   280  C  CZ    . ARG A 1 32 ? -40.112 6.296  -0.282  1.00 24.21 ? 168 ARG A CZ    1 
ATOM   281  N  NH1   . ARG A 1 32 ? -40.604 5.359  0.512   1.00 22.74 ? 168 ARG A NH1   1 
ATOM   282  N  NH2   . ARG A 1 32 ? -38.955 6.865  0.013   1.00 22.44 ? 168 ARG A NH2   1 
ATOM   283  N  N     . ASP A 1 33 ? -39.573 3.991  -6.517  1.00 20.59 ? 169 ASP A N     1 
ATOM   284  C  CA    . ASP A 1 33 ? -38.999 4.387  -7.796  1.00 21.72 ? 169 ASP A CA    1 
ATOM   285  C  C     . ASP A 1 33 ? -39.436 3.447  -8.901  1.00 21.70 ? 169 ASP A C     1 
ATOM   286  O  O     . ASP A 1 33 ? -39.662 3.879  -10.029 1.00 23.61 ? 169 ASP A O     1 
ATOM   287  C  CB    . ASP A 1 33 ? -37.471 4.402  -7.735  1.00 23.99 ? 169 ASP A CB    1 
ATOM   288  C  CG    . ASP A 1 33 ? -36.938 5.381  -6.716  1.00 26.93 ? 169 ASP A CG    1 
ATOM   289  O  OD1   . ASP A 1 33 ? -37.529 6.473  -6.573  1.00 29.26 ? 169 ASP A OD1   1 
ATOM   290  O  OD2   . ASP A 1 33 ? -35.918 5.065  -6.066  1.00 28.95 ? 169 ASP A OD2   1 
ATOM   291  N  N     . GLN A 1 34 ? -39.553 2.161  -8.587  1.00 20.34 ? 170 GLN A N     1 
ATOM   292  C  CA    . GLN A 1 34 ? -39.964 1.199  -9.591  1.00 19.92 ? 170 GLN A CA    1 
ATOM   293  C  C     . GLN A 1 34 ? -41.422 1.415  -9.974  1.00 19.45 ? 170 GLN A C     1 
ATOM   294  O  O     . GLN A 1 34 ? -41.802 1.223  -11.131 1.00 20.18 ? 170 GLN A O     1 
ATOM   295  C  CB    . GLN A 1 34 ? -39.742 -0.231 -9.090  1.00 22.32 ? 170 GLN A CB    1 
ATOM   296  C  CG    . GLN A 1 34 ? -40.322 -1.295 -10.011 1.00 27.47 ? 170 GLN A CG    1 
ATOM   297  C  CD    . GLN A 1 34 ? -39.528 -2.592 -10.012 1.00 32.57 ? 170 GLN A CD    1 
ATOM   298  O  OE1   . GLN A 1 34 ? -38.501 -2.707 -10.691 1.00 35.12 ? 170 GLN A OE1   1 
ATOM   299  N  NE2   . GLN A 1 34 ? -39.997 -3.576 -9.249  1.00 33.43 ? 170 GLN A NE2   1 
ATOM   300  N  N     . LEU A 1 35 ? -42.237 1.823  -9.007  1.00 18.57 ? 171 LEU A N     1 
ATOM   301  C  CA    . LEU A 1 35 ? -43.656 2.077  -9.266  1.00 17.55 ? 171 LEU A CA    1 
ATOM   302  C  C     . LEU A 1 35 ? -43.814 3.383  -10.044 1.00 17.62 ? 171 LEU A C     1 
ATOM   303  O  O     . LEU A 1 35 ? -44.639 3.482  -10.948 1.00 16.53 ? 171 LEU A O     1 
ATOM   304  C  CB    . LEU A 1 35 ? -44.435 2.156  -7.949  1.00 16.16 ? 171 LEU A CB    1 
ATOM   305  C  CG    . LEU A 1 35 ? -45.937 2.457  -7.992  1.00 13.51 ? 171 LEU A CG    1 
ATOM   306  C  CD1   . LEU A 1 35 ? -46.643 1.555  -8.989  1.00 14.61 ? 171 LEU A CD1   1 
ATOM   307  C  CD2   . LEU A 1 35 ? -46.506 2.269  -6.606  1.00 13.05 ? 171 LEU A CD2   1 
ATOM   308  N  N     . ALA A 1 36 ? -43.010 4.380  -9.691  1.00 18.62 ? 172 ALA A N     1 
ATOM   309  C  CA    . ALA A 1 36 ? -43.053 5.670  -10.363 1.00 19.01 ? 172 ALA A CA    1 
ATOM   310  C  C     . ALA A 1 36 ? -42.710 5.474  -11.833 1.00 20.54 ? 172 ALA A C     1 
ATOM   311  O  O     . ALA A 1 36 ? -43.408 5.976  -12.718 1.00 21.16 ? 172 ALA A O     1 
ATOM   312  C  CB    . ALA A 1 36 ? -42.062 6.633  -9.714  1.00 17.45 ? 172 ALA A CB    1 
ATOM   313  N  N     . SER A 1 37 ? -41.632 4.743  -12.094 1.00 21.13 ? 173 SER A N     1 
ATOM   314  C  CA    . SER A 1 37 ? -41.214 4.493  -13.470 1.00 23.37 ? 173 SER A CA    1 
ATOM   315  C  C     . SER A 1 37 ? -42.373 3.887  -14.255 1.00 23.74 ? 173 SER A C     1 
ATOM   316  O  O     . SER A 1 37 ? -42.723 4.371  -15.329 1.00 25.95 ? 173 SER A O     1 
ATOM   317  C  CB    . SER A 1 37 ? -40.021 3.535  -13.505 1.00 23.91 ? 173 SER A CB    1 
ATOM   318  O  OG    . SER A 1 37 ? -40.440 2.200  -13.264 1.00 28.34 ? 173 SER A OG    1 
ATOM   319  N  N     . VAL A 1 38 ? -42.959 2.829  -13.700 1.00 22.29 ? 174 VAL A N     1 
ATOM   320  C  CA    . VAL A 1 38 ? -44.085 2.120  -14.300 1.00 21.49 ? 174 VAL A CA    1 
ATOM   321  C  C     . VAL A 1 38 ? -45.287 3.000  -14.643 1.00 21.52 ? 174 VAL A C     1 
ATOM   322  O  O     . VAL A 1 38 ? -45.881 2.851  -15.708 1.00 21.10 ? 174 VAL A O     1 
ATOM   323  C  CB    . VAL A 1 38 ? -44.582 0.999  -13.355 1.00 22.07 ? 174 VAL A CB    1 
ATOM   324  C  CG1   . VAL A 1 38 ? -45.922 0.445  -13.838 1.00 22.72 ? 174 VAL A CG1   1 
ATOM   325  C  CG2   . VAL A 1 38 ? -43.540 -0.109 -13.273 1.00 22.60 ? 174 VAL A CG2   1 
ATOM   326  N  N     . LEU A 1 39 ? -45.645 3.905  -13.734 1.00 21.98 ? 175 LEU A N     1 
ATOM   327  C  CA    . LEU A 1 39 ? -46.808 4.784  -13.913 1.00 21.33 ? 175 LEU A CA    1 
ATOM   328  C  C     . LEU A 1 39 ? -46.575 6.118  -14.614 1.00 21.16 ? 175 LEU A C     1 
ATOM   329  O  O     . LEU A 1 39 ? -47.524 6.861  -14.840 1.00 21.08 ? 175 LEU A O     1 
ATOM   330  C  CB    . LEU A 1 39 ? -47.454 5.080  -12.556 1.00 19.22 ? 175 LEU A CB    1 
ATOM   331  C  CG    . LEU A 1 39 ? -47.870 3.894  -11.692 1.00 19.29 ? 175 LEU A CG    1 
ATOM   332  C  CD1   . LEU A 1 39 ? -48.466 4.422  -10.400 1.00 18.06 ? 175 LEU A CD1   1 
ATOM   333  C  CD2   . LEU A 1 39 ? -48.866 3.015  -12.441 1.00 19.12 ? 175 LEU A CD2   1 
ATOM   334  N  N     . LYS A 1 40 ? -45.326 6.425  -14.944 1.00 21.57 ? 176 LYS A N     1 
ATOM   335  C  CA    . LYS A 1 40 ? -44.988 7.690  -15.595 1.00 21.99 ? 176 LYS A CA    1 
ATOM   336  C  C     . LYS A 1 40 ? -45.181 8.888  -14.658 1.00 21.07 ? 176 LYS A C     1 
ATOM   337  O  O     . LYS A 1 40 ? -45.605 9.961  -15.088 1.00 21.60 ? 176 LYS A O     1 
ATOM   338  C  CB    . LYS A 1 40 ? -45.822 7.887  -16.865 1.00 23.10 ? 176 LYS A CB    1 
ATOM   339  C  CG    . LYS A 1 40 ? -45.553 6.876  -17.970 1.00 26.98 ? 176 LYS A CG    1 
ATOM   340  C  CD    . LYS A 1 40 ? -44.108 6.927  -18.468 1.00 31.26 ? 176 LYS A CD    1 
ATOM   341  C  CE    . LYS A 1 40 ? -43.220 5.859  -17.820 1.00 32.34 ? 176 LYS A CE    1 
ATOM   342  N  NZ    . LYS A 1 40 ? -43.569 4.460  -18.245 1.00 32.54 ? 176 LYS A NZ    1 
ATOM   343  N  N     . LEU A 1 41 ? -44.889 8.688  -13.374 1.00 19.63 ? 177 LEU A N     1 
ATOM   344  C  CA    . LEU A 1 41 ? -44.985 9.750  -12.364 1.00 19.37 ? 177 LEU A CA    1 
ATOM   345  C  C     . LEU A 1 41 ? -43.620 9.801  -11.682 1.00 19.22 ? 177 LEU A C     1 
ATOM   346  O  O     . LEU A 1 41 ? -42.850 8.842  -11.785 1.00 21.12 ? 177 LEU A O     1 
ATOM   347  C  CB    . LEU A 1 41 ? -46.070 9.430  -11.327 1.00 19.00 ? 177 LEU A CB    1 
ATOM   348  C  CG    . LEU A 1 41 ? -47.531 9.458  -11.784 1.00 18.47 ? 177 LEU A CG    1 
ATOM   349  C  CD1   . LEU A 1 41 ? -48.426 8.982  -10.648 1.00 18.59 ? 177 LEU A CD1   1 
ATOM   350  C  CD2   . LEU A 1 41 ? -47.916 10.865 -12.216 1.00 17.14 ? 177 LEU A CD2   1 
ATOM   351  N  N     . THR A 1 42 ? -43.296 10.904 -11.016 1.00 18.68 ? 178 THR A N     1 
ATOM   352  C  CA    . THR A 1 42 ? -42.003 10.988 -10.345 1.00 18.76 ? 178 THR A CA    1 
ATOM   353  C  C     . THR A 1 42 ? -42.105 10.219 -9.044  1.00 19.88 ? 178 THR A C     1 
ATOM   354  O  O     . THR A 1 42 ? -43.204 9.890  -8.597  1.00 19.86 ? 178 THR A O     1 
ATOM   355  C  CB    . THR A 1 42 ? -41.582 12.435 -10.010 1.00 18.91 ? 178 THR A CB    1 
ATOM   356  O  OG1   . THR A 1 42 ? -42.407 12.946 -8.960  1.00 19.84 ? 178 THR A OG1   1 
ATOM   357  C  CG2   . THR A 1 42 ? -41.708 13.328 -11.235 1.00 20.58 ? 178 THR A CG2   1 
ATOM   358  N  N     . SER A 1 43 ? -40.962 9.941  -8.429  1.00 20.74 ? 179 SER A N     1 
ATOM   359  C  CA    . SER A 1 43 ? -40.953 9.199  -7.179  1.00 21.50 ? 179 SER A CA    1 
ATOM   360  C  C     . SER A 1 43 ? -41.578 10.012 -6.051  1.00 20.10 ? 179 SER A C     1 
ATOM   361  O  O     . SER A 1 43 ? -42.114 9.450  -5.102  1.00 21.14 ? 179 SER A O     1 
ATOM   362  C  CB    . SER A 1 43 ? -39.527 8.799  -6.809  1.00 21.87 ? 179 SER A CB    1 
ATOM   363  O  OG    . SER A 1 43 ? -39.546 7.815  -5.791  1.00 26.82 ? 179 SER A OG    1 
ATOM   364  N  N     . THR A 1 44 ? -41.510 11.334 -6.156  1.00 20.89 ? 180 THR A N     1 
ATOM   365  C  CA    . THR A 1 44 ? -42.092 12.195 -5.135  1.00 20.88 ? 180 THR A CA    1 
ATOM   366  C  C     . THR A 1 44 ? -43.609 12.117 -5.193  1.00 19.86 ? 180 THR A C     1 
ATOM   367  O  O     . THR A 1 44 ? -44.273 12.036 -4.164  1.00 20.39 ? 180 THR A O     1 
ATOM   368  C  CB    . THR A 1 44 ? -41.666 13.664 -5.314  1.00 21.25 ? 180 THR A CB    1 
ATOM   369  O  OG1   . THR A 1 44 ? -40.272 13.793 -5.012  1.00 23.61 ? 180 THR A OG1   1 
ATOM   370  C  CG2   . THR A 1 44 ? -42.460 14.561 -4.387  1.00 21.56 ? 180 THR A CG2   1 
ATOM   371  N  N     . GLN A 1 45 ? -44.161 12.140 -6.400  1.00 19.37 ? 181 GLN A N     1 
ATOM   372  C  CA    . GLN A 1 45 ? -45.607 12.067 -6.544  1.00 16.33 ? 181 GLN A CA    1 
ATOM   373  C  C     . GLN A 1 45 ? -46.124 10.762 -5.971  1.00 15.74 ? 181 GLN A C     1 
ATOM   374  O  O     . GLN A 1 45 ? -47.185 10.731 -5.351  1.00 15.95 ? 181 GLN A O     1 
ATOM   375  C  CB    . GLN A 1 45 ? -45.999 12.200 -8.009  1.00 15.89 ? 181 GLN A CB    1 
ATOM   376  C  CG    . GLN A 1 45 ? -45.667 13.563 -8.588  1.00 14.37 ? 181 GLN A CG    1 
ATOM   377  C  CD    . GLN A 1 45 ? -46.018 13.657 -10.051 1.00 14.20 ? 181 GLN A CD    1 
ATOM   378  O  OE1   . GLN A 1 45 ? -45.582 12.838 -10.852 1.00 14.62 ? 181 GLN A OE1   1 
ATOM   379  N  NE2   . GLN A 1 45 ? -46.812 14.655 -10.408 1.00 14.20 ? 181 GLN A NE2   1 
ATOM   380  N  N     . VAL A 1 46 ? -45.371 9.687  -6.173  1.00 14.96 ? 182 VAL A N     1 
ATOM   381  C  CA    . VAL A 1 46 ? -45.767 8.384  -5.642  1.00 16.10 ? 182 VAL A CA    1 
ATOM   382  C  C     . VAL A 1 46 ? -45.677 8.433  -4.120  1.00 16.17 ? 182 VAL A C     1 
ATOM   383  O  O     . VAL A 1 46 ? -46.609 8.038  -3.418  1.00 14.23 ? 182 VAL A O     1 
ATOM   384  C  CB    . VAL A 1 46 ? -44.863 7.261  -6.186  1.00 15.95 ? 182 VAL A CB    1 
ATOM   385  C  CG1   . VAL A 1 46 ? -45.055 5.987  -5.370  1.00 17.28 ? 182 VAL A CG1   1 
ATOM   386  C  CG2   . VAL A 1 46 ? -45.198 7.001  -7.654  1.00 15.35 ? 182 VAL A CG2   1 
ATOM   387  N  N     . LYS A 1 47 ? -44.554 8.942  -3.622  1.00 16.45 ? 183 LYS A N     1 
ATOM   388  C  CA    . LYS A 1 47 ? -44.323 9.076  -2.191  1.00 16.47 ? 183 LYS A CA    1 
ATOM   389  C  C     . LYS A 1 47 ? -45.455 9.882  -1.564  1.00 15.90 ? 183 LYS A C     1 
ATOM   390  O  O     . LYS A 1 47 ? -46.003 9.501  -0.528  1.00 15.98 ? 183 LYS A O     1 
ATOM   391  C  CB    . LYS A 1 47 ? -42.993 9.794  -1.943  1.00 19.10 ? 183 LYS A CB    1 
ATOM   392  C  CG    . LYS A 1 47 ? -42.632 9.949  -0.477  1.00 21.54 ? 183 LYS A CG    1 
ATOM   393  C  CD    . LYS A 1 47 ? -42.040 11.311 -0.198  1.00 24.37 ? 183 LYS A CD    1 
ATOM   394  C  CE    . LYS A 1 47 ? -40.820 11.566 -1.050  1.00 26.31 ? 183 LYS A CE    1 
ATOM   395  N  NZ    . LYS A 1 47 ? -40.288 12.940 -0.830  1.00 29.41 ? 183 LYS A NZ    1 
ATOM   396  N  N     . ILE A 1 48 ? -45.801 10.997 -2.203  1.00 15.73 ? 184 ILE A N     1 
ATOM   397  C  CA    . ILE A 1 48 ? -46.864 11.871 -1.717  1.00 14.67 ? 184 ILE A CA    1 
ATOM   398  C  C     . ILE A 1 48 ? -48.248 11.221 -1.825  1.00 13.83 ? 184 ILE A C     1 
ATOM   399  O  O     . ILE A 1 48 ? -49.129 11.504 -1.011  1.00 15.08 ? 184 ILE A O     1 
ATOM   400  C  CB    . ILE A 1 48 ? -46.857 13.227 -2.478  1.00 13.90 ? 184 ILE A CB    1 
ATOM   401  C  CG1   . ILE A 1 48 ? -45.523 13.944 -2.248  1.00 17.59 ? 184 ILE A CG1   1 
ATOM   402  C  CG2   . ILE A 1 48 ? -48.001 14.111 -2.017  1.00 14.79 ? 184 ILE A CG2   1 
ATOM   403  C  CD1   . ILE A 1 48 ? -45.190 14.200 -0.789  1.00 20.01 ? 184 ILE A CD1   1 
ATOM   404  N  N     . TRP A 1 49 ? -48.446 10.354 -2.815  1.00 12.63 ? 185 TRP A N     1 
ATOM   405  C  CA    . TRP A 1 49 ? -49.737 9.694  -2.966  1.00 12.66 ? 185 TRP A CA    1 
ATOM   406  C  C     . TRP A 1 49 ? -49.960 8.680  -1.837  1.00 14.01 ? 185 TRP A C     1 
ATOM   407  O  O     . TRP A 1 49 ? -51.059 8.588  -1.279  1.00 15.41 ? 185 TRP A O     1 
ATOM   408  C  CB    . TRP A 1 49 ? -49.850 8.988  -4.314  1.00 12.65 ? 185 TRP A CB    1 
ATOM   409  C  CG    . TRP A 1 49 ? -51.237 8.440  -4.556  1.00 12.49 ? 185 TRP A CG    1 
ATOM   410  C  CD1   . TRP A 1 49 ? -52.273 9.074  -5.185  1.00 12.04 ? 185 TRP A CD1   1 
ATOM   411  C  CD2   . TRP A 1 49 ? -51.745 7.161  -4.140  1.00 13.17 ? 185 TRP A CD2   1 
ATOM   412  N  NE1   . TRP A 1 49 ? -53.392 8.272  -5.188  1.00 13.38 ? 185 TRP A NE1   1 
ATOM   413  C  CE2   . TRP A 1 49 ? -53.098 7.092  -4.556  1.00 13.83 ? 185 TRP A CE2   1 
ATOM   414  C  CE3   . TRP A 1 49 ? -51.190 6.066  -3.457  1.00 11.63 ? 185 TRP A CE3   1 
ATOM   415  C  CZ2   . TRP A 1 49 ? -53.901 5.970  -4.314  1.00 12.45 ? 185 TRP A CZ2   1 
ATOM   416  C  CZ3   . TRP A 1 49 ? -51.990 4.950  -3.216  1.00 11.09 ? 185 TRP A CZ3   1 
ATOM   417  C  CH2   . TRP A 1 49 ? -53.328 4.911  -3.644  1.00 13.38 ? 185 TRP A CH2   1 
ATOM   418  N  N     . PHE A 1 50 ? -48.920 7.924  -1.497  1.00 14.27 ? 186 PHE A N     1 
ATOM   419  C  CA    . PHE A 1 50 ? -49.020 6.940  -0.415  1.00 13.54 ? 186 PHE A CA    1 
ATOM   420  C  C     . PHE A 1 50 ? -49.217 7.647  0.919   1.00 13.53 ? 186 PHE A C     1 
ATOM   421  O  O     . PHE A 1 50 ? -49.934 7.155  1.786   1.00 13.53 ? 186 PHE A O     1 
ATOM   422  C  CB    . PHE A 1 50 ? -47.764 6.061  -0.378  1.00 13.71 ? 186 PHE A CB    1 
ATOM   423  C  CG    . PHE A 1 50 ? -47.879 4.813  -1.213  1.00 14.31 ? 186 PHE A CG    1 
ATOM   424  C  CD1   . PHE A 1 50 ? -48.097 3.576  -0.608  1.00 13.03 ? 186 PHE A CD1   1 
ATOM   425  C  CD2   . PHE A 1 50 ? -47.864 4.884  -2.607  1.00 13.69 ? 186 PHE A CD2   1 
ATOM   426  C  CE1   . PHE A 1 50 ? -48.309 2.433  -1.379  1.00 14.34 ? 186 PHE A CE1   1 
ATOM   427  C  CE2   . PHE A 1 50 ? -48.076 3.741  -3.389  1.00 13.73 ? 186 PHE A CE2   1 
ATOM   428  C  CZ    . PHE A 1 50 ? -48.301 2.517  -2.771  1.00 14.20 ? 186 PHE A CZ    1 
ATOM   429  N  N     . GLN A 1 51 ? -48.575 8.805  1.070   1.00 14.53 ? 187 GLN A N     1 
ATOM   430  C  CA    . GLN A 1 51 ? -48.678 9.609  2.284   1.00 15.81 ? 187 GLN A CA    1 
ATOM   431  C  C     . GLN A 1 51 ? -50.132 10.040 2.439   1.00 15.31 ? 187 GLN A C     1 
ATOM   432  O  O     . GLN A 1 51 ? -50.753 9.819  3.481   1.00 15.02 ? 187 GLN A O     1 
ATOM   433  C  CB    . GLN A 1 51 ? -47.757 10.833 2.171   1.00 18.62 ? 187 GLN A CB    1 
ATOM   434  C  CG    . GLN A 1 51 ? -47.880 11.848 3.311   1.00 24.02 ? 187 GLN A CG    1 
ATOM   435  C  CD    . GLN A 1 51 ? -46.760 12.888 3.306   1.00 25.49 ? 187 GLN A CD    1 
ATOM   436  O  OE1   . GLN A 1 51 ? -45.595 12.554 3.520   1.00 28.17 ? 187 GLN A OE1   1 
ATOM   437  N  NE2   . GLN A 1 51 ? -47.113 14.149 3.068   1.00 25.08 ? 187 GLN A NE2   1 
ATOM   438  N  N     . ASN A 1 52 ? -50.675 10.640 1.380   1.00 14.47 ? 188 ASN A N     1 
ATOM   439  C  CA    . ASN A 1 52 ? -52.059 11.097 1.371   1.00 13.52 ? 188 ASN A CA    1 
ATOM   440  C  C     . ASN A 1 52 ? -53.047 9.955  1.533   1.00 13.25 ? 188 ASN A C     1 
ATOM   441  O  O     . ASN A 1 52 ? -54.027 10.083 2.262   1.00 14.31 ? 188 ASN A O     1 
ATOM   442  C  CB    . ASN A 1 52 ? -52.384 11.831 0.063   1.00 14.25 ? 188 ASN A CB    1 
ATOM   443  C  CG    . ASN A 1 52 ? -51.869 13.260 0.044   1.00 15.90 ? 188 ASN A CG    1 
ATOM   444  O  OD1   . ASN A 1 52 ? -51.845 13.941 1.071   1.00 17.60 ? 188 ASN A OD1   1 
ATOM   445  N  ND2   . ASN A 1 52 ? -51.480 13.731 -1.135  1.00 17.93 ? 188 ASN A ND2   1 
ATOM   446  N  N     . ARG A 1 53 ? -52.800 8.846  0.839   1.00 12.96 ? 189 ARG A N     1 
ATOM   447  C  CA    . ARG A 1 53 ? -53.701 7.703  0.907   1.00 14.96 ? 189 ARG A CA    1 
ATOM   448  C  C     . ARG A 1 53 ? -53.788 7.178  2.335   1.00 15.29 ? 189 ARG A C     1 
ATOM   449  O  O     . ARG A 1 53 ? -54.865 6.844  2.826   1.00 16.67 ? 189 ARG A O     1 
ATOM   450  C  CB    . ARG A 1 53 ? -53.233 6.599  -0.049  1.00 14.18 ? 189 ARG A CB    1 
ATOM   451  C  CG    . ARG A 1 53 ? -54.150 5.387  -0.090  1.00 15.24 ? 189 ARG A CG    1 
ATOM   452  C  CD    . ARG A 1 53 ? -55.511 5.713  -0.692  1.00 18.09 ? 189 ARG A CD    1 
ATOM   453  N  NE    . ARG A 1 53 ? -56.384 4.539  -0.672  1.00 19.02 ? 189 ARG A NE    1 
ATOM   454  C  CZ    . ARG A 1 53 ? -56.949 4.052  0.429   1.00 21.78 ? 189 ARG A CZ    1 
ATOM   455  N  NH1   . ARG A 1 53 ? -56.742 4.642  1.599   1.00 22.88 ? 189 ARG A NH1   1 
ATOM   456  N  NH2   . ARG A 1 53 ? -57.706 2.961  0.367   1.00 22.14 ? 189 ARG A NH2   1 
ATOM   457  N  N     . ARG A 1 54 ? -52.648 7.119  3.009   1.00 16.10 ? 190 ARG A N     1 
ATOM   458  C  CA    . ARG A 1 54 ? -52.618 6.658  4.387   1.00 15.36 ? 190 ARG A CA    1 
ATOM   459  C  C     . ARG A 1 54 ? -53.418 7.590  5.306   1.00 16.26 ? 190 ARG A C     1 
ATOM   460  O  O     . ARG A 1 54 ? -54.214 7.132  6.124   1.00 16.00 ? 190 ARG A O     1 
ATOM   461  C  CB    . ARG A 1 54 ? -51.175 6.559  4.870   1.00 14.67 ? 190 ARG A CB    1 
ATOM   462  C  CG    . ARG A 1 54 ? -50.802 5.164  5.230   1.00 15.88 ? 190 ARG A CG    1 
ATOM   463  C  CD    . ARG A 1 54 ? -49.379 5.085  5.650   1.00 13.93 ? 190 ARG A CD    1 
ATOM   464  N  NE    . ARG A 1 54 ? -48.550 4.879  4.484   1.00 18.54 ? 190 ARG A NE    1 
ATOM   465  C  CZ    . ARG A 1 54 ? -47.655 5.751  4.041   1.00 15.50 ? 190 ARG A CZ    1 
ATOM   466  N  NH1   . ARG A 1 54 ? -47.471 6.894  4.678   1.00 15.34 ? 190 ARG A NH1   1 
ATOM   467  N  NH2   . ARG A 1 54 ? -46.967 5.476  2.950   1.00 8.88  ? 190 ARG A NH2   1 
ATOM   468  N  N     . TYR A 1 55 ? -53.209 8.895  5.176   1.00 16.51 ? 191 TYR A N     1 
ATOM   469  C  CA    . TYR A 1 55 ? -53.935 9.858  5.998   1.00 18.13 ? 191 TYR A CA    1 
ATOM   470  C  C     . TYR A 1 55 ? -55.447 9.686  5.824   1.00 20.53 ? 191 TYR A C     1 
ATOM   471  O  O     . TYR A 1 55 ? -56.200 9.739  6.807   1.00 21.06 ? 191 TYR A O     1 
ATOM   472  C  CB    . TYR A 1 55 ? -53.552 11.287 5.617   1.00 17.46 ? 191 TYR A CB    1 
ATOM   473  C  CG    . TYR A 1 55 ? -54.228 12.343 6.472   1.00 18.94 ? 191 TYR A CG    1 
ATOM   474  C  CD1   . TYR A 1 55 ? -53.795 12.600 7.778   1.00 20.30 ? 191 TYR A CD1   1 
ATOM   475  C  CD2   . TYR A 1 55 ? -55.304 13.085 5.978   1.00 19.52 ? 191 TYR A CD2   1 
ATOM   476  C  CE1   . TYR A 1 55 ? -54.422 13.576 8.569   1.00 20.97 ? 191 TYR A CE1   1 
ATOM   477  C  CE2   . TYR A 1 55 ? -55.933 14.059 6.760   1.00 19.97 ? 191 TYR A CE2   1 
ATOM   478  C  CZ    . TYR A 1 55 ? -55.487 14.297 8.050   1.00 20.57 ? 191 TYR A CZ    1 
ATOM   479  O  OH    . TYR A 1 55 ? -56.108 15.252 8.822   1.00 23.43 ? 191 TYR A OH    1 
ATOM   480  N  N     . LYS A 1 56 ? -55.880 9.485  4.576   1.00 21.88 ? 192 LYS A N     1 
ATOM   481  C  CA    . LYS A 1 56 ? -57.295 9.310  4.247   1.00 24.89 ? 192 LYS A CA    1 
ATOM   482  C  C     . LYS A 1 56 ? -57.828 7.958  4.706   1.00 27.30 ? 192 LYS A C     1 
ATOM   483  O  O     . LYS A 1 56 ? -59.030 7.788  4.901   1.00 27.65 ? 192 LYS A O     1 
ATOM   484  C  CB    . LYS A 1 56 ? -57.516 9.481  2.736   1.00 25.70 ? 192 LYS A CB    1 
ATOM   485  C  CG    . LYS A 1 56 ? -57.293 10.921 2.251   1.00 26.90 ? 192 LYS A CG    1 
ATOM   486  C  CD    . LYS A 1 56 ? -57.770 11.166 0.814   1.00 27.13 ? 192 LYS A CD    1 
ATOM   487  C  CE    . LYS A 1 56 ? -56.834 10.550 -0.226  1.00 30.85 ? 192 LYS A CE    1 
ATOM   488  N  NZ    . LYS A 1 56 ? -57.196 10.904 -1.647  1.00 32.08 ? 192 LYS A NZ    1 
ATOM   489  N  N     . SER A 1 57 ? -56.928 6.996  4.879   1.00 29.74 ? 193 SER A N     1 
ATOM   490  C  CA    . SER A 1 57 ? -57.307 5.664  5.336   1.00 30.97 ? 193 SER A CA    1 
ATOM   491  C  C     . SER A 1 57 ? -57.739 5.756  6.798   1.00 33.24 ? 193 SER A C     1 
ATOM   492  O  O     . SER A 1 57 ? -58.447 4.887  7.308   1.00 33.77 ? 193 SER A O     1 
ATOM   493  C  CB    . SER A 1 57 ? -56.121 4.710  5.197   1.00 29.45 ? 193 SER A CB    1 
ATOM   494  O  OG    . SER A 1 57 ? -56.412 3.442  5.749   1.00 31.58 ? 193 SER A OG    1 
ATOM   495  N  N     . LYS A 1 58 ? -57.309 6.828  7.459   1.00 35.64 ? 194 LYS A N     1 
ATOM   496  C  CA    . LYS A 1 58 ? -57.626 7.069  8.865   1.00 37.91 ? 194 LYS A CA    1 
ATOM   497  C  C     . LYS A 1 58 ? -59.011 7.694  9.015   1.00 38.80 ? 194 LYS A C     1 
ATOM   498  O  O     . LYS A 1 58 ? -59.915 6.991  9.511   1.00 40.45 ? 194 LYS A O     1 
ATOM   499  C  CB    . LYS A 1 58 ? -56.583 8.007  9.475   1.00 38.66 ? 194 LYS A CB    1 
ATOM   500  C  CG    . LYS A 1 58 ? -55.151 7.576  9.238   1.00 38.67 ? 194 LYS A CG    1 
ATOM   501  C  CD    . LYS A 1 58 ? -54.845 6.290  9.963   1.00 40.88 ? 194 LYS A CD    1 
ATOM   502  C  CE    . LYS A 1 58 ? -55.036 6.482  11.450  1.00 42.80 ? 194 LYS A CE    1 
ATOM   503  N  NZ    . LYS A 1 58 ? -54.324 7.711  11.904  1.00 44.54 ? 194 LYS A NZ    1 
ATOM   504  O  OXT   . LYS A 1 58 ? -59.178 8.875  8.633   1.00 38.41 ? 194 LYS A OXT   1 
ATOM   505  N  N     . GLY B 1 1  ? -23.204 35.307 25.640  1.00 21.11 ? 137 GLY B N     1 
ATOM   506  C  CA    . GLY B 1 1  ? -23.596 35.059 27.053  1.00 22.14 ? 137 GLY B CA    1 
ATOM   507  C  C     . GLY B 1 1  ? -23.081 33.717 27.526  1.00 23.01 ? 137 GLY B C     1 
ATOM   508  O  O     . GLY B 1 1  ? -22.278 33.089 26.837  1.00 22.74 ? 137 GLY B O     1 
ATOM   509  N  N     . ARG B 1 2  ? -23.526 33.282 28.702  1.00 24.52 ? 138 ARG B N     1 
ATOM   510  C  CA    . ARG B 1 2  ? -23.119 31.985 29.244  1.00 26.24 ? 138 ARG B CA    1 
ATOM   511  C  C     . ARG B 1 2  ? -23.787 30.878 28.438  1.00 26.71 ? 138 ARG B C     1 
ATOM   512  O  O     . ARG B 1 2  ? -24.950 30.996 28.055  1.00 28.05 ? 138 ARG B O     1 
ATOM   513  C  CB    . ARG B 1 2  ? -23.538 31.863 30.709  1.00 27.67 ? 138 ARG B CB    1 
ATOM   514  C  CG    . ARG B 1 2  ? -23.654 30.432 31.208  1.00 30.21 ? 138 ARG B CG    1 
ATOM   515  C  CD    . ARG B 1 2  ? -22.755 30.190 32.397  1.00 33.40 ? 138 ARG B CD    1 
ATOM   516  N  NE    . ARG B 1 2  ? -23.013 31.146 33.466  1.00 36.91 ? 138 ARG B NE    1 
ATOM   517  C  CZ    . ARG B 1 2  ? -22.357 31.161 34.622  1.00 39.46 ? 138 ARG B CZ    1 
ATOM   518  N  NH1   . ARG B 1 2  ? -21.405 30.263 34.853  1.00 37.80 ? 138 ARG B NH1   1 
ATOM   519  N  NH2   . ARG B 1 2  ? -22.648 32.075 35.545  1.00 39.87 ? 138 ARG B NH2   1 
ATOM   520  N  N     . ARG B 1 3  ? -23.052 29.807 28.174  1.00 27.78 ? 139 ARG B N     1 
ATOM   521  C  CA    . ARG B 1 3  ? -23.599 28.684 27.421  1.00 27.84 ? 139 ARG B CA    1 
ATOM   522  C  C     . ARG B 1 3  ? -23.247 27.370 28.107  1.00 25.62 ? 139 ARG B C     1 
ATOM   523  O  O     . ARG B 1 3  ? -22.338 27.322 28.931  1.00 25.55 ? 139 ARG B O     1 
ATOM   524  C  CB    . ARG B 1 3  ? -23.045 28.687 26.000  1.00 31.24 ? 139 ARG B CB    1 
ATOM   525  C  CG    . ARG B 1 3  ? -23.501 29.854 25.143  1.00 35.97 ? 139 ARG B CG    1 
ATOM   526  C  CD    . ARG B 1 3  ? -22.743 29.814 23.833  1.00 39.29 ? 139 ARG B CD    1 
ATOM   527  N  NE    . ARG B 1 3  ? -23.164 30.826 22.874  1.00 42.81 ? 139 ARG B NE    1 
ATOM   528  C  CZ    . ARG B 1 3  ? -22.571 31.013 21.699  1.00 43.22 ? 139 ARG B CZ    1 
ATOM   529  N  NH1   . ARG B 1 3  ? -21.537 30.257 21.352  1.00 43.88 ? 139 ARG B NH1   1 
ATOM   530  N  NH2   . ARG B 1 3  ? -23.013 31.947 20.870  1.00 45.63 ? 139 ARG B NH2   1 
ATOM   531  N  N     . LYS B 1 4  ? -23.969 26.307 27.772  1.00 23.10 ? 140 LYS B N     1 
ATOM   532  C  CA    . LYS B 1 4  ? -23.707 25.005 28.379  1.00 23.21 ? 140 LYS B CA    1 
ATOM   533  C  C     . LYS B 1 4  ? -22.438 24.399 27.775  1.00 22.10 ? 140 LYS B C     1 
ATOM   534  O  O     . LYS B 1 4  ? -22.294 24.334 26.553  1.00 22.36 ? 140 LYS B O     1 
ATOM   535  C  CB    . LYS B 1 4  ? -24.911 24.085 28.162  1.00 23.02 ? 140 LYS B CB    1 
ATOM   536  C  CG    . LYS B 1 4  ? -26.180 24.635 28.802  1.00 24.54 ? 140 LYS B CG    1 
ATOM   537  C  CD    . LYS B 1 4  ? -27.430 24.307 27.990  1.00 24.89 ? 140 LYS B CD    1 
ATOM   538  C  CE    . LYS B 1 4  ? -28.676 24.946 28.593  1.00 21.77 ? 140 LYS B CE    1 
ATOM   539  N  NZ    . LYS B 1 4  ? -28.902 24.497 29.988  1.00 19.31 ? 140 LYS B NZ    1 
ATOM   540  N  N     . PRO B 1 5  ? -21.496 23.960 28.628  1.00 20.99 ? 141 PRO B N     1 
ATOM   541  C  CA    . PRO B 1 5  ? -20.231 23.363 28.182  1.00 20.46 ? 141 PRO B CA    1 
ATOM   542  C  C     . PRO B 1 5  ? -20.346 21.935 27.660  1.00 19.51 ? 141 PRO B C     1 
ATOM   543  O  O     . PRO B 1 5  ? -21.178 21.158 28.130  1.00 20.13 ? 141 PRO B O     1 
ATOM   544  C  CB    . PRO B 1 5  ? -19.375 23.418 29.436  1.00 19.15 ? 141 PRO B CB    1 
ATOM   545  C  CG    . PRO B 1 5  ? -20.375 23.127 30.489  1.00 18.76 ? 141 PRO B CG    1 
ATOM   546  C  CD    . PRO B 1 5  ? -21.530 24.038 30.098  1.00 19.70 ? 141 PRO B CD    1 
ATOM   547  N  N     . ARG B 1 6  ? -19.510 21.598 26.682  1.00 18.39 ? 142 ARG B N     1 
ATOM   548  C  CA    . ARG B 1 6  ? -19.491 20.242 26.142  1.00 16.84 ? 142 ARG B CA    1 
ATOM   549  C  C     . ARG B 1 6  ? -18.848 19.394 27.226  1.00 16.80 ? 142 ARG B C     1 
ATOM   550  O  O     . ARG B 1 6  ? -17.852 19.799 27.824  1.00 17.42 ? 142 ARG B O     1 
ATOM   551  C  CB    . ARG B 1 6  ? -18.640 20.161 24.869  1.00 14.88 ? 142 ARG B CB    1 
ATOM   552  C  CG    . ARG B 1 6  ? -18.486 18.749 24.286  1.00 13.57 ? 142 ARG B CG    1 
ATOM   553  C  CD    . ARG B 1 6  ? -17.326 17.962 24.911  1.00 12.58 ? 142 ARG B CD    1 
ATOM   554  N  NE    . ARG B 1 6  ? -16.008 18.533 24.629  1.00 12.55 ? 142 ARG B NE    1 
ATOM   555  C  CZ    . ARG B 1 6  ? -15.356 18.406 23.475  1.00 14.42 ? 142 ARG B CZ    1 
ATOM   556  N  NH1   . ARG B 1 6  ? -15.897 17.721 22.472  1.00 14.32 ? 142 ARG B NH1   1 
ATOM   557  N  NH2   . ARG B 1 6  ? -14.155 18.955 23.322  1.00 11.47 ? 142 ARG B NH2   1 
ATOM   558  N  N     . VAL B 1 7  ? -19.434 18.239 27.506  1.00 14.93 ? 143 VAL B N     1 
ATOM   559  C  CA    . VAL B 1 7  ? -18.872 17.352 28.499  1.00 15.29 ? 143 VAL B CA    1 
ATOM   560  C  C     . VAL B 1 7  ? -18.419 16.081 27.784  1.00 15.49 ? 143 VAL B C     1 
ATOM   561  O  O     . VAL B 1 7  ? -19.177 15.461 27.037  1.00 15.33 ? 143 VAL B O     1 
ATOM   562  C  CB    . VAL B 1 7  ? -19.900 17.041 29.595  1.00 15.51 ? 143 VAL B CB    1 
ATOM   563  C  CG1   . VAL B 1 7  ? -19.308 16.088 30.629  1.00 16.36 ? 143 VAL B CG1   1 
ATOM   564  C  CG2   . VAL B 1 7  ? -20.327 18.344 30.252  1.00 16.84 ? 143 VAL B CG2   1 
ATOM   565  N  N     . LEU B 1 8  ? -17.158 15.725 27.999  1.00 16.45 ? 144 LEU B N     1 
ATOM   566  C  CA    . LEU B 1 8  ? -16.556 14.550 27.384  1.00 17.32 ? 144 LEU B CA    1 
ATOM   567  C  C     . LEU B 1 8  ? -17.136 13.259 27.939  1.00 17.59 ? 144 LEU B C     1 
ATOM   568  O  O     . LEU B 1 8  ? -17.530 13.193 29.107  1.00 18.54 ? 144 LEU B O     1 
ATOM   569  C  CB    . LEU B 1 8  ? -15.041 14.554 27.615  1.00 16.71 ? 144 LEU B CB    1 
ATOM   570  C  CG    . LEU B 1 8  ? -14.234 15.725 27.051  1.00 16.06 ? 144 LEU B CG    1 
ATOM   571  C  CD1   . LEU B 1 8  ? -12.792 15.620 27.517  1.00 18.31 ? 144 LEU B CD1   1 
ATOM   572  C  CD2   . LEU B 1 8  ? -14.302 15.710 25.543  1.00 16.52 ? 144 LEU B CD2   1 
ATOM   573  N  N     . PHE B 1 9  ? -17.189 12.236 27.086  1.00 17.56 ? 145 PHE B N     1 
ATOM   574  C  CA    . PHE B 1 9  ? -17.692 10.932 27.485  1.00 15.89 ? 145 PHE B CA    1 
ATOM   575  C  C     . PHE B 1 9  ? -16.536 10.239 28.211  1.00 14.93 ? 145 PHE B C     1 
ATOM   576  O  O     . PHE B 1 9  ? -15.382 10.328 27.781  1.00 16.17 ? 145 PHE B O     1 
ATOM   577  C  CB    . PHE B 1 9  ? -18.143 10.127 26.251  1.00 15.85 ? 145 PHE B CB    1 
ATOM   578  C  CG    . PHE B 1 9  ? -19.319 10.740 25.509  1.00 15.66 ? 145 PHE B CG    1 
ATOM   579  C  CD1   . PHE B 1 9  ? -20.164 11.662 26.135  1.00 15.86 ? 145 PHE B CD1   1 
ATOM   580  C  CD2   . PHE B 1 9  ? -19.608 10.363 24.202  1.00 15.77 ? 145 PHE B CD2   1 
ATOM   581  C  CE1   . PHE B 1 9  ? -21.282 12.198 25.465  1.00 16.38 ? 145 PHE B CE1   1 
ATOM   582  C  CE2   . PHE B 1 9  ? -20.727 10.892 23.523  1.00 13.89 ? 145 PHE B CE2   1 
ATOM   583  C  CZ    . PHE B 1 9  ? -21.562 11.809 24.160  1.00 12.80 ? 145 PHE B CZ    1 
ATOM   584  N  N     . SER B 1 10 ? -16.850 9.566  29.314  1.00 14.32 ? 146 SER B N     1 
ATOM   585  C  CA    . SER B 1 10 ? -15.844 8.883  30.126  1.00 14.24 ? 146 SER B CA    1 
ATOM   586  C  C     . SER B 1 10 ? -15.203 7.696  29.433  1.00 15.69 ? 146 SER B C     1 
ATOM   587  O  O     . SER B 1 10 ? -15.644 7.254  28.369  1.00 16.06 ? 146 SER B O     1 
ATOM   588  C  CB    . SER B 1 10 ? -16.454 8.408  31.439  1.00 14.39 ? 146 SER B CB    1 
ATOM   589  O  OG    . SER B 1 10 ? -17.389 7.372  31.213  1.00 16.23 ? 146 SER B OG    1 
ATOM   590  N  N     . GLN B 1 11 ? -14.153 7.173  30.047  1.00 15.73 ? 147 GLN B N     1 
ATOM   591  C  CA    . GLN B 1 11 ? -13.461 6.037  29.474  1.00 17.48 ? 147 GLN B CA    1 
ATOM   592  C  C     . GLN B 1 11 ? -14.428 4.862  29.335  1.00 15.79 ? 147 GLN B C     1 
ATOM   593  O  O     . GLN B 1 11 ? -14.412 4.143  28.334  1.00 14.97 ? 147 GLN B O     1 
ATOM   594  C  CB    . GLN B 1 11 ? -12.279 5.634  30.356  1.00 18.99 ? 147 GLN B CB    1 
ATOM   595  C  CG    . GLN B 1 11 ? -11.488 4.470  29.794  1.00 26.97 ? 147 GLN B CG    1 
ATOM   596  C  CD    . GLN B 1 11 ? -10.583 3.813  30.824  1.00 30.40 ? 147 GLN B CD    1 
ATOM   597  O  OE1   . GLN B 1 11 ? -9.667  4.442  31.355  1.00 32.95 ? 147 GLN B OE1   1 
ATOM   598  N  NE2   . GLN B 1 11 ? -10.841 2.537  31.112  1.00 34.32 ? 147 GLN B NE2   1 
ATOM   599  N  N     . ALA B 1 12 ? -15.273 4.679  30.344  1.00 15.34 ? 148 ALA B N     1 
ATOM   600  C  CA    . ALA B 1 12 ? -16.233 3.588  30.339  1.00 14.61 ? 148 ALA B CA    1 
ATOM   601  C  C     . ALA B 1 12 ? -17.265 3.774  29.232  1.00 15.90 ? 148 ALA B C     1 
ATOM   602  O  O     . ALA B 1 12 ? -17.541 2.838  28.471  1.00 15.75 ? 148 ALA B O     1 
ATOM   603  C  CB    . ALA B 1 12 ? -16.923 3.492  31.698  1.00 15.30 ? 148 ALA B CB    1 
ATOM   604  N  N     . GLN B 1 13 ? -17.836 4.974  29.138  1.00 13.78 ? 149 GLN B N     1 
ATOM   605  C  CA    . GLN B 1 13 ? -18.839 5.248  28.110  1.00 14.77 ? 149 GLN B CA    1 
ATOM   606  C  C     . GLN B 1 13 ? -18.273 5.066  26.703  1.00 14.59 ? 149 GLN B C     1 
ATOM   607  O  O     . GLN B 1 13 ? -18.907 4.451  25.852  1.00 14.79 ? 149 GLN B O     1 
ATOM   608  C  CB    . GLN B 1 13 ? -19.399 6.663  28.272  1.00 14.38 ? 149 GLN B CB    1 
ATOM   609  C  CG    . GLN B 1 13 ? -20.199 6.844  29.550  1.00 14.78 ? 149 GLN B CG    1 
ATOM   610  C  CD    . GLN B 1 13 ? -20.627 8.276  29.782  1.00 15.49 ? 149 GLN B CD    1 
ATOM   611  O  OE1   . GLN B 1 13 ? -19.845 9.201  29.590  1.00 15.62 ? 149 GLN B OE1   1 
ATOM   612  N  NE2   . GLN B 1 13 ? -21.866 8.465  30.218  1.00 14.89 ? 149 GLN B NE2   1 
ATOM   613  N  N     . VAL B 1 14 ? -17.082 5.603  26.455  1.00 14.51 ? 150 VAL B N     1 
ATOM   614  C  CA    . VAL B 1 14 ? -16.460 5.477  25.142  1.00 14.52 ? 150 VAL B CA    1 
ATOM   615  C  C     . VAL B 1 14 ? -16.168 4.013  24.820  1.00 15.66 ? 150 VAL B C     1 
ATOM   616  O  O     . VAL B 1 14 ? -16.385 3.572  23.700  1.00 16.32 ? 150 VAL B O     1 
ATOM   617  C  CB    . VAL B 1 14 ? -15.155 6.297  25.064  1.00 12.82 ? 150 VAL B CB    1 
ATOM   618  C  CG1   . VAL B 1 14 ? -14.415 5.987  23.790  1.00 12.81 ? 150 VAL B CG1   1 
ATOM   619  C  CG2   . VAL B 1 14 ? -15.479 7.773  25.115  1.00 13.48 ? 150 VAL B CG2   1 
ATOM   620  N  N     . TYR B 1 15 ? -15.681 3.262  25.805  1.00 15.74 ? 151 TYR B N     1 
ATOM   621  C  CA    . TYR B 1 15 ? -15.375 1.852  25.603  1.00 15.83 ? 151 TYR B CA    1 
ATOM   622  C  C     . TYR B 1 15 ? -16.606 1.070  25.123  1.00 15.85 ? 151 TYR B C     1 
ATOM   623  O  O     . TYR B 1 15 ? -16.525 0.270  24.190  1.00 14.47 ? 151 TYR B O     1 
ATOM   624  C  CB    . TYR B 1 15 ? -14.867 1.234  26.904  1.00 16.45 ? 151 TYR B CB    1 
ATOM   625  C  CG    . TYR B 1 15 ? -14.587 -0.253 26.796  1.00 18.64 ? 151 TYR B CG    1 
ATOM   626  C  CD1   . TYR B 1 15 ? -13.337 -0.720 26.410  1.00 19.27 ? 151 TYR B CD1   1 
ATOM   627  C  CD2   . TYR B 1 15 ? -15.586 -1.190 27.065  1.00 19.45 ? 151 TYR B CD2   1 
ATOM   628  C  CE1   . TYR B 1 15 ? -13.084 -2.081 26.298  1.00 21.18 ? 151 TYR B CE1   1 
ATOM   629  C  CE2   . TYR B 1 15 ? -15.347 -2.552 26.951  1.00 20.97 ? 151 TYR B CE2   1 
ATOM   630  C  CZ    . TYR B 1 15 ? -14.093 -2.994 26.570  1.00 21.67 ? 151 TYR B CZ    1 
ATOM   631  O  OH    . TYR B 1 15 ? -13.850 -4.352 26.467  1.00 24.90 ? 151 TYR B OH    1 
ATOM   632  N  N     . GLU B 1 16 ? -17.743 1.296  25.773  1.00 15.30 ? 152 GLU B N     1 
ATOM   633  C  CA    . GLU B 1 16 ? -18.972 0.602  25.408  1.00 15.48 ? 152 GLU B CA    1 
ATOM   634  C  C     . GLU B 1 16 ? -19.504 1.047  24.053  1.00 15.19 ? 152 GLU B C     1 
ATOM   635  O  O     . GLU B 1 16 ? -20.020 0.234  23.287  1.00 16.43 ? 152 GLU B O     1 
ATOM   636  C  CB    . GLU B 1 16 ? -20.047 0.811  26.477  1.00 17.41 ? 152 GLU B CB    1 
ATOM   637  C  CG    . GLU B 1 16 ? -21.396 0.249  26.068  1.00 20.09 ? 152 GLU B CG    1 
ATOM   638  C  CD    . GLU B 1 16 ? -21.320 -1.220 25.666  1.00 24.27 ? 152 GLU B CD    1 
ATOM   639  O  OE1   . GLU B 1 16 ? -22.199 -1.669 24.887  1.00 23.89 ? 152 GLU B OE1   1 
ATOM   640  O  OE2   . GLU B 1 16 ? -20.387 -1.922 26.137  1.00 23.31 ? 152 GLU B OE2   1 
ATOM   641  N  N     . LEU B 1 17 ? -19.401 2.337  23.757  1.00 13.86 ? 153 LEU B N     1 
ATOM   642  C  CA    . LEU B 1 17 ? -19.855 2.832  22.467  1.00 13.68 ? 153 LEU B CA    1 
ATOM   643  C  C     . LEU B 1 17 ? -19.037 2.131  21.378  1.00 13.77 ? 153 LEU B C     1 
ATOM   644  O  O     . LEU B 1 17 ? -19.592 1.658  20.386  1.00 13.67 ? 153 LEU B O     1 
ATOM   645  C  CB    . LEU B 1 17 ? -19.671 4.356  22.380  1.00 12.52 ? 153 LEU B CB    1 
ATOM   646  C  CG    . LEU B 1 17 ? -20.702 5.200  23.144  1.00 12.01 ? 153 LEU B CG    1 
ATOM   647  C  CD1   . LEU B 1 17 ? -20.215 6.636  23.308  1.00 11.80 ? 153 LEU B CD1   1 
ATOM   648  C  CD2   . LEU B 1 17 ? -22.032 5.172  22.390  1.00 12.72 ? 153 LEU B CD2   1 
ATOM   649  N  N     . GLU B 1 18 ? -17.723 2.049  21.592  1.00 14.79 ? 154 GLU B N     1 
ATOM   650  C  CA    . GLU B 1 18 ? -16.796 1.419  20.649  1.00 15.16 ? 154 GLU B CA    1 
ATOM   651  C  C     . GLU B 1 18 ? -17.070 -0.077 20.538  1.00 15.24 ? 154 GLU B C     1 
ATOM   652  O  O     . GLU B 1 18 ? -17.045 -0.637 19.442  1.00 16.35 ? 154 GLU B O     1 
ATOM   653  C  CB    . GLU B 1 18 ? -15.344 1.620  21.099  1.00 17.81 ? 154 GLU B CB    1 
ATOM   654  C  CG    . GLU B 1 18 ? -14.906 3.068  21.305  1.00 21.52 ? 154 GLU B CG    1 
ATOM   655  C  CD    . GLU B 1 18 ? -14.784 3.866  20.015  1.00 27.35 ? 154 GLU B CD    1 
ATOM   656  O  OE1   . GLU B 1 18 ? -14.401 5.060  20.102  1.00 30.78 ? 154 GLU B OE1   1 
ATOM   657  O  OE2   . GLU B 1 18 ? -15.063 3.316  18.920  1.00 29.13 ? 154 GLU B OE2   1 
ATOM   658  N  N     . ARG B 1 19 ? -17.314 -0.721 21.677  1.00 15.61 ? 155 ARG B N     1 
ATOM   659  C  CA    . ARG B 1 19 ? -17.603 -2.155 21.706  1.00 15.21 ? 155 ARG B CA    1 
ATOM   660  C  C     . ARG B 1 19 ? -18.851 -2.438 20.892  1.00 15.08 ? 155 ARG B C     1 
ATOM   661  O  O     . ARG B 1 19 ? -18.930 -3.457 20.215  1.00 16.31 ? 155 ARG B O     1 
ATOM   662  C  CB    . ARG B 1 19 ? -17.831 -2.645 23.133  1.00 15.94 ? 155 ARG B CB    1 
ATOM   663  C  CG    . ARG B 1 19 ? -17.999 -4.151 23.220  1.00 19.50 ? 155 ARG B CG    1 
ATOM   664  C  CD    . ARG B 1 19 ? -18.556 -4.592 24.557  1.00 21.82 ? 155 ARG B CD    1 
ATOM   665  N  NE    . ARG B 1 19 ? -19.975 -4.266 24.678  1.00 27.00 ? 155 ARG B NE    1 
ATOM   666  C  CZ    . ARG B 1 19 ? -20.929 -4.737 23.875  1.00 28.12 ? 155 ARG B CZ    1 
ATOM   667  N  NH1   . ARG B 1 19 ? -20.620 -5.566 22.882  1.00 28.61 ? 155 ARG B NH1   1 
ATOM   668  N  NH2   . ARG B 1 19 ? -22.195 -4.378 24.064  1.00 26.91 ? 155 ARG B NH2   1 
ATOM   669  N  N     . ARG B 1 20 ? -19.836 -1.543 20.971  1.00 15.52 ? 156 ARG B N     1 
ATOM   670  C  CA    . ARG B 1 20 ? -21.071 -1.708 20.206  1.00 15.69 ? 156 ARG B CA    1 
ATOM   671  C  C     . ARG B 1 20 ? -20.827 -1.397 18.740  1.00 15.95 ? 156 ARG B C     1 
ATOM   672  O  O     . ARG B 1 20 ? -21.392 -2.042 17.864  1.00 16.49 ? 156 ARG B O     1 
ATOM   673  C  CB    . ARG B 1 20 ? -22.182 -0.792 20.733  1.00 17.53 ? 156 ARG B CB    1 
ATOM   674  C  CG    . ARG B 1 20 ? -22.830 -1.273 22.018  1.00 22.27 ? 156 ARG B CG    1 
ATOM   675  C  CD    . ARG B 1 20 ? -23.621 -2.579 21.827  1.00 26.26 ? 156 ARG B CD    1 
ATOM   676  N  NE    . ARG B 1 20 ? -25.000 -2.358 21.384  1.00 27.64 ? 156 ARG B NE    1 
ATOM   677  C  CZ    . ARG B 1 20 ? -25.434 -2.539 20.141  1.00 24.68 ? 156 ARG B CZ    1 
ATOM   678  N  NH1   . ARG B 1 20 ? -24.595 -2.948 19.202  1.00 23.77 ? 156 ARG B NH1   1 
ATOM   679  N  NH2   . ARG B 1 20 ? -26.711 -2.318 19.845  1.00 23.06 ? 156 ARG B NH2   1 
ATOM   680  N  N     . PHE B 1 21 ? -19.983 -0.404 18.473  1.00 15.83 ? 157 PHE B N     1 
ATOM   681  C  CA    . PHE B 1 21 ? -19.683 -0.021 17.102  1.00 15.53 ? 157 PHE B CA    1 
ATOM   682  C  C     . PHE B 1 21 ? -19.025 -1.189 16.358  1.00 16.72 ? 157 PHE B C     1 
ATOM   683  O  O     . PHE B 1 21 ? -19.204 -1.343 15.150  1.00 16.71 ? 157 PHE B O     1 
ATOM   684  C  CB    . PHE B 1 21 ? -18.767 1.203  17.077  1.00 15.29 ? 157 PHE B CB    1 
ATOM   685  C  CG    . PHE B 1 21 ? -18.548 1.769  15.698  1.00 13.38 ? 157 PHE B CG    1 
ATOM   686  C  CD1   . PHE B 1 21 ? -19.577 2.423  15.029  1.00 14.30 ? 157 PHE B CD1   1 
ATOM   687  C  CD2   . PHE B 1 21 ? -17.312 1.653  15.073  1.00 14.55 ? 157 PHE B CD2   1 
ATOM   688  C  CE1   . PHE B 1 21 ? -19.378 2.957  13.760  1.00 13.06 ? 157 PHE B CE1   1 
ATOM   689  C  CE2   . PHE B 1 21 ? -17.100 2.182  13.800  1.00 13.01 ? 157 PHE B CE2   1 
ATOM   690  C  CZ    . PHE B 1 21 ? -18.137 2.836  13.145  1.00 14.32 ? 157 PHE B CZ    1 
ATOM   691  N  N     . LYS B 1 22 ? -18.279 -2.019 17.084  1.00 16.59 ? 158 LYS B N     1 
ATOM   692  C  CA    . LYS B 1 22 ? -17.614 -3.166 16.471  1.00 17.83 ? 158 LYS B CA    1 
ATOM   693  C  C     . LYS B 1 22 ? -18.616 -4.214 16.002  1.00 18.62 ? 158 LYS B C     1 
ATOM   694  O  O     . LYS B 1 22 ? -18.285 -5.069 15.183  1.00 19.03 ? 158 LYS B O     1 
ATOM   695  C  CB    . LYS B 1 22 ? -16.633 -3.809 17.451  1.00 15.84 ? 158 LYS B CB    1 
ATOM   696  C  CG    . LYS B 1 22 ? -15.395 -2.992 17.687  1.00 14.79 ? 158 LYS B CG    1 
ATOM   697  C  CD    . LYS B 1 22 ? -14.499 -3.676 18.683  1.00 17.71 ? 158 LYS B CD    1 
ATOM   698  C  CE    . LYS B 1 22 ? -13.216 -2.887 18.878  1.00 18.62 ? 158 LYS B CE    1 
ATOM   699  N  NZ    . LYS B 1 22 ? -12.308 -3.551 19.840  1.00 20.44 ? 158 LYS B NZ    1 
ATOM   700  N  N     . GLN B 1 23 ? -19.837 -4.142 16.527  1.00 18.22 ? 159 GLN B N     1 
ATOM   701  C  CA    . GLN B 1 23 ? -20.895 -5.081 16.159  1.00 17.93 ? 159 GLN B CA    1 
ATOM   702  C  C     . GLN B 1 23 ? -21.897 -4.475 15.175  1.00 18.02 ? 159 GLN B C     1 
ATOM   703  O  O     . GLN B 1 23 ? -22.439 -5.178 14.325  1.00 18.71 ? 159 GLN B O     1 
ATOM   704  C  CB    . GLN B 1 23 ? -21.617 -5.544 17.419  1.00 19.18 ? 159 GLN B CB    1 
ATOM   705  C  CG    . GLN B 1 23 ? -20.717 -6.302 18.368  1.00 20.22 ? 159 GLN B CG    1 
ATOM   706  C  CD    . GLN B 1 23 ? -21.362 -6.524 19.711  1.00 22.53 ? 159 GLN B CD    1 
ATOM   707  O  OE1   . GLN B 1 23 ? -21.725 -5.572 20.401  1.00 23.85 ? 159 GLN B OE1   1 
ATOM   708  N  NE2   . GLN B 1 23 ? -21.508 -7.783 20.095  1.00 22.10 ? 159 GLN B NE2   1 
ATOM   709  N  N     . GLN B 1 24 ? -22.130 -3.169 15.290  1.00 17.16 ? 160 GLN B N     1 
ATOM   710  C  CA    . GLN B 1 24 ? -23.062 -2.448 14.423  1.00 16.37 ? 160 GLN B CA    1 
ATOM   711  C  C     . GLN B 1 24 ? -22.604 -1.010 14.197  1.00 16.74 ? 160 GLN B C     1 
ATOM   712  O  O     . GLN B 1 24 ? -22.354 -0.280 15.156  1.00 15.68 ? 160 GLN B O     1 
ATOM   713  C  CB    . GLN B 1 24 ? -24.445 -2.391 15.057  1.00 17.14 ? 160 GLN B CB    1 
ATOM   714  C  CG    . GLN B 1 24 ? -25.190 -3.689 15.123  1.00 18.81 ? 160 GLN B CG    1 
ATOM   715  C  CD    . GLN B 1 24 ? -26.423 -3.565 15.995  1.00 20.83 ? 160 GLN B CD    1 
ATOM   716  O  OE1   . GLN B 1 24 ? -26.349 -3.715 17.212  1.00 21.22 ? 160 GLN B OE1   1 
ATOM   717  N  NE2   . GLN B 1 24 ? -27.562 -3.262 15.378  1.00 22.63 ? 160 GLN B NE2   1 
ATOM   718  N  N     . ARG B 1 25 ? -22.512 -0.601 12.935  1.00 17.01 ? 161 ARG B N     1 
ATOM   719  C  CA    . ARG B 1 25 ? -22.114 0.765  12.602  1.00 17.39 ? 161 ARG B CA    1 
ATOM   720  C  C     . ARG B 1 25 ? -23.335 1.671  12.715  1.00 16.70 ? 161 ARG B C     1 
ATOM   721  O  O     . ARG B 1 25 ? -23.209 2.876  12.943  1.00 16.56 ? 161 ARG B O     1 
ATOM   722  C  CB    . ARG B 1 25 ? -21.580 0.849  11.172  1.00 19.16 ? 161 ARG B CB    1 
ATOM   723  C  CG    . ARG B 1 25 ? -20.335 0.047  10.895  1.00 21.23 ? 161 ARG B CG    1 
ATOM   724  C  CD    . ARG B 1 25 ? -19.946 0.237  9.447   1.00 23.60 ? 161 ARG B CD    1 
ATOM   725  N  NE    . ARG B 1 25 ? -19.606 1.628  9.158   1.00 24.88 ? 161 ARG B NE    1 
ATOM   726  C  CZ    . ARG B 1 25 ? -18.399 2.157  9.336   1.00 25.80 ? 161 ARG B CZ    1 
ATOM   727  N  NH1   . ARG B 1 25 ? -17.405 1.410  9.801   1.00 25.88 ? 161 ARG B NH1   1 
ATOM   728  N  NH2   . ARG B 1 25 ? -18.184 3.434  9.050   1.00 26.72 ? 161 ARG B NH2   1 
ATOM   729  N  N     . TYR B 1 26 ? -24.514 1.078  12.536  1.00 14.86 ? 162 TYR B N     1 
ATOM   730  C  CA    . TYR B 1 26 ? -25.769 1.808  12.618  1.00 15.36 ? 162 TYR B CA    1 
ATOM   731  C  C     . TYR B 1 26 ? -26.694 1.184  13.649  1.00 17.82 ? 162 TYR B C     1 
ATOM   732  O  O     . TYR B 1 26 ? -26.828 -0.041 13.726  1.00 16.96 ? 162 TYR B O     1 
ATOM   733  C  CB    . TYR B 1 26 ? -26.496 1.818  11.272  1.00 15.24 ? 162 TYR B CB    1 
ATOM   734  C  CG    . TYR B 1 26 ? -25.762 2.525  10.164  1.00 15.60 ? 162 TYR B CG    1 
ATOM   735  C  CD1   . TYR B 1 26 ? -24.739 1.889  9.457   1.00 15.82 ? 162 TYR B CD1   1 
ATOM   736  C  CD2   . TYR B 1 26 ? -26.092 3.836  9.814   1.00 15.30 ? 162 TYR B CD2   1 
ATOM   737  C  CE1   . TYR B 1 26 ? -24.060 2.545  8.422   1.00 16.36 ? 162 TYR B CE1   1 
ATOM   738  C  CE2   . TYR B 1 26 ? -25.422 4.498  8.788   1.00 16.60 ? 162 TYR B CE2   1 
ATOM   739  C  CZ    . TYR B 1 26 ? -24.406 3.847  8.097   1.00 15.45 ? 162 TYR B CZ    1 
ATOM   740  O  OH    . TYR B 1 26 ? -23.734 4.506  7.093   1.00 17.12 ? 162 TYR B OH    1 
ATOM   741  N  N     . LEU B 1 27 ? -27.337 2.043  14.433  1.00 18.12 ? 163 LEU B N     1 
ATOM   742  C  CA    . LEU B 1 27 ? -28.275 1.612  15.460  1.00 17.93 ? 163 LEU B CA    1 
ATOM   743  C  C     . LEU B 1 27 ? -29.673 2.112  15.112  1.00 18.27 ? 163 LEU B C     1 
ATOM   744  O  O     . LEU B 1 27 ? -29.837 3.230  14.623  1.00 17.56 ? 163 LEU B O     1 
ATOM   745  C  CB    . LEU B 1 27 ? -27.865 2.173  16.827  1.00 17.62 ? 163 LEU B CB    1 
ATOM   746  C  CG    . LEU B 1 27 ? -26.986 1.331  17.758  1.00 18.56 ? 163 LEU B CG    1 
ATOM   747  C  CD1   . LEU B 1 27 ? -25.741 0.844  17.048  1.00 19.95 ? 163 LEU B CD1   1 
ATOM   748  C  CD2   . LEU B 1 27 ? -26.632 2.172  18.972  1.00 18.72 ? 163 LEU B CD2   1 
ATOM   749  N  N     . SER B 1 28 ? -30.673 1.272  15.358  1.00 18.82 ? 164 SER B N     1 
ATOM   750  C  CA    . SER B 1 28 ? -32.059 1.635  15.109  1.00 18.75 ? 164 SER B CA    1 
ATOM   751  C  C     . SER B 1 28 ? -32.523 2.512  16.268  1.00 19.89 ? 164 SER B C     1 
ATOM   752  O  O     . SER B 1 28 ? -31.855 2.578  17.307  1.00 19.03 ? 164 SER B O     1 
ATOM   753  C  CB    . SER B 1 28 ? -32.924 0.383  15.054  1.00 19.29 ? 164 SER B CB    1 
ATOM   754  O  OG    . SER B 1 28 ? -32.945 -0.256 16.318  1.00 22.20 ? 164 SER B OG    1 
ATOM   755  N  N     . ALA B 1 29 ? -33.663 3.181  16.090  1.00 20.01 ? 165 ALA B N     1 
ATOM   756  C  CA    . ALA B 1 29 ? -34.228 4.053  17.124  1.00 20.66 ? 165 ALA B CA    1 
ATOM   757  C  C     . ALA B 1 29 ? -34.291 3.361  18.489  1.00 20.72 ? 165 ALA B C     1 
ATOM   758  O  O     . ALA B 1 29 ? -33.857 3.926  19.490  1.00 21.33 ? 165 ALA B O     1 
ATOM   759  C  CB    . ALA B 1 29 ? -35.622 4.531  16.710  1.00 20.88 ? 165 ALA B CB    1 
ATOM   760  N  N     . PRO B 1 30 ? -34.842 2.132  18.548  1.00 20.96 ? 166 PRO B N     1 
ATOM   761  C  CA    . PRO B 1 30 ? -34.937 1.394  19.813  1.00 20.68 ? 166 PRO B CA    1 
ATOM   762  C  C     . PRO B 1 30 ? -33.570 1.154  20.456  1.00 20.14 ? 166 PRO B C     1 
ATOM   763  O  O     . PRO B 1 30 ? -33.383 1.404  21.644  1.00 19.94 ? 166 PRO B O     1 
ATOM   764  C  CB    . PRO B 1 30 ? -35.598 0.084  19.397  1.00 21.37 ? 166 PRO B CB    1 
ATOM   765  C  CG    . PRO B 1 30 ? -36.468 0.503  18.263  1.00 21.58 ? 166 PRO B CG    1 
ATOM   766  C  CD    . PRO B 1 30 ? -35.558 1.409  17.479  1.00 21.11 ? 166 PRO B CD    1 
ATOM   767  N  N     . GLU B 1 31 ? -32.621 0.665  19.658  1.00 19.71 ? 167 GLU B N     1 
ATOM   768  C  CA    . GLU B 1 31 ? -31.276 0.373  20.145  1.00 19.46 ? 167 GLU B CA    1 
ATOM   769  C  C     . GLU B 1 31 ? -30.557 1.591  20.714  1.00 18.03 ? 167 GLU B C     1 
ATOM   770  O  O     . GLU B 1 31 ? -29.823 1.469  21.698  1.00 14.73 ? 167 GLU B O     1 
ATOM   771  C  CB    . GLU B 1 31 ? -30.431 -0.253 19.036  1.00 20.99 ? 167 GLU B CB    1 
ATOM   772  C  CG    . GLU B 1 31 ? -30.963 -1.588 18.542  1.00 22.39 ? 167 GLU B CG    1 
ATOM   773  C  CD    . GLU B 1 31 ? -30.066 -2.221 17.498  1.00 23.80 ? 167 GLU B CD    1 
ATOM   774  O  OE1   . GLU B 1 31 ? -29.618 -1.507 16.577  1.00 23.46 ? 167 GLU B OE1   1 
ATOM   775  O  OE2   . GLU B 1 31 ? -29.817 -3.439 17.595  1.00 27.40 ? 167 GLU B OE2   1 
ATOM   776  N  N     . ARG B 1 32 ? -30.746 2.755  20.095  1.00 18.36 ? 168 ARG B N     1 
ATOM   777  C  CA    . ARG B 1 32 ? -30.110 3.973  20.601  1.00 19.43 ? 168 ARG B CA    1 
ATOM   778  C  C     . ARG B 1 32 ? -30.648 4.268  21.992  1.00 18.59 ? 168 ARG B C     1 
ATOM   779  O  O     . ARG B 1 32 ? -29.890 4.495  22.930  1.00 16.21 ? 168 ARG B O     1 
ATOM   780  C  CB    . ARG B 1 32 ? -30.412 5.174  19.709  1.00 19.63 ? 168 ARG B CB    1 
ATOM   781  C  CG    . ARG B 1 32 ? -29.522 5.331  18.513  1.00 23.35 ? 168 ARG B CG    1 
ATOM   782  C  CD    . ARG B 1 32 ? -29.624 6.763  18.011  1.00 26.89 ? 168 ARG B CD    1 
ATOM   783  N  NE    . ARG B 1 32 ? -31.004 7.132  17.702  1.00 29.06 ? 168 ARG B NE    1 
ATOM   784  C  CZ    . ARG B 1 32 ? -31.665 6.720  16.622  1.00 30.23 ? 168 ARG B CZ    1 
ATOM   785  N  NH1   . ARG B 1 32 ? -31.076 5.926  15.734  1.00 29.40 ? 168 ARG B NH1   1 
ATOM   786  N  NH2   . ARG B 1 32 ? -32.925 7.093  16.436  1.00 30.00 ? 168 ARG B NH2   1 
ATOM   787  N  N     . ASP B 1 33 ? -31.973 4.273  22.106  1.00 19.19 ? 169 ASP B N     1 
ATOM   788  C  CA    . ASP B 1 33 ? -32.640 4.530  23.375  1.00 21.73 ? 169 ASP B CA    1 
ATOM   789  C  C     . ASP B 1 33 ? -32.124 3.595  24.467  1.00 21.29 ? 169 ASP B C     1 
ATOM   790  O  O     . ASP B 1 33 ? -31.854 4.030  25.584  1.00 22.41 ? 169 ASP B O     1 
ATOM   791  C  CB    . ASP B 1 33 ? -34.161 4.347  23.234  1.00 22.34 ? 169 ASP B CB    1 
ATOM   792  C  CG    . ASP B 1 33 ? -34.820 5.438  22.392  1.00 24.70 ? 169 ASP B CG    1 
ATOM   793  O  OD1   . ASP B 1 33 ? -34.111 6.331  21.869  1.00 25.25 ? 169 ASP B OD1   1 
ATOM   794  O  OD2   . ASP B 1 33 ? -36.064 5.395  22.249  1.00 25.00 ? 169 ASP B OD2   1 
ATOM   795  N  N     . GLN B 1 34 ? -31.984 2.311  24.144  1.00 21.68 ? 170 GLN B N     1 
ATOM   796  C  CA    . GLN B 1 34 ? -31.511 1.339  25.121  1.00 21.55 ? 170 GLN B CA    1 
ATOM   797  C  C     . GLN B 1 34 ? -30.080 1.632  25.540  1.00 20.28 ? 170 GLN B C     1 
ATOM   798  O  O     . GLN B 1 34 ? -29.787 1.711  26.730  1.00 20.31 ? 170 GLN B O     1 
ATOM   799  C  CB    . GLN B 1 34 ? -31.651 -0.093 24.561  1.00 23.61 ? 170 GLN B CB    1 
ATOM   800  C  CG    . GLN B 1 34 ? -30.374 -0.953 24.495  1.00 30.29 ? 170 GLN B CG    1 
ATOM   801  C  CD    . GLN B 1 34 ? -29.808 -1.361 25.857  1.00 32.88 ? 170 GLN B CD    1 
ATOM   802  O  OE1   . GLN B 1 34 ? -30.538 -1.792 26.754  1.00 35.38 ? 170 GLN B OE1   1 
ATOM   803  N  NE2   . GLN B 1 34 ? -28.492 -1.244 26.003  1.00 34.74 ? 170 GLN B NE2   1 
ATOM   804  N  N     . LEU B 1 35 ? -29.188 1.804  24.570  1.00 19.89 ? 171 LEU B N     1 
ATOM   805  C  CA    . LEU B 1 35 ? -27.788 2.080  24.885  1.00 18.59 ? 171 LEU B CA    1 
ATOM   806  C  C     . LEU B 1 35 ? -27.647 3.386  25.671  1.00 18.92 ? 171 LEU B C     1 
ATOM   807  O  O     . LEU B 1 35 ? -26.807 3.488  26.564  1.00 20.57 ? 171 LEU B O     1 
ATOM   808  C  CB    . LEU B 1 35 ? -26.957 2.145  23.601  1.00 17.08 ? 171 LEU B CB    1 
ATOM   809  C  CG    . LEU B 1 35 ? -25.438 2.140  23.770  1.00 14.82 ? 171 LEU B CG    1 
ATOM   810  C  CD1   . LEU B 1 35 ? -25.013 0.940  24.595  1.00 15.08 ? 171 LEU B CD1   1 
ATOM   811  C  CD2   . LEU B 1 35 ? -24.777 2.108  22.409  1.00 13.71 ? 171 LEU B CD2   1 
ATOM   812  N  N     . ALA B 1 36 ? -28.473 4.376  25.344  1.00 19.27 ? 172 ALA B N     1 
ATOM   813  C  CA    . ALA B 1 36 ? -28.443 5.667  26.029  1.00 19.70 ? 172 ALA B CA    1 
ATOM   814  C  C     . ALA B 1 36 ? -28.768 5.471  27.508  1.00 20.14 ? 172 ALA B C     1 
ATOM   815  O  O     . ALA B 1 36 ? -28.250 6.181  28.373  1.00 20.55 ? 172 ALA B O     1 
ATOM   816  C  CB    . ALA B 1 36 ? -29.448 6.618  25.394  1.00 17.96 ? 172 ALA B CB    1 
ATOM   817  N  N     . SER B 1 37 ? -29.635 4.505  27.788  1.00 20.18 ? 173 SER B N     1 
ATOM   818  C  CA    . SER B 1 37 ? -30.033 4.197  29.153  1.00 22.10 ? 173 SER B CA    1 
ATOM   819  C  C     . SER B 1 37 ? -28.894 3.492  29.887  1.00 21.96 ? 173 SER B C     1 
ATOM   820  O  O     . SER B 1 37 ? -28.615 3.781  31.051  1.00 23.76 ? 173 SER B O     1 
ATOM   821  C  CB    . SER B 1 37 ? -31.278 3.311  29.141  1.00 23.54 ? 173 SER B CB    1 
ATOM   822  O  OG    . SER B 1 37 ? -31.584 2.851  30.446  1.00 27.99 ? 173 SER B OG    1 
ATOM   823  N  N     . VAL B 1 38 ? -28.240 2.566  29.198  1.00 20.88 ? 174 VAL B N     1 
ATOM   824  C  CA    . VAL B 1 38 ? -27.120 1.829  29.762  1.00 21.37 ? 174 VAL B CA    1 
ATOM   825  C  C     . VAL B 1 38 ? -25.927 2.751  30.033  1.00 20.84 ? 174 VAL B C     1 
ATOM   826  O  O     . VAL B 1 38 ? -25.226 2.588  31.026  1.00 20.92 ? 174 VAL B O     1 
ATOM   827  C  CB    . VAL B 1 38 ? -26.678 0.698  28.802  1.00 21.54 ? 174 VAL B CB    1 
ATOM   828  C  CG1   . VAL B 1 38 ? -25.325 0.127  29.221  1.00 22.23 ? 174 VAL B CG1   1 
ATOM   829  C  CG2   . VAL B 1 38 ? -27.731 -0.398 28.795  1.00 22.73 ? 174 VAL B CG2   1 
ATOM   830  N  N     . LEU B 1 39 ? -25.714 3.728  29.158  1.00 20.57 ? 175 LEU B N     1 
ATOM   831  C  CA    . LEU B 1 39 ? -24.589 4.655  29.289  1.00 19.80 ? 175 LEU B CA    1 
ATOM   832  C  C     . LEU B 1 39 ? -24.908 5.900  30.109  1.00 20.03 ? 175 LEU B C     1 
ATOM   833  O  O     . LEU B 1 39 ? -24.002 6.622  30.522  1.00 19.18 ? 175 LEU B O     1 
ATOM   834  C  CB    . LEU B 1 39 ? -24.114 5.093  27.898  1.00 18.72 ? 175 LEU B CB    1 
ATOM   835  C  CG    . LEU B 1 39 ? -23.777 3.993  26.888  1.00 17.63 ? 175 LEU B CG    1 
ATOM   836  C  CD1   . LEU B 1 39 ? -23.618 4.612  25.518  1.00 18.22 ? 175 LEU B CD1   1 
ATOM   837  C  CD2   . LEU B 1 39 ? -22.519 3.267  27.297  1.00 18.14 ? 175 LEU B CD2   1 
ATOM   838  N  N     . LYS B 1 40 ? -26.195 6.138  30.344  1.00 19.91 ? 176 LYS B N     1 
ATOM   839  C  CA    . LYS B 1 40 ? -26.659 7.317  31.069  1.00 21.09 ? 176 LYS B CA    1 
ATOM   840  C  C     . LYS B 1 40 ? -26.346 8.583  30.271  1.00 20.05 ? 176 LYS B C     1 
ATOM   841  O  O     . LYS B 1 40 ? -25.851 9.574  30.807  1.00 19.53 ? 176 LYS B O     1 
ATOM   842  C  CB    . LYS B 1 40 ? -26.048 7.375  32.476  1.00 22.17 ? 176 LYS B CB    1 
ATOM   843  C  CG    . LYS B 1 40 ? -26.522 6.226  33.354  1.00 25.18 ? 176 LYS B CG    1 
ATOM   844  C  CD    . LYS B 1 40 ? -26.269 6.456  34.842  1.00 29.88 ? 176 LYS B CD    1 
ATOM   845  C  CE    . LYS B 1 40 ? -24.798 6.319  35.204  1.00 31.31 ? 176 LYS B CE    1 
ATOM   846  N  NZ    . LYS B 1 40 ? -24.593 6.418  36.678  1.00 33.28 ? 176 LYS B NZ    1 
ATOM   847  N  N     . LEU B 1 41 ? -26.632 8.512  28.970  1.00 19.89 ? 177 LEU B N     1 
ATOM   848  C  CA    . LEU B 1 41 ? -26.450 9.614  28.023  1.00 18.87 ? 177 LEU B CA    1 
ATOM   849  C  C     . LEU B 1 41 ? -27.810 9.801  27.361  1.00 18.91 ? 177 LEU B C     1 
ATOM   850  O  O     . LEU B 1 41 ? -28.728 9.020  27.620  1.00 19.59 ? 177 LEU B O     1 
ATOM   851  C  CB    . LEU B 1 41 ? -25.418 9.252  26.952  1.00 19.14 ? 177 LEU B CB    1 
ATOM   852  C  CG    . LEU B 1 41 ? -23.968 9.055  27.394  1.00 17.47 ? 177 LEU B CG    1 
ATOM   853  C  CD1   . LEU B 1 41 ? -23.145 8.593  26.201  1.00 19.19 ? 177 LEU B CD1   1 
ATOM   854  C  CD2   . LEU B 1 41 ? -23.416 10.351 27.964  1.00 18.09 ? 177 LEU B CD2   1 
ATOM   855  N  N     . THR B 1 42 ? -27.958 10.819 26.520  1.00 17.78 ? 178 THR B N     1 
ATOM   856  C  CA    . THR B 1 42 ? -29.240 11.029 25.856  1.00 18.95 ? 178 THR B CA    1 
ATOM   857  C  C     . THR B 1 42 ? -29.249 10.268 24.541  1.00 19.61 ? 178 THR B C     1 
ATOM   858  O  O     . THR B 1 42 ? -28.192 9.983  23.980  1.00 19.02 ? 178 THR B O     1 
ATOM   859  C  CB    . THR B 1 42 ? -29.521 12.529 25.572  1.00 18.57 ? 178 THR B CB    1 
ATOM   860  O  OG1   . THR B 1 42 ? -28.651 13.009 24.542  1.00 18.77 ? 178 THR B OG1   1 
ATOM   861  C  CG2   . THR B 1 42 ? -29.304 13.355 26.832  1.00 19.95 ? 178 THR B CG2   1 
ATOM   862  N  N     . SER B 1 43 ? -30.443 9.929  24.058  1.00 20.92 ? 179 SER B N     1 
ATOM   863  C  CA    . SER B 1 43 ? -30.589 9.202  22.798  1.00 19.80 ? 179 SER B CA    1 
ATOM   864  C  C     . SER B 1 43 ? -29.820 9.919  21.704  1.00 19.37 ? 179 SER B C     1 
ATOM   865  O  O     . SER B 1 43 ? -29.092 9.295  20.934  1.00 18.46 ? 179 SER B O     1 
ATOM   866  C  CB    . SER B 1 43 ? -32.060 9.129  22.400  1.00 20.19 ? 179 SER B CB    1 
ATOM   867  O  OG    . SER B 1 43 ? -32.815 8.495  23.407  1.00 25.06 ? 179 SER B OG    1 
ATOM   868  N  N     . THR B 1 44 ? -30.000 11.238 21.654  1.00 18.79 ? 180 THR B N     1 
ATOM   869  C  CA    . THR B 1 44 ? -29.352 12.091 20.668  1.00 18.33 ? 180 THR B CA    1 
ATOM   870  C  C     . THR B 1 44 ? -27.837 12.002 20.744  1.00 17.47 ? 180 THR B C     1 
ATOM   871  O  O     . THR B 1 44 ? -27.164 11.969 19.710  1.00 16.11 ? 180 THR B O     1 
ATOM   872  C  CB    . THR B 1 44 ? -29.777 13.559 20.851  1.00 18.60 ? 180 THR B CB    1 
ATOM   873  O  OG1   . THR B 1 44 ? -31.202 13.652 20.727  1.00 20.74 ? 180 THR B OG1   1 
ATOM   874  C  CG2   . THR B 1 44 ? -29.118 14.450 19.797  1.00 17.44 ? 180 THR B CG2   1 
ATOM   875  N  N     . GLN B 1 45 ? -27.299 11.970 21.962  1.00 17.10 ? 181 GLN B N     1 
ATOM   876  C  CA    . GLN B 1 45 ? -25.852 11.882 22.131  1.00 16.77 ? 181 GLN B CA    1 
ATOM   877  C  C     . GLN B 1 45 ? -25.314 10.601 21.520  1.00 15.97 ? 181 GLN B C     1 
ATOM   878  O  O     . GLN B 1 45 ? -24.267 10.610 20.871  1.00 16.66 ? 181 GLN B O     1 
ATOM   879  C  CB    . GLN B 1 45 ? -25.471 11.968 23.613  1.00 16.84 ? 181 GLN B CB    1 
ATOM   880  C  CG    . GLN B 1 45 ? -25.426 13.399 24.146  1.00 15.96 ? 181 GLN B CG    1 
ATOM   881  C  CD    . GLN B 1 45 ? -25.115 13.463 25.627  1.00 15.88 ? 181 GLN B CD    1 
ATOM   882  O  OE1   . GLN B 1 45 ? -25.747 12.780 26.436  1.00 17.27 ? 181 GLN B OE1   1 
ATOM   883  N  NE2   . GLN B 1 45 ? -24.145 14.294 25.994  1.00 17.15 ? 181 GLN B NE2   1 
ATOM   884  N  N     . VAL B 1 46 ? -26.032 9.502  21.728  1.00 16.52 ? 182 VAL B N     1 
ATOM   885  C  CA    . VAL B 1 46 ? -25.639 8.203  21.176  1.00 17.19 ? 182 VAL B CA    1 
ATOM   886  C  C     . VAL B 1 46 ? -25.731 8.259  19.644  1.00 17.85 ? 182 VAL B C     1 
ATOM   887  O  O     . VAL B 1 46 ? -24.856 7.754  18.941  1.00 18.15 ? 182 VAL B O     1 
ATOM   888  C  CB    . VAL B 1 46 ? -26.548 7.071  21.723  1.00 16.61 ? 182 VAL B CB    1 
ATOM   889  C  CG1   . VAL B 1 46 ? -26.272 5.764  20.993  1.00 16.87 ? 182 VAL B CG1   1 
ATOM   890  C  CG2   . VAL B 1 46 ? -26.299 6.892  23.214  1.00 16.37 ? 182 VAL B CG2   1 
ATOM   891  N  N     . LYS B 1 47 ? -26.789 8.892  19.141  1.00 17.35 ? 183 LYS B N     1 
ATOM   892  C  CA    . LYS B 1 47 ? -27.002 9.055  17.705  1.00 16.22 ? 183 LYS B CA    1 
ATOM   893  C  C     . LYS B 1 47 ? -25.862 9.843  17.065  1.00 15.66 ? 183 LYS B C     1 
ATOM   894  O  O     . LYS B 1 47 ? -25.341 9.455  16.019  1.00 14.19 ? 183 LYS B O     1 
ATOM   895  C  CB    . LYS B 1 47 ? -28.316 9.805  17.449  1.00 18.96 ? 183 LYS B CB    1 
ATOM   896  C  CG    . LYS B 1 47 ? -28.652 9.988  15.975  1.00 20.51 ? 183 LYS B CG    1 
ATOM   897  C  CD    . LYS B 1 47 ? -29.761 10.999 15.773  1.00 21.97 ? 183 LYS B CD    1 
ATOM   898  C  CE    . LYS B 1 47 ? -29.280 12.412 16.054  1.00 22.47 ? 183 LYS B CE    1 
ATOM   899  N  NZ    . LYS B 1 47 ? -30.361 13.412 15.841  1.00 26.37 ? 183 LYS B NZ    1 
ATOM   900  N  N     . ILE B 1 48 ? -25.489 10.959 17.689  1.00 14.17 ? 184 ILE B N     1 
ATOM   901  C  CA    . ILE B 1 48 ? -24.418 11.800 17.165  1.00 13.55 ? 184 ILE B CA    1 
ATOM   902  C  C     . ILE B 1 48 ? -23.051 11.112 17.292  1.00 13.30 ? 184 ILE B C     1 
ATOM   903  O  O     . ILE B 1 48 ? -22.210 11.235 16.395  1.00 12.58 ? 184 ILE B O     1 
ATOM   904  C  CB    . ILE B 1 48 ? -24.404 13.201 17.873  1.00 13.63 ? 184 ILE B CB    1 
ATOM   905  C  CG1   . ILE B 1 48 ? -25.632 14.010 17.443  1.00 14.87 ? 184 ILE B CG1   1 
ATOM   906  C  CG2   . ILE B 1 48 ? -23.144 13.986 17.517  1.00 13.70 ? 184 ILE B CG2   1 
ATOM   907  C  CD1   . ILE B 1 48 ? -25.767 14.199 15.921  1.00 15.07 ? 184 ILE B CD1   1 
ATOM   908  N  N     . TRP B 1 49 ? -22.829 10.379 18.386  1.00 13.69 ? 185 TRP B N     1 
ATOM   909  C  CA    . TRP B 1 49 ? -21.553 9.683  18.558  1.00 13.23 ? 185 TRP B CA    1 
ATOM   910  C  C     . TRP B 1 49 ? -21.329 8.698  17.402  1.00 14.50 ? 185 TRP B C     1 
ATOM   911  O  O     . TRP B 1 49 ? -20.229 8.631  16.837  1.00 14.35 ? 185 TRP B O     1 
ATOM   912  C  CB    . TRP B 1 49 ? -21.497 8.915  19.883  1.00 13.13 ? 185 TRP B CB    1 
ATOM   913  C  CG    . TRP B 1 49 ? -20.128 8.287  20.108  1.00 12.91 ? 185 TRP B CG    1 
ATOM   914  C  CD1   . TRP B 1 49 ? -19.061 8.853  20.747  1.00 13.55 ? 185 TRP B CD1   1 
ATOM   915  C  CD2   . TRP B 1 49 ? -19.671 7.008  19.627  1.00 13.29 ? 185 TRP B CD2   1 
ATOM   916  N  NE1   . TRP B 1 49 ? -17.970 8.013  20.695  1.00 13.65 ? 185 TRP B NE1   1 
ATOM   917  C  CE2   . TRP B 1 49 ? -18.318 6.874  20.017  1.00 13.87 ? 185 TRP B CE2   1 
ATOM   918  C  CE3   . TRP B 1 49 ? -20.275 5.965  18.907  1.00 11.75 ? 185 TRP B CE3   1 
ATOM   919  C  CZ2   . TRP B 1 49 ? -17.559 5.735  19.711  1.00 13.90 ? 185 TRP B CZ2   1 
ATOM   920  C  CZ3   . TRP B 1 49 ? -19.522 4.835  18.603  1.00 12.23 ? 185 TRP B CZ3   1 
ATOM   921  C  CH2   . TRP B 1 49 ? -18.180 4.729  19.006  1.00 13.32 ? 185 TRP B CH2   1 
ATOM   922  N  N     . PHE B 1 50 ? -22.371 7.931  17.065  1.00 14.70 ? 186 PHE B N     1 
ATOM   923  C  CA    . PHE B 1 50 ? -22.299 6.953  15.972  1.00 13.78 ? 186 PHE B CA    1 
ATOM   924  C  C     . PHE B 1 50 ? -22.107 7.654  14.643  1.00 13.56 ? 186 PHE B C     1 
ATOM   925  O  O     . PHE B 1 50 ? -21.343 7.193  13.801  1.00 15.10 ? 186 PHE B O     1 
ATOM   926  C  CB    . PHE B 1 50 ? -23.559 6.081  15.948  1.00 13.08 ? 186 PHE B CB    1 
ATOM   927  C  CG    . PHE B 1 50 ? -23.430 4.832  16.774  1.00 14.58 ? 186 PHE B CG    1 
ATOM   928  C  CD1   . PHE B 1 50 ? -23.021 3.636  16.188  1.00 11.94 ? 186 PHE B CD1   1 
ATOM   929  C  CD2   . PHE B 1 50 ? -23.621 4.870  18.157  1.00 15.95 ? 186 PHE B CD2   1 
ATOM   930  C  CE1   . PHE B 1 50 ? -22.797 2.503  16.962  1.00 13.82 ? 186 PHE B CE1   1 
ATOM   931  C  CE2   . PHE B 1 50 ? -23.396 3.736  18.945  1.00 14.31 ? 186 PHE B CE2   1 
ATOM   932  C  CZ    . PHE B 1 50 ? -22.981 2.551  18.345  1.00 14.54 ? 186 PHE B CZ    1 
ATOM   933  N  N     . GLN B 1 51 ? -22.795 8.781  14.469  1.00 13.86 ? 187 GLN B N     1 
ATOM   934  C  CA    . GLN B 1 51 ? -22.684 9.583  13.255  1.00 13.30 ? 187 GLN B CA    1 
ATOM   935  C  C     . GLN B 1 51 ? -21.249 10.078 13.057  1.00 13.72 ? 187 GLN B C     1 
ATOM   936  O  O     . GLN B 1 51 ? -20.692 9.976  11.963  1.00 13.48 ? 187 GLN B O     1 
ATOM   937  C  CB    . GLN B 1 51 ? -23.632 10.773 13.344  1.00 15.72 ? 187 GLN B CB    1 
ATOM   938  C  CG    . GLN B 1 51 ? -23.493 11.778 12.223  1.00 17.63 ? 187 GLN B CG    1 
ATOM   939  C  CD    . GLN B 1 51 ? -24.595 12.813 12.266  1.00 20.18 ? 187 GLN B CD    1 
ATOM   940  O  OE1   . GLN B 1 51 ? -25.759 12.508 11.985  1.00 19.58 ? 187 GLN B OE1   1 
ATOM   941  N  NE2   . GLN B 1 51 ? -24.239 14.045 12.635  1.00 20.31 ? 187 GLN B NE2   1 
ATOM   942  N  N     . ASN B 1 52 ? -20.652 10.621 14.116  1.00 14.17 ? 188 ASN B N     1 
ATOM   943  C  CA    . ASN B 1 52 ? -19.275 11.110 14.037  1.00 13.91 ? 188 ASN B CA    1 
ATOM   944  C  C     . ASN B 1 52 ? -18.319 9.931  13.894  1.00 13.15 ? 188 ASN B C     1 
ATOM   945  O  O     . ASN B 1 52 ? -17.274 10.047 13.256  1.00 14.27 ? 188 ASN B O     1 
ATOM   946  C  CB    . ASN B 1 52 ? -18.895 11.904 15.296  1.00 14.46 ? 188 ASN B CB    1 
ATOM   947  C  CG    . ASN B 1 52 ? -19.660 13.210 15.425  1.00 14.30 ? 188 ASN B CG    1 
ATOM   948  O  OD1   . ASN B 1 52 ? -19.757 13.985 14.473  1.00 14.30 ? 188 ASN B OD1   1 
ATOM   949  N  ND2   . ASN B 1 52 ? -20.189 13.468 16.613  1.00 16.32 ? 188 ASN B ND2   1 
ATOM   950  N  N     . ARG B 1 53 ? -18.677 8.801  14.499  1.00 12.42 ? 189 ARG B N     1 
ATOM   951  C  CA    . ARG B 1 53 ? -17.839 7.612  14.447  1.00 13.86 ? 189 ARG B CA    1 
ATOM   952  C  C     . ARG B 1 53 ? -17.774 7.030  13.032  1.00 14.29 ? 189 ARG B C     1 
ATOM   953  O  O     . ARG B 1 53 ? -16.710 6.590  12.590  1.00 14.47 ? 189 ARG B O     1 
ATOM   954  C  CB    . ARG B 1 53 ? -18.349 6.566  15.438  1.00 13.37 ? 189 ARG B CB    1 
ATOM   955  C  CG    . ARG B 1 53 ? -17.370 5.434  15.678  1.00 16.25 ? 189 ARG B CG    1 
ATOM   956  C  CD    . ARG B 1 53 ? -16.071 5.936  16.309  1.00 20.19 ? 189 ARG B CD    1 
ATOM   957  N  NE    . ARG B 1 53 ? -15.148 4.834  16.550  1.00 23.08 ? 189 ARG B NE    1 
ATOM   958  C  CZ    . ARG B 1 53 ? -14.537 4.155  15.584  1.00 26.32 ? 189 ARG B CZ    1 
ATOM   959  N  NH1   . ARG B 1 53 ? -14.747 4.475  14.309  1.00 28.44 ? 189 ARG B NH1   1 
ATOM   960  N  NH2   . ARG B 1 53 ? -13.734 3.142  15.888  1.00 28.31 ? 189 ARG B NH2   1 
ATOM   961  N  N     . ARG B 1 54 ? -18.906 7.028  12.326  1.00 15.24 ? 190 ARG B N     1 
ATOM   962  C  CA    . ARG B 1 54 ? -18.946 6.531  10.947  1.00 14.87 ? 190 ARG B CA    1 
ATOM   963  C  C     . ARG B 1 54 ? -18.127 7.494  10.077  1.00 16.99 ? 190 ARG B C     1 
ATOM   964  O  O     . ARG B 1 54 ? -17.457 7.076  9.132   1.00 19.77 ? 190 ARG B O     1 
ATOM   965  C  CB    . ARG B 1 54 ? -20.373 6.517  10.374  1.00 10.63 ? 190 ARG B CB    1 
ATOM   966  C  CG    . ARG B 1 54 ? -21.408 5.630  11.025  1.00 6.88  ? 190 ARG B CG    1 
ATOM   967  C  CD    . ARG B 1 54 ? -22.787 6.086  10.481  1.00 6.22  ? 190 ARG B CD    1 
ATOM   968  N  NE    . ARG B 1 54 ? -23.867 5.899  11.450  1.00 13.70 ? 190 ARG B NE    1 
ATOM   969  C  CZ    . ARG B 1 54 ? -24.821 6.785  11.720  1.00 10.96 ? 190 ARG B CZ    1 
ATOM   970  N  NH1   . ARG B 1 54 ? -24.874 7.957  11.118  1.00 13.56 ? 190 ARG B NH1   1 
ATOM   971  N  NH2   . ARG B 1 54 ? -25.744 6.483  12.604  1.00 23.01 ? 190 ARG B NH2   1 
ATOM   972  N  N     . TYR B 1 55 ? -18.205 8.786  10.386  1.00 17.47 ? 191 TYR B N     1 
ATOM   973  C  CA    . TYR B 1 55 ? -17.482 9.801  9.621   1.00 18.80 ? 191 TYR B CA    1 
ATOM   974  C  C     . TYR B 1 55 ? -15.976 9.695  9.834   1.00 21.43 ? 191 TYR B C     1 
ATOM   975  O  O     . TYR B 1 55 ? -15.203 9.722  8.870   1.00 22.91 ? 191 TYR B O     1 
ATOM   976  C  CB    . TYR B 1 55 ? -17.942 11.208 10.016  1.00 19.06 ? 191 TYR B CB    1 
ATOM   977  C  CG    . TYR B 1 55 ? -17.256 12.296 9.219   1.00 19.92 ? 191 TYR B CG    1 
ATOM   978  C  CD1   . TYR B 1 55 ? -17.621 12.553 7.896   1.00 19.80 ? 191 TYR B CD1   1 
ATOM   979  C  CD2   . TYR B 1 55 ? -16.200 13.028 9.767   1.00 20.73 ? 191 TYR B CD2   1 
ATOM   980  C  CE1   . TYR B 1 55 ? -16.947 13.512 7.131   1.00 21.62 ? 191 TYR B CE1   1 
ATOM   981  C  CE2   . TYR B 1 55 ? -15.521 13.990 9.013   1.00 22.38 ? 191 TYR B CE2   1 
ATOM   982  C  CZ    . TYR B 1 55 ? -15.899 14.222 7.696   1.00 22.45 ? 191 TYR B CZ    1 
ATOM   983  O  OH    . TYR B 1 55 ? -15.218 15.147 6.941   1.00 22.83 ? 191 TYR B OH    1 
ATOM   984  N  N     . LYS B 1 56 ? -15.572 9.588  11.099  1.00 23.08 ? 192 LYS B N     1 
ATOM   985  C  CA    . LYS B 1 56 ? -14.167 9.473  11.481  1.00 26.97 ? 192 LYS B CA    1 
ATOM   986  C  C     . LYS B 1 56 ? -13.541 8.251  10.821  1.00 28.68 ? 192 LYS B C     1 
ATOM   987  O  O     . LYS B 1 56 ? -12.432 8.320  10.292  1.00 29.57 ? 192 LYS B O     1 
ATOM   988  C  CB    . LYS B 1 56 ? -14.041 9.354  13.006  1.00 28.25 ? 192 LYS B CB    1 
ATOM   989  C  CG    . LYS B 1 56 ? -14.453 10.607 13.785  1.00 31.64 ? 192 LYS B CG    1 
ATOM   990  C  CD    . LYS B 1 56 ? -14.534 10.318 15.290  1.00 34.58 ? 192 LYS B CD    1 
ATOM   991  C  CE    . LYS B 1 56 ? -14.964 11.549 16.090  1.00 35.66 ? 192 LYS B CE    1 
ATOM   992  N  NZ    . LYS B 1 56 ? -15.360 11.249 17.510  1.00 35.51 ? 192 LYS B NZ    1 
ATOM   993  N  N     . SER B 1 57 ? -14.257 7.133  10.853  1.00 30.11 ? 193 SER B N     1 
ATOM   994  C  CA    . SER B 1 57 ? -13.770 5.898  10.252  1.00 31.75 ? 193 SER B CA    1 
ATOM   995  C  C     . SER B 1 57 ? -13.922 5.950  8.732   1.00 33.24 ? 193 SER B C     1 
ATOM   996  O  O     . SER B 1 57 ? -14.838 5.281  8.201   1.00 34.63 ? 193 SER B O     1 
ATOM   997  C  CB    . SER B 1 57 ? -14.537 4.699  10.812  1.00 30.98 ? 193 SER B CB    1 
ATOM   998  O  OG    . SER B 1 57 ? -15.883 4.722  10.385  1.00 31.66 ? 193 SER B OG    1 
ATOM   999  O  "O5'" . DT  C 2 1  ? -64.476 15.847 -3.880  1.00 28.59 ? 1   DT  C "O5'" 1 
ATOM   1000 C  "C5'" . DT  C 2 1  ? -64.794 15.502 -5.229  1.00 25.71 ? 1   DT  C "C5'" 1 
ATOM   1001 C  "C4'" . DT  C 2 1  ? -63.581 15.594 -6.124  1.00 25.68 ? 1   DT  C "C4'" 1 
ATOM   1002 O  "O4'" . DT  C 2 1  ? -63.121 16.962 -6.190  1.00 25.80 ? 1   DT  C "O4'" 1 
ATOM   1003 C  "C3'" . DT  C 2 1  ? -62.380 14.773 -5.662  1.00 25.55 ? 1   DT  C "C3'" 1 
ATOM   1004 O  "O3'" . DT  C 2 1  ? -61.735 14.201 -6.803  1.00 25.02 ? 1   DT  C "O3'" 1 
ATOM   1005 C  "C2'" . DT  C 2 1  ? -61.485 15.798 -4.980  1.00 24.43 ? 1   DT  C "C2'" 1 
ATOM   1006 C  "C1'" . DT  C 2 1  ? -61.753 17.044 -5.804  1.00 25.42 ? 1   DT  C "C1'" 1 
ATOM   1007 N  N1    . DT  C 2 1  ? -61.574 18.334 -5.112  1.00 24.38 ? 1   DT  C N1    1 
ATOM   1008 C  C2    . DT  C 2 1  ? -60.748 19.269 -5.691  1.00 24.80 ? 1   DT  C C2    1 
ATOM   1009 O  O2    . DT  C 2 1  ? -60.094 19.047 -6.698  1.00 24.74 ? 1   DT  C O2    1 
ATOM   1010 N  N3    . DT  C 2 1  ? -60.714 20.482 -5.045  1.00 25.48 ? 1   DT  C N3    1 
ATOM   1011 C  C4    . DT  C 2 1  ? -61.401 20.836 -3.898  1.00 26.45 ? 1   DT  C C4    1 
ATOM   1012 O  O4    . DT  C 2 1  ? -61.302 21.981 -3.451  1.00 29.11 ? 1   DT  C O4    1 
ATOM   1013 C  C5    . DT  C 2 1  ? -62.215 19.786 -3.320  1.00 25.64 ? 1   DT  C C5    1 
ATOM   1014 C  C7    . DT  C 2 1  ? -62.979 20.066 -2.065  1.00 23.72 ? 1   DT  C C7    1 
ATOM   1015 C  C6    . DT  C 2 1  ? -62.251 18.602 -3.944  1.00 24.45 ? 1   DT  C C6    1 
ATOM   1016 P  P     . DG  C 2 2  ? -60.956 12.808 -6.651  1.00 27.14 ? 2   DG  C P     1 
ATOM   1017 O  OP1   . DG  C 2 2  ? -60.972 12.082 -7.949  1.00 26.74 ? 2   DG  C OP1   1 
ATOM   1018 O  OP2   . DG  C 2 2  ? -61.476 12.147 -5.428  1.00 25.57 ? 2   DG  C OP2   1 
ATOM   1019 O  "O5'" . DG  C 2 2  ? -59.462 13.250 -6.322  1.00 23.83 ? 2   DG  C "O5'" 1 
ATOM   1020 C  "C5'" . DG  C 2 2  ? -58.677 13.960 -7.268  1.00 18.58 ? 2   DG  C "C5'" 1 
ATOM   1021 C  "C4'" . DG  C 2 2  ? -57.444 14.508 -6.595  1.00 16.79 ? 2   DG  C "C4'" 1 
ATOM   1022 O  "O4'" . DG  C 2 2  ? -57.795 15.646 -5.774  1.00 15.81 ? 2   DG  C "O4'" 1 
ATOM   1023 C  "C3'" . DG  C 2 2  ? -56.734 13.520 -5.663  1.00 16.95 ? 2   DG  C "C3'" 1 
ATOM   1024 O  "O3'" . DG  C 2 2  ? -55.327 13.722 -5.775  1.00 18.21 ? 2   DG  C "O3'" 1 
ATOM   1025 C  "C2'" . DG  C 2 2  ? -57.163 13.986 -4.282  1.00 17.31 ? 2   DG  C "C2'" 1 
ATOM   1026 C  "C1'" . DG  C 2 2  ? -57.191 15.484 -4.504  1.00 15.63 ? 2   DG  C "C1'" 1 
ATOM   1027 N  N9    . DG  C 2 2  ? -57.935 16.280 -3.535  1.00 15.86 ? 2   DG  C N9    1 
ATOM   1028 C  C8    . DG  C 2 2  ? -58.751 15.823 -2.528  1.00 15.72 ? 2   DG  C C8    1 
ATOM   1029 N  N7    . DG  C 2 2  ? -59.268 16.784 -1.813  1.00 19.52 ? 2   DG  C N7    1 
ATOM   1030 C  C5    . DG  C 2 2  ? -58.767 17.948 -2.387  1.00 18.88 ? 2   DG  C C5    1 
ATOM   1031 C  C6    . DG  C 2 2  ? -58.981 19.311 -2.044  1.00 18.84 ? 2   DG  C C6    1 
ATOM   1032 O  O6    . DG  C 2 2  ? -59.691 19.779 -1.143  1.00 22.71 ? 2   DG  C O6    1 
ATOM   1033 N  N1    . DG  C 2 2  ? -58.270 20.166 -2.881  1.00 18.17 ? 2   DG  C N1    1 
ATOM   1034 C  C2    . DG  C 2 2  ? -57.462 19.766 -3.920  1.00 17.34 ? 2   DG  C C2    1 
ATOM   1035 N  N2    . DG  C 2 2  ? -56.844 20.749 -4.604  1.00 16.15 ? 2   DG  C N2    1 
ATOM   1036 N  N3    . DG  C 2 2  ? -57.270 18.501 -4.260  1.00 14.77 ? 2   DG  C N3    1 
ATOM   1037 C  C4    . DG  C 2 2  ? -57.944 17.652 -3.453  1.00 16.00 ? 2   DG  C C4    1 
ATOM   1038 P  P     . DA  C 2 3  ? -54.331 12.468 -5.882  1.00 17.78 ? 3   DA  C P     1 
ATOM   1039 O  OP1   . DA  C 2 3  ? -54.923 11.493 -6.829  1.00 18.81 ? 3   DA  C OP1   1 
ATOM   1040 O  OP2   . DA  C 2 3  ? -53.932 12.016 -4.525  1.00 15.80 ? 3   DA  C OP2   1 
ATOM   1041 O  "O5'" . DA  C 2 3  ? -53.049 13.136 -6.558  1.00 18.67 ? 3   DA  C "O5'" 1 
ATOM   1042 C  "C5'" . DA  C 2 3  ? -53.175 13.942 -7.734  1.00 16.10 ? 3   DA  C "C5'" 1 
ATOM   1043 C  "C4'" . DA  C 2 3  ? -52.444 15.252 -7.557  1.00 14.91 ? 3   DA  C "C4'" 1 
ATOM   1044 O  "O4'" . DA  C 2 3  ? -53.158 16.083 -6.612  1.00 14.72 ? 3   DA  C "O4'" 1 
ATOM   1045 C  "C3'" . DA  C 2 3  ? -51.014 15.137 -7.026  1.00 16.52 ? 3   DA  C "C3'" 1 
ATOM   1046 O  "O3'" . DA  C 2 3  ? -50.173 16.070 -7.714  1.00 18.27 ? 3   DA  C "O3'" 1 
ATOM   1047 C  "C2'" . DA  C 2 3  ? -51.146 15.494 -5.555  1.00 14.23 ? 3   DA  C "C2'" 1 
ATOM   1048 C  "C1'" . DA  C 2 3  ? -52.309 16.476 -5.544  1.00 13.70 ? 3   DA  C "C1'" 1 
ATOM   1049 N  N9    . DA  C 2 3  ? -53.111 16.445 -4.319  1.00 13.64 ? 3   DA  C N9    1 
ATOM   1050 C  C8    . DA  C 2 3  ? -53.514 15.332 -3.615  1.00 10.71 ? 3   DA  C C8    1 
ATOM   1051 N  N7    . DA  C 2 3  ? -54.232 15.608 -2.555  1.00 13.50 ? 3   DA  C N7    1 
ATOM   1052 C  C5    . DA  C 2 3  ? -54.307 16.997 -2.554  1.00 13.06 ? 3   DA  C C5    1 
ATOM   1053 C  C6    . DA  C 2 3  ? -54.920 17.914 -1.676  1.00 11.84 ? 3   DA  C C6    1 
ATOM   1054 N  N6    . DA  C 2 3  ? -55.603 17.552 -0.584  1.00 13.37 ? 3   DA  C N6    1 
ATOM   1055 N  N1    . DA  C 2 3  ? -54.804 19.229 -1.961  1.00 11.80 ? 3   DA  C N1    1 
ATOM   1056 C  C2    . DA  C 2 3  ? -54.116 19.591 -3.049  1.00 10.27 ? 3   DA  C C2    1 
ATOM   1057 N  N3    . DA  C 2 3  ? -53.495 18.832 -3.944  1.00 14.02 ? 3   DA  C N3    1 
ATOM   1058 C  C4    . DA  C 2 3  ? -53.626 17.526 -3.637  1.00 13.54 ? 3   DA  C C4    1 
ATOM   1059 P  P     . DA  C 2 4  ? -48.595 16.111 -7.402  1.00 19.37 ? 4   DA  C P     1 
ATOM   1060 O  OP1   . DA  C 2 4  ? -47.907 16.331 -8.692  1.00 18.06 ? 4   DA  C OP1   1 
ATOM   1061 O  OP2   . DA  C 2 4  ? -48.210 14.946 -6.556  1.00 18.49 ? 4   DA  C OP2   1 
ATOM   1062 O  "O5'" . DA  C 2 4  ? -48.453 17.414 -6.498  1.00 18.15 ? 4   DA  C "O5'" 1 
ATOM   1063 C  "C5'" . DA  C 2 4  ? -49.043 18.640 -6.905  1.00 18.38 ? 4   DA  C "C5'" 1 
ATOM   1064 C  "C4'" . DA  C 2 4  ? -49.053 19.621 -5.758  1.00 18.52 ? 4   DA  C "C4'" 1 
ATOM   1065 O  "O4'" . DA  C 2 4  ? -50.028 19.237 -4.758  1.00 16.36 ? 4   DA  C "O4'" 1 
ATOM   1066 C  "C3'" . DA  C 2 4  ? -47.719 19.768 -5.020  1.00 19.03 ? 4   DA  C "C3'" 1 
ATOM   1067 O  "O3'" . DA  C 2 4  ? -47.485 21.154 -4.770  1.00 20.54 ? 4   DA  C "O3'" 1 
ATOM   1068 C  "C2'" . DA  C 2 4  ? -47.963 19.043 -3.709  1.00 18.15 ? 4   DA  C "C2'" 1 
ATOM   1069 C  "C1'" . DA  C 2 4  ? -49.427 19.354 -3.483  1.00 16.77 ? 4   DA  C "C1'" 1 
ATOM   1070 N  N9    . DA  C 2 4  ? -50.127 18.465 -2.558  1.00 15.64 ? 4   DA  C N9    1 
ATOM   1071 C  C8    . DA  C 2 4  ? -50.118 17.093 -2.491  1.00 14.22 ? 4   DA  C C8    1 
ATOM   1072 N  N7    . DA  C 2 4  ? -50.851 16.608 -1.518  1.00 14.18 ? 4   DA  C N7    1 
ATOM   1073 C  C5    . DA  C 2 4  ? -51.377 17.738 -0.903  1.00 15.17 ? 4   DA  C C5    1 
ATOM   1074 C  C6    . DA  C 2 4  ? -52.238 17.911 0.201   1.00 14.58 ? 4   DA  C C6    1 
ATOM   1075 N  N6    . DA  C 2 4  ? -52.735 16.907 0.931   1.00 14.63 ? 4   DA  C N6    1 
ATOM   1076 N  N1    . DA  C 2 4  ? -52.574 19.177 0.538   1.00 15.98 ? 4   DA  C N1    1 
ATOM   1077 C  C2    . DA  C 2 4  ? -52.071 20.187 -0.177  1.00 13.42 ? 4   DA  C C2    1 
ATOM   1078 N  N3    . DA  C 2 4  ? -51.250 20.153 -1.220  1.00 15.50 ? 4   DA  C N3    1 
ATOM   1079 C  C4    . DA  C 2 4  ? -50.942 18.885 -1.540  1.00 13.79 ? 4   DA  C C4    1 
ATOM   1080 P  P     . DG  C 2 5  ? -46.082 21.635 -4.154  1.00 22.27 ? 5   DG  C P     1 
ATOM   1081 O  OP1   . DG  C 2 5  ? -45.528 22.615 -5.117  1.00 22.10 ? 5   DG  C OP1   1 
ATOM   1082 O  OP2   . DG  C 2 5  ? -45.278 20.457 -3.749  1.00 21.79 ? 5   DG  C OP2   1 
ATOM   1083 O  "O5'" . DG  C 2 5  ? -46.511 22.436 -2.850  1.00 21.75 ? 5   DG  C "O5'" 1 
ATOM   1084 C  "C5'" . DG  C 2 5  ? -47.355 23.570 -2.967  1.00 22.14 ? 5   DG  C "C5'" 1 
ATOM   1085 C  "C4'" . DG  C 2 5  ? -47.613 24.176 -1.610  1.00 21.35 ? 5   DG  C "C4'" 1 
ATOM   1086 O  "O4'" . DG  C 2 5  ? -48.471 23.312 -0.833  1.00 21.00 ? 5   DG  C "O4'" 1 
ATOM   1087 C  "C3'" . DG  C 2 5  ? -46.367 24.425 -0.763  1.00 21.63 ? 5   DG  C "C3'" 1 
ATOM   1088 O  "O3'" . DG  C 2 5  ? -46.527 25.682 -0.109  1.00 24.39 ? 5   DG  C "O3'" 1 
ATOM   1089 C  "C2'" . DG  C 2 5  ? -46.377 23.277 0.232   1.00 20.70 ? 5   DG  C "C2'" 1 
ATOM   1090 C  "C1'" . DG  C 2 5  ? -47.860 22.996 0.412   1.00 20.87 ? 5   DG  C "C1'" 1 
ATOM   1091 N  N9    . DG  C 2 5  ? -48.182 21.603 0.713   1.00 20.18 ? 5   DG  C N9    1 
ATOM   1092 C  C8    . DG  C 2 5  ? -47.734 20.493 0.039   1.00 17.87 ? 5   DG  C C8    1 
ATOM   1093 N  N7    . DG  C 2 5  ? -48.215 19.377 0.514   1.00 17.40 ? 5   DG  C N7    1 
ATOM   1094 C  C5    . DG  C 2 5  ? -49.028 19.769 1.569   1.00 17.35 ? 5   DG  C C5    1 
ATOM   1095 C  C6    . DG  C 2 5  ? -49.824 18.992 2.453   1.00 18.31 ? 5   DG  C C6    1 
ATOM   1096 O  O6    . DG  C 2 5  ? -49.968 17.764 2.484   1.00 19.40 ? 5   DG  C O6    1 
ATOM   1097 N  N1    . DG  C 2 5  ? -50.494 19.791 3.375   1.00 18.62 ? 5   DG  C N1    1 
ATOM   1098 C  C2    . DG  C 2 5  ? -50.409 21.158 3.444   1.00 19.19 ? 5   DG  C C2    1 
ATOM   1099 N  N2    . DG  C 2 5  ? -51.126 21.741 4.418   1.00 19.45 ? 5   DG  C N2    1 
ATOM   1100 N  N3    . DG  C 2 5  ? -49.674 21.897 2.622   1.00 18.27 ? 5   DG  C N3    1 
ATOM   1101 C  C4    . DG  C 2 5  ? -49.014 21.140 1.714   1.00 19.10 ? 5   DG  C C4    1 
ATOM   1102 P  P     . DT  C 2 6  ? -45.308 26.331 0.711   1.00 23.56 ? 6   DT  C P     1 
ATOM   1103 O  OP1   . DT  C 2 6  ? -45.412 27.804 0.524   1.00 25.55 ? 6   DT  C OP1   1 
ATOM   1104 O  OP2   . DT  C 2 6  ? -44.045 25.636 0.372   1.00 23.72 ? 6   DT  C OP2   1 
ATOM   1105 O  "O5'" . DT  C 2 6  ? -45.703 25.997 2.210   1.00 24.77 ? 6   DT  C "O5'" 1 
ATOM   1106 C  "C5'" . DT  C 2 6  ? -46.983 26.376 2.709   1.00 26.24 ? 6   DT  C "C5'" 1 
ATOM   1107 C  "C4'" . DT  C 2 6  ? -47.147 25.919 4.137   1.00 27.84 ? 6   DT  C "C4'" 1 
ATOM   1108 O  "O4'" . DT  C 2 6  ? -47.543 24.527 4.204   1.00 28.06 ? 6   DT  C "O4'" 1 
ATOM   1109 C  "C3'" . DT  C 2 6  ? -45.883 26.051 4.987   1.00 29.71 ? 6   DT  C "C3'" 1 
ATOM   1110 O  "O3'" . DT  C 2 6  ? -46.224 26.659 6.233   1.00 33.47 ? 6   DT  C "O3'" 1 
ATOM   1111 C  "C2'" . DT  C 2 6  ? -45.421 24.612 5.171   1.00 27.85 ? 6   DT  C "C2'" 1 
ATOM   1112 C  "C1'" . DT  C 2 6  ? -46.739 23.859 5.160   1.00 25.18 ? 6   DT  C "C1'" 1 
ATOM   1113 N  N1    . DT  C 2 6  ? -46.685 22.425 4.799   1.00 22.96 ? 6   DT  C N1    1 
ATOM   1114 C  C2    . DT  C 2 6  ? -47.470 21.559 5.537   1.00 22.05 ? 6   DT  C C2    1 
ATOM   1115 O  O2    . DT  C 2 6  ? -48.178 21.922 6.468   1.00 23.60 ? 6   DT  C O2    1 
ATOM   1116 N  N3    . DT  C 2 6  ? -47.393 20.244 5.150   1.00 20.64 ? 6   DT  C N3    1 
ATOM   1117 C  C4    . DT  C 2 6  ? -46.622 19.715 4.137   1.00 19.24 ? 6   DT  C C4    1 
ATOM   1118 O  O4    . DT  C 2 6  ? -46.663 18.506 3.907   1.00 19.08 ? 6   DT  C O4    1 
ATOM   1119 C  C5    . DT  C 2 6  ? -45.808 20.670 3.415   1.00 19.82 ? 6   DT  C C5    1 
ATOM   1120 C  C7    . DT  C 2 6  ? -44.917 20.174 2.317   1.00 18.75 ? 6   DT  C C7    1 
ATOM   1121 C  C6    . DT  C 2 6  ? -45.886 21.964 3.770   1.00 20.60 ? 6   DT  C C6    1 
ATOM   1122 P  P     . DG  C 2 7  ? -45.106 27.457 7.068   1.00 35.05 ? 7   DG  C P     1 
ATOM   1123 O  OP1   . DG  C 2 7  ? -45.729 28.709 7.566   1.00 35.23 ? 7   DG  C OP1   1 
ATOM   1124 O  OP2   . DG  C 2 7  ? -43.858 27.524 6.262   1.00 34.78 ? 7   DG  C OP2   1 
ATOM   1125 O  "O5'" . DG  C 2 7  ? -44.836 26.483 8.299   1.00 36.91 ? 7   DG  C "O5'" 1 
ATOM   1126 C  "C5'" . DG  C 2 7  ? -45.925 25.956 9.059   1.00 37.18 ? 7   DG  C "C5'" 1 
ATOM   1127 C  "C4'" . DG  C 2 7  ? -45.490 24.723 9.816   1.00 37.20 ? 7   DG  C "C4'" 1 
ATOM   1128 O  "O4'" . DG  C 2 7  ? -45.612 23.506 9.031   1.00 35.04 ? 7   DG  C "O4'" 1 
ATOM   1129 C  "C3'" . DG  C 2 7  ? -44.047 24.759 10.328  1.00 38.50 ? 7   DG  C "C3'" 1 
ATOM   1130 O  "O3'" . DG  C 2 7  ? -44.028 24.253 11.662  1.00 42.58 ? 7   DG  C "O3'" 1 
ATOM   1131 C  "C2'" . DG  C 2 7  ? -43.340 23.762 9.427   1.00 36.99 ? 7   DG  C "C2'" 1 
ATOM   1132 C  "C1'" . DG  C 2 7  ? -44.444 22.739 9.269   1.00 34.33 ? 7   DG  C "C1'" 1 
ATOM   1133 N  N9    . DG  C 2 7  ? -44.285 21.753 8.204   1.00 31.94 ? 7   DG  C N9    1 
ATOM   1134 C  C8    . DG  C 2 7  ? -43.557 21.869 7.042   1.00 30.56 ? 7   DG  C C8    1 
ATOM   1135 N  N7    . DG  C 2 7  ? -43.580 20.785 6.313   1.00 29.93 ? 7   DG  C N7    1 
ATOM   1136 C  C5    . DG  C 2 7  ? -44.381 19.904 7.032   1.00 29.06 ? 7   DG  C C5    1 
ATOM   1137 C  C6    . DG  C 2 7  ? -44.774 18.566 6.747   1.00 27.62 ? 7   DG  C C6    1 
ATOM   1138 O  O6    . DG  C 2 7  ? -44.482 17.867 5.771   1.00 28.37 ? 7   DG  C O6    1 
ATOM   1139 N  N1    . DG  C 2 7  ? -45.589 18.048 7.750   1.00 26.81 ? 7   DG  C N1    1 
ATOM   1140 C  C2    . DG  C 2 7  ? -45.970 18.720 8.881   1.00 25.70 ? 7   DG  C C2    1 
ATOM   1141 N  N2    . DG  C 2 7  ? -46.739 18.044 9.739   1.00 25.81 ? 7   DG  C N2    1 
ATOM   1142 N  N3    . DG  C 2 7  ? -45.618 19.962 9.156   1.00 27.10 ? 7   DG  C N3    1 
ATOM   1143 C  C4    . DG  C 2 7  ? -44.828 20.489 8.196   1.00 29.17 ? 7   DG  C C4    1 
ATOM   1144 P  P     . DG  C 2 8  ? -42.819 24.628 12.648  1.00 43.05 ? 8   DG  C P     1 
ATOM   1145 O  OP1   . DG  C 2 8  ? -42.863 26.088 12.911  1.00 42.98 ? 8   DG  C OP1   1 
ATOM   1146 O  OP2   . DG  C 2 8  ? -41.569 24.009 12.125  1.00 41.76 ? 8   DG  C OP2   1 
ATOM   1147 O  "O5'" . DG  C 2 8  ? -43.229 23.869 13.983  1.00 43.72 ? 8   DG  C "O5'" 1 
ATOM   1148 C  "C5'" . DG  C 2 8  ? -44.309 22.931 13.987  1.00 43.55 ? 8   DG  C "C5'" 1 
ATOM   1149 C  "C4'" . DG  C 2 8  ? -43.806 21.579 14.435  1.00 44.02 ? 8   DG  C "C4'" 1 
ATOM   1150 O  "O4'" . DG  C 2 8  ? -43.953 20.608 13.361  1.00 42.52 ? 8   DG  C "O4'" 1 
ATOM   1151 C  "C3'" . DG  C 2 8  ? -42.318 21.608 14.795  1.00 44.26 ? 8   DG  C "C3'" 1 
ATOM   1152 O  "O3'" . DG  C 2 8  ? -42.043 20.899 16.003  1.00 47.46 ? 8   DG  C "O3'" 1 
ATOM   1153 C  "C2'" . DG  C 2 8  ? -41.651 20.919 13.624  1.00 44.15 ? 8   DG  C "C2'" 1 
ATOM   1154 C  "C1'" . DG  C 2 8  ? -42.717 19.939 13.169  1.00 42.04 ? 8   DG  C "C1'" 1 
ATOM   1155 N  N9    . DG  C 2 8  ? -42.562 19.601 11.756  1.00 39.40 ? 8   DG  C N9    1 
ATOM   1156 C  C8    . DG  C 2 8  ? -42.029 20.406 10.777  1.00 38.07 ? 8   DG  C C8    1 
ATOM   1157 N  N7    . DG  C 2 8  ? -41.875 19.793 9.637   1.00 36.89 ? 8   DG  C N7    1 
ATOM   1158 C  C5    . DG  C 2 8  ? -42.365 18.516 9.864   1.00 33.82 ? 8   DG  C C5    1 
ATOM   1159 C  C6    . DG  C 2 8  ? -42.429 17.402 9.005   1.00 29.84 ? 8   DG  C C6    1 
ATOM   1160 O  O6    . DG  C 2 8  ? -42.040 17.314 7.839   1.00 29.31 ? 8   DG  C O6    1 
ATOM   1161 N  N1    . DG  C 2 8  ? -43.004 16.303 9.632   1.00 30.33 ? 8   DG  C N1    1 
ATOM   1162 C  C2    . DG  C 2 8  ? -43.455 16.277 10.931  1.00 31.22 ? 8   DG  C C2    1 
ATOM   1163 N  N2    . DG  C 2 8  ? -43.981 15.120 11.358  1.00 28.70 ? 8   DG  C N2    1 
ATOM   1164 N  N3    . DG  C 2 8  ? -43.390 17.312 11.751  1.00 34.27 ? 8   DG  C N3    1 
ATOM   1165 C  C4    . DG  C 2 8  ? -42.833 18.392 11.156  1.00 36.15 ? 8   DG  C C4    1 
ATOM   1166 P  P     . DG  C 2 9  ? -40.591 20.245 16.220  1.00 49.91 ? 9   DG  C P     1 
ATOM   1167 O  OP1   . DG  C 2 9  ? -40.408 20.018 17.678  1.00 50.87 ? 9   DG  C OP1   1 
ATOM   1168 O  OP2   . DG  C 2 9  ? -39.566 21.013 15.463  1.00 49.86 ? 9   DG  C OP2   1 
ATOM   1169 O  "O5'" . DG  C 2 9  ? -40.744 18.838 15.502  1.00 48.88 ? 9   DG  C "O5'" 1 
ATOM   1170 C  "C5'" . DG  C 2 9  ? -39.789 17.822 15.703  1.00 45.95 ? 9   DG  C "C5'" 1 
ATOM   1171 C  "C4'" . DG  C 2 9  ? -40.489 16.520 15.989  1.00 44.10 ? 9   DG  C "C4'" 1 
ATOM   1172 O  "O4'" . DG  C 2 9  ? -41.348 16.209 14.869  1.00 41.96 ? 9   DG  C "O4'" 1 
ATOM   1173 C  "C3'" . DG  C 2 9  ? -39.502 15.371 16.119  1.00 45.03 ? 9   DG  C "C3'" 1 
ATOM   1174 O  "O3'" . DG  C 2 9  ? -39.738 14.578 17.275  1.00 48.15 ? 9   DG  C "O3'" 1 
ATOM   1175 C  "C2'" . DG  C 2 9  ? -39.612 14.595 14.822  1.00 42.99 ? 9   DG  C "C2'" 1 
ATOM   1176 C  "C1'" . DG  C 2 9  ? -40.878 15.083 14.144  1.00 40.28 ? 9   DG  C "C1'" 1 
ATOM   1177 N  N9    . DG  C 2 9  ? -40.544 15.537 12.800  1.00 38.08 ? 9   DG  C N9    1 
ATOM   1178 C  C8    . DG  C 2 9  ? -40.378 16.835 12.383  1.00 36.72 ? 9   DG  C C8    1 
ATOM   1179 N  N7    . DG  C 2 9  ? -40.001 16.928 11.136  1.00 35.06 ? 9   DG  C N7    1 
ATOM   1180 C  C5    . DG  C 2 9  ? -39.934 15.613 10.699  1.00 35.35 ? 9   DG  C C5    1 
ATOM   1181 C  C6    . DG  C 2 9  ? -39.573 15.086 9.436   1.00 35.46 ? 9   DG  C C6    1 
ATOM   1182 O  O6    . DG  C 2 9  ? -39.233 15.697 8.416   1.00 36.07 ? 9   DG  C O6    1 
ATOM   1183 N  N1    . DG  C 2 9  ? -39.630 13.692 9.427   1.00 35.63 ? 9   DG  C N1    1 
ATOM   1184 C  C2    . DG  C 2 9  ? -39.987 12.907 10.498  1.00 36.37 ? 9   DG  C C2    1 
ATOM   1185 N  N2    . DG  C 2 9  ? -39.972 11.577 10.294  1.00 34.45 ? 9   DG  C N2    1 
ATOM   1186 N  N3    . DG  C 2 9  ? -40.331 13.391 11.683  1.00 36.17 ? 9   DG  C N3    1 
ATOM   1187 C  C4    . DG  C 2 9  ? -40.280 14.742 11.711  1.00 36.29 ? 9   DG  C C4    1 
ATOM   1188 P  P     . DG  C 2 10 ? -38.576 14.451 18.378  1.00 50.07 ? 10  DG  C P     1 
ATOM   1189 O  OP1   . DG  C 2 10 ? -39.147 13.773 19.576  1.00 49.85 ? 10  DG  C OP1   1 
ATOM   1190 O  OP2   . DG  C 2 10 ? -37.961 15.797 18.516  1.00 50.84 ? 10  DG  C OP2   1 
ATOM   1191 O  "O5'" . DG  C 2 10 ? -37.489 13.501 17.697  1.00 49.98 ? 10  DG  C "O5'" 1 
ATOM   1192 C  "C5'" . DG  C 2 10 ? -37.048 13.744 16.363  1.00 47.65 ? 10  DG  C "C5'" 1 
ATOM   1193 C  "C4'" . DG  C 2 10 ? -36.743 12.441 15.663  1.00 46.15 ? 10  DG  C "C4'" 1 
ATOM   1194 O  "O4'" . DG  C 2 10 ? -37.300 12.501 14.321  1.00 45.84 ? 10  DG  C "O4'" 1 
ATOM   1195 C  "C3'" . DG  C 2 10 ? -35.242 12.199 15.504  1.00 45.94 ? 10  DG  C "C3'" 1 
ATOM   1196 O  "O3'" . DG  C 2 10 ? -34.873 10.829 15.661  1.00 44.28 ? 10  DG  C "O3'" 1 
ATOM   1197 C  "C2'" . DG  C 2 10 ? -34.966 12.632 14.081  1.00 46.38 ? 10  DG  C "C2'" 1 
ATOM   1198 C  "C1'" . DG  C 2 10 ? -36.271 12.351 13.354  1.00 43.83 ? 10  DG  C "C1'" 1 
ATOM   1199 N  N9    . DG  C 2 10 ? -36.453 13.360 12.318  1.00 39.55 ? 10  DG  C N9    1 
ATOM   1200 C  C8    . DG  C 2 10 ? -36.703 14.698 12.504  1.00 36.74 ? 10  DG  C C8    1 
ATOM   1201 N  N7    . DG  C 2 10 ? -36.643 15.387 11.399  1.00 36.02 ? 10  DG  C N7    1 
ATOM   1202 C  C5    . DG  C 2 10 ? -36.373 14.442 10.418  1.00 35.39 ? 10  DG  C C5    1 
ATOM   1203 C  C6    . DG  C 2 10 ? -36.167 14.595 9.017   1.00 34.05 ? 10  DG  C C6    1 
ATOM   1204 O  O6    . DG  C 2 10 ? -36.154 15.637 8.345   1.00 31.93 ? 10  DG  C O6    1 
ATOM   1205 N  N1    . DG  C 2 10 ? -35.942 13.368 8.397   1.00 33.71 ? 10  DG  C N1    1 
ATOM   1206 C  C2    . DG  C 2 10 ? -35.906 12.152 9.038   1.00 34.34 ? 10  DG  C C2    1 
ATOM   1207 N  N2    . DG  C 2 10 ? -35.681 11.080 8.259   1.00 34.24 ? 10  DG  C N2    1 
ATOM   1208 N  N3    . DG  C 2 10 ? -36.076 11.999 10.342  1.00 35.81 ? 10  DG  C N3    1 
ATOM   1209 C  C4    . DG  C 2 10 ? -36.301 13.178 10.965  1.00 37.09 ? 10  DG  C C4    1 
ATOM   1210 P  P     . DG  C 2 11 ? -33.350 10.386 15.382  1.00 42.27 ? 11  DG  C P     1 
ATOM   1211 O  OP1   . DG  C 2 11 ? -32.864 9.576  16.527  1.00 44.89 ? 11  DG  C OP1   1 
ATOM   1212 O  OP2   . DG  C 2 11 ? -32.575 11.575 14.948  1.00 42.07 ? 11  DG  C OP2   1 
ATOM   1213 O  "O5'" . DG  C 2 11 ? -33.482 9.433  14.121  1.00 41.07 ? 11  DG  C "O5'" 1 
ATOM   1214 C  "C5'" . DG  C 2 11 ? -33.975 9.940  12.895  1.00 36.65 ? 11  DG  C "C5'" 1 
ATOM   1215 C  "C4'" . DG  C 2 11 ? -33.169 9.381  11.752  1.00 33.46 ? 11  DG  C "C4'" 1 
ATOM   1216 O  "O4'" . DG  C 2 11 ? -33.375 10.263 10.625  1.00 32.13 ? 11  DG  C "O4'" 1 
ATOM   1217 C  "C3'" . DG  C 2 11 ? -31.668 9.393  12.034  1.00 31.69 ? 11  DG  C "C3'" 1 
ATOM   1218 O  "O3'" . DG  C 2 11 ? -31.028 8.283  11.410  1.00 29.14 ? 11  DG  C "O3'" 1 
ATOM   1219 C  "C2'" . DG  C 2 11 ? -31.203 10.697 11.423  1.00 31.97 ? 11  DG  C "C2'" 1 
ATOM   1220 C  "C1'" . DG  C 2 11 ? -32.167 10.906 10.268  1.00 30.71 ? 11  DG  C "C1'" 1 
ATOM   1221 N  N9    . DG  C 2 11 ? -32.455 12.319 10.067  1.00 29.15 ? 11  DG  C N9    1 
ATOM   1222 C  C8    . DG  C 2 11 ? -32.846 13.230 11.021  1.00 28.94 ? 11  DG  C C8    1 
ATOM   1223 N  N7    . DG  C 2 11 ? -32.932 14.448 10.560  1.00 28.92 ? 11  DG  C N7    1 
ATOM   1224 C  C5    . DG  C 2 11 ? -32.600 14.329 9.218   1.00 26.91 ? 11  DG  C C5    1 
ATOM   1225 C  C6    . DG  C 2 11 ? -32.502 15.310 8.213   1.00 26.27 ? 11  DG  C C6    1 
ATOM   1226 O  O6    . DG  C 2 11 ? -32.691 16.530 8.307   1.00 30.40 ? 11  DG  C O6    1 
ATOM   1227 N  N1    . DG  C 2 11 ? -32.133 14.755 6.991   1.00 27.38 ? 11  DG  C N1    1 
ATOM   1228 C  C2    . DG  C 2 11 ? -31.885 13.422 6.771   1.00 25.16 ? 11  DG  C C2    1 
ATOM   1229 N  N2    . DG  C 2 11 ? -31.526 13.083 5.531   1.00 26.24 ? 11  DG  C N2    1 
ATOM   1230 N  N3    . DG  C 2 11 ? -31.976 12.494 7.703   1.00 26.18 ? 11  DG  C N3    1 
ATOM   1231 C  C4    . DG  C 2 11 ? -32.329 13.015 8.895   1.00 26.91 ? 11  DG  C C4    1 
ATOM   1232 P  P     . DC  C 2 12 ? -29.509 7.921  11.789  1.00 29.11 ? 12  DC  C P     1 
ATOM   1233 O  OP1   . DC  C 2 12 ? -29.488 6.465  12.054  1.00 31.89 ? 12  DC  C OP1   1 
ATOM   1234 O  OP2   . DC  C 2 12 ? -29.003 8.862  12.819  1.00 27.94 ? 12  DC  C OP2   1 
ATOM   1235 O  "O5'" . DC  C 2 12 ? -28.712 8.189  10.436  1.00 28.76 ? 12  DC  C "O5'" 1 
ATOM   1236 C  "C5'" . DC  C 2 12 ? -29.040 7.475  9.246   1.00 26.66 ? 12  DC  C "C5'" 1 
ATOM   1237 C  "C4'" . DC  C 2 12 ? -28.304 8.062  8.067   1.00 25.94 ? 12  DC  C "C4'" 1 
ATOM   1238 O  "O4'" . DC  C 2 12 ? -28.882 9.353  7.740   1.00 25.03 ? 12  DC  C "O4'" 1 
ATOM   1239 C  "C3'" . DC  C 2 12 ? -26.818 8.307  8.345   1.00 26.86 ? 12  DC  C "C3'" 1 
ATOM   1240 O  "O3'" . DC  C 2 12 ? -25.980 7.830  7.298   1.00 25.87 ? 12  DC  C "O3'" 1 
ATOM   1241 C  "C2'" . DC  C 2 12 ? -26.698 9.815  8.429   1.00 28.24 ? 12  DC  C "C2'" 1 
ATOM   1242 C  "C1'" . DC  C 2 12 ? -27.848 10.310 7.569   1.00 26.61 ? 12  DC  C "C1'" 1 
ATOM   1243 N  N1    . DC  C 2 12 ? -28.327 11.615 8.049   1.00 25.04 ? 12  DC  C N1    1 
ATOM   1244 C  C2    . DC  C 2 12 ? -28.344 12.702 7.170   1.00 23.53 ? 12  DC  C C2    1 
ATOM   1245 O  O2    . DC  C 2 12 ? -28.055 12.517 5.981   1.00 23.42 ? 12  DC  C O2    1 
ATOM   1246 N  N3    . DC  C 2 12 ? -28.677 13.926 7.643   1.00 21.78 ? 12  DC  C N3    1 
ATOM   1247 C  C4    . DC  C 2 12 ? -29.000 14.079 8.932   1.00 22.15 ? 12  DC  C C4    1 
ATOM   1248 N  N4    . DC  C 2 12 ? -29.284 15.312 9.371   1.00 20.00 ? 12  DC  C N4    1 
ATOM   1249 C  C5    . DC  C 2 12 ? -29.039 12.979 9.832   1.00 22.70 ? 12  DC  C C5    1 
ATOM   1250 C  C6    . DC  C 2 12 ? -28.706 11.777 9.353   1.00 24.46 ? 12  DC  C C6    1 
ATOM   1251 P  P     . DC  C 2 13 ? -24.390 8.024  7.413   1.00 23.09 ? 13  DC  C P     1 
ATOM   1252 O  OP1   . DC  C 2 13 ? -23.729 6.873  6.745   1.00 25.99 ? 13  DC  C OP1   1 
ATOM   1253 O  OP2   . DC  C 2 13 ? -24.040 8.364  8.816   1.00 26.10 ? 13  DC  C OP2   1 
ATOM   1254 O  "O5'" . DC  C 2 13 ? -24.128 9.345  6.573   1.00 24.23 ? 13  DC  C "O5'" 1 
ATOM   1255 C  "C5'" . DC  C 2 13 ? -24.609 9.467  5.247   1.00 23.29 ? 13  DC  C "C5'" 1 
ATOM   1256 C  "C4'" . DC  C 2 13 ? -24.027 10.705 4.616   1.00 23.24 ? 13  DC  C "C4'" 1 
ATOM   1257 O  "O4'" . DC  C 2 13 ? -24.692 11.876 5.138   1.00 23.66 ? 13  DC  C "O4'" 1 
ATOM   1258 C  "C3'" . DC  C 2 13 ? -22.548 10.879 4.936   1.00 24.09 ? 13  DC  C "C3'" 1 
ATOM   1259 O  "O3'" . DC  C 2 13 ? -21.856 11.370 3.800   1.00 26.61 ? 13  DC  C "O3'" 1 
ATOM   1260 C  "C2'" . DC  C 2 13 ? -22.544 11.906 6.052   1.00 24.53 ? 13  DC  C "C2'" 1 
ATOM   1261 C  "C1'" . DC  C 2 13 ? -23.741 12.762 5.693   1.00 23.21 ? 13  DC  C "C1'" 1 
ATOM   1262 N  N1    . DC  C 2 13 ? -24.366 13.435 6.838   1.00 23.39 ? 13  DC  C N1    1 
ATOM   1263 C  C2    . DC  C 2 13 ? -24.563 14.815 6.774   1.00 22.92 ? 13  DC  C C2    1 
ATOM   1264 O  O2    . DC  C 2 13 ? -24.211 15.422 5.752   1.00 24.98 ? 13  DC  C O2    1 
ATOM   1265 N  N3    . DC  C 2 13 ? -25.129 15.452 7.824   1.00 22.08 ? 13  DC  C N3    1 
ATOM   1266 C  C4    . DC  C 2 13 ? -25.495 14.760 8.904   1.00 20.72 ? 13  DC  C C4    1 
ATOM   1267 N  N4    . DC  C 2 13 ? -26.053 15.429 9.914   1.00 21.10 ? 13  DC  C N4    1 
ATOM   1268 C  C5    . DC  C 2 13 ? -25.307 13.349 8.994   1.00 22.05 ? 13  DC  C C5    1 
ATOM   1269 C  C6    . DC  C 2 13 ? -24.746 12.733 7.947   1.00 21.87 ? 13  DC  C C6    1 
ATOM   1270 P  P     . DT  C 2 14 ? -20.253 11.416 3.811   1.00 33.18 ? 14  DT  C P     1 
ATOM   1271 O  OP1   . DT  C 2 14 ? -19.797 10.890 2.494   1.00 32.57 ? 14  DT  C OP1   1 
ATOM   1272 O  OP2   . DT  C 2 14 ? -19.719 10.826 5.074   1.00 31.45 ? 14  DT  C OP2   1 
ATOM   1273 O  "O5'" . DT  C 2 14 ? -19.942 12.969 3.873   1.00 31.07 ? 14  DT  C "O5'" 1 
ATOM   1274 C  "C5'" . DT  C 2 14 ? -20.647 13.891 3.054   1.00 30.45 ? 14  DT  C "C5'" 1 
ATOM   1275 C  "C4'" . DT  C 2 14 ? -20.183 15.285 3.383   1.00 30.01 ? 14  DT  C "C4'" 1 
ATOM   1276 O  "O4'" . DT  C 2 14 ? -20.977 15.848 4.459   1.00 30.62 ? 14  DT  C "O4'" 1 
ATOM   1277 C  "C3'" . DT  C 2 14 ? -18.742 15.245 3.885   1.00 30.71 ? 14  DT  C "C3'" 1 
ATOM   1278 O  "O3'" . DT  C 2 14 ? -17.925 16.193 3.217   1.00 32.03 ? 14  DT  C "O3'" 1 
ATOM   1279 C  "C2'" . DT  C 2 14 ? -18.849 15.539 5.371   1.00 29.54 ? 14  DT  C "C2'" 1 
ATOM   1280 C  "C1'" . DT  C 2 14 ? -20.128 16.343 5.486   1.00 28.02 ? 14  DT  C "C1'" 1 
ATOM   1281 N  N1    . DT  C 2 14 ? -20.821 16.172 6.791   1.00 26.56 ? 14  DT  C N1    1 
ATOM   1282 C  C2    . DT  C 2 14 ? -21.530 17.240 7.320   1.00 25.69 ? 14  DT  C C2    1 
ATOM   1283 O  O2    . DT  C 2 14 ? -21.647 18.314 6.759   1.00 24.98 ? 14  DT  C O2    1 
ATOM   1284 N  N3    . DT  C 2 14 ? -22.102 16.996 8.546   1.00 25.30 ? 14  DT  C N3    1 
ATOM   1285 C  C4    . DT  C 2 14 ? -22.040 15.823 9.282   1.00 25.10 ? 14  DT  C C4    1 
ATOM   1286 O  O4    . DT  C 2 14 ? -22.594 15.756 10.378  1.00 24.95 ? 14  DT  C O4    1 
ATOM   1287 C  C5    . DT  C 2 14 ? -21.296 14.747 8.666   1.00 23.71 ? 14  DT  C C5    1 
ATOM   1288 C  C7    . DT  C 2 14 ? -21.180 13.443 9.391   1.00 23.27 ? 14  DT  C C7    1 
ATOM   1289 C  C6    . DT  C 2 14 ? -20.736 14.970 7.468   1.00 24.44 ? 14  DT  C C6    1 
ATOM   1290 P  P     . DC  C 2 15 ? -16.333 16.134 3.410   1.00 32.34 ? 15  DC  C P     1 
ATOM   1291 O  OP1   . DC  C 2 15 ? -15.709 16.179 2.057   1.00 31.28 ? 15  DC  C OP1   1 
ATOM   1292 O  OP2   . DC  C 2 15 ? -15.995 15.020 4.339   1.00 30.45 ? 15  DC  C OP2   1 
ATOM   1293 O  "O5'" . DC  C 2 15 ? -16.059 17.512 4.149   1.00 31.24 ? 15  DC  C "O5'" 1 
ATOM   1294 C  "C5'" . DC  C 2 15 ? -16.748 18.672 3.715   1.00 30.52 ? 15  DC  C "C5'" 1 
ATOM   1295 C  "C4'" . DC  C 2 15 ? -16.807 19.699 4.816   1.00 29.88 ? 15  DC  C "C4'" 1 
ATOM   1296 O  "O4'" . DC  C 2 15 ? -17.707 19.277 5.871   1.00 28.52 ? 15  DC  C "O4'" 1 
ATOM   1297 C  "C3'" . DC  C 2 15 ? -15.467 20.015 5.481   1.00 29.15 ? 15  DC  C "C3'" 1 
ATOM   1298 O  "O3'" . DC  C 2 15 ? -15.261 21.427 5.432   1.00 30.84 ? 15  DC  C "O3'" 1 
ATOM   1299 C  "C2'" . DC  C 2 15 ? -15.638 19.515 6.910   1.00 28.02 ? 15  DC  C "C2'" 1 
ATOM   1300 C  "C1'" . DC  C 2 15 ? -17.139 19.624 7.121   1.00 26.35 ? 15  DC  C "C1'" 1 
ATOM   1301 N  N1    . DC  C 2 15 ? -17.722 18.742 8.154   1.00 23.59 ? 15  DC  C N1    1 
ATOM   1302 C  C2    . DC  C 2 15 ? -18.618 19.301 9.089   1.00 22.99 ? 15  DC  C C2    1 
ATOM   1303 O  O2    . DC  C 2 15 ? -18.879 20.515 9.024   1.00 23.50 ? 15  DC  C O2    1 
ATOM   1304 N  N3    . DC  C 2 15 ? -19.169 18.503 10.040  1.00 21.03 ? 15  DC  C N3    1 
ATOM   1305 C  C4    . DC  C 2 15 ? -18.845 17.204 10.091  1.00 19.19 ? 15  DC  C C4    1 
ATOM   1306 N  N4    . DC  C 2 15 ? -19.389 16.463 11.060  1.00 15.09 ? 15  DC  C N4    1 
ATOM   1307 C  C5    . DC  C 2 15 ? -17.940 16.613 9.152   1.00 19.38 ? 15  DC  C C5    1 
ATOM   1308 C  C6    . DC  C 2 15 ? -17.408 17.411 8.210   1.00 20.37 ? 15  DC  C C6    1 
ATOM   1309 P  P     . DT  C 2 16 ? -13.974 22.074 6.134   1.00 30.66 ? 16  DT  C P     1 
ATOM   1310 O  OP1   . DT  C 2 16 ? -13.658 23.321 5.390   1.00 31.29 ? 16  DT  C OP1   1 
ATOM   1311 O  OP2   . DT  C 2 16 ? -12.917 21.048 6.336   1.00 31.28 ? 16  DT  C OP2   1 
ATOM   1312 O  "O5'" . DT  C 2 16 ? -14.556 22.489 7.547   1.00 28.21 ? 16  DT  C "O5'" 1 
ATOM   1313 C  "C5'" . DT  C 2 16 ? -15.669 23.360 7.619   1.00 26.00 ? 16  DT  C "C5'" 1 
ATOM   1314 C  "C4'" . DT  C 2 16 ? -15.754 23.958 8.998   1.00 26.61 ? 16  DT  C "C4'" 1 
ATOM   1315 O  "O4'" . DT  C 2 16 ? -16.451 23.054 9.885   1.00 25.96 ? 16  DT  C "O4'" 1 
ATOM   1316 C  "C3'" . DT  C 2 16 ? -14.387 24.229 9.627   1.00 28.20 ? 16  DT  C "C3'" 1 
ATOM   1317 O  "O3'" . DT  C 2 16 ? -14.374 25.547 10.176  1.00 31.44 ? 16  DT  C "O3'" 1 
ATOM   1318 C  "C2'" . DT  C 2 16 ? -14.243 23.133 10.671  1.00 26.79 ? 16  DT  C "C2'" 1 
ATOM   1319 C  "C1'" . DT  C 2 16 ? -15.679 22.806 11.045  1.00 24.47 ? 16  DT  C "C1'" 1 
ATOM   1320 N  N1    . DT  C 2 16 ? -15.901 21.398 11.440  1.00 23.23 ? 16  DT  C N1    1 
ATOM   1321 C  C2    . DT  C 2 16 ? -16.845 21.129 12.410  1.00 21.95 ? 16  DT  C C2    1 
ATOM   1322 O  O2    . DT  C 2 16 ? -17.510 21.990 12.959  1.00 23.20 ? 16  DT  C O2    1 
ATOM   1323 N  N3    . DT  C 2 16 ? -16.983 19.801 12.719  1.00 21.14 ? 16  DT  C N3    1 
ATOM   1324 C  C4    . DT  C 2 16 ? -16.294 18.741 12.173  1.00 19.81 ? 16  DT  C C4    1 
ATOM   1325 O  O4    . DT  C 2 16 ? -16.539 17.599 12.552  1.00 19.58 ? 16  DT  C O4    1 
ATOM   1326 C  C5    . DT  C 2 16 ? -15.315 19.095 11.162  1.00 20.70 ? 16  DT  C C5    1 
ATOM   1327 C  C7    . DT  C 2 16 ? -14.512 18.014 10.513  1.00 19.85 ? 16  DT  C C7    1 
ATOM   1328 C  C6    . DT  C 2 16 ? -15.174 20.386 10.851  1.00 20.71 ? 16  DT  C C6    1 
ATOM   1329 P  P     . DT  C 2 17 ? -13.184 26.018 11.149  1.00 32.57 ? 17  DT  C P     1 
ATOM   1330 O  OP1   . DT  C 2 17 ? -12.670 27.300 10.603  1.00 34.10 ? 17  DT  C OP1   1 
ATOM   1331 O  OP2   . DT  C 2 17 ? -12.241 24.903 11.435  1.00 32.82 ? 17  DT  C OP2   1 
ATOM   1332 O  "O5'" . DT  C 2 17 ? -14.008 26.365 12.458  1.00 29.19 ? 17  DT  C "O5'" 1 
ATOM   1333 C  "C5'" . DT  C 2 17 ? -15.386 26.700 12.328  1.00 26.34 ? 17  DT  C "C5'" 1 
ATOM   1334 C  "C4'" . DT  C 2 17 ? -16.077 26.588 13.660  1.00 22.95 ? 17  DT  C "C4'" 1 
ATOM   1335 O  "O4'" . DT  C 2 17 ? -16.319 25.200 13.990  1.00 22.58 ? 17  DT  C "O4'" 1 
ATOM   1336 C  "C3'" . DT  C 2 17 ? -15.241 27.170 14.790  1.00 22.43 ? 17  DT  C "C3'" 1 
ATOM   1337 O  "O3'" . DT  C 2 17 ? -16.052 28.043 15.570  1.00 22.09 ? 17  DT  C "O3'" 1 
ATOM   1338 C  "C2'" . DT  C 2 17 ? -14.738 25.950 15.553  1.00 21.17 ? 17  DT  C "C2'" 1 
ATOM   1339 C  "C1'" . DT  C 2 17 ? -15.806 24.899 15.277  1.00 20.74 ? 17  DT  C "C1'" 1 
ATOM   1340 N  N1    . DT  C 2 17 ? -15.338 23.497 15.241  1.00 17.26 ? 17  DT  C N1    1 
ATOM   1341 C  C2    . DT  C 2 17 ? -15.946 22.577 16.071  1.00 17.02 ? 17  DT  C C2    1 
ATOM   1342 O  O2    . DT  C 2 17 ? -16.816 22.873 16.879  1.00 16.76 ? 17  DT  C O2    1 
ATOM   1343 N  N3    . DT  C 2 17 ? -15.494 21.284 15.924  1.00 15.75 ? 17  DT  C N3    1 
ATOM   1344 C  C4    . DT  C 2 17 ? -14.513 20.833 15.060  1.00 17.88 ? 17  DT  C C4    1 
ATOM   1345 O  O4    . DT  C 2 17 ? -14.230 19.634 15.023  1.00 18.07 ? 17  DT  C O4    1 
ATOM   1346 C  C5    . DT  C 2 17 ? -13.892 21.861 14.242  1.00 18.70 ? 17  DT  C C5    1 
ATOM   1347 C  C7    . DT  C 2 17 ? -12.797 21.477 13.296  1.00 18.60 ? 17  DT  C C7    1 
ATOM   1348 C  C6    . DT  C 2 17 ? -14.332 23.122 14.375  1.00 19.19 ? 17  DT  C C6    1 
ATOM   1349 P  P     . DG  C 2 18 ? -15.378 29.313 16.279  1.00 22.92 ? 18  DG  C P     1 
ATOM   1350 O  OP1   . DG  C 2 18 ? -16.414 30.358 16.471  1.00 21.92 ? 18  DG  C OP1   1 
ATOM   1351 O  OP2   . DG  C 2 18 ? -14.107 29.652 15.578  1.00 21.97 ? 18  DG  C OP2   1 
ATOM   1352 O  "O5'" . DG  C 2 18 ? -15.022 28.720 17.707  1.00 23.68 ? 18  DG  C "O5'" 1 
ATOM   1353 C  "C5'" . DG  C 2 18 ? -16.050 28.253 18.577  1.00 20.33 ? 18  DG  C "C5'" 1 
ATOM   1354 C  "C4'" . DG  C 2 18 ? -15.430 27.613 19.794  1.00 21.42 ? 18  DG  C "C4'" 1 
ATOM   1355 O  "O4'" . DG  C 2 18 ? -14.923 26.304 19.448  1.00 20.39 ? 18  DG  C "O4'" 1 
ATOM   1356 C  "C3'" . DG  C 2 18 ? -14.236 28.397 20.335  1.00 21.96 ? 18  DG  C "C3'" 1 
ATOM   1357 O  "O3'" . DG  C 2 18 ? -14.220 28.337 21.752  1.00 25.26 ? 18  DG  C "O3'" 1 
ATOM   1358 C  "C2'" . DG  C 2 18 ? -13.042 27.649 19.782  1.00 19.88 ? 18  DG  C "C2'" 1 
ATOM   1359 C  "C1'" . DG  C 2 18 ? -13.553 26.224 19.787  1.00 19.69 ? 18  DG  C "C1'" 1 
ATOM   1360 N  N9    . DG  C 2 18 ? -12.903 25.336 18.832  1.00 18.35 ? 18  DG  C N9    1 
ATOM   1361 C  C8    . DG  C 2 18 ? -11.980 25.675 17.872  1.00 17.30 ? 18  DG  C C8    1 
ATOM   1362 N  N7    . DG  C 2 18 ? -11.548 24.650 17.195  1.00 18.94 ? 18  DG  C N7    1 
ATOM   1363 C  C5    . DG  C 2 18 ? -12.232 23.571 17.733  1.00 18.28 ? 18  DG  C C5    1 
ATOM   1364 C  C6    . DG  C 2 18 ? -12.169 22.200 17.408  1.00 17.58 ? 18  DG  C C6    1 
ATOM   1365 O  O6    . DG  C 2 18 ? -11.468 21.646 16.544  1.00 18.18 ? 18  DG  C O6    1 
ATOM   1366 N  N1    . DG  C 2 18 ? -13.032 21.446 18.208  1.00 16.30 ? 18  DG  C N1    1 
ATOM   1367 C  C2    . DG  C 2 18 ? -13.847 21.956 19.197  1.00 15.96 ? 18  DG  C C2    1 
ATOM   1368 N  N2    . DG  C 2 18 ? -14.603 21.070 19.878  1.00 13.69 ? 18  DG  C N2    1 
ATOM   1369 N  N3    . DG  C 2 18 ? -13.914 23.241 19.503  1.00 16.17 ? 18  DG  C N3    1 
ATOM   1370 C  C4    . DG  C 2 18 ? -13.082 23.983 18.739  1.00 18.52 ? 18  DG  C C4    1 
ATOM   1371 P  P     . DA  C 2 19 ? -14.006 29.681 22.596  1.00 29.90 ? 19  DA  C P     1 
ATOM   1372 O  OP1   . DA  C 2 19 ? -14.969 30.696 22.097  1.00 28.46 ? 19  DA  C OP1   1 
ATOM   1373 O  OP2   . DA  C 2 19 ? -12.546 29.972 22.564  1.00 30.17 ? 19  DA  C OP2   1 
ATOM   1374 O  "O5'" . DA  C 2 19 ? -14.438 29.248 24.068  1.00 29.30 ? 19  DA  C "O5'" 1 
ATOM   1375 C  "C5'" . DA  C 2 19 ? -15.758 28.766 24.324  1.00 29.36 ? 19  DA  C "C5'" 1 
ATOM   1376 C  "C4'" . DA  C 2 19 ? -15.720 27.570 25.249  1.00 29.44 ? 19  DA  C "C4'" 1 
ATOM   1377 O  "O4'" . DA  C 2 19 ? -15.098 26.446 24.584  1.00 28.93 ? 19  DA  C "O4'" 1 
ATOM   1378 C  "C3'" . DA  C 2 19 ? -14.938 27.761 26.544  1.00 29.66 ? 19  DA  C "C3'" 1 
ATOM   1379 O  "O3'" . DA  C 2 19 ? -15.443 26.810 27.469  1.00 33.73 ? 19  DA  C "O3'" 1 
ATOM   1380 C  "C2'" . DA  C 2 19 ? -13.558 27.256 26.174  1.00 28.32 ? 19  DA  C "C2'" 1 
ATOM   1381 C  "C1'" . DA  C 2 19 ? -13.878 26.098 25.234  1.00 25.93 ? 19  DA  C "C1'" 1 
ATOM   1382 N  N9    . DA  C 2 19 ? -12.867 25.889 24.195  1.00 23.97 ? 19  DA  C N9    1 
ATOM   1383 C  C8    . DA  C 2 19 ? -11.916 26.790 23.780  1.00 21.44 ? 19  DA  C C8    1 
ATOM   1384 N  N7    . DA  C 2 19 ? -11.158 26.348 22.809  1.00 22.09 ? 19  DA  C N7    1 
ATOM   1385 C  C5    . DA  C 2 19 ? -11.634 25.067 22.566  1.00 19.86 ? 19  DA  C C5    1 
ATOM   1386 C  C6    . DA  C 2 19 ? -11.247 24.071 21.648  1.00 19.80 ? 19  DA  C C6    1 
ATOM   1387 N  N6    . DA  C 2 19 ? -10.260 24.227 20.759  1.00 17.07 ? 19  DA  C N6    1 
ATOM   1388 N  N1    . DA  C 2 19 ? -11.916 22.897 21.675  1.00 17.72 ? 19  DA  C N1    1 
ATOM   1389 C  C2    . DA  C 2 19 ? -12.903 22.748 22.561  1.00 18.34 ? 19  DA  C C2    1 
ATOM   1390 N  N3    . DA  C 2 19 ? -13.363 23.611 23.469  1.00 19.82 ? 19  DA  C N3    1 
ATOM   1391 C  C4    . DA  C 2 19 ? -12.679 24.765 23.420  1.00 21.10 ? 19  DA  C C4    1 
ATOM   1392 O  "O5'" . DT  D 3 1  ? -5.716  16.531 20.732  1.00 28.58 ? 1   DT  D "O5'" 1 
ATOM   1393 C  "C5'" . DT  D 3 1  ? -6.771  15.603 20.456  1.00 23.00 ? 1   DT  D "C5'" 1 
ATOM   1394 C  "C4'" . DT  D 3 1  ? -7.829  15.639 21.533  1.00 21.49 ? 1   DT  D "C4'" 1 
ATOM   1395 O  "O4'" . DT  D 3 1  ? -8.225  17.003 21.779  1.00 20.88 ? 1   DT  D "O4'" 1 
ATOM   1396 C  "C3'" . DT  D 3 1  ? -9.116  14.892 21.202  1.00 20.68 ? 1   DT  D "C3'" 1 
ATOM   1397 O  "O3'" . DT  D 3 1  ? -9.658  14.406 22.431  1.00 21.49 ? 1   DT  D "O3'" 1 
ATOM   1398 C  "C2'" . DT  D 3 1  ? -9.995  15.981 20.608  1.00 19.60 ? 1   DT  D "C2'" 1 
ATOM   1399 C  "C1'" . DT  D 3 1  ? -9.591  17.199 21.428  1.00 19.77 ? 1   DT  D "C1'" 1 
ATOM   1400 N  N1    . DT  D 3 1  ? -9.670  18.508 20.750  1.00 18.64 ? 1   DT  D N1    1 
ATOM   1401 C  C2    . DT  D 3 1  ? -10.572 19.444 21.208  1.00 16.44 ? 1   DT  D C2    1 
ATOM   1402 O  O2    . DT  D 3 1  ? -11.395 19.217 22.079  1.00 15.07 ? 1   DT  D O2    1 
ATOM   1403 N  N3    . DT  D 3 1  ? -10.473 20.670 20.601  1.00 17.94 ? 1   DT  D N3    1 
ATOM   1404 C  C4    . DT  D 3 1  ? -9.594  21.043 19.603  1.00 16.28 ? 1   DT  D C4    1 
ATOM   1405 O  O4    . DT  D 3 1  ? -9.583  22.202 19.201  1.00 18.11 ? 1   DT  D O4    1 
ATOM   1406 C  C5    . DT  D 3 1  ? -8.724  19.998 19.128  1.00 17.19 ? 1   DT  D C5    1 
ATOM   1407 C  C7    . DT  D 3 1  ? -7.767  20.300 18.018  1.00 15.90 ? 1   DT  D C7    1 
ATOM   1408 C  C6    . DT  D 3 1  ? -8.808  18.796 19.712  1.00 17.72 ? 1   DT  D C6    1 
ATOM   1409 P  P     . DC  D 3 2  ? -10.443 13.010 22.470  1.00 23.31 ? 2   DC  D P     1 
ATOM   1410 O  OP1   . DC  D 3 2  ? -10.511 12.600 23.900  1.00 23.03 ? 2   DC  D OP1   1 
ATOM   1411 O  OP2   . DC  D 3 2  ? -9.857  12.087 21.463  1.00 23.16 ? 2   DC  D OP2   1 
ATOM   1412 O  "O5'" . DC  D 3 2  ? -11.906 13.386 21.960  1.00 20.37 ? 2   DC  D "O5'" 1 
ATOM   1413 C  "C5'" . DC  D 3 2  ? -12.844 14.001 22.837  1.00 17.45 ? 2   DC  D "C5'" 1 
ATOM   1414 C  "C4'" . DC  D 3 2  ? -14.010 14.549 22.052  1.00 16.56 ? 2   DC  D "C4'" 1 
ATOM   1415 O  "O4'" . DC  D 3 2  ? -13.600 15.713 21.292  1.00 15.38 ? 2   DC  D "O4'" 1 
ATOM   1416 C  "C3'" . DC  D 3 2  ? -14.642 13.585 21.043  1.00 16.39 ? 2   DC  D "C3'" 1 
ATOM   1417 O  "O3'" . DC  D 3 2  ? -16.055 13.758 21.085  1.00 18.01 ? 2   DC  D "O3'" 1 
ATOM   1418 C  "C2'" . DC  D 3 2  ? -14.147 14.112 19.706  1.00 16.00 ? 2   DC  D "C2'" 1 
ATOM   1419 C  "C1'" . DC  D 3 2  ? -14.130 15.604 19.986  1.00 15.38 ? 2   DC  D "C1'" 1 
ATOM   1420 N  N1    . DC  D 3 2  ? -13.335 16.463 19.090  1.00 16.46 ? 2   DC  D N1    1 
ATOM   1421 C  C2    . DC  D 3 2  ? -13.491 17.851 19.191  1.00 15.00 ? 2   DC  D C2    1 
ATOM   1422 O  O2    . DC  D 3 2  ? -14.302 18.305 20.011  1.00 14.77 ? 2   DC  D O2    1 
ATOM   1423 N  N3    . DC  D 3 2  ? -12.763 18.661 18.392  1.00 16.97 ? 2   DC  D N3    1 
ATOM   1424 C  C4    . DC  D 3 2  ? -11.914 18.138 17.508  1.00 19.53 ? 2   DC  D C4    1 
ATOM   1425 N  N4    . DC  D 3 2  ? -11.219 18.983 16.743  1.00 21.63 ? 2   DC  D N4    1 
ATOM   1426 C  C5    . DC  D 3 2  ? -11.740 16.727 17.372  1.00 19.39 ? 2   DC  D C5    1 
ATOM   1427 C  C6    . DC  D 3 2  ? -12.463 15.933 18.177  1.00 16.93 ? 2   DC  D C6    1 
ATOM   1428 P  P     . DA  D 3 3  ? -17.022 12.503 21.350  1.00 19.28 ? 3   DA  D P     1 
ATOM   1429 O  OP1   . DA  D 3 3  ? -16.390 11.598 22.338  1.00 20.06 ? 3   DA  D OP1   1 
ATOM   1430 O  OP2   . DA  D 3 3  ? -17.460 11.963 20.031  1.00 18.87 ? 3   DA  D OP2   1 
ATOM   1431 O  "O5'" . DA  D 3 3  ? -18.287 13.187 22.040  1.00 18.08 ? 3   DA  D "O5'" 1 
ATOM   1432 C  "C5'" . DA  D 3 3  ? -18.145 13.985 23.216  1.00 14.17 ? 3   DA  D "C5'" 1 
ATOM   1433 C  "C4'" . DA  D 3 3  ? -18.957 15.251 23.089  1.00 14.37 ? 3   DA  D "C4'" 1 
ATOM   1434 O  "O4'" . DA  D 3 3  ? -18.320 16.156 22.158  1.00 16.38 ? 3   DA  D "O4'" 1 
ATOM   1435 C  "C3'" . DA  D 3 3  ? -20.381 15.063 22.575  1.00 16.84 ? 3   DA  D "C3'" 1 
ATOM   1436 O  "O3'" . DA  D 3 3  ? -21.222 16.012 23.233  1.00 18.32 ? 3   DA  D "O3'" 1 
ATOM   1437 C  "C2'" . DA  D 3 3  ? -20.256 15.348 21.087  1.00 15.47 ? 3   DA  D "C2'" 1 
ATOM   1438 C  "C1'" . DA  D 3 3  ? -19.162 16.408 21.037  1.00 15.99 ? 3   DA  D "C1'" 1 
ATOM   1439 N  N9    . DA  D 3 3  ? -18.313 16.378 19.841  1.00 16.08 ? 3   DA  D N9    1 
ATOM   1440 C  C8    . DA  D 3 3  ? -17.823 15.277 19.170  1.00 15.30 ? 3   DA  D C8    1 
ATOM   1441 N  N7    . DA  D 3 3  ? -17.024 15.575 18.172  1.00 14.78 ? 3   DA  D N7    1 
ATOM   1442 C  C5    . DA  D 3 3  ? -16.994 16.966 18.173  1.00 15.85 ? 3   DA  D C5    1 
ATOM   1443 C  C6    . DA  D 3 3  ? -16.310 17.906 17.369  1.00 15.42 ? 3   DA  D C6    1 
ATOM   1444 N  N6    . DA  D 3 3  ? -15.465 17.580 16.384  1.00 16.84 ? 3   DA  D N6    1 
ATOM   1445 N  N1    . DA  D 3 3  ? -16.515 19.214 17.627  1.00 15.04 ? 3   DA  D N1    1 
ATOM   1446 C  C2    . DA  D 3 3  ? -17.334 19.552 18.634  1.00 14.40 ? 3   DA  D C2    1 
ATOM   1447 N  N3    . DA  D 3 3  ? -18.016 18.769 19.467  1.00 15.33 ? 3   DA  D N3    1 
ATOM   1448 C  C4    . DA  D 3 3  ? -17.802 17.472 19.182  1.00 15.73 ? 3   DA  D C4    1 
ATOM   1449 P  P     . DA  D 3 4  ? -22.753 16.188 22.780  1.00 18.73 ? 4   DA  D P     1 
ATOM   1450 O  OP1   . DA  D 3 4  ? -23.462 16.671 23.987  1.00 18.43 ? 4   DA  D OP1   1 
ATOM   1451 O  OP2   . DA  D 3 4  ? -23.254 14.978 22.079  1.00 17.99 ? 4   DA  D OP2   1 
ATOM   1452 O  "O5'" . DA  D 3 4  ? -22.667 17.380 21.728  1.00 17.42 ? 4   DA  D "O5'" 1 
ATOM   1453 C  "C5'" . DA  D 3 4  ? -22.105 18.629 22.116  1.00 19.34 ? 4   DA  D "C5'" 1 
ATOM   1454 C  "C4'" . DA  D 3 4  ? -22.188 19.623 20.983  1.00 19.05 ? 4   DA  D "C4'" 1 
ATOM   1455 O  "O4'" . DA  D 3 4  ? -21.218 19.297 19.958  1.00 19.73 ? 4   DA  D "O4'" 1 
ATOM   1456 C  "C3'" . DA  D 3 4  ? -23.546 19.708 20.283  1.00 20.50 ? 4   DA  D "C3'" 1 
ATOM   1457 O  "O3'" . DA  D 3 4  ? -23.859 21.081 20.055  1.00 23.62 ? 4   DA  D "O3'" 1 
ATOM   1458 C  "C2'" . DA  D 3 4  ? -23.300 19.005 18.960  1.00 20.60 ? 4   DA  D "C2'" 1 
ATOM   1459 C  "C1'" . DA  D 3 4  ? -21.850 19.358 18.693  1.00 18.82 ? 4   DA  D "C1'" 1 
ATOM   1460 N  N9    . DA  D 3 4  ? -21.146 18.453 17.784  1.00 17.42 ? 4   DA  D N9    1 
ATOM   1461 C  C8    . DA  D 3 4  ? -21.246 17.085 17.689  1.00 16.93 ? 4   DA  D C8    1 
ATOM   1462 N  N7    . DA  D 3 4  ? -20.499 16.566 16.741  1.00 15.42 ? 4   DA  D N7    1 
ATOM   1463 C  C5    . DA  D 3 4  ? -19.859 17.663 16.178  1.00 15.58 ? 4   DA  D C5    1 
ATOM   1464 C  C6    . DA  D 3 4  ? -18.934 17.790 15.122  1.00 15.39 ? 4   DA  D C6    1 
ATOM   1465 N  N6    . DA  D 3 4  ? -18.479 16.763 14.401  1.00 13.80 ? 4   DA  D N6    1 
ATOM   1466 N  N1    . DA  D 3 4  ? -18.485 19.032 14.825  1.00 17.99 ? 4   DA  D N1    1 
ATOM   1467 C  C2    . DA  D 3 4  ? -18.943 20.067 15.536  1.00 15.37 ? 4   DA  D C2    1 
ATOM   1468 N  N3    . DA  D 3 4  ? -19.815 20.078 16.541  1.00 16.92 ? 4   DA  D N3    1 
ATOM   1469 C  C4    . DA  D 3 4  ? -20.240 18.831 16.818  1.00 16.41 ? 4   DA  D C4    1 
ATOM   1470 P  P     . DG  D 3 5  ? -25.316 21.500 19.517  1.00 25.87 ? 5   DG  D P     1 
ATOM   1471 O  OP1   . DG  D 3 5  ? -25.991 22.214 20.630  1.00 24.92 ? 5   DG  D OP1   1 
ATOM   1472 O  OP2   . DG  D 3 5  ? -25.977 20.333 18.879  1.00 25.58 ? 5   DG  D OP2   1 
ATOM   1473 O  "O5'" . DG  D 3 5  ? -24.984 22.551 18.372  1.00 24.86 ? 5   DG  D "O5'" 1 
ATOM   1474 C  "C5'" . DG  D 3 5  ? -24.003 23.553 18.581  1.00 22.82 ? 5   DG  D "C5'" 1 
ATOM   1475 C  "C4'" . DG  D 3 5  ? -23.670 24.228 17.274  1.00 22.72 ? 5   DG  D "C4'" 1 
ATOM   1476 O  "O4'" . DG  D 3 5  ? -22.815 23.381 16.470  1.00 20.45 ? 5   DG  D "O4'" 1 
ATOM   1477 C  "C3'" . DG  D 3 5  ? -24.889 24.551 16.413  1.00 23.90 ? 5   DG  D "C3'" 1 
ATOM   1478 O  "O3'" . DG  D 3 5  ? -24.713 25.847 15.824  1.00 26.19 ? 5   DG  D "O3'" 1 
ATOM   1479 C  "C2'" . DG  D 3 5  ? -24.892 23.437 15.373  1.00 21.13 ? 5   DG  D "C2'" 1 
ATOM   1480 C  "C1'" . DG  D 3 5  ? -23.412 23.134 15.203  1.00 18.96 ? 5   DG  D "C1'" 1 
ATOM   1481 N  N9    . DG  D 3 5  ? -23.094 21.757 14.833  1.00 18.15 ? 5   DG  D N9    1 
ATOM   1482 C  C8    . DG  D 3 5  ? -23.504 20.611 15.471  1.00 15.21 ? 5   DG  D C8    1 
ATOM   1483 N  N7    . DG  D 3 5  ? -23.030 19.523 14.927  1.00 16.02 ? 5   DG  D N7    1 
ATOM   1484 C  C5    . DG  D 3 5  ? -22.262 19.975 13.862  1.00 17.10 ? 5   DG  D C5    1 
ATOM   1485 C  C6    . DG  D 3 5  ? -21.499 19.254 12.903  1.00 17.45 ? 5   DG  D C6    1 
ATOM   1486 O  O6    . DG  D 3 5  ? -21.340 18.031 12.806  1.00 21.80 ? 5   DG  D O6    1 
ATOM   1487 N  N1    . DG  D 3 5  ? -20.887 20.106 11.990  1.00 18.45 ? 5   DG  D N1    1 
ATOM   1488 C  C2    . DG  D 3 5  ? -20.993 21.477 11.995  1.00 19.20 ? 5   DG  D C2    1 
ATOM   1489 N  N2    . DG  D 3 5  ? -20.338 22.125 11.019  1.00 17.83 ? 5   DG  D N2    1 
ATOM   1490 N  N3    . DG  D 3 5  ? -21.693 22.163 12.888  1.00 17.01 ? 5   DG  D N3    1 
ATOM   1491 C  C4    . DG  D 3 5  ? -22.298 21.354 13.783  1.00 17.32 ? 5   DG  D C4    1 
ATOM   1492 P  P     . DA  D 3 6  ? -25.954 26.575 15.105  1.00 28.15 ? 6   DA  D P     1 
ATOM   1493 O  OP1   . DA  D 3 6  ? -25.701 28.037 15.116  1.00 26.85 ? 6   DA  D OP1   1 
ATOM   1494 O  OP2   . DA  D 3 6  ? -27.216 26.038 15.678  1.00 25.75 ? 6   DA  D OP2   1 
ATOM   1495 O  "O5'" . DA  D 3 6  ? -25.830 26.070 13.604  1.00 28.87 ? 6   DA  D "O5'" 1 
ATOM   1496 C  "C5'" . DA  D 3 6  ? -24.682 26.391 12.822  1.00 28.73 ? 6   DA  D "C5'" 1 
ATOM   1497 C  "C4'" . DA  D 3 6  ? -24.803 25.765 11.454  1.00 31.01 ? 6   DA  D "C4'" 1 
ATOM   1498 O  "O4'" . DA  D 3 6  ? -24.391 24.375 11.485  1.00 29.42 ? 6   DA  D "O4'" 1 
ATOM   1499 C  "C3'" . DA  D 3 6  ? -26.233 25.774 10.903  1.00 32.59 ? 6   DA  D "C3'" 1 
ATOM   1500 O  "O3'" . DA  D 3 6  ? -26.207 26.074 9.510   1.00 38.07 ? 6   DA  D "O3'" 1 
ATOM   1501 C  "C2'" . DA  D 3 6  ? -26.685 24.337 11.089  1.00 31.54 ? 6   DA  D "C2'" 1 
ATOM   1502 C  "C1'" . DA  D 3 6  ? -25.385 23.608 10.828  1.00 28.58 ? 6   DA  D "C1'" 1 
ATOM   1503 N  N9    . DA  D 3 6  ? -25.322 22.233 11.317  1.00 26.27 ? 6   DA  D N9    1 
ATOM   1504 C  C8    . DA  D 3 6  ? -25.984 21.653 12.370  1.00 25.50 ? 6   DA  D C8    1 
ATOM   1505 N  N7    . DA  D 3 6  ? -25.742 20.371 12.501  1.00 25.02 ? 6   DA  D N7    1 
ATOM   1506 C  C5    . DA  D 3 6  ? -24.849 20.094 11.473  1.00 24.58 ? 6   DA  D C5    1 
ATOM   1507 C  C6    . DA  D 3 6  ? -24.213 18.909 11.061  1.00 24.87 ? 6   DA  D C6    1 
ATOM   1508 N  N6    . DA  D 3 6  ? -24.398 17.724 11.652  1.00 24.67 ? 6   DA  D N6    1 
ATOM   1509 N  N1    . DA  D 3 6  ? -23.372 18.981 10.002  1.00 25.04 ? 6   DA  D N1    1 
ATOM   1510 C  C2    . DA  D 3 6  ? -23.198 20.160 9.404   1.00 25.21 ? 6   DA  D C2    1 
ATOM   1511 N  N3    . DA  D 3 6  ? -23.745 21.338 9.691   1.00 25.61 ? 6   DA  D N3    1 
ATOM   1512 C  C4    . DA  D 3 6  ? -24.571 21.234 10.748  1.00 25.23 ? 6   DA  D C4    1 
ATOM   1513 P  P     . DG  D 3 7  ? -27.528 26.631 8.781   1.00 40.10 ? 7   DG  D P     1 
ATOM   1514 O  OP1   . DG  D 3 7  ? -27.595 28.098 9.008   1.00 38.91 ? 7   DG  D OP1   1 
ATOM   1515 O  OP2   . DG  D 3 7  ? -28.680 25.773 9.162   1.00 38.49 ? 7   DG  D OP2   1 
ATOM   1516 O  "O5'" . DG  D 3 7  ? -27.199 26.375 7.249   1.00 39.76 ? 7   DG  D "O5'" 1 
ATOM   1517 C  "C5'" . DG  D 3 7  ? -25.869 26.551 6.756   1.00 40.77 ? 7   DG  D "C5'" 1 
ATOM   1518 C  "C4'" . DG  D 3 7  ? -25.580 25.532 5.682   1.00 40.43 ? 7   DG  D "C4'" 1 
ATOM   1519 O  "O4'" . DG  D 3 7  ? -25.251 24.243 6.264   1.00 40.46 ? 7   DG  D "O4'" 1 
ATOM   1520 C  "C3'" . DG  D 3 7  ? -26.781 25.297 4.770   1.00 41.65 ? 7   DG  D "C3'" 1 
ATOM   1521 O  "O3'" . DG  D 3 7  ? -26.381 25.257 3.403   1.00 43.58 ? 7   DG  D "O3'" 1 
ATOM   1522 C  "C2'" . DG  D 3 7  ? -27.324 23.951 5.223   1.00 40.60 ? 7   DG  D "C2'" 1 
ATOM   1523 C  "C1'" . DG  D 3 7  ? -26.076 23.233 5.703   1.00 38.32 ? 7   DG  D "C1'" 1 
ATOM   1524 N  N9    . DG  D 3 7  ? -26.339 22.232 6.734   1.00 37.02 ? 7   DG  D N9    1 
ATOM   1525 C  C8    . DG  D 3 7  ? -27.068 22.405 7.888   1.00 36.13 ? 7   DG  D C8    1 
ATOM   1526 N  N7    . DG  D 3 7  ? -27.172 21.313 8.597   1.00 34.28 ? 7   DG  D N7    1 
ATOM   1527 C  C5    . DG  D 3 7  ? -26.461 20.362 7.874   1.00 32.40 ? 7   DG  D C5    1 
ATOM   1528 C  C6    . DG  D 3 7  ? -26.232 18.984 8.141   1.00 29.97 ? 7   DG  D C6    1 
ATOM   1529 O  O6    . DG  D 3 7  ? -26.628 18.307 9.095   1.00 28.59 ? 7   DG  D O6    1 
ATOM   1530 N  N1    . DG  D 3 7  ? -25.459 18.393 7.149   1.00 30.29 ? 7   DG  D N1    1 
ATOM   1531 C  C2    . DG  D 3 7  ? -24.970 19.037 6.039   1.00 31.67 ? 7   DG  D C2    1 
ATOM   1532 N  N2    . DG  D 3 7  ? -24.247 18.289 5.194   1.00 29.73 ? 7   DG  D N2    1 
ATOM   1533 N  N3    . DG  D 3 7  ? -25.176 20.320 5.776   1.00 33.13 ? 7   DG  D N3    1 
ATOM   1534 C  C4    . DG  D 3 7  ? -25.928 20.916 6.729   1.00 34.15 ? 7   DG  D C4    1 
ATOM   1535 P  P     . DG  D 3 8  ? -27.487 25.018 2.271   1.00 43.90 ? 8   DG  D P     1 
ATOM   1536 O  OP1   . DG  D 3 8  ? -27.034 25.695 1.033   1.00 45.00 ? 8   DG  D OP1   1 
ATOM   1537 O  OP2   . DG  D 3 8  ? -28.811 25.360 2.858   1.00 44.40 ? 8   DG  D OP2   1 
ATOM   1538 O  "O5'" . DG  D 3 8  ? -27.450 23.442 2.057   1.00 43.77 ? 8   DG  D "O5'" 1 
ATOM   1539 C  "C5'" . DG  D 3 8  ? -26.305 22.809 1.495   1.00 43.09 ? 8   DG  D "C5'" 1 
ATOM   1540 C  "C4'" . DG  D 3 8  ? -26.649 21.394 1.097   1.00 43.44 ? 8   DG  D "C4'" 1 
ATOM   1541 O  "O4'" . DG  D 3 8  ? -26.630 20.538 2.267   1.00 41.02 ? 8   DG  D "O4'" 1 
ATOM   1542 C  "C3'" . DG  D 3 8  ? -28.053 21.272 0.494   1.00 44.17 ? 8   DG  D "C3'" 1 
ATOM   1543 O  "O3'" . DG  D 3 8  ? -28.074 20.377 -0.620  1.00 47.83 ? 8   DG  D "O3'" 1 
ATOM   1544 C  "C2'" . DG  D 3 8  ? -28.874 20.688 1.625   1.00 42.53 ? 8   DG  D "C2'" 1 
ATOM   1545 C  "C1'" . DG  D 3 8  ? -27.851 19.826 2.341   1.00 39.49 ? 8   DG  D "C1'" 1 
ATOM   1546 N  N9    . DG  D 3 8  ? -28.179 19.610 3.744   1.00 36.52 ? 8   DG  D N9    1 
ATOM   1547 C  C8    . DG  D 3 8  ? -28.659 20.539 4.637   1.00 34.96 ? 8   DG  D C8    1 
ATOM   1548 N  N7    . DG  D 3 8  ? -28.957 20.025 5.798   1.00 34.07 ? 8   DG  D N7    1 
ATOM   1549 C  C5    . DG  D 3 8  ? -28.629 18.680 5.673   1.00 33.31 ? 8   DG  D C5    1 
ATOM   1550 C  C6    . DG  D 3 8  ? -28.749 17.614 6.602   1.00 30.81 ? 8   DG  D C6    1 
ATOM   1551 O  O6    . DG  D 3 8  ? -29.184 17.646 7.759   1.00 30.51 ? 8   DG  D O6    1 
ATOM   1552 N  N1    . DG  D 3 8  ? -28.302 16.412 6.060   1.00 30.71 ? 8   DG  D N1    1 
ATOM   1553 C  C2    . DG  D 3 8  ? -27.801 16.253 4.788   1.00 31.42 ? 8   DG  D C2    1 
ATOM   1554 N  N2    . DG  D 3 8  ? -27.419 15.016 4.448   1.00 29.86 ? 8   DG  D N2    1 
ATOM   1555 N  N3    . DG  D 3 8  ? -27.686 17.237 3.914   1.00 34.08 ? 8   DG  D N3    1 
ATOM   1556 C  C4    . DG  D 3 8  ? -28.122 18.415 4.419   1.00 34.98 ? 8   DG  D C4    1 
ATOM   1557 P  P     . DC  D 3 9  ? -29.457 20.120 -1.399  1.00 48.14 ? 9   DC  D P     1 
ATOM   1558 O  OP1   . DC  D 3 9  ? -29.154 19.933 -2.841  1.00 49.95 ? 9   DC  D OP1   1 
ATOM   1559 O  OP2   . DC  D 3 9  ? -30.409 21.178 -0.979  1.00 49.47 ? 9   DC  D OP2   1 
ATOM   1560 O  "O5'" . DC  D 3 9  ? -29.979 18.741 -0.802  1.00 48.04 ? 9   DC  D "O5'" 1 
ATOM   1561 C  "C5'" . DC  D 3 9  ? -29.317 17.515 -1.100  1.00 46.16 ? 9   DC  D "C5'" 1 
ATOM   1562 C  "C4'" . DC  D 3 9  ? -30.141 16.355 -0.596  1.00 45.14 ? 9   DC  D "C4'" 1 
ATOM   1563 O  "O4'" . DC  D 3 9  ? -30.057 16.303 0.855   1.00 44.40 ? 9   DC  D "O4'" 1 
ATOM   1564 C  "C3'" . DC  D 3 9  ? -31.630 16.496 -0.934  1.00 44.48 ? 9   DC  D "C3'" 1 
ATOM   1565 O  "O3'" . DC  D 3 9  ? -32.209 15.233 -1.290  1.00 44.71 ? 9   DC  D "O3'" 1 
ATOM   1566 C  "C2'" . DC  D 3 9  ? -32.225 16.983 0.368   1.00 45.77 ? 9   DC  D "C2'" 1 
ATOM   1567 C  "C1'" . DC  D 3 9  ? -31.374 16.234 1.370   1.00 44.88 ? 9   DC  D "C1'" 1 
ATOM   1568 N  N1    . DC  D 3 9  ? -31.409 16.826 2.713   1.00 43.00 ? 9   DC  D N1    1 
ATOM   1569 C  C2    . DC  D 3 9  ? -31.339 15.983 3.822   1.00 41.69 ? 9   DC  D C2    1 
ATOM   1570 O  O2    . DC  D 3 9  ? -31.136 14.770 3.645   1.00 39.08 ? 9   DC  D O2    1 
ATOM   1571 N  N3    . DC  D 3 9  ? -31.489 16.509 5.057   1.00 41.39 ? 9   DC  D N3    1 
ATOM   1572 C  C4    . DC  D 3 9  ? -31.677 17.822 5.204   1.00 41.87 ? 9   DC  D C4    1 
ATOM   1573 N  N4    . DC  D 3 9  ? -31.850 18.296 6.440   1.00 43.71 ? 9   DC  D N4    1 
ATOM   1574 C  C5    . DC  D 3 9  ? -31.700 18.708 4.094   1.00 41.83 ? 9   DC  D C5    1 
ATOM   1575 C  C6    . DC  D 3 9  ? -31.557 18.175 2.879   1.00 42.70 ? 9   DC  D C6    1 
ATOM   1576 P  P     . DC  D 3 10 ? -33.806 15.012 -1.170  1.00 42.78 ? 10  DC  D P     1 
ATOM   1577 O  OP1   . DC  D 3 10 ? -34.281 14.353 -2.410  1.00 44.43 ? 10  DC  D OP1   1 
ATOM   1578 O  OP2   . DC  D 3 10 ? -34.470 16.259 -0.713  1.00 44.52 ? 10  DC  D OP2   1 
ATOM   1579 O  "O5'" . DC  D 3 10 ? -33.930 13.943 0.001   1.00 43.78 ? 10  DC  D "O5'" 1 
ATOM   1580 C  "C5'" . DC  D 3 10 ? -33.190 12.720 -0.044  1.00 41.16 ? 10  DC  D "C5'" 1 
ATOM   1581 C  "C4'" . DC  D 3 10 ? -33.883 11.670 0.791   1.00 40.26 ? 10  DC  D "C4'" 1 
ATOM   1582 O  "O4'" . DC  D 3 10 ? -33.699 11.983 2.195   1.00 39.53 ? 10  DC  D "O4'" 1 
ATOM   1583 C  "C3'" . DC  D 3 10 ? -35.391 11.646 0.544   1.00 39.54 ? 10  DC  D "C3'" 1 
ATOM   1584 O  "O3'" . DC  D 3 10 ? -35.926 10.332 0.515   1.00 39.43 ? 10  DC  D "O3'" 1 
ATOM   1585 C  "C2'" . DC  D 3 10 ? -35.970 12.390 1.726   1.00 40.85 ? 10  DC  D "C2'" 1 
ATOM   1586 C  "C1'" . DC  D 3 10 ? -34.952 12.169 2.834   1.00 39.50 ? 10  DC  D "C1'" 1 
ATOM   1587 N  N1    . DC  D 3 10 ? -34.869 13.367 3.680   1.00 38.56 ? 10  DC  D N1    1 
ATOM   1588 C  C2    . DC  D 3 10 ? -34.919 13.228 5.068   1.00 38.09 ? 10  DC  D C2    1 
ATOM   1589 O  O2    . DC  D 3 10 ? -34.901 12.085 5.561   1.00 36.98 ? 10  DC  D O2    1 
ATOM   1590 N  N3    . DC  D 3 10 ? -34.979 14.344 5.837   1.00 38.02 ? 10  DC  D N3    1 
ATOM   1591 C  C4    . DC  D 3 10 ? -34.962 15.553 5.264   1.00 38.41 ? 10  DC  D C4    1 
ATOM   1592 N  N4    . DC  D 3 10 ? -35.068 16.625 6.053   1.00 39.04 ? 10  DC  D N4    1 
ATOM   1593 C  C5    . DC  D 3 10 ? -34.847 15.716 3.856   1.00 38.46 ? 10  DC  D C5    1 
ATOM   1594 C  C6    . DC  D 3 10 ? -34.798 14.610 3.111   1.00 38.20 ? 10  DC  D C6    1 
ATOM   1595 P  P     . DC  D 3 11 ? -37.499 10.136 0.267   1.00 37.73 ? 11  DC  D P     1 
ATOM   1596 O  OP1   . DC  D 3 11 ? -37.654 8.963  -0.636  1.00 39.24 ? 11  DC  D OP1   1 
ATOM   1597 O  OP2   . DC  D 3 11 ? -38.075 11.450 -0.124  1.00 38.00 ? 11  DC  D OP2   1 
ATOM   1598 O  "O5'" . DC  D 3 11 ? -38.072 9.769  1.705   1.00 37.05 ? 11  DC  D "O5'" 1 
ATOM   1599 C  "C5'" . DC  D 3 11 ? -37.645 8.578  2.371   1.00 35.82 ? 11  DC  D "C5'" 1 
ATOM   1600 C  "C4'" . DC  D 3 11 ? -38.505 8.324  3.585   1.00 32.80 ? 11  DC  D "C4'" 1 
ATOM   1601 O  "O4'" . DC  D 3 11 ? -38.144 9.265  4.627   1.00 33.19 ? 11  DC  D "O4'" 1 
ATOM   1602 C  "C3'" . DC  D 3 11 ? -39.995 8.526  3.313   1.00 31.58 ? 11  DC  D "C3'" 1 
ATOM   1603 O  "O3'" . DC  D 3 11 ? -40.789 7.517  3.935   1.00 30.73 ? 11  DC  D "O3'" 1 
ATOM   1604 C  "C2'" . DC  D 3 11 ? -40.289 9.882  3.921   1.00 32.10 ? 11  DC  D "C2'" 1 
ATOM   1605 C  "C1'" . DC  D 3 11 ? -39.287 9.979  5.059   1.00 31.07 ? 11  DC  D "C1'" 1 
ATOM   1606 N  N1    . DC  D 3 11 ? -38.897 11.374 5.314   1.00 28.83 ? 11  DC  D N1    1 
ATOM   1607 C  C2    . DC  D 3 11 ? -38.905 11.855 6.629   1.00 27.07 ? 11  DC  D C2    1 
ATOM   1608 O  O2    . DC  D 3 11 ? -39.094 11.058 7.560   1.00 27.64 ? 11  DC  D O2    1 
ATOM   1609 N  N3    . DC  D 3 11 ? -38.698 13.174 6.848   1.00 26.70 ? 11  DC  D N3    1 
ATOM   1610 C  C4    . DC  D 3 11 ? -38.458 13.992 5.818   1.00 26.50 ? 11  DC  D C4    1 
ATOM   1611 N  N4    . DC  D 3 11 ? -38.317 15.297 6.071   1.00 27.47 ? 11  DC  D N4    1 
ATOM   1612 C  C5    . DC  D 3 11 ? -38.366 13.512 4.480   1.00 27.14 ? 11  DC  D C5    1 
ATOM   1613 C  C6    . DC  D 3 11 ? -38.586 12.209 4.277   1.00 27.58 ? 11  DC  D C6    1 
ATOM   1614 P  P     . DC  D 3 12 ? -42.392 7.658  3.930   1.00 31.67 ? 12  DC  D P     1 
ATOM   1615 O  OP1   . DC  D 3 12 ? -42.974 6.287  4.003   1.00 31.72 ? 12  DC  D OP1   1 
ATOM   1616 O  OP2   . DC  D 3 12 ? -42.793 8.568  2.823   1.00 30.42 ? 12  DC  D OP2   1 
ATOM   1617 O  "O5'" . DC  D 3 12 ? -42.695 8.401  5.306   1.00 30.87 ? 12  DC  D "O5'" 1 
ATOM   1618 C  "C5'" . DC  D 3 12 ? -42.309 7.809  6.542   1.00 30.53 ? 12  DC  D "C5'" 1 
ATOM   1619 C  "C4'" . DC  D 3 12 ? -43.111 8.404  7.672   1.00 28.63 ? 12  DC  D "C4'" 1 
ATOM   1620 O  "O4'" . DC  D 3 12 ? -42.549 9.694  8.030   1.00 27.41 ? 12  DC  D "O4'" 1 
ATOM   1621 C  "C3'" . DC  D 3 12 ? -44.573 8.646  7.290   1.00 27.31 ? 12  DC  D "C3'" 1 
ATOM   1622 O  "O3'" . DC  D 3 12 ? -45.484 8.166  8.273   1.00 24.49 ? 12  DC  D "O3'" 1 
ATOM   1623 C  "C2'" . DC  D 3 12 ? -44.684 10.154 7.174   1.00 29.41 ? 12  DC  D "C2'" 1 
ATOM   1624 C  "C1'" . DC  D 3 12 ? -43.571 10.673 8.075   1.00 27.97 ? 12  DC  D "C1'" 1 
ATOM   1625 N  N1    . DC  D 3 12 ? -43.023 11.933 7.553   1.00 26.21 ? 12  DC  D N1    1 
ATOM   1626 C  C2    . DC  D 3 12 ? -43.040 13.069 8.364   1.00 23.24 ? 12  DC  D C2    1 
ATOM   1627 O  O2    . DC  D 3 12 ? -43.408 12.961 9.543   1.00 22.46 ? 12  DC  D O2    1 
ATOM   1628 N  N3    . DC  D 3 12 ? -42.651 14.254 7.841   1.00 23.59 ? 12  DC  D N3    1 
ATOM   1629 C  C4    . DC  D 3 12 ? -42.241 14.323 6.571   1.00 23.14 ? 12  DC  D C4    1 
ATOM   1630 N  N4    . DC  D 3 12 ? -41.915 15.523 6.076   1.00 23.14 ? 12  DC  D N4    1 
ATOM   1631 C  C5    . DC  D 3 12 ? -42.158 13.169 5.746   1.00 23.95 ? 12  DC  D C5    1 
ATOM   1632 C  C6    . DC  D 3 12 ? -42.549 12.005 6.273   1.00 24.27 ? 12  DC  D C6    1 
ATOM   1633 P  P     . DC  D 3 13 ? -47.060 8.225  7.976   1.00 21.00 ? 13  DC  D P     1 
ATOM   1634 O  OP1   . DC  D 3 13 ? -47.668 6.935  8.387   1.00 22.74 ? 13  DC  D OP1   1 
ATOM   1635 O  OP2   . DC  D 3 13 ? -47.265 8.736  6.588   1.00 21.46 ? 13  DC  D OP2   1 
ATOM   1636 O  "O5'" . DC  D 3 13 ? -47.567 9.363  8.960   1.00 23.03 ? 13  DC  D "O5'" 1 
ATOM   1637 C  "C5'" . DC  D 3 13 ? -47.366 9.253  10.361  1.00 23.27 ? 13  DC  D "C5'" 1 
ATOM   1638 C  "C4'" . DC  D 3 13 ? -47.987 10.441 11.047  1.00 24.15 ? 13  DC  D "C4'" 1 
ATOM   1639 O  "O4'" . DC  D 3 13 ? -47.239 11.628 10.691  1.00 25.40 ? 13  DC  D "O4'" 1 
ATOM   1640 C  "C3'" . DC  D 3 13 ? -49.415 10.682 10.567  1.00 26.57 ? 13  DC  D "C3'" 1 
ATOM   1641 O  "O3'" . DC  D 3 13 ? -50.222 11.142 11.641  1.00 27.29 ? 13  DC  D "O3'" 1 
ATOM   1642 C  "C2'" . DC  D 3 13 ? -49.257 11.761 9.515   1.00 26.06 ? 13  DC  D "C2'" 1 
ATOM   1643 C  "C1'" . DC  D 3 13 ? -48.102 12.569 10.071  1.00 25.91 ? 13  DC  D "C1'" 1 
ATOM   1644 N  N1    . DC  D 3 13 ? -47.338 13.300 9.046   1.00 24.04 ? 13  DC  D N1    1 
ATOM   1645 C  C2    . DC  D 3 13 ? -47.081 14.657 9.248   1.00 24.45 ? 13  DC  D C2    1 
ATOM   1646 O  O2    . DC  D 3 13 ? -47.482 15.197 10.297  1.00 26.59 ? 13  DC  D O2    1 
ATOM   1647 N  N3    . DC  D 3 13 ? -46.410 15.351 8.297   1.00 23.79 ? 13  DC  D N3    1 
ATOM   1648 C  C4    . DC  D 3 13 ? -46.013 14.739 7.180   1.00 21.35 ? 13  DC  D C4    1 
ATOM   1649 N  N4    . DC  D 3 13 ? -45.385 15.471 6.257   1.00 21.35 ? 13  DC  D N4    1 
ATOM   1650 C  C5    . DC  D 3 13 ? -46.248 13.351 6.958   1.00 20.97 ? 13  DC  D C5    1 
ATOM   1651 C  C6    . DC  D 3 13 ? -46.904 12.675 7.910   1.00 22.57 ? 13  DC  D C6    1 
ATOM   1652 P  P     . DA  D 3 14 ? -51.795 11.376 11.412  1.00 29.16 ? 14  DA  D P     1 
ATOM   1653 O  OP1   . DA  D 3 14 ? -52.466 10.714 12.563  1.00 28.70 ? 14  DA  D OP1   1 
ATOM   1654 O  OP2   . DA  D 3 14 ? -52.191 11.016 10.021  1.00 26.74 ? 14  DA  D OP2   1 
ATOM   1655 O  "O5'" . DA  D 3 14 ? -51.936 12.948 11.593  1.00 28.68 ? 14  DA  D "O5'" 1 
ATOM   1656 C  "C5'" . DA  D 3 14 ? -51.348 13.597 12.719  1.00 29.14 ? 14  DA  D "C5'" 1 
ATOM   1657 C  "C4'" . DA  D 3 14 ? -51.597 15.083 12.647  1.00 29.57 ? 14  DA  D "C4'" 1 
ATOM   1658 O  "O4'" . DA  D 3 14 ? -50.733 15.695 11.659  1.00 29.18 ? 14  DA  D "O4'" 1 
ATOM   1659 C  "C3'" . DA  D 3 14 ? -53.024 15.421 12.234  1.00 30.44 ? 14  DA  D "C3'" 1 
ATOM   1660 O  "O3'" . DA  D 3 14 ? -53.515 16.502 13.016  1.00 32.67 ? 14  DA  D "O3'" 1 
ATOM   1661 C  "C2'" . DA  D 3 14 ? -52.901 15.805 10.770  1.00 29.74 ? 14  DA  D "C2'" 1 
ATOM   1662 C  "C1'" . DA  D 3 14 ? -51.500 16.376 10.673  1.00 28.26 ? 14  DA  D "C1'" 1 
ATOM   1663 N  N9    . DA  D 3 14 ? -50.869 16.123 9.379   1.00 28.14 ? 14  DA  D N9    1 
ATOM   1664 C  C8    . DA  D 3 14 ? -50.774 14.917 8.728   1.00 26.91 ? 14  DA  D C8    1 
ATOM   1665 N  N7    . DA  D 3 14 ? -50.132 14.980 7.589   1.00 27.87 ? 14  DA  D N7    1 
ATOM   1666 C  C5    . DA  D 3 14 ? -49.785 16.321 7.476   1.00 27.39 ? 14  DA  D C5    1 
ATOM   1667 C  C6    . DA  D 3 14 ? -49.089 17.038 6.487   1.00 25.94 ? 14  DA  D C6    1 
ATOM   1668 N  N6    . DA  D 3 14 ? -48.597 16.481 5.376   1.00 24.92 ? 14  DA  D N6    1 
ATOM   1669 N  N1    . DA  D 3 14 ? -48.914 18.365 6.680   1.00 26.60 ? 14  DA  D N1    1 
ATOM   1670 C  C2    . DA  D 3 14 ? -49.410 18.921 7.789   1.00 25.53 ? 14  DA  D C2    1 
ATOM   1671 N  N3    . DA  D 3 14 ? -50.081 18.354 8.789   1.00 26.77 ? 14  DA  D N3    1 
ATOM   1672 C  C4    . DA  D 3 14 ? -50.237 17.037 8.570   1.00 27.45 ? 14  DA  D C4    1 
ATOM   1673 P  P     . DC  D 3 15 ? -55.067 16.878 12.948  1.00 32.56 ? 15  DC  D P     1 
ATOM   1674 O  OP1   . DC  D 3 15 ? -55.433 17.507 14.240  1.00 35.27 ? 15  DC  D OP1   1 
ATOM   1675 O  OP2   . DC  D 3 15 ? -55.814 15.685 12.471  1.00 33.37 ? 15  DC  D OP2   1 
ATOM   1676 O  "O5'" . DC  D 3 15 ? -55.108 17.980 11.802  1.00 34.40 ? 15  DC  D "O5'" 1 
ATOM   1677 C  "C5'" . DC  D 3 15 ? -54.270 19.127 11.876  1.00 34.48 ? 15  DC  D "C5'" 1 
ATOM   1678 C  "C4'" . DC  D 3 15 ? -54.405 19.954 10.621  1.00 34.59 ? 15  DC  D "C4'" 1 
ATOM   1679 O  "O4'" . DC  D 3 15 ? -53.509 19.510 9.569   1.00 34.09 ? 15  DC  D "O4'" 1 
ATOM   1680 C  "C3'" . DC  D 3 15 ? -55.810 19.966 10.012  1.00 35.85 ? 15  DC  D "C3'" 1 
ATOM   1681 O  "O3'" . DC  D 3 15 ? -56.167 21.308 9.692   1.00 39.36 ? 15  DC  D "O3'" 1 
ATOM   1682 C  "C2'" . DC  D 3 15 ? -55.638 19.180 8.721   1.00 34.48 ? 15  DC  D "C2'" 1 
ATOM   1683 C  "C1'" . DC  D 3 15 ? -54.224 19.570 8.349   1.00 32.39 ? 15  DC  D "C1'" 1 
ATOM   1684 N  N1    . DC  D 3 15 ? -53.546 18.726 7.347   1.00 29.02 ? 15  DC  D N1    1 
ATOM   1685 C  C2    . DC  D 3 15 ? -52.604 19.329 6.489   1.00 28.49 ? 15  DC  D C2    1 
ATOM   1686 O  O2    . DC  D 3 15 ? -52.334 20.533 6.639   1.00 26.88 ? 15  DC  D O2    1 
ATOM   1687 N  N3    . DC  D 3 15 ? -52.015 18.584 5.521   1.00 26.03 ? 15  DC  D N3    1 
ATOM   1688 C  C4    . DC  D 3 15 ? -52.331 17.290 5.393   1.00 26.50 ? 15  DC  D C4    1 
ATOM   1689 N  N4    . DC  D 3 15 ? -51.757 16.602 4.400   1.00 22.97 ? 15  DC  D N4    1 
ATOM   1690 C  C5    . DC  D 3 15 ? -53.257 16.647 6.272   1.00 25.63 ? 15  DC  D C5    1 
ATOM   1691 C  C6    . DC  D 3 15 ? -53.834 17.396 7.227   1.00 26.60 ? 15  DC  D C6    1 
ATOM   1692 P  P     . DT  D 3 16 ? -57.701 21.683 9.418   1.00 40.01 ? 16  DT  D P     1 
ATOM   1693 O  OP1   . DT  D 3 16 ? -58.343 21.981 10.719  1.00 43.02 ? 16  DT  D OP1   1 
ATOM   1694 O  OP2   . DT  D 3 16 ? -58.311 20.679 8.505   1.00 41.47 ? 16  DT  D OP2   1 
ATOM   1695 O  "O5'" . DT  D 3 16 ? -57.580 23.044 8.613   1.00 41.35 ? 16  DT  D "O5'" 1 
ATOM   1696 C  "C5'" . DT  D 3 16 ? -57.675 23.048 7.200   1.00 39.64 ? 16  DT  D "C5'" 1 
ATOM   1697 C  "C4'" . DT  D 3 16 ? -56.415 23.617 6.597   1.00 38.39 ? 16  DT  D "C4'" 1 
ATOM   1698 O  "O4'" . DT  D 3 16 ? -55.470 22.553 6.315   1.00 36.43 ? 16  DT  D "O4'" 1 
ATOM   1699 C  "C3'" . DT  D 3 16 ? -56.689 24.306 5.266   1.00 38.34 ? 16  DT  D "C3'" 1 
ATOM   1700 O  "O3'" . DT  D 3 16 ? -55.982 25.536 5.199   1.00 40.20 ? 16  DT  D "O3'" 1 
ATOM   1701 C  "C2'" . DT  D 3 16 ? -56.223 23.318 4.218   1.00 36.40 ? 16  DT  D "C2'" 1 
ATOM   1702 C  "C1'" . DT  D 3 16 ? -55.155 22.511 4.926   1.00 34.57 ? 16  DT  D "C1'" 1 
ATOM   1703 N  N1    . DT  D 3 16 ? -55.173 21.100 4.496   1.00 31.70 ? 16  DT  D N1    1 
ATOM   1704 C  C2    . DT  D 3 16 ? -54.391 20.738 3.422   1.00 29.85 ? 16  DT  D C2    1 
ATOM   1705 O  O2    . DT  D 3 16 ? -53.669 21.519 2.827   1.00 29.06 ? 16  DT  D O2    1 
ATOM   1706 N  N3    . DT  D 3 16 ? -54.487 19.420 3.067   1.00 27.94 ? 16  DT  D N3    1 
ATOM   1707 C  C4    . DT  D 3 16 ? -55.262 18.448 3.665   1.00 29.67 ? 16  DT  D C4    1 
ATOM   1708 O  O4    . DT  D 3 16 ? -55.243 17.298 3.229   1.00 31.27 ? 16  DT  D O4    1 
ATOM   1709 C  C5    . DT  D 3 16 ? -56.052 18.895 4.792   1.00 29.19 ? 16  DT  D C5    1 
ATOM   1710 C  C7    . DT  D 3 16 ? -56.921 17.910 5.508   1.00 27.55 ? 16  DT  D C7    1 
ATOM   1711 C  C6    . DT  D 3 16 ? -55.968 20.181 5.146   1.00 30.09 ? 16  DT  D C6    1 
ATOM   1712 P  P     . DT  D 3 17 ? -56.756 26.854 4.723   1.00 39.85 ? 17  DT  D P     1 
ATOM   1713 O  OP1   . DT  D 3 17 ? -56.231 27.992 5.528   1.00 40.74 ? 17  DT  D OP1   1 
ATOM   1714 O  OP2   . DT  D 3 17 ? -58.213 26.563 4.712   1.00 40.04 ? 17  DT  D OP2   1 
ATOM   1715 O  "O5'" . DT  D 3 17 ? -56.272 27.008 3.220   1.00 37.11 ? 17  DT  D "O5'" 1 
ATOM   1716 C  "C5'" . DT  D 3 17 ? -54.887 26.993 2.917   1.00 32.07 ? 17  DT  D "C5'" 1 
ATOM   1717 C  "C4'" . DT  D 3 17 ? -54.682 26.602 1.476   1.00 30.56 ? 17  DT  D "C4'" 1 
ATOM   1718 O  "O4'" . DT  D 3 17 ? -54.777 25.170 1.314   1.00 29.09 ? 17  DT  D "O4'" 1 
ATOM   1719 C  "C3'" . DT  D 3 17 ? -55.693 27.213 0.503   1.00 30.02 ? 17  DT  D "C3'" 1 
ATOM   1720 O  "O3'" . DT  D 3 17 ? -54.984 27.712 -0.625  1.00 29.79 ? 17  DT  D "O3'" 1 
ATOM   1721 C  "C2'" . DT  D 3 17 ? -56.563 26.029 0.102   1.00 27.81 ? 17  DT  D "C2'" 1 
ATOM   1722 C  "C1'" . DT  D 3 17 ? -55.563 24.892 0.172   1.00 26.73 ? 17  DT  D "C1'" 1 
ATOM   1723 N  N1    . DT  D 3 17 ? -56.094 23.525 0.319   1.00 25.01 ? 17  DT  D N1    1 
ATOM   1724 C  C2    . DT  D 3 17 ? -55.430 22.512 -0.346  1.00 23.96 ? 17  DT  D C2    1 
ATOM   1725 O  O2    . DT  D 3 17 ? -54.470 22.712 -1.078  1.00 22.43 ? 17  DT  D O2    1 
ATOM   1726 N  N3    . DT  D 3 17 ? -55.931 21.252 -0.120  1.00 22.75 ? 17  DT  D N3    1 
ATOM   1727 C  C4    . DT  D 3 17 ? -57.001 20.914 0.687   1.00 24.78 ? 17  DT  D C4    1 
ATOM   1728 O  O4    . DT  D 3 17 ? -57.312 19.735 0.825   1.00 24.65 ? 17  DT  D O4    1 
ATOM   1729 C  C5    . DT  D 3 17 ? -57.673 22.033 1.328   1.00 25.16 ? 17  DT  D C5    1 
ATOM   1730 C  C7    . DT  D 3 17 ? -58.862 21.768 2.198   1.00 25.16 ? 17  DT  D C7    1 
ATOM   1731 C  C6    . DT  D 3 17 ? -57.192 23.265 1.111   1.00 25.26 ? 17  DT  D C6    1 
ATOM   1732 P  P     . DC  D 3 18 ? -55.307 29.176 -1.185  1.00 29.66 ? 18  DC  D P     1 
ATOM   1733 O  OP1   . DC  D 3 18 ? -54.006 29.883 -1.331  1.00 30.03 ? 18  DC  D OP1   1 
ATOM   1734 O  OP2   . DC  D 3 18 ? -56.390 29.783 -0.372  1.00 26.99 ? 18  DC  D OP2   1 
ATOM   1735 O  "O5'" . DC  D 3 18 ? -55.860 28.863 -2.641  1.00 27.50 ? 18  DC  D "O5'" 1 
ATOM   1736 C  "C5'" . DC  D 3 18 ? -55.026 28.231 -3.608  1.00 25.57 ? 18  DC  D "C5'" 1 
ATOM   1737 C  "C4'" . DC  D 3 18 ? -55.861 27.481 -4.621  1.00 22.70 ? 18  DC  D "C4'" 1 
ATOM   1738 O  "O4'" . DC  D 3 18 ? -56.355 26.238 -4.067  1.00 22.91 ? 18  DC  D "O4'" 1 
ATOM   1739 C  "C3'" . DC  D 3 18 ? -57.081 28.231 -5.156  1.00 22.98 ? 18  DC  D "C3'" 1 
ATOM   1740 O  "O3'" . DC  D 3 18 ? -57.156 28.053 -6.576  1.00 25.71 ? 18  DC  D "O3'" 1 
ATOM   1741 C  "C2'" . DC  D 3 18 ? -58.246 27.540 -4.462  1.00 22.46 ? 18  DC  D "C2'" 1 
ATOM   1742 C  "C1'" . DC  D 3 18 ? -57.733 26.112 -4.356  1.00 21.97 ? 18  DC  D "C1'" 1 
ATOM   1743 N  N1    . DC  D 3 18 ? -58.346 25.254 -3.321  1.00 21.34 ? 18  DC  D N1    1 
ATOM   1744 C  C2    . DC  D 3 18 ? -57.954 23.902 -3.245  1.00 21.78 ? 18  DC  D C2    1 
ATOM   1745 O  O2    . DC  D 3 18 ? -57.086 23.481 -4.025  1.00 20.49 ? 18  DC  D O2    1 
ATOM   1746 N  N3    . DC  D 3 18 ? -58.533 23.094 -2.324  1.00 21.92 ? 18  DC  D N3    1 
ATOM   1747 C  C4    . DC  D 3 18 ? -59.465 23.583 -1.498  1.00 23.42 ? 18  DC  D C4    1 
ATOM   1748 N  N4    . DC  D 3 18 ? -60.025 22.743 -0.613  1.00 22.60 ? 18  DC  D N4    1 
ATOM   1749 C  C5    . DC  D 3 18 ? -59.870 24.955 -1.543  1.00 22.01 ? 18  DC  D C5    1 
ATOM   1750 C  C6    . DC  D 3 18 ? -59.289 25.746 -2.459  1.00 21.41 ? 18  DC  D C6    1 
ATOM   1751 P  P     . DA  D 3 19 ? -56.849 29.295 -7.561  1.00 28.04 ? 19  DA  D P     1 
ATOM   1752 O  OP1   . DA  D 3 19 ? -55.826 30.181 -6.931  1.00 25.58 ? 19  DA  D OP1   1 
ATOM   1753 O  OP2   . DA  D 3 19 ? -58.166 29.857 -7.956  1.00 28.88 ? 19  DA  D OP2   1 
ATOM   1754 O  "O5'" . DA  D 3 19 ? -56.215 28.607 -8.852  1.00 26.44 ? 19  DA  D "O5'" 1 
ATOM   1755 C  "C5'" . DA  D 3 19 ? -54.923 28.009 -8.804  1.00 26.31 ? 19  DA  D "C5'" 1 
ATOM   1756 C  "C4'" . DA  D 3 19 ? -54.914 26.713 -9.582  1.00 25.00 ? 19  DA  D "C4'" 1 
ATOM   1757 O  "O4'" . DA  D 3 19 ? -55.765 25.747 -8.924  1.00 25.91 ? 19  DA  D "O4'" 1 
ATOM   1758 C  "C3'" . DA  D 3 19 ? -55.435 26.806 -11.011 1.00 23.38 ? 19  DA  D "C3'" 1 
ATOM   1759 O  "O3'" . DA  D 3 19 ? -54.786 25.770 -11.763 1.00 21.47 ? 19  DA  D "O3'" 1 
ATOM   1760 C  "C2'" . DA  D 3 19 ? -56.912 26.490 -10.845 1.00 22.06 ? 19  DA  D "C2'" 1 
ATOM   1761 C  "C1'" . DA  D 3 19 ? -56.905 25.453 -9.730  1.00 21.30 ? 19  DA  D "C1'" 1 
ATOM   1762 N  N9    . DA  D 3 19 ? -58.072 25.469 -8.844  1.00 16.65 ? 19  DA  D N9    1 
ATOM   1763 C  C8    . DA  D 3 19 ? -59.003 26.468 -8.664  1.00 15.90 ? 19  DA  D C8    1 
ATOM   1764 N  N7    . DA  D 3 19 ? -59.893 26.198 -7.739  1.00 14.58 ? 19  DA  D N7    1 
ATOM   1765 C  C5    . DA  D 3 19 ? -59.532 24.932 -7.287  1.00 15.01 ? 19  DA  D C5    1 
ATOM   1766 C  C6    . DA  D 3 19 ? -60.065 24.089 -6.295  1.00 15.75 ? 19  DA  D C6    1 
ATOM   1767 N  N6    . DA  D 3 19 ? -61.106 24.417 -5.521  1.00 16.58 ? 19  DA  D N6    1 
ATOM   1768 N  N1    . DA  D 3 19 ? -59.479 22.885 -6.109  1.00 17.32 ? 19  DA  D N1    1 
ATOM   1769 C  C2    . DA  D 3 19 ? -58.419 22.568 -6.856  1.00 17.66 ? 19  DA  D C2    1 
ATOM   1770 N  N3    . DA  D 3 19 ? -57.814 23.281 -7.803  1.00 19.23 ? 19  DA  D N3    1 
ATOM   1771 C  C4    . DA  D 3 19 ? -58.426 24.465 -7.974  1.00 16.47 ? 19  DA  D C4    1 
HETATM 1772 MG MG    . MG  E 4 .  ? -13.953 20.077 26.458  1.00 10.32 ? 1   MG  B MG    1 
HETATM 1773 O  O     . HOH F 5 .  ? -46.887 -1.941 4.744   1.00 3.24  ? 1   HOH A O     1 
HETATM 1774 O  O     . HOH F 5 .  ? -58.738 8.793  -16.597 1.00 13.70 ? 2   HOH A O     1 
HETATM 1775 O  O     . HOH F 5 .  ? -44.467 4.910  1.747   1.00 14.42 ? 4   HOH A O     1 
HETATM 1776 O  O     . HOH F 5 .  ? -49.059 12.590 -5.320  1.00 12.32 ? 9   HOH A O     1 
HETATM 1777 O  O     . HOH F 5 .  ? -42.110 15.438 -8.826  1.00 25.35 ? 16  HOH A O     1 
HETATM 1778 O  O     . HOH F 5 .  ? -52.954 -7.755 -0.012  1.00 15.75 ? 17  HOH A O     1 
HETATM 1779 O  O     . HOH F 5 .  ? -55.555 8.876  -2.505  1.00 31.38 ? 20  HOH A O     1 
HETATM 1780 O  O     . HOH F 5 .  ? -55.732 12.285 -9.313  1.00 15.49 ? 22  HOH A O     1 
HETATM 1781 O  O     . HOH F 5 .  ? -55.163 21.635 -12.680 1.00 25.22 ? 24  HOH A O     1 
HETATM 1782 O  O     . HOH F 5 .  ? -56.210 0.449  -2.085  1.00 24.01 ? 31  HOH A O     1 
HETATM 1783 O  O     . HOH F 5 .  ? -45.143 7.825  1.497   1.00 18.95 ? 38  HOH A O     1 
HETATM 1784 O  O     . HOH F 5 .  ? -53.475 -2.386 -12.435 1.00 25.20 ? 40  HOH A O     1 
HETATM 1785 O  O     . HOH F 5 .  ? -36.082 0.360  -8.130  1.00 20.53 ? 46  HOH A O     1 
HETATM 1786 O  O     . HOH F 5 .  ? -49.811 16.501 -10.752 1.00 16.92 ? 47  HOH A O     1 
HETATM 1787 O  O     . HOH F 5 .  ? -50.195 3.293  8.725   1.00 20.16 ? 48  HOH A O     1 
HETATM 1788 O  O     . HOH F 5 .  ? -54.126 -1.420 2.443   1.00 16.41 ? 54  HOH A O     1 
HETATM 1789 O  O     . HOH F 5 .  ? -45.473 13.137 -13.726 1.00 28.91 ? 59  HOH A O     1 
HETATM 1790 O  O     . HOH F 5 .  ? -59.140 3.491  -10.527 1.00 32.02 ? 61  HOH A O     1 
HETATM 1791 O  O     . HOH F 5 .  ? -38.125 5.387  2.382   1.00 27.04 ? 62  HOH A O     1 
HETATM 1792 O  O     . HOH F 5 .  ? -51.748 11.582 -15.177 1.00 21.69 ? 65  HOH A O     1 
HETATM 1793 O  O     . HOH F 5 .  ? -53.103 30.952 -8.525  1.00 23.94 ? 67  HOH A O     1 
HETATM 1794 O  O     . HOH F 5 .  ? -41.007 8.201  -13.692 1.00 29.81 ? 68  HOH A O     1 
HETATM 1795 O  O     . HOH F 5 .  ? -52.642 6.471  -17.835 1.00 16.89 ? 78  HOH A O     1 
HETATM 1796 O  O     . HOH F 5 .  ? -34.056 2.906  -7.623  1.00 27.23 ? 80  HOH A O     1 
HETATM 1797 O  O     . HOH F 5 .  ? -56.703 5.699  -17.566 1.00 11.71 ? 85  HOH A O     1 
HETATM 1798 O  O     . HOH F 5 .  ? -51.880 7.776  13.507  1.00 34.62 ? 89  HOH A O     1 
HETATM 1799 O  O     . HOH F 5 .  ? -52.621 28.167 -5.956  1.00 17.37 ? 90  HOH A O     1 
HETATM 1800 O  O     . HOH F 5 .  ? -57.743 6.857  -2.972  1.00 26.16 ? 93  HOH A O     1 
HETATM 1801 O  O     . HOH F 5 .  ? -38.849 12.440 -7.765  1.00 26.58 ? 99  HOH A O     1 
HETATM 1802 O  O     . HOH F 5 .  ? -57.617 -0.793 0.371   1.00 35.07 ? 103 HOH A O     1 
HETATM 1803 O  O     . HOH F 5 .  ? -49.361 13.560 -14.157 1.00 29.51 ? 121 HOH A O     1 
HETATM 1804 O  O     . HOH F 5 .  ? -54.310 -0.381 5.220   1.00 28.66 ? 126 HOH A O     1 
HETATM 1805 O  O     . HOH F 5 .  ? -58.707 -0.295 -6.388  1.00 24.81 ? 134 HOH A O     1 
HETATM 1806 O  O     . HOH F 5 .  ? -59.922 6.472  -10.684 1.00 22.27 ? 195 HOH A O     1 
HETATM 1807 O  O     . HOH F 5 .  ? -58.529 16.691 8.330   1.00 31.22 ? 196 HOH A O     1 
HETATM 1808 O  O     . HOH F 5 .  ? -57.322 -2.801 -7.115  1.00 22.03 ? 197 HOH A O     1 
HETATM 1809 O  O     . HOH F 5 .  ? -39.119 7.917  -3.222  1.00 28.90 ? 198 HOH A O     1 
HETATM 1810 O  O     . HOH F 5 .  ? -48.829 22.824 -8.261  1.00 27.72 ? 199 HOH A O     1 
HETATM 1811 O  O     . HOH F 5 .  ? -48.122 10.684 -16.128 1.00 25.90 ? 200 HOH A O     1 
HETATM 1812 O  O     . HOH F 5 .  ? -61.186 -1.266 -4.775  1.00 25.81 ? 201 HOH A O     1 
HETATM 1813 O  O     . HOH F 5 .  ? -53.216 0.161  -14.620 1.00 26.47 ? 202 HOH A O     1 
HETATM 1814 O  O     . HOH F 5 .  ? -41.562 13.456 2.152   1.00 19.58 ? 203 HOH A O     1 
HETATM 1815 O  O     . HOH F 5 .  ? -47.583 18.057 -12.834 1.00 32.11 ? 204 HOH A O     1 
HETATM 1816 O  O     . HOH F 5 .  ? -49.955 -9.320 -2.791  1.00 22.89 ? 205 HOH A O     1 
HETATM 1817 O  O     . HOH F 5 .  ? -43.396 11.199 2.891   1.00 27.31 ? 206 HOH A O     1 
HETATM 1818 O  O     . HOH F 5 .  ? -57.205 1.106  2.906   1.00 44.57 ? 207 HOH A O     1 
HETATM 1819 O  O     . HOH F 5 .  ? -44.934 33.372 -12.670 1.00 22.63 ? 208 HOH A O     1 
HETATM 1820 O  O     . HOH F 5 .  ? -38.859 11.235 -3.447  1.00 19.10 ? 209 HOH A O     1 
HETATM 1821 O  O     . HOH G 5 .  ? -21.855 10.324 9.486   1.00 21.09 ? 6   HOH B O     1 
HETATM 1822 O  O     . HOH G 5 .  ? -26.530 7.986  14.326  1.00 16.73 ? 8   HOH B O     1 
HETATM 1823 O  O     . HOH G 5 .  ? -22.047 17.273 26.681  1.00 25.28 ? 10  HOH B O     1 
HETATM 1824 O  O     . HOH G 5 .  ? -20.137 12.301 19.182  1.00 12.56 ? 14  HOH B O     1 
HETATM 1825 O  O     . HOH G 5 .  ? -20.975 3.170  7.547   1.00 22.75 ? 15  HOH B O     1 
HETATM 1826 O  O     . HOH G 5 .  ? -13.261 8.668  32.629  1.00 12.72 ? 26  HOH B O     1 
HETATM 1827 O  O     . HOH G 5 .  ? -26.621 4.895  14.150  1.00 17.49 ? 27  HOH B O     1 
HETATM 1828 O  O     . HOH G 5 .  ? -17.813 23.882 25.612  1.00 12.91 ? 30  HOH B O     1 
HETATM 1829 O  O     . HOH G 5 .  ? -26.405 13.872 28.873  1.00 17.72 ? 33  HOH B O     1 
HETATM 1830 O  O     . HOH G 5 .  ? -14.851 1.036  17.702  1.00 21.58 ? 36  HOH B O     1 
HETATM 1831 O  O     . HOH G 5 .  ? -24.233 33.499 23.772  1.00 14.58 ? 37  HOH B O     1 
HETATM 1832 O  O     . HOH G 5 .  ? -12.293 4.148  26.620  1.00 18.55 ? 41  HOH B O     1 
HETATM 1833 O  O     . HOH G 5 .  ? -23.049 -8.328 23.373  1.00 26.58 ? 44  HOH B O     1 
HETATM 1834 O  O     . HOH G 5 .  ? -32.171 12.763 22.958  1.00 22.02 ? 52  HOH B O     1 
HETATM 1835 O  O     . HOH G 5 .  ? -28.738 15.662 23.669  1.00 24.50 ? 55  HOH B O     1 
HETATM 1836 O  O     . HOH G 5 .  ? -24.476 -5.463 22.830  1.00 34.31 ? 64  HOH B O     1 
HETATM 1837 O  O     . HOH G 5 .  ? -18.902 -2.285 28.495  1.00 28.08 ? 66  HOH B O     1 
HETATM 1838 O  O     . HOH G 5 .  ? -16.666 -4.538 13.243  1.00 18.18 ? 71  HOH B O     1 
HETATM 1839 O  O     . HOH G 5 .  ? -17.598 -7.573 16.594  1.00 25.51 ? 73  HOH B O     1 
HETATM 1840 O  O     . HOH G 5 .  ? -22.344 27.274 31.586  1.00 20.42 ? 75  HOH B O     1 
HETATM 1841 O  O     . HOH G 5 .  ? -15.146 8.537  18.796  1.00 20.71 ? 82  HOH B O     1 
HETATM 1842 O  O     . HOH G 5 .  ? -17.674 9.710  17.704  1.00 12.12 ? 83  HOH B O     1 
HETATM 1843 O  O     . HOH G 5 .  ? -20.222 11.982 29.598  1.00 32.57 ? 84  HOH B O     1 
HETATM 1844 O  O     . HOH G 5 .  ? -12.965 9.006  27.357  1.00 23.42 ? 86  HOH B O     1 
HETATM 1845 O  O     . HOH G 5 .  ? -13.148 11.301 25.602  1.00 22.45 ? 94  HOH B O     1 
HETATM 1846 O  O     . HOH G 5 .  ? -17.492 -5.801 20.146  1.00 14.26 ? 98  HOH B O     1 
HETATM 1847 O  O     . HOH G 5 .  ? -29.664 -1.832 13.861  1.00 25.76 ? 100 HOH B O     1 
HETATM 1848 O  O     . HOH G 5 .  ? -32.700 10.368 25.823  1.00 19.57 ? 102 HOH B O     1 
HETATM 1849 O  O     . HOH G 5 .  ? -17.257 0.074  29.363  1.00 15.51 ? 105 HOH B O     1 
HETATM 1850 O  O     . HOH G 5 .  ? -10.731 1.827  27.867  1.00 31.76 ? 112 HOH B O     1 
HETATM 1851 O  O     . HOH G 5 .  ? -13.138 0.456  30.714  1.00 34.96 ? 115 HOH B O     1 
HETATM 1852 O  O     . HOH G 5 .  ? -23.456 10.485 31.970  1.00 20.20 ? 116 HOH B O     1 
HETATM 1853 O  O     . HOH G 5 .  ? -14.681 -0.679 14.956  1.00 19.21 ? 122 HOH B O     1 
HETATM 1854 O  O     . HOH G 5 .  ? -21.803 31.942 18.413  1.00 20.55 ? 133 HOH B O     1 
HETATM 1855 O  O     . HOH G 5 .  ? -13.098 11.210 7.510   1.00 27.19 ? 195 HOH B O     1 
HETATM 1856 O  O     . HOH G 5 .  ? -20.310 -9.189 16.467  1.00 37.02 ? 196 HOH B O     1 
HETATM 1857 O  O     . HOH G 5 .  ? -32.763 6.760  26.246  1.00 26.55 ? 197 HOH B O     1 
HETATM 1858 O  O     . HOH G 5 .  ? -26.786 -1.963 24.307  1.00 21.21 ? 198 HOH B O     1 
HETATM 1859 O  O     . HOH G 5 .  ? -18.846 13.983 12.111  1.00 23.87 ? 199 HOH B O     1 
HETATM 1860 O  O     . HOH G 5 .  ? -35.351 2.474  13.760  1.00 21.62 ? 200 HOH B O     1 
HETATM 1861 O  O     . HOH G 5 .  ? -12.627 -6.644 20.682  1.00 26.70 ? 201 HOH B O     1 
HETATM 1862 O  O     . HOH G 5 .  ? -12.178 2.583  23.964  1.00 16.64 ? 202 HOH B O     1 
HETATM 1863 O  O     . HOH G 5 .  ? -14.078 -4.910 14.635  1.00 29.36 ? 203 HOH B O     1 
HETATM 1864 O  O     . HOH H 5 .  ? -51.417 12.662 -3.671  1.00 12.82 ? 20  HOH C O     1 
HETATM 1865 O  O     . HOH H 5 .  ? -49.459 15.550 1.395   1.00 16.72 ? 21  HOH C O     1 
HETATM 1866 O  O     . HOH H 5 .  ? -16.157 22.022 28.132  1.00 13.47 ? 22  HOH C O     1 
HETATM 1867 O  O     . HOH H 5 .  ? -19.950 9.288  7.402   1.00 9.00  ? 23  HOH C O     1 
HETATM 1868 O  O     . HOH H 5 .  ? -55.078 21.587 -6.541  1.00 18.24 ? 24  HOH C O     1 
HETATM 1869 O  O     . HOH H 5 .  ? -15.471 22.210 24.864  1.00 14.05 ? 32  HOH C O     1 
HETATM 1870 O  O     . HOH H 5 .  ? -45.163 16.425 13.642  1.00 27.73 ? 34  HOH C O     1 
HETATM 1871 O  O     . HOH H 5 .  ? -52.363 20.598 -5.911  1.00 15.41 ? 42  HOH C O     1 
HETATM 1872 O  O     . HOH H 5 .  ? -28.877 4.117  12.118  1.00 18.28 ? 43  HOH C O     1 
HETATM 1873 O  O     . HOH H 5 .  ? -47.321 17.004 -0.012  1.00 19.81 ? 45  HOH C O     1 
HETATM 1874 O  O     . HOH H 5 .  ? -13.099 30.380 12.687  1.00 24.81 ? 50  HOH C O     1 
HETATM 1875 O  O     . HOH H 5 .  ? -16.366 21.555 22.202  1.00 14.75 ? 51  HOH C O     1 
HETATM 1876 O  O     . HOH H 5 .  ? -56.333 9.181  -5.940  1.00 11.97 ? 58  HOH C O     1 
HETATM 1877 O  O     . HOH H 5 .  ? -10.452 23.935 14.327  1.00 30.02 ? 72  HOH C O     1 
HETATM 1878 O  O     . HOH H 5 .  ? -15.168 32.854 17.126  1.00 18.28 ? 76  HOH C O     1 
HETATM 1879 O  O     . HOH H 5 .  ? -27.203 11.551 3.484   1.00 29.99 ? 87  HOH C O     1 
HETATM 1880 O  O     . HOH H 5 .  ? -46.104 15.632 -4.975  1.00 25.84 ? 92  HOH C O     1 
HETATM 1881 O  O     . HOH H 5 .  ? -58.540 10.638 -8.972  1.00 23.56 ? 101 HOH C O     1 
HETATM 1882 O  O     . HOH H 5 .  ? -31.648 10.979 18.498  1.00 27.90 ? 113 HOH C O     1 
HETATM 1883 O  O     . HOH H 5 .  ? -10.027 28.473 22.048  1.00 20.91 ? 120 HOH C O     1 
HETATM 1884 O  O     . HOH H 5 .  ? -41.670 20.850 4.327   1.00 29.42 ? 124 HOH C O     1 
HETATM 1885 O  O     . HOH H 5 .  ? -55.122 13.175 -1.405  1.00 18.07 ? 131 HOH C O     1 
HETATM 1886 O  O     . HOH H 5 .  ? -59.371 10.205 -5.139  1.00 25.38 ? 140 HOH C O     1 
HETATM 1887 O  O     . HOH H 5 .  ? -19.197 29.523 16.635  1.00 23.59 ? 146 HOH C O     1 
HETATM 1888 O  O     . HOH H 5 .  ? -57.247 15.010 0.586   1.00 25.21 ? 147 HOH C O     1 
HETATM 1889 O  O     . HOH H 5 .  ? -40.060 18.608 6.069   1.00 28.57 ? 148 HOH C O     1 
HETATM 1890 O  O     . HOH H 5 .  ? -46.412 25.561 13.403  1.00 32.23 ? 149 HOH C O     1 
HETATM 1891 O  O     . HOH H 5 .  ? -43.885 16.772 -6.533  1.00 21.08 ? 154 HOH C O     1 
HETATM 1892 O  O     . HOH H 5 .  ? -32.302 9.185  7.152   1.00 24.79 ? 161 HOH C O     1 
HETATM 1893 O  O     . HOH H 5 .  ? -12.688 18.013 13.604  1.00 22.43 ? 167 HOH C O     1 
HETATM 1894 O  O     . HOH H 5 .  ? -15.715 15.008 12.765  1.00 24.12 ? 170 HOH C O     1 
HETATM 1895 O  O     . HOH H 5 .  ? -7.499  24.268 15.267  1.00 31.59 ? 174 HOH C O     1 
HETATM 1896 O  O     . HOH H 5 .  ? -35.510 8.410  8.263   1.00 30.06 ? 176 HOH C O     1 
HETATM 1897 O  O     . HOH H 5 .  ? -43.206 23.569 1.998   1.00 26.44 ? 178 HOH C O     1 
HETATM 1898 O  O     . HOH H 5 .  ? -20.261 21.821 6.763   1.00 32.75 ? 179 HOH C O     1 
HETATM 1899 O  O     . HOH H 5 .  ? -50.733 22.837 -5.072  1.00 20.59 ? 180 HOH C O     1 
HETATM 1900 O  O     . HOH H 5 .  ? -43.316 21.254 -0.428  1.00 30.12 ? 194 HOH C O     1 
HETATM 1901 O  O     . HOH H 5 .  ? -30.032 15.978 12.445  1.00 22.89 ? 195 HOH C O     1 
HETATM 1902 O  O     . HOH I 5 .  ? -22.470 12.747 21.008  1.00 13.85 ? 20  HOH D O     1 
HETATM 1903 O  O     . HOH I 5 .  ? -22.200 15.605 13.771  1.00 17.39 ? 21  HOH D O     1 
HETATM 1904 O  O     . HOH I 5 .  ? -49.725 9.965  6.095   1.00 12.72 ? 22  HOH D O     1 
HETATM 1905 O  O     . HOH I 5 .  ? -18.938 20.678 21.303  1.00 17.41 ? 23  HOH D O     1 
HETATM 1906 O  O     . HOH I 5 .  ? -15.649 12.570 24.633  1.00 15.97 ? 25  HOH D O     1 
HETATM 1907 O  O     . HOH I 5 .  ? -53.621 23.628 -10.488 1.00 26.26 ? 28  HOH D O     1 
HETATM 1908 O  O     . HOH I 5 .  ? -15.654 9.183  21.661  1.00 18.69 ? 29  HOH D O     1 
HETATM 1909 O  O     . HOH I 5 .  ? -55.923 22.228 -9.259  1.00 19.78 ? 35  HOH D O     1 
HETATM 1910 O  O     . HOH I 5 .  ? -59.102 18.054 1.806   1.00 21.58 ? 39  HOH D O     1 
HETATM 1911 O  O     . HOH I 5 .  ? -25.800 16.715 13.561  1.00 18.23 ? 49  HOH D O     1 
HETATM 1912 O  O     . HOH I 5 .  ? -55.776 24.417 -13.537 1.00 24.97 ? 53  HOH D O     1 
HETATM 1913 O  O     . HOH I 5 .  ? -51.599 29.605 -2.886  1.00 19.94 ? 57  HOH D O     1 
HETATM 1914 O  O     . HOH I 5 .  ? -30.099 12.300 2.442   1.00 32.05 ? 70  HOH D O     1 
HETATM 1915 O  O     . HOH I 5 .  ? -27.944 29.722 13.986  1.00 28.97 ? 88  HOH D O     1 
HETATM 1916 O  O     . HOH I 5 .  ? -50.576 7.186  9.169   1.00 14.60 ? 95  HOH D O     1 
HETATM 1917 O  O     . HOH I 5 .  ? -23.729 17.208 15.992  1.00 15.99 ? 96  HOH D O     1 
HETATM 1918 O  O     . HOH I 5 .  ? -30.614 20.276 8.280   1.00 41.02 ? 104 HOH D O     1 
HETATM 1919 O  O     . HOH I 5 .  ? -12.819 9.442  22.723  1.00 16.55 ? 106 HOH D O     1 
HETATM 1920 O  O     . HOH I 5 .  ? -52.663 14.175 3.851   1.00 16.39 ? 107 HOH D O     1 
HETATM 1921 O  O     . HOH I 5 .  ? -41.535 3.966  3.995   1.00 20.74 ? 108 HOH D O     1 
HETATM 1922 O  O     . HOH I 5 .  ? -25.994 15.581 21.002  1.00 20.66 ? 110 HOH D O     1 
HETATM 1923 O  O     . HOH I 5 .  ? -20.613 22.950 22.502  1.00 17.57 ? 111 HOH D O     1 
HETATM 1924 O  O     . HOH I 5 .  ? -51.394 30.546 0.226   1.00 28.38 ? 114 HOH D O     1 
HETATM 1925 O  O     . HOH I 5 .  ? -45.142 6.392  11.029  1.00 22.44 ? 118 HOH D O     1 
HETATM 1926 O  O     . HOH I 5 .  ? -61.987 22.418 1.197   1.00 30.56 ? 119 HOH D O     1 
HETATM 1927 O  O     . HOH I 5 .  ? -56.536 23.845 11.520  1.00 28.25 ? 128 HOH D O     1 
HETATM 1928 O  O     . HOH I 5 .  ? -50.294 11.294 15.049  1.00 24.68 ? 130 HOH D O     1 
HETATM 1929 O  O     . HOH I 5 .  ? -37.187 14.389 -3.114  1.00 28.56 ? 136 HOH D O     1 
HETATM 1930 O  O     . HOH I 5 .  ? -50.181 13.191 5.311   1.00 17.31 ? 141 HOH D O     1 
HETATM 1931 O  O     . HOH I 5 .  ? -16.046 14.171 16.072  1.00 24.23 ? 153 HOH D O     1 
HETATM 1932 O  O     . HOH I 5 .  ? -59.086 21.120 5.467   1.00 24.28 ? 155 HOH D O     1 
HETATM 1933 O  O     . HOH I 5 .  ? -60.124 18.499 4.749   1.00 27.01 ? 165 HOH D O     1 
HETATM 1934 O  O     . HOH I 5 .  ? -8.512  20.922 14.201  1.00 28.75 ? 169 HOH D O     1 
HETATM 1935 O  O     . HOH I 5 .  ? -27.166 16.552 1.329   1.00 40.74 ? 183 HOH D O     1 
HETATM 1936 O  O     . HOH I 5 .  ? -56.480 21.537 14.137  1.00 32.92 ? 186 HOH D O     1 
HETATM 1937 O  O     . HOH I 5 .  ? -29.063 19.176 11.039  1.00 27.51 ? 188 HOH D O     1 
HETATM 1938 O  O     . HOH I 5 .  ? -9.805  18.292 14.690  1.00 20.71 ? 189 HOH D O     1 
HETATM 1939 O  O     . HOH I 5 .  ? -62.235 25.452 0.599   1.00 44.51 ? 191 HOH D O     1 
HETATM 1940 O  O     . HOH I 5 .  ? -59.934 25.287 2.683   1.00 26.56 ? 193 HOH D O     1 
HETATM 1941 O  O     . HOH I 5 .  ? -34.712 9.305  5.207   1.00 43.55 ? 198 HOH D O     1 
HETATM 1942 O  O     . HOH I 5 .  ? -7.530  23.796 18.727  1.00 29.45 ? 199 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  137 137 GLY GLY A . n 
A 1 2  ARG 2  138 138 ARG ARG A . n 
A 1 3  ARG 3  139 139 ARG ARG A . n 
A 1 4  LYS 4  140 140 LYS LYS A . n 
A 1 5  PRO 5  141 141 PRO PRO A . n 
A 1 6  ARG 6  142 142 ARG ARG A . n 
A 1 7  VAL 7  143 143 VAL VAL A . n 
A 1 8  LEU 8  144 144 LEU LEU A . n 
A 1 9  PHE 9  145 145 PHE PHE A . n 
A 1 10 SER 10 146 146 SER SER A . n 
A 1 11 GLN 11 147 147 GLN GLN A . n 
A 1 12 ALA 12 148 148 ALA ALA A . n 
A 1 13 GLN 13 149 149 GLN GLN A . n 
A 1 14 VAL 14 150 150 VAL VAL A . n 
A 1 15 TYR 15 151 151 TYR TYR A . n 
A 1 16 GLU 16 152 152 GLU GLU A . n 
A 1 17 LEU 17 153 153 LEU LEU A . n 
A 1 18 GLU 18 154 154 GLU GLU A . n 
A 1 19 ARG 19 155 155 ARG ARG A . n 
A 1 20 ARG 20 156 156 ARG ARG A . n 
A 1 21 PHE 21 157 157 PHE PHE A . n 
A 1 22 LYS 22 158 158 LYS LYS A . n 
A 1 23 GLN 23 159 159 GLN GLN A . n 
A 1 24 GLN 24 160 160 GLN GLN A . n 
A 1 25 ARG 25 161 161 ARG ARG A . n 
A 1 26 TYR 26 162 162 TYR TYR A . n 
A 1 27 LEU 27 163 163 LEU LEU A . n 
A 1 28 SER 28 164 164 SER SER A . n 
A 1 29 ALA 29 165 165 ALA ALA A . n 
A 1 30 PRO 30 166 166 PRO PRO A . n 
A 1 31 GLU 31 167 167 GLU GLU A . n 
A 1 32 ARG 32 168 168 ARG ARG A . n 
A 1 33 ASP 33 169 169 ASP ASP A . n 
A 1 34 GLN 34 170 170 GLN GLN A . n 
A 1 35 LEU 35 171 171 LEU LEU A . n 
A 1 36 ALA 36 172 172 ALA ALA A . n 
A 1 37 SER 37 173 173 SER SER A . n 
A 1 38 VAL 38 174 174 VAL VAL A . n 
A 1 39 LEU 39 175 175 LEU LEU A . n 
A 1 40 LYS 40 176 176 LYS LYS A . n 
A 1 41 LEU 41 177 177 LEU LEU A . n 
A 1 42 THR 42 178 178 THR THR A . n 
A 1 43 SER 43 179 179 SER SER A . n 
A 1 44 THR 44 180 180 THR THR A . n 
A 1 45 GLN 45 181 181 GLN GLN A . n 
A 1 46 VAL 46 182 182 VAL VAL A . n 
A 1 47 LYS 47 183 183 LYS LYS A . n 
A 1 48 ILE 48 184 184 ILE ILE A . n 
A 1 49 TRP 49 185 185 TRP TRP A . n 
A 1 50 PHE 50 186 186 PHE PHE A . n 
A 1 51 GLN 51 187 187 GLN GLN A . n 
A 1 52 ASN 52 188 188 ASN ASN A . n 
A 1 53 ARG 53 189 189 ARG ARG A . n 
A 1 54 ARG 54 190 190 ARG ARG A . n 
A 1 55 TYR 55 191 191 TYR TYR A . n 
A 1 56 LYS 56 192 192 LYS LYS A . n 
A 1 57 SER 57 193 193 SER SER A . n 
A 1 58 LYS 58 194 194 LYS LYS A . n 
B 1 1  GLY 1  137 137 GLY GLY B . n 
B 1 2  ARG 2  138 138 ARG ARG B . n 
B 1 3  ARG 3  139 139 ARG ARG B . n 
B 1 4  LYS 4  140 140 LYS LYS B . n 
B 1 5  PRO 5  141 141 PRO PRO B . n 
B 1 6  ARG 6  142 142 ARG ARG B . n 
B 1 7  VAL 7  143 143 VAL VAL B . n 
B 1 8  LEU 8  144 144 LEU LEU B . n 
B 1 9  PHE 9  145 145 PHE PHE B . n 
B 1 10 SER 10 146 146 SER SER B . n 
B 1 11 GLN 11 147 147 GLN GLN B . n 
B 1 12 ALA 12 148 148 ALA ALA B . n 
B 1 13 GLN 13 149 149 GLN GLN B . n 
B 1 14 VAL 14 150 150 VAL VAL B . n 
B 1 15 TYR 15 151 151 TYR TYR B . n 
B 1 16 GLU 16 152 152 GLU GLU B . n 
B 1 17 LEU 17 153 153 LEU LEU B . n 
B 1 18 GLU 18 154 154 GLU GLU B . n 
B 1 19 ARG 19 155 155 ARG ARG B . n 
B 1 20 ARG 20 156 156 ARG ARG B . n 
B 1 21 PHE 21 157 157 PHE PHE B . n 
B 1 22 LYS 22 158 158 LYS LYS B . n 
B 1 23 GLN 23 159 159 GLN GLN B . n 
B 1 24 GLN 24 160 160 GLN GLN B . n 
B 1 25 ARG 25 161 161 ARG ARG B . n 
B 1 26 TYR 26 162 162 TYR TYR B . n 
B 1 27 LEU 27 163 163 LEU LEU B . n 
B 1 28 SER 28 164 164 SER SER B . n 
B 1 29 ALA 29 165 165 ALA ALA B . n 
B 1 30 PRO 30 166 166 PRO PRO B . n 
B 1 31 GLU 31 167 167 GLU GLU B . n 
B 1 32 ARG 32 168 168 ARG ARG B . n 
B 1 33 ASP 33 169 169 ASP ASP B . n 
B 1 34 GLN 34 170 170 GLN GLN B . n 
B 1 35 LEU 35 171 171 LEU LEU B . n 
B 1 36 ALA 36 172 172 ALA ALA B . n 
B 1 37 SER 37 173 173 SER SER B . n 
B 1 38 VAL 38 174 174 VAL VAL B . n 
B 1 39 LEU 39 175 175 LEU LEU B . n 
B 1 40 LYS 40 176 176 LYS LYS B . n 
B 1 41 LEU 41 177 177 LEU LEU B . n 
B 1 42 THR 42 178 178 THR THR B . n 
B 1 43 SER 43 179 179 SER SER B . n 
B 1 44 THR 44 180 180 THR THR B . n 
B 1 45 GLN 45 181 181 GLN GLN B . n 
B 1 46 VAL 46 182 182 VAL VAL B . n 
B 1 47 LYS 47 183 183 LYS LYS B . n 
B 1 48 ILE 48 184 184 ILE ILE B . n 
B 1 49 TRP 49 185 185 TRP TRP B . n 
B 1 50 PHE 50 186 186 PHE PHE B . n 
B 1 51 GLN 51 187 187 GLN GLN B . n 
B 1 52 ASN 52 188 188 ASN ASN B . n 
B 1 53 ARG 53 189 189 ARG ARG B . n 
B 1 54 ARG 54 190 190 ARG ARG B . n 
B 1 55 TYR 55 191 191 TYR TYR B . n 
B 1 56 LYS 56 192 192 LYS LYS B . n 
B 1 57 SER 57 193 193 SER SER B . n 
B 1 58 LYS 58 194 ?   ?   ?   B . n 
C 2 1  DT  1  1   1   DT  THY C . n 
C 2 2  DG  2  2   2   DG  GUA C . n 
C 2 3  DA  3  3   3   DA  ADE C . n 
C 2 4  DA  4  4   4   DA  ADE C . n 
C 2 5  DG  5  5   5   DG  GUA C . n 
C 2 6  DT  6  6   6   DT  THY C . n 
C 2 7  DG  7  7   7   DG  GUA C . n 
C 2 8  DG  8  8   8   DG  GUA C . n 
C 2 9  DG  9  9   9   DG  GUA C . n 
C 2 10 DG  10 10  10  DG  GUA C . n 
C 2 11 DG  11 11  11  DG  GUA C . n 
C 2 12 DC  12 12  12  DC  CYT C . n 
C 2 13 DC  13 13  13  DC  CYT C . n 
C 2 14 DT  14 14  14  DT  THY C . n 
C 2 15 DC  15 15  15  DC  CYT C . n 
C 2 16 DT  16 16  16  DT  THY C . n 
C 2 17 DT  17 17  17  DT  THY C . n 
C 2 18 DG  18 18  18  DG  GUA C . n 
C 2 19 DA  19 19  19  DA  ADE C . n 
D 3 1  DT  1  1   1   DT  THY D . n 
D 3 2  DC  2  2   2   DC  CYT D . n 
D 3 3  DA  3  3   3   DA  ADE D . n 
D 3 4  DA  4  4   4   DA  ADE D . n 
D 3 5  DG  5  5   5   DG  GUA D . n 
D 3 6  DA  6  6   6   DA  ADE D . n 
D 3 7  DG  7  7   7   DG  GUA D . n 
D 3 8  DG  8  8   8   DG  GUA D . n 
D 3 9  DC  9  9   9   DC  CYT D . n 
D 3 10 DC  10 10  10  DC  CYT D . n 
D 3 11 DC  11 11  11  DC  CYT D . n 
D 3 12 DC  12 12  12  DC  CYT D . n 
D 3 13 DC  13 13  13  DC  CYT D . n 
D 3 14 DA  14 14  14  DA  ADE D . n 
D 3 15 DC  15 15  15  DC  CYT D . n 
D 3 16 DT  16 16  16  DT  THY D . n 
D 3 17 DT  17 17  17  DT  THY D . n 
D 3 18 DC  18 18  18  DC  CYT D . n 
D 3 19 DA  19 19  19  DA  ADE D . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5080  ? 
1 MORE         -33   ? 
1 'SSA (A^2)'  13490 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-05-09 
2 'Structure model' 1 1 2014-05-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' . ? 1 
PHASER   phasing           . ? 2 
CNS      refinement        . ? 3 
HKL-2000 'data reduction'  . ? 4 
HKL-2000 'data scaling'    . ? 5 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DG C 8  ? ? 0.055 'SIDE CHAIN' 
2 1 DG C 10 ? ? 0.065 'SIDE CHAIN' 
3 1 DC D 11 ? ? 0.066 'SIDE CHAIN' 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     B 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     LYS 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      194 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    B 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    LYS 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     58 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3RKQ 'double helix'        
3RKQ 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DT 1  1_555 D DA 19 1_555 -0.617 0.013  0.390  -25.837 -36.461 1.026  1  C_DT1:DA19_D  C 1  ? D 19 ? 20 1 
1 C DG 2  1_555 D DC 18 1_555 -0.249 -0.026 -0.655 -15.927 -3.919  1.488  2  C_DG2:DC18_D  C 2  ? D 18 ? 19 1 
1 C DA 3  1_555 D DT 17 1_555 -0.168 -0.018 -0.270 -4.619  -20.298 1.725  3  C_DA3:DT17_D  C 3  ? D 17 ? 20 1 
1 C DA 4  1_555 D DT 16 1_555 -0.588 0.143  0.143  3.960   -14.471 3.733  4  C_DA4:DT16_D  C 4  ? D 16 ? 20 1 
1 C DG 5  1_555 D DC 15 1_555 0.045  -0.116 -0.354 -4.342  -8.163  -0.061 5  C_DG5:DC15_D  C 5  ? D 15 ? 19 1 
1 C DT 6  1_555 D DA 14 1_555 -0.143 -0.031 0.057  6.596   -10.010 4.878  6  C_DT6:DA14_D  C 6  ? D 14 ? 20 1 
1 C DG 7  1_555 D DC 13 1_555 0.861  -0.217 -0.193 7.455   -2.331  -6.308 7  C_DG7:DC13_D  C 7  ? D 13 ? 19 1 
1 C DG 8  1_555 D DC 12 1_555 -0.476 -0.455 -0.157 7.000   -2.592  -6.093 8  C_DG8:DC12_D  C 8  ? D 12 ? 19 1 
1 C DG 9  1_555 D DC 11 1_555 -0.663 -0.489 -0.654 -12.941 1.216   -6.612 9  C_DG9:DC11_D  C 9  ? D 11 ? 19 1 
1 C DG 10 1_555 D DC 10 1_555 -0.767 -0.493 -0.888 -4.932  6.505   -6.395 10 C_DG10:DC10_D C 10 ? D 10 ? 19 1 
1 C DG 11 1_555 D DC 9  1_555 -0.130 -0.419 -0.766 -7.514  5.980   -1.087 11 C_DG11:DC9_D  C 11 ? D 9  ? 19 1 
1 C DC 12 1_555 D DG 8  1_555 -0.056 -0.080 -0.349 1.570   -5.720  -2.870 12 C_DC12:DG8_D  C 12 ? D 8  ? 19 1 
1 C DC 13 1_555 D DG 7  1_555 0.608  -0.087 0.173  -6.681  -6.165  -0.011 13 C_DC13:DG7_D  C 13 ? D 7  ? 19 1 
1 C DT 14 1_555 D DA 6  1_555 -0.386 -0.157 -0.150 -1.704  -11.989 2.569  14 C_DT14:DA6_D  C 14 ? D 6  ? 20 1 
1 C DC 15 1_555 D DG 5  1_555 0.516  -0.036 -0.023 4.458   -7.984  -0.354 15 C_DC15:DG5_D  C 15 ? D 5  ? 19 1 
1 C DT 16 1_555 D DA 4  1_555 -0.291 -0.247 -0.251 0.616   -12.398 1.482  16 C_DT16:DA4_D  C 16 ? D 4  ? 20 1 
1 C DT 17 1_555 D DA 3  1_555 -0.207 -0.116 -0.087 -3.570  -11.707 -4.272 17 C_DT17:DA3_D  C 17 ? D 3  ? 20 1 
1 C DG 18 1_555 D DC 2  1_555 0.225  -0.245 -0.345 8.965   0.994   -3.083 18 C_DG18:DC2_D  C 18 ? D 2  ? 19 1 
1 C DA 19 1_555 D DT 1  1_555 0.268  -0.079 0.283  31.194  -21.075 -8.387 19 C_DA19:DT1_D  C 19 ? D 1  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 C DT 1  1_555 D DA 19 1_555 C DG 2  1_555 D DC 18 1_555 1.109  2.599  3.167 3.291  -0.541 39.007 3.942  -1.270 3.211 -0.808 
-4.917  39.144 1  CC_DT1DG2:DC18DA19_DD  C 1  ? D 19 ? C 2  ? D 18 ? 
1 C DG 2  1_555 D DC 18 1_555 C DA 3  1_555 D DT 17 1_555 -0.896 2.132  3.004 -6.303 4.602  35.083 2.810  0.567  3.353 7.520  
10.299  35.914 2  CC_DG2DA3:DT17DC18_DD  C 2  ? D 18 ? C 3  ? D 17 ? 
1 C DA 3  1_555 D DT 17 1_555 C DA 4  1_555 D DT 16 1_555 0.677  -0.020 3.088 -5.468 0.370  32.283 -0.094 -2.076 2.936 0.659  
9.746   32.732 3  CC_DA3DA4:DT16DT17_DD  C 3  ? D 17 ? C 4  ? D 16 ? 
1 C DA 4  1_555 D DT 16 1_555 C DG 5  1_555 D DC 15 1_555 -0.890 -0.347 3.500 0.944  3.591  39.855 -0.944 1.415  3.437 5.254  
-1.381  40.020 4  CC_DA4DG5:DC15DT16_DD  C 4  ? D 16 ? C 5  ? D 15 ? 
1 C DG 5  1_555 D DC 15 1_555 C DT 6  1_555 D DA 14 1_555 -0.154 -0.570 3.099 -3.762 2.946  25.409 -2.047 -0.642 3.006 6.623  
8.458   25.847 5  CC_DG5DT6:DA14DC15_DD  C 5  ? D 15 ? C 6  ? D 14 ? 
1 C DT 6  1_555 D DA 14 1_555 C DG 7  1_555 D DC 13 1_555 0.215  0.037  3.413 3.738  8.420  35.011 -1.186 0.206  3.337 13.704 
-6.085  36.166 6  CC_DT6DG7:DC13DA14_DD  C 6  ? D 14 ? C 7  ? D 13 ? 
1 C DG 7  1_555 D DC 13 1_555 C DG 8  1_555 D DC 12 1_555 0.104  -0.376 3.354 -1.306 10.510 28.881 -2.786 -0.454 3.027 20.233 
2.515   30.723 7  CC_DG7DG8:DC12DC13_DD  C 7  ? D 13 ? C 8  ? D 12 ? 
1 C DG 8  1_555 D DC 12 1_555 C DG 9  1_555 D DC 11 1_555 -0.102 -1.646 3.829 -1.388 9.764  33.210 -4.427 -0.064 3.231 16.633 
2.364   34.604 8  CC_DG8DG9:DC11DC12_DD  C 8  ? D 12 ? C 9  ? D 11 ? 
1 C DG 9  1_555 D DC 11 1_555 C DG 10 1_555 D DC 10 1_555 0.627  -1.096 3.321 2.166  11.257 27.216 -4.457 -0.788 2.705 22.688 
-4.366  29.490 9  CC_DG9DG10:DC10DC11_DD C 9  ? D 11 ? C 10 ? D 10 ? 
1 C DG 10 1_555 D DC 10 1_555 C DG 11 1_555 D DC 9  1_555 0.630  -1.497 3.623 -1.449 4.777  35.119 -3.210 -1.262 3.369 7.868  
2.386   35.461 10 CC_DG10DG11:DC9DC10_DD C 10 ? D 10 ? C 11 ? D 9  ? 
1 C DG 11 1_555 D DC 9  1_555 C DC 12 1_555 D DG 8  1_555 -0.647 -0.559 3.095 -3.618 8.037  30.925 -2.361 0.562  2.917 14.702 
6.618   32.127 11 CC_DG11DC12:DG8DC9_DD  C 11 ? D 9  ? C 12 ? D 8  ? 
1 C DC 12 1_555 D DG 8  1_555 C DC 13 1_555 D DG 7  1_555 0.119  -0.881 3.503 -1.242 10.548 34.826 -2.932 -0.369 3.109 17.137 
2.019   36.361 12 CC_DC12DC13:DG7DG8_DD  C 12 ? D 8  ? C 13 ? D 7  ? 
1 C DC 13 1_555 D DG 7  1_555 C DT 14 1_555 D DA 6  1_555 0.547  -0.190 3.069 6.386  3.656  32.330 -0.919 0.064  3.079 6.462  
-11.286 33.135 13 CC_DC13DT14:DA6DG7_DD  C 13 ? D 7  ? C 14 ? D 6  ? 
1 C DT 14 1_555 D DA 6  1_555 C DC 15 1_555 D DG 5  1_555 -0.158 0.162  3.279 -0.907 8.588  30.080 -1.344 0.120  3.205 16.133 
1.704   31.268 14 CC_DT14DC15:DG5DA6_DD  C 14 ? D 6  ? C 15 ? D 5  ? 
1 C DC 15 1_555 D DG 5  1_555 C DT 16 1_555 D DA 4  1_555 0.569  -0.402 3.416 5.676  7.998  33.677 -1.925 -0.053 3.288 13.454 
-9.549  35.036 15 CC_DC15DT16:DA4DG5_DD  C 15 ? D 5  ? C 16 ? D 4  ? 
1 C DT 16 1_555 D DA 4  1_555 C DT 17 1_555 D DA 3  1_555 -0.708 -0.154 3.464 -3.439 -3.615 34.001 0.345  0.622  3.514 -6.140 
5.842   34.354 16 CC_DT16DT17:DA3DA4_DD  C 16 ? D 4  ? C 17 ? D 3  ? 
1 C DT 17 1_555 D DA 3  1_555 C DG 18 1_555 D DC 2  1_555 1.106  2.086  3.164 7.087  2.061  36.543 2.987  -0.775 3.420 3.246  
-11.162 37.256 17 CC_DT17DG18:DC2DA3_DD  C 17 ? D 3  ? C 18 ? D 2  ? 
1 C DG 18 1_555 D DC 2  1_555 C DA 19 1_555 D DT 1  1_555 -0.973 2.320  2.884 -1.301 -2.294 34.432 4.216  1.465  2.762 -3.868 
2.194   34.530 18 CC_DG18DA19:DT1DC2_DD  C 18 ? D 2  ? C 19 ? D 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION' MG  
5 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 MG  1  1   1   MG  MG  B . 
F 5 HOH 1  1   1   HOH TIP A . 
F 5 HOH 2  2   2   HOH TIP A . 
F 5 HOH 3  4   4   HOH TIP A . 
F 5 HOH 4  9   9   HOH TIP A . 
F 5 HOH 5  16  16  HOH TIP A . 
F 5 HOH 6  17  17  HOH TIP A . 
F 5 HOH 7  20  20  HOH TIP A . 
F 5 HOH 8  22  12  HOH TIP A . 
F 5 HOH 9  24  24  HOH TIP A . 
F 5 HOH 10 31  31  HOH TIP A . 
F 5 HOH 11 38  38  HOH TIP A . 
F 5 HOH 12 40  40  HOH TIP A . 
F 5 HOH 13 46  46  HOH TIP A . 
F 5 HOH 14 47  47  HOH TIP A . 
F 5 HOH 15 48  48  HOH TIP A . 
F 5 HOH 16 54  54  HOH TIP A . 
F 5 HOH 17 59  59  HOH TIP A . 
F 5 HOH 18 61  61  HOH TIP A . 
F 5 HOH 19 62  62  HOH TIP A . 
F 5 HOH 20 65  65  HOH TIP A . 
F 5 HOH 21 67  67  HOH TIP A . 
F 5 HOH 22 68  68  HOH TIP A . 
F 5 HOH 23 78  78  HOH TIP A . 
F 5 HOH 24 80  80  HOH TIP A . 
F 5 HOH 25 85  85  HOH TIP A . 
F 5 HOH 26 89  89  HOH TIP A . 
F 5 HOH 27 90  90  HOH TIP A . 
F 5 HOH 28 93  93  HOH TIP A . 
F 5 HOH 29 99  99  HOH TIP A . 
F 5 HOH 30 103 103 HOH TIP A . 
F 5 HOH 31 121 121 HOH TIP A . 
F 5 HOH 32 126 126 HOH TIP A . 
F 5 HOH 33 134 134 HOH TIP A . 
F 5 HOH 34 195 138 HOH TIP A . 
F 5 HOH 35 196 139 HOH TIP A . 
F 5 HOH 36 197 150 HOH TIP A . 
F 5 HOH 37 198 156 HOH TIP A . 
F 5 HOH 38 199 157 HOH TIP A . 
F 5 HOH 39 200 159 HOH TIP A . 
F 5 HOH 40 201 160 HOH TIP A . 
F 5 HOH 41 202 166 HOH TIP A . 
F 5 HOH 42 203 168 HOH TIP A . 
F 5 HOH 43 204 171 HOH TIP A . 
F 5 HOH 44 205 172 HOH TIP A . 
F 5 HOH 45 206 173 HOH TIP A . 
F 5 HOH 46 207 181 HOH TIP A . 
F 5 HOH 47 208 185 HOH TIP A . 
F 5 HOH 48 209 192 HOH TIP A . 
G 5 HOH 1  6   6   HOH TIP B . 
G 5 HOH 2  8   8   HOH TIP B . 
G 5 HOH 3  10  10  HOH TIP B . 
G 5 HOH 4  14  14  HOH TIP B . 
G 5 HOH 5  15  15  HOH TIP B . 
G 5 HOH 6  26  26  HOH TIP B . 
G 5 HOH 7  27  27  HOH TIP B . 
G 5 HOH 8  30  30  HOH TIP B . 
G 5 HOH 9  33  33  HOH TIP B . 
G 5 HOH 10 36  36  HOH TIP B . 
G 5 HOH 11 37  37  HOH TIP B . 
G 5 HOH 12 41  41  HOH TIP B . 
G 5 HOH 13 44  44  HOH TIP B . 
G 5 HOH 14 52  52  HOH TIP B . 
G 5 HOH 15 55  55  HOH TIP B . 
G 5 HOH 16 64  64  HOH TIP B . 
G 5 HOH 17 66  66  HOH TIP B . 
G 5 HOH 18 71  71  HOH TIP B . 
G 5 HOH 19 73  73  HOH TIP B . 
G 5 HOH 20 75  75  HOH TIP B . 
G 5 HOH 21 82  82  HOH TIP B . 
G 5 HOH 22 83  83  HOH TIP B . 
G 5 HOH 23 84  84  HOH TIP B . 
G 5 HOH 24 86  86  HOH TIP B . 
G 5 HOH 25 94  94  HOH TIP B . 
G 5 HOH 26 98  98  HOH TIP B . 
G 5 HOH 27 100 100 HOH TIP B . 
G 5 HOH 28 102 102 HOH TIP B . 
G 5 HOH 29 105 105 HOH TIP B . 
G 5 HOH 30 112 112 HOH TIP B . 
G 5 HOH 31 115 115 HOH TIP B . 
G 5 HOH 32 116 116 HOH TIP B . 
G 5 HOH 33 122 122 HOH TIP B . 
G 5 HOH 34 133 133 HOH TIP B . 
G 5 HOH 35 195 151 HOH TIP B . 
G 5 HOH 36 196 196 HOH TIP B . 
G 5 HOH 37 197 162 HOH TIP B . 
G 5 HOH 38 198 175 HOH TIP B . 
G 5 HOH 39 199 177 HOH TIP B . 
G 5 HOH 40 200 182 HOH TIP B . 
G 5 HOH 41 201 184 HOH TIP B . 
G 5 HOH 42 202 187 HOH TIP B . 
G 5 HOH 43 203 190 HOH TIP B . 
H 5 HOH 1  20  7   HOH TIP C . 
H 5 HOH 2  21  11  HOH TIP C . 
H 5 HOH 3  22  18  HOH TIP C . 
H 5 HOH 4  23  13  HOH TIP C . 
H 5 HOH 5  24  19  HOH TIP C . 
H 5 HOH 6  32  32  HOH TIP C . 
H 5 HOH 7  34  34  HOH TIP C . 
H 5 HOH 8  42  42  HOH TIP C . 
H 5 HOH 9  43  43  HOH TIP C . 
H 5 HOH 10 45  45  HOH TIP C . 
H 5 HOH 11 50  50  HOH TIP C . 
H 5 HOH 12 51  51  HOH TIP C . 
H 5 HOH 13 58  58  HOH TIP C . 
H 5 HOH 14 72  72  HOH TIP C . 
H 5 HOH 15 76  76  HOH TIP C . 
H 5 HOH 16 87  87  HOH TIP C . 
H 5 HOH 17 92  92  HOH TIP C . 
H 5 HOH 18 101 101 HOH TIP C . 
H 5 HOH 19 113 113 HOH TIP C . 
H 5 HOH 20 120 120 HOH TIP C . 
H 5 HOH 21 124 124 HOH TIP C . 
H 5 HOH 22 131 131 HOH TIP C . 
H 5 HOH 23 140 140 HOH TIP C . 
H 5 HOH 24 146 146 HOH TIP C . 
H 5 HOH 25 147 147 HOH TIP C . 
H 5 HOH 26 148 148 HOH TIP C . 
H 5 HOH 27 149 149 HOH TIP C . 
H 5 HOH 28 154 154 HOH TIP C . 
H 5 HOH 29 161 161 HOH TIP C . 
H 5 HOH 30 167 167 HOH TIP C . 
H 5 HOH 31 170 170 HOH TIP C . 
H 5 HOH 32 174 174 HOH TIP C . 
H 5 HOH 33 176 176 HOH TIP C . 
H 5 HOH 34 178 178 HOH TIP C . 
H 5 HOH 35 179 179 HOH TIP C . 
H 5 HOH 36 180 180 HOH TIP C . 
H 5 HOH 37 194 194 HOH TIP C . 
H 5 HOH 38 195 195 HOH TIP C . 
I 5 HOH 1  20  3   HOH TIP D . 
I 5 HOH 2  21  21  HOH TIP D . 
I 5 HOH 3  22  5   HOH TIP D . 
I 5 HOH 4  23  23  HOH TIP D . 
I 5 HOH 5  25  25  HOH TIP D . 
I 5 HOH 6  28  28  HOH TIP D . 
I 5 HOH 7  29  29  HOH TIP D . 
I 5 HOH 8  35  35  HOH TIP D . 
I 5 HOH 9  39  39  HOH TIP D . 
I 5 HOH 10 49  49  HOH TIP D . 
I 5 HOH 11 53  53  HOH TIP D . 
I 5 HOH 12 57  57  HOH TIP D . 
I 5 HOH 13 70  70  HOH TIP D . 
I 5 HOH 14 88  88  HOH TIP D . 
I 5 HOH 15 95  95  HOH TIP D . 
I 5 HOH 16 96  96  HOH TIP D . 
I 5 HOH 17 104 104 HOH TIP D . 
I 5 HOH 18 106 106 HOH TIP D . 
I 5 HOH 19 107 107 HOH TIP D . 
I 5 HOH 20 108 108 HOH TIP D . 
I 5 HOH 21 110 110 HOH TIP D . 
I 5 HOH 22 111 111 HOH TIP D . 
I 5 HOH 23 114 114 HOH TIP D . 
I 5 HOH 24 118 118 HOH TIP D . 
I 5 HOH 25 119 119 HOH TIP D . 
I 5 HOH 26 128 128 HOH TIP D . 
I 5 HOH 27 130 130 HOH TIP D . 
I 5 HOH 28 136 136 HOH TIP D . 
I 5 HOH 29 141 141 HOH TIP D . 
I 5 HOH 30 153 153 HOH TIP D . 
I 5 HOH 31 155 155 HOH TIP D . 
I 5 HOH 32 165 165 HOH TIP D . 
I 5 HOH 33 169 169 HOH TIP D . 
I 5 HOH 34 183 183 HOH TIP D . 
I 5 HOH 35 186 186 HOH TIP D . 
I 5 HOH 36 188 188 HOH TIP D . 
I 5 HOH 37 189 189 HOH TIP D . 
I 5 HOH 38 191 191 HOH TIP D . 
I 5 HOH 39 193 193 HOH TIP D . 
I 5 HOH 40 198 198 HOH TIP D . 
I 5 HOH 41 199 199 HOH TIP D . 
#