data_3RQ5
# 
_entry.id   3RQ5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.357 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3RQ5         pdb_00003rq5 10.2210/pdb3rq5/pdb 
RCSB  RCSB065240   ?            ?                   
WWPDB D_1000065240 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
TargetDB APC102301 . unspecified 
PDB      1KYH      Apo-protein unspecified 
PDB      3RPZ      
;Crystal Structure of ADP/ATP-dependent NAD(P)H-hydrate dehydratase from Bacillus subtilis co-crystallized with ATP/Mg2+ and soaked with NADPH
;
unspecified 
PDB      3RQ6      
'Crystal Structure of ADP/ATP-dependent NAD(P)H-hydrate dehydratase from Bacillus subtilis soaked with ADP-ribose' unspecified 
PDB      3RQ8      
;Crystal Structure of ADP/ATP-dependent NAD(P)H-hydrate dehydratase from Bacillus subtilis soaked with P1,P5-Di(adenosine-5') pentaphosphate
;
unspecified 
PDB      3RQH      
;Crystal Structure of ADP/ATP-dependent NAD(P)H-hydrate dehydratase from Bacillus subtilis in complex with P1,P6-Di(adenosine-5') hexaphosphate
;
unspecified 
PDB      3RQQ      
;Crystal Structure of ADP/ATP-dependent NAD(P)H-hydrate dehydratase from Bacillus subtilis in complex with P1,P3-Di(adenosine-5') triphosphate
;
unspecified 
PDB      3RQX      
;Crystal Structure of ADP/ATP-dependent NAD(P)H-hydrate dehydratase from Bacillus subtilis in complex with P1,P4-Di(adenosine-5') tetraphosphate
;
unspecified 
# 
_pdbx_database_status.entry_id                        3RQ5 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-04-27 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Shumilin, I.A.'                                1 ?                   
'Cymborowski, M.'                               2 ?                   
'Joachimiak, A.'                                3 ?                   
'Minor, W.'                                     4 0000-0001-7075-7090 
'Midwest Center for Structural Genomics (MCSG)' 5 ?                   
# 
_citation.id                        primary 
_citation.title                     'Identification of unknown protein function using metabolite cocktail screening.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            20 
_citation.page_first                1715 
_citation.page_last                 1725 
_citation.year                      2012 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22940582 
_citation.pdbx_database_id_DOI      10.1016/j.str.2012.07.016 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shumilin, I.A.'  1 ?                   
primary 'Cymborowski, M.' 2 ?                   
primary 'Chertihin, O.'   3 ?                   
primary 'Jha, K.N.'       4 ?                   
primary 'Herr, J.C.'      5 ?                   
primary 'Lesley, S.A.'    6 ?                   
primary 'Joachimiak, A.'  7 ?                   
primary 'Minor, W.'       8 0000-0001-7075-7090 
# 
_cell.entry_id           3RQ5 
_cell.length_a           91.765 
_cell.length_b           91.765 
_cell.length_c           169.498 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3RQ5 
_symmetry.space_group_name_H-M             'I 4 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                97 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ADP/ATP-dependent NAD(P)H-hydrate dehydratase' 30176.439 1   4.2.1.93 ? ? ? 
2 non-polymer syn 'COENZYME A'                                    767.534   1   ?        ? ? ? 
3 non-polymer syn GLYCEROL                                        92.094    2   ?        ? ? ? 
4 water       nat water                                           18.015    169 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SNAMNVPFWTEEHVRATLPERDAESHKGTYGTALLLAGSDDMPGAALLAGLGAMRSGLGKLVIGTSENVIPLIVPVLPEA
TYWRDGWKKAADAQLEETYRAIAIGPGLPQTESVQQAVDHVLTADCPVILDAGALAKRTYPKREGPVILTPHPGEFFRMT
GVPVNELQKKRAEYAKEWAAQLQTVIVLKGNQTVIAFPDGDCWLNPTGNGALAKGGTGDTLTGMILGMLCCHEDPKHAVL
NAVYLHGACAELWTDEHSAHTLLAHELSDILPRVWKRFE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SNAMNVPFWTEEHVRATLPERDAESHKGTYGTALLLAGSDDMPGAALLAGLGAMRSGLGKLVIGTSENVIPLIVPVLPEA
TYWRDGWKKAADAQLEETYRAIAIGPGLPQTESVQQAVDHVLTADCPVILDAGALAKRTYPKREGPVILTPHPGEFFRMT
GVPVNELQKKRAEYAKEWAAQLQTVIVLKGNQTVIAFPDGDCWLNPTGNGALAKGGTGDTLTGMILGMLCCHEDPKHAVL
NAVYLHGACAELWTDEHSAHTLLAHELSDILPRVWKRFE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         APC102301 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ALA n 
1 4   MET n 
1 5   ASN n 
1 6   VAL n 
1 7   PRO n 
1 8   PHE n 
1 9   TRP n 
1 10  THR n 
1 11  GLU n 
1 12  GLU n 
1 13  HIS n 
1 14  VAL n 
1 15  ARG n 
1 16  ALA n 
1 17  THR n 
1 18  LEU n 
1 19  PRO n 
1 20  GLU n 
1 21  ARG n 
1 22  ASP n 
1 23  ALA n 
1 24  GLU n 
1 25  SER n 
1 26  HIS n 
1 27  LYS n 
1 28  GLY n 
1 29  THR n 
1 30  TYR n 
1 31  GLY n 
1 32  THR n 
1 33  ALA n 
1 34  LEU n 
1 35  LEU n 
1 36  LEU n 
1 37  ALA n 
1 38  GLY n 
1 39  SER n 
1 40  ASP n 
1 41  ASP n 
1 42  MET n 
1 43  PRO n 
1 44  GLY n 
1 45  ALA n 
1 46  ALA n 
1 47  LEU n 
1 48  LEU n 
1 49  ALA n 
1 50  GLY n 
1 51  LEU n 
1 52  GLY n 
1 53  ALA n 
1 54  MET n 
1 55  ARG n 
1 56  SER n 
1 57  GLY n 
1 58  LEU n 
1 59  GLY n 
1 60  LYS n 
1 61  LEU n 
1 62  VAL n 
1 63  ILE n 
1 64  GLY n 
1 65  THR n 
1 66  SER n 
1 67  GLU n 
1 68  ASN n 
1 69  VAL n 
1 70  ILE n 
1 71  PRO n 
1 72  LEU n 
1 73  ILE n 
1 74  VAL n 
1 75  PRO n 
1 76  VAL n 
1 77  LEU n 
1 78  PRO n 
1 79  GLU n 
1 80  ALA n 
1 81  THR n 
1 82  TYR n 
1 83  TRP n 
1 84  ARG n 
1 85  ASP n 
1 86  GLY n 
1 87  TRP n 
1 88  LYS n 
1 89  LYS n 
1 90  ALA n 
1 91  ALA n 
1 92  ASP n 
1 93  ALA n 
1 94  GLN n 
1 95  LEU n 
1 96  GLU n 
1 97  GLU n 
1 98  THR n 
1 99  TYR n 
1 100 ARG n 
1 101 ALA n 
1 102 ILE n 
1 103 ALA n 
1 104 ILE n 
1 105 GLY n 
1 106 PRO n 
1 107 GLY n 
1 108 LEU n 
1 109 PRO n 
1 110 GLN n 
1 111 THR n 
1 112 GLU n 
1 113 SER n 
1 114 VAL n 
1 115 GLN n 
1 116 GLN n 
1 117 ALA n 
1 118 VAL n 
1 119 ASP n 
1 120 HIS n 
1 121 VAL n 
1 122 LEU n 
1 123 THR n 
1 124 ALA n 
1 125 ASP n 
1 126 CYS n 
1 127 PRO n 
1 128 VAL n 
1 129 ILE n 
1 130 LEU n 
1 131 ASP n 
1 132 ALA n 
1 133 GLY n 
1 134 ALA n 
1 135 LEU n 
1 136 ALA n 
1 137 LYS n 
1 138 ARG n 
1 139 THR n 
1 140 TYR n 
1 141 PRO n 
1 142 LYS n 
1 143 ARG n 
1 144 GLU n 
1 145 GLY n 
1 146 PRO n 
1 147 VAL n 
1 148 ILE n 
1 149 LEU n 
1 150 THR n 
1 151 PRO n 
1 152 HIS n 
1 153 PRO n 
1 154 GLY n 
1 155 GLU n 
1 156 PHE n 
1 157 PHE n 
1 158 ARG n 
1 159 MET n 
1 160 THR n 
1 161 GLY n 
1 162 VAL n 
1 163 PRO n 
1 164 VAL n 
1 165 ASN n 
1 166 GLU n 
1 167 LEU n 
1 168 GLN n 
1 169 LYS n 
1 170 LYS n 
1 171 ARG n 
1 172 ALA n 
1 173 GLU n 
1 174 TYR n 
1 175 ALA n 
1 176 LYS n 
1 177 GLU n 
1 178 TRP n 
1 179 ALA n 
1 180 ALA n 
1 181 GLN n 
1 182 LEU n 
1 183 GLN n 
1 184 THR n 
1 185 VAL n 
1 186 ILE n 
1 187 VAL n 
1 188 LEU n 
1 189 LYS n 
1 190 GLY n 
1 191 ASN n 
1 192 GLN n 
1 193 THR n 
1 194 VAL n 
1 195 ILE n 
1 196 ALA n 
1 197 PHE n 
1 198 PRO n 
1 199 ASP n 
1 200 GLY n 
1 201 ASP n 
1 202 CYS n 
1 203 TRP n 
1 204 LEU n 
1 205 ASN n 
1 206 PRO n 
1 207 THR n 
1 208 GLY n 
1 209 ASN n 
1 210 GLY n 
1 211 ALA n 
1 212 LEU n 
1 213 ALA n 
1 214 LYS n 
1 215 GLY n 
1 216 GLY n 
1 217 THR n 
1 218 GLY n 
1 219 ASP n 
1 220 THR n 
1 221 LEU n 
1 222 THR n 
1 223 GLY n 
1 224 MET n 
1 225 ILE n 
1 226 LEU n 
1 227 GLY n 
1 228 MET n 
1 229 LEU n 
1 230 CYS n 
1 231 CYS n 
1 232 HIS n 
1 233 GLU n 
1 234 ASP n 
1 235 PRO n 
1 236 LYS n 
1 237 HIS n 
1 238 ALA n 
1 239 VAL n 
1 240 LEU n 
1 241 ASN n 
1 242 ALA n 
1 243 VAL n 
1 244 TYR n 
1 245 LEU n 
1 246 HIS n 
1 247 GLY n 
1 248 ALA n 
1 249 CYS n 
1 250 ALA n 
1 251 GLU n 
1 252 LEU n 
1 253 TRP n 
1 254 THR n 
1 255 ASP n 
1 256 GLU n 
1 257 HIS n 
1 258 SER n 
1 259 ALA n 
1 260 HIS n 
1 261 THR n 
1 262 LEU n 
1 263 LEU n 
1 264 ALA n 
1 265 HIS n 
1 266 GLU n 
1 267 LEU n 
1 268 SER n 
1 269 ASP n 
1 270 ILE n 
1 271 LEU n 
1 272 PRO n 
1 273 ARG n 
1 274 VAL n 
1 275 TRP n 
1 276 LYS n 
1 277 ARG n 
1 278 PHE n 
1 279 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'BSU38720, yxkO' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacillus subtilis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1423 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21-CodonPlus (DE3)-RIPL' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pMCSG19 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    YXKO_BACSU 
_struct_ref.pdbx_db_accession          P94368 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MNVPFWTEEHVRATLPERDAESHKGTYGTALLLAGSDDMPGAALLAGLGAMRSGLGKLVIGTSENVIPLIVPVLPEATYW
RDGWKKAADAQLEETYRAIAIGPGLPQTESVQQAVDHVLTADCPVILDAGALAKRTYPKREGPVILTPHPGEFFRMTGVP
VNELQKKRAEYAKEWAAQLQTVIVLKGNQTVIAFPDGDCWLNPTGNGALAKGGTGDTLTGMILGMLCCHEDPKHAVLNAV
YLHGACAELWTDEHSAHTLLAHELSDILPRVWKRFE
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3RQ5 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 279 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P94368 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  276 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       276 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3RQ5 SER A 1 ? UNP P94368 ? ? 'expression tag' -2 1 
1 3RQ5 ASN A 2 ? UNP P94368 ? ? 'expression tag' -1 2 
1 3RQ5 ALA A 3 ? UNP P94368 ? ? 'expression tag' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'          133.103 
COA non-polymer         . 'COENZYME A'    ?                               'C21 H36 N7 O16 P3 S' 767.534 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'        121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'          75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'            92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1'      156.162 
HOH non-polymer         . WATER           ?                               'H2 O'                18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'       149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'          115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'          105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'         117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3RQ5 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.96 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   58.39 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
;0.005 M ATP, 0.18 M Magnesium Cloride, 13.5%(v/v) PEG 400, 10%(v/v) Glycerol, 0.09 M HEPES pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210r' 
_diffrn_detector.details                MIRRORS 
_diffrn_detector.pdbx_collection_date   2009-10-16 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
# 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            1.70 
_reflns.number_obs                   40558 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.056 
_reflns.pdbx_Rsym_value              0.056 
_reflns.pdbx_netI_over_sigmaI        38.846 
_reflns.pdbx_redundancy              9.5 
_reflns.entry_id                     3RQ5 
_reflns.B_iso_Wilson_estimate        22.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.73 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.610 
_reflns_shell.pdbx_Rsym_value        0.610 
_reflns_shell.meanI_over_sigI_obs    2.488 
_reflns_shell.pdbx_redundancy        8.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3RQ5 
_refine.ls_d_res_high                            1.700 
_refine.ls_d_res_low                             50.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.950 
_refine.ls_number_reflns_obs                     40127 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS  
 U VALUES      : RESIDUAL ONLY
;
_refine.ls_R_factor_obs                          0.154 
_refine.ls_R_factor_R_work                       0.153 
_refine.ls_R_factor_R_free                       0.178 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  2007 
_refine.B_iso_mean                               27.387 
_refine.aniso_B[1][1]                            -1.100 
_refine.aniso_B[2][2]                            -1.100 
_refine.aniso_B[3][3]                            2.190 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.971 
_refine.correlation_coeff_Fo_to_Fc_free          0.963 
_refine.pdbx_overall_ESU_R_Free                  0.075 
_refine.overall_SU_ML                            0.044 
_refine.overall_SU_B                             2.719 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.B_iso_max                                64.42 
_refine.B_iso_min                                15.87 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1KYH' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2059 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         43 
_refine_hist.number_atoms_solvent             169 
_refine_hist.number_atoms_total               2271 
_refine_hist.d_res_high                       1.700 
_refine_hist.d_res_low                        50.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       2152 0.016  0.022  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d         1414 0.000  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    2940 1.571  1.988  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      3467 4.183  3.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 268  6.250  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 85   33.369 24.235 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 335  10.687 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 11   18.223 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         331  0.094  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   2357 0.008  0.021  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     396  0.011  0.020  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            1342 0.890  1.500  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_other         546  0.000  1.500  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           2154 1.620  2.000  ? ? 'X-RAY DIFFRACTION' 
r_scbond_it            810  2.658  3.000  ? ? 'X-RAY DIFFRACTION' 
r_scangle_it           786  4.333  4.500  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       1.700 
_refine_ls_shell.d_res_low                        1.744 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               100.000 
_refine_ls_shell.number_reflns_R_work             2749 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.189 
_refine_ls_shell.R_factor_R_free                  0.227 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             146 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2895 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3RQ5 
_struct.title                     
;Crystal Structure of ADP/ATP-dependent NAD(P)H-hydrate dehydratase from Bacillus subtilis co-crystallized with ATP/Mg2+ and soaked with CoA
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3RQ5 
_struct_keywords.pdbx_keywords   'lyase/lyase substrate' 
_struct_keywords.text            
;STRUCTURAL GENOMICS, PSI-BIOLOGY, PROTEIN STRUCTURE INITIATIVE, MIDWEST CENTER FOR STRUCTURAL GENOMICS, MCSG, LYASE, lyase-lyase substrate complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 10  ? LEU A 18  ? THR A 7   LEU A 15  1 ? 9  
HELX_P HELX_P2  2  PRO A 43  ? ARG A 55  ? PRO A 40  ARG A 52  1 ? 13 
HELX_P HELX_P3  3  VAL A 69  ? VAL A 74  ? VAL A 66  VAL A 71  1 ? 6  
HELX_P HELX_P4  4  ASP A 85  ? ALA A 90  ? ASP A 82  ALA A 87  1 ? 6  
HELX_P HELX_P5  5  THR A 111 ? LEU A 122 ? THR A 108 LEU A 119 1 ? 12 
HELX_P HELX_P6  6  ALA A 132 ? LEU A 135 ? ALA A 129 LEU A 132 5 ? 4  
HELX_P HELX_P7  7  HIS A 152 ? GLY A 161 ? HIS A 149 GLY A 158 1 ? 10 
HELX_P HELX_P8  8  PRO A 163 ? GLN A 168 ? PRO A 160 GLN A 165 1 ? 6  
HELX_P HELX_P9  9  LYS A 170 ? GLN A 183 ? LYS A 167 GLN A 180 1 ? 14 
HELX_P HELX_P10 10 ASN A 209 ? ALA A 213 ? ASN A 206 ALA A 210 5 ? 5  
HELX_P HELX_P11 11 GLY A 216 ? HIS A 232 ? GLY A 213 HIS A 229 1 ? 17 
HELX_P HELX_P12 12 ASP A 234 ? THR A 254 ? ASP A 231 THR A 251 1 ? 21 
HELX_P HELX_P13 13 SER A 258 ? LEU A 263 ? SER A 255 LEU A 260 5 ? 6  
HELX_P HELX_P14 14 ALA A 264 ? PHE A 278 ? ALA A 261 PHE A 275 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   9 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 81  ? TYR A 82  ? THR A 78  TYR A 79  
A 2 LYS A 60  ? GLY A 64  ? LYS A 57  GLY A 61  
A 3 THR A 32  ? LEU A 36  ? THR A 29  LEU A 33  
A 4 ALA A 101 ? ILE A 104 ? ALA A 98  ILE A 101 
A 5 VAL A 128 ? LEU A 130 ? VAL A 125 LEU A 127 
A 6 VAL A 147 ? LEU A 149 ? VAL A 144 LEU A 146 
A 7 VAL A 185 ? LEU A 188 ? VAL A 182 LEU A 185 
A 8 VAL A 194 ? ALA A 196 ? VAL A 191 ALA A 193 
A 9 CYS A 202 ? LEU A 204 ? CYS A 199 LEU A 201 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 81  ? O THR A 78  N ILE A 63  ? N ILE A 60  
A 2 3 O GLY A 64  ? O GLY A 61  N LEU A 35  ? N LEU A 32  
A 3 4 N LEU A 36  ? N LEU A 33  O ALA A 103 ? O ALA A 100 
A 4 5 N ILE A 104 ? N ILE A 101 O ILE A 129 ? O ILE A 126 
A 5 6 N VAL A 128 ? N VAL A 125 O ILE A 148 ? O ILE A 145 
A 6 7 N LEU A 149 ? N LEU A 146 O VAL A 187 ? O VAL A 184 
A 7 8 N ILE A 186 ? N ILE A 183 O ALA A 196 ? O ALA A 193 
A 8 9 N ILE A 195 ? N ILE A 192 O TRP A 203 ? O TRP A 200 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A COA 277 ? 19 'BINDING SITE FOR RESIDUE COA A 277' 
AC2 Software A GOL 278 ? 6  'BINDING SITE FOR RESIDUE GOL A 278' 
AC3 Software A GOL 279 ? 5  'BINDING SITE FOR RESIDUE GOL A 279' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 19 TYR A 30  ? TYR A 27  . ? 3_455 ? 
2  AC1 19 THR A 32  ? THR A 29  . ? 3_455 ? 
3  AC1 19 GLY A 59  ? GLY A 56  . ? 3_455 ? 
4  AC1 19 LYS A 60  ? LYS A 57  . ? 3_455 ? 
5  AC1 19 HIS A 152 ? HIS A 149 . ? 1_555 ? 
6  AC1 19 ALA A 213 ? ALA A 210 . ? 1_555 ? 
7  AC1 19 GLY A 215 ? GLY A 212 . ? 1_555 ? 
8  AC1 19 GLY A 216 ? GLY A 213 . ? 1_555 ? 
9  AC1 19 THR A 217 ? THR A 214 . ? 1_555 ? 
10 AC1 19 GLY A 218 ? GLY A 215 . ? 1_555 ? 
11 AC1 19 ASP A 219 ? ASP A 216 . ? 1_555 ? 
12 AC1 19 HOH E .   ? HOH A 308 . ? 1_555 ? 
13 AC1 19 HOH E .   ? HOH A 324 . ? 1_555 ? 
14 AC1 19 HOH E .   ? HOH A 352 . ? 1_555 ? 
15 AC1 19 HOH E .   ? HOH A 364 . ? 1_555 ? 
16 AC1 19 HOH E .   ? HOH A 366 . ? 1_555 ? 
17 AC1 19 HOH E .   ? HOH A 427 . ? 3_455 ? 
18 AC1 19 HOH E .   ? HOH A 428 . ? 3_455 ? 
19 AC1 19 HOH E .   ? HOH A 429 . ? 1_555 ? 
20 AC2 6  ASP A 40  ? ASP A 37  . ? 1_555 ? 
21 AC2 6  PRO A 43  ? PRO A 40  . ? 1_555 ? 
22 AC2 6  PRO A 71  ? PRO A 68  . ? 3_455 ? 
23 AC2 6  ARG A 84  ? ARG A 81  . ? 3_455 ? 
24 AC2 6  HOH E .   ? HOH A 325 . ? 1_555 ? 
25 AC2 6  HOH E .   ? HOH A 390 . ? 3_455 ? 
26 AC3 5  TRP A 83  ? TRP A 80  . ? 1_555 ? 
27 AC3 5  LEU A 95  ? LEU A 92  . ? 1_555 ? 
28 AC3 5  GLU A 96  ? GLU A 93  . ? 1_555 ? 
29 AC3 5  GLU A 97  ? GLU A 94  . ? 1_555 ? 
30 AC3 5  TYR A 99  ? TYR A 96  . ? 1_555 ? 
# 
_atom_sites.entry_id                    3RQ5 
_atom_sites.fract_transf_matrix[1][1]   0.010897 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010897 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005900 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 4   ? -57.963 -3.423  -36.581 1.00 46.11 ? 1   MET A N   1 
ATOM   2    C CA  . MET A 1 4   ? -56.712 -2.644  -36.382 1.00 45.40 ? 1   MET A CA  1 
ATOM   3    C C   . MET A 1 4   ? -55.651 -3.023  -37.450 1.00 42.07 ? 1   MET A C   1 
ATOM   4    O O   . MET A 1 4   ? -54.478 -2.577  -37.391 1.00 43.67 ? 1   MET A O   1 
ATOM   5    C CB  . MET A 1 4   ? -56.165 -2.948  -34.986 1.00 47.60 ? 1   MET A CB  1 
ATOM   6    C CG  . MET A 1 4   ? -55.621 -1.761  -34.245 1.00 52.03 ? 1   MET A CG  1 
ATOM   7    S SD  . MET A 1 4   ? -55.336 -2.215  -32.534 1.00 61.67 ? 1   MET A SD  1 
ATOM   8    C CE  . MET A 1 4   ? -54.561 -0.718  -31.900 1.00 64.42 ? 1   MET A CE  1 
ATOM   9    N N   . ASN A 1 5   ? -56.028 -3.884  -38.389 1.00 37.83 ? 2   ASN A N   1 
ATOM   10   C CA  . ASN A 1 5   ? -55.076 -4.380  -39.384 1.00 33.50 ? 2   ASN A CA  1 
ATOM   11   C C   . ASN A 1 5   ? -53.789 -4.940  -38.775 1.00 31.71 ? 2   ASN A C   1 
ATOM   12   O O   . ASN A 1 5   ? -52.685 -4.554  -39.133 1.00 31.82 ? 2   ASN A O   1 
ATOM   13   C CB  . ASN A 1 5   ? -54.756 -3.280  -40.382 1.00 33.17 ? 2   ASN A CB  1 
ATOM   14   C CG  . ASN A 1 5   ? -55.731 -3.281  -41.551 1.00 30.66 ? 2   ASN A CG  1 
ATOM   15   O OD1 . ASN A 1 5   ? -56.116 -4.361  -42.005 1.00 28.11 ? 2   ASN A OD1 1 
ATOM   16   N ND2 . ASN A 1 5   ? -56.153 -2.097  -42.010 1.00 26.77 ? 2   ASN A ND2 1 
ATOM   17   N N   . VAL A 1 6   ? -53.932 -5.915  -37.912 1.00 29.63 ? 3   VAL A N   1 
ATOM   18   C CA  . VAL A 1 6   ? -52.769 -6.540  -37.314 1.00 27.13 ? 3   VAL A CA  1 
ATOM   19   C C   . VAL A 1 6   ? -52.213 -7.544  -38.325 1.00 25.94 ? 3   VAL A C   1 
ATOM   20   O O   . VAL A 1 6   ? -52.965 -8.367  -38.854 1.00 25.09 ? 3   VAL A O   1 
ATOM   21   C CB  . VAL A 1 6   ? -53.163 -7.224  -35.990 1.00 28.43 ? 3   VAL A CB  1 
ATOM   22   C CG1 . VAL A 1 6   ? -51.977 -7.937  -35.377 1.00 25.90 ? 3   VAL A CG1 1 
ATOM   23   C CG2 . VAL A 1 6   ? -53.706 -6.180  -35.056 1.00 30.92 ? 3   VAL A CG2 1 
ATOM   24   N N   . PRO A 1 7   ? -50.901 -7.495  -38.595 1.00 25.06 ? 4   PRO A N   1 
ATOM   25   C CA  . PRO A 1 7   ? -50.382 -8.432  -39.605 1.00 24.74 ? 4   PRO A CA  1 
ATOM   26   C C   . PRO A 1 7   ? -50.274 -9.872  -39.091 1.00 23.26 ? 4   PRO A C   1 
ATOM   27   O O   . PRO A 1 7   ? -50.123 -10.107 -37.872 1.00 23.03 ? 4   PRO A O   1 
ATOM   28   C CB  . PRO A 1 7   ? -48.990 -7.891  -39.916 1.00 25.89 ? 4   PRO A CB  1 
ATOM   29   C CG  . PRO A 1 7   ? -48.566 -7.294  -38.613 1.00 24.86 ? 4   PRO A CG  1 
ATOM   30   C CD  . PRO A 1 7   ? -49.832 -6.664  -38.027 1.00 24.77 ? 4   PRO A CD  1 
ATOM   31   N N   . PHE A 1 8   ? -50.341 -10.816 -40.030 1.00 22.68 ? 5   PHE A N   1 
ATOM   32   C CA  . PHE A 1 8   ? -50.076 -12.223 -39.693 1.00 22.31 ? 5   PHE A CA  1 
ATOM   33   C C   . PHE A 1 8   ? -48.574 -12.516 -39.669 1.00 22.12 ? 5   PHE A C   1 
ATOM   34   O O   . PHE A 1 8   ? -47.815 -12.027 -40.500 1.00 23.41 ? 5   PHE A O   1 
ATOM   35   C CB  . PHE A 1 8   ? -50.761 -13.185 -40.657 1.00 22.67 ? 5   PHE A CB  1 
ATOM   36   C CG  . PHE A 1 8   ? -52.250 -13.230 -40.506 1.00 25.02 ? 5   PHE A CG  1 
ATOM   37   C CD1 . PHE A 1 8   ? -52.860 -13.989 -39.527 1.00 25.79 ? 5   PHE A CD1 1 
ATOM   38   C CD2 . PHE A 1 8   ? -53.047 -12.467 -41.344 1.00 31.45 ? 5   PHE A CD2 1 
ATOM   39   C CE1 . PHE A 1 8   ? -54.243 -14.001 -39.387 1.00 30.02 ? 5   PHE A CE1 1 
ATOM   40   C CE2 . PHE A 1 8   ? -54.436 -12.482 -41.206 1.00 32.92 ? 5   PHE A CE2 1 
ATOM   41   C CZ  . PHE A 1 8   ? -55.016 -13.275 -40.222 1.00 34.40 ? 5   PHE A CZ  1 
ATOM   42   N N   . TRP A 1 9   ? -48.162 -13.354 -38.730 1.00 22.33 ? 6   TRP A N   1 
ATOM   43   C CA  . TRP A 1 9   ? -46.813 -13.905 -38.735 1.00 21.70 ? 6   TRP A CA  1 
ATOM   44   C C   . TRP A 1 9   ? -46.848 -15.061 -39.711 1.00 22.38 ? 6   TRP A C   1 
ATOM   45   O O   . TRP A 1 9   ? -47.388 -16.102 -39.411 1.00 24.15 ? 6   TRP A O   1 
ATOM   46   C CB  . TRP A 1 9   ? -46.447 -14.373 -37.337 1.00 20.99 ? 6   TRP A CB  1 
ATOM   47   C CG  . TRP A 1 9   ? -45.007 -14.820 -37.204 1.00 20.06 ? 6   TRP A CG  1 
ATOM   48   C CD1 . TRP A 1 9   ? -44.543 -16.101 -37.006 1.00 20.26 ? 6   TRP A CD1 1 
ATOM   49   C CD2 . TRP A 1 9   ? -43.849 -13.980 -37.254 1.00 20.77 ? 6   TRP A CD2 1 
ATOM   50   N NE1 . TRP A 1 9   ? -43.155 -16.091 -36.909 1.00 21.00 ? 6   TRP A NE1 1 
ATOM   51   C CE2 . TRP A 1 9   ? -42.715 -14.803 -37.065 1.00 21.90 ? 6   TRP A CE2 1 
ATOM   52   C CE3 . TRP A 1 9   ? -43.656 -12.605 -37.433 1.00 23.98 ? 6   TRP A CE3 1 
ATOM   53   C CZ2 . TRP A 1 9   ? -41.422 -14.292 -37.026 1.00 21.57 ? 6   TRP A CZ2 1 
ATOM   54   C CZ3 . TRP A 1 9   ? -42.351 -12.103 -37.392 1.00 23.94 ? 6   TRP A CZ3 1 
ATOM   55   C CH2 . TRP A 1 9   ? -41.263 -12.949 -37.185 1.00 23.52 ? 6   TRP A CH2 1 
ATOM   56   N N   . THR A 1 10  ? -46.363 -14.841 -40.934 1.00 23.60 ? 7   THR A N   1 
ATOM   57   C CA  . THR A 1 10  ? -46.548 -15.783 -42.012 1.00 25.30 ? 7   THR A CA  1 
ATOM   58   C C   . THR A 1 10  ? -45.408 -16.795 -42.148 1.00 24.67 ? 7   THR A C   1 
ATOM   59   O O   . THR A 1 10  ? -44.317 -16.622 -41.588 1.00 23.55 ? 7   THR A O   1 
ATOM   60   C CB  . THR A 1 10  ? -46.648 -15.040 -43.347 1.00 26.82 ? 7   THR A CB  1 
ATOM   61   O OG1 . THR A 1 10  ? -45.431 -14.301 -43.534 1.00 28.03 ? 7   THR A OG1 1 
ATOM   62   C CG2 . THR A 1 10  ? -47.865 -14.064 -43.345 1.00 29.03 ? 7   THR A CG2 1 
ATOM   63   N N   . GLU A 1 11  ? -45.658 -17.807 -42.978 1.00 25.78 ? 8   GLU A N   1 
ATOM   64   C CA  . GLU A 1 11  ? -44.629 -18.799 -43.333 1.00 27.19 ? 8   GLU A CA  1 
ATOM   65   C C   . GLU A 1 11  ? -43.283 -18.152 -43.687 1.00 27.61 ? 8   GLU A C   1 
ATOM   66   O O   . GLU A 1 11  ? -42.219 -18.649 -43.290 1.00 27.53 ? 8   GLU A O   1 
ATOM   67   C CB  . GLU A 1 11  ? -45.117 -19.623 -44.516 1.00 30.56 ? 8   GLU A CB  1 
ATOM   68   C CG  . GLU A 1 11  ? -44.041 -20.502 -45.093 1.00 33.87 ? 8   GLU A CG  1 
ATOM   69   C CD  . GLU A 1 11  ? -44.548 -21.465 -46.092 1.00 37.96 ? 8   GLU A CD  1 
ATOM   70   O OE1 . GLU A 1 11  ? -45.741 -21.382 -46.441 1.00 40.07 ? 8   GLU A OE1 1 
ATOM   71   O OE2 . GLU A 1 11  ? -43.724 -22.296 -46.536 1.00 42.86 ? 8   GLU A OE2 1 
ATOM   72   N N   . GLU A 1 12  ? -43.323 -17.046 -44.425 1.00 28.96 ? 9   GLU A N   1 
ATOM   73   C CA  . GLU A 1 12  ? -42.102 -16.400 -44.883 1.00 30.80 ? 9   GLU A CA  1 
ATOM   74   C C   . GLU A 1 12  ? -41.310 -15.865 -43.677 1.00 27.96 ? 9   GLU A C   1 
ATOM   75   O O   . GLU A 1 12  ? -40.079 -15.959 -43.648 1.00 29.54 ? 9   GLU A O   1 
ATOM   76   C CB  . GLU A 1 12  ? -42.421 -15.285 -45.901 1.00 33.59 ? 9   GLU A CB  1 
ATOM   77   C CG  . GLU A 1 12  ? -42.891 -15.837 -47.288 1.00 40.58 ? 9   GLU A CG  1 
ATOM   78   C CD  . GLU A 1 12  ? -44.401 -16.301 -47.372 1.00 44.93 ? 9   GLU A CD  1 
ATOM   79   O OE1 . GLU A 1 12  ? -45.202 -16.209 -46.389 1.00 36.40 ? 9   GLU A OE1 1 
ATOM   80   O OE2 . GLU A 1 12  ? -44.780 -16.756 -48.479 1.00 50.16 ? 9   GLU A OE2 1 
ATOM   81   N N   . HIS A 1 13  ? -42.014 -15.302 -42.699 1.00 25.69 ? 10  HIS A N   1 
ATOM   82   C CA  . HIS A 1 13  ? -41.395 -14.834 -41.459 1.00 24.77 ? 10  HIS A CA  1 
ATOM   83   C C   . HIS A 1 13  ? -40.791 -15.981 -40.623 1.00 23.78 ? 10  HIS A C   1 
ATOM   84   O O   . HIS A 1 13  ? -39.701 -15.853 -40.084 1.00 24.46 ? 10  HIS A O   1 
ATOM   85   C CB  . HIS A 1 13  ? -42.391 -14.023 -40.618 1.00 24.74 ? 10  HIS A CB  1 
ATOM   86   C CG  . HIS A 1 13  ? -42.685 -12.665 -41.161 1.00 27.64 ? 10  HIS A CG  1 
ATOM   87   N ND1 . HIS A 1 13  ? -43.810 -12.380 -41.907 1.00 34.74 ? 10  HIS A ND1 1 
ATOM   88   C CD2 . HIS A 1 13  ? -42.004 -11.504 -41.053 1.00 31.46 ? 10  HIS A CD2 1 
ATOM   89   C CE1 . HIS A 1 13  ? -43.789 -11.106 -42.257 1.00 29.40 ? 10  HIS A CE1 1 
ATOM   90   N NE2 . HIS A 1 13  ? -42.700 -10.555 -41.768 1.00 34.42 ? 10  HIS A NE2 1 
ATOM   91   N N   . VAL A 1 14  ? -41.524 -17.074 -40.507 1.00 21.43 ? 11  VAL A N   1 
ATOM   92   C CA  . VAL A 1 14  ? -41.058 -18.279 -39.835 1.00 21.24 ? 11  VAL A CA  1 
ATOM   93   C C   . VAL A 1 14  ? -39.766 -18.781 -40.484 1.00 21.91 ? 11  VAL A C   1 
ATOM   94   O O   . VAL A 1 14  ? -38.750 -18.976 -39.821 1.00 22.19 ? 11  VAL A O   1 
ATOM   95   C CB  . VAL A 1 14  ? -42.114 -19.402 -39.860 1.00 22.18 ? 11  VAL A CB  1 
ATOM   96   C CG1 . VAL A 1 14  ? -41.566 -20.673 -39.174 1.00 20.43 ? 11  VAL A CG1 1 
ATOM   97   C CG2 . VAL A 1 14  ? -43.393 -18.977 -39.167 1.00 21.73 ? 11  VAL A CG2 1 
ATOM   98   N N   . ARG A 1 15  ? -39.793 -18.961 -41.786 1.00 23.33 ? 12  ARG A N   1 
ATOM   99   C CA  . ARG A 1 15  ? -38.604 -19.500 -42.471 1.00 25.12 ? 12  ARG A CA  1 
ATOM   100  C C   . ARG A 1 15  ? -37.382 -18.625 -42.288 1.00 25.89 ? 12  ARG A C   1 
ATOM   101  O O   . ARG A 1 15  ? -36.268 -19.125 -42.142 1.00 26.79 ? 12  ARG A O   1 
ATOM   102  C CB  . ARG A 1 15  ? -38.866 -19.636 -43.947 1.00 27.66 ? 12  ARG A CB  1 
ATOM   103  C CG  . ARG A 1 15  ? -39.836 -20.715 -44.311 1.00 29.90 ? 12  ARG A CG  1 
ATOM   104  C CD  . ARG A 1 15  ? -39.855 -20.887 -45.819 1.00 35.34 ? 12  ARG A CD  1 
ATOM   105  N NE  . ARG A 1 15  ? -40.787 -21.955 -46.124 1.00 39.70 ? 12  ARG A NE  1 
ATOM   106  C CZ  . ARG A 1 15  ? -40.472 -23.241 -46.128 1.00 41.03 ? 12  ARG A CZ  1 
ATOM   107  N NH1 . ARG A 1 15  ? -39.213 -23.640 -45.947 1.00 42.15 ? 12  ARG A NH1 1 
ATOM   108  N NH2 . ARG A 1 15  ? -41.421 -24.132 -46.367 1.00 43.99 ? 12  ARG A NH2 1 
ATOM   109  N N   . ALA A 1 16  ? -37.599 -17.307 -42.338 1.00 25.73 ? 13  ALA A N   1 
ATOM   110  C CA  . ALA A 1 16  ? -36.523 -16.341 -42.214 1.00 27.42 ? 13  ALA A CA  1 
ATOM   111  C C   . ALA A 1 16  ? -35.892 -16.268 -40.830 1.00 27.05 ? 13  ALA A C   1 
ATOM   112  O O   . ALA A 1 16  ? -34.761 -15.795 -40.709 1.00 29.58 ? 13  ALA A O   1 
ATOM   113  C CB  . ALA A 1 16  ? -37.022 -14.955 -42.631 1.00 28.25 ? 13  ALA A CB  1 
ATOM   114  N N   . THR A 1 17  ? -36.607 -16.746 -39.808 1.00 24.55 ? 14  THR A N   1 
ATOM   115  C CA  . THR A 1 17  ? -36.227 -16.550 -38.400 1.00 24.34 ? 14  THR A CA  1 
ATOM   116  C C   . THR A 1 17  ? -35.915 -17.808 -37.599 1.00 23.91 ? 14  THR A C   1 
ATOM   117  O O   . THR A 1 17  ? -35.359 -17.707 -36.502 1.00 25.37 ? 14  THR A O   1 
ATOM   118  C CB  . THR A 1 17  ? -37.295 -15.711 -37.622 1.00 23.14 ? 14  THR A CB  1 
ATOM   119  O OG1 . THR A 1 17  ? -38.546 -16.394 -37.635 1.00 21.91 ? 14  THR A OG1 1 
ATOM   120  C CG2 . THR A 1 17  ? -37.484 -14.286 -38.201 1.00 24.62 ? 14  THR A CG2 1 
ATOM   121  N N   . LEU A 1 18  ? -36.300 -18.984 -38.081 1.00 23.64 ? 15  LEU A N   1 
ATOM   122  C CA  . LEU A 1 18  ? -35.982 -20.217 -37.351 1.00 23.78 ? 15  LEU A CA  1 
ATOM   123  C C   . LEU A 1 18  ? -34.472 -20.442 -37.376 1.00 25.90 ? 15  LEU A C   1 
ATOM   124  O O   . LEU A 1 18  ? -33.811 -20.163 -38.370 1.00 27.72 ? 15  LEU A O   1 
ATOM   125  C CB  . LEU A 1 18  ? -36.659 -21.433 -37.962 1.00 23.82 ? 15  LEU A CB  1 
ATOM   126  C CG  . LEU A 1 18  ? -38.135 -21.654 -37.710 1.00 23.45 ? 15  LEU A CG  1 
ATOM   127  C CD1 . LEU A 1 18  ? -38.615 -22.756 -38.678 1.00 25.14 ? 15  LEU A CD1 1 
ATOM   128  C CD2 . LEU A 1 18  ? -38.390 -22.010 -36.226 1.00 23.00 ? 15  LEU A CD2 1 
ATOM   129  N N   . PRO A 1 19  ? -33.925 -20.924 -36.263 1.00 26.86 ? 16  PRO A N   1 
ATOM   130  C CA  . PRO A 1 19  ? -32.489 -21.080 -36.137 1.00 29.81 ? 16  PRO A CA  1 
ATOM   131  C C   . PRO A 1 19  ? -32.022 -22.355 -36.816 1.00 33.04 ? 16  PRO A C   1 
ATOM   132  O O   . PRO A 1 19  ? -32.792 -23.322 -36.938 1.00 30.67 ? 16  PRO A O   1 
ATOM   133  C CB  . PRO A 1 19  ? -32.311 -21.204 -34.617 1.00 30.47 ? 16  PRO A CB  1 
ATOM   134  C CG  . PRO A 1 19  ? -33.565 -21.906 -34.181 1.00 27.79 ? 16  PRO A CG  1 
ATOM   135  C CD  . PRO A 1 19  ? -34.623 -21.250 -35.009 1.00 27.13 ? 16  PRO A CD  1 
ATOM   136  N N   . GLU A 1 20  ? -30.751 -22.363 -37.212 1.00 35.78 ? 17  GLU A N   1 
ATOM   137  C CA  . GLU A 1 20  ? -30.070 -23.602 -37.597 1.00 39.48 ? 17  GLU A CA  1 
ATOM   138  C C   . GLU A 1 20  ? -29.547 -24.319 -36.376 1.00 39.55 ? 17  GLU A C   1 
ATOM   139  O O   . GLU A 1 20  ? -29.345 -23.703 -35.308 1.00 41.75 ? 17  GLU A O   1 
ATOM   140  C CB  . GLU A 1 20  ? -28.895 -23.286 -38.522 1.00 41.84 ? 17  GLU A CB  1 
ATOM   141  C CG  . GLU A 1 20  ? -29.234 -23.324 -39.984 1.00 46.97 ? 17  GLU A CG  1 
ATOM   142  C CD  . GLU A 1 20  ? -27.983 -23.397 -40.837 1.00 52.57 ? 17  GLU A CD  1 
ATOM   143  O OE1 . GLU A 1 20  ? -27.123 -22.492 -40.716 1.00 58.74 ? 17  GLU A OE1 1 
ATOM   144  O OE2 . GLU A 1 20  ? -27.844 -24.367 -41.613 1.00 55.99 ? 17  GLU A OE2 1 
ATOM   145  N N   . ARG A 1 21  ? -29.407 -25.644 -36.460 1.00 39.83 ? 18  ARG A N   1 
ATOM   146  C CA  . ARG A 1 21  ? -28.718 -26.366 -35.378 1.00 39.91 ? 18  ARG A CA  1 
ATOM   147  C C   . ARG A 1 21  ? -27.349 -26.846 -35.820 1.00 43.04 ? 18  ARG A C   1 
ATOM   148  O O   . ARG A 1 21  ? -27.205 -27.982 -36.274 1.00 44.35 ? 18  ARG A O   1 
ATOM   149  C CB  . ARG A 1 21  ? -29.536 -27.548 -34.856 1.00 37.63 ? 18  ARG A CB  1 
ATOM   150  C CG  . ARG A 1 21  ? -29.245 -27.845 -33.379 1.00 34.94 ? 18  ARG A CG  1 
ATOM   151  C CD  . ARG A 1 21  ? -30.192 -28.906 -32.864 1.00 29.03 ? 18  ARG A CD  1 
ATOM   152  N NE  . ARG A 1 21  ? -30.030 -29.201 -31.434 1.00 26.93 ? 18  ARG A NE  1 
ATOM   153  C CZ  . ARG A 1 21  ? -30.629 -28.562 -30.446 1.00 26.37 ? 18  ARG A CZ  1 
ATOM   154  N NH1 . ARG A 1 21  ? -31.504 -27.590 -30.686 1.00 22.69 ? 18  ARG A NH1 1 
ATOM   155  N NH2 . ARG A 1 21  ? -30.390 -28.943 -29.199 1.00 24.73 ? 18  ARG A NH2 1 
ATOM   156  N N   . ASP A 1 22  ? -26.342 -25.996 -35.658 1.00 45.79 ? 19  ASP A N   1 
ATOM   157  C CA  . ASP A 1 22  ? -25.017 -26.255 -36.229 1.00 48.80 ? 19  ASP A CA  1 
ATOM   158  C C   . ASP A 1 22  ? -24.205 -27.272 -35.412 1.00 49.03 ? 19  ASP A C   1 
ATOM   159  O O   . ASP A 1 22  ? -24.557 -27.582 -34.273 1.00 49.53 ? 19  ASP A O   1 
ATOM   160  C CB  . ASP A 1 22  ? -24.248 -24.933 -36.383 1.00 50.70 ? 19  ASP A CB  1 
ATOM   161  C CG  . ASP A 1 22  ? -24.867 -24.010 -37.460 1.00 55.19 ? 19  ASP A CG  1 
ATOM   162  O OD1 . ASP A 1 22  ? -24.852 -22.757 -37.290 1.00 60.54 ? 19  ASP A OD1 1 
ATOM   163  O OD2 . ASP A 1 22  ? -25.363 -24.533 -38.494 1.00 60.90 ? 19  ASP A OD2 1 
ATOM   164  N N   . THR A 1 29  ? -24.307 -22.520 -26.728 1.00 44.85 ? 26  THR A N   1 
ATOM   165  C CA  . THR A 1 29  ? -25.013 -23.788 -26.638 1.00 42.73 ? 26  THR A CA  1 
ATOM   166  C C   . THR A 1 29  ? -26.529 -23.552 -26.759 1.00 40.26 ? 26  THR A C   1 
ATOM   167  O O   . THR A 1 29  ? -26.992 -22.415 -26.927 1.00 41.12 ? 26  THR A O   1 
ATOM   168  C CB  . THR A 1 29  ? -24.628 -24.555 -25.319 1.00 43.55 ? 26  THR A CB  1 
ATOM   169  O OG1 . THR A 1 29  ? -25.219 -23.912 -24.182 1.00 46.49 ? 26  THR A OG1 1 
ATOM   170  C CG2 . THR A 1 29  ? -23.097 -24.575 -25.114 1.00 45.69 ? 26  THR A CG2 1 
ATOM   171  N N   . TYR A 1 30  ? -27.304 -24.632 -26.738 1.00 36.59 ? 27  TYR A N   1 
ATOM   172  C CA  . TYR A 1 30  ? -28.766 -24.535 -26.696 1.00 33.26 ? 27  TYR A CA  1 
ATOM   173  C C   . TYR A 1 30  ? -29.062 -24.514 -25.213 1.00 32.43 ? 27  TYR A C   1 
ATOM   174  O O   . TYR A 1 30  ? -28.373 -25.125 -24.423 1.00 34.27 ? 27  TYR A O   1 
ATOM   175  C CB  . TYR A 1 30  ? -29.407 -25.691 -27.460 1.00 31.68 ? 27  TYR A CB  1 
ATOM   176  C CG  . TYR A 1 30  ? -28.875 -25.692 -28.859 1.00 31.65 ? 27  TYR A CG  1 
ATOM   177  C CD1 . TYR A 1 30  ? -29.303 -24.742 -29.796 1.00 34.59 ? 27  TYR A CD1 1 
ATOM   178  C CD2 . TYR A 1 30  ? -27.840 -26.548 -29.204 1.00 33.54 ? 27  TYR A CD2 1 
ATOM   179  C CE1 . TYR A 1 30  ? -28.743 -24.719 -31.076 1.00 36.60 ? 27  TYR A CE1 1 
ATOM   180  C CE2 . TYR A 1 30  ? -27.288 -26.537 -30.456 1.00 38.77 ? 27  TYR A CE2 1 
ATOM   181  C CZ  . TYR A 1 30  ? -27.718 -25.636 -31.379 1.00 37.81 ? 27  TYR A CZ  1 
ATOM   182  O OH  . TYR A 1 30  ? -27.094 -25.708 -32.617 1.00 47.36 ? 27  TYR A OH  1 
ATOM   183  N N   . GLY A 1 31  ? -30.022 -23.749 -24.785 1.00 31.10 ? 28  GLY A N   1 
ATOM   184  C CA  . GLY A 1 31  ? -30.002 -23.410 -23.346 1.00 30.07 ? 28  GLY A CA  1 
ATOM   185  C C   . GLY A 1 31  ? -30.539 -24.519 -22.455 1.00 28.25 ? 28  GLY A C   1 
ATOM   186  O O   . GLY A 1 31  ? -31.152 -25.468 -22.959 1.00 27.45 ? 28  GLY A O   1 
ATOM   187  N N   . THR A 1 32  ? -30.338 -24.365 -21.142 1.00 25.16 ? 29  THR A N   1 
ATOM   188  C CA  . THR A 1 32  ? -31.027 -25.140 -20.124 1.00 24.03 ? 29  THR A CA  1 
ATOM   189  C C   . THR A 1 32  ? -32.296 -24.394 -19.686 1.00 22.37 ? 29  THR A C   1 
ATOM   190  O O   . THR A 1 32  ? -32.228 -23.230 -19.269 1.00 23.24 ? 29  THR A O   1 
ATOM   191  C CB  . THR A 1 32  ? -30.146 -25.373 -18.895 1.00 26.19 ? 29  THR A CB  1 
ATOM   192  O OG1 . THR A 1 32  ? -28.936 -26.033 -19.314 1.00 26.66 ? 29  THR A OG1 1 
ATOM   193  C CG2 . THR A 1 32  ? -30.874 -26.208 -17.870 1.00 25.22 ? 29  THR A CG2 1 
ATOM   194  N N   . ALA A 1 33  ? -33.438 -25.053 -19.829 1.00 19.29 ? 30  ALA A N   1 
ATOM   195  C CA  . ALA A 1 33  ? -34.718 -24.514 -19.425 1.00 18.71 ? 30  ALA A CA  1 
ATOM   196  C C   . ALA A 1 33  ? -35.163 -25.079 -18.084 1.00 18.30 ? 30  ALA A C   1 
ATOM   197  O O   . ALA A 1 33  ? -34.880 -26.235 -17.771 1.00 19.25 ? 30  ALA A O   1 
ATOM   198  C CB  . ALA A 1 33  ? -35.737 -24.827 -20.445 1.00 19.20 ? 30  ALA A CB  1 
ATOM   199  N N   . LEU A 1 34  ? -35.929 -24.281 -17.350 1.00 18.95 ? 31  LEU A N   1 
ATOM   200  C CA  . LEU A 1 34  ? -36.613 -24.710 -16.129 1.00 17.74 ? 31  LEU A CA  1 
ATOM   201  C C   . LEU A 1 34  ? -38.112 -24.661 -16.383 1.00 17.86 ? 31  LEU A C   1 
ATOM   202  O O   . LEU A 1 34  ? -38.651 -23.627 -16.795 1.00 16.96 ? 31  LEU A O   1 
ATOM   203  C CB  . LEU A 1 34  ? -36.269 -23.834 -14.945 1.00 18.53 ? 31  LEU A CB  1 
ATOM   204  C CG  . LEU A 1 34  ? -36.922 -24.162 -13.609 1.00 19.89 ? 31  LEU A CG  1 
ATOM   205  C CD1 . LEU A 1 34  ? -36.455 -25.522 -13.102 1.00 19.82 ? 31  LEU A CD1 1 
ATOM   206  C CD2 . LEU A 1 34  ? -36.605 -23.084 -12.570 1.00 20.21 ? 31  LEU A CD2 1 
ATOM   207  N N   . LEU A 1 35  ? -38.769 -25.779 -16.108 1.00 17.79 ? 32  LEU A N   1 
ATOM   208  C CA  . LEU A 1 35  ? -40.250 -25.892 -16.192 1.00 17.24 ? 32  LEU A CA  1 
ATOM   209  C C   . LEU A 1 35  ? -40.812 -26.147 -14.793 1.00 17.98 ? 32  LEU A C   1 
ATOM   210  O O   . LEU A 1 35  ? -40.572 -27.200 -14.194 1.00 18.48 ? 32  LEU A O   1 
ATOM   211  C CB  . LEU A 1 35  ? -40.660 -26.992 -17.166 1.00 17.00 ? 32  LEU A CB  1 
ATOM   212  C CG  . LEU A 1 35  ? -42.138 -27.359 -17.196 1.00 16.79 ? 32  LEU A CG  1 
ATOM   213  C CD1 . LEU A 1 35  ? -42.950 -26.129 -17.718 1.00 17.27 ? 32  LEU A CD1 1 
ATOM   214  C CD2 . LEU A 1 35  ? -42.405 -28.589 -18.120 1.00 17.76 ? 32  LEU A CD2 1 
ATOM   215  N N   . LEU A 1 36  ? -41.566 -25.176 -14.273 1.00 18.43 ? 33  LEU A N   1 
ATOM   216  C CA  . LEU A 1 36  ? -42.209 -25.284 -12.979 1.00 18.48 ? 33  LEU A CA  1 
ATOM   217  C C   . LEU A 1 36  ? -43.693 -25.569 -13.267 1.00 19.15 ? 33  LEU A C   1 
ATOM   218  O O   . LEU A 1 36  ? -44.463 -24.652 -13.564 1.00 18.43 ? 33  LEU A O   1 
ATOM   219  C CB  . LEU A 1 36  ? -42.004 -24.002 -12.175 1.00 19.55 ? 33  LEU A CB  1 
ATOM   220  C CG  . LEU A 1 36  ? -40.543 -23.674 -11.815 1.00 19.36 ? 33  LEU A CG  1 
ATOM   221  C CD1 . LEU A 1 36  ? -40.471 -22.374 -11.036 1.00 21.03 ? 33  LEU A CD1 1 
ATOM   222  C CD2 . LEU A 1 36  ? -39.827 -24.830 -11.104 1.00 18.94 ? 33  LEU A CD2 1 
ATOM   223  N N   . ALA A 1 37  ? -44.074 -26.844 -13.163 1.00 17.82 ? 34  ALA A N   1 
ATOM   224  C CA  . ALA A 1 37  ? -45.367 -27.287 -13.626 1.00 17.84 ? 34  ALA A CA  1 
ATOM   225  C C   . ALA A 1 37  ? -45.729 -28.614 -13.021 1.00 18.90 ? 34  ALA A C   1 
ATOM   226  O O   . ALA A 1 37  ? -44.845 -29.387 -12.625 1.00 19.13 ? 34  ALA A O   1 
ATOM   227  C CB  . ALA A 1 37  ? -45.299 -27.464 -15.150 1.00 17.43 ? 34  ALA A CB  1 
ATOM   228  N N   . GLY A 1 38  ? -47.021 -28.870 -12.944 1.00 20.21 ? 35  GLY A N   1 
ATOM   229  C CA  . GLY A 1 38  ? -47.578 -30.175 -12.548 1.00 20.55 ? 35  GLY A CA  1 
ATOM   230  C C   . GLY A 1 38  ? -47.728 -30.288 -11.049 1.00 22.06 ? 35  GLY A C   1 
ATOM   231  O O   . GLY A 1 38  ? -46.804 -30.001 -10.294 1.00 24.30 ? 35  GLY A O   1 
ATOM   232  N N   . SER A 1 39  ? -48.917 -30.648 -10.625 1.00 23.56 ? 36  SER A N   1 
ATOM   233  C CA  . SER A 1 39  ? -49.206 -30.826 -9.206  1.00 23.74 ? 36  SER A CA  1 
ATOM   234  C C   . SER A 1 39  ? -49.925 -32.132 -9.072  1.00 25.45 ? 36  SER A C   1 
ATOM   235  O O   . SER A 1 39  ? -50.412 -32.729 -10.067 1.00 23.17 ? 36  SER A O   1 
ATOM   236  C CB  . SER A 1 39  ? -50.018 -29.654 -8.674  1.00 24.00 ? 36  SER A CB  1 
ATOM   237  O OG  . SER A 1 39  ? -51.274 -29.569 -9.284  1.00 23.89 ? 36  SER A OG  1 
ATOM   238  N N   . ASP A 1 40  ? -50.000 -32.610 -7.830  1.00 26.63 ? 37  ASP A N   1 
ATOM   239  C CA  . ASP A 1 40  ? -50.582 -33.913 -7.594  1.00 29.26 ? 37  ASP A CA  1 
ATOM   240  C C   . ASP A 1 40  ? -51.972 -33.964 -8.182  1.00 29.08 ? 37  ASP A C   1 
ATOM   241  O O   . ASP A 1 40  ? -52.398 -34.968 -8.730  1.00 28.57 ? 37  ASP A O   1 
ATOM   242  C CB  . ASP A 1 40  ? -50.633 -34.225 -6.084  1.00 30.65 ? 37  ASP A CB  1 
ATOM   243  C CG  . ASP A 1 40  ? -49.293 -34.608 -5.501  1.00 33.08 ? 37  ASP A CG  1 
ATOM   244  O OD1 . ASP A 1 40  ? -48.263 -34.502 -6.155  1.00 34.63 ? 37  ASP A OD1 1 
ATOM   245  O OD2 . ASP A 1 40  ? -49.271 -34.995 -4.309  1.00 40.20 ? 37  ASP A OD2 1 
ATOM   246  N N   . ASP A 1 41  ? -52.700 -32.865 -8.086  1.00 30.47 ? 38  ASP A N   1 
ATOM   247  C CA  . ASP A 1 41  ? -54.068 -32.852 -8.575  1.00 31.20 ? 38  ASP A CA  1 
ATOM   248  C C   . ASP A 1 41  ? -54.155 -32.639 -10.123 1.00 29.88 ? 38  ASP A C   1 
ATOM   249  O O   . ASP A 1 41  ? -55.118 -33.044 -10.775 1.00 30.96 ? 38  ASP A O   1 
ATOM   250  C CB  . ASP A 1 41  ? -54.870 -31.737 -7.845  1.00 33.14 ? 38  ASP A CB  1 
ATOM   251  C CG  . ASP A 1 41  ? -55.128 -32.011 -6.339  1.00 37.86 ? 38  ASP A CG  1 
ATOM   252  O OD1 . ASP A 1 41  ? -54.880 -33.126 -5.835  1.00 43.01 ? 38  ASP A OD1 1 
ATOM   253  O OD2 . ASP A 1 41  ? -55.636 -31.079 -5.670  1.00 45.33 ? 38  ASP A OD2 1 
ATOM   254  N N   . MET A 1 42  ? -53.143 -32.001 -10.714 1.00 26.75 ? 39  MET A N   1 
ATOM   255  C CA  . MET A 1 42  ? -53.086 -31.736 -12.180 1.00 23.68 ? 39  MET A CA  1 
ATOM   256  C C   . MET A 1 42  ? -51.696 -32.136 -12.744 1.00 21.37 ? 39  MET A C   1 
ATOM   257  O O   . MET A 1 42  ? -50.889 -31.282 -13.124 1.00 21.62 ? 39  MET A O   1 
ATOM   258  C CB  . MET A 1 42  ? -53.321 -30.232 -12.436 1.00 24.44 ? 39  MET A CB  1 
ATOM   259  C CG  . MET A 1 42  ? -54.770 -29.810 -12.186 1.00 27.81 ? 39  MET A CG  1 
ATOM   260  S SD  . MET A 1 42  ? -54.891 -27.980 -12.260 1.00 30.71 ? 39  MET A SD  1 
ATOM   261  C CE  . MET A 1 42  ? -54.190 -27.511 -10.678 1.00 28.85 ? 39  MET A CE  1 
ATOM   262  N N   . PRO A 1 43  ? -51.429 -33.450 -12.843 1.00 19.02 ? 40  PRO A N   1 
ATOM   263  C CA  . PRO A 1 43  ? -50.077 -33.902 -13.136 1.00 18.49 ? 40  PRO A CA  1 
ATOM   264  C C   . PRO A 1 43  ? -49.731 -33.812 -14.624 1.00 18.12 ? 40  PRO A C   1 
ATOM   265  O O   . PRO A 1 43  ? -48.588 -33.592 -15.012 1.00 17.68 ? 40  PRO A O   1 
ATOM   266  C CB  . PRO A 1 43  ? -50.098 -35.359 -12.671 1.00 18.43 ? 40  PRO A CB  1 
ATOM   267  C CG  . PRO A 1 43  ? -51.548 -35.775 -12.761 1.00 20.06 ? 40  PRO A CG  1 
ATOM   268  C CD  . PRO A 1 43  ? -52.301 -34.537 -12.369 1.00 20.19 ? 40  PRO A CD  1 
ATOM   269  N N   . GLY A 1 44  ? -50.736 -34.025 -15.474 1.00 17.81 ? 41  GLY A N   1 
ATOM   270  C CA  . GLY A 1 44  ? -50.485 -34.212 -16.890 1.00 18.03 ? 41  GLY A CA  1 
ATOM   271  C C   . GLY A 1 44  ? -49.881 -33.014 -17.577 1.00 17.43 ? 41  GLY A C   1 
ATOM   272  O O   . GLY A 1 44  ? -49.107 -33.146 -18.556 1.00 18.24 ? 41  GLY A O   1 
ATOM   273  N N   . ALA A 1 45  ? -50.186 -31.824 -17.051 1.00 17.26 ? 42  ALA A N   1 
ATOM   274  C CA  . ALA A 1 45  ? -49.660 -30.610 -17.661 1.00 17.29 ? 42  ALA A CA  1 
ATOM   275  C C   . ALA A 1 45  ? -48.118 -30.589 -17.699 1.00 17.49 ? 42  ALA A C   1 
ATOM   276  O O   . ALA A 1 45  ? -47.520 -30.047 -18.633 1.00 17.40 ? 42  ALA A O   1 
ATOM   277  C CB  . ALA A 1 45  ? -50.195 -29.356 -16.943 1.00 17.26 ? 42  ALA A CB  1 
ATOM   278  N N   . ALA A 1 46  ? -47.484 -31.183 -16.701 1.00 17.28 ? 43  ALA A N   1 
ATOM   279  C CA  . ALA A 1 46  ? -46.039 -31.232 -16.689 1.00 17.27 ? 43  ALA A CA  1 
ATOM   280  C C   . ALA A 1 46  ? -45.462 -32.108 -17.801 1.00 16.83 ? 43  ALA A C   1 
ATOM   281  O O   . ALA A 1 46  ? -44.425 -31.803 -18.338 1.00 17.16 ? 43  ALA A O   1 
ATOM   282  C CB  . ALA A 1 46  ? -45.513 -31.681 -15.288 1.00 18.26 ? 43  ALA A CB  1 
ATOM   283  N N   . LEU A 1 47  ? -46.104 -33.241 -18.099 1.00 16.38 ? 44  LEU A N   1 
ATOM   284  C CA  . LEU A 1 47  ? -45.644 -34.116 -19.143 1.00 16.72 ? 44  LEU A CA  1 
ATOM   285  C C   . LEU A 1 47  ? -45.858 -33.393 -20.492 1.00 16.68 ? 44  LEU A C   1 
ATOM   286  O O   . LEU A 1 47  ? -44.968 -33.389 -21.348 1.00 17.22 ? 44  LEU A O   1 
ATOM   287  C CB  . LEU A 1 47  ? -46.365 -35.451 -19.088 1.00 17.15 ? 44  LEU A CB  1 
ATOM   288  C CG  . LEU A 1 47  ? -46.036 -36.413 -20.229 1.00 19.09 ? 44  LEU A CG  1 
ATOM   289  C CD1 . LEU A 1 47  ? -44.488 -36.573 -20.458 1.00 20.20 ? 44  LEU A CD1 1 
ATOM   290  C CD2 . LEU A 1 47  ? -46.689 -37.809 -19.941 1.00 22.10 ? 44  LEU A CD2 1 
ATOM   291  N N   . LEU A 1 48  ? -47.022 -32.767 -20.661 1.00 16.65 ? 45  LEU A N   1 
ATOM   292  C CA  . LEU A 1 48  ? -47.341 -32.080 -21.921 1.00 16.68 ? 45  LEU A CA  1 
ATOM   293  C C   . LEU A 1 48  ? -46.355 -30.935 -22.190 1.00 16.75 ? 45  LEU A C   1 
ATOM   294  O O   . LEU A 1 48  ? -45.812 -30.794 -23.292 1.00 16.08 ? 45  LEU A O   1 
ATOM   295  C CB  . LEU A 1 48  ? -48.770 -31.554 -21.904 1.00 16.98 ? 45  LEU A CB  1 
ATOM   296  C CG  . LEU A 1 48  ? -49.818 -32.680 -21.999 1.00 17.37 ? 45  LEU A CG  1 
ATOM   297  C CD1 . LEU A 1 48  ? -51.161 -32.088 -21.734 1.00 19.70 ? 45  LEU A CD1 1 
ATOM   298  C CD2 . LEU A 1 48  ? -49.763 -33.363 -23.412 1.00 19.43 ? 45  LEU A CD2 1 
ATOM   299  N N   . ALA A 1 49  ? -46.129 -30.111 -21.179 1.00 16.69 ? 46  ALA A N   1 
ATOM   300  C CA  . ALA A 1 49  ? -45.214 -28.975 -21.334 1.00 16.28 ? 46  ALA A CA  1 
ATOM   301  C C   . ALA A 1 49  ? -43.781 -29.463 -21.450 1.00 15.98 ? 46  ALA A C   1 
ATOM   302  O O   . ALA A 1 49  ? -42.987 -28.918 -22.210 1.00 16.65 ? 46  ALA A O   1 
ATOM   303  C CB  . ALA A 1 49  ? -45.380 -27.948 -20.190 1.00 16.01 ? 46  ALA A CB  1 
ATOM   304  N N   . GLY A 1 50  ? -43.442 -30.539 -20.765 1.00 16.44 ? 47  GLY A N   1 
ATOM   305  C CA  . GLY A 1 50  ? -42.084 -31.093 -20.860 1.00 17.12 ? 47  GLY A CA  1 
ATOM   306  C C   . GLY A 1 50  ? -41.743 -31.629 -22.224 1.00 16.97 ? 47  GLY A C   1 
ATOM   307  O O   . GLY A 1 50  ? -40.668 -31.349 -22.737 1.00 17.20 ? 47  GLY A O   1 
ATOM   308  N N   . LEU A 1 51  ? -42.674 -32.349 -22.838 1.00 16.67 ? 48  LEU A N   1 
ATOM   309  C CA  . LEU A 1 51  ? -42.509 -32.890 -24.180 1.00 17.04 ? 48  LEU A CA  1 
ATOM   310  C C   . LEU A 1 51  ? -42.410 -31.733 -25.152 1.00 17.25 ? 48  LEU A C   1 
ATOM   311  O O   . LEU A 1 51  ? -41.557 -31.729 -26.016 1.00 16.95 ? 48  LEU A O   1 
ATOM   312  C CB  . LEU A 1 51  ? -43.711 -33.766 -24.515 1.00 17.63 ? 48  LEU A CB  1 
ATOM   313  C CG  . LEU A 1 51  ? -43.692 -35.165 -23.961 1.00 23.54 ? 48  LEU A CG  1 
ATOM   314  C CD1 . LEU A 1 51  ? -45.179 -35.711 -23.982 1.00 24.33 ? 48  LEU A CD1 1 
ATOM   315  C CD2 . LEU A 1 51  ? -42.715 -36.069 -24.771 1.00 26.44 ? 48  LEU A CD2 1 
ATOM   316  N N   . GLY A 1 52  ? -43.297 -30.742 -25.010 1.00 16.52 ? 49  GLY A N   1 
ATOM   317  C CA  . GLY A 1 52  ? -43.245 -29.585 -25.918 1.00 17.79 ? 49  GLY A CA  1 
ATOM   318  C C   . GLY A 1 52  ? -41.905 -28.884 -25.851 1.00 17.34 ? 49  GLY A C   1 
ATOM   319  O O   . GLY A 1 52  ? -41.354 -28.515 -26.858 1.00 17.78 ? 49  GLY A O   1 
ATOM   320  N N   . ALA A 1 53  ? -41.360 -28.744 -24.636 1.00 16.75 ? 50  ALA A N   1 
ATOM   321  C CA  . ALA A 1 53  ? -40.098 -28.021 -24.442 1.00 16.38 ? 50  ALA A CA  1 
ATOM   322  C C   . ALA A 1 53  ? -38.922 -28.804 -25.014 1.00 16.65 ? 50  ALA A C   1 
ATOM   323  O O   . ALA A 1 53  ? -38.124 -28.278 -25.813 1.00 17.06 ? 50  ALA A O   1 
ATOM   324  C CB  . ALA A 1 53  ? -39.874 -27.731 -22.904 1.00 15.87 ? 50  ALA A CB  1 
ATOM   325  N N   . MET A 1 54  ? -38.849 -30.105 -24.711 1.00 17.51 ? 51  MET A N   1 
ATOM   326  C CA  . MET A 1 54  ? -37.724 -30.890 -25.217 1.00 17.11 ? 51  MET A CA  1 
ATOM   327  C C   . MET A 1 54  ? -37.763 -31.099 -26.707 1.00 17.76 ? 51  MET A C   1 
ATOM   328  O O   . MET A 1 54  ? -36.721 -31.234 -27.349 1.00 19.96 ? 51  MET A O   1 
ATOM   329  C CB  . MET A 1 54  ? -37.599 -32.230 -24.471 1.00 17.02 ? 51  MET A CB  1 
ATOM   330  C CG  . MET A 1 54  ? -37.320 -31.993 -22.994 1.00 18.43 ? 51  MET A CG  1 
ATOM   331  S SD  . MET A 1 54  ? -36.339 -33.302 -22.167 1.00 19.01 ? 51  MET A SD  1 
ATOM   332  C CE  . MET A 1 54  ? -34.724 -32.877 -22.739 1.00 18.41 ? 51  MET A CE  1 
ATOM   333  N N   . ARG A 1 55  ? -38.969 -31.117 -27.274 1.00 16.26 ? 52  ARG A N   1 
ATOM   334  C CA  . ARG A 1 55  ? -39.118 -31.184 -28.709 1.00 16.93 ? 52  ARG A CA  1 
ATOM   335  C C   . ARG A 1 55  ? -38.697 -29.884 -29.402 1.00 18.38 ? 52  ARG A C   1 
ATOM   336  O O   . ARG A 1 55  ? -38.519 -29.886 -30.621 1.00 19.88 ? 52  ARG A O   1 
ATOM   337  C CB  . ARG A 1 55  ? -40.585 -31.460 -29.064 1.00 17.84 ? 52  ARG A CB  1 
ATOM   338  C CG  . ARG A 1 55  ? -41.013 -32.901 -28.967 1.00 18.80 ? 52  ARG A CG  1 
ATOM   339  C CD  . ARG A 1 55  ? -40.453 -33.694 -30.080 1.00 19.59 ? 52  ARG A CD  1 
ATOM   340  N NE  . ARG A 1 55  ? -41.031 -35.049 -30.101 1.00 21.30 ? 52  ARG A NE  1 
ATOM   341  C CZ  . ARG A 1 55  ? -40.416 -36.128 -30.584 1.00 24.21 ? 52  ARG A CZ  1 
ATOM   342  N NH1 . ARG A 1 55  ? -39.182 -36.079 -31.067 1.00 20.61 ? 52  ARG A NH1 1 
ATOM   343  N NH2 . ARG A 1 55  ? -41.050 -37.303 -30.562 1.00 26.21 ? 52  ARG A NH2 1 
ATOM   344  N N   . SER A 1 56  ? -38.575 -28.784 -28.665 1.00 17.55 ? 53  SER A N   1 
ATOM   345  C CA  . SER A 1 56  ? -38.444 -27.465 -29.275 1.00 18.52 ? 53  SER A CA  1 
ATOM   346  C C   . SER A 1 56  ? -37.054 -26.838 -29.206 1.00 19.19 ? 53  SER A C   1 
ATOM   347  O O   . SER A 1 56  ? -36.919 -25.629 -29.126 1.00 20.27 ? 53  SER A O   1 
ATOM   348  C CB  . SER A 1 56  ? -39.553 -26.565 -28.727 1.00 19.31 ? 53  SER A CB  1 
ATOM   349  O OG  . SER A 1 56  ? -40.820 -27.008 -29.203 1.00 19.27 ? 53  SER A OG  1 
ATOM   350  N N   . GLY A 1 57  ? -36.008 -27.662 -29.209 1.00 18.97 ? 54  GLY A N   1 
ATOM   351  C CA  . GLY A 1 57  ? -34.659 -27.167 -29.467 1.00 18.54 ? 54  GLY A CA  1 
ATOM   352  C C   . GLY A 1 57  ? -33.808 -26.707 -28.306 1.00 19.22 ? 54  GLY A C   1 
ATOM   353  O O   . GLY A 1 57  ? -32.743 -26.143 -28.538 1.00 19.77 ? 54  GLY A O   1 
ATOM   354  N N   . LEU A 1 58  ? -34.253 -26.954 -27.089 1.00 18.61 ? 55  LEU A N   1 
ATOM   355  C CA  . LEU A 1 58  ? -33.419 -26.693 -25.938 1.00 18.63 ? 55  LEU A CA  1 
ATOM   356  C C   . LEU A 1 58  ? -32.238 -27.674 -25.874 1.00 19.76 ? 55  LEU A C   1 
ATOM   357  O O   . LEU A 1 58  ? -32.136 -28.610 -26.700 1.00 20.45 ? 55  LEU A O   1 
ATOM   358  C CB  . LEU A 1 58  ? -34.226 -26.708 -24.670 1.00 18.35 ? 55  LEU A CB  1 
ATOM   359  C CG  . LEU A 1 58  ? -35.120 -27.895 -24.326 1.00 18.10 ? 55  LEU A CG  1 
ATOM   360  C CD1 . LEU A 1 58  ? -34.288 -29.173 -24.082 1.00 19.38 ? 55  LEU A CD1 1 
ATOM   361  C CD2 . LEU A 1 58  ? -35.979 -27.585 -23.102 1.00 19.72 ? 55  LEU A CD2 1 
ATOM   362  N N   . GLY A 1 59  ? -31.303 -27.399 -24.966 1.00 19.88 ? 56  GLY A N   1 
ATOM   363  C CA  . GLY A 1 59  ? -30.188 -28.333 -24.694 1.00 21.12 ? 56  GLY A CA  1 
ATOM   364  C C   . GLY A 1 59  ? -30.471 -29.273 -23.536 1.00 21.28 ? 56  GLY A C   1 
ATOM   365  O O   . GLY A 1 59  ? -30.102 -30.458 -23.590 1.00 22.31 ? 56  GLY A O   1 
ATOM   366  N N   . LYS A 1 60  ? -31.084 -28.763 -22.463 1.00 19.30 ? 57  LYS A N   1 
ATOM   367  C CA  . LYS A 1 60  ? -31.386 -29.549 -21.267 1.00 19.06 ? 57  LYS A CA  1 
ATOM   368  C C   . LYS A 1 60  ? -32.705 -29.013 -20.701 1.00 18.43 ? 57  LYS A C   1 
ATOM   369  O O   . LYS A 1 60  ? -32.963 -27.797 -20.808 1.00 18.68 ? 57  LYS A O   1 
ATOM   370  C CB  . LYS A 1 60  ? -30.253 -29.421 -20.234 1.00 20.53 ? 57  LYS A CB  1 
ATOM   371  C CG  . LYS A 1 60  ? -30.567 -29.825 -18.820 1.00 24.01 ? 57  LYS A CG  1 
ATOM   372  C CD  . LYS A 1 60  ? -29.355 -29.635 -17.880 1.00 27.64 ? 57  LYS A CD  1 
ATOM   373  C CE  . LYS A 1 60  ? -29.623 -30.039 -16.405 1.00 28.82 ? 57  LYS A CE  1 
ATOM   374  N NZ  . LYS A 1 60  ? -28.466 -29.716 -15.516 1.00 34.10 ? 57  LYS A NZ  1 
ATOM   375  N N   . LEU A 1 61  ? -33.497 -29.883 -20.087 1.00 17.05 ? 58  LEU A N   1 
ATOM   376  C CA  . LEU A 1 61  ? -34.685 -29.488 -19.362 1.00 17.10 ? 58  LEU A CA  1 
ATOM   377  C C   . LEU A 1 61  ? -34.637 -29.977 -17.911 1.00 19.09 ? 58  LEU A C   1 
ATOM   378  O O   . LEU A 1 61  ? -34.431 -31.164 -17.641 1.00 18.96 ? 58  LEU A O   1 
ATOM   379  C CB  . LEU A 1 61  ? -35.959 -30.013 -20.044 1.00 16.33 ? 58  LEU A CB  1 
ATOM   380  C CG  . LEU A 1 61  ? -37.283 -29.666 -19.325 1.00 16.88 ? 58  LEU A CG  1 
ATOM   381  C CD1 . LEU A 1 61  ? -37.525 -28.098 -19.324 1.00 16.45 ? 58  LEU A CD1 1 
ATOM   382  C CD2 . LEU A 1 61  ? -38.461 -30.448 -19.896 1.00 17.78 ? 58  LEU A CD2 1 
ATOM   383  N N   . VAL A 1 62  ? -34.847 -29.044 -17.010 1.00 17.91 ? 59  VAL A N   1 
ATOM   384  C CA  . VAL A 1 62  ? -35.107 -29.336 -15.594 1.00 18.43 ? 59  VAL A CA  1 
ATOM   385  C C   . VAL A 1 62  ? -36.582 -29.080 -15.311 1.00 17.93 ? 59  VAL A C   1 
ATOM   386  O O   . VAL A 1 62  ? -37.097 -27.976 -15.566 1.00 18.32 ? 59  VAL A O   1 
ATOM   387  C CB  . VAL A 1 62  ? -34.253 -28.467 -14.714 1.00 18.79 ? 59  VAL A CB  1 
ATOM   388  C CG1 . VAL A 1 62  ? -34.519 -28.779 -13.224 1.00 20.26 ? 59  VAL A CG1 1 
ATOM   389  C CG2 . VAL A 1 62  ? -32.745 -28.664 -15.034 1.00 20.71 ? 59  VAL A CG2 1 
ATOM   390  N N   . ILE A 1 63  ? -37.267 -30.109 -14.823 1.00 18.29 ? 60  ILE A N   1 
ATOM   391  C CA  . ILE A 1 63  ? -38.687 -30.035 -14.474 1.00 18.07 ? 60  ILE A CA  1 
ATOM   392  C C   . ILE A 1 63  ? -38.786 -29.958 -12.954 1.00 18.50 ? 60  ILE A C   1 
ATOM   393  O O   . ILE A 1 63  ? -38.409 -30.881 -12.241 1.00 19.45 ? 60  ILE A O   1 
ATOM   394  C CB  . ILE A 1 63  ? -39.464 -31.210 -14.978 1.00 17.17 ? 60  ILE A CB  1 
ATOM   395  C CG1 . ILE A 1 63  ? -39.305 -31.350 -16.498 1.00 17.47 ? 60  ILE A CG1 1 
ATOM   396  C CG2 . ILE A 1 63  ? -40.956 -31.037 -14.578 1.00 17.37 ? 60  ILE A CG2 1 
ATOM   397  C CD1 . ILE A 1 63  ? -40.146 -32.454 -17.140 1.00 18.50 ? 60  ILE A CD1 1 
ATOM   398  N N   . GLY A 1 64  ? -39.249 -28.821 -12.445 1.00 19.52 ? 61  GLY A N   1 
ATOM   399  C CA  . GLY A 1 64  ? -39.507 -28.646 -11.026 1.00 20.28 ? 61  GLY A CA  1 
ATOM   400  C C   . GLY A 1 64  ? -40.963 -28.956 -10.731 1.00 22.33 ? 61  GLY A C   1 
ATOM   401  O O   . GLY A 1 64  ? -41.814 -28.081 -10.652 1.00 23.67 ? 61  GLY A O   1 
ATOM   402  N N   . THR A 1 65  ? -41.267 -30.229 -10.634 1.00 22.69 ? 62  THR A N   1 
ATOM   403  C CA  . THR A 1 65  ? -42.646 -30.649 -10.412 1.00 23.04 ? 62  THR A CA  1 
ATOM   404  C C   . THR A 1 65  ? -42.743 -31.279 -9.019  1.00 23.58 ? 62  THR A C   1 
ATOM   405  O O   . THR A 1 65  ? -41.753 -31.555 -8.349  1.00 25.10 ? 62  THR A O   1 
ATOM   406  C CB  . THR A 1 65  ? -43.110 -31.588 -11.479 1.00 22.55 ? 62  THR A CB  1 
ATOM   407  O OG1 . THR A 1 65  ? -44.529 -31.812 -11.371 1.00 22.25 ? 62  THR A OG1 1 
ATOM   408  C CG2 . THR A 1 65  ? -42.375 -32.905 -11.412 1.00 20.91 ? 62  THR A CG2 1 
ATOM   409  N N   . SER A 1 66  ? -43.968 -31.544 -8.597  1.00 25.03 ? 63  SER A N   1 
ATOM   410  C CA  . SER A 1 66  ? -44.214 -32.228 -7.365  1.00 25.57 ? 63  SER A CA  1 
ATOM   411  C C   . SER A 1 66  ? -43.585 -33.605 -7.387  1.00 25.32 ? 63  SER A C   1 
ATOM   412  O O   . SER A 1 66  ? -43.567 -34.284 -8.423  1.00 23.24 ? 63  SER A O   1 
ATOM   413  C CB  . SER A 1 66  ? -45.742 -32.347 -7.159  1.00 26.65 ? 63  SER A CB  1 
ATOM   414  O OG  . SER A 1 66  ? -46.313 -31.046 -6.997  1.00 29.05 ? 63  SER A OG  1 
ATOM   415  N N   . GLU A 1 67  ? -43.087 -34.059 -6.244  1.00 25.99 ? 64  GLU A N   1 
ATOM   416  C CA  . GLU A 1 67  ? -42.412 -35.310 -6.150  1.00 26.75 ? 64  GLU A CA  1 
ATOM   417  C C   . GLU A 1 67  ? -43.215 -36.481 -6.730  1.00 26.95 ? 64  GLU A C   1 
ATOM   418  O O   . GLU A 1 67  ? -42.658 -37.329 -7.404  1.00 27.47 ? 64  GLU A O   1 
ATOM   419  C CB  . GLU A 1 67  ? -42.069 -35.572 -4.668  1.00 29.29 ? 64  GLU A CB  1 
ATOM   420  C CG  . GLU A 1 67  ? -41.748 -36.958 -4.312  1.00 34.05 ? 64  GLU A CG  1 
ATOM   421  C CD  . GLU A 1 67  ? -41.039 -37.029 -2.950  1.00 41.14 ? 64  GLU A CD  1 
ATOM   422  O OE1 . GLU A 1 67  ? -41.532 -36.409 -1.983  1.00 45.24 ? 64  GLU A OE1 1 
ATOM   423  O OE2 . GLU A 1 67  ? -39.994 -37.697 -2.860  1.00 45.69 ? 64  GLU A OE2 1 
ATOM   424  N N   . ASN A 1 68  ? -44.523 -36.516 -6.490  1.00 25.10 ? 65  ASN A N   1 
ATOM   425  C CA  . ASN A 1 68  ? -45.342 -37.634 -6.955  1.00 25.53 ? 65  ASN A CA  1 
ATOM   426  C C   . ASN A 1 68  ? -45.655 -37.582 -8.441  1.00 23.53 ? 65  ASN A C   1 
ATOM   427  O O   . ASN A 1 68  ? -46.149 -38.556 -9.012  1.00 23.35 ? 65  ASN A O   1 
ATOM   428  C CB  . ASN A 1 68  ? -46.636 -37.716 -6.152  1.00 26.86 ? 65  ASN A CB  1 
ATOM   429  C CG  . ASN A 1 68  ? -46.396 -38.072 -4.698  1.00 31.44 ? 65  ASN A CG  1 
ATOM   430  O OD1 . ASN A 1 68  ? -45.403 -38.732 -4.342  1.00 34.46 ? 65  ASN A OD1 1 
ATOM   431  N ND2 . ASN A 1 68  ? -47.280 -37.586 -3.832  1.00 36.56 ? 65  ASN A ND2 1 
ATOM   432  N N   . VAL A 1 69  ? -45.357 -36.462 -9.078  1.00 21.59 ? 66  VAL A N   1 
ATOM   433  C CA  . VAL A 1 69  ? -45.554 -36.314 -10.526 1.00 19.43 ? 66  VAL A CA  1 
ATOM   434  C C   . VAL A 1 69  ? -44.331 -36.830 -11.344 1.00 19.50 ? 66  VAL A C   1 
ATOM   435  O O   . VAL A 1 69  ? -44.446 -37.308 -12.485 1.00 19.77 ? 66  VAL A O   1 
ATOM   436  C CB  . VAL A 1 69  ? -45.874 -34.877 -10.884 1.00 19.44 ? 66  VAL A CB  1 
ATOM   437  C CG1 . VAL A 1 69  ? -46.027 -34.707 -12.456 1.00 19.28 ? 66  VAL A CG1 1 
ATOM   438  C CG2 . VAL A 1 69  ? -47.153 -34.415 -10.110 1.00 19.98 ? 66  VAL A CG2 1 
ATOM   439  N N   . ILE A 1 70  ? -43.150 -36.735 -10.733 1.00 19.98 ? 67  ILE A N   1 
ATOM   440  C CA  . ILE A 1 70  ? -41.914 -37.196 -11.401 1.00 18.40 ? 67  ILE A CA  1 
ATOM   441  C C   . ILE A 1 70  ? -42.033 -38.582 -12.045 1.00 18.14 ? 67  ILE A C   1 
ATOM   442  O O   . ILE A 1 70  ? -41.743 -38.729 -13.237 1.00 19.05 ? 67  ILE A O   1 
ATOM   443  C CB  . ILE A 1 70  ? -40.705 -37.118 -10.471 1.00 18.40 ? 67  ILE A CB  1 
ATOM   444  C CG1 . ILE A 1 70  ? -40.442 -35.671 -10.083 1.00 19.88 ? 67  ILE A CG1 1 
ATOM   445  C CG2 . ILE A 1 70  ? -39.448 -37.760 -11.103 1.00 19.03 ? 67  ILE A CG2 1 
ATOM   446  C CD1 . ILE A 1 70  ? -39.326 -35.461 -9.056  1.00 21.70 ? 67  ILE A CD1 1 
ATOM   447  N N   . PRO A 1 71  ? -42.460 -39.590 -11.295 1.00 19.66 ? 68  PRO A N   1 
ATOM   448  C CA  . PRO A 1 71  ? -42.519 -40.928 -11.870 1.00 19.71 ? 68  PRO A CA  1 
ATOM   449  C C   . PRO A 1 71  ? -43.492 -41.069 -13.058 1.00 20.24 ? 68  PRO A C   1 
ATOM   450  O O   . PRO A 1 71  ? -43.373 -42.022 -13.843 1.00 19.83 ? 68  PRO A O   1 
ATOM   451  C CB  . PRO A 1 71  ? -42.929 -41.815 -10.712 1.00 22.15 ? 68  PRO A CB  1 
ATOM   452  C CG  . PRO A 1 71  ? -43.494 -40.923 -9.737  1.00 21.82 ? 68  PRO A CG  1 
ATOM   453  C CD  . PRO A 1 71  ? -42.828 -39.613 -9.879  1.00 20.15 ? 68  PRO A CD  1 
ATOM   454  N N   . LEU A 1 72  ? -44.417 -40.134 -13.198 1.00 20.02 ? 69  LEU A N   1 
ATOM   455  C CA  . LEU A 1 72  ? -45.376 -40.140 -14.311 1.00 19.74 ? 69  LEU A CA  1 
ATOM   456  C C   . LEU A 1 72  ? -44.796 -39.594 -15.601 1.00 20.56 ? 69  LEU A C   1 
ATOM   457  O O   . LEU A 1 72  ? -45.361 -39.809 -16.677 1.00 22.41 ? 69  LEU A O   1 
ATOM   458  C CB  . LEU A 1 72  ? -46.639 -39.366 -13.908 1.00 18.68 ? 69  LEU A CB  1 
ATOM   459  C CG  . LEU A 1 72  ? -47.182 -39.739 -12.513 1.00 19.93 ? 69  LEU A CG  1 
ATOM   460  C CD1 . LEU A 1 72  ? -48.507 -38.983 -12.242 1.00 22.32 ? 69  LEU A CD1 1 
ATOM   461  C CD2 . LEU A 1 72  ? -47.332 -41.232 -12.379 1.00 21.23 ? 69  LEU A CD2 1 
ATOM   462  N N   . ILE A 1 73  ? -43.705 -38.840 -15.497 1.00 18.90 ? 70  ILE A N   1 
ATOM   463  C CA  . ILE A 1 73  ? -43.060 -38.236 -16.648 1.00 18.26 ? 70  ILE A CA  1 
ATOM   464  C C   . ILE A 1 73  ? -41.969 -39.118 -17.207 1.00 18.59 ? 70  ILE A C   1 
ATOM   465  O O   . ILE A 1 73  ? -41.835 -39.246 -18.409 1.00 18.36 ? 70  ILE A O   1 
ATOM   466  C CB  . ILE A 1 73  ? -42.465 -36.837 -16.266 1.00 18.29 ? 70  ILE A CB  1 
ATOM   467  C CG1 . ILE A 1 73  ? -43.585 -35.887 -15.825 1.00 18.39 ? 70  ILE A CG1 1 
ATOM   468  C CG2 . ILE A 1 73  ? -41.681 -36.227 -17.411 1.00 19.33 ? 70  ILE A CG2 1 
ATOM   469  C CD1 . ILE A 1 73  ? -43.069 -34.603 -15.155 1.00 20.72 ? 70  ILE A CD1 1 
ATOM   470  N N   . VAL A 1 74  ? -41.184 -39.705 -16.322 1.00 18.44 ? 71  VAL A N   1 
ATOM   471  C CA  . VAL A 1 74  ? -39.960 -40.415 -16.717 1.00 18.50 ? 71  VAL A CA  1 
ATOM   472  C C   . VAL A 1 74  ? -40.117 -41.425 -17.860 1.00 18.95 ? 71  VAL A C   1 
ATOM   473  O O   . VAL A 1 74  ? -39.356 -41.407 -18.809 1.00 18.34 ? 71  VAL A O   1 
ATOM   474  C CB  . VAL A 1 74  ? -39.281 -41.031 -15.474 1.00 19.24 ? 71  VAL A CB  1 
ATOM   475  C CG1 . VAL A 1 74  ? -38.044 -41.867 -15.909 1.00 18.87 ? 71  VAL A CG1 1 
ATOM   476  C CG2 . VAL A 1 74  ? -38.911 -39.948 -14.476 1.00 19.02 ? 71  VAL A CG2 1 
ATOM   477  N N   . PRO A 1 75  ? -41.119 -42.318 -17.797 1.00 18.90 ? 72  PRO A N   1 
ATOM   478  C CA  . PRO A 1 75  ? -41.187 -43.336 -18.872 1.00 19.68 ? 72  PRO A CA  1 
ATOM   479  C C   . PRO A 1 75  ? -41.470 -42.754 -20.234 1.00 19.26 ? 72  PRO A C   1 
ATOM   480  O O   . PRO A 1 75  ? -41.096 -43.367 -21.251 1.00 20.37 ? 72  PRO A O   1 
ATOM   481  C CB  . PRO A 1 75  ? -42.356 -44.221 -18.456 1.00 20.32 ? 72  PRO A CB  1 
ATOM   482  C CG  . PRO A 1 75  ? -42.700 -43.825 -17.059 1.00 22.68 ? 72  PRO A CG  1 
ATOM   483  C CD  . PRO A 1 75  ? -42.144 -42.503 -16.765 1.00 20.29 ? 72  PRO A CD  1 
ATOM   484  N N   . VAL A 1 76  ? -42.097 -41.581 -20.272 1.00 18.60 ? 73  VAL A N   1 
ATOM   485  C CA  . VAL A 1 76  ? -42.458 -40.935 -21.544 1.00 19.84 ? 73  VAL A CA  1 
ATOM   486  C C   . VAL A 1 76  ? -41.356 -39.957 -22.018 1.00 20.11 ? 73  VAL A C   1 
ATOM   487  O O   . VAL A 1 76  ? -41.078 -39.867 -23.235 1.00 20.81 ? 73  VAL A O   1 
ATOM   488  C CB  . VAL A 1 76  ? -43.810 -40.215 -21.443 1.00 20.90 ? 73  VAL A CB  1 
ATOM   489  C CG1 . VAL A 1 76  ? -44.173 -39.609 -22.760 1.00 22.89 ? 73  VAL A CG1 1 
ATOM   490  C CG2 . VAL A 1 76  ? -44.902 -41.232 -20.999 1.00 22.28 ? 73  VAL A CG2 1 
ATOM   491  N N   . LEU A 1 77  ? -40.685 -39.334 -21.047 1.00 18.06 ? 74  LEU A N   1 
ATOM   492  C CA  . LEU A 1 77  ? -39.703 -38.292 -21.316 1.00 17.97 ? 74  LEU A CA  1 
ATOM   493  C C   . LEU A 1 77  ? -38.462 -38.546 -20.445 1.00 17.46 ? 74  LEU A C   1 
ATOM   494  O O   . LEU A 1 77  ? -38.168 -37.781 -19.496 1.00 17.69 ? 74  LEU A O   1 
ATOM   495  C CB  . LEU A 1 77  ? -40.330 -36.920 -21.044 1.00 17.05 ? 74  LEU A CB  1 
ATOM   496  C CG  . LEU A 1 77  ? -39.498 -35.718 -21.521 1.00 18.10 ? 74  LEU A CG  1 
ATOM   497  C CD1 . LEU A 1 77  ? -39.254 -35.648 -23.052 1.00 20.28 ? 74  LEU A CD1 1 
ATOM   498  C CD2 . LEU A 1 77  ? -40.143 -34.397 -20.963 1.00 21.21 ? 74  LEU A CD2 1 
ATOM   499  N N   . PRO A 1 78  ? -37.735 -39.641 -20.733 1.00 17.82 ? 75  PRO A N   1 
ATOM   500  C CA  . PRO A 1 78  ? -36.598 -39.978 -19.840 1.00 17.33 ? 75  PRO A CA  1 
ATOM   501  C C   . PRO A 1 78  ? -35.409 -39.027 -20.022 1.00 18.46 ? 75  PRO A C   1 
ATOM   502  O O   . PRO A 1 78  ? -34.438 -39.105 -19.284 1.00 18.48 ? 75  PRO A O   1 
ATOM   503  C CB  . PRO A 1 78  ? -36.273 -41.411 -20.228 1.00 17.95 ? 75  PRO A CB  1 
ATOM   504  C CG  . PRO A 1 78  ? -36.717 -41.484 -21.714 1.00 18.05 ? 75  PRO A CG  1 
ATOM   505  C CD  . PRO A 1 78  ? -37.997 -40.700 -21.719 1.00 18.75 ? 75  PRO A CD  1 
ATOM   506  N N   . GLU A 1 79  ? -35.511 -38.109 -20.980 1.00 16.28 ? 76  GLU A N   1 
ATOM   507  C CA  . GLU A 1 79  ? -34.473 -37.124 -21.221 1.00 17.57 ? 76  GLU A CA  1 
ATOM   508  C C   . GLU A 1 79  ? -34.494 -35.938 -20.288 1.00 17.74 ? 76  GLU A C   1 
ATOM   509  O O   . GLU A 1 79  ? -33.502 -35.227 -20.220 1.00 18.17 ? 76  GLU A O   1 
ATOM   510  C CB  . GLU A 1 79  ? -34.581 -36.611 -22.678 1.00 17.72 ? 76  GLU A CB  1 
ATOM   511  C CG  . GLU A 1 79  ? -34.472 -37.711 -23.767 1.00 19.38 ? 76  GLU A CG  1 
ATOM   512  C CD  . GLU A 1 79  ? -35.733 -38.504 -24.032 1.00 19.49 ? 76  GLU A CD  1 
ATOM   513  O OE1 . GLU A 1 79  ? -36.824 -38.186 -23.489 1.00 18.94 ? 76  GLU A OE1 1 
ATOM   514  O OE2 . GLU A 1 79  ? -35.598 -39.473 -24.809 1.00 18.36 ? 76  GLU A OE2 1 
ATOM   515  N N   . ALA A 1 80  ? -35.608 -35.724 -19.581 1.00 17.52 ? 77  ALA A N   1 
ATOM   516  C CA  . ALA A 1 80  ? -35.718 -34.624 -18.612 1.00 17.23 ? 77  ALA A CA  1 
ATOM   517  C C   . ALA A 1 80  ? -35.035 -34.987 -17.321 1.00 17.84 ? 77  ALA A C   1 
ATOM   518  O O   . ALA A 1 80  ? -34.925 -36.170 -16.974 1.00 17.67 ? 77  ALA A O   1 
ATOM   519  C CB  . ALA A 1 80  ? -37.205 -34.301 -18.322 1.00 17.44 ? 77  ALA A CB  1 
ATOM   520  N N   . THR A 1 81  ? -34.519 -33.967 -16.658 1.00 18.58 ? 78  THR A N   1 
ATOM   521  C CA  . THR A 1 81  ? -34.067 -34.125 -15.269 1.00 20.21 ? 78  THR A CA  1 
ATOM   522  C C   . THR A 1 81  ? -34.979 -33.301 -14.376 1.00 19.26 ? 78  THR A C   1 
ATOM   523  O O   . THR A 1 81  ? -35.877 -32.596 -14.854 1.00 18.70 ? 78  THR A O   1 
ATOM   524  C CB  . THR A 1 81  ? -32.579 -33.739 -15.066 1.00 24.34 ? 78  THR A CB  1 
ATOM   525  O OG1 . THR A 1 81  ? -32.431 -32.373 -15.388 1.00 26.19 ? 78  THR A OG1 1 
ATOM   526  C CG2 . THR A 1 81  ? -31.677 -34.631 -15.956 1.00 27.36 ? 78  THR A CG2 1 
ATOM   527  N N   . TYR A 1 82  ? -34.765 -33.405 -13.057 1.00 20.31 ? 79  TYR A N   1 
ATOM   528  C CA  . TYR A 1 82  ? -35.773 -32.915 -12.075 1.00 21.93 ? 79  TYR A CA  1 
ATOM   529  C C   . TYR A 1 82  ? -35.175 -32.043 -10.967 1.00 23.13 ? 79  TYR A C   1 
ATOM   530  O O   . TYR A 1 82  ? -34.043 -32.240 -10.553 1.00 25.07 ? 79  TYR A O   1 
ATOM   531  C CB  . TYR A 1 82  ? -36.567 -34.097 -11.450 1.00 21.74 ? 79  TYR A CB  1 
ATOM   532  C CG  . TYR A 1 82  ? -37.240 -34.893 -12.512 1.00 19.25 ? 79  TYR A CG  1 
ATOM   533  C CD1 . TYR A 1 82  ? -38.439 -34.482 -13.041 1.00 19.41 ? 79  TYR A CD1 1 
ATOM   534  C CD2 . TYR A 1 82  ? -36.607 -35.978 -13.092 1.00 19.90 ? 79  TYR A CD2 1 
ATOM   535  C CE1 . TYR A 1 82  ? -39.014 -35.137 -14.069 1.00 20.54 ? 79  TYR A CE1 1 
ATOM   536  C CE2 . TYR A 1 82  ? -37.153 -36.625 -14.170 1.00 19.94 ? 79  TYR A CE2 1 
ATOM   537  C CZ  . TYR A 1 82  ? -38.371 -36.216 -14.642 1.00 20.13 ? 79  TYR A CZ  1 
ATOM   538  O OH  . TYR A 1 82  ? -38.969 -36.797 -15.719 1.00 20.50 ? 79  TYR A OH  1 
ATOM   539  N N   . TRP A 1 83  ? -35.979 -31.098 -10.494 1.00 22.28 ? 80  TRP A N   1 
ATOM   540  C CA  . TRP A 1 83  ? -35.767 -30.379 -9.277  1.00 23.95 ? 80  TRP A CA  1 
ATOM   541  C C   . TRP A 1 83  ? -36.987 -30.751 -8.442  1.00 23.57 ? 80  TRP A C   1 
ATOM   542  O O   . TRP A 1 83  ? -38.098 -30.281 -8.679  1.00 22.80 ? 80  TRP A O   1 
ATOM   543  C CB  . TRP A 1 83  ? -35.636 -28.884 -9.550  1.00 23.51 ? 80  TRP A CB  1 
ATOM   544  C CG  . TRP A 1 83  ? -35.456 -28.083 -8.295  1.00 24.36 ? 80  TRP A CG  1 
ATOM   545  C CD1 . TRP A 1 83  ? -34.946 -28.505 -7.106  1.00 27.77 ? 80  TRP A CD1 1 
ATOM   546  C CD2 . TRP A 1 83  ? -35.757 -26.710 -8.146  1.00 24.52 ? 80  TRP A CD2 1 
ATOM   547  N NE1 . TRP A 1 83  ? -34.935 -27.467 -6.203  1.00 28.46 ? 80  TRP A NE1 1 
ATOM   548  C CE2 . TRP A 1 83  ? -35.452 -26.353 -6.820  1.00 25.63 ? 80  TRP A CE2 1 
ATOM   549  C CE3 . TRP A 1 83  ? -36.322 -25.753 -8.987  1.00 25.29 ? 80  TRP A CE3 1 
ATOM   550  C CZ2 . TRP A 1 83  ? -35.645 -25.058 -6.342  1.00 27.62 ? 80  TRP A CZ2 1 
ATOM   551  C CZ3 . TRP A 1 83  ? -36.500 -24.457 -8.509  1.00 26.71 ? 80  TRP A CZ3 1 
ATOM   552  C CH2 . TRP A 1 83  ? -36.173 -24.133 -7.201  1.00 26.71 ? 80  TRP A CH2 1 
ATOM   553  N N   . ARG A 1 84  ? -36.791 -31.672 -7.502  1.00 24.66 ? 81  ARG A N   1 
ATOM   554  C CA  . ARG A 1 84  ? -37.907 -32.266 -6.787  1.00 25.43 ? 81  ARG A CA  1 
ATOM   555  C C   . ARG A 1 84  ? -38.671 -31.204 -6.010  1.00 25.52 ? 81  ARG A C   1 
ATOM   556  O O   . ARG A 1 84  ? -38.069 -30.458 -5.229  1.00 27.14 ? 81  ARG A O   1 
ATOM   557  C CB  . ARG A 1 84  ? -37.346 -33.332 -5.847  1.00 26.94 ? 81  ARG A CB  1 
ATOM   558  C CG  . ARG A 1 84  ? -38.317 -34.161 -5.077  1.00 30.24 ? 81  ARG A CG  1 
ATOM   559  C CD  . ARG A 1 84  ? -37.492 -35.284 -4.339  1.00 35.66 ? 81  ARG A CD  1 
ATOM   560  N NE  . ARG A 1 84  ? -36.929 -36.158 -5.374  1.00 38.86 ? 81  ARG A NE  1 
ATOM   561  C CZ  . ARG A 1 84  ? -37.541 -37.231 -5.876  1.00 42.14 ? 81  ARG A CZ  1 
ATOM   562  N NH1 . ARG A 1 84  ? -38.684 -37.668 -5.345  1.00 42.81 ? 81  ARG A NH1 1 
ATOM   563  N NH2 . ARG A 1 84  ? -36.995 -37.905 -6.895  1.00 41.92 ? 81  ARG A NH2 1 
ATOM   564  N N   . ASP A 1 85  ? -39.995 -31.143 -6.181  1.00 25.72 ? 82  ASP A N   1 
ATOM   565  C CA  . ASP A 1 85  ? -40.839 -30.075 -5.570  1.00 26.42 ? 82  ASP A CA  1 
ATOM   566  C C   . ASP A 1 85  ? -40.361 -28.661 -5.891  1.00 25.95 ? 82  ASP A C   1 
ATOM   567  O O   . ASP A 1 85  ? -40.549 -27.729 -5.108  1.00 27.17 ? 82  ASP A O   1 
ATOM   568  C CB  . ASP A 1 85  ? -40.922 -30.254 -4.047  1.00 28.19 ? 82  ASP A CB  1 
ATOM   569  C CG  . ASP A 1 85  ? -41.754 -31.448 -3.650  1.00 32.41 ? 82  ASP A CG  1 
ATOM   570  O OD1 . ASP A 1 85  ? -42.737 -31.769 -4.355  1.00 36.63 ? 82  ASP A OD1 1 
ATOM   571  O OD2 . ASP A 1 85  ? -41.438 -32.042 -2.616  1.00 40.46 ? 82  ASP A OD2 1 
ATOM   572  N N   . GLY A 1 86  ? -39.768 -28.489 -7.071  1.00 24.76 ? 83  GLY A N   1 
ATOM   573  C CA  . GLY A 1 86  ? -39.178 -27.235 -7.425  1.00 25.50 ? 83  GLY A CA  1 
ATOM   574  C C   . GLY A 1 86  ? -40.118 -26.034 -7.397  1.00 25.47 ? 83  GLY A C   1 
ATOM   575  O O   . GLY A 1 86  ? -39.718 -24.977 -6.909  1.00 25.13 ? 83  GLY A O   1 
ATOM   576  N N   . TRP A 1 87  ? -41.343 -26.178 -7.922  1.00 24.16 ? 84  TRP A N   1 
ATOM   577  C CA  . TRP A 1 87  ? -42.274 -25.045 -7.961  1.00 24.78 ? 84  TRP A CA  1 
ATOM   578  C C   . TRP A 1 87  ? -42.639 -24.609 -6.536  1.00 26.27 ? 84  TRP A C   1 
ATOM   579  O O   . TRP A 1 87  ? -42.912 -23.435 -6.290  1.00 27.27 ? 84  TRP A O   1 
ATOM   580  C CB  . TRP A 1 87  ? -43.530 -25.294 -8.787  1.00 24.72 ? 84  TRP A CB  1 
ATOM   581  C CG  . TRP A 1 87  ? -44.504 -26.324 -8.343  1.00 26.26 ? 84  TRP A CG  1 
ATOM   582  C CD1 . TRP A 1 87  ? -44.547 -27.651 -8.718  1.00 26.17 ? 84  TRP A CD1 1 
ATOM   583  C CD2 . TRP A 1 87  ? -45.655 -26.100 -7.510  1.00 24.54 ? 84  TRP A CD2 1 
ATOM   584  N NE1 . TRP A 1 87  ? -45.620 -28.267 -8.091  1.00 26.49 ? 84  TRP A NE1 1 
ATOM   585  C CE2 . TRP A 1 87  ? -46.329 -27.326 -7.383  1.00 26.63 ? 84  TRP A CE2 1 
ATOM   586  C CE3 . TRP A 1 87  ? -46.181 -24.963 -6.860  1.00 28.54 ? 84  TRP A CE3 1 
ATOM   587  C CZ2 . TRP A 1 87  ? -47.512 -27.465 -6.602  1.00 27.19 ? 84  TRP A CZ2 1 
ATOM   588  C CZ3 . TRP A 1 87  ? -47.372 -25.100 -6.093  1.00 28.68 ? 84  TRP A CZ3 1 
ATOM   589  C CH2 . TRP A 1 87  ? -48.008 -26.339 -5.980  1.00 28.38 ? 84  TRP A CH2 1 
ATOM   590  N N   . LYS A 1 88  ? -42.663 -25.554 -5.628  1.00 25.98 ? 85  LYS A N   1 
ATOM   591  C CA  . LYS A 1 88  ? -42.905 -25.225 -4.203  1.00 28.51 ? 85  LYS A CA  1 
ATOM   592  C C   . LYS A 1 88  ? -41.684 -24.569 -3.563  1.00 28.93 ? 85  LYS A C   1 
ATOM   593  O O   . LYS A 1 88  ? -41.825 -23.568 -2.850  1.00 29.42 ? 85  LYS A O   1 
ATOM   594  C CB  . LYS A 1 88  ? -43.320 -26.467 -3.423  1.00 29.97 ? 85  LYS A CB  1 
ATOM   595  C CG  . LYS A 1 88  ? -44.578 -27.135 -3.974  1.00 31.49 ? 85  LYS A CG  1 
ATOM   596  C CD  . LYS A 1 88  ? -44.964 -28.335 -3.115  1.00 35.56 ? 85  LYS A CD  1 
ATOM   597  C CE  . LYS A 1 88  ? -46.148 -29.095 -3.725  1.00 36.08 ? 85  LYS A CE  1 
ATOM   598  N NZ  . LYS A 1 88  ? -46.679 -30.174 -2.795  1.00 37.10 ? 85  LYS A NZ  1 
ATOM   599  N N   . LYS A 1 89  ? -40.498 -25.125 -3.799  1.00 27.95 ? 86  LYS A N   1 
ATOM   600  C CA  . LYS A 1 89  ? -39.244 -24.532 -3.301  1.00 28.86 ? 86  LYS A CA  1 
ATOM   601  C C   . LYS A 1 89  ? -38.984 -23.118 -3.822  1.00 28.93 ? 86  LYS A C   1 
ATOM   602  O O   . LYS A 1 89  ? -38.417 -22.279 -3.100  1.00 29.65 ? 86  LYS A O   1 
ATOM   603  C CB  . LYS A 1 89  ? -38.061 -25.442 -3.636  1.00 28.78 ? 86  LYS A CB  1 
ATOM   604  C CG  . LYS A 1 89  ? -38.120 -26.776 -2.927  1.00 30.57 ? 86  LYS A CG  1 
ATOM   605  C CD  . LYS A 1 89  ? -37.039 -27.720 -3.411  1.00 32.33 ? 86  LYS A CD  1 
ATOM   606  C CE  . LYS A 1 89  ? -36.992 -29.008 -2.637  1.00 36.14 ? 86  LYS A CE  1 
ATOM   607  N NZ  . LYS A 1 89  ? -36.084 -30.005 -3.324  1.00 38.15 ? 86  LYS A NZ  1 
ATOM   608  N N   . ALA A 1 90  ? -39.407 -22.850 -5.059  1.00 27.06 ? 87  ALA A N   1 
ATOM   609  C CA  . ALA A 1 90  ? -39.250 -21.524 -5.679  1.00 26.80 ? 87  ALA A CA  1 
ATOM   610  C C   . ALA A 1 90  ? -40.047 -20.442 -4.936  1.00 27.35 ? 87  ALA A C   1 
ATOM   611  O O   . ALA A 1 90  ? -39.722 -19.266 -5.008  1.00 27.37 ? 87  ALA A O   1 
ATOM   612  C CB  . ALA A 1 90  ? -39.634 -21.560 -7.186  1.00 26.69 ? 87  ALA A CB  1 
ATOM   613  N N   . ALA A 1 91  ? -41.065 -20.838 -4.179  1.00 28.22 ? 88  ALA A N   1 
ATOM   614  C CA  . ALA A 1 91  ? -41.806 -19.876 -3.347  1.00 28.92 ? 88  ALA A CA  1 
ATOM   615  C C   . ALA A 1 91  ? -40.949 -19.272 -2.225  1.00 30.36 ? 88  ALA A C   1 
ATOM   616  O O   . ALA A 1 91  ? -41.215 -18.161 -1.759  1.00 31.13 ? 88  ALA A O   1 
ATOM   617  C CB  . ALA A 1 91  ? -43.069 -20.563 -2.770  1.00 29.16 ? 88  ALA A CB  1 
ATOM   618  N N   . ASP A 1 92  ? -39.927 -20.010 -1.777  1.00 31.35 ? 89  ASP A N   1 
ATOM   619  C CA  . ASP A 1 92  ? -39.118 -19.626 -0.634  1.00 32.78 ? 89  ASP A CA  1 
ATOM   620  C C   . ASP A 1 92  ? -37.795 -18.943 -0.927  1.00 34.53 ? 89  ASP A C   1 
ATOM   621  O O   . ASP A 1 92  ? -37.234 -18.322 -0.059  1.00 35.66 ? 89  ASP A O   1 
ATOM   622  C CB  . ASP A 1 92  ? -38.885 -20.854 0.253   1.00 33.22 ? 89  ASP A CB  1 
ATOM   623  C CG  . ASP A 1 92  ? -40.175 -21.340 0.880   1.00 33.78 ? 89  ASP A CG  1 
ATOM   624  O OD1 . ASP A 1 92  ? -41.021 -20.477 1.141   1.00 31.98 ? 89  ASP A OD1 1 
ATOM   625  O OD2 . ASP A 1 92  ? -40.361 -22.562 1.071   1.00 35.20 ? 89  ASP A OD2 1 
ATOM   626  N N   . ALA A 1 93  ? -37.279 -19.021 -2.152  1.00 35.03 ? 90  ALA A N   1 
ATOM   627  C CA  . ALA A 1 93  ? -35.964 -18.411 -2.365  1.00 36.77 ? 90  ALA A CA  1 
ATOM   628  C C   . ALA A 1 93  ? -35.687 -18.234 -3.825  1.00 37.27 ? 90  ALA A C   1 
ATOM   629  O O   . ALA A 1 93  ? -36.345 -18.822 -4.650  1.00 35.35 ? 90  ALA A O   1 
ATOM   630  C CB  . ALA A 1 93  ? -34.855 -19.254 -1.717  1.00 37.89 ? 90  ALA A CB  1 
ATOM   631  N N   . GLN A 1 94  ? -34.724 -17.363 -4.091  1.00 39.73 ? 91  GLN A N   1 
ATOM   632  C CA  . GLN A 1 94  ? -34.293 -17.039 -5.438  1.00 40.33 ? 91  GLN A CA  1 
ATOM   633  C C   . GLN A 1 94  ? -33.656 -18.289 -5.983  1.00 39.31 ? 91  GLN A C   1 
ATOM   634  O O   . GLN A 1 94  ? -33.076 -19.070 -5.232  1.00 39.69 ? 91  GLN A O   1 
ATOM   635  C CB  . GLN A 1 94  ? -33.245 -15.904 -5.421  1.00 42.08 ? 91  GLN A CB  1 
ATOM   636  C CG  . GLN A 1 94  ? -33.497 -14.760 -4.434  1.00 47.75 ? 91  GLN A CG  1 
ATOM   637  C CD  . GLN A 1 94  ? -34.424 -13.706 -4.983  1.00 51.55 ? 91  GLN A CD  1 
ATOM   638  O OE1 . GLN A 1 94  ? -35.381 -14.009 -5.713  1.00 52.77 ? 91  GLN A OE1 1 
ATOM   639  N NE2 . GLN A 1 94  ? -34.141 -12.441 -4.641  1.00 53.48 ? 91  GLN A NE2 1 
ATOM   640  N N   . LEU A 1 95  ? -33.768 -18.494 -7.291  1.00 37.99 ? 92  LEU A N   1 
ATOM   641  C CA  . LEU A 1 95  ? -33.069 -19.585 -7.918  1.00 38.17 ? 92  LEU A CA  1 
ATOM   642  C C   . LEU A 1 95  ? -31.544 -19.364 -7.802  1.00 39.91 ? 92  LEU A C   1 
ATOM   643  O O   . LEU A 1 95  ? -31.067 -18.242 -7.973  1.00 40.53 ? 92  LEU A O   1 
ATOM   644  C CB  . LEU A 1 95  ? -33.490 -19.674 -9.386  1.00 36.42 ? 92  LEU A CB  1 
ATOM   645  C CG  . LEU A 1 95  ? -34.979 -19.910 -9.617  1.00 36.66 ? 92  LEU A CG  1 
ATOM   646  C CD1 . LEU A 1 95  ? -35.275 -19.874 -11.103 1.00 34.14 ? 92  LEU A CD1 1 
ATOM   647  C CD2 . LEU A 1 95  ? -35.427 -21.232 -9.000  1.00 36.00 ? 92  LEU A CD2 1 
ATOM   648  N N   . GLU A 1 96  ? -30.803 -20.434 -7.507  1.00 41.50 ? 93  GLU A N   1 
ATOM   649  C CA  . GLU A 1 96  ? -29.338 -20.390 -7.491  1.00 44.16 ? 93  GLU A CA  1 
ATOM   650  C C   . GLU A 1 96  ? -28.679 -20.799 -8.812  1.00 43.65 ? 93  GLU A C   1 
ATOM   651  O O   . GLU A 1 96  ? -27.530 -20.407 -9.070  1.00 45.86 ? 93  GLU A O   1 
ATOM   652  C CB  . GLU A 1 96  ? -28.793 -21.249 -6.340  1.00 45.69 ? 93  GLU A CB  1 
ATOM   653  C CG  . GLU A 1 96  ? -29.070 -20.647 -4.969  1.00 50.76 ? 93  GLU A CG  1 
ATOM   654  C CD  . GLU A 1 96  ? -28.571 -19.206 -4.841  1.00 56.14 ? 93  GLU A CD  1 
ATOM   655  O OE1 . GLU A 1 96  ? -29.358 -18.340 -4.393  1.00 61.01 ? 93  GLU A OE1 1 
ATOM   656  O OE2 . GLU A 1 96  ? -27.398 -18.930 -5.195  1.00 60.37 ? 93  GLU A OE2 1 
ATOM   657  N N   . GLU A 1 97  ? -29.387 -21.556 -9.645  1.00 41.54 ? 94  GLU A N   1 
ATOM   658  C CA  . GLU A 1 97  ? -28.849 -21.971 -10.949 1.00 40.97 ? 94  GLU A CA  1 
ATOM   659  C C   . GLU A 1 97  ? -29.315 -20.988 -12.014 1.00 38.77 ? 94  GLU A C   1 
ATOM   660  O O   . GLU A 1 97  ? -30.341 -20.317 -11.842 1.00 37.51 ? 94  GLU A O   1 
ATOM   661  C CB  . GLU A 1 97  ? -29.303 -23.388 -11.304 1.00 41.18 ? 94  GLU A CB  1 
ATOM   662  C CG  . GLU A 1 97  ? -28.859 -24.466 -10.299 1.00 45.37 ? 94  GLU A CG  1 
ATOM   663  C CD  . GLU A 1 97  ? -27.357 -24.718 -10.268 1.00 50.83 ? 94  GLU A CD  1 
ATOM   664  O OE1 . GLU A 1 97  ? -26.817 -24.909 -9.151  1.00 56.95 ? 94  GLU A OE1 1 
ATOM   665  O OE2 . GLU A 1 97  ? -26.714 -24.738 -11.341 1.00 54.80 ? 94  GLU A OE2 1 
ATOM   666  N N   . THR A 1 98  ? -28.548 -20.889 -13.098 1.00 37.09 ? 95  THR A N   1 
ATOM   667  C CA  . THR A 1 98  ? -28.859 -19.979 -14.193 1.00 35.57 ? 95  THR A CA  1 
ATOM   668  C C   . THR A 1 98  ? -29.562 -20.790 -15.279 1.00 31.54 ? 95  THR A C   1 
ATOM   669  O O   . THR A 1 98  ? -29.134 -21.889 -15.631 1.00 31.77 ? 95  THR A O   1 
ATOM   670  C CB  . THR A 1 98  ? -27.601 -19.359 -14.804 1.00 37.00 ? 95  THR A CB  1 
ATOM   671  O OG1 . THR A 1 98  ? -26.916 -18.597 -13.806 1.00 40.98 ? 95  THR A OG1 1 
ATOM   672  C CG2 . THR A 1 98  ? -27.960 -18.453 -15.999 1.00 38.99 ? 95  THR A CG2 1 
ATOM   673  N N   . TYR A 1 99  ? -30.645 -20.245 -15.803 1.00 27.39 ? 96  TYR A N   1 
ATOM   674  C CA  . TYR A 1 99  ? -31.385 -20.895 -16.855 1.00 25.14 ? 96  TYR A CA  1 
ATOM   675  C C   . TYR A 1 99  ? -31.474 -19.961 -18.024 1.00 23.76 ? 96  TYR A C   1 
ATOM   676  O O   . TYR A 1 99  ? -31.442 -18.728 -17.847 1.00 24.35 ? 96  TYR A O   1 
ATOM   677  C CB  . TYR A 1 99  ? -32.800 -21.241 -16.373 1.00 23.71 ? 96  TYR A CB  1 
ATOM   678  C CG  . TYR A 1 99  ? -32.745 -22.295 -15.318 1.00 23.74 ? 96  TYR A CG  1 
ATOM   679  C CD1 . TYR A 1 99  ? -32.555 -23.633 -15.655 1.00 26.06 ? 96  TYR A CD1 1 
ATOM   680  C CD2 . TYR A 1 99  ? -32.924 -21.981 -14.005 1.00 23.88 ? 96  TYR A CD2 1 
ATOM   681  C CE1 . TYR A 1 99  ? -32.484 -24.624 -14.664 1.00 25.06 ? 96  TYR A CE1 1 
ATOM   682  C CE2 . TYR A 1 99  ? -32.867 -22.948 -13.013 1.00 27.37 ? 96  TYR A CE2 1 
ATOM   683  C CZ  . TYR A 1 99  ? -32.659 -24.272 -13.363 1.00 26.12 ? 96  TYR A CZ  1 
ATOM   684  O OH  . TYR A 1 99  ? -32.596 -25.230 -12.368 1.00 29.39 ? 96  TYR A OH  1 
ATOM   685  N N   . ARG A 1 100 ? -31.589 -20.536 -19.221 1.00 22.97 ? 97  ARG A N   1 
ATOM   686  C CA  . ARG A 1 100 ? -31.775 -19.741 -20.422 1.00 23.05 ? 97  ARG A CA  1 
ATOM   687  C C   . ARG A 1 100 ? -33.187 -19.180 -20.523 1.00 22.04 ? 97  ARG A C   1 
ATOM   688  O O   . ARG A 1 100 ? -33.382 -18.115 -21.113 1.00 22.23 ? 97  ARG A O   1 
ATOM   689  C CB  . ARG A 1 100 ? -31.515 -20.581 -21.660 1.00 23.78 ? 97  ARG A CB  1 
ATOM   690  C CG  . ARG A 1 100 ? -31.524 -19.841 -22.998 1.00 25.18 ? 97  ARG A CG  1 
ATOM   691  C CD  . ARG A 1 100 ? -30.347 -18.947 -23.196 1.00 30.88 ? 97  ARG A CD  1 
ATOM   692  N NE  . ARG A 1 100 ? -29.081 -19.700 -23.142 1.00 34.61 ? 97  ARG A NE  1 
ATOM   693  C CZ  . ARG A 1 100 ? -28.556 -20.408 -24.143 1.00 33.59 ? 97  ARG A CZ  1 
ATOM   694  N NH1 . ARG A 1 100 ? -27.386 -21.028 -23.958 1.00 34.47 ? 97  ARG A NH1 1 
ATOM   695  N NH2 . ARG A 1 100 ? -29.141 -20.458 -25.350 1.00 33.89 ? 97  ARG A NH2 1 
ATOM   696  N N   . ALA A 1 101 ? -34.143 -19.931 -20.007 1.00 20.36 ? 98  ALA A N   1 
ATOM   697  C CA  . ALA A 1 101 ? -35.557 -19.531 -19.949 1.00 19.95 ? 98  ALA A CA  1 
ATOM   698  C C   . ALA A 1 101 ? -36.290 -20.354 -18.909 1.00 20.42 ? 98  ALA A C   1 
ATOM   699  O O   . ALA A 1 101 ? -35.851 -21.491 -18.573 1.00 20.14 ? 98  ALA A O   1 
ATOM   700  C CB  . ALA A 1 101 ? -36.240 -19.675 -21.309 1.00 19.34 ? 98  ALA A CB  1 
ATOM   701  N N   . ILE A 1 102 ? -37.381 -19.782 -18.393 1.00 19.97 ? 99  ILE A N   1 
ATOM   702  C CA  . ILE A 1 102 ? -38.190 -20.396 -17.333 1.00 19.27 ? 99  ILE A CA  1 
ATOM   703  C C   . ILE A 1 102 ? -39.665 -20.311 -17.708 1.00 18.68 ? 99  ILE A C   1 
ATOM   704  O O   . ILE A 1 102 ? -40.130 -19.269 -18.170 1.00 19.59 ? 99  ILE A O   1 
ATOM   705  C CB  . ILE A 1 102 ? -37.953 -19.754 -15.942 1.00 20.49 ? 99  ILE A CB  1 
ATOM   706  C CG1 . ILE A 1 102 ? -36.469 -19.788 -15.553 1.00 22.50 ? 99  ILE A CG1 1 
ATOM   707  C CG2 . ILE A 1 102 ? -38.837 -20.414 -14.895 1.00 21.29 ? 99  ILE A CG2 1 
ATOM   708  C CD1 . ILE A 1 102 ? -36.151 -18.917 -14.361 1.00 25.85 ? 99  ILE A CD1 1 
ATOM   709  N N   . ALA A 1 103 ? -40.384 -21.403 -17.515 1.00 17.73 ? 100 ALA A N   1 
ATOM   710  C CA  . ALA A 1 103 ? -41.855 -21.375 -17.568 1.00 17.79 ? 100 ALA A CA  1 
ATOM   711  C C   . ALA A 1 103 ? -42.441 -21.817 -16.227 1.00 18.94 ? 100 ALA A C   1 
ATOM   712  O O   . ALA A 1 103 ? -41.971 -22.793 -15.614 1.00 19.78 ? 100 ALA A O   1 
ATOM   713  C CB  . ALA A 1 103 ? -42.392 -22.287 -18.690 1.00 18.64 ? 100 ALA A CB  1 
ATOM   714  N N   . ILE A 1 104 ? -43.528 -21.163 -15.823 1.00 17.44 ? 101 ILE A N   1 
ATOM   715  C CA  . ILE A 1 104 ? -44.237 -21.494 -14.595 1.00 18.64 ? 101 ILE A CA  1 
ATOM   716  C C   . ILE A 1 104 ? -45.740 -21.467 -14.811 1.00 19.11 ? 101 ILE A C   1 
ATOM   717  O O   . ILE A 1 104 ? -46.257 -20.590 -15.524 1.00 18.69 ? 101 ILE A O   1 
ATOM   718  C CB  . ILE A 1 104 ? -43.816 -20.596 -13.402 1.00 20.46 ? 101 ILE A CB  1 
ATOM   719  C CG1 . ILE A 1 104 ? -44.554 -21.043 -12.130 1.00 20.26 ? 101 ILE A CG1 1 
ATOM   720  C CG2 . ILE A 1 104 ? -44.060 -19.116 -13.702 1.00 22.56 ? 101 ILE A CG2 1 
ATOM   721  C CD1 . ILE A 1 104 ? -43.947 -20.571 -10.748 1.00 25.74 ? 101 ILE A CD1 1 
ATOM   722  N N   . GLY A 1 105 ? -46.430 -22.460 -14.264 1.00 18.27 ? 102 GLY A N   1 
ATOM   723  C CA  . GLY A 1 105 ? -47.907 -22.440 -14.226 1.00 18.28 ? 102 GLY A CA  1 
ATOM   724  C C   . GLY A 1 105 ? -48.730 -23.637 -14.675 1.00 18.59 ? 102 GLY A C   1 
ATOM   725  O O   . GLY A 1 105 ? -49.795 -23.867 -14.078 1.00 19.40 ? 102 GLY A O   1 
ATOM   726  N N   . PRO A 1 106 ? -48.344 -24.281 -15.793 1.00 18.86 ? 103 PRO A N   1 
ATOM   727  C CA  . PRO A 1 106 ? -49.179 -25.390 -16.250 1.00 19.69 ? 103 PRO A CA  1 
ATOM   728  C C   . PRO A 1 106 ? -49.365 -26.411 -15.112 1.00 19.00 ? 103 PRO A C   1 
ATOM   729  O O   . PRO A 1 106 ? -48.413 -26.878 -14.481 1.00 19.30 ? 103 PRO A O   1 
ATOM   730  C CB  . PRO A 1 106 ? -48.423 -25.934 -17.450 1.00 20.12 ? 103 PRO A CB  1 
ATOM   731  C CG  . PRO A 1 106 ? -47.621 -24.746 -17.955 1.00 19.18 ? 103 PRO A CG  1 
ATOM   732  C CD  . PRO A 1 106 ? -47.207 -24.063 -16.686 1.00 19.80 ? 103 PRO A CD  1 
ATOM   733  N N   . GLY A 1 107 ? -50.611 -26.765 -14.870 1.00 20.09 ? 104 GLY A N   1 
ATOM   734  C CA  . GLY A 1 107 ? -50.928 -27.694 -13.783 1.00 20.10 ? 104 GLY A CA  1 
ATOM   735  C C   . GLY A 1 107 ? -50.706 -27.230 -12.365 1.00 21.85 ? 104 GLY A C   1 
ATOM   736  O O   . GLY A 1 107 ? -50.726 -28.043 -11.465 1.00 22.02 ? 104 GLY A O   1 
ATOM   737  N N   . LEU A 1 108 ? -50.476 -25.935 -12.161 1.00 20.40 ? 105 LEU A N   1 
ATOM   738  C CA  . LEU A 1 108 ? -50.351 -25.397 -10.832 1.00 21.58 ? 105 LEU A CA  1 
ATOM   739  C C   . LEU A 1 108 ? -51.640 -24.718 -10.423 1.00 22.73 ? 105 LEU A C   1 
ATOM   740  O O   . LEU A 1 108 ? -52.359 -24.136 -11.241 1.00 21.80 ? 105 LEU A O   1 
ATOM   741  C CB  . LEU A 1 108 ? -49.183 -24.402 -10.751 1.00 20.30 ? 105 LEU A CB  1 
ATOM   742  C CG  . LEU A 1 108 ? -47.794 -24.936 -11.141 1.00 19.68 ? 105 LEU A CG  1 
ATOM   743  C CD1 . LEU A 1 108 ? -46.701 -23.893 -10.828 1.00 19.80 ? 105 LEU A CD1 1 
ATOM   744  C CD2 . LEU A 1 108 ? -47.489 -26.294 -10.483 1.00 21.04 ? 105 LEU A CD2 1 
ATOM   745  N N   . PRO A 1 109 ? -51.937 -24.775 -9.136  1.00 24.08 ? 106 PRO A N   1 
ATOM   746  C CA  . PRO A 1 109 ? -53.123 -24.092 -8.598  1.00 25.17 ? 106 PRO A CA  1 
ATOM   747  C C   . PRO A 1 109 ? -52.983 -22.584 -8.617  1.00 25.44 ? 106 PRO A C   1 
ATOM   748  O O   . PRO A 1 109 ? -51.879 -22.061 -8.623  1.00 24.83 ? 106 PRO A O   1 
ATOM   749  C CB  . PRO A 1 109 ? -53.167 -24.586 -7.147  1.00 26.69 ? 106 PRO A CB  1 
ATOM   750  C CG  . PRO A 1 109 ? -51.792 -24.884 -6.795  1.00 25.60 ? 106 PRO A CG  1 
ATOM   751  C CD  . PRO A 1 109 ? -51.161 -25.430 -8.069  1.00 24.90 ? 106 PRO A CD  1 
ATOM   752  N N   . GLN A 1 110 ? -54.116 -21.881 -8.620  1.00 26.39 ? 107 GLN A N   1 
ATOM   753  C CA  . GLN A 1 110 ? -54.125 -20.427 -8.667  1.00 27.24 ? 107 GLN A CA  1 
ATOM   754  C C   . GLN A 1 110 ? -53.985 -19.885 -7.265  1.00 27.77 ? 107 GLN A C   1 
ATOM   755  O O   . GLN A 1 110 ? -54.932 -19.319 -6.739  1.00 29.32 ? 107 GLN A O   1 
ATOM   756  C CB  . GLN A 1 110 ? -55.459 -19.931 -9.245  1.00 28.88 ? 107 GLN A CB  1 
ATOM   757  C CG  . GLN A 1 110 ? -55.698 -20.398 -10.662 1.00 31.76 ? 107 GLN A CG  1 
ATOM   758  C CD  . GLN A 1 110 ? -57.159 -20.219 -11.104 1.00 37.66 ? 107 GLN A CD  1 
ATOM   759  O OE1 . GLN A 1 110 ? -57.810 -19.203 -10.800 1.00 40.39 ? 107 GLN A OE1 1 
ATOM   760  N NE2 . GLN A 1 110 ? -57.671 -21.211 -11.815 1.00 38.78 ? 107 GLN A NE2 1 
ATOM   761  N N   . THR A 1 111 ? -52.803 -20.007 -6.667  1.00 26.07 ? 108 THR A N   1 
ATOM   762  C CA  . THR A 1 111 ? -52.647 -19.666 -5.260  1.00 26.64 ? 108 THR A CA  1 
ATOM   763  C C   . THR A 1 111 ? -51.584 -18.570 -5.053  1.00 25.60 ? 108 THR A C   1 
ATOM   764  O O   . THR A 1 111 ? -50.761 -18.291 -5.926  1.00 24.50 ? 108 THR A O   1 
ATOM   765  C CB  . THR A 1 111 ? -52.206 -20.875 -4.453  1.00 26.26 ? 108 THR A CB  1 
ATOM   766  O OG1 . THR A 1 111 ? -50.964 -21.347 -4.970  1.00 25.43 ? 108 THR A OG1 1 
ATOM   767  C CG2 . THR A 1 111 ? -53.242 -22.004 -4.491  1.00 27.56 ? 108 THR A CG2 1 
ATOM   768  N N   . GLU A 1 112 ? -51.578 -18.014 -3.848  1.00 26.46 ? 109 GLU A N   1 
ATOM   769  C CA  . GLU A 1 112 ? -50.588 -17.052 -3.441  1.00 27.31 ? 109 GLU A CA  1 
ATOM   770  C C   . GLU A 1 112 ? -49.187 -17.640 -3.461  1.00 27.28 ? 109 GLU A C   1 
ATOM   771  O O   . GLU A 1 112 ? -48.243 -16.941 -3.819  1.00 27.18 ? 109 GLU A O   1 
ATOM   772  C CB  . GLU A 1 112 ? -50.918 -16.509 -2.030  1.00 28.61 ? 109 GLU A CB  1 
ATOM   773  C CG  . GLU A 1 112 ? -52.149 -15.610 -2.034  1.00 34.45 ? 109 GLU A CG  1 
ATOM   774  C CD  . GLU A 1 112 ? -52.521 -15.094 -0.653  1.00 41.97 ? 109 GLU A CD  1 
ATOM   775  O OE1 . GLU A 1 112 ? -51.626 -15.047 0.240   1.00 43.90 ? 109 GLU A OE1 1 
ATOM   776  O OE2 . GLU A 1 112 ? -53.719 -14.745 -0.471  1.00 46.89 ? 109 GLU A OE2 1 
ATOM   777  N N   . SER A 1 113 ? -49.046 -18.922 -3.119  1.00 27.42 ? 110 SER A N   1 
ATOM   778  C CA  . SER A 1 113 ? -47.717 -19.571 -3.091  1.00 27.46 ? 110 SER A CA  1 
ATOM   779  C C   . SER A 1 113 ? -47.121 -19.651 -4.493  1.00 25.31 ? 110 SER A C   1 
ATOM   780  O O   . SER A 1 113 ? -45.921 -19.519 -4.664  1.00 25.50 ? 110 SER A O   1 
ATOM   781  C CB  . SER A 1 113 ? -47.790 -20.980 -2.509  1.00 27.93 ? 110 SER A CB  1 
ATOM   782  O OG  . SER A 1 113 ? -48.205 -20.913 -1.177  1.00 32.57 ? 110 SER A OG  1 
ATOM   783  N N   . VAL A 1 114 ? -47.974 -19.858 -5.492  1.00 23.97 ? 111 VAL A N   1 
ATOM   784  C CA  . VAL A 1 114 ? -47.531 -19.862 -6.884  1.00 23.19 ? 111 VAL A CA  1 
ATOM   785  C C   . VAL A 1 114 ? -47.080 -18.450 -7.271  1.00 23.74 ? 111 VAL A C   1 
ATOM   786  O O   . VAL A 1 114 ? -46.056 -18.291 -7.929  1.00 23.23 ? 111 VAL A O   1 
ATOM   787  C CB  . VAL A 1 114 ? -48.610 -20.428 -7.814  1.00 22.75 ? 111 VAL A CB  1 
ATOM   788  C CG1 . VAL A 1 114 ? -48.219 -20.175 -9.269  1.00 21.69 ? 111 VAL A CG1 1 
ATOM   789  C CG2 . VAL A 1 114 ? -48.779 -21.937 -7.525  1.00 23.30 ? 111 VAL A CG2 1 
ATOM   790  N N   . GLN A 1 115 ? -47.783 -17.418 -6.794  1.00 24.55 ? 112 GLN A N   1 
ATOM   791  C CA  . GLN A 1 115 ? -47.345 -16.052 -7.066  1.00 25.39 ? 112 GLN A CA  1 
ATOM   792  C C   . GLN A 1 115 ? -46.017 -15.721 -6.376  1.00 25.39 ? 112 GLN A C   1 
ATOM   793  O O   . GLN A 1 115 ? -45.238 -14.928 -6.910  1.00 25.92 ? 112 GLN A O   1 
ATOM   794  C CB  . GLN A 1 115 ? -48.426 -15.032 -6.705  1.00 26.88 ? 112 GLN A CB  1 
ATOM   795  C CG  . GLN A 1 115 ? -49.662 -15.105 -7.577  1.00 26.08 ? 112 GLN A CG  1 
ATOM   796  C CD  . GLN A 1 115 ? -49.332 -14.872 -9.022  1.00 28.79 ? 112 GLN A CD  1 
ATOM   797  O OE1 . GLN A 1 115 ? -48.718 -13.856 -9.365  1.00 32.87 ? 112 GLN A OE1 1 
ATOM   798  N NE2 . GLN A 1 115 ? -49.693 -15.808 -9.874  1.00 25.28 ? 112 GLN A NE2 1 
ATOM   799  N N   . GLN A 1 116 ? -45.778 -16.265 -5.175  1.00 25.91 ? 113 GLN A N   1 
ATOM   800  C CA  . GLN A 1 116 ? -44.477 -16.126 -4.528  1.00 26.80 ? 113 GLN A CA  1 
ATOM   801  C C   . GLN A 1 116 ? -43.362 -16.744 -5.353  1.00 25.47 ? 113 GLN A C   1 
ATOM   802  O O   . GLN A 1 116 ? -42.268 -16.180 -5.445  1.00 25.31 ? 113 GLN A O   1 
ATOM   803  C CB  . GLN A 1 116 ? -44.480 -16.751 -3.124  1.00 29.03 ? 113 GLN A CB  1 
ATOM   804  C CG  . GLN A 1 116 ? -45.342 -16.004 -2.152  1.00 33.30 ? 113 GLN A CG  1 
ATOM   805  C CD  . GLN A 1 116 ? -44.708 -14.723 -1.633  1.00 41.99 ? 113 GLN A CD  1 
ATOM   806  O OE1 . GLN A 1 116 ? -45.046 -13.611 -2.087  1.00 46.66 ? 113 GLN A OE1 1 
ATOM   807  N NE2 . GLN A 1 116 ? -43.813 -14.862 -0.632  1.00 47.20 ? 113 GLN A NE2 1 
ATOM   808  N N   . ALA A 1 117 ? -43.621 -17.911 -5.937  1.00 24.16 ? 114 ALA A N   1 
ATOM   809  C CA  . ALA A 1 117 ? -42.652 -18.529 -6.847  1.00 23.98 ? 114 ALA A CA  1 
ATOM   810  C C   . ALA A 1 117 ? -42.431 -17.655 -8.100  1.00 23.88 ? 114 ALA A C   1 
ATOM   811  O O   . ALA A 1 117 ? -41.294 -17.463 -8.540  1.00 24.39 ? 114 ALA A O   1 
ATOM   812  C CB  . ALA A 1 117 ? -43.080 -19.947 -7.228  1.00 22.97 ? 114 ALA A CB  1 
ATOM   813  N N   . VAL A 1 118 ? -43.505 -17.116 -8.667  1.00 24.23 ? 115 VAL A N   1 
ATOM   814  C CA  . VAL A 1 118 ? -43.387 -16.158 -9.805  1.00 23.71 ? 115 VAL A CA  1 
ATOM   815  C C   . VAL A 1 118 ? -42.472 -14.998 -9.411  1.00 25.61 ? 115 VAL A C   1 
ATOM   816  O O   . VAL A 1 118 ? -41.515 -14.672 -10.113 1.00 25.01 ? 115 VAL A O   1 
ATOM   817  C CB  . VAL A 1 118 ? -44.766 -15.615 -10.235 1.00 23.40 ? 115 VAL A CB  1 
ATOM   818  C CG1 . VAL A 1 118 ? -44.636 -14.475 -11.254 1.00 23.89 ? 115 VAL A CG1 1 
ATOM   819  C CG2 . VAL A 1 118 ? -45.627 -16.734 -10.780 1.00 23.78 ? 115 VAL A CG2 1 
ATOM   820  N N   . ASP A 1 119 ? -42.683 -14.427 -8.220  1.00 25.33 ? 116 ASP A N   1 
ATOM   821  C CA  . ASP A 1 119 ? -41.885 -13.267 -7.797  1.00 27.11 ? 116 ASP A CA  1 
ATOM   822  C C   . ASP A 1 119 ? -40.411 -13.615 -7.743  1.00 27.82 ? 116 ASP A C   1 
ATOM   823  O O   . ASP A 1 119 ? -39.553 -12.811 -8.136  1.00 29.38 ? 116 ASP A O   1 
ATOM   824  C CB  . ASP A 1 119 ? -42.378 -12.730 -6.434  1.00 28.28 ? 116 ASP A CB  1 
ATOM   825  C CG  . ASP A 1 119 ? -43.723 -12.021 -6.551  1.00 31.47 ? 116 ASP A CG  1 
ATOM   826  O OD1 . ASP A 1 119 ? -44.142 -11.724 -7.684  1.00 35.44 ? 116 ASP A OD1 1 
ATOM   827  O OD2 . ASP A 1 119 ? -44.370 -11.783 -5.517  1.00 39.12 ? 116 ASP A OD2 1 
ATOM   828  N N   . HIS A 1 120 ? -40.102 -14.803 -7.234  1.00 27.56 ? 117 HIS A N   1 
ATOM   829  C CA  . HIS A 1 120 ? -38.729 -15.227 -7.150  1.00 29.04 ? 117 HIS A CA  1 
ATOM   830  C C   . HIS A 1 120 ? -38.116 -15.517 -8.504  1.00 28.99 ? 117 HIS A C   1 
ATOM   831  O O   . HIS A 1 120 ? -36.961 -15.168 -8.697  1.00 30.69 ? 117 HIS A O   1 
ATOM   832  C CB  . HIS A 1 120 ? -38.570 -16.436 -6.250  1.00 29.14 ? 117 HIS A CB  1 
ATOM   833  C CG  . HIS A 1 120 ? -38.688 -16.095 -4.813  1.00 32.15 ? 117 HIS A CG  1 
ATOM   834  N ND1 . HIS A 1 120 ? -37.832 -15.208 -4.202  1.00 39.51 ? 117 HIS A ND1 1 
ATOM   835  C CD2 . HIS A 1 120 ? -39.563 -16.498 -3.864  1.00 35.04 ? 117 HIS A CD2 1 
ATOM   836  C CE1 . HIS A 1 120 ? -38.173 -15.086 -2.929  1.00 39.29 ? 117 HIS A CE1 1 
ATOM   837  N NE2 . HIS A 1 120 ? -39.221 -15.861 -2.703  1.00 36.93 ? 117 HIS A NE2 1 
ATOM   838  N N   . VAL A 1 121 ? -38.858 -16.155 -9.390  1.00 28.70 ? 118 VAL A N   1 
ATOM   839  C CA  . VAL A 1 121 ? -38.382 -16.482 -10.744 1.00 29.39 ? 118 VAL A CA  1 
ATOM   840  C C   . VAL A 1 121 ? -38.062 -15.193 -11.524 1.00 29.50 ? 118 VAL A C   1 
ATOM   841  O O   . VAL A 1 121 ? -37.075 -15.145 -12.274 1.00 29.01 ? 118 VAL A O   1 
ATOM   842  C CB  . VAL A 1 121 ? -39.401 -17.384 -11.496 1.00 29.10 ? 118 VAL A CB  1 
ATOM   843  C CG1 . VAL A 1 121 ? -39.185 -17.397 -12.995 1.00 33.17 ? 118 VAL A CG1 1 
ATOM   844  C CG2 . VAL A 1 121 ? -39.398 -18.839 -10.877 1.00 30.07 ? 118 VAL A CG2 1 
ATOM   845  N N   . LEU A 1 122 ? -38.873 -14.162 -11.314 1.00 28.13 ? 119 LEU A N   1 
ATOM   846  C CA  . LEU A 1 122 ? -38.671 -12.887 -12.005 1.00 28.74 ? 119 LEU A CA  1 
ATOM   847  C C   . LEU A 1 122 ? -37.384 -12.147 -11.639 1.00 30.08 ? 119 LEU A C   1 
ATOM   848  O O   . LEU A 1 122 ? -36.973 -11.227 -12.373 1.00 29.28 ? 119 LEU A O   1 
ATOM   849  C CB  . LEU A 1 122 ? -39.878 -11.980 -11.821 1.00 28.80 ? 119 LEU A CB  1 
ATOM   850  C CG  . LEU A 1 122 ? -41.161 -12.481 -12.464 1.00 28.44 ? 119 LEU A CG  1 
ATOM   851  C CD1 . LEU A 1 122 ? -42.364 -11.600 -12.167 1.00 30.99 ? 119 LEU A CD1 1 
ATOM   852  C CD2 . LEU A 1 122 ? -40.994 -12.612 -14.007 1.00 30.40 ? 119 LEU A CD2 1 
ATOM   853  N N   . THR A 1 123 ? -36.744 -12.494 -10.515 1.00 30.71 ? 120 THR A N   1 
ATOM   854  C CA  . THR A 1 123 ? -35.446 -11.919 -10.214 1.00 33.05 ? 120 THR A CA  1 
ATOM   855  C C   . THR A 1 123 ? -34.307 -12.518 -11.057 1.00 33.18 ? 120 THR A C   1 
ATOM   856  O O   . THR A 1 123 ? -33.221 -11.938 -11.116 1.00 34.90 ? 120 THR A O   1 
ATOM   857  C CB  . THR A 1 123 ? -35.106 -12.009 -8.692  1.00 34.44 ? 120 THR A CB  1 
ATOM   858  O OG1 . THR A 1 123 ? -34.768 -13.354 -8.356  1.00 35.71 ? 120 THR A OG1 1 
ATOM   859  C CG2 . THR A 1 123 ? -36.278 -11.523 -7.848  1.00 35.56 ? 120 THR A CG2 1 
ATOM   860  N N   . ALA A 1 124 ? -34.538 -13.642 -11.729 1.00 32.58 ? 121 ALA A N   1 
ATOM   861  C CA  . ALA A 1 124 ? -33.565 -14.163 -12.706 1.00 32.93 ? 121 ALA A CA  1 
ATOM   862  C C   . ALA A 1 124 ? -33.482 -13.249 -13.949 1.00 33.97 ? 121 ALA A C   1 
ATOM   863  O O   . ALA A 1 124 ? -34.372 -12.421 -14.197 1.00 33.88 ? 121 ALA A O   1 
ATOM   864  C CB  . ALA A 1 124 ? -33.910 -15.616 -13.097 1.00 32.93 ? 121 ALA A CB  1 
ATOM   865  N N   . ASP A 1 125 ? -32.371 -13.347 -14.674 1.00 34.64 ? 122 ASP A N   1 
ATOM   866  C CA  . ASP A 1 125 ? -32.158 -12.576 -15.892 1.00 35.46 ? 122 ASP A CA  1 
ATOM   867  C C   . ASP A 1 125 ? -32.363 -13.554 -17.031 1.00 33.95 ? 122 ASP A C   1 
ATOM   868  O O   . ASP A 1 125 ? -31.387 -14.118 -17.551 1.00 37.10 ? 122 ASP A O   1 
ATOM   869  C CB  . ASP A 1 125 ? -30.731 -12.034 -16.008 1.00 37.87 ? 122 ASP A CB  1 
ATOM   870  C CG  . ASP A 1 125 ? -30.372 -11.032 -14.921 1.00 42.52 ? 122 ASP A CG  1 
ATOM   871  O OD1 . ASP A 1 125 ? -29.154 -10.791 -14.764 1.00 50.84 ? 122 ASP A OD1 1 
ATOM   872  O OD2 . ASP A 1 125 ? -31.261 -10.462 -14.243 1.00 46.11 ? 122 ASP A OD2 1 
ATOM   873  N N   . CYS A 1 126 ? -33.610 -13.816 -17.363 1.00 29.39 ? 123 CYS A N   1 
ATOM   874  C CA  . CYS A 1 126 ? -33.936 -14.630 -18.523 1.00 26.69 ? 123 CYS A CA  1 
ATOM   875  C C   . CYS A 1 126 ? -35.401 -14.388 -18.864 1.00 25.14 ? 123 CYS A C   1 
ATOM   876  O O   . CYS A 1 126 ? -36.154 -13.920 -18.012 1.00 23.41 ? 123 CYS A O   1 
ATOM   877  C CB  . CYS A 1 126 ? -33.721 -16.136 -18.261 1.00 26.28 ? 123 CYS A CB  1 
ATOM   878  S SG  . CYS A 1 126 ? -34.672 -16.774 -16.854 1.00 25.80 ? 123 CYS A SG  1 
ATOM   879  N N   . PRO A 1 127 ? -35.817 -14.755 -20.076 1.00 23.16 ? 124 PRO A N   1 
ATOM   880  C CA  . PRO A 1 127 ? -37.252 -14.742 -20.392 1.00 22.45 ? 124 PRO A CA  1 
ATOM   881  C C   . PRO A 1 127 ? -38.032 -15.687 -19.471 1.00 21.77 ? 124 PRO A C   1 
ATOM   882  O O   . PRO A 1 127 ? -37.540 -16.783 -19.126 1.00 20.42 ? 124 PRO A O   1 
ATOM   883  C CB  . PRO A 1 127 ? -37.312 -15.234 -21.818 1.00 23.15 ? 124 PRO A CB  1 
ATOM   884  C CG  . PRO A 1 127 ? -35.998 -15.108 -22.348 1.00 25.57 ? 124 PRO A CG  1 
ATOM   885  C CD  . PRO A 1 127 ? -35.031 -15.229 -21.226 1.00 24.34 ? 124 PRO A CD  1 
ATOM   886  N N   . VAL A 1 128 ? -39.225 -15.270 -19.063 1.00 21.11 ? 125 VAL A N   1 
ATOM   887  C CA  . VAL A 1 128 ? -40.064 -16.075 -18.198 1.00 21.32 ? 125 VAL A CA  1 
ATOM   888  C C   . VAL A 1 128 ? -41.457 -16.134 -18.811 1.00 21.00 ? 125 VAL A C   1 
ATOM   889  O O   . VAL A 1 128 ? -41.998 -15.092 -19.219 1.00 21.60 ? 125 VAL A O   1 
ATOM   890  C CB  . VAL A 1 128 ? -40.125 -15.464 -16.799 1.00 22.18 ? 125 VAL A CB  1 
ATOM   891  C CG1 . VAL A 1 128 ? -41.182 -16.182 -15.923 1.00 24.16 ? 125 VAL A CG1 1 
ATOM   892  C CG2 . VAL A 1 128 ? -38.738 -15.524 -16.142 1.00 21.51 ? 125 VAL A CG2 1 
ATOM   893  N N   . ILE A 1 129 ? -42.028 -17.334 -18.857 1.00 19.30 ? 126 ILE A N   1 
ATOM   894  C CA  . ILE A 1 129 ? -43.403 -17.568 -19.320 1.00 18.65 ? 126 ILE A CA  1 
ATOM   895  C C   . ILE A 1 129 ? -44.293 -17.889 -18.125 1.00 18.99 ? 126 ILE A C   1 
ATOM   896  O O   . ILE A 1 129 ? -43.945 -18.735 -17.280 1.00 18.94 ? 126 ILE A O   1 
ATOM   897  C CB  . ILE A 1 129 ? -43.480 -18.756 -20.310 1.00 18.09 ? 126 ILE A CB  1 
ATOM   898  C CG1 . ILE A 1 129 ? -42.499 -18.627 -21.454 1.00 18.45 ? 126 ILE A CG1 1 
ATOM   899  C CG2 . ILE A 1 129 ? -44.907 -18.989 -20.795 1.00 16.74 ? 126 ILE A CG2 1 
ATOM   900  C CD1 . ILE A 1 129 ? -42.101 -20.028 -22.042 1.00 20.60 ? 126 ILE A CD1 1 
ATOM   901  N N   . LEU A 1 130 ? -45.448 -17.224 -18.054 1.00 18.82 ? 127 LEU A N   1 
ATOM   902  C CA  . LEU A 1 130 ? -46.465 -17.498 -17.055 1.00 18.89 ? 127 LEU A CA  1 
ATOM   903  C C   . LEU A 1 130 ? -47.698 -17.981 -17.757 1.00 19.68 ? 127 LEU A C   1 
ATOM   904  O O   . LEU A 1 130 ? -48.149 -17.393 -18.735 1.00 19.78 ? 127 LEU A O   1 
ATOM   905  C CB  . LEU A 1 130 ? -46.831 -16.234 -16.247 1.00 20.02 ? 127 LEU A CB  1 
ATOM   906  C CG  . LEU A 1 130 ? -45.692 -15.421 -15.597 1.00 23.20 ? 127 LEU A CG  1 
ATOM   907  C CD1 . LEU A 1 130 ? -46.283 -14.276 -14.703 1.00 24.34 ? 127 LEU A CD1 1 
ATOM   908  C CD2 . LEU A 1 130 ? -44.733 -16.286 -14.830 1.00 25.98 ? 127 LEU A CD2 1 
ATOM   909  N N   . ASP A 1 131 ? -48.249 -19.079 -17.257 1.00 19.51 ? 128 ASP A N   1 
ATOM   910  C CA  . ASP A 1 131 ? -49.412 -19.725 -17.856 1.00 19.44 ? 128 ASP A CA  1 
ATOM   911  C C   . ASP A 1 131 ? -50.299 -20.268 -16.737 1.00 19.37 ? 128 ASP A C   1 
ATOM   912  O O   . ASP A 1 131 ? -49.859 -20.440 -15.601 1.00 18.59 ? 128 ASP A O   1 
ATOM   913  C CB  . ASP A 1 131 ? -48.955 -20.840 -18.801 1.00 19.31 ? 128 ASP A CB  1 
ATOM   914  C CG  . ASP A 1 131 ? -50.091 -21.517 -19.560 1.00 20.40 ? 128 ASP A CG  1 
ATOM   915  O OD1 . ASP A 1 131 ? -51.168 -20.911 -19.832 1.00 22.75 ? 128 ASP A OD1 1 
ATOM   916  O OD2 . ASP A 1 131 ? -49.910 -22.697 -19.920 1.00 21.89 ? 128 ASP A OD2 1 
ATOM   917  N N   . ALA A 1 132 ? -51.568 -20.485 -17.055 1.00 19.60 ? 129 ALA A N   1 
ATOM   918  C CA  . ALA A 1 132 ? -52.480 -21.268 -16.213 1.00 19.11 ? 129 ALA A CA  1 
ATOM   919  C C   . ALA A 1 132 ? -52.500 -20.743 -14.789 1.00 20.13 ? 129 ALA A C   1 
ATOM   920  O O   . ALA A 1 132 ? -52.876 -19.580 -14.591 1.00 21.16 ? 129 ALA A O   1 
ATOM   921  C CB  . ALA A 1 132 ? -52.123 -22.770 -16.290 1.00 19.20 ? 129 ALA A CB  1 
ATOM   922  N N   . GLY A 1 133 ? -52.102 -21.555 -13.806 1.00 20.94 ? 130 GLY A N   1 
ATOM   923  C CA  . GLY A 1 133 ? -52.214 -21.157 -12.406 1.00 21.48 ? 130 GLY A CA  1 
ATOM   924  C C   . GLY A 1 133 ? -51.339 -19.977 -12.002 1.00 21.49 ? 130 GLY A C   1 
ATOM   925  O O   . GLY A 1 133 ? -51.569 -19.354 -10.942 1.00 23.38 ? 130 GLY A O   1 
ATOM   926  N N   . ALA A 1 134 ? -50.328 -19.662 -12.829 1.00 19.70 ? 131 ALA A N   1 
ATOM   927  C CA  . ALA A 1 134 ? -49.453 -18.528 -12.570 1.00 20.42 ? 131 ALA A CA  1 
ATOM   928  C C   . ALA A 1 134 ? -50.024 -17.215 -13.094 1.00 21.82 ? 131 ALA A C   1 
ATOM   929  O O   . ALA A 1 134 ? -49.440 -16.152 -12.865 1.00 22.86 ? 131 ALA A O   1 
ATOM   930  C CB  . ALA A 1 134 ? -48.071 -18.783 -13.148 1.00 20.81 ? 131 ALA A CB  1 
ATOM   931  N N   . LEU A 1 135 ? -51.126 -17.292 -13.848 1.00 21.23 ? 132 LEU A N   1 
ATOM   932  C CA  . LEU A 1 135 ? -51.796 -16.085 -14.337 1.00 21.72 ? 132 LEU A CA  1 
ATOM   933  C C   . LEU A 1 135 ? -52.764 -15.498 -13.297 1.00 22.72 ? 132 LEU A C   1 
ATOM   934  O O   . LEU A 1 135 ? -53.686 -16.165 -12.811 1.00 23.90 ? 132 LEU A O   1 
ATOM   935  C CB  . LEU A 1 135 ? -52.500 -16.353 -15.673 1.00 21.03 ? 132 LEU A CB  1 
ATOM   936  C CG  . LEU A 1 135 ? -51.602 -16.697 -16.860 1.00 20.86 ? 132 LEU A CG  1 
ATOM   937  C CD1 . LEU A 1 135 ? -52.494 -17.156 -18.008 1.00 21.24 ? 132 LEU A CD1 1 
ATOM   938  C CD2 . LEU A 1 135 ? -50.677 -15.543 -17.284 1.00 22.65 ? 132 LEU A CD2 1 
ATOM   939  N N   . ALA A 1 136 ? -52.552 -14.228 -12.971 1.00 24.05 ? 133 ALA A N   1 
ATOM   940  C CA  . ALA A 1 136 ? -53.342 -13.533 -11.978 1.00 25.89 ? 133 ALA A CA  1 
ATOM   941  C C   . ALA A 1 136 ? -53.423 -12.059 -12.329 1.00 26.00 ? 133 ALA A C   1 
ATOM   942  O O   . ALA A 1 136 ? -52.668 -11.588 -13.163 1.00 26.39 ? 133 ALA A O   1 
ATOM   943  C CB  . ALA A 1 136 ? -52.696 -13.707 -10.639 1.00 26.84 ? 133 ALA A CB  1 
ATOM   944  N N   . LYS A 1 137 ? -54.337 -11.347 -11.675 1.00 27.74 ? 134 LYS A N   1 
ATOM   945  C CA  . LYS A 1 137 ? -54.374 -9.892  -11.746 1.00 28.77 ? 134 LYS A CA  1 
ATOM   946  C C   . LYS A 1 137 ? -53.221 -9.337  -10.924 1.00 29.18 ? 134 LYS A C   1 
ATOM   947  O O   . LYS A 1 137 ? -53.211 -9.467  -9.710  1.00 28.69 ? 134 LYS A O   1 
ATOM   948  C CB  . LYS A 1 137 ? -55.706 -9.380  -11.205 1.00 30.19 ? 134 LYS A CB  1 
ATOM   949  C CG  . LYS A 1 137 ? -55.891 -7.854  -11.271 1.00 34.80 ? 134 LYS A CG  1 
ATOM   950  C CD  . LYS A 1 137 ? -57.321 -7.461  -10.824 1.00 39.20 ? 134 LYS A CD  1 
ATOM   951  C CE  . LYS A 1 137 ? -58.401 -8.017  -11.791 1.00 41.41 ? 134 LYS A CE  1 
ATOM   952  N NZ  . LYS A 1 137 ? -59.836 -7.553  -11.545 1.00 45.14 ? 134 LYS A NZ  1 
ATOM   953  N N   . ARG A 1 138 ? -52.248 -8.712  -11.575 1.00 28.92 ? 135 ARG A N   1 
ATOM   954  C CA  . ARG A 1 138 ? -51.043 -8.256  -10.866 1.00 30.01 ? 135 ARG A CA  1 
ATOM   955  C C   . ARG A 1 138 ? -50.249 -7.321  -11.767 1.00 31.34 ? 135 ARG A C   1 
ATOM   956  O O   . ARG A 1 138 ? -50.594 -7.153  -12.943 1.00 30.85 ? 135 ARG A O   1 
ATOM   957  C CB  . ARG A 1 138 ? -50.174 -9.451  -10.436 1.00 30.24 ? 135 ARG A CB  1 
ATOM   958  C CG  . ARG A 1 138 ? -49.559 -10.230 -11.608 1.00 28.29 ? 135 ARG A CG  1 
ATOM   959  C CD  . ARG A 1 138 ? -48.431 -11.167 -11.164 1.00 29.91 ? 135 ARG A CD  1 
ATOM   960  N NE  . ARG A 1 138 ? -47.227 -10.424 -10.771 1.00 29.95 ? 135 ARG A NE  1 
ATOM   961  C CZ  . ARG A 1 138 ? -46.269 -10.869 -9.951  1.00 31.29 ? 135 ARG A CZ  1 
ATOM   962  N NH1 . ARG A 1 138 ? -46.346 -12.062 -9.375  1.00 29.57 ? 135 ARG A NH1 1 
ATOM   963  N NH2 . ARG A 1 138 ? -45.245 -10.082 -9.655  1.00 31.25 ? 135 ARG A NH2 1 
ATOM   964  N N   . THR A 1 139 ? -49.174 -6.734  -11.226 1.00 31.84 ? 136 THR A N   1 
ATOM   965  C CA  . THR A 1 139 ? -48.219 -5.999  -12.046 1.00 32.07 ? 136 THR A CA  1 
ATOM   966  C C   . THR A 1 139 ? -46.841 -6.679  -11.975 1.00 31.27 ? 136 THR A C   1 
ATOM   967  O O   . THR A 1 139 ? -46.657 -7.656  -11.237 1.00 31.12 ? 136 THR A O   1 
ATOM   968  C CB  . THR A 1 139 ? -48.125 -4.556  -11.603 1.00 34.00 ? 136 THR A CB  1 
ATOM   969  O OG1 . THR A 1 139 ? -47.621 -4.531  -10.270 1.00 33.87 ? 136 THR A OG1 1 
ATOM   970  C CG2 . THR A 1 139 ? -49.515 -3.893  -11.611 1.00 36.17 ? 136 THR A CG2 1 
ATOM   971  N N   . TYR A 1 140 ? -45.897 -6.176  -12.764 1.00 30.92 ? 137 TYR A N   1 
ATOM   972  C CA  . TYR A 1 140 ? -44.624 -6.873  -13.034 1.00 30.72 ? 137 TYR A CA  1 
ATOM   973  C C   . TYR A 1 140 ? -43.447 -5.926  -12.838 1.00 32.66 ? 137 TYR A C   1 
ATOM   974  O O   . TYR A 1 140 ? -43.534 -4.758  -13.197 1.00 32.95 ? 137 TYR A O   1 
ATOM   975  C CB  . TYR A 1 140 ? -44.606 -7.452  -14.463 1.00 29.66 ? 137 TYR A CB  1 
ATOM   976  C CG  . TYR A 1 140 ? -45.730 -8.452  -14.650 1.00 27.66 ? 137 TYR A CG  1 
ATOM   977  C CD1 . TYR A 1 140 ? -47.004 -8.029  -14.995 1.00 25.89 ? 137 TYR A CD1 1 
ATOM   978  C CD2 . TYR A 1 140 ? -45.547 -9.786  -14.343 1.00 27.10 ? 137 TYR A CD2 1 
ATOM   979  C CE1 . TYR A 1 140 ? -48.051 -8.930  -15.099 1.00 25.01 ? 137 TYR A CE1 1 
ATOM   980  C CE2 . TYR A 1 140 ? -46.586 -10.707 -14.466 1.00 25.36 ? 137 TYR A CE2 1 
ATOM   981  C CZ  . TYR A 1 140 ? -47.840 -10.274 -14.850 1.00 24.91 ? 137 TYR A CZ  1 
ATOM   982  O OH  . TYR A 1 140 ? -48.881 -11.191 -14.958 1.00 25.60 ? 137 TYR A OH  1 
ATOM   983  N N   . PRO A 1 141 ? -42.347 -6.431  -12.270 1.00 34.26 ? 138 PRO A N   1 
ATOM   984  C CA  . PRO A 1 141 ? -41.210 -5.571  -11.965 1.00 36.26 ? 138 PRO A CA  1 
ATOM   985  C C   . PRO A 1 141 ? -40.356 -5.287  -13.194 1.00 37.10 ? 138 PRO A C   1 
ATOM   986  O O   . PRO A 1 141 ? -40.213 -6.145  -14.078 1.00 34.96 ? 138 PRO A O   1 
ATOM   987  C CB  . PRO A 1 141 ? -40.418 -6.416  -10.978 1.00 36.54 ? 138 PRO A CB  1 
ATOM   988  C CG  . PRO A 1 141 ? -40.644 -7.815  -11.432 1.00 35.88 ? 138 PRO A CG  1 
ATOM   989  C CD  . PRO A 1 141 ? -42.011 -7.853  -12.072 1.00 33.85 ? 138 PRO A CD  1 
ATOM   990  N N   . LYS A 1 142 ? -39.730 -4.107  -13.233 1.00 38.57 ? 139 LYS A N   1 
ATOM   991  C CA  . LYS A 1 142 ? -38.789 -3.837  -14.314 1.00 39.31 ? 139 LYS A CA  1 
ATOM   992  C C   . LYS A 1 142 ? -37.676 -4.870  -14.184 1.00 38.60 ? 139 LYS A C   1 
ATOM   993  O O   . LYS A 1 142 ? -37.188 -5.104  -13.085 1.00 38.42 ? 139 LYS A O   1 
ATOM   994  C CB  . LYS A 1 142 ? -38.231 -2.408  -14.219 1.00 41.42 ? 139 LYS A CB  1 
ATOM   995  C CG  . LYS A 1 142 ? -36.975 -2.141  -15.064 1.00 44.57 ? 139 LYS A CG  1 
ATOM   996  C CD  . LYS A 1 142 ? -37.231 -2.215  -16.568 1.00 47.99 ? 139 LYS A CD  1 
ATOM   997  C CE  . LYS A 1 142 ? -35.946 -1.915  -17.379 1.00 50.95 ? 139 LYS A CE  1 
ATOM   998  N NZ  . LYS A 1 142 ? -35.034 -3.105  -17.427 1.00 51.52 ? 139 LYS A NZ  1 
ATOM   999  N N   . ARG A 1 143 ? -37.308 -5.528  -15.281 1.00 38.35 ? 140 ARG A N   1 
ATOM   1000 C CA  . ARG A 1 143 ? -36.282 -6.575  -15.208 1.00 37.87 ? 140 ARG A CA  1 
ATOM   1001 C C   . ARG A 1 143 ? -35.579 -6.771  -16.532 1.00 39.18 ? 140 ARG A C   1 
ATOM   1002 O O   . ARG A 1 143 ? -36.023 -6.249  -17.544 1.00 39.25 ? 140 ARG A O   1 
ATOM   1003 C CB  . ARG A 1 143 ? -36.919 -7.885  -14.762 1.00 36.52 ? 140 ARG A CB  1 
ATOM   1004 C CG  . ARG A 1 143 ? -37.881 -8.475  -15.781 1.00 32.55 ? 140 ARG A CG  1 
ATOM   1005 C CD  . ARG A 1 143 ? -38.648 -9.673  -15.238 1.00 29.00 ? 140 ARG A CD  1 
ATOM   1006 N NE  . ARG A 1 143 ? -37.808 -10.848 -14.965 1.00 25.85 ? 140 ARG A NE  1 
ATOM   1007 C CZ  . ARG A 1 143 ? -37.525 -11.826 -15.831 1.00 27.69 ? 140 ARG A CZ  1 
ATOM   1008 N NH1 . ARG A 1 143 ? -36.767 -12.830 -15.428 1.00 26.69 ? 140 ARG A NH1 1 
ATOM   1009 N NH2 . ARG A 1 143 ? -37.972 -11.826 -17.091 1.00 24.45 ? 140 ARG A NH2 1 
ATOM   1010 N N   . GLU A 1 144 ? -34.494 -7.546  -16.530 1.00 40.84 ? 141 GLU A N   1 
ATOM   1011 C CA  . GLU A 1 144 ? -33.966 -8.023  -17.794 1.00 41.71 ? 141 GLU A CA  1 
ATOM   1012 C C   . GLU A 1 144 ? -34.644 -9.335  -18.102 1.00 39.78 ? 141 GLU A C   1 
ATOM   1013 O O   . GLU A 1 144 ? -34.688 -10.299 -17.274 1.00 40.96 ? 141 GLU A O   1 
ATOM   1014 C CB  . GLU A 1 144 ? -32.447 -8.147  -17.923 1.00 43.71 ? 141 GLU A CB  1 
ATOM   1015 C CG  . GLU A 1 144 ? -31.606 -8.135  -16.678 1.00 48.21 ? 141 GLU A CG  1 
ATOM   1016 C CD  . GLU A 1 144 ? -30.136 -8.336  -17.033 1.00 54.06 ? 141 GLU A CD  1 
ATOM   1017 O OE1 . GLU A 1 144 ? -29.288 -7.598  -16.492 1.00 60.77 ? 141 GLU A OE1 1 
ATOM   1018 O OE2 . GLU A 1 144 ? -29.836 -9.219  -17.881 1.00 58.33 ? 141 GLU A OE2 1 
ATOM   1019 N N   . GLY A 1 145 ? -35.182 -9.326  -19.304 1.00 35.95 ? 142 GLY A N   1 
ATOM   1020 C CA  . GLY A 1 145 ? -35.796 -10.453 -19.901 1.00 32.89 ? 142 GLY A CA  1 
ATOM   1021 C C   . GLY A 1 145 ? -37.285 -10.186 -19.995 1.00 30.28 ? 142 GLY A C   1 
ATOM   1022 O O   . GLY A 1 145 ? -37.909 -9.673  -19.043 1.00 28.47 ? 142 GLY A O   1 
ATOM   1023 N N   . PRO A 1 146 ? -37.877 -10.587 -21.107 1.00 26.05 ? 143 PRO A N   1 
ATOM   1024 C CA  . PRO A 1 146 ? -39.314 -10.462 -21.279 1.00 23.92 ? 143 PRO A CA  1 
ATOM   1025 C C   . PRO A 1 146 ? -40.105 -11.393 -20.358 1.00 23.03 ? 143 PRO A C   1 
ATOM   1026 O O   . PRO A 1 146 ? -39.609 -12.457 -19.937 1.00 22.44 ? 143 PRO A O   1 
ATOM   1027 C CB  . PRO A 1 146 ? -39.533 -10.859 -22.743 1.00 25.53 ? 143 PRO A CB  1 
ATOM   1028 C CG  . PRO A 1 146 ? -38.353 -11.689 -23.069 1.00 26.78 ? 143 PRO A CG  1 
ATOM   1029 C CD  . PRO A 1 146 ? -37.229 -11.243 -22.259 1.00 27.09 ? 143 PRO A CD  1 
ATOM   1030 N N   . VAL A 1 147 ? -41.318 -10.954 -20.027 1.00 21.35 ? 144 VAL A N   1 
ATOM   1031 C CA  . VAL A 1 147 ? -42.282 -11.785 -19.341 1.00 21.59 ? 144 VAL A CA  1 
ATOM   1032 C C   . VAL A 1 147 ? -43.359 -12.067 -20.355 1.00 20.67 ? 144 VAL A C   1 
ATOM   1033 O O   . VAL A 1 147 ? -43.886 -11.152 -20.982 1.00 21.96 ? 144 VAL A O   1 
ATOM   1034 C CB  . VAL A 1 147 ? -42.866 -11.082 -18.132 1.00 21.60 ? 144 VAL A CB  1 
ATOM   1035 C CG1 . VAL A 1 147 ? -43.987 -11.923 -17.482 1.00 24.02 ? 144 VAL A CG1 1 
ATOM   1036 C CG2 . VAL A 1 147 ? -41.760 -10.741 -17.124 1.00 23.46 ? 144 VAL A CG2 1 
ATOM   1037 N N   . ILE A 1 148 ? -43.679 -13.340 -20.545 1.00 19.73 ? 145 ILE A N   1 
ATOM   1038 C CA  . ILE A 1 148 ? -44.609 -13.764 -21.587 1.00 19.81 ? 145 ILE A CA  1 
ATOM   1039 C C   . ILE A 1 148 ? -45.813 -14.452 -20.925 1.00 19.49 ? 145 ILE A C   1 
ATOM   1040 O O   . ILE A 1 148 ? -45.664 -15.506 -20.299 1.00 20.79 ? 145 ILE A O   1 
ATOM   1041 C CB  . ILE A 1 148 ? -43.904 -14.746 -22.573 1.00 19.53 ? 145 ILE A CB  1 
ATOM   1042 C CG1 . ILE A 1 148 ? -42.711 -14.081 -23.237 1.00 19.87 ? 145 ILE A CG1 1 
ATOM   1043 C CG2 . ILE A 1 148 ? -44.911 -15.292 -23.634 1.00 20.15 ? 145 ILE A CG2 1 
ATOM   1044 C CD1 . ILE A 1 148 ? -41.548 -15.065 -23.480 1.00 21.39 ? 145 ILE A CD1 1 
ATOM   1045 N N   . LEU A 1 149 ? -46.988 -13.862 -21.087 1.00 19.19 ? 146 LEU A N   1 
ATOM   1046 C CA  . LEU A 1 149 ? -48.237 -14.382 -20.526 1.00 19.49 ? 146 LEU A CA  1 
ATOM   1047 C C   . LEU A 1 149 ? -49.010 -15.092 -21.623 1.00 19.43 ? 146 LEU A C   1 
ATOM   1048 O O   . LEU A 1 149 ? -49.121 -14.554 -22.751 1.00 19.68 ? 146 LEU A O   1 
ATOM   1049 C CB  . LEU A 1 149 ? -49.078 -13.235 -19.958 1.00 20.58 ? 146 LEU A CB  1 
ATOM   1050 C CG  . LEU A 1 149 ? -48.400 -12.258 -19.016 1.00 20.79 ? 146 LEU A CG  1 
ATOM   1051 C CD1 . LEU A 1 149 ? -49.451 -11.224 -18.551 1.00 21.46 ? 146 LEU A CD1 1 
ATOM   1052 C CD2 . LEU A 1 149 ? -47.735 -12.946 -17.791 1.00 19.91 ? 146 LEU A CD2 1 
ATOM   1053 N N   . THR A 1 150 ? -49.562 -16.284 -21.326 1.00 20.00 ? 147 THR A N   1 
ATOM   1054 C CA  . THR A 1 150 ? -50.278 -17.067 -22.339 1.00 19.32 ? 147 THR A CA  1 
ATOM   1055 C C   . THR A 1 150 ? -51.739 -17.381 -21.926 1.00 19.17 ? 147 THR A C   1 
ATOM   1056 O O   . THR A 1 150 ? -52.125 -18.551 -21.832 1.00 19.56 ? 147 THR A O   1 
ATOM   1057 C CB  . THR A 1 150 ? -49.534 -18.364 -22.696 1.00 19.57 ? 147 THR A CB  1 
ATOM   1058 O OG1 . THR A 1 150 ? -49.552 -19.263 -21.582 1.00 21.93 ? 147 THR A OG1 1 
ATOM   1059 C CG2 . THR A 1 150 ? -48.047 -18.087 -23.140 1.00 20.20 ? 147 THR A CG2 1 
ATOM   1060 N N   . PRO A 1 151 ? -52.565 -16.344 -21.741 1.00 19.31 ? 148 PRO A N   1 
ATOM   1061 C CA  . PRO A 1 151 ? -53.958 -16.583 -21.335 1.00 20.84 ? 148 PRO A CA  1 
ATOM   1062 C C   . PRO A 1 151 ? -54.922 -17.026 -22.455 1.00 21.28 ? 148 PRO A C   1 
ATOM   1063 O O   . PRO A 1 151 ? -54.849 -16.520 -23.583 1.00 22.21 ? 148 PRO A O   1 
ATOM   1064 C CB  . PRO A 1 151 ? -54.417 -15.206 -20.838 1.00 20.46 ? 148 PRO A CB  1 
ATOM   1065 C CG  . PRO A 1 151 ? -53.647 -14.242 -21.701 1.00 19.97 ? 148 PRO A CG  1 
ATOM   1066 C CD  . PRO A 1 151 ? -52.270 -14.900 -21.802 1.00 19.15 ? 148 PRO A CD  1 
ATOM   1067 N N   . HIS A 1 152 ? -55.817 -17.968 -22.122 1.00 22.23 ? 149 HIS A N   1 
ATOM   1068 C CA  . HIS A 1 152 ? -57.101 -18.140 -22.829 1.00 23.72 ? 149 HIS A CA  1 
ATOM   1069 C C   . HIS A 1 152 ? -57.969 -16.938 -22.442 1.00 24.32 ? 149 HIS A C   1 
ATOM   1070 O O   . HIS A 1 152 ? -57.679 -16.241 -21.473 1.00 24.18 ? 149 HIS A O   1 
ATOM   1071 C CB  . HIS A 1 152 ? -57.851 -19.407 -22.378 1.00 25.70 ? 149 HIS A CB  1 
ATOM   1072 C CG  . HIS A 1 152 ? -57.232 -20.701 -22.794 1.00 30.58 ? 149 HIS A CG  1 
ATOM   1073 N ND1 . HIS A 1 152 ? -57.367 -21.221 -24.069 1.00 34.08 ? 149 HIS A ND1 1 
ATOM   1074 C CD2 . HIS A 1 152 ? -56.567 -21.644 -22.072 1.00 33.23 ? 149 HIS A CD2 1 
ATOM   1075 C CE1 . HIS A 1 152 ? -56.759 -22.397 -24.128 1.00 36.78 ? 149 HIS A CE1 1 
ATOM   1076 N NE2 . HIS A 1 152 ? -56.268 -22.679 -22.932 1.00 35.39 ? 149 HIS A NE2 1 
ATOM   1077 N N   . PRO A 1 153 ? -59.054 -16.678 -23.183 1.00 25.69 ? 150 PRO A N   1 
ATOM   1078 C CA  . PRO A 1 153 ? -59.882 -15.513 -22.860 1.00 26.43 ? 150 PRO A CA  1 
ATOM   1079 C C   . PRO A 1 153 ? -60.373 -15.471 -21.406 1.00 26.52 ? 150 PRO A C   1 
ATOM   1080 O O   . PRO A 1 153 ? -60.379 -14.406 -20.800 1.00 27.54 ? 150 PRO A O   1 
ATOM   1081 C CB  . PRO A 1 153 ? -61.028 -15.623 -23.858 1.00 27.92 ? 150 PRO A CB  1 
ATOM   1082 C CG  . PRO A 1 153 ? -60.382 -16.226 -25.080 1.00 27.50 ? 150 PRO A CG  1 
ATOM   1083 C CD  . PRO A 1 153 ? -59.397 -17.251 -24.501 1.00 26.37 ? 150 PRO A CD  1 
ATOM   1084 N N   . GLY A 1 154 ? -60.742 -16.606 -20.827 1.00 26.50 ? 151 GLY A N   1 
ATOM   1085 C CA  . GLY A 1 154 ? -61.122 -16.636 -19.420 1.00 27.02 ? 151 GLY A CA  1 
ATOM   1086 C C   . GLY A 1 154 ? -60.027 -16.222 -18.460 1.00 26.48 ? 151 GLY A C   1 
ATOM   1087 O O   . GLY A 1 154 ? -60.281 -15.549 -17.471 1.00 27.10 ? 151 GLY A O   1 
ATOM   1088 N N   . GLU A 1 155 ? -58.792 -16.600 -18.769 1.00 24.96 ? 152 GLU A N   1 
ATOM   1089 C CA  . GLU A 1 155 ? -57.657 -16.191 -17.951 1.00 23.94 ? 152 GLU A CA  1 
ATOM   1090 C C   . GLU A 1 155 ? -57.366 -14.687 -18.133 1.00 23.82 ? 152 GLU A C   1 
ATOM   1091 O O   . GLU A 1 155 ? -56.957 -14.001 -17.217 1.00 24.30 ? 152 GLU A O   1 
ATOM   1092 C CB  . GLU A 1 155 ? -56.430 -17.042 -18.295 1.00 23.42 ? 152 GLU A CB  1 
ATOM   1093 C CG  . GLU A 1 155 ? -56.592 -18.500 -17.843 1.00 23.81 ? 152 GLU A CG  1 
ATOM   1094 C CD  . GLU A 1 155 ? -55.649 -19.495 -18.463 1.00 23.23 ? 152 GLU A CD  1 
ATOM   1095 O OE1 . GLU A 1 155 ? -55.254 -19.315 -19.630 1.00 23.87 ? 152 GLU A OE1 1 
ATOM   1096 O OE2 . GLU A 1 155 ? -55.352 -20.518 -17.797 1.00 24.18 ? 152 GLU A OE2 1 
ATOM   1097 N N   . PHE A 1 156 ? -57.573 -14.183 -19.346 1.00 22.63 ? 153 PHE A N   1 
ATOM   1098 C CA  . PHE A 1 156 ? -57.446 -12.755 -19.615 1.00 23.40 ? 153 PHE A CA  1 
ATOM   1099 C C   . PHE A 1 156 ? -58.446 -11.949 -18.787 1.00 25.69 ? 153 PHE A C   1 
ATOM   1100 O O   . PHE A 1 156 ? -58.100 -10.896 -18.232 1.00 26.37 ? 153 PHE A O   1 
ATOM   1101 C CB  . PHE A 1 156 ? -57.572 -12.482 -21.124 1.00 22.95 ? 153 PHE A CB  1 
ATOM   1102 C CG  . PHE A 1 156 ? -57.201 -11.069 -21.531 1.00 23.07 ? 153 PHE A CG  1 
ATOM   1103 C CD1 . PHE A 1 156 ? -58.112 -10.044 -21.458 1.00 27.10 ? 153 PHE A CD1 1 
ATOM   1104 C CD2 . PHE A 1 156 ? -55.926 -10.785 -22.012 1.00 24.42 ? 153 PHE A CD2 1 
ATOM   1105 C CE1 . PHE A 1 156 ? -57.767 -8.752  -21.833 1.00 24.89 ? 153 PHE A CE1 1 
ATOM   1106 C CE2 . PHE A 1 156 ? -55.594 -9.493  -22.399 1.00 23.69 ? 153 PHE A CE2 1 
ATOM   1107 C CZ  . PHE A 1 156 ? -56.503 -8.491  -22.309 1.00 25.68 ? 153 PHE A CZ  1 
ATOM   1108 N N   . PHE A 1 157 ? -59.679 -12.446 -18.684 1.00 27.03 ? 154 PHE A N   1 
ATOM   1109 C CA  . PHE A 1 157 ? -60.676 -11.853 -17.790 1.00 29.04 ? 154 PHE A CA  1 
ATOM   1110 C C   . PHE A 1 157 ? -60.173 -11.822 -16.320 1.00 29.41 ? 154 PHE A C   1 
ATOM   1111 O O   . PHE A 1 157 ? -60.278 -10.805 -15.629 1.00 30.11 ? 154 PHE A O   1 
ATOM   1112 C CB  . PHE A 1 157 ? -62.011 -12.603 -17.925 1.00 29.68 ? 154 PHE A CB  1 
ATOM   1113 C CG  . PHE A 1 157 ? -63.015 -12.254 -16.864 1.00 34.26 ? 154 PHE A CG  1 
ATOM   1114 C CD1 . PHE A 1 157 ? -63.372 -10.929 -16.633 1.00 35.71 ? 154 PHE A CD1 1 
ATOM   1115 C CD2 . PHE A 1 157 ? -63.633 -13.253 -16.118 1.00 38.11 ? 154 PHE A CD2 1 
ATOM   1116 C CE1 . PHE A 1 157 ? -64.306 -10.614 -15.675 1.00 38.14 ? 154 PHE A CE1 1 
ATOM   1117 C CE2 . PHE A 1 157 ? -64.571 -12.937 -15.157 1.00 39.37 ? 154 PHE A CE2 1 
ATOM   1118 C CZ  . PHE A 1 157 ? -64.907 -11.618 -14.935 1.00 40.49 ? 154 PHE A CZ  1 
ATOM   1119 N N   . ARG A 1 158 ? -59.608 -12.934 -15.859 1.00 28.54 ? 155 ARG A N   1 
ATOM   1120 C CA  . ARG A 1 158 ? -59.011 -12.996 -14.521 1.00 29.36 ? 155 ARG A CA  1 
ATOM   1121 C C   . ARG A 1 158 ? -57.905 -11.944 -14.339 1.00 28.87 ? 155 ARG A C   1 
ATOM   1122 O O   . ARG A 1 158 ? -57.832 -11.274 -13.282 1.00 30.36 ? 155 ARG A O   1 
ATOM   1123 C CB  . ARG A 1 158 ? -58.454 -14.413 -14.245 1.00 28.82 ? 155 ARG A CB  1 
ATOM   1124 C CG  . ARG A 1 158 ? -58.050 -14.605 -12.813 1.00 30.66 ? 155 ARG A CG  1 
ATOM   1125 C CD  . ARG A 1 158 ? -58.000 -16.105 -12.528 1.00 34.95 ? 155 ARG A CD  1 
ATOM   1126 N NE  . ARG A 1 158 ? -56.758 -16.678 -13.005 1.00 31.37 ? 155 ARG A NE  1 
ATOM   1127 C CZ  . ARG A 1 158 ? -56.617 -17.835 -13.672 1.00 32.20 ? 155 ARG A CZ  1 
ATOM   1128 N NH1 . ARG A 1 158 ? -57.658 -18.582 -14.059 1.00 34.91 ? 155 ARG A NH1 1 
ATOM   1129 N NH2 . ARG A 1 158 ? -55.402 -18.254 -13.967 1.00 26.10 ? 155 ARG A NH2 1 
ATOM   1130 N N   . MET A 1 159 ? -57.079 -11.761 -15.371 1.00 28.23 ? 156 MET A N   1 
ATOM   1131 C CA  . MET A 1 159 ? -55.944 -10.811 -15.335 1.00 27.17 ? 156 MET A CA  1 
ATOM   1132 C C   . MET A 1 159 ? -56.392 -9.334  -15.349 1.00 28.78 ? 156 MET A C   1 
ATOM   1133 O O   . MET A 1 159 ? -55.769 -8.498  -14.717 1.00 29.03 ? 156 MET A O   1 
ATOM   1134 C CB  . MET A 1 159 ? -54.983 -11.036 -16.514 1.00 26.47 ? 156 MET A CB  1 
ATOM   1135 C CG  . MET A 1 159 ? -54.154 -12.344 -16.502 1.00 25.97 ? 156 MET A CG  1 
ATOM   1136 S SD  . MET A 1 159 ? -53.626 -12.721 -18.191 1.00 27.65 ? 156 MET A SD  1 
ATOM   1137 C CE  . MET A 1 159 ? -52.889 -11.174 -18.680 1.00 27.82 ? 156 MET A CE  1 
ATOM   1138 N N   . THR A 1 160 ? -57.467 -9.030  -16.070 1.00 28.53 ? 157 THR A N   1 
ATOM   1139 C CA  . THR A 1 160 ? -57.778 -7.655  -16.439 1.00 28.99 ? 157 THR A CA  1 
ATOM   1140 C C   . THR A 1 160 ? -59.150 -7.146  -16.011 1.00 31.02 ? 157 THR A C   1 
ATOM   1141 O O   . THR A 1 160 ? -59.382 -5.921  -16.020 1.00 32.29 ? 157 THR A O   1 
ATOM   1142 C CB  . THR A 1 160 ? -57.692 -7.494  -17.969 1.00 28.39 ? 157 THR A CB  1 
ATOM   1143 O OG1 . THR A 1 160 ? -58.740 -8.263  -18.576 1.00 28.58 ? 157 THR A OG1 1 
ATOM   1144 C CG2 . THR A 1 160 ? -56.302 -7.911  -18.496 1.00 26.97 ? 157 THR A CG2 1 
ATOM   1145 N N   . GLY A 1 161 ? -60.079 -8.041  -15.681 1.00 31.49 ? 158 GLY A N   1 
ATOM   1146 C CA  . GLY A 1 161 ? -61.477 -7.677  -15.506 1.00 33.81 ? 158 GLY A CA  1 
ATOM   1147 C C   . GLY A 1 161 ? -62.263 -7.394  -16.778 1.00 34.05 ? 158 GLY A C   1 
ATOM   1148 O O   . GLY A 1 161 ? -63.432 -7.028  -16.710 1.00 36.07 ? 158 GLY A O   1 
ATOM   1149 N N   . VAL A 1 162 ? -61.649 -7.538  -17.947 1.00 32.35 ? 159 VAL A N   1 
ATOM   1150 C CA  . VAL A 1 162 ? -62.401 -7.411  -19.215 1.00 32.70 ? 159 VAL A CA  1 
ATOM   1151 C C   . VAL A 1 162 ? -63.232 -8.679  -19.447 1.00 32.91 ? 159 VAL A C   1 
ATOM   1152 O O   . VAL A 1 162 ? -62.660 -9.754  -19.665 1.00 31.75 ? 159 VAL A O   1 
ATOM   1153 C CB  . VAL A 1 162 ? -61.449 -7.217  -20.404 1.00 31.67 ? 159 VAL A CB  1 
ATOM   1154 C CG1 . VAL A 1 162 ? -62.237 -7.139  -21.729 1.00 32.02 ? 159 VAL A CG1 1 
ATOM   1155 C CG2 . VAL A 1 162 ? -60.583 -5.968  -20.196 1.00 31.46 ? 159 VAL A CG2 1 
ATOM   1156 N N   . PRO A 1 163 ? -64.571 -8.575  -19.403 1.00 35.59 ? 160 PRO A N   1 
ATOM   1157 C CA  . PRO A 1 163 ? -65.369 -9.788  -19.559 1.00 36.08 ? 160 PRO A CA  1 
ATOM   1158 C C   . PRO A 1 163 ? -65.133 -10.454 -20.914 1.00 34.94 ? 160 PRO A C   1 
ATOM   1159 O O   . PRO A 1 163 ? -64.822 -9.760  -21.868 1.00 32.67 ? 160 PRO A O   1 
ATOM   1160 C CB  . PRO A 1 163 ? -66.817 -9.289  -19.433 1.00 38.64 ? 160 PRO A CB  1 
ATOM   1161 C CG  . PRO A 1 163 ? -66.725 -7.924  -18.819 1.00 40.04 ? 160 PRO A CG  1 
ATOM   1162 C CD  . PRO A 1 163 ? -65.404 -7.374  -19.220 1.00 37.19 ? 160 PRO A CD  1 
ATOM   1163 N N   . VAL A 1 164 ? -65.284 -11.783 -20.968 1.00 35.06 ? 161 VAL A N   1 
ATOM   1164 C CA  . VAL A 1 164 ? -64.984 -12.565 -22.160 1.00 34.92 ? 161 VAL A CA  1 
ATOM   1165 C C   . VAL A 1 164 ? -65.824 -12.165 -23.373 1.00 35.90 ? 161 VAL A C   1 
ATOM   1166 O O   . VAL A 1 164 ? -65.313 -12.068 -24.503 1.00 34.43 ? 161 VAL A O   1 
ATOM   1167 C CB  . VAL A 1 164 ? -65.131 -14.073 -21.894 1.00 35.56 ? 161 VAL A CB  1 
ATOM   1168 C CG1 . VAL A 1 164 ? -65.016 -14.842 -23.188 1.00 35.39 ? 161 VAL A CG1 1 
ATOM   1169 C CG2 . VAL A 1 164 ? -64.068 -14.548 -20.874 1.00 34.67 ? 161 VAL A CG2 1 
ATOM   1170 N N   . ASN A 1 165 ? -67.111 -11.926 -23.163 1.00 38.45 ? 162 ASN A N   1 
ATOM   1171 C CA  . ASN A 1 165 ? -67.953 -11.534 -24.286 1.00 40.59 ? 162 ASN A CA  1 
ATOM   1172 C C   . ASN A 1 165 ? -67.527 -10.200 -24.922 1.00 40.50 ? 162 ASN A C   1 
ATOM   1173 O O   . ASN A 1 165 ? -67.700 -10.011 -26.115 1.00 41.79 ? 162 ASN A O   1 
ATOM   1174 C CB  . ASN A 1 165 ? -69.450 -11.574 -23.921 1.00 43.60 ? 162 ASN A CB  1 
ATOM   1175 C CG  . ASN A 1 165 ? -69.870 -10.461 -22.978 1.00 47.46 ? 162 ASN A CG  1 
ATOM   1176 O OD1 . ASN A 1 165 ? -69.042 -9.836  -22.315 1.00 53.46 ? 162 ASN A OD1 1 
ATOM   1177 N ND2 . ASN A 1 165 ? -71.175 -10.218 -22.902 1.00 55.12 ? 162 ASN A ND2 1 
ATOM   1178 N N   . GLU A 1 166 ? -66.946 -9.296  -24.140 1.00 39.20 ? 163 GLU A N   1 
ATOM   1179 C CA  . GLU A 1 166 ? -66.439 -8.029  -24.661 1.00 38.66 ? 163 GLU A CA  1 
ATOM   1180 C C   . GLU A 1 166 ? -65.057 -8.186  -25.310 1.00 35.86 ? 163 GLU A C   1 
ATOM   1181 O O   . GLU A 1 166 ? -64.784 -7.667  -26.417 1.00 34.29 ? 163 GLU A O   1 
ATOM   1182 C CB  . GLU A 1 166 ? -66.347 -7.028  -23.514 1.00 39.88 ? 163 GLU A CB  1 
ATOM   1183 C CG  . GLU A 1 166 ? -65.677 -5.717  -23.874 1.00 43.13 ? 163 GLU A CG  1 
ATOM   1184 C CD  . GLU A 1 166 ? -66.331 -5.013  -25.055 1.00 49.01 ? 163 GLU A CD  1 
ATOM   1185 O OE1 . GLU A 1 166 ? -65.593 -4.342  -25.821 1.00 49.91 ? 163 GLU A OE1 1 
ATOM   1186 O OE2 . GLU A 1 166 ? -67.577 -5.118  -25.203 1.00 52.87 ? 163 GLU A OE2 1 
ATOM   1187 N N   . LEU A 1 167 ? -64.205 -8.930  -24.609 1.00 33.65 ? 164 LEU A N   1 
ATOM   1188 C CA  . LEU A 1 167 ? -62.869 -9.230  -25.086 1.00 31.50 ? 164 LEU A CA  1 
ATOM   1189 C C   . LEU A 1 167 ? -62.932 -9.781  -26.494 1.00 32.31 ? 164 LEU A C   1 
ATOM   1190 O O   . LEU A 1 167 ? -62.176 -9.372  -27.361 1.00 30.81 ? 164 LEU A O   1 
ATOM   1191 C CB  . LEU A 1 167 ? -62.200 -10.253 -24.163 1.00 30.56 ? 164 LEU A CB  1 
ATOM   1192 C CG  . LEU A 1 167 ? -60.832 -10.764 -24.611 1.00 28.09 ? 164 LEU A CG  1 
ATOM   1193 C CD1 . LEU A 1 167 ? -59.842 -9.620  -24.803 1.00 26.64 ? 164 LEU A CD1 1 
ATOM   1194 C CD2 . LEU A 1 167 ? -60.278 -11.869 -23.655 1.00 27.08 ? 164 LEU A CD2 1 
ATOM   1195 N N   . GLN A 1 168 ? -63.866 -10.708 -26.720 1.00 34.10 ? 165 GLN A N   1 
ATOM   1196 C CA  . GLN A 1 168 ? -63.853 -11.484 -27.936 1.00 34.87 ? 165 GLN A CA  1 
ATOM   1197 C C   . GLN A 1 168 ? -64.293 -10.651 -29.143 1.00 36.08 ? 165 GLN A C   1 
ATOM   1198 O O   . GLN A 1 168 ? -64.075 -11.072 -30.264 1.00 37.13 ? 165 GLN A O   1 
ATOM   1199 C CB  . GLN A 1 168 ? -64.659 -12.797 -27.767 1.00 35.80 ? 165 GLN A CB  1 
ATOM   1200 C CG  . GLN A 1 168 ? -63.954 -13.848 -26.866 1.00 35.22 ? 165 GLN A CG  1 
ATOM   1201 C CD  . GLN A 1 168 ? -62.697 -14.458 -27.501 1.00 34.70 ? 165 GLN A CD  1 
ATOM   1202 O OE1 . GLN A 1 168 ? -61.590 -13.963 -27.321 1.00 30.47 ? 165 GLN A OE1 1 
ATOM   1203 N NE2 . GLN A 1 168 ? -62.883 -15.535 -28.256 1.00 38.04 ? 165 GLN A NE2 1 
ATOM   1204 N N   . LYS A 1 169 ? -64.870 -9.464  -28.918 1.00 36.13 ? 166 LYS A N   1 
ATOM   1205 C CA  . LYS A 1 169 ? -65.208 -8.542  -29.995 1.00 38.01 ? 166 LYS A CA  1 
ATOM   1206 C C   . LYS A 1 169 ? -64.040 -7.697  -30.487 1.00 36.52 ? 166 LYS A C   1 
ATOM   1207 O O   . LYS A 1 169 ? -64.111 -7.123  -31.573 1.00 37.80 ? 166 LYS A O   1 
ATOM   1208 C CB  . LYS A 1 169 ? -66.269 -7.548  -29.533 1.00 39.89 ? 166 LYS A CB  1 
ATOM   1209 C CG  . LYS A 1 169 ? -67.547 -8.160  -29.041 1.00 42.94 ? 166 LYS A CG  1 
ATOM   1210 C CD  . LYS A 1 169 ? -68.443 -7.067  -28.533 1.00 46.49 ? 166 LYS A CD  1 
ATOM   1211 C CE  . LYS A 1 169 ? -69.715 -7.611  -27.940 1.00 49.29 ? 166 LYS A CE  1 
ATOM   1212 N NZ  . LYS A 1 169 ? -70.560 -6.486  -27.474 1.00 52.71 ? 166 LYS A NZ  1 
ATOM   1213 N N   . LYS A 1 170 ? -63.016 -7.553  -29.656 1.00 34.30 ? 167 LYS A N   1 
ATOM   1214 C CA  . LYS A 1 170 ? -61.893 -6.648  -29.946 1.00 34.12 ? 167 LYS A CA  1 
ATOM   1215 C C   . LYS A 1 170 ? -60.597 -7.241  -29.406 1.00 31.40 ? 167 LYS A C   1 
ATOM   1216 O O   . LYS A 1 170 ? -59.873 -6.608  -28.632 1.00 30.50 ? 167 LYS A O   1 
ATOM   1217 C CB  . LYS A 1 170 ? -62.141 -5.263  -29.302 1.00 35.55 ? 167 LYS A CB  1 
ATOM   1218 C CG  . LYS A 1 170 ? -63.406 -4.546  -29.730 1.00 40.80 ? 167 LYS A CG  1 
ATOM   1219 C CD  . LYS A 1 170 ? -63.372 -3.045  -29.367 1.00 45.43 ? 167 LYS A CD  1 
ATOM   1220 C CE  . LYS A 1 170 ? -62.915 -2.772  -27.914 1.00 47.84 ? 167 LYS A CE  1 
ATOM   1221 N NZ  . LYS A 1 170 ? -63.000 -1.301  -27.513 1.00 51.21 ? 167 LYS A NZ  1 
ATOM   1222 N N   . ARG A 1 171 ? -60.319 -8.483  -29.783 1.00 29.01 ? 168 ARG A N   1 
ATOM   1223 C CA  . ARG A 1 171 ? -59.244 -9.228  -29.130 1.00 27.57 ? 168 ARG A CA  1 
ATOM   1224 C C   . ARG A 1 171 ? -57.879 -8.548  -29.236 1.00 26.46 ? 168 ARG A C   1 
ATOM   1225 O O   . ARG A 1 171 ? -57.183 -8.404  -28.225 1.00 24.78 ? 168 ARG A O   1 
ATOM   1226 C CB  . ARG A 1 171 ? -59.161 -10.643 -29.688 1.00 27.59 ? 168 ARG A CB  1 
ATOM   1227 C CG  . ARG A 1 171 ? -60.323 -11.541 -29.315 1.00 28.61 ? 168 ARG A CG  1 
ATOM   1228 C CD  . ARG A 1 171 ? -60.361 -12.784 -30.217 1.00 28.89 ? 168 ARG A CD  1 
ATOM   1229 N NE  . ARG A 1 171 ? -59.044 -13.414 -30.439 1.00 26.86 ? 168 ARG A NE  1 
ATOM   1230 C CZ  . ARG A 1 171 ? -58.471 -14.289 -29.622 1.00 26.53 ? 168 ARG A CZ  1 
ATOM   1231 N NH1 . ARG A 1 171 ? -59.025 -14.613 -28.456 1.00 28.10 ? 168 ARG A NH1 1 
ATOM   1232 N NH2 . ARG A 1 171 ? -57.281 -14.801 -29.933 1.00 25.62 ? 168 ARG A NH2 1 
ATOM   1233 N N   . ALA A 1 172 ? -57.501 -8.124  -30.443 1.00 27.34 ? 169 ALA A N   1 
ATOM   1234 C CA  . ALA A 1 172 ? -56.172 -7.533  -30.631 1.00 27.69 ? 169 ALA A CA  1 
ATOM   1235 C C   . ALA A 1 172 ? -56.076 -6.173  -29.921 1.00 27.49 ? 169 ALA A C   1 
ATOM   1236 O O   . ALA A 1 172 ? -55.037 -5.871  -29.328 1.00 27.39 ? 169 ALA A O   1 
ATOM   1237 C CB  . ALA A 1 172 ? -55.822 -7.411  -32.139 1.00 27.48 ? 169 ALA A CB  1 
ATOM   1238 N N   . GLU A 1 173 ? -57.145 -5.376  -29.962 1.00 28.90 ? 170 GLU A N   1 
ATOM   1239 C CA  . GLU A 1 173 ? -57.134 -4.083  -29.277 1.00 29.59 ? 170 GLU A CA  1 
ATOM   1240 C C   . GLU A 1 173 ? -56.904 -4.277  -27.775 1.00 27.91 ? 170 GLU A C   1 
ATOM   1241 O O   . GLU A 1 173 ? -56.058 -3.604  -27.181 1.00 26.72 ? 170 GLU A O   1 
ATOM   1242 C CB  . GLU A 1 173 ? -58.440 -3.314  -29.508 1.00 32.50 ? 170 GLU A CB  1 
ATOM   1243 C CG  . GLU A 1 173 ? -58.442 -1.945  -28.880 1.00 39.33 ? 170 GLU A CG  1 
ATOM   1244 C CD  . GLU A 1 173 ? -59.767 -1.246  -29.033 1.00 48.27 ? 170 GLU A CD  1 
ATOM   1245 O OE1 . GLU A 1 173 ? -60.218 -0.625  -28.029 1.00 54.25 ? 170 GLU A OE1 1 
ATOM   1246 O OE2 . GLU A 1 173 ? -60.356 -1.339  -30.146 1.00 51.41 ? 170 GLU A OE2 1 
ATOM   1247 N N   . TYR A 1 174 ? -57.624 -5.217  -27.158 1.00 27.03 ? 171 TYR A N   1 
ATOM   1248 C CA  . TYR A 1 174 ? -57.421 -5.482  -25.722 1.00 25.66 ? 171 TYR A CA  1 
ATOM   1249 C C   . TYR A 1 174 ? -56.045 -6.082  -25.405 1.00 24.56 ? 171 TYR A C   1 
ATOM   1250 O O   . TYR A 1 174 ? -55.386 -5.666  -24.457 1.00 25.58 ? 171 TYR A O   1 
ATOM   1251 C CB  . TYR A 1 174 ? -58.516 -6.385  -25.158 1.00 25.99 ? 171 TYR A CB  1 
ATOM   1252 C CG  . TYR A 1 174 ? -59.816 -5.665  -24.850 1.00 29.28 ? 171 TYR A CG  1 
ATOM   1253 C CD1 . TYR A 1 174 ? -59.879 -4.717  -23.839 1.00 32.60 ? 171 TYR A CD1 1 
ATOM   1254 C CD2 . TYR A 1 174 ? -60.979 -5.929  -25.581 1.00 31.61 ? 171 TYR A CD2 1 
ATOM   1255 C CE1 . TYR A 1 174 ? -61.046 -4.052  -23.547 1.00 34.27 ? 171 TYR A CE1 1 
ATOM   1256 C CE2 . TYR A 1 174 ? -62.164 -5.276  -25.271 1.00 33.88 ? 171 TYR A CE2 1 
ATOM   1257 C CZ  . TYR A 1 174 ? -62.171 -4.336  -24.251 1.00 36.56 ? 171 TYR A CZ  1 
ATOM   1258 O OH  . TYR A 1 174 ? -63.326 -3.665  -23.917 1.00 37.90 ? 171 TYR A OH  1 
ATOM   1259 N N   . ALA A 1 175 ? -55.609 -7.046  -26.204 1.00 23.98 ? 172 ALA A N   1 
ATOM   1260 C CA  . ALA A 1 175 ? -54.318 -7.667  -25.984 1.00 23.52 ? 172 ALA A CA  1 
ATOM   1261 C C   . ALA A 1 175 ? -53.215 -6.609  -26.068 1.00 24.10 ? 172 ALA A C   1 
ATOM   1262 O O   . ALA A 1 175 ? -52.311 -6.570  -25.246 1.00 23.92 ? 172 ALA A O   1 
ATOM   1263 C CB  . ALA A 1 175 ? -54.078 -8.800  -27.007 1.00 22.90 ? 172 ALA A CB  1 
ATOM   1264 N N   . LYS A 1 176 ? -53.293 -5.746  -27.072 1.00 25.11 ? 173 LYS A N   1 
ATOM   1265 C CA  . LYS A 1 176 ? -52.285 -4.698  -27.277 1.00 25.58 ? 173 LYS A CA  1 
ATOM   1266 C C   . LYS A 1 176 ? -52.272 -3.703  -26.104 1.00 26.00 ? 173 LYS A C   1 
ATOM   1267 O O   . LYS A 1 176 ? -51.222 -3.346  -25.570 1.00 26.69 ? 173 LYS A O   1 
ATOM   1268 C CB  . LYS A 1 176 ? -52.562 -3.970  -28.572 1.00 27.84 ? 173 LYS A CB  1 
ATOM   1269 C CG  . LYS A 1 176 ? -52.185 -4.739  -29.793 1.00 31.32 ? 173 LYS A CG  1 
ATOM   1270 C CD  . LYS A 1 176 ? -52.406 -3.928  -31.078 1.00 37.42 ? 173 LYS A CD  1 
ATOM   1271 C CE  . LYS A 1 176 ? -51.350 -2.840  -31.209 1.00 38.39 ? 173 LYS A CE  1 
ATOM   1272 N NZ  . LYS A 1 176 ? -51.667 -1.695  -30.365 1.00 45.40 ? 173 LYS A NZ  1 
ATOM   1273 N N   . GLU A 1 177 ? -53.463 -3.273  -25.703 1.00 26.52 ? 174 GLU A N   1 
ATOM   1274 C CA  . GLU A 1 177 ? -53.608 -2.331  -24.600 1.00 28.67 ? 174 GLU A CA  1 
ATOM   1275 C C   . GLU A 1 177 ? -53.024 -2.866  -23.299 1.00 27.00 ? 174 GLU A C   1 
ATOM   1276 O O   . GLU A 1 177 ? -52.309 -2.154  -22.590 1.00 26.85 ? 174 GLU A O   1 
ATOM   1277 C CB  . GLU A 1 177 ? -55.094 -1.997  -24.479 1.00 30.05 ? 174 GLU A CB  1 
ATOM   1278 C CG  . GLU A 1 177 ? -55.657 -1.498  -23.216 1.00 37.07 ? 174 GLU A CG  1 
ATOM   1279 C CD  . GLU A 1 177 ? -57.128 -1.224  -23.471 1.00 44.15 ? 174 GLU A CD  1 
ATOM   1280 O OE1 . GLU A 1 177 ? -57.427 -0.192  -24.107 1.00 51.24 ? 174 GLU A OE1 1 
ATOM   1281 O OE2 . GLU A 1 177 ? -57.967 -2.079  -23.119 1.00 48.49 ? 174 GLU A OE2 1 
ATOM   1282 N N   . TRP A 1 178 ? -53.289 -4.131  -23.007 1.00 25.09 ? 175 TRP A N   1 
ATOM   1283 C CA  . TRP A 1 178 ? -52.820 -4.726  -21.771 1.00 24.53 ? 175 TRP A CA  1 
ATOM   1284 C C   . TRP A 1 178 ? -51.358 -5.153  -21.805 1.00 22.79 ? 175 TRP A C   1 
ATOM   1285 O O   . TRP A 1 178 ? -50.675 -5.063  -20.784 1.00 23.41 ? 175 TRP A O   1 
ATOM   1286 C CB  . TRP A 1 178 ? -53.775 -5.846  -21.334 1.00 24.76 ? 175 TRP A CB  1 
ATOM   1287 C CG  . TRP A 1 178 ? -54.979 -5.250  -20.676 1.00 26.57 ? 175 TRP A CG  1 
ATOM   1288 C CD1 . TRP A 1 178 ? -56.164 -4.886  -21.259 1.00 29.35 ? 175 TRP A CD1 1 
ATOM   1289 C CD2 . TRP A 1 178 ? -55.085 -4.900  -19.302 1.00 29.38 ? 175 TRP A CD2 1 
ATOM   1290 N NE1 . TRP A 1 178 ? -57.002 -4.336  -20.322 1.00 32.74 ? 175 TRP A NE1 1 
ATOM   1291 C CE2 . TRP A 1 178 ? -56.368 -4.341  -19.108 1.00 31.46 ? 175 TRP A CE2 1 
ATOM   1292 C CE3 . TRP A 1 178 ? -54.216 -5.000  -18.222 1.00 31.42 ? 175 TRP A CE3 1 
ATOM   1293 C CZ2 . TRP A 1 178 ? -56.803 -3.889  -17.868 1.00 36.02 ? 175 TRP A CZ2 1 
ATOM   1294 C CZ3 . TRP A 1 178 ? -54.648 -4.560  -16.982 1.00 33.24 ? 175 TRP A CZ3 1 
ATOM   1295 C CH2 . TRP A 1 178 ? -55.928 -4.005  -16.820 1.00 34.88 ? 175 TRP A CH2 1 
ATOM   1296 N N   . ALA A 1 179 ? -50.846 -5.520  -22.978 1.00 21.90 ? 176 ALA A N   1 
ATOM   1297 C CA  . ALA A 1 179 ? -49.419 -5.786  -23.111 1.00 21.67 ? 176 ALA A CA  1 
ATOM   1298 C C   . ALA A 1 179 ? -48.654 -4.492  -22.818 1.00 22.64 ? 176 ALA A C   1 
ATOM   1299 O O   . ALA A 1 179 ? -47.626 -4.510  -22.126 1.00 22.98 ? 176 ALA A O   1 
ATOM   1300 C CB  . ALA A 1 179 ? -49.070 -6.344  -24.545 1.00 21.82 ? 176 ALA A CB  1 
ATOM   1301 N N   . ALA A 1 180 ? -49.158 -3.375  -23.324 1.00 22.93 ? 177 ALA A N   1 
ATOM   1302 C CA  . ALA A 1 180 ? -48.521 -2.067  -23.091 1.00 23.91 ? 177 ALA A CA  1 
ATOM   1303 C C   . ALA A 1 180 ? -48.613 -1.716  -21.590 1.00 23.91 ? 177 ALA A C   1 
ATOM   1304 O O   . ALA A 1 180 ? -47.632 -1.306  -20.973 1.00 23.70 ? 177 ALA A O   1 
ATOM   1305 C CB  . ALA A 1 180 ? -49.167 -0.981  -23.986 1.00 24.65 ? 177 ALA A CB  1 
ATOM   1306 N N   . GLN A 1 181 ? -49.799 -1.855  -21.004 1.00 24.40 ? 178 GLN A N   1 
ATOM   1307 C CA  . GLN A 1 181 ? -50.013 -1.461  -19.620 1.00 26.25 ? 178 GLN A CA  1 
ATOM   1308 C C   . GLN A 1 181 ? -49.216 -2.289  -18.634 1.00 25.64 ? 178 GLN A C   1 
ATOM   1309 O O   . GLN A 1 181 ? -48.697 -1.759  -17.641 1.00 26.10 ? 178 GLN A O   1 
ATOM   1310 C CB  . GLN A 1 181 ? -51.519 -1.499  -19.286 1.00 28.33 ? 178 GLN A CB  1 
ATOM   1311 C CG  . GLN A 1 181 ? -51.866 -1.201  -17.824 1.00 33.27 ? 178 GLN A CG  1 
ATOM   1312 C CD  . GLN A 1 181 ? -53.383 -1.183  -17.558 1.00 40.30 ? 178 GLN A CD  1 
ATOM   1313 O OE1 . GLN A 1 181 ? -54.196 -0.886  -18.452 1.00 45.02 ? 178 GLN A OE1 1 
ATOM   1314 N NE2 . GLN A 1 181 ? -53.763 -1.476  -16.309 1.00 44.50 ? 178 GLN A NE2 1 
ATOM   1315 N N   . LEU A 1 182 ? -49.146 -3.594  -18.877 1.00 24.10 ? 179 LEU A N   1 
ATOM   1316 C CA  . LEU A 1 182 ? -48.425 -4.507  -17.997 1.00 23.61 ? 179 LEU A CA  1 
ATOM   1317 C C   . LEU A 1 182 ? -46.924 -4.568  -18.303 1.00 23.23 ? 179 LEU A C   1 
ATOM   1318 O O   . LEU A 1 182 ? -46.124 -4.997  -17.438 1.00 23.24 ? 179 LEU A O   1 
ATOM   1319 C CB  . LEU A 1 182 ? -49.011 -5.913  -18.069 1.00 22.70 ? 179 LEU A CB  1 
ATOM   1320 C CG  . LEU A 1 182 ? -50.483 -6.048  -17.692 1.00 25.28 ? 179 LEU A CG  1 
ATOM   1321 C CD1 . LEU A 1 182 ? -50.947 -7.497  -17.944 1.00 24.90 ? 179 LEU A CD1 1 
ATOM   1322 C CD2 . LEU A 1 182 ? -50.666 -5.650  -16.238 1.00 26.19 ? 179 LEU A CD2 1 
ATOM   1323 N N   . GLN A 1 183 ? -46.553 -4.122  -19.509 1.00 23.39 ? 180 GLN A N   1 
ATOM   1324 C CA  . GLN A 1 183 ? -45.205 -4.314  -20.072 1.00 23.02 ? 180 GLN A CA  1 
ATOM   1325 C C   . GLN A 1 183 ? -44.776 -5.794  -20.077 1.00 22.74 ? 180 GLN A C   1 
ATOM   1326 O O   . GLN A 1 183 ? -43.696 -6.150  -19.603 1.00 22.40 ? 180 GLN A O   1 
ATOM   1327 C CB  . GLN A 1 183 ? -44.184 -3.419  -19.399 1.00 24.49 ? 180 GLN A CB  1 
ATOM   1328 C CG  . GLN A 1 183 ? -44.320 -1.964  -19.844 1.00 24.07 ? 180 GLN A CG  1 
ATOM   1329 C CD  . GLN A 1 183 ? -44.018 -1.819  -21.296 1.00 22.51 ? 180 GLN A CD  1 
ATOM   1330 O OE1 . GLN A 1 183 ? -42.857 -1.910  -21.711 1.00 24.19 ? 180 GLN A OE1 1 
ATOM   1331 N NE2 . GLN A 1 183 ? -45.053 -1.543  -22.083 1.00 21.40 ? 180 GLN A NE2 1 
ATOM   1332 N N   . THR A 1 184 ? -45.663 -6.611  -20.617 1.00 22.01 ? 181 THR A N   1 
ATOM   1333 C CA  . THR A 1 184 ? -45.454 -8.040  -20.820 1.00 22.26 ? 181 THR A CA  1 
ATOM   1334 C C   . THR A 1 184 ? -45.843 -8.379  -22.234 1.00 21.90 ? 181 THR A C   1 
ATOM   1335 O O   . THR A 1 184 ? -46.675 -7.700  -22.828 1.00 21.78 ? 181 THR A O   1 
ATOM   1336 C CB  . THR A 1 184 ? -46.333 -8.917  -19.891 1.00 22.39 ? 181 THR A CB  1 
ATOM   1337 O OG1 . THR A 1 184 ? -47.725 -8.718  -20.168 1.00 25.28 ? 181 THR A OG1 1 
ATOM   1338 C CG2 . THR A 1 184 ? -46.059 -8.576  -18.432 1.00 22.04 ? 181 THR A CG2 1 
ATOM   1339 N N   . VAL A 1 185 ? -45.315 -9.490  -22.728 1.00 20.81 ? 182 VAL A N   1 
ATOM   1340 C CA  . VAL A 1 185 ? -45.828 -10.082 -23.951 1.00 20.75 ? 182 VAL A CA  1 
ATOM   1341 C C   . VAL A 1 185 ? -47.141 -10.748 -23.543 1.00 20.69 ? 182 VAL A C   1 
ATOM   1342 O O   . VAL A 1 185 ? -47.216 -11.361 -22.476 1.00 21.95 ? 182 VAL A O   1 
ATOM   1343 C CB  . VAL A 1 185 ? -44.848 -11.118 -24.526 1.00 20.59 ? 182 VAL A CB  1 
ATOM   1344 C CG1 . VAL A 1 185 ? -45.363 -11.754 -25.837 1.00 21.52 ? 182 VAL A CG1 1 
ATOM   1345 C CG2 . VAL A 1 185 ? -43.448 -10.473 -24.739 1.00 20.67 ? 182 VAL A CG2 1 
ATOM   1346 N N   . ILE A 1 186 ? -48.170 -10.612 -24.369 1.00 20.57 ? 183 ILE A N   1 
ATOM   1347 C CA  . ILE A 1 186 ? -49.415 -11.367 -24.197 1.00 20.52 ? 183 ILE A CA  1 
ATOM   1348 C C   . ILE A 1 186 ? -49.712 -12.192 -25.441 1.00 20.90 ? 183 ILE A C   1 
ATOM   1349 O O   . ILE A 1 186 ? -49.898 -11.635 -26.514 1.00 20.60 ? 183 ILE A O   1 
ATOM   1350 C CB  . ILE A 1 186 ? -50.598 -10.474 -23.852 1.00 21.04 ? 183 ILE A CB  1 
ATOM   1351 C CG1 . ILE A 1 186 ? -50.333 -9.682  -22.574 1.00 22.20 ? 183 ILE A CG1 1 
ATOM   1352 C CG2 . ILE A 1 186 ? -51.894 -11.333 -23.685 1.00 22.48 ? 183 ILE A CG2 1 
ATOM   1353 C CD1 . ILE A 1 186 ? -51.502 -8.840  -22.108 1.00 23.44 ? 183 ILE A CD1 1 
ATOM   1354 N N   . VAL A 1 187 ? -49.739 -13.526 -25.270 1.00 19.57 ? 184 VAL A N   1 
ATOM   1355 C CA  . VAL A 1 187 ? -50.213 -14.475 -26.268 1.00 18.76 ? 184 VAL A CA  1 
ATOM   1356 C C   . VAL A 1 187 ? -51.654 -14.812 -25.859 1.00 19.22 ? 184 VAL A C   1 
ATOM   1357 O O   . VAL A 1 187 ? -51.892 -15.615 -24.943 1.00 19.16 ? 184 VAL A O   1 
ATOM   1358 C CB  . VAL A 1 187 ? -49.368 -15.774 -26.302 1.00 18.84 ? 184 VAL A CB  1 
ATOM   1359 C CG1 . VAL A 1 187 ? -49.936 -16.779 -27.296 1.00 19.44 ? 184 VAL A CG1 1 
ATOM   1360 C CG2 . VAL A 1 187 ? -47.823 -15.477 -26.537 1.00 19.28 ? 184 VAL A CG2 1 
ATOM   1361 N N   . LEU A 1 188 ? -52.598 -14.119 -26.479 1.00 19.94 ? 185 LEU A N   1 
ATOM   1362 C CA  . LEU A 1 188 ? -54.024 -14.264 -26.206 1.00 20.42 ? 185 LEU A CA  1 
ATOM   1363 C C   . LEU A 1 188 ? -54.564 -15.323 -27.165 1.00 20.10 ? 185 LEU A C   1 
ATOM   1364 O O   . LEU A 1 188 ? -54.764 -15.110 -28.369 1.00 22.21 ? 185 LEU A O   1 
ATOM   1365 C CB  . LEU A 1 188 ? -54.776 -12.935 -26.355 1.00 21.16 ? 185 LEU A CB  1 
ATOM   1366 C CG  . LEU A 1 188 ? -56.303 -13.058 -26.170 1.00 22.88 ? 185 LEU A CG  1 
ATOM   1367 C CD1 . LEU A 1 188 ? -56.658 -13.583 -24.781 1.00 23.12 ? 185 LEU A CD1 1 
ATOM   1368 C CD2 . LEU A 1 188 ? -57.002 -11.738 -26.463 1.00 24.98 ? 185 LEU A CD2 1 
ATOM   1369 N N   . LYS A 1 189 ? -54.790 -16.493 -26.597 1.00 21.99 ? 186 LYS A N   1 
ATOM   1370 C CA  . LYS A 1 189 ? -55.175 -17.666 -27.365 1.00 22.86 ? 186 LYS A CA  1 
ATOM   1371 C C   . LYS A 1 189 ? -56.608 -17.603 -27.863 1.00 25.31 ? 186 LYS A C   1 
ATOM   1372 O O   . LYS A 1 189 ? -57.447 -16.876 -27.325 1.00 25.77 ? 186 LYS A O   1 
ATOM   1373 C CB  . LYS A 1 189 ? -54.880 -18.916 -26.534 1.00 22.98 ? 186 LYS A CB  1 
ATOM   1374 C CG  . LYS A 1 189 ? -53.380 -19.071 -26.320 1.00 24.08 ? 186 LYS A CG  1 
ATOM   1375 C CD  . LYS A 1 189 ? -53.010 -20.341 -25.551 1.00 25.91 ? 186 LYS A CD  1 
ATOM   1376 C CE  . LYS A 1 189 ? -53.526 -20.302 -24.149 1.00 25.07 ? 186 LYS A CE  1 
ATOM   1377 N NZ  . LYS A 1 189 ? -53.141 -21.489 -23.340 1.00 25.91 ? 186 LYS A NZ  1 
ATOM   1378 N N   . GLY A 1 190 ? -56.847 -18.340 -28.935 1.00 27.49 ? 187 GLY A N   1 
ATOM   1379 C CA  . GLY A 1 190 ? -58.171 -18.443 -29.540 1.00 30.22 ? 187 GLY A CA  1 
ATOM   1380 C C   . GLY A 1 190 ? -57.966 -18.777 -31.000 1.00 31.47 ? 187 GLY A C   1 
ATOM   1381 O O   . GLY A 1 190 ? -56.846 -19.048 -31.427 1.00 31.73 ? 187 GLY A O   1 
ATOM   1382 N N   . ASN A 1 191 ? -59.031 -18.733 -31.783 1.00 33.32 ? 188 ASN A N   1 
ATOM   1383 C CA  . ASN A 1 191 ? -58.846 -18.706 -33.209 1.00 35.29 ? 188 ASN A CA  1 
ATOM   1384 C C   . ASN A 1 191 ? -58.136 -17.354 -33.445 1.00 34.43 ? 188 ASN A C   1 
ATOM   1385 O O   . ASN A 1 191 ? -58.471 -16.350 -32.819 1.00 38.07 ? 188 ASN A O   1 
ATOM   1386 C CB  . ASN A 1 191 ? -60.195 -18.767 -33.931 1.00 37.37 ? 188 ASN A CB  1 
ATOM   1387 C CG  . ASN A 1 191 ? -60.047 -18.839 -35.445 1.00 41.81 ? 188 ASN A CG  1 
ATOM   1388 O OD1 . ASN A 1 191 ? -59.371 -19.726 -35.971 1.00 46.54 ? 188 ASN A OD1 1 
ATOM   1389 N ND2 . ASN A 1 191 ? -60.697 -17.919 -36.153 1.00 45.70 ? 188 ASN A ND2 1 
ATOM   1390 N N   . GLN A 1 192 ? -57.178 -17.345 -34.348 1.00 33.09 ? 189 GLN A N   1 
ATOM   1391 C CA  . GLN A 1 192 ? -56.289 -16.231 -34.580 1.00 31.16 ? 189 GLN A CA  1 
ATOM   1392 C C   . GLN A 1 192 ? -55.756 -15.704 -33.236 1.00 28.18 ? 189 GLN A C   1 
ATOM   1393 O O   . GLN A 1 192 ? -56.104 -14.601 -32.767 1.00 27.67 ? 189 GLN A O   1 
ATOM   1394 C CB  . GLN A 1 192 ? -56.943 -15.163 -35.444 1.00 32.99 ? 189 GLN A CB  1 
ATOM   1395 C CG  . GLN A 1 192 ? -57.385 -15.725 -36.802 1.00 36.78 ? 189 GLN A CG  1 
ATOM   1396 C CD  . GLN A 1 192 ? -57.899 -14.670 -37.736 1.00 40.10 ? 189 GLN A CD  1 
ATOM   1397 O OE1 . GLN A 1 192 ? -58.169 -13.552 -37.322 1.00 45.45 ? 189 GLN A OE1 1 
ATOM   1398 N NE2 . GLN A 1 192 ? -58.066 -15.023 -39.007 1.00 44.73 ? 189 GLN A NE2 1 
ATOM   1399 N N   . THR A 1 193 ? -54.898 -16.519 -32.632 1.00 24.74 ? 190 THR A N   1 
ATOM   1400 C CA  . THR A 1 193 ? -54.168 -16.116 -31.433 1.00 22.25 ? 190 THR A CA  1 
ATOM   1401 C C   . THR A 1 193 ? -53.444 -14.783 -31.717 1.00 22.05 ? 190 THR A C   1 
ATOM   1402 O O   . THR A 1 193 ? -52.880 -14.582 -32.821 1.00 22.92 ? 190 THR A O   1 
ATOM   1403 C CB  . THR A 1 193 ? -53.161 -17.202 -31.036 1.00 21.52 ? 190 THR A CB  1 
ATOM   1404 O OG1 . THR A 1 193 ? -53.899 -18.343 -30.559 1.00 21.11 ? 190 THR A OG1 1 
ATOM   1405 C CG2 . THR A 1 193 ? -52.116 -16.702 -29.978 1.00 20.05 ? 190 THR A CG2 1 
ATOM   1406 N N   . VAL A 1 194 ? -53.545 -13.864 -30.775 1.00 21.64 ? 191 VAL A N   1 
ATOM   1407 C CA  . VAL A 1 194 ? -52.865 -12.569 -30.855 1.00 22.00 ? 191 VAL A CA  1 
ATOM   1408 C C   . VAL A 1 194 ? -51.559 -12.639 -30.074 1.00 22.08 ? 191 VAL A C   1 
ATOM   1409 O O   . VAL A 1 194 ? -51.535 -13.164 -28.946 1.00 22.08 ? 191 VAL A O   1 
ATOM   1410 C CB  . VAL A 1 194 ? -53.742 -11.448 -30.237 1.00 22.60 ? 191 VAL A CB  1 
ATOM   1411 C CG1 . VAL A 1 194 ? -53.047 -10.100 -30.393 1.00 22.51 ? 191 VAL A CG1 1 
ATOM   1412 C CG2 . VAL A 1 194 ? -55.128 -11.410 -30.855 1.00 25.74 ? 191 VAL A CG2 1 
ATOM   1413 N N   . ILE A 1 195 ? -50.464 -12.159 -30.663 1.00 21.13 ? 192 ILE A N   1 
ATOM   1414 C CA  . ILE A 1 195 ? -49.192 -12.045 -29.979 1.00 20.75 ? 192 ILE A CA  1 
ATOM   1415 C C   . ILE A 1 195 ? -48.873 -10.549 -29.905 1.00 21.62 ? 192 ILE A C   1 
ATOM   1416 O O   . ILE A 1 195 ? -48.497 -9.932  -30.918 1.00 21.90 ? 192 ILE A O   1 
ATOM   1417 C CB  . ILE A 1 195 ? -48.030 -12.823 -30.635 1.00 21.01 ? 192 ILE A CB  1 
ATOM   1418 C CG1 . ILE A 1 195 ? -48.384 -14.300 -30.897 1.00 21.66 ? 192 ILE A CG1 1 
ATOM   1419 C CG2 . ILE A 1 195 ? -46.756 -12.725 -29.736 1.00 19.89 ? 192 ILE A CG2 1 
ATOM   1420 C CD1 . ILE A 1 195 ? -49.137 -14.602 -32.246 1.00 21.55 ? 192 ILE A CD1 1 
ATOM   1421 N N   . ALA A 1 196 ? -49.090 -9.994  -28.724 1.00 20.79 ? 193 ALA A N   1 
ATOM   1422 C CA  . ALA A 1 196 ? -48.886 -8.579  -28.453 1.00 21.03 ? 193 ALA A CA  1 
ATOM   1423 C C   . ALA A 1 196 ? -47.646 -8.367  -27.591 1.00 21.64 ? 193 ALA A C   1 
ATOM   1424 O O   . ALA A 1 196 ? -47.529 -8.932  -26.486 1.00 22.14 ? 193 ALA A O   1 
ATOM   1425 C CB  . ALA A 1 196 ? -50.147 -7.966  -27.762 1.00 21.39 ? 193 ALA A CB  1 
ATOM   1426 N N   . PHE A 1 197 ? -46.764 -7.509  -28.080 1.00 22.00 ? 194 PHE A N   1 
ATOM   1427 C CA  . PHE A 1 197 ? -45.531 -7.144  -27.382 1.00 22.32 ? 194 PHE A CA  1 
ATOM   1428 C C   . PHE A 1 197 ? -45.606 -5.794  -26.674 1.00 22.91 ? 194 PHE A C   1 
ATOM   1429 O O   . PHE A 1 197 ? -46.342 -4.897  -27.087 1.00 23.56 ? 194 PHE A O   1 
ATOM   1430 C CB  . PHE A 1 197 ? -44.400 -7.128  -28.414 1.00 22.20 ? 194 PHE A CB  1 
ATOM   1431 C CG  . PHE A 1 197 ? -44.085 -8.474  -28.938 1.00 21.82 ? 194 PHE A CG  1 
ATOM   1432 C CD1 . PHE A 1 197 ? -43.254 -9.318  -28.238 1.00 21.88 ? 194 PHE A CD1 1 
ATOM   1433 C CD2 . PHE A 1 197 ? -44.657 -8.930  -30.112 1.00 22.80 ? 194 PHE A CD2 1 
ATOM   1434 C CE1 . PHE A 1 197 ? -42.992 -10.608 -28.689 1.00 23.50 ? 194 PHE A CE1 1 
ATOM   1435 C CE2 . PHE A 1 197 ? -44.388 -10.213 -30.569 1.00 23.64 ? 194 PHE A CE2 1 
ATOM   1436 C CZ  . PHE A 1 197 ? -43.558 -11.038 -29.883 1.00 23.21 ? 194 PHE A CZ  1 
ATOM   1437 N N   . PRO A 1 198 ? -44.845 -5.644  -25.590 1.00 23.25 ? 195 PRO A N   1 
ATOM   1438 C CA  . PRO A 1 198 ? -44.925 -4.414  -24.784 1.00 24.58 ? 195 PRO A CA  1 
ATOM   1439 C C   . PRO A 1 198 ? -44.409 -3.200  -25.475 1.00 24.92 ? 195 PRO A C   1 
ATOM   1440 O O   . PRO A 1 198 ? -44.776 -2.080  -25.093 1.00 24.24 ? 195 PRO A O   1 
ATOM   1441 C CB  . PRO A 1 198 ? -44.095 -4.726  -23.554 1.00 25.83 ? 195 PRO A CB  1 
ATOM   1442 C CG  . PRO A 1 198 ? -43.421 -6.009  -23.770 1.00 24.86 ? 195 PRO A CG  1 
ATOM   1443 C CD  . PRO A 1 198 ? -44.041 -6.699  -24.955 1.00 23.05 ? 195 PRO A CD  1 
ATOM   1444 N N   . ASP A 1 199 ? -43.643 -3.395  -26.562 1.00 24.02 ? 196 ASP A N   1 
ATOM   1445 C CA  . ASP A 1 199 ? -43.152 -2.266  -27.346 1.00 27.17 ? 196 ASP A CA  1 
ATOM   1446 C C   . ASP A 1 199 ? -44.151 -1.818  -28.416 1.00 26.54 ? 196 ASP A C   1 
ATOM   1447 O O   . ASP A 1 199 ? -43.850 -0.913  -29.215 1.00 27.28 ? 196 ASP A O   1 
ATOM   1448 C CB  . ASP A 1 199 ? -41.770 -2.576  -27.945 1.00 27.97 ? 196 ASP A CB  1 
ATOM   1449 C CG  . ASP A 1 199 ? -41.812 -3.624  -29.053 1.00 31.90 ? 196 ASP A CG  1 
ATOM   1450 O OD1 . ASP A 1 199 ? -42.889 -4.168  -29.375 1.00 25.27 ? 196 ASP A OD1 1 
ATOM   1451 O OD2 . ASP A 1 199 ? -40.717 -3.895  -29.608 1.00 37.21 ? 196 ASP A OD2 1 
ATOM   1452 N N   . GLY A 1 200 ? -45.328 -2.449  -28.420 1.00 25.53 ? 197 GLY A N   1 
ATOM   1453 C CA  . GLY A 1 200 ? -46.394 -2.100  -29.337 1.00 27.12 ? 197 GLY A CA  1 
ATOM   1454 C C   . GLY A 1 200 ? -46.458 -2.939  -30.592 1.00 26.84 ? 197 GLY A C   1 
ATOM   1455 O O   . GLY A 1 200 ? -47.440 -2.854  -31.345 1.00 25.75 ? 197 GLY A O   1 
ATOM   1456 N N   . ASP A 1 201 ? -45.424 -3.740  -30.865 1.00 26.21 ? 198 ASP A N   1 
ATOM   1457 C CA  . ASP A 1 201 ? -45.541 -4.676  -32.007 1.00 26.19 ? 198 ASP A CA  1 
ATOM   1458 C C   . ASP A 1 201 ? -46.692 -5.651  -31.693 1.00 25.13 ? 198 ASP A C   1 
ATOM   1459 O O   . ASP A 1 201 ? -46.901 -6.043  -30.545 1.00 23.64 ? 198 ASP A O   1 
ATOM   1460 C CB  . ASP A 1 201 ? -44.264 -5.511  -32.210 1.00 25.93 ? 198 ASP A CB  1 
ATOM   1461 C CG  . ASP A 1 201 ? -43.116 -4.736  -32.830 1.00 30.48 ? 198 ASP A CG  1 
ATOM   1462 O OD1 . ASP A 1 201 ? -43.264 -3.526  -33.071 1.00 31.25 ? 198 ASP A OD1 1 
ATOM   1463 O OD2 . ASP A 1 201 ? -42.053 -5.369  -33.065 1.00 32.63 ? 198 ASP A OD2 1 
ATOM   1464 N N   . CYS A 1 202 ? -47.416 -6.074  -32.715 1.00 24.37 ? 199 CYS A N   1 
ATOM   1465 C CA  . CYS A 1 202 ? -48.513 -7.031  -32.521 1.00 24.44 ? 199 CYS A CA  1 
ATOM   1466 C C   . CYS A 1 202 ? -48.733 -7.806  -33.812 1.00 22.85 ? 199 CYS A C   1 
ATOM   1467 O O   . CYS A 1 202 ? -48.648 -7.235  -34.919 1.00 24.39 ? 199 CYS A O   1 
ATOM   1468 C CB  . CYS A 1 202 ? -49.787 -6.307  -32.116 1.00 26.56 ? 199 CYS A CB  1 
ATOM   1469 S SG  . CYS A 1 202 ? -51.119 -7.387  -31.583 1.00 31.85 ? 199 CYS A SG  1 
ATOM   1470 N N   . TRP A 1 203 ? -48.988 -9.106  -33.651 1.00 24.36 ? 200 TRP A N   1 
ATOM   1471 C CA  . TRP A 1 203 ? -49.182 -10.034 -34.763 1.00 23.76 ? 200 TRP A CA  1 
ATOM   1472 C C   . TRP A 1 203 ? -50.352 -10.934 -34.465 1.00 23.48 ? 200 TRP A C   1 
ATOM   1473 O O   . TRP A 1 203 ? -50.716 -11.161 -33.293 1.00 22.74 ? 200 TRP A O   1 
ATOM   1474 C CB  . TRP A 1 203 ? -47.942 -10.922 -34.958 1.00 23.54 ? 200 TRP A CB  1 
ATOM   1475 C CG  . TRP A 1 203 ? -46.670 -10.182 -35.243 1.00 23.93 ? 200 TRP A CG  1 
ATOM   1476 C CD1 . TRP A 1 203 ? -45.823 -9.629  -34.339 1.00 22.71 ? 200 TRP A CD1 1 
ATOM   1477 C CD2 . TRP A 1 203 ? -46.120 -9.915  -36.529 1.00 24.27 ? 200 TRP A CD2 1 
ATOM   1478 N NE1 . TRP A 1 203 ? -44.764 -9.060  -34.974 1.00 26.99 ? 200 TRP A NE1 1 
ATOM   1479 C CE2 . TRP A 1 203 ? -44.926 -9.210  -36.330 1.00 23.28 ? 200 TRP A CE2 1 
ATOM   1480 C CE3 . TRP A 1 203 ? -46.520 -10.221 -37.839 1.00 24.83 ? 200 TRP A CE3 1 
ATOM   1481 C CZ2 . TRP A 1 203 ? -44.128 -8.794  -37.392 1.00 29.02 ? 200 TRP A CZ2 1 
ATOM   1482 C CZ3 . TRP A 1 203 ? -45.736 -9.812  -38.889 1.00 28.04 ? 200 TRP A CZ3 1 
ATOM   1483 C CH2 . TRP A 1 203 ? -44.544 -9.107  -38.662 1.00 28.32 ? 200 TRP A CH2 1 
ATOM   1484 N N   . LEU A 1 204 ? -50.944 -11.461 -35.542 1.00 23.00 ? 201 LEU A N   1 
ATOM   1485 C CA  . LEU A 1 204 ? -51.915 -12.556 -35.454 1.00 22.64 ? 201 LEU A CA  1 
ATOM   1486 C C   . LEU A 1 204 ? -51.288 -13.854 -35.965 1.00 22.32 ? 201 LEU A C   1 
ATOM   1487 O O   . LEU A 1 204 ? -50.528 -13.869 -36.942 1.00 22.97 ? 201 LEU A O   1 
ATOM   1488 C CB  . LEU A 1 204 ? -53.144 -12.268 -36.317 1.00 23.77 ? 201 LEU A CB  1 
ATOM   1489 C CG  . LEU A 1 204 ? -53.922 -10.976 -36.045 1.00 24.93 ? 201 LEU A CG  1 
ATOM   1490 C CD1 . LEU A 1 204 ? -55.168 -10.892 -36.931 1.00 27.63 ? 201 LEU A CD1 1 
ATOM   1491 C CD2 . LEU A 1 204 ? -54.312 -10.980 -34.571 1.00 26.45 ? 201 LEU A CD2 1 
ATOM   1492 N N   . ASN A 1 205 ? -51.652 -14.960 -35.359 1.00 21.57 ? 202 ASN A N   1 
ATOM   1493 C CA  . ASN A 1 205 ? -51.171 -16.252 -35.848 1.00 21.42 ? 202 ASN A CA  1 
ATOM   1494 C C   . ASN A 1 205 ? -52.138 -16.821 -36.884 1.00 21.18 ? 202 ASN A C   1 
ATOM   1495 O O   . ASN A 1 205 ? -53.331 -16.881 -36.607 1.00 22.78 ? 202 ASN A O   1 
ATOM   1496 C CB  . ASN A 1 205 ? -51.090 -17.231 -34.712 1.00 20.33 ? 202 ASN A CB  1 
ATOM   1497 C CG  . ASN A 1 205 ? -50.530 -18.531 -35.154 1.00 19.28 ? 202 ASN A CG  1 
ATOM   1498 O OD1 . ASN A 1 205 ? -49.401 -18.572 -35.622 1.00 21.61 ? 202 ASN A OD1 1 
ATOM   1499 N ND2 . ASN A 1 205 ? -51.307 -19.614 -35.018 1.00 19.76 ? 202 ASN A ND2 1 
ATOM   1500 N N   . PRO A 1 206 ? -51.638 -17.241 -38.073 1.00 21.65 ? 203 PRO A N   1 
ATOM   1501 C CA  . PRO A 1 206 ? -52.557 -17.703 -39.094 1.00 22.31 ? 203 PRO A CA  1 
ATOM   1502 C C   . PRO A 1 206 ? -52.857 -19.205 -39.084 1.00 23.32 ? 203 PRO A C   1 
ATOM   1503 O O   . PRO A 1 206 ? -53.697 -19.654 -39.908 1.00 23.66 ? 203 PRO A O   1 
ATOM   1504 C CB  . PRO A 1 206 ? -51.812 -17.375 -40.380 1.00 23.11 ? 203 PRO A CB  1 
ATOM   1505 C CG  . PRO A 1 206 ? -50.391 -17.468 -40.065 1.00 22.17 ? 203 PRO A CG  1 
ATOM   1506 C CD  . PRO A 1 206 ? -50.277 -17.028 -38.623 1.00 20.36 ? 203 PRO A CD  1 
ATOM   1507 N N   . THR A 1 207 ? -52.191 -19.959 -38.220 1.00 21.58 ? 204 THR A N   1 
ATOM   1508 C CA  . THR A 1 207 ? -52.275 -21.421 -38.275 1.00 21.77 ? 204 THR A CA  1 
ATOM   1509 C C   . THR A 1 207 ? -53.181 -21.934 -37.164 1.00 23.62 ? 204 THR A C   1 
ATOM   1510 O O   . THR A 1 207 ? -53.423 -21.258 -36.140 1.00 25.77 ? 204 THR A O   1 
ATOM   1511 C CB  . THR A 1 207 ? -50.884 -22.101 -38.126 1.00 21.40 ? 204 THR A CB  1 
ATOM   1512 O OG1 . THR A 1 207 ? -50.334 -21.762 -36.877 1.00 19.25 ? 204 THR A OG1 1 
ATOM   1513 C CG2 . THR A 1 207 ? -49.920 -21.702 -39.255 1.00 23.48 ? 204 THR A CG2 1 
ATOM   1514 N N   . GLY A 1 208 ? -53.567 -23.186 -37.304 1.00 23.65 ? 205 GLY A N   1 
ATOM   1515 C CA  . GLY A 1 208 ? -54.409 -23.819 -36.347 1.00 25.02 ? 205 GLY A CA  1 
ATOM   1516 C C   . GLY A 1 208 ? -55.840 -24.017 -36.793 1.00 25.15 ? 205 GLY A C   1 
ATOM   1517 O O   . GLY A 1 208 ? -56.293 -23.517 -37.852 1.00 26.34 ? 205 GLY A O   1 
ATOM   1518 N N   . ASN A 1 209 ? -56.543 -24.799 -35.985 1.00 24.34 ? 206 ASN A N   1 
ATOM   1519 C CA  . ASN A 1 209 ? -57.935 -25.135 -36.214 1.00 24.14 ? 206 ASN A CA  1 
ATOM   1520 C C   . ASN A 1 209 ? -58.577 -25.652 -34.948 1.00 22.69 ? 206 ASN A C   1 
ATOM   1521 O O   . ASN A 1 209 ? -57.959 -25.639 -33.851 1.00 21.29 ? 206 ASN A O   1 
ATOM   1522 C CB  . ASN A 1 209 ? -58.085 -26.133 -37.380 1.00 24.41 ? 206 ASN A CB  1 
ATOM   1523 C CG  . ASN A 1 209 ? -57.343 -27.418 -37.148 1.00 24.55 ? 206 ASN A CG  1 
ATOM   1524 O OD1 . ASN A 1 209 ? -57.370 -27.962 -36.057 1.00 23.79 ? 206 ASN A OD1 1 
ATOM   1525 N ND2 . ASN A 1 209 ? -56.680 -27.939 -38.218 1.00 25.11 ? 206 ASN A ND2 1 
ATOM   1526 N N   . GLY A 1 210 ? -59.832 -26.080 -35.060 1.00 22.45 ? 207 GLY A N   1 
ATOM   1527 C CA  . GLY A 1 210 ? -60.594 -26.481 -33.882 1.00 23.28 ? 207 GLY A CA  1 
ATOM   1528 C C   . GLY A 1 210 ? -60.070 -27.701 -33.166 1.00 22.48 ? 207 GLY A C   1 
ATOM   1529 O O   . GLY A 1 210 ? -60.503 -28.005 -32.026 1.00 22.78 ? 207 GLY A O   1 
ATOM   1530 N N   . ALA A 1 211 ? -59.104 -28.405 -33.770 1.00 21.68 ? 208 ALA A N   1 
ATOM   1531 C CA  . ALA A 1 211 ? -58.530 -29.572 -33.097 1.00 21.75 ? 208 ALA A CA  1 
ATOM   1532 C C   . ALA A 1 211 ? -57.840 -29.153 -31.804 1.00 20.52 ? 208 ALA A C   1 
ATOM   1533 O O   . ALA A 1 211 ? -57.647 -29.968 -30.903 1.00 21.09 ? 208 ALA A O   1 
ATOM   1534 C CB  . ALA A 1 211 ? -57.557 -30.308 -33.987 1.00 21.76 ? 208 ALA A CB  1 
ATOM   1535 N N   . LEU A 1 212 ? -57.447 -27.878 -31.722 1.00 20.14 ? 209 LEU A N   1 
ATOM   1536 C CA  . LEU A 1 212 ? -56.739 -27.339 -30.579 1.00 19.10 ? 209 LEU A CA  1 
ATOM   1537 C C   . LEU A 1 212 ? -57.658 -27.003 -29.412 1.00 20.24 ? 209 LEU A C   1 
ATOM   1538 O O   . LEU A 1 212 ? -57.178 -26.756 -28.322 1.00 20.93 ? 209 LEU A O   1 
ATOM   1539 C CB  . LEU A 1 212 ? -55.945 -26.094 -30.977 1.00 19.36 ? 209 LEU A CB  1 
ATOM   1540 C CG  . LEU A 1 212 ? -54.813 -26.278 -31.988 1.00 19.77 ? 209 LEU A CG  1 
ATOM   1541 C CD1 . LEU A 1 212 ? -54.264 -24.891 -32.449 1.00 19.94 ? 209 LEU A CD1 1 
ATOM   1542 C CD2 . LEU A 1 212 ? -53.703 -27.168 -31.406 1.00 17.81 ? 209 LEU A CD2 1 
ATOM   1543 N N   . ALA A 1 213 ? -58.970 -27.001 -29.645 1.00 20.39 ? 210 ALA A N   1 
ATOM   1544 C CA  . ALA A 1 213 ? -59.934 -26.621 -28.621 1.00 20.76 ? 210 ALA A CA  1 
ATOM   1545 C C   . ALA A 1 213 ? -60.237 -27.830 -27.752 1.00 20.64 ? 210 ALA A C   1 
ATOM   1546 O O   . ALA A 1 213 ? -61.354 -28.376 -27.774 1.00 20.62 ? 210 ALA A O   1 
ATOM   1547 C CB  . ALA A 1 213 ? -61.229 -26.043 -29.253 1.00 21.49 ? 210 ALA A CB  1 
ATOM   1548 N N   . LYS A 1 214 ? -59.221 -28.253 -27.022 1.00 20.08 ? 211 LYS A N   1 
ATOM   1549 C CA  . LYS A 1 214 ? -59.321 -29.392 -26.084 1.00 20.01 ? 211 LYS A CA  1 
ATOM   1550 C C   . LYS A 1 214 ? -58.251 -29.255 -25.035 1.00 20.05 ? 211 LYS A C   1 
ATOM   1551 O O   . LYS A 1 214 ? -57.156 -28.724 -25.306 1.00 20.19 ? 211 LYS A O   1 
ATOM   1552 C CB  . LYS A 1 214 ? -59.167 -30.717 -26.853 1.00 19.66 ? 211 LYS A CB  1 
ATOM   1553 C CG  . LYS A 1 214 ? -59.521 -31.960 -26.028 1.00 19.03 ? 211 LYS A CG  1 
ATOM   1554 C CD  . LYS A 1 214 ? -59.336 -33.292 -26.853 1.00 17.89 ? 211 LYS A CD  1 
ATOM   1555 C CE  . LYS A 1 214 ? -60.244 -33.368 -28.116 1.00 19.67 ? 211 LYS A CE  1 
ATOM   1556 N NZ  . LYS A 1 214 ? -59.897 -34.565 -28.935 1.00 17.28 ? 211 LYS A NZ  1 
ATOM   1557 N N   . GLY A 1 215 ? -58.539 -29.738 -23.822 1.00 19.40 ? 212 GLY A N   1 
ATOM   1558 C CA  . GLY A 1 215 ? -57.575 -29.677 -22.763 1.00 19.69 ? 212 GLY A CA  1 
ATOM   1559 C C   . GLY A 1 215 ? -56.219 -30.231 -23.099 1.00 19.79 ? 212 GLY A C   1 
ATOM   1560 O O   . GLY A 1 215 ? -56.091 -31.283 -23.730 1.00 20.46 ? 212 GLY A O   1 
ATOM   1561 N N   . GLY A 1 216 ? -55.197 -29.497 -22.680 1.00 18.58 ? 213 GLY A N   1 
ATOM   1562 C CA  . GLY A 1 216 ? -53.817 -29.889 -22.812 1.00 18.17 ? 213 GLY A CA  1 
ATOM   1563 C C   . GLY A 1 216 ? -53.051 -29.183 -23.909 1.00 18.01 ? 213 GLY A C   1 
ATOM   1564 O O   . GLY A 1 216 ? -51.808 -29.143 -23.877 1.00 17.34 ? 213 GLY A O   1 
ATOM   1565 N N   . THR A 1 217 ? -53.741 -28.611 -24.898 1.00 18.54 ? 214 THR A N   1 
ATOM   1566 C CA  . THR A 1 217 ? -53.021 -28.020 -25.984 1.00 18.15 ? 214 THR A CA  1 
ATOM   1567 C C   . THR A 1 217 ? -52.277 -26.738 -25.552 1.00 18.13 ? 214 THR A C   1 
ATOM   1568 O O   . THR A 1 217 ? -51.237 -26.389 -26.170 1.00 19.16 ? 214 THR A O   1 
ATOM   1569 C CB  . THR A 1 217 ? -53.920 -27.744 -27.197 1.00 18.47 ? 214 THR A CB  1 
ATOM   1570 O OG1 . THR A 1 217 ? -54.903 -26.765 -26.829 1.00 19.12 ? 214 THR A OG1 1 
ATOM   1571 C CG2 . THR A 1 217 ? -54.607 -29.072 -27.698 1.00 18.47 ? 214 THR A CG2 1 
ATOM   1572 N N   . GLY A 1 218 ? -52.768 -26.065 -24.512 1.00 17.89 ? 215 GLY A N   1 
ATOM   1573 C CA  . GLY A 1 218 ? -52.097 -24.886 -24.013 1.00 18.86 ? 215 GLY A CA  1 
ATOM   1574 C C   . GLY A 1 218 ? -50.839 -25.265 -23.233 1.00 17.84 ? 215 GLY A C   1 
ATOM   1575 O O   . GLY A 1 218 ? -49.853 -24.524 -23.243 1.00 17.73 ? 215 GLY A O   1 
ATOM   1576 N N   . ASP A 1 219 ? -50.877 -26.393 -22.521 1.00 18.67 ? 216 ASP A N   1 
ATOM   1577 C CA  . ASP A 1 219 ? -49.698 -26.903 -21.810 1.00 19.14 ? 216 ASP A CA  1 
ATOM   1578 C C   . ASP A 1 219 ? -48.594 -27.213 -22.812 1.00 17.96 ? 216 ASP A C   1 
ATOM   1579 O O   . ASP A 1 219 ? -47.438 -26.871 -22.604 1.00 16.85 ? 216 ASP A O   1 
ATOM   1580 C CB  . ASP A 1 219 ? -50.051 -28.165 -21.010 1.00 18.64 ? 216 ASP A CB  1 
ATOM   1581 C CG  . ASP A 1 219 ? -51.161 -27.933 -19.991 1.00 21.42 ? 216 ASP A CG  1 
ATOM   1582 O OD1 . ASP A 1 219 ? -51.245 -26.815 -19.419 1.00 20.98 ? 216 ASP A OD1 1 
ATOM   1583 O OD2 . ASP A 1 219 ? -51.940 -28.898 -19.773 1.00 22.45 ? 216 ASP A OD2 1 
ATOM   1584 N N   . THR A 1 220 ? -48.960 -27.829 -23.935 1.00 17.29 ? 217 THR A N   1 
ATOM   1585 C CA  . THR A 1 220 ? -48.009 -28.153 -24.997 1.00 17.19 ? 217 THR A CA  1 
ATOM   1586 C C   . THR A 1 220 ? -47.402 -26.840 -25.549 1.00 17.22 ? 217 THR A C   1 
ATOM   1587 O O   . THR A 1 220 ? -46.179 -26.735 -25.712 1.00 16.87 ? 217 THR A O   1 
ATOM   1588 C CB  . THR A 1 220 ? -48.687 -28.941 -26.071 1.00 17.99 ? 217 THR A CB  1 
ATOM   1589 O OG1 . THR A 1 220 ? -49.136 -30.195 -25.538 1.00 18.63 ? 217 THR A OG1 1 
ATOM   1590 C CG2 . THR A 1 220 ? -47.767 -29.179 -27.300 1.00 17.58 ? 217 THR A CG2 1 
ATOM   1591 N N   . LEU A 1 221 ? -48.262 -25.849 -25.812 1.00 16.76 ? 218 LEU A N   1 
ATOM   1592 C CA  . LEU A 1 221 ? -47.759 -24.573 -26.342 1.00 16.98 ? 218 LEU A CA  1 
ATOM   1593 C C   . LEU A 1 221 ? -46.766 -23.925 -25.406 1.00 16.98 ? 218 LEU A C   1 
ATOM   1594 O O   . LEU A 1 221 ? -45.743 -23.440 -25.833 1.00 17.50 ? 218 LEU A O   1 
ATOM   1595 C CB  . LEU A 1 221 ? -48.885 -23.594 -26.644 1.00 17.04 ? 218 LEU A CB  1 
ATOM   1596 C CG  . LEU A 1 221 ? -48.427 -22.196 -27.091 1.00 17.44 ? 218 LEU A CG  1 
ATOM   1597 C CD1 . LEU A 1 221 ? -47.653 -22.309 -28.414 1.00 18.79 ? 218 LEU A CD1 1 
ATOM   1598 C CD2 . LEU A 1 221 ? -49.614 -21.261 -27.248 1.00 20.96 ? 218 LEU A CD2 1 
ATOM   1599 N N   . THR A 1 222 ? -47.060 -23.919 -24.113 1.00 16.32 ? 219 THR A N   1 
ATOM   1600 C CA  . THR A 1 222 ? -46.157 -23.305 -23.146 1.00 17.33 ? 219 THR A CA  1 
ATOM   1601 C C   . THR A 1 222 ? -44.781 -23.958 -23.209 1.00 16.12 ? 219 THR A C   1 
ATOM   1602 O O   . THR A 1 222 ? -43.753 -23.293 -23.188 1.00 16.15 ? 219 THR A O   1 
ATOM   1603 C CB  . THR A 1 222 ? -46.752 -23.349 -21.739 1.00 17.50 ? 219 THR A CB  1 
ATOM   1604 O OG1 . THR A 1 222 ? -47.891 -22.504 -21.710 1.00 19.11 ? 219 THR A OG1 1 
ATOM   1605 C CG2 . THR A 1 222 ? -45.778 -22.900 -20.662 1.00 17.41 ? 219 THR A CG2 1 
ATOM   1606 N N   . GLY A 1 223 ? -44.767 -25.277 -23.272 1.00 16.46 ? 220 GLY A N   1 
ATOM   1607 C CA  . GLY A 1 223 ? -43.511 -25.987 -23.440 1.00 16.33 ? 220 GLY A CA  1 
ATOM   1608 C C   . GLY A 1 223 ? -42.785 -25.643 -24.719 1.00 15.92 ? 220 GLY A C   1 
ATOM   1609 O O   . GLY A 1 223 ? -41.570 -25.411 -24.725 1.00 16.83 ? 220 GLY A O   1 
ATOM   1610 N N   . MET A 1 224 ? -43.529 -25.536 -25.810 1.00 16.20 ? 221 MET A N   1 
ATOM   1611 C CA  . MET A 1 224 ? -42.923 -25.173 -27.087 1.00 16.84 ? 221 MET A CA  1 
ATOM   1612 C C   . MET A 1 224 ? -42.256 -23.796 -27.070 1.00 16.99 ? 221 MET A C   1 
ATOM   1613 O O   . MET A 1 224 ? -41.121 -23.604 -27.576 1.00 16.86 ? 221 MET A O   1 
ATOM   1614 C CB  . MET A 1 224 ? -43.912 -25.300 -28.217 1.00 16.84 ? 221 MET A CB  1 
ATOM   1615 C CG  . MET A 1 224 ? -44.307 -26.739 -28.529 1.00 16.73 ? 221 MET A CG  1 
ATOM   1616 S SD  . MET A 1 224 ? -45.541 -26.837 -29.864 1.00 19.02 ? 221 MET A SD  1 
ATOM   1617 C CE  . MET A 1 224 ? -44.767 -25.939 -31.234 1.00 26.18 ? 221 MET A CE  1 
ATOM   1618 N N   . ILE A 1 225 ? -42.954 -22.831 -26.500 1.00 16.10 ? 222 ILE A N   1 
ATOM   1619 C CA  . ILE A 1 225 ? -42.346 -21.510 -26.278 1.00 17.69 ? 222 ILE A CA  1 
ATOM   1620 C C   . ILE A 1 225 ? -41.080 -21.617 -25.447 1.00 17.29 ? 222 ILE A C   1 
ATOM   1621 O O   . ILE A 1 225 ? -40.056 -21.005 -25.808 1.00 18.59 ? 222 ILE A O   1 
ATOM   1622 C CB  . ILE A 1 225 ? -43.326 -20.463 -25.633 1.00 17.56 ? 222 ILE A CB  1 
ATOM   1623 C CG1 . ILE A 1 225 ? -44.572 -20.315 -26.498 1.00 16.84 ? 222 ILE A CG1 1 
ATOM   1624 C CG2 . ILE A 1 225 ? -42.626 -19.070 -25.459 1.00 19.01 ? 222 ILE A CG2 1 
ATOM   1625 C CD1 . ILE A 1 225 ? -45.776 -19.535 -25.821 1.00 18.83 ? 222 ILE A CD1 1 
ATOM   1626 N N   . LEU A 1 226 ? -41.144 -22.342 -24.318 1.00 17.23 ? 223 LEU A N   1 
ATOM   1627 C CA  . LEU A 1 226 ? -39.986 -22.527 -23.471 1.00 17.93 ? 223 LEU A CA  1 
ATOM   1628 C C   . LEU A 1 226 ? -38.782 -23.056 -24.249 1.00 16.81 ? 223 LEU A C   1 
ATOM   1629 O O   . LEU A 1 226 ? -37.687 -22.486 -24.166 1.00 17.90 ? 223 LEU A O   1 
ATOM   1630 C CB  . LEU A 1 226 ? -40.291 -23.479 -22.331 1.00 16.60 ? 223 LEU A CB  1 
ATOM   1631 C CG  . LEU A 1 226 ? -39.205 -23.648 -21.272 1.00 17.13 ? 223 LEU A CG  1 
ATOM   1632 C CD1 . LEU A 1 226 ? -38.758 -22.331 -20.603 1.00 16.99 ? 223 LEU A CD1 1 
ATOM   1633 C CD2 . LEU A 1 226 ? -39.705 -24.670 -20.273 1.00 17.69 ? 223 LEU A CD2 1 
ATOM   1634 N N   . GLY A 1 227 ? -38.962 -24.141 -24.997 1.00 17.89 ? 224 GLY A N   1 
ATOM   1635 C CA  . GLY A 1 227 ? -37.858 -24.659 -25.789 1.00 18.09 ? 224 GLY A CA  1 
ATOM   1636 C C   . GLY A 1 227 ? -37.354 -23.713 -26.870 1.00 18.76 ? 224 GLY A C   1 
ATOM   1637 O O   . GLY A 1 227 ? -36.124 -23.506 -27.035 1.00 18.92 ? 224 GLY A O   1 
ATOM   1638 N N   . MET A 1 228 ? -38.272 -23.052 -27.566 1.00 18.63 ? 225 MET A N   1 
ATOM   1639 C CA  . MET A 1 228 ? -37.872 -22.134 -28.630 1.00 20.07 ? 225 MET A CA  1 
ATOM   1640 C C   . MET A 1 228 ? -37.082 -20.949 -28.091 1.00 19.41 ? 225 MET A C   1 
ATOM   1641 O O   . MET A 1 228 ? -36.177 -20.488 -28.758 1.00 20.34 ? 225 MET A O   1 
ATOM   1642 C CB  . MET A 1 228 ? -39.045 -21.726 -29.520 1.00 19.71 ? 225 MET A CB  1 
ATOM   1643 C CG  . MET A 1 228 ? -39.378 -22.916 -30.494 1.00 23.35 ? 225 MET A CG  1 
ATOM   1644 S SD  . MET A 1 228 ? -40.556 -22.477 -31.721 1.00 29.20 ? 225 MET A SD  1 
ATOM   1645 C CE  . MET A 1 228 ? -41.097 -24.103 -32.172 1.00 26.26 ? 225 MET A CE  1 
ATOM   1646 N N   . LEU A 1 229 ? -37.378 -20.502 -26.892 1.00 19.24 ? 226 LEU A N   1 
ATOM   1647 C CA  . LEU A 1 229 ? -36.590 -19.434 -26.234 1.00 19.18 ? 226 LEU A CA  1 
ATOM   1648 C C   . LEU A 1 229 ? -35.143 -19.832 -26.050 1.00 20.20 ? 226 LEU A C   1 
ATOM   1649 O O   . LEU A 1 229 ? -34.251 -18.971 -25.948 1.00 21.23 ? 226 LEU A O   1 
ATOM   1650 C CB  . LEU A 1 229 ? -37.214 -19.066 -24.885 1.00 19.64 ? 226 LEU A CB  1 
ATOM   1651 C CG  . LEU A 1 229 ? -38.503 -18.254 -24.990 1.00 19.57 ? 226 LEU A CG  1 
ATOM   1652 C CD1 . LEU A 1 229 ? -39.263 -18.255 -23.652 1.00 19.24 ? 226 LEU A CD1 1 
ATOM   1653 C CD2 . LEU A 1 229 ? -38.196 -16.773 -25.478 1.00 18.98 ? 226 LEU A CD2 1 
ATOM   1654 N N   . CYS A 1 230 ? -34.892 -21.135 -25.986 1.00 19.89 ? 227 CYS A N   1 
ATOM   1655 C CA  . CYS A 1 230 ? -33.540 -21.633 -25.773 1.00 20.79 ? 227 CYS A CA  1 
ATOM   1656 C C   . CYS A 1 230 ? -32.720 -21.802 -27.082 1.00 22.79 ? 227 CYS A C   1 
ATOM   1657 O O   . CYS A 1 230 ? -31.499 -22.025 -27.024 1.00 25.85 ? 227 CYS A O   1 
ATOM   1658 C CB  . CYS A 1 230 ? -33.606 -22.971 -25.037 1.00 20.95 ? 227 CYS A CB  1 
ATOM   1659 S SG  . CYS A 1 230 ? -34.233 -22.872 -23.373 1.00 20.88 ? 227 CYS A SG  1 
ATOM   1660 N N   . CYS A 1 231 ? -33.356 -21.790 -28.239 1.00 21.29 ? 228 CYS A N   1 
ATOM   1661 C CA  . CYS A 1 231 ? -32.616 -21.933 -29.504 1.00 22.14 ? 228 CYS A CA  1 
ATOM   1662 C C   . CYS A 1 231 ? -32.717 -20.740 -30.428 1.00 23.45 ? 228 CYS A C   1 
ATOM   1663 O O   . CYS A 1 231 ? -32.044 -20.750 -31.462 1.00 24.57 ? 228 CYS A O   1 
ATOM   1664 C CB  . CYS A 1 231 ? -33.038 -23.197 -30.269 1.00 21.39 ? 228 CYS A CB  1 
ATOM   1665 S SG  . CYS A 1 231 ? -34.771 -23.356 -30.680 1.00 21.52 ? 228 CYS A SG  1 
ATOM   1666 N N   . HIS A 1 232 ? -33.559 -19.741 -30.104 1.00 22.72 ? 229 HIS A N   1 
ATOM   1667 C CA  . HIS A 1 232 ? -33.602 -18.494 -30.872 1.00 23.52 ? 229 HIS A CA  1 
ATOM   1668 C C   . HIS A 1 232 ? -32.849 -17.412 -30.091 1.00 24.92 ? 229 HIS A C   1 
ATOM   1669 O O   . HIS A 1 232 ? -33.070 -17.250 -28.914 1.00 25.07 ? 229 HIS A O   1 
ATOM   1670 C CB  . HIS A 1 232 ? -35.058 -17.977 -31.032 1.00 23.04 ? 229 HIS A CB  1 
ATOM   1671 C CG  . HIS A 1 232 ? -35.932 -18.775 -31.944 1.00 21.04 ? 229 HIS A CG  1 
ATOM   1672 N ND1 . HIS A 1 232 ? -36.391 -20.043 -31.631 1.00 19.92 ? 229 HIS A ND1 1 
ATOM   1673 C CD2 . HIS A 1 232 ? -36.492 -18.458 -33.144 1.00 22.50 ? 229 HIS A CD2 1 
ATOM   1674 C CE1 . HIS A 1 232 ? -37.168 -20.470 -32.623 1.00 21.27 ? 229 HIS A CE1 1 
ATOM   1675 N NE2 . HIS A 1 232 ? -37.269 -19.515 -33.528 1.00 20.92 ? 229 HIS A NE2 1 
ATOM   1676 N N   . GLU A 1 233 ? -32.004 -16.639 -30.742 1.00 26.54 ? 230 GLU A N   1 
ATOM   1677 C CA  . GLU A 1 233 ? -31.408 -15.486 -30.075 1.00 29.19 ? 230 GLU A CA  1 
ATOM   1678 C C   . GLU A 1 233 ? -32.424 -14.390 -29.755 1.00 27.70 ? 230 GLU A C   1 
ATOM   1679 O O   . GLU A 1 233 ? -32.314 -13.730 -28.730 1.00 28.62 ? 230 GLU A O   1 
ATOM   1680 C CB  . GLU A 1 233 ? -30.270 -14.886 -30.913 1.00 31.50 ? 230 GLU A CB  1 
ATOM   1681 C CG  . GLU A 1 233 ? -29.079 -15.808 -31.048 1.00 38.31 ? 230 GLU A CG  1 
ATOM   1682 C CD  . GLU A 1 233 ? -28.439 -16.159 -29.718 1.00 45.86 ? 230 GLU A CD  1 
ATOM   1683 O OE1 . GLU A 1 233 ? -28.060 -15.222 -28.961 1.00 50.78 ? 230 GLU A OE1 1 
ATOM   1684 O OE2 . GLU A 1 233 ? -28.326 -17.381 -29.423 1.00 52.07 ? 230 GLU A OE2 1 
ATOM   1685 N N   . ASP A 1 234 ? -33.428 -14.241 -30.610 1.00 26.12 ? 231 ASP A N   1 
ATOM   1686 C CA  . ASP A 1 234 ? -34.433 -13.206 -30.435 1.00 26.26 ? 231 ASP A CA  1 
ATOM   1687 C C   . ASP A 1 234 ? -35.704 -13.813 -29.815 1.00 24.64 ? 231 ASP A C   1 
ATOM   1688 O O   . ASP A 1 234 ? -36.383 -14.596 -30.451 1.00 22.66 ? 231 ASP A O   1 
ATOM   1689 C CB  . ASP A 1 234 ? -34.741 -12.583 -31.785 1.00 27.32 ? 231 ASP A CB  1 
ATOM   1690 C CG  . ASP A 1 234 ? -35.765 -11.455 -31.692 1.00 30.02 ? 231 ASP A CG  1 
ATOM   1691 O OD1 . ASP A 1 234 ? -36.454 -11.306 -30.668 1.00 28.19 ? 231 ASP A OD1 1 
ATOM   1692 O OD2 . ASP A 1 234 ? -35.856 -10.675 -32.651 1.00 32.53 ? 231 ASP A OD2 1 
ATOM   1693 N N   . PRO A 1 235 ? -35.994 -13.501 -28.556 1.00 23.66 ? 232 PRO A N   1 
ATOM   1694 C CA  . PRO A 1 235 ? -37.125 -14.150 -27.879 1.00 23.14 ? 232 PRO A CA  1 
ATOM   1695 C C   . PRO A 1 235 ? -38.462 -13.818 -28.530 1.00 22.18 ? 232 PRO A C   1 
ATOM   1696 O O   . PRO A 1 235 ? -39.423 -14.589 -28.401 1.00 22.01 ? 232 PRO A O   1 
ATOM   1697 C CB  . PRO A 1 235 ? -37.054 -13.600 -26.462 1.00 23.76 ? 232 PRO A CB  1 
ATOM   1698 C CG  . PRO A 1 235 ? -36.295 -12.368 -26.589 1.00 25.77 ? 232 PRO A CG  1 
ATOM   1699 C CD  . PRO A 1 235 ? -35.347 -12.492 -27.697 1.00 24.38 ? 232 PRO A CD  1 
ATOM   1700 N N   . LYS A 1 236 ? -38.538 -12.690 -29.240 1.00 22.19 ? 233 LYS A N   1 
ATOM   1701 C CA  . LYS A 1 236 ? -39.770 -12.371 -29.927 1.00 22.89 ? 233 LYS A CA  1 
ATOM   1702 C C   . LYS A 1 236 ? -40.060 -13.402 -31.013 1.00 22.78 ? 233 LYS A C   1 
ATOM   1703 O O   . LYS A 1 236 ? -41.185 -13.847 -31.165 1.00 21.60 ? 233 LYS A O   1 
ATOM   1704 C CB  . LYS A 1 236 ? -39.741 -10.952 -30.479 1.00 23.96 ? 233 LYS A CB  1 
ATOM   1705 C CG  . LYS A 1 236 ? -39.659 -9.924  -29.354 1.00 26.65 ? 233 LYS A CG  1 
ATOM   1706 C CD  . LYS A 1 236 ? -39.461 -8.499  -29.934 1.00 33.21 ? 233 LYS A CD  1 
ATOM   1707 C CE  . LYS A 1 236 ? -40.698 -7.961  -30.634 1.00 35.23 ? 233 LYS A CE  1 
ATOM   1708 N NZ  . LYS A 1 236 ? -40.582 -6.420  -30.848 1.00 35.65 ? 233 LYS A NZ  1 
ATOM   1709 N N   . HIS A 1 237 ? -39.028 -13.757 -31.771 1.00 22.38 ? 234 HIS A N   1 
ATOM   1710 C CA  . HIS A 1 237 ? -39.161 -14.766 -32.835 1.00 22.41 ? 234 HIS A CA  1 
ATOM   1711 C C   . HIS A 1 237 ? -39.469 -16.140 -32.246 1.00 21.22 ? 234 HIS A C   1 
ATOM   1712 O O   . HIS A 1 237 ? -40.232 -16.900 -32.829 1.00 20.42 ? 234 HIS A O   1 
ATOM   1713 C CB  . HIS A 1 237 ? -37.887 -14.806 -33.692 1.00 23.73 ? 234 HIS A CB  1 
ATOM   1714 C CG  . HIS A 1 237 ? -37.631 -13.538 -34.452 1.00 25.61 ? 234 HIS A CG  1 
ATOM   1715 N ND1 . HIS A 1 237 ? -36.411 -13.237 -35.025 1.00 26.41 ? 234 HIS A ND1 1 
ATOM   1716 C CD2 . HIS A 1 237 ? -38.430 -12.472 -34.682 1.00 27.57 ? 234 HIS A CD2 1 
ATOM   1717 C CE1 . HIS A 1 237 ? -36.492 -12.058 -35.624 1.00 29.35 ? 234 HIS A CE1 1 
ATOM   1718 N NE2 . HIS A 1 237 ? -37.699 -11.562 -35.416 1.00 29.04 ? 234 HIS A NE2 1 
ATOM   1719 N N   . ALA A 1 238 ? -38.909 -16.445 -31.063 1.00 20.26 ? 235 ALA A N   1 
ATOM   1720 C CA  . ALA A 1 238 ? -39.193 -17.706 -30.403 1.00 19.09 ? 235 ALA A CA  1 
ATOM   1721 C C   . ALA A 1 238 ? -40.692 -17.831 -30.137 1.00 18.99 ? 235 ALA A C   1 
ATOM   1722 O O   . ALA A 1 238 ? -41.282 -18.878 -30.392 1.00 18.88 ? 235 ALA A O   1 
ATOM   1723 C CB  . ALA A 1 238 ? -38.418 -17.846 -29.044 1.00 19.48 ? 235 ALA A CB  1 
ATOM   1724 N N   . VAL A 1 239 ? -41.282 -16.775 -29.559 1.00 18.17 ? 236 VAL A N   1 
ATOM   1725 C CA  . VAL A 1 239 ? -42.700 -16.804 -29.220 1.00 18.65 ? 236 VAL A CA  1 
ATOM   1726 C C   . VAL A 1 239 ? -43.557 -16.959 -30.487 1.00 18.44 ? 236 VAL A C   1 
ATOM   1727 O O   . VAL A 1 239 ? -44.455 -17.799 -30.538 1.00 18.36 ? 236 VAL A O   1 
ATOM   1728 C CB  . VAL A 1 239 ? -43.101 -15.560 -28.428 1.00 18.44 ? 236 VAL A CB  1 
ATOM   1729 C CG1 . VAL A 1 239 ? -44.638 -15.505 -28.230 1.00 18.86 ? 236 VAL A CG1 1 
ATOM   1730 C CG2 . VAL A 1 239 ? -42.343 -15.525 -27.080 1.00 20.15 ? 236 VAL A CG2 1 
ATOM   1731 N N   . LEU A 1 240 ? -43.289 -16.118 -31.474 1.00 19.41 ? 237 LEU A N   1 
ATOM   1732 C CA  . LEU A 1 240 ? -44.038 -16.128 -32.725 1.00 18.97 ? 237 LEU A CA  1 
ATOM   1733 C C   . LEU A 1 240 ? -43.932 -17.495 -33.430 1.00 18.32 ? 237 LEU A C   1 
ATOM   1734 O O   . LEU A 1 240 ? -44.943 -18.050 -33.868 1.00 18.84 ? 237 LEU A O   1 
ATOM   1735 C CB  . LEU A 1 240 ? -43.579 -14.989 -33.622 1.00 20.00 ? 237 LEU A CB  1 
ATOM   1736 C CG  . LEU A 1 240 ? -43.965 -13.604 -33.108 1.00 19.69 ? 237 LEU A CG  1 
ATOM   1737 C CD1 . LEU A 1 240 ? -43.049 -12.535 -33.710 1.00 20.13 ? 237 LEU A CD1 1 
ATOM   1738 C CD2 . LEU A 1 240 ? -45.440 -13.286 -33.373 1.00 20.18 ? 237 LEU A CD2 1 
ATOM   1739 N N   . ASN A 1 241 ? -42.715 -18.029 -33.525 1.00 18.53 ? 238 ASN A N   1 
ATOM   1740 C CA  . ASN A 1 241 ? -42.509 -19.322 -34.190 1.00 18.04 ? 238 ASN A CA  1 
ATOM   1741 C C   . ASN A 1 241 ? -43.170 -20.475 -33.443 1.00 17.79 ? 238 ASN A C   1 
ATOM   1742 O O   . ASN A 1 241 ? -43.682 -21.424 -34.048 1.00 17.44 ? 238 ASN A O   1 
ATOM   1743 C CB  . ASN A 1 241 ? -41.008 -19.553 -34.460 1.00 16.61 ? 238 ASN A CB  1 
ATOM   1744 C CG  . ASN A 1 241 ? -40.483 -18.692 -35.606 1.00 21.31 ? 238 ASN A CG  1 
ATOM   1745 O OD1 . ASN A 1 241 ? -41.265 -18.168 -36.394 1.00 20.03 ? 238 ASN A OD1 1 
ATOM   1746 N ND2 . ASN A 1 241 ? -39.170 -18.495 -35.661 1.00 19.84 ? 238 ASN A ND2 1 
ATOM   1747 N N   . ALA A 1 242 ? -43.179 -20.413 -32.110 1.00 17.92 ? 239 ALA A N   1 
ATOM   1748 C CA  . ALA A 1 242 ? -43.803 -21.475 -31.321 1.00 17.96 ? 239 ALA A CA  1 
ATOM   1749 C C   . ALA A 1 242 ? -45.309 -21.492 -31.573 1.00 17.99 ? 239 ALA A C   1 
ATOM   1750 O O   . ALA A 1 242 ? -45.919 -22.543 -31.754 1.00 16.97 ? 239 ALA A O   1 
ATOM   1751 C CB  . ALA A 1 242 ? -43.483 -21.307 -29.831 1.00 17.75 ? 239 ALA A CB  1 
ATOM   1752 N N   . VAL A 1 243 ? -45.916 -20.317 -31.550 1.00 17.91 ? 240 VAL A N   1 
ATOM   1753 C CA  . VAL A 1 243 ? -47.377 -20.230 -31.725 1.00 18.11 ? 240 VAL A CA  1 
ATOM   1754 C C   . VAL A 1 243 ? -47.705 -20.714 -33.125 1.00 17.62 ? 240 VAL A C   1 
ATOM   1755 O O   . VAL A 1 243 ? -48.637 -21.513 -33.334 1.00 18.71 ? 240 VAL A O   1 
ATOM   1756 C CB  . VAL A 1 243 ? -47.903 -18.814 -31.464 1.00 18.86 ? 240 VAL A CB  1 
ATOM   1757 C CG1 . VAL A 1 243 ? -49.405 -18.754 -31.734 1.00 17.85 ? 240 VAL A CG1 1 
ATOM   1758 C CG2 . VAL A 1 243 ? -47.673 -18.421 -29.994 1.00 18.81 ? 240 VAL A CG2 1 
ATOM   1759 N N   . TYR A 1 244 ? -46.886 -20.309 -34.090 1.00 18.05 ? 241 TYR A N   1 
ATOM   1760 C CA  . TYR A 1 244 ? -47.104 -20.672 -35.485 1.00 18.29 ? 241 TYR A CA  1 
ATOM   1761 C C   . TYR A 1 244 ? -46.988 -22.181 -35.680 1.00 18.67 ? 241 TYR A C   1 
ATOM   1762 O O   . TYR A 1 244 ? -47.879 -22.802 -36.268 1.00 19.61 ? 241 TYR A O   1 
ATOM   1763 C CB  . TYR A 1 244 ? -46.111 -19.960 -36.395 1.00 18.85 ? 241 TYR A CB  1 
ATOM   1764 C CG  . TYR A 1 244 ? -46.379 -20.201 -37.871 1.00 19.28 ? 241 TYR A CG  1 
ATOM   1765 C CD1 . TYR A 1 244 ? -46.069 -21.419 -38.469 1.00 18.92 ? 241 TYR A CD1 1 
ATOM   1766 C CD2 . TYR A 1 244 ? -46.974 -19.215 -38.672 1.00 22.06 ? 241 TYR A CD2 1 
ATOM   1767 C CE1 . TYR A 1 244 ? -46.303 -21.620 -39.844 1.00 22.74 ? 241 TYR A CE1 1 
ATOM   1768 C CE2 . TYR A 1 244 ? -47.212 -19.431 -39.992 1.00 22.99 ? 241 TYR A CE2 1 
ATOM   1769 C CZ  . TYR A 1 244 ? -46.899 -20.649 -40.577 1.00 22.73 ? 241 TYR A CZ  1 
ATOM   1770 O OH  . TYR A 1 244 ? -47.166 -20.842 -41.956 1.00 25.11 ? 241 TYR A OH  1 
ATOM   1771 N N   . LEU A 1 245 ? -45.885 -22.750 -35.224 1.00 18.57 ? 242 LEU A N   1 
ATOM   1772 C CA  . LEU A 1 245 ? -45.656 -24.197 -35.449 1.00 17.99 ? 242 LEU A CA  1 
ATOM   1773 C C   . LEU A 1 245 ? -46.661 -25.056 -34.681 1.00 18.30 ? 242 LEU A C   1 
ATOM   1774 O O   . LEU A 1 245 ? -47.081 -26.086 -35.178 1.00 18.41 ? 242 LEU A O   1 
ATOM   1775 C CB  . LEU A 1 245 ? -44.203 -24.567 -35.176 1.00 19.30 ? 242 LEU A CB  1 
ATOM   1776 C CG  . LEU A 1 245 ? -43.218 -24.032 -36.221 1.00 19.42 ? 242 LEU A CG  1 
ATOM   1777 C CD1 . LEU A 1 245 ? -41.754 -24.175 -35.707 1.00 23.85 ? 242 LEU A CD1 1 
ATOM   1778 C CD2 . LEU A 1 245 ? -43.379 -24.675 -37.608 1.00 21.77 ? 242 LEU A CD2 1 
ATOM   1779 N N   . HIS A 1 246 ? -47.064 -24.625 -33.484 1.00 18.22 ? 243 HIS A N   1 
ATOM   1780 C CA  . HIS A 1 246 ? -48.086 -25.331 -32.707 1.00 18.30 ? 243 HIS A CA  1 
ATOM   1781 C C   . HIS A 1 246 ? -49.386 -25.446 -33.526 1.00 18.66 ? 243 HIS A C   1 
ATOM   1782 O O   . HIS A 1 246 ? -49.961 -26.531 -33.677 1.00 19.18 ? 243 HIS A O   1 
ATOM   1783 C CB  . HIS A 1 246 ? -48.233 -24.598 -31.372 1.00 18.69 ? 243 HIS A CB  1 
ATOM   1784 C CG  . HIS A 1 246 ? -49.369 -25.028 -30.494 1.00 18.14 ? 243 HIS A CG  1 
ATOM   1785 N ND1 . HIS A 1 246 ? -50.593 -24.379 -30.480 1.00 19.53 ? 243 HIS A ND1 1 
ATOM   1786 C CD2 . HIS A 1 246 ? -49.406 -25.939 -29.487 1.00 19.30 ? 243 HIS A CD2 1 
ATOM   1787 C CE1 . HIS A 1 246 ? -51.338 -24.904 -29.506 1.00 20.39 ? 243 HIS A CE1 1 
ATOM   1788 N NE2 . HIS A 1 246 ? -50.654 -25.865 -28.908 1.00 18.62 ? 243 HIS A NE2 1 
ATOM   1789 N N   . GLY A 1 247 ? -49.803 -24.361 -34.146 1.00 18.42 ? 244 GLY A N   1 
ATOM   1790 C CA  . GLY A 1 247 ? -50.985 -24.418 -34.986 1.00 18.99 ? 244 GLY A CA  1 
ATOM   1791 C C   . GLY A 1 247 ? -50.766 -25.246 -36.268 1.00 18.26 ? 244 GLY A C   1 
ATOM   1792 O O   . GLY A 1 247 ? -51.667 -25.980 -36.714 1.00 18.51 ? 244 GLY A O   1 
ATOM   1793 N N   . ALA A 1 248 ? -49.573 -25.159 -36.830 1.00 18.27 ? 245 ALA A N   1 
ATOM   1794 C CA  . ALA A 1 248 ? -49.247 -25.890 -38.063 1.00 19.48 ? 245 ALA A CA  1 
ATOM   1795 C C   . ALA A 1 248 ? -49.283 -27.413 -37.803 1.00 19.08 ? 245 ALA A C   1 
ATOM   1796 O O   . ALA A 1 248 ? -49.655 -28.205 -38.696 1.00 19.85 ? 245 ALA A O   1 
ATOM   1797 C CB  . ALA A 1 248 ? -47.872 -25.447 -38.594 1.00 19.88 ? 245 ALA A CB  1 
ATOM   1798 N N   . CYS A 1 249 ? -48.951 -27.809 -36.575 1.00 19.68 ? 246 CYS A N   1 
ATOM   1799 C CA  . CYS A 1 249 ? -49.067 -29.233 -36.190 1.00 19.07 ? 246 CYS A CA  1 
ATOM   1800 C C   . CYS A 1 249 ? -50.527 -29.736 -36.227 1.00 18.75 ? 246 CYS A C   1 
ATOM   1801 O O   . CYS A 1 249 ? -50.807 -30.865 -36.648 1.00 19.20 ? 246 CYS A O   1 
ATOM   1802 C CB  . CYS A 1 249 ? -48.465 -29.494 -34.819 1.00 19.68 ? 246 CYS A CB  1 
ATOM   1803 S SG  . CYS A 1 249 ? -46.647 -29.329 -34.802 1.00 20.07 ? 246 CYS A SG  1 
ATOM   1804 N N   . ALA A 1 250 ? -51.460 -28.904 -35.758 1.00 18.99 ? 247 ALA A N   1 
ATOM   1805 C CA  . ALA A 1 250 ? -52.884 -29.240 -35.805 1.00 18.10 ? 247 ALA A CA  1 
ATOM   1806 C C   . ALA A 1 250 ? -53.370 -29.316 -37.231 1.00 19.59 ? 247 ALA A C   1 
ATOM   1807 O O   . ALA A 1 250 ? -54.218 -30.158 -37.564 1.00 19.96 ? 247 ALA A O   1 
ATOM   1808 C CB  . ALA A 1 250 ? -53.741 -28.242 -35.004 1.00 18.81 ? 247 ALA A CB  1 
ATOM   1809 N N   . GLU A 1 251 ? -52.864 -28.439 -38.071 1.00 19.98 ? 248 GLU A N   1 
ATOM   1810 C CA  . GLU A 1 251 ? -53.258 -28.468 -39.469 1.00 20.56 ? 248 GLU A CA  1 
ATOM   1811 C C   . GLU A 1 251 ? -52.763 -29.718 -40.175 1.00 22.26 ? 248 GLU A C   1 
ATOM   1812 O O   . GLU A 1 251 ? -53.474 -30.294 -41.023 1.00 23.75 ? 248 GLU A O   1 
ATOM   1813 C CB  . GLU A 1 251 ? -52.719 -27.225 -40.164 1.00 22.64 ? 248 GLU A CB  1 
ATOM   1814 C CG  . GLU A 1 251 ? -53.394 -25.972 -39.733 1.00 22.17 ? 248 GLU A CG  1 
ATOM   1815 C CD  . GLU A 1 251 ? -52.987 -24.754 -40.552 1.00 30.50 ? 248 GLU A CD  1 
ATOM   1816 O OE1 . GLU A 1 251 ? -52.434 -24.885 -41.672 1.00 36.75 ? 248 GLU A OE1 1 
ATOM   1817 O OE2 . GLU A 1 251 ? -53.291 -23.669 -40.105 1.00 33.63 ? 248 GLU A OE2 1 
ATOM   1818 N N   . LEU A 1 252 ? -51.522 -30.107 -39.917 1.00 20.93 ? 249 LEU A N   1 
ATOM   1819 C CA  . LEU A 1 252 ? -51.001 -31.360 -40.488 1.00 22.85 ? 249 LEU A CA  1 
ATOM   1820 C C   . LEU A 1 252 ? -51.859 -32.535 -40.029 1.00 23.13 ? 249 LEU A C   1 
ATOM   1821 O O   . LEU A 1 252 ? -52.235 -33.381 -40.835 1.00 23.07 ? 249 LEU A O   1 
ATOM   1822 C CB  . LEU A 1 252 ? -49.512 -31.585 -40.161 1.00 23.53 ? 249 LEU A CB  1 
ATOM   1823 C CG  . LEU A 1 252 ? -48.828 -32.748 -40.906 1.00 28.21 ? 249 LEU A CG  1 
ATOM   1824 C CD1 . LEU A 1 252 ? -49.130 -32.704 -42.398 1.00 31.40 ? 249 LEU A CD1 1 
ATOM   1825 C CD2 . LEU A 1 252 ? -47.303 -32.776 -40.701 1.00 30.30 ? 249 LEU A CD2 1 
ATOM   1826 N N   . TRP A 1 253 ? -52.172 -32.586 -38.733 1.00 21.54 ? 250 TRP A N   1 
ATOM   1827 C CA  . TRP A 1 253 ? -53.041 -33.629 -38.183 1.00 21.89 ? 250 TRP A CA  1 
ATOM   1828 C C   . TRP A 1 253 ? -54.325 -33.775 -38.954 1.00 23.98 ? 250 TRP A C   1 
ATOM   1829 O O   . TRP A 1 253 ? -54.712 -34.901 -39.301 1.00 23.94 ? 250 TRP A O   1 
ATOM   1830 C CB  . TRP A 1 253 ? -53.404 -33.321 -36.708 1.00 21.89 ? 250 TRP A CB  1 
ATOM   1831 C CG  . TRP A 1 253 ? -54.459 -34.251 -36.082 1.00 22.15 ? 250 TRP A CG  1 
ATOM   1832 C CD1 . TRP A 1 253 ? -55.799 -33.994 -35.917 1.00 23.31 ? 250 TRP A CD1 1 
ATOM   1833 C CD2 . TRP A 1 253 ? -54.231 -35.527 -35.496 1.00 21.42 ? 250 TRP A CD2 1 
ATOM   1834 N NE1 . TRP A 1 253 ? -56.411 -35.039 -35.285 1.00 21.44 ? 250 TRP A NE1 1 
ATOM   1835 C CE2 . TRP A 1 253 ? -55.473 -35.997 -35.014 1.00 21.61 ? 250 TRP A CE2 1 
ATOM   1836 C CE3 . TRP A 1 253 ? -53.102 -36.346 -35.349 1.00 22.48 ? 250 TRP A CE3 1 
ATOM   1837 C CZ2 . TRP A 1 253 ? -55.597 -37.205 -34.388 1.00 20.77 ? 250 TRP A CZ2 1 
ATOM   1838 C CZ3 . TRP A 1 253 ? -53.223 -37.535 -34.726 1.00 24.73 ? 250 TRP A CZ3 1 
ATOM   1839 C CH2 . TRP A 1 253 ? -54.471 -37.973 -34.247 1.00 22.79 ? 250 TRP A CH2 1 
ATOM   1840 N N   . THR A 1 254 ? -55.022 -32.670 -39.227 1.00 23.27 ? 251 THR A N   1 
ATOM   1841 C CA  . THR A 1 254 ? -56.340 -32.772 -39.862 1.00 25.38 ? 251 THR A CA  1 
ATOM   1842 C C   . THR A 1 254 ? -56.304 -33.182 -41.336 1.00 25.82 ? 251 THR A C   1 
ATOM   1843 O O   . THR A 1 254 ? -57.350 -33.422 -41.924 1.00 26.95 ? 251 THR A O   1 
ATOM   1844 C CB  . THR A 1 254 ? -57.199 -31.488 -39.671 1.00 25.48 ? 251 THR A CB  1 
ATOM   1845 O OG1 . THR A 1 254 ? -56.470 -30.353 -40.174 1.00 27.17 ? 251 THR A OG1 1 
ATOM   1846 C CG2 . THR A 1 254 ? -57.488 -31.291 -38.195 1.00 26.75 ? 251 THR A CG2 1 
ATOM   1847 N N   . ASP A 1 255 ? -55.114 -33.311 -41.927 1.00 25.32 ? 252 ASP A N   1 
ATOM   1848 C CA  . ASP A 1 255 ? -55.054 -33.808 -43.312 1.00 27.26 ? 252 ASP A CA  1 
ATOM   1849 C C   . ASP A 1 255 ? -55.612 -35.233 -43.429 1.00 26.94 ? 252 ASP A C   1 
ATOM   1850 O O   . ASP A 1 255 ? -56.264 -35.569 -44.424 1.00 26.84 ? 252 ASP A O   1 
ATOM   1851 C CB  . ASP A 1 255 ? -53.624 -33.833 -43.825 1.00 28.22 ? 252 ASP A CB  1 
ATOM   1852 C CG  . ASP A 1 255 ? -53.092 -32.454 -44.184 1.00 31.78 ? 252 ASP A CG  1 
ATOM   1853 O OD1 . ASP A 1 255 ? -53.838 -31.452 -44.227 1.00 33.55 ? 252 ASP A OD1 1 
ATOM   1854 O OD2 . ASP A 1 255 ? -51.882 -32.398 -44.443 1.00 38.09 ? 252 ASP A OD2 1 
ATOM   1855 N N   . GLU A 1 256 ? -55.341 -36.071 -42.435 1.00 26.02 ? 253 GLU A N   1 
ATOM   1856 C CA  . GLU A 1 256 ? -55.765 -37.470 -42.462 1.00 26.60 ? 253 GLU A CA  1 
ATOM   1857 C C   . GLU A 1 256 ? -56.546 -37.950 -41.233 1.00 24.40 ? 253 GLU A C   1 
ATOM   1858 O O   . GLU A 1 256 ? -56.951 -39.108 -41.168 1.00 24.51 ? 253 GLU A O   1 
ATOM   1859 C CB  . GLU A 1 256 ? -54.533 -38.334 -42.616 1.00 28.20 ? 253 GLU A CB  1 
ATOM   1860 C CG  . GLU A 1 256 ? -53.914 -38.206 -44.024 1.00 34.02 ? 253 GLU A CG  1 
ATOM   1861 C CD  . GLU A 1 256 ? -52.924 -39.321 -44.291 1.00 41.21 ? 253 GLU A CD  1 
ATOM   1862 O OE1 . GLU A 1 256 ? -51.979 -39.489 -43.492 1.00 47.78 ? 253 GLU A OE1 1 
ATOM   1863 O OE2 . GLU A 1 256 ? -53.102 -40.038 -45.288 1.00 50.47 ? 253 GLU A OE2 1 
ATOM   1864 N N   . HIS A 1 257 ? -56.735 -37.049 -40.290 1.00 22.24 ? 254 HIS A N   1 
ATOM   1865 C CA  . HIS A 1 257 ? -57.391 -37.351 -39.014 1.00 20.99 ? 254 HIS A CA  1 
ATOM   1866 C C   . HIS A 1 257 ? -58.475 -36.318 -38.710 1.00 21.38 ? 254 HIS A C   1 
ATOM   1867 O O   . HIS A 1 257 ? -58.325 -35.121 -39.003 1.00 23.00 ? 254 HIS A O   1 
ATOM   1868 C CB  . HIS A 1 257 ? -56.387 -37.362 -37.884 1.00 20.66 ? 254 HIS A CB  1 
ATOM   1869 C CG  . HIS A 1 257 ? -55.141 -38.141 -38.157 1.00 20.82 ? 254 HIS A CG  1 
ATOM   1870 N ND1 . HIS A 1 257 ? -54.020 -37.575 -38.724 1.00 23.70 ? 254 HIS A ND1 1 
ATOM   1871 C CD2 . HIS A 1 257 ? -54.809 -39.426 -37.880 1.00 25.58 ? 254 HIS A CD2 1 
ATOM   1872 C CE1 . HIS A 1 257 ? -53.062 -38.483 -38.819 1.00 26.73 ? 254 HIS A CE1 1 
ATOM   1873 N NE2 . HIS A 1 257 ? -53.515 -39.620 -38.322 1.00 25.43 ? 254 HIS A NE2 1 
ATOM   1874 N N   . SER A 1 258 ? -59.566 -36.748 -38.088 1.00 20.29 ? 255 SER A N   1 
ATOM   1875 C CA  . SER A 1 258 ? -60.596 -35.804 -37.712 1.00 20.49 ? 255 SER A CA  1 
ATOM   1876 C C   . SER A 1 258 ? -60.110 -34.802 -36.674 1.00 19.88 ? 255 SER A C   1 
ATOM   1877 O O   . SER A 1 258 ? -59.459 -35.165 -35.690 1.00 20.88 ? 255 SER A O   1 
ATOM   1878 C CB  . SER A 1 258 ? -61.837 -36.525 -37.167 1.00 21.18 ? 255 SER A CB  1 
ATOM   1879 O OG  . SER A 1 258 ? -62.733 -35.570 -36.626 1.00 20.81 ? 255 SER A OG  1 
ATOM   1880 N N   . ALA A 1 259 ? -60.483 -33.530 -36.862 1.00 20.48 ? 256 ALA A N   1 
ATOM   1881 C CA  . ALA A 1 259 ? -60.201 -32.497 -35.893 1.00 20.39 ? 256 ALA A CA  1 
ATOM   1882 C C   . ALA A 1 259 ? -60.773 -32.751 -34.517 1.00 20.93 ? 256 ALA A C   1 
ATOM   1883 O O   . ALA A 1 259 ? -60.269 -32.195 -33.515 1.00 23.15 ? 256 ALA A O   1 
ATOM   1884 C CB  . ALA A 1 259 ? -60.715 -31.135 -36.428 1.00 21.80 ? 256 ALA A CB  1 
ATOM   1885 N N   . HIS A 1 260 ? -61.815 -33.567 -34.415 1.00 19.76 ? 257 HIS A N   1 
ATOM   1886 C CA  . HIS A 1 260 ? -62.361 -33.913 -33.088 1.00 18.83 ? 257 HIS A CA  1 
ATOM   1887 C C   . HIS A 1 260 ? -61.499 -34.816 -32.238 1.00 19.11 ? 257 HIS A C   1 
ATOM   1888 O O   . HIS A 1 260 ? -61.732 -34.914 -31.049 1.00 19.82 ? 257 HIS A O   1 
ATOM   1889 C CB  . HIS A 1 260 ? -63.702 -34.624 -33.235 1.00 19.53 ? 257 HIS A CB  1 
ATOM   1890 C CG  . HIS A 1 260 ? -64.774 -33.747 -33.772 1.00 22.02 ? 257 HIS A CG  1 
ATOM   1891 N ND1 . HIS A 1 260 ? -65.292 -32.692 -33.052 1.00 23.96 ? 257 HIS A ND1 1 
ATOM   1892 C CD2 . HIS A 1 260 ? -65.437 -33.769 -34.952 1.00 24.65 ? 257 HIS A CD2 1 
ATOM   1893 C CE1 . HIS A 1 260 ? -66.260 -32.127 -33.749 1.00 25.17 ? 257 HIS A CE1 1 
ATOM   1894 N NE2 . HIS A 1 260 ? -66.354 -32.747 -34.917 1.00 24.83 ? 257 HIS A NE2 1 
ATOM   1895 N N   . THR A 1 261 ? -60.498 -35.450 -32.828 1.00 19.80 ? 258 THR A N   1 
ATOM   1896 C CA  . THR A 1 261 ? -59.820 -36.593 -32.236 1.00 18.77 ? 258 THR A CA  1 
ATOM   1897 C C   . THR A 1 261 ? -58.373 -36.394 -31.797 1.00 17.44 ? 258 THR A C   1 
ATOM   1898 O O   . THR A 1 261 ? -57.773 -37.315 -31.265 1.00 19.37 ? 258 THR A O   1 
ATOM   1899 C CB  . THR A 1 261 ? -59.843 -37.783 -33.187 1.00 19.53 ? 258 THR A CB  1 
ATOM   1900 O OG1 . THR A 1 261 ? -59.009 -37.524 -34.348 1.00 19.15 ? 258 THR A OG1 1 
ATOM   1901 C CG2 . THR A 1 261 ? -61.293 -38.083 -33.655 1.00 19.59 ? 258 THR A CG2 1 
ATOM   1902 N N   . LEU A 1 262 ? -57.836 -35.197 -31.968 1.00 17.25 ? 259 LEU A N   1 
ATOM   1903 C CA  . LEU A 1 262 ? -56.457 -34.901 -31.595 1.00 17.07 ? 259 LEU A CA  1 
ATOM   1904 C C   . LEU A 1 262 ? -56.275 -34.924 -30.091 1.00 17.36 ? 259 LEU A C   1 
ATOM   1905 O O   . LEU A 1 262 ? -57.097 -34.398 -29.367 1.00 17.97 ? 259 LEU A O   1 
ATOM   1906 C CB  . LEU A 1 262 ? -56.073 -33.496 -32.064 1.00 16.98 ? 259 LEU A CB  1 
ATOM   1907 C CG  . LEU A 1 262 ? -54.632 -33.043 -31.712 1.00 19.11 ? 259 LEU A CG  1 
ATOM   1908 C CD1 . LEU A 1 262 ? -53.528 -33.855 -32.392 1.00 18.49 ? 259 LEU A CD1 1 
ATOM   1909 C CD2 . LEU A 1 262 ? -54.533 -31.527 -32.093 1.00 20.56 ? 259 LEU A CD2 1 
ATOM   1910 N N   . LEU A 1 263 ? -55.180 -35.508 -29.657 1.00 16.86 ? 260 LEU A N   1 
ATOM   1911 C CA  . LEU A 1 263 ? -54.732 -35.392 -28.270 1.00 16.50 ? 260 LEU A CA  1 
ATOM   1912 C C   . LEU A 1 263 ? -53.490 -34.471 -28.254 1.00 17.30 ? 260 LEU A C   1 
ATOM   1913 O O   . LEU A 1 263 ? -52.615 -34.604 -29.104 1.00 18.07 ? 260 LEU A O   1 
ATOM   1914 C CB  . LEU A 1 263 ? -54.410 -36.769 -27.727 1.00 17.09 ? 260 LEU A CB  1 
ATOM   1915 C CG  . LEU A 1 263 ? -55.592 -37.757 -27.660 1.00 17.68 ? 260 LEU A CG  1 
ATOM   1916 C CD1 . LEU A 1 263 ? -55.121 -39.138 -27.234 1.00 20.59 ? 260 LEU A CD1 1 
ATOM   1917 C CD2 . LEU A 1 263 ? -56.691 -37.278 -26.752 1.00 21.33 ? 260 LEU A CD2 1 
ATOM   1918 N N   . ALA A 1 264 ? -53.409 -33.551 -27.288 1.00 17.82 ? 261 ALA A N   1 
ATOM   1919 C CA  . ALA A 1 264 ? -52.365 -32.553 -27.252 1.00 17.57 ? 261 ALA A CA  1 
ATOM   1920 C C   . ALA A 1 264 ? -50.970 -33.098 -27.418 1.00 17.65 ? 261 ALA A C   1 
ATOM   1921 O O   . ALA A 1 264 ? -50.156 -32.473 -28.102 1.00 17.45 ? 261 ALA A O   1 
ATOM   1922 C CB  . ALA A 1 264 ? -52.434 -31.790 -25.910 1.00 18.08 ? 261 ALA A CB  1 
ATOM   1923 N N   . HIS A 1 265 ? -50.648 -34.203 -26.749 1.00 18.79 ? 262 HIS A N   1 
ATOM   1924 C CA  . HIS A 1 265 ? -49.278 -34.740 -26.840 1.00 18.66 ? 262 HIS A CA  1 
ATOM   1925 C C   . HIS A 1 265 ? -48.882 -35.060 -28.263 1.00 19.29 ? 262 HIS A C   1 
ATOM   1926 O O   . HIS A 1 265 ? -47.695 -35.031 -28.602 1.00 18.98 ? 262 HIS A O   1 
ATOM   1927 C CB  . HIS A 1 265 ? -49.055 -35.919 -25.911 1.00 19.61 ? 262 HIS A CB  1 
ATOM   1928 C CG  . HIS A 1 265 ? -49.719 -37.181 -26.349 1.00 21.73 ? 262 HIS A CG  1 
ATOM   1929 N ND1 . HIS A 1 265 ? -50.979 -37.530 -25.917 1.00 22.05 ? 262 HIS A ND1 1 
ATOM   1930 C CD2 . HIS A 1 265 ? -49.282 -38.204 -27.129 1.00 25.89 ? 262 HIS A CD2 1 
ATOM   1931 C CE1 . HIS A 1 265 ? -51.299 -38.709 -26.435 1.00 23.39 ? 262 HIS A CE1 1 
ATOM   1932 N NE2 . HIS A 1 265 ? -50.297 -39.131 -27.181 1.00 26.19 ? 262 HIS A NE2 1 
ATOM   1933 N N   . GLU A 1 266 ? -49.863 -35.352 -29.104 1.00 18.10 ? 263 GLU A N   1 
ATOM   1934 C CA  . GLU A 1 266 ? -49.571 -35.628 -30.495 1.00 19.37 ? 263 GLU A CA  1 
ATOM   1935 C C   . GLU A 1 266 ? -49.021 -34.426 -31.258 1.00 19.16 ? 263 GLU A C   1 
ATOM   1936 O O   . GLU A 1 266 ? -48.333 -34.600 -32.283 1.00 19.65 ? 263 GLU A O   1 
ATOM   1937 C CB  . GLU A 1 266 ? -50.806 -36.251 -31.187 1.00 19.57 ? 263 GLU A CB  1 
ATOM   1938 C CG  . GLU A 1 266 ? -51.117 -37.596 -30.589 1.00 21.92 ? 263 GLU A CG  1 
ATOM   1939 C CD  . GLU A 1 266 ? -52.413 -38.183 -31.071 1.00 23.46 ? 263 GLU A CD  1 
ATOM   1940 O OE1 . GLU A 1 266 ? -53.444 -37.463 -31.118 1.00 21.18 ? 263 GLU A OE1 1 
ATOM   1941 O OE2 . GLU A 1 266 ? -52.374 -39.401 -31.399 1.00 24.14 ? 263 GLU A OE2 1 
ATOM   1942 N N   . LEU A 1 267 ? -49.331 -33.210 -30.815 1.00 18.03 ? 264 LEU A N   1 
ATOM   1943 C CA  . LEU A 1 267 ? -48.757 -32.012 -31.442 1.00 17.43 ? 264 LEU A CA  1 
ATOM   1944 C C   . LEU A 1 267 ? -47.236 -32.064 -31.343 1.00 18.63 ? 264 LEU A C   1 
ATOM   1945 O O   . LEU A 1 267 ? -46.542 -31.772 -32.315 1.00 18.79 ? 264 LEU A O   1 
ATOM   1946 C CB  . LEU A 1 267 ? -49.274 -30.731 -30.805 1.00 17.84 ? 264 LEU A CB  1 
ATOM   1947 C CG  . LEU A 1 267 ? -50.770 -30.427 -30.937 1.00 17.32 ? 264 LEU A CG  1 
ATOM   1948 C CD1 . LEU A 1 267 ? -51.195 -29.362 -29.890 1.00 18.78 ? 264 LEU A CD1 1 
ATOM   1949 C CD2 . LEU A 1 267 ? -51.131 -29.958 -32.338 1.00 18.87 ? 264 LEU A CD2 1 
ATOM   1950 N N   . SER A 1 268 ? -46.737 -32.475 -30.186 1.00 19.18 ? 265 SER A N   1 
ATOM   1951 C CA  . SER A 1 268 ? -45.310 -32.653 -29.957 1.00 20.82 ? 265 SER A CA  1 
ATOM   1952 C C   . SER A 1 268 ? -44.673 -33.731 -30.831 1.00 20.83 ? 265 SER A C   1 
ATOM   1953 O O   . SER A 1 268 ? -43.539 -33.614 -31.214 1.00 22.31 ? 265 SER A O   1 
ATOM   1954 C CB  . SER A 1 268 ? -45.039 -32.988 -28.491 1.00 20.76 ? 265 SER A CB  1 
ATOM   1955 O OG  . SER A 1 268 ? -45.498 -31.980 -27.693 1.00 25.67 ? 265 SER A OG  1 
ATOM   1956 N N   . ASP A 1 269 ? -45.417 -34.800 -31.059 1.00 21.23 ? 266 ASP A N   1 
ATOM   1957 C CA  . ASP A 1 269 ? -45.026 -35.943 -31.863 1.00 22.23 ? 266 ASP A CA  1 
ATOM   1958 C C   . ASP A 1 269 ? -44.948 -35.514 -33.359 1.00 21.81 ? 266 ASP A C   1 
ATOM   1959 O O   . ASP A 1 269 ? -44.189 -36.102 -34.140 1.00 21.66 ? 266 ASP A O   1 
ATOM   1960 C CB  . ASP A 1 269 ? -46.057 -37.126 -31.860 1.00 24.24 ? 266 ASP A CB  1 
ATOM   1961 C CG  . ASP A 1 269 ? -46.269 -37.878 -30.516 1.00 31.31 ? 266 ASP A CG  1 
ATOM   1962 O OD1 . ASP A 1 269 ? -45.437 -37.879 -29.607 1.00 30.93 ? 266 ASP A OD1 1 
ATOM   1963 O OD2 . ASP A 1 269 ? -47.340 -38.592 -30.431 1.00 35.90 ? 266 ASP A OD2 1 
ATOM   1964 N N   . ILE A 1 270 ? -45.804 -34.568 -33.771 1.00 20.16 ? 267 ILE A N   1 
ATOM   1965 C CA  . ILE A 1 270 ? -45.904 -34.099 -35.169 1.00 20.96 ? 267 ILE A CA  1 
ATOM   1966 C C   . ILE A 1 270 ? -44.893 -32.992 -35.498 1.00 19.10 ? 267 ILE A C   1 
ATOM   1967 O O   . ILE A 1 270 ? -44.448 -32.859 -36.659 1.00 19.61 ? 267 ILE A O   1 
ATOM   1968 C CB  . ILE A 1 270 ? -47.386 -33.532 -35.429 1.00 21.72 ? 267 ILE A CB  1 
ATOM   1969 C CG1 . ILE A 1 270 ? -48.365 -34.694 -35.429 1.00 25.70 ? 267 ILE A CG1 1 
ATOM   1970 C CG2 . ILE A 1 270 ? -47.506 -32.673 -36.678 1.00 25.73 ? 267 ILE A CG2 1 
ATOM   1971 C CD1 . ILE A 1 270 ? -49.831 -34.222 -35.195 1.00 26.28 ? 267 ILE A CD1 1 
ATOM   1972 N N   . LEU A 1 271 ? -44.522 -32.235 -34.474 1.00 19.04 ? 268 LEU A N   1 
ATOM   1973 C CA  . LEU A 1 271 ? -43.619 -31.101 -34.614 1.00 18.80 ? 268 LEU A CA  1 
ATOM   1974 C C   . LEU A 1 271 ? -42.319 -31.443 -35.362 1.00 19.39 ? 268 LEU A C   1 
ATOM   1975 O O   . LEU A 1 271 ? -41.876 -30.635 -36.170 1.00 20.05 ? 268 LEU A O   1 
ATOM   1976 C CB  . LEU A 1 271 ? -43.351 -30.430 -33.257 1.00 17.34 ? 268 LEU A CB  1 
ATOM   1977 C CG  . LEU A 1 271 ? -42.441 -29.201 -33.269 1.00 18.88 ? 268 LEU A CG  1 
ATOM   1978 C CD1 . LEU A 1 271 ? -43.057 -28.038 -34.095 1.00 17.17 ? 268 LEU A CD1 1 
ATOM   1979 C CD2 . LEU A 1 271 ? -42.084 -28.758 -31.848 1.00 19.96 ? 268 LEU A CD2 1 
ATOM   1980 N N   . PRO A 1 272 ? -41.710 -32.618 -35.104 1.00 18.97 ? 269 PRO A N   1 
ATOM   1981 C CA  . PRO A 1 272 ? -40.455 -32.905 -35.852 1.00 18.72 ? 269 PRO A CA  1 
ATOM   1982 C C   . PRO A 1 272 ? -40.571 -32.792 -37.365 1.00 19.92 ? 269 PRO A C   1 
ATOM   1983 O O   . PRO A 1 272 ? -39.690 -32.234 -38.009 1.00 21.00 ? 269 PRO A O   1 
ATOM   1984 C CB  . PRO A 1 272 ? -40.137 -34.337 -35.461 1.00 18.20 ? 269 PRO A CB  1 
ATOM   1985 C CG  . PRO A 1 272 ? -40.652 -34.393 -33.980 1.00 18.40 ? 269 PRO A CG  1 
ATOM   1986 C CD  . PRO A 1 272 ? -41.932 -33.576 -34.007 1.00 19.12 ? 269 PRO A CD  1 
ATOM   1987 N N   . ARG A 1 273 ? -41.643 -33.335 -37.899 1.00 20.54 ? 270 ARG A N   1 
ATOM   1988 C CA  . ARG A 1 273 ? -41.879 -33.322 -39.349 1.00 22.34 ? 270 ARG A CA  1 
ATOM   1989 C C   . ARG A 1 273 ? -42.307 -31.951 -39.823 1.00 22.96 ? 270 ARG A C   1 
ATOM   1990 O O   . ARG A 1 273 ? -41.884 -31.496 -40.897 1.00 22.23 ? 270 ARG A O   1 
ATOM   1991 C CB  . ARG A 1 273 ? -42.997 -34.321 -39.713 1.00 23.82 ? 270 ARG A CB  1 
ATOM   1992 C CG  . ARG A 1 273 ? -42.586 -35.712 -39.548 1.00 31.66 ? 270 ARG A CG  1 
ATOM   1993 C CD  . ARG A 1 273 ? -43.645 -36.707 -40.060 1.00 39.58 ? 270 ARG A CD  1 
ATOM   1994 N NE  . ARG A 1 273 ? -42.916 -37.896 -40.469 1.00 45.36 ? 270 ARG A NE  1 
ATOM   1995 C CZ  . ARG A 1 273 ? -42.271 -38.041 -41.623 1.00 45.44 ? 270 ARG A CZ  1 
ATOM   1996 N NH1 . ARG A 1 273 ? -42.289 -37.099 -42.555 1.00 49.52 ? 270 ARG A NH1 1 
ATOM   1997 N NH2 . ARG A 1 273 ? -41.603 -39.148 -41.835 1.00 49.27 ? 270 ARG A NH2 1 
ATOM   1998 N N   . VAL A 1 274 ? -43.156 -31.287 -39.038 1.00 21.93 ? 271 VAL A N   1 
ATOM   1999 C CA  . VAL A 1 274 ? -43.646 -29.964 -39.431 1.00 22.26 ? 271 VAL A CA  1 
ATOM   2000 C C   . VAL A 1 274 ? -42.487 -28.961 -39.461 1.00 21.94 ? 271 VAL A C   1 
ATOM   2001 O O   . VAL A 1 274 ? -42.315 -28.238 -40.440 1.00 21.63 ? 271 VAL A O   1 
ATOM   2002 C CB  . VAL A 1 274 ? -44.767 -29.491 -38.518 1.00 23.11 ? 271 VAL A CB  1 
ATOM   2003 C CG1 . VAL A 1 274 ? -45.040 -27.958 -38.694 1.00 23.86 ? 271 VAL A CG1 1 
ATOM   2004 C CG2 . VAL A 1 274 ? -46.018 -30.298 -38.774 1.00 22.85 ? 271 VAL A CG2 1 
ATOM   2005 N N   . TRP A 1 275 ? -41.662 -28.953 -38.413 1.00 20.37 ? 272 TRP A N   1 
ATOM   2006 C CA  . TRP A 1 275 ? -40.514 -28.040 -38.345 1.00 20.58 ? 272 TRP A CA  1 
ATOM   2007 C C   . TRP A 1 275 ? -39.581 -28.251 -39.555 1.00 21.42 ? 272 TRP A C   1 
ATOM   2008 O O   . TRP A 1 275 ? -39.132 -27.273 -40.152 1.00 22.32 ? 272 TRP A O   1 
ATOM   2009 C CB  . TRP A 1 275 ? -39.815 -28.202 -36.990 1.00 19.88 ? 272 TRP A CB  1 
ATOM   2010 C CG  . TRP A 1 275 ? -38.779 -27.188 -36.624 1.00 20.21 ? 272 TRP A CG  1 
ATOM   2011 C CD1 . TRP A 1 275 ? -37.894 -26.525 -37.434 1.00 21.43 ? 272 TRP A CD1 1 
ATOM   2012 C CD2 . TRP A 1 275 ? -38.498 -26.766 -35.292 1.00 20.36 ? 272 TRP A CD2 1 
ATOM   2013 N NE1 . TRP A 1 275 ? -37.075 -25.726 -36.671 1.00 23.56 ? 272 TRP A NE1 1 
ATOM   2014 C CE2 . TRP A 1 275 ? -37.423 -25.855 -35.358 1.00 21.73 ? 272 TRP A CE2 1 
ATOM   2015 C CE3 . TRP A 1 275 ? -39.035 -27.091 -34.056 1.00 20.60 ? 272 TRP A CE3 1 
ATOM   2016 C CZ2 . TRP A 1 275 ? -36.872 -25.261 -34.222 1.00 21.45 ? 272 TRP A CZ2 1 
ATOM   2017 C CZ3 . TRP A 1 275 ? -38.498 -26.491 -32.917 1.00 21.88 ? 272 TRP A CZ3 1 
ATOM   2018 C CH2 . TRP A 1 275 ? -37.435 -25.556 -33.023 1.00 21.88 ? 272 TRP A CH2 1 
ATOM   2019 N N   . LYS A 1 276 ? -39.338 -29.506 -39.942 1.00 20.50 ? 273 LYS A N   1 
ATOM   2020 C CA  . LYS A 1 276 ? -38.483 -29.826 -41.072 1.00 22.26 ? 273 LYS A CA  1 
ATOM   2021 C C   . LYS A 1 276 ? -38.927 -29.092 -42.355 1.00 24.14 ? 273 LYS A C   1 
ATOM   2022 O O   . LYS A 1 276 ? -38.083 -28.628 -43.133 1.00 23.86 ? 273 LYS A O   1 
ATOM   2023 C CB  . LYS A 1 276 ? -38.493 -31.329 -41.338 1.00 22.03 ? 273 LYS A CB  1 
ATOM   2024 C CG  . LYS A 1 276 ? -37.572 -31.816 -42.510 1.00 25.46 ? 273 LYS A CG  1 
ATOM   2025 C CD  . LYS A 1 276 ? -36.087 -31.598 -42.238 1.00 28.55 ? 273 LYS A CD  1 
ATOM   2026 C CE  . LYS A 1 276 ? -35.191 -32.136 -43.372 1.00 31.91 ? 273 LYS A CE  1 
ATOM   2027 N NZ  . LYS A 1 276 ? -33.763 -31.952 -43.060 1.00 34.34 ? 273 LYS A NZ  1 
ATOM   2028 N N   . ARG A 1 277 ? -40.242 -29.010 -42.554 1.00 26.04 ? 274 ARG A N   1 
ATOM   2029 C CA  . ARG A 1 277 ? -40.799 -28.368 -43.746 1.00 28.57 ? 274 ARG A CA  1 
ATOM   2030 C C   . ARG A 1 277 ? -40.450 -26.891 -43.869 1.00 28.87 ? 274 ARG A C   1 
ATOM   2031 O O   . ARG A 1 277 ? -40.471 -26.342 -44.977 1.00 29.03 ? 274 ARG A O   1 
ATOM   2032 C CB  . ARG A 1 277 ? -42.322 -28.525 -43.768 1.00 29.48 ? 274 ARG A CB  1 
ATOM   2033 C CG  . ARG A 1 277 ? -42.763 -29.958 -43.887 1.00 34.85 ? 274 ARG A CG  1 
ATOM   2034 C CD  . ARG A 1 277 ? -44.268 -30.094 -43.880 1.00 41.83 ? 274 ARG A CD  1 
ATOM   2035 N NE  . ARG A 1 277 ? -44.683 -31.475 -44.177 1.00 47.33 ? 274 ARG A NE  1 
ATOM   2036 C CZ  . ARG A 1 277 ? -45.925 -31.847 -44.507 1.00 52.02 ? 274 ARG A CZ  1 
ATOM   2037 N NH1 . ARG A 1 277 ? -46.909 -30.945 -44.594 1.00 54.34 ? 274 ARG A NH1 1 
ATOM   2038 N NH2 . ARG A 1 277 ? -46.190 -33.131 -44.753 1.00 52.87 ? 274 ARG A NH2 1 
ATOM   2039 N N   . PHE A 1 278 ? -40.165 -26.240 -42.737 1.00 28.57 ? 275 PHE A N   1 
ATOM   2040 C CA  . PHE A 1 278 ? -39.889 -24.798 -42.685 1.00 29.78 ? 275 PHE A CA  1 
ATOM   2041 C C   . PHE A 1 278 ? -38.393 -24.483 -42.680 1.00 31.57 ? 275 PHE A C   1 
ATOM   2042 O O   . PHE A 1 278 ? -37.982 -23.319 -42.545 1.00 32.36 ? 275 PHE A O   1 
ATOM   2043 C CB  . PHE A 1 278 ? -40.623 -24.186 -41.472 1.00 29.65 ? 275 PHE A CB  1 
ATOM   2044 C CG  . PHE A 1 278 ? -42.108 -24.175 -41.635 1.00 29.12 ? 275 PHE A CG  1 
ATOM   2045 C CD1 . PHE A 1 278 ? -42.742 -23.127 -42.317 1.00 31.05 ? 275 PHE A CD1 1 
ATOM   2046 C CD2 . PHE A 1 278 ? -42.880 -25.188 -41.172 1.00 28.69 ? 275 PHE A CD2 1 
ATOM   2047 C CE1 . PHE A 1 278 ? -44.125 -23.121 -42.479 1.00 30.30 ? 275 PHE A CE1 1 
ATOM   2048 C CE2 . PHE A 1 278 ? -44.262 -25.188 -41.326 1.00 29.97 ? 275 PHE A CE2 1 
ATOM   2049 C CZ  . PHE A 1 278 ? -44.891 -24.166 -41.997 1.00 31.92 ? 275 PHE A CZ  1 
ATOM   2050 N N   . GLU A 1 279 ? -37.572 -25.518 -42.858 1.00 32.94 ? 276 GLU A N   1 
ATOM   2051 C CA  . GLU A 1 279 ? -36.124 -25.375 -42.908 1.00 34.17 ? 276 GLU A CA  1 
ATOM   2052 C C   . GLU A 1 279 ? -35.668 -25.297 -44.372 1.00 37.04 ? 276 GLU A C   1 
ATOM   2053 O O   . GLU A 1 279 ? -36.452 -25.410 -45.332 1.00 38.09 ? 276 GLU A O   1 
ATOM   2054 C CB  . GLU A 1 279 ? -35.448 -26.539 -42.128 1.00 33.98 ? 276 GLU A CB  1 
ATOM   2055 C CG  . GLU A 1 279 ? -35.720 -26.489 -40.612 1.00 33.17 ? 276 GLU A CG  1 
ATOM   2056 C CD  . GLU A 1 279 ? -34.993 -27.598 -39.792 1.00 31.51 ? 276 GLU A CD  1 
ATOM   2057 O OE1 . GLU A 1 279 ? -34.712 -27.344 -38.540 1.00 26.88 ? 276 GLU A OE1 1 
ATOM   2058 O OE2 . GLU A 1 279 ? -34.697 -28.696 -40.404 1.00 26.92 ? 276 GLU A OE2 1 
ATOM   2059 O OXT . GLU A 1 279 ? -34.498 -25.067 -44.674 1.00 38.80 ? 276 GLU A OXT 1 
HETATM 2060 N N1A . COA B 2 .   ? -63.786 -26.833 -24.277 1.00 42.29 ? 277 COA A N1A 1 
HETATM 2061 C C2A . COA B 2 .   ? -62.490 -26.772 -24.787 1.00 42.68 ? 277 COA A C2A 1 
HETATM 2062 N N3A . COA B 2 .   ? -61.403 -26.675 -23.928 1.00 40.35 ? 277 COA A N3A 1 
HETATM 2063 C C4A . COA B 2 .   ? -61.633 -26.610 -22.576 1.00 43.11 ? 277 COA A C4A 1 
HETATM 2064 C C5A . COA B 2 .   ? -62.932 -26.667 -22.059 1.00 41.81 ? 277 COA A C5A 1 
HETATM 2065 C C6A . COA B 2 .   ? -64.026 -26.801 -22.910 1.00 43.25 ? 277 COA A C6A 1 
HETATM 2066 N N6A . COA B 2 .   ? -65.110 -27.433 -22.409 1.00 41.42 ? 277 COA A N6A 1 
HETATM 2067 N N7A . COA B 2 .   ? -62.854 -26.604 -20.703 1.00 40.82 ? 277 COA A N7A 1 
HETATM 2068 C C8A . COA B 2 .   ? -61.562 -26.503 -20.331 1.00 40.86 ? 277 COA A C8A 1 
HETATM 2069 N N9A . COA B 2 .   ? -60.800 -26.503 -21.480 1.00 41.60 ? 277 COA A N9A 1 
HETATM 2070 C C1B . COA B 2 .   ? -59.340 -26.688 -21.494 1.00 42.22 ? 277 COA A C1B 1 
HETATM 2071 C C2B . COA B 2 .   ? -58.633 -25.374 -21.155 1.00 42.06 ? 277 COA A C2B 1 
HETATM 2072 O O2B . COA B 2 .   ? -58.388 -24.600 -22.303 1.00 43.43 ? 277 COA A O2B 1 
HETATM 2073 C C3B . COA B 2 .   ? -57.371 -25.919 -20.521 1.00 42.19 ? 277 COA A C3B 1 
HETATM 2074 O O3B . COA B 2 .   ? -56.467 -26.299 -21.550 1.00 37.31 ? 277 COA A O3B 1 
HETATM 2075 P P3B . COA B 2 .   ? -54.913 -25.916 -21.372 1.00 32.05 ? 277 COA A P3B 1 
HETATM 2076 O O7A . COA B 2 .   ? -54.626 -26.165 -19.871 1.00 33.57 ? 277 COA A O7A 1 
HETATM 2077 O O8A . COA B 2 .   ? -54.048 -26.907 -22.068 1.00 26.47 ? 277 COA A O8A 1 
HETATM 2078 O O9A . COA B 2 .   ? -54.739 -24.405 -21.639 1.00 27.57 ? 277 COA A O9A 1 
HETATM 2079 C C4B . COA B 2 .   ? -57.778 -27.200 -19.798 1.00 43.63 ? 277 COA A C4B 1 
HETATM 2080 O O4B . COA B 2 .   ? -58.967 -27.617 -20.472 1.00 43.33 ? 277 COA A O4B 1 
HETATM 2081 C C5B . COA B 2 .   ? -57.981 -27.040 -18.286 1.00 47.37 ? 277 COA A C5B 1 
HETATM 2082 O O5B . COA B 2 .   ? -59.028 -26.128 -18.068 1.00 49.70 ? 277 COA A O5B 1 
HETATM 2083 P P1A . COA B 2 .   ? -59.849 -26.030 -16.685 1.00 53.57 ? 277 COA A P1A 1 
HETATM 2084 O O1A . COA B 2 .   ? -59.663 -27.260 -15.806 1.00 54.34 ? 277 COA A O1A 1 
HETATM 2085 O O2A . COA B 2 .   ? -61.315 -25.752 -16.971 1.00 54.13 ? 277 COA A O2A 1 
HETATM 2086 O O3A . COA B 2 .   ? -59.167 -24.796 -15.893 1.00 56.23 ? 277 COA A O3A 1 
HETATM 2087 P P2A . COA B 2 .   ? -58.111 -23.756 -16.530 1.00 57.62 ? 277 COA A P2A 1 
HETATM 2088 O O4A . COA B 2 .   ? -57.695 -22.934 -15.205 1.00 57.92 ? 277 COA A O4A 1 
HETATM 2089 O O5A . COA B 2 .   ? -58.826 -22.843 -17.518 1.00 57.07 ? 277 COA A O5A 1 
HETATM 2090 O O6A . COA B 2 .   ? -56.897 -24.403 -17.165 1.00 56.99 ? 277 COA A O6A 1 
HETATM 2091 C C1  . GOL C 3 .   ? -49.673 -37.232 -9.021  1.00 44.75 ? 278 GOL A C1  1 
HETATM 2092 O O1  . GOL C 3 .   ? -50.871 -36.930 -9.666  1.00 39.83 ? 278 GOL A O1  1 
HETATM 2093 C C2  . GOL C 3 .   ? -50.000 -38.279 -7.972  1.00 45.92 ? 278 GOL A C2  1 
HETATM 2094 O O2  . GOL C 3 .   ? -50.858 -37.754 -6.971  1.00 46.27 ? 278 GOL A O2  1 
HETATM 2095 C C3  . GOL C 3 .   ? -50.641 -39.432 -8.723  1.00 45.38 ? 278 GOL A C3  1 
HETATM 2096 O O3  . GOL C 3 .   ? -50.331 -40.563 -7.979  1.00 47.86 ? 278 GOL A O3  1 
HETATM 2097 C C1  . GOL D 3 .   ? -33.276 -23.881 -9.360  1.00 61.53 ? 279 GOL A C1  1 
HETATM 2098 O O1  . GOL D 3 .   ? -32.891 -25.122 -9.877  1.00 60.09 ? 279 GOL A O1  1 
HETATM 2099 C C2  . GOL D 3 .   ? -32.257 -23.363 -8.354  1.00 61.85 ? 279 GOL A C2  1 
HETATM 2100 O O2  . GOL D 3 .   ? -30.970 -23.638 -8.823  1.00 63.64 ? 279 GOL A O2  1 
HETATM 2101 C C3  . GOL D 3 .   ? -32.390 -23.971 -6.965  1.00 62.19 ? 279 GOL A C3  1 
HETATM 2102 O O3  . GOL D 3 .   ? -32.259 -22.948 -5.999  1.00 62.17 ? 279 GOL A O3  1 
HETATM 2103 O O   . HOH E 4 .   ? -48.673 -18.616 -43.417 1.00 26.09 ? 280 HOH A O   1 
HETATM 2104 O O   . HOH E 4 .   ? -48.813 -31.013 -5.291  1.00 22.15 ? 281 HOH A O   1 
HETATM 2105 O O   . HOH E 4 .   ? -47.007 -32.091 -25.507 1.00 17.98 ? 282 HOH A O   1 
HETATM 2106 O O   . HOH E 4 .   ? -41.237 -5.852  -26.887 1.00 22.91 ? 283 HOH A O   1 
HETATM 2107 O O   . HOH E 4 .   ? -56.405 -31.642 -28.831 1.00 18.57 ? 284 HOH A O   1 
HETATM 2108 O O   . HOH E 4 .   ? -55.874 -32.634 -26.227 1.00 18.12 ? 285 HOH A O   1 
HETATM 2109 O O   . HOH E 4 .   ? -32.409 -32.618 -20.160 1.00 21.06 ? 286 HOH A O   1 
HETATM 2110 O O   . HOH E 4 .   ? -37.058 -38.095 -17.129 1.00 19.99 ? 287 HOH A O   1 
HETATM 2111 O O   . HOH E 4 .   ? -28.470 -22.265 -20.178 1.00 29.65 ? 288 HOH A O   1 
HETATM 2112 O O   . HOH E 4 .   ? -47.442 -16.633 -34.745 1.00 22.47 ? 289 HOH A O   1 
HETATM 2113 O O   . HOH E 4 .   ? -46.206 -5.639  -35.863 1.00 39.53 ? 290 HOH A O   1 
HETATM 2114 O O   . HOH E 4 .   ? -51.095 -22.009 -31.867 1.00 20.02 ? 291 HOH A O   1 
HETATM 2115 O O   . HOH E 4 .   ? -53.709 -33.800 -15.264 1.00 21.31 ? 292 HOH A O   1 
HETATM 2116 O O   . HOH E 4 .   ? -61.671 -19.154 -22.310 1.00 28.11 ? 293 HOH A O   1 
HETATM 2117 O O   . HOH E 4 .   ? -52.326 -20.520 -29.798 1.00 24.68 ? 294 HOH A O   1 
HETATM 2118 O O   . HOH E 4 .   ? -56.052 -30.706 -19.736 1.00 26.84 ? 295 HOH A O   1 
HETATM 2119 O O   . HOH E 4 .   ? -51.393 -17.938 -8.706  1.00 25.08 ? 296 HOH A O   1 
HETATM 2120 O O   . HOH E 4 .   ? -53.555 -21.427 -20.684 1.00 25.33 ? 297 HOH A O   1 
HETATM 2121 O O   . HOH E 4 .   ? -53.046 -31.267 -16.178 1.00 23.06 ? 298 HOH A O   1 
HETATM 2122 O O   . HOH E 4 .   ? -49.844 -13.417 -13.610 1.00 26.98 ? 299 HOH A O   1 
HETATM 2123 O O   . HOH E 4 .   ? -54.177 -28.734 -15.966 1.00 27.42 ? 300 HOH A O   1 
HETATM 2124 O O   . HOH E 4 .   ? -52.006 -24.173 -20.159 1.00 22.87 ? 301 HOH A O   1 
HETATM 2125 O O   . HOH E 4 .   ? -50.219 -21.665 -23.386 1.00 23.26 ? 302 HOH A O   1 
HETATM 2126 O O   . HOH E 4 .   ? -33.522 -15.151 -33.414 1.00 36.99 ? 303 HOH A O   1 
HETATM 2127 O O   . HOH E 4 .   ? -34.828 -24.594 -37.957 1.00 26.41 ? 304 HOH A O   1 
HETATM 2128 O O   . HOH E 4 .   ? -44.867 -44.235 -13.864 1.00 25.74 ? 305 HOH A O   1 
HETATM 2129 O O   . HOH E 4 .   ? -52.576 -26.294 -17.077 1.00 24.82 ? 306 HOH A O   1 
HETATM 2130 O O   . HOH E 4 .   ? -34.649 -16.325 -26.708 1.00 27.27 ? 307 HOH A O   1 
HETATM 2131 O O   . HOH E 4 .   ? -56.181 -20.838 -15.270 1.00 27.95 ? 308 HOH A O   1 
HETATM 2132 O O   . HOH E 4 .   ? -46.753 -4.381  -14.912 1.00 30.08 ? 309 HOH A O   1 
HETATM 2133 O O   . HOH E 4 .   ? -41.703 -7.978  -20.468 1.00 25.53 ? 310 HOH A O   1 
HETATM 2134 O O   . HOH E 4 .   ? -37.645 -18.381 2.509   1.00 29.45 ? 311 HOH A O   1 
HETATM 2135 O O   . HOH E 4 .   ? -41.399 -2.280  -24.049 1.00 31.33 ? 312 HOH A O   1 
HETATM 2136 O O   . HOH E 4 .   ? -61.705 -32.705 -39.170 1.00 28.60 ? 313 HOH A O   1 
HETATM 2137 O O   . HOH E 4 .   ? -42.338 -8.030  -33.732 1.00 37.19 ? 314 HOH A O   1 
HETATM 2138 O O   . HOH E 4 .   ? -50.228 -23.505 -3.455  1.00 29.98 ? 315 HOH A O   1 
HETATM 2139 O O   . HOH E 4 .   ? -54.113 -19.029 -33.929 1.00 24.24 ? 316 HOH A O   1 
HETATM 2140 O O   . HOH E 4 .   ? -53.274 -31.691 -18.970 1.00 29.77 ? 317 HOH A O   1 
HETATM 2141 O O   . HOH E 4 .   ? -40.594 -8.206  -25.365 1.00 32.42 ? 318 HOH A O   1 
HETATM 2142 O O   . HOH E 4 .   ? -31.083 -17.493 -33.638 1.00 37.12 ? 319 HOH A O   1 
HETATM 2143 O O   . HOH E 4 .   ? -52.682 -36.046 -41.055 1.00 27.39 ? 320 HOH A O   1 
HETATM 2144 O O   . HOH E 4 .   ? -52.847 -8.064  -14.557 1.00 31.46 ? 321 HOH A O   1 
HETATM 2145 O O   . HOH E 4 .   ? -57.901 -12.585 -32.934 1.00 26.82 ? 322 HOH A O   1 
HETATM 2146 O O   . HOH E 4 .   ? -39.815 -7.653  -18.466 1.00 29.77 ? 323 HOH A O   1 
HETATM 2147 O O   . HOH E 4 .   ? -55.103 -23.028 -18.764 1.00 28.85 ? 324 HOH A O   1 
HETATM 2148 O O   . HOH E 4 .   ? -47.732 -40.728 -8.504  1.00 31.98 ? 325 HOH A O   1 
HETATM 2149 O O   . HOH E 4 .   ? -39.731 -10.128 -8.514  1.00 35.46 ? 326 HOH A O   1 
HETATM 2150 O O   . HOH E 4 .   ? -64.729 -31.771 -38.096 1.00 37.11 ? 327 HOH A O   1 
HETATM 2151 O O   . HOH E 4 .   ? -61.192 -16.623 -30.712 1.00 40.07 ? 328 HOH A O   1 
HETATM 2152 O O   . HOH E 4 .   ? -48.800 -3.416  -27.026 1.00 31.52 ? 329 HOH A O   1 
HETATM 2153 O O   . HOH E 4 .   ? -31.268 -18.700 -26.597 1.00 35.82 ? 330 HOH A O   1 
HETATM 2154 O O   . HOH E 4 .   ? -42.923 -36.071 -36.661 1.00 27.85 ? 331 HOH A O   1 
HETATM 2155 O O   . HOH E 4 .   ? -41.439 -7.501  -16.041 1.00 33.68 ? 332 HOH A O   1 
HETATM 2156 O O   . HOH E 4 .   ? -37.414 -8.766  -33.127 1.00 39.09 ? 333 HOH A O   1 
HETATM 2157 O O   . HOH E 4 .   ? -56.114 -12.753 -9.781  1.00 29.76 ? 334 HOH A O   1 
HETATM 2158 O O   . HOH E 4 .   ? -51.455 -10.330 -15.292 1.00 30.55 ? 335 HOH A O   1 
HETATM 2159 O O   . HOH E 4 .   ? -36.102 -8.914  -29.407 1.00 43.17 ? 336 HOH A O   1 
HETATM 2160 O O   . HOH E 4 .   ? -37.591 -6.146  -31.874 1.00 44.39 ? 337 HOH A O   1 
HETATM 2161 O O   . HOH E 4 .   ? -45.950 -34.758 -4.610  1.00 30.35 ? 338 HOH A O   1 
HETATM 2162 O O   . HOH E 4 .   ? -42.791 -5.359  -16.987 1.00 30.48 ? 339 HOH A O   1 
HETATM 2163 O O   . HOH E 4 .   ? -46.631 -43.235 -8.910  1.00 30.88 ? 340 HOH A O   1 
HETATM 2164 O O   . HOH E 4 .   ? -55.506 -21.428 -31.844 1.00 42.70 ? 341 HOH A O   1 
HETATM 2165 O O   . HOH E 4 .   ? -30.257 -26.609 -12.842 1.00 46.64 ? 342 HOH A O   1 
HETATM 2166 O O   . HOH E 4 .   ? -48.693 -7.160  -8.269  1.00 43.82 ? 343 HOH A O   1 
HETATM 2167 O O   . HOH E 4 .   ? -31.641 -17.780 -14.878 1.00 39.78 ? 344 HOH A O   1 
HETATM 2168 O O   . HOH E 4 .   ? -33.434 -14.665 -24.880 1.00 36.47 ? 345 HOH A O   1 
HETATM 2169 O O   . HOH E 4 .   ? -55.167 -1.230  -28.370 1.00 35.31 ? 346 HOH A O   1 
HETATM 2170 O O   . HOH E 4 .   ? -34.027 -32.232 -6.748  1.00 35.16 ? 347 HOH A O   1 
HETATM 2171 O O   . HOH E 4 .   ? -52.878 -5.235  -13.407 1.00 37.62 ? 348 HOH A O   1 
HETATM 2172 O O   . HOH E 4 .   ? -39.632 -43.311 -23.503 1.00 40.42 ? 349 HOH A O   1 
HETATM 2173 O O   . HOH E 4 .   ? -55.190 0.352   -41.042 1.00 42.47 ? 350 HOH A O   1 
HETATM 2174 O O   . HOH E 4 .   ? -61.748 -9.883  -32.070 1.00 32.42 ? 351 HOH A O   1 
HETATM 2175 O O   . HOH E 4 .   ? -54.371 -28.523 -18.792 1.00 34.39 ? 352 HOH A O   1 
HETATM 2176 O O   . HOH E 4 .   ? -49.041 -27.793 -41.319 1.00 34.16 ? 353 HOH A O   1 
HETATM 2177 O O   . HOH E 4 .   ? -53.404 -21.800 -33.256 1.00 31.70 ? 354 HOH A O   1 
HETATM 2178 O O   . HOH E 4 .   ? -56.782 -26.778 -40.939 1.00 39.14 ? 355 HOH A O   1 
HETATM 2179 O O   . HOH E 4 .   ? -28.157 -19.170 -20.406 1.00 40.75 ? 356 HOH A O   1 
HETATM 2180 O O   . HOH E 4 .   ? -66.441 -13.007 -18.611 1.00 42.57 ? 357 HOH A O   1 
HETATM 2181 O O   . HOH E 4 .   ? -58.399 -9.413  -33.241 1.00 51.83 ? 358 HOH A O   1 
HETATM 2182 O O   . HOH E 4 .   ? -48.301 -23.217 -42.763 1.00 42.35 ? 359 HOH A O   1 
HETATM 2183 O O   . HOH E 4 .   ? -59.280 -2.526  -20.574 1.00 41.46 ? 360 HOH A O   1 
HETATM 2184 O O   . HOH E 4 .   ? -58.597 -11.748 -10.623 1.00 41.79 ? 361 HOH A O   1 
HETATM 2185 O O   . HOH E 4 .   ? -32.076 -16.398 -9.724  1.00 49.48 ? 362 HOH A O   1 
HETATM 2186 O O   . HOH E 4 .   ? -55.871 -30.074 -42.600 1.00 41.77 ? 363 HOH A O   1 
HETATM 2187 O O   . HOH E 4 .   ? -56.710 -25.739 -24.438 1.00 42.14 ? 364 HOH A O   1 
HETATM 2188 O O   . HOH E 4 .   ? -48.417 -44.724 -7.058  1.00 40.59 ? 365 HOH A O   1 
HETATM 2189 O O   . HOH E 4 .   ? -58.588 -29.864 -19.127 1.00 36.12 ? 366 HOH A O   1 
HETATM 2190 O O   . HOH E 4 .   ? -51.971 -30.879 -5.762  1.00 33.99 ? 367 HOH A O   1 
HETATM 2191 O O   . HOH E 4 .   ? -38.444 -16.270 -45.741 1.00 38.47 ? 368 HOH A O   1 
HETATM 2192 O O   . HOH E 4 .   ? -45.182 -38.785 -26.553 1.00 47.80 ? 369 HOH A O   1 
HETATM 2193 O O   . HOH E 4 .   ? -61.728 -10.543 -13.018 1.00 48.30 ? 370 HOH A O   1 
HETATM 2194 O O   . HOH E 4 .   ? -30.050 -19.419 -28.924 1.00 42.66 ? 371 HOH A O   1 
HETATM 2195 O O   . HOH E 4 .   ? -52.756 0.603   -22.431 1.00 37.37 ? 372 HOH A O   1 
HETATM 2196 O O   . HOH E 4 .   ? -35.818 -21.849 -41.969 1.00 39.53 ? 373 HOH A O   1 
HETATM 2197 O O   . HOH E 4 .   ? -61.637 -26.111 -37.248 1.00 39.14 ? 374 HOH A O   1 
HETATM 2198 O O   . HOH E 4 .   ? -30.088 -15.478 -13.968 1.00 46.96 ? 375 HOH A O   1 
HETATM 2199 O O   . HOH E 4 .   ? -51.197 2.280   -20.513 1.00 34.85 ? 376 HOH A O   1 
HETATM 2200 O O   . HOH E 4 .   ? -40.167 -7.149  -22.706 1.00 31.15 ? 377 HOH A O   1 
HETATM 2201 O O   . HOH E 4 .   ? -34.169 -12.301 -23.384 1.00 37.64 ? 378 HOH A O   1 
HETATM 2202 O O   . HOH E 4 .   ? -32.862 -12.087 -21.011 1.00 41.06 ? 379 HOH A O   1 
HETATM 2203 O O   . HOH E 4 .   ? -56.685 -23.322 -8.502  1.00 38.14 ? 380 HOH A O   1 
HETATM 2204 O O   . HOH E 4 .   ? -58.598 -20.184 -26.274 1.00 36.01 ? 381 HOH A O   1 
HETATM 2205 O O   . HOH E 4 .   ? -45.275 -22.311 -5.044  1.00 31.95 ? 382 HOH A O   1 
HETATM 2206 O O   . HOH E 4 .   ? -48.801 -2.486  -14.944 1.00 41.15 ? 383 HOH A O   1 
HETATM 2207 O O   . HOH E 4 .   ? -50.666 -36.776 -42.884 1.00 46.04 ? 384 HOH A O   1 
HETATM 2208 O O   . HOH E 4 .   ? -59.340 -32.390 -30.982 1.00 21.02 ? 385 HOH A O   1 
HETATM 2209 O O   . HOH E 4 .   ? -33.664 -29.060 -42.582 1.00 33.39 ? 386 HOH A O   1 
HETATM 2210 O O   . HOH E 4 .   ? -58.279 -40.784 -43.037 1.00 46.30 ? 387 HOH A O   1 
HETATM 2211 O O   . HOH E 4 .   ? -33.614 -28.487 -3.783  1.00 43.84 ? 388 HOH A O   1 
HETATM 2212 O O   . HOH E 4 .   ? -55.276 -27.951 -7.054  1.00 43.42 ? 389 HOH A O   1 
HETATM 2213 O O   . HOH E 4 .   ? -40.660 -39.064 -6.827  1.00 42.76 ? 390 HOH A O   1 
HETATM 2214 O O   . HOH E 4 .   ? -38.524 -24.160 0.375   1.00 50.45 ? 391 HOH A O   1 
HETATM 2215 O O   . HOH E 4 .   ? -44.928 -32.546 -3.356  1.00 41.16 ? 392 HOH A O   1 
HETATM 2216 O O   . HOH E 4 .   ? -68.506 -12.510 -20.793 1.00 44.22 ? 393 HOH A O   1 
HETATM 2217 O O   . HOH E 4 .   ? -51.944 -2.712  -14.249 1.00 43.52 ? 394 HOH A O   1 
HETATM 2218 O O   . HOH E 4 .   ? -44.048 -7.184  -9.031  1.00 47.75 ? 395 HOH A O   1 
HETATM 2219 O O   . HOH E 4 .   ? -49.676 -0.937  -27.979 1.00 38.39 ? 396 HOH A O   1 
HETATM 2220 O O   . HOH E 4 .   ? -34.005 -9.870  -13.901 1.00 47.91 ? 397 HOH A O   1 
HETATM 2221 O O   . HOH E 4 .   ? -55.462 -18.753 -36.714 1.00 39.58 ? 398 HOH A O   1 
HETATM 2222 O O   . HOH E 4 .   ? -53.274 -24.746 -13.660 1.00 41.10 ? 399 HOH A O   1 
HETATM 2223 O O   . HOH E 4 .   ? -57.508 -22.317 -33.362 1.00 48.35 ? 400 HOH A O   1 
HETATM 2224 O O   . HOH E 4 .   ? -50.805 -41.082 -29.611 1.00 51.56 ? 401 HOH A O   1 
HETATM 2225 O O   . HOH E 4 .   ? -55.743 -8.250  -39.210 1.00 48.87 ? 402 HOH A O   1 
HETATM 2226 O O   . HOH E 4 .   ? -46.810 -28.869 -42.576 1.00 56.30 ? 403 HOH A O   1 
HETATM 2227 O O   . HOH E 4 .   ? -29.652 -16.862 -18.964 1.00 48.45 ? 404 HOH A O   1 
HETATM 2228 O O   . HOH E 4 .   ? -39.496 -9.181  -36.141 1.00 50.31 ? 405 HOH A O   1 
HETATM 2229 O O   . HOH E 4 .   ? -54.011 -22.617 -28.616 1.00 27.74 ? 406 HOH A O   1 
HETATM 2230 O O   . HOH E 4 .   ? -57.020 -22.167 -27.841 1.00 45.28 ? 407 HOH A O   1 
HETATM 2231 O O   . HOH E 4 .   ? -42.363 -8.959  -8.171  1.00 51.10 ? 408 HOH A O   1 
HETATM 2232 O O   . HOH E 4 .   ? -59.684 -23.306 -32.180 1.00 53.50 ? 409 HOH A O   1 
HETATM 2233 O O   . HOH E 4 .   ? -54.449 -23.551 -25.591 1.00 32.86 ? 410 HOH A O   1 
HETATM 2234 O O   . HOH E 4 .   ? -42.866 -39.132 -33.454 1.00 56.68 ? 411 HOH A O   1 
HETATM 2235 O O   . HOH E 4 .   ? -51.500 -20.449 -42.932 1.00 57.64 ? 412 HOH A O   1 
HETATM 2236 O O   . HOH E 4 .   ? -49.899 -25.004 -41.447 1.00 45.82 ? 413 HOH A O   1 
HETATM 2237 O O   . HOH E 4 .   ? -55.500 -27.497 -42.888 1.00 54.53 ? 414 HOH A O   1 
HETATM 2238 O O   . HOH E 4 .   ? -35.953 -17.311 -45.591 1.00 46.71 ? 415 HOH A O   1 
HETATM 2239 O O   . HOH E 4 .   ? -33.063 -14.750 -42.406 1.00 51.42 ? 416 HOH A O   1 
HETATM 2240 O O   . HOH E 4 .   ? -39.159 -10.901 -39.670 1.00 49.65 ? 417 HOH A O   1 
HETATM 2241 O O   . HOH E 4 .   ? -33.698 -10.453 -34.393 1.00 46.61 ? 418 HOH A O   1 
HETATM 2242 O O   . HOH E 4 .   ? -32.896 -9.853  -30.124 1.00 56.77 ? 419 HOH A O   1 
HETATM 2243 O O   . HOH E 4 .   ? -34.345 -9.942  -24.466 1.00 53.49 ? 420 HOH A O   1 
HETATM 2244 O O   . HOH E 4 .   ? -37.868 -9.139  -26.173 1.00 44.11 ? 421 HOH A O   1 
HETATM 2245 O O   . HOH E 4 .   ? -41.754 -18.880 -47.700 1.00 54.32 ? 422 HOH A O   1 
HETATM 2246 O O   . HOH E 4 .   ? -33.849 -19.069 -40.784 1.00 41.80 ? 423 HOH A O   1 
HETATM 2247 O O   . HOH E 4 .   ? -34.160 -23.065 -40.459 1.00 39.92 ? 424 HOH A O   1 
HETATM 2248 O O   . HOH E 4 .   ? -29.236 -19.937 -36.936 1.00 49.04 ? 425 HOH A O   1 
HETATM 2249 O O   . HOH E 4 .   ? -27.425 -27.215 -16.221 1.00 55.03 ? 426 HOH A O   1 
HETATM 2250 O O   . HOH E 4 .   ? -26.213 -27.275 -18.657 1.00 54.74 ? 427 HOH A O   1 
HETATM 2251 O O   . HOH E 4 .   ? -28.079 -34.780 -15.047 1.00 47.64 ? 428 HOH A O   1 
HETATM 2252 O O   . HOH E 4 .   ? -54.756 -25.163 -16.971 1.00 45.11 ? 429 HOH A O   1 
HETATM 2253 O O   . HOH E 4 .   ? -44.290 -41.397 -5.797  1.00 51.60 ? 430 HOH A O   1 
HETATM 2254 O O   . HOH E 4 .   ? -42.636 -23.856 -0.336  1.00 51.63 ? 431 HOH A O   1 
HETATM 2255 O O   . HOH E 4 .   ? -34.637 -16.566 -9.069  1.00 43.12 ? 432 HOH A O   1 
HETATM 2256 O O   . HOH E 4 .   ? -32.191 -18.527 -12.535 1.00 44.67 ? 433 HOH A O   1 
HETATM 2257 O O   . HOH E 4 .   ? -31.965 -16.254 -22.397 1.00 41.30 ? 434 HOH A O   1 
HETATM 2258 O O   . HOH E 4 .   ? -57.792 -17.283 -9.179  1.00 47.10 ? 435 HOH A O   1 
HETATM 2259 O O   . HOH E 4 .   ? -53.960 -17.134 -10.026 1.00 44.57 ? 436 HOH A O   1 
HETATM 2260 O O   . HOH E 4 .   ? -39.416 -12.329 -4.000  1.00 52.03 ? 437 HOH A O   1 
HETATM 2261 O O   . HOH E 4 .   ? -41.522 -14.400 -3.219  1.00 44.30 ? 438 HOH A O   1 
HETATM 2262 O O   . HOH E 4 .   ? -53.112 -5.060  -10.537 1.00 52.24 ? 439 HOH A O   1 
HETATM 2263 O O   . HOH E 4 .   ? -55.465 -4.672  -13.043 1.00 57.49 ? 440 HOH A O   1 
HETATM 2264 O O   . HOH E 4 .   ? -40.646 -3.620  -17.856 1.00 43.48 ? 441 HOH A O   1 
HETATM 2265 O O   . HOH E 4 .   ? -38.722 -5.215  -17.678 1.00 42.84 ? 442 HOH A O   1 
HETATM 2266 O O   . HOH E 4 .   ? -61.925 -16.234 -15.463 1.00 50.04 ? 443 HOH A O   1 
HETATM 2267 O O   . HOH E 4 .   ? -60.811 -3.735  -16.992 1.00 54.64 ? 444 HOH A O   1 
HETATM 2268 O O   . HOH E 4 .   ? -44.052 -0.841  -31.891 1.00 44.29 ? 445 HOH A O   1 
HETATM 2269 O O   . HOH E 4 .   ? -60.283 -30.810 -41.555 1.00 56.35 ? 446 HOH A O   1 
HETATM 2270 O O   . HOH E 4 .   ? -50.456 -34.643 -44.936 1.00 49.65 ? 447 HOH A O   1 
HETATM 2271 O O   . HOH E 4 .   ? -37.376 -29.314 -45.714 1.00 51.42 ? 448 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . MET A 4   ? 0.6278 0.6220 0.5018 0.1631  -0.0798 0.0709  1   MET A N   
2    C CA  . MET A 4   ? 0.6400 0.5916 0.4933 0.1643  -0.1034 0.0487  1   MET A CA  
3    C C   . MET A 4   ? 0.5973 0.5322 0.4688 0.1241  -0.1070 0.0520  1   MET A C   
4    O O   . MET A 4   ? 0.6268 0.5322 0.5000 0.1180  -0.1232 0.0415  1   MET A O   
5    C CB  . MET A 4   ? 0.6778 0.6290 0.5018 0.1951  -0.1018 0.0376  1   MET A CB  
6    C CG  . MET A 4   ? 0.7550 0.6685 0.5532 0.2262  -0.1347 0.0079  1   MET A CG  
7    S SD  . MET A 4   ? 0.8910 0.8135 0.6387 0.2799  -0.1314 -0.0053 1   MET A SD  
8    C CE  . MET A 4   ? 0.9521 0.8163 0.6790 0.3138  -0.1887 -0.0521 1   MET A CE  
9    N N   . ASN A 5   ? 0.5312 0.4863 0.4199 0.1008  -0.0937 0.0667  2   ASN A N   
10   C CA  . ASN A 5   ? 0.4774 0.4224 0.3729 0.0730  -0.0937 0.0705  2   ASN A CA  
11   C C   . ASN A 5   ? 0.4594 0.3947 0.3504 0.0679  -0.0912 0.0649  2   ASN A C   
12   O O   . ASN A 5   ? 0.4657 0.3803 0.3627 0.0571  -0.0992 0.0642  2   ASN A O   
13   C CB  . ASN A 5   ? 0.4796 0.4024 0.3784 0.0660  -0.1065 0.0743  2   ASN A CB  
14   C CG  . ASN A 5   ? 0.4431 0.3789 0.3428 0.0625  -0.1059 0.0833  2   ASN A CG  
15   O OD1 . ASN A 5   ? 0.4035 0.3583 0.3062 0.0550  -0.0999 0.0847  2   ASN A OD1 
16   N ND2 . ASN A 5   ? 0.3976 0.3215 0.2979 0.0701  -0.1163 0.0874  2   ASN A ND2 
17   N N   . VAL A 6   ? 0.4283 0.3817 0.3157 0.0757  -0.0781 0.0658  3   VAL A N   
18   C CA  . VAL A 6   ? 0.4011 0.3473 0.2822 0.0731  -0.0757 0.0605  3   VAL A CA  
19   C C   . VAL A 6   ? 0.3808 0.3307 0.2738 0.0461  -0.0679 0.0678  3   VAL A C   
20   O O   . VAL A 6   ? 0.3601 0.3275 0.2655 0.0381  -0.0604 0.0753  3   VAL A O   
21   C CB  . VAL A 6   ? 0.4147 0.3813 0.2839 0.0978  -0.0615 0.0637  3   VAL A CB  
22   C CG1 . VAL A 6   ? 0.3882 0.3477 0.2480 0.0972  -0.0596 0.0582  3   VAL A CG1 
23   C CG2 . VAL A 6   ? 0.4554 0.4185 0.3009 0.1350  -0.0703 0.0540  3   VAL A CG2 
24   N N   . PRO A 7   ? 0.3749 0.3085 0.2688 0.0349  -0.0723 0.0651  4   PRO A N   
25   C CA  . PRO A 7   ? 0.3681 0.3068 0.2650 0.0174  -0.0640 0.0716  4   PRO A CA  
26   C C   . PRO A 7   ? 0.3448 0.2956 0.2433 0.0148  -0.0535 0.0705  4   PRO A C   
27   O O   . PRO A 7   ? 0.3422 0.2957 0.2372 0.0260  -0.0496 0.0680  4   PRO A O   
28   C CB  . PRO A 7   ? 0.3849 0.3084 0.2904 0.0105  -0.0678 0.0754  4   PRO A CB  
29   C CG  . PRO A 7   ? 0.3744 0.2843 0.2856 0.0217  -0.0809 0.0634  4   PRO A CG  
30   C CD  . PRO A 7   ? 0.3770 0.2883 0.2759 0.0400  -0.0873 0.0563  4   PRO A CD  
31   N N   . PHE A 8   ? 0.3345 0.2908 0.2363 0.0047  -0.0513 0.0719  5   PHE A N   
32   C CA  . PHE A 8   ? 0.3247 0.2869 0.2358 0.0000  -0.0449 0.0711  5   PHE A CA  
33   C C   . PHE A 8   ? 0.3292 0.2820 0.2292 -0.0040 -0.0409 0.0684  5   PHE A C   
34   O O   . PHE A 8   ? 0.3506 0.2970 0.2417 -0.0062 -0.0419 0.0704  5   PHE A O   
35   C CB  . PHE A 8   ? 0.3229 0.2895 0.2486 -0.0056 -0.0531 0.0677  5   PHE A CB  
36   C CG  . PHE A 8   ? 0.3374 0.3182 0.2949 -0.0040 -0.0579 0.0732  5   PHE A CG  
37   C CD1 . PHE A 8   ? 0.3288 0.3259 0.3249 -0.0035 -0.0485 0.0867  5   PHE A CD1 
38   C CD2 . PHE A 8   ? 0.4199 0.4011 0.3738 -0.0007 -0.0699 0.0699  5   PHE A CD2 
39   C CE1 . PHE A 8   ? 0.3614 0.3781 0.4008 -0.0012 -0.0498 0.0992  5   PHE A CE1 
40   C CE2 . PHE A 8   ? 0.4205 0.4180 0.4123 0.0008  -0.0753 0.0765  5   PHE A CE2 
41   C CZ  . PHE A 8   ? 0.4171 0.4337 0.4562 -0.0002 -0.0645 0.0924  5   PHE A CZ  
42   N N   . TRP A 9   ? 0.3293 0.2848 0.2341 -0.0027 -0.0342 0.0684  6   TRP A N   
43   C CA  . TRP A 9   ? 0.3251 0.2745 0.2246 -0.0067 -0.0309 0.0655  6   TRP A CA  
44   C C   . TRP A 9   ? 0.3330 0.2828 0.2342 -0.0123 -0.0319 0.0623  6   TRP A C   
45   O O   . TRP A 9   ? 0.3484 0.3015 0.2674 -0.0141 -0.0322 0.0625  6   TRP A O   
46   C CB  . TRP A 9   ? 0.3155 0.2669 0.2151 0.0017  -0.0255 0.0658  6   TRP A CB  
47   C CG  . TRP A 9   ? 0.3067 0.2520 0.2035 -0.0010 -0.0246 0.0618  6   TRP A CG  
48   C CD1 . TRP A 9   ? 0.3077 0.2548 0.2072 -0.0027 -0.0178 0.0626  6   TRP A CD1 
49   C CD2 . TRP A 9   ? 0.3168 0.2542 0.2181 -0.0022 -0.0322 0.0586  6   TRP A CD2 
50   N NE1 . TRP A 9   ? 0.3191 0.2615 0.2172 -0.0034 -0.0194 0.0586  6   TRP A NE1 
51   C CE2 . TRP A 9   ? 0.3298 0.2676 0.2344 -0.0039 -0.0284 0.0574  6   TRP A CE2 
52   C CE3 . TRP A 9   ? 0.3559 0.2858 0.2693 -0.0024 -0.0436 0.0589  6   TRP A CE3 
53   C CZ2 . TRP A 9   ? 0.3205 0.2549 0.2441 -0.0060 -0.0352 0.0574  6   TRP A CZ2 
54   C CZ3 . TRP A 9   ? 0.3485 0.2727 0.2881 -0.0059 -0.0520 0.0603  6   TRP A CZ3 
55   C CH2 . TRP A 9   ? 0.3397 0.2679 0.2858 -0.0078 -0.0475 0.0599  6   TRP A CH2 
56   N N   . THR A 10  ? 0.3550 0.3017 0.2401 -0.0107 -0.0341 0.0606  7   THR A N   
57   C CA  . THR A 10  ? 0.3807 0.3248 0.2557 -0.0055 -0.0424 0.0510  7   THR A CA  
58   C C   . THR A 10  ? 0.3768 0.3175 0.2429 -0.0019 -0.0380 0.0462  7   THR A C   
59   O O   . THR A 10  ? 0.3610 0.3046 0.2289 -0.0046 -0.0259 0.0539  7   THR A O   
60   C CB  . THR A 10  ? 0.4084 0.3538 0.2567 0.0068  -0.0455 0.0529  7   THR A CB  
61   O OG1 . THR A 10  ? 0.4247 0.3753 0.2650 0.0101  -0.0294 0.0693  7   THR A OG1 
62   C CG2 . THR A 10  ? 0.4330 0.3804 0.2894 0.0048  -0.0527 0.0559  7   THR A CG2 
63   N N   . GLU A 11  ? 0.3962 0.3295 0.2536 0.0074  -0.0522 0.0310  8   GLU A N   
64   C CA  . GLU A 11  ? 0.4211 0.3495 0.2624 0.0178  -0.0512 0.0227  8   GLU A CA  
65   C C   . GLU A 11  ? 0.4301 0.3707 0.2480 0.0273  -0.0299 0.0381  8   GLU A C   
66   O O   . GLU A 11  ? 0.4269 0.3702 0.2488 0.0268  -0.0197 0.0413  8   GLU A O   
67   C CB  . GLU A 11  ? 0.4744 0.3901 0.2964 0.0379  -0.0766 -0.0007 8   GLU A CB  
68   C CG  . GLU A 11  ? 0.5282 0.4389 0.3198 0.0592  -0.0767 -0.0117 8   GLU A CG  
69   C CD  . GLU A 11  ? 0.5925 0.4835 0.3663 0.0840  -0.1113 -0.0434 8   GLU A CD  
70   O OE1 . GLU A 11  ? 0.6173 0.4996 0.4055 0.0840  -0.1374 -0.0566 8   GLU A OE1 
71   O OE2 . GLU A 11  ? 0.6662 0.5500 0.4124 0.1065  -0.1154 -0.0570 8   GLU A OE2 
72   N N   . GLU A 12  ? 0.4493 0.3995 0.2513 0.0364  -0.0224 0.0518  9   GLU A N   
73   C CA  . GLU A 12  ? 0.4689 0.4359 0.2652 0.0470  0.0000  0.0761  9   GLU A CA  
74   C C   . GLU A 12  ? 0.4172 0.3877 0.2573 0.0248  0.0092  0.0898  9   GLU A C   
75   O O   . GLU A 12  ? 0.4289 0.4108 0.2827 0.0278  0.0229  0.1034  9   GLU A O   
76   C CB  . GLU A 12  ? 0.5065 0.4838 0.2856 0.0624  0.0073  0.0950  9   GLU A CB  
77   C CG  . GLU A 12  ? 0.6145 0.5910 0.3361 0.0989  -0.0022 0.0811  9   GLU A CG  
78   C CD  . GLU A 12  ? 0.6789 0.6353 0.3927 0.0968  -0.0362 0.0482  9   GLU A CD  
79   O OE1 . GLU A 12  ? 0.5607 0.5083 0.3142 0.0675  -0.0469 0.0413  9   GLU A OE1 
80   O OE2 . GLU A 12  ? 0.7620 0.7133 0.4306 0.1300  -0.0533 0.0302  9   GLU A OE2 
81   N N   . HIS A 13  ? 0.3841 0.3457 0.2461 0.0073  -0.0007 0.0850  10  HIS A N   
82   C CA  . HIS A 13  ? 0.3622 0.3214 0.2576 -0.0057 -0.0020 0.0883  10  HIS A CA  
83   C C   . HIS A 13  ? 0.3500 0.3062 0.2471 -0.0078 -0.0023 0.0772  10  HIS A C   
84   O O   . HIS A 13  ? 0.3501 0.3098 0.2695 -0.0103 -0.0004 0.0823  10  HIS A O   
85   C CB  . HIS A 13  ? 0.3619 0.3117 0.2661 -0.0126 -0.0143 0.0820  10  HIS A CB  
86   C CG  . HIS A 13  ? 0.3949 0.3449 0.3101 -0.0125 -0.0161 0.0951  10  HIS A CG  
87   N ND1 . HIS A 13  ? 0.4913 0.4415 0.3870 -0.0079 -0.0181 0.0950  10  HIS A ND1 
88   C CD2 . HIS A 13  ? 0.4316 0.3801 0.3834 -0.0164 -0.0192 0.1096  10  HIS A CD2 
89   C CE1 . HIS A 13  ? 0.4181 0.3677 0.3309 -0.0078 -0.0185 0.1108  10  HIS A CE1 
90   N NE2 . HIS A 13  ? 0.4693 0.4174 0.4208 -0.0139 -0.0194 0.1211  10  HIS A NE2 
91   N N   . VAL A 14  ? 0.3276 0.2770 0.2093 -0.0066 -0.0071 0.0634  11  VAL A N   
92   C CA  . VAL A 14  ? 0.3257 0.2711 0.2101 -0.0067 -0.0065 0.0562  11  VAL A CA  
93   C C   . VAL A 14  ? 0.3341 0.2861 0.2121 0.0017  0.0021  0.0590  11  VAL A C   
94   O O   . VAL A 14  ? 0.3318 0.2873 0.2237 0.0002  0.0061  0.0619  11  VAL A O   
95   C CB  . VAL A 14  ? 0.3403 0.2768 0.2254 -0.0071 -0.0150 0.0461  11  VAL A CB  
96   C CG1 . VAL A 14  ? 0.3169 0.2479 0.2113 -0.0067 -0.0134 0.0433  11  VAL A CG1 
97   C CG2 . VAL A 14  ? 0.3293 0.2669 0.2295 -0.0128 -0.0183 0.0506  11  VAL A CG2 
98   N N   . ARG A 15  ? 0.3587 0.3143 0.2132 0.0156  0.0045  0.0584  12  ARG A N   
99   C CA  . ARG A 15  ? 0.3821 0.3483 0.2238 0.0326  0.0162  0.0632  12  ARG A CA  
100  C C   . ARG A 15  ? 0.3749 0.3610 0.2476 0.0294  0.0326  0.0883  12  ARG A C   
101  O O   . ARG A 15  ? 0.3793 0.3751 0.2633 0.0345  0.0412  0.0935  12  ARG A O   
102  C CB  . ARG A 15  ? 0.4268 0.3966 0.2275 0.0595  0.0167  0.0603  12  ARG A CB  
103  C CG  . ARG A 15  ? 0.4702 0.4177 0.2480 0.0686  -0.0080 0.0302  12  ARG A CG  
104  C CD  . ARG A 15  ? 0.5555 0.5058 0.2812 0.1076  -0.0120 0.0220  12  ARG A CD  
105  N NE  . ARG A 15  ? 0.6236 0.5463 0.3386 0.1165  -0.0471 -0.0134 12  ARG A NE  
106  C CZ  . ARG A 15  ? 0.6473 0.5528 0.3588 0.1277  -0.0632 -0.0359 12  ARG A CZ  
107  N NH1 . ARG A 15  ? 0.6602 0.5762 0.3650 0.1362  -0.0439 -0.0271 12  ARG A NH1 
108  N NH2 . ARG A 15  ? 0.6912 0.5680 0.4120 0.1321  -0.1021 -0.0676 12  ARG A NH2 
109  N N   . ALA A 16  ? 0.3634 0.3556 0.2584 0.0214  0.0346  0.1049  13  ALA A N   
110  C CA  . ALA A 16  ? 0.3621 0.3714 0.3080 0.0159  0.0444  0.1320  13  ALA A CA  
111  C C   . ALA A 16  ? 0.3464 0.3480 0.3331 0.0001  0.0300  0.1235  13  ALA A C   
112  O O   . ALA A 16  ? 0.3561 0.3720 0.3955 -0.0030 0.0333  0.1424  13  ALA A O   
113  C CB  . ALA A 16  ? 0.3650 0.3771 0.3309 0.0117  0.0450  0.1511  13  ALA A CB  
114  N N   . THR A 17  ? 0.3283 0.3099 0.2944 -0.0058 0.0140  0.0978  14  THR A N   
115  C CA  . THR A 17  ? 0.3210 0.2927 0.3108 -0.0115 -0.0037 0.0861  14  THR A CA  
116  C C   . THR A 17  ? 0.3236 0.2900 0.2947 -0.0063 -0.0051 0.0717  14  THR A C   
117  O O   . THR A 17  ? 0.3385 0.2998 0.3254 -0.0040 -0.0195 0.0632  14  THR A O   
118  C CB  . THR A 17  ? 0.3134 0.2691 0.2966 -0.0136 -0.0210 0.0741  14  THR A CB  
119  O OG1 . THR A 17  ? 0.3133 0.2633 0.2559 -0.0108 -0.0159 0.0656  14  THR A OG1 
120  C CG2 . THR A 17  ? 0.3219 0.2783 0.3351 -0.0193 -0.0256 0.0878  14  THR A CG2 
121  N N   . LEU A 18  ? 0.3314 0.2961 0.2705 -0.0017 0.0050  0.0670  15  LEU A N   
122  C CA  . LEU A 18  ? 0.3387 0.2972 0.2675 0.0030  0.0043  0.0576  15  LEU A CA  
123  C C   . LEU A 18  ? 0.3539 0.3248 0.3052 0.0071  0.0084  0.0632  15  LEU A C   
124  O O   . LEU A 18  ? 0.3668 0.3542 0.3322 0.0100  0.0200  0.0773  15  LEU A O   
125  C CB  . LEU A 18  ? 0.3501 0.3001 0.2546 0.0068  0.0084  0.0509  15  LEU A CB  
126  C CG  . LEU A 18  ? 0.3515 0.2900 0.2495 0.0025  0.0026  0.0470  15  LEU A CG  
127  C CD1 . LEU A 18  ? 0.3791 0.3073 0.2686 0.0067  -0.0022 0.0376  15  LEU A CD1 
128  C CD2 . LEU A 18  ? 0.3450 0.2798 0.2488 0.0046  0.0020  0.0502  15  LEU A CD2 
129  N N   . PRO A 19  ? 0.3661 0.3322 0.3222 0.0109  0.0002  0.0556  16  PRO A N   
130  C CA  . PRO A 19  ? 0.3894 0.3681 0.3751 0.0146  -0.0001 0.0599  16  PRO A CA  
131  C C   . PRO A 19  ? 0.4343 0.4179 0.4029 0.0231  0.0149  0.0611  16  PRO A C   
132  O O   . PRO A 19  ? 0.4201 0.3888 0.3562 0.0264  0.0170  0.0521  16  PRO A O   
133  C CB  . PRO A 19  ? 0.4023 0.3697 0.3857 0.0218  -0.0186 0.0464  16  PRO A CB  
134  C CG  . PRO A 19  ? 0.3870 0.3400 0.3286 0.0264  -0.0135 0.0419  16  PRO A CG  
135  C CD  . PRO A 19  ? 0.3808 0.3330 0.3170 0.0166  -0.0085 0.0462  16  PRO A CD  
136  N N   . GLU A 20  ? 0.5052 0.4635 0.3907 -0.0015 0.0730  0.0558  17  GLU A N   
137  C CA  . GLU A 20  ? 0.5491 0.5143 0.4366 0.0028  0.0787  0.0546  17  GLU A CA  
138  C C   . GLU A 20  ? 0.5368 0.5182 0.4475 -0.0002 0.0742  0.0513  17  GLU A C   
139  O O   . GLU A 20  ? 0.5567 0.5454 0.4842 -0.0070 0.0696  0.0513  17  GLU A O   
140  C CB  . GLU A 20  ? 0.5788 0.5436 0.4670 0.0032  0.0937  0.0611  17  GLU A CB  
141  C CG  . GLU A 20  ? 0.6583 0.6075 0.5185 0.0105  0.1002  0.0634  17  GLU A CG  
142  C CD  . GLU A 20  ? 0.7281 0.6791 0.5900 0.0123  0.1165  0.0690  17  GLU A CD  
143  O OE1 . GLU A 20  ? 0.7997 0.7553 0.6769 0.0062  0.1246  0.0750  17  GLU A OE1 
144  O OE2 . GLU A 20  ? 0.7768 0.7247 0.6257 0.0196  0.1216  0.0674  17  GLU A OE2 
145  N N   . ARG A 21  ? 0.5389 0.5249 0.4494 0.0048  0.0744  0.0480  18  ARG A N   
146  C CA  . ARG A 21  ? 0.5272 0.5289 0.4600 0.0028  0.0717  0.0461  18  ARG A CA  
147  C C   . ARG A 21  ? 0.5598 0.5708 0.5044 0.0048  0.0832  0.0495  18  ARG A C   
148  O O   . ARG A 21  ? 0.5784 0.5891 0.5175 0.0114  0.0865  0.0475  18  ARG A O   
149  C CB  . ARG A 21  ? 0.4997 0.5013 0.4284 0.0065  0.0627  0.0400  18  ARG A CB  
150  C CG  . ARG A 21  ? 0.4546 0.4692 0.4037 0.0026  0.0556  0.0382  18  ARG A CG  
151  C CD  . ARG A 21  ? 0.3825 0.3946 0.3259 0.0059  0.0472  0.0329  18  ARG A CD  
152  N NE  . ARG A 21  ? 0.3471 0.3695 0.3063 0.0029  0.0402  0.0315  18  ARG A NE  
153  C CZ  . ARG A 21  ? 0.3391 0.3616 0.3011 -0.0017 0.0324  0.0302  18  ARG A CZ  
154  N NH1 . ARG A 21  ? 0.2991 0.3123 0.2505 -0.0039 0.0300  0.0299  18  ARG A NH1 
155  N NH2 . ARG A 21  ? 0.3114 0.3426 0.2856 -0.0033 0.0268  0.0292  18  ARG A NH2 
156  N N   . ASP A 22  ? 0.5861 0.6055 0.5481 -0.0008 0.0893  0.0544  19  ASP A N   
157  C CA  . ASP A 22  ? 0.6171 0.6454 0.5914 0.0008  0.1023  0.0588  19  ASP A CA  
158  C C   . ASP A 22  ? 0.6068 0.6524 0.6034 0.0022  0.1003  0.0570  19  ASP A C   
159  O O   . ASP A 22  ? 0.6088 0.6600 0.6132 0.0002  0.0888  0.0533  19  ASP A O   
160  C CB  . ASP A 22  ? 0.6361 0.6673 0.6229 -0.0063 0.1099  0.0649  19  ASP A CB  
161  C CG  . ASP A 22  ? 0.7072 0.7197 0.6698 -0.0057 0.1154  0.0683  19  ASP A CG  
162  O OD1 . ASP A 22  ? 0.7746 0.7837 0.7416 -0.0127 0.1155  0.0716  19  ASP A OD1 
163  O OD2 . ASP A 22  ? 0.7917 0.7920 0.7300 0.0020  0.1194  0.0677  19  ASP A OD2 
164  N N   . THR A 29  ? 0.5146 0.5960 0.5934 -0.0487 0.0289  0.0428  26  THR A N   
165  C CA  . THR A 29  ? 0.4926 0.5721 0.5586 -0.0403 0.0262  0.0407  26  THR A CA  
166  C C   . THR A 29  ? 0.4751 0.5372 0.5171 -0.0382 0.0234  0.0381  26  THR A C   
167  O O   . THR A 29  ? 0.4919 0.5435 0.5268 -0.0424 0.0237  0.0382  26  THR A O   
168  C CB  . THR A 29  ? 0.4952 0.5870 0.5724 -0.0394 0.0161  0.0379  26  THR A CB  
169  O OG1 . THR A 29  ? 0.5359 0.6225 0.6078 -0.0438 0.0058  0.0340  26  THR A OG1 
170  C CG2 . THR A 29  ? 0.5070 0.6177 0.6113 -0.0425 0.0172  0.0404  26  THR A CG2 
171  N N   . TYR A 30  ? 0.4338 0.4925 0.4638 -0.0313 0.0212  0.0359  27  TYR A N   
172  C CA  . TYR A 30  ? 0.4028 0.4476 0.4133 -0.0292 0.0172  0.0330  27  TYR A CA  
173  C C   . TYR A 30  ? 0.3906 0.4378 0.4037 -0.0316 0.0072  0.0295  27  TYR A C   
174  O O   . TYR A 30  ? 0.4065 0.4647 0.4309 -0.0313 0.0033  0.0291  27  TYR A O   
175  C CB  . TYR A 30  ? 0.3885 0.4285 0.3864 -0.0215 0.0202  0.0324  27  TYR A CB  
176  C CG  . TYR A 30  ? 0.3894 0.4279 0.3851 -0.0191 0.0304  0.0360  27  TYR A CG  
177  C CD1 . TYR A 30  ? 0.4344 0.4615 0.4183 -0.0202 0.0350  0.0379  27  TYR A CD1 
178  C CD2 . TYR A 30  ? 0.4066 0.4550 0.4126 -0.0159 0.0362  0.0379  27  TYR A CD2 
179  C CE1 . TYR A 30  ? 0.4618 0.4867 0.4421 -0.0177 0.0453  0.0418  27  TYR A CE1 
180  C CE2 . TYR A 30  ? 0.4741 0.5209 0.4778 -0.0135 0.0469  0.0413  27  TYR A CE2 
181  C CZ  . TYR A 30  ? 0.4704 0.5055 0.4608 -0.0145 0.0516  0.0433  27  TYR A CZ  
182  O OH  . TYR A 30  ? 0.5930 0.6264 0.5800 -0.0114 0.0631  0.0471  27  TYR A OH  
183  N N   . GLY A 31  ? 0.3804 0.4176 0.3835 -0.0337 0.0029  0.0271  28  GLY A N   
184  C CA  . GLY A 31  ? 0.3652 0.4049 0.3723 -0.0375 -0.0055 0.0240  28  GLY A CA  
185  C C   . GLY A 31  ? 0.3432 0.3847 0.3454 -0.0329 -0.0109 0.0217  28  GLY A C   
186  O O   . GLY A 31  ? 0.3364 0.3752 0.3313 -0.0273 -0.0083 0.0219  28  GLY A O   
187  N N   . THR A 32  ? 0.3020 0.3467 0.3073 -0.0354 -0.0184 0.0194  29  THR A N   
188  C CA  . THR A 32  ? 0.2910 0.3338 0.2882 -0.0317 -0.0235 0.0172  29  THR A CA  
189  C C   . THR A 32  ? 0.2787 0.3088 0.2623 -0.0326 -0.0254 0.0142  29  THR A C   
190  O O   . THR A 32  ? 0.2912 0.3171 0.2743 -0.0376 -0.0280 0.0123  29  THR A O   
191  C CB  . THR A 32  ? 0.3126 0.3647 0.3178 -0.0330 -0.0308 0.0164  29  THR A CB  
192  O OG1 . THR A 32  ? 0.3091 0.3742 0.3293 -0.0317 -0.0289 0.0195  29  THR A OG1 
193  C CG2 . THR A 32  ? 0.3050 0.3535 0.2996 -0.0286 -0.0349 0.0151  29  THR A CG2 
194  N N   . ALA A 33  ? 0.2450 0.2691 0.2187 -0.0280 -0.0237 0.0136  30  ALA A N   
195  C CA  . ALA A 33  ? 0.2449 0.2585 0.2074 -0.0277 -0.0247 0.0111  30  ALA A CA  
196  C C   . ALA A 33  ? 0.2419 0.2546 0.1987 -0.0256 -0.0288 0.0093  30  ALA A C   
197  O O   . ALA A 33  ? 0.2513 0.2696 0.2104 -0.0225 -0.0294 0.0106  30  ALA A O   
198  C CB  . ALA A 33  ? 0.2548 0.2629 0.2115 -0.0241 -0.0205 0.0116  30  ALA A CB  
199  N N   . LEU A 34  ? 0.2555 0.2600 0.2042 -0.0268 -0.0306 0.0066  31  LEU A N   
200  C CA  . LEU A 34  ? 0.2443 0.2452 0.1845 -0.0243 -0.0327 0.0050  31  LEU A CA  
201  C C   . LEU A 34  ? 0.2506 0.2437 0.1842 -0.0216 -0.0288 0.0041  31  LEU A C   
202  O O   . LEU A 34  ? 0.2421 0.2289 0.1733 -0.0229 -0.0275 0.0029  31  LEU A O   
203  C CB  . LEU A 34  ? 0.2571 0.2545 0.1922 -0.0275 -0.0378 0.0021  31  LEU A CB  
204  C CG  . LEU A 34  ? 0.2800 0.2721 0.2034 -0.0246 -0.0394 0.0005  31  LEU A CG  
205  C CD1 . LEU A 34  ? 0.2765 0.2753 0.2010 -0.0212 -0.0411 0.0031  31  LEU A CD1 
206  C CD2 . LEU A 34  ? 0.2885 0.2748 0.2047 -0.0280 -0.0447 -0.0034 31  LEU A CD2 
207  N N   . LEU A 35  ? 0.2502 0.2438 0.1817 -0.0177 -0.0270 0.0050  32  LEU A N   
208  C CA  . LEU A 35  ? 0.2464 0.2344 0.1741 -0.0151 -0.0235 0.0042  32  LEU A CA  
209  C C   . LEU A 35  ? 0.2596 0.2435 0.1797 -0.0133 -0.0233 0.0034  32  LEU A C   
210  O O   . LEU A 35  ? 0.2655 0.2518 0.1845 -0.0114 -0.0234 0.0051  32  LEU A O   
211  C CB  . LEU A 35  ? 0.2407 0.2317 0.1735 -0.0126 -0.0208 0.0057  32  LEU A CB  
212  C CG  . LEU A 35  ? 0.2394 0.2269 0.1715 -0.0101 -0.0179 0.0049  32  LEU A CG  
213  C CD1 . LEU A 35  ? 0.2474 0.2303 0.1784 -0.0105 -0.0175 0.0032  32  LEU A CD1 
214  C CD2 . LEU A 35  ? 0.2489 0.2393 0.1864 -0.0083 -0.0163 0.0058  32  LEU A CD2 
215  N N   . LEU A 36  ? 0.2698 0.2466 0.1836 -0.0135 -0.0224 0.0010  33  LEU A N   
216  C CA  . LEU A 36  ? 0.2753 0.2467 0.1800 -0.0113 -0.0207 0.0001  33  LEU A CA  
217  C C   . LEU A 36  ? 0.2835 0.2530 0.1911 -0.0085 -0.0151 0.0003  33  LEU A C   
218  O O   . LEU A 36  ? 0.2756 0.2411 0.1835 -0.0082 -0.0135 -0.0014 33  LEU A O   
219  C CB  . LEU A 36  ? 0.2943 0.2585 0.1899 -0.0131 -0.0232 -0.0032 33  LEU A CB  
220  C CG  . LEU A 36  ? 0.2914 0.2581 0.1858 -0.0167 -0.0298 -0.0040 33  LEU A CG  
221  C CD1 . LEU A 36  ? 0.3188 0.2765 0.2036 -0.0188 -0.0325 -0.0083 33  LEU A CD1 
222  C CD2 . LEU A 36  ? 0.2850 0.2570 0.1776 -0.0151 -0.0326 -0.0017 33  LEU A CD2 
223  N N   . ALA A 37  ? 0.2647 0.2370 0.1753 -0.0065 -0.0123 0.0026  34  ALA A N   
224  C CA  . ALA A 37  ? 0.2624 0.2353 0.1800 -0.0048 -0.0078 0.0028  34  ALA A CA  
225  C C   . ALA A 37  ? 0.2755 0.2489 0.1936 -0.0031 -0.0040 0.0053  34  ALA A C   
226  O O   . ALA A 37  ? 0.2792 0.2537 0.1940 -0.0029 -0.0056 0.0074  34  ALA A O   
227  C CB  . ALA A 37  ? 0.2525 0.2303 0.1795 -0.0057 -0.0097 0.0029  34  ALA A CB  
228  N N   . GLY A 38  ? 0.2907 0.2632 0.2138 -0.0018 0.0010  0.0053  35  GLY A N   
229  C CA  . GLY A 38  ? 0.2937 0.2664 0.2206 -0.0008 0.0059  0.0079  35  GLY A CA  
230  C C   . GLY A 38  ? 0.3186 0.2853 0.2343 0.0011  0.0105  0.0097  35  GLY A C   
231  O O   . GLY A 38  ? 0.3521 0.3155 0.2555 0.0016  0.0076  0.0099  35  GLY A O   
232  N N   . SER A 39  ? 0.3367 0.3018 0.2566 0.0022  0.0178  0.0107  36  SER A N   
233  C CA  . SER A 39  ? 0.3450 0.3033 0.2534 0.0047  0.0241  0.0130  36  SER A CA  
234  C C   . SER A 39  ? 0.3639 0.3224 0.2805 0.0047  0.0309  0.0166  36  SER A C   
235  O O   . SER A 39  ? 0.3279 0.2920 0.2605 0.0026  0.0307  0.0161  36  SER A O   
236  C CB  . SER A 39  ? 0.3510 0.3056 0.2550 0.0064  0.0282  0.0106  36  SER A CB  
237  O OG  . SER A 39  ? 0.3428 0.3021 0.2628 0.0063  0.0325  0.0097  36  SER A OG  
238  N N   . ASP A 40  ? 0.3850 0.3365 0.2900 0.0070  0.0370  0.0201  37  ASP A N   
239  C CA  . ASP A 40  ? 0.4167 0.3666 0.3283 0.0069  0.0443  0.0244  37  ASP A CA  
240  C C   . ASP A 40  ? 0.4061 0.3614 0.3373 0.0049  0.0498  0.0231  37  ASP A C   
241  O O   . ASP A 40  ? 0.3940 0.3521 0.3394 0.0025  0.0517  0.0244  37  ASP A O   
242  C CB  . ASP A 40  ? 0.4434 0.3835 0.3376 0.0103  0.0518  0.0288  37  ASP A CB  
243  C CG  . ASP A 40  ? 0.4816 0.4168 0.3585 0.0125  0.0461  0.0312  37  ASP A CG  
244  O OD1 . ASP A 40  ? 0.4992 0.4390 0.3775 0.0114  0.0366  0.0294  37  ASP A OD1 
245  O OD2 . ASP A 40  ? 0.5800 0.5064 0.4411 0.0158  0.0514  0.0354  37  ASP A OD2 
246  N N   . ASP A 41  ? 0.4226 0.3795 0.3557 0.0060  0.0521  0.0204  38  ASP A N   
247  C CA  . ASP A 41  ? 0.4229 0.3863 0.3762 0.0047  0.0571  0.0193  38  ASP A CA  
248  C C   . ASP A 41  ? 0.3977 0.3702 0.3671 0.0021  0.0483  0.0153  38  ASP A C   
249  O O   . ASP A 41  ? 0.4028 0.3818 0.3915 0.0001  0.0497  0.0145  38  ASP A O   
250  C CB  . ASP A 41  ? 0.4495 0.4108 0.3989 0.0080  0.0637  0.0181  38  ASP A CB  
251  C CG  . ASP A 41  ? 0.5171 0.4692 0.4522 0.0111  0.0749  0.0222  38  ASP A CG  
252  O OD1 . ASP A 41  ? 0.5853 0.5329 0.5157 0.0106  0.0788  0.0267  38  ASP A OD1 
253  O OD2 . ASP A 41  ? 0.6152 0.5638 0.5433 0.0145  0.0804  0.0209  38  ASP A OD2 
254  N N   . MET A 42  ? 0.3608 0.3335 0.3221 0.0020  0.0392  0.0128  39  MET A N   
255  C CA  . MET A 42  ? 0.3161 0.2955 0.2881 0.0002  0.0309  0.0094  39  MET A CA  
256  C C   . MET A 42  ? 0.2897 0.2680 0.2540 -0.0010 0.0235  0.0095  39  MET A C   
257  O O   . MET A 42  ? 0.2954 0.2737 0.2523 -0.0007 0.0177  0.0077  39  MET A O   
258  C CB  . MET A 42  ? 0.3260 0.3063 0.2962 0.0021  0.0282  0.0064  39  MET A CB  
259  C CG  . MET A 42  ? 0.3637 0.3471 0.3458 0.0039  0.0346  0.0059  39  MET A CG  
260  S SD  . MET A 42  ? 0.4033 0.3844 0.3791 0.0073  0.0322  0.0028  39  MET A SD  
261  C CE  . MET A 42  ? 0.3913 0.3610 0.3437 0.0094  0.0372  0.0037  39  MET A CE  
262  N N   . PRO A 43  ? 0.2591 0.2368 0.2265 -0.0024 0.0243  0.0115  40  PRO A N   
263  C CA  . PRO A 43  ? 0.2555 0.2318 0.2150 -0.0025 0.0191  0.0123  40  PRO A CA  
264  C C   . PRO A 43  ? 0.2472 0.2282 0.2130 -0.0039 0.0120  0.0092  40  PRO A C   
265  O O   . PRO A 43  ? 0.2438 0.2250 0.2028 -0.0036 0.0072  0.0090  40  PRO A O   
266  C CB  . PRO A 43  ? 0.2555 0.2281 0.2167 -0.0028 0.0238  0.0159  40  PRO A CB  
267  C CG  . PRO A 43  ? 0.2705 0.2449 0.2467 -0.0046 0.0295  0.0155  40  PRO A CG  
268  C CD  . PRO A 43  ? 0.2713 0.2479 0.2476 -0.0033 0.0318  0.0141  40  PRO A CD  
269  N N   . GLY A 44  ? 0.2376 0.2223 0.2167 -0.0053 0.0115  0.0069  41  GLY A N   
270  C CA  . GLY A 44  ? 0.2380 0.2254 0.2215 -0.0063 0.0052  0.0040  41  GLY A CA  
271  C C   . GLY A 44  ? 0.2320 0.2210 0.2091 -0.0053 -0.0001 0.0024  41  GLY A C   
272  O O   . GLY A 44  ? 0.2431 0.2324 0.2173 -0.0054 -0.0045 0.0013  41  GLY A O   
273  N N   . ALA A 45  ? 0.2311 0.2198 0.2048 -0.0042 0.0009  0.0023  42  ALA A N   
274  C CA  . ALA A 45  ? 0.2334 0.2222 0.2012 -0.0035 -0.0035 0.0010  42  ALA A CA  
275  C C   . ALA A 45  ? 0.2397 0.2269 0.1977 -0.0040 -0.0059 0.0023  42  ALA A C   
276  O O   . ALA A 45  ? 0.2391 0.2269 0.1947 -0.0042 -0.0097 0.0015  42  ALA A O   
277  C CB  . ALA A 45  ? 0.2346 0.2215 0.1995 -0.0021 -0.0013 0.0007  42  ALA A CB  
278  N N   . ALA A 46  ? 0.2393 0.2247 0.1923 -0.0040 -0.0036 0.0045  43  ALA A N   
279  C CA  . ALA A 46  ? 0.2412 0.2269 0.1878 -0.0042 -0.0062 0.0058  43  ALA A CA  
280  C C   . ALA A 46  ? 0.2337 0.2216 0.1840 -0.0043 -0.0082 0.0057  43  ALA A C   
281  O O   . ALA A 46  ? 0.2381 0.2278 0.1859 -0.0045 -0.0107 0.0059  43  ALA A O   
282  C CB  . ALA A 46  ? 0.2570 0.2402 0.1965 -0.0034 -0.0042 0.0084  43  ALA A CB  
283  N N   . LEU A 47  ? 0.2261 0.2135 0.1825 -0.0042 -0.0065 0.0053  44  LEU A N   
284  C CA  . LEU A 47  ? 0.2296 0.2173 0.1883 -0.0038 -0.0080 0.0045  44  LEU A CA  
285  C C   . LEU A 47  ? 0.2284 0.2174 0.1876 -0.0040 -0.0115 0.0018  44  LEU A C   
286  O O   . LEU A 47  ? 0.2363 0.2258 0.1921 -0.0033 -0.0131 0.0016  44  LEU A O   
287  C CB  . LEU A 47  ? 0.2338 0.2190 0.1988 -0.0042 -0.0055 0.0043  44  LEU A CB  
288  C CG  . LEU A 47  ? 0.2582 0.2419 0.2251 -0.0038 -0.0071 0.0023  44  LEU A CG  
289  C CD1 . LEU A 47  ? 0.2741 0.2584 0.2349 -0.0017 -0.0077 0.0041  44  LEU A CD1 
290  C CD2 . LEU A 47  ? 0.2957 0.2751 0.2689 -0.0047 -0.0041 0.0024  44  LEU A CD2 
291  N N   . LEU A 48  ? 0.2266 0.2162 0.1896 -0.0044 -0.0124 0.0000  45  LEU A N   
292  C CA  . LEU A 48  ? 0.2271 0.2171 0.1895 -0.0038 -0.0163 -0.0022 45  LEU A CA  
293  C C   . LEU A 48  ? 0.2307 0.2203 0.1852 -0.0035 -0.0173 -0.0008 45  LEU A C   
294  O O   . LEU A 48  ? 0.2239 0.2127 0.1742 -0.0027 -0.0191 -0.0012 45  LEU A O   
295  C CB  . LEU A 48  ? 0.2281 0.2196 0.1973 -0.0037 -0.0173 -0.0039 45  LEU A CB  
296  C CG  . LEU A 48  ? 0.2290 0.2219 0.2088 -0.0047 -0.0173 -0.0059 45  LEU A CG  
297  C CD1 . LEU A 48  ? 0.2543 0.2506 0.2434 -0.0044 -0.0172 -0.0068 45  LEU A CD1 
298  C CD2 . LEU A 48  ? 0.2556 0.2475 0.2349 -0.0045 -0.0220 -0.0090 45  LEU A CD2 
299  N N   . ALA A 49  ? 0.2309 0.2202 0.1831 -0.0041 -0.0158 0.0006  46  ALA A N   
300  C CA  . ALA A 49  ? 0.2279 0.2162 0.1741 -0.0047 -0.0167 0.0017  46  ALA A CA  
301  C C   . ALA A 49  ? 0.2242 0.2145 0.1684 -0.0054 -0.0163 0.0034  46  ALA A C   
302  O O   . ALA A 49  ? 0.2334 0.2238 0.1750 -0.0058 -0.0168 0.0041  46  ALA A O   
303  C CB  . ALA A 49  ? 0.2261 0.2123 0.1698 -0.0055 -0.0158 0.0019  46  ALA A CB  
304  N N   . GLY A 50  ? 0.2289 0.2207 0.1750 -0.0051 -0.0150 0.0043  47  GLY A N   
305  C CA  . GLY A 50  ? 0.2365 0.2312 0.1825 -0.0048 -0.0146 0.0061  47  GLY A CA  
306  C C   . GLY A 50  ? 0.2346 0.2294 0.1807 -0.0034 -0.0142 0.0055  47  GLY A C   
307  O O   . GLY A 50  ? 0.2370 0.2341 0.1824 -0.0034 -0.0136 0.0068  47  GLY A O   
308  N N   . LEU A 51  ? 0.2313 0.2235 0.1784 -0.0023 -0.0145 0.0033  48  LEU A N   
309  C CA  . LEU A 51  ? 0.2375 0.2277 0.1822 -0.0006 -0.0146 0.0017  48  LEU A CA  
310  C C   . LEU A 51  ? 0.2422 0.2314 0.1816 -0.0006 -0.0156 0.0017  48  LEU A C   
311  O O   . LEU A 51  ? 0.2399 0.2287 0.1753 0.0005  -0.0140 0.0025  48  LEU A O   
312  C CB  . LEU A 51  ? 0.2451 0.2322 0.1923 -0.0003 -0.0160 -0.0014 48  LEU A CB  
313  C CG  . LEU A 51  ? 0.3190 0.3047 0.2704 0.0000  -0.0141 -0.0014 48  LEU A CG  
314  C CD1 . LEU A 51  ? 0.3280 0.3114 0.2851 -0.0014 -0.0157 -0.0045 48  LEU A CD1 
315  C CD2 . LEU A 51  ? 0.3576 0.3412 0.3057 0.0023  -0.0125 -0.0018 48  LEU A CD2 
316  N N   . GLY A 52  ? 0.2334 0.2215 0.1724 -0.0014 -0.0177 0.0011  49  GLY A N   
317  C CA  . GLY A 52  ? 0.2524 0.2379 0.1855 -0.0009 -0.0185 0.0018  49  GLY A CA  
318  C C   . GLY A 52  ? 0.2468 0.2336 0.1782 -0.0024 -0.0158 0.0049  49  GLY A C   
319  O O   . GLY A 52  ? 0.2548 0.2397 0.1810 -0.0015 -0.0142 0.0061  49  GLY A O   
320  N N   . ALA A 53  ? 0.2366 0.2270 0.1727 -0.0046 -0.0151 0.0061  50  ALA A N   
321  C CA  . ALA A 53  ? 0.2306 0.2236 0.1679 -0.0069 -0.0134 0.0086  50  ALA A CA  
322  C C   . ALA A 53  ? 0.2320 0.2290 0.1714 -0.0057 -0.0105 0.0101  50  ALA A C   
323  O O   . ALA A 53  ? 0.2375 0.2347 0.1758 -0.0062 -0.0078 0.0120  50  ALA A O   
324  C CB  . ALA A 53  ? 0.2221 0.2176 0.1631 -0.0093 -0.0149 0.0087  50  ALA A CB  
325  N N   . MET A 54  ? 0.2412 0.2405 0.1834 -0.0038 -0.0103 0.0094  51  MET A N   
326  C CA  . MET A 54  ? 0.2340 0.2370 0.1788 -0.0019 -0.0071 0.0108  51  MET A CA  
327  C C   . MET A 54  ? 0.2460 0.2447 0.1841 0.0007  -0.0044 0.0101  51  MET A C   
328  O O   . MET A 54  ? 0.2728 0.2739 0.2117 0.0020  -0.0002 0.0119  51  MET A O   
329  C CB  . MET A 54  ? 0.2308 0.2359 0.1797 0.0000  -0.0074 0.0106  51  MET A CB  
330  C CG  . MET A 54  ? 0.2457 0.2551 0.1992 -0.0019 -0.0099 0.0120  51  MET A CG  
331  S SD  . MET A 54  ? 0.2493 0.2641 0.2090 0.0010  -0.0096 0.0143  51  MET A SD  
332  C CE  . MET A 54  ? 0.2363 0.2597 0.2034 0.0008  -0.0074 0.0167  51  MET A CE  
333  N N   . ARG A 55  ? 0.2312 0.2236 0.1627 0.0017  -0.0068 0.0074  52  ARG A N   
334  C CA  . ARG A 55  ? 0.2447 0.2315 0.1668 0.0044  -0.0056 0.0063  52  ARG A CA  
335  C C   . ARG A 55  ? 0.2654 0.2503 0.1823 0.0037  -0.0033 0.0091  52  ARG A C   
336  O O   . ARG A 55  ? 0.2892 0.2694 0.1967 0.0063  -0.0007 0.0093  52  ARG A O   
337  C CB  . ARG A 55  ? 0.2595 0.2409 0.1770 0.0055  -0.0104 0.0024  52  ARG A CB  
338  C CG  . ARG A 55  ? 0.2715 0.2515 0.1913 0.0068  -0.0116 -0.0008 52  ARG A CG  
339  C CD  . ARG A 55  ? 0.2853 0.2612 0.1977 0.0102  -0.0090 -0.0023 52  ARG A CD  
340  N NE  . ARG A 55  ? 0.3078 0.2800 0.2214 0.0111  -0.0108 -0.0064 52  ARG A NE  
341  C CZ  . ARG A 55  ? 0.3468 0.3156 0.2574 0.0140  -0.0077 -0.0078 52  ARG A CZ  
342  N NH1 . ARG A 55  ? 0.3020 0.2718 0.2092 0.0166  -0.0020 -0.0054 52  ARG A NH1 
343  N NH2 . ARG A 55  ? 0.3732 0.3372 0.2852 0.0143  -0.0098 -0.0119 52  ARG A NH2 
344  N N   . SER A 56  ? 0.2528 0.2399 0.1741 0.0002  -0.0040 0.0111  53  SER A N   
345  C CA  . SER A 56  ? 0.2682 0.2511 0.1842 -0.0008 -0.0023 0.0137  53  SER A CA  
346  C C   . SER A 56  ? 0.2733 0.2606 0.1952 -0.0037 0.0026  0.0175  53  SER A C   
347  O O   . SER A 56  ? 0.2877 0.2725 0.2097 -0.0066 0.0032  0.0196  53  SER A O   
348  C CB  . SER A 56  ? 0.2796 0.2591 0.1949 -0.0022 -0.0070 0.0126  53  SER A CB  
349  O OG  . SER A 56  ? 0.2822 0.2577 0.1920 0.0008  -0.0110 0.0097  53  SER A OG  
350  N N   . GLY A 57  ? 0.2663 0.2600 0.1944 -0.0029 0.0063  0.0184  54  GLY A N   
351  C CA  . GLY A 57  ? 0.2570 0.2555 0.1916 -0.0050 0.0122  0.0222  54  GLY A CA  
352  C C   . GLY A 57  ? 0.2580 0.2653 0.2069 -0.0099 0.0109  0.0235  54  GLY A C   
353  O O   . GLY A 57  ? 0.2611 0.2727 0.2173 -0.0126 0.0155  0.0267  54  GLY A O   
354  N N   . LEU A 58  ? 0.2481 0.2579 0.2009 -0.0111 0.0049  0.0212  55  LEU A N   
355  C CA  . LEU A 58  ? 0.2415 0.2597 0.2064 -0.0151 0.0024  0.0218  55  LEU A CA  
356  C C   . LEU A 58  ? 0.2488 0.2774 0.2243 -0.0132 0.0049  0.0233  55  LEU A C   
357  O O   . LEU A 58  ? 0.2586 0.2868 0.2312 -0.0085 0.0091  0.0237  55  LEU A O   
358  C CB  . LEU A 58  ? 0.2391 0.2557 0.2024 -0.0160 -0.0040 0.0190  55  LEU A CB  
359  C CG  . LEU A 58  ? 0.2380 0.2528 0.1968 -0.0120 -0.0063 0.0168  55  LEU A CG  
360  C CD1 . LEU A 58  ? 0.2493 0.2717 0.2151 -0.0091 -0.0054 0.0177  55  LEU A CD1 
361  C CD2 . LEU A 58  ? 0.2604 0.2723 0.2166 -0.0135 -0.0112 0.0146  55  LEU A CD2 
362  N N   . GLY A 59  ? 0.2431 0.2810 0.2312 -0.0166 0.0023  0.0243  56  GLY A N   
363  C CA  . GLY A 59  ? 0.2508 0.3002 0.2512 -0.0144 0.0031  0.0258  56  GLY A CA  
364  C C   . GLY A 59  ? 0.2522 0.3037 0.2525 -0.0118 -0.0029 0.0243  56  GLY A C   
365  O O   . GLY A 59  ? 0.2628 0.3183 0.2664 -0.0069 -0.0014 0.0251  56  GLY A O   
366  N N   . LYS A 60  ? 0.2297 0.2778 0.2258 -0.0147 -0.0092 0.0222  57  LYS A N   
367  C CA  . LYS A 60  ? 0.2271 0.2759 0.2211 -0.0123 -0.0146 0.0212  57  LYS A CA  
368  C C   . LYS A 60  ? 0.2265 0.2651 0.2086 -0.0140 -0.0176 0.0185  57  LYS A C   
369  O O   . LYS A 60  ? 0.2318 0.2663 0.2114 -0.0181 -0.0180 0.0174  57  LYS A O   
370  C CB  . LYS A 60  ? 0.2383 0.2978 0.2436 -0.0142 -0.0200 0.0222  57  LYS A CB  
371  C CG  . LYS A 60  ? 0.2846 0.3429 0.2846 -0.0129 -0.0268 0.0212  57  LYS A CG  
372  C CD  . LYS A 60  ? 0.3232 0.3927 0.3342 -0.0146 -0.0335 0.0220  57  LYS A CD  
373  C CE  . LYS A 60  ? 0.3417 0.4089 0.3444 -0.0126 -0.0408 0.0213  57  LYS A CE  
374  N NZ  . LYS A 60  ? 0.4019 0.4796 0.4141 -0.0146 -0.0490 0.0213  57  LYS A NZ  
375  N N   . LEU A 61  ? 0.2125 0.2470 0.1881 -0.0107 -0.0190 0.0177  58  LEU A N   
376  C CA  . LEU A 61  ? 0.2189 0.2454 0.1851 -0.0117 -0.0213 0.0155  58  LEU A CA  
377  C C   . LEU A 61  ? 0.2448 0.2721 0.2085 -0.0104 -0.0256 0.0157  58  LEU A C   
378  O O   . LEU A 61  ? 0.2420 0.2714 0.2069 -0.0065 -0.0253 0.0174  58  LEU A O   
379  C CB  . LEU A 61  ? 0.2139 0.2329 0.1736 -0.0092 -0.0180 0.0143  58  LEU A CB  
380  C CG  . LEU A 61  ? 0.2257 0.2374 0.1780 -0.0097 -0.0193 0.0122  58  LEU A CG  
381  C CD1 . LEU A 61  ? 0.2224 0.2305 0.1719 -0.0134 -0.0205 0.0107  58  LEU A CD1 
382  C CD2 . LEU A 61  ? 0.2397 0.2464 0.1892 -0.0071 -0.0168 0.0112  58  LEU A CD2 
383  N N   . VAL A 62  ? 0.2323 0.2566 0.1912 -0.0134 -0.0293 0.0139  59  VAL A N   
384  C CA  . VAL A 62  ? 0.2423 0.2639 0.1938 -0.0119 -0.0330 0.0136  59  VAL A CA  
385  C C   . VAL A 62  ? 0.2427 0.2543 0.1843 -0.0116 -0.0304 0.0117  59  VAL A C   
386  O O   . VAL A 62  ? 0.2499 0.2570 0.1890 -0.0143 -0.0299 0.0094  59  VAL A O   
387  C CB  . VAL A 62  ? 0.2457 0.2704 0.1977 -0.0153 -0.0393 0.0123  59  VAL A CB  
388  C CG1 . VAL A 62  ? 0.2693 0.2899 0.2103 -0.0130 -0.0433 0.0120  59  VAL A CG1 
389  C CG2 . VAL A 62  ? 0.2614 0.2984 0.2271 -0.0160 -0.0419 0.0143  59  VAL A CG2 
390  N N   . ILE A 63  ? 0.2498 0.2580 0.1868 -0.0080 -0.0283 0.0129  60  ILE A N   
391  C CA  . ILE A 63  ? 0.2521 0.2523 0.1820 -0.0072 -0.0250 0.0116  60  ILE A CA  
392  C C   . ILE A 63  ? 0.2625 0.2584 0.1820 -0.0062 -0.0270 0.0117  60  ILE A C   
393  O O   . ILE A 63  ? 0.2752 0.2718 0.1919 -0.0033 -0.0279 0.0143  60  ILE A O   
394  C CB  . ILE A 63  ? 0.2405 0.2390 0.1729 -0.0046 -0.0205 0.0129  60  ILE A CB  
395  C CG1 . ILE A 63  ? 0.2407 0.2424 0.1808 -0.0050 -0.0191 0.0124  60  ILE A CG1 
396  C CG2 . ILE A 63  ? 0.2467 0.2384 0.1746 -0.0043 -0.0169 0.0116  60  ILE A CG2 
397  C CD1 . ILE A 63  ? 0.2537 0.2527 0.1963 -0.0031 -0.0155 0.0124  60  ILE A CD1 
398  N N   . GLY A 64  ? 0.2794 0.2700 0.1921 -0.0081 -0.0277 0.0089  61  GLY A N   
399  C CA  . GLY A 64  ? 0.2953 0.2797 0.1953 -0.0067 -0.0287 0.0082  61  GLY A CA  
400  C C   . GLY A 64  ? 0.3252 0.3027 0.2205 -0.0044 -0.0219 0.0085  61  GLY A C   
401  O O   . GLY A 64  ? 0.3448 0.3172 0.2369 -0.0050 -0.0193 0.0060  61  GLY A O   
402  N N   . THR A 65  ? 0.3291 0.3069 0.2259 -0.0016 -0.0183 0.0118  62  THR A N   
403  C CA  . THR A 65  ? 0.3356 0.3082 0.2313 0.0000  -0.0111 0.0126  62  THR A CA  
404  C C   . THR A 65  ? 0.3487 0.3152 0.2318 0.0032  -0.0088 0.0154  62  THR A C   
405  O O   . THR A 65  ? 0.3703 0.3370 0.2461 0.0047  -0.0135 0.0171  62  THR A O   
406  C CB  . THR A 65  ? 0.3243 0.3003 0.2321 0.0000  -0.0079 0.0139  62  THR A CB  
407  O OG1 . THR A 65  ? 0.3208 0.2932 0.2311 0.0005  -0.0013 0.0139  62  THR A OG1 
408  C CG2 . THR A 65  ? 0.3025 0.2803 0.2117 0.0020  -0.0085 0.0174  62  THR A CG2 
409  N N   . SER A 66  ? 0.3695 0.3306 0.2505 0.0047  -0.0013 0.0164  63  SER A N   
410  C CA  . SER A 66  ? 0.3828 0.3369 0.2518 0.0080  0.0029  0.0199  63  SER A CA  
411  C C   . SER A 66  ? 0.3784 0.3339 0.2495 0.0099  0.0022  0.0245  63  SER A C   
412  O O   . SER A 66  ? 0.3459 0.3063 0.2306 0.0087  0.0026  0.0250  63  SER A O   
413  C CB  . SER A 66  ? 0.3971 0.3468 0.2687 0.0086  0.0128  0.0204  63  SER A CB  
414  O OG  . SER A 66  ? 0.4293 0.3768 0.2974 0.0081  0.0138  0.0164  63  SER A OG  
415  N N   . GLU A 67  ? 0.3935 0.3437 0.2503 0.0134  0.0013  0.0279  64  GLU A N   
416  C CA  . GLU A 67  ? 0.4029 0.3532 0.2600 0.0162  0.0002  0.0327  64  GLU A CA  
417  C C   . GLU A 67  ? 0.4022 0.3509 0.2707 0.0159  0.0080  0.0355  64  GLU A C   
418  O O   . GLU A 67  ? 0.4048 0.3568 0.2820 0.0164  0.0061  0.0371  64  GLU A O   
419  C CB  . GLU A 67  ? 0.4447 0.3868 0.2814 0.0208  -0.0004 0.0364  64  GLU A CB  
420  C CG  . GLU A 67  ? 0.5072 0.4455 0.3410 0.0250  0.0014  0.0428  64  GLU A CG  
421  C CD  . GLU A 67  ? 0.6061 0.5382 0.4186 0.0301  -0.0032 0.0460  64  GLU A CD  
422  O OE1 . GLU A 67  ? 0.6662 0.5905 0.4620 0.0313  -0.0008 0.0451  64  GLU A OE1 
423  O OE2 . GLU A 67  ? 0.6630 0.5979 0.4751 0.0334  -0.0094 0.0493  64  GLU A OE2 
424  N N   . ASN A 68  ? 0.3801 0.3238 0.2495 0.0151  0.0167  0.0359  65  ASN A N   
425  C CA  . ASN A 68  ? 0.3823 0.3241 0.2634 0.0141  0.0240  0.0384  65  ASN A CA  
426  C C   . ASN A 68  ? 0.3482 0.2976 0.2480 0.0101  0.0223  0.0342  65  ASN A C   
427  O O   . ASN A 68  ? 0.3426 0.2910 0.2534 0.0088  0.0261  0.0352  65  ASN A O   
428  C CB  . ASN A 68  ? 0.4026 0.3373 0.2803 0.0144  0.0345  0.0405  65  ASN A CB  
429  C CG  . ASN A 68  ? 0.4709 0.3955 0.3282 0.0191  0.0379  0.0459  65  ASN A CG  
430  O OD1 . ASN A 68  ? 0.5129 0.4348 0.3616 0.0224  0.0337  0.0496  65  ASN A OD1 
431  N ND2 . ASN A 68  ? 0.5407 0.4595 0.3890 0.0201  0.0455  0.0464  65  ASN A ND2 
432  N N   . VAL A 69  ? 0.3206 0.2765 0.2232 0.0082  0.0164  0.0295  66  VAL A N   
433  C CA  . VAL A 69  ? 0.2861 0.2487 0.2035 0.0051  0.0139  0.0256  66  VAL A CA  
434  C C   . VAL A 69  ? 0.2843 0.2510 0.2053 0.0056  0.0081  0.0257  66  VAL A C   
435  O O   . VAL A 69  ? 0.2834 0.2526 0.2148 0.0042  0.0076  0.0239  66  VAL A O   
436  C CB  . VAL A 69  ? 0.2845 0.2508 0.2030 0.0033  0.0114  0.0212  66  VAL A CB  
437  C CG1 . VAL A 69  ? 0.2762 0.2486 0.2078 0.0007  0.0081  0.0176  66  VAL A CG1 
438  C CG2 . VAL A 69  ? 0.2935 0.2558 0.2098 0.0035  0.0182  0.0211  66  VAL A CG2 
439  N N   . ILE A 70  ? 0.2932 0.2606 0.2053 0.0080  0.0036  0.0276  67  ILE A N   
440  C CA  . ILE A 70  ? 0.2700 0.2424 0.1865 0.0092  -0.0012 0.0282  67  ILE A CA  
441  C C   . ILE A 70  ? 0.2651 0.2349 0.1892 0.0103  0.0021  0.0298  67  ILE A C   
442  O O   . ILE A 70  ? 0.2724 0.2462 0.2049 0.0093  0.0004  0.0274  67  ILE A O   
443  C CB  . ILE A 70  ? 0.2727 0.2464 0.1799 0.0123  -0.0063 0.0309  67  ILE A CB  
444  C CG1 . ILE A 70  ? 0.2924 0.2690 0.1938 0.0103  -0.0111 0.0278  67  ILE A CG1 
445  C CG2 . ILE A 70  ? 0.2763 0.2560 0.1904 0.0144  -0.0103 0.0322  67  ILE A CG2 
446  C CD1 . ILE A 70  ? 0.3182 0.2961 0.2099 0.0127  -0.0176 0.0294  67  ILE A CD1 
447  N N   . PRO A 71  ? 0.2881 0.2503 0.2086 0.0123  0.0071  0.0338  68  PRO A N   
448  C CA  . PRO A 71  ? 0.2878 0.2459 0.2152 0.0132  0.0101  0.0352  68  PRO A CA  
449  C C   . PRO A 71  ? 0.2904 0.2489 0.2296 0.0091  0.0123  0.0307  68  PRO A C   
450  O O   . PRO A 71  ? 0.2839 0.2399 0.2293 0.0094  0.0130  0.0300  68  PRO A O   
451  C CB  . PRO A 71  ? 0.3243 0.2727 0.2445 0.0156  0.0159  0.0408  68  PRO A CB  
452  C CG  . PRO A 71  ? 0.3233 0.2707 0.2348 0.0149  0.0176  0.0412  68  PRO A CG  
453  C CD  . PRO A 71  ? 0.3004 0.2559 0.2089 0.0143  0.0105  0.0376  68  PRO A CD  
454  N N   . LEU A 72  ? 0.2858 0.2471 0.2278 0.0058  0.0128  0.0275  69  LEU A N   
455  C CA  . LEU A 72  ? 0.2779 0.2408 0.2311 0.0022  0.0133  0.0230  69  LEU A CA  
456  C C   . LEU A 72  ? 0.2854 0.2543 0.2415 0.0017  0.0076  0.0188  69  LEU A C   
457  O O   . LEU A 72  ? 0.3063 0.2755 0.2697 -0.0002 0.0067  0.0150  69  LEU A O   
458  C CB  . LEU A 72  ? 0.2632 0.2272 0.2193 -0.0001 0.0163  0.0217  69  LEU A CB  
459  C CG  . LEU A 72  ? 0.2828 0.2406 0.2338 0.0008  0.0233  0.0264  69  LEU A CG  
460  C CD1 . LEU A 72  ? 0.3106 0.2703 0.2669 -0.0013 0.0274  0.0248  69  LEU A CD1 
461  C CD2 . LEU A 72  ? 0.3005 0.2509 0.2551 0.0009  0.0281  0.0296  69  LEU A CD2 
462  N N   . ILE A 73  ? 0.2648 0.2383 0.2149 0.0033  0.0036  0.0194  70  ILE A N   
463  C CA  . ILE A 73  ? 0.2543 0.2332 0.2063 0.0029  -0.0005 0.0164  70  ILE A CA  
464  C C   . ILE A 73  ? 0.2581 0.2371 0.2110 0.0056  -0.0012 0.0174  70  ILE A C   
465  O O   . ILE A 73  ? 0.2539 0.2337 0.2099 0.0055  -0.0021 0.0145  70  ILE A O   
466  C CB  . ILE A 73  ? 0.2547 0.2387 0.2016 0.0024  -0.0039 0.0164  70  ILE A CB  
467  C CG1 . ILE A 73  ? 0.2566 0.2397 0.2024 0.0003  -0.0028 0.0148  70  ILE A CG1 
468  C CG2 . ILE A 73  ? 0.2654 0.2546 0.2144 0.0019  -0.0072 0.0143  70  ILE A CG2 
469  C CD1 . ILE A 73  ? 0.2877 0.2728 0.2266 0.0000  -0.0056 0.0148  70  ILE A CD1 
470  N N   . VAL A 74  ? 0.2577 0.2357 0.2072 0.0087  -0.0007 0.0215  71  VAL A N   
471  C CA  . VAL A 74  ? 0.2574 0.2370 0.2083 0.0124  -0.0016 0.0231  71  VAL A CA  
472  C C   . VAL A 74  ? 0.2632 0.2381 0.2185 0.0132  0.0006  0.0206  71  VAL A C   
473  O O   . VAL A 74  ? 0.2538 0.2320 0.2110 0.0147  -0.0002 0.0190  71  VAL A O   
474  C CB  . VAL A 74  ? 0.2688 0.2468 0.2153 0.0164  -0.0016 0.0285  71  VAL A CB  
475  C CG1 . VAL A 74  ? 0.2623 0.2423 0.2123 0.0211  -0.0021 0.0303  71  VAL A CG1 
476  C CG2 . VAL A 74  ? 0.2662 0.2492 0.2069 0.0158  -0.0054 0.0298  71  VAL A CG2 
477  N N   . PRO A 75  ? 0.2648 0.2314 0.2218 0.0120  0.0039  0.0201  72  PRO A N   
478  C CA  . PRO A 75  ? 0.2756 0.2363 0.2359 0.0128  0.0054  0.0171  72  PRO A CA  
479  C C   . PRO A 75  ? 0.2690 0.2323 0.2305 0.0106  0.0030  0.0114  72  PRO A C   
480  O O   . PRO A 75  ? 0.2842 0.2441 0.2454 0.0124  0.0033  0.0087  72  PRO A O   
481  C CB  . PRO A 75  ? 0.2857 0.2374 0.2490 0.0104  0.0089  0.0172  72  PRO A CB  
482  C CG  . PRO A 75  ? 0.3162 0.2687 0.2766 0.0098  0.0106  0.0217  72  PRO A CG  
483  C CD  . PRO A 75  ? 0.2843 0.2459 0.2405 0.0101  0.0069  0.0222  72  PRO A CD  
484  N N   . VAL A 76  ? 0.2589 0.2273 0.2205 0.0073  0.0007  0.0097  73  VAL A N   
485  C CA  . VAL A 76  ? 0.2741 0.2443 0.2355 0.0056  -0.0020 0.0049  73  VAL A CA  
486  C C   . VAL A 76  ? 0.2765 0.2535 0.2341 0.0072  -0.0036 0.0056  73  VAL A C   
487  O O   . VAL A 76  ? 0.2863 0.2629 0.2414 0.0081  -0.0042 0.0028  73  VAL A O   
488  C CB  . VAL A 76  ? 0.2860 0.2575 0.2505 0.0017  -0.0036 0.0028  73  VAL A CB  
489  C CG1 . VAL A 76  ? 0.3113 0.2840 0.2745 0.0008  -0.0072 -0.0017 73  VAL A CG1 
490  C CG2 . VAL A 76  ? 0.3033 0.2688 0.2742 -0.0003 -0.0012 0.0022  73  VAL A CG2 
491  N N   . LEU A 77  ? 0.2488 0.2313 0.2059 0.0076  -0.0039 0.0095  74  LEU A N   
492  C CA  . LEU A 77  ? 0.2457 0.2353 0.2016 0.0078  -0.0054 0.0104  74  LEU A CA  
493  C C   . LEU A 77  ? 0.2372 0.2314 0.1947 0.0105  -0.0054 0.0146  74  LEU A C   
494  O O   . LEU A 77  ? 0.2389 0.2375 0.1957 0.0093  -0.0076 0.0167  74  LEU A O   
495  C CB  . LEU A 77  ? 0.2337 0.2258 0.1881 0.0044  -0.0077 0.0096  74  LEU A CB  
496  C CG  . LEU A 77  ? 0.2455 0.2431 0.1990 0.0035  -0.0090 0.0099  74  LEU A CG  
497  C CD1 . LEU A 77  ? 0.2740 0.2708 0.2256 0.0045  -0.0080 0.0079  74  LEU A CD1 
498  C CD2 . LEU A 77  ? 0.2853 0.2835 0.2368 0.0004  -0.0111 0.0095  74  LEU A CD2 
499  N N   . PRO A 78  ? 0.2416 0.2345 0.2010 0.0144  -0.0032 0.0157  75  PRO A N   
500  C CA  . PRO A 78  ? 0.2329 0.2306 0.1949 0.0177  -0.0039 0.0202  75  PRO A CA  
501  C C   . PRO A 78  ? 0.2422 0.2506 0.2084 0.0175  -0.0058 0.0213  75  PRO A C   
502  O O   . PRO A 78  ? 0.2391 0.2538 0.2091 0.0198  -0.0078 0.0246  75  PRO A O   
503  C CB  . PRO A 78  ? 0.2420 0.2343 0.2055 0.0224  -0.0006 0.0207  75  PRO A CB  
504  C CG  . PRO A 78  ? 0.2453 0.2331 0.2071 0.0215  0.0015  0.0158  75  PRO A CG  
505  C CD  . PRO A 78  ? 0.2558 0.2416 0.2148 0.0163  -0.0005 0.0130  75  PRO A CD  
506  N N   . GLU A 79  ? 0.2141 0.2244 0.1800 0.0147  -0.0053 0.0187  76  GLU A N   
507  C CA  . GLU A 79  ? 0.2257 0.2453 0.1964 0.0135  -0.0062 0.0198  76  GLU A CA  
508  C C   . GLU A 79  ? 0.2267 0.2502 0.1971 0.0094  -0.0105 0.0204  76  GLU A C   
509  O O   . GLU A 79  ? 0.2273 0.2592 0.2038 0.0080  -0.0121 0.0217  76  GLU A O   
510  C CB  . GLU A 79  ? 0.2288 0.2468 0.1974 0.0124  -0.0030 0.0174  76  GLU A CB  
511  C CG  . GLU A 79  ? 0.2522 0.2651 0.2189 0.0167  0.0014  0.0159  76  GLU A CG  
512  C CD  . GLU A 79  ? 0.2593 0.2615 0.2194 0.0170  0.0013  0.0126  76  GLU A CD  
513  O OE1 . GLU A 79  ? 0.2543 0.2532 0.2119 0.0137  -0.0015 0.0114  76  GLU A OE1 
514  O OE2 . GLU A 79  ? 0.2475 0.2444 0.2056 0.0205  0.0044  0.0109  76  GLU A OE2 
515  N N   . ALA A 80  ? 0.2279 0.2455 0.1921 0.0074  -0.0122 0.0192  77  ALA A N   
516  C CA  . ALA A 80  ? 0.2245 0.2438 0.1863 0.0040  -0.0161 0.0192  77  ALA A CA  
517  C C   . ALA A 80  ? 0.2310 0.2536 0.1930 0.0059  -0.0196 0.0219  77  ALA A C   
518  O O   . ALA A 80  ? 0.2296 0.2504 0.1914 0.0100  -0.0186 0.0241  77  ALA A O   
519  C CB  . ALA A 80  ? 0.2320 0.2434 0.1869 0.0020  -0.0156 0.0170  77  ALA A CB  
520  N N   . THR A 81  ? 0.2388 0.2660 0.2010 0.0031  -0.0241 0.0217  78  THR A N   
521  C CA  . THR A 81  ? 0.2600 0.2888 0.2189 0.0046  -0.0290 0.0236  78  THR A CA  
522  C C   . THR A 81  ? 0.2538 0.2757 0.2021 0.0019  -0.0307 0.0215  78  THR A C   
523  O O   . THR A 81  ? 0.2491 0.2663 0.1949 -0.0009 -0.0282 0.0189  78  THR A O   
524  C CB  . THR A 81  ? 0.3053 0.3457 0.2736 0.0040  -0.0343 0.0247  78  THR A CB  
525  O OG1 . THR A 81  ? 0.3270 0.3698 0.2980 -0.0015 -0.0357 0.0221  78  THR A OG1 
526  C CG2 . THR A 81  ? 0.3374 0.3848 0.3170 0.0078  -0.0312 0.0271  78  THR A CG2 
527  N N   . TYR A 82  ? 0.2699 0.2907 0.2111 0.0035  -0.0350 0.0228  79  TYR A N   
528  C CA  . TYR A 82  ? 0.2977 0.3095 0.2258 0.0026  -0.0349 0.0213  79  TYR A CA  
529  C C   . TYR A 82  ? 0.3148 0.3276 0.2361 0.0011  -0.0421 0.0199  79  TYR A C   
530  O O   . TYR A 82  ? 0.3360 0.3557 0.2606 0.0024  -0.0481 0.0213  79  TYR A O   
531  C CB  . TYR A 82  ? 0.3006 0.3045 0.2209 0.0069  -0.0306 0.0243  79  TYR A CB  
532  C CG  . TYR A 82  ? 0.2674 0.2694 0.1944 0.0074  -0.0243 0.0246  79  TYR A CG  
533  C CD1 . TYR A 82  ? 0.2710 0.2685 0.1980 0.0049  -0.0201 0.0219  79  TYR A CD1 
534  C CD2 . TYR A 82  ? 0.2722 0.2774 0.2065 0.0105  -0.0232 0.0270  79  TYR A CD2 
535  C CE1 . TYR A 82  ? 0.2837 0.2798 0.2170 0.0049  -0.0159 0.0214  79  TYR A CE1 
536  C CE2 . TYR A 82  ? 0.2716 0.2744 0.2114 0.0106  -0.0183 0.0261  79  TYR A CE2 
537  C CZ  . TYR A 82  ? 0.2758 0.2740 0.2148 0.0076  -0.0150 0.0232  79  TYR A CZ  
538  O OH  . TYR A 82  ? 0.2797 0.2754 0.2236 0.0074  -0.0114 0.0216  79  TYR A OH  
539  N N   . TRP A 83  ? 0.3097 0.3151 0.2215 -0.0013 -0.0415 0.0168  80  TRP A N   
540  C CA  . TRP A 83  ? 0.3360 0.3377 0.2362 -0.0020 -0.0472 0.0148  80  TRP A CA  
541  C C   . TRP A 83  ? 0.3398 0.3303 0.2254 0.0011  -0.0419 0.0156  80  TRP A C   
542  O O   . TRP A 83  ? 0.3328 0.3173 0.2161 -0.0001 -0.0362 0.0137  80  TRP A O   
543  C CB  . TRP A 83  ? 0.3297 0.3313 0.2319 -0.0076 -0.0500 0.0101  80  TRP A CB  
544  C CG  . TRP A 83  ? 0.3469 0.3428 0.2357 -0.0087 -0.0562 0.0068  80  TRP A CG  
545  C CD1 . TRP A 83  ? 0.3938 0.3889 0.2721 -0.0056 -0.0622 0.0078  80  TRP A CD1 
546  C CD2 . TRP A 83  ? 0.3528 0.3424 0.2365 -0.0129 -0.0574 0.0019  80  TRP A CD2 
547  N NE1 . TRP A 83  ? 0.4092 0.3973 0.2748 -0.0078 -0.0674 0.0032  80  TRP A NE1 
548  C CE2 . TRP A 83  ? 0.3735 0.3578 0.2425 -0.0123 -0.0641 -0.0006 80  TRP A CE2 
549  C CE3 . TRP A 83  ? 0.3619 0.3483 0.2504 -0.0164 -0.0533 -0.0005 80  TRP A CE3 
550  C CZ2 . TRP A 83  ? 0.4047 0.3803 0.2644 -0.0158 -0.0667 -0.0061 80  TRP A CZ2 
551  C CZ3 . TRP A 83  ? 0.3854 0.3635 0.2656 -0.0197 -0.0557 -0.0055 80  TRP A CZ3 
552  C CH2 . TRP A 83  ? 0.3920 0.3646 0.2581 -0.0194 -0.0621 -0.0085 80  TRP A CH2 
553  N N   . ARG A 84  ? 0.3574 0.3454 0.2340 0.0057  -0.0431 0.0192  81  ARG A N   
554  C CA  . ARG A 84  ? 0.3747 0.3523 0.2390 0.0092  -0.0361 0.0215  81  ARG A CA  
555  C C   . ARG A 84  ? 0.3834 0.3520 0.2338 0.0080  -0.0348 0.0178  81  ARG A C   
556  O O   . ARG A 84  ? 0.4079 0.3748 0.2482 0.0074  -0.0419 0.0151  81  ARG A O   
557  C CB  . ARG A 84  ? 0.3975 0.3733 0.2528 0.0147  -0.0387 0.0264  81  ARG A CB  
558  C CG  . ARG A 84  ? 0.4471 0.4120 0.2899 0.0187  -0.0310 0.0304  81  ARG A CG  
559  C CD  . ARG A 84  ? 0.5183 0.4824 0.3541 0.0247  -0.0348 0.0362  81  ARG A CD  
560  N NE  . ARG A 84  ? 0.5503 0.5225 0.4036 0.0252  -0.0347 0.0385  81  ARG A NE  
561  C CZ  . ARG A 84  ? 0.5910 0.5596 0.4503 0.0267  -0.0266 0.0419  81  ARG A CZ  
562  N NH1 . ARG A 84  ? 0.6061 0.5638 0.4564 0.0278  -0.0181 0.0442  81  ARG A NH1 
563  N NH2 . ARG A 84  ? 0.5809 0.5564 0.4555 0.0270  -0.0267 0.0428  81  ARG A NH2 
564  N N   . ASP A 85  ? 0.3883 0.3509 0.2380 0.0079  -0.0260 0.0174  82  ASP A N   
565  C CA  . ASP A 85  ? 0.4038 0.3578 0.2421 0.0072  -0.0231 0.0136  82  ASP A CA  
566  C C   . ASP A 85  ? 0.3965 0.3524 0.2370 0.0028  -0.0292 0.0080  82  ASP A C   
567  O O   . ASP A 85  ? 0.4189 0.3670 0.2462 0.0026  -0.0304 0.0043  82  ASP A O   
568  C CB  . ASP A 85  ? 0.4367 0.3809 0.2532 0.0114  -0.0227 0.0150  82  ASP A CB  
569  C CG  . ASP A 85  ? 0.4932 0.4322 0.3060 0.0154  -0.0135 0.0205  82  ASP A CG  
570  O OD1 . ASP A 85  ? 0.5423 0.4824 0.3670 0.0144  -0.0054 0.0214  82  ASP A OD1 
571  O OD2 . ASP A 85  ? 0.6022 0.5354 0.3997 0.0196  -0.0145 0.0240  82  ASP A OD2 
572  N N   . GLY A 86  ? 0.3730 0.3380 0.2297 -0.0006 -0.0322 0.0074  83  GLY A N   
573  C CA  . GLY A 86  ? 0.3805 0.3473 0.2407 -0.0051 -0.0378 0.0030  83  GLY A CA  
574  C C   . GLY A 86  ? 0.3848 0.3431 0.2398 -0.0066 -0.0341 -0.0010 83  GLY A C   
575  O O   . GLY A 86  ? 0.3844 0.3381 0.2321 -0.0090 -0.0390 -0.0052 83  GLY A O   
576  N N   . TRP A 87  ? 0.3674 0.3236 0.2267 -0.0051 -0.0260 -0.0001 84  TRP A N   
577  C CA  . TRP A 87  ? 0.3787 0.3276 0.2349 -0.0056 -0.0223 -0.0037 84  TRP A CA  
578  C C   . TRP A 87  ? 0.4077 0.3456 0.2448 -0.0031 -0.0211 -0.0061 84  TRP A C   
579  O O   . TRP A 87  ? 0.4251 0.3553 0.2556 -0.0040 -0.0211 -0.0105 84  TRP A O   
580  C CB  . TRP A 87  ? 0.3742 0.3244 0.2404 -0.0041 -0.0147 -0.0023 84  TRP A CB  
581  C CG  . TRP A 87  ? 0.3944 0.3436 0.2596 -0.0005 -0.0075 0.0006  84  TRP A CG  
582  C CD1 . TRP A 87  ? 0.3887 0.3435 0.2620 0.0003  -0.0054 0.0046  84  TRP A CD1 
583  C CD2 . TRP A 87  ? 0.3779 0.3194 0.2350 0.0026  -0.0002 0.0000  84  TRP A CD2 
584  N NE1 . TRP A 87  ? 0.3950 0.3458 0.2656 0.0033  0.0023  0.0067  84  TRP A NE1 
585  C CE2 . TRP A 87  ? 0.4022 0.3457 0.2637 0.0048  0.0061  0.0041  84  TRP A CE2 
586  C CE3 . TRP A 87  ? 0.4350 0.3676 0.2817 0.0038  0.0021  -0.0035 84  TRP A CE3 
587  C CZ2 . TRP A 87  ? 0.4128 0.3506 0.2696 0.0080  0.0153  0.0051  84  TRP A CZ2 
588  C CZ3 . TRP A 87  ? 0.4405 0.3673 0.2817 0.0078  0.0114  -0.0028 84  TRP A CZ3 
589  C CH2 . TRP A 87  ? 0.4338 0.3639 0.2806 0.0097  0.0181  0.0017  84  TRP A CH2 
590  N N   . LYS A 88  ? 0.4079 0.3438 0.2353 0.0003  -0.0195 -0.0032 85  LYS A N   
591  C CA  . LYS A 88  ? 0.4510 0.3754 0.2567 0.0034  -0.0184 -0.0052 85  LYS A CA  
592  C C   . LYS A 88  ? 0.4608 0.3827 0.2557 0.0012  -0.0292 -0.0091 85  LYS A C   
593  O O   . LYS A 88  ? 0.4752 0.3867 0.2557 0.0011  -0.0304 -0.0141 85  LYS A O   
594  C CB  . LYS A 88  ? 0.4732 0.3950 0.2704 0.0082  -0.0126 -0.0001 85  LYS A CB  
595  C CG  . LYS A 88  ? 0.4876 0.4118 0.2969 0.0097  -0.0018 0.0033  85  LYS A CG  
596  C CD  . LYS A 88  ? 0.5436 0.4636 0.3438 0.0140  0.0046  0.0087  85  LYS A CD  
597  C CE  . LYS A 88  ? 0.5438 0.4673 0.3595 0.0144  0.0147  0.0121  85  LYS A CE  
598  N NZ  . LYS A 88  ? 0.5620 0.4792 0.3684 0.0183  0.0233  0.0176  85  LYS A NZ  
599  N N   . LYS A 89  ? 0.4429 0.3741 0.2449 -0.0005 -0.0373 -0.0071 86  LYS A N   
600  C CA  . LYS A 89  ? 0.4561 0.3879 0.2525 -0.0034 -0.0490 -0.0108 86  LYS A CA  
601  C C   . LYS A 89  ? 0.4554 0.3856 0.2579 -0.0092 -0.0527 -0.0166 86  LYS A C   
602  O O   . LYS A 89  ? 0.4702 0.3943 0.2618 -0.0115 -0.0602 -0.0218 86  LYS A O   
603  C CB  . LYS A 89  ? 0.4469 0.3916 0.2550 -0.0040 -0.0559 -0.0069 86  LYS A CB  
604  C CG  . LYS A 89  ? 0.4728 0.4169 0.2718 0.0019  -0.0541 -0.0014 86  LYS A CG  
605  C CD  . LYS A 89  ? 0.4860 0.4431 0.2992 0.0022  -0.0596 0.0028  86  LYS A CD  
606  C CE  . LYS A 89  ? 0.5383 0.4934 0.3411 0.0085  -0.0588 0.0085  86  LYS A CE  
607  N NZ  . LYS A 89  ? 0.5539 0.5217 0.3737 0.0094  -0.0619 0.0131  86  LYS A NZ  
608  N N   . ALA A 90  ? 0.4249 0.3595 0.2437 -0.0116 -0.0476 -0.0157 87  ALA A N   
609  C CA  . ALA A 90  ? 0.4203 0.3522 0.2455 -0.0167 -0.0495 -0.0201 87  ALA A CA  
610  C C   . ALA A 90  ? 0.4378 0.3543 0.2468 -0.0156 -0.0467 -0.0254 87  ALA A C   
611  O O   . ALA A 90  ? 0.4403 0.3510 0.2486 -0.0199 -0.0505 -0.0302 87  ALA A O   
612  C CB  . ALA A 90  ? 0.4104 0.3494 0.2543 -0.0181 -0.0441 -0.0171 87  ALA A CB  
613  N N   . ALA A 91  ? 0.4557 0.3649 0.2514 -0.0099 -0.0397 -0.0245 88  ALA A N   
614  C CA  . ALA A 91  ? 0.4756 0.3693 0.2539 -0.0077 -0.0362 -0.0297 88  ALA A CA  
615  C C   . ALA A 91  ? 0.5029 0.3877 0.2629 -0.0095 -0.0456 -0.0355 88  ALA A C   
616  O O   . ALA A 91  ? 0.5211 0.3927 0.2690 -0.0099 -0.0456 -0.0415 88  ALA A O   
617  C CB  . ALA A 91  ? 0.4831 0.3722 0.2523 -0.0009 -0.0253 -0.0266 88  ALA A CB  
618  N N   . ASP A 92  ? 0.5140 0.4056 0.2716 -0.0101 -0.0540 -0.0338 89  ASP A N   
619  C CA  . ASP A 92  ? 0.5405 0.4249 0.2798 -0.0109 -0.0642 -0.0390 89  ASP A CA  
620  C C   . ASP A 92  ? 0.5572 0.4473 0.3071 -0.0186 -0.0768 -0.0431 89  ASP A C   
621  O O   . ASP A 92  ? 0.5790 0.4611 0.3147 -0.0205 -0.0857 -0.0493 89  ASP A O   
622  C CB  . ASP A 92  ? 0.5496 0.4362 0.2763 -0.0056 -0.0662 -0.0347 89  ASP A CB  
623  C CG  . ASP A 92  ? 0.5653 0.4420 0.2760 0.0017  -0.0538 -0.0319 89  ASP A CG  
624  O OD1 . ASP A 92  ? 0.5499 0.4144 0.2506 0.0029  -0.0475 -0.0361 89  ASP A OD1 
625  O OD2 . ASP A 92  ? 0.5822 0.4634 0.2918 0.0061  -0.0498 -0.0253 89  ASP A OD2 
626  N N   . ALA A 93  ? 0.5508 0.4543 0.3256 -0.0233 -0.0776 -0.0401 90  ALA A N   
627  C CA  . ALA A 93  ? 0.5669 0.4767 0.3532 -0.0309 -0.0890 -0.0436 90  ALA A CA  
628  C C   . ALA A 93  ? 0.5611 0.4817 0.3730 -0.0357 -0.0859 -0.0404 90  ALA A C   
629  O O   . ALA A 93  ? 0.5322 0.4578 0.3529 -0.0327 -0.0770 -0.0351 90  ALA A O   
630  C CB  . ALA A 93  ? 0.5781 0.4980 0.3635 -0.0302 -0.0998 -0.0421 90  ALA A CB  
631  N N   . GLN A 94  ? 0.5881 0.5109 0.4106 -0.0434 -0.0934 -0.0442 91  GLN A N   
632  C CA  . GLN A 94  ? 0.5849 0.5167 0.4308 -0.0488 -0.0909 -0.0415 91  GLN A CA  
633  C C   . GLN A 94  ? 0.5606 0.5106 0.4221 -0.0472 -0.0914 -0.0348 91  GLN A C   
634  O O   . GLN A 94  ? 0.5646 0.5212 0.4223 -0.0447 -0.0982 -0.0341 91  GLN A O   
635  C CB  . GLN A 94  ? 0.6046 0.5353 0.4588 -0.0580 -0.0996 -0.0470 91  GLN A CB  
636  C CG  . GLN A 94  ? 0.6889 0.6010 0.5241 -0.0602 -0.1040 -0.0556 91  GLN A CG  
637  C CD  . GLN A 94  ? 0.7430 0.6404 0.5751 -0.0609 -0.0952 -0.0574 91  GLN A CD  
638  O OE1 . GLN A 94  ? 0.7577 0.6551 0.5920 -0.0560 -0.0847 -0.0525 91  GLN A OE1 
639  N NE2 . GLN A 94  ? 0.7734 0.6577 0.6008 -0.0669 -0.1000 -0.0646 91  GLN A NE2 
640  N N   . LEU A 95  ? 0.5360 0.4935 0.4139 -0.0478 -0.0842 -0.0300 92  LEU A N   
641  C CA  . LEU A 95  ? 0.5274 0.5015 0.4213 -0.0466 -0.0843 -0.0242 92  LEU A CA  
642  C C   . LEU A 95  ? 0.5407 0.5263 0.4491 -0.0527 -0.0943 -0.0256 92  LEU A C   
643  O O   . LEU A 95  ? 0.5474 0.5300 0.4623 -0.0599 -0.0974 -0.0294 92  LEU A O   
644  C CB  . LEU A 95  ? 0.4999 0.4775 0.4064 -0.0465 -0.0747 -0.0197 92  LEU A CB  
645  C CG  . LEU A 95  ? 0.5093 0.4780 0.4055 -0.0408 -0.0656 -0.0183 92  LEU A CG  
646  C CD1 . LEU A 95  ? 0.4722 0.4441 0.3805 -0.0412 -0.0582 -0.0146 92  LEU A CD1 
647  C CD2 . LEU A 95  ? 0.5028 0.4740 0.3908 -0.0340 -0.0642 -0.0154 92  LEU A CD2 
648  N N   . GLU A 96  ? 0.5547 0.5531 0.4688 -0.0497 -0.0993 -0.0225 93  GLU A N   
649  C CA  . GLU A 96  ? 0.5776 0.5904 0.5097 -0.0546 -0.1085 -0.0228 93  GLU A CA  
650  C C   . GLU A 96  ? 0.5579 0.5857 0.5146 -0.0562 -0.1030 -0.0173 93  GLU A C   
651  O O   . GLU A 96  ? 0.5759 0.6149 0.5516 -0.0622 -0.1080 -0.0178 93  GLU A O   
652  C CB  . GLU A 96  ? 0.5974 0.6162 0.5223 -0.0500 -0.1184 -0.0226 93  GLU A CB  
653  C CG  . GLU A 96  ? 0.6739 0.6789 0.5757 -0.0501 -0.1265 -0.0292 93  GLU A CG  
654  C CD  . GLU A 96  ? 0.7422 0.7423 0.6483 -0.0595 -0.1332 -0.0364 93  GLU A CD  
655  O OE1 . GLU A 96  ? 0.8157 0.7983 0.7038 -0.0606 -0.1316 -0.0417 93  GLU A OE1 
656  O OE2 . GLU A 96  ? 0.7840 0.7974 0.7122 -0.0660 -0.1396 -0.0369 93  GLU A OE2 
657  N N   . GLU A 97  ? 0.5313 0.5592 0.4878 -0.0509 -0.0928 -0.0123 94  GLU A N   
658  C CA  . GLU A 97  ? 0.5134 0.5533 0.4898 -0.0515 -0.0865 -0.0073 94  GLU A CA  
659  C C   . GLU A 97  ? 0.4870 0.5194 0.4664 -0.0558 -0.0784 -0.0075 94  GLU A C   
660  O O   . GLU A 97  ? 0.4808 0.4985 0.4455 -0.0559 -0.0758 -0.0103 94  GLU A O   
661  C CB  . GLU A 97  ? 0.5157 0.5592 0.4897 -0.0433 -0.0805 -0.0022 94  GLU A CB  
662  C CG  . GLU A 97  ? 0.5678 0.6177 0.5382 -0.0378 -0.0875 -0.0007 94  GLU A CG  
663  C CD  . GLU A 97  ? 0.6246 0.6918 0.6148 -0.0395 -0.0947 0.0006  94  GLU A CD  
664  O OE1 . GLU A 97  ? 0.7022 0.7729 0.6886 -0.0382 -0.1051 -0.0008 94  GLU A OE1 
665  O OE2 . GLU A 97  ? 0.6651 0.7425 0.6744 -0.0416 -0.0899 0.0033  94  GLU A OE2 
666  N N   . THR A 98  ? 0.4564 0.4983 0.4544 -0.0591 -0.0743 -0.0043 95  THR A N   
667  C CA  . THR A 98  ? 0.4384 0.4734 0.4395 -0.0630 -0.0664 -0.0035 95  THR A CA  
668  C C   . THR A 98  ? 0.3885 0.4230 0.3868 -0.0568 -0.0567 0.0011  95  THR A C   
669  O O   . THR A 98  ? 0.3852 0.4305 0.3911 -0.0526 -0.0548 0.0046  95  THR A O   
670  C CB  . THR A 98  ? 0.4461 0.4909 0.4687 -0.0704 -0.0662 -0.0022 95  THR A CB  
671  O OG1 . THR A 98  ? 0.4948 0.5404 0.5216 -0.0770 -0.0764 -0.0072 95  THR A OG1 
672  C CG2 . THR A 98  ? 0.4740 0.5098 0.4976 -0.0736 -0.0568 -0.0003 95  THR A CG2 
673  N N   . TYR A 99  ? 0.3438 0.3655 0.3312 -0.0559 -0.0509 0.0007  96  TYR A N   
674  C CA  . TYR A 99  ? 0.3170 0.3372 0.3009 -0.0505 -0.0429 0.0043  96  TYR A CA  
675  C C   . TYR A 99  ? 0.3007 0.3148 0.2870 -0.0536 -0.0365 0.0061  96  TYR A C   
676  O O   . TYR A 99  ? 0.3112 0.3173 0.2967 -0.0590 -0.0378 0.0039  96  TYR A O   
677  C CB  . TYR A 99  ? 0.3078 0.3180 0.2751 -0.0452 -0.0424 0.0026  96  TYR A CB  
678  C CG  . TYR A 99  ? 0.3078 0.3229 0.2713 -0.0413 -0.0470 0.0021  96  TYR A CG  
679  C CD1 . TYR A 99  ? 0.3328 0.3563 0.3008 -0.0364 -0.0449 0.0055  96  TYR A CD1 
680  C CD2 . TYR A 99  ? 0.3145 0.3244 0.2683 -0.0419 -0.0531 -0.0015 96  TYR A CD2 
681  C CE1 . TYR A 99  ? 0.3204 0.3473 0.2844 -0.0325 -0.0490 0.0057  96  TYR A CE1 
682  C CE2 . TYR A 99  ? 0.3594 0.3726 0.3078 -0.0378 -0.0571 -0.0013 96  TYR A CE2 
683  C CZ  . TYR A 99  ? 0.3390 0.3607 0.2928 -0.0331 -0.0549 0.0026  96  TYR A CZ  
684  O OH  . TYR A 99  ? 0.3817 0.4054 0.3294 -0.0287 -0.0587 0.0034  96  TYR A OH  
685  N N   . ARG A 100 ? 0.2892 0.3059 0.2774 -0.0501 -0.0296 0.0100  97  ARG A N   
686  C CA  . ARG A 100 ? 0.2929 0.3025 0.2803 -0.0515 -0.0229 0.0125  97  ARG A CA  
687  C C   . ARG A 100 ? 0.2900 0.2852 0.2622 -0.0489 -0.0218 0.0110  97  ARG A C   
688  O O   . ARG A 100 ? 0.2963 0.2822 0.2659 -0.0513 -0.0187 0.0119  97  ARG A O   
689  C CB  . ARG A 100 ? 0.2990 0.3146 0.2899 -0.0476 -0.0161 0.0168  97  ARG A CB  
690  C CG  . ARG A 100 ? 0.3195 0.3283 0.3087 -0.0486 -0.0086 0.0204  97  ARG A CG  
691  C CD  . ARG A 100 ? 0.3862 0.3983 0.3887 -0.0558 -0.0062 0.0223  97  ARG A CD  
692  N NE  . ARG A 100 ? 0.4226 0.4508 0.4416 -0.0567 -0.0057 0.0240  97  ARG A NE  
693  C CZ  . ARG A 100 ? 0.4056 0.4407 0.4297 -0.0534 0.0014  0.0280  97  ARG A CZ  
694  N NH1 . ARG A 100 ? 0.4060 0.4564 0.4470 -0.0541 0.0014  0.0293  97  ARG A NH1 
695  N NH2 . ARG A 100 ? 0.4162 0.4428 0.4286 -0.0492 0.0086  0.0307  97  ARG A NH2 
696  N N   . ALA A 101 ? 0.2721 0.2659 0.2356 -0.0437 -0.0239 0.0092  98  ALA A N   
697  C CA  . ALA A 101 ? 0.2748 0.2570 0.2261 -0.0405 -0.0233 0.0074  98  ALA A CA  
698  C C   . ALA A 101 ? 0.2824 0.2656 0.2278 -0.0366 -0.0264 0.0049  98  ALA A C   
699  O O   . ALA A 101 ? 0.2745 0.2668 0.2237 -0.0348 -0.0278 0.0056  98  ALA A O   
700  C CB  . ALA A 101 ? 0.2696 0.2483 0.2169 -0.0364 -0.0181 0.0104  98  ALA A CB  
701  N N   . ILE A 102 ? 0.2829 0.2564 0.2192 -0.0350 -0.0268 0.0023  99  ILE A N   
702  C CA  . ILE A 102 ? 0.2766 0.2491 0.2062 -0.0315 -0.0284 0.0001  99  ILE A CA  
703  C C   . ILE A 102 ? 0.2732 0.2392 0.1972 -0.0270 -0.0251 0.0000  99  ILE A C   
704  O O   . ILE A 102 ? 0.2883 0.2462 0.2097 -0.0272 -0.0237 -0.0003 99  ILE A O   
705  C CB  . ILE A 102 ? 0.2956 0.2632 0.2194 -0.0342 -0.0328 -0.0037 99  ILE A CB  
706  C CG1 . ILE A 102 ? 0.3162 0.2914 0.2473 -0.0390 -0.0377 -0.0039 99  ILE A CG1 
707  C CG2 . ILE A 102 ? 0.3094 0.2749 0.2246 -0.0298 -0.0329 -0.0053 99  ILE A CG2 
708  C CD1 . ILE A 102 ? 0.3627 0.3316 0.2878 -0.0427 -0.0431 -0.0085 99  ILE A CD1 
709  N N   . ALA A 103 ? 0.2603 0.2298 0.1836 -0.0229 -0.0240 0.0002  100 ALA A N   
710  C CA  . ALA A 103 ? 0.2637 0.2284 0.1836 -0.0188 -0.0215 -0.0005 100 ALA A CA  
711  C C   . ALA A 103 ? 0.2804 0.2438 0.1954 -0.0168 -0.0212 -0.0023 100 ALA A C   
712  O O   . ALA A 103 ? 0.2893 0.2577 0.2044 -0.0166 -0.0222 -0.0016 100 ALA A O   
713  C CB  . ALA A 103 ? 0.2714 0.2409 0.1959 -0.0157 -0.0198 0.0014  100 ALA A CB  
714  N N   . ILE A 104 ? 0.2652 0.2215 0.1758 -0.0145 -0.0190 -0.0042 101 ILE A N   
715  C CA  . ILE A 104 ? 0.2831 0.2369 0.1882 -0.0120 -0.0169 -0.0057 101 ILE A CA  
716  C C   . ILE A 104 ? 0.2886 0.2408 0.1965 -0.0078 -0.0126 -0.0058 101 ILE A C   
717  O O   . ILE A 104 ? 0.2838 0.2324 0.1937 -0.0067 -0.0123 -0.0062 101 ILE A O   
718  C CB  . ILE A 104 ? 0.3124 0.2580 0.2069 -0.0137 -0.0186 -0.0089 101 ILE A CB  
719  C CG1 . ILE A 104 ? 0.3136 0.2560 0.2001 -0.0102 -0.0154 -0.0099 101 ILE A CG1 
720  C CG2 . ILE A 104 ? 0.3428 0.2792 0.2349 -0.0145 -0.0184 -0.0111 101 ILE A CG2 
721  C CD1 . ILE A 104 ? 0.3901 0.3250 0.2627 -0.0114 -0.0181 -0.0132 101 ILE A CD1 
722  N N   . GLY A 105 ? 0.2764 0.2318 0.1858 -0.0054 -0.0094 -0.0050 102 GLY A N   
723  C CA  . GLY A 105 ? 0.2752 0.2300 0.1892 -0.0016 -0.0048 -0.0054 102 GLY A CA  
724  C C   . GLY A 105 ? 0.2730 0.2355 0.1977 0.0000  -0.0025 -0.0036 102 GLY A C   
725  O O   . GLY A 105 ? 0.2822 0.2447 0.2099 0.0024  0.0024  -0.0037 102 GLY A O   
726  N N   . PRO A 106 ? 0.2724 0.2406 0.2035 -0.0014 -0.0058 -0.0023 103 PRO A N   
727  C CA  . PRO A 106 ? 0.2774 0.2517 0.2188 -0.0004 -0.0044 -0.0015 103 PRO A CA  
728  C C   . PRO A 106 ? 0.2689 0.2435 0.2095 -0.0002 0.0001  -0.0003 103 PRO A C   
729  O O   . PRO A 106 ? 0.2755 0.2488 0.2089 -0.0014 -0.0003 0.0008  103 PRO A O   
730  C CB  . PRO A 106 ? 0.2807 0.2588 0.2247 -0.0021 -0.0087 -0.0007 103 PRO A CB  
731  C CG  . PRO A 106 ? 0.2722 0.2466 0.2100 -0.0031 -0.0117 -0.0010 103 PRO A CG  
732  C CD  . PRO A 106 ? 0.2845 0.2536 0.2141 -0.0039 -0.0103 -0.0017 103 PRO A CD  
733  N N   . GLY A 107 ? 0.2793 0.2559 0.2281 0.0013  0.0046  -0.0002 104 GLY A N   
734  C CA  . GLY A 107 ? 0.2798 0.2557 0.2280 0.0017  0.0105  0.0015  104 GLY A CA  
735  C C   . GLY A 107 ? 0.3089 0.2777 0.2435 0.0031  0.0145  0.0018  104 GLY A C   
736  O O   . GLY A 107 ? 0.3131 0.2799 0.2436 0.0036  0.0189  0.0040  104 GLY A O   
737  N N   . LEU A 108 ? 0.2950 0.2587 0.2213 0.0039  0.0128  -0.0003 105 LEU A N   
738  C CA  . LEU A 108 ? 0.3175 0.2730 0.2293 0.0056  0.0162  -0.0011 105 LEU A CA  
739  C C   . LEU A 108 ? 0.3320 0.2848 0.2465 0.0091  0.0229  -0.0023 105 LEU A C   
740  O O   . LEU A 108 ? 0.3156 0.2716 0.2409 0.0102  0.0224  -0.0035 105 LEU A O   
741  C CB  . LEU A 108 ? 0.3069 0.2572 0.2071 0.0038  0.0099  -0.0034 105 LEU A CB  
742  C CG  . LEU A 108 ? 0.2981 0.2522 0.1971 0.0005  0.0032  -0.0022 105 LEU A CG  
743  C CD1 . LEU A 108 ? 0.3050 0.2538 0.1934 -0.0016 -0.0023 -0.0047 105 LEU A CD1 
744  C CD2 . LEU A 108 ? 0.3158 0.2716 0.2120 0.0010  0.0048  0.0008  105 LEU A CD2 
745  N N   . PRO A 109 ? 0.3548 0.3013 0.2587 0.0115  0.0296  -0.0019 106 PRO A N   
746  C CA  . PRO A 109 ? 0.3694 0.3124 0.2744 0.0155  0.0375  -0.0031 106 PRO A CA  
747  C C   . PRO A 109 ? 0.3780 0.3135 0.2749 0.0170  0.0349  -0.0071 106 PRO A C   
748  O O   . PRO A 109 ? 0.3756 0.3061 0.2615 0.0146  0.0282  -0.0090 106 PRO A O   
749  C CB  . PRO A 109 ? 0.3958 0.3317 0.2862 0.0176  0.0449  -0.0015 106 PRO A CB  
750  C CG  . PRO A 109 ? 0.3883 0.3204 0.2640 0.0152  0.0381  -0.0013 106 PRO A CG  
751  C CD  . PRO A 109 ? 0.3718 0.3133 0.2606 0.0112  0.0302  -0.0003 106 PRO A CD  
752  N N   . GLN A 110 ? 0.3881 0.3228 0.2918 0.0210  0.0406  -0.0083 107 GLN A N   
753  C CA  . GLN A 110 ? 0.4038 0.3302 0.3009 0.0231  0.0391  -0.0119 107 GLN A CA  
754  C C   . GLN A 110 ? 0.4218 0.3350 0.2982 0.0257  0.0442  -0.0145 107 GLN A C   
755  O O   . GLN A 110 ? 0.4434 0.3518 0.3188 0.0307  0.0522  -0.0157 107 GLN A O   
756  C CB  . GLN A 110 ? 0.4174 0.3487 0.3312 0.0275  0.0433  -0.0118 107 GLN A CB  
757  C CG  . GLN A 110 ? 0.4433 0.3869 0.3765 0.0256  0.0375  -0.0098 107 GLN A CG  
758  C CD  . GLN A 110 ? 0.5089 0.4603 0.4615 0.0302  0.0417  -0.0092 107 GLN A CD  
759  O OE1 . GLN A 110 ? 0.5455 0.4916 0.4974 0.0353  0.0461  -0.0109 107 GLN A OE1 
760  N NE2 . GLN A 110 ? 0.5128 0.4768 0.4834 0.0286  0.0402  -0.0071 107 GLN A NE2 
761  N N   . THR A 111 ? 0.4081 0.3150 0.2674 0.0226  0.0392  -0.0156 108 THR A N   
762  C CA  . THR A 111 ? 0.4269 0.3210 0.2641 0.0251  0.0432  -0.0181 108 THR A CA  
763  C C   . THR A 111 ? 0.4227 0.3057 0.2441 0.0226  0.0351  -0.0232 108 THR A C   
764  O O   . THR A 111 ? 0.4056 0.2920 0.2330 0.0179  0.0263  -0.0236 108 THR A O   
765  C CB  . THR A 111 ? 0.4249 0.3199 0.2527 0.0243  0.0445  -0.0150 108 THR A CB  
766  O OG1 . THR A 111 ? 0.4123 0.3127 0.2413 0.0191  0.0341  -0.0141 108 THR A OG1 
767  C CG2 . THR A 111 ? 0.4337 0.3376 0.2759 0.0263  0.0536  -0.0100 108 THR A CG2 
768  N N   . GLU A 112 ? 0.4452 0.3144 0.2456 0.0254  0.0384  -0.0269 109 GLU A N   
769  C CA  . GLU A 112 ? 0.4655 0.3228 0.2490 0.0227  0.0307  -0.0324 109 GLU A CA  
770  C C   . GLU A 112 ? 0.4648 0.3268 0.2447 0.0169  0.0200  -0.0317 109 GLU A C   
771  O O   . GLU A 112 ? 0.4647 0.3242 0.2438 0.0121  0.0111  -0.0348 109 GLU A O   
772  C CB  . GLU A 112 ? 0.4956 0.3364 0.2548 0.0276  0.0367  -0.0368 109 GLU A CB  
773  C CG  . GLU A 112 ? 0.5709 0.4049 0.3330 0.0335  0.0464  -0.0389 109 GLU A CG  
774  C CD  . GLU A 112 ? 0.6803 0.4970 0.4173 0.0391  0.0538  -0.0434 109 GLU A CD  
775  O OE1 . GLU A 112 ? 0.7157 0.5223 0.4298 0.0373  0.0480  -0.0470 109 GLU A OE1 
776  O OE2 . GLU A 112 ? 0.7425 0.5561 0.4828 0.0456  0.0653  -0.0434 109 GLU A OE2 
777  N N   . SER A 113 ? 0.4644 0.3335 0.2438 0.0173  0.0211  -0.0272 110 SER A N   
778  C CA  . SER A 113 ? 0.4640 0.3384 0.2406 0.0128  0.0112  -0.0260 110 SER A CA  
779  C C   . SER A 113 ? 0.4260 0.3124 0.2232 0.0076  0.0046  -0.0241 110 SER A C   
780  O O   . SER A 113 ? 0.4279 0.3164 0.2246 0.0030  -0.0047 -0.0254 110 SER A O   
781  C CB  . SER A 113 ? 0.4698 0.3486 0.2427 0.0152  0.0148  -0.0207 110 SER A CB  
782  O OG  . SER A 113 ? 0.5398 0.4065 0.2909 0.0200  0.0208  -0.0221 110 SER A OG  
783  N N   . VAL A 114 ? 0.4004 0.2946 0.2156 0.0086  0.0095  -0.0212 111 VAL A N   
784  C CA  . VAL A 114 ? 0.3815 0.2854 0.2141 0.0046  0.0042  -0.0196 111 VAL A CA  
785  C C   . VAL A 114 ? 0.3914 0.2881 0.2222 0.0018  -0.0005 -0.0238 111 VAL A C   
786  O O   . VAL A 114 ? 0.3819 0.2826 0.2182 -0.0030 -0.0076 -0.0237 111 VAL A O   
787  C CB  . VAL A 114 ? 0.3669 0.2800 0.2174 0.0068  0.0098  -0.0160 111 VAL A CB  
788  C CG1 . VAL A 114 ? 0.3465 0.2664 0.2110 0.0035  0.0044  -0.0151 111 VAL A CG1 
789  C CG2 . VAL A 114 ? 0.3704 0.2907 0.2241 0.0078  0.0131  -0.0116 111 VAL A CG2 
790  N N   . GLN A 115 ? 0.4084 0.2934 0.2308 0.0049  0.0037  -0.0275 112 GLN A N   
791  C CA  . GLN A 115 ? 0.4232 0.2988 0.2424 0.0021  -0.0003 -0.0317 112 GLN A CA  
792  C C   . GLN A 115 ? 0.4294 0.2992 0.2361 -0.0028 -0.0088 -0.0356 112 GLN A C   
793  O O   . GLN A 115 ? 0.4357 0.3031 0.2460 -0.0079 -0.0146 -0.0375 112 GLN A O   
794  C CB  . GLN A 115 ? 0.4483 0.3117 0.2614 0.0073  0.0065  -0.0349 112 GLN A CB  
795  C CG  . GLN A 115 ? 0.4306 0.3006 0.2596 0.0118  0.0128  -0.0315 112 GLN A CG  
796  C CD  . GLN A 115 ? 0.4578 0.3344 0.3015 0.0086  0.0079  -0.0289 112 GLN A CD  
797  O OE1 . GLN A 115 ? 0.5131 0.3817 0.3539 0.0054  0.0037  -0.0311 112 GLN A OE1 
798  N NE2 . GLN A 115 ? 0.4039 0.2940 0.2624 0.0091  0.0085  -0.0243 112 GLN A NE2 
799  N N   . GLN A 116 ? 0.4419 0.3088 0.2337 -0.0014 -0.0094 -0.0368 113 GLN A N   
800  C CA  . GLN A 116 ? 0.4576 0.3216 0.2389 -0.0061 -0.0191 -0.0402 113 GLN A CA  
801  C C   . GLN A 116 ? 0.4310 0.3093 0.2275 -0.0115 -0.0265 -0.0367 113 GLN A C   
802  O O   . GLN A 116 ? 0.4286 0.3063 0.2264 -0.0174 -0.0347 -0.0395 113 GLN A O   
803  C CB  . GLN A 116 ? 0.4942 0.3530 0.2557 -0.0024 -0.0186 -0.0412 113 GLN A CB  
804  C CG  . GLN A 116 ? 0.5601 0.4024 0.3026 0.0025  -0.0122 -0.0459 113 GLN A CG  
805  C CD  . GLN A 116 ? 0.6798 0.5074 0.4082 -0.0008 -0.0191 -0.0540 113 GLN A CD  
806  O OE1 . GLN A 116 ? 0.7404 0.5599 0.4723 -0.0016 -0.0172 -0.0572 113 GLN A OE1 
807  N NE2 . GLN A 116 ? 0.7529 0.5760 0.4643 -0.0024 -0.0275 -0.0574 113 GLN A NE2 
808  N N   . ALA A 117 ? 0.4062 0.2970 0.2145 -0.0097 -0.0232 -0.0307 114 ALA A N   
809  C CA  . ALA A 117 ? 0.3944 0.2986 0.2179 -0.0139 -0.0286 -0.0271 114 ALA A CA  
810  C C   . ALA A 117 ? 0.3883 0.2938 0.2251 -0.0180 -0.0297 -0.0273 114 ALA A C   
811  O O   . ALA A 117 ? 0.3906 0.3011 0.2348 -0.0234 -0.0360 -0.0273 114 ALA A O   
812  C CB  . ALA A 117 ? 0.3750 0.2902 0.2073 -0.0107 -0.0242 -0.0213 114 ALA A CB  
813  N N   . VAL A 118 ? 0.3931 0.2941 0.2333 -0.0152 -0.0234 -0.0270 115 VAL A N   
814  C CA  . VAL A 118 ? 0.3841 0.2831 0.2337 -0.0182 -0.0239 -0.0269 115 VAL A CA  
815  C C   . VAL A 118 ? 0.4134 0.3027 0.2567 -0.0236 -0.0296 -0.0318 115 VAL A C   
816  O O   . VAL A 118 ? 0.4016 0.2946 0.2539 -0.0292 -0.0338 -0.0309 115 VAL A O   
817  C CB  . VAL A 118 ? 0.3816 0.2748 0.2327 -0.0131 -0.0170 -0.0266 115 VAL A CB  
818  C CG1 . VAL A 118 ? 0.3876 0.2753 0.2445 -0.0155 -0.0177 -0.0266 115 VAL A CG1 
819  C CG2 . VAL A 118 ? 0.3795 0.2835 0.2403 -0.0089 -0.0124 -0.0221 115 VAL A CG2 
820  N N   . ASP A 119 ? 0.4192 0.2962 0.2467 -0.0224 -0.0300 -0.0371 116 ASP A N   
821  C CA  . ASP A 119 ? 0.4477 0.3136 0.2685 -0.0279 -0.0359 -0.0428 116 ASP A CA  
822  C C   . ASP A 119 ? 0.4516 0.3267 0.2784 -0.0346 -0.0449 -0.0428 116 ASP A C   
823  O O   . ASP A 119 ? 0.4699 0.3430 0.3034 -0.0413 -0.0495 -0.0447 116 ASP A O   
824  C CB  . ASP A 119 ? 0.4747 0.3250 0.2747 -0.0246 -0.0350 -0.0491 116 ASP A CB  
825  C CG  . ASP A 119 ? 0.5202 0.3593 0.3161 -0.0186 -0.0261 -0.0499 116 ASP A CG  
826  O OD1 . ASP A 119 ? 0.5653 0.4071 0.3741 -0.0181 -0.0226 -0.0464 116 ASP A OD1 
827  O OD2 . ASP A 119 ? 0.6262 0.4541 0.4060 -0.0139 -0.0224 -0.0539 116 ASP A OD2 
828  N N   . HIS A 120 ? 0.4455 0.3308 0.2707 -0.0328 -0.0474 -0.0407 117 HIS A N   
829  C CA  . HIS A 120 ? 0.4584 0.3542 0.2906 -0.0380 -0.0561 -0.0403 117 HIS A CA  
830  C C   . HIS A 120 ? 0.4465 0.3555 0.2995 -0.0416 -0.0556 -0.0351 117 HIS A C   
831  O O   . HIS A 120 ? 0.4634 0.3770 0.3256 -0.0481 -0.0618 -0.0361 117 HIS A O   
832  C CB  . HIS A 120 ? 0.4601 0.3624 0.2844 -0.0341 -0.0587 -0.0388 117 HIS A CB  
833  C CG  . HIS A 120 ? 0.5097 0.3995 0.3121 -0.0322 -0.0621 -0.0446 117 HIS A CG  
834  N ND1 . HIS A 120 ? 0.6075 0.4902 0.4034 -0.0377 -0.0713 -0.0511 117 HIS A ND1 
835  C CD2 . HIS A 120 ? 0.5549 0.4369 0.3394 -0.0255 -0.0574 -0.0450 117 HIS A CD2 
836  C CE1 . HIS A 120 ? 0.6163 0.4869 0.3895 -0.0340 -0.0727 -0.0557 117 HIS A CE1 
837  N NE2 . HIS A 120 ? 0.5893 0.4591 0.3548 -0.0264 -0.0638 -0.0518 117 HIS A NE2 
838  N N   . VAL A 121 ? 0.4384 0.3533 0.2986 -0.0374 -0.0486 -0.0299 118 VAL A N   
839  C CA  . VAL A 121 ? 0.4377 0.3637 0.3151 -0.0397 -0.0471 -0.0249 118 VAL A CA  
840  C C   . VAL A 121 ? 0.4393 0.3587 0.3228 -0.0449 -0.0467 -0.0259 118 VAL A C   
841  O O   . VAL A 121 ? 0.4262 0.3533 0.3226 -0.0499 -0.0484 -0.0236 118 VAL A O   
842  C CB  . VAL A 121 ? 0.4311 0.3623 0.3122 -0.0337 -0.0400 -0.0202 118 VAL A CB  
843  C CG1 . VAL A 121 ? 0.4761 0.4136 0.3706 -0.0352 -0.0374 -0.0160 118 VAL A CG1 
844  C CG2 . VAL A 121 ? 0.4412 0.3810 0.3202 -0.0299 -0.0406 -0.0180 118 VAL A CG2 
845  N N   . LEU A 122 ? 0.4299 0.3345 0.3042 -0.0437 -0.0439 -0.0291 119 LEU A N   
846  C CA  . LEU A 122 ? 0.4393 0.3348 0.3177 -0.0482 -0.0429 -0.0298 119 LEU A CA  
847  C C   . LEU A 122 ? 0.4558 0.3491 0.3379 -0.0569 -0.0497 -0.0335 119 LEU A C   
848  O O   . LEU A 122 ? 0.4450 0.3331 0.3343 -0.0619 -0.0486 -0.0328 119 LEU A O   
849  C CB  . LEU A 122 ? 0.4490 0.3285 0.3165 -0.0438 -0.0382 -0.0324 119 LEU A CB  
850  C CG  . LEU A 122 ? 0.4433 0.3255 0.3118 -0.0361 -0.0314 -0.0283 119 LEU A CG  
851  C CD1 . LEU A 122 ? 0.4835 0.3510 0.3426 -0.0310 -0.0268 -0.0310 119 LEU A CD1 
852  C CD2 . LEU A 122 ? 0.4615 0.3508 0.3425 -0.0368 -0.0289 -0.0223 119 LEU A CD2 
853  N N   . THR A 123 ? 0.4644 0.3608 0.3416 -0.0588 -0.0570 -0.0375 120 THR A N   
854  C CA  . THR A 123 ? 0.4913 0.3889 0.3754 -0.0675 -0.0648 -0.0410 120 THR A CA  
855  C C   . THR A 123 ? 0.4802 0.3956 0.3847 -0.0719 -0.0663 -0.0359 120 THR A C   
856  O O   . THR A 123 ? 0.4975 0.4154 0.4131 -0.0800 -0.0711 -0.0376 120 THR A O   
857  C CB  . THR A 123 ? 0.5144 0.4087 0.3854 -0.0681 -0.0738 -0.0477 120 THR A CB  
858  O OG1 . THR A 123 ? 0.5247 0.4342 0.3977 -0.0646 -0.0769 -0.0446 120 THR A OG1 
859  C CG2 . THR A 123 ? 0.5417 0.4183 0.3911 -0.0626 -0.0707 -0.0524 120 THR A CG2 
860  N N   . ALA A 124 ? 0.4666 0.3942 0.3769 -0.0668 -0.0617 -0.0298 121 ALA A N   
861  C CA  . ALA A 124 ? 0.4597 0.4027 0.3887 -0.0698 -0.0608 -0.0245 121 ALA A CA  
862  C C   . ALA A 124 ? 0.4717 0.4095 0.4093 -0.0737 -0.0545 -0.0215 121 ALA A C   
863  O O   . ALA A 124 ? 0.4785 0.4017 0.4072 -0.0721 -0.0502 -0.0223 121 ALA A O   
864  C CB  . ALA A 124 ? 0.4552 0.4101 0.3858 -0.0627 -0.0572 -0.0194 121 ALA A CB  
865  N N   . ASP A 125 ? 0.4708 0.4198 0.4256 -0.0787 -0.0541 -0.0180 122 ASP A N   
866  C CA  . ASP A 125 ? 0.4797 0.4245 0.4429 -0.0824 -0.0473 -0.0140 122 ASP A CA  
867  C C   . ASP A 125 ? 0.4562 0.4105 0.4232 -0.0767 -0.0404 -0.0073 122 ASP A C   
868  O O   . ASP A 125 ? 0.4866 0.4548 0.4680 -0.0787 -0.0393 -0.0038 122 ASP A O   
869  C CB  . ASP A 125 ? 0.5021 0.4535 0.4833 -0.0922 -0.0499 -0.0141 122 ASP A CB  
870  C CG  . ASP A 125 ? 0.5647 0.5069 0.5439 -0.0993 -0.0580 -0.0214 122 ASP A CG  
871  O OD1 . ASP A 125 ? 0.6618 0.6125 0.6574 -0.1075 -0.0627 -0.0226 122 ASP A OD1 
872  O OD2 . ASP A 125 ? 0.6211 0.5475 0.5834 -0.0971 -0.0596 -0.0263 122 ASP A OD2 
873  N N   . CYS A 126 ? 0.4047 0.3525 0.3596 -0.0694 -0.0362 -0.0060 123 CYS A N   
874  C CA  . CYS A 126 ? 0.3679 0.3217 0.3242 -0.0640 -0.0301 -0.0005 123 CYS A CA  
875  C C   . CYS A 126 ? 0.3566 0.2988 0.2996 -0.0576 -0.0266 -0.0002 123 CYS A C   
876  O O   . CYS A 126 ? 0.3411 0.2738 0.2746 -0.0562 -0.0289 -0.0043 123 CYS A O   
877  C CB  . CYS A 126 ? 0.3567 0.3252 0.3164 -0.0599 -0.0321 0.0003  123 CYS A CB  
878  S SG  . CYS A 126 ? 0.3557 0.3220 0.3024 -0.0547 -0.0372 -0.0041 123 CYS A SG  
879  N N   . PRO A 127 ? 0.3314 0.2747 0.2736 -0.0533 -0.0212 0.0044  124 PRO A N   
880  C CA  . PRO A 127 ? 0.3287 0.2641 0.2602 -0.0464 -0.0192 0.0046  124 PRO A CA  
881  C C   . PRO A 127 ? 0.3200 0.2599 0.2470 -0.0417 -0.0222 0.0015  124 PRO A C   
882  O O   . PRO A 127 ? 0.2976 0.2489 0.2291 -0.0414 -0.0241 0.0015  124 PRO A O   
883  C CB  . PRO A 127 ? 0.3360 0.2750 0.2684 -0.0430 -0.0145 0.0098  124 PRO A CB  
884  C CG  . PRO A 127 ? 0.3619 0.3060 0.3036 -0.0483 -0.0120 0.0127  124 PRO A CG  
885  C CD  . PRO A 127 ? 0.3408 0.2926 0.2914 -0.0539 -0.0168 0.0095  124 PRO A CD  
886  N N   . VAL A 128 ? 0.3175 0.2484 0.2360 -0.0378 -0.0220 -0.0007 125 VAL A N   
887  C CA  . VAL A 128 ? 0.3206 0.2545 0.2349 -0.0333 -0.0233 -0.0031 125 VAL A CA  
888  C C   . VAL A 128 ? 0.3188 0.2493 0.2297 -0.0268 -0.0204 -0.0019 125 VAL A C   
889  O O   . VAL A 128 ? 0.3309 0.2512 0.2383 -0.0255 -0.0188 -0.0016 125 VAL A O   
890  C CB  . VAL A 128 ? 0.3362 0.2626 0.2438 -0.0350 -0.0260 -0.0081 125 VAL A CB  
891  C CG1 . VAL A 128 ? 0.3630 0.2903 0.2645 -0.0295 -0.0254 -0.0101 125 VAL A CG1 
892  C CG2 . VAL A 128 ? 0.3246 0.2563 0.2363 -0.0413 -0.0308 -0.0098 125 VAL A CG2 
893  N N   . ILE A 129 ? 0.2939 0.2326 0.2067 -0.0229 -0.0200 -0.0012 126 ILE A N   
894  C CA  . ILE A 129 ? 0.2861 0.2241 0.1982 -0.0169 -0.0183 -0.0007 126 ILE A CA  
895  C C   . ILE A 129 ? 0.2913 0.2289 0.2010 -0.0141 -0.0177 -0.0036 126 ILE A C   
896  O O   . ILE A 129 ? 0.2890 0.2320 0.1987 -0.0152 -0.0184 -0.0045 126 ILE A O   
897  C CB  . ILE A 129 ? 0.2744 0.2216 0.1912 -0.0148 -0.0182 0.0018  126 ILE A CB  
898  C CG1 . ILE A 129 ? 0.2782 0.2264 0.1962 -0.0172 -0.0177 0.0049  126 ILE A CG1 
899  C CG2 . ILE A 129 ? 0.2570 0.2043 0.1748 -0.0093 -0.0177 0.0018  126 ILE A CG2 
900  C CD1 . ILE A 129 ? 0.3008 0.2590 0.2228 -0.0163 -0.0176 0.0064  126 ILE A CD1 
901  N N   . LEU A 130 ? 0.2920 0.2232 0.1998 -0.0101 -0.0159 -0.0046 127 LEU A N   
902  C CA  . LEU A 130 ? 0.2935 0.2243 0.2000 -0.0065 -0.0135 -0.0068 127 LEU A CA  
903  C C   . LEU A 130 ? 0.2993 0.2353 0.2130 -0.0016 -0.0123 -0.0054 127 LEU A C   
904  O O   . LEU A 130 ? 0.3008 0.2343 0.2163 0.0007  -0.0130 -0.0040 127 LEU A O   
905  C CB  . LEU A 130 ? 0.3143 0.2329 0.2134 -0.0055 -0.0119 -0.0099 127 LEU A CB  
906  C CG  . LEU A 130 ? 0.3598 0.2703 0.2513 -0.0108 -0.0141 -0.0124 127 LEU A CG  
907  C CD1 . LEU A 130 ? 0.3817 0.2785 0.2645 -0.0086 -0.0118 -0.0164 127 LEU A CD1 
908  C CD2 . LEU A 130 ? 0.3934 0.3104 0.2834 -0.0145 -0.0167 -0.0132 127 LEU A CD2 
909  N N   . ASP A 131 ? 0.2934 0.2365 0.2113 -0.0001 -0.0106 -0.0056 128 ASP A N   
910  C CA  . ASP A 131 ? 0.2871 0.2369 0.2143 0.0036  -0.0099 -0.0047 128 ASP A CA  
911  C C   . ASP A 131 ? 0.2846 0.2367 0.2147 0.0057  -0.0054 -0.0059 128 ASP A C   
912  O O   . ASP A 131 ? 0.2780 0.2273 0.2011 0.0043  -0.0032 -0.0069 128 ASP A O   
913  C CB  . ASP A 131 ? 0.2812 0.2391 0.2131 0.0018  -0.0127 -0.0029 128 ASP A CB  
914  C CG  . ASP A 131 ? 0.2895 0.2541 0.2313 0.0050  -0.0137 -0.0027 128 ASP A CG  
915  O OD1 . ASP A 131 ? 0.3180 0.2818 0.2643 0.0088  -0.0137 -0.0030 128 ASP A OD1 
916  O OD2 . ASP A 131 ? 0.3050 0.2757 0.2507 0.0036  -0.0148 -0.0023 128 ASP A OD2 
917  N N   . ALA A 132 ? 0.2825 0.2394 0.2227 0.0095  -0.0039 -0.0057 129 ALA A N   
918  C CA  . ALA A 132 ? 0.2725 0.2341 0.2193 0.0111  0.0011  -0.0060 129 ALA A CA  
919  C C   . ALA A 132 ? 0.2912 0.2451 0.2284 0.0122  0.0066  -0.0075 129 ALA A C   
920  O O   . ALA A 132 ? 0.3078 0.2547 0.2415 0.0151  0.0081  -0.0089 129 ALA A O   
921  C CB  . ALA A 132 ? 0.2699 0.2387 0.2208 0.0081  0.0005  -0.0047 129 ALA A CB  
922  N N   . GLY A 133 ? 0.3033 0.2573 0.2351 0.0104  0.0094  -0.0071 130 GLY A N   
923  C CA  . GLY A 133 ? 0.3164 0.2625 0.2370 0.0121  0.0149  -0.0086 130 GLY A CA  
924  C C   . GLY A 133 ? 0.3252 0.2602 0.2310 0.0109  0.0121  -0.0112 130 GLY A C   
925  O O   . GLY A 133 ? 0.3556 0.2817 0.2509 0.0132  0.0163  -0.0136 130 GLY A O   
926  N N   . ALA A 134 ? 0.3028 0.2378 0.2077 0.0073  0.0054  -0.0111 131 ALA A N   
927  C CA  . ALA A 134 ? 0.3191 0.2441 0.2127 0.0050  0.0023  -0.0136 131 ALA A CA  
928  C C   . ALA A 134 ? 0.3388 0.2566 0.2335 0.0076  0.0029  -0.0148 131 ALA A C   
929  O O   . ALA A 134 ? 0.3584 0.2658 0.2442 0.0058  0.0011  -0.0173 131 ALA A O   
930  C CB  . ALA A 134 ? 0.3228 0.2514 0.2164 -0.0003 -0.0039 -0.0125 131 ALA A CB  
931  N N   . LEU A 135 ? 0.3256 0.2487 0.2320 0.0116  0.0048  -0.0131 132 LEU A N   
932  C CA  . LEU A 135 ? 0.3335 0.2500 0.2415 0.0155  0.0055  -0.0137 132 LEU A CA  
933  C C   . LEU A 135 ? 0.3497 0.2591 0.2542 0.0208  0.0123  -0.0162 132 LEU A C   
934  O O   . LEU A 135 ? 0.3604 0.2762 0.2715 0.0240  0.0175  -0.0157 132 LEU A O   
935  C CB  . LEU A 135 ? 0.3174 0.2427 0.2390 0.0181  0.0031  -0.0108 132 LEU A CB  
936  C CG  . LEU A 135 ? 0.3134 0.2428 0.2361 0.0142  -0.0028 -0.0084 132 LEU A CG  
937  C CD1 . LEU A 135 ? 0.3112 0.2496 0.2461 0.0175  -0.0052 -0.0063 132 LEU A CD1 
938  C CD2 . LEU A 135 ? 0.3425 0.2612 0.2565 0.0117  -0.0055 -0.0083 132 LEU A CD2 
939  N N   . ALA A 136 ? 0.3745 0.2702 0.2688 0.0216  0.0127  -0.0189 133 ALA A N   
940  C CA  . ALA A 136 ? 0.4030 0.2893 0.2911 0.0268  0.0194  -0.0219 133 ALA A CA  
941  C C   . ALA A 136 ? 0.4103 0.2833 0.2942 0.0292  0.0189  -0.0235 133 ALA A C   
942  O O   . ALA A 136 ? 0.4166 0.2863 0.2996 0.0256  0.0133  -0.0223 133 ALA A O   
943  C CB  . ALA A 136 ? 0.4227 0.3020 0.2951 0.0242  0.0211  -0.0253 133 ALA A CB  
944  N N   . LYS A 137 ? 0.4360 0.3007 0.3171 0.0357  0.0254  -0.0258 134 LYS A N   
945  C CA  . LYS A 137 ? 0.4569 0.3053 0.3308 0.0383  0.0259  -0.0282 134 LYS A CA  
946  C C   . LYS A 137 ? 0.4733 0.3068 0.3286 0.0325  0.0236  -0.0329 134 LYS A C   
947  O O   . LYS A 137 ? 0.4727 0.3008 0.3164 0.0330  0.0273  -0.0368 134 LYS A O   
948  C CB  . LYS A 137 ? 0.4754 0.3196 0.3520 0.0476  0.0343  -0.0296 134 LYS A CB  
949  C CG  . LYS A 137 ? 0.5421 0.3681 0.4117 0.0519  0.0358  -0.0319 134 LYS A CG  
950  C CD  . LYS A 137 ? 0.5963 0.4209 0.4720 0.0624  0.0449  -0.0326 134 LYS A CD  
951  C CE  . LYS A 137 ? 0.6103 0.4536 0.5095 0.0677  0.0446  -0.0272 134 LYS A CE  
952  N NZ  . LYS A 137 ? 0.6535 0.4979 0.5636 0.0786  0.0527  -0.0272 134 LYS A NZ  
953  N N   . ARG A 138 ? 0.4731 0.3000 0.3255 0.0270  0.0176  -0.0328 135 ARG A N   
954  C CA  . ARG A 138 ? 0.4958 0.3108 0.3335 0.0200  0.0138  -0.0374 135 ARG A CA  
955  C C   . ARG A 138 ? 0.5153 0.3216 0.3537 0.0152  0.0091  -0.0364 135 ARG A C   
956  O O   . ARG A 138 ? 0.5044 0.3146 0.3530 0.0175  0.0087  -0.0315 135 ARG A O   
957  C CB  . ARG A 138 ? 0.4954 0.3220 0.3316 0.0140  0.0099  -0.0372 135 ARG A CB  
958  C CG  . ARG A 138 ? 0.4614 0.3028 0.3104 0.0094  0.0047  -0.0318 135 ARG A CG  
959  C CD  . ARG A 138 ? 0.4802 0.3297 0.3264 0.0028  0.0000  -0.0322 135 ARG A CD  
960  N NE  . ARG A 138 ? 0.4871 0.3264 0.3243 -0.0039 -0.0052 -0.0361 135 ARG A NE  
961  C CZ  . ARG A 138 ? 0.5059 0.3469 0.3361 -0.0088 -0.0098 -0.0388 135 ARG A CZ  
962  N NH1 . ARG A 138 ? 0.4811 0.3322 0.3100 -0.0073 -0.0093 -0.0376 135 ARG A NH1 
963  N NH2 . ARG A 138 ? 0.5105 0.3422 0.3346 -0.0152 -0.0152 -0.0428 135 ARG A NH2 
964  N N   . THR A 139 ? 0.5291 0.3238 0.3568 0.0083  0.0053  -0.0409 136 THR A N   
965  C CA  . THR A 139 ? 0.5334 0.3216 0.3634 0.0016  0.0008  -0.0396 136 THR A CA  
966  C C   . THR A 139 ? 0.5195 0.3171 0.3511 -0.0077 -0.0055 -0.0396 136 THR A C   
967  O O   . THR A 139 ? 0.5152 0.3226 0.3444 -0.0085 -0.0070 -0.0410 136 THR A O   
968  C CB  . THR A 139 ? 0.5691 0.3343 0.3882 0.0010  0.0019  -0.0447 136 THR A CB  
969  O OG1 . THR A 139 ? 0.5743 0.3323 0.3800 -0.0024 -0.0001 -0.0520 136 THR A OG1 
970  C CG2 . THR A 139 ? 0.6002 0.3560 0.4179 0.0116  0.0088  -0.0446 136 THR A CG2 
971  N N   . TYR A 140 ? 0.5144 0.3093 0.3509 -0.0145 -0.0089 -0.0376 137 TYR A N   
972  C CA  . TYR A 140 ? 0.5055 0.3128 0.3487 -0.0227 -0.0143 -0.0358 137 TYR A CA  
973  C C   . TYR A 140 ? 0.5347 0.3306 0.3756 -0.0319 -0.0184 -0.0394 137 TYR A C   
974  O O   . TYR A 140 ? 0.5441 0.3244 0.3831 -0.0325 -0.0165 -0.0398 137 TYR A O   
975  C CB  . TYR A 140 ? 0.4836 0.3039 0.3394 -0.0220 -0.0135 -0.0281 137 TYR A CB  
976  C CG  . TYR A 140 ? 0.4529 0.2854 0.3124 -0.0140 -0.0106 -0.0252 137 TYR A CG  
977  C CD1 . TYR A 140 ? 0.4322 0.2596 0.2919 -0.0059 -0.0064 -0.0238 137 TYR A CD1 
978  C CD2 . TYR A 140 ? 0.4394 0.2875 0.3024 -0.0146 -0.0122 -0.0245 137 TYR A CD2 
979  C CE1 . TYR A 140 ? 0.4152 0.2544 0.2805 0.0007  -0.0041 -0.0217 137 TYR A CE1 
980  C CE2 . TYR A 140 ? 0.4125 0.2710 0.2800 -0.0081 -0.0094 -0.0223 137 TYR A CE2 
981  C CZ  . TYR A 140 ? 0.4074 0.2620 0.2769 -0.0008 -0.0055 -0.0210 137 TYR A CZ  
982  O OH  . TYR A 140 ? 0.4101 0.2760 0.2864 0.0049  -0.0031 -0.0191 137 TYR A OH  
983  N N   . PRO A 141 ? 0.5519 0.3556 0.3940 -0.0389 -0.0243 -0.0420 138 PRO A N   
984  C CA  . PRO A 141 ? 0.5806 0.3747 0.4223 -0.0484 -0.0293 -0.0463 138 PRO A CA  
985  C C   . PRO A 141 ? 0.5854 0.3833 0.4410 -0.0548 -0.0291 -0.0407 138 PRO A C   
986  O O   . PRO A 141 ? 0.5497 0.3632 0.4153 -0.0538 -0.0277 -0.0343 138 PRO A O   
987  C CB  . PRO A 141 ? 0.5812 0.3861 0.4210 -0.0522 -0.0362 -0.0501 138 PRO A CB  
988  C CG  . PRO A 141 ? 0.5636 0.3884 0.4110 -0.0479 -0.0346 -0.0440 138 PRO A CG  
989  C CD  . PRO A 141 ? 0.5387 0.3617 0.3855 -0.0390 -0.0271 -0.0400 138 PRO A CD  
990  N N   . LYS A 142 ? 0.6087 0.3919 0.4647 -0.0619 -0.0303 -0.0433 139 LYS A N   
991  C CA  . LYS A 142 ? 0.6122 0.3991 0.4820 -0.0691 -0.0295 -0.0379 139 LYS A CA  
992  C C   . LYS A 142 ? 0.5926 0.4001 0.4736 -0.0748 -0.0348 -0.0372 139 LYS A C   
993  O O   . LYS A 142 ? 0.5905 0.4008 0.4683 -0.0782 -0.0416 -0.0435 139 LYS A O   
994  C CB  . LYS A 142 ? 0.6457 0.4128 0.5150 -0.0770 -0.0301 -0.0416 139 LYS A CB  
995  C CG  . LYS A 142 ? 0.6788 0.4505 0.5641 -0.0871 -0.0300 -0.0372 139 LYS A CG  
996  C CD  . LYS A 142 ? 0.7191 0.4939 0.6103 -0.0834 -0.0222 -0.0270 139 LYS A CD  
997  C CE  . LYS A 142 ? 0.7502 0.5287 0.6570 -0.0935 -0.0205 -0.0223 139 LYS A CE  
998  N NZ  . LYS A 142 ? 0.7448 0.5480 0.6647 -0.0970 -0.0238 -0.0206 139 LYS A NZ  
999  N N   . ARG A 143 ? 0.5808 0.4026 0.4736 -0.0750 -0.0319 -0.0297 140 ARG A N   
1000 C CA  . ARG A 143 ? 0.5641 0.4062 0.4684 -0.0792 -0.0362 -0.0285 140 ARG A CA  
1001 C C   . ARG A 143 ? 0.5729 0.4244 0.4914 -0.0824 -0.0318 -0.0208 140 ARG A C   
1002 O O   . ARG A 143 ? 0.5769 0.4201 0.4941 -0.0799 -0.0253 -0.0157 140 ARG A O   
1003 C CB  . ARG A 143 ? 0.5445 0.3993 0.4435 -0.0714 -0.0374 -0.0284 140 ARG A CB  
1004 C CG  . ARG A 143 ? 0.4928 0.3523 0.3914 -0.0631 -0.0309 -0.0220 140 ARG A CG  
1005 C CD  . ARG A 143 ? 0.4465 0.3158 0.3396 -0.0557 -0.0316 -0.0226 140 ARG A CD  
1006 N NE  . ARG A 143 ? 0.3984 0.2849 0.2988 -0.0579 -0.0356 -0.0219 140 ARG A NE  
1007 C CZ  . ARG A 143 ? 0.4139 0.3146 0.3235 -0.0565 -0.0337 -0.0164 140 ARG A CZ  
1008 N NH1 . ARG A 143 ? 0.3946 0.3093 0.3100 -0.0579 -0.0376 -0.0164 140 ARG A NH1 
1009 N NH2 . ARG A 143 ? 0.3721 0.2726 0.2842 -0.0533 -0.0282 -0.0111 140 ARG A NH2 
1010 N N   . GLU A 144 ? 0.5837 0.4527 0.5152 -0.0871 -0.0350 -0.0196 141 GLU A N   
1011 C CA  . GLU A 144 ? 0.5870 0.4673 0.5303 -0.0876 -0.0295 -0.0119 141 GLU A CA  
1012 C C   . GLU A 144 ? 0.5599 0.4522 0.4992 -0.0785 -0.0279 -0.0088 141 GLU A C   
1013 O O   . GLU A 144 ? 0.5718 0.4745 0.5096 -0.0759 -0.0329 -0.0117 141 GLU A O   
1014 C CB  . GLU A 144 ? 0.6018 0.4950 0.5638 -0.0967 -0.0315 -0.0107 141 GLU A CB  
1015 C CG  . GLU A 144 ? 0.6549 0.5537 0.6230 -0.1034 -0.0411 -0.0176 141 GLU A CG  
1016 C CD  . GLU A 144 ? 0.7163 0.6309 0.7067 -0.1115 -0.0420 -0.0150 141 GLU A CD  
1017 O OE1 . GLU A 144 ? 0.7988 0.7113 0.7987 -0.1210 -0.0473 -0.0194 141 GLU A OE1 
1018 O OE2 . GLU A 144 ? 0.7629 0.6917 0.7617 -0.1084 -0.0370 -0.0087 141 GLU A OE2 
1019 N N   . GLY A 145 ? 0.5131 0.4025 0.4502 -0.0739 -0.0211 -0.0028 142 GLY A N   
1020 C CA  . GLY A 145 ? 0.4720 0.3711 0.4064 -0.0661 -0.0188 0.0007  142 GLY A CA  
1021 C C   . GLY A 145 ? 0.4470 0.3350 0.3683 -0.0581 -0.0171 0.0004  142 GLY A C   
1022 O O   . GLY A 145 ? 0.4299 0.3084 0.3435 -0.0569 -0.0196 -0.0046 142 GLY A O   
1023 N N   . PRO A 146 ? 0.3455 0.3028 0.3415 -0.0242 -0.0517 0.0139  143 PRO A N   
1024 C CA  . PRO A 146 ? 0.3292 0.2737 0.3060 -0.0201 -0.0469 0.0119  143 PRO A CA  
1025 C C   . PRO A 146 ? 0.3222 0.2654 0.2874 -0.0146 -0.0493 0.0117  143 PRO A C   
1026 O O   . PRO A 146 ? 0.3096 0.2614 0.2814 -0.0121 -0.0523 0.0148  143 PRO A O   
1027 C CB  . PRO A 146 ? 0.3477 0.2934 0.3287 -0.0174 -0.0370 0.0144  143 PRO A CB  
1028 C CG  . PRO A 146 ? 0.3526 0.3120 0.3526 -0.0174 -0.0353 0.0176  143 PRO A CG  
1029 C CD  . PRO A 146 ? 0.3495 0.3170 0.3628 -0.0226 -0.0435 0.0177  143 PRO A CD  
1030 N N   . VAL A 147 ? 0.3100 0.2420 0.2589 -0.0125 -0.0472 0.0086  144 VAL A N   
1031 C CA  . VAL A 147 ? 0.3175 0.2472 0.2556 -0.0077 -0.0459 0.0088  144 VAL A CA  
1032 C C   . VAL A 147 ? 0.3060 0.2344 0.2449 -0.0039 -0.0382 0.0094  144 VAL A C   
1033 O O   . VAL A 147 ? 0.3249 0.2474 0.2619 -0.0040 -0.0356 0.0077  144 VAL A O   
1034 C CB  . VAL A 147 ? 0.3270 0.2460 0.2476 -0.0083 -0.0481 0.0044  144 VAL A CB  
1035 C CG1 . VAL A 147 ? 0.3620 0.2784 0.2719 -0.0035 -0.0435 0.0051  144 VAL A CG1 
1036 C CG2 . VAL A 147 ? 0.3518 0.2707 0.2687 -0.0134 -0.0583 0.0030  144 VAL A CG2 
1037 N N   . ILE A 148 ? 0.2915 0.2247 0.2334 -0.0006 -0.0354 0.0119  145 ILE A N   
1038 C CA  . ILE A 148 ? 0.2918 0.2251 0.2357 0.0016  -0.0300 0.0122  145 ILE A CA  
1039 C C   . ILE A 148 ? 0.2901 0.2218 0.2287 0.0044  -0.0274 0.0120  145 ILE A C   
1040 O O   . ILE A 148 ? 0.3061 0.2395 0.2443 0.0053  -0.0274 0.0142  145 ILE A O   
1041 C CB  . ILE A 148 ? 0.2833 0.2221 0.2365 0.0019  -0.0275 0.0144  145 ILE A CB  
1042 C CG1 . ILE A 148 ? 0.2844 0.2258 0.2448 -0.0010 -0.0275 0.0150  145 ILE A CG1 
1043 C CG2 . ILE A 148 ? 0.2924 0.2293 0.2439 0.0032  -0.0235 0.0136  145 ILE A CG2 
1044 C CD1 . ILE A 148 ? 0.2968 0.2459 0.2699 -0.0001 -0.0257 0.0173  145 ILE A CD1 
1045 N N   . LEU A 149 ? 0.2879 0.2167 0.2242 0.0058  -0.0250 0.0100  146 LEU A N   
1046 C CA  . LEU A 149 ? 0.2920 0.2212 0.2274 0.0079  -0.0208 0.0097  146 LEU A CA  
1047 C C   . LEU A 149 ? 0.2867 0.2206 0.2308 0.0081  -0.0194 0.0104  146 LEU A C   
1048 O O   . LEU A 149 ? 0.2888 0.2230 0.2357 0.0081  -0.0215 0.0099  146 LEU A O   
1049 C CB  . LEU A 149 ? 0.3087 0.2332 0.2398 0.0099  -0.0185 0.0067  146 LEU A CB  
1050 C CG  . LEU A 149 ? 0.3179 0.2343 0.2375 0.0088  -0.0205 0.0040  146 LEU A CG  
1051 C CD1 . LEU A 149 ? 0.3299 0.2395 0.2458 0.0121  -0.0155 0.0001  146 LEU A CD1 
1052 C CD2 . LEU A 149 ? 0.3110 0.2257 0.2196 0.0071  -0.0223 0.0050  146 LEU A CD2 
1053 N N   . THR A 150 ? 0.2921 0.2283 0.2393 0.0078  -0.0164 0.0116  147 THR A N   
1054 C CA  . THR A 150 ? 0.2797 0.2194 0.2350 0.0064  -0.0162 0.0113  147 THR A CA  
1055 C C   . THR A 150 ? 0.2737 0.2177 0.2369 0.0063  -0.0123 0.0110  147 THR A C   
1056 O O   . THR A 150 ? 0.2768 0.2217 0.2445 0.0038  -0.0097 0.0119  147 THR A O   
1057 C CB  . THR A 150 ? 0.2834 0.2210 0.2388 0.0048  -0.0157 0.0124  147 THR A CB  
1058 O OG1 . THR A 150 ? 0.3145 0.2499 0.2686 0.0048  -0.0123 0.0150  147 THR A OG1 
1059 C CG2 . THR A 150 ? 0.2929 0.2289 0.2454 0.0053  -0.0179 0.0128  147 THR A CG2 
1060 N N   . PRO A 151 ? 0.2731 0.2200 0.2403 0.0089  -0.0115 0.0098  148 PRO A N   
1061 C CA  . PRO A 151 ? 0.2862 0.2399 0.2656 0.0091  -0.0064 0.0098  148 PRO A CA  
1062 C C   . PRO A 151 ? 0.2836 0.2460 0.2786 0.0069  -0.0108 0.0093  148 PRO A C   
1063 O O   . PRO A 151 ? 0.2951 0.2583 0.2903 0.0075  -0.0183 0.0088  148 PRO A O   
1064 C CB  . PRO A 151 ? 0.2813 0.2345 0.2613 0.0141  -0.0039 0.0082  148 PRO A CB  
1065 C CG  . PRO A 151 ? 0.2787 0.2272 0.2526 0.0154  -0.0112 0.0078  148 PRO A CG  
1066 C CD  . PRO A 151 ? 0.2738 0.2172 0.2363 0.0119  -0.0138 0.0086  148 PRO A CD  
1067 N N   . HIS A 152 ? 0.2897 0.2581 0.2967 0.0037  -0.0063 0.0098  149 HIS A N   
1068 C CA  . HIS A 152 ? 0.2977 0.2781 0.3254 0.0016  -0.0098 0.0091  149 HIS A CA  
1069 C C   . HIS A 152 ? 0.2986 0.2868 0.3386 0.0077  -0.0070 0.0093  149 HIS A C   
1070 O O   . HIS A 152 ? 0.3016 0.2841 0.3327 0.0120  0.0001  0.0092  149 HIS A O   
1071 C CB  . HIS A 152 ? 0.3170 0.3019 0.3573 -0.0042 -0.0037 0.0098  149 HIS A CB  
1072 C CG  . HIS A 152 ? 0.3845 0.3607 0.4166 -0.0101 -0.0057 0.0093  149 HIS A CG  
1073 N ND1 . HIS A 152 ? 0.4275 0.4044 0.4628 -0.0148 -0.0148 0.0064  149 HIS A ND1 
1074 C CD2 . HIS A 152 ? 0.4250 0.3908 0.4465 -0.0121 0.0006  0.0114  149 HIS A CD2 
1075 C CE1 . HIS A 152 ? 0.4681 0.4341 0.4949 -0.0190 -0.0129 0.0057  149 HIS A CE1 
1076 N NE2 . HIS A 152 ? 0.4550 0.4147 0.4749 -0.0171 -0.0038 0.0094  149 HIS A NE2 
1077 N N   . PRO A 153 ? 0.3046 0.3056 0.3656 0.0084  -0.0130 0.0094  150 PRO A N   
1078 C CA  . PRO A 153 ? 0.3065 0.3150 0.3824 0.0159  -0.0101 0.0100  150 PRO A CA  
1079 C C   . PRO A 153 ? 0.3052 0.3153 0.3868 0.0182  0.0059  0.0096  150 PRO A C   
1080 O O   . PRO A 153 ? 0.3210 0.3265 0.3988 0.0251  0.0119  0.0085  150 PRO A O   
1081 C CB  . PRO A 153 ? 0.3113 0.3362 0.4131 0.0148  -0.0201 0.0110  150 PRO A CB  
1082 C CG  . PRO A 153 ? 0.3129 0.3317 0.4000 0.0088  -0.0327 0.0103  150 PRO A CG  
1083 C CD  . PRO A 153 ? 0.3090 0.3157 0.3772 0.0034  -0.0251 0.0088  150 PRO A CD  
1084 N N   . GLY A 154 ? 0.3017 0.3156 0.3895 0.0121  0.0138  0.0102  151 GLY A N   
1085 C CA  . GLY A 154 ? 0.3089 0.3214 0.3963 0.0136  0.0306  0.0105  151 GLY A CA  
1086 C C   . GLY A 154 ? 0.3188 0.3129 0.3742 0.0162  0.0362  0.0095  151 GLY A C   
1087 O O   . GLY A 154 ? 0.3298 0.3198 0.3799 0.0209  0.0475  0.0079  151 GLY A O   
1088 N N   . GLU A 155 ? 0.3103 0.2933 0.3445 0.0132  0.0280  0.0100  152 GLU A N   
1089 C CA  . GLU A 155 ? 0.3121 0.2795 0.3179 0.0150  0.0297  0.0092  152 GLU A CA  
1090 C C   . GLU A 155 ? 0.3139 0.2765 0.3144 0.0212  0.0259  0.0060  152 GLU A C   
1091 O O   . GLU A 155 ? 0.3295 0.2811 0.3124 0.0238  0.0310  0.0037  152 GLU A O   
1092 C CB  . GLU A 155 ? 0.3129 0.2728 0.3040 0.0106  0.0217  0.0112  152 GLU A CB  
1093 C CG  . GLU A 155 ? 0.3182 0.2769 0.3096 0.0052  0.0273  0.0148  152 GLU A CG  
1094 C CD  . GLU A 155 ? 0.3145 0.2680 0.3000 0.0015  0.0197  0.0165  152 GLU A CD  
1095 O OE1 . GLU A 155 ? 0.3206 0.2764 0.3099 0.0015  0.0104  0.0145  152 GLU A OE1 
1096 O OE2 . GLU A 155 ? 0.3318 0.2780 0.3089 -0.0011 0.0240  0.0203  152 GLU A OE2 
1097 N N   . PHE A 156 ? 0.2923 0.2614 0.3062 0.0231  0.0165  0.0060  153 PHE A N   
1098 C CA  . PHE A 156 ? 0.3045 0.2681 0.3162 0.0292  0.0132  0.0041  153 PHE A CA  
1099 C C   . PHE A 156 ? 0.3299 0.2948 0.3513 0.0358  0.0246  0.0017  153 PHE A C   
1100 O O   . PHE A 156 ? 0.3472 0.2994 0.3553 0.0400  0.0282  -0.0015 153 PHE A O   
1101 C CB  . PHE A 156 ? 0.2931 0.2627 0.3160 0.0298  0.0007  0.0062  153 PHE A CB  
1102 C CG  . PHE A 156 ? 0.2998 0.2600 0.3165 0.0351  -0.0038 0.0059  153 PHE A CG  
1103 C CD1 . PHE A 156 ? 0.3456 0.3076 0.3765 0.0429  -0.0010 0.0056  153 PHE A CD1 
1104 C CD2 . PHE A 156 ? 0.3267 0.2759 0.3251 0.0322  -0.0102 0.0062  153 PHE A CD2 
1105 C CE1 . PHE A 156 ? 0.3235 0.2738 0.3481 0.0477  -0.0049 0.0058  153 PHE A CE1 
1106 C CE2 . PHE A 156 ? 0.3227 0.2617 0.3157 0.0359  -0.0137 0.0065  153 PHE A CE2 
1107 C CZ  . PHE A 156 ? 0.3441 0.2824 0.3490 0.0436  -0.0113 0.0064  153 PHE A CZ  
1108 N N   . PHE A 157 ? 0.3340 0.3136 0.3794 0.0364  0.0312  0.0029  154 PHE A N   
1109 C CA  . PHE A 157 ? 0.3545 0.3369 0.4117 0.0428  0.0458  0.0006  154 PHE A CA  
1110 C C   . PHE A 157 ? 0.3741 0.3402 0.4028 0.0420  0.0589  -0.0027 154 PHE A C   
1111 O O   . PHE A 157 ? 0.3895 0.3450 0.4094 0.0480  0.0675  -0.0072 154 PHE A O   
1112 C CB  . PHE A 157 ? 0.3444 0.3480 0.4351 0.0416  0.0511  0.0032  154 PHE A CB  
1113 C CG  . PHE A 157 ? 0.3967 0.4045 0.5004 0.0469  0.0702  0.0011  154 PHE A CG  
1114 C CD1 . PHE A 157 ? 0.4149 0.4181 0.5236 0.0573  0.0760  -0.0021 154 PHE A CD1 
1115 C CD2 . PHE A 157 ? 0.4402 0.4557 0.5521 0.0418  0.0838  0.0026  154 PHE A CD2 
1116 C CE1 . PHE A 157 ? 0.4403 0.4469 0.5616 0.0630  0.0957  -0.0048 154 PHE A CE1 
1117 C CE2 . PHE A 157 ? 0.4507 0.4703 0.5748 0.0467  0.1038  0.0007  154 PHE A CE2 
1118 C CZ  . PHE A 157 ? 0.4646 0.4801 0.5935 0.0576  0.1102  -0.0033 154 PHE A CZ  
1119 N N   . ARG A 158 ? 0.3698 0.3322 0.3822 0.0346  0.0598  -0.0005 155 ARG A N   
1120 C CA  . ARG A 158 ? 0.3962 0.3420 0.3771 0.0331  0.0687  -0.0025 155 ARG A CA  
1121 C C   . ARG A 158 ? 0.4042 0.3328 0.3596 0.0349  0.0617  -0.0069 155 ARG A C   
1122 O O   . ARG A 158 ? 0.4349 0.3491 0.3694 0.0373  0.0707  -0.0118 155 ARG A O   
1123 C CB  . ARG A 158 ? 0.3941 0.3382 0.3626 0.0253  0.0669  0.0024  155 ARG A CB  
1124 C CG  . ARG A 158 ? 0.4332 0.3615 0.3700 0.0237  0.0764  0.0021  155 ARG A CG  
1125 C CD  . ARG A 158 ? 0.4883 0.4177 0.4220 0.0173  0.0787  0.0089  155 ARG A CD  
1126 N NE  . ARG A 158 ? 0.4478 0.3729 0.3711 0.0139  0.0636  0.0119  155 ARG A NE  
1127 C CZ  . ARG A 158 ? 0.4525 0.3834 0.3876 0.0096  0.0580  0.0166  155 ARG A CZ  
1128 N NH1 . ARG A 158 ? 0.4749 0.4171 0.4342 0.0065  0.0641  0.0188  155 ARG A NH1 
1129 N NH2 . ARG A 158 ? 0.3808 0.3060 0.3046 0.0080  0.0463  0.0188  155 ARG A NH2 
1130 N N   . MET A 159 ? 0.3956 0.3247 0.3524 0.0333  0.0466  -0.0056 156 MET A N   
1131 C CA  . MET A 159 ? 0.3938 0.3081 0.3304 0.0333  0.0387  -0.0090 156 MET A CA  
1132 C C   . MET A 159 ? 0.4155 0.3221 0.3559 0.0402  0.0424  -0.0141 156 MET A C   
1133 O O   . MET A 159 ? 0.4312 0.3211 0.3505 0.0402  0.0429  -0.0193 156 MET A O   
1134 C CB  . MET A 159 ? 0.3825 0.3005 0.3225 0.0295  0.0238  -0.0057 156 MET A CB  
1135 C CG  . MET A 159 ? 0.3778 0.2986 0.3103 0.0233  0.0187  -0.0016 156 MET A CG  
1136 S SD  . MET A 159 ? 0.3914 0.3210 0.3379 0.0209  0.0064  0.0019  156 MET A SD  
1137 C CE  . MET A 159 ? 0.3988 0.3188 0.3392 0.0227  0.0000  -0.0007 156 MET A CE  
1138 N N   . THR A 160 ? 0.3993 0.3175 0.3671 0.0460  0.0443  -0.0126 157 THR A N   
1139 C CA  . THR A 160 ? 0.4048 0.3161 0.3804 0.0534  0.0441  -0.0152 157 THR A CA  
1140 C C   . THR A 160 ? 0.4225 0.3383 0.4176 0.0625  0.0580  -0.0176 157 THR A C   
1141 O O   . THR A 160 ? 0.4414 0.3465 0.4390 0.0700  0.0608  -0.0210 157 THR A O   
1142 C CB  . THR A 160 ? 0.3890 0.3086 0.3811 0.0540  0.0299  -0.0098 157 THR A CB  
1143 O OG1 . THR A 160 ? 0.3754 0.3158 0.3947 0.0551  0.0291  -0.0053 157 THR A OG1 
1144 C CG2 . THR A 160 ? 0.3781 0.2932 0.3532 0.0457  0.0181  -0.0077 157 THR A CG2 
1145 N N   . GLY A 161 ? 0.4178 0.3493 0.4293 0.0623  0.0673  -0.0156 158 GLY A N   
1146 C CA  . GLY A 161 ? 0.4338 0.3764 0.4742 0.0710  0.0798  -0.0163 158 GLY A CA  
1147 C C   . GLY A 161 ? 0.4188 0.3791 0.4957 0.0767  0.0698  -0.0111 158 GLY A C   
1148 O O   . GLY A 161 ? 0.4307 0.4027 0.5370 0.0851  0.0786  -0.0110 158 GLY A O   
1149 N N   . VAL A 162 ? 0.3969 0.3595 0.4725 0.0727  0.0515  -0.0066 159 VAL A N   
1150 C CA  . VAL A 162 ? 0.3853 0.3650 0.4920 0.0769  0.0394  -0.0007 159 VAL A CA  
1151 C C   . VAL A 162 ? 0.3715 0.3755 0.5033 0.0717  0.0389  0.0026  159 VAL A C   
1152 O O   . VAL A 162 ? 0.3603 0.3660 0.4799 0.0617  0.0331  0.0039  159 VAL A O   
1153 C CB  . VAL A 162 ? 0.3797 0.3517 0.4717 0.0732  0.0211  0.0029  159 VAL A CB  
1154 C CG1 . VAL A 162 ? 0.3698 0.3579 0.4888 0.0769  0.0070  0.0095  159 VAL A CG1 
1155 C CG2 . VAL A 162 ? 0.3931 0.3404 0.4617 0.0766  0.0216  0.0000  159 VAL A CG2 
1156 N N   . PRO A 163 ? 0.3868 0.4098 0.5556 0.0781  0.0451  0.0040  160 PRO A N   
1157 C CA  . PRO A 163 ? 0.3766 0.4229 0.5713 0.0715  0.0452  0.0068  160 PRO A CA  
1158 C C   . PRO A 163 ? 0.3584 0.4131 0.5557 0.0641  0.0237  0.0111  160 PRO A C   
1159 O O   . PRO A 163 ? 0.3332 0.3825 0.5255 0.0679  0.0092  0.0136  160 PRO A O   
1160 C CB  . PRO A 163 ? 0.3876 0.4540 0.6264 0.0813  0.0534  0.0079  160 PRO A CB  
1161 C CG  . PRO A 163 ? 0.4141 0.4632 0.6437 0.0933  0.0643  0.0041  160 PRO A CG  
1162 C CD  . PRO A 163 ? 0.3992 0.4235 0.5902 0.0916  0.0525  0.0032  160 PRO A CD  
1163 N N   . VAL A 164 ? 0.3546 0.4199 0.5574 0.0536  0.0229  0.0118  161 VAL A N   
1164 C CA  . VAL A 164 ? 0.3526 0.4220 0.5522 0.0452  0.0044  0.0141  161 VAL A CA  
1165 C C   . VAL A 164 ? 0.3501 0.4362 0.5777 0.0490  -0.0126 0.0179  161 VAL A C   
1166 O O   . VAL A 164 ? 0.3384 0.4183 0.5511 0.0471  -0.0299 0.0199  161 VAL A O   
1167 C CB  . VAL A 164 ? 0.3570 0.4334 0.5606 0.0333  0.0087  0.0135  161 VAL A CB  
1168 C CG1 . VAL A 164 ? 0.3533 0.4343 0.5571 0.0251  -0.0101 0.0145  161 VAL A CG1 
1169 C CG2 . VAL A 164 ? 0.3639 0.4204 0.5328 0.0292  0.0209  0.0113  161 VAL A CG2 
1170 N N   . ASN A 165 ? 0.3617 0.4691 0.6298 0.0545  -0.0082 0.0195  162 ASN A N   
1171 C CA  . ASN A 165 ? 0.3732 0.4983 0.6706 0.0588  -0.0265 0.0242  162 ASN A CA  
1172 C C   . ASN A 165 ? 0.3817 0.4925 0.6644 0.0696  -0.0368 0.0274  162 ASN A C   
1173 O O   . ASN A 165 ? 0.3952 0.5107 0.6817 0.0703  -0.0571 0.0320  162 ASN A O   
1174 C CB  . ASN A 165 ? 0.3839 0.5383 0.7343 0.0628  -0.0198 0.0258  162 ASN A CB  
1175 C CG  . ASN A 165 ? 0.4284 0.5816 0.7932 0.0771  -0.0015 0.0251  162 ASN A CG  
1176 O OD1 . ASN A 165 ? 0.5232 0.6521 0.8556 0.0816  0.0098  0.0219  162 ASN A OD1 
1177 N ND2 . ASN A 165 ? 0.4998 0.6795 0.9149 0.0840  0.0015  0.0277  162 ASN A ND2 
1178 N N   . GLU A 166 ? 0.3781 0.4696 0.6416 0.0772  -0.0233 0.0251  163 GLU A N   
1179 C CA  . GLU A 166 ? 0.3827 0.4564 0.6296 0.0862  -0.0311 0.0279  163 GLU A CA  
1180 C C   . GLU A 166 ? 0.3688 0.4211 0.5724 0.0784  -0.0407 0.0279  163 GLU A C   
1181 O O   . GLU A 166 ? 0.3548 0.3999 0.5478 0.0803  -0.0565 0.0329  163 GLU A O   
1182 C CB  . GLU A 166 ? 0.4043 0.4637 0.6472 0.0961  -0.0119 0.0240  163 GLU A CB  
1183 C CG  . GLU A 166 ? 0.4604 0.4960 0.6822 0.1039  -0.0168 0.0258  163 GLU A CG  
1184 C CD  . GLU A 166 ? 0.5253 0.5685 0.7680 0.1127  -0.0347 0.0344  163 GLU A CD  
1185 O OE1 . GLU A 166 ? 0.5513 0.5754 0.7695 0.1137  -0.0456 0.0384  163 GLU A OE1 
1186 O OE2 . GLU A 166 ? 0.5521 0.6202 0.8363 0.1185  -0.0377 0.0377  163 GLU A OE2 
1187 N N   . LEU A 167 ? 0.3521 0.3946 0.5317 0.0696  -0.0305 0.0227  164 LEU A N   
1188 C CA  . LEU A 167 ? 0.3430 0.3680 0.4859 0.0618  -0.0367 0.0220  164 LEU A CA  
1189 C C   . LEU A 167 ? 0.3514 0.3829 0.4930 0.0562  -0.0553 0.0258  164 LEU A C   
1190 O O   . LEU A 167 ? 0.3447 0.3625 0.4632 0.0555  -0.0649 0.0284  164 LEU A O   
1191 C CB  . LEU A 167 ? 0.3380 0.3584 0.4646 0.0531  -0.0250 0.0170  164 LEU A CB  
1192 C CG  . LEU A 167 ? 0.3223 0.3282 0.4166 0.0450  -0.0304 0.0162  164 LEU A CG  
1193 C CD1 . LEU A 167 ? 0.3179 0.3045 0.3896 0.0487  -0.0321 0.0169  164 LEU A CD1 
1194 C CD2 . LEU A 167 ? 0.3143 0.3175 0.3969 0.0375  -0.0197 0.0126  164 LEU A CD2 
1195 N N   . GLN A 168 ? 0.3591 0.4111 0.5252 0.0515  -0.0602 0.0258  165 GLN A N   
1196 C CA  . GLN A 168 ? 0.3697 0.4257 0.5295 0.0433  -0.0769 0.0270  165 GLN A CA  
1197 C C   . GLN A 168 ? 0.3830 0.4410 0.5469 0.0493  -0.0954 0.0335  165 GLN A C   
1198 O O   . GLN A 168 ? 0.4027 0.4574 0.5505 0.0432  -0.1101 0.0347  165 GLN A O   
1199 C CB  . GLN A 168 ? 0.3672 0.4422 0.5506 0.0344  -0.0766 0.0242  165 GLN A CB  
1200 C CG  . GLN A 168 ? 0.3677 0.4344 0.5358 0.0261  -0.0617 0.0191  165 GLN A CG  
1201 C CD  . GLN A 168 ? 0.3794 0.4278 0.5112 0.0187  -0.0666 0.0170  165 GLN A CD  
1202 O OE1 . GLN A 168 ? 0.3402 0.3714 0.4458 0.0213  -0.0617 0.0168  165 GLN A OE1 
1203 N NE2 . GLN A 168 ? 0.4204 0.4726 0.5522 0.0092  -0.0760 0.0149  165 GLN A NE2 
1204 N N   . LYS A 169 ? 0.3765 0.4373 0.5589 0.0616  -0.0943 0.0377  166 LYS A N   
1205 C CA  . LYS A 169 ? 0.4004 0.4595 0.5843 0.0691  -0.1115 0.0455  166 LYS A CA  
1206 C C   . LYS A 169 ? 0.4035 0.4350 0.5488 0.0711  -0.1130 0.0485  166 LYS A C   
1207 O O   . LYS A 169 ? 0.4249 0.4503 0.5608 0.0744  -0.1286 0.0557  166 LYS A O   
1208 C CB  . LYS A 169 ? 0.4077 0.4789 0.6288 0.0832  -0.1085 0.0495  166 LYS A CB  
1209 C CG  . LYS A 169 ? 0.4212 0.5224 0.6880 0.0833  -0.1057 0.0480  166 LYS A CG  
1210 C CD  . LYS A 169 ? 0.4514 0.5616 0.7534 0.0990  -0.0993 0.0515  166 LYS A CD  
1211 C CE  . LYS A 169 ? 0.4598 0.6014 0.8116 0.0997  -0.0927 0.0500  166 LYS A CE  
1212 N NZ  . LYS A 169 ? 0.4886 0.6382 0.8758 0.1167  -0.0850 0.0534  166 LYS A NZ  
1213 N N   . LYS A 170 ? 0.3878 0.4028 0.5126 0.0693  -0.0969 0.0436  167 LYS A N   
1214 C CA  . LYS A 170 ? 0.4045 0.3940 0.4978 0.0709  -0.0955 0.0461  167 LYS A CA  
1215 C C   . LYS A 170 ? 0.3828 0.3602 0.4499 0.0616  -0.0838 0.0396  167 LYS A C   
1216 O O   . LYS A 170 ? 0.3796 0.3429 0.4361 0.0634  -0.0725 0.0370  167 LYS A O   
1217 C CB  . LYS A 170 ? 0.4220 0.4023 0.5264 0.0832  -0.0877 0.0481  167 LYS A CB  
1218 C CG  . LYS A 170 ? 0.4747 0.4664 0.6092 0.0951  -0.0978 0.0553  167 LYS A CG  
1219 C CD  . LYS A 170 ? 0.5387 0.5123 0.6749 0.1074  -0.0913 0.0583  167 LYS A CD  
1220 C CE  . LYS A 170 ? 0.5739 0.5371 0.7066 0.1081  -0.0697 0.0491  167 LYS A CE  
1221 N NZ  . LYS A 170 ? 0.6218 0.5658 0.7580 0.1203  -0.0626 0.0504  167 LYS A NZ  
1222 N N   . ARG A 171 ? 0.3536 0.3367 0.4118 0.0517  -0.0871 0.0366  168 ARG A N   
1223 C CA  . ARG A 171 ? 0.3434 0.3194 0.3845 0.0440  -0.0757 0.0305  168 ARG A CA  
1224 C C   . ARG A 171 ? 0.3455 0.3007 0.3591 0.0429  -0.0715 0.0312  168 ARG A C   
1225 O O   . ARG A 171 ? 0.3281 0.2767 0.3365 0.0422  -0.0603 0.0273  168 ARG A O   
1226 C CB  . ARG A 171 ? 0.3434 0.3259 0.3787 0.0344  -0.0807 0.0277  168 ARG A CB  
1227 C CG  . ARG A 171 ? 0.3405 0.3431 0.4035 0.0322  -0.0814 0.0253  168 ARG A CG  
1228 C CD  . ARG A 171 ? 0.3452 0.3512 0.4011 0.0225  -0.0907 0.0230  168 ARG A CD  
1229 N NE  . ARG A 171 ? 0.3345 0.3250 0.3611 0.0161  -0.0859 0.0197  168 ARG A NE  
1230 C CZ  . ARG A 171 ? 0.3320 0.3203 0.3558 0.0117  -0.0746 0.0154  168 ARG A CZ  
1231 N NH1 . ARG A 171 ? 0.3419 0.3400 0.3858 0.0123  -0.0655 0.0139  168 ARG A NH1 
1232 N NH2 . ARG A 171 ? 0.3325 0.3078 0.3329 0.0072  -0.0712 0.0131  168 ARG A NH2 
1233 N N   . ALA A 172 ? 0.3659 0.3108 0.3620 0.0422  -0.0807 0.0363  169 ALA A N   
1234 C CA  . ALA A 172 ? 0.3846 0.3108 0.3566 0.0396  -0.0757 0.0375  169 ALA A CA  
1235 C C   . ALA A 172 ? 0.3844 0.2995 0.3605 0.0464  -0.0698 0.0388  169 ALA A C   
1236 O O   . ALA A 172 ? 0.3902 0.2947 0.3557 0.0432  -0.0612 0.0359  169 ALA A O   
1237 C CB  . ALA A 172 ? 0.3926 0.3089 0.3424 0.0367  -0.0852 0.0433  169 ALA A CB  
1238 N N   . GLU A 173 ? 0.3960 0.3135 0.3886 0.0556  -0.0745 0.0429  170 GLU A N   
1239 C CA  . GLU A 173 ? 0.4075 0.3121 0.4044 0.0628  -0.0680 0.0433  170 GLU A CA  
1240 C C   . GLU A 173 ? 0.3840 0.2902 0.3863 0.0617  -0.0545 0.0344  170 GLU A C   
1241 O O   . GLU A 173 ? 0.3780 0.2686 0.3684 0.0601  -0.0473 0.0314  170 GLU A O   
1242 C CB  . GLU A 173 ? 0.4357 0.3448 0.4544 0.0746  -0.0746 0.0489  170 GLU A CB  
1243 C CG  . GLU A 173 ? 0.5268 0.4188 0.5488 0.0829  -0.0672 0.0490  170 GLU A CG  
1244 C CD  . GLU A 173 ? 0.6293 0.5272 0.6775 0.0963  -0.0724 0.0544  170 GLU A CD  
1245 O OE1 . GLU A 173 ? 0.7008 0.5957 0.7645 0.1042  -0.0617 0.0500  170 GLU A OE1 
1246 O OE2 . GLU A 173 ? 0.6649 0.5705 0.7179 0.0989  -0.0873 0.0629  170 GLU A OE2 
1247 N N   . TYR A 174 ? 0.3613 0.2855 0.3799 0.0615  -0.0513 0.0303  171 TYR A N   
1248 C CA  . TYR A 174 ? 0.3436 0.2682 0.3631 0.0600  -0.0383 0.0226  171 TYR A CA  
1249 C C   . TYR A 174 ? 0.3390 0.2569 0.3370 0.0502  -0.0349 0.0190  171 TYR A C   
1250 O O   . TYR A 174 ? 0.3589 0.2660 0.3469 0.0489  -0.0276 0.0144  171 TYR A O   
1251 C CB  . TYR A 174 ? 0.3337 0.2783 0.3752 0.0613  -0.0343 0.0202  171 TYR A CB  
1252 C CG  . TYR A 174 ? 0.3644 0.3160 0.4319 0.0723  -0.0311 0.0212  171 TYR A CG  
1253 C CD1 . TYR A 174 ? 0.4106 0.3501 0.4780 0.0789  -0.0193 0.0170  171 TYR A CD1 
1254 C CD2 . TYR A 174 ? 0.3791 0.3493 0.4724 0.0762  -0.0400 0.0261  171 TYR A CD2 
1255 C CE1 . TYR A 174 ? 0.4213 0.3665 0.5141 0.0902  -0.0143 0.0175  171 TYR A CE1 
1256 C CE2 . TYR A 174 ? 0.3953 0.3743 0.5175 0.0873  -0.0364 0.0273  171 TYR A CE2 
1257 C CZ  . TYR A 174 ? 0.4337 0.3997 0.5555 0.0947  -0.0225 0.0230  171 TYR A CZ  
1258 O OH  . TYR A 174 ? 0.4383 0.4119 0.5899 0.1069  -0.0167 0.0238  171 TYR A OH  
1259 N N   . ALA A 175 ? 0.3320 0.2559 0.3231 0.0436  -0.0408 0.0208  172 ALA A N   
1260 C CA  . ALA A 175 ? 0.3329 0.2525 0.3080 0.0356  -0.0378 0.0182  172 ALA A CA  
1261 C C   . ALA A 175 ? 0.3507 0.2534 0.3114 0.0339  -0.0368 0.0189  172 ALA A C   
1262 O O   . ALA A 175 ? 0.3527 0.2500 0.3058 0.0300  -0.0320 0.0151  172 ALA A O   
1263 C CB  . ALA A 175 ? 0.3243 0.2508 0.2946 0.0299  -0.0435 0.0199  172 ALA A CB  
1264 N N   . LYS A 176 ? 0.3676 0.2617 0.3246 0.0364  -0.0422 0.0244  173 LYS A N   
1265 C CA  . LYS A 176 ? 0.3836 0.2603 0.3280 0.0339  -0.0409 0.0262  173 LYS A CA  
1266 C C   . LYS A 176 ? 0.3920 0.2575 0.3383 0.0368  -0.0349 0.0215  173 LYS A C   
1267 O O   . LYS A 176 ? 0.4067 0.2629 0.3443 0.0312  -0.0315 0.0182  173 LYS A O   
1268 C CB  . LYS A 176 ? 0.4168 0.2848 0.3561 0.0369  -0.0476 0.0343  173 LYS A CB  
1269 C CG  . LYS A 176 ? 0.4634 0.3351 0.3912 0.0317  -0.0522 0.0382  173 LYS A CG  
1270 C CD  . LYS A 176 ? 0.5484 0.4080 0.4653 0.0344  -0.0591 0.0473  173 LYS A CD  
1271 C CE  . LYS A 176 ? 0.5712 0.4112 0.4760 0.0309  -0.0539 0.0505  173 LYS A CE  
1272 N NZ  . LYS A 176 ? 0.6605 0.4899 0.5745 0.0364  -0.0514 0.0494  173 LYS A NZ  
1273 N N   . GLU A 177 ? 0.3940 0.2608 0.3528 0.0456  -0.0336 0.0208  174 GLU A N   
1274 C CA  . GLU A 177 ? 0.4252 0.2794 0.3846 0.0497  -0.0265 0.0153  174 GLU A CA  
1275 C C   . GLU A 177 ? 0.4061 0.2618 0.3580 0.0441  -0.0201 0.0070  174 GLU A C   
1276 O O   . GLU A 177 ? 0.4129 0.2535 0.3538 0.0409  -0.0169 0.0021  174 GLU A O   
1277 C CB  . GLU A 177 ? 0.4346 0.2941 0.4127 0.0612  -0.0250 0.0163  174 GLU A CB  
1278 C CG  . GLU A 177 ? 0.5238 0.3775 0.5072 0.0672  -0.0146 0.0090  174 GLU A CG  
1279 C CD  . GLU A 177 ? 0.6022 0.4651 0.6100 0.0792  -0.0144 0.0126  174 GLU A CD  
1280 O OE1 . GLU A 177 ? 0.6941 0.5457 0.7069 0.0864  -0.0184 0.0178  174 GLU A OE1 
1281 O OE2 . GLU A 177 ? 0.6454 0.5278 0.6689 0.0812  -0.0112 0.0112  174 GLU A OE2 
1282 N N   . TRP A 178 ? 0.3747 0.2474 0.3311 0.0423  -0.0191 0.0059  175 TRP A N   
1283 C CA  . TRP A 178 ? 0.3700 0.2440 0.3179 0.0379  -0.0138 -0.0002 175 TRP A CA  
1284 C C   . TRP A 178 ? 0.3524 0.2253 0.2882 0.0284  -0.0178 -0.0003 175 TRP A C   
1285 O O   . TRP A 178 ? 0.3660 0.2324 0.2910 0.0244  -0.0159 -0.0053 175 TRP A O   
1286 C CB  . TRP A 178 ? 0.3640 0.2544 0.3223 0.0402  -0.0097 -0.0006 175 TRP A CB  
1287 C CG  . TRP A 178 ? 0.3841 0.2729 0.3526 0.0488  -0.0015 -0.0036 175 TRP A CG  
1288 C CD1 . TRP A 178 ? 0.4102 0.3060 0.3990 0.0570  -0.0019 -0.0002 175 TRP A CD1 
1289 C CD2 . TRP A 178 ? 0.4261 0.3051 0.3848 0.0503  0.0086  -0.0107 175 TRP A CD2 
1290 N NE1 . TRP A 178 ? 0.4521 0.3442 0.4477 0.0643  0.0089  -0.0049 175 TRP A NE1 
1291 C CE2 . TRP A 178 ? 0.4466 0.3271 0.4216 0.0601  0.0164  -0.0118 175 TRP A CE2 
1292 C CE3 . TRP A 178 ? 0.4627 0.3314 0.3996 0.0445  0.0114  -0.0162 175 TRP A CE3 
1293 C CZ2 . TRP A 178 ? 0.5098 0.3803 0.4783 0.0643  0.0293  -0.0190 175 TRP A CZ2 
1294 C CZ3 . TRP A 178 ? 0.4926 0.3505 0.4196 0.0478  0.0223  -0.0233 175 TRP A CZ3 
1295 C CH2 . TRP A 178 ? 0.5084 0.3664 0.4503 0.0576  0.0323  -0.0250 175 TRP A CH2 
1296 N N   . ALA A 179 ? 0.3390 0.2169 0.2762 0.0251  -0.0232 0.0050  176 ALA A N   
1297 C CA  . ALA A 179 ? 0.3387 0.2159 0.2687 0.0170  -0.0255 0.0053  176 ALA A CA  
1298 C C   . ALA A 179 ? 0.3587 0.2196 0.2818 0.0137  -0.0256 0.0031  176 ALA A C   
1299 O O   . ALA A 179 ? 0.3654 0.2244 0.2833 0.0073  -0.0266 -0.0002 176 ALA A O   
1300 C CB  . ALA A 179 ? 0.3378 0.2214 0.2695 0.0146  -0.0289 0.0112  176 ALA A CB  
1301 N N   . ALA A 180 ? 0.3662 0.2148 0.2900 0.0177  -0.0253 0.0051  177 ALA A N   
1302 C CA  . ALA A 180 ? 0.3871 0.2166 0.3046 0.0143  -0.0248 0.0029  177 ALA A CA  
1303 C C   . ALA A 180 ? 0.3922 0.2132 0.3028 0.0144  -0.0216 -0.0062 177 ALA A C   
1304 O O   . ALA A 180 ? 0.3950 0.2075 0.2980 0.0068  -0.0233 -0.0108 177 ALA A O   
1305 C CB  . ALA A 180 ? 0.4004 0.2163 0.3199 0.0202  -0.0250 0.0083  177 ALA A CB  
1306 N N   . GLN A 181 ? 0.3970 0.2200 0.3100 0.0227  -0.0169 -0.0091 178 GLN A N   
1307 C CA  . GLN A 181 ? 0.4275 0.2394 0.3303 0.0237  -0.0117 -0.0181 178 GLN A CA  
1308 C C   . GLN A 181 ? 0.4214 0.2396 0.3130 0.0164  -0.0137 -0.0224 178 GLN A C   
1309 O O   . GLN A 181 ? 0.4368 0.2413 0.3136 0.0119  -0.0140 -0.0298 178 GLN A O   
1310 C CB  . GLN A 181 ? 0.4502 0.2651 0.3609 0.0348  -0.0038 -0.0194 178 GLN A CB  
1311 C CG  . GLN A 181 ? 0.5209 0.3243 0.4186 0.0368  0.0047  -0.0292 178 GLN A CG  
1312 C CD  . GLN A 181 ? 0.6044 0.4121 0.5145 0.0484  0.0151  -0.0301 178 GLN A CD  
1313 O OE1 . GLN A 181 ? 0.6560 0.4690 0.5855 0.0563  0.0147  -0.0244 178 GLN A OE1 
1314 N NE2 . GLN A 181 ? 0.6622 0.4674 0.5612 0.0495  0.0246  -0.0371 178 GLN A NE2 
1315 N N   . LEU A 182 ? 0.3936 0.2309 0.2910 0.0154  -0.0158 -0.0178 179 LEU A N   
1316 C CA  . LEU A 182 ? 0.3881 0.2322 0.2764 0.0098  -0.0186 -0.0197 179 LEU A CA  
1317 C C   . LEU A 182 ? 0.3822 0.2292 0.2712 0.0008  -0.0270 -0.0178 179 LEU A C   
1318 O O   . LEU A 182 ? 0.3844 0.2335 0.2651 -0.0044 -0.0318 -0.0201 179 LEU A O   
1319 C CB  . LEU A 182 ? 0.3687 0.2300 0.2638 0.0129  -0.0164 -0.0154 179 LEU A CB  
1320 C CG  . LEU A 182 ? 0.3996 0.2626 0.2983 0.0207  -0.0073 -0.0167 179 LEU A CG  
1321 C CD1 . LEU A 182 ? 0.3857 0.2661 0.2940 0.0215  -0.0062 -0.0117 179 LEU A CD1 
1322 C CD2 . LEU A 182 ? 0.4215 0.2714 0.3020 0.0212  -0.0013 -0.0242 179 LEU A CD2 
1323 N N   . GLN A 183 ? 0.3808 0.2279 0.2798 -0.0008 -0.0287 -0.0132 180 GLN A N   
1324 C CA  . GLN A 183 ? 0.3716 0.2256 0.2773 -0.0086 -0.0340 -0.0098 180 GLN A CA  
1325 C C   . GLN A 183 ? 0.3600 0.2324 0.2714 -0.0092 -0.0361 -0.0063 180 GLN A C   
1326 O O   . GLN A 183 ? 0.3532 0.2316 0.2663 -0.0147 -0.0413 -0.0067 180 GLN A O   
1327 C CB  . GLN A 183 ? 0.3957 0.2388 0.2960 -0.0170 -0.0388 -0.0149 180 GLN A CB  
1328 C CG  . GLN A 183 ? 0.3972 0.2212 0.2960 -0.0181 -0.0365 -0.0162 180 GLN A CG  
1329 C CD  . GLN A 183 ? 0.3727 0.1999 0.2824 -0.0193 -0.0348 -0.0082 180 GLN A CD  
1330 O OE1 . GLN A 183 ? 0.3891 0.2229 0.3070 -0.0272 -0.0371 -0.0054 180 GLN A OE1 
1331 N NE2 . GLN A 183 ? 0.3603 0.1823 0.2702 -0.0114 -0.0307 -0.0041 180 GLN A NE2 
1332 N N   . THR A 184 ? 0.3467 0.2272 0.2622 -0.0032 -0.0324 -0.0030 181 THR A N   
1333 C CA  . THR A 184 ? 0.3431 0.2381 0.2644 -0.0027 -0.0328 0.0004  181 THR A CA  
1334 C C   . THR A 184 ? 0.3345 0.2343 0.2630 -0.0004 -0.0304 0.0049  181 THR A C   
1335 O O   . THR A 184 ? 0.3352 0.2290 0.2631 0.0028  -0.0290 0.0057  181 THR A O   
1336 C CB  . THR A 184 ? 0.3454 0.2438 0.2616 0.0014  -0.0304 -0.0008 181 THR A CB  
1337 O OG1 . THR A 184 ? 0.3819 0.2784 0.2999 0.0071  -0.0254 -0.0011 181 THR A OG1 
1338 C CG2 . THR A 184 ? 0.3479 0.2386 0.2507 -0.0006 -0.0324 -0.0054 181 THR A CG2 
1339 N N   . VAL A 185 ? 0.3155 0.2254 0.2496 -0.0014 -0.0303 0.0076  182 VAL A N   
1340 C CA  . VAL A 185 ? 0.3127 0.2263 0.2493 0.0006  -0.0282 0.0105  182 VAL A CA  
1341 C C   . VAL A 185 ? 0.3108 0.2277 0.2476 0.0051  -0.0273 0.0094  182 VAL A C   
1342 O O   . VAL A 185 ? 0.3261 0.2457 0.2620 0.0055  -0.0266 0.0080  182 VAL A O   
1343 C CB  . VAL A 185 ? 0.3063 0.2275 0.2482 -0.0015 -0.0267 0.0124  182 VAL A CB  
1344 C CG1 . VAL A 185 ? 0.3186 0.2405 0.2584 -0.0001 -0.0244 0.0139  182 VAL A CG1 
1345 C CG2 . VAL A 185 ? 0.3059 0.2269 0.2525 -0.0065 -0.0265 0.0135  182 VAL A CG2 
1346 N N   . ILE A 186 ? 0.3088 0.2254 0.2470 0.0079  -0.0275 0.0106  183 ILE A N   
1347 C CA  . ILE A 186 ? 0.3044 0.2273 0.2477 0.0109  -0.0267 0.0101  183 ILE A CA  
1348 C C   . ILE A 186 ? 0.3073 0.2345 0.2523 0.0100  -0.0287 0.0117  183 ILE A C   
1349 O O   . ILE A 186 ? 0.3057 0.2295 0.2475 0.0104  -0.0319 0.0137  183 ILE A O   
1350 C CB  . ILE A 186 ? 0.3104 0.2312 0.2576 0.0157  -0.0260 0.0092  183 ILE A CB  
1351 C CG1 . ILE A 186 ? 0.3295 0.2428 0.2712 0.0165  -0.0229 0.0059  183 ILE A CG1 
1352 C CG2 . ILE A 186 ? 0.3219 0.2525 0.2796 0.0180  -0.0244 0.0090  183 ILE A CG2 
1353 C CD1 . ILE A 186 ? 0.3448 0.2546 0.2909 0.0223  -0.0195 0.0041  183 ILE A CD1 
1354 N N   . VAL A 187 ? 0.2877 0.2202 0.2354 0.0084  -0.0271 0.0108  184 VAL A N   
1355 C CA  . VAL A 187 ? 0.2762 0.2115 0.2250 0.0067  -0.0290 0.0105  184 VAL A CA  
1356 C C   . VAL A 187 ? 0.2762 0.2184 0.2356 0.0080  -0.0296 0.0098  184 VAL A C   
1357 O O   . VAL A 187 ? 0.2728 0.2180 0.2370 0.0073  -0.0256 0.0092  184 VAL A O   
1358 C CB  . VAL A 187 ? 0.2778 0.2127 0.2250 0.0042  -0.0258 0.0096  184 VAL A CB  
1359 C CG1 . VAL A 187 ? 0.2858 0.2205 0.2321 0.0018  -0.0274 0.0077  184 VAL A CG1 
1360 C CG2 . VAL A 187 ? 0.2861 0.2176 0.2287 0.0033  -0.0234 0.0105  184 VAL A CG2 
1361 N N   . LEU A 188 ? 0.2830 0.2276 0.2469 0.0101  -0.0345 0.0108  185 LEU A N   
1362 C CA  . LEU A 188 ? 0.2808 0.2348 0.2601 0.0118  -0.0355 0.0106  185 LEU A CA  
1363 C C   . LEU A 188 ? 0.2741 0.2327 0.2567 0.0073  -0.0411 0.0096  185 LEU A C   
1364 O O   . LEU A 188 ? 0.3030 0.2603 0.2805 0.0065  -0.0492 0.0104  185 LEU A O   
1365 C CB  . LEU A 188 ? 0.2875 0.2427 0.2737 0.0175  -0.0389 0.0127  185 LEU A CB  
1366 C CG  . LEU A 188 ? 0.2976 0.2659 0.3056 0.0200  -0.0401 0.0130  185 LEU A CG  
1367 C CD1 . LEU A 188 ? 0.2962 0.2693 0.3130 0.0198  -0.0295 0.0109  185 LEU A CD1 
1368 C CD2 . LEU A 188 ? 0.3211 0.2902 0.3378 0.0272  -0.0443 0.0158  185 LEU A CD2 
1369 N N   . LYS A 189 ? 0.2947 0.2568 0.2837 0.0038  -0.0367 0.0078  186 LYS A N   
1370 C CA  . LYS A 189 ? 0.3047 0.2681 0.2957 -0.0019 -0.0408 0.0055  186 LYS A CA  
1371 C C   . LYS A 189 ? 0.3262 0.3013 0.3340 -0.0031 -0.0487 0.0055  186 LYS A C   
1372 O O   . LYS A 189 ? 0.3236 0.3082 0.3473 0.0011  -0.0479 0.0075  186 LYS A O   
1373 C CB  . LYS A 189 ? 0.3066 0.2674 0.2991 -0.0052 -0.0329 0.0043  186 LYS A CB  
1374 C CG  . LYS A 189 ? 0.3290 0.2795 0.3064 -0.0039 -0.0283 0.0047  186 LYS A CG  
1375 C CD  . LYS A 189 ? 0.3534 0.2994 0.3314 -0.0061 -0.0217 0.0049  186 LYS A CD  
1376 C CE  . LYS A 189 ? 0.3389 0.2890 0.3243 -0.0047 -0.0158 0.0077  186 LYS A CE  
1377 N NZ  . LYS A 189 ? 0.3525 0.2961 0.3357 -0.0064 -0.0098 0.0097  186 LYS A NZ  
1378 N N   . GLY A 190 ? 0.3556 0.3293 0.3595 -0.0087 -0.0565 0.0028  187 GLY A N   
1379 C CA  . GLY A 190 ? 0.3807 0.3664 0.4010 -0.0117 -0.0671 0.0024  187 GLY A CA  
1380 C C   . GLY A 190 ? 0.4056 0.3828 0.4071 -0.0165 -0.0781 -0.0003 187 GLY A C   
1381 O O   . GLY A 190 ? 0.4216 0.3841 0.3998 -0.0175 -0.0743 -0.0024 187 GLY A O   
1382 N N   . ASN A 191 ? 0.4229 0.4092 0.4338 -0.0192 -0.0918 -0.0004 188 ASN A N   
1383 C CA  . ASN A 191 ? 0.4590 0.4356 0.4463 -0.0223 -0.1039 -0.0020 188 ASN A CA  
1384 C C   . ASN A 191 ? 0.4560 0.4251 0.4271 -0.0141 -0.1029 0.0037  188 ASN A C   
1385 O O   . ASN A 191 ? 0.4942 0.4714 0.4808 -0.0068 -0.1014 0.0088  188 ASN A O   
1386 C CB  . ASN A 191 ? 0.4759 0.4656 0.4781 -0.0263 -0.1216 -0.0020 188 ASN A CB  
1387 C CG  . ASN A 191 ? 0.5463 0.5236 0.5185 -0.0308 -0.1358 -0.0042 188 ASN A CG  
1388 O OD1 . ASN A 191 ? 0.6197 0.5810 0.5677 -0.0372 -0.1327 -0.0107 188 ASN A OD1 
1389 N ND2 . ASN A 191 ? 0.5934 0.5769 0.5661 -0.0271 -0.1513 0.0014  188 ASN A ND2 
1390 N N   . GLN A 192 ? 0.4548 0.4072 0.3951 -0.0157 -0.1027 0.0025  189 GLN A N   
1391 C CA  . GLN A 192 ? 0.4396 0.3818 0.3623 -0.0100 -0.0987 0.0075  189 GLN A CA  
1392 C C   . GLN A 192 ? 0.3960 0.3417 0.3330 -0.0044 -0.0856 0.0098  189 GLN A C   
1393 O O   . GLN A 192 ? 0.3840 0.3347 0.3325 0.0020  -0.0864 0.0147  189 GLN A O   
1394 C CB  . GLN A 192 ? 0.4644 0.4072 0.3817 -0.0063 -0.1128 0.0140  189 GLN A CB  
1395 C CG  . GLN A 192 ? 0.5209 0.4581 0.4183 -0.0128 -0.1273 0.0114  189 GLN A CG  
1396 C CD  . GLN A 192 ? 0.5675 0.5023 0.4539 -0.0089 -0.1424 0.0192  189 GLN A CD  
1397 O OE1 . GLN A 192 ? 0.6286 0.5687 0.5294 -0.0008 -0.1433 0.0266  189 GLN A OE1 
1398 N NE2 . GLN A 192 ? 0.6383 0.5635 0.4977 -0.0145 -0.1550 0.0177  189 GLN A NE2 
1399 N N   . THR A 193 ? 0.3545 0.2960 0.2892 -0.0068 -0.0741 0.0058  190 THR A N   
1400 C CA  . THR A 193 ? 0.3205 0.2625 0.2622 -0.0027 -0.0629 0.0074  190 THR A CA  
1401 C C   . THR A 193 ? 0.3246 0.2588 0.2544 0.0013  -0.0620 0.0120  190 THR A C   
1402 O O   . THR A 193 ? 0.3459 0.2697 0.2553 -0.0003 -0.0638 0.0130  190 THR A O   
1403 C CB  . THR A 193 ? 0.3148 0.2512 0.2516 -0.0057 -0.0531 0.0036  190 THR A CB  
1404 O OG1 . THR A 193 ? 0.3031 0.2454 0.2533 -0.0093 -0.0528 0.0004  190 THR A OG1 
1405 C CG2 . THR A 193 ? 0.2960 0.2310 0.2347 -0.0021 -0.0438 0.0057  190 THR A CG2 
1406 N N   . VAL A 194 ? 0.3144 0.2521 0.2556 0.0062  -0.0589 0.0147  191 VAL A N   
1407 C CA  . VAL A 194 ? 0.3248 0.2537 0.2573 0.0095  -0.0571 0.0187  191 VAL A CA  
1408 C C   . VAL A 194 ? 0.3281 0.2530 0.2578 0.0081  -0.0471 0.0170  191 VAL A C   
1409 O O   . VAL A 194 ? 0.3228 0.2534 0.2626 0.0082  -0.0423 0.0144  191 VAL A O   
1410 C CB  . VAL A 194 ? 0.3264 0.2591 0.2732 0.0160  -0.0595 0.0217  191 VAL A CB  
1411 C CG1 . VAL A 194 ? 0.3327 0.2530 0.2695 0.0185  -0.0578 0.0257  191 VAL A CG1 
1412 C CG2 . VAL A 194 ? 0.3598 0.3009 0.3172 0.0184  -0.0703 0.0239  191 VAL A CG2 
1413 N N   . ILE A 195 ? 0.3237 0.2392 0.2399 0.0063  -0.0440 0.0189  192 ILE A N   
1414 C CA  . ILE A 195 ? 0.3191 0.2328 0.2362 0.0048  -0.0363 0.0181  192 ILE A CA  
1415 C C   . ILE A 195 ? 0.3337 0.2395 0.2482 0.0061  -0.0361 0.0217  192 ILE A C   
1416 O O   . ILE A 195 ? 0.3442 0.2411 0.2468 0.0047  -0.0363 0.0255  192 ILE A O   
1417 C CB  . ILE A 195 ? 0.3262 0.2370 0.2349 0.0009  -0.0303 0.0168  192 ILE A CB  
1418 C CG1 . ILE A 195 ? 0.3335 0.2475 0.2420 -0.0003 -0.0304 0.0127  192 ILE A CG1 
1419 C CG2 . ILE A 195 ? 0.3085 0.2217 0.2253 -0.0001 -0.0241 0.0164  192 ILE A CG2 
1420 C CD1 . ILE A 195 ? 0.3385 0.2474 0.2328 -0.0021 -0.0362 0.0121  192 ILE A CD1 
1421 N N   . ALA A 196 ? 0.3195 0.2269 0.2435 0.0086  -0.0355 0.0204  193 ALA A N   
1422 C CA  . ALA A 196 ? 0.3260 0.2240 0.2488 0.0098  -0.0352 0.0224  193 ALA A CA  
1423 C C   . ALA A 196 ? 0.3336 0.2302 0.2581 0.0058  -0.0307 0.0201  193 ALA A C   
1424 O O   . ALA A 196 ? 0.3360 0.2389 0.2661 0.0056  -0.0295 0.0163  193 ALA A O   
1425 C CB  . ALA A 196 ? 0.3276 0.2261 0.2591 0.0161  -0.0377 0.0217  193 ALA A CB  
1426 N N   . PHE A 197 ? 0.3428 0.2305 0.2624 0.0022  -0.0289 0.0228  194 PHE A N   
1427 C CA  . PHE A 197 ? 0.3458 0.2325 0.2695 -0.0029 -0.0262 0.0209  194 PHE A CA  
1428 C C   . PHE A 197 ? 0.3573 0.2324 0.2806 -0.0031 -0.0273 0.0196  194 PHE A C   
1429 O O   . PHE A 197 ? 0.3706 0.2348 0.2895 0.0004  -0.0285 0.0222  194 PHE A O   
1430 C CB  . PHE A 197 ? 0.3456 0.2309 0.2669 -0.0083 -0.0216 0.0245  194 PHE A CB  
1431 C CG  . PHE A 197 ? 0.3372 0.2323 0.2592 -0.0085 -0.0186 0.0240  194 PHE A CG  
1432 C CD1 . PHE A 197 ? 0.3308 0.2367 0.2638 -0.0101 -0.0169 0.0213  194 PHE A CD1 
1433 C CD2 . PHE A 197 ? 0.3542 0.2466 0.2652 -0.0068 -0.0182 0.0261  194 PHE A CD2 
1434 C CE1 . PHE A 197 ? 0.3484 0.2615 0.2830 -0.0092 -0.0133 0.0205  194 PHE A CE1 
1435 C CE2 . PHE A 197 ? 0.3631 0.2618 0.2731 -0.0070 -0.0147 0.0242  194 PHE A CE2 
1436 C CZ  . PHE A 197 ? 0.3504 0.2587 0.2727 -0.0079 -0.0115 0.0214  194 PHE A CZ  
1437 N N   . PRO A 198 ? 0.3599 0.2360 0.2872 -0.0071 -0.0277 0.0154  195 PRO A N   
1438 C CA  . PRO A 198 ? 0.3822 0.2449 0.3067 -0.0080 -0.0288 0.0120  195 PRO A CA  
1439 C C   . PRO A 198 ? 0.3919 0.2403 0.3143 -0.0123 -0.0274 0.0154  195 PRO A C   
1440 O O   . PRO A 198 ? 0.3898 0.2226 0.3084 -0.0112 -0.0277 0.0135  195 PRO A O   
1441 C CB  . PRO A 198 ? 0.3954 0.2637 0.3224 -0.0128 -0.0313 0.0067  195 PRO A CB  
1442 C CG  . PRO A 198 ? 0.3751 0.2598 0.3094 -0.0144 -0.0314 0.0087  195 PRO A CG  
1443 C CD  . PRO A 198 ? 0.3509 0.2401 0.2845 -0.0100 -0.0282 0.0131  195 PRO A CD  
1444 N N   . ASP A 199 ? 0.3790 0.2306 0.3029 -0.0167 -0.0245 0.0208  196 ASP A N   
1445 C CA  . ASP A 199 ? 0.4248 0.2617 0.3455 -0.0215 -0.0214 0.0257  196 ASP A CA  
1446 C C   . ASP A 199 ? 0.4243 0.2496 0.3341 -0.0151 -0.0214 0.0324  196 ASP A C   
1447 O O   . ASP A 199 ? 0.4407 0.2513 0.3443 -0.0182 -0.0186 0.0385  196 ASP A O   
1448 C CB  . ASP A 199 ? 0.4300 0.2747 0.3578 -0.0300 -0.0164 0.0286  196 ASP A CB  
1449 C CG  . ASP A 199 ? 0.4781 0.3322 0.4017 -0.0274 -0.0123 0.0328  196 ASP A CG  
1450 O OD1 . ASP A 199 ? 0.3965 0.2518 0.3117 -0.0201 -0.0150 0.0333  196 ASP A OD1 
1451 O OD2 . ASP A 199 ? 0.5413 0.4015 0.4709 -0.0334 -0.0057 0.0351  196 ASP A OD2 
1452 N N   . GLY A 200 ? 0.4100 0.2420 0.3180 -0.0066 -0.0249 0.0318  197 GLY A N   
1453 C CA  . GLY A 200 ? 0.4352 0.2594 0.3355 0.0002  -0.0279 0.0380  197 GLY A CA  
1454 C C   . GLY A 200 ? 0.4326 0.2631 0.3241 0.0002  -0.0284 0.0430  197 GLY A C   
1455 O O   . GLY A 200 ? 0.4222 0.2492 0.3068 0.0061  -0.0336 0.0479  197 GLY A O   
1456 N N   . ASP A 201 ? 0.4217 0.2608 0.3130 -0.0061 -0.0233 0.0418  198 ASP A N   
1457 C CA  . ASP A 201 ? 0.4236 0.2675 0.3040 -0.0058 -0.0228 0.0445  198 ASP A CA  
1458 C C   . ASP A 201 ? 0.4046 0.2606 0.2895 0.0001  -0.0293 0.0405  198 ASP A C   
1459 O O   . ASP A 201 ? 0.3783 0.2439 0.2761 0.0018  -0.0302 0.0348  198 ASP A O   
1460 C CB  . ASP A 201 ? 0.4164 0.2690 0.2995 -0.0123 -0.0144 0.0423  198 ASP A CB  
1461 C CG  . ASP A 201 ? 0.4786 0.3215 0.3577 -0.0194 -0.0059 0.0473  198 ASP A CG  
1462 O OD1 . ASP A 201 ? 0.4957 0.3231 0.3684 -0.0201 -0.0067 0.0526  198 ASP A OD1 
1463 O OD2 . ASP A 201 ? 0.5015 0.3524 0.3857 -0.0241 0.0022  0.0460  198 ASP A OD2 
1464 N N   . CYS A 202 ? 0.3991 0.2543 0.2725 0.0026  -0.0340 0.0435  199 CYS A N   
1465 C CA  . CYS A 202 ? 0.3938 0.2612 0.2734 0.0067  -0.0405 0.0398  199 CYS A CA  
1466 C C   . CYS A 202 ? 0.3795 0.2458 0.2426 0.0050  -0.0436 0.0413  199 CYS A C   
1467 O O   . CYS A 202 ? 0.4096 0.2632 0.2539 0.0042  -0.0451 0.0476  199 CYS A O   
1468 C CB  . CYS A 202 ? 0.4177 0.2848 0.3066 0.0139  -0.0481 0.0417  199 CYS A CB  
1469 S SG  . CYS A 202 ? 0.4734 0.3584 0.3781 0.0180  -0.0540 0.0368  199 CYS A SG  
1470 N N   . TRP A 203 ? 0.3491 0.2515 0.3249 0.0070  -0.0375 0.0510  200 TRP A N   
1471 C CA  . TRP A 203 ? 0.3418 0.2511 0.3096 0.0076  -0.0396 0.0556  200 TRP A CA  
1472 C C   . TRP A 203 ? 0.3356 0.2523 0.3043 0.0109  -0.0414 0.0516  200 TRP A C   
1473 O O   . TRP A 203 ? 0.3241 0.2424 0.2973 0.0116  -0.0401 0.0446  200 TRP A O   
1474 C CB  . TRP A 203 ? 0.3401 0.2543 0.2997 0.0032  -0.0374 0.0550  200 TRP A CB  
1475 C CG  . TRP A 203 ? 0.3473 0.2561 0.3059 -0.0007 -0.0352 0.0585  200 TRP A CG  
1476 C CD1 . TRP A 203 ? 0.3318 0.2366 0.2945 -0.0038 -0.0325 0.0549  200 TRP A CD1 
1477 C CD2 . TRP A 203 ? 0.3539 0.2613 0.3068 -0.0024 -0.0354 0.0664  200 TRP A CD2 
1478 N NE1 . TRP A 203 ? 0.3879 0.2890 0.3485 -0.0074 -0.0310 0.0599  200 TRP A NE1 
1479 C CE2 . TRP A 203 ? 0.3424 0.2449 0.2970 -0.0065 -0.0326 0.0672  200 TRP A CE2 
1480 C CE3 . TRP A 203 ? 0.3621 0.2728 0.3085 -0.0011 -0.0377 0.0728  200 TRP A CE3 
1481 C CZ2 . TRP A 203 ? 0.4174 0.3176 0.3675 -0.0093 -0.0317 0.0745  200 TRP A CZ2 
1482 C CZ3 . TRP A 203 ? 0.4052 0.3138 0.3463 -0.0039 -0.0370 0.0799  200 TRP A CZ3 
1483 C CH2 . TRP A 203 ? 0.4098 0.3132 0.3529 -0.0079 -0.0338 0.0808  200 TRP A CH2 
1484 N N   . LEU A 204 ? 0.3294 0.2509 0.2933 0.0126  -0.0444 0.0562  201 LEU A N   
1485 C CA  . LEU A 204 ? 0.3224 0.2524 0.2852 0.0146  -0.0460 0.0527  201 LEU A CA  
1486 C C   . LEU A 204 ? 0.3194 0.2561 0.2724 0.0115  -0.0452 0.0522  201 LEU A C   
1487 O O   . LEU A 204 ? 0.3300 0.2664 0.2762 0.0093  -0.0450 0.0570  201 LEU A O   
1488 C CB  . LEU A 204 ? 0.3353 0.2671 0.3004 0.0186  -0.0504 0.0577  201 LEU A CB  
1489 C CG  . LEU A 204 ? 0.3487 0.2741 0.3244 0.0227  -0.0518 0.0597  201 LEU A CG  
1490 C CD1 . LEU A 204 ? 0.3807 0.3102 0.3586 0.0268  -0.0567 0.0649  201 LEU A CD1 
1491 C CD2 . LEU A 204 ? 0.3654 0.2904 0.3489 0.0238  -0.0493 0.0511  201 LEU A CD2 
1492 N N   . ASN A 205 ? 0.3080 0.2509 0.2605 0.0115  -0.0445 0.0464  202 ASN A N   
1493 C CA  . ASN A 205 ? 0.3069 0.2558 0.2511 0.0091  -0.0436 0.0455  202 ASN A CA  
1494 C C   . ASN A 205 ? 0.3032 0.2576 0.2437 0.0106  -0.0470 0.0478  202 ASN A C   
1495 O O   . ASN A 205 ? 0.3209 0.2781 0.2665 0.0133  -0.0493 0.0460  202 ASN A O   
1496 C CB  . ASN A 205 ? 0.2914 0.2440 0.2369 0.0082  -0.0412 0.0386  202 ASN A CB  
1497 C CG  . ASN A 205 ? 0.2789 0.2364 0.2171 0.0059  -0.0398 0.0376  202 ASN A CG  
1498 O OD1 . ASN A 205 ? 0.3103 0.2667 0.2438 0.0035  -0.0379 0.0397  202 ASN A OD1 
1499 N ND2 . ASN A 205 ? 0.2833 0.2463 0.2211 0.0066  -0.0404 0.0341  202 ASN A ND2 
1500 N N   . PRO A 206 ? 0.3113 0.2680 0.2431 0.0085  -0.0474 0.0514  203 PRO A N   
1501 C CA  . PRO A 206 ? 0.3191 0.2815 0.2469 0.0095  -0.0509 0.0535  203 PRO A CA  
1502 C C   . PRO A 206 ? 0.3309 0.3002 0.2550 0.0082  -0.0503 0.0481  203 PRO A C   
1503 O O   . PRO A 206 ? 0.3344 0.3091 0.2553 0.0086  -0.0535 0.0490  203 PRO A O   
1504 C CB  . PRO A 206 ? 0.3324 0.2938 0.2518 0.0074  -0.0512 0.0598  203 PRO A CB  
1505 C CG  . PRO A 206 ? 0.3223 0.2806 0.2392 0.0044  -0.0466 0.0586  203 PRO A CG  
1506 C CD  . PRO A 206 ? 0.2978 0.2517 0.2237 0.0054  -0.0448 0.0546  203 PRO A CD  
1507 N N   . THR A 207 ? 0.3088 0.2779 0.2332 0.0066  -0.0465 0.0429  204 THR A N   
1508 C CA  . THR A 207 ? 0.3107 0.2850 0.2313 0.0050  -0.0453 0.0383  204 THR A CA  
1509 C C   . THR A 207 ? 0.3311 0.3077 0.2585 0.0064  -0.0454 0.0332  204 THR A C   
1510 O O   . THR A 207 ? 0.3568 0.3308 0.2914 0.0082  -0.0451 0.0321  204 THR A O   
1511 C CB  . THR A 207 ? 0.3077 0.2810 0.2241 0.0023  -0.0407 0.0364  204 THR A CB  
1512 O OG1 . THR A 207 ? 0.2797 0.2497 0.2017 0.0025  -0.0384 0.0345  204 THR A OG1 
1513 C CG2 . THR A 207 ? 0.3370 0.3088 0.2462 0.0004  -0.0398 0.0411  204 THR A CG2 
1514 N N   . GLY A 208 ? 0.3308 0.3121 0.2558 0.0053  -0.0451 0.0295  205 GLY A N   
1515 C CA  . GLY A 208 ? 0.3453 0.3294 0.2760 0.0060  -0.0448 0.0249  205 GLY A CA  
1516 C C   . GLY A 208 ? 0.3444 0.3339 0.2773 0.0072  -0.0487 0.0244  205 GLY A C   
1517 O O   . GLY A 208 ? 0.3596 0.3510 0.2901 0.0079  -0.0523 0.0282  205 GLY A O   
1518 N N   . ASN A 209 ? 0.3316 0.3242 0.2690 0.0071  -0.0479 0.0198  206 ASN A N   
1519 C CA  . ASN A 209 ? 0.3257 0.3245 0.2667 0.0078  -0.0510 0.0184  206 ASN A CA  
1520 C C   . ASN A 209 ? 0.3044 0.3051 0.2524 0.0080  -0.0492 0.0139  206 ASN A C   
1521 O O   . ASN A 209 ? 0.2872 0.2845 0.2371 0.0080  -0.0457 0.0122  206 ASN A O   
1522 C CB  . ASN A 209 ? 0.3302 0.3331 0.2641 0.0051  -0.0523 0.0175  206 ASN A CB  
1523 C CG  . ASN A 209 ? 0.3338 0.3352 0.2637 0.0022  -0.0481 0.0134  206 ASN A CG  
1524 O OD1 . ASN A 209 ? 0.3229 0.3237 0.2572 0.0020  -0.0454 0.0103  206 ASN A OD1 
1525 N ND2 . ASN A 209 ? 0.3438 0.3450 0.2652 0.0000  -0.0475 0.0137  206 ASN A ND2 
1526 N N   . GLY A 210 ? 0.2980 0.3050 0.2500 0.0082  -0.0515 0.0120  207 GLY A N   
1527 C CA  . GLY A 210 ? 0.3051 0.3149 0.2645 0.0085  -0.0498 0.0080  207 GLY A CA  
1528 C C   . GLY A 210 ? 0.2960 0.3046 0.2533 0.0057  -0.0457 0.0045  207 GLY A C   
1529 O O   . GLY A 210 ? 0.2975 0.3076 0.2601 0.0056  -0.0435 0.0017  207 GLY A O   
1530 N N   . ALA A 211 ? 0.2894 0.2951 0.2392 0.0034  -0.0441 0.0046  208 ALA A N   
1531 C CA  . ALA A 211 ? 0.2913 0.2951 0.2397 0.0011  -0.0400 0.0019  208 ALA A CA  
1532 C C   . ALA A 211 ? 0.2760 0.2765 0.2270 0.0021  -0.0371 0.0022  208 ALA A C   
1533 O O   . ALA A 211 ? 0.2828 0.2831 0.2351 0.0009  -0.0341 0.0003  208 ALA A O   
1534 C CB  . ALA A 211 ? 0.2949 0.2961 0.2358 -0.0008 -0.0386 0.0020  208 ALA A CB  
1535 N N   . LEU A 212 ? 0.2718 0.2697 0.2234 0.0042  -0.0380 0.0047  209 LEU A N   
1536 C CA  . LEU A 212 ? 0.2591 0.2540 0.2126 0.0048  -0.0356 0.0047  209 LEU A CA  
1537 C C   . LEU A 212 ? 0.2703 0.2679 0.2306 0.0059  -0.0352 0.0024  209 LEU A C   
1538 O O   . LEU A 212 ? 0.2791 0.2754 0.2407 0.0058  -0.0329 0.0014  209 LEU A O   
1539 C CB  . LEU A 212 ? 0.2644 0.2549 0.2160 0.0060  -0.0366 0.0080  209 LEU A CB  
1540 C CG  . LEU A 212 ? 0.2729 0.2607 0.2176 0.0047  -0.0361 0.0106  209 LEU A CG  
1541 C CD1 . LEU A 212 ? 0.2766 0.2604 0.2204 0.0058  -0.0375 0.0143  209 LEU A CD1 
1542 C CD2 . LEU A 212 ? 0.2493 0.2358 0.1916 0.0028  -0.0325 0.0095  209 LEU A CD2 
1543 N N   . ALA A 213 ? 0.2692 0.2714 0.2341 0.0069  -0.0373 0.0012  210 ALA A N   
1544 C CA  . ALA A 213 ? 0.2702 0.2757 0.2425 0.0083  -0.0367 -0.0011 210 ALA A CA  
1545 C C   . ALA A 213 ? 0.2674 0.2762 0.2406 0.0059  -0.0338 -0.0040 210 ALA A C   
1546 O O   . ALA A 213 ? 0.2641 0.2781 0.2413 0.0054  -0.0344 -0.0058 210 ALA A O   
1547 C CB  . ALA A 213 ? 0.2761 0.2859 0.2542 0.0107  -0.0402 -0.0008 210 ALA A CB  
1548 N N   . LYS A 214 ? 0.2624 0.2683 0.2320 0.0043  -0.0309 -0.0040 211 LYS A N   
1549 C CA  . LYS A 214 ? 0.2607 0.2688 0.2306 0.0021  -0.0279 -0.0056 211 LYS A CA  
1550 C C   . LYS A 214 ? 0.2628 0.2685 0.2302 0.0014  -0.0253 -0.0051 211 LYS A C   
1551 O O   . LYS A 214 ? 0.2671 0.2688 0.2310 0.0018  -0.0256 -0.0032 211 LYS A O   
1552 C CB  . LYS A 214 ? 0.2575 0.2652 0.2241 0.0000  -0.0277 -0.0052 211 LYS A CB  
1553 C CG  . LYS A 214 ? 0.2483 0.2581 0.2165 -0.0024 -0.0249 -0.0066 211 LYS A CG  
1554 C CD  . LYS A 214 ? 0.2353 0.2433 0.2007 -0.0046 -0.0244 -0.0067 211 LYS A CD  
1555 C CE  . LYS A 214 ? 0.2569 0.2674 0.2230 -0.0050 -0.0275 -0.0081 211 LYS A CE  
1556 N NZ  . LYS A 214 ? 0.2286 0.2366 0.1912 -0.0073 -0.0267 -0.0089 211 LYS A NZ  
1557 N N   . GLY A 215 ? 0.2529 0.2618 0.2221 0.0001  -0.0228 -0.0066 212 GLY A N   
1558 C CA  . GLY A 215 ? 0.2578 0.2657 0.2244 -0.0007 -0.0206 -0.0059 212 GLY A CA  
1559 C C   . GLY A 215 ? 0.2620 0.2662 0.2236 -0.0016 -0.0202 -0.0030 212 GLY A C   
1560 O O   . GLY A 215 ? 0.2713 0.2744 0.2315 -0.0024 -0.0200 -0.0019 212 GLY A O   
1561 N N   . GLY A 216 ? 0.2479 0.2504 0.2075 -0.0014 -0.0201 -0.0022 213 GLY A N   
1562 C CA  . GLY A 216 ? 0.2448 0.2449 0.2007 -0.0022 -0.0195 0.0005  213 GLY A CA  
1563 C C   . GLY A 216 ? 0.2447 0.2408 0.1985 -0.0012 -0.0211 0.0019  213 GLY A C   
1564 O O   . GLY A 216 ? 0.2375 0.2321 0.1891 -0.0017 -0.0206 0.0039  213 GLY A O   
1565 N N   . THR A 217 ? 0.2517 0.2463 0.2064 0.0001  -0.0231 0.0014  214 THR A N   
1566 C CA  . THR A 217 ? 0.2487 0.2398 0.2009 0.0007  -0.0244 0.0034  214 THR A CA  
1567 C C   . THR A 217 ? 0.2491 0.2381 0.2016 0.0008  -0.0247 0.0038  214 THR A C   
1568 O O   . THR A 217 ? 0.2638 0.2501 0.2138 0.0005  -0.0248 0.0061  214 THR A O   
1569 C CB  . THR A 217 ? 0.2528 0.2434 0.2054 0.0020  -0.0269 0.0035  214 THR A CB  
1570 O OG1 . THR A 217 ? 0.2592 0.2509 0.2163 0.0035  -0.0282 0.0020  214 THR A OG1 
1571 C CG2 . THR A 217 ? 0.2522 0.2451 0.2043 0.0011  -0.0267 0.0025  214 THR A CG2 
1572 N N   . GLY A 218 ? 0.2446 0.2349 0.2002 0.0010  -0.0243 0.0014  215 GLY A N   
1573 C CA  . GLY A 218 ? 0.2574 0.2456 0.2135 0.0007  -0.0243 0.0009  215 GLY A CA  
1574 C C   . GLY A 218 ? 0.2448 0.2344 0.1984 -0.0014 -0.0228 0.0017  215 GLY A C   
1575 O O   . GLY A 218 ? 0.2444 0.2319 0.1972 -0.0023 -0.0229 0.0025  215 GLY A O   
1576 N N   . ASP A 219 ? 0.2543 0.2479 0.2071 -0.0024 -0.0214 0.0017  216 ASP A N   
1577 C CA  . ASP A 219 ? 0.2601 0.2560 0.2109 -0.0041 -0.0204 0.0033  216 ASP A CA  
1578 C C   . ASP A 219 ? 0.2465 0.2402 0.1956 -0.0040 -0.0205 0.0066  216 ASP A C   
1579 O O   . ASP A 219 ? 0.2325 0.2266 0.1809 -0.0051 -0.0204 0.0079  216 ASP A O   
1580 C CB  . ASP A 219 ? 0.2524 0.2525 0.2030 -0.0048 -0.0190 0.0037  216 ASP A CB  
1581 C CG  . ASP A 219 ? 0.2861 0.2893 0.2382 -0.0052 -0.0183 0.0004  216 ASP A CG  
1582 O OD1 . ASP A 219 ? 0.2803 0.2837 0.2331 -0.0056 -0.0185 -0.0023 216 ASP A OD1 
1583 O OD2 . ASP A 219 ? 0.2983 0.3037 0.2510 -0.0052 -0.0173 0.0005  216 ASP A OD2 
1584 N N   . THR A 220 ? 0.2389 0.2306 0.1873 -0.0028 -0.0207 0.0076  217 THR A N   
1585 C CA  . THR A 220 ? 0.2390 0.2287 0.1854 -0.0027 -0.0203 0.0102  217 THR A CA  
1586 C C   . THR A 220 ? 0.2404 0.2273 0.1863 -0.0030 -0.0213 0.0110  217 THR A C   
1587 O O   . THR A 220 ? 0.2363 0.2232 0.1814 -0.0038 -0.0206 0.0129  217 THR A O   
1588 C CB  . THR A 220 ? 0.2500 0.2383 0.1953 -0.0018 -0.0203 0.0101  217 THR A CB  
1589 O OG1 . THR A 220 ? 0.2571 0.2474 0.2034 -0.0020 -0.0190 0.0095  217 THR A OG1 
1590 C CG2 . THR A 220 ? 0.2463 0.2325 0.1889 -0.0018 -0.0196 0.0121  217 THR A CG2 
1591 N N   . LEU A 221 ? 0.2352 0.2196 0.1820 -0.0021 -0.0229 0.0097  218 LEU A N   
1592 C CA  . LEU A 221 ? 0.2391 0.2199 0.1859 -0.0024 -0.0238 0.0109  218 LEU A CA  
1593 C C   . LEU A 221 ? 0.2386 0.2201 0.1865 -0.0043 -0.0231 0.0104  218 LEU A C   
1594 O O   . LEU A 221 ? 0.2458 0.2258 0.1931 -0.0054 -0.0229 0.0124  218 LEU A O   
1595 C CB  . LEU A 221 ? 0.2402 0.2182 0.1890 -0.0008 -0.0255 0.0099  218 LEU A CB  
1596 C CG  . LEU A 221 ? 0.2465 0.2197 0.1961 -0.0010 -0.0264 0.0114  218 LEU A CG  
1597 C CD1 . LEU A 221 ? 0.2655 0.2370 0.2113 -0.0015 -0.0264 0.0154  218 LEU A CD1 
1598 C CD2 . LEU A 221 ? 0.2909 0.2613 0.2440 0.0010  -0.0281 0.0106  218 LEU A CD2 
1599 N N   . THR A 222 ? 0.2287 0.2131 0.1783 -0.0050 -0.0228 0.0077  219 THR A N   
1600 C CA  . THR A 222 ? 0.2407 0.2266 0.1909 -0.0073 -0.0224 0.0066  219 THR A CA  
1601 C C   . THR A 222 ? 0.2248 0.2138 0.1739 -0.0086 -0.0217 0.0095  219 THR A C   
1602 O O   . THR A 222 ? 0.2250 0.2138 0.1747 -0.0105 -0.0218 0.0103  219 THR A O   
1603 C CB  . THR A 222 ? 0.2414 0.2309 0.1925 -0.0080 -0.0220 0.0030  219 THR A CB  
1604 O OG1 . THR A 222 ? 0.2620 0.2485 0.2154 -0.0067 -0.0224 0.0000  219 THR A OG1 
1605 C CG2 . THR A 222 ? 0.2392 0.2320 0.1902 -0.0109 -0.0218 0.0017  219 THR A CG2 
1606 N N   . GLY A 223 ? 0.2284 0.2202 0.1766 -0.0077 -0.0209 0.0112  220 GLY A N   
1607 C CA  . GLY A 223 ? 0.2259 0.2205 0.1739 -0.0083 -0.0200 0.0142  220 GLY A CA  
1608 C C   . GLY A 223 ? 0.2219 0.2136 0.1694 -0.0082 -0.0196 0.0163  220 GLY A C   
1609 O O   . GLY A 223 ? 0.2324 0.2260 0.1810 -0.0097 -0.0191 0.0180  220 GLY A O   
1610 N N   . MET A 224 ? 0.2274 0.2148 0.1732 -0.0068 -0.0198 0.0164  221 MET A N   
1611 C CA  . MET A 224 ? 0.2369 0.2216 0.1811 -0.0070 -0.0193 0.0187  221 MET A CA  
1612 C C   . MET A 224 ? 0.2391 0.2219 0.1844 -0.0089 -0.0199 0.0193  221 MET A C   
1613 O O   . MET A 224 ? 0.2372 0.2207 0.1827 -0.0103 -0.0188 0.0216  221 MET A O   
1614 C CB  . MET A 224 ? 0.2389 0.2204 0.1804 -0.0054 -0.0199 0.0188  221 MET A CB  
1615 C CG  . MET A 224 ? 0.2374 0.2205 0.1776 -0.0041 -0.0189 0.0182  221 MET A CG  
1616 S SD  . MET A 224 ? 0.2685 0.2488 0.2052 -0.0029 -0.0202 0.0178  221 MET A SD  
1617 C CE  . MET A 224 ? 0.3612 0.3390 0.2944 -0.0037 -0.0201 0.0209  221 MET A CE  
1618 N N   . ILE A 225 ? 0.2282 0.2085 0.1749 -0.0092 -0.0213 0.0171  222 ILE A N   
1619 C CA  . ILE A 225 ? 0.2485 0.2263 0.1971 -0.0114 -0.0216 0.0170  222 ILE A CA  
1620 C C   . ILE A 225 ? 0.2412 0.2240 0.1915 -0.0140 -0.0209 0.0169  222 ILE A C   
1621 O O   . ILE A 225 ? 0.2575 0.2398 0.2088 -0.0162 -0.0204 0.0187  222 ILE A O   
1622 C CB  . ILE A 225 ? 0.2474 0.2214 0.1981 -0.0111 -0.0228 0.0137  222 ILE A CB  
1623 C CG1 . ILE A 225 ? 0.2399 0.2098 0.1900 -0.0083 -0.0238 0.0144  222 ILE A CG1 
1624 C CG2 . ILE A 225 ? 0.2663 0.2366 0.2194 -0.0138 -0.0228 0.0133  222 ILE A CG2 
1625 C CD1 . ILE A 225 ? 0.2649 0.2321 0.2182 -0.0070 -0.0248 0.0108  222 ILE A CD1 
1626 N N   . LEU A 226 ? 0.2386 0.2266 0.1894 -0.0141 -0.0210 0.0152  223 LEU A N   
1627 C CA  . LEU A 226 ? 0.2449 0.2391 0.1973 -0.0164 -0.0209 0.0155  223 LEU A CA  
1628 C C   . LEU A 226 ? 0.2295 0.2263 0.1828 -0.0166 -0.0196 0.0193  223 LEU A C   
1629 O O   . LEU A 226 ? 0.2418 0.2409 0.1973 -0.0192 -0.0195 0.0201  223 LEU A O   
1630 C CB  . LEU A 226 ? 0.2262 0.2260 0.1784 -0.0159 -0.0212 0.0145  223 LEU A CB  
1631 C CG  . LEU A 226 ? 0.2299 0.2373 0.1837 -0.0183 -0.0218 0.0150  223 LEU A CG  
1632 C CD1 . LEU A 226 ? 0.2276 0.2354 0.1825 -0.0221 -0.0228 0.0121  223 LEU A CD1 
1633 C CD2 . LEU A 226 ? 0.2358 0.2480 0.1884 -0.0174 -0.0221 0.0149  223 LEU A CD2 
1634 N N   . GLY A 227 ? 0.2436 0.2405 0.1956 -0.0140 -0.0184 0.0212  224 GLY A N   
1635 C CA  . GLY A 227 ? 0.2449 0.2442 0.1980 -0.0139 -0.0166 0.0242  224 GLY A CA  
1636 C C   . GLY A 227 ? 0.2548 0.2506 0.2073 -0.0153 -0.0158 0.0257  224 GLY A C   
1637 O O   . GLY A 227 ? 0.2549 0.2540 0.2099 -0.0172 -0.0147 0.0275  224 GLY A O   
1638 N N   . MET A 228 ? 0.2563 0.2456 0.2059 -0.0148 -0.0165 0.0252  225 MET A N   
1639 C CA  . MET A 228 ? 0.2762 0.2617 0.2247 -0.0162 -0.0158 0.0274  225 MET A CA  
1640 C C   . MET A 228 ? 0.2667 0.2521 0.2185 -0.0197 -0.0162 0.0272  225 MET A C   
1641 O O   . MET A 228 ? 0.2782 0.2637 0.2307 -0.0216 -0.0149 0.0297  225 MET A O   
1642 C CB  . MET A 228 ? 0.2750 0.2541 0.2198 -0.0146 -0.0168 0.0277  225 MET A CB  
1643 C CG  . MET A 228 ? 0.3219 0.3021 0.2629 -0.0123 -0.0156 0.0285  225 MET A CG  
1644 S SD  . MET A 228 ? 0.3995 0.3742 0.3357 -0.0109 -0.0170 0.0298  225 MET A SD  
1645 C CE  . MET A 228 ? 0.3624 0.3398 0.2956 -0.0086 -0.0160 0.0282  225 MET A CE  
1646 N N   . LEU A 229 ? 0.2638 0.2496 0.2176 -0.0207 -0.0179 0.0242  226 LEU A N   
1647 C CA  . LEU A 229 ? 0.2617 0.2480 0.2189 -0.0246 -0.0183 0.0231  226 LEU A CA  
1648 C C   . LEU A 229 ? 0.2710 0.2651 0.2312 -0.0268 -0.0173 0.0248  226 LEU A C   
1649 O O   . LEU A 229 ? 0.2829 0.2777 0.2460 -0.0305 -0.0171 0.0250  226 LEU A O   
1650 C CB  . LEU A 229 ? 0.2671 0.2537 0.2253 -0.0253 -0.0200 0.0186  226 LEU A CB  
1651 C CG  . LEU A 229 ? 0.2692 0.2478 0.2266 -0.0239 -0.0208 0.0164  226 LEU A CG  
1652 C CD1 . LEU A 229 ? 0.2643 0.2445 0.2220 -0.0238 -0.0218 0.0116  226 LEU A CD1 
1653 C CD2 . LEU A 229 ? 0.2633 0.2347 0.2228 -0.0264 -0.0205 0.0170  226 LEU A CD2 
1654 N N   . CYS A 230 ? 0.2651 0.2651 0.2253 -0.0245 -0.0166 0.0260  227 CYS A N   
1655 C CA  . CYS A 230 ? 0.2724 0.2807 0.2366 -0.0258 -0.0157 0.0279  227 CYS A CA  
1656 C C   . CYS A 230 ? 0.2975 0.3062 0.2623 -0.0257 -0.0129 0.0313  227 CYS A C   
1657 O O   . CYS A 230 ? 0.3324 0.3481 0.3016 -0.0271 -0.0118 0.0330  227 CYS A O   
1658 C CB  . CYS A 230 ? 0.2722 0.2866 0.2371 -0.0232 -0.0161 0.0281  227 CYS A CB  
1659 S SG  . CYS A 230 ? 0.2705 0.2876 0.2350 -0.0242 -0.0190 0.0248  227 CYS A SG  
1660 N N   . CYS A 231 ? 0.2819 0.2844 0.2424 -0.0240 -0.0117 0.0323  228 CYS A N   
1661 C CA  . CYS A 231 ? 0.2927 0.2959 0.2527 -0.0242 -0.0087 0.0352  228 CYS A CA  
1662 C C   . CYS A 231 ? 0.3122 0.3089 0.2696 -0.0264 -0.0082 0.0369  228 CYS A C   
1663 O O   . CYS A 231 ? 0.3263 0.3241 0.2829 -0.0272 -0.0055 0.0395  228 CYS A O   
1664 C CB  . CYS A 231 ? 0.2842 0.2874 0.2410 -0.0204 -0.0068 0.0356  228 CYS A CB  
1665 S SG  . CYS A 231 ? 0.2906 0.2862 0.2409 -0.0177 -0.0084 0.0339  228 CYS A SG  
1666 N N   . HIS A 232 ? 0.3056 0.2958 0.2618 -0.0272 -0.0105 0.0356  229 HIS A N   
1667 C CA  . HIS A 232 ? 0.3184 0.3018 0.2733 -0.0295 -0.0102 0.0378  229 HIS A CA  
1668 C C   . HIS A 232 ? 0.3344 0.3180 0.2945 -0.0338 -0.0108 0.0369  229 HIS A C   
1669 O O   . HIS A 232 ? 0.3350 0.3196 0.2976 -0.0344 -0.0128 0.0334  229 HIS A O   
1670 C CB  . HIS A 232 ? 0.3162 0.2914 0.2677 -0.0273 -0.0124 0.0371  229 HIS A CB  
1671 C CG  . HIS A 232 ? 0.2931 0.2670 0.2390 -0.0238 -0.0124 0.0382  229 HIS A CG  
1672 N ND1 . HIS A 232 ? 0.2781 0.2558 0.2229 -0.0209 -0.0125 0.0359  229 HIS A ND1 
1673 C CD2 . HIS A 232 ? 0.3148 0.2840 0.2560 -0.0229 -0.0124 0.0412  229 HIS A CD2 
1674 C CE1 . HIS A 232 ? 0.2976 0.2730 0.2372 -0.0186 -0.0125 0.0370  229 HIS A CE1 
1675 N NE2 . HIS A 232 ? 0.2957 0.2663 0.2329 -0.0198 -0.0127 0.0402  229 HIS A NE2 
1676 N N   . GLU A 233 ? 0.3547 0.3373 0.3163 -0.0372 -0.0091 0.0398  230 GLU A N   
1677 C CA  . GLU A 233 ? 0.3870 0.3683 0.3536 -0.0419 -0.0097 0.0386  230 GLU A CA  
1678 C C   . GLU A 233 ? 0.3716 0.3429 0.3379 -0.0421 -0.0117 0.0367  230 GLU A C   
1679 O O   . GLU A 233 ? 0.3822 0.3527 0.3522 -0.0448 -0.0129 0.0331  230 GLU A O   
1680 C CB  . GLU A 233 ? 0.4152 0.3974 0.3839 -0.0459 -0.0070 0.0425  230 GLU A CB  
1681 C CG  . GLU A 233 ? 0.4970 0.4901 0.4684 -0.0464 -0.0047 0.0437  230 GLU A CG  
1682 C CD  . GLU A 233 ? 0.5878 0.5896 0.5650 -0.0477 -0.0063 0.0403  230 GLU A CD  
1683 O OE1 . GLU A 233 ? 0.6489 0.6503 0.6302 -0.0521 -0.0077 0.0383  230 GLU A OE1 
1684 O OE2 . GLU A 233 ? 0.6639 0.6729 0.6414 -0.0445 -0.0063 0.0398  230 GLU A OE2 
1685 N N   . ASP A 234 ? 0.3554 0.3196 0.3173 -0.0391 -0.0120 0.0390  231 ASP A N   
1686 C CA  . ASP A 234 ? 0.3603 0.3148 0.3227 -0.0385 -0.0137 0.0379  231 ASP A CA  
1687 C C   . ASP A 234 ? 0.3404 0.2947 0.3009 -0.0341 -0.0158 0.0343  231 ASP A C   
1688 O O   . ASP A 234 ? 0.3166 0.2716 0.2728 -0.0305 -0.0161 0.0358  231 ASP A O   
1689 C CB  . ASP A 234 ? 0.3771 0.3244 0.3365 -0.0380 -0.0130 0.0436  231 ASP A CB  
1690 C CG  . ASP A 234 ? 0.4143 0.3509 0.3753 -0.0369 -0.0147 0.0434  231 ASP A CG  
1691 O OD1 . ASP A 234 ? 0.3907 0.3257 0.3544 -0.0356 -0.0163 0.0384  231 ASP A OD1 
1692 O OD2 . ASP A 234 ? 0.4486 0.3786 0.4087 -0.0374 -0.0143 0.0485  231 ASP A OD2 
1693 N N   . PRO A 235 ? 0.3270 0.2811 0.2907 -0.0349 -0.0170 0.0290  232 PRO A N   
1694 C CA  . PRO A 235 ? 0.3206 0.2759 0.2828 -0.0311 -0.0186 0.0254  232 PRO A CA  
1695 C C   . PRO A 235 ? 0.3115 0.2593 0.2719 -0.0273 -0.0196 0.0268  232 PRO A C   
1696 O O   . PRO A 235 ? 0.3094 0.2591 0.2677 -0.0237 -0.0206 0.0254  232 PRO A O   
1697 C CB  . PRO A 235 ? 0.3269 0.2828 0.2928 -0.0337 -0.0192 0.0196  232 PRO A CB  
1698 C CG  . PRO A 235 ? 0.3528 0.3038 0.3223 -0.0381 -0.0184 0.0202  232 PRO A CG  
1699 C CD  . PRO A 235 ? 0.3350 0.2875 0.3036 -0.0395 -0.0169 0.0259  232 PRO A CD  
1700 N N   . LYS A 236 ? 0.3138 0.2535 0.2756 -0.0281 -0.0195 0.0299  233 LYS A N   
1701 C CA  . LYS A 236 ? 0.3251 0.2585 0.2858 -0.0243 -0.0208 0.0321  233 LYS A CA  
1702 C C   . LYS A 236 ? 0.3244 0.2617 0.2792 -0.0215 -0.0211 0.0361  233 LYS A C   
1703 O O   . LYS A 236 ? 0.3101 0.2475 0.2632 -0.0178 -0.0227 0.0356  233 LYS A O   
1704 C CB  . LYS A 236 ? 0.3410 0.2646 0.3047 -0.0256 -0.0207 0.0355  233 LYS A CB  
1705 C CG  . LYS A 236 ? 0.3746 0.2933 0.3446 -0.0280 -0.0203 0.0304  233 LYS A CG  
1706 C CD  . LYS A 236 ? 0.4600 0.3680 0.4337 -0.0299 -0.0197 0.0342  233 LYS A CD  
1707 C CE  . LYS A 236 ? 0.4878 0.3881 0.4625 -0.0253 -0.0213 0.0378  233 LYS A CE  
1708 N NZ  . LYS A 236 ? 0.4951 0.3835 0.4757 -0.0271 -0.0205 0.0403  233 LYS A NZ  
1709 N N   . HIS A 237 ? 0.3192 0.2600 0.2711 -0.0237 -0.0194 0.0397  234 HIS A N   
1710 C CA  . HIS A 237 ? 0.3202 0.2650 0.2660 -0.0217 -0.0191 0.0427  234 HIS A CA  
1711 C C   . HIS A 237 ? 0.3032 0.2550 0.2478 -0.0195 -0.0193 0.0387  234 HIS A C   
1712 O O   . HIS A 237 ? 0.2940 0.2471 0.2346 -0.0167 -0.0200 0.0392  234 HIS A O   
1713 C CB  . HIS A 237 ? 0.3368 0.2842 0.2805 -0.0248 -0.0165 0.0467  234 HIS A CB  
1714 C CG  . HIS A 237 ? 0.3628 0.3033 0.3068 -0.0270 -0.0161 0.0518  234 HIS A CG  
1715 N ND1 . HIS A 237 ? 0.3726 0.3145 0.3164 -0.0308 -0.0135 0.0553  234 HIS A ND1 
1716 C CD2 . HIS A 237 ? 0.3899 0.3221 0.3353 -0.0259 -0.0179 0.0541  234 HIS A CD2 
1717 C CE1 . HIS A 237 ? 0.4121 0.3464 0.3564 -0.0322 -0.0137 0.0599  234 HIS A CE1 
1718 N NE2 . HIS A 237 ? 0.4099 0.3379 0.3554 -0.0292 -0.0165 0.0594  234 HIS A NE2 
1719 N N   . ALA A 238 ? 0.2886 0.2446 0.2366 -0.0210 -0.0187 0.0348  235 ALA A N   
1720 C CA  . ALA A 238 ? 0.2720 0.2340 0.2192 -0.0190 -0.0189 0.0316  235 ALA A CA  
1721 C C   . ALA A 238 ? 0.2717 0.2314 0.2185 -0.0157 -0.0209 0.0293  235 ALA A C   
1722 O O   . ALA A 238 ? 0.2703 0.2328 0.2143 -0.0134 -0.0211 0.0289  235 ALA A O   
1723 C CB  . ALA A 238 ? 0.2739 0.2410 0.2251 -0.0213 -0.0185 0.0282  235 ALA A CB  
1724 N N   . VAL A 239 ? 0.2619 0.2164 0.2121 -0.0157 -0.0221 0.0274  236 VAL A N   
1725 C CA  . VAL A 239 ? 0.2681 0.2210 0.2192 -0.0126 -0.0238 0.0250  236 VAL A CA  
1726 C C   . VAL A 239 ? 0.2673 0.2181 0.2152 -0.0098 -0.0251 0.0286  236 VAL A C   
1727 O O   . VAL A 239 ? 0.2658 0.2195 0.2122 -0.0073 -0.0260 0.0273  236 VAL A O   
1728 C CB  . VAL A 239 ? 0.2657 0.2131 0.2217 -0.0130 -0.0243 0.0221  236 VAL A CB  
1729 C CG1 . VAL A 239 ? 0.2710 0.2166 0.2288 -0.0093 -0.0258 0.0199  236 VAL A CG1 
1730 C CG2 . VAL A 239 ? 0.2853 0.2363 0.2436 -0.0161 -0.0233 0.0176  236 VAL A CG2 
1731 N N   . LEU A 240 ? 0.2815 0.2275 0.2284 -0.0105 -0.0253 0.0331  237 LEU A N   
1732 C CA  . LEU A 240 ? 0.2777 0.2220 0.2210 -0.0082 -0.0269 0.0373  237 LEU A CA  
1733 C C   . LEU A 240 ? 0.2693 0.2198 0.2068 -0.0078 -0.0263 0.0378  237 LEU A C   
1734 O O   . LEU A 240 ? 0.2761 0.2283 0.2114 -0.0055 -0.0280 0.0376  237 LEU A O   
1735 C CB  . LEU A 240 ? 0.2928 0.2314 0.2358 -0.0096 -0.0269 0.0428  237 LEU A CB  
1736 C CG  . LEU A 240 ? 0.2893 0.2202 0.2386 -0.0093 -0.0278 0.0426  237 LEU A CG  
1737 C CD1 . LEU A 240 ? 0.2965 0.2217 0.2463 -0.0122 -0.0266 0.0475  237 LEU A CD1 
1738 C CD2 . LEU A 240 ? 0.2957 0.2239 0.2471 -0.0050 -0.0306 0.0435  237 LEU A CD2 
1739 N N   . ASN A 241 ? 0.2715 0.2254 0.2070 -0.0102 -0.0237 0.0381  238 ASN A N   
1740 C CA  . ASN A 241 ? 0.2652 0.2243 0.1957 -0.0099 -0.0225 0.0381  238 ASN A CA  
1741 C C   . ASN A 241 ? 0.2605 0.2234 0.1918 -0.0081 -0.0228 0.0337  238 ASN A C   
1742 O O   . ASN A 241 ? 0.2564 0.2218 0.1841 -0.0068 -0.0229 0.0331  238 ASN A O   
1743 C CB  . ASN A 241 ? 0.2465 0.2084 0.1760 -0.0126 -0.0193 0.0395  238 ASN A CB  
1744 C CG  . ASN A 241 ? 0.3081 0.2671 0.2345 -0.0145 -0.0186 0.0447  238 ASN A CG  
1745 O OD1 . ASN A 241 ? 0.2940 0.2496 0.2175 -0.0135 -0.0206 0.0477  238 ASN A OD1 
1746 N ND2 . ASN A 241 ? 0.2885 0.2491 0.2160 -0.0174 -0.0159 0.0461  238 ASN A ND2 
1747 N N   . ALA A 242 ? 0.2604 0.2240 0.1964 -0.0082 -0.0228 0.0304  239 ALA A N   
1748 C CA  . ALA A 242 ? 0.2592 0.2266 0.1963 -0.0067 -0.0230 0.0267  239 ALA A CA  
1749 C C   . ALA A 242 ? 0.2602 0.2263 0.1970 -0.0042 -0.0253 0.0258  239 ALA A C   
1750 O O   . ALA A 242 ? 0.2470 0.2159 0.1820 -0.0031 -0.0254 0.0244  239 ALA A O   
1751 C CB  . ALA A 242 ? 0.2547 0.2236 0.1962 -0.0077 -0.0226 0.0237  239 ALA A CB  
1752 N N   . VAL A 243 ? 0.2597 0.2216 0.1990 -0.0034 -0.0271 0.0266  240 VAL A N   
1753 C CA  . VAL A 243 ? 0.2619 0.2234 0.2025 -0.0008 -0.0296 0.0259  240 VAL A CA  
1754 C C   . VAL A 243 ? 0.2571 0.2198 0.1924 -0.0002 -0.0307 0.0288  240 VAL A C   
1755 O O   . VAL A 243 ? 0.2701 0.2360 0.2045 0.0010  -0.0319 0.0272  240 VAL A O   
1756 C CB  . VAL A 243 ? 0.2716 0.2279 0.2169 0.0003  -0.0311 0.0264  240 VAL A CB  
1757 C CG1 . VAL A 243 ? 0.2579 0.2147 0.2054 0.0034  -0.0337 0.0262  240 VAL A CG1 
1758 C CG2 . VAL A 243 ? 0.2696 0.2254 0.2197 -0.0006 -0.0297 0.0222  240 VAL A CG2 
1759 N N   . TYR A 244 ? 0.2645 0.2254 0.1960 -0.0016 -0.0301 0.0328  241 TYR A N   
1760 C CA  . TYR A 244 ? 0.2691 0.2314 0.1944 -0.0016 -0.0311 0.0357  241 TYR A CA  
1761 C C   . TYR A 244 ? 0.2735 0.2406 0.1951 -0.0021 -0.0294 0.0328  241 TYR A C   
1762 O O   . TYR A 244 ? 0.2855 0.2552 0.2044 -0.0013 -0.0310 0.0319  241 TYR A O   
1763 C CB  . TYR A 244 ? 0.2783 0.2381 0.1999 -0.0035 -0.0300 0.0405  241 TYR A CB  
1764 C CG  . TYR A 244 ? 0.2855 0.2472 0.1998 -0.0037 -0.0312 0.0439  241 TYR A CG  
1765 C CD1 . TYR A 244 ? 0.2813 0.2475 0.1900 -0.0048 -0.0293 0.0420  241 TYR A CD1 
1766 C CD2 . TYR A 244 ? 0.3220 0.2812 0.2350 -0.0027 -0.0342 0.0490  241 TYR A CD2 
1767 C CE1 . TYR A 244 ? 0.3315 0.2999 0.2325 -0.0055 -0.0303 0.0445  241 TYR A CE1 
1768 C CE2 . TYR A 244 ? 0.3354 0.2971 0.2410 -0.0033 -0.0355 0.0522  241 TYR A CE2 
1769 C CZ  . TYR A 244 ? 0.3325 0.2992 0.2317 -0.0048 -0.0336 0.0496  241 TYR A CZ  
1770 O OH  . TYR A 244 ? 0.3644 0.3343 0.2552 -0.0057 -0.0350 0.0524  241 TYR A OH  
1771 N N   . LEU A 245 ? 0.2717 0.2401 0.1935 -0.0036 -0.0262 0.0313  242 LEU A N   
1772 C CA  . LEU A 245 ? 0.2640 0.2361 0.1831 -0.0040 -0.0241 0.0287  242 LEU A CA  
1773 C C   . LEU A 245 ? 0.2664 0.2404 0.1883 -0.0026 -0.0249 0.0248  242 LEU A C   
1774 O O   . LEU A 245 ? 0.2680 0.2441 0.1872 -0.0026 -0.0246 0.0229  242 LEU A O   
1775 C CB  . LEU A 245 ? 0.2800 0.2533 0.1997 -0.0055 -0.0205 0.0288  242 LEU A CB  
1776 C CG  . LEU A 245 ? 0.2830 0.2558 0.1988 -0.0072 -0.0189 0.0324  242 LEU A CG  
1777 C CD1 . LEU A 245 ? 0.3375 0.3120 0.2564 -0.0086 -0.0156 0.0325  242 LEU A CD1 
1778 C CD2 . LEU A 245 ? 0.3147 0.2891 0.2233 -0.0076 -0.0181 0.0327  242 LEU A CD2 
1779 N N   . HIS A 246 ? 0.2638 0.2371 0.1911 -0.0018 -0.0258 0.0234  243 HIS A N   
1780 C CA  . HIS A 246 ? 0.2632 0.2386 0.1934 -0.0007 -0.0265 0.0200  243 HIS A CA  
1781 C C   . HIS A 246 ? 0.2679 0.2444 0.1966 0.0002  -0.0292 0.0198  243 HIS A C   
1782 O O   . HIS A 246 ? 0.2740 0.2530 0.2017 0.0001  -0.0290 0.0174  243 HIS A O   
1783 C CB  . HIS A 246 ? 0.2666 0.2413 0.2022 -0.0003 -0.0269 0.0188  243 HIS A CB  
1784 C CG  . HIS A 246 ? 0.2577 0.2345 0.1968 0.0006  -0.0276 0.0156  243 HIS A CG  
1785 N ND1 . HIS A 246 ? 0.2744 0.2510 0.2164 0.0023  -0.0299 0.0149  243 HIS A ND1 
1786 C CD2 . HIS A 246 ? 0.2709 0.2505 0.2118 0.0002  -0.0260 0.0132  243 HIS A CD2 
1787 C CE1 . HIS A 246 ? 0.2833 0.2626 0.2286 0.0026  -0.0295 0.0118  243 HIS A CE1 
1788 N NE2 . HIS A 246 ? 0.2607 0.2417 0.2049 0.0013  -0.0272 0.0109  243 HIS A NE2 
1789 N N   . GLY A 247 ? 0.2656 0.2403 0.1939 0.0011  -0.0318 0.0226  244 GLY A N   
1790 C CA  . GLY A 247 ? 0.2726 0.2494 0.1995 0.0020  -0.0349 0.0230  244 GLY A CA  
1791 C C   . GLY A 247 ? 0.2651 0.2440 0.1848 0.0005  -0.0345 0.0234  244 GLY A C   
1792 O O   . GLY A 247 ? 0.2675 0.2497 0.1858 0.0004  -0.0360 0.0214  244 GLY A O   
1793 N N   . ALA A 248 ? 0.2671 0.2445 0.1823 -0.0008 -0.0323 0.0255  245 ALA A N   
1794 C CA  . ALA A 248 ? 0.2843 0.2637 0.1921 -0.0025 -0.0313 0.0255  245 ALA A CA  
1795 C C   . ALA A 248 ? 0.2785 0.2600 0.1864 -0.0033 -0.0288 0.0205  245 ALA A C   
1796 O O   . ALA A 248 ? 0.2890 0.2729 0.1921 -0.0045 -0.0290 0.0185  245 ALA A O   
1797 C CB  . ALA A 248 ? 0.2911 0.2687 0.1952 -0.0039 -0.0287 0.0286  245 ALA A CB  
1798 N N   . CYS A 249 ? 0.2846 0.2651 0.1978 -0.0028 -0.0267 0.0185  246 CYS A N   
1799 C CA  . CYS A 249 ? 0.2760 0.2578 0.1906 -0.0033 -0.0245 0.0144  246 CYS A CA  
1800 C C   . CYS A 249 ? 0.2708 0.2549 0.1865 -0.0032 -0.0270 0.0117  246 CYS A C   
1801 O O   . CYS A 249 ? 0.2767 0.2620 0.1906 -0.0044 -0.0259 0.0085  246 CYS A O   
1802 C CB  . CYS A 249 ? 0.2822 0.2631 0.2023 -0.0027 -0.0222 0.0138  246 CYS A CB  
1803 S SG  . CYS A 249 ? 0.2877 0.2675 0.2072 -0.0032 -0.0187 0.0161  246 CYS A SG  
1804 N N   . ALA A 250 ? 0.2723 0.2571 0.1918 -0.0018 -0.0302 0.0127  247 ALA A N   
1805 C CA  . ALA A 250 ? 0.2593 0.2474 0.1810 -0.0017 -0.0329 0.0105  247 ALA A CA  
1806 C C   . ALA A 250 ? 0.2792 0.2698 0.1951 -0.0027 -0.0354 0.0108  247 ALA A C   
1807 O O   . ALA A 250 ? 0.2829 0.2767 0.1985 -0.0040 -0.0364 0.0077  247 ALA A O   
1808 C CB  . ALA A 250 ? 0.2659 0.2546 0.1938 0.0003  -0.0355 0.0115  247 ALA A CB  
1809 N N   . GLU A 251 ? 0.2860 0.2757 0.1973 -0.0026 -0.0365 0.0147  248 GLU A N   
1810 C CA  . GLU A 251 ? 0.2945 0.2874 0.1991 -0.0038 -0.0390 0.0156  248 GLU A CA  
1811 C C   . GLU A 251 ? 0.3178 0.3115 0.2164 -0.0065 -0.0360 0.0118  248 GLU A C   
1812 O O   . GLU A 251 ? 0.3367 0.3342 0.2313 -0.0083 -0.0378 0.0094  248 GLU A O   
1813 C CB  . GLU A 251 ? 0.3226 0.3139 0.2234 -0.0032 -0.0404 0.0213  248 GLU A CB  
1814 C CG  . GLU A 251 ? 0.3151 0.3055 0.2216 -0.0006 -0.0440 0.0250  248 GLU A CG  
1815 C CD  . GLU A 251 ? 0.4224 0.4110 0.3252 -0.0001 -0.0457 0.0313  248 GLU A CD  
1816 O OE1 . GLU A 251 ? 0.5040 0.4937 0.3985 -0.0021 -0.0452 0.0332  248 GLU A OE1 
1817 O OE2 . GLU A 251 ? 0.4611 0.4472 0.3694 0.0021  -0.0476 0.0344  248 GLU A OE2 
1818 N N   . LEU A 252 ? 0.3024 0.2927 0.2001 -0.0069 -0.0314 0.0111  249 LEU A N   
1819 C CA  . LEU A 252 ? 0.3280 0.3184 0.2215 -0.0091 -0.0277 0.0069  249 LEU A CA  
1820 C C   . LEU A 252 ? 0.3300 0.3213 0.2273 -0.0099 -0.0274 0.0019  249 LEU A C   
1821 O O   . LEU A 252 ? 0.3301 0.3232 0.2232 -0.0121 -0.0272 -0.0019 249 LEU A O   
1822 C CB  . LEU A 252 ? 0.3376 0.3247 0.2316 -0.0088 -0.0227 0.0073  249 LEU A CB  
1823 C CG  . LEU A 252 ? 0.3984 0.3853 0.2880 -0.0106 -0.0183 0.0033  249 LEU A CG  
1824 C CD1 . LEU A 252 ? 0.4409 0.4309 0.3211 -0.0129 -0.0197 0.0025  249 LEU A CD1 
1825 C CD2 . LEU A 252 ? 0.4253 0.4100 0.3160 -0.0100 -0.0136 0.0046  249 LEU A CD2 
1826 N N   . TRP A 253 ? 0.3078 0.2978 0.2128 -0.0084 -0.0273 0.0017  250 TRP A N   
1827 C CA  . TRP A 253 ? 0.3104 0.3012 0.2198 -0.0092 -0.0270 -0.0023 250 TRP A CA  
1828 C C   . TRP A 253 ? 0.3361 0.3315 0.2436 -0.0109 -0.0308 -0.0044 250 TRP A C   
1829 O O   . TRP A 253 ? 0.3355 0.3316 0.2421 -0.0132 -0.0297 -0.0090 250 TRP A O   
1830 C CB  . TRP A 253 ? 0.3079 0.2982 0.2253 -0.0074 -0.0274 -0.0011 250 TRP A CB  
1831 C CG  . TRP A 253 ? 0.3091 0.3009 0.2315 -0.0084 -0.0274 -0.0045 250 TRP A CG  
1832 C CD1 . TRP A 253 ? 0.3212 0.3171 0.2472 -0.0084 -0.0308 -0.0052 250 TRP A CD1 
1833 C CD2 . TRP A 253 ? 0.2997 0.2891 0.2250 -0.0095 -0.0236 -0.0073 250 TRP A CD2 
1834 N NE1 . TRP A 253 ? 0.2959 0.2923 0.2264 -0.0099 -0.0293 -0.0084 250 TRP A NE1 
1835 C CE2 . TRP A 253 ? 0.2997 0.2916 0.2296 -0.0106 -0.0249 -0.0095 250 TRP A CE2 
1836 C CE3 . TRP A 253 ? 0.3147 0.2999 0.2395 -0.0096 -0.0192 -0.0078 250 TRP A CE3 
1837 C CZ2 . TRP A 253 ? 0.2885 0.2784 0.2221 -0.0119 -0.0219 -0.0119 250 TRP A CZ2 
1838 C CZ3 . TRP A 253 ? 0.3426 0.3256 0.2714 -0.0105 -0.0164 -0.0100 250 TRP A CZ3 
1839 C CH2 . TRP A 253 ? 0.3158 0.3010 0.2489 -0.0118 -0.0177 -0.0119 250 TRP A CH2 
1840 N N   . THR A 254 ? 0.3259 0.3246 0.2334 -0.0097 -0.0354 -0.0011 251 THR A N   
1841 C CA  . THR A 254 ? 0.3508 0.3553 0.2579 -0.0110 -0.0397 -0.0027 251 THR A CA  
1842 C C   . THR A 254 ? 0.3585 0.3658 0.2565 -0.0138 -0.0407 -0.0045 251 THR A C   
1843 O O   . THR A 254 ? 0.3714 0.3842 0.2685 -0.0156 -0.0442 -0.0065 251 THR A O   
1844 C CB  . THR A 254 ? 0.3496 0.3574 0.2610 -0.0083 -0.0446 0.0015  251 THR A CB  
1845 O OG1 . THR A 254 ? 0.3731 0.3789 0.2802 -0.0068 -0.0456 0.0067  251 THR A OG1 
1846 C CG2 . THR A 254 ? 0.3632 0.3694 0.2837 -0.0062 -0.0435 0.0014  251 THR A CG2 
1847 N N   . ASP A 255 ? 0.3555 0.3597 0.2469 -0.0146 -0.0373 -0.0043 252 ASP A N   
1848 C CA  . ASP A 255 ? 0.3821 0.3892 0.2642 -0.0178 -0.0374 -0.0070 252 ASP A CA  
1849 C C   . ASP A 255 ? 0.3776 0.3856 0.2603 -0.0210 -0.0359 -0.0143 252 ASP A C   
1850 O O   . ASP A 255 ? 0.3764 0.3894 0.2537 -0.0240 -0.0384 -0.0173 252 ASP A O   
1851 C CB  . ASP A 255 ? 0.3976 0.4012 0.2734 -0.0182 -0.0329 -0.0064 252 ASP A CB  
1852 C CG  . ASP A 255 ? 0.4438 0.4476 0.3161 -0.0165 -0.0347 0.0004  252 ASP A CG  
1853 O OD1 . ASP A 255 ? 0.4648 0.4713 0.3384 -0.0151 -0.0398 0.0049  252 ASP A OD1 
1854 O OD2 . ASP A 255 ? 0.5258 0.5268 0.3944 -0.0166 -0.0307 0.0014  252 ASP A OD2 
1855 N N   . GLU A 256 ? 0.3654 0.3686 0.2545 -0.0205 -0.0318 -0.0172 253 GLU A N   
1856 C CA  . GLU A 256 ? 0.3725 0.3748 0.2632 -0.0236 -0.0295 -0.0239 253 GLU A CA  
1857 C C   . GLU A 256 ? 0.3416 0.3430 0.2422 -0.0231 -0.0295 -0.0250 253 GLU A C   
1858 O O   . GLU A 256 ? 0.3426 0.3428 0.2455 -0.0258 -0.0275 -0.0302 253 GLU A O   
1859 C CB  . GLU A 256 ? 0.3955 0.3919 0.2839 -0.0241 -0.0231 -0.0270 253 GLU A CB  
1860 C CG  . GLU A 256 ? 0.4721 0.4704 0.3498 -0.0259 -0.0223 -0.0282 253 GLU A CG  
1861 C CD  . GLU A 256 ? 0.5654 0.5586 0.4416 -0.0271 -0.0157 -0.0333 253 GLU A CD  
1862 O OE1 . GLU A 256 ? 0.6486 0.6366 0.5300 -0.0244 -0.0116 -0.0316 253 GLU A OE1 
1863 O OE2 . GLU A 256 ? 0.6842 0.6788 0.5543 -0.0306 -0.0146 -0.0393 253 GLU A OE2 
1864 N N   . HIS A 257 ? 0.3123 0.3142 0.2184 -0.0200 -0.0313 -0.0202 254 HIS A N   
1865 C CA  . HIS A 257 ? 0.2936 0.2951 0.2088 -0.0193 -0.0310 -0.0204 254 HIS A CA  
1866 C C   . HIS A 257 ? 0.2952 0.3024 0.2145 -0.0177 -0.0361 -0.0174 254 HIS A C   
1867 O O   . HIS A 257 ? 0.3159 0.3247 0.2331 -0.0154 -0.0389 -0.0131 254 HIS A O   
1868 C CB  . HIS A 257 ? 0.2901 0.2858 0.2091 -0.0168 -0.0269 -0.0179 254 HIS A CB  
1869 C CG  . HIS A 257 ? 0.2948 0.2852 0.2107 -0.0172 -0.0220 -0.0195 254 HIS A CG  
1870 N ND1 . HIS A 257 ? 0.3336 0.3225 0.2441 -0.0160 -0.0208 -0.0172 254 HIS A ND1 
1871 C CD2 . HIS A 257 ? 0.3558 0.3417 0.2742 -0.0185 -0.0176 -0.0229 254 HIS A CD2 
1872 C CE1 . HIS A 257 ? 0.3737 0.3581 0.2836 -0.0163 -0.0159 -0.0194 254 HIS A CE1 
1873 N NE2 . HIS A 257 ? 0.3564 0.3386 0.2711 -0.0177 -0.0139 -0.0228 254 HIS A NE2 
1874 N N   . SER A 258 ? 0.2781 0.2884 0.2042 -0.0187 -0.0370 -0.0195 255 SER A N   
1875 C CA  . SER A 258 ? 0.2770 0.2929 0.2085 -0.0167 -0.0413 -0.0170 255 SER A CA  
1876 C C   . SER A 258 ? 0.2690 0.2822 0.2042 -0.0128 -0.0404 -0.0126 255 SER A C   
1877 O O   . SER A 258 ? 0.2824 0.2909 0.2198 -0.0123 -0.0364 -0.0125 255 SER A O   
1878 C CB  . SER A 258 ? 0.2819 0.3021 0.2208 -0.0189 -0.0417 -0.0204 255 SER A CB  
1879 O OG  . SER A 258 ? 0.2733 0.2988 0.2187 -0.0163 -0.0450 -0.0178 255 SER A OG  
1880 N N   . ALA A 259 ? 0.2751 0.2915 0.2113 -0.0102 -0.0443 -0.0090 256 ALA A N   
1881 C CA  . ALA A 259 ? 0.2733 0.2875 0.2137 -0.0067 -0.0438 -0.0056 256 ALA A CA  
1882 C C   . ALA A 259 ? 0.2772 0.2922 0.2256 -0.0063 -0.0418 -0.0072 256 ALA A C   
1883 O O   . ALA A 259 ? 0.3056 0.3175 0.2564 -0.0043 -0.0398 -0.0055 256 ALA A O   
1884 C CB  . ALA A 259 ? 0.2898 0.3073 0.2311 -0.0040 -0.0486 -0.0017 256 ALA A CB  
1885 N N   . HIS A 260 ? 0.2595 0.2790 0.2120 -0.0085 -0.0423 -0.0105 257 HIS A N   
1886 C CA  . HIS A 260 ? 0.2449 0.2656 0.2047 -0.0086 -0.0398 -0.0119 257 HIS A CA  
1887 C C   . HIS A 260 ? 0.2507 0.2657 0.2094 -0.0099 -0.0348 -0.0126 257 HIS A C   
1888 O O   . HIS A 260 ? 0.2579 0.2734 0.2215 -0.0096 -0.0326 -0.0127 257 HIS A O   
1889 C CB  . HIS A 260 ? 0.2499 0.2772 0.2147 -0.0112 -0.0413 -0.0152 257 HIS A CB  
1890 C CG  . HIS A 260 ? 0.2777 0.3125 0.2465 -0.0095 -0.0464 -0.0143 257 HIS A CG  
1891 N ND1 . HIS A 260 ? 0.2991 0.3367 0.2745 -0.0060 -0.0473 -0.0124 257 HIS A ND1 
1892 C CD2 . HIS A 260 ? 0.3095 0.3500 0.2769 -0.0108 -0.0508 -0.0149 257 HIS A CD2 
1893 C CE1 . HIS A 260 ? 0.3108 0.3554 0.2898 -0.0049 -0.0521 -0.0117 257 HIS A CE1 
1894 N NE2 . HIS A 260 ? 0.3075 0.3543 0.2814 -0.0077 -0.0545 -0.0128 257 HIS A NE2 
1895 N N   . THR A 261 ? 0.2631 0.2732 0.2158 -0.0112 -0.0330 -0.0129 258 THR A N   
1896 C CA  . THR A 261 ? 0.2517 0.2569 0.2043 -0.0128 -0.0284 -0.0139 258 THR A CA  
1897 C C   . THR A 261 ? 0.2378 0.2374 0.1873 -0.0110 -0.0257 -0.0111 258 THR A C   
1898 O O   . THR A 261 ? 0.2633 0.2592 0.2134 -0.0118 -0.0221 -0.0112 258 THR A O   
1899 C CB  . THR A 261 ? 0.2629 0.2666 0.2125 -0.0160 -0.0275 -0.0174 258 THR A CB  
1900 O OG1 . THR A 261 ? 0.2612 0.2627 0.2035 -0.0157 -0.0282 -0.0171 258 THR A OG1 
1901 C CG2 . THR A 261 ? 0.2605 0.2705 0.2133 -0.0186 -0.0304 -0.0207 258 THR A CG2 
1902 N N   . LEU A 262 ? 0.2362 0.2356 0.1833 -0.0085 -0.0274 -0.0084 259 LEU A N   
1903 C CA  . LEU A 262 ? 0.2362 0.2312 0.1808 -0.0071 -0.0252 -0.0057 259 LEU A CA  
1904 C C   . LEU A 262 ? 0.2386 0.2334 0.1874 -0.0064 -0.0230 -0.0045 259 LEU A C   
1905 O O   . LEU A 262 ? 0.2440 0.2421 0.1967 -0.0058 -0.0241 -0.0047 259 LEU A O   
1906 C CB  . LEU A 262 ? 0.2359 0.2310 0.1780 -0.0050 -0.0277 -0.0031 259 LEU A CB  
1907 C CG  . LEU A 262 ? 0.2649 0.2563 0.2048 -0.0038 -0.0257 -0.0003 259 LEU A CG  
1908 C CD1 . LEU A 262 ? 0.2595 0.2477 0.1951 -0.0048 -0.0230 -0.0005 259 LEU A CD1 
1909 C CD2 . LEU A 262 ? 0.2837 0.2751 0.2223 -0.0021 -0.0284 0.0022  259 LEU A CD2 
1910 N N   . LEU A 263 ? 0.2338 0.2251 0.1816 -0.0065 -0.0200 -0.0032 260 LEU A N   
1911 C CA  . LEU A 263 ? 0.2283 0.2198 0.1786 -0.0058 -0.0183 -0.0012 260 LEU A CA  
1912 C C   . LEU A 263 ? 0.2399 0.2298 0.1876 -0.0042 -0.0185 0.0013  260 LEU A C   
1913 O O   . LEU A 263 ? 0.2515 0.2389 0.1960 -0.0040 -0.0178 0.0020  260 LEU A O   
1914 C CB  . LEU A 263 ? 0.2359 0.2253 0.1879 -0.0070 -0.0150 -0.0008 260 LEU A CB  
1915 C CG  . LEU A 263 ? 0.2420 0.2325 0.1972 -0.0092 -0.0144 -0.0033 260 LEU A CG  
1916 C CD1 . LEU A 263 ? 0.2795 0.2663 0.2363 -0.0102 -0.0108 -0.0024 260 LEU A CD1 
1917 C CD2 . LEU A 263 ? 0.2855 0.2807 0.2442 -0.0094 -0.0154 -0.0038 260 LEU A CD2 
1918 N N   . ALA A 264 ? 0.2454 0.2370 0.1946 -0.0033 -0.0191 0.0024  261 ALA A N   
1919 C CA  . ALA A 264 ? 0.2433 0.2336 0.1906 -0.0023 -0.0195 0.0044  261 ALA A CA  
1920 C C   . ALA A 264 ? 0.2456 0.2338 0.1911 -0.0024 -0.0175 0.0064  261 ALA A C   
1921 O O   . ALA A 264 ? 0.2443 0.2312 0.1875 -0.0019 -0.0179 0.0076  261 ALA A O   
1922 C CB  . ALA A 264 ? 0.2482 0.2408 0.1979 -0.0021 -0.0196 0.0045  261 ALA A CB  
1923 N N   . HIS A 265 ? 0.2594 0.2477 0.2066 -0.0029 -0.0152 0.0072  262 HIS A N   
1924 C CA  . HIS A 265 ? 0.2584 0.2453 0.2053 -0.0024 -0.0131 0.0094  262 HIS A CA  
1925 C C   . HIS A 265 ? 0.2682 0.2523 0.2124 -0.0023 -0.0123 0.0085  262 HIS A C   
1926 O O   . HIS A 265 ? 0.2646 0.2480 0.2082 -0.0017 -0.0110 0.0101  262 HIS A O   
1927 C CB  . HIS A 265 ? 0.2693 0.2565 0.2191 -0.0026 -0.0109 0.0110  262 HIS A CB  
1928 C CG  . HIS A 265 ? 0.2966 0.2813 0.2477 -0.0033 -0.0092 0.0093  262 HIS A CG  
1929 N ND1 . HIS A 265 ? 0.2997 0.2855 0.2524 -0.0046 -0.0096 0.0077  262 HIS A ND1 
1930 C CD2 . HIS A 265 ? 0.3504 0.3316 0.3018 -0.0031 -0.0069 0.0087  262 HIS A CD2 
1931 C CE1 . HIS A 265 ? 0.3173 0.3000 0.2711 -0.0054 -0.0077 0.0063  262 HIS A CE1 
1932 N NE2 . HIS A 265 ? 0.3541 0.3337 0.3071 -0.0045 -0.0061 0.0066  262 HIS A NE2 
1933 N N   . GLU A 266 ? 0.2538 0.2371 0.1966 -0.0030 -0.0130 0.0058  263 GLU A N   
1934 C CA  . GLU A 266 ? 0.2717 0.2530 0.2110 -0.0033 -0.0124 0.0044  263 GLU A CA  
1935 C C   . GLU A 266 ? 0.2702 0.2518 0.2057 -0.0029 -0.0139 0.0057  263 GLU A C   
1936 O O   . GLU A 266 ? 0.2780 0.2583 0.2102 -0.0030 -0.0125 0.0055  263 GLU A O   
1937 C CB  . GLU A 266 ? 0.2746 0.2558 0.2130 -0.0048 -0.0132 0.0008  263 GLU A CB  
1938 C CG  . GLU A 266 ? 0.3036 0.2834 0.2458 -0.0056 -0.0107 -0.0003 263 GLU A CG  
1939 C CD  . GLU A 266 ? 0.3229 0.3031 0.2653 -0.0076 -0.0117 -0.0039 263 GLU A CD  
1940 O OE1 . GLU A 266 ? 0.2928 0.2765 0.2353 -0.0080 -0.0148 -0.0046 263 GLU A OE1 
1941 O OE2 . GLU A 266 ? 0.3322 0.3094 0.2754 -0.0088 -0.0090 -0.0061 263 GLU A OE2 
1942 N N   . LEU A 267 ? 0.2553 0.2383 0.1913 -0.0024 -0.0165 0.0070  264 LEU A N   
1943 C CA  . LEU A 267 ? 0.2488 0.2313 0.1819 -0.0021 -0.0177 0.0090  264 LEU A CA  
1944 C C   . LEU A 267 ? 0.2642 0.2462 0.1973 -0.0019 -0.0152 0.0110  264 LEU A C   
1945 O O   . LEU A 267 ? 0.2675 0.2488 0.1974 -0.0022 -0.0145 0.0120  264 LEU A O   
1946 C CB  . LEU A 267 ? 0.2531 0.2364 0.1881 -0.0014 -0.0204 0.0099  264 LEU A CB  
1947 C CG  . LEU A 267 ? 0.2457 0.2303 0.1818 -0.0011 -0.0231 0.0083  264 LEU A CG  
1948 C CD1 . LEU A 267 ? 0.2627 0.2480 0.2026 -0.0002 -0.0246 0.0085  264 LEU A CD1 
1949 C CD2 . LEU A 267 ? 0.2668 0.2511 0.1989 -0.0011 -0.0253 0.0090  264 LEU A CD2 
1950 N N   . SER A 268 ? 0.2695 0.2526 0.2065 -0.0016 -0.0139 0.0119  265 SER A N   
1951 C CA  . SER A 268 ? 0.2895 0.2733 0.2280 -0.0013 -0.0117 0.0140  265 SER A CA  
1952 C C   . SER A 268 ? 0.2903 0.2729 0.2280 -0.0010 -0.0085 0.0134  265 SER A C   
1953 O O   . SER A 268 ? 0.3088 0.2921 0.2466 -0.0008 -0.0068 0.0148  265 SER A O   
1954 C CB  . SER A 268 ? 0.2866 0.2726 0.2293 -0.0011 -0.0113 0.0153  265 SER A CB  
1955 O OG  . SER A 268 ? 0.3483 0.3357 0.2914 -0.0016 -0.0137 0.0153  265 SER A OG  
1956 N N   . ASP A 269 ? 0.2959 0.2769 0.2337 -0.0011 -0.0076 0.0109  266 ASP A N   
1957 C CA  . ASP A 269 ? 0.3093 0.2883 0.2468 -0.0009 -0.0043 0.0091  266 ASP A CA  
1958 C C   . ASP A 269 ? 0.3062 0.2847 0.2377 -0.0018 -0.0042 0.0076  266 ASP A C   
1959 O O   . ASP A 269 ? 0.3049 0.2826 0.2353 -0.0017 -0.0009 0.0064  266 ASP A O   
1960 C CB  . ASP A 269 ? 0.3352 0.3120 0.2738 -0.0015 -0.0035 0.0060  266 ASP A CB  
1961 C CG  . ASP A 269 ? 0.4229 0.3996 0.3670 -0.0010 -0.0029 0.0075  266 ASP A CG  
1962 O OD1 . ASP A 269 ? 0.4164 0.3946 0.3640 0.0001  -0.0023 0.0108  266 ASP A OD1 
1963 O OD2 . ASP A 269 ? 0.4813 0.4565 0.4262 -0.0020 -0.0030 0.0052  266 ASP A OD2 
1964 N N   . ILE A 270 ? 0.2863 0.2655 0.2140 -0.0027 -0.0076 0.0074  267 ILE A N   
1965 C CA  . ILE A 270 ? 0.2985 0.2779 0.2197 -0.0038 -0.0082 0.0067  267 ILE A CA  
1966 C C   . ILE A 270 ? 0.2754 0.2556 0.1947 -0.0038 -0.0081 0.0101  267 ILE A C   
1967 O O   . ILE A 270 ? 0.2834 0.2638 0.1976 -0.0047 -0.0068 0.0100  267 ILE A O   
1968 C CB  . ILE A 270 ? 0.3088 0.2889 0.2276 -0.0045 -0.0126 0.0059  267 ILE A CB  
1969 C CG1 . ILE A 270 ? 0.3589 0.3387 0.2788 -0.0053 -0.0123 0.0020  267 ILE A CG1 
1970 C CG2 . ILE A 270 ? 0.3613 0.3424 0.2736 -0.0053 -0.0145 0.0070  267 ILE A CG2 
1971 C CD1 . ILE A 270 ? 0.3653 0.3471 0.2861 -0.0055 -0.0165 0.0015  267 ILE A CD1 
1972 N N   . LEU A 271 ? 0.2731 0.2538 0.1963 -0.0031 -0.0092 0.0128  268 LEU A N   
1973 C CA  . LEU A 271 ? 0.2702 0.2514 0.1927 -0.0035 -0.0094 0.0160  268 LEU A CA  
1974 C C   . LEU A 271 ? 0.2776 0.2599 0.1989 -0.0039 -0.0055 0.0165  268 LEU A C   
1975 O O   . LEU A 271 ? 0.2872 0.2697 0.2047 -0.0049 -0.0054 0.0184  268 LEU A O   
1976 C CB  . LEU A 271 ? 0.2496 0.2317 0.1773 -0.0031 -0.0107 0.0178  268 LEU A CB  
1977 C CG  . LEU A 271 ? 0.2690 0.2513 0.1968 -0.0040 -0.0110 0.0208  268 LEU A CG  
1978 C CD1 . LEU A 271 ? 0.2495 0.2296 0.1732 -0.0047 -0.0136 0.0222  268 LEU A CD1 
1979 C CD2 . LEU A 271 ? 0.2804 0.2642 0.2135 -0.0041 -0.0119 0.0216  268 LEU A CD2 
1980 N N   . PRO A 272 ? 0.2710 0.2539 0.1958 -0.0029 -0.0022 0.0151  269 PRO A N   
1981 C CA  . PRO A 272 ? 0.2675 0.2518 0.1919 -0.0030 0.0019  0.0154  269 PRO A CA  
1982 C C   . PRO A 272 ? 0.2853 0.2693 0.2021 -0.0045 0.0030  0.0140  269 PRO A C   
1983 O O   . PRO A 272 ? 0.2992 0.2848 0.2138 -0.0054 0.0048  0.0158  269 PRO A O   
1984 C CB  . PRO A 272 ? 0.2593 0.2433 0.1887 -0.0014 0.0051  0.0133  269 PRO A CB  
1985 C CG  . PRO A 272 ? 0.2602 0.2441 0.1947 -0.0005 0.0023  0.0146  269 PRO A CG  
1986 C CD  . PRO A 272 ? 0.2711 0.2538 0.2015 -0.0016 -0.0017 0.0141  269 PRO A CD  
1987 N N   . ARG A 273 ? 0.2950 0.2774 0.2077 -0.0049 0.0020  0.0108  270 ARG A N   
1988 C CA  . ARG A 273 ? 0.3205 0.3033 0.2248 -0.0067 0.0027  0.0091  270 ARG A CA  
1989 C C   . ARG A 273 ? 0.3299 0.3133 0.2292 -0.0079 -0.0011 0.0126  270 ARG A C   
1990 O O   . ARG A 273 ? 0.3223 0.3070 0.2153 -0.0094 0.0000  0.0139  270 ARG A O   
1991 C CB  . ARG A 273 ? 0.3406 0.3221 0.2424 -0.0072 0.0021  0.0043  270 ARG A CB  
1992 C CG  . ARG A 273 ? 0.4389 0.4189 0.3449 -0.0064 0.0065  0.0004  270 ARG A CG  
1993 C CD  . ARG A 273 ? 0.5408 0.5192 0.4439 -0.0077 0.0064  -0.0048 270 ARG A CD  
1994 N NE  . ARG A 273 ? 0.6140 0.5908 0.5186 -0.0074 0.0121  -0.0089 270 ARG A NE  
1995 C CZ  . ARG A 273 ? 0.6164 0.5944 0.5156 -0.0085 0.0157  -0.0113 270 ARG A CZ  
1996 N NH1 . ARG A 273 ? 0.6699 0.6509 0.5607 -0.0104 0.0141  -0.0097 270 ARG A NH1 
1997 N NH2 . ARG A 273 ? 0.6645 0.6405 0.5667 -0.0078 0.0213  -0.0153 270 ARG A NH2 
1998 N N   . VAL A 274 ? 0.3163 0.2987 0.2182 -0.0072 -0.0054 0.0143  271 VAL A N   
1999 C CA  . VAL A 274 ? 0.3217 0.3039 0.2200 -0.0079 -0.0092 0.0180  271 VAL A CA  
2000 C C   . VAL A 274 ? 0.3175 0.2997 0.2164 -0.0085 -0.0079 0.0222  271 VAL A C   
2001 O O   . VAL A 274 ? 0.3153 0.2978 0.2085 -0.0099 -0.0082 0.0250  271 VAL A O   
2002 C CB  . VAL A 274 ? 0.3315 0.3126 0.2338 -0.0067 -0.0135 0.0184  271 VAL A CB  
2003 C CG1 . VAL A 274 ? 0.3418 0.3217 0.2430 -0.0067 -0.0170 0.0229  271 VAL A CG1 
2004 C CG2 . VAL A 274 ? 0.3285 0.3103 0.2291 -0.0067 -0.0153 0.0148  271 VAL A CG2 
2005 N N   . TRP A 275 ? 0.2953 0.2776 0.2010 -0.0078 -0.0064 0.0228  272 TRP A N   
2006 C CA  . TRP A 275 ? 0.2972 0.2800 0.2045 -0.0088 -0.0050 0.0264  272 TRP A CA  
2007 C C   . TRP A 275 ? 0.3088 0.2938 0.2113 -0.0102 -0.0010 0.0269  272 TRP A C   
2008 O O   . TRP A 275 ? 0.3211 0.3061 0.2206 -0.0119 -0.0009 0.0305  272 TRP A O   
2009 C CB  . TRP A 275 ? 0.2852 0.2692 0.2007 -0.0079 -0.0042 0.0262  272 TRP A CB  
2010 C CG  . TRP A 275 ? 0.2881 0.2729 0.2069 -0.0093 -0.0037 0.0295  272 TRP A CG  
2011 C CD1 . TRP A 275 ? 0.3040 0.2896 0.2205 -0.0112 -0.0018 0.0323  272 TRP A CD1 
2012 C CD2 . TRP A 275 ? 0.2876 0.2729 0.2128 -0.0092 -0.0052 0.0300  272 TRP A CD2 
2013 N NE1 . TRP A 275 ? 0.3289 0.3154 0.2507 -0.0124 -0.0019 0.0344  272 TRP A NE1 
2014 C CE2 . TRP A 275 ? 0.3040 0.2904 0.2310 -0.0112 -0.0041 0.0328  272 TRP A CE2 
2015 C CE3 . TRP A 275 ? 0.2893 0.2747 0.2186 -0.0079 -0.0071 0.0282  272 TRP A CE3 
2016 C CZ2 . TRP A 275 ? 0.2981 0.2858 0.2310 -0.0122 -0.0051 0.0334  272 TRP A CZ2 
2017 C CZ3 . TRP A 275 ? 0.3033 0.2901 0.2377 -0.0087 -0.0081 0.0290  272 TRP A CZ3 
2018 C CH2 . TRP A 275 ? 0.3024 0.2903 0.2385 -0.0109 -0.0072 0.0314  272 TRP A CH2 
2019 N N   . LYS A 276 ? 0.2968 0.2834 0.1985 -0.0097 0.0024  0.0232  273 LYS A N   
2020 C CA  . LYS A 276 ? 0.3197 0.3087 0.2170 -0.0110 0.0069  0.0226  273 LYS A CA  
2021 C C   . LYS A 276 ? 0.3468 0.3359 0.2343 -0.0132 0.0055  0.0247  273 LYS A C   
2022 O O   . LYS A 276 ? 0.3438 0.3349 0.2278 -0.0150 0.0082  0.0271  273 LYS A O   
2023 C CB  . LYS A 276 ? 0.3166 0.3061 0.2140 -0.0100 0.0104  0.0172  273 LYS A CB  
2024 C CG  . LYS A 276 ? 0.3605 0.3528 0.2537 -0.0112 0.0161  0.0153  273 LYS A CG  
2025 C CD  . LYS A 276 ? 0.3966 0.3920 0.2959 -0.0109 0.0201  0.0176  273 LYS A CD  
2026 C CE  . LYS A 276 ? 0.4392 0.4378 0.3352 -0.0118 0.0263  0.0152  273 LYS A CE  
2027 N NZ  . LYS A 276 ? 0.4663 0.4688 0.3697 -0.0114 0.0301  0.0174  273 LYS A NZ  
2028 N N   . ARG A 277 ? 0.3728 0.3603 0.2562 -0.0131 0.0012  0.0241  274 ARG A N   
2029 C CA  . ARG A 277 ? 0.4076 0.3958 0.2818 -0.0149 -0.0009 0.0265  274 ARG A CA  
2030 C C   . ARG A 277 ? 0.4120 0.3991 0.2855 -0.0160 -0.0026 0.0331  274 ARG A C   
2031 O O   . ARG A 277 ? 0.4164 0.4046 0.2819 -0.0179 -0.0029 0.0363  274 ARG A O   
2032 C CB  . ARG A 277 ? 0.4202 0.4076 0.2921 -0.0142 -0.0058 0.0250  274 ARG A CB  
2033 C CG  . ARG A 277 ? 0.4882 0.4765 0.3593 -0.0141 -0.0041 0.0184  274 ARG A CG  
2034 C CD  . ARG A 277 ? 0.5770 0.5654 0.4468 -0.0138 -0.0091 0.0169  274 ARG A CD  
2035 N NE  . ARG A 277 ? 0.6469 0.6362 0.5151 -0.0145 -0.0073 0.0103  274 ARG A NE  
2036 C CZ  . ARG A 277 ? 0.7068 0.6976 0.5721 -0.0153 -0.0107 0.0077  274 ARG A CZ  
2037 N NH1 . ARG A 277 ? 0.7361 0.7281 0.6002 -0.0151 -0.0164 0.0113  274 ARG A NH1 
2038 N NH2 . ARG A 277 ? 0.7178 0.7087 0.5821 -0.0164 -0.0084 0.0013  274 ARG A NH2 
2039 N N   . PHE A 278 ? 0.4063 0.3910 0.2879 -0.0150 -0.0038 0.0351  275 PHE A N   
2040 C CA  . PHE A 278 ? 0.4222 0.4045 0.3046 -0.0160 -0.0055 0.0410  275 PHE A CA  
2041 C C   . PHE A 278 ? 0.4434 0.4273 0.3285 -0.0178 -0.0011 0.0430  275 PHE A C   
2042 O O   . PHE A 278 ? 0.4535 0.4352 0.3406 -0.0191 -0.0019 0.0475  275 PHE A O   
2043 C CB  . PHE A 278 ? 0.4194 0.3981 0.3089 -0.0142 -0.0097 0.0414  275 PHE A CB  
2044 C CG  . PHE A 278 ? 0.4139 0.3914 0.3009 -0.0127 -0.0142 0.0408  275 PHE A CG  
2045 C CD1 . PHE A 278 ? 0.4402 0.4159 0.3235 -0.0130 -0.0177 0.0457  275 PHE A CD1 
2046 C CD2 . PHE A 278 ? 0.4075 0.3862 0.2963 -0.0111 -0.0151 0.0360  275 PHE A CD2 
2047 C CE1 . PHE A 278 ? 0.4311 0.4069 0.3131 -0.0114 -0.0221 0.0454  275 PHE A CE1 
2048 C CE2 . PHE A 278 ? 0.4242 0.4028 0.3115 -0.0100 -0.0192 0.0354  275 PHE A CE2 
2049 C CZ  . PHE A 278 ? 0.4503 0.4280 0.3343 -0.0100 -0.0229 0.0401  275 PHE A CZ  
2050 N N   . GLU A 279 ? 0.4594 0.4471 0.3450 -0.0178 0.0035  0.0395  276 GLU A N   
2051 C CA  . GLU A 279 ? 0.4729 0.4635 0.3617 -0.0194 0.0081  0.0409  276 GLU A CA  
2052 C C   . GLU A 279 ? 0.5112 0.5046 0.3912 -0.0219 0.0115  0.0427  276 GLU A C   
2053 O O   . GLU A 279 ? 0.5275 0.5208 0.3986 -0.0224 0.0102  0.0426  276 GLU A O   
2054 C CB  . GLU A 279 ? 0.4670 0.4606 0.3634 -0.0175 0.0113  0.0365  276 GLU A CB  
2055 C CG  . GLU A 279 ? 0.4545 0.4462 0.3593 -0.0156 0.0081  0.0358  276 GLU A CG  
2056 C CD  . GLU A 279 ? 0.4297 0.4247 0.3425 -0.0137 0.0110  0.0327  276 GLU A CD  
2057 O OE1 . GLU A 279 ? 0.3684 0.3639 0.2887 -0.0131 0.0092  0.0335  276 GLU A OE1 
2058 O OE2 . GLU A 279 ? 0.3714 0.3686 0.2827 -0.0128 0.0150  0.0296  276 GLU A OE2 
2059 O OXT . GLU A 279 ? 0.5321 0.5286 0.4135 -0.0237 0.0157  0.0444  276 GLU A OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   -2  ?   ?   ?   A . n 
A 1 2   ASN 2   -1  ?   ?   ?   A . n 
A 1 3   ALA 3   0   ?   ?   ?   A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ASN 5   2   2   ASN ASN A . n 
A 1 6   VAL 6   3   3   VAL VAL A . n 
A 1 7   PRO 7   4   4   PRO PRO A . n 
A 1 8   PHE 8   5   5   PHE PHE A . n 
A 1 9   TRP 9   6   6   TRP TRP A . n 
A 1 10  THR 10  7   7   THR THR A . n 
A 1 11  GLU 11  8   8   GLU GLU A . n 
A 1 12  GLU 12  9   9   GLU GLU A . n 
A 1 13  HIS 13  10  10  HIS HIS A . n 
A 1 14  VAL 14  11  11  VAL VAL A . n 
A 1 15  ARG 15  12  12  ARG ARG A . n 
A 1 16  ALA 16  13  13  ALA ALA A . n 
A 1 17  THR 17  14  14  THR THR A . n 
A 1 18  LEU 18  15  15  LEU LEU A . n 
A 1 19  PRO 19  16  16  PRO PRO A . n 
A 1 20  GLU 20  17  17  GLU GLU A . n 
A 1 21  ARG 21  18  18  ARG ARG A . n 
A 1 22  ASP 22  19  19  ASP ASP A . n 
A 1 23  ALA 23  20  ?   ?   ?   A . n 
A 1 24  GLU 24  21  ?   ?   ?   A . n 
A 1 25  SER 25  22  ?   ?   ?   A . n 
A 1 26  HIS 26  23  ?   ?   ?   A . n 
A 1 27  LYS 27  24  ?   ?   ?   A . n 
A 1 28  GLY 28  25  ?   ?   ?   A . n 
A 1 29  THR 29  26  26  THR THR A . n 
A 1 30  TYR 30  27  27  TYR TYR A . n 
A 1 31  GLY 31  28  28  GLY GLY A . n 
A 1 32  THR 32  29  29  THR THR A . n 
A 1 33  ALA 33  30  30  ALA ALA A . n 
A 1 34  LEU 34  31  31  LEU LEU A . n 
A 1 35  LEU 35  32  32  LEU LEU A . n 
A 1 36  LEU 36  33  33  LEU LEU A . n 
A 1 37  ALA 37  34  34  ALA ALA A . n 
A 1 38  GLY 38  35  35  GLY GLY A . n 
A 1 39  SER 39  36  36  SER SER A . n 
A 1 40  ASP 40  37  37  ASP ASP A . n 
A 1 41  ASP 41  38  38  ASP ASP A . n 
A 1 42  MET 42  39  39  MET MET A . n 
A 1 43  PRO 43  40  40  PRO PRO A . n 
A 1 44  GLY 44  41  41  GLY GLY A . n 
A 1 45  ALA 45  42  42  ALA ALA A . n 
A 1 46  ALA 46  43  43  ALA ALA A . n 
A 1 47  LEU 47  44  44  LEU LEU A . n 
A 1 48  LEU 48  45  45  LEU LEU A . n 
A 1 49  ALA 49  46  46  ALA ALA A . n 
A 1 50  GLY 50  47  47  GLY GLY A . n 
A 1 51  LEU 51  48  48  LEU LEU A . n 
A 1 52  GLY 52  49  49  GLY GLY A . n 
A 1 53  ALA 53  50  50  ALA ALA A . n 
A 1 54  MET 54  51  51  MET MET A . n 
A 1 55  ARG 55  52  52  ARG ARG A . n 
A 1 56  SER 56  53  53  SER SER A . n 
A 1 57  GLY 57  54  54  GLY GLY A . n 
A 1 58  LEU 58  55  55  LEU LEU A . n 
A 1 59  GLY 59  56  56  GLY GLY A . n 
A 1 60  LYS 60  57  57  LYS LYS A . n 
A 1 61  LEU 61  58  58  LEU LEU A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  ILE 63  60  60  ILE ILE A . n 
A 1 64  GLY 64  61  61  GLY GLY A . n 
A 1 65  THR 65  62  62  THR THR A . n 
A 1 66  SER 66  63  63  SER SER A . n 
A 1 67  GLU 67  64  64  GLU GLU A . n 
A 1 68  ASN 68  65  65  ASN ASN A . n 
A 1 69  VAL 69  66  66  VAL VAL A . n 
A 1 70  ILE 70  67  67  ILE ILE A . n 
A 1 71  PRO 71  68  68  PRO PRO A . n 
A 1 72  LEU 72  69  69  LEU LEU A . n 
A 1 73  ILE 73  70  70  ILE ILE A . n 
A 1 74  VAL 74  71  71  VAL VAL A . n 
A 1 75  PRO 75  72  72  PRO PRO A . n 
A 1 76  VAL 76  73  73  VAL VAL A . n 
A 1 77  LEU 77  74  74  LEU LEU A . n 
A 1 78  PRO 78  75  75  PRO PRO A . n 
A 1 79  GLU 79  76  76  GLU GLU A . n 
A 1 80  ALA 80  77  77  ALA ALA A . n 
A 1 81  THR 81  78  78  THR THR A . n 
A 1 82  TYR 82  79  79  TYR TYR A . n 
A 1 83  TRP 83  80  80  TRP TRP A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  ASP 85  82  82  ASP ASP A . n 
A 1 86  GLY 86  83  83  GLY GLY A . n 
A 1 87  TRP 87  84  84  TRP TRP A . n 
A 1 88  LYS 88  85  85  LYS LYS A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ALA 91  88  88  ALA ALA A . n 
A 1 92  ASP 92  89  89  ASP ASP A . n 
A 1 93  ALA 93  90  90  ALA ALA A . n 
A 1 94  GLN 94  91  91  GLN GLN A . n 
A 1 95  LEU 95  92  92  LEU LEU A . n 
A 1 96  GLU 96  93  93  GLU GLU A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  THR 98  95  95  THR THR A . n 
A 1 99  TYR 99  96  96  TYR TYR A . n 
A 1 100 ARG 100 97  97  ARG ARG A . n 
A 1 101 ALA 101 98  98  ALA ALA A . n 
A 1 102 ILE 102 99  99  ILE ILE A . n 
A 1 103 ALA 103 100 100 ALA ALA A . n 
A 1 104 ILE 104 101 101 ILE ILE A . n 
A 1 105 GLY 105 102 102 GLY GLY A . n 
A 1 106 PRO 106 103 103 PRO PRO A . n 
A 1 107 GLY 107 104 104 GLY GLY A . n 
A 1 108 LEU 108 105 105 LEU LEU A . n 
A 1 109 PRO 109 106 106 PRO PRO A . n 
A 1 110 GLN 110 107 107 GLN GLN A . n 
A 1 111 THR 111 108 108 THR THR A . n 
A 1 112 GLU 112 109 109 GLU GLU A . n 
A 1 113 SER 113 110 110 SER SER A . n 
A 1 114 VAL 114 111 111 VAL VAL A . n 
A 1 115 GLN 115 112 112 GLN GLN A . n 
A 1 116 GLN 116 113 113 GLN GLN A . n 
A 1 117 ALA 117 114 114 ALA ALA A . n 
A 1 118 VAL 118 115 115 VAL VAL A . n 
A 1 119 ASP 119 116 116 ASP ASP A . n 
A 1 120 HIS 120 117 117 HIS HIS A . n 
A 1 121 VAL 121 118 118 VAL VAL A . n 
A 1 122 LEU 122 119 119 LEU LEU A . n 
A 1 123 THR 123 120 120 THR THR A . n 
A 1 124 ALA 124 121 121 ALA ALA A . n 
A 1 125 ASP 125 122 122 ASP ASP A . n 
A 1 126 CYS 126 123 123 CYS CYS A . n 
A 1 127 PRO 127 124 124 PRO PRO A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 ILE 129 126 126 ILE ILE A . n 
A 1 130 LEU 130 127 127 LEU LEU A . n 
A 1 131 ASP 131 128 128 ASP ASP A . n 
A 1 132 ALA 132 129 129 ALA ALA A . n 
A 1 133 GLY 133 130 130 GLY GLY A . n 
A 1 134 ALA 134 131 131 ALA ALA A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 ALA 136 133 133 ALA ALA A . n 
A 1 137 LYS 137 134 134 LYS LYS A . n 
A 1 138 ARG 138 135 135 ARG ARG A . n 
A 1 139 THR 139 136 136 THR THR A . n 
A 1 140 TYR 140 137 137 TYR TYR A . n 
A 1 141 PRO 141 138 138 PRO PRO A . n 
A 1 142 LYS 142 139 139 LYS LYS A . n 
A 1 143 ARG 143 140 140 ARG ARG A . n 
A 1 144 GLU 144 141 141 GLU GLU A . n 
A 1 145 GLY 145 142 142 GLY GLY A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 VAL 147 144 144 VAL VAL A . n 
A 1 148 ILE 148 145 145 ILE ILE A . n 
A 1 149 LEU 149 146 146 LEU LEU A . n 
A 1 150 THR 150 147 147 THR THR A . n 
A 1 151 PRO 151 148 148 PRO PRO A . n 
A 1 152 HIS 152 149 149 HIS HIS A . n 
A 1 153 PRO 153 150 150 PRO PRO A . n 
A 1 154 GLY 154 151 151 GLY GLY A . n 
A 1 155 GLU 155 152 152 GLU GLU A . n 
A 1 156 PHE 156 153 153 PHE PHE A . n 
A 1 157 PHE 157 154 154 PHE PHE A . n 
A 1 158 ARG 158 155 155 ARG ARG A . n 
A 1 159 MET 159 156 156 MET MET A . n 
A 1 160 THR 160 157 157 THR THR A . n 
A 1 161 GLY 161 158 158 GLY GLY A . n 
A 1 162 VAL 162 159 159 VAL VAL A . n 
A 1 163 PRO 163 160 160 PRO PRO A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 ASN 165 162 162 ASN ASN A . n 
A 1 166 GLU 166 163 163 GLU GLU A . n 
A 1 167 LEU 167 164 164 LEU LEU A . n 
A 1 168 GLN 168 165 165 GLN GLN A . n 
A 1 169 LYS 169 166 166 LYS LYS A . n 
A 1 170 LYS 170 167 167 LYS LYS A . n 
A 1 171 ARG 171 168 168 ARG ARG A . n 
A 1 172 ALA 172 169 169 ALA ALA A . n 
A 1 173 GLU 173 170 170 GLU GLU A . n 
A 1 174 TYR 174 171 171 TYR TYR A . n 
A 1 175 ALA 175 172 172 ALA ALA A . n 
A 1 176 LYS 176 173 173 LYS LYS A . n 
A 1 177 GLU 177 174 174 GLU GLU A . n 
A 1 178 TRP 178 175 175 TRP TRP A . n 
A 1 179 ALA 179 176 176 ALA ALA A . n 
A 1 180 ALA 180 177 177 ALA ALA A . n 
A 1 181 GLN 181 178 178 GLN GLN A . n 
A 1 182 LEU 182 179 179 LEU LEU A . n 
A 1 183 GLN 183 180 180 GLN GLN A . n 
A 1 184 THR 184 181 181 THR THR A . n 
A 1 185 VAL 185 182 182 VAL VAL A . n 
A 1 186 ILE 186 183 183 ILE ILE A . n 
A 1 187 VAL 187 184 184 VAL VAL A . n 
A 1 188 LEU 188 185 185 LEU LEU A . n 
A 1 189 LYS 189 186 186 LYS LYS A . n 
A 1 190 GLY 190 187 187 GLY GLY A . n 
A 1 191 ASN 191 188 188 ASN ASN A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 THR 193 190 190 THR THR A . n 
A 1 194 VAL 194 191 191 VAL VAL A . n 
A 1 195 ILE 195 192 192 ILE ILE A . n 
A 1 196 ALA 196 193 193 ALA ALA A . n 
A 1 197 PHE 197 194 194 PHE PHE A . n 
A 1 198 PRO 198 195 195 PRO PRO A . n 
A 1 199 ASP 199 196 196 ASP ASP A . n 
A 1 200 GLY 200 197 197 GLY GLY A . n 
A 1 201 ASP 201 198 198 ASP ASP A . n 
A 1 202 CYS 202 199 199 CYS CYS A . n 
A 1 203 TRP 203 200 200 TRP TRP A . n 
A 1 204 LEU 204 201 201 LEU LEU A . n 
A 1 205 ASN 205 202 202 ASN ASN A . n 
A 1 206 PRO 206 203 203 PRO PRO A . n 
A 1 207 THR 207 204 204 THR THR A . n 
A 1 208 GLY 208 205 205 GLY GLY A . n 
A 1 209 ASN 209 206 206 ASN ASN A . n 
A 1 210 GLY 210 207 207 GLY GLY A . n 
A 1 211 ALA 211 208 208 ALA ALA A . n 
A 1 212 LEU 212 209 209 LEU LEU A . n 
A 1 213 ALA 213 210 210 ALA ALA A . n 
A 1 214 LYS 214 211 211 LYS LYS A . n 
A 1 215 GLY 215 212 212 GLY GLY A . n 
A 1 216 GLY 216 213 213 GLY GLY A . n 
A 1 217 THR 217 214 214 THR THR A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ASP 219 216 216 ASP ASP A . n 
A 1 220 THR 220 217 217 THR THR A . n 
A 1 221 LEU 221 218 218 LEU LEU A . n 
A 1 222 THR 222 219 219 THR THR A . n 
A 1 223 GLY 223 220 220 GLY GLY A . n 
A 1 224 MET 224 221 221 MET MET A . n 
A 1 225 ILE 225 222 222 ILE ILE A . n 
A 1 226 LEU 226 223 223 LEU LEU A . n 
A 1 227 GLY 227 224 224 GLY GLY A . n 
A 1 228 MET 228 225 225 MET MET A . n 
A 1 229 LEU 229 226 226 LEU LEU A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 CYS 231 228 228 CYS CYS A . n 
A 1 232 HIS 232 229 229 HIS HIS A . n 
A 1 233 GLU 233 230 230 GLU GLU A . n 
A 1 234 ASP 234 231 231 ASP ASP A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 LYS 236 233 233 LYS LYS A . n 
A 1 237 HIS 237 234 234 HIS HIS A . n 
A 1 238 ALA 238 235 235 ALA ALA A . n 
A 1 239 VAL 239 236 236 VAL VAL A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 ASN 241 238 238 ASN ASN A . n 
A 1 242 ALA 242 239 239 ALA ALA A . n 
A 1 243 VAL 243 240 240 VAL VAL A . n 
A 1 244 TYR 244 241 241 TYR TYR A . n 
A 1 245 LEU 245 242 242 LEU LEU A . n 
A 1 246 HIS 246 243 243 HIS HIS A . n 
A 1 247 GLY 247 244 244 GLY GLY A . n 
A 1 248 ALA 248 245 245 ALA ALA A . n 
A 1 249 CYS 249 246 246 CYS CYS A . n 
A 1 250 ALA 250 247 247 ALA ALA A . n 
A 1 251 GLU 251 248 248 GLU GLU A . n 
A 1 252 LEU 252 249 249 LEU LEU A . n 
A 1 253 TRP 253 250 250 TRP TRP A . n 
A 1 254 THR 254 251 251 THR THR A . n 
A 1 255 ASP 255 252 252 ASP ASP A . n 
A 1 256 GLU 256 253 253 GLU GLU A . n 
A 1 257 HIS 257 254 254 HIS HIS A . n 
A 1 258 SER 258 255 255 SER SER A . n 
A 1 259 ALA 259 256 256 ALA ALA A . n 
A 1 260 HIS 260 257 257 HIS HIS A . n 
A 1 261 THR 261 258 258 THR THR A . n 
A 1 262 LEU 262 259 259 LEU LEU A . n 
A 1 263 LEU 263 260 260 LEU LEU A . n 
A 1 264 ALA 264 261 261 ALA ALA A . n 
A 1 265 HIS 265 262 262 HIS HIS A . n 
A 1 266 GLU 266 263 263 GLU GLU A . n 
A 1 267 LEU 267 264 264 LEU LEU A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 ASP 269 266 266 ASP ASP A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 LEU 271 268 268 LEU LEU A . n 
A 1 272 PRO 272 269 269 PRO PRO A . n 
A 1 273 ARG 273 270 270 ARG ARG A . n 
A 1 274 VAL 274 271 271 VAL VAL A . n 
A 1 275 TRP 275 272 272 TRP TRP A . n 
A 1 276 LYS 276 273 273 LYS LYS A . n 
A 1 277 ARG 277 274 274 ARG ARG A . n 
A 1 278 PHE 278 275 275 PHE PHE A . n 
A 1 279 GLU 279 276 276 GLU GLU A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          PSI:Biology 
_pdbx_SG_project.full_name_of_center   'Midwest Center for Structural Genomics' 
_pdbx_SG_project.initial_of_center     MCSG 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 COA 1   277 1   COA COA A . 
C 3 GOL 1   278 2   GOL GOL A . 
D 3 GOL 1   279 3   GOL GOL A . 
E 4 HOH 1   280 1   HOH HOH A . 
E 4 HOH 2   281 2   HOH HOH A . 
E 4 HOH 3   282 3   HOH HOH A . 
E 4 HOH 4   283 4   HOH HOH A . 
E 4 HOH 5   284 5   HOH HOH A . 
E 4 HOH 6   285 6   HOH HOH A . 
E 4 HOH 7   286 7   HOH HOH A . 
E 4 HOH 8   287 8   HOH HOH A . 
E 4 HOH 9   288 9   HOH HOH A . 
E 4 HOH 10  289 10  HOH HOH A . 
E 4 HOH 11  290 11  HOH HOH A . 
E 4 HOH 12  291 12  HOH HOH A . 
E 4 HOH 13  292 13  HOH HOH A . 
E 4 HOH 14  293 14  HOH HOH A . 
E 4 HOH 15  294 15  HOH HOH A . 
E 4 HOH 16  295 16  HOH HOH A . 
E 4 HOH 17  296 17  HOH HOH A . 
E 4 HOH 18  297 18  HOH HOH A . 
E 4 HOH 19  298 19  HOH HOH A . 
E 4 HOH 20  299 20  HOH HOH A . 
E 4 HOH 21  300 21  HOH HOH A . 
E 4 HOH 22  301 22  HOH HOH A . 
E 4 HOH 23  302 23  HOH HOH A . 
E 4 HOH 24  303 24  HOH HOH A . 
E 4 HOH 25  304 25  HOH HOH A . 
E 4 HOH 26  305 26  HOH HOH A . 
E 4 HOH 27  306 27  HOH HOH A . 
E 4 HOH 28  307 28  HOH HOH A . 
E 4 HOH 29  308 29  HOH HOH A . 
E 4 HOH 30  309 30  HOH HOH A . 
E 4 HOH 31  310 31  HOH HOH A . 
E 4 HOH 32  311 32  HOH HOH A . 
E 4 HOH 33  312 33  HOH HOH A . 
E 4 HOH 34  313 34  HOH HOH A . 
E 4 HOH 35  314 35  HOH HOH A . 
E 4 HOH 36  315 36  HOH HOH A . 
E 4 HOH 37  316 37  HOH HOH A . 
E 4 HOH 38  317 38  HOH HOH A . 
E 4 HOH 39  318 39  HOH HOH A . 
E 4 HOH 40  319 40  HOH HOH A . 
E 4 HOH 41  320 41  HOH HOH A . 
E 4 HOH 42  321 42  HOH HOH A . 
E 4 HOH 43  322 43  HOH HOH A . 
E 4 HOH 44  323 44  HOH HOH A . 
E 4 HOH 45  324 45  HOH HOH A . 
E 4 HOH 46  325 46  HOH HOH A . 
E 4 HOH 47  326 47  HOH HOH A . 
E 4 HOH 48  327 48  HOH HOH A . 
E 4 HOH 49  328 49  HOH HOH A . 
E 4 HOH 50  329 50  HOH HOH A . 
E 4 HOH 51  330 51  HOH HOH A . 
E 4 HOH 52  331 52  HOH HOH A . 
E 4 HOH 53  332 53  HOH HOH A . 
E 4 HOH 54  333 54  HOH HOH A . 
E 4 HOH 55  334 55  HOH HOH A . 
E 4 HOH 56  335 56  HOH HOH A . 
E 4 HOH 57  336 57  HOH HOH A . 
E 4 HOH 58  337 58  HOH HOH A . 
E 4 HOH 59  338 59  HOH HOH A . 
E 4 HOH 60  339 60  HOH HOH A . 
E 4 HOH 61  340 61  HOH HOH A . 
E 4 HOH 62  341 62  HOH HOH A . 
E 4 HOH 63  342 63  HOH HOH A . 
E 4 HOH 64  343 64  HOH HOH A . 
E 4 HOH 65  344 65  HOH HOH A . 
E 4 HOH 66  345 66  HOH HOH A . 
E 4 HOH 67  346 67  HOH HOH A . 
E 4 HOH 68  347 68  HOH HOH A . 
E 4 HOH 69  348 69  HOH HOH A . 
E 4 HOH 70  349 70  HOH HOH A . 
E 4 HOH 71  350 71  HOH HOH A . 
E 4 HOH 72  351 72  HOH HOH A . 
E 4 HOH 73  352 73  HOH HOH A . 
E 4 HOH 74  353 74  HOH HOH A . 
E 4 HOH 75  354 75  HOH HOH A . 
E 4 HOH 76  355 76  HOH HOH A . 
E 4 HOH 77  356 77  HOH HOH A . 
E 4 HOH 78  357 78  HOH HOH A . 
E 4 HOH 79  358 79  HOH HOH A . 
E 4 HOH 80  359 80  HOH HOH A . 
E 4 HOH 81  360 81  HOH HOH A . 
E 4 HOH 82  361 82  HOH HOH A . 
E 4 HOH 83  362 83  HOH HOH A . 
E 4 HOH 84  363 84  HOH HOH A . 
E 4 HOH 85  364 85  HOH HOH A . 
E 4 HOH 86  365 86  HOH HOH A . 
E 4 HOH 87  366 87  HOH HOH A . 
E 4 HOH 88  367 88  HOH HOH A . 
E 4 HOH 89  368 89  HOH HOH A . 
E 4 HOH 90  369 90  HOH HOH A . 
E 4 HOH 91  370 91  HOH HOH A . 
E 4 HOH 92  371 92  HOH HOH A . 
E 4 HOH 93  372 93  HOH HOH A . 
E 4 HOH 94  373 94  HOH HOH A . 
E 4 HOH 95  374 95  HOH HOH A . 
E 4 HOH 96  375 96  HOH HOH A . 
E 4 HOH 97  376 97  HOH HOH A . 
E 4 HOH 98  377 98  HOH HOH A . 
E 4 HOH 99  378 99  HOH HOH A . 
E 4 HOH 100 379 100 HOH HOH A . 
E 4 HOH 101 380 101 HOH HOH A . 
E 4 HOH 102 381 102 HOH HOH A . 
E 4 HOH 103 382 103 HOH HOH A . 
E 4 HOH 104 383 104 HOH HOH A . 
E 4 HOH 105 384 105 HOH HOH A . 
E 4 HOH 106 385 106 HOH HOH A . 
E 4 HOH 107 386 107 HOH HOH A . 
E 4 HOH 108 387 108 HOH HOH A . 
E 4 HOH 109 388 109 HOH HOH A . 
E 4 HOH 110 389 110 HOH HOH A . 
E 4 HOH 111 390 111 HOH HOH A . 
E 4 HOH 112 391 112 HOH HOH A . 
E 4 HOH 113 392 113 HOH HOH A . 
E 4 HOH 114 393 114 HOH HOH A . 
E 4 HOH 115 394 115 HOH HOH A . 
E 4 HOH 116 395 116 HOH HOH A . 
E 4 HOH 117 396 117 HOH HOH A . 
E 4 HOH 118 397 118 HOH HOH A . 
E 4 HOH 119 398 119 HOH HOH A . 
E 4 HOH 120 399 120 HOH HOH A . 
E 4 HOH 121 400 121 HOH HOH A . 
E 4 HOH 122 401 122 HOH HOH A . 
E 4 HOH 123 402 123 HOH HOH A . 
E 4 HOH 124 403 124 HOH HOH A . 
E 4 HOH 125 404 125 HOH HOH A . 
E 4 HOH 126 405 126 HOH HOH A . 
E 4 HOH 127 406 127 HOH HOH A . 
E 4 HOH 128 407 128 HOH HOH A . 
E 4 HOH 129 408 129 HOH HOH A . 
E 4 HOH 130 409 130 HOH HOH A . 
E 4 HOH 131 410 131 HOH HOH A . 
E 4 HOH 132 411 132 HOH HOH A . 
E 4 HOH 133 412 133 HOH HOH A . 
E 4 HOH 134 413 134 HOH HOH A . 
E 4 HOH 135 414 135 HOH HOH A . 
E 4 HOH 136 415 136 HOH HOH A . 
E 4 HOH 137 416 137 HOH HOH A . 
E 4 HOH 138 417 138 HOH HOH A . 
E 4 HOH 139 418 139 HOH HOH A . 
E 4 HOH 140 419 140 HOH HOH A . 
E 4 HOH 141 420 141 HOH HOH A . 
E 4 HOH 142 421 142 HOH HOH A . 
E 4 HOH 143 422 143 HOH HOH A . 
E 4 HOH 144 423 144 HOH HOH A . 
E 4 HOH 145 424 145 HOH HOH A . 
E 4 HOH 146 425 146 HOH HOH A . 
E 4 HOH 147 426 147 HOH HOH A . 
E 4 HOH 148 427 148 HOH HOH A . 
E 4 HOH 149 428 149 HOH HOH A . 
E 4 HOH 150 429 150 HOH HOH A . 
E 4 HOH 151 430 151 HOH HOH A . 
E 4 HOH 152 431 152 HOH HOH A . 
E 4 HOH 153 432 153 HOH HOH A . 
E 4 HOH 154 433 154 HOH HOH A . 
E 4 HOH 155 434 155 HOH HOH A . 
E 4 HOH 156 435 156 HOH HOH A . 
E 4 HOH 157 436 157 HOH HOH A . 
E 4 HOH 158 437 158 HOH HOH A . 
E 4 HOH 159 438 159 HOH HOH A . 
E 4 HOH 160 439 160 HOH HOH A . 
E 4 HOH 161 440 161 HOH HOH A . 
E 4 HOH 162 441 162 HOH HOH A . 
E 4 HOH 163 442 163 HOH HOH A . 
E 4 HOH 164 443 164 HOH HOH A . 
E 4 HOH 165 444 165 HOH HOH A . 
E 4 HOH 166 445 166 HOH HOH A . 
E 4 HOH 167 446 167 HOH HOH A . 
E 4 HOH 168 447 168 HOH HOH A . 
E 4 HOH 169 448 169 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 14590 ? 
1 MORE         -55   ? 
1 'SSA (A^2)'  36930 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_445 -x-1,-y-1,z -1.0000000000 0.0000000000  0.0000000000 -91.7650000000 0.0000000000  
-1.0000000000 0.0000000000 -91.7650000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_455 -y-1,x,z    0.0000000000  -1.0000000000 0.0000000000 -91.7650000000 1.0000000000  
0.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_545 y,-x-1,z    0.0000000000  1.0000000000  0.0000000000 0.0000000000   -1.0000000000 
0.0000000000  0.0000000000 -91.7650000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-07-27 
2 'Structure model' 1 1 2011-09-21 
3 'Structure model' 1 2 2013-01-09 
4 'Structure model' 1 3 2022-04-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Structure summary'    
2 3 'Structure model' 'Database references'  
3 4 'Structure model' 'Database references'  
4 4 'Structure model' 'Derived calculations' 
5 4 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' audit_author       
2 4 'Structure model' citation_author    
3 4 'Structure model' database_2         
4 4 'Structure model' struct_ref_seq_dif 
5 4 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_audit_author.identifier_ORCID'      
2 4 'Structure model' '_citation_author.identifier_ORCID'   
3 4 'Structure model' '_database_2.pdbx_DOI'                
4 4 'Structure model' '_database_2.pdbx_database_accession' 
5 4 'Structure model' '_struct_ref_seq_dif.details'         
6 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
7 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
8 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
_diffrn_reflns.av_R_equivalents   0.056 
_diffrn_reflns.number             384069 
_diffrn_reflns.diffrn_id          1 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined -44.5910 -14.4240 -40.1670 0.1773 0.1222 0.0666 -0.0125 -0.0247 0.0671 7.0766 6.2676 2.2040 -5.7122 2.2018  -1.7976 
-0.0088 -0.0809 0.0898  0.2834  0.1337 -0.0602 -0.2341 -0.0241 -0.0035 'X-RAY DIFFRACTION' 
2 ? refined -40.7740 -24.3690 -14.5210 0.1119 0.0889 0.0267 -0.0165 -0.0253 0.0002 0.7845 1.4708 0.8856 -0.3051 -0.1593 -0.0450 
-0.0235 -0.0017 0.0251  -0.1002 0.0557 -0.0601 0.1702  -0.1173 0.1043  'X-RAY DIFFRACTION' 
3 ? refined -54.5090 -10.0340 -24.3140 0.1104 0.0486 0.0931 0.0292  -0.0274 0.0113 1.4800 2.6893 1.5389 0.1808  -0.2533 -0.1675 
-0.0165 0.0210  -0.0045 0.0239  0.1477 0.3556  0.0037  -0.1889 -0.1992 'X-RAY DIFFRACTION' 
4 ? refined -47.2780 -26.1310 -33.2820 0.1113 0.0877 0.0382 -0.0018 -0.0244 0.0204 0.8938 0.5024 0.5206 0.1869  -0.1386 -0.0180 
-0.0294 -0.0145 0.0439  0.0976  0.0700 0.0183  -0.1056 -0.0489 -0.0090 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 1   A 16  ? . . . . 'X-RAY DIFFRACTION' ? 
2 2 A 17  A 142 ? . . . . 'X-RAY DIFFRACTION' ? 
3 3 A 143 A 199 ? . . . . 'X-RAY DIFFRACTION' ? 
4 4 A 200 A 276 ? . . . . 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      5.5.0109 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 1 
PDB_EXTRACT 3.006    'June 11, 2008' package PDB                  help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 2 
HKL-3000    .        ?               ?       ?                    ?                     'data collection' ? ?          ? 3 
HKL-3000    .        ?               ?       ?                    ?                     'data reduction'  ? ?          ? 4 
HKL-3000    .        ?               ?       ?                    ?                     'data scaling'    ? ?          ? 5 
HKL-3000    MOLREP   ?               ?       ?                    ?                     phasing           ? ?          ? 6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 122 ? ? -104.29 79.84   
2 1 ALA A 129 ? ? 53.42   -118.34 
3 1 LYS A 167 ? ? -145.38 52.83   
4 1 GLN A 189 ? ? 46.58   70.46   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 N 1 A COA 277 ? CBP ? B COA 1 CBP 
2  1 N 1 A COA 277 ? CCP ? B COA 1 CCP 
3  1 N 1 A COA 277 ? CDP ? B COA 1 CDP 
4  1 N 1 A COA 277 ? CEP ? B COA 1 CEP 
5  1 N 1 A COA 277 ? CAP ? B COA 1 CAP 
6  1 N 1 A COA 277 ? OAP ? B COA 1 OAP 
7  1 N 1 A COA 277 ? C9P ? B COA 1 C9P 
8  1 N 1 A COA 277 ? O9P ? B COA 1 O9P 
9  1 N 1 A COA 277 ? N8P ? B COA 1 N8P 
10 1 N 1 A COA 277 ? C7P ? B COA 1 C7P 
11 1 N 1 A COA 277 ? C6P ? B COA 1 C6P 
12 1 N 1 A COA 277 ? C5P ? B COA 1 C5P 
13 1 N 1 A COA 277 ? O5P ? B COA 1 O5P 
14 1 N 1 A COA 277 ? N4P ? B COA 1 N4P 
15 1 N 1 A COA 277 ? C3P ? B COA 1 C3P 
16 1 N 1 A COA 277 ? C2P ? B COA 1 C2P 
17 1 N 1 A COA 277 ? S1P ? B COA 1 S1P 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER -2 ? A SER 1  
2 1 Y 1 A ASN -1 ? A ASN 2  
3 1 Y 1 A ALA 0  ? A ALA 3  
4 1 Y 1 A ALA 20 ? A ALA 23 
5 1 Y 1 A GLU 21 ? A GLU 24 
6 1 Y 1 A SER 22 ? A SER 25 
7 1 Y 1 A HIS 23 ? A HIS 26 
8 1 Y 1 A LYS 24 ? A LYS 27 
9 1 Y 1 A GLY 25 ? A GLY 28 
# 
_cell_measurement.reflns_used   384069 
_cell_measurement.entry_id      3RQ5 
# 
_diffrn_measurement.method      scans 
_diffrn_measurement.details     '1.00 degrees, 2.50 sec, detector distance 160.00 mm' 
_diffrn_measurement.diffrn_id   1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'COENZYME A' COA 
3 GLYCEROL     GOL 
4 water        HOH 
#