data_3RLN
# 
_entry.id   3RLN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3RLN         
RCSB  RCSB065084   
WWPDB D_1000065084 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3RLO . unspecified 
PDB 3RN5 . unspecified 
PDB 3RN2 . unspecified 
PDB 3RNU . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3RLN 
_pdbx_database_status.recvd_initial_deposition_date   2011-04-19 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jin, T.C.' 1 
'Xiao, T.'  2 
# 
_citation.id                        primary 
_citation.title                     
;Structures of the HIN Domain:DNA Complexes Reveal Ligand Binding and Activation Mechanisms of the AIM2 Inflammasome and IFI16 Receptor.
;
_citation.journal_abbrev            Immunity 
_citation.journal_volume            36 
_citation.page_first                561 
_citation.page_last                 571 
_citation.year                      2012 
_citation.journal_id_ASTM           IUNIEH 
_citation.country                   US 
_citation.journal_id_ISSN           1074-7613 
_citation.journal_id_CSD            2048 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22483801 
_citation.pdbx_database_id_DOI      10.1016/j.immuni.2012.02.014 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Jin, T.'          1  
primary 'Perry, A.'        2  
primary 'Jiang, J.'        3  
primary 'Smith, P.'        4  
primary 'Curry, J.A.'      5  
primary 'Unterholzner, L.' 6  
primary 'Jiang, Z.'        7  
primary 'Horvath, G.'      8  
primary 'Rathinam, V.A.'   9  
primary 'Johnstone, R.W.'  10 
primary 'Hornung, V.'      11 
primary 'Latz, E.'         12 
primary 'Bowie, A.G.'      13 
primary 'Fitzgerald, K.A.' 14 
primary 'Xiao, T.S.'       15 
# 
_cell.entry_id           3RLN 
_cell.length_a           128.673 
_cell.length_b           128.673 
_cell.length_c           67.772 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3RLN 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Gamma-interferon-inducible protein 16' 22408.717 1  ? 'K663A, R667A, N710A' 'unp residues 571-766' ? 
2 water   nat water                                   18.015    86 ? ?                     ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Ifi-16, Interferon-inducible myeloid differentiation transcriptional activator' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSVDDSAQSDLKEVMVLNATESFVYEPKEQKKMFHATVATENEVFRVKVFNIDLKEKFTPKKIIAIANYVCRNGFLEVYP
FTLVADVNADRNMEIPAGLIASASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDATGKMEVVVHGRLTTIN
CEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSVDDSAQSDLKEVMVLNATESFVYEPKEQKKMFHATVATENEVFRVKVFNIDLKEKFTPKKIIAIANYVCRNGFLEVYP
FTLVADVNADRNMEIPAGLIASASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDATGKMEVVVHGRLTTIN
CEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   VAL n 
1 4   ASP n 
1 5   ASP n 
1 6   SER n 
1 7   ALA n 
1 8   GLN n 
1 9   SER n 
1 10  ASP n 
1 11  LEU n 
1 12  LYS n 
1 13  GLU n 
1 14  VAL n 
1 15  MET n 
1 16  VAL n 
1 17  LEU n 
1 18  ASN n 
1 19  ALA n 
1 20  THR n 
1 21  GLU n 
1 22  SER n 
1 23  PHE n 
1 24  VAL n 
1 25  TYR n 
1 26  GLU n 
1 27  PRO n 
1 28  LYS n 
1 29  GLU n 
1 30  GLN n 
1 31  LYS n 
1 32  LYS n 
1 33  MET n 
1 34  PHE n 
1 35  HIS n 
1 36  ALA n 
1 37  THR n 
1 38  VAL n 
1 39  ALA n 
1 40  THR n 
1 41  GLU n 
1 42  ASN n 
1 43  GLU n 
1 44  VAL n 
1 45  PHE n 
1 46  ARG n 
1 47  VAL n 
1 48  LYS n 
1 49  VAL n 
1 50  PHE n 
1 51  ASN n 
1 52  ILE n 
1 53  ASP n 
1 54  LEU n 
1 55  LYS n 
1 56  GLU n 
1 57  LYS n 
1 58  PHE n 
1 59  THR n 
1 60  PRO n 
1 61  LYS n 
1 62  LYS n 
1 63  ILE n 
1 64  ILE n 
1 65  ALA n 
1 66  ILE n 
1 67  ALA n 
1 68  ASN n 
1 69  TYR n 
1 70  VAL n 
1 71  CYS n 
1 72  ARG n 
1 73  ASN n 
1 74  GLY n 
1 75  PHE n 
1 76  LEU n 
1 77  GLU n 
1 78  VAL n 
1 79  TYR n 
1 80  PRO n 
1 81  PHE n 
1 82  THR n 
1 83  LEU n 
1 84  VAL n 
1 85  ALA n 
1 86  ASP n 
1 87  VAL n 
1 88  ASN n 
1 89  ALA n 
1 90  ASP n 
1 91  ARG n 
1 92  ASN n 
1 93  MET n 
1 94  GLU n 
1 95  ILE n 
1 96  PRO n 
1 97  ALA n 
1 98  GLY n 
1 99  LEU n 
1 100 ILE n 
1 101 ALA n 
1 102 SER n 
1 103 ALA n 
1 104 SER n 
1 105 VAL n 
1 106 THR n 
1 107 PRO n 
1 108 LYS n 
1 109 ILE n 
1 110 ASN n 
1 111 GLN n 
1 112 LEU n 
1 113 CYS n 
1 114 SER n 
1 115 GLN n 
1 116 THR n 
1 117 LYS n 
1 118 GLY n 
1 119 SER n 
1 120 PHE n 
1 121 VAL n 
1 122 ASN n 
1 123 GLY n 
1 124 VAL n 
1 125 PHE n 
1 126 GLU n 
1 127 VAL n 
1 128 HIS n 
1 129 LYS n 
1 130 LYS n 
1 131 ASN n 
1 132 VAL n 
1 133 ARG n 
1 134 GLY n 
1 135 GLU n 
1 136 PHE n 
1 137 THR n 
1 138 TYR n 
1 139 TYR n 
1 140 GLU n 
1 141 ILE n 
1 142 GLN n 
1 143 ASP n 
1 144 ALA n 
1 145 THR n 
1 146 GLY n 
1 147 LYS n 
1 148 MET n 
1 149 GLU n 
1 150 VAL n 
1 151 VAL n 
1 152 VAL n 
1 153 HIS n 
1 154 GLY n 
1 155 ARG n 
1 156 LEU n 
1 157 THR n 
1 158 THR n 
1 159 ILE n 
1 160 ASN n 
1 161 CYS n 
1 162 GLU n 
1 163 GLU n 
1 164 GLY n 
1 165 ASP n 
1 166 LYS n 
1 167 LEU n 
1 168 LYS n 
1 169 LEU n 
1 170 THR n 
1 171 CYS n 
1 172 PHE n 
1 173 GLU n 
1 174 LEU n 
1 175 ALA n 
1 176 PRO n 
1 177 LYS n 
1 178 SER n 
1 179 GLY n 
1 180 ASN n 
1 181 THR n 
1 182 GLY n 
1 183 GLU n 
1 184 LEU n 
1 185 ARG n 
1 186 SER n 
1 187 VAL n 
1 188 ILE n 
1 189 HIS n 
1 190 SER n 
1 191 HIS n 
1 192 ILE n 
1 193 LYS n 
1 194 VAL n 
1 195 ILE n 
1 196 LYS n 
1 197 THR n 
1 198 ARG n 
1 199 LYS n 
1 200 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'IFI16, IFNGIP1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET30a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IF16_HUMAN 
_struct_ref.pdbx_db_accession          Q16666 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DSAQSDLKEVMVLNATESFVYEPKEQKKMFHATVATENEVFRVKVFNIDLKEKFTPKKIIAIANYVCRNGFLEVYPFTLV
ADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEG
DKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKN
;
_struct_ref.pdbx_align_begin           571 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3RLN 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 5 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 200 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q16666 
_struct_ref_seq.db_align_beg                  571 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  766 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       571 
_struct_ref_seq.pdbx_auth_seq_align_end       766 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3RLN GLY A 1   ? UNP Q16666 ?   ?   'EXPRESSION TAG'      567 1 
1 3RLN SER A 2   ? UNP Q16666 ?   ?   'EXPRESSION TAG'      568 2 
1 3RLN VAL A 3   ? UNP Q16666 ?   ?   'EXPRESSION TAG'      569 3 
1 3RLN ASP A 4   ? UNP Q16666 ?   ?   'EXPRESSION TAG'      570 4 
1 3RLN ALA A 97  ? UNP Q16666 LYS 663 'ENGINEERED MUTATION' 663 5 
1 3RLN ALA A 101 ? UNP Q16666 ARG 667 'ENGINEERED MUTATION' 667 6 
1 3RLN ALA A 144 ? UNP Q16666 ASN 710 'ENGINEERED MUTATION' 710 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3RLN 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.41 
_exptl_crystal.density_percent_sol   48.94 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    '0.2 M KCl, 20% PEG3350, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 300 mm CCD' 
_diffrn_detector.pdbx_collection_date   2010-10-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0332 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0332 
# 
_reflns.entry_id                     3RLN 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            2.25 
_reflns.number_obs                   10296 
_reflns.number_all                   10327 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.097 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        23.48 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              9.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.25 
_reflns_shell.d_res_low              2.29 
_reflns_shell.percent_possible_all   96.7 
_reflns_shell.Rmerge_I_obs           0.599 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.76 
_reflns_shell.pdbx_redundancy        7.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      499 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3RLN 
_refine.ls_number_reflns_obs                     10296 
_refine.ls_number_reflns_all                     10327 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             37.145 
_refine.ls_d_res_high                            2.251 
_refine.ls_percent_reflns_obs                    99.44 
_refine.ls_R_factor_obs                          0.1798 
_refine.ls_R_factor_all                          0.1798 
_refine.ls_R_factor_R_work                       0.1773 
_refine.ls_R_factor_R_free                       0.2291 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.83 
_refine.ls_number_reflns_R_free                  496 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            0.1700 
_refine.aniso_B[2][2]                            0.1700 
_refine.aniso_B[3][3]                            -0.3399 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.342 
_refine.solvent_model_param_bsol                 53.301 
_refine.pdbx_solvent_vdw_probe_radii             1.00 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.72 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'pdb entry 3RLO' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.67 
_refine.pdbx_overall_phase_error                 24.02 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1490 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             86 
_refine_hist.number_atoms_total               1576 
_refine_hist.d_res_high                       2.251 
_refine_hist.d_res_low                        37.145 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
f_bond_d           0.007  ? ? 1533 ? 'X-RAY DIFFRACTION' 
f_angle_d          1.124  ? ? 2069 ? 'X-RAY DIFFRACTION' 
f_dihedral_angle_d 13.771 ? ? 574  ? 'X-RAY DIFFRACTION' 
f_chiral_restr     0.083  ? ? 240  ? 'X-RAY DIFFRACTION' 
f_plane_restr      0.005  ? ? 264  ? 'X-RAY DIFFRACTION' 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 2.2505 2.4770  2391 0.2569 99.00  0.3458 . . 123 . . . . 'X-RAY DIFFRACTION' 
. 2.4770 2.8353  2428 0.2134 100.00 0.2891 . . 119 . . . . 'X-RAY DIFFRACTION' 
. 2.8353 3.5717  2445 0.1745 100.00 0.2577 . . 123 . . . . 'X-RAY DIFFRACTION' 
. 3.5717 37.1497 2506 0.1547 100.00 0.1810 . . 131 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3RLN 
_struct.title                     'Structural Basis of Cytosolic DNA Recognition by Innate Immune Receptors' 
_struct.pdbx_descriptor           'Gamma-interferon-inducible protein 16' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3RLN 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
_struct_keywords.text            'HIN200/OB fold/DNA binding, cytosolic DNA sensor/DNA binding, DNA, cytosol, DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 51  ? LYS A 55  ? ASN A 617 LYS A 621 5 ? 5  
HELX_P HELX_P2 2 PRO A 96  ? VAL A 105 ? PRO A 662 VAL A 671 1 ? 10 
HELX_P HELX_P3 3 LYS A 108 ? SER A 114 ? LYS A 674 SER A 680 1 ? 7  
HELX_P HELX_P4 4 ARG A 155 ? ILE A 159 ? ARG A 721 ILE A 725 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 5 ? 
C ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? parallel      
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 23  ? GLU A 26  ? PHE A 589 GLU A 592 
A 2 LYS A 31  ? ALA A 39  ? LYS A 597 ALA A 605 
A 3 VAL A 44  ? VAL A 49  ? VAL A 610 VAL A 615 
A 4 PHE A 75  ? VAL A 78  ? PHE A 641 VAL A 644 
A 5 VAL A 70  ? ARG A 72  ? VAL A 636 ARG A 638 
B 1 PHE A 23  ? GLU A 26  ? PHE A 589 GLU A 592 
B 2 LYS A 31  ? ALA A 39  ? LYS A 597 ALA A 605 
B 3 LYS A 12  ? ALA A 19  ? LYS A 578 ALA A 585 
B 4 ILE A 63  ? ALA A 67  ? ILE A 629 ALA A 633 
B 5 LEU A 83  ? ASP A 86  ? LEU A 649 ASP A 652 
C 1 SER A 119 ? ARG A 133 ? SER A 685 ARG A 699 
C 2 PHE A 136 ? ASP A 143 ? PHE A 702 ASP A 709 
C 3 GLY A 146 ? HIS A 153 ? GLY A 712 HIS A 719 
C 4 GLU A 183 ? ILE A 195 ? GLU A 749 ILE A 761 
C 5 LYS A 166 ? ALA A 175 ? LYS A 732 ALA A 741 
C 6 SER A 119 ? ARG A 133 ? SER A 685 ARG A 699 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 23  ? N PHE A 589 O MET A 33  ? O MET A 599 
A 2 3 N ALA A 36  ? N ALA A 602 O VAL A 47  ? O VAL A 613 
A 3 4 N LYS A 48  ? N LYS A 614 O VAL A 78  ? O VAL A 644 
A 4 5 O GLU A 77  ? O GLU A 643 N VAL A 70  ? N VAL A 636 
B 1 2 N PHE A 23  ? N PHE A 589 O MET A 33  ? O MET A 599 
B 2 3 O THR A 37  ? O THR A 603 N LEU A 17  ? N LEU A 583 
B 3 4 N VAL A 14  ? N VAL A 580 O ILE A 64  ? O ILE A 630 
B 4 5 N ALA A 65  ? N ALA A 631 O ALA A 85  ? O ALA A 651 
C 1 2 N ASN A 131 ? N ASN A 697 O TYR A 138 ? O TYR A 704 
C 2 3 N TYR A 139 ? N TYR A 705 O VAL A 150 ? O VAL A 716 
C 3 4 N VAL A 151 ? N VAL A 717 O LEU A 184 ? O LEU A 750 
C 4 5 O ARG A 185 ? O ARG A 751 N GLU A 173 ? N GLU A 739 
C 5 6 O LEU A 167 ? O LEU A 733 N PHE A 125 ? N PHE A 691 
# 
_database_PDB_matrix.entry_id          3RLN 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3RLN 
_atom_sites.fract_transf_matrix[1][1]   0.007772 
_atom_sites.fract_transf_matrix[1][2]   0.004487 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008974 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014755 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 9   ? 3.699   -0.008 23.634 1.00 87.76  ? 575 SER A N   1 
ATOM   2    C CA  . SER A 1 9   ? 3.927   1.123  22.751 1.00 87.99  ? 575 SER A CA  1 
ATOM   3    C C   . SER A 1 9   ? 2.659   1.895  22.567 1.00 88.27  ? 575 SER A C   1 
ATOM   4    O O   . SER A 1 9   ? 2.091   1.997  21.472 1.00 79.95  ? 575 SER A O   1 
ATOM   5    C CB  . SER A 1 9   ? 4.492   0.707  21.399 1.00 80.07  ? 575 SER A CB  1 
ATOM   6    O OG  . SER A 1 9   ? 5.472   1.612  21.038 1.00 69.61  ? 575 SER A OG  1 
ATOM   7    N N   . ASP A 1 10  ? 2.232   2.403  23.703 1.00 92.29  ? 576 ASP A N   1 
ATOM   8    C CA  . ASP A 1 10  ? 1.162   3.337  23.847 1.00 88.67  ? 576 ASP A CA  1 
ATOM   9    C C   . ASP A 1 10  ? 1.446   4.488  22.932 1.00 72.19  ? 576 ASP A C   1 
ATOM   10   O O   . ASP A 1 10  ? 2.511   4.973  22.862 1.00 71.99  ? 576 ASP A O   1 
ATOM   11   C CB  . ASP A 1 10  ? 1.128   3.765  25.298 1.00 96.41  ? 576 ASP A CB  1 
ATOM   12   C CG  . ASP A 1 10  ? 0.344   5.012  25.527 1.00 102.36 ? 576 ASP A CG  1 
ATOM   13   O OD1 . ASP A 1 10  ? -0.871  5.002  25.324 1.00 107.13 ? 576 ASP A OD1 1 
ATOM   14   O OD2 . ASP A 1 10  ? 0.949   6.007  25.954 1.00 103.61 ? 576 ASP A OD2 1 
ATOM   15   N N   . LEU A 1 11  ? 0.461   4.880  22.190 1.00 58.41  ? 577 LEU A N   1 
ATOM   16   C CA  . LEU A 1 11  ? 0.557   6.022  21.292 1.00 50.76  ? 577 LEU A CA  1 
ATOM   17   C C   . LEU A 1 11  ? 0.791   7.323  22.054 1.00 56.49  ? 577 LEU A C   1 
ATOM   18   O O   . LEU A 1 11  ? 0.150   7.595  23.065 1.00 62.29  ? 577 LEU A O   1 
ATOM   19   C CB  . LEU A 1 11  ? -0.702  6.125  20.416 1.00 52.16  ? 577 LEU A CB  1 
ATOM   20   C CG  . LEU A 1 11  ? -0.748  7.217  19.341 1.00 45.27  ? 577 LEU A CG  1 
ATOM   21   C CD1 . LEU A 1 11  ? -1.528  6.739  18.128 1.00 49.16  ? 577 LEU A CD1 1 
ATOM   22   C CD2 . LEU A 1 11  ? -1.314  8.527  19.879 1.00 46.00  ? 577 LEU A CD2 1 
ATOM   23   N N   . LYS A 1 12  ? 1.720   8.130  21.568 1.00 52.88  ? 578 LYS A N   1 
ATOM   24   C CA  . LYS A 1 12  ? 1.954   9.419  22.188 1.00 45.23  ? 578 LYS A CA  1 
ATOM   25   C C   . LYS A 1 12  ? 1.725   10.501 21.158 1.00 46.56  ? 578 LYS A C   1 
ATOM   26   O O   . LYS A 1 12  ? 2.140   10.377 20.004 1.00 52.86  ? 578 LYS A O   1 
ATOM   27   C CB  . LYS A 1 12  ? 3.380   9.532  22.741 1.00 47.58  ? 578 LYS A CB  1 
ATOM   28   C CG  . LYS A 1 12  ? 3.953   8.258  23.321 1.00 50.53  ? 578 LYS A CG  1 
ATOM   29   C CD  . LYS A 1 12  ? 4.070   8.295  24.833 1.00 51.17  ? 578 LYS A CD  1 
ATOM   30   C CE  . LYS A 1 12  ? 5.261   7.455  25.291 1.00 53.13  ? 578 LYS A CE  1 
ATOM   31   N NZ  . LYS A 1 12  ? 5.218   7.138  26.745 1.00 65.68  ? 578 LYS A NZ  1 
ATOM   32   N N   . GLU A 1 13  ? 1.053   11.559 21.587 1.00 42.91  ? 579 GLU A N   1 
ATOM   33   C CA  . GLU A 1 13  ? 0.866   12.734 20.770 1.00 51.47  ? 579 GLU A CA  1 
ATOM   34   C C   . GLU A 1 13  ? 1.884   13.738 21.273 1.00 48.01  ? 579 GLU A C   1 
ATOM   35   O O   . GLU A 1 13  ? 1.877   14.083 22.460 1.00 48.22  ? 579 GLU A O   1 
ATOM   36   C CB  . GLU A 1 13  ? -0.546  13.263 20.981 1.00 64.29  ? 579 GLU A CB  1 
ATOM   37   C CG  . GLU A 1 13  ? -1.100  14.122 19.865 1.00 74.53  ? 579 GLU A CG  1 
ATOM   38   C CD  . GLU A 1 13  ? -2.561  14.473 20.104 1.00 79.53  ? 579 GLU A CD  1 
ATOM   39   O OE1 . GLU A 1 13  ? -2.889  14.866 21.246 1.00 73.44  ? 579 GLU A OE1 1 
ATOM   40   O OE2 . GLU A 1 13  ? -3.379  14.332 19.166 1.00 83.15  ? 579 GLU A OE2 1 
ATOM   41   N N   . VAL A 1 14  ? 2.773   14.197 20.395 1.00 43.05  ? 580 VAL A N   1 
ATOM   42   C CA  . VAL A 1 14  ? 3.852   15.084 20.837 1.00 46.50  ? 580 VAL A CA  1 
ATOM   43   C C   . VAL A 1 14  ? 4.151   16.229 19.883 1.00 39.87  ? 580 VAL A C   1 
ATOM   44   O O   . VAL A 1 14  ? 3.857   16.158 18.692 1.00 53.96  ? 580 VAL A O   1 
ATOM   45   C CB  . VAL A 1 14  ? 5.162   14.298 21.049 1.00 42.77  ? 580 VAL A CB  1 
ATOM   46   C CG1 . VAL A 1 14  ? 4.964   13.229 22.106 1.00 39.61  ? 580 VAL A CG1 1 
ATOM   47   C CG2 . VAL A 1 14  ? 5.608   13.677 19.740 1.00 39.21  ? 580 VAL A CG2 1 
ATOM   48   N N   . MET A 1 15  ? 4.742   17.287 20.427 1.00 40.54  ? 581 MET A N   1 
ATOM   49   C CA  . MET A 1 15  ? 5.345   18.334 19.617 1.00 40.06  ? 581 MET A CA  1 
ATOM   50   C C   . MET A 1 15  ? 6.856   18.154 19.615 1.00 48.62  ? 581 MET A C   1 
ATOM   51   O O   . MET A 1 15  ? 7.459   17.841 20.647 1.00 43.94  ? 581 MET A O   1 
ATOM   52   C CB  . MET A 1 15  ? 5.012   19.721 20.167 1.00 45.18  ? 581 MET A CB  1 
ATOM   53   C CG  . MET A 1 15  ? 5.516   20.848 19.279 1.00 49.18  ? 581 MET A CG  1 
ATOM   54   S SD  . MET A 1 15  ? 5.317   22.505 19.962 1.00 78.32  ? 581 MET A SD  1 
ATOM   55   C CE  . MET A 1 15  ? 6.467   22.456 21.336 1.00 107.51 ? 581 MET A CE  1 
ATOM   56   N N   . VAL A 1 16  ? 7.468   18.357 18.455 1.00 50.78  ? 582 VAL A N   1 
ATOM   57   C CA  . VAL A 1 16  ? 8.915   18.309 18.342 1.00 45.57  ? 582 VAL A CA  1 
ATOM   58   C C   . VAL A 1 16  ? 9.580   19.566 18.912 1.00 47.03  ? 582 VAL A C   1 
ATOM   59   O O   . VAL A 1 16  ? 9.242   20.685 18.528 1.00 48.52  ? 582 VAL A O   1 
ATOM   60   C CB  . VAL A 1 16  ? 9.332   18.178 16.889 1.00 45.37  ? 582 VAL A CB  1 
ATOM   61   C CG1 . VAL A 1 16  ? 10.845  17.977 16.805 1.00 36.70  ? 582 VAL A CG1 1 
ATOM   62   C CG2 . VAL A 1 16  ? 8.593   17.041 16.246 1.00 36.62  ? 582 VAL A CG2 1 
ATOM   63   N N   . LEU A 1 17  ? 10.532  19.372 19.820 1.00 46.04  ? 583 LEU A N   1 
ATOM   64   C CA  . LEU A 1 17  ? 11.299  20.480 20.389 1.00 51.76  ? 583 LEU A CA  1 
ATOM   65   C C   . LEU A 1 17  ? 12.531  20.767 19.533 1.00 57.86  ? 583 LEU A C   1 
ATOM   66   O O   . LEU A 1 17  ? 12.705  21.876 19.017 1.00 54.86  ? 583 LEU A O   1 
ATOM   67   C CB  . LEU A 1 17  ? 11.683  20.204 21.843 1.00 48.61  ? 583 LEU A CB  1 
ATOM   68   C CG  . LEU A 1 17  ? 10.503  19.941 22.785 1.00 53.42  ? 583 LEU A CG  1 
ATOM   69   C CD1 . LEU A 1 17  ? 10.953  19.878 24.236 1.00 56.33  ? 583 LEU A CD1 1 
ATOM   70   C CD2 . LEU A 1 17  ? 9.426   20.999 22.613 1.00 49.52  ? 583 LEU A CD2 1 
ATOM   71   N N   . ASN A 1 18  ? 13.405  19.775 19.425 1.00 52.13  ? 584 ASN A N   1 
ATOM   72   C CA  . ASN A 1 18  ? 14.595  19.895 18.598 1.00 54.18  ? 584 ASN A CA  1 
ATOM   73   C C   . ASN A 1 18  ? 14.968  18.577 17.903 1.00 55.34  ? 584 ASN A C   1 
ATOM   74   O O   . ASN A 1 18  ? 14.475  17.507 18.263 1.00 52.85  ? 584 ASN A O   1 
ATOM   75   C CB  . ASN A 1 18  ? 15.760  20.391 19.451 1.00 46.34  ? 584 ASN A CB  1 
ATOM   76   C CG  . ASN A 1 18  ? 15.922  19.587 20.727 1.00 53.81  ? 584 ASN A CG  1 
ATOM   77   O OD1 . ASN A 1 18  ? 16.298  18.413 20.693 1.00 61.24  ? 584 ASN A OD1 1 
ATOM   78   N ND2 . ASN A 1 18  ? 15.639  20.214 21.863 1.00 56.88  ? 584 ASN A ND2 1 
ATOM   79   N N   . ALA A 1 19  ? 15.828  18.667 16.894 1.00 49.27  ? 585 ALA A N   1 
ATOM   80   C CA  . ALA A 1 19  ? 16.364  17.485 16.230 1.00 44.02  ? 585 ALA A CA  1 
ATOM   81   C C   . ALA A 1 19  ? 17.778  17.764 15.741 1.00 48.40  ? 585 ALA A C   1 
ATOM   82   O O   . ALA A 1 19  ? 18.095  18.891 15.350 1.00 49.61  ? 585 ALA A O   1 
ATOM   83   C CB  . ALA A 1 19  ? 15.473  17.069 15.060 1.00 39.26  ? 585 ALA A CB  1 
ATOM   84   N N   . THR A 1 20  ? 18.630  16.743 15.759 1.00 42.15  ? 586 THR A N   1 
ATOM   85   C CA  . THR A 1 20  ? 19.947  16.892 15.176 1.00 36.97  ? 586 THR A CA  1 
ATOM   86   C C   . THR A 1 20  ? 19.781  16.606 13.693 1.00 44.15  ? 586 THR A C   1 
ATOM   87   O O   . THR A 1 20  ? 18.704  16.190 13.247 1.00 40.02  ? 586 THR A O   1 
ATOM   88   C CB  . THR A 1 20  ? 20.951  15.868 15.767 1.00 32.60  ? 586 THR A CB  1 
ATOM   89   O OG1 . THR A 1 20  ? 20.552  14.535 15.412 1.00 32.49  ? 586 THR A OG1 1 
ATOM   90   C CG2 . THR A 1 20  ? 21.026  15.986 17.281 1.00 29.02  ? 586 THR A CG2 1 
ATOM   91   N N   . GLU A 1 21  ? 20.853  16.786 12.935 1.00 42.70  ? 587 GLU A N   1 
ATOM   92   C CA  . GLU A 1 21  ? 20.868  16.354 11.547 1.00 50.20  ? 587 GLU A CA  1 
ATOM   93   C C   . GLU A 1 21  ? 21.099  14.852 11.515 1.00 40.10  ? 587 GLU A C   1 
ATOM   94   O O   . GLU A 1 21  ? 21.589  14.276 12.485 1.00 34.55  ? 587 GLU A O   1 
ATOM   95   C CB  . GLU A 1 21  ? 21.935  17.095 10.739 1.00 60.00  ? 587 GLU A CB  1 
ATOM   96   C CG  . GLU A 1 21  ? 23.333  16.559 10.906 1.00 71.22  ? 587 GLU A CG  1 
ATOM   97   C CD  . GLU A 1 21  ? 23.970  16.972 12.217 1.00 80.26  ? 587 GLU A CD  1 
ATOM   98   O OE1 . GLU A 1 21  ? 23.298  17.661 13.019 1.00 82.08  ? 587 GLU A OE1 1 
ATOM   99   O OE2 . GLU A 1 21  ? 25.150  16.615 12.435 1.00 78.85  ? 587 GLU A OE2 1 
ATOM   100  N N   . SER A 1 22  ? 20.708  14.213 10.422 1.00 39.19  ? 588 SER A N   1 
ATOM   101  C CA  . SER A 1 22  ? 21.027  12.810 10.214 1.00 33.24  ? 588 SER A CA  1 
ATOM   102  C C   . SER A 1 22  ? 22.539  12.650 10.144 1.00 39.33  ? 588 SER A C   1 
ATOM   103  O O   . SER A 1 22  ? 23.230  13.519 9.627  1.00 44.90  ? 588 SER A O   1 
ATOM   104  C CB  . SER A 1 22  ? 20.416  12.328 8.908  1.00 38.08  ? 588 SER A CB  1 
ATOM   105  O OG  . SER A 1 22  ? 19.052  12.682 8.833  1.00 51.72  ? 588 SER A OG  1 
ATOM   106  N N   . PHE A 1 23  ? 23.053  11.542 10.663 1.00 32.70  ? 589 PHE A N   1 
ATOM   107  C CA  . PHE A 1 23  ? 24.480  11.254 10.583 1.00 34.51  ? 589 PHE A CA  1 
ATOM   108  C C   . PHE A 1 23  ? 24.701  9.754  10.517 1.00 37.00  ? 589 PHE A C   1 
ATOM   109  O O   . PHE A 1 23  ? 23.809  8.979  10.853 1.00 31.35  ? 589 PHE A O   1 
ATOM   110  C CB  . PHE A 1 23  ? 25.236  11.853 11.776 1.00 31.55  ? 589 PHE A CB  1 
ATOM   111  C CG  . PHE A 1 23  ? 24.778  11.340 13.122 1.00 30.65  ? 589 PHE A CG  1 
ATOM   112  C CD1 . PHE A 1 23  ? 25.537  10.412 13.820 1.00 28.81  ? 589 PHE A CD1 1 
ATOM   113  C CD2 . PHE A 1 23  ? 23.607  11.806 13.693 1.00 29.34  ? 589 PHE A CD2 1 
ATOM   114  C CE1 . PHE A 1 23  ? 25.128  9.942  15.056 1.00 28.95  ? 589 PHE A CE1 1 
ATOM   115  C CE2 . PHE A 1 23  ? 23.194  11.348 14.935 1.00 36.33  ? 589 PHE A CE2 1 
ATOM   116  C CZ  . PHE A 1 23  ? 23.955  10.408 15.614 1.00 32.60  ? 589 PHE A CZ  1 
ATOM   117  N N   . VAL A 1 24  ? 25.888  9.339  10.086 1.00 39.32  ? 590 VAL A N   1 
ATOM   118  C CA  . VAL A 1 24  ? 26.206  7.918  10.064 1.00 32.30  ? 590 VAL A CA  1 
ATOM   119  C C   . VAL A 1 24  ? 26.724  7.537  11.451 1.00 34.38  ? 590 VAL A C   1 
ATOM   120  O O   . VAL A 1 24  ? 27.758  8.048  11.903 1.00 34.98  ? 590 VAL A O   1 
ATOM   121  C CB  . VAL A 1 24  ? 27.285  7.618  8.996  1.00 27.99  ? 590 VAL A CB  1 
ATOM   122  C CG1 . VAL A 1 24  ? 27.874  6.229  9.180  1.00 26.87  ? 590 VAL A CG1 1 
ATOM   123  C CG2 . VAL A 1 24  ? 26.709  7.795  7.603  1.00 28.22  ? 590 VAL A CG2 1 
ATOM   124  N N   . TYR A 1 25  ? 25.992  6.672  12.150 1.00 25.12  ? 591 TYR A N   1 
ATOM   125  C CA  . TYR A 1 25  ? 26.477  6.185  13.441 1.00 29.76  ? 591 TYR A CA  1 
ATOM   126  C C   . TYR A 1 25  ? 27.318  4.903  13.357 1.00 31.19  ? 591 TYR A C   1 
ATOM   127  O O   . TYR A 1 25  ? 28.034  4.565  14.294 1.00 36.97  ? 591 TYR A O   1 
ATOM   128  C CB  . TYR A 1 25  ? 25.308  6.020  14.429 1.00 25.85  ? 591 TYR A CB  1 
ATOM   129  C CG  . TYR A 1 25  ? 24.330  4.905  14.115 1.00 27.67  ? 591 TYR A CG  1 
ATOM   130  C CD1 . TYR A 1 25  ? 24.468  3.651  14.700 1.00 27.35  ? 591 TYR A CD1 1 
ATOM   131  C CD2 . TYR A 1 25  ? 23.249  5.114  13.258 1.00 32.69  ? 591 TYR A CD2 1 
ATOM   132  C CE1 . TYR A 1 25  ? 23.567  2.625  14.431 1.00 28.48  ? 591 TYR A CE1 1 
ATOM   133  C CE2 . TYR A 1 25  ? 22.338  4.093  12.989 1.00 25.54  ? 591 TYR A CE2 1 
ATOM   134  C CZ  . TYR A 1 25  ? 22.506  2.852  13.578 1.00 32.58  ? 591 TYR A CZ  1 
ATOM   135  O OH  . TYR A 1 25  ? 21.616  1.832  13.308 1.00 35.95  ? 591 TYR A OH  1 
ATOM   136  N N   . GLU A 1 26  ? 27.226  4.218  12.221 1.00 32.15  ? 592 GLU A N   1 
ATOM   137  C CA  . GLU A 1 26  ? 27.882  2.925  11.985 1.00 35.08  ? 592 GLU A CA  1 
ATOM   138  C C   . GLU A 1 26  ? 28.536  2.910  10.602 1.00 38.87  ? 592 GLU A C   1 
ATOM   139  O O   . GLU A 1 26  ? 27.869  2.628  9.597  1.00 38.92  ? 592 GLU A O   1 
ATOM   140  C CB  . GLU A 1 26  ? 26.902  1.756  12.122 1.00 37.42  ? 592 GLU A CB  1 
ATOM   141  C CG  . GLU A 1 26  ? 27.585  0.422  12.422 1.00 38.91  ? 592 GLU A CG  1 
ATOM   142  C CD  . GLU A 1 26  ? 28.563  0.002  11.344 1.00 49.54  ? 592 GLU A CD  1 
ATOM   143  O OE1 . GLU A 1 26  ? 28.093  -0.450 10.286 1.00 51.79  ? 592 GLU A OE1 1 
ATOM   144  O OE2 . GLU A 1 26  ? 29.794  0.131  11.545 1.00 52.43  ? 592 GLU A OE2 1 
ATOM   145  N N   . PRO A 1 27  ? 29.818  3.277  10.532 1.00 33.71  ? 593 PRO A N   1 
ATOM   146  C CA  . PRO A 1 27  ? 30.485  3.531  9.252  1.00 31.68  ? 593 PRO A CA  1 
ATOM   147  C C   . PRO A 1 27  ? 30.665  2.304  8.351  1.00 37.16  ? 593 PRO A C   1 
ATOM   148  O O   . PRO A 1 27  ? 30.738  2.469  7.126  1.00 40.38  ? 593 PRO A O   1 
ATOM   149  C CB  . PRO A 1 27  ? 31.846  4.093  9.680  1.00 40.59  ? 593 PRO A CB  1 
ATOM   150  C CG  . PRO A 1 27  ? 32.096  3.474  11.010 1.00 36.82  ? 593 PRO A CG  1 
ATOM   151  C CD  . PRO A 1 27  ? 30.745  3.371  11.673 1.00 38.99  ? 593 PRO A CD  1 
ATOM   152  N N   . LYS A 1 28  ? 30.739  1.102  8.920  1.00 36.21  ? 594 LYS A N   1 
ATOM   153  C CA  . LYS A 1 28  ? 30.940  -0.085 8.088  1.00 45.29  ? 594 LYS A CA  1 
ATOM   154  C C   . LYS A 1 28  ? 29.730  -0.337 7.189  1.00 41.29  ? 594 LYS A C   1 
ATOM   155  O O   . LYS A 1 28  ? 29.862  -0.594 5.991  1.00 37.78  ? 594 LYS A O   1 
ATOM   156  C CB  . LYS A 1 28  ? 31.240  -1.313 8.945  1.00 47.05  ? 594 LYS A CB  1 
ATOM   157  C CG  . LYS A 1 28  ? 32.544  -1.221 9.725  1.00 49.29  ? 594 LYS A CG  1 
ATOM   158  C CD  . LYS A 1 28  ? 32.700  -2.429 10.645 1.00 55.61  ? 594 LYS A CD  1 
ATOM   159  C CE  . LYS A 1 28  ? 34.137  -2.602 11.097 1.00 67.20  ? 594 LYS A CE  1 
ATOM   160  N NZ  . LYS A 1 28  ? 34.331  -3.877 11.844 1.00 75.71  ? 594 LYS A NZ  1 
ATOM   161  N N   . GLU A 1 29  ? 28.546  -0.282 7.778  1.00 34.02  ? 595 GLU A N   1 
ATOM   162  C CA  . GLU A 1 29  ? 27.314  -0.425 7.007  1.00 43.66  ? 595 GLU A CA  1 
ATOM   163  C C   . GLU A 1 29  ? 26.676  0.915  6.649  1.00 40.62  ? 595 GLU A C   1 
ATOM   164  O O   . GLU A 1 29  ? 25.638  0.954  5.997  1.00 31.47  ? 595 GLU A O   1 
ATOM   165  C CB  . GLU A 1 29  ? 26.321  -1.339 7.734  1.00 45.59  ? 595 GLU A CB  1 
ATOM   166  C CG  . GLU A 1 29  ? 26.892  -2.736 7.976  1.00 57.54  ? 595 GLU A CG  1 
ATOM   167  C CD  . GLU A 1 29  ? 25.832  -3.816 8.079  1.00 64.24  ? 595 GLU A CD  1 
ATOM   168  O OE1 . GLU A 1 29  ? 24.624  -3.505 7.987  1.00 64.89  ? 595 GLU A OE1 1 
ATOM   169  O OE2 . GLU A 1 29  ? 26.216  -4.989 8.247  1.00 72.86  ? 595 GLU A OE2 1 
ATOM   170  N N   . GLN A 1 30  ? 27.293  2.011  7.086  1.00 39.56  ? 596 GLN A N   1 
ATOM   171  C CA  . GLN A 1 30  ? 26.752  3.342  6.817  1.00 34.96  ? 596 GLN A CA  1 
ATOM   172  C C   . GLN A 1 30  ? 25.323  3.478  7.353  1.00 33.78  ? 596 GLN A C   1 
ATOM   173  O O   . GLN A 1 30  ? 24.429  3.991  6.682  1.00 33.35  ? 596 GLN A O   1 
ATOM   174  C CB  . GLN A 1 30  ? 26.798  3.640  5.323  1.00 30.27  ? 596 GLN A CB  1 
ATOM   175  C CG  . GLN A 1 30  ? 28.199  3.877  4.791  1.00 31.33  ? 596 GLN A CG  1 
ATOM   176  C CD  . GLN A 1 30  ? 28.779  5.151  5.342  1.00 37.15  ? 596 GLN A CD  1 
ATOM   177  O OE1 . GLN A 1 30  ? 28.255  6.235  5.091  1.00 36.26  ? 596 GLN A OE1 1 
ATOM   178  N NE2 . GLN A 1 30  ? 29.845  5.034  6.120  1.00 29.96  ? 596 GLN A NE2 1 
ATOM   179  N N   . LYS A 1 31  ? 25.114  3.008  8.574  1.00 34.48  ? 597 LYS A N   1 
ATOM   180  C CA  . LYS A 1 31  ? 23.812  3.108  9.193  1.00 32.99  ? 597 LYS A CA  1 
ATOM   181  C C   . LYS A 1 31  ? 23.649  4.536  9.669  1.00 33.48  ? 597 LYS A C   1 
ATOM   182  O O   . LYS A 1 31  ? 24.598  5.122  10.174 1.00 37.10  ? 597 LYS A O   1 
ATOM   183  C CB  . LYS A 1 31  ? 23.706  2.133  10.356 1.00 34.13  ? 597 LYS A CB  1 
ATOM   184  C CG  . LYS A 1 31  ? 23.841  0.678  9.954  1.00 37.01  ? 597 LYS A CG  1 
ATOM   185  C CD  . LYS A 1 31  ? 23.601  -0.225 11.157 1.00 39.52  ? 597 LYS A CD  1 
ATOM   186  C CE  . LYS A 1 31  ? 23.936  -1.660 10.827 1.00 56.06  ? 597 LYS A CE  1 
ATOM   187  N NZ  . LYS A 1 31  ? 23.883  -2.517 12.038 1.00 68.71  ? 597 LYS A NZ  1 
ATOM   188  N N   . LYS A 1 32  ? 22.450  5.089  9.489  1.00 29.88  ? 598 LYS A N   1 
ATOM   189  C CA  . LYS A 1 32  ? 22.177  6.490  9.797  1.00 29.10  ? 598 LYS A CA  1 
ATOM   190  C C   . LYS A 1 32  ? 21.034  6.643  10.788 1.00 28.89  ? 598 LYS A C   1 
ATOM   191  O O   . LYS A 1 32  ? 20.207  5.741  10.959 1.00 27.11  ? 598 LYS A O   1 
ATOM   192  C CB  . LYS A 1 32  ? 21.874  7.274  8.518  1.00 29.61  ? 598 LYS A CB  1 
ATOM   193  C CG  . LYS A 1 32  ? 22.862  6.995  7.408  1.00 34.35  ? 598 LYS A CG  1 
ATOM   194  C CD  . LYS A 1 32  ? 22.607  7.831  6.165  1.00 33.37  ? 598 LYS A CD  1 
ATOM   195  C CE  . LYS A 1 32  ? 23.679  7.505  5.122  1.00 47.33  ? 598 LYS A CE  1 
ATOM   196  N NZ  . LYS A 1 32  ? 23.464  8.199  3.819  1.00 50.72  ? 598 LYS A NZ  1 
ATOM   197  N N   . MET A 1 33  ? 21.029  7.782  11.471 1.00 26.89  ? 599 MET A N   1 
ATOM   198  C CA  . MET A 1 33  ? 20.002  8.099  12.448 1.00 29.11  ? 599 MET A CA  1 
ATOM   199  C C   . MET A 1 33  ? 19.979  9.598  12.654 1.00 32.18  ? 599 MET A C   1 
ATOM   200  O O   . MET A 1 33  ? 20.893  10.290 12.228 1.00 34.02  ? 599 MET A O   1 
ATOM   201  C CB  . MET A 1 33  ? 20.296  7.410  13.775 1.00 23.00  ? 599 MET A CB  1 
ATOM   202  C CG  . MET A 1 33  ? 21.449  8.035  14.537 1.00 23.46  ? 599 MET A CG  1 
ATOM   203  S SD  . MET A 1 33  ? 21.765  7.159  16.076 1.00 31.42  ? 599 MET A SD  1 
ATOM   204  C CE  . MET A 1 33  ? 20.288  7.547  17.009 1.00 23.86  ? 599 MET A CE  1 
ATOM   205  N N   . PHE A 1 34  ? 18.922  10.108 13.275 1.00 28.15  ? 600 PHE A N   1 
ATOM   206  C CA  . PHE A 1 34  ? 19.033  11.396 13.943 1.00 22.49  ? 600 PHE A CA  1 
ATOM   207  C C   . PHE A 1 34  ? 18.423  11.288 15.327 1.00 29.48  ? 600 PHE A C   1 
ATOM   208  O O   . PHE A 1 34  ? 17.679  10.346 15.603 1.00 27.28  ? 600 PHE A O   1 
ATOM   209  C CB  . PHE A 1 34  ? 18.414  12.552 13.127 1.00 23.24  ? 600 PHE A CB  1 
ATOM   210  C CG  . PHE A 1 34  ? 16.944  12.399 12.836 1.00 32.28  ? 600 PHE A CG  1 
ATOM   211  C CD1 . PHE A 1 34  ? 16.507  11.678 11.730 1.00 26.82  ? 600 PHE A CD1 1 
ATOM   212  C CD2 . PHE A 1 34  ? 15.994  13.015 13.644 1.00 36.17  ? 600 PHE A CD2 1 
ATOM   213  C CE1 . PHE A 1 34  ? 15.154  11.552 11.452 1.00 30.65  ? 600 PHE A CE1 1 
ATOM   214  C CE2 . PHE A 1 34  ? 14.631  12.889 13.372 1.00 26.63  ? 600 PHE A CE2 1 
ATOM   215  C CZ  . PHE A 1 34  ? 14.215  12.153 12.276 1.00 28.31  ? 600 PHE A CZ  1 
ATOM   216  N N   . HIS A 1 35  ? 18.755  12.246 16.193 1.00 34.02  ? 601 HIS A N   1 
ATOM   217  C CA  . HIS A 1 35  ? 18.129  12.371 17.507 1.00 37.81  ? 601 HIS A CA  1 
ATOM   218  C C   . HIS A 1 35  ? 17.099  13.494 17.491 1.00 37.82  ? 601 HIS A C   1 
ATOM   219  O O   . HIS A 1 35  ? 17.267  14.491 16.795 1.00 31.74  ? 601 HIS A O   1 
ATOM   220  C CB  . HIS A 1 35  ? 19.160  12.697 18.596 1.00 33.95  ? 601 HIS A CB  1 
ATOM   221  C CG  . HIS A 1 35  ? 20.152  11.605 18.851 1.00 35.19  ? 601 HIS A CG  1 
ATOM   222  N ND1 . HIS A 1 35  ? 19.945  10.617 19.790 1.00 36.62  ? 601 HIS A ND1 1 
ATOM   223  C CD2 . HIS A 1 35  ? 21.369  11.362 18.311 1.00 26.11  ? 601 HIS A CD2 1 
ATOM   224  C CE1 . HIS A 1 35  ? 20.986  9.805  19.810 1.00 30.64  ? 601 HIS A CE1 1 
ATOM   225  N NE2 . HIS A 1 35  ? 21.864  10.234 18.920 1.00 40.16  ? 601 HIS A NE2 1 
ATOM   226  N N   . ALA A 1 36  ? 16.038  13.325 18.267 1.00 26.71  ? 602 ALA A N   1 
ATOM   227  C CA  . ALA A 1 36  ? 15.090  14.397 18.493 1.00 31.54  ? 602 ALA A CA  1 
ATOM   228  C C   . ALA A 1 36  ? 14.642  14.415 19.954 1.00 34.59  ? 602 ALA A C   1 
ATOM   229  O O   . ALA A 1 36  ? 14.787  13.432 20.687 1.00 33.06  ? 602 ALA A O   1 
ATOM   230  C CB  . ALA A 1 36  ? 13.894  14.250 17.558 1.00 30.93  ? 602 ALA A CB  1 
ATOM   231  N N   . THR A 1 37  ? 14.117  15.554 20.377 1.00 34.52  ? 603 THR A N   1 
ATOM   232  C CA  . THR A 1 37  ? 13.491  15.672 21.684 1.00 40.25  ? 603 THR A CA  1 
ATOM   233  C C   . THR A 1 37  ? 12.038  16.080 21.446 1.00 43.14  ? 603 THR A C   1 
ATOM   234  O O   . THR A 1 37  ? 11.753  16.988 20.659 1.00 42.18  ? 603 THR A O   1 
ATOM   235  C CB  . THR A 1 37  ? 14.232  16.704 22.563 1.00 49.75  ? 603 THR A CB  1 
ATOM   236  O OG1 . THR A 1 37  ? 15.591  16.289 22.730 1.00 58.86  ? 603 THR A OG1 1 
ATOM   237  C CG2 . THR A 1 37  ? 13.579  16.850 23.934 1.00 51.27  ? 603 THR A CG2 1 
ATOM   238  N N   . VAL A 1 38  ? 11.116  15.379 22.090 1.00 42.42  ? 604 VAL A N   1 
ATOM   239  C CA  . VAL A 1 38  ? 9.703   15.656 21.887 1.00 39.46  ? 604 VAL A CA  1 
ATOM   240  C C   . VAL A 1 38  ? 9.026   15.800 23.228 1.00 41.37  ? 604 VAL A C   1 
ATOM   241  O O   . VAL A 1 38  ? 9.552   15.363 24.250 1.00 47.54  ? 604 VAL A O   1 
ATOM   242  C CB  . VAL A 1 38  ? 8.981   14.540 21.079 1.00 47.11  ? 604 VAL A CB  1 
ATOM   243  C CG1 . VAL A 1 38  ? 9.542   14.429 19.673 1.00 39.30  ? 604 VAL A CG1 1 
ATOM   244  C CG2 . VAL A 1 38  ? 9.064   13.208 21.805 1.00 51.96  ? 604 VAL A CG2 1 
ATOM   245  N N   . ALA A 1 39  ? 7.846   16.399 23.221 1.00 45.28  ? 605 ALA A N   1 
ATOM   246  C CA  . ALA A 1 39  ? 7.122   16.593 24.461 1.00 50.09  ? 605 ALA A CA  1 
ATOM   247  C C   . ALA A 1 39  ? 5.618   16.417 24.305 1.00 51.23  ? 605 ALA A C   1 
ATOM   248  O O   . ALA A 1 39  ? 5.014   16.921 23.354 1.00 50.00  ? 605 ALA A O   1 
ATOM   249  C CB  . ALA A 1 39  ? 7.441   17.980 25.037 1.00 50.90  ? 605 ALA A CB  1 
ATOM   250  N N   . THR A 1 40  ? 5.018   15.703 25.252 1.00 58.57  ? 606 THR A N   1 
ATOM   251  C CA  . THR A 1 40  ? 3.574   15.723 25.408 1.00 60.25  ? 606 THR A CA  1 
ATOM   252  C C   . THR A 1 40  ? 3.271   16.992 26.190 1.00 74.05  ? 606 THR A C   1 
ATOM   253  O O   . THR A 1 40  ? 4.159   17.820 26.399 1.00 75.12  ? 606 THR A O   1 
ATOM   254  C CB  . THR A 1 40  ? 3.040   14.481 26.171 1.00 56.53  ? 606 THR A CB  1 
ATOM   255  O OG1 . THR A 1 40  ? 3.620   14.415 27.483 1.00 50.08  ? 606 THR A OG1 1 
ATOM   256  C CG2 . THR A 1 40  ? 3.341   13.188 25.404 1.00 45.99  ? 606 THR A CG2 1 
ATOM   257  N N   . GLU A 1 41  ? 2.028   17.167 26.616 1.00 87.51  ? 607 GLU A N   1 
ATOM   258  C CA  . GLU A 1 41  ? 1.695   18.341 27.411 1.00 95.92  ? 607 GLU A CA  1 
ATOM   259  C C   . GLU A 1 41  ? 2.544   18.360 28.679 1.00 90.15  ? 607 GLU A C   1 
ATOM   260  O O   . GLU A 1 41  ? 3.119   19.388 29.035 1.00 88.41  ? 607 GLU A O   1 
ATOM   261  C CB  . GLU A 1 41  ? 0.200   18.376 27.755 1.00 105.66 ? 607 GLU A CB  1 
ATOM   262  C CG  . GLU A 1 41  ? -0.336  17.116 28.437 1.00 112.35 ? 607 GLU A CG  1 
ATOM   263  C CD  . GLU A 1 41  ? -0.532  15.957 27.471 1.00 112.30 ? 607 GLU A CD  1 
ATOM   264  O OE1 . GLU A 1 41  ? -0.742  16.217 26.265 1.00 111.86 ? 607 GLU A OE1 1 
ATOM   265  O OE2 . GLU A 1 41  ? -0.473  14.789 27.917 1.00 109.77 ? 607 GLU A OE2 1 
ATOM   266  N N   . ASN A 1 42  ? 2.574   17.225 29.374 1.00 88.14  ? 608 ASN A N   1 
ATOM   267  C CA  . ASN A 1 42  ? 3.319   17.076 30.624 1.00 84.88  ? 608 ASN A CA  1 
ATOM   268  C C   . ASN A 1 42  ? 4.709   16.397 30.643 1.00 74.95  ? 608 ASN A C   1 
ATOM   269  O O   . ASN A 1 42  ? 5.318   16.305 31.706 1.00 70.35  ? 608 ASN A O   1 
ATOM   270  C CB  . ASN A 1 42  ? 2.418   16.440 31.681 1.00 92.02  ? 608 ASN A CB  1 
ATOM   271  C CG  . ASN A 1 42  ? 1.984   15.052 31.299 1.00 93.56  ? 608 ASN A CG  1 
ATOM   272  O OD1 . ASN A 1 42  ? 2.807   14.219 30.914 1.00 80.74  ? 608 ASN A OD1 1 
ATOM   273  N ND2 . ASN A 1 42  ? 0.680   14.795 31.383 1.00 100.23 ? 608 ASN A ND2 1 
ATOM   274  N N   . GLU A 1 43  ? 5.223   15.906 29.518 1.00 67.11  ? 609 GLU A N   1 
ATOM   275  C CA  . GLU A 1 43  ? 6.473   15.137 29.604 1.00 64.53  ? 609 GLU A CA  1 
ATOM   276  C C   . GLU A 1 43  ? 7.408   15.192 28.396 1.00 57.83  ? 609 GLU A C   1 
ATOM   277  O O   . GLU A 1 43  ? 6.970   15.357 27.259 1.00 62.59  ? 609 GLU A O   1 
ATOM   278  C CB  . GLU A 1 43  ? 6.179   13.677 29.959 1.00 68.55  ? 609 GLU A CB  1 
ATOM   279  C CG  . GLU A 1 43  ? 7.426   12.842 30.186 1.00 73.57  ? 609 GLU A CG  1 
ATOM   280  C CD  . GLU A 1 43  ? 7.106   11.402 30.537 1.00 79.52  ? 609 GLU A CD  1 
ATOM   281  O OE1 . GLU A 1 43  ? 8.058   10.605 30.731 1.00 76.42  ? 609 GLU A OE1 1 
ATOM   282  O OE2 . GLU A 1 43  ? 5.901   11.074 30.616 1.00 78.68  ? 609 GLU A OE2 1 
ATOM   283  N N   . VAL A 1 44  ? 8.702   15.031 28.663 1.00 55.82  ? 610 VAL A N   1 
ATOM   284  C CA  . VAL A 1 44  ? 9.733   15.067 27.628 1.00 49.11  ? 610 VAL A CA  1 
ATOM   285  C C   . VAL A 1 44  ? 10.291  13.673 27.346 1.00 50.62  ? 610 VAL A C   1 
ATOM   286  O O   . VAL A 1 44  ? 10.542  12.892 28.263 1.00 52.52  ? 610 VAL A O   1 
ATOM   287  C CB  . VAL A 1 44  ? 10.906  15.959 28.044 1.00 53.82  ? 610 VAL A CB  1 
ATOM   288  C CG1 . VAL A 1 44  ? 11.940  16.037 26.933 1.00 47.29  ? 610 VAL A CG1 1 
ATOM   289  C CG2 . VAL A 1 44  ? 10.409  17.347 28.441 1.00 62.87  ? 610 VAL A CG2 1 
ATOM   290  N N   . PHE A 1 45  ? 10.479  13.363 26.069 1.00 43.54  ? 611 PHE A N   1 
ATOM   291  C CA  . PHE A 1 45  ? 11.070  12.096 25.684 1.00 36.38  ? 611 PHE A CA  1 
ATOM   292  C C   . PHE A 1 45  ? 12.179  12.367 24.710 1.00 38.91  ? 611 PHE A C   1 
ATOM   293  O O   . PHE A 1 45  ? 12.060  13.248 23.857 1.00 41.87  ? 611 PHE A O   1 
ATOM   294  C CB  . PHE A 1 45  ? 10.051  11.196 24.988 1.00 30.31  ? 611 PHE A CB  1 
ATOM   295  C CG  . PHE A 1 45  ? 8.863   10.843 25.839 1.00 42.29  ? 611 PHE A CG  1 
ATOM   296  C CD1 . PHE A 1 45  ? 8.913   9.766  26.709 1.00 35.76  ? 611 PHE A CD1 1 
ATOM   297  C CD2 . PHE A 1 45  ? 7.693   11.587 25.761 1.00 39.21  ? 611 PHE A CD2 1 
ATOM   298  C CE1 . PHE A 1 45  ? 7.817   9.441  27.491 1.00 47.16  ? 611 PHE A CE1 1 
ATOM   299  C CE2 . PHE A 1 45  ? 6.593   11.268 26.539 1.00 40.32  ? 611 PHE A CE2 1 
ATOM   300  C CZ  . PHE A 1 45  ? 6.651   10.195 27.402 1.00 44.70  ? 611 PHE A CZ  1 
ATOM   301  N N   A ARG A 1 46  ? 13.263  11.611 24.843 0.46 34.75  ? 612 ARG A N   1 
ATOM   302  N N   B ARG A 1 46  ? 13.262  11.611 24.832 0.54 34.62  ? 612 ARG A N   1 
ATOM   303  C CA  A ARG A 1 46  ? 14.337  11.632 23.865 0.46 33.08  ? 612 ARG A CA  1 
ATOM   304  C CA  B ARG A 1 46  ? 14.337  11.663 23.854 0.54 33.02  ? 612 ARG A CA  1 
ATOM   305  C C   A ARG A 1 46  ? 14.062  10.536 22.844 0.46 33.46  ? 612 ARG A C   1 
ATOM   306  C C   B ARG A 1 46  ? 14.155  10.521 22.853 0.54 33.89  ? 612 ARG A C   1 
ATOM   307  O O   A ARG A 1 46  ? 13.667  9.422  23.201 0.46 31.89  ? 612 ARG A O   1 
ATOM   308  O O   B ARG A 1 46  ? 13.905  9.372  23.233 0.54 32.77  ? 612 ARG A O   1 
ATOM   309  C CB  A ARG A 1 46  ? 15.686  11.397 24.542 0.46 31.11  ? 612 ARG A CB  1 
ATOM   310  C CB  B ARG A 1 46  ? 15.702  11.611 24.547 0.54 32.34  ? 612 ARG A CB  1 
ATOM   311  C CG  A ARG A 1 46  ? 15.943  12.309 25.731 0.46 38.48  ? 612 ARG A CG  1 
ATOM   312  C CG  B ARG A 1 46  ? 15.943  12.812 25.463 0.54 38.57  ? 612 ARG A CG  1 
ATOM   313  C CD  A ARG A 1 46  ? 16.011  13.763 25.309 0.46 39.53  ? 612 ARG A CD  1 
ATOM   314  C CD  B ARG A 1 46  ? 17.196  12.669 26.327 0.54 38.11  ? 612 ARG A CD  1 
ATOM   315  N NE  A ARG A 1 46  ? 16.304  14.640 26.438 0.46 45.56  ? 612 ARG A NE  1 
ATOM   316  N NE  B ARG A 1 46  ? 17.372  13.846 27.176 0.54 46.99  ? 612 ARG A NE  1 
ATOM   317  C CZ  A ARG A 1 46  ? 16.631  15.921 26.316 0.46 45.00  ? 612 ARG A CZ  1 
ATOM   318  C CZ  B ARG A 1 46  ? 18.261  13.948 28.159 0.54 45.87  ? 612 ARG A CZ  1 
ATOM   319  N NH1 A ARG A 1 46  ? 16.717  16.465 25.111 0.46 43.95  ? 612 ARG A NH1 1 
ATOM   320  N NH1 B ARG A 1 46  ? 19.079  12.936 28.434 0.54 38.28  ? 612 ARG A NH1 1 
ATOM   321  N NH2 A ARG A 1 46  ? 16.883  16.651 27.394 0.46 45.41  ? 612 ARG A NH2 1 
ATOM   322  N NH2 B ARG A 1 46  ? 18.332  15.069 28.866 0.54 41.67  ? 612 ARG A NH2 1 
ATOM   323  N N   . VAL A 1 47  ? 14.271  10.857 21.573 1.00 33.29  ? 613 VAL A N   1 
ATOM   324  C CA  . VAL A 1 47  ? 13.935  9.944  20.493 1.00 29.15  ? 613 VAL A CA  1 
ATOM   325  C C   . VAL A 1 47  ? 15.171  9.618  19.659 1.00 34.52  ? 613 VAL A C   1 
ATOM   326  O O   . VAL A 1 47  ? 15.978  10.493 19.363 1.00 31.38  ? 613 VAL A O   1 
ATOM   327  C CB  . VAL A 1 47  ? 12.887  10.595 19.569 1.00 26.93  ? 613 VAL A CB  1 
ATOM   328  C CG1 . VAL A 1 47  ? 12.398  9.613  18.533 1.00 22.67  ? 613 VAL A CG1 1 
ATOM   329  C CG2 . VAL A 1 47  ? 11.718  11.161 20.390 1.00 24.23  ? 613 VAL A CG2 1 
ATOM   330  N N   . LYS A 1 48  ? 15.325  8.351  19.295 1.00 33.01  ? 614 LYS A N   1 
ATOM   331  C CA  . LYS A 1 48  ? 16.337  7.967  18.325 1.00 30.87  ? 614 LYS A CA  1 
ATOM   332  C C   . LYS A 1 48  ? 15.575  7.523  17.095 1.00 29.31  ? 614 LYS A C   1 
ATOM   333  O O   . LYS A 1 48  ? 14.727  6.638  17.181 1.00 27.79  ? 614 LYS A O   1 
ATOM   334  C CB  . LYS A 1 48  ? 17.212  6.818  18.839 1.00 26.29  ? 614 LYS A CB  1 
ATOM   335  C CG  . LYS A 1 48  ? 17.972  7.127  20.125 1.00 28.06  ? 614 LYS A CG  1 
ATOM   336  C CD  . LYS A 1 48  ? 18.885  5.971  20.489 1.00 27.17  ? 614 LYS A CD  1 
ATOM   337  C CE  . LYS A 1 48  ? 19.813  6.337  21.623 1.00 32.06  ? 614 LYS A CE  1 
ATOM   338  N NZ  . LYS A 1 48  ? 20.365  5.137  22.304 1.00 26.71  ? 614 LYS A NZ  1 
ATOM   339  N N   . VAL A 1 49  ? 15.860  8.149  15.959 1.00 22.79  ? 615 VAL A N   1 
ATOM   340  C CA  . VAL A 1 49  ? 15.108  7.868  14.750 1.00 25.97  ? 615 VAL A CA  1 
ATOM   341  C C   . VAL A 1 49  ? 16.019  7.221  13.729 1.00 27.59  ? 615 VAL A C   1 
ATOM   342  O O   . VAL A 1 49  ? 16.997  7.819  13.288 1.00 26.38  ? 615 VAL A O   1 
ATOM   343  C CB  . VAL A 1 49  ? 14.464  9.137  14.188 1.00 30.70  ? 615 VAL A CB  1 
ATOM   344  C CG1 . VAL A 1 49  ? 13.629  8.813  12.949 1.00 21.59  ? 615 VAL A CG1 1 
ATOM   345  C CG2 . VAL A 1 49  ? 13.624  9.813  15.279 1.00 20.11  ? 615 VAL A CG2 1 
ATOM   346  N N   . PHE A 1 50  ? 15.715  5.966  13.421 1.00 26.99  ? 616 PHE A N   1 
ATOM   347  C CA  . PHE A 1 50  ? 16.477  5.167  12.481 1.00 29.44  ? 616 PHE A CA  1 
ATOM   348  C C   . PHE A 1 50  ? 15.860  5.144  11.074 1.00 35.55  ? 616 PHE A C   1 
ATOM   349  O O   . PHE A 1 50  ? 16.401  4.531  10.165 1.00 36.94  ? 616 PHE A O   1 
ATOM   350  C CB  . PHE A 1 50  ? 16.678  3.752  13.041 1.00 26.53  ? 616 PHE A CB  1 
ATOM   351  C CG  . PHE A 1 50  ? 17.357  3.737  14.396 1.00 24.63  ? 616 PHE A CG  1 
ATOM   352  C CD1 . PHE A 1 50  ? 16.619  3.608  15.554 1.00 17.64  ? 616 PHE A CD1 1 
ATOM   353  C CD2 . PHE A 1 50  ? 18.734  3.898  14.503 1.00 25.10  ? 616 PHE A CD2 1 
ATOM   354  C CE1 . PHE A 1 50  ? 17.241  3.610  16.797 1.00 23.11  ? 616 PHE A CE1 1 
ATOM   355  C CE2 . PHE A 1 50  ? 19.357  3.909  15.736 1.00 21.68  ? 616 PHE A CE2 1 
ATOM   356  C CZ  . PHE A 1 50  ? 18.611  3.757  16.888 1.00 24.23  ? 616 PHE A CZ  1 
ATOM   357  N N   . ASN A 1 51  ? 14.724  5.802  10.893 1.00 35.13  ? 617 ASN A N   1 
ATOM   358  C CA  . ASN A 1 51  ? 14.230  6.017  9.539  1.00 34.06  ? 617 ASN A CA  1 
ATOM   359  C C   . ASN A 1 51  ? 14.431  7.495  9.214  1.00 39.17  ? 617 ASN A C   1 
ATOM   360  O O   . ASN A 1 51  ? 13.651  8.347  9.640  1.00 34.22  ? 617 ASN A O   1 
ATOM   361  C CB  . ASN A 1 51  ? 12.747  5.650  9.504  1.00 33.73  ? 617 ASN A CB  1 
ATOM   362  C CG  . ASN A 1 51  ? 12.117  5.821  8.133  1.00 43.08  ? 617 ASN A CG  1 
ATOM   363  O OD1 . ASN A 1 51  ? 12.792  6.116  7.140  1.00 44.52  ? 617 ASN A OD1 1 
ATOM   364  N ND2 . ASN A 1 51  ? 10.801  5.618  8.074  1.00 41.91  ? 617 ASN A ND2 1 
ATOM   365  N N   . ILE A 1 52  ? 15.426  7.800  8.391  1.00 40.97  ? 618 ILE A N   1 
ATOM   366  C CA  . ILE A 1 52  ? 15.803  9.190  8.236  1.00 46.11  ? 618 ILE A CA  1 
ATOM   367  C C   . ILE A 1 52  ? 14.905  9.901  7.217  1.00 44.44  ? 618 ILE A C   1 
ATOM   368  O O   . ILE A 1 52  ? 14.981  11.117 7.051  1.00 43.99  ? 618 ILE A O   1 
ATOM   369  C CB  . ILE A 1 52  ? 17.311  9.374  7.920  1.00 41.91  ? 618 ILE A CB  1 
ATOM   370  C CG1 . ILE A 1 52  ? 17.700  8.596  6.673  1.00 53.32  ? 618 ILE A CG1 1 
ATOM   371  C CG2 . ILE A 1 52  ? 18.178  8.938  9.102  1.00 30.51  ? 618 ILE A CG2 1 
ATOM   372  C CD1 . ILE A 1 52  ? 19.138  8.818  6.265  1.00 61.36  ? 618 ILE A CD1 1 
ATOM   373  N N   . ASP A 1 53  ? 14.044  9.143  6.552  1.00 40.06  ? 619 ASP A N   1 
ATOM   374  C CA  . ASP A 1 53  ? 13.019  9.751  5.711  1.00 48.79  ? 619 ASP A CA  1 
ATOM   375  C C   . ASP A 1 53  ? 12.016  10.519 6.576  1.00 53.70  ? 619 ASP A C   1 
ATOM   376  O O   . ASP A 1 53  ? 11.201  11.293 6.066  1.00 52.69  ? 619 ASP A O   1 
ATOM   377  C CB  . ASP A 1 53  ? 12.307  8.694  4.868  1.00 52.24  ? 619 ASP A CB  1 
ATOM   378  C CG  . ASP A 1 53  ? 13.222  8.068  3.820  1.00 71.83  ? 619 ASP A CG  1 
ATOM   379  O OD1 . ASP A 1 53  ? 13.986  8.815  3.166  1.00 75.01  ? 619 ASP A OD1 1 
ATOM   380  O OD2 . ASP A 1 53  ? 13.180  6.828  3.652  1.00 78.82  ? 619 ASP A OD2 1 
ATOM   381  N N   . LEU A 1 54  ? 12.094  10.309 7.888  1.00 45.99  ? 620 LEU A N   1 
ATOM   382  C CA  . LEU A 1 54  ? 11.192  10.964 8.828  1.00 37.66  ? 620 LEU A CA  1 
ATOM   383  C C   . LEU A 1 54  ? 11.690  12.338 9.260  1.00 41.48  ? 620 LEU A C   1 
ATOM   384  O O   . LEU A 1 54  ? 11.040  13.018 10.048 1.00 39.71  ? 620 LEU A O   1 
ATOM   385  C CB  . LEU A 1 54  ? 10.963  10.078 10.053 1.00 31.38  ? 620 LEU A CB  1 
ATOM   386  C CG  . LEU A 1 54  ? 10.325  8.705  9.770  1.00 36.29  ? 620 LEU A CG  1 
ATOM   387  C CD1 . LEU A 1 54  ? 10.358  7.801  10.999 1.00 28.93  ? 620 LEU A CD1 1 
ATOM   388  C CD2 . LEU A 1 54  ? 8.900   8.845  9.243  1.00 31.62  ? 620 LEU A CD2 1 
ATOM   389  N N   . LYS A 1 55  ? 12.842  12.750 8.747  1.00 43.76  ? 621 LYS A N   1 
ATOM   390  C CA  . LYS A 1 55  ? 13.421  14.034 9.141  1.00 49.35  ? 621 LYS A CA  1 
ATOM   391  C C   . LYS A 1 55  ? 12.414  15.192 9.038  1.00 51.69  ? 621 LYS A C   1 
ATOM   392  O O   . LYS A 1 55  ? 12.342  16.042 9.929  1.00 48.40  ? 621 LYS A O   1 
ATOM   393  C CB  . LYS A 1 55  ? 14.676  14.332 8.316  1.00 59.14  ? 621 LYS A CB  1 
ATOM   394  C CG  . LYS A 1 55  ? 15.949  14.448 9.143  1.00 67.80  ? 621 LYS A CG  1 
ATOM   395  C CD  . LYS A 1 55  ? 15.919  15.686 10.026 1.00 68.44  ? 621 LYS A CD  1 
ATOM   396  C CE  . LYS A 1 55  ? 17.264  15.926 10.687 1.00 65.51  ? 621 LYS A CE  1 
ATOM   397  N NZ  . LYS A 1 55  ? 17.330  17.283 11.291 1.00 68.81  ? 621 LYS A NZ  1 
ATOM   398  N N   . GLU A 1 56  ? 11.637  15.225 7.955  1.00 50.15  ? 622 GLU A N   1 
ATOM   399  C CA  . GLU A 1 56  ? 10.641  16.277 7.781  1.00 56.88  ? 622 GLU A CA  1 
ATOM   400  C C   . GLU A 1 56  ? 9.609   16.257 8.906  1.00 59.78  ? 622 GLU A C   1 
ATOM   401  O O   . GLU A 1 56  ? 9.278   17.301 9.465  1.00 63.84  ? 622 GLU A O   1 
ATOM   402  C CB  . GLU A 1 56  ? 9.944   16.164 6.425  1.00 71.29  ? 622 GLU A CB  1 
ATOM   403  C CG  . GLU A 1 56  ? 8.834   17.195 6.227  1.00 93.83  ? 622 GLU A CG  1 
ATOM   404  C CD  . GLU A 1 56  ? 8.224   17.159 4.831  1.00 112.62 ? 622 GLU A CD  1 
ATOM   405  O OE1 . GLU A 1 56  ? 8.591   16.260 4.043  1.00 118.42 ? 622 GLU A OE1 1 
ATOM   406  O OE2 . GLU A 1 56  ? 7.380   18.034 4.522  1.00 116.28 ? 622 GLU A OE2 1 
ATOM   407  N N   . LYS A 1 57  ? 9.107   15.067 9.241  1.00 51.49  ? 623 LYS A N   1 
ATOM   408  C CA  . LYS A 1 57  ? 8.109   14.927 10.303 1.00 42.44  ? 623 LYS A CA  1 
ATOM   409  C C   . LYS A 1 57  ? 8.621   15.457 11.637 1.00 41.81  ? 623 LYS A C   1 
ATOM   410  O O   . LYS A 1 57  ? 7.851   15.938 12.465 1.00 47.48  ? 623 LYS A O   1 
ATOM   411  C CB  . LYS A 1 57  ? 7.670   13.469 10.464 1.00 38.45  ? 623 LYS A CB  1 
ATOM   412  C CG  . LYS A 1 57  ? 7.016   12.856 9.239  1.00 48.94  ? 623 LYS A CG  1 
ATOM   413  C CD  . LYS A 1 57  ? 5.749   13.596 8.852  1.00 58.77  ? 623 LYS A CD  1 
ATOM   414  C CE  . LYS A 1 57  ? 4.596   12.627 8.626  1.00 65.24  ? 623 LYS A CE  1 
ATOM   415  N NZ  . LYS A 1 57  ? 5.022   11.448 7.824  1.00 68.76  ? 623 LYS A NZ  1 
ATOM   416  N N   . PHE A 1 58  ? 9.930   15.387 11.827 1.00 39.88  ? 624 PHE A N   1 
ATOM   417  C CA  . PHE A 1 58  ? 10.558  15.787 13.082 1.00 44.31  ? 624 PHE A CA  1 
ATOM   418  C C   . PHE A 1 58  ? 10.964  17.270 13.163 1.00 61.01  ? 624 PHE A C   1 
ATOM   419  O O   . PHE A 1 58  ? 11.702  17.672 14.056 1.00 67.50  ? 624 PHE A O   1 
ATOM   420  C CB  . PHE A 1 58  ? 11.643  14.797 13.521 1.00 38.49  ? 624 PHE A CB  1 
ATOM   421  C CG  . PHE A 1 58  ? 11.073  13.531 14.116 1.00 44.57  ? 624 PHE A CG  1 
ATOM   422  C CD1 . PHE A 1 58  ? 10.945  13.390 15.496 1.00 37.95  ? 624 PHE A CD1 1 
ATOM   423  C CD2 . PHE A 1 58  ? 10.605  12.507 13.293 1.00 35.57  ? 624 PHE A CD2 1 
ATOM   424  C CE1 . PHE A 1 58  ? 10.403  12.237 16.048 1.00 37.62  ? 624 PHE A CE1 1 
ATOM   425  C CE2 . PHE A 1 58  ? 10.055  11.345 13.839 1.00 34.50  ? 624 PHE A CE2 1 
ATOM   426  C CZ  . PHE A 1 58  ? 9.954   11.211 15.216 1.00 32.51  ? 624 PHE A CZ  1 
ATOM   427  N N   . THR A 1 59  ? 10.537  18.052 12.175 1.00 56.84  ? 625 THR A N   1 
ATOM   428  C CA  . THR A 1 59  ? 10.671  19.511 12.208 1.00 52.20  ? 625 THR A CA  1 
ATOM   429  C C   . THR A 1 59  ? 10.114  20.155 13.491 1.00 47.49  ? 625 THR A C   1 
ATOM   430  O O   . THR A 1 59  ? 8.954   19.962 13.843 1.00 48.35  ? 625 THR A O   1 
ATOM   431  C CB  . THR A 1 59  ? 9.947   20.147 11.008 1.00 58.29  ? 625 THR A CB  1 
ATOM   432  O OG1 . THR A 1 59  ? 10.461  19.593 9.793  1.00 58.62  ? 625 THR A OG1 1 
ATOM   433  C CG2 . THR A 1 59  ? 10.133  21.668 11.001 1.00 62.61  ? 625 THR A CG2 1 
ATOM   434  N N   . PRO A 1 60  ? 10.939  20.963 14.176 1.00 50.91  ? 626 PRO A N   1 
ATOM   435  C CA  . PRO A 1 60  ? 10.530  21.574 15.444 1.00 54.23  ? 626 PRO A CA  1 
ATOM   436  C C   . PRO A 1 60  ? 9.195   22.307 15.340 1.00 61.29  ? 626 PRO A C   1 
ATOM   437  O O   . PRO A 1 60  ? 8.844   22.830 14.281 1.00 62.37  ? 626 PRO A O   1 
ATOM   438  C CB  . PRO A 1 60  ? 11.662  22.557 15.729 1.00 53.13  ? 626 PRO A CB  1 
ATOM   439  C CG  . PRO A 1 60  ? 12.849  21.936 15.064 1.00 50.86  ? 626 PRO A CG  1 
ATOM   440  C CD  . PRO A 1 60  ? 12.313  21.343 13.803 1.00 50.46  ? 626 PRO A CD  1 
ATOM   441  N N   . LYS A 1 61  ? 8.456   22.306 16.443 1.00 62.28  ? 627 LYS A N   1 
ATOM   442  C CA  . LYS A 1 61  ? 7.113   22.879 16.529 1.00 67.52  ? 627 LYS A CA  1 
ATOM   443  C C   . LYS A 1 61  ? 6.010   22.011 15.904 1.00 59.68  ? 627 LYS A C   1 
ATOM   444  O O   . LYS A 1 61  ? 4.836   22.202 16.205 1.00 60.56  ? 627 LYS A O   1 
ATOM   445  C CB  . LYS A 1 61  ? 7.075   24.293 15.926 1.00 74.64  ? 627 LYS A CB  1 
ATOM   446  C CG  . LYS A 1 61  ? 7.944   25.299 16.663 1.00 82.57  ? 627 LYS A CG  1 
ATOM   447  C CD  . LYS A 1 61  ? 7.556   25.379 18.128 1.00 89.48  ? 627 LYS A CD  1 
ATOM   448  C CE  . LYS A 1 61  ? 8.312   26.481 18.854 1.00 97.94  ? 627 LYS A CE  1 
ATOM   449  N NZ  . LYS A 1 61  ? 7.843   26.624 20.264 1.00 102.08 ? 627 LYS A NZ  1 
ATOM   450  N N   . LYS A 1 62  ? 6.378   21.028 15.087 1.00 56.27  ? 628 LYS A N   1 
ATOM   451  C CA  . LYS A 1 62  ? 5.374   20.164 14.469 1.00 58.71  ? 628 LYS A CA  1 
ATOM   452  C C   . LYS A 1 62  ? 4.723   19.248 15.499 1.00 56.30  ? 628 LYS A C   1 
ATOM   453  O O   . LYS A 1 62  ? 5.381   18.795 16.433 1.00 60.79  ? 628 LYS A O   1 
ATOM   454  C CB  . LYS A 1 62  ? 5.980   19.322 13.341 1.00 65.44  ? 628 LYS A CB  1 
ATOM   455  C CG  . LYS A 1 62  ? 5.996   20.003 11.982 1.00 74.97  ? 628 LYS A CG  1 
ATOM   456  C CD  . LYS A 1 62  ? 6.367   19.021 10.878 1.00 77.34  ? 628 LYS A CD  1 
ATOM   457  C CE  . LYS A 1 62  ? 5.419   17.832 10.862 1.00 81.61  ? 628 LYS A CE  1 
ATOM   458  N NZ  . LYS A 1 62  ? 5.590   17.003 9.635  1.00 84.46  ? 628 LYS A NZ  1 
ATOM   459  N N   . ILE A 1 63  ? 3.428   18.983 15.327 1.00 58.59  ? 629 ILE A N   1 
ATOM   460  C CA  . ILE A 1 63  ? 2.716   18.006 16.148 1.00 50.03  ? 629 ILE A CA  1 
ATOM   461  C C   . ILE A 1 63  ? 2.610   16.685 15.397 1.00 51.51  ? 629 ILE A C   1 
ATOM   462  O O   . ILE A 1 63  ? 2.155   16.652 14.250 1.00 59.64  ? 629 ILE A O   1 
ATOM   463  C CB  . ILE A 1 63  ? 1.291   18.470 16.502 1.00 56.04  ? 629 ILE A CB  1 
ATOM   464  C CG1 . ILE A 1 63  ? 1.289   19.922 17.002 1.00 63.22  ? 629 ILE A CG1 1 
ATOM   465  C CG2 . ILE A 1 63  ? 0.674   17.529 17.531 1.00 52.99  ? 629 ILE A CG2 1 
ATOM   466  C CD1 . ILE A 1 63  ? 1.664   20.077 18.458 1.00 61.77  ? 629 ILE A CD1 1 
ATOM   467  N N   . ILE A 1 64  ? 3.031   15.602 16.046 1.00 44.97  ? 630 ILE A N   1 
ATOM   468  C CA  . ILE A 1 64  ? 2.973   14.266 15.459 1.00 40.52  ? 630 ILE A CA  1 
ATOM   469  C C   . ILE A 1 64  ? 2.483   13.220 16.472 1.00 42.55  ? 630 ILE A C   1 
ATOM   470  O O   . ILE A 1 64  ? 2.608   13.409 17.686 1.00 44.18  ? 630 ILE A O   1 
ATOM   471  C CB  . ILE A 1 64  ? 4.353   13.826 14.912 1.00 40.30  ? 630 ILE A CB  1 
ATOM   472  C CG1 . ILE A 1 64  ? 5.387   13.770 16.041 1.00 35.68  ? 630 ILE A CG1 1 
ATOM   473  C CG2 . ILE A 1 64  ? 4.803   14.747 13.777 1.00 36.69  ? 630 ILE A CG2 1 
ATOM   474  C CD1 . ILE A 1 64  ? 6.798   13.383 15.593 1.00 33.59  ? 630 ILE A CD1 1 
ATOM   475  N N   . ALA A 1 65  ? 1.913   12.126 15.966 1.00 34.29  ? 631 ALA A N   1 
ATOM   476  C CA  . ALA A 1 65  ? 1.588   10.962 16.796 1.00 37.99  ? 631 ALA A CA  1 
ATOM   477  C C   . ALA A 1 65  ? 2.606   9.853  16.541 1.00 41.50  ? 631 ALA A C   1 
ATOM   478  O O   . ALA A 1 65  ? 2.918   9.539  15.387 1.00 37.27  ? 631 ALA A O   1 
ATOM   479  C CB  . ALA A 1 65  ? 0.178   10.462 16.504 1.00 37.49  ? 631 ALA A CB  1 
ATOM   480  N N   . ILE A 1 66  ? 3.123   9.270  17.620 1.00 38.72  ? 632 ILE A N   1 
ATOM   481  C CA  . ILE A 1 66  ? 4.080   8.176  17.518 1.00 39.04  ? 632 ILE A CA  1 
ATOM   482  C C   . ILE A 1 66  ? 3.572   6.918  18.222 1.00 42.15  ? 632 ILE A C   1 
ATOM   483  O O   . ILE A 1 66  ? 3.230   6.948  19.403 1.00 44.62  ? 632 ILE A O   1 
ATOM   484  C CB  . ILE A 1 66  ? 5.445   8.576  18.101 1.00 38.73  ? 632 ILE A CB  1 
ATOM   485  C CG1 . ILE A 1 66  ? 5.895   9.913  17.503 1.00 34.95  ? 632 ILE A CG1 1 
ATOM   486  C CG2 . ILE A 1 66  ? 6.479   7.490  17.830 1.00 37.28  ? 632 ILE A CG2 1 
ATOM   487  C CD1 . ILE A 1 66  ? 7.118   10.496 18.167 1.00 33.73  ? 632 ILE A CD1 1 
ATOM   488  N N   . ALA A 1 67  ? 3.521   5.817  17.480 1.00 32.11  ? 633 ALA A N   1 
ATOM   489  C CA  . ALA A 1 67  ? 3.086   4.538  18.025 1.00 25.28  ? 633 ALA A CA  1 
ATOM   490  C C   . ALA A 1 67  ? 3.929   3.392  17.444 1.00 29.98  ? 633 ALA A C   1 
ATOM   491  O O   . ALA A 1 67  ? 4.569   3.536  16.403 1.00 31.99  ? 633 ALA A O   1 
ATOM   492  C CB  . ALA A 1 67  ? 1.599   4.318  17.745 1.00 25.39  ? 633 ALA A CB  1 
ATOM   493  N N   . ASN A 1 68  ? 3.918   2.247  18.110 1.00 29.62  ? 634 ASN A N   1 
ATOM   494  C CA  . ASN A 1 68  ? 4.714   1.108  17.656 1.00 27.87  ? 634 ASN A CA  1 
ATOM   495  C C   . ASN A 1 68  ? 6.196   1.442  17.577 1.00 27.48  ? 634 ASN A C   1 
ATOM   496  O O   . ASN A 1 68  ? 6.880   1.037  16.644 1.00 26.92  ? 634 ASN A O   1 
ATOM   497  C CB  . ASN A 1 68  ? 4.186   0.573  16.318 1.00 24.14  ? 634 ASN A CB  1 
ATOM   498  C CG  . ASN A 1 68  ? 2.714   0.198  16.397 1.00 41.39  ? 634 ASN A CG  1 
ATOM   499  O OD1 . ASN A 1 68  ? 2.000   0.225  15.400 1.00 41.50  ? 634 ASN A OD1 1 
ATOM   500  N ND2 . ASN A 1 68  ? 2.250   -0.133 17.603 1.00 32.93  ? 634 ASN A ND2 1 
ATOM   501  N N   . TYR A 1 69  ? 6.675   2.203  18.560 1.00 27.17  ? 635 TYR A N   1 
ATOM   502  C CA  . TYR A 1 69  ? 8.104   2.456  18.721 1.00 29.82  ? 635 TYR A CA  1 
ATOM   503  C C   . TYR A 1 69  ? 8.696   1.455  19.732 1.00 33.47  ? 635 TYR A C   1 
ATOM   504  O O   . TYR A 1 69  ? 7.963   0.690  20.379 1.00 33.27  ? 635 TYR A O   1 
ATOM   505  C CB  . TYR A 1 69  ? 8.309   3.901  19.223 1.00 23.19  ? 635 TYR A CB  1 
ATOM   506  C CG  . TYR A 1 69  ? 7.456   4.205  20.438 1.00 26.56  ? 635 TYR A CG  1 
ATOM   507  C CD1 . TYR A 1 69  ? 7.905   3.907  21.725 1.00 32.05  ? 635 TYR A CD1 1 
ATOM   508  C CD2 . TYR A 1 69  ? 6.190   4.747  20.298 1.00 33.76  ? 635 TYR A CD2 1 
ATOM   509  C CE1 . TYR A 1 69  ? 7.124   4.154  22.831 1.00 28.91  ? 635 TYR A CE1 1 
ATOM   510  C CE2 . TYR A 1 69  ? 5.401   5.004  21.400 1.00 41.06  ? 635 TYR A CE2 1 
ATOM   511  C CZ  . TYR A 1 69  ? 5.870   4.707  22.662 1.00 38.81  ? 635 TYR A CZ  1 
ATOM   512  O OH  . TYR A 1 69  ? 5.072   4.957  23.751 1.00 39.00  ? 635 TYR A OH  1 
ATOM   513  N N   . VAL A 1 70  ? 10.011  1.493  19.914 1.00 32.82  ? 636 VAL A N   1 
ATOM   514  C CA  . VAL A 1 70  ? 10.667  0.605  20.876 1.00 32.65  ? 636 VAL A CA  1 
ATOM   515  C C   . VAL A 1 70  ? 11.230  1.444  22.018 1.00 31.92  ? 636 VAL A C   1 
ATOM   516  O O   . VAL A 1 70  ? 11.830  2.486  21.786 1.00 40.17  ? 636 VAL A O   1 
ATOM   517  C CB  . VAL A 1 70  ? 11.833  -0.213 20.232 1.00 34.14  ? 636 VAL A CB  1 
ATOM   518  C CG1 . VAL A 1 70  ? 12.497  -1.113 21.268 1.00 38.04  ? 636 VAL A CG1 1 
ATOM   519  C CG2 . VAL A 1 70  ? 11.358  -1.038 19.026 1.00 27.73  ? 636 VAL A CG2 1 
ATOM   520  N N   . CYS A 1 71  ? 11.026  1.007  23.251 1.00 31.26  ? 637 CYS A N   1 
ATOM   521  C CA  . CYS A 1 71  ? 11.643  1.663  24.394 1.00 31.69  ? 637 CYS A CA  1 
ATOM   522  C C   . CYS A 1 71  ? 12.948  0.956  24.737 1.00 44.75  ? 637 CYS A C   1 
ATOM   523  O O   . CYS A 1 71  ? 12.954  -0.223 25.079 1.00 44.89  ? 637 CYS A O   1 
ATOM   524  C CB  . CYS A 1 71  ? 10.716  1.641  25.611 1.00 36.58  ? 637 CYS A CB  1 
ATOM   525  S SG  . CYS A 1 71  ? 9.547   2.987  25.642 1.00 68.36  ? 637 CYS A SG  1 
ATOM   526  N N   . ARG A 1 72  ? 14.062  1.661  24.609 1.00 44.51  ? 638 ARG A N   1 
ATOM   527  C CA  . ARG A 1 72  ? 15.334  1.092  25.011 1.00 39.09  ? 638 ARG A CA  1 
ATOM   528  C C   . ARG A 1 72  ? 16.179  2.162  25.677 1.00 43.79  ? 638 ARG A C   1 
ATOM   529  O O   . ARG A 1 72  ? 16.378  3.240  25.105 1.00 36.03  ? 638 ARG A O   1 
ATOM   530  C CB  . ARG A 1 72  ? 16.065  0.527  23.796 1.00 41.35  ? 638 ARG A CB  1 
ATOM   531  C CG  . ARG A 1 72  ? 16.965  -0.645 24.113 1.00 44.34  ? 638 ARG A CG  1 
ATOM   532  C CD  . ARG A 1 72  ? 17.959  -0.909 22.993 1.00 53.54  ? 638 ARG A CD  1 
ATOM   533  N NE  . ARG A 1 72  ? 17.343  -1.083 21.678 1.00 53.63  ? 638 ARG A NE  1 
ATOM   534  C CZ  . ARG A 1 72  ? 16.493  -2.058 21.369 1.00 54.21  ? 638 ARG A CZ  1 
ATOM   535  N NH1 . ARG A 1 72  ? 16.130  -2.937 22.291 1.00 53.63  ? 638 ARG A NH1 1 
ATOM   536  N NH2 . ARG A 1 72  ? 15.996  -2.146 20.140 1.00 53.24  ? 638 ARG A NH2 1 
ATOM   537  N N   . ASN A 1 73  ? 16.666  1.866  26.883 1.00 48.33  ? 639 ASN A N   1 
ATOM   538  C CA  . ASN A 1 73  ? 17.579  2.757  27.598 1.00 49.94  ? 639 ASN A CA  1 
ATOM   539  C C   . ASN A 1 73  ? 17.016  4.140  27.872 1.00 48.32  ? 639 ASN A C   1 
ATOM   540  O O   . ASN A 1 73  ? 17.776  5.097  28.014 1.00 54.26  ? 639 ASN A O   1 
ATOM   541  C CB  . ASN A 1 73  ? 18.892  2.921  26.825 1.00 50.66  ? 639 ASN A CB  1 
ATOM   542  C CG  . ASN A 1 73  ? 19.644  1.618  26.662 1.00 57.40  ? 639 ASN A CG  1 
ATOM   543  O OD1 . ASN A 1 73  ? 19.625  0.766  27.548 1.00 58.04  ? 639 ASN A OD1 1 
ATOM   544  N ND2 . ASN A 1 73  ? 20.315  1.456  25.521 1.00 57.07  ? 639 ASN A ND2 1 
ATOM   545  N N   . GLY A 1 74  ? 15.696  4.258  27.931 1.00 46.33  ? 640 GLY A N   1 
ATOM   546  C CA  . GLY A 1 74  ? 15.075  5.536  28.240 1.00 46.47  ? 640 GLY A CA  1 
ATOM   547  C C   . GLY A 1 74  ? 14.808  6.404  27.023 1.00 46.33  ? 640 GLY A C   1 
ATOM   548  O O   . GLY A 1 74  ? 14.344  7.548  27.153 1.00 48.08  ? 640 GLY A O   1 
ATOM   549  N N   . PHE A 1 75  ? 15.120  5.861  25.846 1.00 35.45  ? 641 PHE A N   1 
ATOM   550  C CA  . PHE A 1 75  ? 14.842  6.514  24.570 1.00 37.17  ? 641 PHE A CA  1 
ATOM   551  C C   . PHE A 1 75  ? 13.664  5.809  23.896 1.00 46.14  ? 641 PHE A C   1 
ATOM   552  O O   . PHE A 1 75  ? 13.467  4.594  24.075 1.00 43.22  ? 641 PHE A O   1 
ATOM   553  C CB  . PHE A 1 75  ? 16.056  6.430  23.624 1.00 32.24  ? 641 PHE A CB  1 
ATOM   554  C CG  . PHE A 1 75  ? 17.306  7.098  24.149 1.00 40.69  ? 641 PHE A CG  1 
ATOM   555  C CD1 . PHE A 1 75  ? 18.189  6.409  24.968 1.00 47.74  ? 641 PHE A CD1 1 
ATOM   556  C CD2 . PHE A 1 75  ? 17.609  8.409  23.801 1.00 44.87  ? 641 PHE A CD2 1 
ATOM   557  C CE1 . PHE A 1 75  ? 19.348  7.022  25.444 1.00 49.20  ? 641 PHE A CE1 1 
ATOM   558  C CE2 . PHE A 1 75  ? 18.758  9.027  24.272 1.00 46.37  ? 641 PHE A CE2 1 
ATOM   559  C CZ  . PHE A 1 75  ? 19.633  8.329  25.097 1.00 44.45  ? 641 PHE A CZ  1 
ATOM   560  N N   . LEU A 1 76  ? 12.876  6.569  23.137 1.00 38.56  ? 642 LEU A N   1 
ATOM   561  C CA  . LEU A 1 76  ? 11.956  5.969  22.182 1.00 32.07  ? 642 LEU A CA  1 
ATOM   562  C C   . LEU A 1 76  ? 12.701  5.811  20.869 1.00 24.58  ? 642 LEU A C   1 
ATOM   563  O O   . LEU A 1 76  ? 13.236  6.778  20.335 1.00 34.05  ? 642 LEU A O   1 
ATOM   564  C CB  . LEU A 1 76  ? 10.726  6.840  21.949 1.00 38.38  ? 642 LEU A CB  1 
ATOM   565  C CG  . LEU A 1 76  ? 10.009  7.463  23.142 1.00 41.20  ? 642 LEU A CG  1 
ATOM   566  C CD1 . LEU A 1 76  ? 8.695   8.036  22.639 1.00 42.77  ? 642 LEU A CD1 1 
ATOM   567  C CD2 . LEU A 1 76  ? 9.768   6.438  24.244 1.00 52.06  ? 642 LEU A CD2 1 
ATOM   568  N N   . GLU A 1 77  ? 12.720  4.589  20.353 1.00 24.65  ? 643 GLU A N   1 
ATOM   569  C CA  . GLU A 1 77  ? 13.401  4.276  19.117 1.00 22.99  ? 643 GLU A CA  1 
ATOM   570  C C   . GLU A 1 77  ? 12.370  4.113  18.007 1.00 24.59  ? 643 GLU A C   1 
ATOM   571  O O   . GLU A 1 77  ? 11.399  3.364  18.139 1.00 32.00  ? 643 GLU A O   1 
ATOM   572  C CB  . GLU A 1 77  ? 14.233  2.999  19.270 1.00 22.87  ? 643 GLU A CB  1 
ATOM   573  C CG  . GLU A 1 77  ? 15.111  2.943  20.527 1.00 22.88  ? 643 GLU A CG  1 
ATOM   574  C CD  . GLU A 1 77  ? 16.192  1.876  20.412 1.00 33.66  ? 643 GLU A CD  1 
ATOM   575  O OE1 . GLU A 1 77  ? 17.282  2.063  20.985 1.00 38.90  ? 643 GLU A OE1 1 
ATOM   576  O OE2 . GLU A 1 77  ? 15.958  0.854  19.729 1.00 35.20  ? 643 GLU A OE2 1 
ATOM   577  N N   . VAL A 1 78  ? 12.592  4.831  16.917 1.00 27.22  ? 644 VAL A N   1 
ATOM   578  C CA  . VAL A 1 78  ? 11.674  4.859  15.799 1.00 26.53  ? 644 VAL A CA  1 
ATOM   579  C C   . VAL A 1 78  ? 12.288  4.148  14.596 1.00 27.24  ? 644 VAL A C   1 
ATOM   580  O O   . VAL A 1 78  ? 13.327  4.555  14.079 1.00 25.22  ? 644 VAL A O   1 
ATOM   581  C CB  . VAL A 1 78  ? 11.347  6.302  15.421 1.00 32.02  ? 644 VAL A CB  1 
ATOM   582  C CG1 . VAL A 1 78  ? 10.521  6.338  14.147 1.00 28.33  ? 644 VAL A CG1 1 
ATOM   583  C CG2 . VAL A 1 78  ? 10.652  7.024  16.601 1.00 23.62  ? 644 VAL A CG2 1 
ATOM   584  N N   . TYR A 1 79  ? 11.665  3.043  14.209 1.00 23.30  ? 645 TYR A N   1 
ATOM   585  C CA  . TYR A 1 79  ? 12.077  2.266  13.045 1.00 25.63  ? 645 TYR A CA  1 
ATOM   586  C C   . TYR A 1 79  ? 11.103  2.468  11.889 1.00 25.65  ? 645 TYR A C   1 
ATOM   587  O O   . TYR A 1 79  ? 10.130  3.210  12.009 1.00 28.11  ? 645 TYR A O   1 
ATOM   588  C CB  . TYR A 1 79  ? 12.215  0.778  13.426 1.00 29.43  ? 645 TYR A CB  1 
ATOM   589  C CG  . TYR A 1 79  ? 13.265  0.563  14.497 1.00 29.95  ? 645 TYR A CG  1 
ATOM   590  C CD1 . TYR A 1 79  ? 14.604  0.392  14.155 1.00 30.84  ? 645 TYR A CD1 1 
ATOM   591  C CD2 . TYR A 1 79  ? 12.928  0.569  15.847 1.00 26.05  ? 645 TYR A CD2 1 
ATOM   592  C CE1 . TYR A 1 79  ? 15.579  0.207  15.123 1.00 29.69  ? 645 TYR A CE1 1 
ATOM   593  C CE2 . TYR A 1 79  ? 13.907  0.389  16.835 1.00 24.86  ? 645 TYR A CE2 1 
ATOM   594  C CZ  . TYR A 1 79  ? 15.229  0.210  16.450 1.00 32.36  ? 645 TYR A CZ  1 
ATOM   595  O OH  . TYR A 1 79  ? 16.216  0.037  17.381 1.00 36.96  ? 645 TYR A OH  1 
ATOM   596  N N   . PRO A 1 80  ? 11.361  1.800  10.763 1.00 34.82  ? 646 PRO A N   1 
ATOM   597  C CA  . PRO A 1 80  ? 10.464  1.899  9.607  1.00 33.15  ? 646 PRO A CA  1 
ATOM   598  C C   . PRO A 1 80  ? 9.082   1.306  9.868  1.00 32.88  ? 646 PRO A C   1 
ATOM   599  O O   . PRO A 1 80  ? 8.145   1.635  9.151  1.00 30.51  ? 646 PRO A O   1 
ATOM   600  C CB  . PRO A 1 80  ? 11.189  1.074  8.530  1.00 34.47  ? 646 PRO A CB  1 
ATOM   601  C CG  . PRO A 1 80  ? 12.637  1.091  8.941  1.00 38.06  ? 646 PRO A CG  1 
ATOM   602  C CD  . PRO A 1 80  ? 12.602  1.068  10.447 1.00 38.05  ? 646 PRO A CD  1 
ATOM   603  N N   . PHE A 1 81  ? 8.951   0.431  10.861 1.00 30.71  ? 647 PHE A N   1 
ATOM   604  C CA  . PHE A 1 81  ? 7.645   -0.148 11.158 1.00 30.33  ? 647 PHE A CA  1 
ATOM   605  C C   . PHE A 1 81  ? 6.859   0.704  12.148 1.00 32.92  ? 647 PHE A C   1 
ATOM   606  O O   . PHE A 1 81  ? 5.710   0.403  12.476 1.00 38.04  ? 647 PHE A O   1 
ATOM   607  C CB  . PHE A 1 81  ? 7.798   -1.559 11.707 1.00 28.78  ? 647 PHE A CB  1 
ATOM   608  C CG  . PHE A 1 81  ? 8.655   -1.644 12.939 1.00 35.73  ? 647 PHE A CG  1 
ATOM   609  C CD1 . PHE A 1 81  ? 8.174   -1.214 14.169 1.00 34.06  ? 647 PHE A CD1 1 
ATOM   610  C CD2 . PHE A 1 81  ? 9.932   -2.179 12.874 1.00 24.96  ? 647 PHE A CD2 1 
ATOM   611  C CE1 . PHE A 1 81  ? 8.951   -1.308 15.308 1.00 27.36  ? 647 PHE A CE1 1 
ATOM   612  C CE2 . PHE A 1 81  ? 10.718  -2.271 14.022 1.00 29.03  ? 647 PHE A CE2 1 
ATOM   613  C CZ  . PHE A 1 81  ? 10.222  -1.844 15.236 1.00 26.59  ? 647 PHE A CZ  1 
ATOM   614  N N   . THR A 1 82  ? 7.501   1.762  12.626 1.00 33.11  ? 648 THR A N   1 
ATOM   615  C CA  . THR A 1 82  ? 6.916   2.664  13.603 1.00 22.72  ? 648 THR A CA  1 
ATOM   616  C C   . THR A 1 82  ? 5.989   3.642  12.904 1.00 29.66  ? 648 THR A C   1 
ATOM   617  O O   . THR A 1 82  ? 6.287   4.132  11.807 1.00 28.73  ? 648 THR A O   1 
ATOM   618  C CB  . THR A 1 82  ? 8.020   3.461  14.305 1.00 25.48  ? 648 THR A CB  1 
ATOM   619  O OG1 . THR A 1 82  ? 8.860   2.554  15.010 1.00 27.49  ? 648 THR A OG1 1 
ATOM   620  C CG2 . THR A 1 82  ? 7.439   4.496  15.276 1.00 24.10  ? 648 THR A CG2 1 
ATOM   621  N N   . LEU A 1 83  ? 4.863   3.927  13.544 1.00 30.28  ? 649 LEU A N   1 
ATOM   622  C CA  . LEU A 1 83  ? 3.925   4.915  13.028 1.00 31.53  ? 649 LEU A CA  1 
ATOM   623  C C   . LEU A 1 83  ? 4.362   6.303  13.472 1.00 32.20  ? 649 LEU A C   1 
ATOM   624  O O   . LEU A 1 83  ? 4.568   6.552  14.668 1.00 32.87  ? 649 LEU A O   1 
ATOM   625  C CB  . LEU A 1 83  ? 2.505   4.630  13.524 1.00 27.28  ? 649 LEU A CB  1 
ATOM   626  C CG  . LEU A 1 83  ? 1.422   5.656  13.172 1.00 39.04  ? 649 LEU A CG  1 
ATOM   627  C CD1 . LEU A 1 83  ? 1.101   5.589  11.672 1.00 46.34  ? 649 LEU A CD1 1 
ATOM   628  C CD2 . LEU A 1 83  ? 0.160   5.425  13.992 1.00 40.30  ? 649 LEU A CD2 1 
ATOM   629  N N   . VAL A 1 84  ? 4.533   7.194  12.501 1.00 31.21  ? 650 VAL A N   1 
ATOM   630  C CA  . VAL A 1 84  ? 4.762   8.608  12.776 1.00 24.40  ? 650 VAL A CA  1 
ATOM   631  C C   . VAL A 1 84  ? 3.825   9.377  11.863 1.00 33.42  ? 650 VAL A C   1 
ATOM   632  O O   . VAL A 1 84  ? 3.979   9.338  10.646 1.00 42.18  ? 650 VAL A O   1 
ATOM   633  C CB  . VAL A 1 84  ? 6.220   9.023  12.472 1.00 26.21  ? 650 VAL A CB  1 
ATOM   634  C CG1 . VAL A 1 84  ? 6.450   10.499 12.825 1.00 30.83  ? 650 VAL A CG1 1 
ATOM   635  C CG2 . VAL A 1 84  ? 7.223   8.125  13.225 1.00 26.64  ? 650 VAL A CG2 1 
ATOM   636  N N   . ALA A 1 85  ? 2.865   10.091 12.440 1.00 35.66  ? 651 ALA A N   1 
ATOM   637  C CA  . ALA A 1 85  ? 1.843   10.748 11.627 1.00 43.01  ? 651 ALA A CA  1 
ATOM   638  C C   . ALA A 1 85  ? 1.593   12.188 12.055 1.00 53.16  ? 651 ALA A C   1 
ATOM   639  O O   . ALA A 1 85  ? 1.705   12.528 13.240 1.00 49.18  ? 651 ALA A O   1 
ATOM   640  C CB  . ALA A 1 85  ? 0.531   9.943  11.636 1.00 38.82  ? 651 ALA A CB  1 
ATOM   641  N N   . ASP A 1 86  ? 1.271   13.031 11.077 1.00 58.12  ? 652 ASP A N   1 
ATOM   642  C CA  . ASP A 1 86  ? 0.879   14.404 11.353 1.00 70.17  ? 652 ASP A CA  1 
ATOM   643  C C   . ASP A 1 86  ? -0.443  14.412 12.099 1.00 72.18  ? 652 ASP A C   1 
ATOM   644  O O   . ASP A 1 86  ? -1.403  13.748 11.701 1.00 68.77  ? 652 ASP A O   1 
ATOM   645  C CB  . ASP A 1 86  ? 0.736   15.206 10.060 1.00 79.96  ? 652 ASP A CB  1 
ATOM   646  C CG  . ASP A 1 86  ? 2.041   15.353 9.321  1.00 87.68  ? 652 ASP A CG  1 
ATOM   647  O OD1 . ASP A 1 86  ? 3.097   15.419 9.983  1.00 90.73  ? 652 ASP A OD1 1 
ATOM   648  O OD2 . ASP A 1 86  ? 2.012   15.400 8.076  1.00 93.88  ? 652 ASP A OD2 1 
ATOM   649  N N   . VAL A 1 87  ? -0.482  15.153 13.194 1.00 70.18  ? 653 VAL A N   1 
ATOM   650  C CA  . VAL A 1 87  ? -1.726  15.387 13.880 1.00 71.50  ? 653 VAL A CA  1 
ATOM   651  C C   . VAL A 1 87  ? -2.234  16.687 13.293 1.00 81.24  ? 653 VAL A C   1 
ATOM   652  O O   . VAL A 1 87  ? -1.448  17.589 12.997 1.00 81.09  ? 653 VAL A O   1 
ATOM   653  C CB  . VAL A 1 87  ? -1.514  15.515 15.387 1.00 77.18  ? 653 VAL A CB  1 
ATOM   654  C CG1 . VAL A 1 87  ? -2.830  15.827 16.082 1.00 91.40  ? 653 VAL A CG1 1 
ATOM   655  C CG2 . VAL A 1 87  ? -0.903  14.233 15.932 1.00 73.41  ? 653 VAL A CG2 1 
ATOM   656  N N   . ASN A 1 88  ? -3.542  16.789 13.118 1.00 84.56  ? 654 ASN A N   1 
ATOM   657  C CA  . ASN A 1 88  ? -4.096  17.913 12.388 1.00 104.10 ? 654 ASN A CA  1 
ATOM   658  C C   . ASN A 1 88  ? -3.788  19.240 13.086 1.00 126.41 ? 654 ASN A C   1 
ATOM   659  O O   . ASN A 1 88  ? -3.493  19.273 14.282 1.00 131.33 ? 654 ASN A O   1 
ATOM   660  C CB  . ASN A 1 88  ? -5.605  17.737 12.198 1.00 104.49 ? 654 ASN A CB  1 
ATOM   661  C CG  . ASN A 1 88  ? -6.346  17.529 13.512 1.00 101.44 ? 654 ASN A CG  1 
ATOM   662  O OD1 . ASN A 1 88  ? -5.775  17.671 14.598 1.00 87.88  ? 654 ASN A OD1 1 
ATOM   663  N ND2 . ASN A 1 88  ? -7.633  17.199 13.414 1.00 109.03 ? 654 ASN A ND2 1 
ATOM   664  N N   . ALA A 1 89  ? -3.829  20.326 12.320 1.00 135.55 ? 655 ALA A N   1 
ATOM   665  C CA  . ALA A 1 89  ? -3.573  21.663 12.846 1.00 141.66 ? 655 ALA A CA  1 
ATOM   666  C C   . ALA A 1 89  ? -4.733  22.056 13.753 1.00 148.71 ? 655 ALA A C   1 
ATOM   667  O O   . ALA A 1 89  ? -4.735  23.119 14.377 1.00 151.50 ? 655 ALA A O   1 
ATOM   668  C CB  . ALA A 1 89  ? -3.409  22.656 11.719 1.00 143.46 ? 655 ALA A CB  1 
ATOM   669  N N   . ASP A 1 90  ? -5.720  21.169 13.804 1.00 152.03 ? 656 ASP A N   1 
ATOM   670  C CA  . ASP A 1 90  ? -6.910  21.326 14.624 1.00 160.56 ? 656 ASP A CA  1 
ATOM   671  C C   . ASP A 1 90  ? -6.567  20.926 16.057 1.00 155.93 ? 656 ASP A C   1 
ATOM   672  O O   . ASP A 1 90  ? -7.402  20.993 16.961 1.00 158.34 ? 656 ASP A O   1 
ATOM   673  C CB  . ASP A 1 90  ? -8.010  20.420 14.065 1.00 165.15 ? 656 ASP A CB  1 
ATOM   674  C CG  . ASP A 1 90  ? -9.310  20.522 14.833 1.00 172.86 ? 656 ASP A CG  1 
ATOM   675  O OD1 . ASP A 1 90  ? -9.463  21.462 15.640 1.00 178.14 ? 656 ASP A OD1 1 
ATOM   676  O OD2 . ASP A 1 90  ? -10.187 19.660 14.613 1.00 173.08 ? 656 ASP A OD2 1 
ATOM   677  N N   . ARG A 1 91  ? -5.318  20.518 16.252 1.00 169.79 ? 657 ARG A N   1 
ATOM   678  C CA  . ARG A 1 91  ? -4.834  20.073 17.552 1.00 162.03 ? 657 ARG A CA  1 
ATOM   679  C C   . ARG A 1 91  ? -4.602  21.241 18.519 1.00 154.16 ? 657 ARG A C   1 
ATOM   680  O O   . ARG A 1 91  ? -5.325  21.388 19.506 1.00 152.34 ? 657 ARG A O   1 
ATOM   681  C CB  . ARG A 1 91  ? -3.544  19.265 17.372 1.00 156.25 ? 657 ARG A CB  1 
ATOM   682  C CG  . ARG A 1 91  ? -2.958  18.725 18.656 1.00 151.12 ? 657 ARG A CG  1 
ATOM   683  C CD  . ARG A 1 91  ? -3.918  17.785 19.353 1.00 154.14 ? 657 ARG A CD  1 
ATOM   684  N NE  . ARG A 1 91  ? -3.381  17.342 20.635 1.00 155.25 ? 657 ARG A NE  1 
ATOM   685  C CZ  . ARG A 1 91  ? -3.531  18.004 21.777 1.00 157.34 ? 657 ARG A CZ  1 
ATOM   686  N NH1 . ARG A 1 91  ? -3.002  17.526 22.896 1.00 158.69 ? 657 ARG A NH1 1 
ATOM   687  N NH2 . ARG A 1 91  ? -4.208  19.145 21.803 1.00 156.12 ? 657 ARG A NH2 1 
ATOM   688  N N   . ASN A 1 92  ? -3.603  22.070 18.225 1.00 147.96 ? 658 ASN A N   1 
ATOM   689  C CA  . ASN A 1 92  ? -3.245  23.190 19.097 1.00 140.07 ? 658 ASN A CA  1 
ATOM   690  C C   . ASN A 1 92  ? -2.902  22.745 20.517 1.00 125.70 ? 658 ASN A C   1 
ATOM   691  O O   . ASN A 1 92  ? -3.637  23.028 21.467 1.00 123.33 ? 658 ASN A O   1 
ATOM   692  C CB  . ASN A 1 92  ? -4.359  24.242 19.125 1.00 146.80 ? 658 ASN A CB  1 
ATOM   693  C CG  . ASN A 1 92  ? -4.267  25.226 17.970 1.00 151.23 ? 658 ASN A CG  1 
ATOM   694  O OD1 . ASN A 1 92  ? -5.077  25.193 17.044 1.00 156.91 ? 658 ASN A OD1 1 
ATOM   695  N ND2 . ASN A 1 92  ? -3.280  26.115 18.027 1.00 148.38 ? 658 ASN A ND2 1 
ATOM   696  N N   . MET A 1 93  ? -1.778  22.049 20.653 1.00 115.51 ? 659 MET A N   1 
ATOM   697  C CA  . MET A 1 93  ? -1.362  21.512 21.945 1.00 109.14 ? 659 MET A CA  1 
ATOM   698  C C   . MET A 1 93  ? -0.787  22.607 22.835 1.00 101.36 ? 659 MET A C   1 
ATOM   699  O O   . MET A 1 93  ? -0.134  23.535 22.350 1.00 95.03  ? 659 MET A O   1 
ATOM   700  C CB  . MET A 1 93  ? -0.333  20.391 21.755 1.00 104.49 ? 659 MET A CB  1 
ATOM   701  C CG  . MET A 1 93  ? -0.367  19.328 22.846 1.00 101.28 ? 659 MET A CG  1 
ATOM   702  S SD  . MET A 1 93  ? 0.844   18.019 22.597 1.00 95.87  ? 659 MET A SD  1 
ATOM   703  C CE  . MET A 1 93  ? 0.574   17.646 20.871 1.00 101.08 ? 659 MET A CE  1 
ATOM   704  N N   . GLU A 1 94  ? -1.030  22.502 24.138 1.00 99.08  ? 660 GLU A N   1 
ATOM   705  C CA  . GLU A 1 94  ? -0.486  23.479 25.068 1.00 101.10 ? 660 GLU A CA  1 
ATOM   706  C C   . GLU A 1 94  ? 0.802   22.949 25.666 1.00 99.14  ? 660 GLU A C   1 
ATOM   707  O O   . GLU A 1 94  ? 0.791   22.030 26.489 1.00 104.83 ? 660 GLU A O   1 
ATOM   708  C CB  . GLU A 1 94  ? -1.493  23.768 26.178 1.00 106.03 ? 660 GLU A CB  1 
ATOM   709  C CG  . GLU A 1 94  ? -2.778  24.395 25.680 1.00 109.44 ? 660 GLU A CG  1 
ATOM   710  C CD  . GLU A 1 94  ? -3.844  24.449 26.748 1.00 106.91 ? 660 GLU A CD  1 
ATOM   711  O OE1 . GLU A 1 94  ? -3.499  24.291 27.937 1.00 107.47 ? 660 GLU A OE1 1 
ATOM   712  O OE2 . GLU A 1 94  ? -5.025  24.635 26.396 1.00 100.67 ? 660 GLU A OE2 1 
ATOM   713  N N   . ILE A 1 95  ? 1.911   23.560 25.269 1.00 90.55  ? 661 ILE A N   1 
ATOM   714  C CA  . ILE A 1 95  ? 3.220   23.095 25.688 1.00 99.85  ? 661 ILE A CA  1 
ATOM   715  C C   . ILE A 1 95  ? 3.893   24.147 26.555 1.00 102.73 ? 661 ILE A C   1 
ATOM   716  O O   . ILE A 1 95  ? 4.334   25.180 26.053 1.00 101.97 ? 661 ILE A O   1 
ATOM   717  C CB  . ILE A 1 95  ? 4.106   22.766 24.465 1.00 108.90 ? 661 ILE A CB  1 
ATOM   718  C CG1 . ILE A 1 95  ? 5.421   22.128 24.912 1.00 104.87 ? 661 ILE A CG1 1 
ATOM   719  C CG2 . ILE A 1 95  ? 4.332   24.012 23.601 1.00 113.62 ? 661 ILE A CG2 1 
ATOM   720  C CD1 . ILE A 1 95  ? 5.225   20.846 25.684 1.00 104.88 ? 661 ILE A CD1 1 
ATOM   721  N N   . PRO A 1 96  ? 3.985   23.882 27.867 1.00 86.27  ? 662 PRO A N   1 
ATOM   722  C CA  . PRO A 1 96  ? 4.516   24.887 28.800 1.00 77.18  ? 662 PRO A CA  1 
ATOM   723  C C   . PRO A 1 96  ? 5.965   25.258 28.474 1.00 79.35  ? 662 PRO A C   1 
ATOM   724  O O   . PRO A 1 96  ? 6.768   24.379 28.149 1.00 78.39  ? 662 PRO A O   1 
ATOM   725  C CB  . PRO A 1 96  ? 4.430   24.187 30.161 1.00 70.45  ? 662 PRO A CB  1 
ATOM   726  C CG  . PRO A 1 96  ? 3.425   23.089 29.972 1.00 71.67  ? 662 PRO A CG  1 
ATOM   727  C CD  . PRO A 1 96  ? 3.566   22.647 28.551 1.00 67.81  ? 662 PRO A CD  1 
ATOM   728  N N   . ALA A 1 97  ? 6.286   26.546 28.559 1.00 75.32  ? 663 ALA A N   1 
ATOM   729  C CA  . ALA A 1 97  ? 7.639   27.023 28.287 1.00 72.84  ? 663 ALA A CA  1 
ATOM   730  C C   . ALA A 1 97  ? 8.661   26.451 29.269 1.00 73.38  ? 663 ALA A C   1 
ATOM   731  O O   . ALA A 1 97  ? 9.825   26.261 28.914 1.00 79.75  ? 663 ALA A O   1 
ATOM   732  C CB  . ALA A 1 97  ? 7.682   28.550 28.299 1.00 80.53  ? 663 ALA A CB  1 
ATOM   733  N N   . GLY A 1 98  ? 8.220   26.178 30.497 1.00 70.20  ? 664 GLY A N   1 
ATOM   734  C CA  . GLY A 1 98  ? 9.078   25.610 31.525 1.00 65.84  ? 664 GLY A CA  1 
ATOM   735  C C   . GLY A 1 98  ? 9.523   24.194 31.210 1.00 74.16  ? 664 GLY A C   1 
ATOM   736  O O   . GLY A 1 98  ? 10.697  23.846 31.369 1.00 72.23  ? 664 GLY A O   1 
ATOM   737  N N   . LEU A 1 99  ? 8.578   23.371 30.762 1.00 80.08  ? 665 LEU A N   1 
ATOM   738  C CA  . LEU A 1 99  ? 8.874   22.001 30.356 1.00 72.57  ? 665 LEU A CA  1 
ATOM   739  C C   . LEU A 1 99  ? 9.849   22.004 29.189 1.00 69.40  ? 665 LEU A C   1 
ATOM   740  O O   . LEU A 1 99  ? 10.844  21.276 29.193 1.00 64.74  ? 665 LEU A O   1 
ATOM   741  C CB  . LEU A 1 99  ? 7.595   21.283 29.949 1.00 69.72  ? 665 LEU A CB  1 
ATOM   742  C CG  . LEU A 1 99  ? 7.712   19.806 29.585 1.00 74.53  ? 665 LEU A CG  1 
ATOM   743  C CD1 . LEU A 1 99  ? 8.062   18.975 30.810 1.00 71.11  ? 665 LEU A CD1 1 
ATOM   744  C CD2 . LEU A 1 99  ? 6.401   19.332 28.969 1.00 78.43  ? 665 LEU A CD2 1 
ATOM   745  N N   . ILE A 1 100 ? 9.557   22.833 28.192 1.00 69.21  ? 666 ILE A N   1 
ATOM   746  C CA  . ILE A 1 100 ? 10.452  23.007 27.053 1.00 74.01  ? 666 ILE A CA  1 
ATOM   747  C C   . ILE A 1 100 ? 11.857  23.396 27.515 1.00 72.92  ? 666 ILE A C   1 
ATOM   748  O O   . ILE A 1 100 ? 12.855  22.999 26.909 1.00 72.80  ? 666 ILE A O   1 
ATOM   749  C CB  . ILE A 1 100 ? 9.907   24.066 26.069 1.00 81.03  ? 666 ILE A CB  1 
ATOM   750  C CG1 . ILE A 1 100 ? 8.628   23.555 25.393 1.00 79.75  ? 666 ILE A CG1 1 
ATOM   751  C CG2 . ILE A 1 100 ? 10.964  24.425 25.032 1.00 84.74  ? 666 ILE A CG2 1 
ATOM   752  C CD1 . ILE A 1 100 ? 8.010   24.514 24.378 1.00 77.99  ? 666 ILE A CD1 1 
ATOM   753  N N   . ALA A 1 101 ? 11.922  24.170 28.596 1.00 73.56  ? 667 ALA A N   1 
ATOM   754  C CA  . ALA A 1 101 ? 13.196  24.579 29.187 1.00 77.97  ? 667 ALA A CA  1 
ATOM   755  C C   . ALA A 1 101 ? 13.882  23.415 29.904 1.00 71.57  ? 667 ALA A C   1 
ATOM   756  O O   . ALA A 1 101 ? 15.103  23.270 29.830 1.00 63.90  ? 667 ALA A O   1 
ATOM   757  C CB  . ALA A 1 101 ? 12.991  25.765 30.145 1.00 75.77  ? 667 ALA A CB  1 
ATOM   758  N N   . SER A 1 102 ? 13.093  22.590 30.592 1.00 69.77  ? 668 SER A N   1 
ATOM   759  C CA  . SER A 1 102 ? 13.615  21.398 31.259 1.00 66.67  ? 668 SER A CA  1 
ATOM   760  C C   . SER A 1 102 ? 14.343  20.477 30.280 1.00 65.02  ? 668 SER A C   1 
ATOM   761  O O   . SER A 1 102 ? 15.230  19.719 30.669 1.00 59.54  ? 668 SER A O   1 
ATOM   762  C CB  . SER A 1 102 ? 12.485  20.610 31.915 1.00 65.85  ? 668 SER A CB  1 
ATOM   763  O OG  . SER A 1 102 ? 12.484  19.267 31.451 1.00 71.01  ? 668 SER A OG  1 
ATOM   764  N N   . ALA A 1 103 ? 13.963  20.542 29.010 1.00 60.76  ? 669 ALA A N   1 
ATOM   765  C CA  . ALA A 1 103 ? 14.581  19.702 27.994 1.00 64.27  ? 669 ALA A CA  1 
ATOM   766  C C   . ALA A 1 103 ? 15.985  20.183 27.626 1.00 66.33  ? 669 ALA A C   1 
ATOM   767  O O   . ALA A 1 103 ? 16.834  19.387 27.224 1.00 71.26  ? 669 ALA A O   1 
ATOM   768  C CB  . ALA A 1 103 ? 13.701  19.639 26.757 1.00 67.19  ? 669 ALA A CB  1 
ATOM   769  N N   . SER A 1 104 ? 16.213  21.489 27.744 1.00 59.60  ? 670 SER A N   1 
ATOM   770  C CA  . SER A 1 104 ? 17.481  22.098 27.345 1.00 64.55  ? 670 SER A CA  1 
ATOM   771  C C   . SER A 1 104 ? 18.495  22.331 28.478 1.00 60.79  ? 670 SER A C   1 
ATOM   772  O O   . SER A 1 104 ? 19.592  22.826 28.236 1.00 62.38  ? 670 SER A O   1 
ATOM   773  C CB  . SER A 1 104 ? 17.235  23.404 26.578 1.00 75.23  ? 670 SER A CB  1 
ATOM   774  O OG  . SER A 1 104 ? 16.518  24.337 27.370 1.00 82.15  ? 670 SER A OG  1 
ATOM   775  N N   . VAL A 1 105 ? 18.137  21.986 29.708 1.00 50.14  ? 671 VAL A N   1 
ATOM   776  C CA  . VAL A 1 105 ? 19.047  22.215 30.824 1.00 44.48  ? 671 VAL A CA  1 
ATOM   777  C C   . VAL A 1 105 ? 20.218  21.234 30.810 1.00 46.14  ? 671 VAL A C   1 
ATOM   778  O O   . VAL A 1 105 ? 20.034  20.030 30.604 1.00 50.03  ? 671 VAL A O   1 
ATOM   779  C CB  . VAL A 1 105 ? 18.330  22.115 32.176 1.00 47.56  ? 671 VAL A CB  1 
ATOM   780  C CG1 . VAL A 1 105 ? 19.303  22.411 33.305 1.00 50.94  ? 671 VAL A CG1 1 
ATOM   781  C CG2 . VAL A 1 105 ? 17.152  23.067 32.220 1.00 54.16  ? 671 VAL A CG2 1 
ATOM   782  N N   . THR A 1 106 ? 21.420  21.758 31.028 1.00 39.30  ? 672 THR A N   1 
ATOM   783  C CA  . THR A 1 106 ? 22.617  20.932 31.092 1.00 33.52  ? 672 THR A CA  1 
ATOM   784  C C   . THR A 1 106 ? 22.933  20.508 32.535 1.00 39.39  ? 672 THR A C   1 
ATOM   785  O O   . THR A 1 106 ? 23.086  21.354 33.415 1.00 43.54  ? 672 THR A O   1 
ATOM   786  C CB  . THR A 1 106 ? 23.831  21.664 30.498 1.00 38.00  ? 672 THR A CB  1 
ATOM   787  O OG1 . THR A 1 106 ? 23.598  21.932 29.112 1.00 38.58  ? 672 THR A OG1 1 
ATOM   788  C CG2 . THR A 1 106 ? 25.095  20.816 30.638 1.00 43.25  ? 672 THR A CG2 1 
ATOM   789  N N   . PRO A 1 107 ? 23.058  19.187 32.767 1.00 38.93  ? 673 PRO A N   1 
ATOM   790  C CA  . PRO A 1 107 ? 23.392  18.609 34.073 1.00 43.78  ? 673 PRO A CA  1 
ATOM   791  C C   . PRO A 1 107 ? 24.690  19.182 34.644 1.00 48.27  ? 673 PRO A C   1 
ATOM   792  O O   . PRO A 1 107 ? 25.576  19.583 33.882 1.00 46.22  ? 673 PRO A O   1 
ATOM   793  C CB  . PRO A 1 107 ? 23.595  17.120 33.759 1.00 48.34  ? 673 PRO A CB  1 
ATOM   794  C CG  . PRO A 1 107 ? 22.851  16.875 32.501 1.00 41.58  ? 673 PRO A CG  1 
ATOM   795  C CD  . PRO A 1 107 ? 22.910  18.152 31.725 1.00 37.97  ? 673 PRO A CD  1 
ATOM   796  N N   . LYS A 1 108 ? 24.788  19.211 35.973 1.00 49.80  ? 674 LYS A N   1 
ATOM   797  C CA  . LYS A 1 108 ? 25.983  19.687 36.656 1.00 40.88  ? 674 LYS A CA  1 
ATOM   798  C C   . LYS A 1 108 ? 27.038  18.592 36.777 1.00 41.99  ? 674 LYS A C   1 
ATOM   799  O O   . LYS A 1 108 ? 26.738  17.454 37.127 1.00 43.47  ? 674 LYS A O   1 
ATOM   800  C CB  . LYS A 1 108 ? 25.628  20.220 38.049 1.00 53.06  ? 674 LYS A CB  1 
ATOM   801  C CG  . LYS A 1 108 ? 24.645  21.378 38.042 1.00 61.39  ? 674 LYS A CG  1 
ATOM   802  C CD  . LYS A 1 108 ? 25.166  22.556 37.225 1.00 64.88  ? 674 LYS A CD  1 
ATOM   803  C CE  . LYS A 1 108 ? 24.125  23.662 37.131 1.00 67.32  ? 674 LYS A CE  1 
ATOM   804  N NZ  . LYS A 1 108 ? 22.801  23.142 36.658 1.00 76.97  ? 674 LYS A NZ  1 
ATOM   805  N N   . ILE A 1 109 ? 28.283  18.964 36.510 1.00 49.67  ? 675 ILE A N   1 
ATOM   806  C CA  . ILE A 1 109 ? 29.404  18.036 36.506 1.00 45.55  ? 675 ILE A CA  1 
ATOM   807  C C   . ILE A 1 109 ? 29.595  17.326 37.848 1.00 48.96  ? 675 ILE A C   1 
ATOM   808  O O   . ILE A 1 109 ? 29.826  16.113 37.895 1.00 46.23  ? 675 ILE A O   1 
ATOM   809  C CB  . ILE A 1 109 ? 30.693  18.769 36.079 1.00 48.12  ? 675 ILE A CB  1 
ATOM   810  C CG1 . ILE A 1 109 ? 30.670  19.021 34.567 1.00 43.35  ? 675 ILE A CG1 1 
ATOM   811  C CG2 . ILE A 1 109 ? 31.930  17.990 36.492 1.00 38.72  ? 675 ILE A CG2 1 
ATOM   812  C CD1 . ILE A 1 109 ? 31.888  19.729 34.048 1.00 48.13  ? 675 ILE A CD1 1 
ATOM   813  N N   . ASN A 1 110 ? 29.483  18.076 38.939 1.00 50.42  ? 676 ASN A N   1 
ATOM   814  C CA  . ASN A 1 110 ? 29.665  17.496 40.265 1.00 52.82  ? 676 ASN A CA  1 
ATOM   815  C C   . ASN A 1 110 ? 28.673  16.370 40.549 1.00 57.60  ? 676 ASN A C   1 
ATOM   816  O O   . ASN A 1 110 ? 28.994  15.413 41.254 1.00 64.02  ? 676 ASN A O   1 
ATOM   817  C CB  . ASN A 1 110 ? 29.626  18.566 41.365 1.00 54.89  ? 676 ASN A CB  1 
ATOM   818  C CG  . ASN A 1 110 ? 28.226  19.079 41.641 1.00 66.49  ? 676 ASN A CG  1 
ATOM   819  O OD1 . ASN A 1 110 ? 27.451  19.336 40.722 1.00 70.66  ? 676 ASN A OD1 1 
ATOM   820  N ND2 . ASN A 1 110 ? 27.895  19.230 42.918 1.00 74.88  ? 676 ASN A ND2 1 
ATOM   821  N N   . GLN A 1 111 ? 27.470  16.480 39.998 1.00 51.85  ? 677 GLN A N   1 
ATOM   822  C CA  . GLN A 1 111 ? 26.502  15.400 40.122 1.00 53.47  ? 677 GLN A CA  1 
ATOM   823  C C   . GLN A 1 111 ? 26.803  14.280 39.136 1.00 53.68  ? 677 GLN A C   1 
ATOM   824  O O   . GLN A 1 111 ? 26.615  13.104 39.443 1.00 60.17  ? 677 GLN A O   1 
ATOM   825  C CB  . GLN A 1 111 ? 25.078  15.915 39.937 1.00 49.25  ? 677 GLN A CB  1 
ATOM   826  C CG  . GLN A 1 111 ? 24.671  16.934 40.979 1.00 60.81  ? 677 GLN A CG  1 
ATOM   827  C CD  . GLN A 1 111 ? 23.193  17.235 40.932 1.00 64.84  ? 677 GLN A CD  1 
ATOM   828  O OE1 . GLN A 1 111 ? 22.712  17.880 40.002 1.00 68.39  ? 677 GLN A OE1 1 
ATOM   829  N NE2 . GLN A 1 111 ? 22.456  16.756 41.932 1.00 65.19  ? 677 GLN A NE2 1 
ATOM   830  N N   . LEU A 1 112 ? 27.271  14.644 37.948 1.00 44.03  ? 678 LEU A N   1 
ATOM   831  C CA  . LEU A 1 112 ? 27.575  13.636 36.951 1.00 43.10  ? 678 LEU A CA  1 
ATOM   832  C C   . LEU A 1 112 ? 28.666  12.701 37.452 1.00 51.65  ? 678 LEU A C   1 
ATOM   833  O O   . LEU A 1 112 ? 28.455  11.496 37.545 1.00 56.38  ? 678 LEU A O   1 
ATOM   834  C CB  . LEU A 1 112 ? 27.994  14.281 35.631 1.00 39.40  ? 678 LEU A CB  1 
ATOM   835  C CG  . LEU A 1 112 ? 26.861  14.969 34.870 1.00 40.53  ? 678 LEU A CG  1 
ATOM   836  C CD1 . LEU A 1 112 ? 27.387  15.598 33.591 1.00 35.53  ? 678 LEU A CD1 1 
ATOM   837  C CD2 . LEU A 1 112 ? 25.744  13.985 34.571 1.00 34.86  ? 678 LEU A CD2 1 
ATOM   838  N N   . CYS A 1 113 ? 29.822  13.256 37.802 1.00 52.91  ? 679 CYS A N   1 
ATOM   839  C CA  . CYS A 1 113 ? 30.993  12.420 38.077 1.00 55.17  ? 679 CYS A CA  1 
ATOM   840  C C   . CYS A 1 113 ? 30.887  11.662 39.407 1.00 58.72  ? 679 CYS A C   1 
ATOM   841  O O   . CYS A 1 113 ? 31.554  10.640 39.608 1.00 54.99  ? 679 CYS A O   1 
ATOM   842  C CB  . CYS A 1 113 ? 32.287  13.242 38.004 1.00 45.61  ? 679 CYS A CB  1 
ATOM   843  S SG  . CYS A 1 113 ? 32.422  14.534 39.245 1.00 68.24  ? 679 CYS A SG  1 
ATOM   844  N N   . SER A 1 114 ? 30.037  12.167 40.297 1.00 59.83  ? 680 SER A N   1 
ATOM   845  C CA  . SER A 1 114 ? 29.769  11.532 41.583 1.00 62.50  ? 680 SER A CA  1 
ATOM   846  C C   . SER A 1 114 ? 28.554  10.615 41.473 1.00 62.89  ? 680 SER A C   1 
ATOM   847  O O   . SER A 1 114 ? 28.079  10.066 42.468 1.00 60.99  ? 680 SER A O   1 
ATOM   848  C CB  . SER A 1 114 ? 29.502  12.588 42.650 1.00 70.91  ? 680 SER A CB  1 
ATOM   849  O OG  . SER A 1 114 ? 28.234  13.184 42.443 1.00 78.36  ? 680 SER A OG  1 
ATOM   850  N N   . GLN A 1 115 ? 28.031  10.492 40.257 1.00 61.80  ? 681 GLN A N   1 
ATOM   851  C CA  . GLN A 1 115 ? 26.897  9.619  39.976 1.00 61.77  ? 681 GLN A CA  1 
ATOM   852  C C   . GLN A 1 115 ? 27.268  8.159  40.246 1.00 65.58  ? 681 GLN A C   1 
ATOM   853  O O   . GLN A 1 115 ? 28.363  7.705  39.897 1.00 70.92  ? 681 GLN A O   1 
ATOM   854  C CB  . GLN A 1 115 ? 26.456  9.811  38.520 1.00 56.23  ? 681 GLN A CB  1 
ATOM   855  C CG  . GLN A 1 115 ? 25.105  9.232  38.163 1.00 60.45  ? 681 GLN A CG  1 
ATOM   856  C CD  . GLN A 1 115 ? 24.628  9.664  36.781 1.00 56.55  ? 681 GLN A CD  1 
ATOM   857  O OE1 . GLN A 1 115 ? 24.239  8.835  35.960 1.00 62.91  ? 681 GLN A OE1 1 
ATOM   858  N NE2 . GLN A 1 115 ? 24.651  10.967 36.526 1.00 46.64  ? 681 GLN A NE2 1 
ATOM   859  N N   . THR A 1 116 ? 26.377  7.437  40.914 1.00 64.29  ? 682 THR A N   1 
ATOM   860  C CA  . THR A 1 116 ? 26.638  6.038  41.249 1.00 70.09  ? 682 THR A CA  1 
ATOM   861  C C   . THR A 1 116 ? 26.007  5.014  40.294 1.00 67.12  ? 682 THR A C   1 
ATOM   862  O O   . THR A 1 116 ? 26.210  3.809  40.441 1.00 70.40  ? 682 THR A O   1 
ATOM   863  C CB  . THR A 1 116 ? 26.205  5.722  42.689 1.00 78.22  ? 682 THR A CB  1 
ATOM   864  O OG1 . THR A 1 116 ? 26.835  4.510  43.118 1.00 91.67  ? 682 THR A OG1 1 
ATOM   865  C CG2 . THR A 1 116 ? 24.691  5.579  42.777 1.00 77.20  ? 682 THR A CG2 1 
ATOM   866  N N   . LYS A 1 117 ? 25.245  5.490  39.320 1.00 63.83  ? 683 LYS A N   1 
ATOM   867  C CA  . LYS A 1 117 ? 24.575  4.592  38.388 1.00 68.80  ? 683 LYS A CA  1 
ATOM   868  C C   . LYS A 1 117 ? 24.746  5.116  36.966 1.00 62.74  ? 683 LYS A C   1 
ATOM   869  O O   . LYS A 1 117 ? 24.852  6.326  36.747 1.00 59.11  ? 683 LYS A O   1 
ATOM   870  C CB  . LYS A 1 117 ? 23.088  4.468  38.730 1.00 79.32  ? 683 LYS A CB  1 
ATOM   871  C CG  . LYS A 1 117 ? 22.282  5.703  38.355 1.00 89.95  ? 683 LYS A CG  1 
ATOM   872  C CD  . LYS A 1 117 ? 20.785  5.498  38.516 1.00 98.18  ? 683 LYS A CD  1 
ATOM   873  C CE  . LYS A 1 117 ? 20.013  6.459  37.618 1.00 98.06  ? 683 LYS A CE  1 
ATOM   874  N NZ  . LYS A 1 117 ? 20.472  7.872  37.760 1.00 95.33  ? 683 LYS A NZ  1 
ATOM   875  N N   . GLY A 1 118 ? 24.782  4.205  36.001 1.00 57.92  ? 684 GLY A N   1 
ATOM   876  C CA  . GLY A 1 118 ? 24.935  4.598  34.613 1.00 51.56  ? 684 GLY A CA  1 
ATOM   877  C C   . GLY A 1 118 ? 23.652  5.183  34.041 1.00 59.15  ? 684 GLY A C   1 
ATOM   878  O O   . GLY A 1 118 ? 22.544  4.843  34.462 1.00 67.94  ? 684 GLY A O   1 
ATOM   879  N N   . SER A 1 119 ? 23.806  6.071  33.072 1.00 46.42  ? 685 SER A N   1 
ATOM   880  C CA  . SER A 1 119 ? 22.667  6.697  32.419 1.00 48.88  ? 685 SER A CA  1 
ATOM   881  C C   . SER A 1 119 ? 23.167  7.344  31.134 1.00 41.75  ? 685 SER A C   1 
ATOM   882  O O   . SER A 1 119 ? 24.367  7.311  30.839 1.00 39.60  ? 685 SER A O   1 
ATOM   883  C CB  . SER A 1 119 ? 22.051  7.764  33.329 1.00 48.07  ? 685 SER A CB  1 
ATOM   884  O OG  . SER A 1 119 ? 22.920  8.881  33.437 1.00 46.15  ? 685 SER A OG  1 
ATOM   885  N N   . PHE A 1 120 ? 22.259  7.947  30.378 1.00 40.69  ? 686 PHE A N   1 
ATOM   886  C CA  . PHE A 1 120 ? 22.642  8.596  29.131 1.00 35.25  ? 686 PHE A CA  1 
ATOM   887  C C   . PHE A 1 120 ? 22.314  10.078 29.182 1.00 42.60  ? 686 PHE A C   1 
ATOM   888  O O   . PHE A 1 120 ? 21.206  10.473 29.548 1.00 46.37  ? 686 PHE A O   1 
ATOM   889  C CB  . PHE A 1 120 ? 22.008  7.884  27.940 1.00 35.73  ? 686 PHE A CB  1 
ATOM   890  C CG  . PHE A 1 120 ? 22.435  6.445  27.816 1.00 44.38  ? 686 PHE A CG  1 
ATOM   891  C CD1 . PHE A 1 120 ? 21.716  5.436  28.442 1.00 39.56  ? 686 PHE A CD1 1 
ATOM   892  C CD2 . PHE A 1 120 ? 23.578  6.106  27.103 1.00 43.42  ? 686 PHE A CD2 1 
ATOM   893  C CE1 . PHE A 1 120 ? 22.115  4.109  28.345 1.00 43.08  ? 686 PHE A CE1 1 
ATOM   894  C CE2 . PHE A 1 120 ? 23.986  4.776  27.000 1.00 40.06  ? 686 PHE A CE2 1 
ATOM   895  C CZ  . PHE A 1 120 ? 23.255  3.777  27.621 1.00 44.20  ? 686 PHE A CZ  1 
ATOM   896  N N   . VAL A 1 121 ? 23.302  10.884 28.807 1.00 35.61  ? 687 VAL A N   1 
ATOM   897  C CA  . VAL A 1 121 ? 23.313  12.314 29.082 1.00 32.33  ? 687 VAL A CA  1 
ATOM   898  C C   . VAL A 1 121 ? 23.387  13.150 27.806 1.00 35.33  ? 687 VAL A C   1 
ATOM   899  O O   . VAL A 1 121 ? 24.084  12.787 26.852 1.00 36.83  ? 687 VAL A O   1 
ATOM   900  C CB  . VAL A 1 121 ? 24.534  12.669 30.008 1.00 36.67  ? 687 VAL A CB  1 
ATOM   901  C CG1 . VAL A 1 121 ? 24.791  14.181 30.064 1.00 32.58  ? 687 VAL A CG1 1 
ATOM   902  C CG2 . VAL A 1 121 ? 24.341  12.082 31.418 1.00 34.52  ? 687 VAL A CG2 1 
ATOM   903  N N   . ASN A 1 122 ? 22.634  14.252 27.804 1.00 39.91  ? 688 ASN A N   1 
ATOM   904  C CA  . ASN A 1 122 ? 22.741  15.349 26.839 1.00 32.59  ? 688 ASN A CA  1 
ATOM   905  C C   . ASN A 1 122 ? 23.210  16.595 27.586 1.00 42.75  ? 688 ASN A C   1 
ATOM   906  O O   . ASN A 1 122 ? 22.799  16.819 28.725 1.00 48.87  ? 688 ASN A O   1 
ATOM   907  C CB  . ASN A 1 122 ? 21.370  15.693 26.246 1.00 32.63  ? 688 ASN A CB  1 
ATOM   908  C CG  . ASN A 1 122 ? 20.821  14.619 25.303 1.00 44.79  ? 688 ASN A CG  1 
ATOM   909  O OD1 . ASN A 1 122 ? 21.403  13.545 25.128 1.00 44.55  ? 688 ASN A OD1 1 
ATOM   910  N ND2 . ASN A 1 122 ? 19.670  14.916 24.697 1.00 45.23  ? 688 ASN A ND2 1 
ATOM   911  N N   . GLY A 1 123 ? 24.042  17.422 26.961 1.00 32.87  ? 689 GLY A N   1 
ATOM   912  C CA  . GLY A 1 123 ? 24.377  18.700 27.560 1.00 34.01  ? 689 GLY A CA  1 
ATOM   913  C C   . GLY A 1 123 ? 25.358  19.504 26.728 1.00 35.50  ? 689 GLY A C   1 
ATOM   914  O O   . GLY A 1 123 ? 25.933  18.985 25.772 1.00 36.93  ? 689 GLY A O   1 
ATOM   915  N N   . VAL A 1 124 ? 25.533  20.772 27.088 1.00 29.20  ? 690 VAL A N   1 
ATOM   916  C CA  . VAL A 1 124 ? 26.532  21.640 26.473 1.00 32.52  ? 690 VAL A CA  1 
ATOM   917  C C   . VAL A 1 124 ? 27.653  21.896 27.485 1.00 47.70  ? 690 VAL A C   1 
ATOM   918  O O   . VAL A 1 124 ? 27.412  22.494 28.542 1.00 49.18  ? 690 VAL A O   1 
ATOM   919  C CB  . VAL A 1 124 ? 25.915  22.995 26.116 1.00 34.32  ? 690 VAL A CB  1 
ATOM   920  C CG1 . VAL A 1 124 ? 26.968  23.936 25.530 1.00 34.81  ? 690 VAL A CG1 1 
ATOM   921  C CG2 . VAL A 1 124 ? 24.735  22.814 25.175 1.00 35.69  ? 690 VAL A CG2 1 
ATOM   922  N N   . PHE A 1 125 ? 28.870  21.459 27.173 1.00 39.47  ? 691 PHE A N   1 
ATOM   923  C CA  . PHE A 1 125 ? 29.973  21.562 28.135 1.00 37.93  ? 691 PHE A CA  1 
ATOM   924  C C   . PHE A 1 125 ? 31.193  22.264 27.551 1.00 39.75  ? 691 PHE A C   1 
ATOM   925  O O   . PHE A 1 125 ? 31.649  21.930 26.452 1.00 37.13  ? 691 PHE A O   1 
ATOM   926  C CB  . PHE A 1 125 ? 30.373  20.169 28.642 1.00 37.07  ? 691 PHE A CB  1 
ATOM   927  C CG  . PHE A 1 125 ? 29.244  19.412 29.305 1.00 40.89  ? 691 PHE A CG  1 
ATOM   928  C CD1 . PHE A 1 125 ? 28.405  18.590 28.561 1.00 32.88  ? 691 PHE A CD1 1 
ATOM   929  C CD2 . PHE A 1 125 ? 29.018  19.530 30.672 1.00 41.07  ? 691 PHE A CD2 1 
ATOM   930  C CE1 . PHE A 1 125 ? 27.367  17.894 29.168 1.00 35.01  ? 691 PHE A CE1 1 
ATOM   931  C CE2 . PHE A 1 125 ? 27.982  18.842 31.282 1.00 36.13  ? 691 PHE A CE2 1 
ATOM   932  C CZ  . PHE A 1 125 ? 27.156  18.019 30.527 1.00 38.53  ? 691 PHE A CZ  1 
ATOM   933  N N   . GLU A 1 126 ? 31.732  23.228 28.287 1.00 41.43  ? 692 GLU A N   1 
ATOM   934  C CA  . GLU A 1 126 ? 32.945  23.901 27.837 1.00 45.30  ? 692 GLU A CA  1 
ATOM   935  C C   . GLU A 1 126 ? 34.196  23.046 28.074 1.00 46.36  ? 692 GLU A C   1 
ATOM   936  O O   . GLU A 1 126 ? 34.355  22.418 29.124 1.00 41.52  ? 692 GLU A O   1 
ATOM   937  C CB  . GLU A 1 126 ? 33.104  25.271 28.488 1.00 51.52  ? 692 GLU A CB  1 
ATOM   938  C CG  . GLU A 1 126 ? 34.230  26.082 27.872 1.00 56.81  ? 692 GLU A CG  1 
ATOM   939  C CD  . GLU A 1 126 ? 34.432  27.417 28.554 1.00 65.10  ? 692 GLU A CD  1 
ATOM   940  O OE1 . GLU A 1 126 ? 35.406  28.116 28.201 1.00 78.45  ? 692 GLU A OE1 1 
ATOM   941  O OE2 . GLU A 1 126 ? 33.627  27.766 29.443 1.00 56.23  ? 692 GLU A OE2 1 
ATOM   942  N N   . VAL A 1 127 ? 35.082  23.040 27.084 1.00 40.87  ? 693 VAL A N   1 
ATOM   943  C CA  . VAL A 1 127 ? 36.294  22.234 27.123 1.00 40.54  ? 693 VAL A CA  1 
ATOM   944  C C   . VAL A 1 127 ? 37.431  23.027 27.749 1.00 45.67  ? 693 VAL A C   1 
ATOM   945  O O   . VAL A 1 127 ? 37.827  24.064 27.226 1.00 44.68  ? 693 VAL A O   1 
ATOM   946  C CB  . VAL A 1 127 ? 36.698  21.825 25.695 1.00 38.19  ? 693 VAL A CB  1 
ATOM   947  C CG1 . VAL A 1 127 ? 38.093  21.145 25.672 1.00 32.21  ? 693 VAL A CG1 1 
ATOM   948  C CG2 . VAL A 1 127 ? 35.624  20.929 25.094 1.00 26.49  ? 693 VAL A CG2 1 
ATOM   949  N N   . HIS A 1 128 ? 37.911  22.565 28.900 1.00 58.97  ? 694 HIS A N   1 
ATOM   950  C CA  . HIS A 1 128 ? 39.082  23.157 29.555 1.00 61.02  ? 694 HIS A CA  1 
ATOM   951  C C   . HIS A 1 128 ? 40.420  22.654 28.994 1.00 57.40  ? 694 HIS A C   1 
ATOM   952  O O   . HIS A 1 128 ? 41.356  23.437 28.809 1.00 55.02  ? 694 HIS A O   1 
ATOM   953  C CB  . HIS A 1 128 ? 39.024  22.950 31.073 1.00 66.39  ? 694 HIS A CB  1 
ATOM   954  C CG  . HIS A 1 128 ? 40.143  23.614 31.815 1.00 81.58  ? 694 HIS A CG  1 
ATOM   955  N ND1 . HIS A 1 128 ? 41.126  22.905 32.469 1.00 88.73  ? 694 HIS A ND1 1 
ATOM   956  C CD2 . HIS A 1 128 ? 40.439  24.924 31.995 1.00 90.22  ? 694 HIS A CD2 1 
ATOM   957  C CE1 . HIS A 1 128 ? 41.981  23.749 33.023 1.00 91.72  ? 694 HIS A CE1 1 
ATOM   958  N NE2 . HIS A 1 128 ? 41.586  24.979 32.751 1.00 93.01  ? 694 HIS A NE2 1 
ATOM   959  N N   . LYS A 1 129 ? 40.495  21.344 28.749 1.00 50.33  ? 695 LYS A N   1 
ATOM   960  C CA  . LYS A 1 129 ? 41.688  20.686 28.202 1.00 41.61  ? 695 LYS A CA  1 
ATOM   961  C C   . LYS A 1 129 ? 41.285  19.608 27.198 1.00 36.31  ? 695 LYS A C   1 
ATOM   962  O O   . LYS A 1 129 ? 40.170  19.073 27.243 1.00 33.67  ? 695 LYS A O   1 
ATOM   963  C CB  . LYS A 1 129 ? 42.512  19.994 29.295 1.00 44.79  ? 695 LYS A CB  1 
ATOM   964  C CG  . LYS A 1 129 ? 43.170  20.889 30.316 1.00 65.64  ? 695 LYS A CG  1 
ATOM   965  C CD  . LYS A 1 129 ? 44.182  20.083 31.132 1.00 76.96  ? 695 LYS A CD  1 
ATOM   966  C CE  . LYS A 1 129 ? 44.976  20.965 32.087 1.00 86.11  ? 695 LYS A CE  1 
ATOM   967  N NZ  . LYS A 1 129 ? 46.157  20.257 32.668 1.00 88.89  ? 695 LYS A NZ  1 
ATOM   968  N N   . LYS A 1 130 ? 42.218  19.273 26.317 1.00 39.41  ? 696 LYS A N   1 
ATOM   969  C CA  . LYS A 1 130 ? 42.042  18.203 25.345 1.00 39.19  ? 696 LYS A CA  1 
ATOM   970  C C   . LYS A 1 130 ? 43.316  17.351 25.313 1.00 40.48  ? 696 LYS A C   1 
ATOM   971  O O   . LYS A 1 130 ? 44.413  17.872 25.117 1.00 42.66  ? 696 LYS A O   1 
ATOM   972  C CB  . LYS A 1 130 ? 41.787  18.808 23.974 1.00 33.74  ? 696 LYS A CB  1 
ATOM   973  C CG  . LYS A 1 130 ? 41.751  17.801 22.839 1.00 35.82  ? 696 LYS A CG  1 
ATOM   974  C CD  . LYS A 1 130 ? 42.051  18.507 21.528 1.00 39.06  ? 696 LYS A CD  1 
ATOM   975  C CE  . LYS A 1 130 ? 41.552  17.715 20.342 1.00 38.34  ? 696 LYS A CE  1 
ATOM   976  N NZ  . LYS A 1 130 ? 41.929  18.382 19.069 1.00 39.41  ? 696 LYS A NZ  1 
ATOM   977  N N   . ASN A 1 131 ? 43.187  16.050 25.535 1.00 34.05  ? 697 ASN A N   1 
ATOM   978  C CA  . ASN A 1 131 ? 44.358  15.173 25.472 1.00 32.68  ? 697 ASN A CA  1 
ATOM   979  C C   . ASN A 1 131 ? 44.094  13.993 24.559 1.00 29.13  ? 697 ASN A C   1 
ATOM   980  O O   . ASN A 1 131 ? 43.244  13.160 24.851 1.00 30.74  ? 697 ASN A O   1 
ATOM   981  C CB  . ASN A 1 131 ? 44.763  14.684 26.874 1.00 39.49  ? 697 ASN A CB  1 
ATOM   982  C CG  . ASN A 1 131 ? 46.099  13.934 26.878 1.00 52.52  ? 697 ASN A CG  1 
ATOM   983  O OD1 . ASN A 1 131 ? 46.782  13.854 25.856 1.00 65.48  ? 697 ASN A OD1 1 
ATOM   984  N ND2 . ASN A 1 131 ? 46.476  13.389 28.032 1.00 53.02  ? 697 ASN A ND2 1 
ATOM   985  N N   . VAL A 1 132 ? 44.817  13.910 23.448 1.00 31.96  ? 698 VAL A N   1 
ATOM   986  C CA  . VAL A 1 132 ? 44.596  12.805 22.529 1.00 31.53  ? 698 VAL A CA  1 
ATOM   987  C C   . VAL A 1 132 ? 45.520  11.657 22.908 1.00 41.22  ? 698 VAL A C   1 
ATOM   988  O O   . VAL A 1 132 ? 46.745  11.817 22.895 1.00 34.83  ? 698 VAL A O   1 
ATOM   989  C CB  . VAL A 1 132 ? 44.866  13.219 21.069 1.00 34.78  ? 698 VAL A CB  1 
ATOM   990  C CG1 . VAL A 1 132 ? 44.824  11.996 20.156 1.00 27.46  ? 698 VAL A CG1 1 
ATOM   991  C CG2 . VAL A 1 132 ? 43.864  14.287 20.615 1.00 29.03  ? 698 VAL A CG2 1 
ATOM   992  N N   . ARG A 1 133 ? 44.951  10.527 23.325 1.00 29.51  ? 699 ARG A N   1 
ATOM   993  C CA  . ARG A 1 133 ? 45.782  9.342  23.501 1.00 39.49  ? 699 ARG A CA  1 
ATOM   994  C C   . ARG A 1 133 ? 45.380  8.210  22.573 1.00 35.02  ? 699 ARG A C   1 
ATOM   995  O O   . ARG A 1 133 ? 44.433  7.482  22.862 1.00 38.60  ? 699 ARG A O   1 
ATOM   996  C CB  . ARG A 1 133 ? 45.694  8.867  24.945 1.00 32.65  ? 699 ARG A CB  1 
ATOM   997  C CG  . ARG A 1 133 ? 45.381  9.970  25.931 1.00 32.45  ? 699 ARG A CG  1 
ATOM   998  C CD  . ARG A 1 133 ? 45.796  9.567  27.339 1.00 36.37  ? 699 ARG A CD  1 
ATOM   999  N NE  . ARG A 1 133 ? 44.818  10.032 28.305 1.00 49.57  ? 699 ARG A NE  1 
ATOM   1000 C CZ  . ARG A 1 133 ? 44.242  9.261  29.221 1.00 54.83  ? 699 ARG A CZ  1 
ATOM   1001 N NH1 . ARG A 1 133 ? 44.563  7.969  29.322 1.00 51.27  ? 699 ARG A NH1 1 
ATOM   1002 N NH2 . ARG A 1 133 ? 43.351  9.792  30.044 1.00 35.62  ? 699 ARG A NH2 1 
ATOM   1003 N N   . GLY A 1 134 ? 46.177  7.974  21.538 1.00 45.51  ? 700 GLY A N   1 
ATOM   1004 C CA  . GLY A 1 134 ? 45.868  6.936  20.570 1.00 31.32  ? 700 GLY A CA  1 
ATOM   1005 C C   . GLY A 1 134 ? 44.469  7.083  20.015 1.00 28.71  ? 700 GLY A C   1 
ATOM   1006 O O   . GLY A 1 134 ? 44.078  8.144  19.549 1.00 35.59  ? 700 GLY A O   1 
ATOM   1007 N N   . GLU A 1 135 ? 43.703  6.009  20.103 1.00 46.93  ? 701 GLU A N   1 
ATOM   1008 C CA  . GLU A 1 135 ? 42.398  5.930  19.470 1.00 46.06  ? 701 GLU A CA  1 
ATOM   1009 C C   . GLU A 1 135 ? 41.323  6.611  20.311 1.00 44.31  ? 701 GLU A C   1 
ATOM   1010 O O   . GLU A 1 135 ? 40.159  6.683  19.913 1.00 37.31  ? 701 GLU A O   1 
ATOM   1011 C CB  . GLU A 1 135 ? 42.041  4.461  19.219 1.00 52.73  ? 701 GLU A CB  1 
ATOM   1012 C CG  . GLU A 1 135 ? 43.065  3.734  18.356 1.00 62.97  ? 701 GLU A CG  1 
ATOM   1013 C CD  . GLU A 1 135 ? 43.433  4.513  17.088 1.00 80.68  ? 701 GLU A CD  1 
ATOM   1014 O OE1 . GLU A 1 135 ? 42.522  5.076  16.437 1.00 79.75  ? 701 GLU A OE1 1 
ATOM   1015 O OE2 . GLU A 1 135 ? 44.639  4.569  16.747 1.00 87.96  ? 701 GLU A OE2 1 
ATOM   1016 N N   . PHE A 1 136 ? 41.730  7.116  21.472 1.00 35.53  ? 702 PHE A N   1 
ATOM   1017 C CA  . PHE A 1 136 ? 40.824  7.808  22.373 1.00 33.31  ? 702 PHE A CA  1 
ATOM   1018 C C   . PHE A 1 136 ? 41.264  9.247  22.573 1.00 33.54  ? 702 PHE A C   1 
ATOM   1019 O O   . PHE A 1 136 ? 42.451  9.531  22.775 1.00 35.01  ? 702 PHE A O   1 
ATOM   1020 C CB  . PHE A 1 136 ? 40.769  7.096  23.738 1.00 33.94  ? 702 PHE A CB  1 
ATOM   1021 C CG  . PHE A 1 136 ? 40.238  5.700  23.664 1.00 43.55  ? 702 PHE A CG  1 
ATOM   1022 C CD1 . PHE A 1 136 ? 41.079  4.639  23.359 1.00 46.97  ? 702 PHE A CD1 1 
ATOM   1023 C CD2 . PHE A 1 136 ? 38.892  5.445  23.878 1.00 50.05  ? 702 PHE A CD2 1 
ATOM   1024 C CE1 . PHE A 1 136 ? 40.587  3.346  23.272 1.00 47.81  ? 702 PHE A CE1 1 
ATOM   1025 C CE2 . PHE A 1 136 ? 38.393  4.155  23.797 1.00 54.91  ? 702 PHE A CE2 1 
ATOM   1026 C CZ  . PHE A 1 136 ? 39.243  3.105  23.495 1.00 51.70  ? 702 PHE A CZ  1 
ATOM   1027 N N   . THR A 1 137 ? 40.293  10.151 22.532 1.00 28.28  ? 703 THR A N   1 
ATOM   1028 C CA  . THR A 1 137 ? 40.522  11.552 22.851 1.00 32.88  ? 703 THR A CA  1 
ATOM   1029 C C   . THR A 1 137 ? 39.778  11.936 24.130 1.00 36.75  ? 703 THR A C   1 
ATOM   1030 O O   . THR A 1 137 ? 38.577  11.682 24.251 1.00 36.23  ? 703 THR A O   1 
ATOM   1031 C CB  . THR A 1 137 ? 40.063  12.448 21.693 1.00 37.97  ? 703 THR A CB  1 
ATOM   1032 O OG1 . THR A 1 137 ? 40.872  12.168 20.543 1.00 38.30  ? 703 THR A OG1 1 
ATOM   1033 C CG2 . THR A 1 137 ? 40.184  13.920 22.070 1.00 25.22  ? 703 THR A CG2 1 
ATOM   1034 N N   . TYR A 1 138 ? 40.505  12.543 25.069 1.00 36.44  ? 704 TYR A N   1 
ATOM   1035 C CA  . TYR A 1 138 ? 39.974  12.956 26.371 1.00 34.07  ? 704 TYR A CA  1 
ATOM   1036 C C   . TYR A 1 138 ? 39.762  14.472 26.463 1.00 34.85  ? 704 TYR A C   1 
ATOM   1037 O O   . TYR A 1 138 ? 40.703  15.253 26.370 1.00 38.38  ? 704 TYR A O   1 
ATOM   1038 C CB  . TYR A 1 138 ? 40.909  12.508 27.507 1.00 32.57  ? 704 TYR A CB  1 
ATOM   1039 C CG  . TYR A 1 138 ? 40.909  11.013 27.754 1.00 40.41  ? 704 TYR A CG  1 
ATOM   1040 C CD1 . TYR A 1 138 ? 41.558  10.151 26.885 1.00 30.71  ? 704 TYR A CD1 1 
ATOM   1041 C CD2 . TYR A 1 138 ? 40.253  10.463 28.857 1.00 43.63  ? 704 TYR A CD2 1 
ATOM   1042 C CE1 . TYR A 1 138 ? 41.565  8.776  27.097 1.00 32.99  ? 704 TYR A CE1 1 
ATOM   1043 C CE2 . TYR A 1 138 ? 40.257  9.085  29.081 1.00 43.07  ? 704 TYR A CE2 1 
ATOM   1044 C CZ  . TYR A 1 138 ? 40.909  8.250  28.188 1.00 42.76  ? 704 TYR A CZ  1 
ATOM   1045 O OH  . TYR A 1 138 ? 40.925  6.886  28.381 1.00 45.38  ? 704 TYR A OH  1 
ATOM   1046 N N   . TYR A 1 139 ? 38.518  14.886 26.647 1.00 35.16  ? 705 TYR A N   1 
ATOM   1047 C CA  . TYR A 1 139 ? 38.244  16.285 26.895 1.00 38.20  ? 705 TYR A CA  1 
ATOM   1048 C C   . TYR A 1 139 ? 38.005  16.470 28.379 1.00 43.33  ? 705 TYR A C   1 
ATOM   1049 O O   . TYR A 1 139 ? 37.177  15.785 28.976 1.00 45.30  ? 705 TYR A O   1 
ATOM   1050 C CB  . TYR A 1 139 ? 37.015  16.752 26.111 1.00 30.30  ? 705 TYR A CB  1 
ATOM   1051 C CG  . TYR A 1 139 ? 37.185  16.691 24.612 1.00 35.74  ? 705 TYR A CG  1 
ATOM   1052 C CD1 . TYR A 1 139 ? 36.759  15.584 23.893 1.00 38.99  ? 705 TYR A CD1 1 
ATOM   1053 C CD2 . TYR A 1 139 ? 37.768  17.737 23.916 1.00 31.73  ? 705 TYR A CD2 1 
ATOM   1054 C CE1 . TYR A 1 139 ? 36.914  15.519 22.530 1.00 37.45  ? 705 TYR A CE1 1 
ATOM   1055 C CE2 . TYR A 1 139 ? 37.927  17.680 22.553 1.00 31.92  ? 705 TYR A CE2 1 
ATOM   1056 C CZ  . TYR A 1 139 ? 37.497  16.569 21.865 1.00 35.97  ? 705 TYR A CZ  1 
ATOM   1057 O OH  . TYR A 1 139 ? 37.647  16.510 20.503 1.00 35.29  ? 705 TYR A OH  1 
ATOM   1058 N N   . GLU A 1 140 ? 38.731  17.389 28.992 1.00 45.05  ? 706 GLU A N   1 
ATOM   1059 C CA  . GLU A 1 140 ? 38.366  17.770 30.339 1.00 44.82  ? 706 GLU A CA  1 
ATOM   1060 C C   . GLU A 1 140 ? 37.409  18.931 30.244 1.00 41.43  ? 706 GLU A C   1 
ATOM   1061 O O   . GLU A 1 140 ? 37.738  19.973 29.680 1.00 42.91  ? 706 GLU A O   1 
ATOM   1062 C CB  . GLU A 1 140 ? 39.564  18.150 31.191 1.00 49.16  ? 706 GLU A CB  1 
ATOM   1063 C CG  . GLU A 1 140 ? 39.159  18.450 32.625 1.00 52.28  ? 706 GLU A CG  1 
ATOM   1064 C CD  . GLU A 1 140 ? 40.332  18.478 33.576 1.00 61.02  ? 706 GLU A CD  1 
ATOM   1065 O OE1 . GLU A 1 140 ? 41.087  19.471 33.556 1.00 58.00  ? 706 GLU A OE1 1 
ATOM   1066 O OE2 . GLU A 1 140 ? 40.487  17.504 34.345 1.00 67.75  ? 706 GLU A OE2 1 
ATOM   1067 N N   . ILE A 1 141 ? 36.221  18.731 30.797 1.00 35.41  ? 707 ILE A N   1 
ATOM   1068 C CA  . ILE A 1 141 ? 35.174  19.733 30.761 1.00 44.53  ? 707 ILE A CA  1 
ATOM   1069 C C   . ILE A 1 141 ? 34.995  20.271 32.167 1.00 56.24  ? 707 ILE A C   1 
ATOM   1070 O O   . ILE A 1 141 ? 35.299  19.592 33.152 1.00 50.88  ? 707 ILE A O   1 
ATOM   1071 C CB  . ILE A 1 141 ? 33.845  19.158 30.262 1.00 38.09  ? 707 ILE A CB  1 
ATOM   1072 C CG1 . ILE A 1 141 ? 33.485  17.910 31.066 1.00 32.56  ? 707 ILE A CG1 1 
ATOM   1073 C CG2 . ILE A 1 141 ? 33.937  18.839 28.770 1.00 39.43  ? 707 ILE A CG2 1 
ATOM   1074 C CD1 . ILE A 1 141 ? 32.045  17.472 30.906 1.00 35.76  ? 707 ILE A CD1 1 
ATOM   1075 N N   . GLN A 1 142 ? 34.538  21.514 32.244 1.00 61.01  ? 708 GLN A N   1 
ATOM   1076 C CA  . GLN A 1 142 ? 34.425  22.223 33.500 1.00 61.70  ? 708 GLN A CA  1 
ATOM   1077 C C   . GLN A 1 142 ? 33.132  23.021 33.521 1.00 56.27  ? 708 GLN A C   1 
ATOM   1078 O O   . GLN A 1 142 ? 32.698  23.537 32.493 1.00 58.20  ? 708 GLN A O   1 
ATOM   1079 C CB  . GLN A 1 142 ? 35.596  23.194 33.634 1.00 74.12  ? 708 GLN A CB  1 
ATOM   1080 C CG  . GLN A 1 142 ? 35.789  24.043 32.378 1.00 83.48  ? 708 GLN A CG  1 
ATOM   1081 C CD  . GLN A 1 142 ? 36.843  25.116 32.535 1.00 91.30  ? 708 GLN A CD  1 
ATOM   1082 O OE1 . GLN A 1 142 ? 37.350  25.350 33.635 1.00 95.10  ? 708 GLN A OE1 1 
ATOM   1083 N NE2 . GLN A 1 142 ? 37.181  25.780 31.432 1.00 88.95  ? 708 GLN A NE2 1 
ATOM   1084 N N   . ASP A 1 143 ? 32.517  23.090 34.695 1.00 50.18  ? 709 ASP A N   1 
ATOM   1085 C CA  . ASP A 1 143 ? 31.496  24.080 35.004 1.00 53.79  ? 709 ASP A CA  1 
ATOM   1086 C C   . ASP A 1 143 ? 31.803  24.626 36.398 1.00 58.26  ? 709 ASP A C   1 
ATOM   1087 O O   . ASP A 1 143 ? 32.856  24.317 36.981 1.00 47.92  ? 709 ASP A O   1 
ATOM   1088 C CB  . ASP A 1 143 ? 30.076  23.502 34.911 1.00 53.99  ? 709 ASP A CB  1 
ATOM   1089 C CG  . ASP A 1 143 ? 29.841  22.347 35.871 1.00 55.50  ? 709 ASP A CG  1 
ATOM   1090 O OD1 . ASP A 1 143 ? 30.589  22.225 36.857 1.00 64.35  ? 709 ASP A OD1 1 
ATOM   1091 O OD2 . ASP A 1 143 ? 28.896  21.561 35.644 1.00 49.63  ? 709 ASP A OD2 1 
ATOM   1092 N N   . ALA A 1 144 ? 30.905  25.451 36.922 1.00 59.82  ? 710 ALA A N   1 
ATOM   1093 C CA  . ALA A 1 144 ? 31.102  26.035 38.241 1.00 64.69  ? 710 ALA A CA  1 
ATOM   1094 C C   . ALA A 1 144 ? 31.197  24.978 39.344 1.00 67.52  ? 710 ALA A C   1 
ATOM   1095 O O   . ALA A 1 144 ? 31.790  25.227 40.397 1.00 71.96  ? 710 ALA A O   1 
ATOM   1096 C CB  . ALA A 1 144 ? 29.990  27.033 38.552 1.00 60.16  ? 710 ALA A CB  1 
ATOM   1097 N N   . THR A 1 145 ? 30.606  23.808 39.112 1.00 64.69  ? 711 THR A N   1 
ATOM   1098 C CA  . THR A 1 145 ? 30.564  22.770 40.142 1.00 66.59  ? 711 THR A CA  1 
ATOM   1099 C C   . THR A 1 145 ? 31.778  21.843 40.168 1.00 66.29  ? 711 THR A C   1 
ATOM   1100 O O   . THR A 1 145 ? 31.984  21.116 41.142 1.00 71.81  ? 711 THR A O   1 
ATOM   1101 C CB  . THR A 1 145 ? 29.310  21.897 40.018 1.00 59.72  ? 711 THR A CB  1 
ATOM   1102 O OG1 . THR A 1 145 ? 29.359  21.164 38.788 1.00 53.49  ? 711 THR A OG1 1 
ATOM   1103 C CG2 . THR A 1 145 ? 28.056  22.761 40.060 1.00 58.12  ? 711 THR A CG2 1 
ATOM   1104 N N   . GLY A 1 146 ? 32.588  21.870 39.115 1.00 55.87  ? 712 GLY A N   1 
ATOM   1105 C CA  . GLY A 1 146 ? 33.758  21.014 39.071 1.00 54.29  ? 712 GLY A CA  1 
ATOM   1106 C C   . GLY A 1 146 ? 34.170  20.638 37.668 1.00 48.33  ? 712 GLY A C   1 
ATOM   1107 O O   . GLY A 1 146 ? 33.754  21.279 36.710 1.00 49.70  ? 712 GLY A O   1 
ATOM   1108 N N   . LYS A 1 147 ? 34.997  19.603 37.551 1.00 44.88  ? 713 LYS A N   1 
ATOM   1109 C CA  . LYS A 1 147 ? 35.434  19.122 36.242 1.00 53.28  ? 713 LYS A CA  1 
ATOM   1110 C C   . LYS A 1 147 ? 35.428  17.596 36.125 1.00 50.83  ? 713 LYS A C   1 
ATOM   1111 O O   . LYS A 1 147 ? 35.468  16.872 37.124 1.00 46.56  ? 713 LYS A O   1 
ATOM   1112 C CB  . LYS A 1 147 ? 36.820  19.679 35.888 1.00 50.97  ? 713 LYS A CB  1 
ATOM   1113 C CG  . LYS A 1 147 ? 37.886  19.411 36.925 1.00 62.67  ? 713 LYS A CG  1 
ATOM   1114 C CD  . LYS A 1 147 ? 39.188  20.089 36.528 1.00 80.34  ? 713 LYS A CD  1 
ATOM   1115 C CE  . LYS A 1 147 ? 40.349  19.649 37.406 1.00 92.72  ? 713 LYS A CE  1 
ATOM   1116 N NZ  . LYS A 1 147 ? 41.644  20.227 36.934 1.00 97.44  ? 713 LYS A NZ  1 
ATOM   1117 N N   . MET A 1 148 ? 35.389  17.117 34.889 1.00 45.43  ? 714 MET A N   1 
ATOM   1118 C CA  . MET A 1 148 ? 35.398  15.691 34.620 1.00 47.06  ? 714 MET A CA  1 
ATOM   1119 C C   . MET A 1 148 ? 35.882  15.481 33.201 1.00 45.14  ? 714 MET A C   1 
ATOM   1120 O O   . MET A 1 148 ? 36.221  16.438 32.509 1.00 45.12  ? 714 MET A O   1 
ATOM   1121 C CB  . MET A 1 148 ? 33.996  15.081 34.804 1.00 36.65  ? 714 MET A CB  1 
ATOM   1122 C CG  . MET A 1 148 ? 32.909  15.753 33.992 1.00 35.08  ? 714 MET A CG  1 
ATOM   1123 S SD  . MET A 1 148 ? 31.278  14.984 34.177 1.00 41.52  ? 714 MET A SD  1 
ATOM   1124 C CE  . MET A 1 148 ? 31.613  13.284 33.735 1.00 45.85  ? 714 MET A CE  1 
ATOM   1125 N N   . GLU A 1 149 ? 35.897  14.230 32.761 1.00 43.00  ? 715 GLU A N   1 
ATOM   1126 C CA  . GLU A 1 149 ? 36.341  13.933 31.414 1.00 38.28  ? 715 GLU A CA  1 
ATOM   1127 C C   . GLU A 1 149 ? 35.265  13.345 30.527 1.00 41.20  ? 715 GLU A C   1 
ATOM   1128 O O   . GLU A 1 149 ? 34.389  12.606 30.977 1.00 42.92  ? 715 GLU A O   1 
ATOM   1129 C CB  . GLU A 1 149 ? 37.568  13.027 31.431 1.00 37.48  ? 715 GLU A CB  1 
ATOM   1130 C CG  . GLU A 1 149 ? 38.841  13.763 31.859 1.00 52.55  ? 715 GLU A CG  1 
ATOM   1131 C CD  . GLU A 1 149 ? 40.075  12.883 31.801 1.00 58.71  ? 715 GLU A CD  1 
ATOM   1132 O OE1 . GLU A 1 149 ? 39.966  11.687 32.150 1.00 57.56  ? 715 GLU A OE1 1 
ATOM   1133 O OE2 . GLU A 1 149 ? 41.149  13.386 31.397 1.00 63.41  ? 715 GLU A OE2 1 
ATOM   1134 N N   . VAL A 1 150 ? 35.348  13.714 29.254 1.00 40.37  ? 716 VAL A N   1 
ATOM   1135 C CA  . VAL A 1 150 ? 34.558  13.128 28.194 1.00 29.68  ? 716 VAL A CA  1 
ATOM   1136 C C   . VAL A 1 150 ? 35.508  12.312 27.331 1.00 36.29  ? 716 VAL A C   1 
ATOM   1137 O O   . VAL A 1 150 ? 36.490  12.840 26.813 1.00 39.57  ? 716 VAL A O   1 
ATOM   1138 C CB  . VAL A 1 150 ? 33.905  14.219 27.324 1.00 29.16  ? 716 VAL A CB  1 
ATOM   1139 C CG1 . VAL A 1 150 ? 33.111  13.586 26.172 1.00 26.23  ? 716 VAL A CG1 1 
ATOM   1140 C CG2 . VAL A 1 150 ? 33.023  15.116 28.169 1.00 39.25  ? 716 VAL A CG2 1 
ATOM   1141 N N   . VAL A 1 151 ? 35.225  11.024 27.185 1.00 38.44  ? 717 VAL A N   1 
ATOM   1142 C CA  . VAL A 1 151 ? 36.080  10.152 26.401 1.00 31.35  ? 717 VAL A CA  1 
ATOM   1143 C C   . VAL A 1 151 ? 35.432  9.785  25.064 1.00 39.13  ? 717 VAL A C   1 
ATOM   1144 O O   . VAL A 1 151 ? 34.331  9.226  25.009 1.00 36.13  ? 717 VAL A O   1 
ATOM   1145 C CB  . VAL A 1 151 ? 36.436  8.876  27.165 1.00 38.84  ? 717 VAL A CB  1 
ATOM   1146 C CG1 . VAL A 1 151 ? 37.550  8.131  26.438 1.00 39.49  ? 717 VAL A CG1 1 
ATOM   1147 C CG2 . VAL A 1 151 ? 36.860  9.221  28.575 1.00 44.23  ? 717 VAL A CG2 1 
ATOM   1148 N N   . VAL A 1 152 ? 36.139  10.101 23.987 1.00 24.61  ? 718 VAL A N   1 
ATOM   1149 C CA  . VAL A 1 152 ? 35.652  9.854  22.647 1.00 32.55  ? 718 VAL A CA  1 
ATOM   1150 C C   . VAL A 1 152 ? 36.509  8.802  21.926 1.00 36.94  ? 718 VAL A C   1 
ATOM   1151 O O   . VAL A 1 152 ? 37.720  8.719  22.132 1.00 37.76  ? 718 VAL A O   1 
ATOM   1152 C CB  . VAL A 1 152 ? 35.642  11.170 21.852 1.00 37.75  ? 718 VAL A CB  1 
ATOM   1153 C CG1 . VAL A 1 152 ? 35.578  10.903 20.377 1.00 47.56  ? 718 VAL A CG1 1 
ATOM   1154 C CG2 . VAL A 1 152 ? 34.485  12.048 22.307 1.00 42.46  ? 718 VAL A CG2 1 
ATOM   1155 N N   . HIS A 1 153 ? 35.866  7.989  21.097 1.00 36.02  ? 719 HIS A N   1 
ATOM   1156 C CA  . HIS A 1 153 ? 36.568  7.044  20.241 1.00 39.85  ? 719 HIS A CA  1 
ATOM   1157 C C   . HIS A 1 153 ? 35.812  6.927  18.927 1.00 48.91  ? 719 HIS A C   1 
ATOM   1158 O O   . HIS A 1 153 ? 34.653  7.341  18.828 1.00 61.50  ? 719 HIS A O   1 
ATOM   1159 C CB  . HIS A 1 153 ? 36.651  5.673  20.902 1.00 44.96  ? 719 HIS A CB  1 
ATOM   1160 C CG  . HIS A 1 153 ? 35.347  4.937  20.913 1.00 62.77  ? 719 HIS A CG  1 
ATOM   1161 N ND1 . HIS A 1 153 ? 34.348  5.205  21.826 1.00 64.97  ? 719 HIS A ND1 1 
ATOM   1162 C CD2 . HIS A 1 153 ? 34.872  3.952  20.114 1.00 65.90  ? 719 HIS A CD2 1 
ATOM   1163 C CE1 . HIS A 1 153 ? 33.318  4.411  21.593 1.00 65.55  ? 719 HIS A CE1 1 
ATOM   1164 N NE2 . HIS A 1 153 ? 33.610  3.641  20.560 1.00 69.21  ? 719 HIS A NE2 1 
ATOM   1165 N N   . GLY A 1 154 ? 36.465  6.356  17.920 1.00 42.11  ? 720 GLY A N   1 
ATOM   1166 C CA  . GLY A 1 154 ? 35.824  6.127  16.637 1.00 31.07  ? 720 GLY A CA  1 
ATOM   1167 C C   . GLY A 1 154 ? 35.630  7.407  15.848 1.00 33.14  ? 720 GLY A C   1 
ATOM   1168 O O   . GLY A 1 154 ? 36.470  8.305  15.904 1.00 45.29  ? 720 GLY A O   1 
ATOM   1169 N N   . ARG A 1 155 ? 34.516  7.496  15.125 1.00 32.21  ? 721 ARG A N   1 
ATOM   1170 C CA  . ARG A 1 155 ? 34.277  8.606  14.203 1.00 36.46  ? 721 ARG A CA  1 
ATOM   1171 C C   . ARG A 1 155 ? 34.424  9.949  14.896 1.00 29.39  ? 721 ARG A C   1 
ATOM   1172 O O   . ARG A 1 155 ? 34.910  10.907 14.307 1.00 39.75  ? 721 ARG A O   1 
ATOM   1173 C CB  . ARG A 1 155 ? 32.891  8.498  13.564 1.00 39.11  ? 721 ARG A CB  1 
ATOM   1174 C CG  . ARG A 1 155 ? 31.786  8.422  14.597 1.00 46.74  ? 721 ARG A CG  1 
ATOM   1175 C CD  . ARG A 1 155 ? 30.432  8.119  13.976 1.00 57.58  ? 721 ARG A CD  1 
ATOM   1176 N NE  . ARG A 1 155 ? 29.499  7.660  15.000 1.00 50.47  ? 721 ARG A NE  1 
ATOM   1177 C CZ  . ARG A 1 155 ? 28.730  8.464  15.722 1.00 44.06  ? 721 ARG A CZ  1 
ATOM   1178 N NH1 . ARG A 1 155 ? 28.774  9.774  15.510 1.00 38.72  ? 721 ARG A NH1 1 
ATOM   1179 N NH2 . ARG A 1 155 ? 27.914  7.957  16.648 1.00 39.51  ? 721 ARG A NH2 1 
ATOM   1180 N N   . LEU A 1 156 ? 34.026  10.017 16.158 1.00 29.11  ? 722 LEU A N   1 
ATOM   1181 C CA  . LEU A 1 156 ? 34.099  11.285 16.883 1.00 30.31  ? 722 LEU A CA  1 
ATOM   1182 C C   . LEU A 1 156 ? 35.512  11.801 17.166 1.00 32.17  ? 722 LEU A C   1 
ATOM   1183 O O   . LEU A 1 156 ? 35.673  12.950 17.571 1.00 34.79  ? 722 LEU A O   1 
ATOM   1184 C CB  . LEU A 1 156 ? 33.278  11.219 18.170 1.00 25.43  ? 722 LEU A CB  1 
ATOM   1185 C CG  . LEU A 1 156 ? 31.781  11.060 17.908 1.00 27.34  ? 722 LEU A CG  1 
ATOM   1186 C CD1 . LEU A 1 156 ? 30.993  10.896 19.211 1.00 27.33  ? 722 LEU A CD1 1 
ATOM   1187 C CD2 . LEU A 1 156 ? 31.250  12.232 17.080 1.00 27.06  ? 722 LEU A CD2 1 
ATOM   1188 N N   . THR A 1 157 ? 36.540  10.979 16.957 1.00 31.47  ? 723 THR A N   1 
ATOM   1189 C CA  . THR A 1 157 ? 37.911  11.466 17.168 1.00 36.26  ? 723 THR A CA  1 
ATOM   1190 C C   . THR A 1 157 ? 38.334  12.471 16.078 1.00 37.10  ? 723 THR A C   1 
ATOM   1191 O O   . THR A 1 157 ? 39.372  13.132 16.193 1.00 35.92  ? 723 THR A O   1 
ATOM   1192 C CB  . THR A 1 157 ? 38.945  10.314 17.245 1.00 31.44  ? 723 THR A CB  1 
ATOM   1193 O OG1 . THR A 1 157 ? 38.998  9.635  15.984 1.00 30.43  ? 723 THR A OG1 1 
ATOM   1194 C CG2 . THR A 1 157 ? 38.577  9.316  18.340 1.00 32.71  ? 723 THR A CG2 1 
ATOM   1195 N N   . THR A 1 158 ? 37.531  12.586 15.021 1.00 36.64  ? 724 THR A N   1 
ATOM   1196 C CA  . THR A 1 158 ? 37.830  13.529 13.944 1.00 31.37  ? 724 THR A CA  1 
ATOM   1197 C C   . THR A 1 158 ? 37.182  14.908 14.125 1.00 34.30  ? 724 THR A C   1 
ATOM   1198 O O   . THR A 1 158 ? 37.407  15.793 13.315 1.00 43.78  ? 724 THR A O   1 
ATOM   1199 C CB  . THR A 1 158 ? 37.414  12.993 12.549 1.00 29.25  ? 724 THR A CB  1 
ATOM   1200 O OG1 . THR A 1 158 ? 35.986  12.965 12.456 1.00 29.77  ? 724 THR A OG1 1 
ATOM   1201 C CG2 . THR A 1 158 ? 37.958  11.596 12.314 1.00 35.61  ? 724 THR A CG2 1 
ATOM   1202 N N   . ILE A 1 159 ? 36.375  15.104 15.164 1.00 36.90  ? 725 ILE A N   1 
ATOM   1203 C CA  . ILE A 1 159 ? 35.772  16.420 15.351 1.00 35.05  ? 725 ILE A CA  1 
ATOM   1204 C C   . ILE A 1 159 ? 36.877  17.415 15.635 1.00 44.12  ? 725 ILE A C   1 
ATOM   1205 O O   . ILE A 1 159 ? 37.968  17.047 16.084 1.00 39.38  ? 725 ILE A O   1 
ATOM   1206 C CB  . ILE A 1 159 ? 34.771  16.479 16.513 1.00 34.95  ? 725 ILE A CB  1 
ATOM   1207 C CG1 . ILE A 1 159 ? 35.509  16.376 17.849 1.00 37.90  ? 725 ILE A CG1 1 
ATOM   1208 C CG2 . ILE A 1 159 ? 33.683  15.404 16.355 1.00 34.21  ? 725 ILE A CG2 1 
ATOM   1209 C CD1 . ILE A 1 159 ? 34.656  16.715 19.035 1.00 38.99  ? 725 ILE A CD1 1 
ATOM   1210 N N   . ASN A 1 160 ? 36.598  18.679 15.358 1.00 47.40  ? 726 ASN A N   1 
ATOM   1211 C CA  . ASN A 1 160 ? 37.561  19.710 15.640 1.00 44.54  ? 726 ASN A CA  1 
ATOM   1212 C C   . ASN A 1 160 ? 37.070  20.484 16.855 1.00 45.24  ? 726 ASN A C   1 
ATOM   1213 O O   . ASN A 1 160 ? 36.158  21.307 16.782 1.00 41.88  ? 726 ASN A O   1 
ATOM   1214 C CB  . ASN A 1 160 ? 37.651  20.613 14.418 1.00 44.70  ? 726 ASN A CB  1 
ATOM   1215 C CG  . ASN A 1 160 ? 38.766  21.608 14.510 1.00 56.98  ? 726 ASN A CG  1 
ATOM   1216 O OD1 . ASN A 1 160 ? 39.639  21.510 15.374 1.00 67.53  ? 726 ASN A OD1 1 
ATOM   1217 N ND2 . ASN A 1 160 ? 38.750  22.585 13.613 1.00 60.28  ? 726 ASN A ND2 1 
ATOM   1218 N N   . CYS A 1 161 ? 37.709  20.230 17.982 1.00 44.09  ? 727 CYS A N   1 
ATOM   1219 C CA  . CYS A 1 161 ? 37.291  20.848 19.221 1.00 40.25  ? 727 CYS A CA  1 
ATOM   1220 C C   . CYS A 1 161 ? 38.525  21.176 20.003 1.00 49.08  ? 727 CYS A C   1 
ATOM   1221 O O   . CYS A 1 161 ? 39.374  20.314 20.235 1.00 48.54  ? 727 CYS A O   1 
ATOM   1222 C CB  . CYS A 1 161 ? 36.383  19.920 20.021 1.00 38.60  ? 727 CYS A CB  1 
ATOM   1223 S SG  . CYS A 1 161 ? 35.737  20.681 21.523 1.00 49.38  ? 727 CYS A SG  1 
ATOM   1224 N N   . GLU A 1 162 ? 38.620  22.423 20.426 1.00 53.13  ? 728 GLU A N   1 
ATOM   1225 C CA  . GLU A 1 162 ? 39.813  22.885 21.095 1.00 52.46  ? 728 GLU A CA  1 
ATOM   1226 C C   . GLU A 1 162 ? 39.408  23.482 22.418 1.00 50.30  ? 728 GLU A C   1 
ATOM   1227 O O   . GLU A 1 162 ? 38.227  23.744 22.674 1.00 44.75  ? 728 GLU A O   1 
ATOM   1228 C CB  . GLU A 1 162 ? 40.554  23.920 20.245 1.00 61.01  ? 728 GLU A CB  1 
ATOM   1229 C CG  . GLU A 1 162 ? 41.122  23.370 18.943 1.00 74.11  ? 728 GLU A CG  1 
ATOM   1230 C CD  . GLU A 1 162 ? 42.150  22.265 19.158 1.00 83.99  ? 728 GLU A CD  1 
ATOM   1231 O OE1 . GLU A 1 162 ? 42.344  21.455 18.223 1.00 90.45  ? 728 GLU A OE1 1 
ATOM   1232 O OE2 . GLU A 1 162 ? 42.767  22.209 20.251 1.00 78.38  ? 728 GLU A OE2 1 
ATOM   1233 N N   . GLU A 1 163 ? 40.402  23.656 23.269 1.00 48.23  ? 729 GLU A N   1 
ATOM   1234 C CA  . GLU A 1 163 ? 40.222  24.286 24.558 1.00 58.35  ? 729 GLU A CA  1 
ATOM   1235 C C   . GLU A 1 163 ? 39.543  25.649 24.351 1.00 60.25  ? 729 GLU A C   1 
ATOM   1236 O O   . GLU A 1 163 ? 39.947  26.438 23.493 1.00 60.60  ? 729 GLU A O   1 
ATOM   1237 C CB  . GLU A 1 163 ? 41.596  24.389 25.237 1.00 64.63  ? 729 GLU A CB  1 
ATOM   1238 C CG  . GLU A 1 163 ? 42.511  23.219 24.798 1.00 69.73  ? 729 GLU A CG  1 
ATOM   1239 C CD  . GLU A 1 163 ? 43.747  23.000 25.668 1.00 80.40  ? 729 GLU A CD  1 
ATOM   1240 O OE1 . GLU A 1 163 ? 44.279  23.982 26.242 1.00 87.74  ? 729 GLU A OE1 1 
ATOM   1241 O OE2 . GLU A 1 163 ? 44.190  21.828 25.763 1.00 66.46  ? 729 GLU A OE2 1 
ATOM   1242 N N   . GLY A 1 164 ? 38.480  25.890 25.114 1.00 52.22  ? 730 GLY A N   1 
ATOM   1243 C CA  . GLY A 1 164 ? 37.705  27.110 25.006 1.00 49.12  ? 730 GLY A CA  1 
ATOM   1244 C C   . GLY A 1 164 ? 36.413  26.929 24.231 1.00 60.47  ? 730 GLY A C   1 
ATOM   1245 O O   . GLY A 1 164 ? 35.464  27.693 24.418 1.00 72.85  ? 730 GLY A O   1 
ATOM   1246 N N   . ASP A 1 165 ? 36.354  25.906 23.381 1.00 50.33  ? 731 ASP A N   1 
ATOM   1247 C CA  . ASP A 1 165 ? 35.126  25.611 22.654 1.00 41.72  ? 731 ASP A CA  1 
ATOM   1248 C C   . ASP A 1 165 ? 34.153  24.916 23.578 1.00 35.62  ? 731 ASP A C   1 
ATOM   1249 O O   . ASP A 1 165 ? 34.479  24.610 24.718 1.00 39.53  ? 731 ASP A O   1 
ATOM   1250 C CB  . ASP A 1 165 ? 35.388  24.687 21.466 1.00 45.56  ? 731 ASP A CB  1 
ATOM   1251 C CG  . ASP A 1 165 ? 36.221  25.332 20.399 1.00 46.21  ? 731 ASP A CG  1 
ATOM   1252 O OD1 . ASP A 1 165 ? 36.373  26.571 20.435 1.00 41.48  ? 731 ASP A OD1 1 
ATOM   1253 O OD2 . ASP A 1 165 ? 36.717  24.589 19.525 1.00 43.90  ? 731 ASP A OD2 1 
ATOM   1254 N N   . LYS A 1 166 ? 32.967  24.626 23.062 1.00 36.72  ? 732 LYS A N   1 
ATOM   1255 C CA  . LYS A 1 166 ? 31.981  23.882 23.829 1.00 44.80  ? 732 LYS A CA  1 
ATOM   1256 C C   . LYS A 1 166 ? 31.528  22.656 23.060 1.00 41.79  ? 732 LYS A C   1 
ATOM   1257 O O   . LYS A 1 166 ? 31.414  22.688 21.834 1.00 43.00  ? 732 LYS A O   1 
ATOM   1258 C CB  . LYS A 1 166 ? 30.786  24.773 24.183 1.00 44.33  ? 732 LYS A CB  1 
ATOM   1259 C CG  . LYS A 1 166 ? 31.165  25.939 25.079 1.00 51.19  ? 732 LYS A CG  1 
ATOM   1260 C CD  . LYS A 1 166 ? 29.985  26.841 25.312 1.00 55.13  ? 732 LYS A CD  1 
ATOM   1261 C CE  . LYS A 1 166 ? 30.425  28.160 25.919 1.00 62.34  ? 732 LYS A CE  1 
ATOM   1262 N NZ  . LYS A 1 166 ? 29.241  29.004 26.209 1.00 67.78  ? 732 LYS A NZ  1 
ATOM   1263 N N   . LEU A 1 167 ? 31.284  21.572 23.788 1.00 38.39  ? 733 LEU A N   1 
ATOM   1264 C CA  . LEU A 1 167 ? 30.780  20.349 23.185 1.00 41.11  ? 733 LEU A CA  1 
ATOM   1265 C C   . LEU A 1 167 ? 29.291  20.226 23.479 1.00 34.28  ? 733 LEU A C   1 
ATOM   1266 O O   . LEU A 1 167 ? 28.895  20.145 24.630 1.00 33.83  ? 733 LEU A O   1 
ATOM   1267 C CB  . LEU A 1 167 ? 31.511  19.126 23.756 1.00 34.52  ? 733 LEU A CB  1 
ATOM   1268 C CG  . LEU A 1 167 ? 32.994  18.913 23.431 1.00 38.54  ? 733 LEU A CG  1 
ATOM   1269 C CD1 . LEU A 1 167 ? 33.577  17.790 24.299 1.00 31.29  ? 733 LEU A CD1 1 
ATOM   1270 C CD2 . LEU A 1 167 ? 33.194  18.619 21.961 1.00 36.86  ? 733 LEU A CD2 1 
ATOM   1271 N N   . LYS A 1 168 ? 28.457  20.213 22.450 1.00 31.09  ? 734 LYS A N   1 
ATOM   1272 C CA  . LYS A 1 168 ? 27.056  19.914 22.695 1.00 28.93  ? 734 LYS A CA  1 
ATOM   1273 C C   . LYS A 1 168 ? 26.887  18.421 22.448 1.00 38.42  ? 734 LYS A C   1 
ATOM   1274 O O   . LYS A 1 168 ? 26.933  17.954 21.298 1.00 34.65  ? 734 LYS A O   1 
ATOM   1275 C CB  . LYS A 1 168 ? 26.165  20.750 21.779 1.00 28.48  ? 734 LYS A CB  1 
ATOM   1276 C CG  . LYS A 1 168 ? 24.683  20.479 21.912 1.00 30.26  ? 734 LYS A CG  1 
ATOM   1277 C CD  . LYS A 1 168 ? 23.888  21.610 21.256 1.00 39.03  ? 734 LYS A CD  1 
ATOM   1278 C CE  . LYS A 1 168 ? 22.415  21.273 21.190 1.00 50.26  ? 734 LYS A CE  1 
ATOM   1279 N NZ  . LYS A 1 168 ? 21.954  20.753 22.511 1.00 62.89  ? 734 LYS A NZ  1 
ATOM   1280 N N   . LEU A 1 169 ? 26.674  17.685 23.540 1.00 33.97  ? 735 LEU A N   1 
ATOM   1281 C CA  . LEU A 1 169 ? 26.682  16.231 23.508 1.00 35.37  ? 735 LEU A CA  1 
ATOM   1282 C C   . LEU A 1 169 ? 25.270  15.672 23.449 1.00 33.87  ? 735 LEU A C   1 
ATOM   1283 O O   . LEU A 1 169 ? 24.378  16.176 24.118 1.00 35.10  ? 735 LEU A O   1 
ATOM   1284 C CB  . LEU A 1 169 ? 27.347  15.684 24.771 1.00 29.11  ? 735 LEU A CB  1 
ATOM   1285 C CG  . LEU A 1 169 ? 28.741  16.184 25.152 1.00 31.27  ? 735 LEU A CG  1 
ATOM   1286 C CD1 . LEU A 1 169 ? 29.156  15.482 26.416 1.00 25.17  ? 735 LEU A CD1 1 
ATOM   1287 C CD2 . LEU A 1 169 ? 29.744  15.935 24.038 1.00 25.38  ? 735 LEU A CD2 1 
ATOM   1288 N N   . THR A 1 170 ? 25.085  14.608 22.675 1.00 27.18  ? 736 THR A N   1 
ATOM   1289 C CA  . THR A 1 170 ? 23.839  13.859 22.694 1.00 26.14  ? 736 THR A CA  1 
ATOM   1290 C C   . THR A 1 170 ? 24.105  12.369 22.869 1.00 27.70  ? 736 THR A C   1 
ATOM   1291 O O   . THR A 1 170 ? 24.911  11.784 22.151 1.00 31.18  ? 736 THR A O   1 
ATOM   1292 C CB  . THR A 1 170 ? 22.985  14.105 21.426 1.00 28.37  ? 736 THR A CB  1 
ATOM   1293 O OG1 . THR A 1 170 ? 22.712  15.504 21.312 1.00 32.76  ? 736 THR A OG1 1 
ATOM   1294 C CG2 . THR A 1 170 ? 21.661  13.349 21.514 1.00 25.63  ? 736 THR A CG2 1 
ATOM   1295 N N   . CYS A 1 171 ? 23.419  11.770 23.837 1.00 32.46  ? 737 CYS A N   1 
ATOM   1296 C CA  . CYS A 1 171 ? 23.517  10.336 24.103 1.00 31.04  ? 737 CYS A CA  1 
ATOM   1297 C C   . CYS A 1 171 ? 24.954  9.896  24.386 1.00 35.42  ? 737 CYS A C   1 
ATOM   1298 O O   . CYS A 1 171 ? 25.492  9.023  23.710 1.00 36.97  ? 737 CYS A O   1 
ATOM   1299 C CB  . CYS A 1 171 ? 22.894  9.512  22.973 1.00 23.71  ? 737 CYS A CB  1 
ATOM   1300 S SG  . CYS A 1 171 ? 22.686  7.757  23.363 1.00 32.57  ? 737 CYS A SG  1 
ATOM   1301 N N   . PHE A 1 172 ? 25.573  10.548 25.368 1.00 31.62  ? 738 PHE A N   1 
ATOM   1302 C CA  . PHE A 1 172 ? 26.810  10.060 25.966 1.00 31.75  ? 738 PHE A CA  1 
ATOM   1303 C C   . PHE A 1 172 ? 26.531  9.229  27.217 1.00 39.00  ? 738 PHE A C   1 
ATOM   1304 O O   . PHE A 1 172 ? 25.645  9.551  28.012 1.00 42.18  ? 738 PHE A O   1 
ATOM   1305 C CB  . PHE A 1 172 ? 27.766  11.217 26.269 1.00 25.55  ? 738 PHE A CB  1 
ATOM   1306 C CG  . PHE A 1 172 ? 28.630  11.578 25.102 1.00 29.94  ? 738 PHE A CG  1 
ATOM   1307 C CD1 . PHE A 1 172 ? 28.071  12.129 23.963 1.00 31.94  ? 738 PHE A CD1 1 
ATOM   1308 C CD2 . PHE A 1 172 ? 29.985  11.319 25.117 1.00 23.48  ? 738 PHE A CD2 1 
ATOM   1309 C CE1 . PHE A 1 172 ? 28.850  12.439 22.881 1.00 27.08  ? 738 PHE A CE1 1 
ATOM   1310 C CE2 . PHE A 1 172 ? 30.764  11.632 24.037 1.00 31.94  ? 738 PHE A CE2 1 
ATOM   1311 C CZ  . PHE A 1 172 ? 30.189  12.192 22.914 1.00 29.41  ? 738 PHE A CZ  1 
ATOM   1312 N N   . GLU A 1 173 ? 27.280  8.145  27.386 1.00 36.08  ? 739 GLU A N   1 
ATOM   1313 C CA  . GLU A 1 173 ? 27.063  7.295  28.545 1.00 39.56  ? 739 GLU A CA  1 
ATOM   1314 C C   . GLU A 1 173 ? 27.899  7.750  29.730 1.00 40.94  ? 739 GLU A C   1 
ATOM   1315 O O   . GLU A 1 173 ? 29.098  8.007  29.593 1.00 37.17  ? 739 GLU A O   1 
ATOM   1316 C CB  . GLU A 1 173 ? 27.358  5.827  28.236 1.00 40.57  ? 739 GLU A CB  1 
ATOM   1317 C CG  . GLU A 1 173 ? 27.277  4.961  29.491 1.00 47.36  ? 739 GLU A CG  1 
ATOM   1318 C CD  . GLU A 1 173 ? 27.115  3.492  29.192 1.00 52.89  ? 739 GLU A CD  1 
ATOM   1319 O OE1 . GLU A 1 173 ? 26.400  2.807  29.957 1.00 57.27  ? 739 GLU A OE1 1 
ATOM   1320 O OE2 . GLU A 1 173 ? 27.706  3.020  28.198 1.00 54.26  ? 739 GLU A OE2 1 
ATOM   1321 N N   . LEU A 1 174 ? 27.268  7.852  30.894 1.00 41.88  ? 740 LEU A N   1 
ATOM   1322 C CA  . LEU A 1 174 ? 28.024  8.172  32.085 1.00 43.95  ? 740 LEU A CA  1 
ATOM   1323 C C   . LEU A 1 174 ? 28.503  6.881  32.712 1.00 42.82  ? 740 LEU A C   1 
ATOM   1324 O O   . LEU A 1 174 ? 27.699  6.050  33.147 1.00 41.54  ? 740 LEU A O   1 
ATOM   1325 C CB  . LEU A 1 174 ? 27.203  8.981  33.089 1.00 46.17  ? 740 LEU A CB  1 
ATOM   1326 C CG  . LEU A 1 174 ? 28.158  9.415  34.207 1.00 53.63  ? 740 LEU A CG  1 
ATOM   1327 C CD1 . LEU A 1 174 ? 28.018  10.883 34.551 1.00 51.68  ? 740 LEU A CD1 1 
ATOM   1328 C CD2 . LEU A 1 174 ? 28.000  8.529  35.427 1.00 48.64  ? 740 LEU A CD2 1 
ATOM   1329 N N   . ALA A 1 175 ? 29.821  6.714  32.746 1.00 38.31  ? 741 ALA A N   1 
ATOM   1330 C CA  . ALA A 1 175 ? 30.417  5.534  33.348 1.00 45.07  ? 741 ALA A CA  1 
ATOM   1331 C C   . ALA A 1 175 ? 30.915  5.918  34.728 1.00 47.61  ? 741 ALA A C   1 
ATOM   1332 O O   . ALA A 1 175 ? 31.941  6.585  34.863 1.00 49.73  ? 741 ALA A O   1 
ATOM   1333 C CB  . ALA A 1 175 ? 31.574  5.014  32.481 1.00 37.00  ? 741 ALA A CB  1 
ATOM   1334 N N   . PRO A 1 176 ? 30.195  5.479  35.764 1.00 48.74  ? 742 PRO A N   1 
ATOM   1335 C CA  . PRO A 1 176 ? 30.554  5.823  37.141 1.00 59.41  ? 742 PRO A CA  1 
ATOM   1336 C C   . PRO A 1 176 ? 31.927  5.268  37.478 1.00 65.74  ? 742 PRO A C   1 
ATOM   1337 O O   . PRO A 1 176 ? 32.219  4.116  37.148 1.00 63.12  ? 742 PRO A O   1 
ATOM   1338 C CB  . PRO A 1 176 ? 29.487  5.097  37.967 1.00 55.16  ? 742 PRO A CB  1 
ATOM   1339 C CG  . PRO A 1 176 ? 28.319  4.968  37.045 1.00 47.91  ? 742 PRO A CG  1 
ATOM   1340 C CD  . PRO A 1 176 ? 28.912  4.762  35.681 1.00 43.23  ? 742 PRO A CD  1 
ATOM   1341 N N   . LYS A 1 177 ? 32.767  6.077  38.109 1.00 68.61  ? 743 LYS A N   1 
ATOM   1342 C CA  . LYS A 1 177 ? 34.053  5.577  38.569 1.00 74.66  ? 743 LYS A CA  1 
ATOM   1343 C C   . LYS A 1 177 ? 34.225  5.792  40.060 1.00 86.49  ? 743 LYS A C   1 
ATOM   1344 O O   . LYS A 1 177 ? 33.373  6.386  40.722 1.00 91.10  ? 743 LYS A O   1 
ATOM   1345 C CB  . LYS A 1 177 ? 35.207  6.205  37.794 1.00 69.74  ? 743 LYS A CB  1 
ATOM   1346 C CG  . LYS A 1 177 ? 35.547  5.494  36.506 1.00 71.43  ? 743 LYS A CG  1 
ATOM   1347 C CD  . LYS A 1 177 ? 36.432  6.375  35.646 1.00 75.47  ? 743 LYS A CD  1 
ATOM   1348 C CE  . LYS A 1 177 ? 37.667  6.829  36.415 1.00 76.65  ? 743 LYS A CE  1 
ATOM   1349 N NZ  . LYS A 1 177 ? 38.398  7.927  35.715 1.00 69.63  ? 743 LYS A NZ  1 
ATOM   1350 N N   . SER A 1 178 ? 35.360  5.329  40.567 1.00 92.43  ? 744 SER A N   1 
ATOM   1351 C CA  . SER A 1 178 ? 35.558  5.141  41.994 1.00 97.21  ? 744 SER A CA  1 
ATOM   1352 C C   . SER A 1 178 ? 35.679  6.424  42.817 1.00 94.91  ? 744 SER A C   1 
ATOM   1353 O O   . SER A 1 178 ? 35.138  6.519  43.914 1.00 98.37  ? 744 SER A O   1 
ATOM   1354 C CB  . SER A 1 178 ? 36.790  4.261  42.217 1.00 102.48 ? 744 SER A CB  1 
ATOM   1355 O OG  . SER A 1 178 ? 37.099  4.156  43.594 1.00 109.98 ? 744 SER A OG  1 
ATOM   1356 N N   . GLY A 1 179 ? 36.383  7.410  42.284 1.00 89.48  ? 745 GLY A N   1 
ATOM   1357 C CA  . GLY A 1 179 ? 36.849  8.524  43.091 1.00 90.17  ? 745 GLY A CA  1 
ATOM   1358 C C   . GLY A 1 179 ? 36.059  9.815  43.020 1.00 81.69  ? 745 GLY A C   1 
ATOM   1359 O O   . GLY A 1 179 ? 36.618  10.873 43.302 1.00 83.82  ? 745 GLY A O   1 
ATOM   1360 N N   . ASN A 1 180 ? 34.775  9.742  42.670 1.00 74.00  ? 746 ASN A N   1 
ATOM   1361 C CA  . ASN A 1 180 ? 34.084  10.887 42.090 1.00 67.76  ? 746 ASN A CA  1 
ATOM   1362 C C   . ASN A 1 180 ? 34.678  11.100 40.707 1.00 68.78  ? 746 ASN A C   1 
ATOM   1363 O O   . ASN A 1 180 ? 34.694  12.214 40.177 1.00 61.39  ? 746 ASN A O   1 
ATOM   1364 C CB  . ASN A 1 180 ? 34.352  12.143 42.923 1.00 77.87  ? 746 ASN A CB  1 
ATOM   1365 C CG  . ASN A 1 180 ? 33.140  12.619 43.685 1.00 89.73  ? 746 ASN A CG  1 
ATOM   1366 O OD1 . ASN A 1 180 ? 32.305  13.346 43.148 1.00 93.70  ? 746 ASN A OD1 1 
ATOM   1367 N ND2 . ASN A 1 180 ? 33.052  12.242 44.956 1.00 91.17  ? 746 ASN A ND2 1 
ATOM   1368 N N   . THR A 1 181 ? 35.190  10.009 40.145 1.00 73.30  ? 747 THR A N   1 
ATOM   1369 C CA  . THR A 1 181 ? 35.911  10.014 38.871 1.00 68.16  ? 747 THR A CA  1 
ATOM   1370 C C   . THR A 1 181 ? 35.084  9.668  37.632 1.00 68.43  ? 747 THR A C   1 
ATOM   1371 O O   . THR A 1 181 ? 35.643  9.458  36.556 1.00 70.50  ? 747 THR A O   1 
ATOM   1372 C CB  . THR A 1 181 ? 37.205  9.174  38.917 1.00 69.46  ? 747 THR A CB  1 
ATOM   1373 O OG1 . THR A 1 181 ? 36.923  7.888  39.481 1.00 78.20  ? 747 THR A OG1 1 
ATOM   1374 C CG2 . THR A 1 181 ? 38.257  9.884  39.758 1.00 71.36  ? 747 THR A CG2 1 
ATOM   1375 N N   . GLY A 1 182 ? 33.771  9.544  37.792 1.00 66.13  ? 748 GLY A N   1 
ATOM   1376 C CA  . GLY A 1 182 ? 32.914  9.169  36.677 1.00 54.09  ? 748 GLY A CA  1 
ATOM   1377 C C   . GLY A 1 182 ? 33.189  9.983  35.420 1.00 47.12  ? 748 GLY A C   1 
ATOM   1378 O O   . GLY A 1 182 ? 33.539  11.164 35.478 1.00 44.81  ? 748 GLY A O   1 
ATOM   1379 N N   . GLU A 1 183 ? 33.089  9.332  34.268 1.00 43.08  ? 749 GLU A N   1 
ATOM   1380 C CA  . GLU A 1 183 ? 33.327  10.014 33.006 1.00 45.31  ? 749 GLU A CA  1 
ATOM   1381 C C   . GLU A 1 183 ? 32.183  9.797  32.025 1.00 40.49  ? 749 GLU A C   1 
ATOM   1382 O O   . GLU A 1 183 ? 31.420  8.838  32.132 1.00 48.24  ? 749 GLU A O   1 
ATOM   1383 C CB  . GLU A 1 183 ? 34.667  9.579  32.382 1.00 40.32  ? 749 GLU A CB  1 
ATOM   1384 C CG  . GLU A 1 183 ? 34.826  8.086  32.208 1.00 50.22  ? 749 GLU A CG  1 
ATOM   1385 C CD  . GLU A 1 183 ? 36.180  7.689  31.621 1.00 58.12  ? 749 GLU A CD  1 
ATOM   1386 O OE1 . GLU A 1 183 ? 36.190  6.862  30.691 1.00 61.92  ? 749 GLU A OE1 1 
ATOM   1387 O OE2 . GLU A 1 183 ? 37.229  8.186  32.088 1.00 51.02  ? 749 GLU A OE2 1 
ATOM   1388 N N   . LEU A 1 184 ? 32.063  10.723 31.086 1.00 29.83  ? 750 LEU A N   1 
ATOM   1389 C CA  . LEU A 1 184 ? 31.150  10.578 29.966 1.00 37.70  ? 750 LEU A CA  1 
ATOM   1390 C C   . LEU A 1 184 ? 31.891  9.898  28.805 1.00 39.53  ? 750 LEU A C   1 
ATOM   1391 O O   . LEU A 1 184 ? 32.941  10.373 28.371 1.00 38.88  ? 750 LEU A O   1 
ATOM   1392 C CB  . LEU A 1 184 ? 30.632  11.952 29.541 1.00 37.31  ? 750 LEU A CB  1 
ATOM   1393 C CG  . LEU A 1 184 ? 29.727  12.685 30.537 1.00 38.41  ? 750 LEU A CG  1 
ATOM   1394 C CD1 . LEU A 1 184 ? 29.557  14.145 30.156 1.00 33.14  ? 750 LEU A CD1 1 
ATOM   1395 C CD2 . LEU A 1 184 ? 28.365  12.005 30.632 1.00 44.92  ? 750 LEU A CD2 1 
ATOM   1396 N N   . ARG A 1 185 ? 31.362  8.777  28.322 1.00 30.93  ? 751 ARG A N   1 
ATOM   1397 C CA  . ARG A 1 185 ? 31.991  8.047  27.229 1.00 33.95  ? 751 ARG A CA  1 
ATOM   1398 C C   . ARG A 1 185 ? 31.102  8.011  25.985 1.00 33.38  ? 751 ARG A C   1 
ATOM   1399 O O   . ARG A 1 185 ? 29.887  7.892  26.080 1.00 33.06  ? 751 ARG A O   1 
ATOM   1400 C CB  . ARG A 1 185 ? 32.315  6.627  27.671 1.00 33.00  ? 751 ARG A CB  1 
ATOM   1401 C CG  . ARG A 1 185 ? 33.111  6.578  28.946 1.00 36.86  ? 751 ARG A CG  1 
ATOM   1402 C CD  . ARG A 1 185 ? 33.250  5.176  29.466 1.00 44.89  ? 751 ARG A CD  1 
ATOM   1403 N NE  . ARG A 1 185 ? 34.220  5.144  30.556 1.00 62.10  ? 751 ARG A NE  1 
ATOM   1404 C CZ  . ARG A 1 185 ? 34.514  4.065  31.278 1.00 65.41  ? 751 ARG A CZ  1 
ATOM   1405 N NH1 . ARG A 1 185 ? 33.912  2.907  31.032 1.00 59.92  ? 751 ARG A NH1 1 
ATOM   1406 N NH2 . ARG A 1 185 ? 35.414  4.150  32.249 1.00 67.90  ? 751 ARG A NH2 1 
ATOM   1407 N N   . SER A 1 186 ? 31.703  8.107  24.812 1.00 29.53  ? 752 SER A N   1 
ATOM   1408 C CA  . SER A 1 186 ? 30.908  8.032  23.591 1.00 29.70  ? 752 SER A CA  1 
ATOM   1409 C C   . SER A 1 186 ? 30.446  6.591  23.361 1.00 28.99  ? 752 SER A C   1 
ATOM   1410 O O   . SER A 1 186 ? 31.182  5.633  23.644 1.00 27.21  ? 752 SER A O   1 
ATOM   1411 C CB  . SER A 1 186 ? 31.721  8.530  22.400 1.00 29.19  ? 752 SER A CB  1 
ATOM   1412 O OG  . SER A 1 186 ? 32.913  7.768  22.256 1.00 33.78  ? 752 SER A OG  1 
ATOM   1413 N N   . VAL A 1 187 ? 29.222  6.440  22.869 1.00 23.67  ? 753 VAL A N   1 
ATOM   1414 C CA  . VAL A 1 187 ? 28.678  5.123  22.531 1.00 25.27  ? 753 VAL A CA  1 
ATOM   1415 C C   . VAL A 1 187 ? 28.236  5.122  21.062 1.00 28.43  ? 753 VAL A C   1 
ATOM   1416 O O   . VAL A 1 187 ? 28.384  6.129  20.359 1.00 26.08  ? 753 VAL A O   1 
ATOM   1417 C CB  . VAL A 1 187 ? 27.496  4.727  23.460 1.00 27.73  ? 753 VAL A CB  1 
ATOM   1418 C CG1 . VAL A 1 187 ? 27.998  4.385  24.885 1.00 32.19  ? 753 VAL A CG1 1 
ATOM   1419 C CG2 . VAL A 1 187 ? 26.456  5.844  23.521 1.00 30.09  ? 753 VAL A CG2 1 
ATOM   1420 N N   . ILE A 1 188 ? 27.680  4.001  20.616 1.00 29.29  ? 754 ILE A N   1 
ATOM   1421 C CA  . ILE A 1 188 ? 27.282  3.816  19.217 1.00 35.69  ? 754 ILE A CA  1 
ATOM   1422 C C   . ILE A 1 188 ? 26.397  4.943  18.657 1.00 38.02  ? 754 ILE A C   1 
ATOM   1423 O O   . ILE A 1 188 ? 26.581  5.357  17.512 1.00 35.76  ? 754 ILE A O   1 
ATOM   1424 C CB  . ILE A 1 188 ? 26.623  2.414  18.984 1.00 37.08  ? 754 ILE A CB  1 
ATOM   1425 C CG1 . ILE A 1 188 ? 26.330  2.179  17.501 1.00 45.64  ? 754 ILE A CG1 1 
ATOM   1426 C CG2 . ILE A 1 188 ? 25.357  2.263  19.799 1.00 43.32  ? 754 ILE A CG2 1 
ATOM   1427 C CD1 . ILE A 1 188 ? 27.565  2.256  16.615 1.00 51.41  ? 754 ILE A CD1 1 
ATOM   1428 N N   . HIS A 1 189 ? 25.451  5.434  19.460 1.00 32.44  ? 755 HIS A N   1 
ATOM   1429 C CA  . HIS A 1 189 ? 24.516  6.477  19.013 1.00 29.40  ? 755 HIS A CA  1 
ATOM   1430 C C   . HIS A 1 189 ? 24.907  7.916  19.377 1.00 32.28  ? 755 HIS A C   1 
ATOM   1431 O O   . HIS A 1 189 ? 24.153  8.854  19.100 1.00 30.76  ? 755 HIS A O   1 
ATOM   1432 C CB  . HIS A 1 189 ? 23.094  6.176  19.501 1.00 34.27  ? 755 HIS A CB  1 
ATOM   1433 C CG  . HIS A 1 189 ? 22.563  4.856  19.038 1.00 27.74  ? 755 HIS A CG  1 
ATOM   1434 N ND1 . HIS A 1 189 ? 22.009  3.935  19.899 1.00 32.63  ? 755 HIS A ND1 1 
ATOM   1435 C CD2 . HIS A 1 189 ? 22.497  4.302  17.805 1.00 28.52  ? 755 HIS A CD2 1 
ATOM   1436 C CE1 . HIS A 1 189 ? 21.629  2.867  19.219 1.00 32.32  ? 755 HIS A CE1 1 
ATOM   1437 N NE2 . HIS A 1 189 ? 21.907  3.068  17.943 1.00 31.32  ? 755 HIS A NE2 1 
ATOM   1438 N N   . SER A 1 190 ? 26.074  8.096  19.991 1.00 33.64  ? 756 SER A N   1 
ATOM   1439 C CA  . SER A 1 190 ? 26.531  9.431  20.399 1.00 28.04  ? 756 SER A CA  1 
ATOM   1440 C C   . SER A 1 190 ? 26.603  10.445 19.256 1.00 32.43  ? 756 SER A C   1 
ATOM   1441 O O   . SER A 1 190 ? 26.905  10.112 18.109 1.00 31.58  ? 756 SER A O   1 
ATOM   1442 C CB  . SER A 1 190 ? 27.896  9.355  21.091 1.00 25.02  ? 756 SER A CB  1 
ATOM   1443 O OG  . SER A 1 190 ? 27.808  8.605  22.284 1.00 28.17  ? 756 SER A OG  1 
ATOM   1444 N N   . HIS A 1 191 ? 26.322  11.696 19.587 1.00 30.93  ? 757 HIS A N   1 
ATOM   1445 C CA  . HIS A 1 191 ? 26.420  12.786 18.635 1.00 20.26  ? 757 HIS A CA  1 
ATOM   1446 C C   . HIS A 1 191 ? 27.059  13.995 19.303 1.00 26.64  ? 757 HIS A C   1 
ATOM   1447 O O   . HIS A 1 191 ? 26.764  14.317 20.454 1.00 24.83  ? 757 HIS A O   1 
ATOM   1448 C CB  . HIS A 1 191 ? 25.035  13.161 18.098 1.00 23.81  ? 757 HIS A CB  1 
ATOM   1449 C CG  . HIS A 1 191 ? 25.048  14.328 17.156 1.00 28.42  ? 757 HIS A CG  1 
ATOM   1450 N ND1 . HIS A 1 191 ? 25.013  15.638 17.588 1.00 36.50  ? 757 HIS A ND1 1 
ATOM   1451 C CD2 . HIS A 1 191 ? 25.112  14.383 15.802 1.00 36.67  ? 757 HIS A CD2 1 
ATOM   1452 C CE1 . HIS A 1 191 ? 25.046  16.448 16.544 1.00 39.26  ? 757 HIS A CE1 1 
ATOM   1453 N NE2 . HIS A 1 191 ? 25.105  15.712 15.448 1.00 34.20  ? 757 HIS A NE2 1 
ATOM   1454 N N   . ILE A 1 192 ? 27.944  14.659 18.574 1.00 30.16  ? 758 ILE A N   1 
ATOM   1455 C CA  . ILE A 1 192 ? 28.553  15.883 19.062 1.00 32.98  ? 758 ILE A CA  1 
ATOM   1456 C C   . ILE A 1 192 ? 28.295  17.000 18.060 1.00 32.84  ? 758 ILE A C   1 
ATOM   1457 O O   . ILE A 1 192 ? 28.388  16.791 16.855 1.00 27.45  ? 758 ILE A O   1 
ATOM   1458 C CB  . ILE A 1 192 ? 30.074  15.736 19.205 1.00 32.36  ? 758 ILE A CB  1 
ATOM   1459 C CG1 . ILE A 1 192 ? 30.420  14.655 20.229 1.00 31.28  ? 758 ILE A CG1 1 
ATOM   1460 C CG2 . ILE A 1 192 ? 30.696  17.062 19.606 1.00 28.32  ? 758 ILE A CG2 1 
ATOM   1461 C CD1 . ILE A 1 192 ? 31.884  14.644 20.591 1.00 30.01  ? 758 ILE A CD1 1 
ATOM   1462 N N   . LYS A 1 193 ? 27.951  18.177 18.564 1.00 30.79  ? 759 LYS A N   1 
ATOM   1463 C CA  . LYS A 1 193 ? 28.038  19.382 17.763 1.00 30.69  ? 759 LYS A CA  1 
ATOM   1464 C C   . LYS A 1 193 ? 28.992  20.321 18.492 1.00 35.06  ? 759 LYS A C   1 
ATOM   1465 O O   . LYS A 1 193 ? 28.804  20.621 19.668 1.00 39.77  ? 759 LYS A O   1 
ATOM   1466 C CB  . LYS A 1 193 ? 26.671  20.044 17.578 1.00 29.68  ? 759 LYS A CB  1 
ATOM   1467 C CG  . LYS A 1 193 ? 26.720  21.313 16.731 1.00 41.28  ? 759 LYS A CG  1 
ATOM   1468 C CD  . LYS A 1 193 ? 25.356  21.991 16.672 1.00 56.52  ? 759 LYS A CD  1 
ATOM   1469 C CE  . LYS A 1 193 ? 25.392  23.382 17.305 1.00 68.81  ? 759 LYS A CE  1 
ATOM   1470 N NZ  . LYS A 1 193 ? 24.020  23.943 17.538 1.00 78.73  ? 759 LYS A NZ  1 
ATOM   1471 N N   . VAL A 1 194 ? 30.025  20.774 17.796 1.00 37.45  ? 760 VAL A N   1 
ATOM   1472 C CA  . VAL A 1 194 ? 30.995  21.670 18.398 1.00 34.75  ? 760 VAL A CA  1 
ATOM   1473 C C   . VAL A 1 194 ? 30.518  23.108 18.271 1.00 40.11  ? 760 VAL A C   1 
ATOM   1474 O O   . VAL A 1 194 ? 30.162  23.565 17.182 1.00 46.26  ? 760 VAL A O   1 
ATOM   1475 C CB  . VAL A 1 194 ? 32.381  21.528 17.734 1.00 37.03  ? 760 VAL A CB  1 
ATOM   1476 C CG1 . VAL A 1 194 ? 33.372  22.576 18.284 1.00 35.32  ? 760 VAL A CG1 1 
ATOM   1477 C CG2 . VAL A 1 194 ? 32.911  20.120 17.920 1.00 48.22  ? 760 VAL A CG2 1 
ATOM   1478 N N   . ILE A 1 195 ? 30.512  23.821 19.388 1.00 39.39  ? 761 ILE A N   1 
ATOM   1479 C CA  . ILE A 1 195 ? 30.265  25.249 19.351 1.00 42.38  ? 761 ILE A CA  1 
ATOM   1480 C C   . ILE A 1 195 ? 31.584  25.998 19.489 1.00 45.52  ? 761 ILE A C   1 
ATOM   1481 O O   . ILE A 1 195 ? 32.172  26.046 20.570 1.00 44.60  ? 761 ILE A O   1 
ATOM   1482 C CB  . ILE A 1 195 ? 29.314  25.651 20.484 1.00 47.38  ? 761 ILE A CB  1 
ATOM   1483 C CG1 . ILE A 1 195 ? 28.018  24.840 20.374 1.00 43.44  ? 761 ILE A CG1 1 
ATOM   1484 C CG2 . ILE A 1 195 ? 29.061  27.156 20.466 1.00 48.20  ? 761 ILE A CG2 1 
ATOM   1485 C CD1 . ILE A 1 195 ? 27.068  25.052 21.520 1.00 44.25  ? 761 ILE A CD1 1 
ATOM   1486 N N   . LYS A 1 196 ? 32.021  26.607 18.387 1.00 55.18  ? 762 LYS A N   1 
ATOM   1487 C CA  . LYS A 1 196 ? 33.273  27.368 18.346 1.00 67.06  ? 762 LYS A CA  1 
ATOM   1488 C C   . LYS A 1 196 ? 33.111  28.725 19.017 1.00 69.88  ? 762 LYS A C   1 
ATOM   1489 O O   . LYS A 1 196 ? 32.206  29.487 18.679 1.00 73.27  ? 762 LYS A O   1 
ATOM   1490 C CB  . LYS A 1 196 ? 33.736  27.564 16.897 1.00 67.01  ? 762 LYS A CB  1 
ATOM   1491 C CG  . LYS A 1 196 ? 34.452  26.364 16.297 1.00 69.58  ? 762 LYS A CG  1 
ATOM   1492 C CD  . LYS A 1 196 ? 35.855  26.211 16.879 1.00 78.57  ? 762 LYS A CD  1 
ATOM   1493 C CE  . LYS A 1 196 ? 36.554  24.960 16.349 1.00 75.52  ? 762 LYS A CE  1 
ATOM   1494 N NZ  . LYS A 1 196 ? 37.922  24.790 16.921 1.00 71.91  ? 762 LYS A NZ  1 
ATOM   1495 N N   . THR A 1 197 ? 33.992  29.034 19.961 1.00 74.10  ? 763 THR A N   1 
ATOM   1496 C CA  . THR A 1 197 ? 33.858  30.268 20.730 1.00 83.82  ? 763 THR A CA  1 
ATOM   1497 C C   . THR A 1 197 ? 34.892  31.325 20.348 1.00 93.89  ? 763 THR A C   1 
ATOM   1498 O O   . THR A 1 197 ? 34.562  32.317 19.698 1.00 100.17 ? 763 THR A O   1 
ATOM   1499 C CB  . THR A 1 197 ? 33.960  29.995 22.235 1.00 78.79  ? 763 THR A CB  1 
ATOM   1500 O OG1 . THR A 1 197 ? 35.226  29.386 22.514 1.00 78.54  ? 763 THR A OG1 1 
ATOM   1501 C CG2 . THR A 1 197 ? 32.834  29.063 22.688 1.00 71.45  ? 763 THR A CG2 1 
HETATM 1502 O O   . HOH B 2 .   ? 40.666  16.445 15.480 1.00 36.30  ? 1   HOH A O   1 
HETATM 1503 O O   . HOH B 2 .   ? 32.761  12.818 13.587 1.00 48.79  ? 2   HOH A O   1 
HETATM 1504 O O   . HOH B 2 .   ? 41.979  16.053 17.724 1.00 27.07  ? 3   HOH A O   1 
HETATM 1505 O O   . HOH B 2 .   ? 24.096  4.417  21.874 1.00 35.03  ? 4   HOH A O   1 
HETATM 1506 O O   . HOH B 2 .   ? 27.482  3.346  32.436 1.00 39.77  ? 5   HOH A O   1 
HETATM 1507 O O   . HOH B 2 .   ? 22.121  4.586  24.409 1.00 45.54  ? 6   HOH A O   1 
HETATM 1508 O O   . HOH B 2 .   ? 28.308  13.520 15.577 1.00 43.29  ? 7   HOH A O   1 
HETATM 1509 O O   . HOH B 2 .   ? 26.347  7.052  3.493  1.00 43.78  ? 8   HOH A O   1 
HETATM 1510 O O   . HOH B 2 .   ? 39.250  17.596 18.523 1.00 40.00  ? 9   HOH A O   1 
HETATM 1511 O O   . HOH B 2 .   ? 36.184  12.112 34.635 1.00 40.43  ? 10  HOH A O   1 
HETATM 1512 O O   . HOH B 2 .   ? 41.866  15.617 29.535 1.00 48.75  ? 11  HOH A O   1 
HETATM 1513 O O   . HOH B 2 .   ? 0.000   0.000  13.490 0.50 39.01  ? 12  HOH A O   1 
HETATM 1514 O O   . HOH B 2 .   ? 30.838  2.783  19.724 1.00 48.79  ? 13  HOH A O   1 
HETATM 1515 O O   . HOH B 2 .   ? 48.064  10.069 20.810 1.00 36.97  ? 14  HOH A O   1 
HETATM 1516 O O   . HOH B 2 .   ? 33.875  19.481 14.242 1.00 47.29  ? 15  HOH A O   1 
HETATM 1517 O O   . HOH B 2 .   ? 31.624  3.582  25.362 1.00 40.03  ? 16  HOH A O   1 
HETATM 1518 O O   . HOH B 2 .   ? 31.598  0.888  4.336  1.00 51.36  ? 17  HOH A O   1 
HETATM 1519 O O   . HOH B 2 .   ? 16.346  21.455 15.707 1.00 45.78  ? 18  HOH A O   1 
HETATM 1520 O O   . HOH B 2 .   ? 37.709  29.052 30.917 1.00 52.38  ? 19  HOH A O   1 
HETATM 1521 O O   . HOH B 2 .   ? 40.606  18.956 13.897 1.00 32.38  ? 20  HOH A O   1 
HETATM 1522 O O   . HOH B 2 .   ? 43.987  5.625  25.244 1.00 36.76  ? 21  HOH A O   1 
HETATM 1523 O O   . HOH B 2 .   ? 4.025   6.357  9.657  1.00 40.55  ? 22  HOH A O   1 
HETATM 1524 O O   . HOH B 2 .   ? 44.300  12.563 29.902 1.00 46.41  ? 23  HOH A O   1 
HETATM 1525 O O   . HOH B 2 .   ? 25.750  1.255  26.155 1.00 44.30  ? 24  HOH A O   1 
HETATM 1526 O O   . HOH B 2 .   ? 15.618  -0.621 28.393 1.00 45.65  ? 25  HOH A O   1 
HETATM 1527 O O   . HOH B 2 .   ? 30.229  27.561 16.336 1.00 49.59  ? 26  HOH A O   1 
HETATM 1528 O O   . HOH B 2 .   ? 19.475  0.526  20.291 1.00 45.12  ? 27  HOH A O   1 
HETATM 1529 O O   . HOH B 2 .   ? 19.437  7.120  30.868 1.00 45.06  ? 28  HOH A O   1 
HETATM 1530 O O   . HOH B 2 .   ? 14.464  22.763 23.888 1.00 51.84  ? 29  HOH A O   1 
HETATM 1531 O O   . HOH B 2 .   ? 27.217  21.925 33.636 1.00 43.69  ? 30  HOH A O   1 
HETATM 1532 O O   . HOH B 2 .   ? 20.794  14.349 30.274 1.00 57.13  ? 31  HOH A O   1 
HETATM 1533 O O   . HOH B 2 .   ? 38.846  27.354 36.067 1.00 59.20  ? 32  HOH A O   1 
HETATM 1534 O O   . HOH B 2 .   ? 22.137  1.115  6.146  1.00 60.15  ? 33  HOH A O   1 
HETATM 1535 O O   . HOH B 2 .   ? 12.150  13.683 5.291  1.00 63.05  ? 34  HOH A O   1 
HETATM 1536 O O   . HOH B 2 .   ? 19.028  -0.093 15.965 1.00 56.92  ? 35  HOH A O   1 
HETATM 1537 O O   . HOH B 2 .   ? 32.568  5.071  14.690 1.00 31.38  ? 36  HOH A O   1 
HETATM 1538 O O   . HOH B 2 .   ? 39.004  5.513  17.727 1.00 34.51  ? 37  HOH A O   1 
HETATM 1539 O O   . HOH B 2 .   ? 24.622  16.976 20.045 1.00 30.81  ? 38  HOH A O   1 
HETATM 1540 O O   . HOH B 2 .   ? 34.880  -5.734 9.704  1.00 31.19  ? 39  HOH A O   1 
HETATM 1541 O O   . HOH B 2 .   ? 37.801  14.124 19.284 1.00 34.26  ? 40  HOH A O   1 
HETATM 1542 O O   . HOH B 2 .   ? 18.061  3.366  23.031 1.00 36.67  ? 41  HOH A O   1 
HETATM 1543 O O   . HOH B 2 .   ? 2.919   1.037  13.291 1.00 41.54  ? 42  HOH A O   1 
HETATM 1544 O O   . HOH B 2 .   ? 46.918  15.991 22.754 1.00 41.61  ? 43  HOH A O   1 
HETATM 1545 O O   . HOH B 2 .   ? 19.267  3.433  10.114 1.00 33.52  ? 44  HOH A O   1 
HETATM 1546 O O   . HOH B 2 .   ? 29.892  11.252 13.779 1.00 34.22  ? 45  HOH A O   1 
HETATM 1547 O O   . HOH B 2 .   ? 17.719  11.567 21.534 1.00 39.13  ? 46  HOH A O   1 
HETATM 1548 O O   . HOH B 2 .   ? 8.850   5.030  10.093 1.00 39.38  ? 47  HOH A O   1 
HETATM 1549 O O   . HOH B 2 .   ? 30.954  6.292  18.551 1.00 52.95  ? 48  HOH A O   1 
HETATM 1550 O O   . HOH B 2 .   ? 41.718  10.022 19.163 1.00 34.06  ? 49  HOH A O   1 
HETATM 1551 O O   . HOH B 2 .   ? 3.843   28.065 30.415 1.00 40.85  ? 50  HOH A O   1 
HETATM 1552 O O   . HOH B 2 .   ? 34.228  15.004 11.295 0.50 57.41  ? 51  HOH A O   1 
HETATM 1553 O O   . HOH B 2 .   ? 30.458  20.164 15.184 1.00 49.86  ? 52  HOH A O   1 
HETATM 1554 O O   . HOH B 2 .   ? 30.216  3.188  27.413 1.00 45.73  ? 53  HOH A O   1 
HETATM 1555 O O   . HOH B 2 .   ? 27.849  1.641  22.192 1.00 40.60  ? 54  HOH A O   1 
HETATM 1556 O O   . HOH B 2 .   ? 20.474  3.621  7.758  1.00 47.14  ? 55  HOH A O   1 
HETATM 1557 O O   . HOH B 2 .   ? 22.457  11.465 34.656 1.00 48.55  ? 56  HOH A O   1 
HETATM 1558 O O   . HOH B 2 .   ? 21.864  0.736  16.535 1.00 51.18  ? 57  HOH A O   1 
HETATM 1559 O O   . HOH B 2 .   ? 35.963  4.887  26.454 1.00 52.17  ? 58  HOH A O   1 
HETATM 1560 O O   . HOH B 2 .   ? 23.171  18.904 15.517 1.00 46.36  ? 59  HOH A O   1 
HETATM 1561 O O   . HOH B 2 .   ? 16.668  5.643  7.474  1.00 51.28  ? 60  HOH A O   1 
HETATM 1562 O O   . HOH B 2 .   ? -3.339  6.024  24.675 1.00 56.88  ? 61  HOH A O   1 
HETATM 1563 O O   . HOH B 2 .   ? -0.583  2.457  20.290 1.00 45.14  ? 62  HOH A O   1 
HETATM 1564 O O   . HOH B 2 .   ? 42.859  10.709 16.955 1.00 39.34  ? 63  HOH A O   1 
HETATM 1565 O O   . HOH B 2 .   ? 45.174  9.651  17.289 1.00 40.06  ? 64  HOH A O   1 
HETATM 1566 O O   . HOH B 2 .   ? 40.397  14.036 18.554 1.00 44.91  ? 65  HOH A O   1 
HETATM 1567 O O   . HOH B 2 .   ? 31.457  7.805  10.154 1.00 33.16  ? 66  HOH A O   1 
HETATM 1568 O O   . HOH B 2 .   ? 31.276  7.537  7.651  1.00 47.51  ? 67  HOH A O   1 
HETATM 1569 O O   . HOH B 2 .   ? 35.155  6.349  24.386 1.00 54.33  ? 68  HOH A O   1 
HETATM 1570 O O   . HOH B 2 .   ? 43.908  1.084  24.532 1.00 59.85  ? 69  HOH A O   1 
HETATM 1571 O O   . HOH B 2 .   ? 37.999  2.863  19.711 1.00 55.16  ? 70  HOH A O   1 
HETATM 1572 O O   . HOH B 2 .   ? 42.038  4.847  27.139 1.00 56.16  ? 71  HOH A O   1 
HETATM 1573 O O   . HOH B 2 .   ? -2.029  20.042 26.078 1.00 58.99  ? 72  HOH A O   1 
HETATM 1574 O O   . HOH B 2 .   ? 18.288  16.226 20.717 1.00 59.42  ? 73  HOH A O   1 
HETATM 1575 O O   . HOH B 2 .   ? 20.032  18.640 27.879 1.00 63.10  ? 74  HOH A O   1 
HETATM 1576 O O   . HOH B 2 .   ? 22.354  24.156 28.404 1.00 54.16  ? 75  HOH A O   1 
HETATM 1577 O O   . HOH B 2 .   ? 22.859  18.910 18.490 1.00 57.36  ? 76  HOH A O   1 
HETATM 1578 O O   . HOH B 2 .   ? 28.001  23.087 31.461 1.00 40.66  ? 77  HOH A O   1 
HETATM 1579 O O   . HOH B 2 .   ? 34.275  22.286 14.240 1.00 64.03  ? 78  HOH A O   1 
HETATM 1580 O O   . HOH B 2 .   ? 9.468   -1.334 23.818 1.00 50.93  ? 79  HOH A O   1 
HETATM 1581 O O   . HOH B 2 .   ? 7.079   23.218 33.046 1.00 63.14  ? 80  HOH A O   1 
HETATM 1582 O O   . HOH B 2 .   ? 31.575  15.920 42.646 1.00 61.86  ? 81  HOH A O   1 
HETATM 1583 O O   . HOH B 2 .   ? 22.030  24.866 30.922 1.00 55.51  ? 82  HOH A O   1 
HETATM 1584 O O   . HOH B 2 .   ? 38.155  10.043 33.507 1.00 63.83  ? 83  HOH A O   1 
HETATM 1585 O O   . HOH B 2 .   ? 45.088  3.478  23.880 1.00 38.50  ? 84  HOH A O   1 
HETATM 1586 O O   . HOH B 2 .   ? 30.240  4.120  15.643 1.00 47.26  ? 85  HOH A O   1 
HETATM 1587 O O   . HOH B 2 .   ? 18.970  5.275  6.231  1.00 58.69  ? 86  HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 9   ? 1.0451 0.8728 1.4166 0.0908  0.1255  -0.1678 575 SER A N   
2    C CA  . SER A 9   ? 1.0331 0.8905 1.4196 0.0833  0.0930  -0.1727 575 SER A CA  
3    C C   . SER A 9   ? 1.0054 0.8877 1.4606 0.0694  0.0944  -0.1824 575 SER A C   
4    O O   . SER A 9   ? 0.8709 0.7836 1.3833 0.0547  0.0774  -0.1903 575 SER A O   
5    C CB  . SER A 9   ? 0.9243 0.7996 1.3185 0.0749  0.0675  -0.1723 575 SER A CB  
6    O OG  . SER A 9   ? 0.7993 0.6837 1.1618 0.0793  0.0433  -0.1695 575 SER A OG  
7    N N   . ASP A 10  ? 1.0643 0.9323 1.5099 0.0774  0.1146  -0.1826 576 ASP A N   
8    C CA  . ASP A 10  ? 0.9958 0.8813 1.4920 0.0689  0.1182  -0.1908 576 ASP A CA  
9    C C   . ASP A 10  ? 0.7732 0.6878 1.2819 0.0631  0.0833  -0.1956 576 ASP A C   
10   O O   . ASP A 10  ? 0.7871 0.6986 1.2496 0.0714  0.0663  -0.1911 576 ASP A O   
11   C CB  . ASP A 10  ? 1.1161 0.9757 1.5715 0.0861  0.1409  -0.1878 576 ASP A CB  
12   C CG  . ASP A 10  ? 1.1750 1.0504 1.6639 0.0818  0.1387  -0.1956 576 ASP A CG  
13   O OD1 . ASP A 10  ? 1.2078 1.0980 1.7647 0.0666  0.1506  -0.2021 576 ASP A OD1 
14   O OD2 . ASP A 10  ? 1.2051 1.0778 1.6539 0.0941  0.1258  -0.1960 576 ASP A OD2 
15   N N   . LEU A 11  ? 0.5666 0.5101 1.1428 0.0486  0.0737  -0.2054 577 LEU A N   
16   C CA  . LEU A 11  ? 0.4548 0.4255 1.0482 0.0443  0.0422  -0.2101 577 LEU A CA  
17   C C   . LEU A 11  ? 0.5379 0.5031 1.1054 0.0518  0.0415  -0.2092 577 LEU A C   
18   O O   . LEU A 11  ? 0.6134 0.5675 1.1859 0.0551  0.0629  -0.2117 577 LEU A O   
19   C CB  . LEU A 11  ? 0.4360 0.4372 1.1089 0.0306  0.0323  -0.2234 577 LEU A CB  
20   C CG  . LEU A 11  ? 0.3335 0.3605 1.0262 0.0281  -0.0010 -0.2291 577 LEU A CG  
21   C CD1 . LEU A 11  ? 0.3548 0.4070 1.1060 0.0202  -0.0193 -0.2419 577 LEU A CD1 
22   C CD2 . LEU A 11  ? 0.3365 0.3674 1.0437 0.0278  0.0010  -0.2335 577 LEU A CD2 
23   N N   . LYS A 12  ? 0.4981 0.4711 1.0401 0.0548  0.0179  -0.2060 578 LYS A N   
24   C CA  . LYS A 12  ? 0.4065 0.3784 0.9339 0.0602  0.0149  -0.2075 578 LYS A CA  
25   C C   . LYS A 12  ? 0.4016 0.4000 0.9673 0.0518  -0.0098 -0.2124 578 LYS A C   
26   O O   . LYS A 12  ? 0.4756 0.4861 1.0468 0.0482  -0.0298 -0.2104 578 LYS A O   
27   C CB  . LYS A 12  ? 0.4610 0.4168 0.9300 0.0722  0.0121  -0.2021 578 LYS A CB  
28   C CG  . LYS A 12  ? 0.5233 0.4524 0.9442 0.0828  0.0282  -0.1953 578 LYS A CG  
29   C CD  . LYS A 12  ? 0.5565 0.4569 0.9310 0.1013  0.0494  -0.1952 578 LYS A CD  
30   C CE  . LYS A 12  ? 0.6107 0.4864 0.9215 0.1172  0.0535  -0.1887 578 LYS A CE  
31   N NZ  . LYS A 12  ? 0.7983 0.6408 1.0563 0.1417  0.0772  -0.1877 578 LYS A NZ  
32   N N   . GLU A 13  ? 0.3461 0.3500 0.9342 0.0507  -0.0076 -0.2185 579 GLU A N   
33   C CA  . GLU A 13  ? 0.4386 0.4612 1.0557 0.0457  -0.0287 -0.2226 579 GLU A CA  
34   C C   . GLU A 13  ? 0.4060 0.4235 0.9946 0.0516  -0.0337 -0.2208 579 GLU A C   
35   O O   . GLU A 13  ? 0.4178 0.4239 0.9903 0.0582  -0.0197 -0.2237 579 GLU A O   
36   C CB  . GLU A 13  ? 0.5830 0.6143 1.2456 0.0406  -0.0221 -0.2317 579 GLU A CB  
37   C CG  . GLU A 13  ? 0.6945 0.7434 1.3939 0.0352  -0.0442 -0.2374 579 GLU A CG  
38   C CD  . GLU A 13  ? 0.7376 0.7958 1.4886 0.0296  -0.0374 -0.2493 579 GLU A CD  
39   O OE1 . GLU A 13  ? 0.6633 0.7139 1.4134 0.0317  -0.0187 -0.2511 579 GLU A OE1 
40   O OE2 . GLU A 13  ? 0.7656 0.8369 1.5569 0.0242  -0.0511 -0.2582 579 GLU A OE2 
41   N N   . VAL A 14  ? 0.3430 0.3672 0.9253 0.0505  -0.0530 -0.2170 580 VAL A N   
42   C CA  . VAL A 14  ? 0.3943 0.4155 0.9568 0.0548  -0.0577 -0.2169 580 VAL A CA  
43   C C   . VAL A 14  ? 0.3007 0.3314 0.8826 0.0509  -0.0749 -0.2159 580 VAL A C   
44   O O   . VAL A 14  ? 0.4735 0.5084 1.0683 0.0478  -0.0858 -0.2125 580 VAL A O   
45   C CB  . VAL A 14  ? 0.3643 0.3757 0.8851 0.0603  -0.0575 -0.2115 580 VAL A CB  
46   C CG1 . VAL A 14  ? 0.3400 0.3336 0.8313 0.0678  -0.0375 -0.2113 580 VAL A CG1 
47   C CG2 . VAL A 14  ? 0.3182 0.3344 0.8371 0.0565  -0.0704 -0.2040 580 VAL A CG2 
48   N N   . MET A 15  ? 0.3091 0.3400 0.8912 0.0527  -0.0763 -0.2196 581 MET A N   
49   C CA  . MET A 15  ? 0.2975 0.3319 0.8928 0.0502  -0.0884 -0.2169 581 MET A CA  
50   C C   . MET A 15  ? 0.4142 0.4460 0.9870 0.0522  -0.0924 -0.2138 581 MET A C   
51   O O   . MET A 15  ? 0.3625 0.3919 0.9152 0.0568  -0.0877 -0.2191 581 MET A O   
52   C CB  . MET A 15  ? 0.3527 0.3908 0.9733 0.0496  -0.0871 -0.2247 581 MET A CB  
53   C CG  . MET A 15  ? 0.3976 0.4353 1.0356 0.0474  -0.0955 -0.2206 581 MET A CG  
54   S SD  . MET A 15  ? 0.7547 0.7963 1.4248 0.0466  -0.0937 -0.2302 581 MET A SD  
55   C CE  . MET A 15  ? 1.1278 1.1733 1.7837 0.0501  -0.0919 -0.2414 581 MET A CE  
56   N N   . VAL A 16  ? 0.4420 0.4717 1.0158 0.0504  -0.1006 -0.2056 582 VAL A N   
57   C CA  . VAL A 16  ? 0.3813 0.4091 0.9412 0.0512  -0.1039 -0.2028 582 VAL A CA  
58   C C   . VAL A 16  ? 0.3907 0.4234 0.9729 0.0500  -0.1043 -0.2107 582 VAL A C   
59   O O   . VAL A 16  ? 0.4006 0.4330 1.0100 0.0477  -0.1042 -0.2102 582 VAL A O   
60   C CB  . VAL A 16  ? 0.3835 0.4034 0.9368 0.0511  -0.1090 -0.1905 582 VAL A CB  
61   C CG1 . VAL A 16  ? 0.2788 0.2969 0.8187 0.0516  -0.1103 -0.1878 582 VAL A CG1 
62   C CG2 . VAL A 16  ? 0.2791 0.2959 0.8162 0.0527  -0.1115 -0.1857 582 VAL A CG2 
63   N N   . LEU A 17  ? 0.3803 0.4171 0.9518 0.0529  -0.1053 -0.2191 583 LEU A N   
64   C CA  . LEU A 17  ? 0.4417 0.4862 1.0388 0.0521  -0.1082 -0.2304 583 LEU A CA  
65   C C   . LEU A 17  ? 0.5149 0.5591 1.1245 0.0484  -0.1112 -0.2248 583 LEU A C   
66   O O   . LEU A 17  ? 0.4660 0.5097 1.1087 0.0442  -0.1090 -0.2230 583 LEU A O   
67   C CB  . LEU A 17  ? 0.4061 0.4548 0.9861 0.0599  -0.1097 -0.2456 583 LEU A CB  
68   C CG  . LEU A 17  ? 0.4744 0.5174 1.0379 0.0658  -0.1019 -0.2502 583 LEU A CG  
69   C CD1 . LEU A 17  ? 0.5189 0.5606 1.0609 0.0775  -0.1026 -0.2659 583 LEU A CD1 
70   C CD2 . LEU A 17  ? 0.4130 0.4589 1.0099 0.0608  -0.0989 -0.2511 583 LEU A CD2 
71   N N   . ASN A 18  ? 0.4514 0.4943 1.0351 0.0507  -0.1141 -0.2221 584 ASN A N   
72   C CA  . ASN A 18  ? 0.4749 0.5157 1.0678 0.0477  -0.1149 -0.2161 584 ASN A CA  
73   C C   . ASN A 18  ? 0.5051 0.5373 1.0604 0.0501  -0.1156 -0.2043 584 ASN A C   
74   O O   . ASN A 18  ? 0.4848 0.5152 1.0083 0.0541  -0.1165 -0.2036 584 ASN A O   
75   C CB  . ASN A 18  ? 0.3634 0.4178 0.9794 0.0478  -0.1205 -0.2331 584 ASN A CB  
76   C CG  . ASN A 18  ? 0.4657 0.5267 1.0521 0.0565  -0.1275 -0.2466 584 ASN A CG  
77   O OD1 . ASN A 18  ? 0.5735 0.6297 1.1235 0.0610  -0.1291 -0.2419 584 ASN A OD1 
78   N ND2 . ASN A 18  ? 0.4977 0.5671 1.0962 0.0608  -0.1307 -0.2631 584 ASN A ND2 
79   N N   . ALA A 19  ? 0.5043 0.4439 0.9239 -0.0564 -0.0700 -0.0615 585 ALA A N   
80   C CA  . ALA A 19  ? 0.4479 0.3978 0.8270 -0.0590 -0.0726 -0.0517 585 ALA A CA  
81   C C   . ALA A 19  ? 0.5214 0.4675 0.8499 -0.0675 -0.0753 -0.0372 585 ALA A C   
82   O O   . ALA A 19  ? 0.5432 0.4707 0.8709 -0.0719 -0.0839 -0.0292 585 ALA A O   
83   C CB  . ALA A 19  ? 0.3827 0.3302 0.7789 -0.0531 -0.0979 -0.0466 585 ALA A CB  
84   N N   . THR A 20  ? 0.4504 0.4120 0.7391 -0.0697 -0.0649 -0.0345 586 THR A N   
85   C CA  . THR A 20  ? 0.3974 0.3609 0.6465 -0.0780 -0.0659 -0.0229 586 THR A CA  
86   C C   . THR A 20  ? 0.5016 0.4478 0.7281 -0.0776 -0.0842 -0.0047 586 THR A C   
87   O O   . THR A 20  ? 0.4461 0.3860 0.6886 -0.0698 -0.0985 -0.0052 586 THR A O   
88   C CB  . THR A 20  ? 0.3444 0.3338 0.5605 -0.0759 -0.0492 -0.0286 586 THR A CB  
89   O OG1 . THR A 20  ? 0.3486 0.3387 0.5471 -0.0688 -0.0472 -0.0246 586 THR A OG1 
90   C CG2 . THR A 20  ? 0.2914 0.2940 0.5170 -0.0699 -0.0338 -0.0479 586 THR A CG2 
91   N N   . GLU A 21  ? 0.4979 0.4372 0.6874 -0.0855 -0.0828 0.0086  587 GLU A N   
92   C CA  . GLU A 21  ? 0.6123 0.5318 0.7634 -0.0834 -0.0960 0.0259  587 GLU A CA  
93   C C   . GLU A 21  ? 0.4851 0.4254 0.6130 -0.0798 -0.0890 0.0227  587 GLU A C   
94   O O   . GLU A 21  ? 0.4051 0.3717 0.5361 -0.0791 -0.0712 0.0116  587 GLU A O   
95   C CB  . GLU A 21  ? 0.7553 0.6524 0.8718 -0.0939 -0.0891 0.0418  587 GLU A CB  
96   C CG  . GLU A 21  ? 0.8950 0.8194 0.9915 -0.1034 -0.0673 0.0390  587 GLU A CG  
97   C CD  . GLU A 21  ? 0.9868 0.9445 1.1180 -0.1103 -0.0524 0.0193  587 GLU A CD  
98   O OE1 . GLU A 21  ? 0.9991 0.9541 1.1654 -0.1087 -0.0564 0.0088  587 GLU A OE1 
99   O OE2 . GLU A 21  ? 0.9615 0.9490 1.0854 -0.1157 -0.0380 0.0124  587 GLU A OE2 
100  N N   . SER A 22  ? 0.4875 0.4125 0.5889 -0.0750 -0.1039 0.0312  588 SER A N   
101  C CA  . SER A 22  ? 0.4179 0.3545 0.4904 -0.0729 -0.0954 0.0294  588 SER A CA  
102  C C   . SER A 22  ? 0.5034 0.4508 0.5401 -0.0786 -0.0756 0.0366  588 SER A C   
103  O O   . SER A 22  ? 0.5830 0.5177 0.6052 -0.0863 -0.0733 0.0474  588 SER A O   
104  C CB  . SER A 22  ? 0.4956 0.4097 0.5416 -0.0679 -0.1181 0.0356  588 SER A CB  
105  O OG  . SER A 22  ? 0.6566 0.5650 0.7436 -0.0612 -0.1424 0.0267  588 SER A OG  
106  N N   . PHE A 23  ? 0.4163 0.3855 0.4406 -0.0739 -0.0591 0.0298  589 PHE A N   
107  C CA  . PHE A 23  ? 0.4426 0.4294 0.4393 -0.0754 -0.0422 0.0332  589 PHE A CA  
108  C C   . PHE A 23  ? 0.4825 0.4746 0.4486 -0.0651 -0.0319 0.0316  589 PHE A C   
109  O O   . PHE A 23  ? 0.4117 0.3962 0.3834 -0.0585 -0.0322 0.0248  589 PHE A O   
110  C CB  . PHE A 23  ? 0.3854 0.4037 0.4096 -0.0765 -0.0311 0.0209  589 PHE A CB  
111  C CG  . PHE A 23  ? 0.3643 0.3969 0.4034 -0.0637 -0.0256 0.0063  589 PHE A CG  
112  C CD1 . PHE A 23  ? 0.3405 0.3953 0.3587 -0.0492 -0.0123 -0.0008 589 PHE A CD1 
113  C CD2 . PHE A 23  ? 0.3415 0.3614 0.4120 -0.0638 -0.0316 0.0000  589 PHE A CD2 
114  C CE1 . PHE A 23  ? 0.3422 0.3982 0.3596 -0.0342 -0.0038 -0.0117 589 PHE A CE1 
115  C CE2 . PHE A 23  ? 0.4260 0.4510 0.5034 -0.0522 -0.0200 -0.0127 589 PHE A CE2 
116  C CZ  . PHE A 23  ? 0.3847 0.4239 0.4301 -0.0370 -0.0054 -0.0173 589 PHE A CZ  
117  N N   . VAL A 24  ? 0.5180 0.5214 0.4546 -0.0640 -0.0192 0.0364  590 VAL A N   
118  C CA  . VAL A 24  ? 0.4386 0.4449 0.3439 -0.0515 -0.0069 0.0350  590 VAL A CA  
119  C C   . VAL A 24  ? 0.4517 0.4875 0.3672 -0.0365 0.0057  0.0231  590 VAL A C   
120  O O   . VAL A 24  ? 0.4440 0.5124 0.3726 -0.0350 0.0097  0.0172  590 VAL A O   
121  C CB  . VAL A 24  ? 0.3963 0.4019 0.2653 -0.0537 0.0029  0.0444  590 VAL A CB  
122  C CG1 . VAL A 24  ? 0.3884 0.4033 0.2293 -0.0372 0.0191  0.0411  590 VAL A CG1 
123  C CG2 . VAL A 24  ? 0.4224 0.3881 0.2618 -0.0626 -0.0098 0.0566  590 VAL A CG2 
124  N N   . TYR A 25  ? 0.3408 0.3633 0.2502 -0.0246 0.0125  0.0177  591 TYR A N   
125  C CA  . TYR A 25  ? 0.3974 0.4359 0.2975 -0.0038 0.0257  0.0090  591 TYR A CA  
126  C C   . TYR A 25  ? 0.4296 0.4690 0.2863 0.0162  0.0407  0.0118  591 TYR A C   
127  O O   . TYR A 25  ? 0.5018 0.5592 0.3437 0.0389  0.0476  0.0055  591 TYR A O   
128  C CB  . TYR A 25  ? 0.3516 0.3679 0.2626 0.0011  0.0327  0.0022  591 TYR A CB  
129  C CG  . TYR A 25  ? 0.3915 0.3707 0.2891 0.0007  0.0453  0.0036  591 TYR A CG  
130  C CD1 . TYR A 25  ? 0.4076 0.3656 0.2659 0.0203  0.0697  0.0034  591 TYR A CD1 
131  C CD2 . TYR A 25  ? 0.4510 0.4146 0.3766 -0.0182 0.0327  0.0030  591 TYR A CD2 
132  C CE1 . TYR A 25  ? 0.4368 0.3572 0.2879 0.0163  0.0863  0.0016  591 TYR A CE1 
133  C CE2 . TYR A 25  ? 0.3705 0.3054 0.2946 -0.0212 0.0436  -0.0023 591 TYR A CE2 
134  C CZ  . TYR A 25  ? 0.4787 0.3913 0.3678 -0.0064 0.0729  -0.0034 591 TYR A CZ  
135  O OH  . TYR A 25  ? 0.5312 0.4119 0.4230 -0.0130 0.0886  -0.0113 591 TYR A OH  
136  N N   . GLU A 26  ? 0.4563 0.4748 0.2905 0.0101  0.0439  0.0200  592 GLU A N   
137  C CA  . GLU A 26  ? 0.5105 0.5206 0.3019 0.0280  0.0604  0.0233  592 GLU A CA  
138  C C   . GLU A 26  ? 0.5622 0.5753 0.3393 0.0174  0.0585  0.0307  592 GLU A C   
139  O O   . GLU A 26  ? 0.5782 0.5600 0.3405 0.0045  0.0547  0.0353  592 GLU A O   
140  C CB  . GLU A 26  ? 0.5630 0.5278 0.3311 0.0334  0.0756  0.0228  592 GLU A CB  
141  C CG  . GLU A 26  ? 0.6027 0.5528 0.3229 0.0607  0.0981  0.0250  592 GLU A CG  
142  C CD  . GLU A 26  ? 0.7377 0.6997 0.4450 0.0600  0.0964  0.0290  592 GLU A CD  
143  O OE1 . GLU A 26  ? 0.7806 0.7151 0.4723 0.0467  0.0983  0.0314  592 GLU A OE1 
144  O OE2 . GLU A 26  ? 0.7592 0.7572 0.4756 0.0719  0.0927  0.0270  592 GLU A OE2 
145  N N   . PRO A 27  ? 0.4820 0.5330 0.2657 0.0221  0.0610  0.0295  593 PRO A N   
146  C CA  . PRO A 27  ? 0.4584 0.5119 0.2335 0.0085  0.0644  0.0364  593 PRO A CA  
147  C C   . PRO A 27  ? 0.5529 0.5788 0.2803 0.0164  0.0783  0.0422  593 PRO A C   
148  O O   . PRO A 27  ? 0.6069 0.6136 0.3138 0.0021  0.0794  0.0497  593 PRO A O   
149  C CB  . PRO A 27  ? 0.5426 0.6507 0.3487 0.0138  0.0692  0.0273  593 PRO A CB  
150  C CG  . PRO A 27  ? 0.4877 0.6176 0.2937 0.0432  0.0692  0.0166  593 PRO A CG  
151  C CD  . PRO A 27  ? 0.5298 0.6235 0.3281 0.0431  0.0626  0.0187  593 PRO A CD  
152  N N   . LYS A 28  ? 0.5509 0.5680 0.2569 0.0390  0.0896  0.0385  594 LYS A N   
153  C CA  . LYS A 28  ? 0.6804 0.6725 0.3681 0.0388  0.0964  0.0380  594 LYS A CA  
154  C C   . LYS A 28  ? 0.6516 0.6011 0.3163 0.0238  0.0906  0.0416  594 LYS A C   
155  O O   . LYS A 28  ? 0.6182 0.5537 0.2637 0.0157  0.0902  0.0442  594 LYS A O   
156  C CB  . LYS A 28  ? 0.7034 0.6906 0.3937 0.0612  0.1034  0.0319  594 LYS A CB  
157  C CG  . LYS A 28  ? 0.7135 0.7403 0.4189 0.0839  0.1051  0.0271  594 LYS A CG  
158  C CD  . LYS A 28  ? 0.8018 0.8119 0.4994 0.1107  0.1086  0.0257  594 LYS A CD  
159  C CE  . LYS A 28  ? 0.9333 0.9823 0.6376 0.1398  0.1083  0.0216  594 LYS A CE  
160  N NZ  . LYS A 28  ? 1.0560 1.0792 0.7414 0.1701  0.1115  0.0250  594 LYS A NZ  
161  N N   . GLU A 29  ? 0.5680 0.4932 0.2312 0.0218  0.0873  0.0394  595 GLU A N   
162  C CA  . GLU A 29  ? 0.7068 0.5930 0.3591 0.0048  0.0763  0.0361  595 GLU A CA  
163  C C   . GLU A 29  ? 0.6552 0.5495 0.3385 -0.0142 0.0488  0.0379  595 GLU A C   
164  O O   . GLU A 29  ? 0.5462 0.4176 0.2319 -0.0263 0.0306  0.0325  595 GLU A O   
165  C CB  . GLU A 29  ? 0.7383 0.5969 0.3972 0.0083  0.0877  0.0257  595 GLU A CB  
166  C CG  . GLU A 29  ? 0.9018 0.7464 0.5381 0.0275  0.1118  0.0245  595 GLU A CG  
167  C CD  . GLU A 29  ? 1.0092 0.8024 0.6294 0.0236  0.1306  0.0137  595 GLU A CD  
168  O OE1 . GLU A 29  ? 1.0114 0.7934 0.6605 0.0038  0.1199  0.0027  595 GLU A OE1 
169  O OE2 . GLU A 29  ? 1.1233 0.9039 0.7412 0.0371  0.1444  0.0131  595 GLU A OE2 
170  N N   . GLN A 30  ? 0.6227 0.5494 0.3311 -0.0155 0.0450  0.0435  596 GLN A N   
171  C CA  . GLN A 30  ? 0.5547 0.4835 0.2901 -0.0312 0.0225  0.0470  596 GLN A CA  
172  C C   . GLN A 30  ? 0.5310 0.4500 0.3025 -0.0363 0.0074  0.0374  596 GLN A C   
173  O O   . GLN A 30  ? 0.5279 0.4310 0.3081 -0.0461 -0.0159 0.0364  596 GLN A O   
174  C CB  . GLN A 30  ? 0.5168 0.4190 0.2144 -0.0405 0.0118  0.0560  596 GLN A CB  
175  C CG  . GLN A 30  ? 0.5350 0.4475 0.2077 -0.0403 0.0308  0.0658  596 GLN A CG  
176  C CD  . GLN A 30  ? 0.5856 0.5279 0.2980 -0.0479 0.0331  0.0687  596 GLN A CD  
177  O OE1 . GLN A 30  ? 0.5756 0.5034 0.2989 -0.0590 0.0178  0.0744  596 GLN A OE1 
178  N NE2 . GLN A 30  ? 0.4729 0.4567 0.2086 -0.0403 0.0508  0.0625  596 GLN A NE2 
179  N N   . LYS A 31  ? 0.5197 0.3156 0.4746 0.0551  0.1704  0.1153  597 LYS A N   
180  C CA  . LYS A 31  ? 0.5088 0.2967 0.4479 0.0371  0.1501  0.1011  597 LYS A CA  
181  C C   . LYS A 31  ? 0.4801 0.3113 0.4809 0.0294  0.1236  0.1007  597 LYS A C   
182  O O   . LYS A 31  ? 0.4950 0.3599 0.5547 0.0378  0.1204  0.1087  597 LYS A O   
183  C CB  . LYS A 31  ? 0.5318 0.3084 0.4565 0.0421  0.1524  0.0947  597 LYS A CB  
184  C CG  . LYS A 31  ? 0.5988 0.3353 0.4721 0.0498  0.1755  0.0874  597 LYS A CG  
185  C CD  . LYS A 31  ? 0.6403 0.3627 0.4985 0.0543  0.1783  0.0842  597 LYS A CD  
186  C CE  . LYS A 31  ? 0.8777 0.5562 0.6961 0.0668  0.2056  0.0803  597 LYS A CE  
187  N NZ  . LYS A 31  ? 1.0462 0.7118 0.8525 0.0771  0.2115  0.0845  597 LYS A NZ  
188  N N   . LYS A 32  ? 0.4367 0.2699 0.4286 0.0138  0.1039  0.0880  598 LYS A N   
189  C CA  . LYS A 32  ? 0.3974 0.2630 0.4451 0.0083  0.0806  0.0857  598 LYS A CA  
190  C C   . LYS A 32  ? 0.3862 0.2702 0.4414 -0.0028 0.0569  0.0614  598 LYS A C   
191  O O   . LYS A 32  ? 0.3825 0.2524 0.3953 -0.0110 0.0588  0.0475  598 LYS A O   
192  C CB  . LYS A 32  ? 0.4114 0.2649 0.4488 0.0077  0.0811  0.0998  598 LYS A CB  
193  C CG  . LYS A 32  ? 0.4870 0.3177 0.5002 0.0185  0.1111  0.1240  598 LYS A CG  
194  C CD  . LYS A 32  ? 0.4853 0.3027 0.4799 0.0220  0.1139  0.1438  598 LYS A CD  
195  C CE  . LYS A 32  ? 0.6722 0.4832 0.6428 0.0327  0.1413  0.1563  598 LYS A CE  
196  N NZ  . LYS A 32  ? 0.7306 0.5287 0.6677 0.0390  0.1457  0.1753  598 LYS A NZ  
197  N N   . MET A 33  ? 0.3312 0.2461 0.4445 -0.0040 0.0380  0.0543  599 MET A N   
198  C CA  . MET A 33  ? 0.3473 0.2844 0.4743 -0.0116 0.0178  0.0298  599 MET A CA  
199  C C   . MET A 33  ? 0.3582 0.3162 0.5482 -0.0116 0.0004  0.0243  599 MET A C   
200  O O   . MET A 33  ? 0.3701 0.3253 0.5971 -0.0080 0.0060  0.0396  599 MET A O   
201  C CB  . MET A 33  ? 0.2669 0.2187 0.3884 -0.0081 0.0186  0.0188  599 MET A CB  
202  C CG  . MET A 33  ? 0.2449 0.2277 0.4188 0.0015  0.0100  0.0177  599 MET A CG  
203  S SD  . MET A 33  ? 0.3463 0.3501 0.4972 0.0136  0.0074  0.0084  599 MET A SD  
204  C CE  . MET A 33  ? 0.2481 0.2672 0.3914 0.0024  -0.0066 -0.0202 599 MET A CE  
205  N N   . PHE A 34  ? 0.2961 0.2720 0.5015 -0.0160 -0.0168 0.0022  600 PHE A N   
206  C CA  . PHE A 34  ? 0.1966 0.1925 0.4654 -0.0148 -0.0318 -0.0124 600 PHE A CA  
207  C C   . PHE A 34  ? 0.2748 0.2996 0.5457 -0.0169 -0.0430 -0.0436 600 PHE A C   
208  O O   . PHE A 34  ? 0.2611 0.2876 0.4877 -0.0207 -0.0375 -0.0497 600 PHE A O   
209  C CB  . PHE A 34  ? 0.2011 0.1842 0.4976 -0.0115 -0.0394 -0.0049 600 PHE A CB  
210  C CG  . PHE A 34  ? 0.3224 0.3115 0.5926 -0.0105 -0.0494 -0.0135 600 PHE A CG  
211  C CD1 . PHE A 34  ? 0.2752 0.2507 0.4934 -0.0104 -0.0449 0.0020  600 PHE A CD1 
212  C CD2 . PHE A 34  ? 0.3530 0.3665 0.6550 -0.0092 -0.0640 -0.0404 600 PHE A CD2 
213  C CE1 . PHE A 34  ? 0.3227 0.3154 0.5265 -0.0109 -0.0580 -0.0104 600 PHE A CE1 
214  C CE2 . PHE A 34  ? 0.2307 0.2607 0.5204 -0.0076 -0.0734 -0.0499 600 PHE A CE2 
215  C CZ  . PHE A 34  ? 0.2698 0.2926 0.5134 -0.0094 -0.0721 -0.0353 600 PHE A CZ  
216  N N   . HIS A 35  ? 0.3082 0.3542 0.6302 -0.0155 -0.0558 -0.0647 601 HIS A N   
217  C CA  . HIS A 35  ? 0.3459 0.4210 0.6696 -0.0148 -0.0663 -0.0978 601 HIS A CA  
218  C C   . HIS A 35  ? 0.3422 0.4112 0.6838 -0.0099 -0.0709 -0.1108 601 HIS A C   
219  O O   . HIS A 35  ? 0.2584 0.3081 0.6393 -0.0069 -0.0737 -0.1023 601 HIS A O   
220  C CB  . HIS A 35  ? 0.2856 0.3814 0.6230 -0.0093 -0.0734 -0.1141 601 HIS A CB  
221  C CG  . HIS A 35  ? 0.3031 0.4140 0.6201 -0.0050 -0.0708 -0.1022 601 HIS A CG  
222  N ND1 . HIS A 35  ? 0.3352 0.4592 0.5968 0.0030  -0.0675 -0.1061 601 HIS A ND1 
223  C CD2 . HIS A 35  ? 0.1840 0.2920 0.5162 -0.0021 -0.0651 -0.0809 601 HIS A CD2 
224  C CE1 . HIS A 35  ? 0.2653 0.3913 0.5076 0.0135  -0.0623 -0.0866 601 HIS A CE1 
225  N NE2 . HIS A 35  ? 0.3727 0.4929 0.6602 0.0104  -0.0613 -0.0730 601 HIS A NE2 
226  N N   . ALA A 36  ? 0.2020 0.2893 0.5235 -0.0082 -0.0703 -0.1310 602 ALA A N   
227  C CA  . ALA A 36  ? 0.2535 0.3432 0.6017 0.0002  -0.0745 -0.1491 602 ALA A CA  
228  C C   . ALA A 36  ? 0.2864 0.4041 0.6239 0.0042  -0.0722 -0.1804 602 ALA A C   
229  O O   . ALA A 36  ? 0.2722 0.4093 0.5748 -0.0008 -0.0673 -0.1853 602 ALA A O   
230  C CB  . ALA A 36  ? 0.2456 0.3359 0.5938 -0.0003 -0.0758 -0.1403 602 ALA A CB  
231  N N   . THR A 37  ? 0.2723 0.3935 0.6459 0.0142  -0.0761 -0.2042 603 THR A N   
232  C CA  . THR A 37  ? 0.3350 0.4886 0.7057 0.0197  -0.0726 -0.2384 603 THR A CA  
233  C C   . THR A 37  ? 0.3601 0.5232 0.7558 0.0255  -0.0700 -0.2516 603 THR A C   
234  O O   . THR A 37  ? 0.3413 0.4831 0.7784 0.0328  -0.0785 -0.2488 603 THR A O   
235  C CB  . THR A 37  ? 0.4433 0.6029 0.8439 0.0280  -0.0801 -0.2645 603 THR A CB  
236  O OG1 . THR A 37  ? 0.5664 0.7228 0.9473 0.0224  -0.0851 -0.2537 603 THR A OG1 
237  C CG2 . THR A 37  ? 0.4499 0.6509 0.8471 0.0348  -0.0771 -0.3023 603 THR A CG2 
238  N N   . VAL A 38  ? 0.3464 0.5436 0.7218 0.0214  -0.0587 -0.2666 604 VAL A N   
239  C CA  . VAL A 38  ? 0.2945 0.5091 0.6955 0.0252  -0.0554 -0.2809 604 VAL A CA  
240  C C   . VAL A 38  ? 0.3009 0.5594 0.7117 0.0294  -0.0445 -0.3240 604 VAL A C   
241  O O   . VAL A 38  ? 0.3792 0.6623 0.7647 0.0262  -0.0381 -0.3352 604 VAL A O   
242  C CB  . VAL A 38  ? 0.3968 0.6199 0.7735 0.0112  -0.0479 -0.2567 604 VAL A CB  
243  C CG1 . VAL A 38  ? 0.3116 0.5010 0.6807 0.0089  -0.0597 -0.2203 604 VAL A CG1 
244  C CG2 . VAL A 38  ? 0.4641 0.7097 0.8006 -0.0062 -0.0298 -0.2588 604 VAL A CG2 
245  N N   . ALA A 39  ? 0.3348 0.6073 0.7784 0.0341  -0.0450 -0.3454 605 ALA A N   
246  C CA  . ALA A 39  ? 0.3767 0.6959 0.8304 0.0312  -0.0372 -0.3836 605 ALA A CA  
247  C C   . ALA A 39  ? 0.3769 0.7240 0.8455 0.0307  -0.0234 -0.3844 605 ALA A C   
248  O O   . ALA A 39  ? 0.3560 0.6901 0.8537 0.0398  -0.0340 -0.3710 605 ALA A O   
249  C CB  . ALA A 39  ? 0.3729 0.6932 0.8678 0.0420  -0.0526 -0.4036 605 ALA A CB  
250  N N   . THR A 40  ? 0.4624 0.8517 0.9113 0.0209  0.0013  -0.3968 606 THR A N   
251  C CA  . THR A 40  ? 0.4641 0.8875 0.9375 0.0207  0.0169  -0.4067 606 THR A CA  
252  C C   . THR A 40  ? 0.6266 1.0583 1.1286 0.0388  0.0124  -0.4353 606 THR A C   
253  O O   . THR A 40  ? 0.6467 1.0540 1.1535 0.0479  -0.0053 -0.4441 606 THR A O   
254  C CB  . THR A 40  ? 0.4169 0.8741 0.8569 0.0013  0.0528  -0.4052 606 THR A CB  
255  O OG1 . THR A 40  ? 0.3500 0.8095 0.7432 0.0050  0.0672  -0.4147 606 THR A OG1 
256  C CG2 . THR A 40  ? 0.2958 0.7411 0.7104 -0.0202 0.0603  -0.3774 606 THR A CG2 
257  N N   . GLU A 41  ? 0.7775 1.2443 1.3030 0.0432  0.0292  -0.4501 607 GLU A N   
258  C CA  . GLU A 41  ? 0.8733 1.3474 1.4236 0.0618  0.0295  -0.4783 607 GLU A CA  
259  C C   . GLU A 41  ? 0.8166 1.2887 1.3200 0.0616  0.0374  -0.4936 607 GLU A C   
260  O O   . GLU A 41  ? 0.7970 1.2504 1.3117 0.0738  0.0220  -0.5111 607 GLU A O   
261  C CB  . GLU A 41  ? 0.9720 1.4903 1.5524 0.0671  0.0522  -0.4911 607 GLU A CB  
262  C CG  . GLU A 41  ? 1.0560 1.6101 1.6029 0.0473  0.0881  -0.4871 607 GLU A CG  
263  C CD  . GLU A 41  ? 1.0543 1.6128 1.5999 0.0252  0.0899  -0.4609 607 GLU A CD  
264  O OE1 . GLU A 41  ? 1.0401 1.5900 1.6202 0.0305  0.0654  -0.4491 607 GLU A OE1 
265  O OE2 . GLU A 41  ? 1.0331 1.5992 1.5384 0.0037  0.1171  -0.4497 607 GLU A OE2 
266  N N   . ASN A 42  ? 0.8038 1.2933 1.2519 0.0489  0.0630  -0.4851 608 ASN A N   
267  C CA  . ASN A 42  ? 0.7848 1.2713 1.1689 0.0529  0.0722  -0.4929 608 ASN A CA  
268  C C   . ASN A 42  ? 0.6859 1.1477 1.0144 0.0470  0.0607  -0.4729 608 ASN A C   
269  O O   . ASN A 42  ? 0.6477 1.1075 0.9177 0.0544  0.0644  -0.4790 608 ASN A O   
270  C CB  . ASN A 42  ? 0.8790 1.3937 1.2237 0.0512  0.1130  -0.4961 608 ASN A CB  
271  C CG  . ASN A 42  ? 0.9022 1.4242 1.2284 0.0300  0.1389  -0.4667 608 ASN A CG  
272  O OD1 . ASN A 42  ? 0.7596 1.2586 1.0495 0.0189  0.1346  -0.4420 608 ASN A OD1 
273  N ND2 . ASN A 42  ? 0.9663 1.5200 1.3220 0.0232  0.1672  -0.4696 608 ASN A ND2 
274  N N   . GLU A 43  ? 0.6133 0.9540 0.9826 0.0455  0.1427  -0.3355 609 GLU A N   
275  C CA  . GLU A 43  ? 0.6069 0.9355 0.9094 0.0441  0.1313  -0.3265 609 GLU A CA  
276  C C   . GLU A 43  ? 0.5199 0.8311 0.8464 0.0359  0.1012  -0.3137 609 GLU A C   
277  O O   . GLU A 43  ? 0.5653 0.8688 0.9441 0.0282  0.0927  -0.2968 609 GLU A O   
278  C CB  . GLU A 43  ? 0.6791 1.0096 0.9159 0.0400  0.1579  -0.3007 609 GLU A CB  
279  C CG  . GLU A 43  ? 0.7746 1.0878 0.9327 0.0431  0.1473  -0.2893 609 GLU A CG  
280  C CD  . GLU A 43  ? 0.8758 1.1795 0.9663 0.0394  0.1757  -0.2594 609 GLU A CD  
281  O OE1 . GLU A 43  ? 0.8670 1.1494 0.8871 0.0440  0.1680  -0.2445 609 GLU A OE1 
282  O OE2 . GLU A 43  ? 0.8539 1.1695 0.9659 0.0318  0.2053  -0.2494 609 GLU A OE2 
283  N N   . VAL A 44  ? 0.5106 0.8150 0.7952 0.0396  0.0850  -0.3196 610 VAL A N   
284  C CA  . VAL A 44  ? 0.4242 0.7133 0.7283 0.0335  0.0605  -0.3089 610 VAL A CA  
285  C C   . VAL A 44  ? 0.4656 0.7493 0.7085 0.0308  0.0633  -0.2828 610 VAL A C   
286  O O   . VAL A 44  ? 0.5131 0.7986 0.6839 0.0379  0.0726  -0.2804 610 VAL A O   
287  C CB  . VAL A 44  ? 0.4790 0.7689 0.7969 0.0386  0.0377  -0.3364 610 VAL A CB  
288  C CG1 . VAL A 44  ? 0.3919 0.6655 0.7393 0.0312  0.0180  -0.3238 610 VAL A CG1 
289  C CG2 . VAL A 44  ? 0.5732 0.8666 0.9491 0.0413  0.0364  -0.3658 610 VAL A CG2 
290  N N   . PHE A 45  ? 0.3717 0.6433 0.6391 0.0222  0.0553  -0.2599 611 PHE A N   
291  C CA  . PHE A 45  ? 0.3010 0.5654 0.5158 0.0197  0.0576  -0.2373 611 PHE A CA  
292  C C   . PHE A 45  ? 0.3301 0.5795 0.5686 0.0180  0.0353  -0.2279 611 PHE A C   
293  O O   . PHE A 45  ? 0.3494 0.5904 0.6510 0.0134  0.0252  -0.2233 611 PHE A O   
294  C CB  . PHE A 45  ? 0.2252 0.4865 0.4401 0.0056  0.0722  -0.2078 611 PHE A CB  
295  C CG  . PHE A 45  ? 0.3748 0.6533 0.5790 0.0033  0.1011  -0.2129 611 PHE A CG  
296  C CD1 . PHE A 45  ? 0.3211 0.5912 0.4466 0.0043  0.1217  -0.2027 611 PHE A CD1 
297  C CD2 . PHE A 45  ? 0.3102 0.6023 0.5774 0.0004  0.1054  -0.2196 611 PHE A CD2 
298  C CE1 . PHE A 45  ? 0.4661 0.7444 0.5815 0.0009  0.1512  -0.1996 611 PHE A CE1 
299  C CE2 . PHE A 45  ? 0.3212 0.6279 0.5828 -0.0023 0.1333  -0.2210 611 PHE A CE2 
300  C CZ  . PHE A 45  ? 0.4032 0.7041 0.5910 -0.0031 0.1585  -0.2109 611 PHE A CZ  
301  N N   A ARG A 46  ? 0.2991 0.5388 0.4823 0.0219  0.0274  -0.2192 612 ARG A N   
302  N N   B ARG A 46  ? 0.2974 0.5370 0.4810 0.0218  0.0274  -0.2189 612 ARG A N   
303  C CA  A ARG A 46  ? 0.2785 0.5018 0.4765 0.0182  0.0111  -0.2022 612 ARG A CA  
304  C CA  B ARG A 46  ? 0.2771 0.5005 0.4769 0.0182  0.0109  -0.2025 612 ARG A CA  
305  C C   A ARG A 46  ? 0.3033 0.5011 0.4670 0.0078  0.0159  -0.1620 612 ARG A C   
306  C C   B ARG A 46  ? 0.3093 0.5070 0.4715 0.0083  0.0152  -0.1622 612 ARG A C   
307  O O   A ARG A 46  ? 0.3050 0.4952 0.4117 0.0066  0.0276  -0.1496 612 ARG A O   
308  O O   B ARG A 46  ? 0.3182 0.5074 0.4194 0.0084  0.0258  -0.1498 612 ARG A O   
309  C CB  A ARG A 46  ? 0.2611 0.4935 0.4274 0.0307  -0.0017 -0.2176 612 ARG A CB  
310  C CB  B ARG A 46  ? 0.2722 0.5068 0.4498 0.0305  -0.0030 -0.2219 612 ARG A CB  
311  C CG  A ARG A 46  ? 0.3393 0.5985 0.5243 0.0418  -0.0106 -0.2629 612 ARG A CG  
312  C CG  B ARG A 46  ? 0.3286 0.5877 0.5490 0.0384  -0.0126 -0.2684 612 ARG A CG  
313  C CD  A ARG A 46  ? 0.3214 0.5824 0.5980 0.0339  -0.0185 -0.2823 612 ARG A CD  
314  C CD  B ARG A 46  ? 0.3253 0.6028 0.5199 0.0507  -0.0324 -0.2838 612 ARG A CD  
315  N NE  A ARG A 46  ? 0.3836 0.6678 0.6798 0.0399  -0.0306 -0.3161 612 ARG A NE  
316  N NE  B ARG A 46  ? 0.4153 0.7152 0.6549 0.0545  -0.0436 -0.3177 612 ARG A NE  
317  C CZ  A ARG A 46  ? 0.3478 0.6374 0.7245 0.0351  -0.0390 -0.3373 612 ARG A CZ  
318  C CZ  B ARG A 46  ? 0.3980 0.7207 0.6243 0.0689  -0.0606 -0.3379 612 ARG A CZ  
319  N NH1 A ARG A 46  ? 0.3411 0.5792 0.7495 0.0243  -0.0325 -0.3178 612 ARG A NH1 
320  N NH1 B ARG A 46  ? 0.3193 0.6454 0.4899 0.0819  -0.0703 -0.3254 612 ARG A NH1 
321  N NH2 A ARG A 46  ? 0.3402 0.6533 0.7317 0.0442  -0.0476 -0.3687 612 ARG A NH2 
322  N NH2 B ARG A 46  ? 0.3240 0.6650 0.5943 0.0720  -0.0686 -0.3713 612 ARG A NH2 
323  N N   . VAL A 47  ? 0.2957 0.4771 0.4920 0.0004  0.0080  -0.1422 613 VAL A N   
324  C CA  . VAL A 47  ? 0.2617 0.4185 0.4272 -0.0091 0.0094  -0.1098 613 VAL A CA  
325  C C   . VAL A 47  ? 0.3427 0.4797 0.4894 -0.0070 0.0042  -0.0923 613 VAL A C   
326  O O   . VAL A 47  ? 0.2878 0.4284 0.4759 -0.0044 -0.0005 -0.0966 613 VAL A O   
327  C CB  . VAL A 47  ? 0.2186 0.3733 0.4312 -0.0166 0.0043  -0.0991 613 VAL A CB  
328  C CG1 . VAL A 47  ? 0.1836 0.3171 0.3606 -0.0264 0.0012  -0.0728 613 VAL A CG1 
329  C CG2 . VAL A 47  ? 0.1622 0.3436 0.4147 -0.0157 0.0110  -0.1207 613 VAL A CG2 
330  N N   . LYS A 48  ? 0.3502 0.4653 0.4386 -0.0086 0.0082  -0.0739 614 LYS A N   
331  C CA  . LYS A 48  ? 0.3363 0.4308 0.4058 -0.0059 0.0074  -0.0561 614 LYS A CA  
332  C C   . LYS A 48  ? 0.3322 0.4007 0.3809 -0.0162 0.0061  -0.0345 614 LYS A C   
333  O O   . LYS A 48  ? 0.3269 0.3848 0.3443 -0.0238 0.0079  -0.0316 614 LYS A O   
334  C CB  . LYS A 48  ? 0.2987 0.3848 0.3154 0.0050  0.0113  -0.0547 614 LYS A CB  
335  C CG  . LYS A 48  ? 0.3080 0.4234 0.3347 0.0191  0.0059  -0.0779 614 LYS A CG  
336  C CD  . LYS A 48  ? 0.3175 0.4228 0.2919 0.0349  0.0060  -0.0714 614 LYS A CD  
337  C CE  . LYS A 48  ? 0.3638 0.5036 0.3507 0.0526  -0.0071 -0.0954 614 LYS A CE  
338  N NZ  . LYS A 48  ? 0.3204 0.4503 0.2442 0.0731  -0.0095 -0.0879 614 LYS A NZ  
339  N N   . VAL A 49  ? 0.2473 0.3052 0.3135 -0.0166 0.0032  -0.0201 615 VAL A N   
340  C CA  . VAL A 49  ? 0.3028 0.3388 0.3451 -0.0231 -0.0038 -0.0020 615 VAL A CA  
341  C C   . VAL A 49  ? 0.3492 0.3566 0.3426 -0.0184 0.0029  0.0144  615 VAL A C   
342  O O   . VAL A 49  ? 0.3292 0.3351 0.3380 -0.0119 0.0118  0.0232  615 VAL A O   
343  C CB  . VAL A 49  ? 0.3442 0.3870 0.4351 -0.0233 -0.0137 0.0053  615 VAL A CB  
344  C CG1 . VAL A 49  ? 0.2455 0.2698 0.3052 -0.0265 -0.0280 0.0226  615 VAL A CG1 
345  C CG2 . VAL A 49  ? 0.1818 0.2548 0.3273 -0.0249 -0.0167 -0.0157 615 VAL A CG2 
346  N N   . PHE A 50  ? 0.3676 0.3520 0.3059 -0.0223 0.0020  0.0161  616 PHE A N   
347  C CA  . PHE A 50  ? 0.4272 0.3805 0.3110 -0.0163 0.0098  0.0266  616 PHE A CA  
348  C C   . PHE A 50  ? 0.5236 0.4544 0.3728 -0.0196 -0.0015 0.0387  616 PHE A C   
349  O O   . PHE A 50  ? 0.5682 0.4709 0.3644 -0.0137 0.0054  0.0455  616 PHE A O   
350  C CB  . PHE A 50  ? 0.4108 0.3450 0.2522 -0.0153 0.0166  0.0185  616 PHE A CB  
351  C CG  . PHE A 50  ? 0.3728 0.3282 0.2349 -0.0062 0.0241  0.0092  616 PHE A CG  
352  C CD1 . PHE A 50  ? 0.2762 0.2453 0.1486 -0.0119 0.0219  -0.0007 616 PHE A CD1 
353  C CD2 . PHE A 50  ? 0.3719 0.3372 0.2444 0.0092  0.0330  0.0097  616 PHE A CD2 
354  C CE1 . PHE A 50  ? 0.3372 0.3252 0.2157 0.0001  0.0258  -0.0096 616 PHE A CE1 
355  C CE2 . PHE A 50  ? 0.3145 0.3041 0.2051 0.0201  0.0325  -0.0017 616 PHE A CE2 
356  C CZ  . PHE A 50  ? 0.3451 0.3439 0.2317 0.0169  0.0275  -0.0111 616 PHE A CZ  
357  N N   . ASN A 51  ? 0.5045 0.4489 0.3815 -0.0265 -0.0200 0.0399  617 ASN A N   
358  C CA  . ASN A 51  ? 0.5068 0.4349 0.3523 -0.0240 -0.0359 0.0536  617 ASN A CA  
359  C C   . ASN A 51  ? 0.5553 0.4930 0.4400 -0.0148 -0.0346 0.0728  617 ASN A C   
360  O O   . ASN A 51  ? 0.4662 0.4266 0.4073 -0.0164 -0.0470 0.0708  617 ASN A O   
361  C CB  . ASN A 51  ? 0.4963 0.4347 0.3506 -0.0363 -0.0624 0.0415  617 ASN A CB  
362  C CG  . ASN A 51  ? 0.6304 0.5571 0.4495 -0.0315 -0.0884 0.0518  617 ASN A CG  
363  O OD1 . ASN A 51  ? 0.6721 0.5755 0.4439 -0.0181 -0.0835 0.0707  617 ASN A OD1 
364  N ND2 . ASN A 51  ? 0.6018 0.5467 0.4437 -0.0416 -0.1164 0.0390  617 ASN A ND2 
365  N N   . ILE A 52  ? 0.5946 0.5118 0.4504 -0.0046 -0.0175 0.0928  618 ILE A N   
366  C CA  . ILE A 52  ? 0.6430 0.5638 0.5449 0.0017  -0.0077 0.1126  618 ILE A CA  
367  C C   . ILE A 52  ? 0.6313 0.5393 0.5178 0.0097  -0.0287 0.1356  618 ILE A C   
368  O O   . ILE A 52  ? 0.6134 0.5179 0.5401 0.0161  -0.0237 0.1558  618 ILE A O   
369  C CB  . ILE A 52  ? 0.5953 0.5046 0.4925 0.0073  0.0263  0.1263  618 ILE A CB  
370  C CG1 . ILE A 52  ? 0.7801 0.6576 0.5883 0.0156  0.0363  0.1405  618 ILE A CG1 
371  C CG2 . ILE A 52  ? 0.4309 0.3633 0.3650 0.0031  0.0401  0.1024  618 ILE A CG2 
372  C CD1 . ILE A 52  ? 0.8844 0.7539 0.6930 0.0219  0.0753  0.1561  618 ILE A CD1 
373  N N   . ASP A 53  ? 0.5969 0.4970 0.4280 0.0102  -0.0542 0.1315  619 ASP A N   
374  C CA  . ASP A 53  ? 0.7121 0.6091 0.5329 0.0203  -0.0845 0.1485  619 ASP A CA  
375  C C   . ASP A 53  ? 0.7333 0.6640 0.6431 0.0172  -0.1028 0.1382  619 ASP A C   
376  O O   . ASP A 53  ? 0.7142 0.6477 0.6401 0.0294  -0.1271 0.1540  619 ASP A O   
377  C CB  . ASP A 53  ? 0.7833 0.6709 0.5309 0.0200  -0.1135 0.1377  619 ASP A CB  
378  C CG  . ASP A 53  ? 1.0766 0.9261 0.7266 0.0285  -0.0960 0.1485  619 ASP A CG  
379  O OD1 . ASP A 53  ? 1.1306 0.9607 0.7586 0.0421  -0.0730 0.1796  619 ASP A OD1 
380  O OD2 . ASP A 53  ? 1.1850 1.0241 0.7855 0.0212  -0.1015 0.1249  619 ASP A OD2 
381  N N   . LEU A 54  ? 0.6091 0.5648 0.5735 0.0041  -0.0903 0.1121  620 LEU A N   
382  C CA  . LEU A 54  ? 0.4649 0.4544 0.5118 0.0016  -0.1008 0.0969  620 LEU A CA  
383  C C   . LEU A 54  ? 0.4926 0.4811 0.6024 0.0092  -0.0847 0.1063  620 LEU A C   
384  O O   . LEU A 54  ? 0.4386 0.4513 0.6187 0.0102  -0.0898 0.0920  620 LEU A O   
385  C CB  . LEU A 54  ? 0.3704 0.3849 0.4369 -0.0146 -0.0930 0.0646  620 LEU A CB  
386  C CG  . LEU A 54  ? 0.4478 0.4614 0.4695 -0.0268 -0.1073 0.0515  620 LEU A CG  
387  C CD1 . LEU A 54  ? 0.3474 0.3731 0.3786 -0.0418 -0.0894 0.0278  620 LEU A CD1 
388  C CD2 . LEU A 54  ? 0.3729 0.4081 0.4203 -0.0264 -0.1420 0.0490  620 LEU A CD2 
389  N N   . LYS A 55  ? 0.5379 0.4980 0.6270 0.0141  -0.0628 0.1283  621 LYS A N   
390  C CA  . LYS A 55  ? 0.5882 0.5428 0.7442 0.0172  -0.0448 0.1352  621 LYS A CA  
391  C C   . LYS A 55  ? 0.5991 0.5541 0.8109 0.0296  -0.0633 0.1456  621 LYS A C   
392  O O   . LYS A 55  ? 0.5277 0.4947 0.8166 0.0288  -0.0574 0.1287  621 LYS A O   
393  C CB  . LYS A 55  ? 0.7331 0.6541 0.8599 0.0201  -0.0175 0.1650  621 LYS A CB  
394  C CG  . LYS A 55  ? 0.8247 0.7562 0.9953 0.0093  0.0112  0.1475  621 LYS A CG  
395  C CD  . LYS A 55  ? 0.7973 0.7387 1.0644 0.0066  0.0140  0.1328  621 LYS A CD  
396  C CE  . LYS A 55  ? 0.7406 0.6925 1.0561 -0.0040 0.0387  0.1157  621 LYS A CE  
397  N NZ  . LYS A 55  ? 0.7515 0.7019 1.1612 -0.0071 0.0430  0.1038  621 LYS A NZ  
398  N N   . GLU A 56  ? 0.5972 0.5389 0.7695 0.0434  -0.0877 0.1715  622 GLU A N   
399  C CA  . GLU A 56  ? 0.6649 0.6072 0.8891 0.0605  -0.1095 0.1844  622 GLU A CA  
400  C C   . GLU A 56  ? 0.6621 0.6506 0.9587 0.0561  -0.1235 0.1461  622 GLU A C   
401  O O   . GLU A 56  ? 0.6861 0.6794 1.0602 0.0643  -0.1215 0.1397  622 GLU A O   
402  C CB  . GLU A 56  ? 0.8740 0.8006 1.0343 0.0791  -0.1408 0.2163  622 GLU A CB  
403  C CG  . GLU A 56  ? 1.1393 1.0706 1.3553 0.1020  -0.1696 0.2307  622 GLU A CG  
404  C CD  . GLU A 56  ? 1.4075 1.3236 1.5481 0.1238  -0.2005 0.2593  622 GLU A CD  
405  O OE1 . GLU A 56  ? 1.5165 1.4194 1.5634 0.1209  -0.2039 0.2670  622 GLU A OE1 
406  O OE2 . GLU A 56  ? 1.4439 1.3616 1.6125 0.1449  -0.2180 0.2678  622 GLU A OE2 
407  N N   . LYS A 57  ? 0.5545 0.5745 0.8274 0.0430  -0.1341 0.1203  623 LYS A N   
408  C CA  . LYS A 57  ? 0.4032 0.4691 0.7404 0.0368  -0.1406 0.0856  623 LYS A CA  
409  C C   . LYS A 57  ? 0.3732 0.4489 0.7664 0.0308  -0.1125 0.0594  623 LYS A C   
410  O O   . LYS A 57  ? 0.4126 0.5176 0.8739 0.0345  -0.1129 0.0363  623 LYS A O   
411  C CB  . LYS A 57  ? 0.3576 0.4470 0.6565 0.0191  -0.1477 0.0651  623 LYS A CB  
412  C CG  . LYS A 57  ? 0.5076 0.5943 0.7574 0.0227  -0.1815 0.0791  623 LYS A CG  
413  C CD  . LYS A 57  ? 0.6042 0.7170 0.9120 0.0404  -0.2155 0.0846  623 LYS A CD  
414  C CE  . LYS A 57  ? 0.6713 0.8223 0.9854 0.0299  -0.2460 0.0648  623 LYS A CE  
415  N NZ  . LYS A 57  ? 0.7555 0.8816 0.9755 0.0180  -0.2543 0.0666  623 LYS A NZ  
416  N N   . PHE A 58  ? 0.3653 0.4189 0.7312 0.0230  -0.0888 0.0608  624 PHE A N   
417  C CA  . PHE A 58  ? 0.4032 0.4678 0.8127 0.0169  -0.0668 0.0315  624 PHE A CA  
418  C C   . PHE A 58  ? 0.5997 0.6436 1.0749 0.0261  -0.0582 0.0355  624 PHE A C   
419  O O   . PHE A 58  ? 0.6694 0.7170 1.1786 0.0202  -0.0420 0.0104  624 PHE A O   
420  C CB  . PHE A 58  ? 0.3465 0.4113 0.7046 0.0036  -0.0501 0.0203  624 PHE A CB  
421  C CG  . PHE A 58  ? 0.4267 0.5165 0.7503 -0.0060 -0.0523 0.0014  624 PHE A CG  
422  C CD1 . PHE A 58  ? 0.3264 0.4437 0.6718 -0.0101 -0.0409 -0.0312 624 PHE A CD1 
423  C CD2 . PHE A 58  ? 0.3329 0.4162 0.6023 -0.0108 -0.0651 0.0157  624 PHE A CD2 
424  C CE1 . PHE A 58  ? 0.3274 0.4618 0.6405 -0.0193 -0.0373 -0.0430 624 PHE A CE1 
425  C CE2 . PHE A 58  ? 0.3213 0.4220 0.5675 -0.0227 -0.0639 -0.0008 624 PHE A CE2 
426  C CZ  . PHE A 58  ? 0.2807 0.4054 0.5492 -0.0272 -0.0477 -0.0271 624 PHE A CZ  
427  N N   . THR A 59  ? 0.6241 0.5007 1.0350 -0.0223 -0.0821 0.0737  625 THR A N   
428  C CA  . THR A 59  ? 0.5515 0.4074 1.0244 -0.0237 -0.0805 0.0733  625 THR A CA  
429  C C   . THR A 59  ? 0.4643 0.3409 0.9991 -0.0270 -0.0810 0.0312  625 THR A C   
430  O O   . THR A 59  ? 0.4669 0.3559 1.0145 -0.0190 -0.0905 0.0146  625 THR A O   
431  C CB  . THR A 59  ? 0.6418 0.4674 1.1054 -0.0100 -0.0936 0.1011  625 THR A CB  
432  O OG1 . THR A 59  ? 0.6772 0.4812 1.0688 -0.0065 -0.0901 0.1358  625 THR A OG1 
433  C CG2 . THR A 59  ? 0.6840 0.4985 1.1964 -0.0105 -0.0873 0.0997  625 THR A CG2 
434  N N   . PRO A 60  ? 0.4941 0.3789 1.0613 -0.0367 -0.0692 0.0135  626 PRO A N   
435  C CA  . PRO A 60  ? 0.5167 0.4210 1.1227 -0.0374 -0.0664 -0.0283 626 PRO A CA  
436  C C   . PRO A 60  ? 0.5967 0.4908 1.2411 -0.0231 -0.0744 -0.0334 626 PRO A C   
437  O O   . PRO A 60  ? 0.6163 0.4865 1.2671 -0.0146 -0.0827 -0.0040 626 PRO A O   
438  C CB  . PRO A 60  ? 0.4965 0.3971 1.1251 -0.0468 -0.0569 -0.0333 626 PRO A CB  
439  C CG  . PRO A 60  ? 0.4781 0.3780 1.0762 -0.0558 -0.0511 -0.0050 626 PRO A CG  
440  C CD  . PRO A 60  ? 0.4917 0.3692 1.0561 -0.0460 -0.0569 0.0317  626 PRO A CD  
441  N N   . LYS A 61  ? 0.5954 0.5103 1.2606 -0.0202 -0.0704 -0.0697 627 LYS A N   
442  C CA  . LYS A 61  ? 0.6471 0.5615 1.3569 -0.0068 -0.0746 -0.0789 627 LYS A CA  
443  C C   . LYS A 61  ? 0.5484 0.4671 1.2522 0.0030  -0.0892 -0.0634 627 LYS A C   
444  O O   . LYS A 61  ? 0.5425 0.4729 1.2855 0.0125  -0.0909 -0.0767 627 LYS A O   
445  C CB  . LYS A 61  ? 0.7329 0.6222 1.4807 -0.0018 -0.0773 -0.0632 627 LYS A CB  
446  C CG  . LYS A 61  ? 0.8288 0.7127 1.5956 -0.0107 -0.0642 -0.0841 627 LYS A CG  
447  C CD  . LYS A 61  ? 0.9051 0.8092 1.6855 -0.0113 -0.0525 -0.1299 627 LYS A CD  
448  C CE  . LYS A 61  ? 1.0102 0.9035 1.8077 -0.0198 -0.0435 -0.1519 627 LYS A CE  
449  N NZ  . LYS A 61  ? 1.0564 0.9633 1.8587 -0.0196 -0.0318 -0.1960 627 LYS A NZ  
450  N N   . LYS A 62  ? 0.5240 0.4345 1.1793 0.0002  -0.0989 -0.0364 628 LYS A N   
451  C CA  . LYS A 62  ? 0.5583 0.4730 1.1996 0.0095  -0.1161 -0.0211 628 LYS A CA  
452  C C   . LYS A 62  ? 0.5153 0.4704 1.1536 0.0068  -0.1069 -0.0517 628 LYS A C   
453  O O   . LYS A 62  ? 0.5745 0.5485 1.1867 -0.0041 -0.0898 -0.0741 628 LYS A O   
454  C CB  . LYS A 62  ? 0.6720 0.5729 1.2414 0.0071  -0.1257 0.0151  628 LYS A CB  
455  C CG  . LYS A 62  ? 0.8085 0.6741 1.3660 0.0151  -0.1400 0.0531  628 LYS A CG  
456  C CD  . LYS A 62  ? 0.8708 0.7190 1.3490 0.0154  -0.1493 0.0852  628 LYS A CD  
457  C CE  . LYS A 62  ? 0.9256 0.7913 1.3838 0.0187  -0.1666 0.0805  628 LYS A CE  
458  N NZ  . LYS A 62  ? 0.9969 0.8393 1.3728 0.0202  -0.1795 0.1108  628 LYS A NZ  
459  N N   . ILE A 63  ? 0.5303 0.4983 1.1974 0.0170  -0.1187 -0.0511 629 ILE A N   
460  C CA  . ILE A 63  ? 0.4105 0.4153 1.0752 0.0142  -0.1088 -0.0738 629 ILE A CA  
461  C C   . ILE A 63  ? 0.4462 0.4571 1.0538 0.0102  -0.1238 -0.0514 629 ILE A C   
462  O O   . ILE A 63  ? 0.5556 0.5501 1.1606 0.0170  -0.1500 -0.0237 629 ILE A O   
463  C CB  . ILE A 63  ? 0.4558 0.4758 1.1978 0.0262  -0.1089 -0.0890 629 ILE A CB  
464  C CG1 . ILE A 63  ? 0.5363 0.5395 1.3265 0.0293  -0.0963 -0.1061 629 ILE A CG1 
465  C CG2 . ILE A 63  ? 0.4108 0.4621 1.1404 0.0205  -0.0880 -0.1142 629 ILE A CG2 
466  C CD1 . ILE A 63  ? 0.5124 0.5283 1.3061 0.0238  -0.0660 -0.1472 629 ILE A CD1 
467  N N   . ILE A 64  ? 0.3731 0.4037 0.9318 -0.0004 -0.1083 -0.0637 630 ILE A N   
468  C CA  . ILE A 64  ? 0.3349 0.3683 0.8365 -0.0053 -0.1185 -0.0467 630 ILE A CA  
469  C C   . ILE A 64  ? 0.3521 0.4178 0.8467 -0.0121 -0.1009 -0.0693 630 ILE A C   
470  O O   . ILE A 64  ? 0.3624 0.4454 0.8707 -0.0146 -0.0766 -0.0966 630 ILE A O   
471  C CB  . ILE A 64  ? 0.3638 0.3764 0.7912 -0.0113 -0.1165 -0.0269 630 ILE A CB  
472  C CG1 . ILE A 64  ? 0.3059 0.3334 0.7164 -0.0194 -0.0911 -0.0478 630 ILE A CG1 
473  C CG2 . ILE A 64  ? 0.3301 0.3066 0.7574 -0.0049 -0.1312 0.0010  630 ILE A CG2 
474  C CD1 . ILE A 64  ? 0.3036 0.3172 0.6555 -0.0243 -0.0865 -0.0288 630 ILE A CD1 
475  N N   . ALA A 65  ? 0.2541 0.3241 0.7248 -0.0155 -0.1131 -0.0578 631 ALA A N   
476  C CA  . ALA A 65  ? 0.2990 0.3932 0.7514 -0.0239 -0.0951 -0.0731 631 ALA A CA  
477  C C   . ALA A 65  ? 0.3766 0.4572 0.7430 -0.0313 -0.0917 -0.0601 631 ALA A C   
478  O O   . ALA A 65  ? 0.3452 0.4002 0.6708 -0.0306 -0.1115 -0.0360 631 ALA A O   
479  C CB  . ALA A 65  ? 0.2784 0.3832 0.7628 -0.0229 -0.1064 -0.0702 631 ALA A CB  
480  N N   . ILE A 66  ? 0.3465 0.4419 0.6830 -0.0367 -0.0660 -0.0759 632 ILE A N   
481  C CA  . ILE A 66  ? 0.3790 0.4643 0.6399 -0.0416 -0.0598 -0.0645 632 ILE A CA  
482  C C   . ILE A 66  ? 0.4203 0.5203 0.6609 -0.0484 -0.0442 -0.0736 632 ILE A C   
483  O O   . ILE A 66  ? 0.4376 0.5595 0.6984 -0.0499 -0.0227 -0.0949 632 ILE A O   
484  C CB  . ILE A 66  ? 0.3833 0.4693 0.6189 -0.0411 -0.0461 -0.0693 632 ILE A CB  
485  C CG1 . ILE A 66  ? 0.3301 0.4013 0.5966 -0.0364 -0.0578 -0.0618 632 ILE A CG1 
486  C CG2 . ILE A 66  ? 0.3923 0.4674 0.5569 -0.0430 -0.0414 -0.0529 632 ILE A CG2 
487  C CD1 . ILE A 66  ? 0.3146 0.3908 0.5763 -0.0384 -0.0465 -0.0709 632 ILE A CD1 
488  N N   . ALA A 67  ? 0.3131 0.3967 0.5104 -0.0526 -0.0538 -0.0572 633 ALA A N   
489  C CA  . ALA A 67  ? 0.2316 0.3223 0.4066 -0.0603 -0.0393 -0.0621 633 ALA A CA  
490  C C   . ALA A 67  ? 0.3260 0.3898 0.4232 -0.0620 -0.0404 -0.0443 633 ALA A C   
491  O O   . ALA A 67  ? 0.3705 0.4089 0.4360 -0.0576 -0.0557 -0.0271 633 ALA A O   
492  C CB  . ALA A 67  ? 0.2119 0.3125 0.4402 -0.0662 -0.0511 -0.0654 633 ALA A CB  
493  N N   . ASN A 68  ? 0.3313 0.3975 0.3967 -0.0673 -0.0216 -0.0476 634 ASN A N   
494  C CA  . ASN A 68  ? 0.3424 0.3810 0.3356 -0.0672 -0.0189 -0.0319 634 ASN A CA  
495  C C   . ASN A 68  ? 0.3519 0.3840 0.3081 -0.0574 -0.0139 -0.0222 634 ASN A C   
496  O O   . ASN A 68  ? 0.3695 0.3734 0.2800 -0.0533 -0.0200 -0.0047 634 ASN A O   
497  C CB  . ASN A 68  ? 0.3114 0.3189 0.2871 -0.0718 -0.0432 -0.0193 634 ASN A CB  
498  C CG  . ASN A 68  ? 0.5105 0.5290 0.5333 -0.0836 -0.0513 -0.0289 634 ASN A CG  
499  O OD1 . ASN A 68  ? 0.5116 0.5163 0.5488 -0.0879 -0.0797 -0.0238 634 ASN A OD1 
500  N ND2 . ASN A 68  ? 0.3861 0.4302 0.4349 -0.0888 -0.0263 -0.0423 634 ASN A ND2 
501  N N   . TYR A 69  ? 0.3323 0.3898 0.3103 -0.0540 -0.0025 -0.0343 635 TYR A N   
502  C CA  . TYR A 69  ? 0.3737 0.4331 0.3263 -0.0470 0.0030  -0.0274 635 TYR A CA  
503  C C   . TYR A 69  ? 0.4312 0.4987 0.3417 -0.0452 0.0221  -0.0287 635 TYR A C   
504  O O   . TYR A 69  ? 0.4305 0.5010 0.3324 -0.0498 0.0337  -0.0360 635 TYR A O   
505  C CB  . TYR A 69  ? 0.2664 0.3467 0.2681 -0.0459 -0.0001 -0.0418 635 TYR A CB  
506  C CG  . TYR A 69  ? 0.2904 0.3940 0.3249 -0.0496 0.0108  -0.0672 635 TYR A CG  
507  C CD1 . TYR A 69  ? 0.3624 0.4820 0.3732 -0.0491 0.0271  -0.0800 635 TYR A CD1 
508  C CD2 . TYR A 69  ? 0.3627 0.4708 0.4491 -0.0523 0.0056  -0.0775 635 TYR A CD2 
509  C CE1 . TYR A 69  ? 0.3109 0.4462 0.3414 -0.0515 0.0413  -0.1031 635 TYR A CE1 
510  C CE2 . TYR A 69  ? 0.4383 0.5663 0.5554 -0.0542 0.0213  -0.1005 635 TYR A CE2 
511  C CZ  . TYR A 69  ? 0.4167 0.5561 0.5018 -0.0539 0.0409  -0.1137 635 TYR A CZ  
512  O OH  . TYR A 69  ? 0.4068 0.5610 0.5140 -0.0548 0.0605  -0.1366 635 TYR A OH  
513  N N   . VAL A 70  ? 0.3060 0.4716 0.4695 -0.0446 0.0448  0.1216  636 VAL A N   
514  C CA  . VAL A 70  ? 0.3175 0.4822 0.4408 -0.0327 0.0462  0.1364  636 VAL A CA  
515  C C   . VAL A 70  ? 0.2983 0.5134 0.4011 -0.0130 0.0605  0.1160  636 VAL A C   
516  O O   . VAL A 70  ? 0.3971 0.6243 0.5049 -0.0033 0.0599  0.0815  636 VAL A O   
517  C CB  . VAL A 70  ? 0.3610 0.4750 0.4612 -0.0238 0.0247  0.1287  636 VAL A CB  
518  C CG1 . VAL A 70  ? 0.4237 0.5325 0.4893 -0.0073 0.0174  0.1473  636 VAL A CG1 
519  C CG2 . VAL A 70  ? 0.2943 0.3521 0.4072 -0.0440 0.0096  0.1399  636 VAL A CG2 
520  N N   . CYS A 71  ? 0.2900 0.5330 0.3648 -0.0117 0.0721  0.1380  637 CYS A N   
521  C CA  . CYS A 71  ? 0.2915 0.5792 0.3333 0.0047  0.0823  0.1186  637 CYS A CA  
522  C C   . CYS A 71  ? 0.4783 0.7436 0.4786 0.0201  0.0590  0.1245  637 CYS A C   
523  O O   . CYS A 71  ? 0.4977 0.7350 0.4730 0.0161  0.0462  0.1621  637 CYS A O   
524  C CB  . CYS A 71  ? 0.3418 0.6813 0.3668 -0.0056 0.1094  0.1368  637 CYS A CB  
525  S SG  . CYS A 71  ? 0.7081 1.1018 0.7873 -0.0060 0.1395  0.1029  637 CYS A SG  
526  N N   . ARG A 72  ? 0.4724 0.7479 0.4707 0.0370  0.0498  0.0881  638 ARG A N   
527  C CA  . ARG A 72  ? 0.4151 0.6842 0.3860 0.0555  0.0259  0.0889  638 ARG A CA  
528  C C   . ARG A 72  ? 0.4642 0.7803 0.4192 0.0673  0.0267  0.0530  638 ARG A C   
529  O O   . ARG A 72  ? 0.3536 0.6813 0.3339 0.0648  0.0336  0.0164  638 ARG A O   
530  C CB  . ARG A 72  ? 0.4482 0.6756 0.4472 0.0631  0.0066  0.0783  638 ARG A CB  
531  C CG  . ARG A 72  ? 0.4987 0.7017 0.4842 0.0837  -0.0221 0.0949  638 ARG A CG  
532  C CD  . ARG A 72  ? 0.6096 0.7948 0.6299 0.0981  -0.0356 0.0637  638 ARG A CD  
533  N NE  . ARG A 72  ? 0.6157 0.7624 0.6598 0.0803  -0.0265 0.0580  638 ARG A NE  
534  C CZ  . ARG A 72  ? 0.6412 0.7346 0.6840 0.0692  -0.0316 0.0888  638 ARG A CZ  
535  N NH1 . ARG A 72  ? 0.6494 0.7199 0.6683 0.0714  -0.0441 0.1312  638 ARG A NH1 
536  N NH2 . ARG A 72  ? 0.6336 0.6950 0.6944 0.0510  -0.0264 0.0793  638 ARG A NH2 
537  N N   . ASN A 73  ? 0.5293 0.8681 0.4388 0.0762  0.0160  0.0658  639 ASN A N   
538  C CA  . ASN A 73  ? 0.5421 0.9247 0.4308 0.0861  0.0099  0.0325  639 ASN A CA  
539  C C   . ASN A 73  ? 0.5102 0.9260 0.3998 0.0770  0.0369  -0.0026 639 ASN A C   
540  O O   . ASN A 73  ? 0.5776 1.0166 0.4673 0.0811  0.0314  -0.0412 639 ASN A O   
541  C CB  . ASN A 73  ? 0.5398 0.9220 0.4631 0.0994  -0.0117 0.0028  639 ASN A CB  
542  C CG  . ASN A 73  ? 0.6310 0.9880 0.5619 0.1180  -0.0419 0.0258  639 ASN A CG  
543  O OD1 . ASN A 73  ? 0.6546 1.0020 0.5486 0.1250  -0.0598 0.0622  639 ASN A OD1 
544  N ND2 . ASN A 73  ? 0.6150 0.9602 0.5931 0.1255  -0.0488 0.0036  639 ASN A ND2 
545  N N   . GLY A 74  ? 0.4818 0.9002 0.3783 0.0649  0.0644  0.0080  640 GLY A N   
546  C CA  . GLY A 74  ? 0.4724 0.9108 0.3825 0.0608  0.0856  -0.0282 640 GLY A CA  
547  C C   . GLY A 74  ? 0.4612 0.8695 0.4297 0.0577  0.0855  -0.0526 640 GLY A C   
548  O O   . GLY A 74  ? 0.4794 0.8806 0.4668 0.0561  0.0922  -0.0810 640 GLY A O   
549  N N   . PHE A 75  ? 0.3230 0.7069 0.3169 0.0558  0.0745  -0.0398 641 PHE A N   
550  C CA  . PHE A 75  ? 0.3395 0.6927 0.3801 0.0464  0.0715  -0.0537 641 PHE A CA  
551  C C   . PHE A 75  ? 0.4514 0.7811 0.5208 0.0359  0.0777  -0.0211 641 PHE A C   
552  O O   . PHE A 75  ? 0.4221 0.7438 0.4763 0.0337  0.0768  0.0134  641 PHE A O   
553  C CB  . PHE A 75  ? 0.2828 0.6139 0.3283 0.0422  0.0507  -0.0640 641 PHE A CB  
554  C CG  . PHE A 75  ? 0.3866 0.7455 0.4138 0.0476  0.0408  -0.0958 641 PHE A CG  
555  C CD1 . PHE A 75  ? 0.4768 0.8619 0.4750 0.0617  0.0296  -0.0900 641 PHE A CD1 
556  C CD2 . PHE A 75  ? 0.4393 0.7862 0.4794 0.0347  0.0346  -0.1258 641 PHE A CD2 
557  C CE1 . PHE A 75  ? 0.4887 0.9046 0.4760 0.0644  0.0162  -0.1191 641 PHE A CE1 
558  C CE2 . PHE A 75  ? 0.4551 0.8224 0.4842 0.0327  0.0210  -0.1504 641 PHE A CE2 
559  C CZ  . PHE A 75  ? 0.4261 0.8293 0.4334 0.0469  0.0116  -0.1468 641 PHE A CZ  
560  N N   . LEU A 76  ? 0.3459 0.6613 0.4580 0.0281  0.0794  -0.0304 642 LEU A N   
561  C CA  . LEU A 76  ? 0.2624 0.5497 0.4063 0.0138  0.0753  -0.0024 642 LEU A CA  
562  C C   . LEU A 76  ? 0.1833 0.4255 0.3251 0.0011  0.0540  -0.0040 642 LEU A C   
563  O O   . LEU A 76  ? 0.3059 0.5365 0.4515 -0.0046 0.0444  -0.0282 642 LEU A O   
564  C CB  . LEU A 76  ? 0.3219 0.6180 0.5184 0.0123  0.0811  -0.0099 642 LEU A CB  
565  C CG  . LEU A 76  ? 0.3367 0.6823 0.5463 0.0275  0.1057  -0.0281 642 LEU A CG  
566  C CD1 . LEU A 76  ? 0.3317 0.6820 0.6112 0.0279  0.1057  -0.0292 642 LEU A CD1 
567  C CD2 . LEU A 76  ? 0.4781 0.8503 0.6496 0.0253  0.1250  -0.0049 642 LEU A CD2 
568  N N   . GLU A 77  ? 0.2964 0.3379 0.3022 -0.0500 0.0233  0.0530  643 GLU A N   
569  C CA  . GLU A 77  ? 0.2743 0.3088 0.2905 -0.0392 0.0167  0.0561  643 GLU A CA  
570  C C   . GLU A 77  ? 0.2946 0.3194 0.3203 -0.0424 0.0193  0.0561  643 GLU A C   
571  O O   . GLU A 77  ? 0.3938 0.4080 0.4142 -0.0511 0.0212  0.0588  643 GLU A O   
572  C CB  . GLU A 77  ? 0.2847 0.3022 0.2819 -0.0288 0.0070  0.0658  643 GLU A CB  
573  C CG  . GLU A 77  ? 0.2869 0.3137 0.2688 -0.0237 -0.0034 0.0688  643 GLU A CG  
574  C CD  . GLU A 77  ? 0.4285 0.4438 0.4065 -0.0046 -0.0176 0.0770  643 GLU A CD  
575  O OE1 . GLU A 77  ? 0.4850 0.5226 0.4703 0.0060  -0.0315 0.0748  643 GLU A OE1 
576  O OE2 . GLU A 77  ? 0.4601 0.4452 0.4322 0.0009  -0.0162 0.0831  643 GLU A OE2 
577  N N   . VAL A 78  ? 0.3226 0.3509 0.3609 -0.0372 0.0188  0.0532  644 VAL A N   
578  C CA  . VAL A 78  ? 0.3147 0.3363 0.3570 -0.0379 0.0152  0.0531  644 VAL A CA  
579  C C   . VAL A 78  ? 0.3355 0.3404 0.3591 -0.0308 0.0116  0.0545  644 VAL A C   
580  O O   . VAL A 78  ? 0.3105 0.3171 0.3306 -0.0244 0.0168  0.0550  644 VAL A O   
581  C CB  . VAL A 78  ? 0.3755 0.4057 0.4354 -0.0357 0.0161  0.0515  644 VAL A CB  
582  C CG1 . VAL A 78  ? 0.3321 0.3547 0.3896 -0.0322 0.0054  0.0543  644 VAL A CG1 
583  C CG2 . VAL A 78  ? 0.2566 0.3027 0.3382 -0.0407 0.0226  0.0439  644 VAL A CG2 
584  N N   . TYR A 79  ? 0.2946 0.2834 0.3073 -0.0343 0.0055  0.0527  645 TYR A N   
585  C CA  . TYR A 79  ? 0.3383 0.3069 0.3287 -0.0283 0.0026  0.0483  645 TYR A CA  
586  C C   . TYR A 79  ? 0.3422 0.3083 0.3240 -0.0321 -0.0086 0.0441  645 TYR A C   
587  O O   . TYR A 79  ? 0.3615 0.3441 0.3626 -0.0365 -0.0158 0.0459  645 TYR A O   
588  C CB  . TYR A 79  ? 0.3983 0.3412 0.3787 -0.0286 0.0017  0.0463  645 TYR A CB  
589  C CG  . TYR A 79  ? 0.4033 0.3476 0.3872 -0.0195 0.0061  0.0532  645 TYR A CG  
590  C CD1 . TYR A 79  ? 0.4137 0.3598 0.3982 -0.0028 0.0098  0.0499  645 TYR A CD1 
591  C CD2 . TYR A 79  ? 0.3516 0.2998 0.3385 -0.0270 0.0060  0.0619  645 TYR A CD2 
592  C CE1 . TYR A 79  ? 0.3931 0.3476 0.3874 0.0085  0.0073  0.0552  645 TYR A CE1 
593  C CE2 . TYR A 79  ? 0.3373 0.2873 0.3201 -0.0170 0.0037  0.0691  645 TYR A CE2 
594  C CZ  . TYR A 79  ? 0.4283 0.3830 0.4181 0.0018  0.0013  0.0657  645 TYR A CZ  
595  O OH  . TYR A 79  ? 0.4826 0.4462 0.4756 0.0146  -0.0071 0.0713  645 TYR A OH  
596  N N   . PRO A 80  ? 0.4748 0.4211 0.4272 -0.0286 -0.0117 0.0364  646 PRO A N   
597  C CA  . PRO A 80  ? 0.4609 0.4038 0.3949 -0.0320 -0.0282 0.0310  646 PRO A CA  
598  C C   . PRO A 80  ? 0.4476 0.3967 0.4048 -0.0458 -0.0442 0.0231  646 PRO A C   
599  O O   . PRO A 80  ? 0.4134 0.3740 0.3719 -0.0483 -0.0637 0.0193  646 PRO A O   
600  C CB  . PRO A 80  ? 0.5004 0.4172 0.3920 -0.0266 -0.0238 0.0191  646 PRO A CB  
601  C CG  . PRO A 80  ? 0.5443 0.4618 0.4400 -0.0159 -0.0014 0.0224  646 PRO A CG  
602  C CD  . PRO A 80  ? 0.5273 0.4570 0.4613 -0.0184 0.0001  0.0306  646 PRO A CD  
603  N N   . PHE A 81  ? 0.4165 0.3583 0.3920 -0.0555 -0.0367 0.0213  647 PHE A N   
604  C CA  . PHE A 81  ? 0.3998 0.3495 0.4031 -0.0746 -0.0457 0.0135  647 PHE A CA  
605  C C   . PHE A 81  ? 0.4058 0.3925 0.4524 -0.0800 -0.0408 0.0201  647 PHE A C   
606  O O   . PHE A 81  ? 0.4528 0.4584 0.5342 -0.0969 -0.0436 0.0129  647 PHE A O   
607  C CB  . PHE A 81  ? 0.3941 0.3085 0.3908 -0.0862 -0.0369 0.0104  647 PHE A CB  
608  C CG  . PHE A 81  ? 0.4869 0.3904 0.4801 -0.0798 -0.0193 0.0259  647 PHE A CG  
609  C CD1 . PHE A 81  ? 0.4512 0.3761 0.4666 -0.0893 -0.0091 0.0360  647 PHE A CD1 
610  C CD2 . PHE A 81  ? 0.3691 0.2430 0.3364 -0.0633 -0.0139 0.0285  647 PHE A CD2 
611  C CE1 . PHE A 81  ? 0.3746 0.2884 0.3765 -0.0836 0.0025  0.0500  647 PHE A CE1 
612  C CE2 . PHE A 81  ? 0.4234 0.2910 0.3884 -0.0550 -0.0049 0.0431  647 PHE A CE2 
613  C CZ  . PHE A 81  ? 0.3826 0.2681 0.3597 -0.0660 0.0015  0.0546  647 PHE A CZ  
614  N N   . THR A 82  ? 0.4043 0.4021 0.4515 -0.0670 -0.0310 0.0307  648 THR A N   
615  C CA  . THR A 82  ? 0.2505 0.2789 0.3339 -0.0688 -0.0227 0.0331  648 THR A CA  
616  C C   . THR A 82  ? 0.3199 0.3752 0.4317 -0.0613 -0.0394 0.0292  648 THR A C   
617  O O   . THR A 82  ? 0.3193 0.3643 0.4080 -0.0485 -0.0540 0.0334  648 THR A O   
618  C CB  . THR A 82  ? 0.2902 0.3160 0.3620 -0.0582 -0.0089 0.0417  648 THR A CB  
619  O OG1 . THR A 82  ? 0.3303 0.3354 0.3790 -0.0613 0.0008  0.0464  648 THR A OG1 
620  C CG2 . THR A 82  ? 0.2526 0.3059 0.3572 -0.0589 0.0008  0.0390  648 THR A CG2 
621  N N   . LEU A 83  ? 0.3001 0.3894 0.4611 -0.0681 -0.0366 0.0219  649 LEU A N   
622  C CA  . LEU A 83  ? 0.2927 0.4122 0.4930 -0.0555 -0.0544 0.0177  649 LEU A CA  
623  C C   . LEU A 83  ? 0.3000 0.4180 0.5055 -0.0383 -0.0446 0.0245  649 LEU A C   
624  O O   . LEU A 83  ? 0.3032 0.4271 0.5187 -0.0431 -0.0209 0.0212  649 LEU A O   
625  C CB  . LEU A 83  ? 0.2023 0.3672 0.4672 -0.0691 -0.0532 0.0024  649 LEU A CB  
626  C CG  . LEU A 83  ? 0.3174 0.5244 0.6417 -0.0518 -0.0721 -0.0050 649 LEU A CG  
627  C CD1 . LEU A 83  ? 0.4145 0.6198 0.7266 -0.0415 -0.1133 -0.0036 649 LEU A CD1 
628  C CD2 . LEU A 83  ? 0.2901 0.5513 0.6897 -0.0669 -0.0581 -0.0235 649 LEU A CD2 
629  N N   . VAL A 84  ? 0.2965 0.4010 0.4884 -0.0197 -0.0628 0.0339  650 VAL A N   
630  C CA  . VAL A 84  ? 0.2089 0.3058 0.4125 -0.0034 -0.0568 0.0397  650 VAL A CA  
631  C C   . VAL A 84  ? 0.3122 0.4173 0.5402 0.0168  -0.0861 0.0440  650 VAL A C   
632  O O   . VAL A 84  ? 0.4434 0.5275 0.6317 0.0238  -0.1090 0.0565  650 VAL A O   
633  C CB  . VAL A 84  ? 0.2627 0.3190 0.4140 -0.0014 -0.0471 0.0540  650 VAL A CB  
634  C CG1 . VAL A 84  ? 0.3208 0.3630 0.4875 0.0105  -0.0390 0.0579  650 VAL A CG1 
635  C CG2 . VAL A 84  ? 0.2776 0.3290 0.4054 -0.0171 -0.0263 0.0505  650 VAL A CG2 
636  N N   . ALA A 85  ? 0.2543 0.4943 0.6065 0.0291  -0.1256 0.1135  651 ALA A N   
637  C CA  . ALA A 85  ? 0.3391 0.5720 0.7231 0.0801  -0.1438 0.1048  651 ALA A CA  
638  C C   . ALA A 85  ? 0.4491 0.6587 0.9120 0.1216  -0.1526 0.0804  651 ALA A C   
639  O O   . ALA A 85  ? 0.3863 0.6102 0.8720 0.1094  -0.1304 0.0407  651 ALA A O   
640  C CB  . ALA A 85  ? 0.2524 0.5745 0.6481 0.0854  -0.1394 0.0762  651 ALA A CB  
641  N N   . ASP A 86  ? 0.5369 0.6878 0.9838 0.1586  -0.1652 0.0905  652 ASP A N   
642  C CA  . ASP A 86  ? 0.6829 0.8006 1.1826 0.2008  -0.1692 0.0634  652 ASP A CA  
643  C C   . ASP A 86  ? 0.6516 0.8624 1.2284 0.2254  -0.1604 0.0144  652 ASP A C   
644  O O   . ASP A 86  ? 0.5857 0.8647 1.1626 0.2282  -0.1606 0.0172  652 ASP A O   
645  C CB  . ASP A 86  ? 0.8432 0.8971 1.2979 0.2268  -0.1782 0.0864  652 ASP A CB  
646  C CG  . ASP A 86  ? 0.9967 0.9689 1.3659 0.2009  -0.1750 0.1211  652 ASP A CG  
647  O OD1 . ASP A 86  ? 1.0523 0.9876 1.4075 0.1738  -0.1693 0.1260  652 ASP A OD1 
648  O OD2 . ASP A 86  ? 1.0998 1.0519 1.4153 0.2071  -0.1738 0.1390  652 ASP A OD2 
649  N N   . VAL A 87  ? 0.6084 0.8192 1.2390 0.2406  -0.1477 -0.0325 653 VAL A N   
650  C CA  . VAL A 87  ? 0.5822 0.8673 1.2670 0.2663  -0.1319 -0.0818 653 VAL A CA  
651  C C   . VAL A 87  ? 0.7245 0.9467 1.4156 0.3152  -0.1430 -0.0795 653 VAL A C   
652  O O   . VAL A 87  ? 0.7655 0.8872 1.4285 0.3234  -0.1521 -0.0645 653 VAL A O   
653  C CB  . VAL A 87  ? 0.6436 0.9500 1.3389 0.2457  -0.0988 -0.1339 653 VAL A CB  
654  C CG1 . VAL A 87  ? 0.7776 1.1606 1.5347 0.2799  -0.0829 -0.1845 653 VAL A CG1 
655  C CG2 . VAL A 87  ? 0.5952 0.9491 1.2450 0.1809  -0.0800 -0.1268 653 VAL A CG2 
656  N N   . ASN A 88  ? 0.7368 1.0178 1.4585 0.3432  -0.1406 -0.0903 654 ASN A N   
657  C CA  . ASN A 88  ? 0.9994 1.2317 1.7244 0.3864  -0.1509 -0.0800 654 ASN A CA  
658  C C   . ASN A 88  ? 1.3024 1.4627 2.0378 0.4117  -0.1426 -0.1126 654 ASN A C   
659  O O   . ASN A 88  ? 1.3563 1.5246 2.1090 0.4022  -0.1244 -0.1540 654 ASN A O   
660  C CB  . ASN A 88  ? 0.9626 1.2797 1.7278 0.4105  -0.1475 -0.0855 654 ASN A CB  
661  C CG  . ASN A 88  ? 0.8809 1.2799 1.6933 0.4119  -0.1230 -0.1350 654 ASN A CG  
662  O OD1 . ASN A 88  ? 0.7115 1.1002 1.5272 0.3999  -0.1059 -0.1717 654 ASN A OD1 
663  N ND2 . ASN A 88  ? 0.9395 1.4188 1.7845 0.4244  -0.1191 -0.1345 654 ASN A ND2 
664  N N   . ALA A 89  ? 1.4486 1.5365 2.1654 0.4404  -0.1536 -0.0934 655 ALA A N   
665  C CA  . ALA A 89  ? 1.5530 1.5624 2.2672 0.4644  -0.1473 -0.1180 655 ALA A CA  
666  C C   . ALA A 89  ? 1.6059 1.6717 2.3728 0.4984  -0.1280 -0.1660 655 ALA A C   
667  O O   . ALA A 89  ? 1.6587 1.6715 2.4260 0.5219  -0.1177 -0.1949 655 ALA A O   
668  C CB  . ALA A 89  ? 1.6138 1.5451 2.2920 0.4833  -0.1612 -0.0823 655 ALA A CB  
669  N N   . ASP A 90  ? 1.5998 1.7728 2.4039 0.4981  -0.1221 -0.1710 656 ASP A N   
670  C CA  . ASP A 90  ? 1.6678 1.9134 2.5193 0.5244  -0.1014 -0.2098 656 ASP A CA  
671  C C   . ASP A 90  ? 1.5968 1.8738 2.4541 0.4997  -0.0763 -0.2563 656 ASP A C   
672  O O   . ASP A 90  ? 1.5980 1.9339 2.4842 0.5133  -0.0534 -0.2925 656 ASP A O   
673  C CB  . ASP A 90  ? 1.6825 2.0294 2.5629 0.5234  -0.1057 -0.1885 656 ASP A CB  
674  C CG  . ASP A 90  ? 1.7370 2.1649 2.6660 0.5483  -0.0847 -0.2201 656 ASP A CG  
675  O OD1 . ASP A 90  ? 1.8103 2.2091 2.7493 0.5759  -0.0677 -0.2558 656 ASP A OD1 
676  O OD2 . ASP A 90  ? 1.7020 2.2191 2.6550 0.5391  -0.0850 -0.2060 656 ASP A OD2 
677  N N   . ARG A 91  ? 1.5280 2.1831 2.7401 0.3216  -0.3209 -0.8321 657 ARG A N   
678  C CA  . ARG A 91  ? 1.4306 2.0521 2.6736 0.2753  -0.2815 -0.8125 657 ARG A CA  
679  C C   . ARG A 91  ? 1.3464 1.9463 2.5648 0.2663  -0.2389 -0.7659 657 ARG A C   
680  O O   . ARG A 91  ? 1.3085 1.9076 2.5721 0.2443  -0.2192 -0.7541 657 ARG A O   
681  C CB  . ARG A 91  ? 1.3766 1.9747 2.5853 0.2715  -0.2782 -0.8181 657 ARG A CB  
682  C CG  . ARG A 91  ? 1.3152 1.8805 2.5463 0.2311  -0.2407 -0.7988 657 ARG A CG  
683  C CD  . ARG A 91  ? 1.3222 1.8894 2.6451 0.2008  -0.2387 -0.8165 657 ARG A CD  
684  N NE  . ARG A 91  ? 1.3421 1.8791 2.6775 0.1714  -0.1981 -0.7911 657 ARG A NE  
685  C CZ  . ARG A 91  ? 1.3732 1.8996 2.7052 0.1596  -0.1626 -0.7563 657 ARG A CZ  
686  N NH1 . ARG A 91  ? 1.3978 1.8998 2.7318 0.1417  -0.1292 -0.7358 657 ARG A NH1 
687  N NH2 . ARG A 91  ? 1.3560 1.8972 2.6787 0.1710  -0.1614 -0.7428 657 ARG A NH2 
688  N N   . ASN A 92  ? 1.2973 1.8781 2.4466 0.2859  -0.2237 -0.7405 658 ASN A N   
689  C CA  . ASN A 92  ? 1.2134 1.7669 2.3418 0.2782  -0.1867 -0.7036 658 ASN A CA  
690  C C   . ASN A 92  ? 1.0320 1.5609 2.1834 0.2386  -0.1585 -0.6938 658 ASN A C   
691  O O   . ASN A 92  ? 0.9918 1.5201 2.1738 0.2259  -0.1429 -0.6845 658 ASN A O   
692  C CB  . ASN A 92  ? 1.2890 1.8580 2.4307 0.2964  -0.1875 -0.6939 658 ASN A CB  
693  C CG  . ASN A 92  ? 1.3601 1.9346 2.4515 0.3442  -0.1966 -0.6829 658 ASN A CG  
694  O OD1 . ASN A 92  ? 1.4201 2.0297 2.5122 0.3756  -0.2283 -0.7001 658 ASN A OD1 
695  N ND2 . ASN A 92  ? 1.3496 1.8887 2.3995 0.3527  -0.1677 -0.6542 658 ASN A ND2 
696  N N   . MET A 93  ? 0.9157 1.4262 2.0468 0.2253  -0.1511 -0.6941 659 MET A N   
697  C CA  . MET A 93  ? 0.8379 1.3275 1.9815 0.1959  -0.1267 -0.6852 659 MET A CA  
698  C C   . MET A 93  ? 0.7575 1.2231 1.8705 0.1928  -0.1009 -0.6605 659 MET A C   
699  O O   . MET A 93  ? 0.6916 1.1472 1.7718 0.2068  -0.0982 -0.6504 659 MET A O   
700  C CB  . MET A 93  ? 0.7867 1.2670 1.9166 0.1876  -0.1297 -0.6945 659 MET A CB  
701  C CG  . MET A 93  ? 0.7387 1.2076 1.9019 0.1637  -0.1132 -0.6945 659 MET A CG  
702  S SD  . MET A 93  ? 0.6807 1.1366 1.8255 0.1594  -0.1161 -0.7039 659 MET A SD  
703  C CE  . MET A 93  ? 0.7386 1.2165 1.8853 0.1819  -0.1566 -0.7372 659 MET A CE  
704  N N   . GLU A 94  ? 0.7273 1.1830 1.8544 0.1781  -0.0810 -0.6522 660 GLU A N   
705  C CA  . GLU A 94  ? 0.7697 1.2033 1.8683 0.1782  -0.0625 -0.6378 660 GLU A CA  
706  C C   . GLU A 94  ? 0.7582 1.1768 1.8318 0.1670  -0.0543 -0.6364 660 GLU A C   
707  O O   . GLU A 94  ? 0.8286 1.2459 1.9086 0.1592  -0.0439 -0.6350 660 GLU A O   
708  C CB  . GLU A 94  ? 0.8259 1.2603 1.9427 0.1798  -0.0461 -0.6301 660 GLU A CB  
709  C CG  . GLU A 94  ? 0.8539 1.3069 1.9974 0.1934  -0.0531 -0.6299 660 GLU A CG  
710  C CD  . GLU A 94  ? 0.8105 1.2715 1.9802 0.1962  -0.0333 -0.6203 660 GLU A CD  
711  O OE1 . GLU A 94  ? 0.8285 1.2742 1.9808 0.1943  -0.0119 -0.6116 660 GLU A OE1 
712  O OE2 . GLU A 94  ? 0.7108 1.1969 1.9174 0.2047  -0.0385 -0.6207 660 GLU A OE2 
713  N N   . ILE A 95  ? 0.6608 1.0694 1.7102 0.1692  -0.0564 -0.6351 661 ILE A N   
714  C CA  . ILE A 95  ? 0.7868 1.1892 1.8179 0.1607  -0.0526 -0.6362 661 ILE A CA  
715  C C   . ILE A 95  ? 0.8310 1.2188 1.8536 0.1598  -0.0457 -0.6371 661 ILE A C   
716  O O   . ILE A 95  ? 0.8215 1.2010 1.8517 0.1629  -0.0454 -0.6372 661 ILE A O   
717  C CB  . ILE A 95  ? 0.9021 1.3116 1.9239 0.1646  -0.0604 -0.6374 661 ILE A CB  
718  C CG1 . ILE A 95  ? 0.8559 1.2651 1.8634 0.1570  -0.0565 -0.6386 661 ILE A CG1 
719  C CG2 . ILE A 95  ? 0.9629 1.3684 1.9858 0.1775  -0.0579 -0.6307 661 ILE A CG2 
720  C CD1 . ILE A 95  ? 0.8574 1.2662 1.8614 0.1514  -0.0541 -0.6405 661 ILE A CD1 
721  N N   . PRO A 96  ? 0.6759 1.0199 1.5821 0.0948  -0.1294 -0.5317 662 PRO A N   
722  C CA  . PRO A 96  ? 0.5589 0.8976 1.4758 0.0886  -0.1184 -0.5374 662 PRO A CA  
723  C C   . PRO A 96  ? 0.5979 0.9203 1.4968 0.0932  -0.1195 -0.5144 662 PRO A C   
724  O O   . PRO A 96  ? 0.5963 0.9204 1.4618 0.0923  -0.1142 -0.4984 662 PRO A O   
725  C CB  . PRO A 96  ? 0.4731 0.8279 1.3760 0.0677  -0.0934 -0.5551 662 PRO A CB  
726  C CG  . PRO A 96  ? 0.4848 0.8547 1.3837 0.0658  -0.0932 -0.5632 662 PRO A CG  
727  C CD  . PRO A 96  ? 0.4413 0.8037 1.3313 0.0798  -0.1134 -0.5451 662 PRO A CD  
728  N N   . ALA A 97  ? 0.5441 0.8520 1.4656 0.0996  -0.1271 -0.5119 663 ALA A N   
729  C CA  . ALA A 97  ? 0.5206 0.8145 1.4327 0.1046  -0.1298 -0.4884 663 ALA A CA  
730  C C   . ALA A 97  ? 0.5319 0.8363 1.4200 0.0873  -0.1058 -0.4873 663 ALA A C   
731  O O   . ALA A 97  ? 0.6188 0.9238 1.4876 0.0894  -0.1043 -0.4615 663 ALA A O   
732  C CB  . ALA A 97  ? 0.6130 0.8876 1.5593 0.1136  -0.1450 -0.4896 663 ALA A CB  
733  N N   . GLY A 98  ? 0.4880 0.8033 1.3759 0.0697  -0.0875 -0.5123 664 GLY A N   
734  C CA  . GLY A 98  ? 0.4391 0.7624 1.3003 0.0506  -0.0636 -0.5133 664 GLY A CA  
735  C C   . GLY A 98  ? 0.5557 0.8897 1.3725 0.0456  -0.0522 -0.4990 664 GLY A C   
736  O O   . GLY A 98  ? 0.5388 0.8767 1.3291 0.0395  -0.0401 -0.4811 664 GLY A O   
737  N N   . LEU A 99  ? 0.6304 0.9714 1.4409 0.0483  -0.0572 -0.5065 665 LEU A N   
738  C CA  . LEU A 99  ? 0.5454 0.8952 1.3168 0.0468  -0.0512 -0.4961 665 LEU A CA  
739  C C   . LEU A 99  ? 0.5129 0.8566 1.2675 0.0664  -0.0621 -0.4650 665 LEU A C   
740  O O   . LEU A 99  ? 0.4736 0.8120 1.1743 0.0615  -0.0499 -0.4432 665 LEU A O   
741  C CB  . LEU A 99  ? 0.5043 0.8614 1.2833 0.0495  -0.0613 -0.5108 665 LEU A CB  
742  C CG  . LEU A 99  ? 0.5739 0.9404 1.3175 0.0480  -0.0585 -0.5070 665 LEU A CG  
743  C CD1 . LEU A 99  ? 0.5390 0.9128 1.2500 0.0240  -0.0324 -0.5156 665 LEU A CD1 
744  C CD2 . LEU A 99  ? 0.6151 0.9874 1.3777 0.0545  -0.0763 -0.5192 665 LEU A CD2 
745  N N   . ILE A 100 ? 0.5083 0.8372 1.2842 0.0850  -0.0859 -0.4540 666 ILE A N   
746  C CA  . ILE A 100 ? 0.5892 0.8955 1.3274 0.1005  -0.0989 -0.4137 666 ILE A CA  
747  C C   . ILE A 100 ? 0.5844 0.8872 1.2988 0.0911  -0.0859 -0.3881 666 ILE A C   
748  O O   . ILE A 100 ? 0.6022 0.8973 1.2667 0.0982  -0.0845 -0.3521 666 ILE A O   
749  C CB  . ILE A 100 ? 0.6704 0.9632 1.4453 0.1199  -0.1261 -0.4084 666 ILE A CB  
750  C CG1 . ILE A 100 ? 0.6484 0.9439 1.4378 0.1306  -0.1415 -0.4252 666 ILE A CG1 
751  C CG2 . ILE A 100 ? 0.7353 1.0085 1.4760 0.1346  -0.1377 -0.3641 666 ILE A CG2 
752  C CD1 . ILE A 100 ? 0.6186 0.9016 1.4429 0.1505  -0.1685 -0.4206 666 ILE A CD1 
753  N N   . ALA A 101 ? 0.5791 0.8880 1.3279 0.0761  -0.0772 -0.4057 667 ALA A N   
754  C CA  . ALA A 101 ? 0.6420 0.9480 1.3727 0.0624  -0.0663 -0.3837 667 ALA A CA  
755  C C   . ALA A 101 ? 0.5710 0.8916 1.2567 0.0470  -0.0398 -0.3802 667 ALA A C   
756  O O   . ALA A 101 ? 0.4870 0.8072 1.1339 0.0433  -0.0323 -0.3457 667 ALA A O   
757  C CB  . ALA A 101 ? 0.6006 0.9011 1.3773 0.0514  -0.0680 -0.4061 667 ALA A CB  
758  N N   . SER A 102 ? 0.5412 0.8769 1.2327 0.0382  -0.0258 -0.4142 668 SER A N   
759  C CA  . SER A 102 ? 0.5120 0.8606 1.1604 0.0240  -0.0013 -0.4142 668 SER A CA  
760  C C   . SER A 102 ? 0.5155 0.8552 1.0999 0.0372  -0.0021 -0.3786 668 SER A C   
761  O O   . SER A 102 ? 0.4594 0.8050 0.9979 0.0292  0.0169  -0.3635 668 SER A O   
762  C CB  . SER A 102 ? 0.4928 0.8551 1.1542 0.0143  0.0078  -0.4523 668 SER A CB  
763  O OG  . SER A 102 ? 0.5723 0.9368 1.1890 0.0182  0.0119  -0.4462 668 SER A OG  
764  N N   . ALA A 103 ? 0.4682 0.7929 1.0473 0.0593  -0.0239 -0.3652 669 ALA A N   
765  C CA  . ALA A 103 ? 0.5386 0.8503 1.0528 0.0774  -0.0269 -0.3318 669 ALA A CA  
766  C C   . ALA A 103 ? 0.5745 0.8853 1.0606 0.0845  -0.0245 -0.2854 669 ALA A C   
767  O O   . ALA A 103 ? 0.6581 0.9667 1.0825 0.0951  -0.0156 -0.2555 669 ALA A O   
768  C CB  . ALA A 103 ? 0.5809 0.8748 1.0972 0.0994  -0.0523 -0.3325 669 ALA A CB  
769  N N   . SER A 104 ? 0.4740 0.7864 1.0043 0.0796  -0.0338 -0.2779 670 SER A N   
770  C CA  . SER A 104 ? 0.5418 0.8561 1.0545 0.0842  -0.0364 -0.2305 670 SER A CA  
771  C C   . SER A 104 ? 0.4897 0.8195 1.0007 0.0595  -0.0176 -0.2200 670 SER A C   
772  O O   . SER A 104 ? 0.5120 0.8480 1.0103 0.0595  -0.0198 -0.1776 670 SER A O   
773  C CB  . SER A 104 ? 0.6672 0.9693 1.2220 0.0950  -0.0633 -0.2193 670 SER A CB  
774  O OG  . SER A 104 ? 0.7361 1.0344 1.3507 0.0793  -0.0693 -0.2544 670 SER A OG  
775  N N   . VAL A 105 ? 0.3359 0.8029 0.7662 0.0482  0.0678  -0.0255 671 VAL A N   
776  C CA  . VAL A 105 ? 0.2940 0.7260 0.6701 0.0572  0.0763  -0.0567 671 VAL A CA  
777  C C   . VAL A 105 ? 0.3432 0.7397 0.6701 0.0274  0.0599  -0.0514 671 VAL A C   
778  O O   . VAL A 105 ? 0.3892 0.8029 0.7089 0.0018  0.0583  -0.0247 671 VAL A O   
779  C CB  . VAL A 105 ? 0.3208 0.8032 0.6831 0.0739  0.1085  -0.0669 671 VAL A CB  
780  C CG1 . VAL A 105 ? 0.3965 0.8434 0.6956 0.0821  0.1131  -0.1014 671 VAL A CG1 
781  C CG2 . VAL A 105 ? 0.3731 0.8964 0.7885 0.1093  0.1289  -0.0725 671 VAL A CG2 
782  N N   . THR A 106 ? 0.2838 0.6307 0.5789 0.0309  0.0483  -0.0770 672 THR A N   
783  C CA  . THR A 106 ? 0.2334 0.5536 0.4865 0.0101  0.0332  -0.0735 672 THR A CA  
784  C C   . THR A 106 ? 0.3195 0.6566 0.5204 0.0153  0.0449  -0.0853 672 THR A C   
785  O O   . THR A 106 ? 0.3789 0.7150 0.5604 0.0334  0.0526  -0.1172 672 THR A O   
786  C CB  . THR A 106 ? 0.3077 0.5766 0.5594 0.0068  0.0121  -0.0915 672 THR A CB  
787  O OG1 . THR A 106 ? 0.3078 0.5594 0.5988 -0.0004 0.0009  -0.0749 672 THR A OG1 
788  C CG2 . THR A 106 ? 0.3917 0.6454 0.6062 -0.0094 -0.0020 -0.0879 672 THR A CG2 
789  N N   . PRO A 107 ? 0.3196 0.6672 0.4925 -0.0010 0.0459  -0.0592 673 PRO A N   
790  C CA  . PRO A 107 ? 0.3944 0.7575 0.5115 0.0030  0.0548  -0.0605 673 PRO A CA  
791  C C   . PRO A 107 ? 0.4697 0.8124 0.5518 0.0114  0.0380  -0.0907 673 PRO A C   
792  O O   . PRO A 107 ? 0.4486 0.7599 0.5474 0.0055  0.0169  -0.1002 673 PRO A O   
793  C CB  . PRO A 107 ? 0.4615 0.8138 0.5613 -0.0180 0.0507  -0.0230 673 PRO A CB  
794  C CG  . PRO A 107 ? 0.3612 0.7098 0.5089 -0.0351 0.0492  -0.0035 673 PRO A CG  
795  C CD  . PRO A 107 ? 0.3055 0.6430 0.4942 -0.0249 0.0379  -0.0260 673 PRO A CD  
796  N N   . LYS A 108 ? 0.4979 0.8633 0.5309 0.0224  0.0474  -0.1050 674 LYS A N   
797  C CA  . LYS A 108 ? 0.4005 0.7581 0.3948 0.0268  0.0291  -0.1344 674 LYS A CA  
798  C C   . LYS A 108 ? 0.4250 0.7821 0.3883 0.0192  0.0100  -0.1097 674 LYS A C   
799  O O   . LYS A 108 ? 0.4485 0.8173 0.3859 0.0178  0.0199  -0.0757 674 LYS A O   
800  C CB  . LYS A 108 ? 0.5615 0.9459 0.5088 0.0422  0.0462  -0.1633 674 LYS A CB  
801  C CG  . LYS A 108 ? 0.6583 1.0405 0.6336 0.0575  0.0683  -0.1924 674 LYS A CG  
802  C CD  . LYS A 108 ? 0.7053 1.0419 0.7181 0.0562  0.0516  -0.2217 674 LYS A CD  
803  C CE  . LYS A 108 ? 0.7288 1.0556 0.7734 0.0773  0.0751  -0.2446 674 LYS A CE  
804  N NZ  . LYS A 108 ? 0.8250 1.1864 0.9131 0.0845  0.0967  -0.2091 674 LYS A NZ  
805  N N   . ILE A 109 ? 0.5254 0.8692 0.4927 0.0150  -0.0162 -0.1262 675 ILE A N   
806  C CA  . ILE A 109 ? 0.4780 0.8254 0.4273 0.0131  -0.0362 -0.1041 675 ILE A CA  
807  C C   . ILE A 109 ? 0.5318 0.9113 0.4170 0.0243  -0.0357 -0.0915 675 ILE A C   
808  O O   . ILE A 109 ? 0.5044 0.8820 0.3702 0.0280  -0.0367 -0.0528 675 ILE A O   
809  C CB  . ILE A 109 ? 0.5049 0.8471 0.4765 0.0061  -0.0631 -0.1296 675 ILE A CB  
810  C CG1 . ILE A 109 ? 0.4371 0.7440 0.4661 -0.0056 -0.0639 -0.1239 675 ILE A CG1 
811  C CG2 . ILE A 109 ? 0.3855 0.7530 0.3327 0.0113  -0.0849 -0.1141 675 ILE A CG2 
812  C CD1 . ILE A 109 ? 0.4903 0.7925 0.5458 -0.0165 -0.0856 -0.1448 675 ILE A CD1 
813  N N   . ASN A 110 ? 0.5546 0.9589 0.4021 0.0305  -0.0330 -0.1236 676 ASN A N   
814  C CA  . ASN A 110 ? 0.5967 1.0356 0.3746 0.0410  -0.0336 -0.1129 676 ASN A CA  
815  C C   . ASN A 110 ? 0.6647 1.1048 0.4191 0.0446  -0.0059 -0.0687 676 ASN A C   
816  O O   . ASN A 110 ? 0.7580 1.2117 0.4629 0.0522  -0.0090 -0.0369 676 ASN A O   
817  C CB  . ASN A 110 ? 0.6295 1.0920 0.3643 0.0447  -0.0328 -0.1609 676 ASN A CB  
818  C CG  . ASN A 110 ? 0.7775 1.2378 0.5109 0.0504  0.0040  -0.1760 676 ASN A CG  
819  O OD1 . ASN A 110 ? 0.8192 1.2564 0.6093 0.0479  0.0198  -0.1727 676 ASN A OD1 
820  N ND2 . ASN A 110 ? 0.8957 1.3855 0.5636 0.0597  0.0180  -0.1919 676 ASN A ND2 
821  N N   . GLN A 111 ? 0.5837 1.0115 0.3749 0.0383  0.0206  -0.0642 677 GLN A N   
822  C CA  . GLN A 111 ? 0.6075 1.0370 0.3872 0.0336  0.0471  -0.0214 677 GLN A CA  
823  C C   . GLN A 111 ? 0.6147 1.0065 0.4185 0.0230  0.0388  0.0185  677 GLN A C   
824  O O   . GLN A 111 ? 0.7107 1.0928 0.4827 0.0201  0.0496  0.0594  677 GLN A O   
825  C CB  . GLN A 111 ? 0.5375 0.9813 0.3525 0.0297  0.0780  -0.0309 677 GLN A CB  
826  C CG  . GLN A 111 ? 0.6828 1.1595 0.4680 0.0446  0.0940  -0.0700 677 GLN A CG  
827  C CD  . GLN A 111 ? 0.7141 1.2163 0.5331 0.0465  0.1302  -0.0707 677 GLN A CD  
828  O OE1 . GLN A 111 ? 0.7409 1.2336 0.6241 0.0464  0.1316  -0.0830 677 GLN A OE1 
829  N NE2 . GLN A 111 ? 0.7202 1.2598 0.4971 0.0490  0.1604  -0.0544 677 GLN A NE2 
830  N N   . LEU A 112 ? 0.4839 0.8493 0.3397 0.0167  0.0217  0.0064  678 LEU A N   
831  C CA  . LEU A 112 ? 0.4790 0.8046 0.3542 0.0074  0.0158  0.0381  678 LEU A CA  
832  C C   . LEU A 112 ? 0.6044 0.9220 0.4361 0.0213  0.0013  0.0632  678 LEU A C   
833  O O   . LEU A 112 ? 0.6814 0.9733 0.4875 0.0195  0.0127  0.1026  678 LEU A O   
834  C CB  . LEU A 112 ? 0.4207 0.7241 0.3522 0.0001  0.0002  0.0183  678 LEU A CB  
835  C CG  . LEU A 112 ? 0.4191 0.7223 0.3984 -0.0124 0.0131  0.0062  678 LEU A CG  
836  C CD1 . LEU A 112 ? 0.3486 0.6273 0.3740 -0.0187 -0.0037 -0.0091 678 LEU A CD1 
837  C CD2 . LEU A 112 ? 0.3482 0.6440 0.3322 -0.0291 0.0336  0.0394  678 LEU A CD2 
838  N N   . CYS A 113 ? 0.6152 0.9557 0.4392 0.0349  -0.0240 0.0415  679 CYS A N   
839  C CA  . CYS A 113 ? 0.6528 0.9931 0.4504 0.0523  -0.0427 0.0662  679 CYS A CA  
840  C C   . CYS A 113 ? 0.7151 1.0732 0.4428 0.0665  -0.0365 0.0960  679 CYS A C   
841  O O   . CYS A 113 ? 0.6811 1.0260 0.3822 0.0834  -0.0443 0.1323  679 CYS A O   
842  C CB  . CYS A 113 ? 0.5142 0.8860 0.3329 0.0592  -0.0737 0.0353  679 CYS A CB  
843  S SG  . CYS A 113 ? 0.7926 1.2204 0.5798 0.0590  -0.0865 -0.0107 679 CYS A SG  
844  N N   . SER A 114 ? 0.7301 1.1165 0.4268 0.0619  -0.0205 0.0819  680 SER A N   
845  C CA  . SER A 114 ? 0.7815 1.1872 0.4059 0.0721  -0.0094 0.1099  680 SER A CA  
846  C C   . SER A 114 ? 0.8000 1.1728 0.4168 0.0576  0.0260  0.1479  680 SER A C   
847  O O   . SER A 114 ? 0.7911 1.1656 0.3605 0.0586  0.0430  0.1711  680 SER A O   
848  C CB  . SER A 114 ? 0.8829 1.3375 0.4738 0.0737  -0.0073 0.0708  680 SER A CB  
849  O OG  . SER A 114 ? 0.9688 1.4249 0.5835 0.0598  0.0226  0.0509  680 SER A OG  
850  N N   . GLN A 115 ? 0.7793 1.1149 0.4539 0.0390  0.0357  0.1484  681 GLN A N   
851  C CA  . GLN A 115 ? 0.7881 1.0929 0.4659 0.0173  0.0659  0.1816  681 GLN A CA  
852  C C   . GLN A 115 ? 0.8677 1.1255 0.4985 0.0231  0.0695  0.2345  681 GLN A C   
853  O O   . GLN A 115 ? 0.9459 1.1739 0.5749 0.0411  0.0482  0.2454  681 GLN A O   
854  C CB  . GLN A 115 ? 0.7040 0.9806 0.4519 -0.0040 0.0670  0.1683  681 GLN A CB  
855  C CG  . GLN A 115 ? 0.7559 1.0196 0.5214 -0.0341 0.0958  0.1900  681 GLN A CG  
856  C CD  . GLN A 115 ? 0.6871 0.9403 0.5212 -0.0541 0.0919  0.1706  681 GLN A CD  
857  O OE1 . GLN A 115 ? 0.7765 0.9882 0.6254 -0.0781 0.0980  0.1912  681 GLN A OE1 
858  N NE2 . GLN A 115 ? 0.5374 0.8252 0.4094 -0.0451 0.0813  0.1311  681 GLN A NE2 
859  N N   . THR A 116 ? 0.8665 1.1058 0.4706 0.0091  0.0950  0.2585  682 THR A N   
860  C CA  . THR A 116 ? 0.9750 1.1472 0.5410 0.0115  0.0984  0.2982  682 THR A CA  
861  C C   . THR A 116 ? 0.9550 1.0537 0.5417 -0.0175 0.1155  0.3192  682 THR A C   
862  O O   . THR A 116 ? 1.0305 1.0604 0.5842 -0.0185 0.1192  0.3485  682 THR A O   
863  C CB  . THR A 116 ? 1.0924 1.2769 0.6028 0.0130  0.1132  0.3133  682 THR A CB  
864  O OG1 . THR A 116 ? 1.2969 1.4228 0.7634 0.0245  0.1069  0.3497  682 THR A OG1 
865  C CG2 . THR A 116 ? 1.0750 1.2620 0.5964 -0.0199 0.1485  0.3175  682 THR A CG2 
866  N N   . LYS A 117 ? 0.7848 1.1644 0.4760 0.0339  0.0044  0.2305  683 LYS A N   
867  C CA  . LYS A 117 ? 0.8549 1.1986 0.5607 0.0011  0.0002  0.2618  683 LYS A CA  
868  C C   . LYS A 117 ? 0.7763 1.1005 0.5070 -0.0083 -0.0131 0.2405  683 LYS A C   
869  O O   . LYS A 117 ? 0.7142 1.0712 0.4603 0.0050  -0.0117 0.2087  683 LYS A O   
870  C CB  . LYS A 117 ? 0.9627 1.3570 0.6941 -0.0205 0.0192  0.2927  683 LYS A CB  
871  C CG  . LYS A 117 ? 1.0627 1.5217 0.8333 -0.0177 0.0296  0.2755  683 LYS A CG  
872  C CD  . LYS A 117 ? 1.1368 1.6522 0.9415 -0.0404 0.0458  0.3070  683 LYS A CD  
873  C CE  . LYS A 117 ? 1.1061 1.6655 0.9542 -0.0439 0.0488  0.2950  683 LYS A CE  
874  N NZ  . LYS A 117 ? 1.0661 1.6502 0.9059 -0.0051 0.0527  0.2533  683 LYS A NZ  
875  N N   . GLY A 118 ? 0.7350 0.9999 0.4657 -0.0314 -0.0272 0.2568  684 GLY A N   
876  C CA  . GLY A 118 ? 0.6543 0.8982 0.4066 -0.0430 -0.0416 0.2387  684 GLY A CA  
877  C C   . GLY A 118 ? 0.7213 1.0098 0.5164 -0.0673 -0.0334 0.2472  684 GLY A C   
878  O O   . GLY A 118 ? 0.8161 1.1370 0.6283 -0.0859 -0.0198 0.2758  684 GLY A O   
879  N N   . SER A 119 ? 0.5518 0.8410 0.3709 -0.0656 -0.0415 0.2175  685 SER A N   
880  C CA  . SER A 119 ? 0.5555 0.8813 0.4204 -0.0823 -0.0358 0.2185  685 SER A CA  
881  C C   . SER A 119 ? 0.4701 0.7632 0.3529 -0.0823 -0.0516 0.1852  685 SER A C   
882  O O   . SER A 119 ? 0.4641 0.7153 0.3253 -0.0705 -0.0642 0.1624  685 SER A O   
883  C CB  . SER A 119 ? 0.5165 0.9186 0.3914 -0.0586 -0.0147 0.2120  685 SER A CB  
884  O OG  . SER A 119 ? 0.4977 0.8958 0.3601 -0.0281 -0.0176 0.1700  685 SER A OG  
885  N N   . PHE A 120 ? 0.4350 0.7539 0.3571 -0.0943 -0.0506 0.1839  686 PHE A N   
886  C CA  . PHE A 120 ? 0.3704 0.6609 0.3080 -0.0958 -0.0649 0.1567  686 PHE A CA  
887  C C   . PHE A 120 ? 0.4441 0.7737 0.4009 -0.0735 -0.0563 0.1352  686 PHE A C   
888  O O   . PHE A 120 ? 0.4659 0.8501 0.4460 -0.0687 -0.0426 0.1487  686 PHE A O   
889  C CB  . PHE A 120 ? 0.3769 0.6443 0.3362 -0.1310 -0.0782 0.1730  686 PHE A CB  
890  C CG  . PHE A 120 ? 0.5157 0.7239 0.4466 -0.1506 -0.0895 0.1887  686 PHE A CG  
891  C CD1 . PHE A 120 ? 0.4551 0.6678 0.3804 -0.1728 -0.0840 0.2253  686 PHE A CD1 
892  C CD2 . PHE A 120 ? 0.5323 0.6790 0.4386 -0.1452 -0.1053 0.1676  686 PHE A CD2 
893  C CE1 . PHE A 120 ? 0.5342 0.6767 0.4258 -0.1894 -0.0960 0.2402  686 PHE A CE1 
894  C CE2 . PHE A 120 ? 0.5215 0.6052 0.3954 -0.1558 -0.1161 0.1799  686 PHE A CE2 
895  C CZ  . PHE A 120 ? 0.5802 0.6545 0.4445 -0.1778 -0.1124 0.2159  686 PHE A CZ  
896  N N   . VAL A 121 ? 0.3692 0.6695 0.3144 -0.0597 -0.0648 0.1025  687 VAL A N   
897  C CA  . VAL A 121 ? 0.3219 0.6385 0.2682 -0.0351 -0.0583 0.0770  687 VAL A CA  
898  C C   . VAL A 121 ? 0.3627 0.6529 0.3268 -0.0410 -0.0703 0.0608  687 VAL A C   
899  O O   . VAL A 121 ? 0.3949 0.6481 0.3566 -0.0584 -0.0849 0.0555  687 VAL A O   
900  C CB  . VAL A 121 ? 0.3933 0.6986 0.3014 -0.0154 -0.0581 0.0513  687 VAL A CB  
901  C CG1 . VAL A 121 ? 0.3461 0.6440 0.2479 0.0027  -0.0580 0.0184  687 VAL A CG1 
902  C CG2 . VAL A 121 ? 0.3616 0.7019 0.2480 -0.0025 -0.0439 0.0672  687 VAL A CG2 
903  N N   . ASN A 122 ? 0.4090 0.7192 0.3881 -0.0238 -0.0633 0.0545  688 ASN A N   
904  C CA  . ASN A 122 ? 0.3235 0.6045 0.3103 -0.0211 -0.0728 0.0373  688 ASN A CA  
905  C C   . ASN A 122 ? 0.4665 0.7310 0.4269 0.0055  -0.0678 0.0075  688 ASN A C   
906  O O   . ASN A 122 ? 0.5377 0.8321 0.4870 0.0295  -0.0533 0.0046  688 ASN A O   
907  C CB  . ASN A 122 ? 0.3013 0.6145 0.3239 -0.0169 -0.0703 0.0553  688 ASN A CB  
908  C CG  . ASN A 122 ? 0.4420 0.7682 0.4917 -0.0487 -0.0798 0.0820  688 ASN A CG  
909  O OD1 . ASN A 122 ? 0.4500 0.7542 0.4885 -0.0722 -0.0872 0.0875  688 ASN A OD1 
910  N ND2 . ASN A 122 ? 0.4245 0.7863 0.5078 -0.0478 -0.0809 0.0980  688 ASN A ND2 
911  N N   . GLY A 123 ? 0.3287 0.4302 0.4899 0.0690  -0.0523 0.0917  689 GLY A N   
912  C CA  . GLY A 123 ? 0.3386 0.4485 0.5050 0.0664  -0.0211 0.0564  689 GLY A CA  
913  C C   . GLY A 123 ? 0.3748 0.4483 0.5259 0.0549  -0.0142 0.0321  689 GLY A C   
914  O O   . GLY A 123 ? 0.4093 0.4573 0.5365 0.0512  -0.0319 0.0415  689 GLY A O   
915  N N   . VAL A 124 ? 0.2915 0.3598 0.4580 0.0502  0.0144  0.0016  690 VAL A N   
916  C CA  . VAL A 124 ? 0.3445 0.3836 0.5076 0.0383  0.0273  -0.0239 690 VAL A CA  
917  C C   . VAL A 124 ? 0.5262 0.6073 0.6789 0.0270  0.0394  -0.0695 690 VAL A C   
918  O O   . VAL A 124 ? 0.5337 0.6385 0.6964 0.0264  0.0580  -0.0970 690 VAL A O   
919  C CB  . VAL A 124 ? 0.3688 0.3672 0.5681 0.0393  0.0534  -0.0262 690 VAL A CB  
920  C CG1 . VAL A 124 ? 0.3832 0.3515 0.5881 0.0269  0.0716  -0.0511 690 VAL A CG1 
921  C CG2 . VAL A 124 ? 0.3920 0.3579 0.6062 0.0511  0.0392  0.0213  690 VAL A CG2 
922  N N   . PHE A 125 ? 0.4254 0.5165 0.5578 0.0185  0.0288  -0.0781 691 PHE A N   
923  C CA  . PHE A 125 ? 0.3914 0.5332 0.5167 0.0068  0.0330  -0.1174 691 PHE A CA  
924  C C   . PHE A 125 ? 0.4161 0.5401 0.5542 -0.0095 0.0429  -0.1403 691 PHE A C   
925  O O   . PHE A 125 ? 0.3955 0.4888 0.5264 -0.0077 0.0368  -0.1175 691 PHE A O   
926  C CB  . PHE A 125 ? 0.3725 0.5668 0.4693 0.0138  0.0104  -0.1023 691 PHE A CB  
927  C CG  . PHE A 125 ? 0.4149 0.6327 0.5061 0.0302  0.0031  -0.0771 691 PHE A CG  
928  C CD1 . PHE A 125 ? 0.3233 0.5111 0.4149 0.0411  -0.0124 -0.0337 691 PHE A CD1 
929  C CD2 . PHE A 125 ? 0.4014 0.6714 0.4876 0.0347  0.0120  -0.0968 691 PHE A CD2 
930  C CE1 . PHE A 125 ? 0.3404 0.5510 0.4387 0.0548  -0.0179 -0.0075 691 PHE A CE1 
931  C CE2 . PHE A 125 ? 0.3315 0.6241 0.4173 0.0522  0.0100  -0.0686 691 PHE A CE2 
932  C CZ  . PHE A 125 ? 0.3676 0.6310 0.4651 0.0616  -0.0045 -0.0224 691 PHE A CZ  
933  N N   . GLU A 126 ? 0.4246 0.5672 0.5822 -0.0252 0.0590  -0.1860 692 GLU A N   
934  C CA  . GLU A 126 ? 0.4690 0.6014 0.6509 -0.0435 0.0688  -0.2086 692 GLU A CA  
935  C C   . GLU A 126 ? 0.4690 0.6557 0.6369 -0.0494 0.0497  -0.2110 692 GLU A C   
936  O O   . GLU A 126 ? 0.3937 0.6429 0.5410 -0.0481 0.0344  -0.2217 692 GLU A O   
937  C CB  . GLU A 126 ? 0.5378 0.6660 0.7538 -0.0619 0.0919  -0.2596 692 GLU A CB  
938  C CG  . GLU A 126 ? 0.5982 0.7054 0.8549 -0.0816 0.1061  -0.2777 692 GLU A CG  
939  C CD  . GLU A 126 ? 0.6923 0.7930 0.9882 -0.1035 0.1280  -0.3332 692 GLU A CD  
940  O OE1 . GLU A 126 ? 0.8501 0.9437 1.1869 -0.1206 0.1384  -0.3442 692 GLU A OE1 
941  O OE2 . GLU A 126 ? 0.5816 0.6892 0.8657 -0.0995 0.1334  -0.3500 692 GLU A OE2 
942  N N   . VAL A 127 ? 0.4028 0.5668 0.5832 -0.0535 0.0533  -0.1975 693 VAL A N   
943  C CA  . VAL A 127 ? 0.3856 0.5950 0.5599 -0.0563 0.0395  -0.1917 693 VAL A CA  
944  C C   . VAL A 127 ? 0.4234 0.6743 0.6377 -0.0817 0.0445  -0.2353 693 VAL A C   
945  O O   . VAL A 127 ? 0.4087 0.6243 0.6645 -0.0959 0.0647  -0.2503 693 VAL A O   
946  C CB  . VAL A 127 ? 0.3743 0.5354 0.5414 -0.0454 0.0447  -0.1533 693 VAL A CB  
947  C CG1 . VAL A 127 ? 0.2824 0.4871 0.4543 -0.0481 0.0385  -0.1470 693 VAL A CG1 
948  C CG2 . VAL A 127 ? 0.2529 0.3766 0.3771 -0.0231 0.0328  -0.1140 693 VAL A CG2 
949  N N   . HIS A 128 ? 0.5694 0.8972 0.7739 -0.0876 0.0255  -0.2554 694 HIS A N   
950  C CA  . HIS A 128 ? 0.5654 0.9463 0.8068 -0.1136 0.0211  -0.2968 694 HIS A CA  
951  C C   . HIS A 128 ? 0.5023 0.9099 0.7687 -0.1169 0.0166  -0.2753 694 HIS A C   
952  O O   . HIS A 128 ? 0.4584 0.8622 0.7701 -0.1353 0.0261  -0.2923 694 HIS A O   
953  C CB  . HIS A 128 ? 0.6244 1.0662 0.8320 -0.1100 0.0059  -0.3167 694 HIS A CB  
954  C CG  . HIS A 128 ? 0.7980 1.2742 1.0274 -0.1277 0.0029  -0.3471 694 HIS A CG  
955  N ND1 . HIS A 128 ? 0.8724 1.4100 1.0890 -0.1246 -0.0157 -0.3359 694 HIS A ND1 
956  C CD2 . HIS A 128 ? 0.9022 1.3577 1.1681 -0.1487 0.0156  -0.3864 694 HIS A CD2 
957  C CE1 . HIS A 128 ? 0.8944 1.4520 1.1385 -0.1451 -0.0185 -0.3695 694 HIS A CE1 
958  N NE2 . HIS A 128 ? 0.9173 1.4253 1.1914 -0.1600 0.0002  -0.4013 694 HIS A NE2 
959  N N   . LYS A 129 ? 0.4183 0.8430 0.6512 -0.0945 0.0051  -0.2323 695 LYS A N   
960  C CA  . LYS A 129 ? 0.2941 0.7421 0.5448 -0.0907 0.0043  -0.2041 695 LYS A CA  
961  C C   . LYS A 129 ? 0.2573 0.6552 0.4672 -0.0618 0.0092  -0.1526 695 LYS A C   
962  O O   . LYS A 129 ? 0.2463 0.6193 0.4137 -0.0457 0.0026  -0.1380 695 LYS A O   
963  C CB  . LYS A 129 ? 0.3155 0.8355 0.5508 -0.0879 -0.0165 -0.2008 695 LYS A CB  
964  C CG  . LYS A 129 ? 0.5631 1.1147 0.8162 -0.1088 -0.0231 -0.2401 695 LYS A CG  
965  C CD  . LYS A 129 ? 0.6893 1.3036 0.9313 -0.1026 -0.0405 -0.2231 695 LYS A CD  
966  C CE  . LYS A 129 ? 0.7844 1.4369 1.0504 -0.1251 -0.0506 -0.2613 695 LYS A CE  
967  N NZ  . LYS A 129 ? 0.7971 1.5111 1.0690 -0.1225 -0.0676 -0.2413 695 LYS A NZ  
968  N N   . LYS A 130 ? 0.3296 0.6388 0.5290 -0.0357 0.0317  -0.1495 696 LYS A N   
969  C CA  . LYS A 130 ? 0.3433 0.6257 0.5199 -0.0147 0.0333  -0.1270 696 LYS A CA  
970  C C   . LYS A 130 ? 0.3390 0.6605 0.5384 0.0040  0.0198  -0.1298 696 LYS A C   
971  O O   . LYS A 130 ? 0.3360 0.6978 0.5870 -0.0018 0.0274  -0.1453 696 LYS A O   
972  C CB  . LYS A 130 ? 0.2812 0.5336 0.4670 -0.0199 0.0638  -0.1193 696 LYS A CB  
973  C CG  . LYS A 130 ? 0.3237 0.5493 0.4879 0.0013  0.0671  -0.1001 696 LYS A CG  
974  C CD  . LYS A 130 ? 0.3635 0.5735 0.5472 -0.0010 0.0972  -0.0972 696 LYS A CD  
975  C CE  . LYS A 130 ? 0.3796 0.5495 0.5275 0.0174  0.1034  -0.0784 696 LYS A CE  
976  N NZ  . LYS A 130 ? 0.4012 0.5458 0.5504 0.0192  0.1238  -0.0681 696 LYS A NZ  
977  N N   . ASN A 131 ? 0.2733 0.5838 0.4368 0.0266  0.0012  -0.1151 697 ASN A N   
978  C CA  . ASN A 131 ? 0.2388 0.5830 0.4200 0.0490  -0.0102 -0.1146 697 ASN A CA  
979  C C   . ASN A 131 ? 0.2193 0.5217 0.3659 0.0709  -0.0058 -0.0922 697 ASN A C   
980  O O   . ASN A 131 ? 0.2682 0.5336 0.3660 0.0797  -0.0160 -0.0779 697 ASN A O   
981  C CB  . ASN A 131 ? 0.3155 0.6966 0.4882 0.0603  -0.0403 -0.1219 697 ASN A CB  
982  C CG  . ASN A 131 ? 0.4558 0.8836 0.6560 0.0847  -0.0527 -0.1238 697 ASN A CG  
983  O OD1 . ASN A 131 ? 0.6071 1.0424 0.8384 0.0907  -0.0368 -0.1213 697 ASN A OD1 
984  N ND2 . ASN A 131 ? 0.4560 0.9152 0.6433 0.1010  -0.0801 -0.1272 697 ASN A ND2 
985  N N   . VAL A 132 ? 0.2459 0.5514 0.4170 0.0793  0.0110  -0.0897 698 VAL A N   
986  C CA  . VAL A 132 ? 0.2670 0.5290 0.4019 0.1001  0.0160  -0.0707 698 VAL A CA  
987  C C   . VAL A 132 ? 0.3821 0.6678 0.5164 0.1281  0.0003  -0.0661 698 VAL A C   
988  O O   . VAL A 132 ? 0.2684 0.6046 0.4501 0.1356  0.0017  -0.0754 698 VAL A O   
989  C CB  . VAL A 132 ? 0.3083 0.5534 0.4597 0.0996  0.0443  -0.0680 698 VAL A CB  
990  C CG1 . VAL A 132 ? 0.2422 0.4457 0.3553 0.1239  0.0475  -0.0514 698 VAL A CG1 
991  C CG2 . VAL A 132 ? 0.2481 0.4633 0.3918 0.0771  0.0608  -0.0689 698 VAL A CG2 
992  N N   . ARG A 133 ? 0.2617 0.5139 0.3456 0.1436  -0.0140 -0.0521 699 ARG A N   
993  C CA  . ARG A 133 ? 0.3873 0.6502 0.4630 0.1749  -0.0239 -0.0437 699 ARG A CA  
994  C C   . ARG A 133 ? 0.3663 0.5674 0.3967 0.1919  -0.0144 -0.0260 699 ARG A C   
995  O O   . ARG A 133 ? 0.4436 0.5980 0.4251 0.1934  -0.0210 -0.0152 699 ARG A O   
996  C CB  . ARG A 133 ? 0.3026 0.5815 0.3564 0.1848  -0.0488 -0.0425 699 ARG A CB  
997  C CG  . ARG A 133 ? 0.2841 0.5943 0.3546 0.1607  -0.0589 -0.0586 699 ARG A CG  
998  C CD  . ARG A 133 ? 0.3256 0.6711 0.3852 0.1775  -0.0848 -0.0613 699 ARG A CD  
999  N NE  . ARG A 133 ? 0.5071 0.8379 0.5387 0.1605  -0.0929 -0.0648 699 ARG A NE  
1000 C CZ  . ARG A 133 ? 0.5998 0.9038 0.5798 0.1747  -0.1047 -0.0523 699 ARG A CZ  
1001 N NH1 . ARG A 133 ? 0.5703 0.8582 0.5198 0.2066  -0.1105 -0.0354 699 ARG A NH1 
1002 N NH2 . ARG A 133 ? 0.3683 0.6590 0.3260 0.1579  -0.1082 -0.0558 699 ARG A NH2 
1003 N N   . GLY A 134 ? 0.4934 0.6954 0.5402 0.2064  0.0011  -0.0235 700 GLY A N   
1004 C CA  . GLY A 134 ? 0.3489 0.4900 0.3511 0.2226  0.0115  -0.0096 700 GLY A CA  
1005 C C   . GLY A 134 ? 0.3477 0.4314 0.3116 0.2024  0.0166  -0.0066 700 GLY A C   
1006 O O   . GLY A 134 ? 0.4281 0.5151 0.4090 0.1814  0.0266  -0.0136 700 GLY A O   
1007 N N   . GLU A 135 ? 0.6127 0.6445 0.5257 0.2092  0.0098  0.0039  701 GLU A N   
1008 C CA  . GLU A 135 ? 0.6320 0.6092 0.5089 0.1928  0.0131  0.0063  701 GLU A CA  
1009 C C   . GLU A 135 ? 0.6075 0.5906 0.4855 0.1672  0.0033  0.0031  701 GLU A C   
1010 O O   . GLU A 135 ? 0.5379 0.4856 0.3941 0.1512  0.0042  0.0043  701 GLU A O   
1011 C CB  . GLU A 135 ? 0.7530 0.6714 0.5792 0.2082  0.0114  0.0166  701 GLU A CB  
1012 C CG  . GLU A 135 ? 0.8894 0.7947 0.7085 0.2358  0.0234  0.0206  701 GLU A CG  
1013 C CD  . GLU A 135 ? 1.1055 1.0170 0.9429 0.2325  0.0403  0.0145  701 GLU A CD  
1014 O OE1 . GLU A 135 ? 1.1054 0.9940 0.9309 0.2145  0.0436  0.0104  701 GLU A OE1 
1015 O OE2 . GLU A 135 ? 1.1787 1.1199 1.0437 0.2430  0.0501  0.0150  701 GLU A OE2 
1016 N N   . PHE A 136 ? 0.4686 0.4947 0.3866 0.0923  -0.0484 0.0773  702 PHE A N   
1017 C CA  . PHE A 136 ? 0.4234 0.4812 0.3611 0.0757  -0.0555 0.0625  702 PHE A CA  
1018 C C   . PHE A 136 ? 0.3966 0.5008 0.3771 0.0746  -0.0644 0.0501  702 PHE A C   
1019 O O   . PHE A 136 ? 0.4016 0.5307 0.3979 0.0876  -0.0659 0.0539  702 PHE A O   
1020 C CB  . PHE A 136 ? 0.4351 0.5022 0.3522 0.0787  -0.0495 0.0709  702 PHE A CB  
1021 C CG  . PHE A 136 ? 0.5844 0.6028 0.4677 0.0781  -0.0339 0.0830  702 PHE A CG  
1022 C CD1 . PHE A 136 ? 0.6466 0.6342 0.5038 0.0961  -0.0223 0.1029  702 PHE A CD1 
1023 C CD2 . PHE A 136 ? 0.6716 0.6736 0.5565 0.0590  -0.0275 0.0736  702 PHE A CD2 
1024 C CE1 . PHE A 136 ? 0.6822 0.6203 0.5140 0.0944  -0.0031 0.1123  702 PHE A CE1 
1025 C CE2 . PHE A 136 ? 0.7557 0.7108 0.6197 0.0561  -0.0091 0.0817  702 PHE A CE2 
1026 C CZ  . PHE A 136 ? 0.7353 0.6569 0.5722 0.0735  0.0039  0.1007  702 PHE A CZ  
1027 N N   . THR A 137 ? 0.3173 0.4342 0.3230 0.0586  -0.0689 0.0341  703 THR A N   
1028 C CA  . THR A 137 ? 0.3464 0.5048 0.3983 0.0540  -0.0727 0.0192  703 THR A CA  
1029 C C   . THR A 137 ? 0.3822 0.5703 0.4436 0.0400  -0.0750 0.0039  703 THR A C   
1030 O O   . THR A 137 ? 0.3836 0.5570 0.4360 0.0275  -0.0727 0.0009  703 THR A O   
1031 C CB  . THR A 137 ? 0.4059 0.5538 0.4830 0.0511  -0.0715 0.0154  703 THR A CB  
1032 O OG1 . THR A 137 ? 0.4236 0.5444 0.4874 0.0675  -0.0663 0.0299  703 THR A OG1 
1033 C CG2 . THR A 137 ? 0.2135 0.3996 0.3454 0.0448  -0.0694 -0.0005 703 THR A CG2 
1034 N N   . TYR A 138 ? 0.3574 0.5883 0.4388 0.0423  -0.0791 -0.0077 704 TYR A N   
1035 C CA  . TYR A 138 ? 0.3161 0.5782 0.4003 0.0322  -0.0805 -0.0249 704 TYR A CA  
1036 C C   . TYR A 138 ? 0.2974 0.5896 0.4371 0.0190  -0.0797 -0.0500 704 TYR A C   
1037 O O   . TYR A 138 ? 0.3204 0.6390 0.4990 0.0223  -0.0820 -0.0615 704 TYR A O   
1038 C CB  . TYR A 138 ? 0.2947 0.5883 0.3545 0.0463  -0.0879 -0.0242 704 TYR A CB  
1039 C CG  . TYR A 138 ? 0.4229 0.6872 0.4255 0.0601  -0.0829 0.0021  704 TYR A CG  
1040 C CD1 . TYR A 138 ? 0.3153 0.5488 0.3029 0.0736  -0.0801 0.0240  704 TYR A CD1 
1041 C CD2 . TYR A 138 ? 0.4769 0.7402 0.4407 0.0609  -0.0761 0.0063  704 TYR A CD2 
1042 C CE1 . TYR A 138 ? 0.3704 0.5726 0.3104 0.0865  -0.0707 0.0484  704 TYR A CE1 
1043 C CE2 . TYR A 138 ? 0.4966 0.7280 0.4118 0.0753  -0.0651 0.0334  704 TYR A CE2 
1044 C CZ  . TYR A 138 ? 0.5061 0.7067 0.4120 0.0873  -0.0624 0.0538  704 TYR A CZ  
1045 O OH  . TYR A 138 ? 0.5655 0.7303 0.4283 0.1017  -0.0471 0.0808  704 TYR A OH  
1046 N N   . TYR A 139 ? 0.2997 0.5868 0.4492 0.0040  -0.0736 -0.0590 705 TYR A N   
1047 C CA  . TYR A 139 ? 0.3121 0.6258 0.5136 -0.0082 -0.0688 -0.0829 705 TYR A CA  
1048 C C   . TYR A 139 ? 0.3707 0.7146 0.5611 -0.0151 -0.0684 -0.1031 705 TYR A C   
1049 O O   . TYR A 139 ? 0.4122 0.7432 0.5657 -0.0179 -0.0638 -0.0966 705 TYR A O   
1050 C CB  . TYR A 139 ? 0.2112 0.5033 0.4367 -0.0178 -0.0610 -0.0798 705 TYR A CB  
1051 C CG  . TYR A 139 ? 0.2876 0.5520 0.5182 -0.0079 -0.0620 -0.0615 705 TYR A CG  
1052 C CD1 . TYR A 139 ? 0.3534 0.5838 0.5441 -0.0030 -0.0676 -0.0433 705 TYR A CD1 
1053 C CD2 . TYR A 139 ? 0.2202 0.4908 0.4947 -0.0023 -0.0548 -0.0634 705 TYR A CD2 
1054 C CE1 . TYR A 139 ? 0.3437 0.5494 0.5300 0.0082  -0.0696 -0.0291 705 TYR A CE1 
1055 C CE2 . TYR A 139 ? 0.2333 0.4763 0.5033 0.0110  -0.0530 -0.0442 705 TYR A CE2 
1056 C CZ  . TYR A 139 ? 0.3111 0.5229 0.5329 0.0168  -0.0622 -0.0278 705 TYR A CZ  
1057 O OH  . TYR A 139 ? 0.3157 0.5004 0.5247 0.0320  -0.0614 -0.0111 705 TYR A OH  
1058 N N   . GLU A 140 ? 0.3683 0.7522 0.5910 -0.0174 -0.0716 -0.1292 706 GLU A N   
1059 C CA  . GLU A 140 ? 0.3597 0.7709 0.5722 -0.0249 -0.0697 -0.1538 706 GLU A CA  
1060 C C   . GLU A 140 ? 0.3113 0.7025 0.5604 -0.0401 -0.0509 -0.1655 706 GLU A C   
1061 O O   . GLU A 140 ? 0.3248 0.6966 0.6091 -0.0415 -0.0416 -0.1680 706 GLU A O   
1062 C CB  . GLU A 140 ? 0.4057 0.8474 0.6149 -0.0176 -0.0788 -0.1740 706 GLU A CB  
1063 C CG  . GLU A 140 ? 0.4410 0.9163 0.6292 -0.0224 -0.0793 -0.2022 706 GLU A CG  
1064 C CD  . GLU A 140 ? 0.5458 1.0578 0.7147 -0.0096 -0.0944 -0.2197 706 GLU A CD  
1065 O OE1 . GLU A 140 ? 0.4918 1.0089 0.7031 -0.0140 -0.0918 -0.2406 706 GLU A OE1 
1066 O OE2 . GLU A 140 ? 0.6442 1.1771 0.7529 0.0066  -0.1077 -0.2106 706 GLU A OE2 
1067 N N   . ILE A 141 ? 0.2957 0.6276 0.4221 0.0599  -0.0213 -0.1997 707 ILE A N   
1068 C CA  . ILE A 141 ? 0.4069 0.7338 0.5513 0.0583  -0.0083 -0.2001 707 ILE A CA  
1069 C C   . ILE A 141 ? 0.5326 0.9119 0.6922 0.0651  -0.0150 -0.2361 707 ILE A C   
1070 O O   . ILE A 141 ? 0.4617 0.8786 0.5927 0.0747  -0.0332 -0.2469 707 ILE A O   
1071 C CB  . ILE A 141 ? 0.3456 0.6550 0.4467 0.0572  -0.0107 -0.1597 707 ILE A CB  
1072 C CG1 . ILE A 141 ? 0.2837 0.6184 0.3351 0.0601  -0.0263 -0.1471 707 ILE A CG1 
1073 C CG2 . ILE A 141 ? 0.3835 0.6428 0.4720 0.0532  -0.0035 -0.1292 707 ILE A CG2 
1074 C CD1 . ILE A 141 ? 0.3339 0.6655 0.3591 0.0567  -0.0247 -0.1216 707 ILE A CD1 
1075 N N   . GLN A 142 ? 0.5789 0.9580 0.7810 0.0630  0.0016  -0.2548 708 GLN A N   
1076 C CA  . GLN A 142 ? 0.5634 0.9907 0.7903 0.0677  -0.0006 -0.2960 708 GLN A CA  
1077 C C   . GLN A 142 ? 0.4936 0.9136 0.7307 0.0669  0.0135  -0.2880 708 GLN A C   
1078 O O   . GLN A 142 ? 0.5274 0.9042 0.7797 0.0646  0.0312  -0.2662 708 GLN A O   
1079 C CB  . GLN A 142 ? 0.6960 1.1300 0.9901 0.0613  0.0096  -0.3432 708 GLN A CB  
1080 C CG  . GLN A 142 ? 0.8223 1.1924 1.1570 0.0500  0.0409  -0.3307 708 GLN A CG  
1081 C CD  . GLN A 142 ? 0.9054 1.2628 1.3007 0.0331  0.0537  -0.3658 708 GLN A CD  
1082 O OE1 . GLN A 142 ? 0.9309 1.3357 1.3468 0.0285  0.0359  -0.4057 708 GLN A OE1 
1083 N NE2 . GLN A 142 ? 0.8864 1.1825 1.3107 0.0245  0.0858  -0.3517 708 GLN A NE2 
1084 N N   . ASP A 143 ? 0.4069 0.8688 0.6310 0.0723  0.0059  -0.3047 709 ASP A N   
1085 C CA  . ASP A 143 ? 0.4417 0.9093 0.6928 0.0719  0.0209  -0.3142 709 ASP A CA  
1086 C C   . ASP A 143 ? 0.4827 0.9872 0.7439 0.0700  0.0115  -0.3544 709 ASP A C   
1087 O O   . ASP A 143 ? 0.3435 0.8759 0.6013 0.0728  -0.0058 -0.3787 709 ASP A O   
1088 C CB  . ASP A 143 ? 0.4601 0.9216 0.6696 0.0733  0.0177  -0.2765 709 ASP A CB  
1089 C CG  . ASP A 143 ? 0.4892 0.9796 0.6397 0.0779  0.0024  -0.2692 709 ASP A CG  
1090 O OD1 . ASP A 143 ? 0.5942 1.1180 0.7326 0.0859  -0.0075 -0.2975 709 ASP A OD1 
1091 O OD2 . ASP A 143 ? 0.4298 0.9094 0.5464 0.0758  0.0021  -0.2369 709 ASP A OD2 
1092 N N   . ALA A 144 ? 0.4960 1.0044 0.7726 0.0670  0.0210  -0.3624 710 ALA A N   
1093 C CA  . ALA A 144 ? 0.5409 1.0874 0.8298 0.0650  0.0125  -0.4009 710 ALA A CA  
1094 C C   . ALA A 144 ? 0.5788 1.1748 0.8119 0.0809  -0.0104 -0.4037 710 ALA A C   
1095 O O   . ALA A 144 ? 0.6174 1.2564 0.8604 0.0862  -0.0250 -0.4351 710 ALA A O   
1096 C CB  . ALA A 144 ? 0.4786 1.0169 0.7902 0.0598  0.0294  -0.4041 710 ALA A CB  
1097 N N   . THR A 145 ? 0.5645 1.1532 0.7401 0.0903  -0.0114 -0.3675 711 THR A N   
1098 C CA  . THR A 145 ? 0.6021 1.2149 0.7132 0.1069  -0.0249 -0.3553 711 THR A CA  
1099 C C   . THR A 145 ? 0.6048 1.2239 0.6900 0.1204  -0.0434 -0.3482 711 THR A C   
1100 O O   . THR A 145 ? 0.6857 1.3187 0.7243 0.1399  -0.0532 -0.3378 711 THR A O   
1101 C CB  . THR A 145 ? 0.5395 1.1311 0.5985 0.1071  -0.0119 -0.3166 711 THR A CB  
1102 O OG1 . THR A 145 ? 0.4741 1.0373 0.5210 0.1020  -0.0089 -0.2893 711 THR A OG1 
1103 C CG2 . THR A 145 ? 0.5089 1.0998 0.5996 0.0972  0.0068  -0.3228 711 THR A CG2 
1104 N N   . GLY A 146 ? 0.4683 1.0712 0.5835 0.1126  -0.0451 -0.3519 712 GLY A N   
1105 C CA  . GLY A 146 ? 0.4525 1.0596 0.5507 0.1252  -0.0606 -0.3455 712 GLY A CA  
1106 C C   . GLY A 146 ? 0.3875 0.9576 0.4912 0.1136  -0.0567 -0.3307 712 GLY A C   
1107 O O   . GLY A 146 ? 0.4029 0.9447 0.5406 0.0980  -0.0394 -0.3299 712 GLY A O   
1108 N N   . LYS A 147 ? 0.3562 0.9189 0.4302 0.1241  -0.0685 -0.3124 713 LYS A N   
1109 C CA  . LYS A 147 ? 0.4746 1.0017 0.5480 0.1127  -0.0672 -0.2960 713 LYS A CA  
1110 C C   . LYS A 147 ? 0.4744 0.9753 0.4818 0.1209  -0.0725 -0.2486 713 LYS A C   
1111 O O   . LYS A 147 ? 0.4311 0.9400 0.3980 0.1398  -0.0769 -0.2344 713 LYS A O   
1112 C CB  . LYS A 147 ? 0.4202 0.9588 0.5576 0.1097  -0.0701 -0.3343 713 LYS A CB  
1113 C CG  . LYS A 147 ? 0.5526 1.1318 0.6968 0.1326  -0.0846 -0.3538 713 LYS A CG  
1114 C CD  . LYS A 147 ? 0.7441 1.3401 0.9683 0.1264  -0.0822 -0.3982 713 LYS A CD  
1115 C CE  . LYS A 147 ? 0.8876 1.5229 1.1125 0.1541  -0.0969 -0.4191 713 LYS A CE  
1116 N NZ  . LYS A 147 ? 0.9291 1.5554 1.2179 0.1381  -0.0934 -0.4532 713 LYS A NZ  
1117 N N   . MET A 148 ? 0.4208 0.8814 0.4238 0.1063  -0.0670 -0.2207 714 MET A N   
1118 C CA  . MET A 148 ? 0.4687 0.9035 0.4160 0.1102  -0.0689 -0.1810 714 MET A CA  
1119 C C   . MET A 148 ? 0.4504 0.8438 0.4210 0.0938  -0.0635 -0.1636 714 MET A C   
1120 O O   . MET A 148 ? 0.4359 0.8190 0.4595 0.0827  -0.0566 -0.1807 714 MET A O   
1121 C CB  . MET A 148 ? 0.3570 0.7750 0.2605 0.1059  -0.0555 -0.1477 714 MET A CB  
1122 C CG  . MET A 148 ? 0.3321 0.7314 0.2692 0.0856  -0.0426 -0.1394 714 MET A CG  
1123 S SD  . MET A 148 ? 0.4292 0.8175 0.3310 0.0783  -0.0262 -0.1099 714 MET A SD  
1124 C CE  . MET A 148 ? 0.5110 0.8656 0.3657 0.0769  -0.0212 -0.0747 714 MET A CE  
1125 N N   . GLU A 149 ? 0.4463 0.8116 0.3757 0.0928  -0.0621 -0.1292 715 GLU A N   
1126 C CA  . GLU A 149 ? 0.3948 0.7204 0.3392 0.0782  -0.0566 -0.1122 715 GLU A CA  
1127 C C   . GLU A 149 ? 0.4507 0.7413 0.3735 0.0629  -0.0450 -0.0772 715 GLU A C   
1128 O O   . GLU A 149 ? 0.4838 0.7758 0.3714 0.0635  -0.0397 -0.0595 715 GLU A O   
1129 C CB  . GLU A 149 ? 0.3901 0.7140 0.3198 0.0887  -0.0656 -0.1103 715 GLU A CB  
1130 C CG  . GLU A 149 ? 0.5541 0.9132 0.5295 0.0996  -0.0780 -0.1545 715 GLU A CG  
1131 C CD  . GLU A 149 ? 0.6338 0.9950 0.6020 0.1120  -0.0887 -0.1553 715 GLU A CD  
1132 O OE1 . GLU A 149 ? 0.6408 0.9944 0.5517 0.1261  -0.0921 -0.1268 715 GLU A OE1 
1133 O OE2 . GLU A 149 ? 0.6729 1.0408 0.6956 0.1081  -0.0900 -0.1849 715 GLU A OE2 
1134 N N   . VAL A 150 ? 0.4425 0.7024 0.3889 0.0505  -0.0389 -0.0707 716 VAL A N   
1135 C CA  . VAL A 150 ? 0.3228 0.5530 0.2518 0.0386  -0.0326 -0.0435 716 VAL A CA  
1136 C C   . VAL A 150 ? 0.4204 0.6194 0.3393 0.0336  -0.0311 -0.0304 716 VAL A C   
1137 O O   . VAL A 150 ? 0.4585 0.6425 0.4024 0.0337  -0.0287 -0.0410 716 VAL A O   
1138 C CB  . VAL A 150 ? 0.3122 0.5296 0.2663 0.0355  -0.0275 -0.0449 716 VAL A CB  
1139 C CG1 . VAL A 150 ? 0.2889 0.4845 0.2232 0.0280  -0.0264 -0.0222 716 VAL A CG1 
1140 C CG2 . VAL A 150 ? 0.4240 0.6720 0.3952 0.0408  -0.0274 -0.0602 716 VAL A CG2 
1141 N N   . VAL A 151 ? 0.4624 0.6495 0.3488 0.0282  -0.0281 -0.0092 717 VAL A N   
1142 C CA  . VAL A 151 ? 0.3861 0.5432 0.2618 0.0230  -0.0249 0.0035  717 VAL A CA  
1143 C C   . VAL A 151 ? 0.4964 0.6260 0.3645 0.0089  -0.0189 0.0189  717 VAL A C   
1144 O O   . VAL A 151 ? 0.4603 0.5960 0.3163 0.0014  -0.0155 0.0266  717 VAL A O   
1145 C CB  . VAL A 151 ? 0.4910 0.6495 0.3353 0.0301  -0.0225 0.0155  717 VAL A CB  
1146 C CG1 . VAL A 151 ? 0.5095 0.6397 0.3513 0.0275  -0.0200 0.0240  717 VAL A CG1 
1147 C CG2 . VAL A 151 ? 0.5490 0.7423 0.3893 0.0511  -0.0319 -0.0006 717 VAL A CG2 
1148 N N   . VAL A 152 ? 0.3192 0.4199 0.1960 0.0063  -0.0162 0.0198  718 VAL A N   
1149 C CA  . VAL A 152 ? 0.4326 0.5081 0.2960 -0.0014 -0.0129 0.0315  718 VAL A CA  
1150 C C   . VAL A 152 ? 0.5034 0.5479 0.3522 -0.0097 -0.0060 0.0422  718 VAL A C   
1151 O O   . VAL A 152 ? 0.5140 0.5479 0.3727 -0.0071 -0.0027 0.0389  718 VAL A O   
1152 C CB  . VAL A 152 ? 0.5004 0.5586 0.3753 0.0072  -0.0101 0.0277  718 VAL A CB  
1153 C CG1 . VAL A 152 ? 0.6440 0.6681 0.4951 0.0062  -0.0060 0.0403  718 VAL A CG1 
1154 C CG2 . VAL A 152 ? 0.5470 0.6335 0.4326 0.0151  -0.0163 0.0206  718 VAL A CG2 
1155 N N   . HIS A 153 ? 0.5013 0.5359 0.3315 -0.0196 -0.0040 0.0510  719 HIS A N   
1156 C CA  . HIS A 153 ? 0.5650 0.5679 0.3815 -0.0287 0.0044  0.0596  719 HIS A CA  
1157 C C   . HIS A 153 ? 0.6885 0.6817 0.4881 -0.0328 0.0024  0.0604  719 HIS A C   
1158 O O   . HIS A 153 ? 0.8394 0.8577 0.6397 -0.0286 -0.0072 0.0539  719 HIS A O   
1159 C CB  . HIS A 153 ? 0.6310 0.6368 0.4405 -0.0371 0.0124  0.0664  719 HIS A CB  
1160 C CG  . HIS A 153 ? 0.8525 0.8746 0.6578 -0.0486 0.0167  0.0651  719 HIS A CG  
1161 N ND1 . HIS A 153 ? 0.8673 0.9208 0.6806 -0.0462 0.0150  0.0594  719 HIS A ND1 
1162 C CD2 . HIS A 153 ? 0.8966 0.9100 0.6975 -0.0641 0.0254  0.0638  719 HIS A CD2 
1163 C CE1 . HIS A 153 ? 0.8699 0.9329 0.6879 -0.0605 0.0241  0.0540  719 HIS A CE1 
1164 N NE2 . HIS A 153 ? 0.9254 0.9665 0.7378 -0.0718 0.0298  0.0547  719 HIS A NE2 
1165 N N   . GLY A 154 ? 0.5603 0.5805 0.4593 -0.0519 0.0165  -0.0496 720 GLY A N   
1166 C CA  . GLY A 154 ? 0.4125 0.4450 0.3231 -0.0694 0.0104  -0.0685 720 GLY A CA  
1167 C C   . GLY A 154 ? 0.4168 0.4998 0.3428 -0.0691 -0.0099 -0.0664 720 GLY A C   
1168 O O   . GLY A 154 ? 0.5658 0.6625 0.4925 -0.0546 -0.0156 -0.0529 720 GLY A O   
1169 N N   . ARG A 155 ? 0.3884 0.5033 0.3320 -0.0834 -0.0173 -0.0795 721 ARG A N   
1170 C CA  . ARG A 155 ? 0.4200 0.5895 0.3757 -0.0751 -0.0315 -0.0713 721 ARG A CA  
1171 C C   . ARG A 155 ? 0.3216 0.4986 0.2963 -0.0645 -0.0283 -0.0476 721 ARG A C   
1172 O O   . ARG A 155 ? 0.4422 0.6429 0.4253 -0.0487 -0.0285 -0.0323 721 ARG A O   
1173 C CB  . ARG A 155 ? 0.4314 0.6481 0.4065 -0.0892 -0.0404 -0.0877 721 ARG A CB  
1174 C CG  . ARG A 155 ? 0.5226 0.7287 0.5246 -0.1067 -0.0324 -0.0900 721 ARG A CG  
1175 C CD  . ARG A 155 ? 0.6333 0.8917 0.6627 -0.1245 -0.0411 -0.1133 721 ARG A CD  
1176 N NE  . ARG A 155 ? 0.5428 0.7747 0.6000 -0.1449 -0.0263 -0.1206 721 ARG A NE  
1177 C CZ  . ARG A 155 ? 0.4500 0.6930 0.5311 -0.1439 -0.0225 -0.1013 721 ARG A CZ  
1178 N NH1 . ARG A 155 ? 0.3693 0.6482 0.4535 -0.1246 -0.0302 -0.0749 721 ARG A NH1 
1179 N NH2 . ARG A 155 ? 0.3937 0.6086 0.4990 -0.1608 -0.0052 -0.1070 721 ARG A NH2 
1180 N N   . LEU A 156 ? 0.3226 0.4773 0.3063 -0.0723 -0.0203 -0.0458 722 LEU A N   
1181 C CA  . LEU A 156 ? 0.3283 0.4901 0.3333 -0.0662 -0.0142 -0.0323 722 LEU A CA  
1182 C C   . LEU A 156 ? 0.3554 0.5090 0.3580 -0.0536 -0.0115 -0.0296 722 LEU A C   
1183 O O   . LEU A 156 ? 0.3760 0.5398 0.4061 -0.0510 -0.0032 -0.0258 722 LEU A O   
1184 C CB  . LEU A 156 ? 0.2702 0.4146 0.2815 -0.0761 -0.0056 -0.0339 722 LEU A CB  
1185 C CG  . LEU A 156 ? 0.2812 0.4444 0.3134 -0.0896 -0.0055 -0.0353 722 LEU A CG  
1186 C CD1 . LEU A 156 ? 0.2869 0.4263 0.3252 -0.0977 0.0079  -0.0345 722 LEU A CD1 
1187 C CD2 . LEU A 156 ? 0.2520 0.4630 0.3131 -0.0825 -0.0080 -0.0212 722 LEU A CD2 
1188 N N   . THR A 157 ? 0.3605 0.4978 0.3372 -0.0468 -0.0155 -0.0342 723 THR A N   
1189 C CA  . THR A 157 ? 0.4183 0.5588 0.4006 -0.0352 -0.0142 -0.0340 723 THR A CA  
1190 C C   . THR A 157 ? 0.4124 0.5746 0.4225 -0.0266 -0.0089 -0.0239 723 THR A C   
1191 O O   . THR A 157 ? 0.3877 0.5562 0.4209 -0.0203 -0.0021 -0.0255 723 THR A O   
1192 C CB  . THR A 157 ? 0.3747 0.4957 0.3244 -0.0255 -0.0170 -0.0365 723 THR A CB  
1193 O OG1 . THR A 157 ? 0.3698 0.4832 0.3033 -0.0236 -0.0185 -0.0350 723 THR A OG1 
1194 C CG2 . THR A 157 ? 0.4071 0.5045 0.3312 -0.0258 -0.0125 -0.0379 723 THR A CG2 
1195 N N   . THR A 158 ? 0.4007 0.5798 0.4118 -0.0241 -0.0093 -0.0134 724 THR A N   
1196 C CA  . THR A 158 ? 0.3185 0.5212 0.3521 -0.0072 0.0020  0.0054  724 THR A CA  
1197 C C   . THR A 158 ? 0.3349 0.5540 0.4142 -0.0043 0.0211  0.0206  724 THR A C   
1198 O O   . THR A 158 ? 0.4409 0.6762 0.5462 0.0143  0.0404  0.0427  724 THR A O   
1199 C CB  . THR A 158 ? 0.2923 0.5204 0.2985 0.0042  -0.0067 0.0122  724 THR A CB  
1200 O OG1 . THR A 158 ? 0.2888 0.5452 0.2971 -0.0028 -0.0141 0.0114  724 THR A OG1 
1201 C CG2 . THR A 158 ? 0.3940 0.6001 0.3589 -0.0008 -0.0192 -0.0065 724 THR A CG2 
1202 N N   . ILE A 159 ? 0.3663 0.5789 0.4569 -0.0194 0.0218  0.0124  725 ILE A N   
1203 C CA  . ILE A 159 ? 0.3240 0.5469 0.4608 -0.0162 0.0458  0.0270  725 ILE A CA  
1204 C C   . ILE A 159 ? 0.4285 0.6390 0.6089 -0.0142 0.0703  0.0220  725 ILE A C   
1205 O O   . ILE A 159 ? 0.3744 0.5736 0.5481 -0.0208 0.0619  0.0003  725 ILE A O   
1206 C CB  . ILE A 159 ? 0.3238 0.5381 0.4659 -0.0330 0.0453  0.0166  725 ILE A CB  
1207 C CG1 . ILE A 159 ? 0.3703 0.5609 0.5089 -0.0465 0.0433  -0.0117 725 ILE A CG1 
1208 C CG2 . ILE A 159 ? 0.3217 0.5464 0.4316 -0.0402 0.0242  0.0152  725 ILE A CG2 
1209 C CD1 . ILE A 159 ? 0.3837 0.5665 0.5314 -0.0584 0.0508  -0.0210 725 ILE A CD1 
1210 N N   . ASN A 160 ? 0.6004 0.6007 0.5999 -0.0992 0.1371  0.0670  726 ASN A N   
1211 C CA  . ASN A 160 ? 0.5383 0.5767 0.5774 -0.1304 0.1425  0.0719  726 ASN A CA  
1212 C C   . ASN A 160 ? 0.5352 0.5778 0.6059 -0.1369 0.1063  0.0578  726 ASN A C   
1213 O O   . ASN A 160 ? 0.5228 0.5033 0.5651 -0.1442 0.0805  0.0526  726 ASN A O   
1214 C CB  . ASN A 160 ? 0.5779 0.5553 0.5652 -0.1606 0.1524  0.0873  726 ASN A CB  
1215 C CG  . ASN A 160 ? 0.7081 0.7232 0.7336 -0.2002 0.1637  0.0978  726 ASN A CG  
1216 O OD1 . ASN A 160 ? 0.7905 0.8884 0.8870 -0.2035 0.1682  0.0937  726 ASN A OD1 
1217 N ND2 . ASN A 160 ? 0.7853 0.7392 0.7659 -0.2272 0.1612  0.1121  726 ASN A ND2 
1218 N N   . CYS A 161 ? 0.4777 0.5925 0.6052 -0.1320 0.1034  0.0504  727 CYS A N   
1219 C CA  . CYS A 161 ? 0.4202 0.5402 0.5689 -0.1343 0.0715  0.0339  727 CYS A CA  
1220 C C   . CYS A 161 ? 0.4901 0.6792 0.6956 -0.1525 0.0696  0.0333  727 CYS A C   
1221 O O   . CYS A 161 ? 0.4482 0.7046 0.6916 -0.1404 0.0852  0.0384  727 CYS A O   
1222 C CB  . CYS A 161 ? 0.3983 0.5255 0.5428 -0.1013 0.0608  0.0223  727 CYS A CB  
1223 S SG  . CYS A 161 ? 0.5301 0.6596 0.6865 -0.1004 0.0281  -0.0009 727 CYS A SG  
1224 N N   . GLU A 162 ? 0.5454 0.7153 0.7580 -0.1803 0.0463  0.0262  728 GLU A N   
1225 C CA  . GLU A 162 ? 0.4990 0.7282 0.7659 -0.2057 0.0382  0.0263  728 GLU A CA  
1226 C C   . GLU A 162 ? 0.4759 0.6934 0.7421 -0.2045 0.0004  0.0032  728 GLU A C   
1227 O O   . GLU A 162 ? 0.4380 0.5990 0.6633 -0.1878 -0.0148 -0.0122 728 GLU A O   
1228 C CB  . GLU A 162 ? 0.6103 0.8238 0.8842 -0.2516 0.0465  0.0424  728 GLU A CB  
1229 C CG  . GLU A 162 ? 0.7728 1.0006 1.0425 -0.2493 0.0898  0.0642  728 GLU A CG  
1230 C CD  . GLU A 162 ? 0.8505 1.1655 1.1752 -0.2227 0.1125  0.0662  728 GLU A CD  
1231 O OE1 . GLU A 162 ? 0.9345 1.2563 1.2458 -0.2037 0.1478  0.0763  728 GLU A OE1 
1232 O OE2 . GLU A 162 ? 0.7450 1.1125 1.1206 -0.2188 0.0926  0.0559  728 GLU A OE2 
1233 N N   . GLU A 163 ? 0.4147 0.6900 0.7277 -0.2201 -0.0147 -0.0004 729 GLU A N   
1234 C CA  . GLU A 163 ? 0.5487 0.8126 0.8556 -0.2229 -0.0524 -0.0237 729 GLU A CA  
1235 C C   . GLU A 163 ? 0.6164 0.7906 0.8823 -0.2423 -0.0733 -0.0358 729 GLU A C   
1236 O O   . GLU A 163 ? 0.6303 0.7739 0.8985 -0.2770 -0.0706 -0.0218 729 GLU A O   
1237 C CB  . GLU A 163 ? 0.5876 0.9168 0.9511 -0.2407 -0.0673 -0.0215 729 GLU A CB  
1238 C CG  . GLU A 163 ? 0.6130 1.0133 1.0229 -0.2213 -0.0367 -0.0020 729 GLU A CG  
1239 C CD  . GLU A 163 ? 0.7094 1.1716 1.1736 -0.2192 -0.0541 -0.0043 729 GLU A CD  
1240 O OE1 . GLU A 163 ? 0.7991 1.2556 1.2792 -0.2462 -0.0827 -0.0146 729 GLU A OE1 
1241 O OE2 . GLU A 163 ? 0.5084 1.0194 0.9974 -0.1896 -0.0413 0.0028  729 GLU A OE2 
1242 N N   . GLY A 164 ? 0.5426 0.6732 0.7686 -0.2179 -0.0923 -0.0611 730 GLY A N   
1243 C CA  . GLY A 164 ? 0.5459 0.5883 0.7322 -0.2241 -0.1146 -0.0776 730 GLY A CA  
1244 C C   . GLY A 164 ? 0.7180 0.7099 0.8698 -0.1966 -0.1016 -0.0769 730 GLY A C   
1245 O O   . GLY A 164 ? 0.9061 0.8347 1.0270 -0.1829 -0.1211 -0.0979 730 GLY A O   
1246 N N   . ASP A 165 ? 0.5783 0.5976 0.7363 -0.1858 -0.0712 -0.0550 731 ASP A N   
1247 C CA  . ASP A 165 ? 0.4937 0.4698 0.6217 -0.1605 -0.0632 -0.0535 731 ASP A CA  
1248 C C   . ASP A 165 ? 0.4085 0.4102 0.5346 -0.1233 -0.0626 -0.0723 731 ASP A C   
1249 O O   . ASP A 165 ? 0.4384 0.4867 0.5769 -0.1173 -0.0656 -0.0837 731 ASP A O   
1250 C CB  . ASP A 165 ? 0.5378 0.5288 0.6643 -0.1613 -0.0331 -0.0261 731 ASP A CB  
1251 C CG  . ASP A 165 ? 0.5574 0.5213 0.6771 -0.1981 -0.0254 -0.0046 731 ASP A CG  
1252 O OD1 . ASP A 165 ? 0.5167 0.4324 0.6270 -0.2243 -0.0481 -0.0087 731 ASP A OD1 
1253 O OD2 . ASP A 165 ? 0.5202 0.5079 0.6399 -0.2010 0.0043  0.0163  731 ASP A OD2 
1254 N N   . LYS A 166 ? 0.4374 0.4105 0.5474 -0.1006 -0.0589 -0.0731 732 LYS A N   
1255 C CA  . LYS A 166 ? 0.5281 0.5322 0.6417 -0.0696 -0.0528 -0.0863 732 LYS A CA  
1256 C C   . LYS A 166 ? 0.4858 0.5028 0.5993 -0.0579 -0.0337 -0.0666 732 LYS A C   
1257 O O   . LYS A 166 ? 0.5195 0.4961 0.6184 -0.0644 -0.0327 -0.0517 732 LYS A O   
1258 C CB  . LYS A 166 ? 0.5383 0.5029 0.6431 -0.0501 -0.0711 -0.1129 732 LYS A CB  
1259 C CG  . LYS A 166 ? 0.6352 0.5787 0.7309 -0.0569 -0.0924 -0.1381 732 LYS A CG  
1260 C CD  . LYS A 166 ? 0.7033 0.6017 0.7896 -0.0313 -0.1095 -0.1669 732 LYS A CD  
1261 C CE  . LYS A 166 ? 0.8175 0.6674 0.8838 -0.0408 -0.1369 -0.1917 732 LYS A CE  
1262 N NZ  . LYS A 166 ? 0.9040 0.7101 0.9613 -0.0070 -0.1526 -0.2245 732 LYS A NZ  
1263 N N   . LEU A 167 ? 0.4235 0.4894 0.5457 -0.0425 -0.0208 -0.0660 733 LEU A N   
1264 C CA  . LEU A 167 ? 0.4568 0.5290 0.5764 -0.0321 -0.0069 -0.0493 733 LEU A CA  
1265 C C   . LEU A 167 ? 0.3685 0.4398 0.4942 -0.0139 -0.0108 -0.0608 733 LEU A C   
1266 O O   . LEU A 167 ? 0.3484 0.4551 0.4819 -0.0042 -0.0069 -0.0744 733 LEU A O   
1267 C CB  . LEU A 167 ? 0.3548 0.4768 0.4800 -0.0290 0.0081  -0.0369 733 LEU A CB  
1268 C CG  . LEU A 167 ? 0.3963 0.5381 0.5299 -0.0408 0.0161  -0.0232 733 LEU A CG  
1269 C CD1 . LEU A 167 ? 0.2850 0.4765 0.4275 -0.0303 0.0225  -0.0159 733 LEU A CD1 
1270 C CD2 . LEU A 167 ? 0.3903 0.4999 0.5103 -0.0449 0.0280  -0.0067 733 LEU A CD2 
1271 N N   . LYS A 168 ? 0.3416 0.3756 0.4641 -0.0099 -0.0184 -0.0553 734 LYS A N   
1272 C CA  . LYS A 168 ? 0.3028 0.3512 0.4454 0.0059  -0.0211 -0.0631 734 LYS A CA  
1273 C C   . LYS A 168 ? 0.4179 0.4836 0.5581 0.0043  -0.0092 -0.0428 734 LYS A C   
1274 O O   . LYS A 168 ? 0.3888 0.4170 0.5107 -0.0006 -0.0139 -0.0274 734 LYS A O   
1275 C CB  . LYS A 168 ? 0.3122 0.3113 0.4587 0.0127  -0.0443 -0.0696 734 LYS A CB  
1276 C CG  . LYS A 168 ? 0.3151 0.3375 0.4972 0.0294  -0.0500 -0.0775 734 LYS A CG  
1277 C CD  . LYS A 168 ? 0.4379 0.4144 0.6304 0.0425  -0.0792 -0.0906 734 LYS A CD  
1278 C CE  . LYS A 168 ? 0.5544 0.5608 0.7945 0.0588  -0.0882 -0.0957 734 LYS A CE  
1279 N NZ  . LYS A 168 ? 0.6754 0.7627 0.9515 0.0663  -0.0607 -0.1066 734 LYS A NZ  
1280 N N   . LEU A 169 ? 0.3414 0.4566 0.4925 0.0079  0.0050  -0.0429 735 LEU A N   
1281 C CA  . LEU A 169 ? 0.3582 0.4846 0.5012 0.0039  0.0149  -0.0223 735 LEU A CA  
1282 C C   . LEU A 169 ? 0.3276 0.4655 0.4939 0.0048  0.0125  -0.0191 735 LEU A C   
1283 O O   . LEU A 169 ? 0.3219 0.4938 0.5178 0.0112  0.0154  -0.0341 735 LEU A O   
1284 C CB  . LEU A 169 ? 0.2681 0.4357 0.4023 0.0035  0.0289  -0.0192 735 LEU A CB  
1285 C CG  . LEU A 169 ? 0.2969 0.4713 0.4198 0.0015  0.0286  -0.0235 735 LEU A CG  
1286 C CD1 . LEU A 169 ? 0.2111 0.4229 0.3224 0.0030  0.0360  -0.0184 735 LEU A CD1 
1287 C CD2 . LEU A 169 ? 0.2348 0.3815 0.3481 -0.0026 0.0280  -0.0099 735 LEU A CD2 
1288 N N   . THR A 170 ? 0.2554 0.3674 0.4099 -0.0019 0.0075  -0.0004 736 THR A N   
1289 C CA  . THR A 170 ? 0.2289 0.3559 0.4084 -0.0082 0.0037  0.0074  736 THR A CA  
1290 C C   . THR A 170 ? 0.2591 0.3789 0.4145 -0.0184 0.0102  0.0297  736 THR A C   
1291 O O   . THR A 170 ? 0.3305 0.4051 0.4489 -0.0173 0.0058  0.0400  736 THR A O   
1292 C CB  . THR A 170 ? 0.2661 0.3542 0.4578 -0.0086 -0.0222 0.0067  736 THR A CB  
1293 O OG1 . THR A 170 ? 0.3148 0.4028 0.5270 0.0035  -0.0320 -0.0133 736 THR A OG1 
1294 C CG2 . THR A 170 ? 0.2092 0.3242 0.4405 -0.0190 -0.0290 0.0147  736 THR A CG2 
1295 N N   . CYS A 171 ? 0.2989 0.4614 0.4731 -0.0278 0.0218  0.0370  737 CYS A N   
1296 C CA  . CYS A 171 ? 0.2935 0.4428 0.4433 -0.0408 0.0246  0.0608  737 CYS A CA  
1297 C C   . CYS A 171 ? 0.3709 0.4994 0.4756 -0.0314 0.0301  0.0679  737 CYS A C   
1298 O O   . CYS A 171 ? 0.4174 0.4966 0.4908 -0.0291 0.0211  0.0801  737 CYS A O   
1299 C CB  . CYS A 171 ? 0.2179 0.3183 0.3646 -0.0524 0.0028  0.0736  737 CYS A CB  
1300 S SG  . CYS A 171 ? 0.3463 0.4234 0.4677 -0.0739 0.0009  0.1032  737 CYS A SG  
1301 N N   . PHE A 172 ? 0.3108 0.4768 0.4140 -0.0236 0.0428  0.0577  738 PHE A N   
1302 C CA  . PHE A 172 ? 0.3240 0.4875 0.3950 -0.0161 0.0457  0.0662  738 PHE A CA  
1303 C C   . PHE A 172 ? 0.4149 0.5995 0.4673 -0.0262 0.0541  0.0825  738 PHE A C   
1304 O O   . PHE A 172 ? 0.4372 0.6620 0.5034 -0.0360 0.0674  0.0781  738 PHE A O   
1305 C CB  . PHE A 172 ? 0.2366 0.4221 0.3121 -0.0051 0.0476  0.0474  738 PHE A CB  
1306 C CG  . PHE A 172 ? 0.3022 0.4577 0.3777 0.0028  0.0411  0.0431  738 PHE A CG  
1307 C CD1 . PHE A 172 ? 0.3337 0.4609 0.4191 0.0005  0.0352  0.0360  738 PHE A CD1 
1308 C CD2 . PHE A 172 ? 0.2234 0.3802 0.2887 0.0123  0.0410  0.0478  738 PHE A CD2 
1309 C CE1 . PHE A 172 ? 0.2859 0.3824 0.3608 0.0047  0.0333  0.0348  738 PHE A CE1 
1310 C CE2 . PHE A 172 ? 0.3364 0.4736 0.4036 0.0175  0.0420  0.0450  738 PHE A CE2 
1311 C CZ  . PHE A 172 ? 0.3155 0.4199 0.3822 0.0123  0.0399  0.0392  738 PHE A CZ  
1312 N N   . GLU A 173 ? 0.3990 0.5546 0.4174 -0.0227 0.0471  0.1018  739 GLU A N   
1313 C CA  . GLU A 173 ? 0.4506 0.6131 0.4395 -0.0343 0.0516  0.1222  739 GLU A CA  
1314 C C   . GLU A 173 ? 0.4646 0.6587 0.4324 -0.0251 0.0543  0.1162  739 GLU A C   
1315 O O   . GLU A 173 ? 0.4183 0.6095 0.3846 -0.0072 0.0433  0.1090  739 GLU A O   
1316 C CB  . GLU A 173 ? 0.4940 0.5980 0.4493 -0.0350 0.0368  0.1481  739 GLU A CB  
1317 C CG  . GLU A 173 ? 0.5948 0.6959 0.5089 -0.0480 0.0379  0.1731  739 GLU A CG  
1318 C CD  . GLU A 173 ? 0.6979 0.7321 0.5796 -0.0575 0.0221  0.2013  739 GLU A CD  
1319 O OE1 . GLU A 173 ? 0.7632 0.7918 0.6209 -0.0841 0.0266  0.2255  739 GLU A OE1 
1320 O OE2 . GLU A 173 ? 0.7338 0.7176 0.6101 -0.0389 0.0060  0.1992  739 GLU A OE2 
1321 N N   . LEU A 174 ? 0.4712 0.6977 0.4223 -0.0383 0.0689  0.1190  740 LEU A N   
1322 C CA  . LEU A 174 ? 0.5026 0.7490 0.4185 -0.0312 0.0671  0.1148  740 LEU A CA  
1323 C C   . LEU A 174 ? 0.5167 0.7295 0.3809 -0.0341 0.0544  0.1462  740 LEU A C   
1324 O O   . LEU A 174 ? 0.5133 0.7141 0.3510 -0.0549 0.0638  0.1698  740 LEU A O   
1325 C CB  . LEU A 174 ? 0.5177 0.8102 0.4265 -0.0399 0.0903  0.0989  740 LEU A CB  
1326 C CG  . LEU A 174 ? 0.6237 0.9258 0.4881 -0.0301 0.0808  0.0900  740 LEU A CG  
1327 C CD1 . LEU A 174 ? 0.5841 0.9189 0.4607 -0.0221 0.0893  0.0530  740 LEU A CD1 
1328 C CD2 . LEU A 174 ? 0.5850 0.8804 0.3826 -0.0433 0.0863  0.1156  740 LEU A CD2 
1329 N N   . ALA A 175 ? 0.4684 0.6662 0.3212 -0.0139 0.0315  0.1476  741 ALA A N   
1330 C CA  . ALA A 175 ? 0.5827 0.7434 0.3864 -0.0095 0.0120  0.1760  741 ALA A CA  
1331 C C   . ALA A 175 ? 0.6216 0.8052 0.3820 -0.0082 0.0044  0.1740  741 ALA A C   
1332 O O   . ALA A 175 ? 0.6362 0.8419 0.4115 0.0090  -0.0122 0.1568  741 ALA A O   
1333 C CB  . ALA A 175 ? 0.4833 0.6153 0.3071 0.0177  -0.0110 0.1783  741 ALA A CB  
1334 N N   . PRO A 176 ? 0.6572 0.8329 0.3618 -0.0287 0.0157  0.1918  742 PRO A N   
1335 C CA  . PRO A 176 ? 0.8073 0.9904 0.4595 -0.0286 0.0095  0.1856  742 PRO A CA  
1336 C C   . PRO A 176 ? 0.9054 1.0603 0.5321 -0.0076 -0.0316 0.1984  742 PRO A C   
1337 O O   . PRO A 176 ? 0.8912 0.9965 0.5107 -0.0003 -0.0487 0.2211  742 PRO A O   
1338 C CB  . PRO A 176 ? 0.7784 0.9324 0.3852 -0.0530 0.0311  0.2022  742 PRO A CB  
1339 C CG  . PRO A 176 ? 0.6659 0.8306 0.3239 -0.0692 0.0567  0.2029  742 PRO A CG  
1340 C CD  . PRO A 176 ? 0.5959 0.7481 0.2986 -0.0540 0.0374  0.2057  742 PRO A CD  
1341 N N   . LYS A 177 ? 0.9355 1.1189 0.5523 0.0038  -0.0504 0.1812  743 LYS A N   
1342 C CA  . LYS A 177 ? 1.0255 1.1869 0.6245 0.0238  -0.0934 0.1915  743 LYS A CA  
1343 C C   . LYS A 177 ? 1.2048 1.3509 0.7305 0.0174  -0.1066 0.1884  743 LYS A C   
1344 O O   . LYS A 177 ? 1.2725 1.4275 0.7613 -0.0002 -0.0787 0.1757  743 LYS A O   
1345 C CB  . LYS A 177 ? 0.9241 1.1310 0.5946 0.0475  -0.1158 0.1752  743 LYS A CB  
1346 C CG  . LYS A 177 ? 0.9311 1.1231 0.6599 0.0657  -0.1165 0.1834  743 LYS A CG  
1347 C CD  . LYS A 177 ? 0.9385 1.1781 0.7508 0.0799  -0.1195 0.1569  743 LYS A CD  
1348 C CE  . LYS A 177 ? 0.9385 1.2132 0.7607 0.0913  -0.1567 0.1491  743 LYS A CE  
1349 N NZ  . LYS A 177 ? 0.8048 1.1334 0.7075 0.0929  -0.1552 0.1224  743 LYS A NZ  
1350 N N   . SER A 178 ? 1.2943 1.4166 0.8010 0.0351  -0.1503 0.1977  744 SER A N   
1351 C CA  . SER A 178 ? 1.3969 1.4800 0.8165 0.0329  -0.1701 0.2036  744 SER A CA  
1352 C C   . SER A 178 ? 1.3668 1.4794 0.7600 0.0258  -0.1731 0.1745  744 SER A C   
1353 O O   . SER A 178 ? 1.4472 1.5321 0.7585 0.0154  -0.1606 0.1735  744 SER A O   
1354 C CB  . SER A 178 ? 1.4773 1.5255 0.8908 0.0603  -0.2218 0.2199  744 SER A CB  
1355 O OG  . SER A 178 ? 1.6091 1.6295 0.9402 0.0685  -0.2442 0.2237  744 SER A OG  
1356 N N   . GLY A 179 ? 1.2574 1.4236 0.7188 0.0331  -0.1883 0.1498  745 GLY A N   
1357 C CA  . GLY A 179 ? 1.2694 1.4499 0.7067 0.0299  -0.2090 0.1221  745 GLY A CA  
1358 C C   . GLY A 179 ? 1.1502 1.3621 0.5914 0.0170  -0.1746 0.0885  745 GLY A C   
1359 O O   . GLY A 179 ? 1.1691 1.3978 0.6179 0.0165  -0.1965 0.0604  745 GLY A O   
1360 N N   . ASN A 180 ? 1.1317 1.1799 0.5001 0.1160  -0.1656 0.1299  746 ASN A N   
1361 C CA  . ASN A 180 ? 1.0324 1.1119 0.4304 0.1080  -0.1261 0.1105  746 ASN A CA  
1362 C C   . ASN A 180 ? 0.9955 1.1298 0.4880 0.1164  -0.1352 0.0926  746 ASN A C   
1363 O O   . ASN A 180 ? 0.8781 1.0482 0.4062 0.1111  -0.1228 0.0679  746 ASN A O   
1364 C CB  . ASN A 180 ? 1.1746 1.2520 0.5321 0.1041  -0.1307 0.0845  746 ASN A CB  
1365 C CG  . ASN A 180 ? 1.3540 1.4053 0.6501 0.0916  -0.0866 0.0889  746 ASN A CG  
1366 O OD1 . ASN A 180 ? 1.3880 1.4585 0.7137 0.0879  -0.0484 0.0781  746 ASN A OD1 
1367 N ND2 . ASN A 180 ? 1.4119 1.4254 0.6266 0.0856  -0.0920 0.1031  746 ASN A ND2 
1368 N N   . THR A 181 ? 1.0395 1.1764 0.5691 0.1279  -0.1579 0.1046  747 THR A N   
1369 C CA  . THR A 181 ? 0.9264 1.1170 0.5466 0.1367  -0.1694 0.0871  747 THR A CA  
1370 C C   . THR A 181 ? 0.9100 1.1151 0.5749 0.1313  -0.1371 0.0992  747 THR A C   
1371 O O   . THR A 181 ? 0.9013 1.1428 0.6344 0.1384  -0.1456 0.0880  747 THR A O   
1372 C CB  . THR A 181 ? 0.9310 1.1263 0.5817 0.1568  -0.2165 0.0825  747 THR A CB  
1373 O OG1 . THR A 181 ? 1.0791 1.2135 0.6785 0.1638  -0.2279 0.1141  747 THR A OG1 
1374 C CG2 . THR A 181 ? 0.9520 1.1641 0.5954 0.1580  -0.2502 0.0599  747 THR A CG2 
1375 N N   . GLY A 182 ? 0.9019 1.0788 0.5319 0.1171  -0.1003 0.1217  748 GLY A N   
1376 C CA  . GLY A 182 ? 0.7320 0.9187 0.4045 0.1078  -0.0724 0.1362  748 GLY A CA  
1377 C C   . GLY A 182 ? 0.6016 0.8413 0.3473 0.1042  -0.0651 0.1114  748 GLY A C   
1378 O O   . GLY A 182 ? 0.5603 0.8268 0.3156 0.0994  -0.0640 0.0849  748 GLY A O   
1379 N N   . GLU A 183 ? 0.5330 0.7733 0.3304 0.1020  -0.0612 0.1164  749 GLU A N   
1380 C CA  . GLU A 183 ? 0.5276 0.8021 0.3917 0.0926  -0.0510 0.0921  749 GLU A CA  
1381 C C   . GLU A 183 ? 0.4627 0.7238 0.3518 0.0771  -0.0237 0.1059  749 GLU A C   
1382 O O   . GLU A 183 ? 0.5774 0.8072 0.4481 0.0742  -0.0184 0.1336  749 GLU A O   
1383 C CB  . GLU A 183 ? 0.4406 0.7402 0.3511 0.1077  -0.0780 0.0734  749 GLU A CB  
1384 C CG  . GLU A 183 ? 0.5778 0.8453 0.4849 0.1272  -0.0963 0.0914  749 GLU A CG  
1385 C CD  . GLU A 183 ? 0.6495 0.9508 0.6079 0.1499  -0.1212 0.0675  749 GLU A CD  
1386 O OE1 . GLU A 183 ? 0.6950 0.9803 0.6775 0.1587  -0.1199 0.0691  749 GLU A OE1 
1387 O OE2 . GLU A 183 ? 0.5388 0.8847 0.5149 0.1594  -0.1422 0.0456  749 GLU A OE2 
1388 N N   . LEU A 184 ? 0.3082 0.5897 0.2355 0.0645  -0.0090 0.0868  750 LEU A N   
1389 C CA  . LEU A 184 ? 0.4019 0.6721 0.3583 0.0515  0.0085  0.0948  750 LEU A CA  
1390 C C   . LEU A 184 ? 0.4147 0.6820 0.4054 0.0554  -0.0035 0.0863  750 LEU A C   
1391 O O   . LEU A 184 ? 0.3898 0.6836 0.4038 0.0574  -0.0098 0.0615  750 LEU A O   
1392 C CB  . LEU A 184 ? 0.3891 0.6710 0.3574 0.0389  0.0263  0.0788  750 LEU A CB  
1393 C CG  . LEU A 184 ? 0.4125 0.6967 0.3503 0.0398  0.0432  0.0830  750 LEU A CG  
1394 C CD1 . LEU A 184 ? 0.3430 0.6299 0.2863 0.0345  0.0513  0.0599  750 LEU A CD1 
1395 C CD2 . LEU A 184 ? 0.4957 0.7744 0.4366 0.0349  0.0612  0.1102  750 LEU A CD2 
1396 N N   . ARG A 185 ? 0.3161 0.5514 0.3079 0.0554  -0.0057 0.1057  751 ARG A N   
1397 C CA  . ARG A 185 ? 0.3506 0.5740 0.3653 0.0632  -0.0159 0.0962  751 ARG A CA  
1398 C C   . ARG A 185 ? 0.3463 0.5464 0.3756 0.0457  -0.0041 0.1002  751 ARG A C   
1399 O O   . ARG A 185 ? 0.3500 0.5329 0.3733 0.0313  0.0036  0.1210  751 ARG A O   
1400 C CB  . ARG A 185 ? 0.3574 0.5463 0.3502 0.0831  -0.0384 0.1121  751 ARG A CB  
1401 C CG  . ARG A 185 ? 0.4092 0.6121 0.3791 0.1024  -0.0571 0.1115  751 ARG A CG  
1402 C CD  . ARG A 185 ? 0.5401 0.6917 0.4739 0.1217  -0.0826 0.1328  751 ARG A CD  
1403 N NE  . ARG A 185 ? 0.7602 0.9254 0.6737 0.1458  -0.1087 0.1275  751 ARG A NE  
1404 C CZ  . ARG A 185 ? 0.8326 0.9501 0.7025 0.1678  -0.1388 0.1453  751 ARG A CZ  
1405 N NH1 . ARG A 185 ? 0.7961 0.8446 0.6360 0.1659  -0.1447 0.1704  751 ARG A NH1 
1406 N NH2 . ARG A 185 ? 0.8651 0.9948 0.7200 0.1867  -0.1648 0.1362  751 ARG A NH2 
1407 N N   . SER A 186 ? 0.2906 0.4925 0.3389 0.0460  -0.0028 0.0797  752 SER A N   
1408 C CA  . SER A 186 ? 0.3023 0.4726 0.3536 0.0303  0.0031  0.0828  752 SER A CA  
1409 C C   . SER A 186 ? 0.3145 0.4350 0.3521 0.0346  -0.0113 0.1018  752 SER A C   
1410 O O   . SER A 186 ? 0.3003 0.4057 0.3279 0.0559  -0.0258 0.1013  752 SER A O   
1411 C CB  . SER A 186 ? 0.2896 0.4685 0.3510 0.0274  0.0111  0.0557  752 SER A CB  
1412 O OG  . SER A 186 ? 0.3414 0.5310 0.4111 0.0494  0.0045  0.0402  752 SER A OG  
1413 N N   . VAL A 187 ? 0.2566 0.3491 0.2936 0.0146  -0.0108 0.1182  753 VAL A N   
1414 C CA  . VAL A 187 ? 0.3003 0.3375 0.3223 0.0101  -0.0269 0.1364  753 VAL A CA  
1415 C C   . VAL A 187 ? 0.3511 0.3555 0.3735 -0.0029 -0.0309 0.1277  753 VAL A C   
1416 O O   . VAL A 187 ? 0.3127 0.3356 0.3425 -0.0075 -0.0205 0.1096  753 VAL A O   
1417 C CB  . VAL A 187 ? 0.3337 0.3664 0.3535 -0.0086 -0.0266 0.1695  753 VAL A CB  
1418 C CG1 . VAL A 187 ? 0.3952 0.4358 0.3920 0.0053  -0.0278 0.1816  753 VAL A CG1 
1419 C CG2 . VAL A 187 ? 0.3396 0.4153 0.3884 -0.0268 -0.0096 0.1727  753 VAL A CG2 
1420 N N   . ILE A 188 ? 0.3863 0.3340 0.3925 -0.0112 -0.0487 0.1417  754 ILE A N   
1421 C CA  . ILE A 188 ? 0.4861 0.3891 0.4808 -0.0227 -0.0592 0.1333  754 ILE A CA  
1422 C C   . ILE A 188 ? 0.5009 0.4275 0.5163 -0.0434 -0.0538 0.1324  754 ILE A C   
1423 O O   . ILE A 188 ? 0.4849 0.3901 0.4837 -0.0450 -0.0550 0.1145  754 ILE A O   
1424 C CB  . ILE A 188 ? 0.5346 0.3670 0.5071 -0.0349 -0.0845 0.1525  754 ILE A CB  
1425 C CG1 . ILE A 188 ? 0.6691 0.4462 0.6188 -0.0443 -0.0997 0.1398  754 ILE A CG1 
1426 C CG2 . ILE A 188 ? 0.5999 0.4500 0.5961 -0.0633 -0.0859 0.1832  754 ILE A CG2 
1427 C CD1 . ILE A 188 ? 0.7574 0.5181 0.6779 -0.0175 -0.0913 0.1061  754 ILE A CD1 
1428 N N   . HIS A 189 ? 0.4057 0.3737 0.4530 -0.0568 -0.0478 0.1507  755 HIS A N   
1429 C CA  . HIS A 189 ? 0.3512 0.3424 0.4235 -0.0699 -0.0473 0.1497  755 HIS A CA  
1430 C C   . HIS A 189 ? 0.3700 0.4063 0.4502 -0.0589 -0.0280 0.1345  755 HIS A C   
1431 O O   . HIS A 189 ? 0.3401 0.3911 0.4375 -0.0640 -0.0295 0.1327  755 HIS A O   
1432 C CB  . HIS A 189 ? 0.3925 0.4062 0.5034 -0.0906 -0.0532 0.1755  755 HIS A CB  
1433 C CG  . HIS A 189 ? 0.3284 0.2966 0.4289 -0.1053 -0.0750 0.1825  755 HIS A CG  
1434 N ND1 . HIS A 189 ? 0.3854 0.3605 0.4939 -0.1168 -0.0739 0.1995  755 HIS A ND1 
1435 C CD2 . HIS A 189 ? 0.3652 0.2780 0.4402 -0.1101 -0.0977 0.1711  755 HIS A CD2 
1436 C CE1 . HIS A 189 ? 0.4032 0.3293 0.4953 -0.1297 -0.0962 0.1996  755 HIS A CE1 
1437 N NE2 . HIS A 189 ? 0.4095 0.2991 0.4815 -0.1243 -0.1113 0.1816  755 HIS A NE2 
1438 N N   . SER A 190 ? 0.3853 0.4401 0.4526 -0.0431 -0.0139 0.1227  756 SER A N   
1439 C CA  . SER A 190 ? 0.3017 0.3925 0.3713 -0.0366 0.0016  0.1075  756 SER A CA  
1440 C C   . SER A 190 ? 0.3696 0.4389 0.4237 -0.0439 0.0003  0.0906  756 SER A C   
1441 O O   . SER A 190 ? 0.3800 0.4094 0.4105 -0.0493 -0.0066 0.0825  756 SER A O   
1442 C CB  . SER A 190 ? 0.2593 0.3719 0.3192 -0.0218 0.0107  0.0953  756 SER A CB  
1443 O OG  . SER A 190 ? 0.2937 0.4200 0.3566 -0.0140 0.0096  0.1123  756 SER A OG  
1444 N N   . HIS A 191 ? 0.3427 0.4310 0.4015 -0.0435 0.0066  0.0851  757 HIS A N   
1445 C CA  . HIS A 191 ? 0.2262 0.2843 0.2595 -0.0513 0.0038  0.0711  757 HIS A CA  
1446 C C   . HIS A 191 ? 0.3034 0.3815 0.3272 -0.0489 0.0169  0.0571  757 HIS A C   
1447 O O   . HIS A 191 ? 0.2635 0.3753 0.3046 -0.0383 0.0228  0.0603  757 HIS A O   
1448 C CB  . HIS A 191 ? 0.2740 0.3127 0.3179 -0.0537 -0.0146 0.0803  757 HIS A CB  
1449 C CG  . HIS A 191 ? 0.3598 0.3536 0.3665 -0.0598 -0.0233 0.0686  757 HIS A CG  
1450 N ND1 . HIS A 191 ? 0.4646 0.4598 0.4625 -0.0538 -0.0198 0.0598  757 HIS A ND1 
1451 C CD2 . HIS A 191 ? 0.4978 0.4330 0.4624 -0.0723 -0.0368 0.0645  757 HIS A CD2 
1452 C CE1 . HIS A 191 ? 0.5342 0.4708 0.4866 -0.0634 -0.0322 0.0529  757 HIS A CE1 
1453 N NE2 . HIS A 191 ? 0.4895 0.3903 0.4196 -0.0753 -0.0416 0.0562  757 HIS A NE2 
1454 N N   . ILE A 192 ? 0.3670 0.4208 0.3582 -0.0616 0.0221  0.0411  758 ILE A N   
1455 C CA  . ILE A 192 ? 0.4053 0.4662 0.3813 -0.0671 0.0305  0.0274  758 ILE A CA  
1456 C C   . ILE A 192 ? 0.4374 0.4396 0.3709 -0.0820 0.0227  0.0219  758 ILE A C   
1457 O O   . ILE A 192 ? 0.3920 0.3540 0.2970 -0.0953 0.0195  0.0218  758 ILE A O   
1458 C CB  . ILE A 192 ? 0.3878 0.4783 0.3636 -0.0760 0.0454  0.0124  758 ILE A CB  
1459 C CG1 . ILE A 192 ? 0.3462 0.4860 0.3562 -0.0573 0.0468  0.0174  758 ILE A CG1 
1460 C CG2 . ILE A 192 ? 0.3424 0.4338 0.2999 -0.0901 0.0505  -0.0020 758 ILE A CG2 
1461 C CD1 . ILE A 192 ? 0.3125 0.4941 0.3338 -0.0601 0.0556  0.0004  758 ILE A CD1 
1462 N N   . LYS A 193 ? 0.3993 0.3775 0.3930 -0.0116 0.0736  0.0001  759 LYS A N   
1463 C CA  . LYS A 193 ? 0.4212 0.3546 0.3904 -0.0285 0.0519  0.0069  759 LYS A CA  
1464 C C   . LYS A 193 ? 0.4723 0.4056 0.4542 -0.0409 0.0378  0.0089  759 LYS A C   
1465 O O   . LYS A 193 ? 0.5213 0.4693 0.5206 -0.0278 0.0246  -0.0055 759 LYS A O   
1466 C CB  . LYS A 193 ? 0.4270 0.3254 0.3752 -0.0128 0.0242  -0.0064 759 LYS A CB  
1467 C CG  . LYS A 193 ? 0.6052 0.4427 0.5204 -0.0267 -0.0020 0.0055  759 LYS A CG  
1468 C CD  . LYS A 193 ? 0.8138 0.6197 0.7138 -0.0010 -0.0341 -0.0091 759 LYS A CD  
1469 C CE  . LYS A 193 ? 0.9861 0.7447 0.8838 0.0050  -0.0670 -0.0163 759 LYS A CE  
1470 N NZ  . LYS A 193 ? 1.1176 0.8593 1.0145 0.0409  -0.0977 -0.0394 759 LYS A NZ  
1471 N N   . VAL A 194 ? 0.5098 0.4316 0.4816 -0.0704 0.0425  0.0243  760 VAL A N   
1472 C CA  . VAL A 194 ? 0.4715 0.3964 0.4526 -0.0903 0.0321  0.0242  760 VAL A CA  
1473 C C   . VAL A 194 ? 0.5744 0.4261 0.5237 -0.0991 -0.0003 0.0210  760 VAL A C   
1474 O O   . VAL A 194 ? 0.6837 0.4795 0.5947 -0.1098 -0.0095 0.0334  760 VAL A O   
1475 C CB  . VAL A 194 ? 0.4896 0.4425 0.4747 -0.1235 0.0539  0.0386  760 VAL A CB  
1476 C CG1 . VAL A 194 ? 0.4650 0.4221 0.4550 -0.1526 0.0427  0.0357  760 VAL A CG1 
1477 C CG2 . VAL A 194 ? 0.5960 0.6189 0.6173 -0.1076 0.0843  0.0398  760 VAL A CG2 
1478 N N   . ILE A 195 ? 0.5613 0.4109 0.5242 -0.0940 -0.0183 0.0044  761 ILE A N   
1479 C CA  . ILE A 195 ? 0.6343 0.4074 0.5687 -0.1042 -0.0475 -0.0006 761 ILE A CA  
1480 C C   . ILE A 195 ? 0.6765 0.4460 0.6072 -0.1472 -0.0444 0.0040  761 ILE A C   
1481 O O   . ILE A 195 ? 0.6382 0.4573 0.5992 -0.1521 -0.0415 -0.0109 761 ILE A O   
1482 C CB  . ILE A 195 ? 0.6936 0.4624 0.6442 -0.0722 -0.0692 -0.0295 761 ILE A CB  
1483 C CG1 . ILE A 195 ? 0.6355 0.4228 0.5921 -0.0343 -0.0690 -0.0379 761 ILE A CG1 
1484 C CG2 . ILE A 195 ? 0.7430 0.4230 0.6655 -0.0782 -0.0998 -0.0378 761 ILE A CG2 
1485 C CD1 . ILE A 195 ? 0.6333 0.4373 0.6108 -0.0041 -0.0850 -0.0708 761 ILE A CD1 
1486 N N   . LYS A 196 ? 0.8315 0.5440 0.7212 -0.1818 -0.0455 0.0240  762 LYS A N   
1487 C CA  . LYS A 196 ? 0.9886 0.6932 0.8663 -0.2328 -0.0403 0.0284  762 LYS A CA  
1488 C C   . LYS A 196 ? 1.0542 0.6870 0.9138 -0.2419 -0.0669 0.0127  762 LYS A C   
1489 O O   . LYS A 196 ? 1.1405 0.6792 0.9643 -0.2268 -0.0926 0.0148  762 LYS A O   
1490 C CB  . LYS A 196 ? 1.0170 0.6805 0.8484 -0.2724 -0.0310 0.0554  762 LYS A CB  
1491 C CG  . LYS A 196 ? 1.0132 0.7627 0.8677 -0.2821 0.0033  0.0646  762 LYS A CG  
1492 C CD  . LYS A 196 ? 1.0860 0.9209 0.9784 -0.3113 0.0239  0.0547  762 LYS A CD  
1493 C CE  . LYS A 196 ? 1.0068 0.9320 0.9306 -0.3113 0.0575  0.0593  762 LYS A CE  
1494 N NZ  . LYS A 196 ? 0.9150 0.9355 0.8816 -0.3333 0.0751  0.0478  762 LYS A NZ  
1495 N N   . THR A 197 ? 1.0845 0.7620 0.9689 -0.2657 -0.0613 -0.0047 763 THR A N   
1496 C CA  . THR A 197 ? 1.2325 0.8479 1.1043 -0.2755 -0.0833 -0.0267 763 THR A CA  
1497 C C   . THR A 197 ? 1.3907 0.9527 1.2241 -0.3398 -0.0810 -0.0207 763 THR A C   
1498 O O   . THR A 197 ? 1.5176 0.9821 1.3062 -0.3409 -0.0945 -0.0095 763 THR A O   
1499 C CB  . THR A 197 ? 1.1234 0.8236 1.0465 -0.2584 -0.0819 -0.0574 763 THR A CB  
1500 O OG1 . THR A 197 ? 1.0747 0.8800 1.0294 -0.2859 -0.0580 -0.0547 763 THR A OG1 
1501 C CG2 . THR A 197 ? 1.0073 0.7480 0.9595 -0.2000 -0.0853 -0.0654 763 THR A CG2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   567 ?   ?   ?   A . n 
A 1 2   SER 2   568 ?   ?   ?   A . n 
A 1 3   VAL 3   569 ?   ?   ?   A . n 
A 1 4   ASP 4   570 ?   ?   ?   A . n 
A 1 5   ASP 5   571 ?   ?   ?   A . n 
A 1 6   SER 6   572 ?   ?   ?   A . n 
A 1 7   ALA 7   573 ?   ?   ?   A . n 
A 1 8   GLN 8   574 ?   ?   ?   A . n 
A 1 9   SER 9   575 575 SER SER A . n 
A 1 10  ASP 10  576 576 ASP ASP A . n 
A 1 11  LEU 11  577 577 LEU LEU A . n 
A 1 12  LYS 12  578 578 LYS LYS A . n 
A 1 13  GLU 13  579 579 GLU GLU A . n 
A 1 14  VAL 14  580 580 VAL VAL A . n 
A 1 15  MET 15  581 581 MET MET A . n 
A 1 16  VAL 16  582 582 VAL VAL A . n 
A 1 17  LEU 17  583 583 LEU LEU A . n 
A 1 18  ASN 18  584 584 ASN ASN A . n 
A 1 19  ALA 19  585 585 ALA ALA A . n 
A 1 20  THR 20  586 586 THR THR A . n 
A 1 21  GLU 21  587 587 GLU GLU A . n 
A 1 22  SER 22  588 588 SER SER A . n 
A 1 23  PHE 23  589 589 PHE PHE A . n 
A 1 24  VAL 24  590 590 VAL VAL A . n 
A 1 25  TYR 25  591 591 TYR TYR A . n 
A 1 26  GLU 26  592 592 GLU GLU A . n 
A 1 27  PRO 27  593 593 PRO PRO A . n 
A 1 28  LYS 28  594 594 LYS LYS A . n 
A 1 29  GLU 29  595 595 GLU GLU A . n 
A 1 30  GLN 30  596 596 GLN GLN A . n 
A 1 31  LYS 31  597 597 LYS LYS A . n 
A 1 32  LYS 32  598 598 LYS LYS A . n 
A 1 33  MET 33  599 599 MET MET A . n 
A 1 34  PHE 34  600 600 PHE PHE A . n 
A 1 35  HIS 35  601 601 HIS HIS A . n 
A 1 36  ALA 36  602 602 ALA ALA A . n 
A 1 37  THR 37  603 603 THR THR A . n 
A 1 38  VAL 38  604 604 VAL VAL A . n 
A 1 39  ALA 39  605 605 ALA ALA A . n 
A 1 40  THR 40  606 606 THR THR A . n 
A 1 41  GLU 41  607 607 GLU GLU A . n 
A 1 42  ASN 42  608 608 ASN ASN A . n 
A 1 43  GLU 43  609 609 GLU GLU A . n 
A 1 44  VAL 44  610 610 VAL VAL A . n 
A 1 45  PHE 45  611 611 PHE PHE A . n 
A 1 46  ARG 46  612 612 ARG ARG A . n 
A 1 47  VAL 47  613 613 VAL VAL A . n 
A 1 48  LYS 48  614 614 LYS LYS A . n 
A 1 49  VAL 49  615 615 VAL VAL A . n 
A 1 50  PHE 50  616 616 PHE PHE A . n 
A 1 51  ASN 51  617 617 ASN ASN A . n 
A 1 52  ILE 52  618 618 ILE ILE A . n 
A 1 53  ASP 53  619 619 ASP ASP A . n 
A 1 54  LEU 54  620 620 LEU LEU A . n 
A 1 55  LYS 55  621 621 LYS LYS A . n 
A 1 56  GLU 56  622 622 GLU GLU A . n 
A 1 57  LYS 57  623 623 LYS LYS A . n 
A 1 58  PHE 58  624 624 PHE PHE A . n 
A 1 59  THR 59  625 625 THR THR A . n 
A 1 60  PRO 60  626 626 PRO PRO A . n 
A 1 61  LYS 61  627 627 LYS LYS A . n 
A 1 62  LYS 62  628 628 LYS LYS A . n 
A 1 63  ILE 63  629 629 ILE ILE A . n 
A 1 64  ILE 64  630 630 ILE ILE A . n 
A 1 65  ALA 65  631 631 ALA ALA A . n 
A 1 66  ILE 66  632 632 ILE ILE A . n 
A 1 67  ALA 67  633 633 ALA ALA A . n 
A 1 68  ASN 68  634 634 ASN ASN A . n 
A 1 69  TYR 69  635 635 TYR TYR A . n 
A 1 70  VAL 70  636 636 VAL VAL A . n 
A 1 71  CYS 71  637 637 CYS CYS A . n 
A 1 72  ARG 72  638 638 ARG ARG A . n 
A 1 73  ASN 73  639 639 ASN ASN A . n 
A 1 74  GLY 74  640 640 GLY GLY A . n 
A 1 75  PHE 75  641 641 PHE PHE A . n 
A 1 76  LEU 76  642 642 LEU LEU A . n 
A 1 77  GLU 77  643 643 GLU GLU A . n 
A 1 78  VAL 78  644 644 VAL VAL A . n 
A 1 79  TYR 79  645 645 TYR TYR A . n 
A 1 80  PRO 80  646 646 PRO PRO A . n 
A 1 81  PHE 81  647 647 PHE PHE A . n 
A 1 82  THR 82  648 648 THR THR A . n 
A 1 83  LEU 83  649 649 LEU LEU A . n 
A 1 84  VAL 84  650 650 VAL VAL A . n 
A 1 85  ALA 85  651 651 ALA ALA A . n 
A 1 86  ASP 86  652 652 ASP ASP A . n 
A 1 87  VAL 87  653 653 VAL VAL A . n 
A 1 88  ASN 88  654 654 ASN ASN A . n 
A 1 89  ALA 89  655 655 ALA ALA A . n 
A 1 90  ASP 90  656 656 ASP ASP A . n 
A 1 91  ARG 91  657 657 ARG ARG A . n 
A 1 92  ASN 92  658 658 ASN ASN A . n 
A 1 93  MET 93  659 659 MET MET A . n 
A 1 94  GLU 94  660 660 GLU GLU A . n 
A 1 95  ILE 95  661 661 ILE ILE A . n 
A 1 96  PRO 96  662 662 PRO PRO A . n 
A 1 97  ALA 97  663 663 ALA ALA A . n 
A 1 98  GLY 98  664 664 GLY GLY A . n 
A 1 99  LEU 99  665 665 LEU LEU A . n 
A 1 100 ILE 100 666 666 ILE ILE A . n 
A 1 101 ALA 101 667 667 ALA ALA A . n 
A 1 102 SER 102 668 668 SER SER A . n 
A 1 103 ALA 103 669 669 ALA ALA A . n 
A 1 104 SER 104 670 670 SER SER A . n 
A 1 105 VAL 105 671 671 VAL VAL A . n 
A 1 106 THR 106 672 672 THR THR A . n 
A 1 107 PRO 107 673 673 PRO PRO A . n 
A 1 108 LYS 108 674 674 LYS LYS A . n 
A 1 109 ILE 109 675 675 ILE ILE A . n 
A 1 110 ASN 110 676 676 ASN ASN A . n 
A 1 111 GLN 111 677 677 GLN GLN A . n 
A 1 112 LEU 112 678 678 LEU LEU A . n 
A 1 113 CYS 113 679 679 CYS CYS A . n 
A 1 114 SER 114 680 680 SER SER A . n 
A 1 115 GLN 115 681 681 GLN GLN A . n 
A 1 116 THR 116 682 682 THR THR A . n 
A 1 117 LYS 117 683 683 LYS LYS A . n 
A 1 118 GLY 118 684 684 GLY GLY A . n 
A 1 119 SER 119 685 685 SER SER A . n 
A 1 120 PHE 120 686 686 PHE PHE A . n 
A 1 121 VAL 121 687 687 VAL VAL A . n 
A 1 122 ASN 122 688 688 ASN ASN A . n 
A 1 123 GLY 123 689 689 GLY GLY A . n 
A 1 124 VAL 124 690 690 VAL VAL A . n 
A 1 125 PHE 125 691 691 PHE PHE A . n 
A 1 126 GLU 126 692 692 GLU GLU A . n 
A 1 127 VAL 127 693 693 VAL VAL A . n 
A 1 128 HIS 128 694 694 HIS HIS A . n 
A 1 129 LYS 129 695 695 LYS LYS A . n 
A 1 130 LYS 130 696 696 LYS LYS A . n 
A 1 131 ASN 131 697 697 ASN ASN A . n 
A 1 132 VAL 132 698 698 VAL VAL A . n 
A 1 133 ARG 133 699 699 ARG ARG A . n 
A 1 134 GLY 134 700 700 GLY GLY A . n 
A 1 135 GLU 135 701 701 GLU GLU A . n 
A 1 136 PHE 136 702 702 PHE PHE A . n 
A 1 137 THR 137 703 703 THR THR A . n 
A 1 138 TYR 138 704 704 TYR TYR A . n 
A 1 139 TYR 139 705 705 TYR TYR A . n 
A 1 140 GLU 140 706 706 GLU GLU A . n 
A 1 141 ILE 141 707 707 ILE ILE A . n 
A 1 142 GLN 142 708 708 GLN GLN A . n 
A 1 143 ASP 143 709 709 ASP ASP A . n 
A 1 144 ALA 144 710 710 ALA ALA A . n 
A 1 145 THR 145 711 711 THR THR A . n 
A 1 146 GLY 146 712 712 GLY GLY A . n 
A 1 147 LYS 147 713 713 LYS LYS A . n 
A 1 148 MET 148 714 714 MET MET A . n 
A 1 149 GLU 149 715 715 GLU GLU A . n 
A 1 150 VAL 150 716 716 VAL VAL A . n 
A 1 151 VAL 151 717 717 VAL VAL A . n 
A 1 152 VAL 152 718 718 VAL VAL A . n 
A 1 153 HIS 153 719 719 HIS HIS A . n 
A 1 154 GLY 154 720 720 GLY GLY A . n 
A 1 155 ARG 155 721 721 ARG ARG A . n 
A 1 156 LEU 156 722 722 LEU LEU A . n 
A 1 157 THR 157 723 723 THR THR A . n 
A 1 158 THR 158 724 724 THR THR A . n 
A 1 159 ILE 159 725 725 ILE ILE A . n 
A 1 160 ASN 160 726 726 ASN ASN A . n 
A 1 161 CYS 161 727 727 CYS CYS A . n 
A 1 162 GLU 162 728 728 GLU GLU A . n 
A 1 163 GLU 163 729 729 GLU GLU A . n 
A 1 164 GLY 164 730 730 GLY GLY A . n 
A 1 165 ASP 165 731 731 ASP ASP A . n 
A 1 166 LYS 166 732 732 LYS LYS A . n 
A 1 167 LEU 167 733 733 LEU LEU A . n 
A 1 168 LYS 168 734 734 LYS LYS A . n 
A 1 169 LEU 169 735 735 LEU LEU A . n 
A 1 170 THR 170 736 736 THR THR A . n 
A 1 171 CYS 171 737 737 CYS CYS A . n 
A 1 172 PHE 172 738 738 PHE PHE A . n 
A 1 173 GLU 173 739 739 GLU GLU A . n 
A 1 174 LEU 174 740 740 LEU LEU A . n 
A 1 175 ALA 175 741 741 ALA ALA A . n 
A 1 176 PRO 176 742 742 PRO PRO A . n 
A 1 177 LYS 177 743 743 LYS LYS A . n 
A 1 178 SER 178 744 744 SER SER A . n 
A 1 179 GLY 179 745 745 GLY GLY A . n 
A 1 180 ASN 180 746 746 ASN ASN A . n 
A 1 181 THR 181 747 747 THR THR A . n 
A 1 182 GLY 182 748 748 GLY GLY A . n 
A 1 183 GLU 183 749 749 GLU GLU A . n 
A 1 184 LEU 184 750 750 LEU LEU A . n 
A 1 185 ARG 185 751 751 ARG ARG A . n 
A 1 186 SER 186 752 752 SER SER A . n 
A 1 187 VAL 187 753 753 VAL VAL A . n 
A 1 188 ILE 188 754 754 ILE ILE A . n 
A 1 189 HIS 189 755 755 HIS HIS A . n 
A 1 190 SER 190 756 756 SER SER A . n 
A 1 191 HIS 191 757 757 HIS HIS A . n 
A 1 192 ILE 192 758 758 ILE ILE A . n 
A 1 193 LYS 193 759 759 LYS LYS A . n 
A 1 194 VAL 194 760 760 VAL VAL A . n 
A 1 195 ILE 195 761 761 ILE ILE A . n 
A 1 196 LYS 196 762 762 LYS LYS A . n 
A 1 197 THR 197 763 763 THR THR A . n 
A 1 198 ARG 198 764 ?   ?   ?   A . n 
A 1 199 LYS 199 765 ?   ?   ?   A . n 
A 1 200 ASN 200 766 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 12 ? B HOH . 
2 1 A HOH 51 ? B HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-04-25 
2 'Structure model' 1 1 2012-05-09 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 5.1687  13.0220 21.0855 0.2736 0.1632 0.9979 0.1654  -0.0449 -0.3361 2.9388 4.0834 1.2162 -2.9292 
-0.9981 1.3793  -0.2243 -0.2732 0.3781  0.4816  0.0193  0.8756  0.1602  -0.0992 -0.0710 
'X-RAY DIFFRACTION' 2  ? refined 25.3866 7.0301  10.9586 0.3489 0.3496 0.2595 -0.0399 -0.0017 0.0257  2.8427 6.4905 4.0201 -1.7553 
-1.8983 2.4570  -0.3121 0.0533  0.4214  -0.4165 0.0938  0.3727  0.1975  0.4835  0.1435  
'X-RAY DIFFRACTION' 3  ? refined 13.5658 12.1458 19.1073 0.1637 0.3013 0.4587 -0.0211 -0.0621 -0.1658 6.7365 5.8573 5.6342 -1.6814 
-2.1320 1.1373  -0.2578 -0.6169 1.0228  0.1422  -0.1557 0.1366  0.1295  -0.3999 -0.0550 
'X-RAY DIFFRACTION' 4  ? refined 12.7640 11.2699 16.3833 0.1558 0.2640 0.3892 -0.0213 -0.0186 -0.0416 6.2243 6.9258 4.1833 -1.6550 
-0.8570 1.0779  -0.0495 -0.1904 1.1483  -0.3026 -0.0228 0.3682  0.1359  -0.2594 0.0521  
'X-RAY DIFFRACTION' 5  ? refined 5.7255  13.0962 16.4428 0.2239 0.2620 0.6039 -0.0241 -0.0821 -0.0531 3.1522 6.0019 2.6470 -0.4565 
-0.5821 -0.5186 0.0213  -0.1994 1.2962  -0.3397 -0.1593 0.7990  -0.2004 -0.1721 0.1289  
'X-RAY DIFFRACTION' 6  ? refined 14.5808 3.3098  24.1759 0.2451 0.5457 0.2661 0.0422  0.0553  0.0339  7.1535 6.3359 6.5978 2.7340  
2.7403  1.1571  0.0384  -1.5022 -0.2687 0.7405  0.3636  0.3313  0.5522  -0.0028 0.0600  
'X-RAY DIFFRACTION' 7  ? refined 9.5859  3.0528  14.1190 0.2106 0.2110 0.2464 -0.0489 -0.0041 0.0475  5.5281 6.8566 5.5267 0.4211  
-0.2456 1.6244  0.0977  0.0761  -0.1066 -0.2547 -0.1469 0.4518  0.4122  -0.2661 0.1345  
'X-RAY DIFFRACTION' 8  ? refined -2.9180 17.1727 13.1205 0.5664 0.8129 1.3476 0.3723  -0.1616 -0.1000 0.2029 1.2175 2.6696 -0.1462 
0.4180  -1.7208 0.2220  -0.6198 1.9918  -0.0455 -0.6441 1.4152  -1.6359 -1.8028 0.5616  
'X-RAY DIFFRACTION' 9  ? refined -1.4214 21.8938 22.2654 0.6091 1.1406 1.8399 0.2290  -0.1144 -0.7151 7.0232 6.5586 4.5368 -5.3594 
-1.0004 0.2010  0.3685  0.6897  -0.4350 -0.4138 -0.3921 1.1490  -0.1683 -0.6101 0.4507  
'X-RAY DIFFRACTION' 10 ? refined 11.0458 22.9660 28.8595 0.3866 0.7116 1.1291 0.0718  -0.0672 -0.4323 0.6009 1.2015 3.1351 -0.8109 
1.2432  -1.9255 0.1149  0.0161  1.0293  -0.3554 -0.7272 0.8655  -0.1707 -0.1881 0.6194  
'X-RAY DIFFRACTION' 11 ? refined 26.3276 15.6148 37.3835 0.4256 0.7954 0.3299 0.0107  0.0344  -0.0178 5.2258 4.3675 7.0068 0.3552  
-1.0541 -0.7000 -0.2269 -1.7800 0.2164  1.1448  0.2728  0.3385  0.2399  -0.2827 -0.3142 
'X-RAY DIFFRACTION' 12 ? refined 22.9105 8.9556  31.2144 0.3910 0.7313 0.2947 -0.0587 -0.0420 0.1565  4.2398 2.4088 7.8667 -0.4603 
0.8629  -0.7224 -0.1969 -1.2064 -0.3060 0.4752  0.6058  0.6385  0.5475  -0.9214 -0.3672 
'X-RAY DIFFRACTION' 13 ? refined 34.3102 22.0202 28.5566 0.2656 0.4972 0.4068 -0.0412 0.0310  -0.1985 5.6888 5.0020 2.6566 -1.4231 
-1.7817 -2.0910 0.3557  -1.4113 1.2532  0.1473  0.1580  -0.2471 -0.5837 0.6431  -0.2960 
'X-RAY DIFFRACTION' 14 ? refined 44.0428 11.3255 23.0687 0.2431 0.4721 0.3214 0.1207  -0.0043 -0.0545 2.2738 3.6110 3.2142 -1.4371 
-1.7452 0.2030  0.1602  -0.6023 0.2491  0.0188  0.0845  -0.8590 0.5207  1.0112  -0.0939 
'X-RAY DIFFRACTION' 15 ? refined 39.5776 12.7716 25.9665 0.2411 0.4849 0.3209 0.0295  -0.0779 -0.0199 5.0954 5.0592 2.2971 -1.9552 
-2.7801 0.5534  -0.0048 -0.8556 0.4036  0.2347  -0.0679 -0.0741 0.6177  0.3769  -0.0562 
'X-RAY DIFFRACTION' 16 ? refined 34.5191 16.6192 31.5553 0.2893 0.6344 0.3042 0.0664  -0.0401 -0.1440 4.7999 5.0580 3.1205 -2.5629 
-3.4394 2.9896  -0.0730 -1.1160 0.8509  0.2427  0.4201  -0.3527 0.1733  0.0721  -0.1428 
'X-RAY DIFFRACTION' 17 ? refined 35.0631 11.5196 15.8279 0.2602 0.4354 0.2596 -0.0525 -0.0183 -0.0273 8.6349 3.6355 4.0449 -2.9031 
-5.3690 0.4360  0.1932  0.6050  0.1638  -0.0535 -0.1133 0.2524  0.4514  -0.3337 -0.2444 
'X-RAY DIFFRACTION' 18 ? refined 32.1051 15.3623 26.6790 0.1545 0.3919 0.2649 0.0001  0.0272  -0.0075 3.7148 7.1432 6.5501 0.1694  
2.1971  -0.0235 -0.1113 -0.7996 0.2782  0.1975  -0.0452 -0.2006 -0.0620 0.3500  0.0794  
'X-RAY DIFFRACTION' 19 ? refined 30.0826 9.0909  26.5146 0.2190 0.4358 0.2446 0.0300  0.0135  0.1068  2.8987 6.9351 7.6524 0.3314  
1.9565  1.0161  0.0695  -0.7172 -0.4246 0.4634  0.3764  -0.0269 0.5922  0.2807  -0.1822 
'X-RAY DIFFRACTION' 20 ? refined 31.9081 25.9044 19.0752 0.5892 0.3600 0.5133 -0.1598 -0.0372 0.0130  4.9177 2.2916 7.2346 1.8744  
-0.3236 2.2183  -0.5617 -0.1308 0.9501  -0.7559 0.1314  -0.2026 -1.5876 0.8251  0.3417  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  ? ? ? ? ? ? ? ? ? '(chain A and resid 575:584)' 
'X-RAY DIFFRACTION' 2  2  ? ? ? ? ? ? ? ? ? '(chain A and resid 585:596)' 
'X-RAY DIFFRACTION' 3  3  ? ? ? ? ? ? ? ? ? '(chain A and resid 597:608)' 
'X-RAY DIFFRACTION' 4  4  ? ? ? ? ? ? ? ? ? '(chain A and resid 609:624)' 
'X-RAY DIFFRACTION' 5  5  ? ? ? ? ? ? ? ? ? '(chain A and resid 625:635)' 
'X-RAY DIFFRACTION' 6  6  ? ? ? ? ? ? ? ? ? '(chain A and resid 636:642)' 
'X-RAY DIFFRACTION' 7  7  ? ? ? ? ? ? ? ? ? '(chain A and resid 643:650)' 
'X-RAY DIFFRACTION' 8  8  ? ? ? ? ? ? ? ? ? '(chain A and resid 651:656)' 
'X-RAY DIFFRACTION' 9  9  ? ? ? ? ? ? ? ? ? '(chain A and resid 657:661)' 
'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? '(chain A and resid 662:670)' 
'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? '(chain A and resid 671:682)' 
'X-RAY DIFFRACTION' 12 12 ? ? ? ? ? ? ? ? ? '(chain A and resid 683:688)' 
'X-RAY DIFFRACTION' 13 13 ? ? ? ? ? ? ? ? ? '(chain A and resid 689:695)' 
'X-RAY DIFFRACTION' 14 14 ? ? ? ? ? ? ? ? ? '(chain A and resid 696:701)' 
'X-RAY DIFFRACTION' 15 15 ? ? ? ? ? ? ? ? ? '(chain A and resid 702:706)' 
'X-RAY DIFFRACTION' 16 16 ? ? ? ? ? ? ? ? ? '(chain A and resid 707:719)' 
'X-RAY DIFFRACTION' 17 17 ? ? ? ? ? ? ? ? ? '(chain A and resid 720:725)' 
'X-RAY DIFFRACTION' 18 18 ? ? ? ? ? ? ? ? ? '(chain A and resid 726:745)' 
'X-RAY DIFFRACTION' 19 19 ? ? ? ? ? ? ? ? ? '(chain A and resid 746:758)' 
'X-RAY DIFFRACTION' 20 20 ? ? ? ? ? ? ? ? ? '(chain A and resid 759:764)' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                          ? 1 
PHASER   phasing           .                          ? 2 
PHENIX   refinement        '(phenix.refine: dev_723)' ? 3 
HKL-2000 'data reduction'  .                          ? 4 
HKL-2000 'data scaling'    .                          ? 5 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    LYS 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     627 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             77.01 
_pdbx_validate_torsion.psi             -15.81 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 567 ? A GLY 1   
2  1 Y 1 A SER 568 ? A SER 2   
3  1 Y 1 A VAL 569 ? A VAL 3   
4  1 Y 1 A ASP 570 ? A ASP 4   
5  1 Y 1 A ASP 571 ? A ASP 5   
6  1 Y 1 A SER 572 ? A SER 6   
7  1 Y 1 A ALA 573 ? A ALA 7   
8  1 Y 1 A GLN 574 ? A GLN 8   
9  1 Y 1 A ARG 764 ? A ARG 198 
10 1 Y 1 A LYS 765 ? A LYS 199 
11 1 Y 1 A ASN 766 ? A ASN 200 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  1  1  HOH HOH A . 
B 2 HOH 2  2  2  HOH HOH A . 
B 2 HOH 3  3  3  HOH HOH A . 
B 2 HOH 4  4  4  HOH HOH A . 
B 2 HOH 5  5  5  HOH HOH A . 
B 2 HOH 6  6  6  HOH HOH A . 
B 2 HOH 7  7  7  HOH HOH A . 
B 2 HOH 8  8  8  HOH HOH A . 
B 2 HOH 9  9  9  HOH HOH A . 
B 2 HOH 10 10 10 HOH HOH A . 
B 2 HOH 11 11 11 HOH HOH A . 
B 2 HOH 12 12 12 HOH HOH A . 
B 2 HOH 13 13 13 HOH HOH A . 
B 2 HOH 14 14 14 HOH HOH A . 
B 2 HOH 15 15 15 HOH HOH A . 
B 2 HOH 16 16 16 HOH HOH A . 
B 2 HOH 17 17 17 HOH HOH A . 
B 2 HOH 18 18 18 HOH HOH A . 
B 2 HOH 19 19 19 HOH HOH A . 
B 2 HOH 20 20 20 HOH HOH A . 
B 2 HOH 21 21 21 HOH HOH A . 
B 2 HOH 22 22 22 HOH HOH A . 
B 2 HOH 23 23 23 HOH HOH A . 
B 2 HOH 24 24 24 HOH HOH A . 
B 2 HOH 25 25 25 HOH HOH A . 
B 2 HOH 26 26 26 HOH HOH A . 
B 2 HOH 27 27 27 HOH HOH A . 
B 2 HOH 28 28 28 HOH HOH A . 
B 2 HOH 29 29 29 HOH HOH A . 
B 2 HOH 30 30 30 HOH HOH A . 
B 2 HOH 31 31 31 HOH HOH A . 
B 2 HOH 32 32 32 HOH HOH A . 
B 2 HOH 33 33 33 HOH HOH A . 
B 2 HOH 34 34 34 HOH HOH A . 
B 2 HOH 35 35 35 HOH HOH A . 
B 2 HOH 36 36 36 HOH HOH A . 
B 2 HOH 37 37 37 HOH HOH A . 
B 2 HOH 38 38 38 HOH HOH A . 
B 2 HOH 39 39 39 HOH HOH A . 
B 2 HOH 40 40 40 HOH HOH A . 
B 2 HOH 41 41 41 HOH HOH A . 
B 2 HOH 42 42 42 HOH HOH A . 
B 2 HOH 43 43 43 HOH HOH A . 
B 2 HOH 44 44 44 HOH HOH A . 
B 2 HOH 45 45 45 HOH HOH A . 
B 2 HOH 46 46 46 HOH HOH A . 
B 2 HOH 47 47 47 HOH HOH A . 
B 2 HOH 48 48 48 HOH HOH A . 
B 2 HOH 49 49 49 HOH HOH A . 
B 2 HOH 50 50 50 HOH HOH A . 
B 2 HOH 51 51 51 HOH HOH A . 
B 2 HOH 52 52 52 HOH HOH A . 
B 2 HOH 53 53 53 HOH HOH A . 
B 2 HOH 54 54 54 HOH HOH A . 
B 2 HOH 55 55 55 HOH HOH A . 
B 2 HOH 56 56 56 HOH HOH A . 
B 2 HOH 57 57 57 HOH HOH A . 
B 2 HOH 58 58 58 HOH HOH A . 
B 2 HOH 59 59 59 HOH HOH A . 
B 2 HOH 60 60 60 HOH HOH A . 
B 2 HOH 61 61 61 HOH HOH A . 
B 2 HOH 62 62 62 HOH HOH A . 
B 2 HOH 63 63 63 HOH HOH A . 
B 2 HOH 64 64 64 HOH HOH A . 
B 2 HOH 65 65 65 HOH HOH A . 
B 2 HOH 66 66 66 HOH HOH A . 
B 2 HOH 67 67 67 HOH HOH A . 
B 2 HOH 68 68 68 HOH HOH A . 
B 2 HOH 69 69 69 HOH HOH A . 
B 2 HOH 70 70 70 HOH HOH A . 
B 2 HOH 71 71 71 HOH HOH A . 
B 2 HOH 72 72 72 HOH HOH A . 
B 2 HOH 73 73 73 HOH HOH A . 
B 2 HOH 74 74 74 HOH HOH A . 
B 2 HOH 75 75 75 HOH HOH A . 
B 2 HOH 76 76 76 HOH HOH A . 
B 2 HOH 77 77 77 HOH HOH A . 
B 2 HOH 78 78 78 HOH HOH A . 
B 2 HOH 79 79 79 HOH HOH A . 
B 2 HOH 80 80 80 HOH HOH A . 
B 2 HOH 81 81 81 HOH HOH A . 
B 2 HOH 82 82 82 HOH HOH A . 
B 2 HOH 83 83 83 HOH HOH A . 
B 2 HOH 84 84 84 HOH HOH A . 
B 2 HOH 85 85 85 HOH HOH A . 
B 2 HOH 86 86 86 HOH HOH A . 
#