data_3RRQ
# 
_entry.id   3RRQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3RRQ         
RCSB  RCSB065297   
WWPDB D_1000065297 
# 
_pdbx_database_status.entry_id                        3RRQ 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-04-29 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lazar-Molnar, E.' 1 
'Ramagopal, U.A.'  2 
'Nathenson, S.G.'  3 
'Almo, S.C.'       4 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the extracellular domain of human  PD-1' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lazar-Molnar, E.' 1 
primary 'Ramagopal, U.A.'  2 
primary 'Nathenson, S.G.'  3 
primary 'Almo, S.C.'       4 
# 
_cell.length_a           46.020 
_cell.length_b           46.020 
_cell.length_c           187.395 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           3RRQ 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              12 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.entry_id                         3RRQ 
_symmetry.Int_Tables_number                179 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Programmed cell death protein 1' 14445.148 1  ? A132L 'Residues 32-160' ? 
2 water   nat water                             18.015    35 ? ?     ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Protein PD-1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;WNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVV
RARRNDSGTYLCGAISLAPKLQIKESLRAELRVTERRAEVPTAHPSPSP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;WNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVV
RARRNDSGTYLCGAISLAPKLQIKESLRAELRVTERRAEVPTAHPSPSP
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   TRP n 
1 2   ASN n 
1 3   PRO n 
1 4   PRO n 
1 5   THR n 
1 6   PHE n 
1 7   SER n 
1 8   PRO n 
1 9   ALA n 
1 10  LEU n 
1 11  LEU n 
1 12  VAL n 
1 13  VAL n 
1 14  THR n 
1 15  GLU n 
1 16  GLY n 
1 17  ASP n 
1 18  ASN n 
1 19  ALA n 
1 20  THR n 
1 21  PHE n 
1 22  THR n 
1 23  CYS n 
1 24  SER n 
1 25  PHE n 
1 26  SER n 
1 27  ASN n 
1 28  THR n 
1 29  SER n 
1 30  GLU n 
1 31  SER n 
1 32  PHE n 
1 33  VAL n 
1 34  LEU n 
1 35  ASN n 
1 36  TRP n 
1 37  TYR n 
1 38  ARG n 
1 39  MET n 
1 40  SER n 
1 41  PRO n 
1 42  SER n 
1 43  ASN n 
1 44  GLN n 
1 45  THR n 
1 46  ASP n 
1 47  LYS n 
1 48  LEU n 
1 49  ALA n 
1 50  ALA n 
1 51  PHE n 
1 52  PRO n 
1 53  GLU n 
1 54  ASP n 
1 55  ARG n 
1 56  SER n 
1 57  GLN n 
1 58  PRO n 
1 59  GLY n 
1 60  GLN n 
1 61  ASP n 
1 62  CYS n 
1 63  ARG n 
1 64  PHE n 
1 65  ARG n 
1 66  VAL n 
1 67  THR n 
1 68  GLN n 
1 69  LEU n 
1 70  PRO n 
1 71  ASN n 
1 72  GLY n 
1 73  ARG n 
1 74  ASP n 
1 75  PHE n 
1 76  HIS n 
1 77  MET n 
1 78  SER n 
1 79  VAL n 
1 80  VAL n 
1 81  ARG n 
1 82  ALA n 
1 83  ARG n 
1 84  ARG n 
1 85  ASN n 
1 86  ASP n 
1 87  SER n 
1 88  GLY n 
1 89  THR n 
1 90  TYR n 
1 91  LEU n 
1 92  CYS n 
1 93  GLY n 
1 94  ALA n 
1 95  ILE n 
1 96  SER n 
1 97  LEU n 
1 98  ALA n 
1 99  PRO n 
1 100 LYS n 
1 101 LEU n 
1 102 GLN n 
1 103 ILE n 
1 104 LYS n 
1 105 GLU n 
1 106 SER n 
1 107 LEU n 
1 108 ARG n 
1 109 ALA n 
1 110 GLU n 
1 111 LEU n 
1 112 ARG n 
1 113 VAL n 
1 114 THR n 
1 115 GLU n 
1 116 ARG n 
1 117 ARG n 
1 118 ALA n 
1 119 GLU n 
1 120 VAL n 
1 121 PRO n 
1 122 THR n 
1 123 ALA n 
1 124 HIS n 
1 125 PRO n 
1 126 SER n 
1 127 PRO n 
1 128 SER n 
1 129 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PD-1, PD1, PDCD1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Rosetta (DE3) pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-3a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PDCD1_HUMAN 
_struct_ref.pdbx_db_accession          Q15116 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;WNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVV
RARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSP
;
_struct_ref.pdbx_align_begin           32 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3RRQ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 129 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q15116 
_struct_ref_seq.db_align_beg                  32 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  160 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       32 
_struct_ref_seq.pdbx_auth_seq_align_end       160 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             3RRQ 
_struct_ref_seq_dif.mon_id                       LEU 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      101 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q15116 
_struct_ref_seq_dif.db_mon_id                    ALA 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          132 
_struct_ref_seq_dif.details                      'ENGINEERED MUTATION' 
_struct_ref_seq_dif.pdbx_auth_seq_num            132 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3RRQ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      1.98 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   37.97 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.pdbx_details    
'3.5M Sodium formate, 0.1M Bis-Tris, pH 7.5, Vapor diffusion, Sitting drop, temperature 298K, VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-01-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
# 
_reflns.entry_id                     3RRQ 
_reflns.d_resolution_high            2.100 
_reflns.d_resolution_low             50.000 
_reflns.number_obs                   7612 
_reflns.pdbx_Rmerge_I_obs            0.066 
_reflns.pdbx_netI_over_sigmaI        9.100 
_reflns.pdbx_chi_squared             1.012 
_reflns.pdbx_redundancy              17.400 
_reflns.percent_possible_obs         99.900 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   7612 
_reflns.pdbx_Rsym_value              0.043 
_reflns.B_iso_Wilson_estimate        36.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.number_unique_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
2.100 2.180  ? ? ? 0.572 ? ? 0.958 18.300 ? 708 100.000 1  ? 
2.180 2.260  ? ? ? 0.477 ? ? 1.080 18.200 ? 725 100.000 2  ? 
2.260 2.370  ? ? ? 0.372 ? ? 0.998 18.100 ? 731 100.000 3  ? 
2.370 2.490  ? ? ? 0.293 ? ? 0.913 18.100 ? 737 100.000 4  ? 
2.490 2.650  ? ? ? 0.223 ? ? 0.976 18.000 ? 746 100.000 5  ? 
2.650 2.850  ? ? ? 0.137 ? ? 0.932 17.800 ? 751 100.000 6  ? 
2.850 3.140  ? ? ? 0.086 ? ? 1.048 17.600 ? 746 100.000 7  ? 
3.140 3.590  ? ? ? 0.066 ? ? 1.301 17.300 ? 777 100.000 8  ? 
3.590 4.520  ? ? ? 0.038 ? ? 0.953 16.500 ? 790 100.000 9  ? 
4.520 50.000 ? ? ? 0.026 ? ? 0.958 14.900 ? 901 99.300  10 ? 
# 
_refine.entry_id                                 3RRQ 
_refine.ls_d_res_high                            2.1000 
_refine.ls_d_res_low                             36.6900 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.8500 
_refine.ls_number_reflns_obs                     7526 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : WITH TLS ADDED' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2159 
_refine.ls_R_factor_R_work                       0.2143 
_refine.ls_wR_factor_R_work                      0.2016 
_refine.ls_R_factor_R_free                       0.2488 
_refine.ls_wR_factor_R_free                      0.2339 
_refine.ls_percent_reflns_R_free                 4.7000 
_refine.ls_number_reflns_R_free                  350 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               48.9633 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.6700 
_refine.aniso_B[2][2]                            0.6700 
_refine.aniso_B[3][3]                            -1.0100 
_refine.aniso_B[1][2]                            0.3400 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9410 
_refine.correlation_coeff_Fo_to_Fc_free          0.9350 
_refine.overall_SU_R_Cruickshank_DPI             0.2301 
_refine.overall_SU_R_free                        0.1883 
_refine.pdbx_overall_ESU_R_Free                  0.1880 
_refine.overall_SU_ML                            0.1510 
_refine.overall_SU_B                             12.8690 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      1NPU 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.8019 
_refine.B_iso_max                                125.600 
_refine.B_iso_min                                20.330 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.000 
_refine.occupancy_min                            0.500 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        845 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             35 
_refine_hist.number_atoms_total               880 
_refine_hist.d_res_high                       2.1000 
_refine_hist.d_res_low                        36.6900 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       888  0.013  0.022  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    1206 1.501  1.953  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 111  7.361  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 44   36.743 22.045 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 145  16.183 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 12   15.649 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         134  0.111  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   689  0.006  0.021  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            552  2.019  2.000  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           893  3.237  3.000  ? ? 'X-RAY DIFFRACTION' 
r_scbond_it            336  2.213  2.000  ? ? 'X-RAY DIFFRACTION' 
r_scangle_it           311  3.248  3.000  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.10 
_refine_ls_shell.d_res_low                        2.1530 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               99.8100 
_refine_ls_shell.number_reflns_R_work             493 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.1970 
_refine_ls_shell.R_factor_R_free                  0.2390 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             20 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                513 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3RRQ 
_struct.title                     'Crystal structure of the extracellular domain of human PD-1' 
_struct.pdbx_descriptor           'Programmed cell death protein 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3RRQ 
_struct_keywords.text            'PD-1; Programmed death-1, costimulatory, IMMUNE SYSTEM' 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   monomer 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 83 ? SER A 87  ? ARG A 114 SER A 118 5 ? 5 
HELX_P HELX_P2 2 ALA A 98 ? LEU A 101 ? ALA A 129 LEU A 132 5 ? 4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            23 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            92 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             54 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             123 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.068 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 7  A . ? SER 38  A PRO 8   A ? PRO 39  A 1 -2.51 
2 SER 40 A . ? SER 71  A PRO 41  A ? PRO 72  A 1 4.61  
3 PHE 51 A . ? PHE 82  A PRO 52  A ? PRO 83  A 1 -0.75 
4 PRO 99 A . ? PRO 130 A LYS 100 A ? LYS 131 A 1 -3.04 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 5   ? SER A 7   ? THR A 36  SER A 38  
A 2 ALA A 19  ? SER A 24  ? ALA A 50  SER A 55  
A 3 ASP A 74  ? VAL A 79  ? ASP A 105 VAL A 110 
A 4 PHE A 64  ? GLN A 68  ? PHE A 95  GLN A 99  
B 1 LEU A 10  ? THR A 14  ? LEU A 41  THR A 45  
B 2 ALA A 109 ? THR A 114 ? ALA A 140 THR A 145 
B 3 GLY A 88  ? SER A 96  ? GLY A 119 SER A 127 
B 4 PHE A 32  ? SER A 40  ? PHE A 63  SER A 71  
B 5 ASP A 46  ? PHE A 51  ? ASP A 77  PHE A 82  
C 1 LEU A 10  ? THR A 14  ? LEU A 41  THR A 45  
C 2 ALA A 109 ? THR A 114 ? ALA A 140 THR A 145 
C 3 GLY A 88  ? SER A 96  ? GLY A 119 SER A 127 
C 4 GLN A 102 ? GLU A 105 ? GLN A 133 GLU A 136 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 7   ? N SER A 38  O THR A 22  ? O THR A 53  
A 2 3 N PHE A 21  ? N PHE A 52  O MET A 77  ? O MET A 108 
A 3 4 O HIS A 76  ? O HIS A 107 N THR A 67  ? N THR A 98  
B 1 2 N LEU A 11  ? N LEU A 42  O GLU A 110 ? O GLU A 141 
B 2 3 O LEU A 111 ? O LEU A 142 N GLY A 88  ? N GLY A 119 
B 3 4 O ILE A 95  ? O ILE A 126 N VAL A 33  ? N VAL A 64  
B 4 5 N ARG A 38  ? N ARG A 69  O ASP A 46  ? O ASP A 77  
C 1 2 N LEU A 11  ? N LEU A 42  O GLU A 110 ? O GLU A 141 
C 2 3 O LEU A 111 ? O LEU A 142 N GLY A 88  ? N GLY A 119 
C 3 4 N ALA A 94  ? N ALA A 125 O LYS A 104 ? O LYS A 135 
# 
_atom_sites.entry_id                    3RRQ 
_atom_sites.fract_transf_matrix[1][1]   0.021730 
_atom_sites.fract_transf_matrix[1][2]   0.012546 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.025091 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005336 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . ASN A 1 2   ? -26.449 30.539 12.132  1.00 65.55  ? 33  ASN A N   1 
ATOM   2   C CA  . ASN A 1 2   ? -26.365 30.150 10.682  1.00 62.97  ? 33  ASN A CA  1 
ATOM   3   C C   . ASN A 1 2   ? -25.802 28.761 10.402  1.00 57.86  ? 33  ASN A C   1 
ATOM   4   O O   . ASN A 1 2   ? -24.772 28.363 10.968  1.00 57.70  ? 33  ASN A O   1 
ATOM   5   C CB  . ASN A 1 2   ? -25.598 31.178 9.853   1.00 64.30  ? 33  ASN A CB  1 
ATOM   6   C CG  . ASN A 1 2   ? -26.287 32.517 9.820   1.00 69.56  ? 33  ASN A CG  1 
ATOM   7   O OD1 . ASN A 1 2   ? -27.524 32.608 9.792   1.00 73.67  ? 33  ASN A OD1 1 
ATOM   8   N ND2 . ASN A 1 2   ? -25.493 33.574 9.836   1.00 71.09  ? 33  ASN A ND2 1 
ATOM   9   N N   . PRO A 1 3   ? -26.486 28.024 9.512   1.00 52.88  ? 34  PRO A N   1 
ATOM   10  C CA  . PRO A 1 3   ? -26.069 26.683 9.119   1.00 46.84  ? 34  PRO A CA  1 
ATOM   11  C C   . PRO A 1 3   ? -24.803 26.758 8.288   1.00 42.06  ? 34  PRO A C   1 
ATOM   12  O O   . PRO A 1 3   ? -24.527 27.794 7.693   1.00 42.41  ? 34  PRO A O   1 
ATOM   13  C CB  . PRO A 1 3   ? -27.249 26.184 8.274   1.00 47.95  ? 34  PRO A CB  1 
ATOM   14  C CG  . PRO A 1 3   ? -27.954 27.420 7.819   1.00 50.12  ? 34  PRO A CG  1 
ATOM   15  C CD  . PRO A 1 3   ? -27.783 28.410 8.915   1.00 53.58  ? 34  PRO A CD  1 
ATOM   16  N N   . PRO A 1 4   ? -24.023 25.674 8.266   1.00 37.37  ? 35  PRO A N   1 
ATOM   17  C CA  . PRO A 1 4   ? -22.903 25.529 7.363   1.00 33.30  ? 35  PRO A CA  1 
ATOM   18  C C   . PRO A 1 4   ? -23.342 25.645 5.900   1.00 33.71  ? 35  PRO A C   1 
ATOM   19  O O   . PRO A 1 4   ? -24.493 25.332 5.558   1.00 34.77  ? 35  PRO A O   1 
ATOM   20  C CB  . PRO A 1 4   ? -22.391 24.112 7.652   1.00 31.75  ? 35  PRO A CB  1 
ATOM   21  C CG  . PRO A 1 4   ? -23.413 23.466 8.448   1.00 34.30  ? 35  PRO A CG  1 
ATOM   22  C CD  . PRO A 1 4   ? -24.204 24.506 9.134   1.00 37.00  ? 35  PRO A CD  1 
ATOM   23  N N   . THR A 1 5   ? -22.469 26.125 5.039   1.00 33.52  ? 36  THR A N   1 
ATOM   24  C CA  . THR A 1 5   ? -22.740 25.990 3.617   1.00 34.87  ? 36  THR A CA  1 
ATOM   25  C C   . THR A 1 5   ? -21.728 24.979 3.120   1.00 32.37  ? 36  THR A C   1 
ATOM   26  O O   . THR A 1 5   ? -20.688 24.792 3.761   1.00 31.51  ? 36  THR A O   1 
ATOM   27  C CB  . THR A 1 5   ? -22.548 27.312 2.875   1.00 37.82  ? 36  THR A CB  1 
ATOM   28  O OG1 . THR A 1 5   ? -21.226 27.766 3.148   1.00 41.09  ? 36  THR A OG1 1 
ATOM   29  C CG2 . THR A 1 5   ? -23.554 28.345 3.379   1.00 41.11  ? 36  THR A CG2 1 
ATOM   30  N N   . PHE A 1 6   ? -22.046 24.304 2.003   1.00 28.05  ? 37  PHE A N   1 
ATOM   31  C CA  . PHE A 1 6   ? -21.255 23.178 1.534   1.00 27.62  ? 37  PHE A CA  1 
ATOM   32  C C   . PHE A 1 6   ? -21.146 23.364 0.030   1.00 26.67  ? 37  PHE A C   1 
ATOM   33  O O   . PHE A 1 6   ? -22.164 23.466 -0.651  1.00 26.33  ? 37  PHE A O   1 
ATOM   34  C CB  . PHE A 1 6   ? -21.964 21.871 1.924   1.00 27.02  ? 37  PHE A CB  1 
ATOM   35  C CG  . PHE A 1 6   ? -21.103 20.615 1.874   1.00 27.58  ? 37  PHE A CG  1 
ATOM   36  C CD1 . PHE A 1 6   ? -21.594 19.460 1.315   1.00 28.61  ? 37  PHE A CD1 1 
ATOM   37  C CD2 . PHE A 1 6   ? -19.851 20.581 2.433   1.00 28.42  ? 37  PHE A CD2 1 
ATOM   38  C CE1 . PHE A 1 6   ? -20.811 18.285 1.290   1.00 28.38  ? 37  PHE A CE1 1 
ATOM   39  C CE2 . PHE A 1 6   ? -19.087 19.413 2.443   1.00 29.77  ? 37  PHE A CE2 1 
ATOM   40  C CZ  . PHE A 1 6   ? -19.566 18.276 1.856   1.00 30.84  ? 37  PHE A CZ  1 
ATOM   41  N N   . SER A 1 7   ? -19.920 23.478 -0.482  1.00 24.81  ? 38  SER A N   1 
ATOM   42  C CA  . SER A 1 7   ? -19.739 23.814 -1.883  1.00 28.49  ? 38  SER A CA  1 
ATOM   43  C C   . SER A 1 7   ? -18.557 23.084 -2.440  1.00 28.00  ? 38  SER A C   1 
ATOM   44  O O   . SER A 1 7   ? -17.727 22.604 -1.674  1.00 31.20  ? 38  SER A O   1 
ATOM   45  C CB  . SER A 1 7   ? -19.492 25.308 -2.078  1.00 31.00  ? 38  SER A CB  1 
ATOM   46  O OG  . SER A 1 7   ? -18.299 25.672 -1.446  1.00 38.56  ? 38  SER A OG  1 
ATOM   47  N N   . PRO A 1 8   ? -18.487 22.994 -3.788  1.00 27.87  ? 39  PRO A N   1 
ATOM   48  C CA  . PRO A 1 8   ? -19.536 23.528 -4.708  1.00 23.98  ? 39  PRO A CA  1 
ATOM   49  C C   . PRO A 1 8   ? -20.808 22.681 -4.719  1.00 25.39  ? 39  PRO A C   1 
ATOM   50  O O   . PRO A 1 8   ? -20.750 21.492 -4.399  1.00 29.35  ? 39  PRO A O   1 
ATOM   51  C CB  . PRO A 1 8   ? -18.878 23.427 -6.093  1.00 26.91  ? 39  PRO A CB  1 
ATOM   52  C CG  . PRO A 1 8   ? -17.963 22.241 -5.968  1.00 27.88  ? 39  PRO A CG  1 
ATOM   53  C CD  . PRO A 1 8   ? -17.386 22.336 -4.519  1.00 25.54  ? 39  PRO A CD  1 
ATOM   54  N N   . ALA A 1 9   ? -21.947 23.265 -5.099  1.00 21.14  ? 40  ALA A N   1 
ATOM   55  C CA  . ALA A 1 9   ? -23.188 22.512 -5.082  1.00 22.26  ? 40  ALA A CA  1 
ATOM   56  C C   . ALA A 1 9   ? -23.125 21.285 -6.022  1.00 25.17  ? 40  ALA A C   1 
ATOM   57  O O   . ALA A 1 9   ? -23.868 20.296 -5.836  1.00 25.21  ? 40  ALA A O   1 
ATOM   58  C CB  . ALA A 1 9   ? -24.406 23.453 -5.443  1.00 26.21  ? 40  ALA A CB  1 
ATOM   59  N N   . LEU A 1 10  ? -22.290 21.362 -7.070  1.00 22.37  ? 41  LEU A N   1 
ATOM   60  C CA  . LEU A 1 10  ? -22.168 20.235 -8.002  1.00 24.94  ? 41  LEU A CA  1 
ATOM   61  C C   . LEU A 1 10  ? -20.688 20.179 -8.327  1.00 24.04  ? 41  LEU A C   1 
ATOM   62  O O   . LEU A 1 10  ? -20.132 21.149 -8.862  1.00 25.28  ? 41  LEU A O   1 
ATOM   63  C CB  . LEU A 1 10  ? -23.003 20.451 -9.294  1.00 25.60  ? 41  LEU A CB  1 
ATOM   64  C CG  . LEU A 1 10  ? -22.760 19.423 -10.431 1.00 24.98  ? 41  LEU A CG  1 
ATOM   65  C CD1 . LEU A 1 10  ? -22.897 17.961 -9.986  1.00 20.33  ? 41  LEU A CD1 1 
ATOM   66  C CD2 . LEU A 1 10  ? -23.702 19.730 -11.585 1.00 26.45  ? 41  LEU A CD2 1 
ATOM   67  N N   . LEU A 1 11  ? -20.055 19.085 -7.938  1.00 22.50  ? 42  LEU A N   1 
ATOM   68  C CA  . LEU A 1 11  ? -18.651 18.856 -8.216  1.00 20.96  ? 42  LEU A CA  1 
ATOM   69  C C   . LEU A 1 11  ? -18.551 17.612 -9.091  1.00 24.05  ? 42  LEU A C   1 
ATOM   70  O O   . LEU A 1 11  ? -19.100 16.562 -8.799  1.00 22.89  ? 42  LEU A O   1 
ATOM   71  C CB  . LEU A 1 11  ? -17.930 18.636 -6.900  1.00 22.65  ? 42  LEU A CB  1 
ATOM   72  C CG  . LEU A 1 11  ? -16.478 18.178 -6.943  1.00 25.49  ? 42  LEU A CG  1 
ATOM   73  C CD1 . LEU A 1 11  ? -15.594 19.222 -7.612  1.00 24.99  ? 42  LEU A CD1 1 
ATOM   74  C CD2 . LEU A 1 11  ? -16.131 18.004 -5.497  1.00 27.91  ? 42  LEU A CD2 1 
ATOM   75  N N   . VAL A 1 12  ? -17.890 17.743 -10.208 1.00 25.68  ? 43  VAL A N   1 
ATOM   76  C CA  . VAL A 1 12  ? -17.750 16.629 -11.133 1.00 28.55  ? 43  VAL A CA  1 
ATOM   77  C C   . VAL A 1 12  ? -16.252 16.383 -11.209 1.00 30.52  ? 43  VAL A C   1 
ATOM   78  O O   . VAL A 1 12  ? -15.488 17.321 -11.410 1.00 27.58  ? 43  VAL A O   1 
ATOM   79  C CB  . VAL A 1 12  ? -18.234 17.063 -12.528 1.00 31.24  ? 43  VAL A CB  1 
ATOM   80  C CG1 . VAL A 1 12  ? -17.955 15.973 -13.578 1.00 30.67  ? 43  VAL A CG1 1 
ATOM   81  C CG2 . VAL A 1 12  ? -19.702 17.427 -12.462 1.00 26.76  ? 43  VAL A CG2 1 
ATOM   82  N N   . VAL A 1 13  ? -15.828 15.140 -11.044 1.00 27.52  ? 44  VAL A N   1 
ATOM   83  C CA  . VAL A 1 13  ? -14.434 14.825 -11.257 1.00 27.71  ? 44  VAL A CA  1 
ATOM   84  C C   . VAL A 1 13  ? -14.393 13.470 -11.953 1.00 30.91  ? 44  VAL A C   1 
ATOM   85  O O   . VAL A 1 13  ? -15.418 12.797 -12.068 1.00 29.17  ? 44  VAL A O   1 
ATOM   86  C CB  . VAL A 1 13  ? -13.666 14.735 -9.917  1.00 29.02  ? 44  VAL A CB  1 
ATOM   87  C CG1 . VAL A 1 13  ? -13.842 16.035 -9.062  1.00 27.85  ? 44  VAL A CG1 1 
ATOM   88  C CG2 . VAL A 1 13  ? -14.153 13.536 -9.131  1.00 29.73  ? 44  VAL A CG2 1 
ATOM   89  N N   . THR A 1 14  ? -13.214 13.087 -12.423 1.00 28.76  ? 45  THR A N   1 
ATOM   90  C CA  . THR A 1 14  ? -12.989 11.837 -13.151 1.00 34.48  ? 45  THR A CA  1 
ATOM   91  C C   . THR A 1 14  ? -12.518 10.809 -12.157 1.00 34.41  ? 45  THR A C   1 
ATOM   92  O O   . THR A 1 14  ? -11.809 11.159 -11.204 1.00 32.63  ? 45  THR A O   1 
ATOM   93  C CB  . THR A 1 14  ? -11.892 12.063 -14.153 1.00 38.60  ? 45  THR A CB  1 
ATOM   94  O OG1 . THR A 1 14  ? -12.351 13.074 -15.052 1.00 42.66  ? 45  THR A OG1 1 
ATOM   95  C CG2 . THR A 1 14  ? -11.550 10.776 -14.931 1.00 41.76  ? 45  THR A CG2 1 
ATOM   96  N N   . GLU A 1 15  ? -12.921 9.563  -12.332 1.00 33.24  ? 46  GLU A N   1 
ATOM   97  C CA  . GLU A 1 15  ? -12.526 8.527  -11.379 1.00 36.55  ? 46  GLU A CA  1 
ATOM   98  C C   . GLU A 1 15  ? -11.009 8.506  -11.257 1.00 37.59  ? 46  GLU A C   1 
ATOM   99  O O   . GLU A 1 15  ? -10.274 8.650  -12.248 1.00 38.23  ? 46  GLU A O   1 
ATOM   100 C CB  . GLU A 1 15  ? -13.087 7.141  -11.766 1.00 38.18  ? 46  GLU A CB  1 
ATOM   101 C CG  . GLU A 1 15  ? -12.469 6.537  -12.971 1.00 46.31  ? 46  GLU A CG  1 
ATOM   102 C CD  . GLU A 1 15  ? -13.108 5.206  -13.354 1.00 51.06  ? 46  GLU A CD  1 
ATOM   103 O OE1 . GLU A 1 15  ? -13.164 4.888  -14.560 1.00 53.96  ? 46  GLU A OE1 1 
ATOM   104 O OE2 . GLU A 1 15  ? -13.557 4.489  -12.441 1.00 54.41  ? 46  GLU A OE2 1 
ATOM   105 N N   . GLY A 1 16  ? -10.520 8.362  -10.036 1.00 39.17  ? 47  GLY A N   1 
ATOM   106 C CA  . GLY A 1 16  ? -9.078  8.401  -9.827  1.00 36.75  ? 47  GLY A CA  1 
ATOM   107 C C   . GLY A 1 16  ? -8.641  9.735  -9.272  1.00 36.87  ? 47  GLY A C   1 
ATOM   108 O O   . GLY A 1 16  ? -7.642  9.797  -8.563  1.00 35.95  ? 47  GLY A O   1 
ATOM   109 N N   . ASP A 1 17  ? -9.376  10.800 -9.590  1.00 31.23  ? 48  ASP A N   1 
ATOM   110 C CA  . ASP A 1 17  ? -9.020  12.117 -9.098  1.00 35.54  ? 48  ASP A CA  1 
ATOM   111 C C   . ASP A 1 17  ? -9.483  12.322 -7.665  1.00 34.54  ? 48  ASP A C   1 
ATOM   112 O O   . ASP A 1 17  ? -10.254 11.526 -7.131  1.00 36.23  ? 48  ASP A O   1 
ATOM   113 C CB  . ASP A 1 17  ? -9.565  13.223 -10.015 1.00 39.31  ? 48  ASP A CB  1 
ATOM   114 C CG  . ASP A 1 17  ? -8.811  13.272 -11.339 1.00 45.73  ? 48  ASP A CG  1 
ATOM   115 O OD1 . ASP A 1 17  ? -9.208  13.986 -12.278 1.00 49.02  ? 48  ASP A OD1 1 
ATOM   116 O OD2 . ASP A 1 17  ? -7.802  12.550 -11.430 1.00 52.29  ? 48  ASP A OD2 1 
ATOM   117 N N   . ASN A 1 18  ? -9.002  13.382 -7.029  1.00 34.30  ? 49  ASN A N   1 
ATOM   118 C CA  . ASN A 1 18  ? -9.487  13.709 -5.699  1.00 33.26  ? 49  ASN A CA  1 
ATOM   119 C C   . ASN A 1 18  ? -10.687 14.610 -5.869  1.00 34.06  ? 49  ASN A C   1 
ATOM   120 O O   . ASN A 1 18  ? -10.847 15.255 -6.902  1.00 31.17  ? 49  ASN A O   1 
ATOM   121 C CB  . ASN A 1 18  ? -8.457  14.471 -4.889  1.00 34.59  ? 49  ASN A CB  1 
ATOM   122 C CG  . ASN A 1 18  ? -7.165  13.747 -4.786  1.00 37.72  ? 49  ASN A CG  1 
ATOM   123 O OD1 . ASN A 1 18  ? -7.131  12.554 -4.489  1.00 38.18  ? 49  ASN A OD1 1 
ATOM   124 N ND2 . ASN A 1 18  ? -6.081  14.459 -5.024  1.00 37.96  ? 49  ASN A ND2 1 
ATOM   125 N N   . ALA A 1 19  ? -11.532 14.660 -4.849  1.00 30.69  ? 50  ALA A N   1 
ATOM   126 C CA  . ALA A 1 19  ? -12.707 15.475 -4.934  1.00 30.01  ? 50  ALA A CA  1 
ATOM   127 C C   . ALA A 1 19  ? -12.794 16.241 -3.605  1.00 29.75  ? 50  ALA A C   1 
ATOM   128 O O   . ALA A 1 19  ? -12.827 15.621 -2.553  1.00 30.46  ? 50  ALA A O   1 
ATOM   129 C CB  . ALA A 1 19  ? -13.899 14.603 -5.110  1.00 28.78  ? 50  ALA A CB  1 
ATOM   130 N N   . THR A 1 20  ? -12.843 17.573 -3.652  1.00 28.55  ? 51  THR A N   1 
ATOM   131 C CA  . THR A 1 20  ? -12.833 18.324 -2.421  1.00 25.63  ? 51  THR A CA  1 
ATOM   132 C C   . THR A 1 20  ? -14.038 19.246 -2.331  1.00 27.95  ? 51  THR A C   1 
ATOM   133 O O   . THR A 1 20  ? -14.254 20.100 -3.220  1.00 25.83  ? 51  THR A O   1 
ATOM   134 C CB  . THR A 1 20  ? -11.507 19.073 -2.311  1.00 27.26  ? 51  THR A CB  1 
ATOM   135 O OG1 . THR A 1 20  ? -10.487 18.094 -2.082  1.00 27.81  ? 51  THR A OG1 1 
ATOM   136 C CG2 . THR A 1 20  ? -11.509 20.077 -1.147  1.00 24.16  ? 51  THR A CG2 1 
ATOM   137 N N   . PHE A 1 21  ? -14.849 19.056 -1.288  1.00 25.37  ? 52  PHE A N   1 
ATOM   138 C CA  . PHE A 1 21  ? -15.847 20.074 -0.947  1.00 25.16  ? 52  PHE A CA  1 
ATOM   139 C C   . PHE A 1 21  ? -15.323 20.928 0.180   1.00 24.13  ? 52  PHE A C   1 
ATOM   140 O O   . PHE A 1 21  ? -14.481 20.497 0.964   1.00 26.39  ? 52  PHE A O   1 
ATOM   141 C CB  . PHE A 1 21  ? -17.143 19.435 -0.453  1.00 25.24  ? 52  PHE A CB  1 
ATOM   142 C CG  . PHE A 1 21  ? -17.833 18.593 -1.466  1.00 25.76  ? 52  PHE A CG  1 
ATOM   143 C CD1 . PHE A 1 21  ? -17.693 17.224 -1.459  1.00 27.78  ? 52  PHE A CD1 1 
ATOM   144 C CD2 . PHE A 1 21  ? -18.667 19.185 -2.411  1.00 26.56  ? 52  PHE A CD2 1 
ATOM   145 C CE1 . PHE A 1 21  ? -18.384 16.432 -2.412  1.00 32.49  ? 52  PHE A CE1 1 
ATOM   146 C CE2 . PHE A 1 21  ? -19.346 18.433 -3.354  1.00 29.15  ? 52  PHE A CE2 1 
ATOM   147 C CZ  . PHE A 1 21  ? -19.223 17.052 -3.356  1.00 30.54  ? 52  PHE A CZ  1 
ATOM   148 N N   . THR A 1 22  ? -15.900 22.105 0.310   1.00 24.43  ? 53  THR A N   1 
ATOM   149 C CA  . THR A 1 22  ? -15.627 22.987 1.412   1.00 26.36  ? 53  THR A CA  1 
ATOM   150 C C   . THR A 1 22  ? -16.887 23.235 2.233   1.00 29.01  ? 53  THR A C   1 
ATOM   151 O O   . THR A 1 22  ? -17.913 23.653 1.704   1.00 27.07  ? 53  THR A O   1 
ATOM   152 C CB  . THR A 1 22  ? -15.118 24.330 0.881   1.00 28.17  ? 53  THR A CB  1 
ATOM   153 O OG1 . THR A 1 22  ? -13.964 24.073 0.075   1.00 30.61  ? 53  THR A OG1 1 
ATOM   154 C CG2 . THR A 1 22  ? -14.755 25.300 2.049   1.00 27.77  ? 53  THR A CG2 1 
ATOM   155 N N   . CYS A 1 23  ? -16.792 22.976 3.531   1.00 29.50  ? 54  CYS A N   1 
ATOM   156 C CA  . CYS A 1 23  ? -17.870 23.264 4.441   1.00 32.77  ? 54  CYS A CA  1 
ATOM   157 C C   . CYS A 1 23  ? -17.467 24.534 5.190   1.00 35.75  ? 54  CYS A C   1 
ATOM   158 O O   . CYS A 1 23  ? -16.388 24.563 5.785   1.00 36.16  ? 54  CYS A O   1 
ATOM   159 C CB  . CYS A 1 23  ? -18.054 22.080 5.420   1.00 32.24  ? 54  CYS A CB  1 
ATOM   160 S SG  . CYS A 1 23  ? -19.321 22.339 6.722   1.00 34.91  ? 54  CYS A SG  1 
ATOM   161 N N   . SER A 1 24  ? -18.297 25.580 5.135   1.00 34.96  ? 55  SER A N   1 
ATOM   162 C CA  . SER A 1 24  ? -18.032 26.807 5.873   1.00 37.66  ? 55  SER A CA  1 
ATOM   163 C C   . SER A 1 24  ? -19.022 27.009 6.973   1.00 42.22  ? 55  SER A C   1 
ATOM   164 O O   . SER A 1 24  ? -20.238 27.010 6.732   1.00 41.95  ? 55  SER A O   1 
ATOM   165 C CB  . SER A 1 24  ? -18.073 28.016 4.964   1.00 38.38  ? 55  SER A CB  1 
ATOM   166 O OG  . SER A 1 24  ? -17.196 27.767 3.890   1.00 43.25  ? 55  SER A OG  1 
ATOM   167 N N   . PHE A 1 25  ? -18.500 27.189 8.183   1.00 45.70  ? 56  PHE A N   1 
ATOM   168 C CA  . PHE A 1 25  ? -19.327 27.297 9.374   1.00 49.31  ? 56  PHE A CA  1 
ATOM   169 C C   . PHE A 1 25  ? -18.600 28.104 10.415  1.00 55.64  ? 56  PHE A C   1 
ATOM   170 O O   . PHE A 1 25  ? -17.466 27.762 10.754  1.00 52.38  ? 56  PHE A O   1 
ATOM   171 C CB  . PHE A 1 25  ? -19.558 25.916 9.972   1.00 49.10  ? 56  PHE A CB  1 
ATOM   172 C CG  . PHE A 1 25  ? -20.408 25.950 11.201  1.00 55.40  ? 56  PHE A CG  1 
ATOM   173 C CD1 . PHE A 1 25  ? -21.729 26.371 11.126  1.00 56.91  ? 56  PHE A CD1 1 
ATOM   174 C CD2 . PHE A 1 25  ? -19.885 25.611 12.439  1.00 58.58  ? 56  PHE A CD2 1 
ATOM   175 C CE1 . PHE A 1 25  ? -22.534 26.432 12.269  1.00 60.68  ? 56  PHE A CE1 1 
ATOM   176 C CE2 . PHE A 1 25  ? -20.673 25.668 13.587  1.00 62.41  ? 56  PHE A CE2 1 
ATOM   177 C CZ  . PHE A 1 25  ? -22.005 26.080 13.503  1.00 63.13  ? 56  PHE A CZ  1 
ATOM   178 N N   . SER A 1 26  ? -19.224 29.151 10.952  1.00 62.79  ? 57  SER A N   1 
ATOM   179 C CA  . SER A 1 26  ? -18.629 29.855 12.120  1.00 71.34  ? 57  SER A CA  1 
ATOM   180 C C   . SER A 1 26  ? -19.572 29.945 13.341  1.00 77.85  ? 57  SER A C   1 
ATOM   181 O O   . SER A 1 26  ? -20.735 30.335 13.213  1.00 77.55  ? 57  SER A O   1 
ATOM   182 C CB  . SER A 1 26  ? -18.014 31.228 11.746  1.00 71.52  ? 57  SER A CB  1 
ATOM   183 O OG  . SER A 1 26  ? -18.891 32.038 10.981  1.00 70.28  ? 57  SER A OG  1 
ATOM   184 N N   . ASN A 1 27  ? -19.063 29.561 14.515  1.00 85.34  ? 58  ASN A N   1 
ATOM   185 C CA  . ASN A 1 27  ? -19.878 29.532 15.739  1.00 93.47  ? 58  ASN A CA  1 
ATOM   186 C C   . ASN A 1 27  ? -19.110 29.921 17.002  1.00 99.47  ? 58  ASN A C   1 
ATOM   187 O O   . ASN A 1 27  ? -18.252 29.171 17.479  1.00 100.60 ? 58  ASN A O   1 
ATOM   188 C CB  . ASN A 1 27  ? -20.511 28.147 15.916  1.00 94.51  ? 58  ASN A CB  1 
ATOM   189 C CG  . ASN A 1 27  ? -21.362 28.033 17.174  1.00 99.20  ? 58  ASN A CG  1 
ATOM   190 O OD1 . ASN A 1 27  ? -21.828 29.034 17.729  1.00 102.52 ? 58  ASN A OD1 1 
ATOM   191 N ND2 . ASN A 1 27  ? -21.574 26.797 17.627  1.00 99.98  ? 58  ASN A ND2 1 
ATOM   192 N N   . THR A 1 28  ? -19.441 31.091 17.546  1.00 105.19 ? 59  THR A N   1 
ATOM   193 C CA  . THR A 1 28  ? -18.791 31.610 18.751  1.00 111.59 ? 59  THR A CA  1 
ATOM   194 C C   . THR A 1 28  ? -19.304 30.931 20.034  1.00 116.35 ? 59  THR A C   1 
ATOM   195 O O   . THR A 1 28  ? -20.302 31.367 20.624  1.00 119.57 ? 59  THR A O   1 
ATOM   196 C CB  . THR A 1 28  ? -18.964 33.149 18.869  1.00 113.74 ? 59  THR A CB  1 
ATOM   197 N N   . SER A 1 29  ? -18.603 29.872 20.455  1.00 117.52 ? 60  SER A N   1 
ATOM   198 C CA  . SER A 1 29  ? -18.944 29.089 21.654  1.00 121.08 ? 60  SER A CA  1 
ATOM   199 C C   . SER A 1 29  ? -19.963 27.985 21.361  1.00 119.55 ? 60  SER A C   1 
ATOM   200 O O   . SER A 1 29  ? -19.697 27.079 20.568  1.00 115.92 ? 60  SER A O   1 
ATOM   201 C CB  . SER A 1 29  ? -19.423 29.984 22.808  1.00 125.60 ? 60  SER A CB  1 
ATOM   202 N N   . SER A 1 31  ? -18.428 25.279 21.511  1.00 90.75  ? 62  SER A N   1 
ATOM   203 C CA  . SER A 1 31  ? -17.772 24.205 20.760  1.00 88.80  ? 62  SER A CA  1 
ATOM   204 C C   . SER A 1 31  ? -18.712 23.473 19.802  1.00 84.88  ? 62  SER A C   1 
ATOM   205 O O   . SER A 1 31  ? -19.941 23.538 19.932  1.00 86.50  ? 62  SER A O   1 
ATOM   206 C CB  . SER A 1 31  ? -17.141 23.192 21.714  1.00 91.72  ? 62  SER A CB  1 
ATOM   207 O OG  . SER A 1 31  ? -15.814 23.556 22.029  1.00 93.61  ? 62  SER A OG  1 
ATOM   208 N N   . PHE A 1 32  ? -18.126 22.758 18.850  1.00 80.81  ? 63  PHE A N   1 
ATOM   209 C CA  . PHE A 1 32  ? -18.919 22.003 17.887  1.00 75.87  ? 63  PHE A CA  1 
ATOM   210 C C   . PHE A 1 32  ? -18.201 20.769 17.296  1.00 71.31  ? 63  PHE A C   1 
ATOM   211 O O   . PHE A 1 32  ? -16.970 20.736 17.196  1.00 69.77  ? 63  PHE A O   1 
ATOM   212 C CB  . PHE A 1 32  ? -19.449 22.933 16.776  1.00 75.45  ? 63  PHE A CB  1 
ATOM   213 C CG  . PHE A 1 32  ? -18.365 23.567 15.917  1.00 76.12  ? 63  PHE A CG  1 
ATOM   214 C CD1 . PHE A 1 32  ? -17.661 22.816 14.977  1.00 73.16  ? 63  PHE A CD1 1 
ATOM   215 C CD2 . PHE A 1 32  ? -18.074 24.923 16.027  1.00 77.99  ? 63  PHE A CD2 1 
ATOM   216 C CE1 . PHE A 1 32  ? -16.669 23.397 14.187  1.00 73.00  ? 63  PHE A CE1 1 
ATOM   217 C CE2 . PHE A 1 32  ? -17.082 25.513 15.227  1.00 77.28  ? 63  PHE A CE2 1 
ATOM   218 C CZ  . PHE A 1 32  ? -16.381 24.745 14.311  1.00 73.67  ? 63  PHE A CZ  1 
ATOM   219 N N   . VAL A 1 33  ? -18.987 19.755 16.934  1.00 66.29  ? 64  VAL A N   1 
ATOM   220 C CA  . VAL A 1 33  ? -18.519 18.663 16.077  1.00 60.31  ? 64  VAL A CA  1 
ATOM   221 C C   . VAL A 1 33  ? -19.082 18.909 14.681  1.00 55.89  ? 64  VAL A C   1 
ATOM   222 O O   . VAL A 1 33  ? -20.257 19.288 14.531  1.00 52.03  ? 64  VAL A O   1 
ATOM   223 C CB  . VAL A 1 33  ? -19.001 17.274 16.564  1.00 63.22  ? 64  VAL A CB  1 
ATOM   224 C CG1 . VAL A 1 33  ? -18.499 16.166 15.640  1.00 59.91  ? 64  VAL A CG1 1 
ATOM   225 C CG2 . VAL A 1 33  ? -18.556 17.010 18.012  1.00 69.10  ? 64  VAL A CG2 1 
ATOM   226 N N   . LEU A 1 34  ? -18.248 18.682 13.667  1.00 51.34  ? 65  LEU A N   1 
ATOM   227 C CA  . LEU A 1 34  ? -18.602 18.976 12.294  1.00 50.76  ? 65  LEU A CA  1 
ATOM   228 C C   . LEU A 1 34  ? -18.534 17.684 11.504  1.00 50.37  ? 65  LEU A C   1 
ATOM   229 O O   . LEU A 1 34  ? -17.437 17.201 11.232  1.00 51.06  ? 65  LEU A O   1 
ATOM   230 C CB  . LEU A 1 34  ? -17.594 19.968 11.704  1.00 51.03  ? 65  LEU A CB  1 
ATOM   231 C CG  . LEU A 1 34  ? -18.149 21.105 10.845  1.00 52.86  ? 65  LEU A CG  1 
ATOM   232 C CD1 . LEU A 1 34  ? -17.191 21.458 9.707   1.00 50.21  ? 65  LEU A CD1 1 
ATOM   233 C CD2 . LEU A 1 34  ? -19.485 20.735 10.268  1.00 52.22  ? 65  LEU A CD2 1 
ATOM   234 N N   . ASN A 1 35  ? -19.699 17.144 11.126  1.00 46.57  ? 66  ASN A N   1 
ATOM   235 C CA  . ASN A 1 35  ? -19.797 15.853 10.459  1.00 42.43  ? 66  ASN A CA  1 
ATOM   236 C C   . ASN A 1 35  ? -20.045 15.908 8.954   1.00 37.74  ? 66  ASN A C   1 
ATOM   237 O O   . ASN A 1 35  ? -20.736 16.790 8.472   1.00 36.06  ? 66  ASN A O   1 
ATOM   238 C CB  . ASN A 1 35  ? -20.881 15.048 11.120  1.00 46.65  ? 66  ASN A CB  1 
ATOM   239 C CG  . ASN A 1 35  ? -20.495 14.620 12.522  1.00 54.83  ? 66  ASN A CG  1 
ATOM   240 O OD1 . ASN A 1 35  ? -19.343 14.800 12.943  1.00 56.75  ? 66  ASN A OD1 1 
ATOM   241 N ND2 . ASN A 1 35  ? -21.445 14.034 13.245  1.00 57.51  ? 66  ASN A ND2 1 
ATOM   242 N N   . TRP A 1 36  ? -19.478 14.962 8.218   1.00 32.60  ? 67  TRP A N   1 
ATOM   243 C CA  . TRP A 1 36  ? -19.629 14.927 6.775   1.00 34.10  ? 67  TRP A CA  1 
ATOM   244 C C   . TRP A 1 36  ? -20.424 13.651 6.523   1.00 36.20  ? 67  TRP A C   1 
ATOM   245 O O   . TRP A 1 36  ? -19.988 12.552 6.892   1.00 37.81  ? 67  TRP A O   1 
ATOM   246 C CB  . TRP A 1 36  ? -18.243 14.909 6.090   1.00 33.82  ? 67  TRP A CB  1 
ATOM   247 C CG  . TRP A 1 36  ? -18.211 14.793 4.554   1.00 29.90  ? 67  TRP A CG  1 
ATOM   248 C CD1 . TRP A 1 36  ? -19.221 15.092 3.680   1.00 29.87  ? 67  TRP A CD1 1 
ATOM   249 C CD2 . TRP A 1 36  ? -17.088 14.385 3.744   1.00 31.18  ? 67  TRP A CD2 1 
ATOM   250 N NE1 . TRP A 1 36  ? -18.803 14.881 2.383   1.00 32.01  ? 67  TRP A NE1 1 
ATOM   251 C CE2 . TRP A 1 36  ? -17.498 14.447 2.397   1.00 30.25  ? 67  TRP A CE2 1 
ATOM   252 C CE3 . TRP A 1 36  ? -15.776 13.954 4.033   1.00 33.76  ? 67  TRP A CE3 1 
ATOM   253 C CZ2 . TRP A 1 36  ? -16.653 14.089 1.337   1.00 29.16  ? 67  TRP A CZ2 1 
ATOM   254 C CZ3 . TRP A 1 36  ? -14.934 13.615 2.985   1.00 31.23  ? 67  TRP A CZ3 1 
ATOM   255 C CH2 . TRP A 1 36  ? -15.374 13.692 1.652   1.00 31.36  ? 67  TRP A CH2 1 
ATOM   256 N N   . TYR A 1 37  ? -21.606 13.807 5.953   1.00 32.20  ? 68  TYR A N   1 
ATOM   257 C CA  . TYR A 1 37  ? -22.469 12.671 5.716   1.00 32.92  ? 68  TYR A CA  1 
ATOM   258 C C   . TYR A 1 37  ? -22.623 12.445 4.218   1.00 33.20  ? 68  TYR A C   1 
ATOM   259 O O   . TYR A 1 37  ? -22.680 13.406 3.447   1.00 30.57  ? 68  TYR A O   1 
ATOM   260 C CB  . TYR A 1 37  ? -23.850 12.936 6.320   1.00 34.50  ? 68  TYR A CB  1 
ATOM   261 C CG  . TYR A 1 37  ? -23.825 13.083 7.822   1.00 38.45  ? 68  TYR A CG  1 
ATOM   262 C CD1 . TYR A 1 37  ? -23.761 11.970 8.641   1.00 41.92  ? 68  TYR A CD1 1 
ATOM   263 C CD2 . TYR A 1 37  ? -23.863 14.334 8.424   1.00 39.96  ? 68  TYR A CD2 1 
ATOM   264 C CE1 . TYR A 1 37  ? -23.759 12.089 10.045  1.00 45.57  ? 68  TYR A CE1 1 
ATOM   265 C CE2 . TYR A 1 37  ? -23.851 14.470 9.826   1.00 42.52  ? 68  TYR A CE2 1 
ATOM   266 C CZ  . TYR A 1 37  ? -23.794 13.340 10.623  1.00 45.11  ? 68  TYR A CZ  1 
ATOM   267 O OH  . TYR A 1 37  ? -23.778 13.454 12.004  1.00 49.92  ? 68  TYR A OH  1 
ATOM   268 N N   . ARG A 1 38  ? -22.697 11.182 3.812   1.00 34.54  ? 69  ARG A N   1 
ATOM   269 C CA  . ARG A 1 38  ? -23.222 10.838 2.494   1.00 37.21  ? 69  ARG A CA  1 
ATOM   270 C C   . ARG A 1 38  ? -24.743 10.579 2.602   1.00 40.83  ? 69  ARG A C   1 
ATOM   271 O O   . ARG A 1 38  ? -25.168 9.802  3.455   1.00 40.63  ? 69  ARG A O   1 
ATOM   272 C CB  . ARG A 1 38  ? -22.526 9.582  1.977   1.00 41.04  ? 69  ARG A CB  1 
ATOM   273 C CG  . ARG A 1 38  ? -22.980 9.207  0.607   1.00 43.50  ? 69  ARG A CG  1 
ATOM   274 C CD  . ARG A 1 38  ? -22.088 8.188  -0.034  1.00 44.06  ? 69  ARG A CD  1 
ATOM   275 N NE  . ARG A 1 38  ? -22.504 7.958  -1.412  1.00 42.77  ? 69  ARG A NE  1 
ATOM   276 C CZ  . ARG A 1 38  ? -21.888 7.099  -2.215  1.00 45.95  ? 69  ARG A CZ  1 
ATOM   277 N NH1 . ARG A 1 38  ? -20.834 6.398  -1.753  1.00 45.35  ? 69  ARG A NH1 1 
ATOM   278 N NH2 . ARG A 1 38  ? -22.316 6.943  -3.464  1.00 44.86  ? 69  ARG A NH2 1 
ATOM   279 N N   . MET A 1 39  ? -25.564 11.216 1.756   1.00 40.43  ? 70  MET A N   1 
ATOM   280 C CA  . MET A 1 39  ? -27.028 11.113 1.939   1.00 44.39  ? 70  MET A CA  1 
ATOM   281 C C   . MET A 1 39  ? -27.678 10.270 0.884   1.00 45.58  ? 70  MET A C   1 
ATOM   282 O O   . MET A 1 39  ? -28.811 9.896  1.019   1.00 51.99  ? 70  MET A O   1 
ATOM   283 C CB  . MET A 1 39  ? -27.691 12.491 1.908   1.00 43.08  ? 70  MET A CB  1 
ATOM   284 C CG  . MET A 1 39  ? -27.116 13.490 2.888   1.00 41.68  ? 70  MET A CG  1 
ATOM   285 S SD  . MET A 1 39  ? -27.393 12.969 4.583   1.00 45.43  ? 70  MET A SD  1 
ATOM   286 C CE  . MET A 1 39  ? -29.199 12.984 4.716   1.00 47.36  ? 70  MET A CE  1 
ATOM   287 N N   . SER A 1 40  ? -26.980 10.010 -0.201  1.00 47.34  ? 71  SER A N   1 
ATOM   288 C CA  . SER A 1 40  ? -27.537 9.210  -1.281  1.00 48.94  ? 71  SER A CA  1 
ATOM   289 C C   . SER A 1 40  ? -26.380 8.603  -2.069  1.00 50.02  ? 71  SER A C   1 
ATOM   290 O O   . SER A 1 40  ? -25.301 9.207  -2.137  1.00 46.82  ? 71  SER A O   1 
ATOM   291 C CB  . SER A 1 40  ? -28.490 10.037 -2.185  1.00 47.56  ? 71  SER A CB  1 
ATOM   292 O OG  . SER A 1 40  ? -27.795 10.753 -3.202  1.00 46.00  ? 71  SER A OG  1 
ATOM   293 N N   . PRO A 1 41  ? -26.602 7.414  -2.673  1.00 53.17  ? 72  PRO A N   1 
ATOM   294 C CA  . PRO A 1 41  ? -27.899 6.711  -2.708  1.00 58.32  ? 72  PRO A CA  1 
ATOM   295 C C   . PRO A 1 41  ? -28.350 6.196  -1.340  1.00 63.95  ? 72  PRO A C   1 
ATOM   296 O O   . PRO A 1 41  ? -27.514 6.024  -0.450  1.00 63.50  ? 72  PRO A O   1 
ATOM   297 C CB  . PRO A 1 41  ? -27.647 5.539  -3.668  1.00 58.72  ? 72  PRO A CB  1 
ATOM   298 C CG  . PRO A 1 41  ? -26.510 5.995  -4.511  1.00 56.50  ? 72  PRO A CG  1 
ATOM   299 C CD  . PRO A 1 41  ? -25.623 6.793  -3.581  1.00 53.43  ? 72  PRO A CD  1 
ATOM   300 N N   . SER A 1 42  ? -29.661 5.953  -1.205  1.00 69.96  ? 73  SER A N   1 
ATOM   301 C CA  . SER A 1 42  ? -30.327 5.652  0.082   1.00 77.10  ? 73  SER A CA  1 
ATOM   302 C C   . SER A 1 42  ? -29.680 4.521  0.876   1.00 80.57  ? 73  SER A C   1 
ATOM   303 O O   . SER A 1 42  ? -29.691 4.516  2.114   1.00 82.28  ? 73  SER A O   1 
ATOM   304 C CB  . SER A 1 42  ? -31.809 5.307  -0.140  1.00 81.40  ? 73  SER A CB  1 
ATOM   305 O OG  . SER A 1 42  ? -32.479 6.342  -0.842  1.00 83.11  ? 73  SER A OG  1 
ATOM   306 N N   . ASN A 1 43  ? -29.144 3.553  0.148   1.00 82.40  ? 74  ASN A N   1 
ATOM   307 C CA  . ASN A 1 43  ? -28.484 2.415  0.741   1.00 85.64  ? 74  ASN A CA  1 
ATOM   308 C C   . ASN A 1 43  ? -27.125 2.827  1.286   1.00 82.69  ? 74  ASN A C   1 
ATOM   309 O O   . ASN A 1 43  ? -26.672 2.298  2.300   1.00 84.91  ? 74  ASN A O   1 
ATOM   310 C CB  . ASN A 1 43  ? -28.306 1.339  -0.322  1.00 89.38  ? 74  ASN A CB  1 
ATOM   311 C CG  . ASN A 1 43  ? -27.747 1.899  -1.625  1.00 87.94  ? 74  ASN A CG  1 
ATOM   312 O OD1 . ASN A 1 43  ? -26.541 1.818  -1.884  1.00 87.47  ? 74  ASN A OD1 1 
ATOM   313 N ND2 . ASN A 1 43  ? -28.621 2.496  -2.441  1.00 86.75  ? 74  ASN A ND2 1 
ATOM   314 N N   . GLN A 1 44  ? -26.487 3.786  0.615   1.00 77.18  ? 75  GLN A N   1 
ATOM   315 C CA  . GLN A 1 44  ? -25.101 4.152  0.920   1.00 74.77  ? 75  GLN A CA  1 
ATOM   316 C C   . GLN A 1 44  ? -24.940 5.274  1.950   1.00 72.27  ? 75  GLN A C   1 
ATOM   317 O O   . GLN A 1 44  ? -23.812 5.732  2.221   1.00 71.05  ? 75  GLN A O   1 
ATOM   318 C CB  . GLN A 1 44  ? -24.348 4.524  -0.358  1.00 72.60  ? 75  GLN A CB  1 
ATOM   319 C CG  . GLN A 1 44  ? -24.367 3.438  -1.411  1.00 76.34  ? 75  GLN A CG  1 
ATOM   320 C CD  . GLN A 1 44  ? -23.010 3.244  -2.056  1.00 76.29  ? 75  GLN A CD  1 
ATOM   321 O OE1 . GLN A 1 44  ? -22.023 2.951  -1.372  1.00 77.28  ? 75  GLN A OE1 1 
ATOM   322 N NE2 . GLN A 1 44  ? -22.951 3.396  -3.380  1.00 75.39  ? 75  GLN A NE2 1 
ATOM   323 N N   . THR A 1 45  ? -26.049 5.720  2.532   1.00 70.64  ? 76  THR A N   1 
ATOM   324 C CA  . THR A 1 45  ? -25.946 6.839  3.452   1.00 67.34  ? 76  THR A CA  1 
ATOM   325 C C   . THR A 1 45  ? -25.065 6.409  4.613   1.00 67.51  ? 76  THR A C   1 
ATOM   326 O O   . THR A 1 45  ? -25.103 5.258  5.029   1.00 71.69  ? 76  THR A O   1 
ATOM   327 C CB  . THR A 1 45  ? -27.306 7.360  3.917   1.00 66.48  ? 76  THR A CB  1 
ATOM   328 O OG1 . THR A 1 45  ? -27.808 6.522  4.958   1.00 71.55  ? 76  THR A OG1 1 
ATOM   329 C CG2 . THR A 1 45  ? -28.274 7.386  2.759   1.00 65.16  ? 76  THR A CG2 1 
ATOM   330 N N   . ASP A 1 46  ? -24.240 7.326  5.102   1.00 64.32  ? 77  ASP A N   1 
ATOM   331 C CA  . ASP A 1 46  ? -23.241 6.994  6.102   1.00 63.98  ? 77  ASP A CA  1 
ATOM   332 C C   . ASP A 1 46  ? -22.585 8.290  6.578   1.00 59.18  ? 77  ASP A C   1 
ATOM   333 O O   . ASP A 1 46  ? -22.532 9.277  5.827   1.00 53.47  ? 77  ASP A O   1 
ATOM   334 C CB  . ASP A 1 46  ? -22.192 6.064  5.472   1.00 66.07  ? 77  ASP A CB  1 
ATOM   335 C CG  . ASP A 1 46  ? -21.429 5.235  6.504   1.00 70.60  ? 77  ASP A CG  1 
ATOM   336 O OD1 . ASP A 1 46  ? -22.054 4.493  7.301   1.00 73.65  ? 77  ASP A OD1 1 
ATOM   337 O OD2 . ASP A 1 46  ? -20.185 5.306  6.489   1.00 71.05  ? 77  ASP A OD2 1 
ATOM   338 N N   . LYS A 1 47  ? -22.109 8.302  7.821   1.00 56.78  ? 78  LYS A N   1 
ATOM   339 C CA  . LYS A 1 47  ? -21.197 9.364  8.233   1.00 55.11  ? 78  LYS A CA  1 
ATOM   340 C C   . LYS A 1 47  ? -19.813 8.992  7.726   1.00 55.01  ? 78  LYS A C   1 
ATOM   341 O O   . LYS A 1 47  ? -19.335 7.889  7.997   1.00 59.00  ? 78  LYS A O   1 
ATOM   342 C CB  . LYS A 1 47  ? -21.156 9.563  9.754   1.00 56.21  ? 78  LYS A CB  1 
ATOM   343 C CG  . LYS A 1 47  ? -19.988 10.457 10.171  1.00 54.60  ? 78  LYS A CG  1 
ATOM   344 C CD  . LYS A 1 47  ? -20.027 10.837 11.633  1.00 56.89  ? 78  LYS A CD  1 
ATOM   345 C CE  . LYS A 1 47  ? -19.563 9.705  12.512  1.00 61.71  ? 78  LYS A CE  1 
ATOM   346 N NZ  . LYS A 1 47  ? -19.766 10.044 13.938  1.00 65.14  ? 78  LYS A NZ  1 
ATOM   347 N N   . LEU A 1 48  ? -19.178 9.906  6.997   1.00 51.04  ? 79  LEU A N   1 
ATOM   348 C CA  . LEU A 1 48  ? -17.908 9.633  6.353   1.00 51.83  ? 79  LEU A CA  1 
ATOM   349 C C   . LEU A 1 48  ? -16.728 9.945  7.248   1.00 54.53  ? 79  LEU A C   1 
ATOM   350 O O   . LEU A 1 48  ? -15.792 9.154  7.350   1.00 54.98  ? 79  LEU A O   1 
ATOM   351 C CB  . LEU A 1 48  ? -17.754 10.472 5.091   1.00 45.97  ? 79  LEU A CB  1 
ATOM   352 C CG  . LEU A 1 48  ? -18.864 10.260 4.080   1.00 46.00  ? 79  LEU A CG  1 
ATOM   353 C CD1 . LEU A 1 48  ? -18.637 11.191 2.928   1.00 43.46  ? 79  LEU A CD1 1 
ATOM   354 C CD2 . LEU A 1 48  ? -18.897 8.805  3.595   1.00 47.36  ? 79  LEU A CD2 1 
ATOM   355 N N   . ALA A 1 49  ? -16.761 11.122 7.860   1.00 54.86  ? 80  ALA A N   1 
ATOM   356 C CA  . ALA A 1 49  ? -15.576 11.700 8.484   1.00 57.06  ? 80  ALA A CA  1 
ATOM   357 C C   . ALA A 1 49  ? -15.999 12.885 9.329   1.00 58.39  ? 80  ALA A C   1 
ATOM   358 O O   . ALA A 1 49  ? -17.090 13.429 9.144   1.00 59.91  ? 80  ALA A O   1 
ATOM   359 C CB  . ALA A 1 49  ? -14.571 12.141 7.408   1.00 54.87  ? 80  ALA A CB  1 
ATOM   360 N N   . ALA A 1 50  ? -15.146 13.287 10.259  1.00 59.40  ? 81  ALA A N   1 
ATOM   361 C CA  . ALA A 1 50  ? -15.522 14.302 11.237  1.00 59.94  ? 81  ALA A CA  1 
ATOM   362 C C   . ALA A 1 50  ? -14.347 15.185 11.668  1.00 61.76  ? 81  ALA A C   1 
ATOM   363 O O   . ALA A 1 50  ? -13.155 14.854 11.475  1.00 63.25  ? 81  ALA A O   1 
ATOM   364 C CB  . ALA A 1 50  ? -16.179 13.661 12.458  1.00 60.91  ? 81  ALA A CB  1 
ATOM   365 N N   . PHE A 1 51  ? -14.707 16.327 12.236  1.00 60.41  ? 82  PHE A N   1 
ATOM   366 C CA  . PHE A 1 51  ? -13.757 17.197 12.872  1.00 60.25  ? 82  PHE A CA  1 
ATOM   367 C C   . PHE A 1 51  ? -14.306 17.503 14.262  1.00 63.17  ? 82  PHE A C   1 
ATOM   368 O O   . PHE A 1 51  ? -15.483 17.846 14.399  1.00 57.98  ? 82  PHE A O   1 
ATOM   369 C CB  . PHE A 1 51  ? -13.571 18.476 12.076  1.00 57.02  ? 82  PHE A CB  1 
ATOM   370 C CG  . PHE A 1 51  ? -12.761 19.479 12.789  1.00 58.16  ? 82  PHE A CG  1 
ATOM   371 C CD1 . PHE A 1 51  ? -11.403 19.564 12.569  1.00 58.92  ? 82  PHE A CD1 1 
ATOM   372 C CD2 . PHE A 1 51  ? -13.348 20.321 13.721  1.00 59.98  ? 82  PHE A CD2 1 
ATOM   373 C CE1 . PHE A 1 51  ? -10.627 20.494 13.271  1.00 61.51  ? 82  PHE A CE1 1 
ATOM   374 C CE2 . PHE A 1 51  ? -12.584 21.248 14.416  1.00 62.11  ? 82  PHE A CE2 1 
ATOM   375 C CZ  . PHE A 1 51  ? -11.226 21.335 14.187  1.00 61.82  ? 82  PHE A CZ  1 
ATOM   376 N N   . PRO A 1 52  ? -13.460 17.342 15.299  1.00 68.72  ? 83  PRO A N   1 
ATOM   377 C CA  . PRO A 1 52  ? -12.086 16.881 15.116  1.00 72.60  ? 83  PRO A CA  1 
ATOM   378 C C   . PRO A 1 52  ? -11.965 15.361 15.173  1.00 77.94  ? 83  PRO A C   1 
ATOM   379 O O   . PRO A 1 52  ? -12.376 14.748 16.159  1.00 82.31  ? 83  PRO A O   1 
ATOM   380 C CB  . PRO A 1 52  ? -11.346 17.514 16.300  1.00 74.08  ? 83  PRO A CB  1 
ATOM   381 C CG  . PRO A 1 52  ? -12.378 17.612 17.372  1.00 75.86  ? 83  PRO A CG  1 
ATOM   382 C CD  . PRO A 1 52  ? -13.751 17.654 16.708  1.00 71.67  ? 83  PRO A CD  1 
ATOM   383 N N   . GLU A 1 53  ? -11.425 14.764 14.113  1.00 79.94  ? 84  GLU A N   1 
ATOM   384 C CA  . GLU A 1 53  ? -11.017 13.359 14.148  1.00 85.97  ? 84  GLU A CA  1 
ATOM   385 C C   . GLU A 1 53  ? -10.190 12.972 12.928  1.00 85.11  ? 84  GLU A C   1 
ATOM   386 O O   . GLU A 1 53  ? -9.016  12.628 13.063  1.00 87.75  ? 84  GLU A O   1 
ATOM   387 C CB  . GLU A 1 53  ? -12.212 12.415 14.300  1.00 88.48  ? 84  GLU A CB  1 
ATOM   388 C CG  . GLU A 1 53  ? -11.812 11.060 14.882  1.00 95.53  ? 84  GLU A CG  1 
ATOM   389 C CD  . GLU A 1 53  ? -12.953 10.354 15.597  1.00 99.50  ? 84  GLU A CD  1 
ATOM   390 O OE1 . GLU A 1 53  ? -12.673 9.556  16.521  1.00 104.43 ? 84  GLU A OE1 1 
ATOM   391 O OE2 . GLU A 1 53  ? -14.128 10.603 15.236  1.00 98.77  ? 84  GLU A OE2 1 
ATOM   392 N N   . CYS A 1 62  ? -9.019  6.382  6.096   1.00 73.75  ? 93  CYS A N   1 
ATOM   393 C CA  . CYS A 1 62  ? -9.215  5.900  4.741   1.00 70.72  ? 93  CYS A CA  1 
ATOM   394 C C   . CYS A 1 62  ? -9.271  7.074  3.769   1.00 62.66  ? 93  CYS A C   1 
ATOM   395 O O   . CYS A 1 62  ? -8.567  8.072  3.954   1.00 59.08  ? 93  CYS A O   1 
ATOM   396 C CB  . CYS A 1 62  ? -10.477 5.005  4.620   1.00 74.38  ? 93  CYS A CB  1 
ATOM   397 S SG  . CYS A 1 62  ? -12.114 5.700  5.167   1.00 75.17  ? 93  CYS A SG  1 
ATOM   398 N N   . ARG A 1 63  ? -10.126 6.944  2.753   1.00 56.19  ? 94  ARG A N   1 
ATOM   399 C CA  . ARG A 1 63  ? -10.185 7.878  1.630   1.00 50.24  ? 94  ARG A CA  1 
ATOM   400 C C   . ARG A 1 63  ? -10.966 9.165  1.902   1.00 45.31  ? 94  ARG A C   1 
ATOM   401 O O   . ARG A 1 63  ? -11.109 9.984  1.008   1.00 44.15  ? 94  ARG A O   1 
ATOM   402 C CB  . ARG A 1 63  ? -10.800 7.190  0.393   1.00 49.83  ? 94  ARG A CB  1 
ATOM   403 C CG  . ARG A 1 63  ? -9.955  6.082  -0.242  1.00 52.68  ? 94  ARG A CG  1 
ATOM   404 C CD  . ARG A 1 63  ? -10.604 5.520  -1.531  1.00 51.60  ? 94  ARG A CD  1 
ATOM   405 N NE  . ARG A 1 63  ? -12.050 5.327  -1.375  1.00 49.12  ? 94  ARG A NE  1 
ATOM   406 C CZ  . ARG A 1 63  ? -12.987 5.993  -2.055  1.00 45.89  ? 94  ARG A CZ  1 
ATOM   407 N NH1 . ARG A 1 63  ? -12.648 6.874  -2.981  1.00 44.21  ? 94  ARG A NH1 1 
ATOM   408 N NH2 . ARG A 1 63  ? -14.267 5.753  -1.829  1.00 45.25  ? 94  ARG A NH2 1 
ATOM   409 N N   . PHE A 1 64  ? -11.516 9.345  3.095   1.00 44.67  ? 95  PHE A N   1 
ATOM   410 C CA  . PHE A 1 64  ? -12.298 10.567 3.360   1.00 43.34  ? 95  PHE A CA  1 
ATOM   411 C C   . PHE A 1 64  ? -11.578 11.375 4.408   1.00 42.80  ? 95  PHE A C   1 
ATOM   412 O O   . PHE A 1 64  ? -11.268 10.862 5.472   1.00 45.84  ? 95  PHE A O   1 
ATOM   413 C CB  . PHE A 1 64  ? -13.707 10.237 3.835   1.00 45.26  ? 95  PHE A CB  1 
ATOM   414 C CG  . PHE A 1 64  ? -14.464 9.382  2.888   1.00 46.97  ? 95  PHE A CG  1 
ATOM   415 C CD1 . PHE A 1 64  ? -14.692 8.055  3.176   1.00 52.46  ? 95  PHE A CD1 1 
ATOM   416 C CD2 . PHE A 1 64  ? -14.920 9.898  1.697   1.00 46.93  ? 95  PHE A CD2 1 
ATOM   417 C CE1 . PHE A 1 64  ? -15.386 7.249  2.294   1.00 54.28  ? 95  PHE A CE1 1 
ATOM   418 C CE2 . PHE A 1 64  ? -15.610 9.109  0.796   1.00 48.40  ? 95  PHE A CE2 1 
ATOM   419 C CZ  . PHE A 1 64  ? -15.845 7.777  1.094   1.00 52.64  ? 95  PHE A CZ  1 
ATOM   420 N N   . ARG A 1 65  ? -11.299 12.631 4.113   1.00 38.10  ? 96  ARG A N   1 
ATOM   421 C CA  . ARG A 1 65  ? -10.509 13.442 5.027   1.00 39.54  ? 96  ARG A CA  1 
ATOM   422 C C   . ARG A 1 65  ? -11.238 14.745 5.320   1.00 35.52  ? 96  ARG A C   1 
ATOM   423 O O   . ARG A 1 65  ? -11.867 15.327 4.421   1.00 31.85  ? 96  ARG A O   1 
ATOM   424 C CB  . ARG A 1 65  ? -9.146  13.723 4.401   1.00 41.78  ? 96  ARG A CB  1 
ATOM   425 C CG  . ARG A 1 65  ? -8.459  12.447 3.880   1.00 50.79  ? 96  ARG A CG  1 
ATOM   426 C CD  . ARG A 1 65  ? -7.189  12.699 3.023   1.00 54.36  ? 96  ARG A CD  1 
ATOM   427 N NE  . ARG A 1 65  ? -5.986  12.875 3.832   1.00 60.60  ? 96  ARG A NE  1 
ATOM   428 C CZ  . ARG A 1 65  ? -5.522  14.058 4.216   1.00 61.79  ? 96  ARG A CZ  1 
ATOM   429 N NH1 . ARG A 1 65  ? -6.168  15.159 3.852   1.00 60.95  ? 96  ARG A NH1 1 
ATOM   430 N NH2 . ARG A 1 65  ? -4.431  14.142 4.970   1.00 64.27  ? 96  ARG A NH2 1 
ATOM   431 N N   . VAL A 1 66  ? -11.170 15.214 6.565   1.00 33.64  ? 97  VAL A N   1 
ATOM   432 C CA  . VAL A 1 66  ? -11.749 16.534 6.878   1.00 32.70  ? 97  VAL A CA  1 
ATOM   433 C C   . VAL A 1 66  ? -10.645 17.378 7.471   1.00 30.97  ? 97  VAL A C   1 
ATOM   434 O O   . VAL A 1 66  ? -10.037 16.992 8.467   1.00 32.71  ? 97  VAL A O   1 
ATOM   435 C CB  . VAL A 1 66  ? -12.889 16.427 7.903   1.00 36.02  ? 97  VAL A CB  1 
ATOM   436 C CG1 . VAL A 1 66  ? -13.331 17.801 8.332   1.00 34.37  ? 97  VAL A CG1 1 
ATOM   437 C CG2 . VAL A 1 66  ? -14.084 15.638 7.306   1.00 35.29  ? 97  VAL A CG2 1 
ATOM   438 N N   . THR A 1 67  ? -10.346 18.517 6.859   1.00 28.48  ? 98  THR A N   1 
ATOM   439 C CA  . THR A 1 67  ? -9.261  19.343 7.393   1.00 30.12  ? 98  THR A CA  1 
ATOM   440 C C   . THR A 1 67  ? -9.713  20.754 7.629   1.00 31.58  ? 98  THR A C   1 
ATOM   441 O O   . THR A 1 67  ? -10.252 21.396 6.740   1.00 28.70  ? 98  THR A O   1 
ATOM   442 C CB  . THR A 1 67  ? -8.065  19.368 6.461   1.00 30.10  ? 98  THR A CB  1 
ATOM   443 O OG1 . THR A 1 67  ? -7.662  18.015 6.221   1.00 31.44  ? 98  THR A OG1 1 
ATOM   444 C CG2 . THR A 1 67  ? -6.847  20.147 7.128   1.00 32.50  ? 98  THR A CG2 1 
ATOM   445 N N   . GLN A 1 68  ? -9.473  21.259 8.824   1.00 32.90  ? 99  GLN A N   1 
ATOM   446 C CA  . GLN A 1 68  ? -9.871  22.623 9.127   1.00 32.67  ? 99  GLN A CA  1 
ATOM   447 C C   . GLN A 1 68  ? -8.870  23.575 8.484   1.00 34.63  ? 99  GLN A C   1 
ATOM   448 O O   . GLN A 1 68  ? -7.667  23.428 8.702   1.00 34.23  ? 99  GLN A O   1 
ATOM   449 C CB  . GLN A 1 68  ? -9.854  22.836 10.641  1.00 36.56  ? 99  GLN A CB  1 
ATOM   450 C CG  . GLN A 1 68  ? -10.130 24.276 11.035  1.00 39.52  ? 99  GLN A CG  1 
ATOM   451 C CD  . GLN A 1 68  ? -10.297 24.464 12.514  1.00 45.28  ? 99  GLN A CD  1 
ATOM   452 O OE1 . GLN A 1 68  ? -9.484  24.012 13.299  1.00 46.90  ? 99  GLN A OE1 1 
ATOM   453 N NE2 . GLN A 1 68  ? -11.369 25.136 12.905  1.00 47.13  ? 99  GLN A NE2 1 
ATOM   454 N N   . LEU A 1 69  ? -9.336  24.557 7.717   1.00 32.52  ? 100 LEU A N   1 
ATOM   455 C CA  . LEU A 1 69  ? -8.379  25.509 7.121   1.00 32.84  ? 100 LEU A CA  1 
ATOM   456 C C   . LEU A 1 69  ? -7.944  26.511 8.162   1.00 34.86  ? 100 LEU A C   1 
ATOM   457 O O   . LEU A 1 69  ? -8.595  26.619 9.192   1.00 39.07  ? 100 LEU A O   1 
ATOM   458 C CB  . LEU A 1 69  ? -8.971  26.204 5.901   1.00 32.48  ? 100 LEU A CB  1 
ATOM   459 C CG  . LEU A 1 69  ? -9.328  25.172 4.816   1.00 31.83  ? 100 LEU A CG  1 
ATOM   460 C CD1 . LEU A 1 69  ? -9.887  25.841 3.582   1.00 34.36  ? 100 LEU A CD1 1 
ATOM   461 C CD2 . LEU A 1 69  ? -8.103  24.334 4.442   1.00 32.98  ? 100 LEU A CD2 1 
ATOM   462 N N   . PRO A 1 70  ? -6.834  27.248 7.915   1.00 37.42  ? 101 PRO A N   1 
ATOM   463 C CA  . PRO A 1 70  ? -6.299  28.133 8.941   1.00 40.31  ? 101 PRO A CA  1 
ATOM   464 C C   . PRO A 1 70  ? -7.249  29.263 9.363   1.00 42.01  ? 101 PRO A C   1 
ATOM   465 O O   . PRO A 1 70  ? -7.161  29.708 10.485  1.00 43.00  ? 101 PRO A O   1 
ATOM   466 C CB  . PRO A 1 70  ? -4.998  28.684 8.312   1.00 42.38  ? 101 PRO A CB  1 
ATOM   467 C CG  . PRO A 1 70  ? -4.573  27.625 7.303   1.00 41.26  ? 101 PRO A CG  1 
ATOM   468 C CD  . PRO A 1 70  ? -5.914  27.118 6.759   1.00 38.38  ? 101 PRO A CD  1 
ATOM   469 N N   . ASN A 1 71  ? -8.171  29.707 8.508   1.00 44.10  ? 102 ASN A N   1 
ATOM   470 C CA  . ASN A 1 71  ? -9.097  30.781 8.954   1.00 49.87  ? 102 ASN A CA  1 
ATOM   471 C C   . ASN A 1 71  ? -10.071 30.294 10.035  1.00 50.57  ? 102 ASN A C   1 
ATOM   472 O O   . ASN A 1 71  ? -10.704 31.091 10.736  1.00 51.63  ? 102 ASN A O   1 
ATOM   473 C CB  . ASN A 1 71  ? -9.851  31.460 7.794   1.00 49.77  ? 102 ASN A CB  1 
ATOM   474 C CG  . ASN A 1 71  ? -10.808 30.533 7.092   1.00 45.15  ? 102 ASN A CG  1 
ATOM   475 O OD1 . ASN A 1 71  ? -11.223 29.518 7.636   1.00 44.20  ? 102 ASN A OD1 1 
ATOM   476 N ND2 . ASN A 1 71  ? -11.135 30.856 5.850   1.00 46.38  ? 102 ASN A ND2 1 
ATOM   477 N N   . GLY A 1 72  ? -10.172 28.976 10.173  1.00 49.45  ? 103 GLY A N   1 
ATOM   478 C CA  . GLY A 1 72  ? -10.927 28.395 11.276  1.00 49.58  ? 103 GLY A CA  1 
ATOM   479 C C   . GLY A 1 72  ? -12.395 28.183 10.928  1.00 45.94  ? 103 GLY A C   1 
ATOM   480 O O   . GLY A 1 72  ? -13.086 27.443 11.622  1.00 44.96  ? 103 GLY A O   1 
ATOM   481 N N   . ARG A 1 73  ? -12.862 28.794 9.839   1.00 43.04  ? 104 ARG A N   1 
ATOM   482 C CA  A ARG A 1 73  ? -14.275 28.721 9.461   0.50 41.97  ? 104 ARG A CA  1 
ATOM   483 C CA  B ARG A 1 73  ? -14.279 28.678 9.492   0.50 41.41  ? 104 ARG A CA  1 
ATOM   484 C C   . ARG A 1 73  ? -14.521 27.782 8.287   1.00 38.23  ? 104 ARG A C   1 
ATOM   485 O O   . ARG A 1 73  ? -15.620 27.283 8.107   1.00 37.42  ? 104 ARG A O   1 
ATOM   486 C CB  A ARG A 1 73  ? -14.807 30.117 9.149   0.50 43.87  ? 104 ARG A CB  1 
ATOM   487 C CB  B ARG A 1 73  ? -14.922 30.051 9.300   0.50 42.34  ? 104 ARG A CB  1 
ATOM   488 C CG  A ARG A 1 73  ? -14.465 31.149 10.218  0.50 49.30  ? 104 ARG A CG  1 
ATOM   489 C CG  B ARG A 1 73  ? -14.434 30.786 8.090   0.50 42.98  ? 104 ARG A CG  1 
ATOM   490 C CD  A ARG A 1 73  ? -14.990 32.524 9.832   0.50 51.37  ? 104 ARG A CD  1 
ATOM   491 C CD  B ARG A 1 73  ? -14.985 32.194 8.017   0.50 44.42  ? 104 ARG A CD  1 
ATOM   492 N NE  A ARG A 1 73  ? -14.475 32.923 8.527   0.50 50.48  ? 104 ARG A NE  1 
ATOM   493 N NE  B ARG A 1 73  ? -14.513 32.816 6.791   0.50 44.91  ? 104 ARG A NE  1 
ATOM   494 C CZ  A ARG A 1 73  ? -13.432 33.728 8.353   0.50 51.30  ? 104 ARG A CZ  1 
ATOM   495 C CZ  B ARG A 1 73  ? -14.885 32.396 5.591   0.50 44.55  ? 104 ARG A CZ  1 
ATOM   496 N NH1 A ARG A 1 73  ? -12.799 34.240 9.403   0.50 53.43  ? 104 ARG A NH1 1 
ATOM   497 N NH1 B ARG A 1 73  ? -15.729 31.374 5.501   0.50 40.79  ? 104 ARG A NH1 1 
ATOM   498 N NH2 A ARG A 1 73  ? -13.034 34.027 7.127   0.50 49.85  ? 104 ARG A NH2 1 
ATOM   499 N NH2 B ARG A 1 73  ? -14.419 32.981 4.496   0.50 45.02  ? 104 ARG A NH2 1 
ATOM   500 N N   . ASP A 1 74  ? -13.489 27.568 7.480   1.00 35.52  ? 105 ASP A N   1 
ATOM   501 C CA  . ASP A 1 74  ? -13.575 26.646 6.354   1.00 35.57  ? 105 ASP A CA  1 
ATOM   502 C C   . ASP A 1 74  ? -12.918 25.297 6.676   1.00 33.26  ? 105 ASP A C   1 
ATOM   503 O O   . ASP A 1 74  ? -11.900 25.239 7.356   1.00 35.17  ? 105 ASP A O   1 
ATOM   504 C CB  . ASP A 1 74  ? -12.977 27.271 5.098   1.00 35.18  ? 105 ASP A CB  1 
ATOM   505 C CG  . ASP A 1 74  ? -13.681 28.566 4.707   1.00 41.76  ? 105 ASP A CG  1 
ATOM   506 O OD1 . ASP A 1 74  ? -14.910 28.703 4.957   1.00 45.15  ? 105 ASP A OD1 1 
ATOM   507 O OD2 . ASP A 1 74  ? -13.016 29.456 4.144   1.00 43.17  ? 105 ASP A OD2 1 
ATOM   508 N N   . PHE A 1 75  ? -13.532 24.234 6.181   1.00 29.72  ? 106 PHE A N   1 
ATOM   509 C CA  . PHE A 1 75  ? -13.025 22.873 6.301   1.00 33.35  ? 106 PHE A CA  1 
ATOM   510 C C   . PHE A 1 75  ? -13.047 22.247 4.934   1.00 30.02  ? 106 PHE A C   1 
ATOM   511 O O   . PHE A 1 75  ? -14.034 22.384 4.220   1.00 30.08  ? 106 PHE A O   1 
ATOM   512 C CB  . PHE A 1 75  ? -13.946 22.058 7.212   1.00 31.60  ? 106 PHE A CB  1 
ATOM   513 C CG  . PHE A 1 75  ? -14.111 22.668 8.561   1.00 34.33  ? 106 PHE A CG  1 
ATOM   514 C CD1 . PHE A 1 75  ? -14.875 23.814 8.728   1.00 33.67  ? 106 PHE A CD1 1 
ATOM   515 C CD2 . PHE A 1 75  ? -13.412 22.160 9.652   1.00 37.42  ? 106 PHE A CD2 1 
ATOM   516 C CE1 . PHE A 1 75  ? -14.988 24.420 9.976   1.00 36.86  ? 106 PHE A CE1 1 
ATOM   517 C CE2 . PHE A 1 75  ? -13.545 22.746 10.908  1.00 38.40  ? 106 PHE A CE2 1 
ATOM   518 C CZ  . PHE A 1 75  ? -14.319 23.879 11.064  1.00 39.05  ? 106 PHE A CZ  1 
ATOM   519 N N   . HIS A 1 76  ? -12.002 21.510 4.585   1.00 29.51  ? 107 HIS A N   1 
ATOM   520 C CA  . HIS A 1 76  ? -12.035 20.697 3.360   1.00 29.55  ? 107 HIS A CA  1 
ATOM   521 C C   . HIS A 1 76  ? -12.495 19.297 3.662   1.00 27.67  ? 107 HIS A C   1 
ATOM   522 O O   . HIS A 1 76  ? -11.945 18.635 4.530   1.00 29.31  ? 107 HIS A O   1 
ATOM   523 C CB  . HIS A 1 76  ? -10.648 20.612 2.705   1.00 32.10  ? 107 HIS A CB  1 
ATOM   524 C CG  . HIS A 1 76  ? -10.338 21.786 1.839   1.00 34.06  ? 107 HIS A CG  1 
ATOM   525 N ND1 . HIS A 1 76  ? -9.076  22.052 1.351   1.00 36.20  ? 107 HIS A ND1 1 
ATOM   526 C CD2 . HIS A 1 76  ? -11.131 22.803 1.428   1.00 34.06  ? 107 HIS A CD2 1 
ATOM   527 C CE1 . HIS A 1 76  ? -9.119  23.170 0.645   1.00 39.02  ? 107 HIS A CE1 1 
ATOM   528 N NE2 . HIS A 1 76  ? -10.353 23.651 0.691   1.00 36.09  ? 107 HIS A NE2 1 
ATOM   529 N N   . MET A 1 77  ? -13.479 18.837 2.903   1.00 25.90  ? 108 MET A N   1 
ATOM   530 C CA  . MET A 1 77  ? -13.925 17.470 2.972   1.00 25.53  ? 108 MET A CA  1 
ATOM   531 C C   . MET A 1 77  ? -13.507 16.850 1.673   1.00 25.97  ? 108 MET A C   1 
ATOM   532 O O   . MET A 1 77  ? -14.083 17.178 0.649   1.00 28.10  ? 108 MET A O   1 
ATOM   533 C CB  . MET A 1 77  ? -15.451 17.470 3.056   1.00 24.91  ? 108 MET A CB  1 
ATOM   534 C CG  . MET A 1 77  ? -15.951 17.459 4.446   1.00 34.52  ? 108 MET A CG  1 
ATOM   535 S SD  . MET A 1 77  ? -15.824 19.069 5.184   1.00 42.23  ? 108 MET A SD  1 
ATOM   536 C CE  . MET A 1 77  ? -16.872 18.787 6.652   1.00 40.02  ? 108 MET A CE  1 
ATOM   537 N N   . SER A 1 78  ? -12.503 15.974 1.690   1.00 28.42  ? 109 SER A N   1 
ATOM   538 C CA  . SER A 1 78  ? -11.939 15.442 0.446   1.00 26.66  ? 109 SER A CA  1 
ATOM   539 C C   . SER A 1 78  ? -12.097 13.947 0.368   1.00 28.40  ? 109 SER A C   1 
ATOM   540 O O   . SER A 1 78  ? -11.791 13.252 1.341   1.00 31.81  ? 109 SER A O   1 
ATOM   541 C CB  . SER A 1 78  ? -10.419 15.699 0.425   1.00 27.37  ? 109 SER A CB  1 
ATOM   542 O OG  . SER A 1 78  ? -10.176 17.080 0.293   1.00 29.63  ? 109 SER A OG  1 
ATOM   543 N N   . VAL A 1 79  ? -12.504 13.461 -0.801  1.00 28.65  ? 110 VAL A N   1 
ATOM   544 C CA  . VAL A 1 79  ? -12.422 12.046 -1.160  1.00 30.79  ? 110 VAL A CA  1 
ATOM   545 C C   . VAL A 1 79  ? -11.108 11.807 -1.880  1.00 33.90  ? 110 VAL A C   1 
ATOM   546 O O   . VAL A 1 79  ? -10.800 12.468 -2.895  1.00 32.53  ? 110 VAL A O   1 
ATOM   547 C CB  . VAL A 1 79  ? -13.546 11.676 -2.155  1.00 31.45  ? 110 VAL A CB  1 
ATOM   548 C CG1 . VAL A 1 79  ? -13.604 10.162 -2.369  1.00 36.66  ? 110 VAL A CG1 1 
ATOM   549 C CG2 . VAL A 1 79  ? -14.855 12.159 -1.630  1.00 33.82  ? 110 VAL A CG2 1 
ATOM   550 N N   . VAL A 1 80  ? -10.330 10.843 -1.407  1.00 36.42  ? 111 VAL A N   1 
ATOM   551 C CA  . VAL A 1 80  ? -9.066  10.584 -2.050  1.00 37.68  ? 111 VAL A CA  1 
ATOM   552 C C   . VAL A 1 80  ? -9.266  9.552  -3.137  1.00 38.59  ? 111 VAL A C   1 
ATOM   553 O O   . VAL A 1 80  ? -9.774  8.474  -2.882  1.00 38.10  ? 111 VAL A O   1 
ATOM   554 C CB  . VAL A 1 80  ? -8.057  10.085 -1.039  1.00 41.66  ? 111 VAL A CB  1 
ATOM   555 C CG1 . VAL A 1 80  ? -6.786  9.665  -1.731  1.00 42.53  ? 111 VAL A CG1 1 
ATOM   556 C CG2 . VAL A 1 80  ? -7.798  11.170 0.005   1.00 42.68  ? 111 VAL A CG2 1 
ATOM   557 N N   . ARG A 1 81  ? -8.871  9.882  -4.357  1.00 37.63  ? 112 ARG A N   1 
ATOM   558 C CA  . ARG A 1 81  ? -9.014  8.926  -5.470  1.00 42.58  ? 112 ARG A CA  1 
ATOM   559 C C   . ARG A 1 81  ? -10.448 8.400  -5.635  1.00 38.18  ? 112 ARG A C   1 
ATOM   560 O O   . ARG A 1 81  ? -10.760 7.236  -5.382  1.00 39.53  ? 112 ARG A O   1 
ATOM   561 C CB  . ARG A 1 81  ? -7.958  7.810  -5.411  1.00 47.60  ? 112 ARG A CB  1 
ATOM   562 C CG  . ARG A 1 81  ? -6.548  8.303  -5.825  1.00 54.50  ? 112 ARG A CG  1 
ATOM   563 C CD  . ARG A 1 81  ? -5.494  7.272  -5.438  1.00 62.35  ? 112 ARG A CD  1 
ATOM   564 N NE  . ARG A 1 81  ? -5.896  6.603  -4.196  1.00 68.81  ? 112 ARG A NE  1 
ATOM   565 C CZ  . ARG A 1 81  ? -5.271  6.719  -3.021  1.00 72.46  ? 112 ARG A CZ  1 
ATOM   566 N NH1 . ARG A 1 81  ? -4.173  7.462  -2.917  1.00 73.46  ? 112 ARG A NH1 1 
ATOM   567 N NH2 . ARG A 1 81  ? -5.742  6.081  -1.944  1.00 74.35  ? 112 ARG A NH2 1 
ATOM   568 N N   . ALA A 1 82  ? -11.295 9.292  -6.109  1.00 33.09  ? 113 ALA A N   1 
ATOM   569 C CA  . ALA A 1 82  ? -12.738 9.072  -6.221  1.00 32.49  ? 113 ALA A CA  1 
ATOM   570 C C   . ALA A 1 82  ? -13.051 7.892  -7.124  1.00 35.35  ? 113 ALA A C   1 
ATOM   571 O O   . ALA A 1 82  ? -12.354 7.668  -8.108  1.00 37.62  ? 113 ALA A O   1 
ATOM   572 C CB  . ALA A 1 82  ? -13.397 10.344 -6.762  1.00 28.56  ? 113 ALA A CB  1 
ATOM   573 N N   . ARG A 1 83  ? -14.105 7.153  -6.785  1.00 36.01  ? 114 ARG A N   1 
ATOM   574 C CA  . ARG A 1 83  ? -14.536 5.982  -7.536  1.00 38.59  ? 114 ARG A CA  1 
ATOM   575 C C   . ARG A 1 83  ? -15.889 6.254  -8.059  1.00 38.64  ? 114 ARG A C   1 
ATOM   576 O O   . ARG A 1 83  ? -16.594 7.143  -7.566  1.00 33.18  ? 114 ARG A O   1 
ATOM   577 C CB  . ARG A 1 83  ? -14.647 4.785  -6.622  1.00 41.57  ? 114 ARG A CB  1 
ATOM   578 C CG  . ARG A 1 83  ? -13.317 4.354  -6.134  1.00 47.11  ? 114 ARG A CG  1 
ATOM   579 C CD  . ARG A 1 83  ? -13.495 3.583  -4.888  1.00 51.79  ? 114 ARG A CD  1 
ATOM   580 N NE  . ARG A 1 83  ? -12.206 3.160  -4.373  1.00 56.64  ? 114 ARG A NE  1 
ATOM   581 C CZ  . ARG A 1 83  ? -12.088 2.414  -3.290  1.00 61.89  ? 114 ARG A CZ  1 
ATOM   582 N NH1 . ARG A 1 83  ? -13.193 2.040  -2.646  1.00 63.93  ? 114 ARG A NH1 1 
ATOM   583 N NH2 . ARG A 1 83  ? -10.885 2.051  -2.847  1.00 65.54  ? 114 ARG A NH2 1 
ATOM   584 N N   . ARG A 1 84  ? -16.281 5.473  -9.045  1.00 40.46  ? 115 ARG A N   1 
ATOM   585 C CA  . ARG A 1 84  ? -17.567 5.690  -9.646  1.00 43.36  ? 115 ARG A CA  1 
ATOM   586 C C   . ARG A 1 84  ? -18.712 5.614  -8.651  1.00 42.03  ? 115 ARG A C   1 
ATOM   587 O O   . ARG A 1 84  ? -19.648 6.394  -8.729  1.00 40.51  ? 115 ARG A O   1 
ATOM   588 C CB  . ARG A 1 84  ? -17.784 4.745  -10.811 1.00 47.04  ? 115 ARG A CB  1 
ATOM   589 C CG  . ARG A 1 84  ? -17.543 5.445  -12.123 1.00 50.15  ? 115 ARG A CG  1 
ATOM   590 C CD  . ARG A 1 84  ? -16.784 4.546  -13.010 1.00 55.49  ? 115 ARG A CD  1 
ATOM   591 N NE  . ARG A 1 84  ? -17.650 3.810  -13.911 1.00 61.23  ? 115 ARG A NE  1 
ATOM   592 C CZ  . ARG A 1 84  ? -17.208 2.826  -14.685 1.00 65.46  ? 115 ARG A CZ  1 
ATOM   593 N NH1 . ARG A 1 84  ? -15.929 2.475  -14.618 1.00 67.21  ? 115 ARG A NH1 1 
ATOM   594 N NH2 . ARG A 1 84  ? -18.033 2.191  -15.503 1.00 68.28  ? 115 ARG A NH2 1 
ATOM   595 N N   . ASN A 1 85  ? -18.649 4.679  -7.719  1.00 43.32  ? 116 ASN A N   1 
ATOM   596 C CA  . ASN A 1 85  ? -19.726 4.584  -6.762  1.00 45.06  ? 116 ASN A CA  1 
ATOM   597 C C   . ASN A 1 85  ? -19.553 5.529  -5.582  1.00 41.68  ? 116 ASN A C   1 
ATOM   598 O O   . ASN A 1 85  ? -20.219 5.370  -4.568  1.00 43.19  ? 116 ASN A O   1 
ATOM   599 C CB  . ASN A 1 85  ? -19.955 3.137  -6.310  1.00 52.54  ? 116 ASN A CB  1 
ATOM   600 C CG  . ASN A 1 85  ? -18.843 2.615  -5.438  1.00 56.21  ? 116 ASN A CG  1 
ATOM   601 O OD1 . ASN A 1 85  ? -17.930 3.347  -5.063  1.00 57.40  ? 116 ASN A OD1 1 
ATOM   602 N ND2 . ASN A 1 85  ? -18.914 1.345  -5.108  1.00 60.48  ? 116 ASN A ND2 1 
ATOM   603 N N   . ASP A 1 86  ? -18.666 6.513  -5.712  1.00 37.31  ? 117 ASP A N   1 
ATOM   604 C CA  . ASP A 1 86  ? -18.689 7.660  -4.786  1.00 34.07  ? 117 ASP A CA  1 
ATOM   605 C C   . ASP A 1 86  ? -19.728 8.695  -5.227  1.00 32.99  ? 117 ASP A C   1 
ATOM   606 O O   . ASP A 1 86  ? -20.046 9.611  -4.464  1.00 30.07  ? 117 ASP A O   1 
ATOM   607 C CB  . ASP A 1 86  ? -17.323 8.352  -4.692  1.00 33.93  ? 117 ASP A CB  1 
ATOM   608 C CG  . ASP A 1 86  ? -16.298 7.514  -3.952  1.00 36.69  ? 117 ASP A CG  1 
ATOM   609 O OD1 . ASP A 1 86  ? -16.671 6.829  -2.977  1.00 40.62  ? 117 ASP A OD1 1 
ATOM   610 O OD2 . ASP A 1 86  ? -15.109 7.546  -4.320  1.00 38.02  ? 117 ASP A OD2 1 
ATOM   611 N N   . SER A 1 87  ? -20.236 8.580  -6.454  1.00 31.82  ? 118 SER A N   1 
ATOM   612 C CA  . SER A 1 87  ? -21.231 9.549  -6.950  1.00 31.22  ? 118 SER A CA  1 
ATOM   613 C C   . SER A 1 87  ? -22.438 9.568  -6.003  1.00 33.53  ? 118 SER A C   1 
ATOM   614 O O   . SER A 1 87  ? -22.880 8.513  -5.519  1.00 34.32  ? 118 SER A O   1 
ATOM   615 C CB  . SER A 1 87  ? -21.697 9.187  -8.364  1.00 34.12  ? 118 SER A CB  1 
ATOM   616 O OG  . SER A 1 87  ? -20.615 9.114  -9.283  1.00 32.36  ? 118 SER A OG  1 
ATOM   617 N N   . GLY A 1 88  ? -22.970 10.751 -5.707  1.00 30.40  ? 119 GLY A N   1 
ATOM   618 C CA  . GLY A 1 88  ? -24.181 10.804 -4.880  1.00 33.32  ? 119 GLY A CA  1 
ATOM   619 C C   . GLY A 1 88  ? -24.226 12.171 -4.265  1.00 30.28  ? 119 GLY A C   1 
ATOM   620 O O   . GLY A 1 88  ? -23.589 13.064 -4.774  1.00 28.25  ? 119 GLY A O   1 
ATOM   621 N N   . THR A 1 89  ? -24.987 12.342 -3.195  1.00 30.05  ? 120 THR A N   1 
ATOM   622 C CA  . THR A 1 89  ? -25.104 13.648 -2.564  1.00 30.53  ? 120 THR A CA  1 
ATOM   623 C C   . THR A 1 89  ? -24.643 13.544 -1.120  1.00 29.37  ? 120 THR A C   1 
ATOM   624 O O   . THR A 1 89  ? -24.672 12.477 -0.526  1.00 32.74  ? 120 THR A O   1 
ATOM   625 C CB  . THR A 1 89  ? -26.517 14.204 -2.647  1.00 32.22  ? 120 THR A CB  1 
ATOM   626 O OG1 . THR A 1 89  ? -27.386 13.330 -1.934  1.00 37.69  ? 120 THR A OG1 1 
ATOM   627 C CG2 . THR A 1 89  ? -26.980 14.268 -4.106  1.00 34.13  ? 120 THR A CG2 1 
ATOM   628 N N   . TYR A 1 90  ? -24.214 14.665 -0.572  1.00 25.63  ? 121 TYR A N   1 
ATOM   629 C CA  . TYR A 1 90  ? -23.436 14.679 0.625   1.00 26.89  ? 121 TYR A CA  1 
ATOM   630 C C   . TYR A 1 90  ? -23.827 15.940 1.361   1.00 29.54  ? 121 TYR A C   1 
ATOM   631 O O   . TYR A 1 90  ? -24.270 16.915 0.728   1.00 26.84  ? 121 TYR A O   1 
ATOM   632 C CB  . TYR A 1 90  ? -21.954 14.821 0.230   1.00 27.70  ? 121 TYR A CB  1 
ATOM   633 C CG  . TYR A 1 90  ? -21.352 13.561 -0.381  1.00 28.84  ? 121 TYR A CG  1 
ATOM   634 C CD1 . TYR A 1 90  ? -21.411 13.321 -1.767  1.00 26.87  ? 121 TYR A CD1 1 
ATOM   635 C CD2 . TYR A 1 90  ? -20.714 12.629 0.421   1.00 31.03  ? 121 TYR A CD2 1 
ATOM   636 C CE1 . TYR A 1 90  ? -20.859 12.161 -2.324  1.00 29.33  ? 121 TYR A CE1 1 
ATOM   637 C CE2 . TYR A 1 90  ? -20.149 11.463 -0.124  1.00 32.49  ? 121 TYR A CE2 1 
ATOM   638 C CZ  . TYR A 1 90  ? -20.225 11.244 -1.486  1.00 31.82  ? 121 TYR A CZ  1 
ATOM   639 O OH  . TYR A 1 90  ? -19.672 10.102 -2.006  1.00 36.16  ? 121 TYR A OH  1 
ATOM   640 N N   . LEU A 1 91  ? -23.654 15.974 2.683   1.00 25.95  ? 122 LEU A N   1 
ATOM   641 C CA  . LEU A 1 91  ? -23.774 17.277 3.346   1.00 28.70  ? 122 LEU A CA  1 
ATOM   642 C C   . LEU A 1 91  ? -22.839 17.394 4.521   1.00 29.24  ? 122 LEU A C   1 
ATOM   643 O O   . LEU A 1 91  ? -22.195 16.414 4.903   1.00 28.06  ? 122 LEU A O   1 
ATOM   644 C CB  . LEU A 1 91  ? -25.224 17.601 3.742   1.00 31.43  ? 122 LEU A CB  1 
ATOM   645 C CG  . LEU A 1 91  ? -25.986 16.719 4.740   1.00 34.50  ? 122 LEU A CG  1 
ATOM   646 C CD1 . LEU A 1 91  ? -25.526 16.926 6.198   1.00 36.97  ? 122 LEU A CD1 1 
ATOM   647 C CD2 . LEU A 1 91  ? -27.471 17.024 4.644   1.00 34.13  ? 122 LEU A CD2 1 
ATOM   648 N N   . CYS A 1 92  ? -22.708 18.600 5.064   1.00 29.43  ? 123 CYS A N   1 
ATOM   649 C CA  . CYS A 1 92  ? -21.975 18.733 6.309   1.00 30.91  ? 123 CYS A CA  1 
ATOM   650 C C   . CYS A 1 92  ? -22.952 19.197 7.383   1.00 33.66  ? 123 CYS A C   1 
ATOM   651 O O   . CYS A 1 92  ? -23.902 19.937 7.106   1.00 34.55  ? 123 CYS A O   1 
ATOM   652 C CB  . CYS A 1 92  ? -20.691 19.601 6.183   1.00 33.46  ? 123 CYS A CB  1 
ATOM   653 S SG  . CYS A 1 92  ? -20.970 21.358 5.951   1.00 38.47  ? 123 CYS A SG  1 
ATOM   654 N N   . GLY A 1 93  ? -22.781 18.686 8.593   1.00 35.45  ? 124 GLY A N   1 
ATOM   655 C CA  . GLY A 1 93  ? -23.701 19.014 9.687   1.00 37.82  ? 124 GLY A CA  1 
ATOM   656 C C   . GLY A 1 93  ? -22.858 19.387 10.891  1.00 40.85  ? 124 GLY A C   1 
ATOM   657 O O   . GLY A 1 93  ? -21.830 18.757 11.158  1.00 41.34  ? 124 GLY A O   1 
ATOM   658 N N   . ALA A 1 94  ? -23.249 20.441 11.590  1.00 41.94  ? 125 ALA A N   1 
ATOM   659 C CA  . ALA A 1 94  ? -22.554 20.835 12.801  1.00 43.46  ? 125 ALA A CA  1 
ATOM   660 C C   . ALA A 1 94  ? -23.419 20.481 14.008  1.00 46.03  ? 125 ALA A C   1 
ATOM   661 O O   . ALA A 1 94  ? -24.634 20.670 13.983  1.00 44.51  ? 125 ALA A O   1 
ATOM   662 C CB  . ALA A 1 94  ? -22.272 22.310 12.771  1.00 44.33  ? 125 ALA A CB  1 
ATOM   663 N N   . ILE A 1 95  ? -22.787 19.959 15.053  1.00 49.34  ? 126 ILE A N   1 
ATOM   664 C CA  . ILE A 1 95  ? -23.485 19.576 16.274  1.00 54.52  ? 126 ILE A CA  1 
ATOM   665 C C   . ILE A 1 95  ? -22.963 20.486 17.383  1.00 59.24  ? 126 ILE A C   1 
ATOM   666 O O   . ILE A 1 95  ? -21.749 20.617 17.565  1.00 60.51  ? 126 ILE A O   1 
ATOM   667 C CB  . ILE A 1 95  ? -23.184 18.109 16.677  1.00 56.50  ? 126 ILE A CB  1 
ATOM   668 C CG1 . ILE A 1 95  ? -23.234 17.173 15.466  1.00 54.89  ? 126 ILE A CG1 1 
ATOM   669 C CG2 . ILE A 1 95  ? -24.162 17.628 17.733  1.00 57.56  ? 126 ILE A CG2 1 
ATOM   670 C CD1 . ILE A 1 95  ? -24.556 16.453 15.352  1.00 57.17  ? 126 ILE A CD1 1 
ATOM   671 N N   . SER A 1 96  ? -23.864 21.122 18.104  1.00 62.21  ? 127 SER A N   1 
ATOM   672 C CA  . SER A 1 96  ? -23.470 21.946 19.231  1.00 70.64  ? 127 SER A CA  1 
ATOM   673 C C   . SER A 1 96  ? -24.065 21.350 20.502  1.00 77.29  ? 127 SER A C   1 
ATOM   674 O O   . SER A 1 96  ? -25.165 20.792 20.479  1.00 74.56  ? 127 SER A O   1 
ATOM   675 C CB  . SER A 1 96  ? -24.006 23.354 19.041  1.00 72.14  ? 127 SER A CB  1 
ATOM   676 O OG  . SER A 1 96  ? -25.397 23.300 18.730  1.00 74.60  ? 127 SER A OG  1 
ATOM   677 N N   . LEU A 1 97  ? -23.331 21.482 21.604  1.00 85.88  ? 128 LEU A N   1 
ATOM   678 C CA  . LEU A 1 97  ? -23.793 21.019 22.907  1.00 94.80  ? 128 LEU A CA  1 
ATOM   679 C C   . LEU A 1 97  ? -24.191 22.212 23.777  1.00 101.30 ? 128 LEU A C   1 
ATOM   680 O O   . LEU A 1 97  ? -25.184 22.136 24.500  1.00 104.34 ? 128 LEU A O   1 
ATOM   681 C CB  . LEU A 1 97  ? -22.709 20.203 23.614  1.00 97.65  ? 128 LEU A CB  1 
ATOM   682 C CG  . LEU A 1 97  ? -21.915 19.187 22.792  1.00 96.32  ? 128 LEU A CG  1 
ATOM   683 C CD1 . LEU A 1 97  ? -20.851 18.550 23.678  1.00 100.29 ? 128 LEU A CD1 1 
ATOM   684 C CD2 . LEU A 1 97  ? -22.836 18.131 22.207  1.00 95.18  ? 128 LEU A CD2 1 
ATOM   685 N N   . ALA A 1 98  ? -23.410 23.299 23.705  1.00 103.85 ? 129 ALA A N   1 
ATOM   686 C CA  . ALA A 1 98  ? -23.682 24.539 24.463  1.00 108.84 ? 129 ALA A CA  1 
ATOM   687 C C   . ALA A 1 98  ? -25.174 24.878 24.420  1.00 111.23 ? 129 ALA A C   1 
ATOM   688 O O   . ALA A 1 98  ? -25.825 24.705 23.373  1.00 108.91 ? 129 ALA A O   1 
ATOM   689 C CB  . ALA A 1 98  ? -22.833 25.712 23.935  1.00 106.13 ? 129 ALA A CB  1 
ATOM   690 N N   . PRO A 1 99  ? -25.718 25.362 25.554  1.00 116.65 ? 130 PRO A N   1 
ATOM   691 C CA  . PRO A 1 99  ? -27.174 25.423 25.768  1.00 119.13 ? 130 PRO A CA  1 
ATOM   692 C C   . PRO A 1 99  ? -28.043 25.564 24.486  1.00 114.72 ? 130 PRO A C   1 
ATOM   693 O O   . PRO A 1 99  ? -28.257 26.677 23.997  1.00 114.79 ? 130 PRO A O   1 
ATOM   694 C CB  . PRO A 1 99  ? -27.329 26.623 26.717  1.00 123.64 ? 130 PRO A CB  1 
ATOM   695 C CG  . PRO A 1 99  ? -26.060 26.594 27.554  1.00 125.57 ? 130 PRO A CG  1 
ATOM   696 C CD  . PRO A 1 99  ? -24.971 25.948 26.689  1.00 120.73 ? 130 PRO A CD  1 
ATOM   697 N N   . LYS A 1 100 ? -28.533 24.442 23.948  1.00 110.37 ? 131 LYS A N   1 
ATOM   698 C CA  . LYS A 1 100 ? -28.229 23.111 24.478  1.00 108.78 ? 131 LYS A CA  1 
ATOM   699 C C   . LYS A 1 100 ? -28.493 22.052 23.426  1.00 103.11 ? 131 LYS A C   1 
ATOM   700 O O   . LYS A 1 100 ? -29.618 21.575 23.292  1.00 105.26 ? 131 LYS A O   1 
ATOM   701 C CB  . LYS A 1 100 ? -29.038 22.795 25.743  1.00 113.65 ? 131 LYS A CB  1 
ATOM   702 C CG  . LYS A 1 100 ? -28.579 21.537 26.480  1.00 115.34 ? 131 LYS A CG  1 
ATOM   703 N N   . LEU A 1 101 ? -27.455 21.702 22.676  1.00 95.27  ? 132 LEU A N   1 
ATOM   704 C CA  . LEU A 1 101 ? -27.523 20.578 21.754  1.00 90.07  ? 132 LEU A CA  1 
ATOM   705 C C   . LEU A 1 101 ? -28.490 20.745 20.578  1.00 85.10  ? 132 LEU A C   1 
ATOM   706 O O   . LEU A 1 101 ? -29.713 20.803 20.771  1.00 85.71  ? 132 LEU A O   1 
ATOM   707 C CB  . LEU A 1 101 ? -27.860 19.274 22.494  1.00 93.49  ? 132 LEU A CB  1 
ATOM   708 C CG  . LEU A 1 101 ? -27.815 18.024 21.598  1.00 90.76  ? 132 LEU A CG  1 
ATOM   709 C CD1 . LEU A 1 101 ? -26.396 17.479 21.476  1.00 87.85  ? 132 LEU A CD1 1 
ATOM   710 C CD2 . LEU A 1 101 ? -28.736 16.962 22.136  1.00 94.34  ? 132 LEU A CD2 1 
ATOM   711 N N   A GLN A 1 102 ? -27.928 20.794 19.371  0.50 78.04  ? 133 GLN A N   1 
ATOM   712 N N   B GLN A 1 102 ? -27.927 20.830 19.371  0.50 77.96  ? 133 GLN A N   1 
ATOM   713 C CA  A GLN A 1 102 ? -28.705 20.764 18.131  0.50 74.40  ? 133 GLN A CA  1 
ATOM   714 C CA  B GLN A 1 102 ? -28.701 20.846 18.122  0.50 74.24  ? 133 GLN A CA  1 
ATOM   715 C C   A GLN A 1 102 ? -27.780 20.523 16.941  0.50 68.83  ? 133 GLN A C   1 
ATOM   716 C C   B GLN A 1 102 ? -27.789 20.590 16.917  0.50 68.72  ? 133 GLN A C   1 
ATOM   717 O O   A GLN A 1 102 ? -26.581 20.779 17.022  0.50 66.87  ? 133 GLN A O   1 
ATOM   718 O O   B GLN A 1 102 ? -26.600 20.890 16.971  0.50 66.88  ? 133 GLN A O   1 
ATOM   719 C CB  A GLN A 1 102 ? -29.489 22.066 17.942  0.50 75.34  ? 133 GLN A CB  1 
ATOM   720 C CB  B GLN A 1 102 ? -29.477 22.165 17.959  0.50 75.07  ? 133 GLN A CB  1 
ATOM   721 C CG  A GLN A 1 102 ? -30.242 22.154 16.621  0.50 72.22  ? 133 GLN A CG  1 
ATOM   722 C CG  B GLN A 1 102 ? -28.684 23.444 18.240  0.50 74.21  ? 133 GLN A CG  1 
ATOM   723 C CD  A GLN A 1 102 ? -31.218 21.011 16.418  0.50 73.31  ? 133 GLN A CD  1 
ATOM   724 C CD  B GLN A 1 102 ? -29.571 24.683 18.264  0.50 75.65  ? 133 GLN A CD  1 
ATOM   725 O OE1 A GLN A 1 102 ? -31.964 20.646 17.323  0.50 77.84  ? 133 GLN A OE1 1 
ATOM   726 O OE1 B GLN A 1 102 ? -30.712 24.655 17.803  0.50 75.13  ? 133 GLN A OE1 1 
ATOM   727 N NE2 A GLN A 1 102 ? -31.226 20.448 15.216  0.50 71.43  ? 133 GLN A NE2 1 
ATOM   728 N NE2 B GLN A 1 102 ? -29.047 25.776 18.801  0.50 76.82  ? 133 GLN A NE2 1 
ATOM   729 N N   . ILE A 1 103 ? -28.335 20.013 15.849  1.00 65.16  ? 134 ILE A N   1 
ATOM   730 C CA  . ILE A 1 103 ? -27.582 19.820 14.623  1.00 64.09  ? 134 ILE A CA  1 
ATOM   731 C C   . ILE A 1 103 ? -28.091 20.797 13.559  1.00 61.39  ? 134 ILE A C   1 
ATOM   732 O O   . ILE A 1 103 ? -29.295 20.959 13.395  1.00 64.58  ? 134 ILE A O   1 
ATOM   733 C CB  . ILE A 1 103 ? -27.693 18.353 14.127  1.00 64.91  ? 134 ILE A CB  1 
ATOM   734 C CG1 . ILE A 1 103 ? -27.623 18.255 12.603  1.00 61.27  ? 134 ILE A CG1 1 
ATOM   735 C CG2 . ILE A 1 103 ? -28.988 17.771 14.576  1.00 69.52  ? 134 ILE A CG2 1 
ATOM   736 C CD1 . ILE A 1 103 ? -26.375 17.534 12.050  1.00 57.81  ? 134 ILE A CD1 1 
ATOM   737 N N   . LYS A 1 104 ? -27.182 21.483 12.879  1.00 55.49  ? 135 LYS A N   1 
ATOM   738 C CA  . LYS A 1 104 ? -27.550 22.375 11.782  1.00 52.77  ? 135 LYS A CA  1 
ATOM   739 C C   . LYS A 1 104 ? -26.829 21.894 10.551  1.00 48.91  ? 135 LYS A C   1 
ATOM   740 O O   . LYS A 1 104 ? -25.605 21.835 10.522  1.00 47.82  ? 135 LYS A O   1 
ATOM   741 C CB  . LYS A 1 104 ? -27.151 23.819 12.069  1.00 55.31  ? 135 LYS A CB  1 
ATOM   742 C CG  . LYS A 1 104 ? -28.071 24.537 13.050  1.00 62.31  ? 135 LYS A CG  1 
ATOM   743 C CD  . LYS A 1 104 ? -27.244 25.443 13.957  1.00 68.69  ? 135 LYS A CD  1 
ATOM   744 C CE  . LYS A 1 104 ? -25.870 24.801 14.285  1.00 70.75  ? 135 LYS A CE  1 
ATOM   745 N NZ  . LYS A 1 104 ? -25.368 25.112 15.676  1.00 74.71  ? 135 LYS A NZ  1 
ATOM   746 N N   . GLU A 1 105 ? -27.591 21.529 9.538   1.00 45.54  ? 136 GLU A N   1 
ATOM   747 C CA  . GLU A 1 105 ? -27.006 20.958 8.339   1.00 43.23  ? 136 GLU A CA  1 
ATOM   748 C C   . GLU A 1 105 ? -26.969 21.966 7.192   1.00 38.32  ? 136 GLU A C   1 
ATOM   749 O O   . GLU A 1 105 ? -27.815 22.878 7.105   1.00 38.45  ? 136 GLU A O   1 
ATOM   750 C CB  . GLU A 1 105 ? -27.850 19.773 7.897   1.00 45.61  ? 136 GLU A CB  1 
ATOM   751 C CG  . GLU A 1 105 ? -29.147 20.228 7.329   1.00 51.46  ? 136 GLU A CG  1 
ATOM   752 C CD  . GLU A 1 105 ? -30.228 19.209 7.478   1.00 56.77  ? 136 GLU A CD  1 
ATOM   753 O OE1 . GLU A 1 105 ? -30.993 19.327 8.452   1.00 59.32  ? 136 GLU A OE1 1 
ATOM   754 O OE2 . GLU A 1 105 ? -30.285 18.279 6.638   1.00 58.12  ? 136 GLU A OE2 1 
ATOM   755 N N   . SER A 1 106 ? -26.001 21.776 6.306   1.00 32.87  ? 137 SER A N   1 
ATOM   756 C CA  . SER A 1 106 ? -25.928 22.541 5.089   1.00 30.67  ? 137 SER A CA  1 
ATOM   757 C C   . SER A 1 106 ? -26.954 22.004 4.096   1.00 31.78  ? 137 SER A C   1 
ATOM   758 O O   . SER A 1 106 ? -27.515 20.942 4.301   1.00 32.84  ? 137 SER A O   1 
ATOM   759 C CB  . SER A 1 106 ? -24.547 22.352 4.507   1.00 28.68  ? 137 SER A CB  1 
ATOM   760 O OG  . SER A 1 106 ? -24.389 20.996 4.125   1.00 27.64  ? 137 SER A OG  1 
ATOM   761 N N   . LEU A 1 107 ? -27.204 22.730 3.015   1.00 31.16  ? 138 LEU A N   1 
ATOM   762 C CA  . LEU A 1 107 ? -27.842 22.122 1.842   1.00 30.54  ? 138 LEU A CA  1 
ATOM   763 C C   . LEU A 1 107 ? -26.920 21.037 1.277   1.00 26.89  ? 138 LEU A C   1 
ATOM   764 O O   . LEU A 1 107 ? -25.707 21.045 1.542   1.00 27.03  ? 138 LEU A O   1 
ATOM   765 C CB  . LEU A 1 107 ? -28.152 23.190 0.786   1.00 30.78  ? 138 LEU A CB  1 
ATOM   766 C CG  . LEU A 1 107 ? -29.159 24.241 1.283   1.00 33.06  ? 138 LEU A CG  1 
ATOM   767 C CD1 . LEU A 1 107 ? -29.538 25.064 0.082   1.00 38.24  ? 138 LEU A CD1 1 
ATOM   768 C CD2 . LEU A 1 107 ? -30.405 23.647 1.931   1.00 34.63  ? 138 LEU A CD2 1 
ATOM   769 N N   . ARG A 1 108 ? -27.470 20.074 0.541   1.00 27.41  ? 139 ARG A N   1 
ATOM   770 C CA  . ARG A 1 108 ? -26.599 19.017 0.003   1.00 26.78  ? 139 ARG A CA  1 
ATOM   771 C C   . ARG A 1 108 ? -25.763 19.555 -1.142  1.00 26.45  ? 139 ARG A C   1 
ATOM   772 O O   . ARG A 1 108 ? -26.103 20.576 -1.735  1.00 25.16  ? 139 ARG A O   1 
ATOM   773 C CB  . ARG A 1 108 ? -27.392 17.809 -0.497  1.00 26.93  ? 139 ARG A CB  1 
ATOM   774 C CG  . ARG A 1 108 ? -28.291 17.186 0.556   1.00 30.35  ? 139 ARG A CG  1 
ATOM   775 C CD  . ARG A 1 108 ? -28.705 15.825 0.097   1.00 30.60  ? 139 ARG A CD  1 
ATOM   776 N NE  . ARG A 1 108 ? -29.728 15.240 0.929   1.00 38.26  ? 139 ARG A NE  1 
ATOM   777 C CZ  . ARG A 1 108 ? -30.332 14.100 0.605   1.00 41.07  ? 139 ARG A CZ  1 
ATOM   778 N NH1 . ARG A 1 108 ? -29.968 13.457 -0.518  1.00 39.02  ? 139 ARG A NH1 1 
ATOM   779 N NH2 . ARG A 1 108 ? -31.283 13.606 1.384   1.00 42.27  ? 139 ARG A NH2 1 
ATOM   780 N N   . ALA A 1 109 ? -24.644 18.888 -1.419  1.00 24.93  ? 140 ALA A N   1 
ATOM   781 C CA  . ALA A 1 109 ? -23.898 19.090 -2.651  1.00 24.58  ? 140 ALA A CA  1 
ATOM   782 C C   . ALA A 1 109 ? -23.841 17.730 -3.344  1.00 27.21  ? 140 ALA A C   1 
ATOM   783 O O   . ALA A 1 109 ? -23.880 16.701 -2.687  1.00 30.69  ? 140 ALA A O   1 
ATOM   784 C CB  . ALA A 1 109 ? -22.495 19.534 -2.324  1.00 22.02  ? 140 ALA A CB  1 
ATOM   785 N N   . GLU A 1 110 ? -23.703 17.732 -4.665  1.00 28.85  ? 141 GLU A N   1 
ATOM   786 C CA  . GLU A 1 110 ? -23.660 16.506 -5.445  1.00 29.01  ? 141 GLU A CA  1 
ATOM   787 C C   . GLU A 1 110 ? -22.242 16.266 -5.973  1.00 28.28  ? 141 GLU A C   1 
ATOM   788 O O   . GLU A 1 110 ? -21.557 17.197 -6.440  1.00 24.59  ? 141 GLU A O   1 
ATOM   789 C CB  . GLU A 1 110 ? -24.615 16.588 -6.645  1.00 28.77  ? 141 GLU A CB  1 
ATOM   790 C CG  . GLU A 1 110 ? -24.588 15.313 -7.528  1.00 29.53  ? 141 GLU A CG  1 
ATOM   791 C CD  . GLU A 1 110 ? -25.520 15.377 -8.721  1.00 32.18  ? 141 GLU A CD  1 
ATOM   792 O OE1 . GLU A 1 110 ? -26.237 16.403 -8.914  1.00 32.45  ? 141 GLU A OE1 1 
ATOM   793 O OE2 . GLU A 1 110 ? -25.565 14.366 -9.462  1.00 34.13  ? 141 GLU A OE2 1 
ATOM   794 N N   . LEU A 1 111 ? -21.814 15.009 -5.905  1.00 28.93  ? 142 LEU A N   1 
ATOM   795 C CA  . LEU A 1 111 ? -20.546 14.584 -6.514  1.00 27.92  ? 142 LEU A CA  1 
ATOM   796 C C   . LEU A 1 111 ? -20.926 13.684 -7.671  1.00 30.52  ? 142 LEU A C   1 
ATOM   797 O O   . LEU A 1 111 ? -21.683 12.724 -7.479  1.00 30.64  ? 142 LEU A O   1 
ATOM   798 C CB  . LEU A 1 111 ? -19.720 13.756 -5.529  1.00 25.44  ? 142 LEU A CB  1 
ATOM   799 C CG  . LEU A 1 111 ? -18.419 13.161 -6.082  1.00 25.27  ? 142 LEU A CG  1 
ATOM   800 C CD1 . LEU A 1 111 ? -17.458 14.252 -6.544  1.00 21.84  ? 142 LEU A CD1 1 
ATOM   801 C CD2 . LEU A 1 111 ? -17.747 12.351 -4.980  1.00 27.79  ? 142 LEU A CD2 1 
ATOM   802 N N   . ARG A 1 112 ? -20.426 14.005 -8.859  1.00 28.67  ? 143 ARG A N   1 
ATOM   803 C CA  . ARG A 1 112 ? -20.476 13.103 -10.029 1.00 30.81  ? 143 ARG A CA  1 
ATOM   804 C C   . ARG A 1 112 ? -19.092 12.608 -10.367 1.00 31.08  ? 143 ARG A C   1 
ATOM   805 O O   . ARG A 1 112 ? -18.153 13.415 -10.627 1.00 26.31  ? 143 ARG A O   1 
ATOM   806 C CB  . ARG A 1 112 ? -21.012 13.844 -11.261 1.00 34.08  ? 143 ARG A CB  1 
ATOM   807 C CG  . ARG A 1 112 ? -22.440 14.253 -11.132 1.00 31.39  ? 143 ARG A CG  1 
ATOM   808 C CD  . ARG A 1 112 ? -23.091 14.716 -12.436 1.00 33.09  ? 143 ARG A CD  1 
ATOM   809 N NE  . ARG A 1 112 ? -24.348 15.349 -12.053 1.00 29.84  ? 143 ARG A NE  1 
ATOM   810 C CZ  . ARG A 1 112 ? -24.969 16.304 -12.725 1.00 32.33  ? 143 ARG A CZ  1 
ATOM   811 N NH1 . ARG A 1 112 ? -24.495 16.752 -13.898 1.00 28.49  ? 143 ARG A NH1 1 
ATOM   812 N NH2 . ARG A 1 112 ? -26.103 16.797 -12.227 1.00 31.50  ? 143 ARG A NH2 1 
ATOM   813 N N   . VAL A 1 113 ? -18.931 11.298 -10.325 1.00 27.90  ? 144 VAL A N   1 
ATOM   814 C CA  . VAL A 1 113 ? -17.635 10.733 -10.668 1.00 31.03  ? 144 VAL A CA  1 
ATOM   815 C C   . VAL A 1 113 ? -17.686 10.090 -12.057 1.00 33.29  ? 144 VAL A C   1 
ATOM   816 O O   . VAL A 1 113 ? -18.266 9.027  -12.228 1.00 36.37  ? 144 VAL A O   1 
ATOM   817 C CB  . VAL A 1 113 ? -17.177 9.692  -9.634  1.00 32.14  ? 144 VAL A CB  1 
ATOM   818 C CG1 . VAL A 1 113 ? -15.798 9.162  -10.012 1.00 32.64  ? 144 VAL A CG1 1 
ATOM   819 C CG2 . VAL A 1 113 ? -17.139 10.322 -8.236  1.00 30.32  ? 144 VAL A CG2 1 
ATOM   820 N N   . THR A 1 114 ? -17.046 10.733 -13.023 1.00 33.11  ? 145 THR A N   1 
ATOM   821 C CA  . THR A 1 114 ? -17.090 10.369 -14.447 1.00 37.01  ? 145 THR A CA  1 
ATOM   822 C C   . THR A 1 114 ? -16.219 9.159  -14.710 1.00 38.84  ? 145 THR A C   1 
ATOM   823 O O   . THR A 1 114 ? -15.035 9.167  -14.360 1.00 38.28  ? 145 THR A O   1 
ATOM   824 C CB  . THR A 1 114 ? -16.440 11.515 -15.278 1.00 37.51  ? 145 THR A CB  1 
ATOM   825 O OG1 . THR A 1 114 ? -17.209 12.713 -15.159 1.00 39.16  ? 145 THR A OG1 1 
ATOM   826 C CG2 . THR A 1 114 ? -16.284 11.151 -16.747 1.00 43.95  ? 145 THR A CG2 1 
ATOM   827 N N   . GLU A 1 115 ? -16.771 8.142  -15.356 1.00 38.17  ? 146 GLU A N   1 
ATOM   828 C CA  A GLU A 1 115 ? -16.019 6.985  -15.834 0.50 41.61  ? 146 GLU A CA  1 
ATOM   829 C CA  B GLU A 1 115 ? -15.967 6.996  -15.728 0.50 41.36  ? 146 GLU A CA  1 
ATOM   830 C C   . GLU A 1 115 ? -14.799 7.406  -16.633 1.00 43.57  ? 146 GLU A C   1 
ATOM   831 O O   . GLU A 1 115 ? -14.886 8.358  -17.404 1.00 43.12  ? 146 GLU A O   1 
ATOM   832 C CB  A GLU A 1 115 ? -16.888 6.158  -16.798 0.50 41.38  ? 146 GLU A CB  1 
ATOM   833 C CB  B GLU A 1 115 ? -16.829 5.926  -16.418 0.50 41.98  ? 146 GLU A CB  1 
ATOM   834 C CG  A GLU A 1 115 ? -18.302 5.918  -16.363 0.50 39.29  ? 146 GLU A CG  1 
ATOM   835 C CG  B GLU A 1 115 ? -17.192 6.244  -17.840 0.50 40.19  ? 146 GLU A CG  1 
ATOM   836 C CD  A GLU A 1 115 ? -19.279 6.985  -16.834 0.50 36.30  ? 146 GLU A CD  1 
ATOM   837 C CD  B GLU A 1 115 ? -17.872 5.095  -18.558 0.50 43.83  ? 146 GLU A CD  1 
ATOM   838 O OE1 A GLU A 1 115 ? -19.297 8.062  -16.215 0.50 33.63  ? 146 GLU A OE1 1 
ATOM   839 O OE1 B GLU A 1 115 ? -17.185 4.153  -19.019 0.50 45.26  ? 146 GLU A OE1 1 
ATOM   840 O OE2 A GLU A 1 115 ? -20.054 6.717  -17.795 0.50 38.32  ? 146 GLU A OE2 1 
ATOM   841 O OE2 B GLU A 1 115 ? -19.108 5.160  -18.688 0.50 45.06  ? 146 GLU A OE2 1 
ATOM   842 N N   . ARG A 1 116 ? -13.690 6.674  -16.520 1.00 49.70  ? 147 ARG A N   1 
ATOM   843 C CA  . ARG A 1 116 ? -12.555 6.851  -17.440 1.00 54.34  ? 147 ARG A CA  1 
ATOM   844 C C   . ARG A 1 116 ? -12.746 5.931  -18.632 1.00 57.92  ? 147 ARG A C   1 
ATOM   845 O O   . ARG A 1 116 ? -12.206 4.834  -18.627 1.00 63.67  ? 147 ARG A O   1 
ATOM   846 C CB  . ARG A 1 116 ? -11.228 6.456  -16.784 1.00 59.95  ? 147 ARG A CB  1 
ATOM   847 C CG  . ARG A 1 116 ? -10.508 7.581  -16.043 1.00 64.03  ? 147 ARG A CG  1 
ATOM   848 C CD  . ARG A 1 116 ? -9.045  7.211  -15.671 1.00 68.74  ? 147 ARG A CD  1 
ATOM   849 N NE  . ARG A 1 116 ? -8.633  7.894  -14.442 1.00 69.23  ? 147 ARG A NE  1 
ATOM   850 C CZ  . ARG A 1 116 ? -7.491  7.671  -13.795 1.00 72.97  ? 147 ARG A CZ  1 
ATOM   851 N NH1 . ARG A 1 116 ? -6.617  6.784  -14.260 1.00 77.25  ? 147 ARG A NH1 1 
ATOM   852 N NH2 . ARG A 1 116 ? -7.212  8.345  -12.683 1.00 72.15  ? 147 ARG A NH2 1 
ATOM   853 N N   . ARG A 1 117 ? -13.488 6.368  -19.650 1.00 55.44  ? 148 ARG A N   1 
ATOM   854 C CA  . ARG A 1 117 ? -13.832 5.535  -20.808 1.00 56.27  ? 148 ARG A CA  1 
ATOM   855 C C   . ARG A 1 117 ? -12.655 5.497  -21.793 1.00 60.70  ? 148 ARG A C   1 
ATOM   856 O O   . ARG A 1 117 ? -12.262 6.527  -22.320 1.00 61.39  ? 148 ARG A O   1 
ATOM   857 C CB  . ARG A 1 117 ? -15.106 6.083  -21.462 1.00 51.33  ? 148 ARG A CB  1 
ATOM   858 C CG  . ARG A 1 117 ? -15.747 5.173  -22.500 1.00 54.99  ? 148 ARG A CG  1 
ATOM   859 C CD  . ARG A 1 117 ? -17.119 5.700  -22.958 1.00 50.67  ? 148 ARG A CD  1 
ATOM   860 N NE  . ARG A 1 117 ? -18.070 5.787  -21.854 1.00 47.22  ? 148 ARG A NE  1 
ATOM   861 C CZ  . ARG A 1 117 ? -19.229 6.443  -21.888 1.00 46.15  ? 148 ARG A CZ  1 
ATOM   862 N NH1 . ARG A 1 117 ? -20.001 6.441  -20.815 1.00 44.10  ? 148 ARG A NH1 1 
ATOM   863 N NH2 . ARG A 1 117 ? -19.624 7.093  -22.977 1.00 47.48  ? 148 ARG A NH2 1 
ATOM   864 N N   . ALA A 1 118 ? -12.090 4.319  -22.042 1.00 65.21  ? 149 ALA A N   1 
ATOM   865 C CA  . ALA A 1 118 ? -10.806 4.225  -22.756 1.00 68.89  ? 149 ALA A CA  1 
ATOM   866 C C   . ALA A 1 118 ? -10.913 4.375  -24.278 1.00 71.48  ? 149 ALA A C   1 
ATOM   867 O O   . ALA A 1 118 ? -11.964 4.093  -24.855 1.00 73.02  ? 149 ALA A O   1 
ATOM   868 C CB  . ALA A 1 118 ? -10.112 2.918  -22.413 1.00 73.70  ? 149 ALA A CB  1 
HETATM 869 O O   . HOH B 2 .   ? -15.146 14.554 -15.511 1.00 39.59  ? 1   HOH A O   1 
HETATM 870 O O   . HOH B 2 .   ? -21.731 24.247 -8.119  1.00 38.96  ? 2   HOH A O   1 
HETATM 871 O O   . HOH B 2 .   ? -17.190 20.389 -11.073 1.00 39.93  ? 3   HOH A O   1 
HETATM 872 O O   . HOH B 2 .   ? -18.812 26.325 1.717   1.00 43.23  ? 4   HOH A O   1 
HETATM 873 O O   . HOH B 2 .   ? -14.163 23.013 -2.394  1.00 33.18  ? 5   HOH A O   1 
HETATM 874 O O   . HOH B 2 .   ? -6.860  16.180 8.092   1.00 43.78  ? 6   HOH A O   1 
HETATM 875 O O   . HOH B 2 .   ? -21.948 11.480 15.009  0.50 49.98  ? 7   HOH A O   1 
HETATM 876 O O   . HOH B 2 .   ? -24.748 24.466 1.390   1.00 44.88  ? 8   HOH A O   1 
HETATM 877 O O   . HOH B 2 .   ? -7.990  19.856 10.722  1.00 48.29  ? 9   HOH A O   1 
HETATM 878 O O   . HOH B 2 .   ? -24.766 23.105 -1.293  1.00 33.69  ? 10  HOH A O   1 
HETATM 879 O O   . HOH B 2 .   ? -10.673 5.472  -8.421  1.00 46.41  ? 11  HOH A O   1 
HETATM 880 O O   . HOH B 2 .   ? -23.557 6.183  -6.880  1.00 52.41  ? 12  HOH A O   1 
HETATM 881 O O   . HOH B 2 .   ? -30.170 19.557 3.325   1.00 50.20  ? 13  HOH A O   1 
HETATM 882 O O   . HOH B 2 .   ? -8.826  18.307 -4.586  1.00 48.11  ? 14  HOH A O   1 
HETATM 883 O O   . HOH B 2 .   ? -8.053  29.474 5.660   1.00 48.42  ? 15  HOH A O   1 
HETATM 884 O O   . HOH B 2 .   ? -28.432 21.314 -2.679  1.00 44.47  ? 16  HOH A O   1 
HETATM 885 O O   . HOH B 2 .   ? -5.922  22.952 10.722  1.00 44.39  ? 17  HOH A O   1 
HETATM 886 O O   . HOH B 2 .   ? -7.234  21.055 13.018  1.00 55.49  ? 18  HOH A O   1 
HETATM 887 O O   . HOH B 2 .   ? -11.444 23.609 -2.778  1.00 61.55  ? 19  HOH A O   1 
HETATM 888 O O   . HOH B 2 .   ? -7.091  20.964 3.157   1.00 36.53  ? 20  HOH A O   1 
HETATM 889 O O   . HOH B 2 .   ? -30.432 19.982 0.098   1.00 37.36  ? 21  HOH A O   1 
HETATM 890 O O   . HOH B 2 .   ? -24.212 12.234 -8.722  1.00 28.32  ? 22  HOH A O   1 
HETATM 891 O O   . HOH B 2 .   ? -21.394 26.142 -5.501  1.00 41.93  ? 23  HOH A O   1 
HETATM 892 O O   . HOH B 2 .   ? -26.259 25.556 3.406   1.00 45.21  ? 24  HOH A O   1 
HETATM 893 O O   . HOH B 2 .   ? -22.828 26.309 -2.467  1.00 39.93  ? 25  HOH A O   1 
HETATM 894 O O   . HOH B 2 .   ? -27.466 13.672 -11.110 1.00 48.64  ? 26  HOH A O   1 
HETATM 895 O O   . HOH B 2 .   ? -5.355  23.520 7.088   1.00 44.71  ? 27  HOH A O   1 
HETATM 896 O O   . HOH B 2 .   ? -12.195 18.901 -6.281  1.00 38.30  ? 28  HOH A O   1 
HETATM 897 O O   . HOH B 2 .   ? -7.166  15.406 -8.595  1.00 47.90  ? 29  HOH A O   1 
HETATM 898 O O   . HOH B 2 .   ? -30.817 16.678 3.155   1.00 46.40  ? 30  HOH A O   1 
HETATM 899 O O   . HOH B 2 .   ? -5.012  17.537 5.058   1.00 42.35  ? 31  HOH A O   1 
HETATM 900 O O   . HOH B 2 .   ? -26.526 20.047 -5.652  1.00 31.35  ? 161 HOH A O   1 
HETATM 901 O O   . HOH B 2 .   ? -4.340  12.014 -3.855  1.00 52.36  ? 162 HOH A O   1 
HETATM 902 O O   . HOH B 2 .   ? -31.728 11.101 -1.323  1.00 53.47  ? 163 HOH A O   1 
HETATM 903 O O   . HOH B 2 .   ? -27.811 17.735 -4.532  1.00 28.24  ? 164 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1   N N   . ASN A 2   ? 0.6257 1.0476 0.8171 0.1273  0.0722  -0.3260 33  ASN A N   
2   C CA  . ASN A 2   ? 0.5986 0.9835 0.8104 0.1192  0.0611  -0.2883 33  ASN A CA  
3   C C   . ASN A 2   ? 0.5472 0.9294 0.7218 0.1021  0.0608  -0.2491 33  ASN A C   
4   O O   . ASN A 2   ? 0.5574 0.9400 0.6947 0.0960  0.0559  -0.2465 33  ASN A O   
5   C CB  . ASN A 2   ? 0.6228 0.9565 0.8639 0.1210  0.0411  -0.2936 33  ASN A CB  
6   C CG  . ASN A 2   ? 0.6782 0.9998 0.9646 0.1396  0.0396  -0.3247 33  ASN A CG  
7   O OD1 . ASN A 2   ? 0.7139 1.0593 1.0255 0.1528  0.0495  -0.3304 33  ASN A OD1 
8   N ND2 . ASN A 2   ? 0.7052 0.9901 1.0057 0.1411  0.0271  -0.3464 33  ASN A ND2 
9   N N   . PRO A 3   ? 0.4807 0.8606 0.6677 0.0955  0.0646  -0.2203 34  PRO A N   
10  C CA  . PRO A 3   ? 0.4169 0.7880 0.5748 0.0800  0.0648  -0.1846 34  PRO A CA  
11  C C   . PRO A 3   ? 0.3702 0.7011 0.5267 0.0750  0.0458  -0.1721 34  PRO A C   
12  O O   . PRO A 3   ? 0.3728 0.6799 0.5584 0.0799  0.0339  -0.1832 34  PRO A O   
13  C CB  . PRO A 3   ? 0.4193 0.7988 0.6037 0.0751  0.0720  -0.1674 34  PRO A CB  
14  C CG  . PRO A 3   ? 0.4307 0.8103 0.6632 0.0904  0.0664  -0.1882 34  PRO A CG  
15  C CD  . PRO A 3   ? 0.4711 0.8622 0.7023 0.1039  0.0694  -0.2239 34  PRO A CD  
16  N N   . PRO A 4   ? 0.3242 0.6475 0.4481 0.0655  0.0436  -0.1490 35  PRO A N   
17  C CA  . PRO A 4   ? 0.2825 0.5751 0.4074 0.0597  0.0287  -0.1348 35  PRO A CA  
18  C C   . PRO A 4   ? 0.2846 0.5555 0.4407 0.0554  0.0239  -0.1204 35  PRO A C   
19  O O   . PRO A 4   ? 0.2899 0.5716 0.4594 0.0542  0.0319  -0.1130 35  PRO A O   
20  C CB  . PRO A 4   ? 0.2753 0.5692 0.3618 0.0538  0.0316  -0.1112 35  PRO A CB  
21  C CG  . PRO A 4   ? 0.3057 0.6234 0.3739 0.0523  0.0492  -0.1060 35  PRO A CG  
22  C CD  . PRO A 4   ? 0.3259 0.6699 0.4098 0.0605  0.0568  -0.1346 35  PRO A CD  
23  N N   . THR A 5   ? 0.2867 0.5318 0.4548 0.0522  0.0110  -0.1170 36  THR A N   
24  C CA  . THR A 5   ? 0.3041 0.5312 0.4894 0.0465  0.0062  -0.0980 36  THR A CA  
25  C C   . THR A 5   ? 0.2828 0.5000 0.4469 0.0371  0.0030  -0.0803 36  THR A C   
26  O O   . THR A 5   ? 0.2769 0.4970 0.4232 0.0376  0.0003  -0.0854 36  THR A O   
27  C CB  . THR A 5   ? 0.3400 0.5431 0.5536 0.0490  -0.0042 -0.1037 36  THR A CB  
28  O OG1 . THR A 5   ? 0.3871 0.5788 0.5951 0.0445  -0.0105 -0.1132 36  THR A OG1 
29  C CG2 . THR A 5   ? 0.3712 0.5804 0.6100 0.0628  -0.0021 -0.1238 36  THR A CG2 
30  N N   . PHE A 6   ? 0.2299 0.4390 0.3966 0.0301  0.0026  -0.0619 37  PHE A N   
31  C CA  . PHE A 6   ? 0.2336 0.4346 0.3813 0.0231  0.0020  -0.0477 37  PHE A CA  
32  C C   . PHE A 6   ? 0.2216 0.4093 0.3822 0.0163  -0.0045 -0.0377 37  PHE A C   
33  O O   . PHE A 6   ? 0.2122 0.4022 0.3858 0.0148  -0.0050 -0.0325 37  PHE A O   
34  C CB  . PHE A 6   ? 0.2292 0.4371 0.3601 0.0198  0.0124  -0.0378 37  PHE A CB  
35  C CG  . PHE A 6   ? 0.2483 0.4437 0.3558 0.0174  0.0127  -0.0259 37  PHE A CG  
36  C CD1 . PHE A 6   ? 0.2663 0.4518 0.3687 0.0091  0.0181  -0.0137 37  PHE A CD1 
37  C CD2 . PHE A 6   ? 0.2638 0.4586 0.3570 0.0244  0.0070  -0.0291 37  PHE A CD2 
38  C CE1 . PHE A 6   ? 0.2757 0.4437 0.3587 0.0098  0.0182  -0.0041 37  PHE A CE1 
39  C CE2 . PHE A 6   ? 0.2909 0.4748 0.3653 0.0270  0.0061  -0.0184 37  PHE A CE2 
40  C CZ  . PHE A 6   ? 0.3117 0.4788 0.3811 0.0206  0.0120  -0.0057 37  PHE A CZ  
41  N N   . SER A 7   ? 0.2021 0.3808 0.3596 0.0124  -0.0097 -0.0360 38  SER A N   
42  C CA  . SER A 7   ? 0.2494 0.4180 0.4151 0.0049  -0.0145 -0.0263 38  SER A CA  
43  C C   . SER A 7   ? 0.2470 0.4157 0.4010 -0.0007 -0.0140 -0.0223 38  SER A C   
44  O O   . SER A 7   ? 0.2884 0.4632 0.4338 0.0034  -0.0130 -0.0287 38  SER A O   
45  C CB  . SER A 7   ? 0.2791 0.4359 0.4627 0.0042  -0.0202 -0.0299 38  SER A CB  
46  O OG  . SER A 7   ? 0.3742 0.5321 0.5585 0.0023  -0.0210 -0.0414 38  SER A OG  
47  N N   . PRO A 8   ? 0.2468 0.4120 0.4000 -0.0087 -0.0152 -0.0126 39  PRO A N   
48  C CA  . PRO A 8   ? 0.1967 0.3578 0.3567 -0.0113 -0.0195 -0.0028 39  PRO A CA  
49  C C   . PRO A 8   ? 0.2123 0.3817 0.3707 -0.0096 -0.0181 -0.0015 39  PRO A C   
50  O O   . PRO A 8   ? 0.2654 0.4371 0.4127 -0.0109 -0.0123 -0.0043 39  PRO A O   
51  C CB  . PRO A 8   ? 0.2368 0.3980 0.3876 -0.0214 -0.0201 0.0064  39  PRO A CB  
52  C CG  . PRO A 8   ? 0.2504 0.4190 0.3897 -0.0221 -0.0140 -0.0007 39  PRO A CG  
53  C CD  . PRO A 8   ? 0.2188 0.3884 0.3632 -0.0141 -0.0129 -0.0113 39  PRO A CD  
54  N N   . ALA A 9   ? 0.1526 0.3264 0.3240 -0.0068 -0.0237 0.0027  40  ALA A N   
55  C CA  . ALA A 9   ? 0.1600 0.3493 0.3364 -0.0075 -0.0222 0.0012  40  ALA A CA  
56  C C   . ALA A 9   ? 0.2006 0.3933 0.3624 -0.0185 -0.0212 0.0036  40  ALA A C   
57  O O   . ALA A 9   ? 0.1978 0.3988 0.3610 -0.0238 -0.0165 -0.0006 40  ALA A O   
58  C CB  . ALA A 9   ? 0.1989 0.3994 0.3975 0.0002  -0.0314 0.0044  40  ALA A CB  
59  N N   . LEU A 10  ? 0.1711 0.3585 0.3201 -0.0234 -0.0248 0.0089  41  LEU A N   
60  C CA  . LEU A 10  ? 0.2071 0.3988 0.3416 -0.0327 -0.0235 0.0061  41  LEU A CA  
61  C C   . LEU A 10  ? 0.2029 0.3867 0.3236 -0.0343 -0.0192 0.0055  41  LEU A C   
62  O O   . LEU A 10  ? 0.2193 0.4031 0.3381 -0.0357 -0.0222 0.0136  41  LEU A O   
63  C CB  . LEU A 10  ? 0.2103 0.4185 0.3437 -0.0374 -0.0341 0.0115  41  LEU A CB  
64  C CG  . LEU A 10  ? 0.2061 0.4217 0.3210 -0.0480 -0.0338 0.0047  41  LEU A CG  
65  C CD1 . LEU A 10  ? 0.1495 0.3579 0.2648 -0.0538 -0.0252 -0.0098 41  LEU A CD1 
66  C CD2 . LEU A 10  ? 0.2180 0.4564 0.3305 -0.0513 -0.0472 0.0097  41  LEU A CD2 
67  N N   . LEU A 11  ? 0.1881 0.3650 0.3018 -0.0337 -0.0119 -0.0032 42  LEU A N   
68  C CA  . LEU A 11  ? 0.1713 0.3478 0.2771 -0.0328 -0.0074 -0.0076 42  LEU A CA  
69  C C   . LEU A 11  ? 0.2140 0.3912 0.3084 -0.0372 -0.0040 -0.0173 42  LEU A C   
70  O O   . LEU A 11  ? 0.2034 0.3691 0.2972 -0.0375 -0.0018 -0.0234 42  LEU A O   
71  C CB  . LEU A 11  ? 0.1941 0.3627 0.3038 -0.0229 -0.0038 -0.0115 42  LEU A CB  
72  C CG  . LEU A 11  ? 0.2292 0.4022 0.3368 -0.0176 -0.0001 -0.0191 42  LEU A CG  
73  C CD1 . LEU A 11  ? 0.2157 0.4050 0.3285 -0.0242 0.0002  -0.0177 42  LEU A CD1 
74  C CD2 . LEU A 11  ? 0.2610 0.4282 0.3710 -0.0059 -0.0008 -0.0203 42  LEU A CD2 
75  N N   . VAL A 12  ? 0.2335 0.4238 0.3183 -0.0423 -0.0026 -0.0197 43  VAL A N   
76  C CA  . VAL A 12  ? 0.2724 0.4665 0.3457 -0.0460 0.0010  -0.0339 43  VAL A CA  
77  C C   . VAL A 12  ? 0.2950 0.4960 0.3684 -0.0398 0.0091  -0.0429 43  VAL A C   
78  O O   . VAL A 12  ? 0.2520 0.4686 0.3271 -0.0424 0.0113  -0.0363 43  VAL A O   
79  C CB  . VAL A 12  ? 0.3046 0.5190 0.3631 -0.0570 -0.0037 -0.0306 43  VAL A CB  
80  C CG1 . VAL A 12  ? 0.2992 0.5231 0.3429 -0.0615 0.0008  -0.0505 43  VAL A CG1 
81  C CG2 . VAL A 12  ? 0.2457 0.4611 0.3097 -0.0604 -0.0144 -0.0218 43  VAL A CG2 
82  N N   . VAL A 13  ? 0.2605 0.4501 0.3349 -0.0315 0.0138  -0.0582 44  VAL A N   
83  C CA  . VAL A 13  ? 0.2571 0.4602 0.3354 -0.0229 0.0210  -0.0705 44  VAL A CA  
84  C C   . VAL A 13  ? 0.3024 0.4973 0.3746 -0.0197 0.0256  -0.0920 44  VAL A C   
85  O O   . VAL A 13  ? 0.2890 0.4635 0.3558 -0.0253 0.0225  -0.0958 44  VAL A O   
86  C CB  . VAL A 13  ? 0.2716 0.4660 0.3648 -0.0069 0.0198  -0.0681 44  VAL A CB  
87  C CG1 . VAL A 13  ? 0.2532 0.4516 0.3533 -0.0104 0.0144  -0.0514 44  VAL A CG1 
88  C CG2 . VAL A 13  ? 0.2927 0.4520 0.3849 0.0035  0.0178  -0.0699 44  VAL A CG2 
89  N N   . THR A 14  ? 0.2678 0.4809 0.3440 -0.0112 0.0334  -0.1084 45  THR A N   
90  C CA  . THR A 14  ? 0.3432 0.5505 0.4160 -0.0053 0.0391  -0.1345 45  THR A CA  
91  C C   . THR A 14  ? 0.3480 0.5232 0.4361 0.0165  0.0380  -0.1404 45  THR A C   
92  O O   . THR A 14  ? 0.3196 0.4991 0.4207 0.0294  0.0353  -0.1299 45  THR A O   
93  C CB  . THR A 14  ? 0.3816 0.6319 0.4529 -0.0055 0.0497  -0.1497 45  THR A CB  
94  O OG1 . THR A 14  ? 0.4309 0.7073 0.4825 -0.0263 0.0501  -0.1378 45  THR A OG1 
95  C CG2 . THR A 14  ? 0.4228 0.6712 0.4926 0.0035  0.0571  -0.1829 45  THR A CG2 
96  N N   . GLU A 15  ? 0.3451 0.4864 0.4314 0.0206  0.0388  -0.1562 46  GLU A N   
97  C CA  . GLU A 15  ? 0.3965 0.4975 0.4947 0.0428  0.0368  -0.1573 46  GLU A CA  
98  C C   . GLU A 15  ? 0.3952 0.5228 0.5103 0.0665  0.0395  -0.1675 46  GLU A C   
99  O O   . GLU A 15  ? 0.3887 0.5561 0.5076 0.0666  0.0478  -0.1880 46  GLU A O   
100 C CB  . GLU A 15  ? 0.4329 0.4888 0.5288 0.0424  0.0390  -0.1767 46  GLU A CB  
101 C CG  . GLU A 15  ? 0.5299 0.6019 0.6278 0.0477  0.0467  -0.2117 46  GLU A CG  
102 C CD  . GLU A 15  ? 0.6066 0.6296 0.7035 0.0443  0.0482  -0.2343 46  GLU A CD  
103 O OE1 . GLU A 15  ? 0.6397 0.6801 0.7301 0.0359  0.0535  -0.2651 46  GLU A OE1 
104 O OE2 . GLU A 15  ? 0.6662 0.6334 0.7678 0.0486  0.0446  -0.2214 46  GLU A OE2 
105 N N   . GLY A 16  ? 0.4168 0.5290 0.5422 0.0865  0.0326  -0.1533 47  GLY A N   
106 C CA  . GLY A 16  ? 0.3681 0.5137 0.5145 0.1103  0.0323  -0.1629 47  GLY A CA  
107 C C   . GLY A 16  ? 0.3533 0.5412 0.5061 0.1038  0.0285  -0.1471 47  GLY A C   
108 O O   . GLY A 16  ? 0.3289 0.5374 0.4997 0.1239  0.0228  -0.1470 47  GLY A O   
109 N N   . ASP A 17  ? 0.2819 0.4826 0.4218 0.0768  0.0305  -0.1350 48  ASP A N   
110 C CA  . ASP A 17  ? 0.3231 0.5568 0.4702 0.0682  0.0274  -0.1218 48  ASP A CA  
111 C C   . ASP A 17  ? 0.3204 0.5290 0.4630 0.0740  0.0161  -0.1013 48  ASP A C   
112 O O   . ASP A 17  ? 0.3604 0.5257 0.4903 0.0798  0.0125  -0.0927 48  ASP A O   
113 C CB  . ASP A 17  ? 0.3681 0.6215 0.5039 0.0396  0.0334  -0.1156 48  ASP A CB  
114 C CG  . ASP A 17  ? 0.4351 0.7284 0.5737 0.0328  0.0462  -0.1337 48  ASP A CG  
115 O OD1 . ASP A 17  ? 0.4768 0.7851 0.6003 0.0111  0.0519  -0.1285 48  ASP A OD1 
116 O OD2 . ASP A 17  ? 0.5066 0.8177 0.6622 0.0512  0.0505  -0.1535 48  ASP A OD2 
117 N N   . ASN A 18  ? 0.3046 0.5415 0.4572 0.0711  0.0114  -0.0946 49  ASN A N   
118 C CA  . ASN A 18  ? 0.2998 0.5191 0.4446 0.0745  0.0016  -0.0780 49  ASN A CA  
119 C C   . ASN A 18  ? 0.3178 0.5260 0.4502 0.0511  0.0037  -0.0660 49  ASN A C   
120 O O   . ASN A 18  ? 0.2761 0.4987 0.4093 0.0336  0.0100  -0.0683 49  ASN A O   
121 C CB  . ASN A 18  ? 0.2984 0.5548 0.4607 0.0817  -0.0059 -0.0808 49  ASN A CB  
122 C CG  . ASN A 18  ? 0.3235 0.6043 0.5051 0.1060  -0.0097 -0.0947 49  ASN A CG  
123 O OD1 . ASN A 18  ? 0.3404 0.5942 0.5159 0.1285  -0.0138 -0.0935 49  ASN A OD1 
124 N ND2 . ASN A 18  ? 0.3008 0.6330 0.5086 0.1021  -0.0083 -0.1080 49  ASN A ND2 
125 N N   . ALA A 19  ? 0.2869 0.4717 0.4073 0.0521  -0.0013 -0.0525 50  ALA A N   
126 C CA  . ALA A 19  ? 0.2833 0.4602 0.3966 0.0341  0.0000  -0.0431 50  ALA A CA  
127 C C   . ALA A 19  ? 0.2786 0.4603 0.3915 0.0377  -0.0063 -0.0365 50  ALA A C   
128 O O   . ALA A 19  ? 0.2953 0.4644 0.3976 0.0511  -0.0101 -0.0309 50  ALA A O   
129 C CB  . ALA A 19  ? 0.2827 0.4278 0.3826 0.0295  0.0033  -0.0375 50  ALA A CB  
130 N N   . THR A 20  ? 0.2549 0.4526 0.3772 0.0259  -0.0074 -0.0373 51  THR A N   
131 C CA  . THR A 20  ? 0.2152 0.4198 0.3387 0.0296  -0.0135 -0.0375 51  THR A CA  
132 C C   . THR A 20  ? 0.2483 0.4426 0.3709 0.0183  -0.0121 -0.0323 51  THR A C   
133 O O   . THR A 20  ? 0.2178 0.4134 0.3501 0.0054  -0.0103 -0.0312 51  THR A O   
134 C CB  . THR A 20  ? 0.2191 0.4548 0.3619 0.0293  -0.0178 -0.0495 51  THR A CB  
135 O OG1 . THR A 20  ? 0.2209 0.4699 0.3657 0.0465  -0.0215 -0.0550 51  THR A OG1 
136 C CG2 . THR A 20  ? 0.1755 0.4204 0.3219 0.0290  -0.0247 -0.0552 51  THR A CG2 
137 N N   . PHE A 21  ? 0.2228 0.4076 0.3334 0.0240  -0.0124 -0.0279 52  PHE A N   
138 C CA  . PHE A 21  ? 0.2191 0.4025 0.3344 0.0178  -0.0118 -0.0283 52  PHE A CA  
139 C C   . PHE A 21  ? 0.2000 0.3979 0.3187 0.0230  -0.0172 -0.0395 52  PHE A C   
140 O O   . PHE A 21  ? 0.2274 0.4372 0.3378 0.0332  -0.0220 -0.0436 52  PHE A O   
141 C CB  . PHE A 21  ? 0.2281 0.4000 0.3307 0.0187  -0.0061 -0.0202 52  PHE A CB  
142 C CG  . PHE A 21  ? 0.2395 0.3983 0.3407 0.0110  -0.0014 -0.0128 52  PHE A CG  
143 C CD1 . PHE A 21  ? 0.2745 0.4182 0.3626 0.0141  0.0019  -0.0074 52  PHE A CD1 
144 C CD2 . PHE A 21  ? 0.2450 0.4058 0.3584 0.0013  -0.0016 -0.0117 52  PHE A CD2 
145 C CE1 . PHE A 21  ? 0.3383 0.4692 0.4270 0.0046  0.0061  -0.0051 52  PHE A CE1 
146 C CE2 . PHE A 21  ? 0.2802 0.4349 0.3925 -0.0068 0.0006  -0.0082 52  PHE A CE2 
147 C CZ  . PHE A 21  ? 0.3065 0.4467 0.4072 -0.0067 0.0051  -0.0068 52  PHE A CZ  
148 N N   . THR A 22  ? 0.2001 0.3971 0.3308 0.0176  -0.0176 -0.0455 53  THR A N   
149 C CA  . THR A 22  ? 0.2195 0.4280 0.3540 0.0214  -0.0221 -0.0609 53  THR A CA  
150 C C   . THR A 22  ? 0.2557 0.4627 0.3836 0.0260  -0.0176 -0.0638 53  THR A C   
151 O O   . THR A 22  ? 0.2308 0.4277 0.3700 0.0224  -0.0139 -0.0600 53  THR A O   
152 C CB  . THR A 22  ? 0.2350 0.4407 0.3946 0.0105  -0.0256 -0.0704 53  THR A CB  
153 O OG1 . THR A 22  ? 0.2607 0.4745 0.4276 0.0038  -0.0266 -0.0678 53  THR A OG1 
154 C CG2 . THR A 22  ? 0.2236 0.4405 0.3907 0.0126  -0.0312 -0.0929 53  THR A CG2 
155 N N   . CYS A 23  ? 0.2632 0.4850 0.3725 0.0350  -0.0181 -0.0708 54  CYS A N   
156 C CA  . CYS A 23  ? 0.3048 0.5335 0.4066 0.0392  -0.0116 -0.0774 54  CYS A CA  
157 C C   . CYS A 23  ? 0.3351 0.5757 0.4475 0.0414  -0.0177 -0.1034 54  CYS A C   
158 O O   . CYS A 23  ? 0.3377 0.5936 0.4425 0.0443  -0.0261 -0.1138 54  CYS A O   
159 C CB  . CYS A 23  ? 0.3067 0.5442 0.3738 0.0464  -0.0063 -0.0663 54  CYS A CB  
160 S SG  . CYS A 23  ? 0.3394 0.5963 0.3907 0.0502  0.0058  -0.0750 54  CYS A SG  
161 N N   . SER A 24  ? 0.3204 0.5544 0.4533 0.0407  -0.0147 -0.1157 55  SER A N   
162 C CA  . SER A 24  ? 0.3485 0.5884 0.4938 0.0428  -0.0194 -0.1445 55  SER A CA  
163 C C   . SER A 24  ? 0.4038 0.6614 0.5388 0.0524  -0.0112 -0.1601 55  SER A C   
164 O O   . SER A 24  ? 0.3983 0.6532 0.5424 0.0555  -0.0021 -0.1546 55  SER A O   
165 C CB  . SER A 24  ? 0.3550 0.5676 0.5355 0.0362  -0.0231 -0.1499 55  SER A CB  
166 O OG  . SER A 24  ? 0.4185 0.6193 0.6052 0.0252  -0.0275 -0.1333 55  SER A OG  
167 N N   . PHE A 25  ? 0.4461 0.7274 0.5626 0.0572  -0.0146 -0.1815 56  PHE A N   
168 C CA  . PHE A 25  ? 0.4895 0.7961 0.5879 0.0663  -0.0051 -0.1985 56  PHE A CA  
169 C C   . PHE A 25  ? 0.5651 0.8912 0.6577 0.0693  -0.0136 -0.2337 56  PHE A C   
170 O O   . PHE A 25  ? 0.5248 0.8648 0.6003 0.0678  -0.0250 -0.2341 56  PHE A O   
171 C CB  . PHE A 25  ? 0.4945 0.8204 0.5505 0.0690  0.0029  -0.1753 56  PHE A CB  
172 C CG  . PHE A 25  ? 0.5720 0.9289 0.6039 0.0758  0.0159  -0.1895 56  PHE A CG  
173 C CD1 . PHE A 25  ? 0.5825 0.9442 0.6353 0.0777  0.0303  -0.1979 56  PHE A CD1 
174 C CD2 . PHE A 25  ? 0.6168 1.0031 0.6059 0.0813  0.0136  -0.1961 56  PHE A CD2 
175 C CE1 . PHE A 25  ? 0.6253 1.0225 0.6578 0.0835  0.0453  -0.2140 56  PHE A CE1 
176 C CE2 . PHE A 25  ? 0.6632 1.0827 0.6254 0.0865  0.0277  -0.2098 56  PHE A CE2 
177 C CZ  . PHE A 25  ? 0.6626 1.0885 0.6474 0.0868  0.0452  -0.2197 56  PHE A CZ  
178 N N   . SER A 26  ? 0.6490 0.9796 0.7568 0.0748  -0.0091 -0.2657 57  SER A N   
179 C CA  . SER A 26  ? 0.7527 1.1082 0.8496 0.0778  -0.0161 -0.3054 57  SER A CA  
180 C C   . SER A 26  ? 0.8316 1.2221 0.9040 0.0892  -0.0026 -0.3282 57  SER A C   
181 O O   . SER A 26  ? 0.8227 1.2086 0.9150 0.0954  0.0104  -0.3350 57  SER A O   
182 C CB  . SER A 26  ? 0.7499 1.0781 0.8894 0.0704  -0.0273 -0.3352 57  SER A CB  
183 O OG  . SER A 26  ? 0.7334 1.0251 0.9119 0.0727  -0.0213 -0.3368 57  SER A OG  
184 N N   . ASN A 27  ? 0.9281 1.3579 0.9564 0.0927  -0.0061 -0.3393 58  ASN A N   
185 C CA  . ASN A 27  ? 1.0286 1.4991 1.0235 0.1020  0.0084  -0.3586 58  ASN A CA  
186 C C   . ASN A 27  ? 1.1022 1.6119 1.0652 0.1057  -0.0022 -0.3956 58  ASN A C   
187 O O   . ASN A 27  ? 1.1225 1.6545 1.0454 0.1058  -0.0137 -0.3804 58  ASN A O   
188 C CB  . ASN A 27  ? 1.0502 1.5360 1.0046 0.1024  0.0235  -0.3164 58  ASN A CB  
189 C CG  . ASN A 27  ? 1.1071 1.6393 1.0225 0.1090  0.0423  -0.3314 58  ASN A CG  
190 O OD1 . ASN A 27  ? 1.1384 1.6895 1.0673 0.1155  0.0487  -0.3748 58  ASN A OD1 
191 N ND2 . ASN A 27  ? 1.1278 1.6771 0.9939 0.1069  0.0526  -0.2951 58  ASN A ND2 
192 N N   . THR A 28  ? 1.1655 1.6845 1.1466 0.1103  0.0006  -0.4455 59  THR A N   
193 C CA  . THR A 28  ? 1.2423 1.8011 1.1964 0.1130  -0.0096 -0.4902 59  THR A CA  
194 C C   . THR A 28  ? 1.3056 1.9212 1.1938 0.1219  0.0037  -0.4898 59  THR A C   
195 O O   . THR A 28  ? 1.3402 1.9780 1.2248 0.1293  0.0226  -0.5173 59  THR A O   
196 C CB  . THR A 28  ? 1.2595 1.8031 1.2590 0.1144  -0.0109 -0.5490 59  THR A CB  
197 N N   . SER A 29  ? 1.3299 1.9692 1.1661 0.1219  -0.0059 -0.4581 60  SER A N   
198 C CA  . SER A 29  ? 1.3823 2.0722 1.1458 0.1289  0.0048  -0.4468 60  SER A CA  
199 C C   . SER A 29  ? 1.3725 2.0522 1.1174 0.1271  0.0290  -0.3949 60  SER A C   
200 O O   . SER A 29  ? 1.3362 1.9830 1.0850 0.1227  0.0244  -0.3474 60  SER A O   
201 C CB  . SER A 29  ? 1.4302 2.1663 1.1757 0.1354  0.0144  -0.5041 60  SER A CB  
202 N N   . SER A 31  ? 1.0418 1.7143 0.6916 0.1309  0.0041  -0.2891 62  SER A N   
203 C CA  . SER A 31  ? 1.0291 1.6653 0.6794 0.1314  -0.0081 -0.2399 62  SER A CA  
204 C C   . SER A 31  ? 0.9867 1.5790 0.6591 0.1217  0.0133  -0.2005 62  SER A C   
205 O O   . SER A 31  ? 1.0049 1.6033 0.6781 0.1151  0.0395  -0.2017 62  SER A O   
206 C CB  . SER A 31  ? 1.0820 1.7430 0.6597 0.1428  -0.0198 -0.2087 62  SER A CB  
207 O OG  . SER A 31  ? 1.0980 1.7848 0.6739 0.1526  -0.0516 -0.2316 62  SER A OG  
208 N N   . PHE A 32  ? 0.9420 1.4946 0.6335 0.1209  0.0020  -0.1681 63  PHE A N   
209 C CA  . PHE A 32  ? 0.8864 1.3972 0.5990 0.1109  0.0192  -0.1329 63  PHE A CA  
210 C C   . PHE A 32  ? 0.8437 1.3183 0.5472 0.1143  0.0077  -0.0890 63  PHE A C   
211 O O   . PHE A 32  ? 0.8229 1.2988 0.5290 0.1245  -0.0167 -0.0915 63  PHE A O   
212 C CB  . PHE A 32  ? 0.8653 1.3549 0.6465 0.1020  0.0247  -0.1567 63  PHE A CB  
213 C CG  . PHE A 32  ? 0.8652 1.3364 0.6905 0.1028  0.0019  -0.1734 63  PHE A CG  
214 C CD1 . PHE A 32  ? 0.8339 1.2735 0.6724 0.1020  -0.0088 -0.1448 63  PHE A CD1 
215 C CD2 . PHE A 32  ? 0.8743 1.3590 0.7299 0.1029  -0.0067 -0.2189 63  PHE A CD2 
216 C CE1 . PHE A 32  ? 0.8220 1.2507 0.7009 0.1004  -0.0265 -0.1599 63  PHE A CE1 
217 C CE2 . PHE A 32  ? 0.8573 1.3246 0.7544 0.0993  -0.0249 -0.2322 63  PHE A CE2 
218 C CZ  . PHE A 32  ? 0.8162 1.2587 0.7240 0.0975  -0.0340 -0.2019 63  PHE A CZ  
219 N N   . VAL A 33  ? 0.7931 1.2375 0.4880 0.1056  0.0258  -0.0515 64  VAL A N   
220 C CA  . VAL A 33  ? 0.7300 1.1290 0.4322 0.1064  0.0187  -0.0155 64  VAL A CA  
221 C C   . VAL A 33  ? 0.6640 1.0335 0.4259 0.0929  0.0268  -0.0213 64  VAL A C   
222 O O   . VAL A 33  ? 0.6069 0.9824 0.3875 0.0808  0.0464  -0.0305 64  VAL A O   
223 C CB  . VAL A 33  ? 0.7907 1.1680 0.4432 0.1037  0.0331  0.0314  64  VAL A CB  
224 C CG1 . VAL A 33  ? 0.7623 1.0871 0.4269 0.1061  0.0250  0.0635  64  VAL A CG1 
225 C CG2 . VAL A 33  ? 0.8778 1.2860 0.4616 0.1175  0.0262  0.0426  64  VAL A CG2 
226 N N   . LEU A 34  ? 0.6058 0.9479 0.3968 0.0961  0.0115  -0.0162 65  LEU A N   
227 C CA  . LEU A 34  ? 0.5890 0.9068 0.4325 0.0849  0.0152  -0.0226 65  LEU A CA  
228 C C   . LEU A 34  ? 0.5981 0.8744 0.4411 0.0820  0.0171  0.0101  65  LEU A C   
229 O O   . LEU A 34  ? 0.6115 0.8753 0.4529 0.0933  0.0011  0.0183  65  LEU A O   
230 C CB  . LEU A 34  ? 0.5778 0.9028 0.4582 0.0889  -0.0034 -0.0502 65  LEU A CB  
231 C CG  . LEU A 34  ? 0.5861 0.9073 0.5147 0.0784  0.0010  -0.0737 65  LEU A CG  
232 C CD1 . LEU A 34  ? 0.5454 0.8516 0.5106 0.0763  -0.0127 -0.0799 65  LEU A CD1 
233 C CD2 . LEU A 34  ? 0.5795 0.8842 0.5201 0.0673  0.0196  -0.0596 65  LEU A CD2 
234 N N   . ASN A 35  ? 0.5543 0.8121 0.4028 0.0671  0.0364  0.0253  66  ASN A N   
235 C CA  . ASN A 35  ? 0.5166 0.7322 0.3632 0.0612  0.0408  0.0542  66  ASN A CA  
236 C C   . ASN A 35  ? 0.4487 0.6437 0.3414 0.0506  0.0408  0.0470  66  ASN A C   
237 O O   . ASN A 35  ? 0.4116 0.6229 0.3356 0.0418  0.0456  0.0281  66  ASN A O   
238 C CB  . ASN A 35  ? 0.5822 0.7904 0.3997 0.0483  0.0627  0.0780  66  ASN A CB  
239 C CG  . ASN A 35  ? 0.7018 0.9195 0.4616 0.0597  0.0619  0.0967  66  ASN A CG  
240 O OD1 . ASN A 35  ? 0.7285 0.9565 0.4712 0.0796  0.0416  0.0927  66  ASN A OD1 
241 N ND2 . ASN A 35  ? 0.7463 0.9635 0.4752 0.0465  0.0838  0.1182  66  ASN A ND2 
242 N N   . TRP A 36  ? 0.3942 0.5543 0.2900 0.0530  0.0347  0.0617  67  TRP A N   
243 C CA  . TRP A 36  ? 0.4064 0.5496 0.3396 0.0435  0.0339  0.0544  67  TRP A CA  
244 C C   . TRP A 36  ? 0.4471 0.5554 0.3729 0.0296  0.0477  0.0759  67  TRP A C   
245 O O   . TRP A 36  ? 0.4867 0.5634 0.3864 0.0364  0.0470  0.0976  67  TRP A O   
246 C CB  . TRP A 36  ? 0.4009 0.5372 0.3466 0.0572  0.0164  0.0475  67  TRP A CB  
247 C CG  . TRP A 36  ? 0.3458 0.4666 0.3236 0.0488  0.0153  0.0402  67  TRP A CG  
248 C CD1 . TRP A 36  ? 0.3376 0.4588 0.3385 0.0319  0.0233  0.0338  67  TRP A CD1 
249 C CD2 . TRP A 36  ? 0.3621 0.4718 0.3508 0.0584  0.0051  0.0368  67  TRP A CD2 
250 N NE1 . TRP A 36  ? 0.3622 0.4717 0.3823 0.0294  0.0184  0.0280  67  TRP A NE1 
251 C CE2 . TRP A 36  ? 0.3444 0.4470 0.3580 0.0450  0.0089  0.0287  67  TRP A CE2 
252 C CE3 . TRP A 36  ? 0.3975 0.5071 0.3781 0.0785  -0.0071 0.0388  67  TRP A CE3 
253 C CZ2 . TRP A 36  ? 0.3284 0.4236 0.3559 0.0492  0.0034  0.0217  67  TRP A CZ2 
254 C CZ3 . TRP A 36  ? 0.3608 0.4644 0.3613 0.0840  -0.0125 0.0307  67  TRP A CZ3 
255 C CH2 . TRP A 36  ? 0.3575 0.4540 0.3798 0.0686  -0.0060 0.0218  67  TRP A CH2 
256 N N   . TYR A 37  ? 0.3865 0.5007 0.3362 0.0106  0.0597  0.0700  68  TYR A N   
257 C CA  . TYR A 37  ? 0.4054 0.4914 0.3538 -0.0077 0.0740  0.0861  68  TYR A CA  
258 C C   . TYR A 37  ? 0.4028 0.4743 0.3844 -0.0175 0.0698  0.0752  68  TYR A C   
259 O O   . TYR A 37  ? 0.3523 0.4482 0.3608 -0.0168 0.0623  0.0561  68  TYR A O   
260 C CB  . TYR A 37  ? 0.4151 0.5293 0.3663 -0.0250 0.0930  0.0863  68  TYR A CB  
261 C CG  . TYR A 37  ? 0.4718 0.6041 0.3848 -0.0181 0.1008  0.0968  68  TYR A CG  
262 C CD1 . TYR A 37  ? 0.5389 0.6421 0.4118 -0.0212 0.1102  0.1267  68  TYR A CD1 
263 C CD2 . TYR A 37  ? 0.4755 0.6523 0.3904 -0.0083 0.0987  0.0768  68  TYR A CD2 
264 C CE1 . TYR A 37  ? 0.5924 0.7161 0.4228 -0.0152 0.1177  0.1386  68  TYR A CE1 
265 C CE2 . TYR A 37  ? 0.5136 0.7125 0.3893 -0.0021 0.1062  0.0831  68  TYR A CE2 
266 C CZ  . TYR A 37  ? 0.5693 0.7439 0.4007 -0.0057 0.1156  0.1149  68  TYR A CZ  
267 O OH  . TYR A 37  ? 0.6371 0.8363 0.4231 0.0002  0.1228  0.1234  68  TYR A OH  
268 N N   . ARG A 38  ? 0.4348 0.4649 0.4125 -0.0266 0.0744  0.0872  69  ARG A N   
269 C CA  . ARG A 38  ? 0.4619 0.4829 0.4690 -0.0427 0.0748  0.0751  69  ARG A CA  
270 C C   . ARG A 38  ? 0.4992 0.5320 0.5201 -0.0697 0.0919  0.0773  69  ARG A C   
271 O O   . ARG A 38  ? 0.5095 0.5230 0.5112 -0.0806 0.1065  0.0965  69  ARG A O   
272 C CB  . ARG A 38  ? 0.5300 0.4995 0.5297 -0.0393 0.0713  0.0814  69  ARG A CB  
273 C CG  . ARG A 38  ? 0.5546 0.5167 0.5813 -0.0553 0.0706  0.0645  69  ARG A CG  
274 C CD  . ARG A 38  ? 0.5780 0.4951 0.6009 -0.0462 0.0647  0.0618  69  ARG A CD  
275 N NE  . ARG A 38  ? 0.5531 0.4718 0.6001 -0.0614 0.0630  0.0400  69  ARG A NE  
276 C CZ  . ARG A 38  ? 0.6038 0.4889 0.6532 -0.0567 0.0591  0.0290  69  ARG A CZ  
277 N NH1 . ARG A 38  ? 0.6146 0.4606 0.6476 -0.0350 0.0561  0.0394  69  ARG A NH1 
278 N NH2 . ARG A 38  ? 0.5810 0.4741 0.6492 -0.0717 0.0572  0.0064  69  ARG A NH2 
279 N N   . MET A 39  ? 0.4717 0.5382 0.5259 -0.0809 0.0901  0.0588  70  MET A N   
280 C CA  . MET A 39  ? 0.5067 0.5990 0.5806 -0.1048 0.1055  0.0576  70  MET A CA  
281 C C   . MET A 39  ? 0.5183 0.5975 0.6159 -0.1278 0.1070  0.0494  70  MET A C   
282 O O   . MET A 39  ? 0.5886 0.6831 0.7036 -0.1516 0.1207  0.0492  70  MET A O   
283 C CB  . MET A 39  ? 0.4628 0.6119 0.5621 -0.0994 0.1024  0.0415  70  MET A CB  
284 C CG  . MET A 39  ? 0.4452 0.6117 0.5265 -0.0777 0.1000  0.0418  70  MET A CG  
285 S SD  . MET A 39  ? 0.5044 0.6708 0.5506 -0.0830 0.1215  0.0615  70  MET A SD  
286 C CE  . MET A 39  ? 0.5022 0.7151 0.5820 -0.1090 0.1426  0.0543  70  MET A CE  
287 N N   . SER A 40  ? 0.5471 0.6040 0.6476 -0.1218 0.0931  0.0395  71  SER A N   
288 C CA  . SER A 40  ? 0.5639 0.6099 0.6853 -0.1432 0.0925  0.0264  71  SER A CA  
289 C C   . SER A 40  ? 0.5960 0.5998 0.7046 -0.1313 0.0817  0.0207  71  SER A C   
290 O O   . SER A 40  ? 0.5592 0.5648 0.6548 -0.1069 0.0709  0.0205  71  SER A O   
291 C CB  . SER A 40  ? 0.5165 0.6181 0.6723 -0.1513 0.0842  0.0065  71  SER A CB  
292 O OG  . SER A 40  ? 0.4930 0.6055 0.6493 -0.1342 0.0658  -0.0051 71  SER A OG  
293 N N   . PRO A 41  ? 0.6457 0.6137 0.7607 -0.1494 0.0854  0.0131  72  PRO A N   
294 C CA  . PRO A 41  ? 0.7033 0.6726 0.8398 -0.1831 0.0978  0.0093  72  PRO A CA  
295 C C   . PRO A 41  ? 0.7860 0.7340 0.9097 -0.1957 0.1179  0.0353  72  PRO A C   
296 O O   . PRO A 41  ? 0.8020 0.7164 0.8940 -0.1773 0.1206  0.0573  72  PRO A O   
297 C CB  . PRO A 41  ? 0.7223 0.6457 0.8631 -0.1942 0.0949  -0.0069 72  PRO A CB  
298 C CG  . PRO A 41  ? 0.6962 0.6234 0.8270 -0.1676 0.0782  -0.0200 72  PRO A CG  
299 C CD  . PRO A 41  ? 0.6629 0.5957 0.7713 -0.1389 0.0760  0.0003  72  PRO A CD  
300 N N   . SER A 42  ? 0.8458 0.8178 0.9943 -0.2272 0.1316  0.0326  73  SER A N   
301 C CA  . SER A 42  ? 0.9398 0.9099 1.0796 -0.2445 0.1546  0.0565  73  SER A CA  
302 C C   . SER A 42  ? 1.0217 0.9144 1.1252 -0.2446 0.1656  0.0855  73  SER A C   
303 O O   . SER A 42  ? 1.0543 0.9414 1.1303 -0.2428 0.1796  0.1130  73  SER A O   
304 C CB  . SER A 42  ? 0.9698 0.9736 1.1493 -0.2845 0.1684  0.0445  73  SER A CB  
305 O OG  . SER A 42  ? 0.9549 1.0333 1.1696 -0.2817 0.1564  0.0196  73  SER A OG  
306 N N   . ASN A 43  ? 1.0647 0.8981 1.1677 -0.2461 0.1589  0.0786  74  ASN A N   
307 C CA  . ASN A 43  ? 1.1435 0.8947 1.2157 -0.2424 0.1659  0.1048  74  ASN A CA  
308 C C   . ASN A 43  ? 1.1227 0.8605 1.1584 -0.1991 0.1527  0.1208  74  ASN A C   
309 O O   . ASN A 43  ? 1.1773 0.8705 1.1782 -0.1894 0.1592  0.1532  74  ASN A O   
310 C CB  . ASN A 43  ? 1.2039 0.8991 1.2929 -0.2535 0.1606  0.0847  74  ASN A CB  
311 C CG  . ASN A 43  ? 1.1701 0.8959 1.2753 -0.2342 0.1387  0.0492  74  ASN A CG  
312 O OD1 . ASN A 43  ? 1.1790 0.8766 1.2675 -0.2029 0.1259  0.0470  74  ASN A OD1 
313 N ND2 . ASN A 43  ? 1.1234 0.9118 1.2609 -0.2521 0.1343  0.0222  74  ASN A ND2 
314 N N   . GLN A 44  ? 1.0366 0.8155 1.0803 -0.1741 0.1339  0.0989  75  GLN A N   
315 C CA  . GLN A 44  ? 1.0177 0.7879 1.0353 -0.1346 0.1193  0.1068  75  GLN A CA  
316 C C   . GLN A 44  ? 0.9764 0.7946 0.9748 -0.1179 0.1184  0.1200  75  GLN A C   
317 O O   . GLN A 44  ? 0.9652 0.7881 0.9460 -0.0868 0.1048  0.1229  75  GLN A O   
318 C CB  . GLN A 44  ? 0.9794 0.7644 1.0145 -0.1177 0.1012  0.0767  75  GLN A CB  
319 C CG  . GLN A 44  ? 1.0364 0.7764 1.0877 -0.1300 0.1005  0.0578  75  GLN A CG  
320 C CD  . GLN A 44  ? 1.0441 0.7634 1.0909 -0.0995 0.0862  0.0443  75  GLN A CD  
321 O OE1 . GLN A 44  ? 1.0742 0.7624 1.0996 -0.0725 0.0820  0.0625  75  GLN A OE1 
322 N NE2 . GLN A 44  ? 1.0188 0.7597 1.0857 -0.1029 0.0784  0.0118  75  GLN A NE2 
323 N N   . THR A 45  ? 0.9408 0.7982 0.9448 -0.1386 0.1329  0.1248  76  THR A N   
324 C CA  . THR A 45  ? 0.8880 0.7940 0.8764 -0.1228 0.1323  0.1304  76  THR A CA  
325 C C   . THR A 45  ? 0.9172 0.7884 0.8594 -0.1026 0.1320  0.1602  76  THR A C   
326 O O   . THR A 45  ? 0.9953 0.8115 0.9171 -0.1116 0.1418  0.1849  76  THR A O   
327 C CB  . THR A 45  ? 0.8548 0.8121 0.8588 -0.1464 0.1498  0.1279  76  THR A CB  
328 O OG1 . THR A 45  ? 0.9357 0.8678 0.9147 -0.1649 0.1714  0.1565  76  THR A OG1 
329 C CG2 . THR A 45  ? 0.8147 0.7960 0.8648 -0.1698 0.1501  0.1030  76  THR A CG2 
330 N N   . ASP A 46  ? 0.8720 0.7735 0.7982 -0.0750 0.1192  0.1576  77  ASP A N   
331 C CA  . ASP A 46  ? 0.8902 0.7668 0.7737 -0.0505 0.1126  0.1821  77  ASP A CA  
332 C C   . ASP A 46  ? 0.8140 0.7440 0.6903 -0.0270 0.0994  0.1691  77  ASP A C   
333 O O   . ASP A 46  ? 0.7191 0.6860 0.6264 -0.0243 0.0906  0.1411  77  ASP A O   
334 C CB  . ASP A 46  ? 0.9356 0.7558 0.8187 -0.0329 0.0987  0.1852  77  ASP A CB  
335 C CG  . ASP A 46  ? 1.0226 0.7981 0.8615 -0.0123 0.0949  0.2197  77  ASP A CG  
336 O OD1 . ASP A 46  ? 1.0812 0.8245 0.8925 -0.0279 0.1112  0.2504  77  ASP A OD1 
337 O OD2 . ASP A 46  ? 1.0313 0.8043 0.8639 0.0197  0.0752  0.2170  77  ASP A OD2 
338 N N   . LYS A 47  ? 0.7964 0.7300 0.6309 -0.0112 0.0976  0.1893  78  LYS A N   
339 C CA  . LYS A 47  ? 0.7635 0.7393 0.5909 0.0139  0.0805  0.1747  78  LYS A CA  
340 C C   . LYS A 47  ? 0.7694 0.7201 0.6004 0.0396  0.0590  0.1727  78  LYS A C   
341 O O   . LYS A 47  ? 0.8433 0.7468 0.6513 0.0507  0.0558  0.1974  78  LYS A O   
342 C CB  . LYS A 47  ? 0.7859 0.7839 0.5658 0.0224  0.0841  0.1925  78  LYS A CB  
343 C CG  . LYS A 47  ? 0.7562 0.7906 0.5277 0.0503  0.0620  0.1767  78  LYS A CG  
344 C CD  . LYS A 47  ? 0.7892 0.8575 0.5148 0.0573  0.0648  0.1860  78  LYS A CD  
345 C CE  . LYS A 47  ? 0.8799 0.9120 0.5526 0.0703  0.0617  0.2263  78  LYS A CE  
346 N NZ  . LYS A 47  ? 0.9281 0.9972 0.5497 0.0734  0.0675  0.2369  78  LYS A NZ  
347 N N   . LEU A 48  ? 0.6987 0.6807 0.5597 0.0493  0.0451  0.1441  79  LEU A N   
348 C CA  . LEU A 48  ? 0.7089 0.6777 0.5827 0.0709  0.0274  0.1365  79  LEU A CA  
349 C C   . LEU A 48  ? 0.7424 0.7347 0.5947 0.0989  0.0097  0.1394  79  LEU A C   
350 O O   . LEU A 48  ? 0.7595 0.7276 0.6019 0.1214  -0.0024 0.1514  79  LEU A O   
351 C CB  . LEU A 48  ? 0.6122 0.6065 0.5279 0.0649  0.0227  0.1057  79  LEU A CB  
352 C CG  . LEU A 48  ? 0.6092 0.5898 0.5486 0.0391  0.0359  0.0985  79  LEU A CG  
353 C CD1 . LEU A 48  ? 0.5563 0.5659 0.5289 0.0362  0.0292  0.0723  79  LEU A CD1 
354 C CD2 . LEU A 48  ? 0.6459 0.5701 0.5832 0.0360  0.0403  0.1102  79  LEU A CD2 
355 N N   . ALA A 49  ? 0.7312 0.7730 0.5802 0.0985  0.0069  0.1254  80  ALA A N   
356 C CA  . ALA A 49  ? 0.7498 0.8275 0.5907 0.1217  -0.0126 0.1160  80  ALA A CA  
357 C C   . ALA A 49  ? 0.7545 0.8786 0.5852 0.1148  -0.0099 0.1017  80  ALA A C   
358 O O   . ALA A 49  ? 0.7672 0.8991 0.6097 0.0943  0.0056  0.0929  80  ALA A O   
359 C CB  . ALA A 49  ? 0.7029 0.7962 0.5855 0.1292  -0.0255 0.0909  80  ALA A CB  
360 N N   . ALA A 50  ? 0.7630 0.9203 0.5735 0.1331  -0.0258 0.0968  81  ALA A N   
361 C CA  . ALA A 50  ? 0.7612 0.9613 0.5547 0.1287  -0.0234 0.0819  81  ALA A CA  
362 C C   . ALA A 50  ? 0.7668 1.0130 0.5667 0.1441  -0.0455 0.0563  81  ALA A C   
363 O O   . ALA A 50  ? 0.7813 1.0317 0.5901 0.1622  -0.0644 0.0563  81  ALA A O   
364 C CB  . ALA A 50  ? 0.7939 0.9881 0.5320 0.1289  -0.0126 0.1101  81  ALA A CB  
365 N N   . PHE A 51  ? 0.7375 1.0204 0.5371 0.1362  -0.0426 0.0314  82  PHE A N   
366 C CA  . PHE A 51  ? 0.7199 1.0490 0.5201 0.1468  -0.0619 0.0045  82  PHE A CA  
367 C C   . PHE A 51  ? 0.7626 1.1212 0.5162 0.1481  -0.0569 0.0017  82  PHE A C   
368 O O   . PHE A 51  ? 0.6987 1.0553 0.4489 0.1332  -0.0362 -0.0020 82  PHE A O   
369 C CB  . PHE A 51  ? 0.6566 1.0004 0.5095 0.1338  -0.0636 -0.0314 82  PHE A CB  
370 C CG  . PHE A 51  ? 0.6543 1.0445 0.5107 0.1388  -0.0804 -0.0638 82  PHE A CG  
371 C CD1 . PHE A 51  ? 0.6491 1.0616 0.5278 0.1481  -0.1012 -0.0757 82  PHE A CD1 
372 C CD2 . PHE A 51  ? 0.6746 1.0907 0.5134 0.1340  -0.0752 -0.0854 82  PHE A CD2 
373 C CE1 . PHE A 51  ? 0.6640 1.1241 0.5487 0.1501  -0.1180 -0.1090 82  PHE A CE1 
374 C CE2 . PHE A 51  ? 0.6860 1.1456 0.5281 0.1373  -0.0918 -0.1200 82  PHE A CE2 
375 C CZ  . PHE A 51  ? 0.6673 1.1485 0.5330 0.1441  -0.1137 -0.1317 82  PHE A CZ  
376 N N   . PRO A 52  ? 0.8347 1.2249 0.5514 0.1670  -0.0761 0.0034  83  PRO A N   
377 C CA  . PRO A 52  ? 0.8783 1.2756 0.6043 0.1873  -0.1015 0.0080  83  PRO A CA  
378 C C   . PRO A 52  ? 0.9699 1.3276 0.6635 0.2038  -0.1034 0.0543  83  PRO A C   
379 O O   . PRO A 52  ? 1.0459 1.3987 0.6825 0.2106  -0.0995 0.0823  83  PRO A O   
380 C CB  . PRO A 52  ? 0.8857 1.3426 0.5864 0.1999  -0.1227 -0.0150 83  PRO A CB  
381 C CG  . PRO A 52  ? 0.9225 1.3895 0.5703 0.1941  -0.1069 -0.0089 83  PRO A CG  
382 C CD  . PRO A 52  ? 0.8764 1.3050 0.5417 0.1712  -0.0756 -0.0024 83  PRO A CD  
383 N N   . GLU A 53  ? 0.9935 1.3211 0.7226 0.2097  -0.1080 0.0623  84  GLU A N   
384 C CA  . GLU A 53  ? 1.0900 1.3802 0.7961 0.2316  -0.1158 0.1004  84  GLU A CA  
385 C C   . GLU A 53  ? 1.0679 1.3411 0.8246 0.2403  -0.1239 0.0939  84  GLU A C   
386 O O   . GLU A 53  ? 1.0927 1.3858 0.8555 0.2670  -0.1472 0.0939  84  GLU A O   
387 C CB  . GLU A 53  ? 1.1524 1.3871 0.8221 0.2204  -0.0924 0.1387  84  GLU A CB  
388 C CG  . GLU A 53  ? 1.2684 1.4674 0.8936 0.2459  -0.1030 0.1828  84  GLU A CG  
389 C CD  . GLU A 53  ? 1.3495 1.5108 0.9201 0.2331  -0.0811 0.2217  84  GLU A CD  
390 O OE1 . GLU A 53  ? 1.4346 1.5819 0.9511 0.2531  -0.0909 0.2584  84  GLU A OE1 
391 O OE2 . GLU A 53  ? 1.3408 1.4889 0.9230 0.2028  -0.0543 0.2165  84  GLU A OE2 
392 N N   . CYS A 62  ? 0.9757 0.9342 0.8921 0.2881  -0.0949 0.1297  93  CYS A N   
393 C CA  . CYS A 62  ? 0.9373 0.8644 0.8852 0.2774  -0.0816 0.1119  93  CYS A CA  
394 C C   . CYS A 62  ? 0.8066 0.7861 0.7880 0.2517  -0.0729 0.0778  93  CYS A C   
395 O O   . CYS A 62  ? 0.7355 0.7776 0.7316 0.2550  -0.0827 0.0614  93  CYS A O   
396 C CB  . CYS A 62  ? 1.0161 0.8675 0.9425 0.2561  -0.0633 0.1333  93  CYS A CB  
397 S SG  . CYS A 62  ? 1.0355 0.8880 0.9326 0.2125  -0.0438 0.1479  93  CYS A SG  
398 N N   . ARG A 63  ? 0.7300 0.6825 0.7222 0.2252  -0.0553 0.0683  94  ARG A N   
399 C CA  . ARG A 63  ? 0.6316 0.6238 0.6534 0.2028  -0.0470 0.0392  94  ARG A CA  
400 C C   . ARG A 63  ? 0.5606 0.5852 0.5758 0.1752  -0.0412 0.0381  94  ARG A C   
401 O O   . ARG A 63  ? 0.5299 0.5816 0.5659 0.1562  -0.0348 0.0191  94  ARG A O   
402 C CB  . ARG A 63  ? 0.6354 0.5886 0.6690 0.1872  -0.0327 0.0282  94  ARG A CB  
403 C CG  . ARG A 63  ? 0.6739 0.6022 0.7252 0.2126  -0.0360 0.0162  94  ARG A CG  
404 C CD  . ARG A 63  ? 0.6672 0.5637 0.7295 0.1933  -0.0216 -0.0015 94  ARG A CD  
405 N NE  . ARG A 63  ? 0.6557 0.5124 0.6981 0.1640  -0.0107 0.0141  94  ARG A NE  
406 C CZ  . ARG A 63  ? 0.6074 0.4826 0.6535 0.1318  -0.0008 0.0041  94  ARG A CZ  
407 N NH1 . ARG A 63  ? 0.5633 0.4887 0.6274 0.1241  0.0000  -0.0184 94  ARG A NH1 
408 N NH2 . ARG A 63  ? 0.6141 0.4584 0.6466 0.1074  0.0082  0.0176  94  ARG A NH2 
409 N N   . PHE A 64  ? 0.5639 0.5841 0.5492 0.1731  -0.0426 0.0585  95  PHE A N   
410 C CA  . PHE A 64  ? 0.5380 0.5883 0.5201 0.1493  -0.0363 0.0536  95  PHE A CA  
411 C C   . PHE A 64  ? 0.5188 0.6140 0.4931 0.1624  -0.0502 0.0506  95  PHE A C   
412 O O   . PHE A 64  ? 0.5685 0.6578 0.5153 0.1818  -0.0597 0.0683  95  PHE A O   
413 C CB  . PHE A 64  ? 0.5819 0.5989 0.5386 0.1307  -0.0224 0.0734  95  PHE A CB  
414 C CG  . PHE A 64  ? 0.6153 0.5888 0.5804 0.1154  -0.0098 0.0749  95  PHE A CG  
415 C CD1 . PHE A 64  ? 0.7093 0.6277 0.6560 0.1209  -0.0059 0.0958  95  PHE A CD1 
416 C CD2 . PHE A 64  ? 0.6018 0.5884 0.5926 0.0955  -0.0030 0.0551  95  PHE A CD2 
417 C CE1 . PHE A 64  ? 0.7425 0.6199 0.6999 0.1044  0.0053  0.0929  95  PHE A CE1 
418 C CE2 . PHE A 64  ? 0.6294 0.5815 0.6281 0.0807  0.0067  0.0523  95  PHE A CE2 
419 C CZ  . PHE A 64  ? 0.7061 0.6038 0.6900 0.0841  0.0112  0.0690  95  PHE A CZ  
420 N N   . ARG A 65  ? 0.4371 0.5762 0.4342 0.1515  -0.0522 0.0285  96  ARG A N   
421 C CA  . ARG A 65  ? 0.4403 0.6257 0.4362 0.1618  -0.0667 0.0188  96  ARG A CA  
422 C C   . ARG A 65  ? 0.3823 0.5886 0.3787 0.1403  -0.0607 0.0075  96  ARG A C   
423 O O   . ARG A 65  ? 0.3313 0.5317 0.3469 0.1195  -0.0494 -0.0010 96  ARG A O   
424 C CB  . ARG A 65  ? 0.4440 0.6670 0.4762 0.1716  -0.0770 -0.0025 96  ARG A CB  
425 C CG  . ARG A 65  ? 0.5623 0.7649 0.6026 0.1942  -0.0807 0.0030  96  ARG A CG  
426 C CD  . ARG A 65  ? 0.5791 0.8240 0.6621 0.2008  -0.0855 -0.0216 96  ARG A CD  
427 N NE  . ARG A 65  ? 0.6385 0.9323 0.7316 0.2234  -0.1055 -0.0300 96  ARG A NE  
428 C CZ  . ARG A 65  ? 0.6314 0.9765 0.7397 0.2126  -0.1125 -0.0478 96  ARG A CZ  
429 N NH1 . ARG A 65  ? 0.6183 0.9649 0.7325 0.1813  -0.1005 -0.0568 96  ARG A NH1 
430 N NH2 . ARG A 65  ? 0.6431 1.0369 0.7618 0.2333  -0.1327 -0.0573 96  ARG A NH2 
431 N N   . VAL A 66  ? 0.3574 0.5883 0.3323 0.1466  -0.0689 0.0065  97  VAL A N   
432 C CA  . VAL A 66  ? 0.3366 0.5893 0.3164 0.1291  -0.0643 -0.0104 97  VAL A CA  
433 C C   . VAL A 66  ? 0.2950 0.5955 0.2862 0.1363  -0.0811 -0.0330 97  VAL A C   
434 O O   . VAL A 66  ? 0.3180 0.6385 0.2860 0.1556  -0.0954 -0.0286 97  VAL A O   
435 C CB  . VAL A 66  ? 0.3947 0.6371 0.3367 0.1257  -0.0550 0.0030  97  VAL A CB  
436 C CG1 . VAL A 66  ? 0.3622 0.6317 0.3117 0.1135  -0.0525 -0.0199 97  VAL A CG1 
437 C CG2 . VAL A 66  ? 0.4018 0.6008 0.3383 0.1134  -0.0368 0.0230  97  VAL A CG2 
438 N N   . THR A 67  ? 0.2451 0.5647 0.2722 0.1206  -0.0807 -0.0568 98  THR A N   
439 C CA  . THR A 67  ? 0.2447 0.6110 0.2885 0.1231  -0.0964 -0.0818 98  THR A CA  
440 C C   . THR A 67  ? 0.2561 0.6316 0.3119 0.1043  -0.0926 -0.1045 98  THR A C   
441 O O   . THR A 67  ? 0.2193 0.5738 0.2973 0.0862  -0.0808 -0.1078 98  THR A O   
442 C CB  . THR A 67  ? 0.2242 0.6114 0.3080 0.1223  -0.1017 -0.0929 98  THR A CB  
443 O OG1 . THR A 67  ? 0.2477 0.6238 0.3229 0.1435  -0.1051 -0.0744 98  THR A OG1 
444 C CG2 . THR A 67  ? 0.2286 0.6729 0.3334 0.1242  -0.1199 -0.1210 98  THR A CG2 
445 N N   . GLN A 68  ? 0.2674 0.6741 0.3085 0.1097  -0.1038 -0.1214 99  GLN A N   
446 C CA  . GLN A 68  ? 0.2579 0.6713 0.3120 0.0935  -0.1009 -0.1480 99  GLN A CA  
447 C C   . GLN A 68  ? 0.2606 0.6925 0.3625 0.0778  -0.1069 -0.1724 99  GLN A C   
448 O O   . GLN A 68  ? 0.2385 0.7090 0.3530 0.0842  -0.1219 -0.1834 99  GLN A O   
449 C CB  . GLN A 68  ? 0.3073 0.7532 0.3285 0.1041  -0.1116 -0.1630 99  GLN A CB  
450 C CG  . GLN A 68  ? 0.3360 0.7914 0.3739 0.0892  -0.1104 -0.1983 99  GLN A CG  
451 C CD  . GLN A 68  ? 0.4110 0.8986 0.4109 0.0993  -0.1179 -0.2154 99  GLN A CD  
452 O OE1 . GLN A 68  ? 0.4261 0.9516 0.4040 0.1136  -0.1353 -0.2175 99  GLN A OE1 
453 N NE2 . GLN A 68  ? 0.4410 0.9170 0.4325 0.0934  -0.1050 -0.2286 99  GLN A NE2 
454 N N   . LEU A 69  ? 0.2331 0.6398 0.3624 0.0573  -0.0958 -0.1805 100 LEU A N   
455 C CA  . LEU A 69  ? 0.2177 0.6384 0.3915 0.0381  -0.0993 -0.2013 100 LEU A CA  
456 C C   . LEU A 69  ? 0.2306 0.6807 0.4131 0.0324  -0.1112 -0.2371 100 LEU A C   
457 O O   . LEU A 69  ? 0.2926 0.7453 0.4462 0.0419  -0.1134 -0.2458 100 LEU A O   
458 C CB  . LEU A 69  ? 0.2192 0.5984 0.4164 0.0184  -0.0843 -0.1930 100 LEU A CB  
459 C CG  . LEU A 69  ? 0.2214 0.5781 0.4097 0.0231  -0.0740 -0.1615 100 LEU A CG  
460 C CD1 . LEU A 69  ? 0.2592 0.5803 0.4659 0.0050  -0.0616 -0.1516 100 LEU A CD1 
461 C CD2 . LEU A 69  ? 0.2223 0.6098 0.4208 0.0297  -0.0798 -0.1582 100 LEU A CD2 
462 N N   . PRO A 70  ? 0.2412 0.7167 0.4639 0.0152  -0.1182 -0.2602 101 PRO A N   
463 C CA  . PRO A 70  ? 0.2629 0.7721 0.4964 0.0084  -0.1320 -0.2991 101 PRO A CA  
464 C C   . PRO A 70  ? 0.2957 0.7722 0.5281 -0.0013 -0.1255 -0.3193 101 PRO A C   
465 O O   . PRO A 70  ? 0.3029 0.8054 0.5252 0.0018  -0.1363 -0.3499 101 PRO A O   
466 C CB  . PRO A 70  ? 0.2628 0.7994 0.5479 -0.0141 -0.1360 -0.3162 101 PRO A CB  
467 C CG  . PRO A 70  ? 0.2456 0.7869 0.5352 -0.0065 -0.1301 -0.2859 101 PRO A CG  
468 C CD  . PRO A 70  ? 0.2385 0.7231 0.4965 0.0025  -0.1143 -0.2525 101 PRO A CD  
469 N N   . ASN A 71  ? 0.3372 0.7596 0.5787 -0.0106 -0.1091 -0.3038 102 ASN A N   
470 C CA  . ASN A 71  ? 0.4198 0.8114 0.6635 -0.0149 -0.1040 -0.3251 102 ASN A CA  
471 C C   . ASN A 71  ? 0.4404 0.8418 0.6390 0.0079  -0.1031 -0.3263 102 ASN A C   
472 O O   . ASN A 71  ? 0.4572 0.8511 0.6534 0.0091  -0.1012 -0.3530 102 ASN A O   
473 C CB  . ASN A 71  ? 0.4306 0.7629 0.6974 -0.0275 -0.0895 -0.3084 102 ASN A CB  
474 C CG  . ASN A 71  ? 0.3873 0.6972 0.6309 -0.0143 -0.0783 -0.2689 102 ASN A CG  
475 O OD1 . ASN A 71  ? 0.3809 0.7089 0.5894 0.0042  -0.0783 -0.2568 102 ASN A OD1 
476 N ND2 . ASN A 71  ? 0.4098 0.6802 0.6720 -0.0254 -0.0691 -0.2475 102 ASN A ND2 
477 N N   . GLY A 72  ? 0.4325 0.8506 0.5957 0.0255  -0.1033 -0.2978 103 GLY A N   
478 C CA  . GLY A 72  ? 0.4445 0.8788 0.5604 0.0448  -0.1019 -0.2954 103 GLY A CA  
479 C C   . GLY A 72  ? 0.4147 0.8123 0.5182 0.0496  -0.0833 -0.2736 103 GLY A C   
480 O O   . GLY A 72  ? 0.4119 0.8202 0.4758 0.0632  -0.0775 -0.2609 103 GLY A O   
481 N N   . ARG A 73  ? 0.3803 0.7373 0.5174 0.0379  -0.0740 -0.2672 104 ARG A N   
482 C CA  A ARG A 73  ? 0.3779 0.7056 0.5110 0.0426  -0.0587 -0.2505 104 ARG A CA  
483 C CA  B ARG A 73  ? 0.3709 0.6997 0.5025 0.0431  -0.0586 -0.2500 104 ARG A CA  
484 C C   . ARG A 73  ? 0.3378 0.6439 0.4707 0.0412  -0.0519 -0.2112 104 ARG A C   
485 O O   . ARG A 73  ? 0.3355 0.6298 0.4565 0.0468  -0.0408 -0.1931 104 ARG A O   
486 C CB  A ARG A 73  ? 0.4003 0.6975 0.5690 0.0351  -0.0549 -0.2721 104 ARG A CB  
487 C CB  B ARG A 73  ? 0.3814 0.6819 0.5452 0.0373  -0.0541 -0.2729 104 ARG A CB  
488 C CG  A ARG A 73  ? 0.4614 0.7749 0.6368 0.0338  -0.0621 -0.3176 104 ARG A CG  
489 C CG  B ARG A 73  ? 0.3878 0.6537 0.5914 0.0209  -0.0564 -0.2675 104 ARG A CG  
490 C CD  A ARG A 73  ? 0.4884 0.7608 0.7026 0.0279  -0.0584 -0.3376 104 ARG A CD  
491 C CD  B ARG A 73  ? 0.4070 0.6389 0.6418 0.0172  -0.0542 -0.2905 104 ARG A CD  
492 N NE  A ARG A 73  ? 0.4784 0.7138 0.7257 0.0112  -0.0601 -0.3192 104 ARG A NE  
493 N NE  B ARG A 73  ? 0.4148 0.6093 0.6821 0.0000  -0.0554 -0.2771 104 ARG A NE  
494 C CZ  A ARG A 73  ? 0.4822 0.7088 0.7580 -0.0075 -0.0680 -0.3376 104 ARG A CZ  
495 C CZ  B ARG A 73  ? 0.4170 0.5897 0.6858 -0.0016 -0.0500 -0.2410 104 ARG A CZ  
496 N NH1 A ARG A 73  ? 0.4997 0.7524 0.7778 -0.0114 -0.0770 -0.3785 104 ARG A NH1 
497 N NH1 B ARG A 73  ? 0.3737 0.5577 0.6183 0.0117  -0.0439 -0.2189 104 ARG A NH1 
498 N NH2 A ARG A 73  ? 0.4661 0.6602 0.7674 -0.0240 -0.0662 -0.3157 104 ARG A NH2 
499 N NH2 B ARG A 73  ? 0.4254 0.5667 0.7182 -0.0183 -0.0502 -0.2273 104 ARG A NH2 
500 N N   . ASP A 74  ? 0.2986 0.6034 0.4473 0.0327  -0.0581 -0.2015 105 ASP A N   
501 C CA  . ASP A 74  ? 0.3051 0.5935 0.4526 0.0314  -0.0525 -0.1691 105 ASP A CA  
502 C C   . ASP A 74  ? 0.2773 0.5878 0.3984 0.0429  -0.0576 -0.1543 105 ASP A C   
503 O O   . ASP A 74  ? 0.2925 0.6337 0.4100 0.0476  -0.0696 -0.1679 105 ASP A O   
504 C CB  . ASP A 74  ? 0.2949 0.5654 0.4762 0.0148  -0.0526 -0.1659 105 ASP A CB  
505 C CG  . ASP A 74  ? 0.3809 0.6196 0.5862 0.0057  -0.0484 -0.1742 105 ASP A CG  
506 O OD1 . ASP A 74  ? 0.4303 0.6560 0.6289 0.0146  -0.0426 -0.1731 105 ASP A OD1 
507 O OD2 . ASP A 74  ? 0.3936 0.6199 0.6266 -0.0100 -0.0506 -0.1812 105 ASP A OD2 
508 N N   . PHE A 75  ? 0.2435 0.5373 0.3484 0.0479  -0.0495 -0.1273 106 PHE A N   
509 C CA  . PHE A 75  ? 0.2945 0.5956 0.3768 0.0598  -0.0530 -0.1090 106 PHE A CA  
510 C C   . PHE A 75  ? 0.2557 0.5343 0.3503 0.0543  -0.0467 -0.0903 106 PHE A C   
511 O O   . PHE A 75  ? 0.2622 0.5177 0.3628 0.0460  -0.0369 -0.0816 106 PHE A O   
512 C CB  . PHE A 75  ? 0.2863 0.5839 0.3302 0.0703  -0.0466 -0.0947 106 PHE A CB  
513 C CG  . PHE A 75  ? 0.3187 0.6412 0.3443 0.0755  -0.0498 -0.1137 106 PHE A CG  
514 C CD1 . PHE A 75  ? 0.3058 0.6271 0.3461 0.0679  -0.0435 -0.1342 106 PHE A CD1 
515 C CD2 . PHE A 75  ? 0.3590 0.7086 0.3539 0.0895  -0.0610 -0.1140 106 PHE A CD2 
516 C CE1 . PHE A 75  ? 0.3431 0.6904 0.3670 0.0730  -0.0460 -0.1578 106 PHE A CE1 
517 C CE2 . PHE A 75  ? 0.3691 0.7470 0.3427 0.0939  -0.0645 -0.1346 106 PHE A CE2 
518 C CZ  . PHE A 75  ? 0.3724 0.7499 0.3611 0.0849  -0.0562 -0.1586 106 PHE A CZ  
519 N N   . HIS A 76  ? 0.2449 0.5335 0.3426 0.0608  -0.0528 -0.0854 107 HIS A N   
520 C CA  . HIS A 76  ? 0.2501 0.5190 0.3535 0.0584  -0.0459 -0.0696 107 HIS A CA  
521 C C   . HIS A 76  ? 0.2420 0.4923 0.3170 0.0714  -0.0429 -0.0498 107 HIS A C   
522 O O   . HIS A 76  ? 0.2655 0.5260 0.3221 0.0879  -0.0512 -0.0457 107 HIS A O   
523 C CB  . HIS A 76  ? 0.2673 0.5581 0.3940 0.0589  -0.0515 -0.0775 107 HIS A CB  
524 C CG  . HIS A 76  ? 0.2803 0.5768 0.4371 0.0387  -0.0479 -0.0885 107 HIS A CG  
525 N ND1 . HIS A 76  ? 0.2892 0.6140 0.4723 0.0327  -0.0506 -0.0999 107 HIS A ND1 
526 C CD2 . HIS A 76  ? 0.2840 0.5610 0.4490 0.0230  -0.0417 -0.0887 107 HIS A CD2 
527 C CE1 . HIS A 76  ? 0.3202 0.6387 0.5235 0.0112  -0.0445 -0.1041 107 HIS A CE1 
528 N NE2 . HIS A 76  ? 0.2974 0.5844 0.4895 0.0068  -0.0404 -0.0968 107 HIS A NE2 
529 N N   . MET A 77  ? 0.2299 0.4522 0.3020 0.0635  -0.0319 -0.0371 108 MET A N   
530 C CA  . MET A 77  ? 0.2406 0.4379 0.2912 0.0707  -0.0271 -0.0188 108 MET A CA  
531 C C   . MET A 77  ? 0.2453 0.4308 0.3105 0.0687  -0.0249 -0.0179 108 MET A C   
532 O O   . MET A 77  ? 0.2705 0.4486 0.3483 0.0542  -0.0182 -0.0196 108 MET A O   
533 C CB  . MET A 77  ? 0.2416 0.4217 0.2830 0.0592  -0.0153 -0.0102 108 MET A CB  
534 C CG  . MET A 77  ? 0.3696 0.5563 0.3855 0.0645  -0.0132 -0.0053 108 MET A CG  
535 S SD  . MET A 77  ? 0.4532 0.6726 0.4788 0.0636  -0.0187 -0.0286 108 MET A SD  
536 C CE  . MET A 77  ? 0.4350 0.6606 0.4247 0.0667  -0.0090 -0.0206 108 MET A CE  
537 N N   . SER A 78  ? 0.2766 0.4629 0.3403 0.0849  -0.0311 -0.0165 109 SER A N   
538 C CA  . SER A 78  ? 0.2500 0.4324 0.3305 0.0851  -0.0284 -0.0219 109 SER A CA  
539 C C   . SER A 78  ? 0.2885 0.4357 0.3548 0.0968  -0.0259 -0.0104 109 SER A C   
540 O O   . SER A 78  ? 0.3407 0.4779 0.3899 0.1153  -0.0327 0.0005  109 SER A O   
541 C CB  . SER A 78  ? 0.2398 0.4592 0.3408 0.0967  -0.0377 -0.0362 109 SER A CB  
542 O OG  . SER A 78  ? 0.2528 0.5008 0.3721 0.0814  -0.0384 -0.0487 109 SER A OG  
543 N N   . VAL A 79  ? 0.2957 0.4240 0.3688 0.0869  -0.0173 -0.0135 110 VAL A N   
544 C CA  . VAL A 79  ? 0.3360 0.4300 0.4040 0.0976  -0.0148 -0.0103 110 VAL A CA  
545 C C   . VAL A 79  ? 0.3613 0.4766 0.4500 0.1120  -0.0183 -0.0271 110 VAL A C   
546 O O   . VAL A 79  ? 0.3287 0.4722 0.4347 0.1000  -0.0138 -0.0420 110 VAL A O   
547 C CB  . VAL A 79  ? 0.3529 0.4217 0.4202 0.0771  -0.0040 -0.0119 110 VAL A CB  
548 C CG1 . VAL A 79  ? 0.4358 0.4598 0.4971 0.0857  -0.0008 -0.0097 110 VAL A CG1 
549 C CG2 . VAL A 79  ? 0.3884 0.4515 0.4450 0.0601  0.0005  -0.0003 110 VAL A CG2 
550 N N   . VAL A 80  ? 0.3978 0.5007 0.4852 0.1382  -0.0255 -0.0244 111 VAL A N   
551 C CA  . VAL A 80  ? 0.3966 0.5261 0.5087 0.1550  -0.0284 -0.0432 111 VAL A CA  
552 C C   . VAL A 80  ? 0.4175 0.5152 0.5335 0.1553  -0.0191 -0.0536 111 VAL A C   
553 O O   . VAL A 80  ? 0.4332 0.4791 0.5350 0.1627  -0.0184 -0.0430 111 VAL A O   
554 C CB  . VAL A 80  ? 0.4438 0.5815 0.5574 0.1877  -0.0433 -0.0379 111 VAL A CB  
555 C CG1 . VAL A 80  ? 0.4350 0.6015 0.5794 0.2085  -0.0455 -0.0595 111 VAL A CG1 
556 C CG2 . VAL A 80  ? 0.4447 0.6219 0.5549 0.1858  -0.0537 -0.0335 111 VAL A CG2 
557 N N   . ARG A 81  ? 0.3891 0.5172 0.5232 0.1457  -0.0111 -0.0750 112 ARG A N   
558 C CA  . ARG A 81  ? 0.4587 0.5631 0.5959 0.1458  -0.0020 -0.0912 112 ARG A CA  
559 C C   . ARG A 81  ? 0.4271 0.4798 0.5437 0.1269  0.0036  -0.0818 112 ARG A C   
560 O O   . ARG A 81  ? 0.4638 0.4649 0.5731 0.1368  0.0034  -0.0773 112 ARG A O   
561 C CB  . ARG A 81  ? 0.5200 0.6154 0.6730 0.1803  -0.0066 -0.1033 112 ARG A CB  
562 C CG  . ARG A 81  ? 0.5751 0.7372 0.7584 0.1930  -0.0068 -0.1247 112 ARG A CG  
563 C CD  . ARG A 81  ? 0.6696 0.8273 0.8719 0.2340  -0.0159 -0.1331 112 ARG A CD  
564 N NE  . ARG A 81  ? 0.7763 0.8799 0.9580 0.2515  -0.0288 -0.1057 112 ARG A NE  
565 C CZ  . ARG A 81  ? 0.8171 0.9365 0.9995 0.2746  -0.0453 -0.0909 112 ARG A CZ  
566 N NH1 . ARG A 81  ? 0.7971 0.9875 1.0065 0.2831  -0.0519 -0.1045 112 ARG A NH1 
567 N NH2 . ARG A 81  ? 0.8675 0.9342 1.0231 0.2879  -0.0552 -0.0623 112 ARG A NH2 
568 N N   . ALA A 82  ? 0.3595 0.4281 0.4694 0.0991  0.0085  -0.0795 113 ALA A N   
569 C CA  . ALA A 82  ? 0.3678 0.4035 0.4631 0.0775  0.0126  -0.0710 113 ALA A CA  
570 C C   . ALA A 82  ? 0.4148 0.4177 0.5104 0.0747  0.0186  -0.0883 113 ALA A C   
571 O O   . ALA A 82  ? 0.4343 0.4554 0.5393 0.0805  0.0223  -0.1115 113 ALA A O   
572 C CB  . ALA A 82  ? 0.3073 0.3766 0.4010 0.0531  0.0146  -0.0693 113 ALA A CB  
573 N N   . ARG A 83  ? 0.4418 0.3984 0.5280 0.0640  0.0208  -0.0789 114 ARG A N   
574 C CA  . ARG A 83  ? 0.4869 0.4047 0.5746 0.0575  0.0261  -0.0965 114 ARG A CA  
575 C C   . ARG A 83  ? 0.4872 0.4101 0.5707 0.0262  0.0294  -0.0982 114 ARG A C   
576 O O   . ARG A 83  ? 0.4128 0.3557 0.4920 0.0132  0.0278  -0.0804 114 ARG A O   
577 C CB  . ARG A 83  ? 0.5478 0.4009 0.6308 0.0692  0.0260  -0.0823 114 ARG A CB  
578 C CG  . ARG A 83  ? 0.6187 0.4636 0.7074 0.1051  0.0200  -0.0811 114 ARG A CG  
579 C CD  . ARG A 83  ? 0.7010 0.4898 0.7767 0.1166  0.0170  -0.0525 114 ARG A CD  
580 N NE  . ARG A 83  ? 0.7627 0.5455 0.8438 0.1555  0.0076  -0.0493 114 ARG A NE  
581 C CZ  . ARG A 83  ? 0.8503 0.5835 0.9177 0.1744  0.0019  -0.0224 114 ARG A CZ  
582 N NH1 . ARG A 83  ? 0.8984 0.5851 0.9453 0.1537  0.0080  0.0028  114 ARG A NH1 
583 N NH2 . ARG A 83  ? 0.8942 0.6273 0.9685 0.2135  -0.0097 -0.0197 114 ARG A NH2 
584 N N   . ARG A 84  ? 0.5148 0.4210 0.6013 0.0147  0.0332  -0.1221 115 ARG A N   
585 C CA  . ARG A 84  ? 0.5479 0.4665 0.6331 -0.0149 0.0339  -0.1275 115 ARG A CA  
586 C C   . ARG A 84  ? 0.5389 0.4340 0.6237 -0.0308 0.0356  -0.1041 115 ARG A C   
587 O O   . ARG A 84  ? 0.5087 0.4355 0.5950 -0.0490 0.0339  -0.0977 115 ARG A O   
588 C CB  . ARG A 84  ? 0.5983 0.5020 0.6868 -0.0250 0.0366  -0.1609 115 ARG A CB  
589 C CG  . ARG A 84  ? 0.6209 0.5808 0.7035 -0.0301 0.0347  -0.1817 115 ARG A CG  
590 C CD  . ARG A 84  ? 0.6914 0.6411 0.7757 -0.0194 0.0392  -0.2162 115 ARG A CD  
591 N NE  . ARG A 84  ? 0.7679 0.7067 0.8515 -0.0409 0.0394  -0.2446 115 ARG A NE  
592 C CZ  . ARG A 84  ? 0.8268 0.7473 0.9130 -0.0349 0.0438  -0.2812 115 ARG A CZ  
593 N NH1 . ARG A 84  ? 0.8499 0.7618 0.9419 -0.0058 0.0487  -0.2910 115 ARG A NH1 
594 N NH2 . ARG A 84  ? 0.8650 0.7784 0.9508 -0.0569 0.0429  -0.3105 115 ARG A NH2 
595 N N   . ASN A 85  ? 0.5740 0.4150 0.6568 -0.0235 0.0396  -0.0904 116 ASN A N   
596 C CA  . ASN A 85  ? 0.6032 0.4252 0.6834 -0.0412 0.0446  -0.0671 116 ASN A CA  
597 C C   . ASN A 85  ? 0.5562 0.4012 0.6263 -0.0300 0.0427  -0.0388 116 ASN A C   
598 O O   . ASN A 85  ? 0.5835 0.4106 0.6467 -0.0387 0.0486  -0.0167 116 ASN A O   
599 C CB  . ASN A 85  ? 0.7224 0.4717 0.8019 -0.0456 0.0518  -0.0617 116 ASN A CB  
600 C CG  . ASN A 85  ? 0.7863 0.4952 0.8542 -0.0137 0.0496  -0.0438 116 ASN A CG  
601 O OD1 . ASN A 85  ? 0.7927 0.5334 0.8546 0.0102  0.0425  -0.0357 116 ASN A OD1 
602 N ND2 . ASN A 85  ? 0.8646 0.5028 0.9305 -0.0134 0.0547  -0.0372 116 ASN A ND2 
603 N N   . ASP A 86  ? 0.4875 0.3737 0.5565 -0.0126 0.0355  -0.0411 117 ASP A N   
604 C CA  . ASP A 86  ? 0.4374 0.3563 0.5005 -0.0080 0.0328  -0.0219 117 ASP A CA  
605 C C   . ASP A 86  ? 0.4071 0.3675 0.4788 -0.0285 0.0325  -0.0253 117 ASP A C   
606 O O   . ASP A 86  ? 0.3629 0.3466 0.4329 -0.0284 0.0319  -0.0122 117 ASP A O   
607 C CB  . ASP A 86  ? 0.4267 0.3729 0.4893 0.0160  0.0251  -0.0239 117 ASP A CB  
608 C CG  . ASP A 86  ? 0.4746 0.3893 0.5301 0.0419  0.0221  -0.0158 117 ASP A CG  
609 O OD1 . ASP A 86  ? 0.5416 0.4181 0.5836 0.0435  0.0249  0.0041  117 ASP A OD1 
610 O OD2 . ASP A 86  ? 0.4838 0.4138 0.5470 0.0615  0.0169  -0.0280 117 ASP A OD2 
611 N N   . SER A 87  ? 0.3853 0.3572 0.4662 -0.0438 0.0316  -0.0442 118 SER A N   
612 C CA  . SER A 87  ? 0.3610 0.3742 0.4509 -0.0598 0.0281  -0.0464 118 SER A CA  
613 C C   . SER A 87  ? 0.3885 0.4007 0.4844 -0.0734 0.0342  -0.0323 118 SER A C   
614 O O   . SER A 87  ? 0.4104 0.3877 0.5057 -0.0836 0.0427  -0.0280 118 SER A O   
615 C CB  . SER A 87  ? 0.3922 0.4165 0.4878 -0.0750 0.0250  -0.0688 118 SER A CB  
616 O OG  . SER A 87  ? 0.3705 0.4001 0.4587 -0.0639 0.0223  -0.0842 118 SER A OG  
617 N N   . GLY A 88  ? 0.3344 0.3834 0.4370 -0.0739 0.0312  -0.0252 119 GLY A N   
618 C CA  . GLY A 88  ? 0.3653 0.4233 0.4774 -0.0871 0.0387  -0.0160 119 GLY A CA  
619 C C   . GLY A 88  ? 0.3152 0.4054 0.4299 -0.0756 0.0355  -0.0081 119 GLY A C   
620 O O   . GLY A 88  ? 0.2844 0.3904 0.3984 -0.0642 0.0262  -0.0115 119 GLY A O   
621 N N   . THR A 89  ? 0.3079 0.4077 0.4260 -0.0799 0.0443  0.0011  120 THR A N   
622 C CA  . THR A 89  ? 0.3024 0.4323 0.4251 -0.0683 0.0420  0.0039  120 THR A CA  
623 C C   . THR A 89  ? 0.2990 0.4158 0.4009 -0.0588 0.0503  0.0163  120 THR A C   
624 O O   . THR A 89  ? 0.3558 0.4453 0.4428 -0.0651 0.0601  0.0271  120 THR A O   
625 C CB  . THR A 89  ? 0.3023 0.4704 0.4514 -0.0786 0.0436  -0.0016 120 THR A CB  
626 O OG1 . THR A 89  ? 0.3714 0.5369 0.5236 -0.0955 0.0591  0.0032  120 THR A OG1 
627 C CG2 . THR A 89  ? 0.3151 0.4999 0.4817 -0.0868 0.0321  -0.0130 120 THR A CG2 
628 N N   . TYR A 90  ? 0.2464 0.3814 0.3459 -0.0437 0.0455  0.0150  121 TYR A N   
629 C CA  . TYR A 90  ? 0.2731 0.3994 0.3489 -0.0307 0.0478  0.0231  121 TYR A CA  
630 C C   . TYR A 90  ? 0.2934 0.4521 0.3765 -0.0239 0.0484  0.0162  121 TYR A C   
631 O O   . TYR A 90  ? 0.2444 0.4237 0.3515 -0.0235 0.0424  0.0055  121 TYR A O   
632 C CB  . TYR A 90  ? 0.2902 0.4041 0.3580 -0.0159 0.0356  0.0202  121 TYR A CB  
633 C CG  . TYR A 90  ? 0.3183 0.3992 0.3780 -0.0165 0.0349  0.0238  121 TYR A CG  
634 C CD1 . TYR A 90  ? 0.2898 0.3674 0.3634 -0.0247 0.0312  0.0138  121 TYR A CD1 
635 C CD2 . TYR A 90  ? 0.3628 0.4162 0.3998 -0.0070 0.0370  0.0364  121 TYR A CD2 
636 C CE1 . TYR A 90  ? 0.3331 0.3803 0.4009 -0.0239 0.0314  0.0121  121 TYR A CE1 
637 C CE2 . TYR A 90  ? 0.3944 0.4129 0.4271 -0.0040 0.0359  0.0379  121 TYR A CE2 
638 C CZ  . TYR A 90  ? 0.3812 0.3970 0.4307 -0.0127 0.0339  0.0236  121 TYR A CZ  
639 O OH  . TYR A 90  ? 0.4485 0.4300 0.4952 -0.0084 0.0336  0.0204  121 TYR A OH  
640 N N   . LEU A 91  ? 0.2537 0.4169 0.3153 -0.0169 0.0547  0.0213  122 LEU A N   
641 C CA  . LEU A 91  ? 0.2765 0.4692 0.3447 -0.0071 0.0531  0.0083  122 LEU A CA  
642 C C   . LEU A 91  ? 0.2928 0.4862 0.3317 0.0060  0.0507  0.0097  122 LEU A C   
643 O O   . LEU A 91  ? 0.2938 0.4662 0.3059 0.0090  0.0507  0.0246  122 LEU A O   
644 C CB  . LEU A 91  ? 0.2955 0.5181 0.3805 -0.0152 0.0661  0.0025  122 LEU A CB  
645 C CG  . LEU A 91  ? 0.3384 0.5674 0.4048 -0.0267 0.0856  0.0144  122 LEU A CG  
646 C CD1 . LEU A 91  ? 0.3779 0.6169 0.4098 -0.0159 0.0910  0.0163  122 LEU A CD1 
647 C CD2 . LEU A 91  ? 0.3111 0.5760 0.4093 -0.0377 0.0973  0.0050  122 LEU A CD2 
648 N N   . CYS A 92  ? 0.2857 0.5021 0.3304 0.0154  0.0467  -0.0069 123 CYS A N   
649 C CA  . CYS A 92  ? 0.3110 0.5371 0.3263 0.0267  0.0446  -0.0093 123 CYS A CA  
650 C C   . CYS A 92  ? 0.3379 0.5943 0.3466 0.0262  0.0582  -0.0186 123 CYS A C   
651 O O   . CYS A 92  ? 0.3337 0.6073 0.3717 0.0232  0.0636  -0.0324 123 CYS A O   
652 C CB  . CYS A 92  ? 0.3402 0.5686 0.3625 0.0376  0.0275  -0.0244 123 CYS A CB  
653 S SG  . CYS A 92  ? 0.3866 0.6308 0.4440 0.0394  0.0227  -0.0520 123 CYS A SG  
654 N N   . GLY A 93  ? 0.3709 0.6355 0.3402 0.0297  0.0646  -0.0095 124 GLY A N   
655 C CA  . GLY A 93  ? 0.3940 0.6924 0.3506 0.0282  0.0811  -0.0179 124 GLY A CA  
656 C C   . GLY A 93  ? 0.4381 0.7548 0.3588 0.0419  0.0741  -0.0272 124 GLY A C   
657 O O   . GLY A 93  ? 0.4593 0.7608 0.3504 0.0491  0.0629  -0.0120 124 GLY A O   
658 N N   . ALA A 94  ? 0.4389 0.7900 0.3644 0.0473  0.0787  -0.0550 125 ALA A N   
659 C CA  . ALA A 94  ? 0.4620 0.8376 0.3516 0.0589  0.0725  -0.0691 125 ALA A CA  
660 C C   . ALA A 94  ? 0.4965 0.9043 0.3479 0.0552  0.0946  -0.0640 125 ALA A C   
661 O O   . ALA A 94  ? 0.4643 0.8909 0.3358 0.0470  0.1141  -0.0712 125 ALA A O   
662 C CB  . ALA A 94  ? 0.4580 0.8480 0.3783 0.0673  0.0617  -0.1088 125 ALA A CB  
663 N N   . ILE A 95  ? 0.5535 0.9713 0.3497 0.0616  0.0914  -0.0509 126 ILE A N   
664 C CA  . ILE A 95  ? 0.6243 1.0740 0.3732 0.0574  0.1128  -0.0419 126 ILE A CA  
665 C C   . ILE A 95  ? 0.6791 1.1709 0.4005 0.0716  0.1043  -0.0748 126 ILE A C   
666 O O   . ILE A 95  ? 0.7015 1.1900 0.4075 0.0839  0.0801  -0.0795 126 ILE A O   
667 C CB  . ILE A 95  ? 0.6756 1.1000 0.3710 0.0536  0.1158  0.0065  126 ILE A CB  
668 C CG1 . ILE A 95  ? 0.6635 1.0352 0.3869 0.0433  0.1146  0.0351  126 ILE A CG1 
669 C CG2 . ILE A 95  ? 0.6943 1.1469 0.3457 0.0420  0.1447  0.0226  126 ILE A CG2 
670 C CD1 . ILE A 95  ? 0.6922 1.0593 0.4205 0.0205  0.1433  0.0554  126 ILE A CD1 
671 N N   . SER A 96  ? 0.7034 1.2383 0.4216 0.0699  0.1238  -0.1007 127 SER A N   
672 C CA  . SER A 96  ? 0.8058 1.3844 0.4938 0.0821  0.1183  -0.1359 127 SER A CA  
673 C C   . SER A 96  ? 0.8985 1.5163 0.5215 0.0775  0.1418  -0.1203 127 SER A C   
674 O O   . SER A 96  ? 0.8621 1.4851 0.4856 0.0628  0.1695  -0.1004 127 SER A O   
675 C CB  . SER A 96  ? 0.8007 1.3991 0.5412 0.0867  0.1218  -0.1878 127 SER A CB  
676 O OG  . SER A 96  ? 0.8182 1.4271 0.5891 0.0772  0.1484  -0.1861 127 SER A OG  
677 N N   . LEU A 97  ? 1.0157 1.6645 0.5825 0.0888  0.1306  -0.1298 128 LEU A N   
678 C CA  . LEU A 97  ? 1.1383 1.8301 0.6336 0.0858  0.1515  -0.1167 128 LEU A CA  
679 C C   . LEU A 97  ? 1.2013 1.9545 0.6930 0.0926  0.1613  -0.1742 128 LEU A C   
680 O O   . LEU A 97  ? 1.2345 2.0296 0.7002 0.0849  0.1922  -0.1772 128 LEU A O   
681 C CB  . LEU A 97  ? 1.1997 1.8870 0.6233 0.0957  0.1313  -0.0822 128 LEU A CB  
682 C CG  . LEU A 97  ? 1.2014 1.8271 0.6310 0.0979  0.1113  -0.0358 128 LEU A CG  
683 C CD1 . LEU A 97  ? 1.2732 1.9065 0.6307 0.1139  0.0891  -0.0088 128 LEU A CD1 
684 C CD2 . LEU A 97  ? 1.1972 1.7828 0.6362 0.0785  0.1365  0.0090  128 LEU A CD2 
685 N N   . ALA A 98  ? 1.2226 1.9812 0.7419 0.1059  0.1361  -0.2212 129 ALA A N   
686 C CA  . ALA A 98  ? 1.2675 2.0771 0.7909 0.1141  0.1416  -0.2842 129 ALA A CA  
687 C C   . ALA A 98  ? 1.2788 2.1124 0.8350 0.1074  0.1772  -0.3021 129 ALA A C   
688 O O   . ALA A 98  ? 1.2417 2.0422 0.8538 0.0995  0.1862  -0.2854 129 ALA A O   
689 C CB  . ALA A 98  ? 1.2212 2.0120 0.7990 0.1235  0.1125  -0.3309 129 ALA A CB  
690 N N   . PRO A 99  ? 1.3377 2.2341 0.8601 0.1114  0.1972  -0.3383 130 PRO A N   
691 C CA  . PRO A 99  ? 1.3509 2.2863 0.8889 0.1045  0.2365  -0.3485 130 PRO A CA  
692 C C   . PRO A 99  ? 1.2773 2.1794 0.9020 0.0993  0.2456  -0.3442 130 PRO A C   
693 O O   . PRO A 99  ? 1.2587 2.1546 0.9481 0.1113  0.2389  -0.3898 130 PRO A O   
694 C CB  . PRO A 99  ? 1.3909 2.3839 0.9229 0.1188  0.2424  -0.4191 130 PRO A CB  
695 C CG  . PRO A 99  ? 1.4341 2.4393 0.8977 0.1258  0.2157  -0.4241 130 PRO A CG  
696 C CD  . PRO A 99  ? 1.3919 2.3321 0.8631 0.1233  0.1829  -0.3779 130 PRO A CD  
697 N N   . LYS A 100 ? 1.2294 2.1093 0.8547 0.0817  0.2593  -0.2900 131 LYS A N   
698 C CA  . LYS A 100 ? 1.2361 2.1104 0.7863 0.0679  0.2655  -0.2326 131 LYS A CA  
699 C C   . LYS A 100 ? 1.1732 1.9947 0.7498 0.0507  0.2681  -0.1792 131 LYS A C   
700 O O   . LYS A 100 ? 1.1893 2.0271 0.7829 0.0333  0.2982  -0.1634 131 LYS A O   
701 C CB  . LYS A 100 ? 1.2954 2.2369 0.7857 0.0587  0.3022  -0.2311 131 LYS A CB  
702 C CG  . LYS A 100 ? 1.3494 2.2842 0.7488 0.0477  0.3054  -0.1722 131 LYS A CG  
703 N N   . LEU A 101 ? 1.0916 1.8536 0.6746 0.0549  0.2370  -0.1552 132 LEU A N   
704 C CA  . LEU A 101 ? 1.0390 1.7471 0.6359 0.0396  0.2368  -0.1040 132 LEU A CA  
705 C C   . LEU A 101 ? 0.9540 1.6492 0.6301 0.0296  0.2469  -0.1109 132 LEU A C   
706 O O   . LEU A 101 ? 0.9416 1.6777 0.6372 0.0185  0.2769  -0.1204 132 LEU A O   
707 C CB  . LEU A 101 ? 1.1035 1.8148 0.6337 0.0218  0.2602  -0.0524 132 LEU A CB  
708 C CG  . LEU A 101 ? 1.0872 1.7340 0.6273 0.0060  0.2582  0.0004  132 LEU A CG  
709 C CD1 . LEU A 101 ? 1.0783 1.6747 0.5845 0.0202  0.2248  0.0281  132 LEU A CD1 
710 C CD2 . LEU A 101 ? 1.1419 1.7977 0.6449 -0.0199 0.2937  0.0411  132 LEU A CD2 
711 N N   A GLN A 102 ? 0.8672 1.5104 0.5874 0.0336  0.2219  -0.1056 133 GLN A N   
712 N N   B GLN A 102 ? 0.8656 1.5095 0.5868 0.0340  0.2216  -0.1070 133 GLN A N   
713 C CA  A GLN A 102 ? 0.8048 1.4289 0.5929 0.0239  0.2260  -0.1035 133 GLN A CA  
714 C CA  B GLN A 102 ? 0.8016 1.4269 0.5921 0.0250  0.2253  -0.1063 133 GLN A CA  
715 C C   A GLN A 102 ? 0.7471 1.3095 0.5586 0.0271  0.1968  -0.0866 133 GLN A C   
716 C C   B GLN A 102 ? 0.7445 1.3076 0.5588 0.0278  0.1963  -0.0888 133 GLN A C   
717 O O   A GLN A 102 ? 0.7351 1.2778 0.5278 0.0406  0.1724  -0.0909 133 GLN A O   
718 O O   B GLN A 102 ? 0.7331 1.2767 0.5310 0.0415  0.1717  -0.0946 133 GLN A O   
719 C CB  A GLN A 102 ? 0.7849 1.4458 0.6316 0.0349  0.2312  -0.1528 133 GLN A CB  
720 C CB  B GLN A 102 ? 0.7804 1.4429 0.6287 0.0365  0.2305  -0.1564 133 GLN A CB  
721 C CG  A GLN A 102 ? 0.7271 1.3720 0.6449 0.0295  0.2299  -0.1524 133 GLN A CG  
722 C CG  B GLN A 102 ? 0.7667 1.4324 0.6205 0.0592  0.2092  -0.1997 133 GLN A CG  
723 C CD  A GLN A 102 ? 0.7369 1.3902 0.6582 0.0041  0.2541  -0.1198 133 GLN A CD  
724 C CD  B GLN A 102 ? 0.7552 1.4574 0.6616 0.0720  0.2186  -0.2490 133 GLN A CD  
725 O OE1 A GLN A 102 ? 0.7876 1.4855 0.6842 -0.0078 0.2835  -0.1164 133 GLN A OE1 
726 O OE1 B GLN A 102 ? 0.7275 1.4487 0.6780 0.0669  0.2352  -0.2502 133 GLN A OE1 
727 N NE2 A GLN A 102 ? 0.7163 1.3286 0.6690 -0.0060 0.2430  -0.0974 133 GLN A NE2 
728 N NE2 B GLN A 102 ? 0.7672 1.4798 0.6718 0.0895  0.2070  -0.2917 133 GLN A NE2 
729 N N   . ILE A 103 ? 0.6954 1.2324 0.5477 0.0138  0.1999  -0.0691 134 ILE A N   
730 C CA  . ILE A 103 ? 0.6909 1.1752 0.5690 0.0160  0.1752  -0.0569 134 ILE A CA  
731 C C   . ILE A 103 ? 0.6330 1.1199 0.5793 0.0213  0.1675  -0.0843 134 ILE A C   
732 O O   . ILE A 103 ? 0.6520 1.1688 0.6327 0.0145  0.1844  -0.0941 134 ILE A O   
733 C CB  . ILE A 103 ? 0.7181 1.1642 0.5837 -0.0031 0.1816  -0.0134 134 ILE A CB  
734 C CG1 . ILE A 103 ? 0.6679 1.0774 0.5825 -0.0068 0.1665  -0.0106 134 ILE A CG1 
735 C CG2 . ILE A 103 ? 0.7674 1.2432 0.6306 -0.0243 0.2135  -0.0019 134 ILE A CG2 
736 C CD1 . ILE A 103 ? 0.6480 1.0041 0.5442 -0.0024 0.1455  0.0123  134 ILE A CD1 
737 N N   . LYS A 104 ? 0.5611 1.0201 0.5270 0.0339  0.1422  -0.0966 135 LYS A N   
738 C CA  . LYS A 104 ? 0.5094 0.9611 0.5344 0.0396  0.1320  -0.1154 135 LYS A CA  
739 C C   . LYS A 104 ? 0.4726 0.8776 0.5081 0.0347  0.1137  -0.0936 135 LYS A C   
740 O O   . LYS A 104 ? 0.4740 0.8540 0.4888 0.0399  0.0976  -0.0883 135 LYS A O   
741 C CB  . LYS A 104 ? 0.5334 0.9932 0.5750 0.0579  0.1202  -0.1531 135 LYS A CB  
742 C CG  . LYS A 104 ? 0.6036 1.1125 0.6514 0.0661  0.1382  -0.1850 135 LYS A CG  
743 C CD  . LYS A 104 ? 0.6886 1.2054 0.7156 0.0799  0.1291  -0.2167 135 LYS A CD  
744 C CE  . LYS A 104 ? 0.7384 1.2341 0.7157 0.0765  0.1144  -0.1970 135 LYS A CE  
745 N NZ  . LYS A 104 ? 0.7927 1.3207 0.7249 0.0843  0.1154  -0.2197 135 LYS A NZ  
746 N N   . GLU A 105 ? 0.4213 0.8197 0.4894 0.0247  0.1164  -0.0828 136 GLU A N   
747 C CA  . GLU A 105 ? 0.4030 0.7613 0.4781 0.0184  0.1019  -0.0633 136 GLU A CA  
748 C C   . GLU A 105 ? 0.3301 0.6776 0.4479 0.0265  0.0851  -0.0767 136 GLU A C   
749 O O   . GLU A 105 ? 0.3128 0.6830 0.4649 0.0343  0.0870  -0.0958 136 GLU A O   
750 C CB  . GLU A 105 ? 0.4322 0.7886 0.5120 -0.0010 0.1149  -0.0420 136 GLU A CB  
751 C CG  . GLU A 105 ? 0.4804 0.8671 0.6077 -0.0043 0.1205  -0.0551 136 GLU A CG  
752 C CD  . GLU A 105 ? 0.5396 0.9464 0.6708 -0.0259 0.1414  -0.0426 136 GLU A CD  
753 O OE1 . GLU A 105 ? 0.5592 1.0063 0.6882 -0.0285 0.1616  -0.0511 136 GLU A OE1 
754 O OE2 . GLU A 105 ? 0.5631 0.9461 0.6990 -0.0415 0.1388  -0.0259 136 GLU A OE2 
755 N N   . SER A 106 ? 0.2735 0.5866 0.3888 0.0255  0.0693  -0.0654 137 SER A N   
756 C CA  . SER A 106 ? 0.2395 0.5380 0.3877 0.0293  0.0545  -0.0700 137 SER A CA  
757 C C   . SER A 106 ? 0.2437 0.5481 0.4155 0.0190  0.0571  -0.0596 137 SER A C   
758 O O   . SER A 106 ? 0.2575 0.5703 0.4198 0.0061  0.0698  -0.0485 137 SER A O   
759 C CB  . SER A 106 ? 0.2296 0.4965 0.3634 0.0284  0.0407  -0.0605 137 SER A CB  
760 O OG  . SER A 106 ? 0.2272 0.4798 0.3432 0.0175  0.0440  -0.0400 137 SER A OG  
761 N N   . LEU A 107 ? 0.2274 0.5271 0.4293 0.0238  0.0445  -0.0625 138 LEU A N   
762 C CA  . LEU A 107 ? 0.2136 0.5152 0.4314 0.0132  0.0407  -0.0511 138 LEU A CA  
763 C C   . LEU A 107 ? 0.1860 0.4581 0.3773 0.0012  0.0377  -0.0350 138 LEU A C   
764 O O   . LEU A 107 ? 0.2027 0.4529 0.3712 0.0052  0.0337  -0.0325 138 LEU A O   
765 C CB  . LEU A 107 ? 0.2066 0.5075 0.4551 0.0237  0.0247  -0.0545 138 LEU A CB  
766 C CG  . LEU A 107 ? 0.2153 0.5443 0.4966 0.0397  0.0266  -0.0720 138 LEU A CG  
767 C CD1 . LEU A 107 ? 0.2730 0.5973 0.5823 0.0500  0.0086  -0.0682 138 LEU A CD1 
768 C CD2 . LEU A 107 ? 0.2156 0.5888 0.5113 0.0337  0.0436  -0.0792 138 LEU A CD2 
769 N N   . ARG A 108 ? 0.1905 0.4643 0.3865 -0.0129 0.0396  -0.0267 139 ARG A N   
770 C CA  . ARG A 108 ? 0.2003 0.4439 0.3731 -0.0222 0.0373  -0.0154 139 ARG A CA  
771 C C   . ARG A 108 ? 0.2010 0.4288 0.3749 -0.0170 0.0216  -0.0144 139 ARG A C   
772 O O   . ARG A 108 ? 0.1746 0.4128 0.3683 -0.0102 0.0119  -0.0181 139 ARG A O   
773 C CB  . ARG A 108 ? 0.1997 0.4455 0.3779 -0.0410 0.0439  -0.0107 139 ARG A CB  
774 C CG  . ARG A 108 ? 0.2375 0.4995 0.4158 -0.0520 0.0627  -0.0087 139 ARG A CG  
775 C CD  . ARG A 108 ? 0.2452 0.4941 0.4231 -0.0739 0.0695  -0.0024 139 ARG A CD  
776 N NE  . ARG A 108 ? 0.3339 0.6016 0.5180 -0.0903 0.0891  0.0004  139 ARG A NE  
777 C CZ  . ARG A 108 ? 0.3695 0.6298 0.5609 -0.1144 0.0978  0.0039  139 ARG A CZ  
778 N NH1 . ARG A 108 ? 0.3524 0.5860 0.5439 -0.1215 0.0870  0.0019  139 ARG A NH1 
779 N NH2 . ARG A 108 ? 0.3757 0.6556 0.5745 -0.1327 0.1182  0.0076  139 ARG A NH2 
780 N N   . ALA A 109 ? 0.1972 0.4001 0.3496 -0.0190 0.0196  -0.0087 140 ALA A N   
781 C CA  . ALA A 109 ? 0.1967 0.3890 0.3480 -0.0192 0.0088  -0.0072 140 ALA A CA  
782 C C   . ALA A 109 ? 0.2376 0.4172 0.3789 -0.0307 0.0114  -0.0049 140 ALA A C   
783 O O   . ALA A 109 ? 0.2896 0.4564 0.4199 -0.0351 0.0207  -0.0019 140 ALA A O   
784 C CB  . ALA A 109 ? 0.1726 0.3523 0.3117 -0.0105 0.0055  -0.0079 140 ALA A CB  
785 N N   . GLU A 110 ? 0.2573 0.4382 0.4003 -0.0353 0.0034  -0.0063 141 GLU A N   
786 C CA  . GLU A 110 ? 0.2656 0.4357 0.4007 -0.0460 0.0050  -0.0098 141 GLU A CA  
787 C C   . GLU A 110 ? 0.2668 0.4216 0.3861 -0.0408 0.0033  -0.0116 141 GLU A C   
788 O O   . GLU A 110 ? 0.2177 0.3803 0.3362 -0.0355 -0.0024 -0.0100 141 GLU A O   
789 C CB  . GLU A 110 ? 0.2515 0.4429 0.3985 -0.0558 -0.0030 -0.0145 141 GLU A CB  
790 C CG  . GLU A 110 ? 0.2670 0.4487 0.4060 -0.0687 -0.0019 -0.0241 141 GLU A CG  
791 C CD  . GLU A 110 ? 0.2883 0.4976 0.4366 -0.0788 -0.0123 -0.0314 141 GLU A CD  
792 O OE1 . GLU A 110 ? 0.2781 0.5145 0.4401 -0.0740 -0.0217 -0.0262 141 GLU A OE1 
793 O OE2 . GLU A 110 ? 0.3166 0.5208 0.4594 -0.0907 -0.0121 -0.0439 141 GLU A OE2 
794 N N   . LEU A 111 ? 0.2856 0.4185 0.3948 -0.0426 0.0091  -0.0151 142 LEU A N   
795 C CA  . LEU A 111 ? 0.2796 0.4025 0.3784 -0.0366 0.0084  -0.0213 142 LEU A CA  
796 C C   . LEU A 111 ? 0.3143 0.4337 0.4115 -0.0481 0.0084  -0.0333 142 LEU A C   
797 O O   . LEU A 111 ? 0.3202 0.4235 0.4203 -0.0576 0.0128  -0.0364 142 LEU A O   
798 C CB  . LEU A 111 ? 0.2597 0.3575 0.3495 -0.0250 0.0134  -0.0184 142 LEU A CB  
799 C CG  . LEU A 111 ? 0.2618 0.3516 0.3466 -0.0151 0.0132  -0.0276 142 LEU A CG  
800 C CD1 . LEU A 111 ? 0.2079 0.3252 0.2966 -0.0103 0.0092  -0.0304 142 LEU A CD1 
801 C CD2 . LEU A 111 ? 0.3047 0.3692 0.3819 0.0001  0.0151  -0.0214 142 LEU A CD2 
802 N N   . ARG A 112 ? 0.2873 0.4228 0.3792 -0.0492 0.0042  -0.0406 143 ARG A N   
803 C CA  . ARG A 112 ? 0.3168 0.4516 0.4023 -0.0578 0.0044  -0.0575 143 ARG A CA  
804 C C   . ARG A 112 ? 0.3253 0.4527 0.4028 -0.0473 0.0093  -0.0681 143 ARG A C   
805 O O   . ARG A 112 ? 0.2596 0.4061 0.3338 -0.0408 0.0093  -0.0647 143 ARG A O   
806 C CB  . ARG A 112 ? 0.3489 0.5163 0.4298 -0.0670 -0.0040 -0.0589 143 ARG A CB  
807 C CG  . ARG A 112 ? 0.3056 0.4878 0.3991 -0.0754 -0.0112 -0.0526 143 ARG A CG  
808 C CD  . ARG A 112 ? 0.3183 0.5329 0.4058 -0.0833 -0.0230 -0.0553 143 ARG A CD  
809 N NE  . ARG A 112 ? 0.2650 0.4970 0.3715 -0.0847 -0.0308 -0.0461 143 ARG A NE  
810 C CZ  . ARG A 112 ? 0.2868 0.5471 0.3943 -0.0828 -0.0443 -0.0372 143 ARG A CZ  
811 N NH1 . ARG A 112 ? 0.2411 0.5153 0.3260 -0.0824 -0.0514 -0.0334 143 ARG A NH1 
812 N NH2 . ARG A 112 ? 0.2629 0.5395 0.3942 -0.0806 -0.0504 -0.0315 143 ARG A NH2 
813 N N   . VAL A 113 ? 0.2945 0.3937 0.3718 -0.0455 0.0143  -0.0812 144 VAL A N   
814 C CA  . VAL A 113 ? 0.3370 0.4308 0.4111 -0.0319 0.0189  -0.0951 144 VAL A CA  
815 C C   . VAL A 113 ? 0.3652 0.4674 0.4322 -0.0404 0.0205  -0.1205 144 VAL A C   
816 O O   . VAL A 113 ? 0.4121 0.4883 0.4812 -0.0476 0.0218  -0.1348 144 VAL A O   
817 C CB  . VAL A 113 ? 0.3633 0.4156 0.4419 -0.0170 0.0226  -0.0931 144 VAL A CB  
818 C CG1 . VAL A 113 ? 0.3688 0.4215 0.4498 0.0016  0.0258  -0.1095 144 VAL A CG1 
819 C CG2 . VAL A 113 ? 0.3408 0.3902 0.4208 -0.0088 0.0203  -0.0693 144 VAL A CG2 
820 N N   . THR A 114 ? 0.3537 0.4923 0.4116 -0.0406 0.0214  -0.1267 145 THR A N   
821 C CA  . THR A 114 ? 0.4008 0.5603 0.4451 -0.0498 0.0228  -0.1504 145 THR A CA  
822 C C   . THR A 114 ? 0.4286 0.5706 0.4765 -0.0375 0.0311  -0.1782 145 THR A C   
823 O O   . THR A 114 ? 0.4178 0.5627 0.4737 -0.0199 0.0369  -0.1787 145 THR A O   
824 C CB  . THR A 114 ? 0.3966 0.6015 0.4268 -0.0523 0.0244  -0.1434 145 THR A CB  
825 O OG1 . THR A 114 ? 0.4143 0.6326 0.4409 -0.0615 0.0156  -0.1176 145 THR A OG1 
826 C CG2 . THR A 114 ? 0.4755 0.7087 0.4854 -0.0600 0.0281  -0.1680 145 THR A CG2 
827 N N   . GLU A 115 ? 0.4262 0.5529 0.4709 -0.0459 0.0313  -0.2038 146 GLU A N   
828 C CA  A GLU A 115 ? 0.4741 0.5845 0.5221 -0.0344 0.0391  -0.2369 146 GLU A CA  
829 C CA  B GLU A 115 ? 0.4712 0.5796 0.5204 -0.0329 0.0393  -0.2350 146 GLU A CA  
830 C C   . GLU A 115 ? 0.4866 0.6423 0.5265 -0.0244 0.0475  -0.2496 146 GLU A C   
831 O O   . GLU A 115 ? 0.4717 0.6730 0.4933 -0.0367 0.0469  -0.2426 146 GLU A O   
832 C CB  A GLU A 115 ? 0.4757 0.5805 0.5159 -0.0520 0.0370  -0.2678 146 GLU A CB  
833 C CB  B GLU A 115 ? 0.4870 0.5740 0.5338 -0.0477 0.0378  -0.2651 146 GLU A CB  
834 C CG  A GLU A 115 ? 0.4551 0.5349 0.5026 -0.0716 0.0290  -0.2588 146 GLU A CG  
835 C CG  B GLU A 115 ? 0.4554 0.5911 0.4802 -0.0642 0.0352  -0.2853 146 GLU A CG  
836 C CD  A GLU A 115 ? 0.4059 0.5315 0.4416 -0.0900 0.0186  -0.2438 146 GLU A CD  
837 C CD  B GLU A 115 ? 0.5078 0.6255 0.5320 -0.0777 0.0336  -0.3236 146 GLU A CD  
838 O OE1 A GLU A 115 ? 0.3670 0.5068 0.4038 -0.0860 0.0155  -0.2113 146 GLU A OE1 
839 O OE1 B GLU A 115 ? 0.5302 0.6326 0.5568 -0.0671 0.0418  -0.3587 146 GLU A OE1 
840 O OE2 A GLU A 115 ? 0.4276 0.5738 0.4547 -0.1075 0.0122  -0.2658 146 GLU A OE2 
841 O OE2 B GLU A 115 ? 0.5220 0.6445 0.5456 -0.0992 0.0237  -0.3212 146 GLU A OE2 
842 N N   . ARG A 116 ? 0.5632 0.7082 0.6168 -0.0023 0.0557  -0.2690 147 ARG A N   
843 C CA  . ARG A 116 ? 0.6072 0.8009 0.6563 0.0057  0.0670  -0.2905 147 ARG A CA  
844 C C   . ARG A 116 ? 0.6553 0.8528 0.6923 0.0005  0.0722  -0.3330 147 ARG A C   
845 O O   . ARG A 116 ? 0.7318 0.9028 0.7846 0.0189  0.0777  -0.3625 147 ARG A O   
846 C CB  . ARG A 116 ? 0.6713 0.8600 0.7466 0.0353  0.0730  -0.2966 147 ARG A CB  
847 C CG  . ARG A 116 ? 0.7096 0.9279 0.7953 0.0406  0.0724  -0.2668 147 ARG A CG  
848 C CD  . ARG A 116 ? 0.7546 0.9888 0.8684 0.0701  0.0785  -0.2808 147 ARG A CD  
849 N NE  . ARG A 116 ? 0.7551 0.9906 0.8846 0.0789  0.0708  -0.2512 147 ARG A NE  
850 C CZ  . ARG A 116 ? 0.7894 1.0370 0.9461 0.1056  0.0702  -0.2556 147 ARG A CZ  
851 N NH1 . ARG A 116 ? 0.8338 1.0928 1.0084 0.1286  0.0777  -0.2881 147 ARG A NH1 
852 N NH2 . ARG A 116 ? 0.7739 1.0260 0.9413 0.1106  0.0612  -0.2299 147 ARG A NH2 
853 N N   . ARG A 117 ? 0.6221 0.8528 0.6313 -0.0227 0.0694  -0.3375 148 ARG A N   
854 C CA  . ARG A 117 ? 0.6353 0.8740 0.6286 -0.0314 0.0717  -0.3803 148 ARG A CA  
855 C C   . ARG A 117 ? 0.6778 0.9675 0.6607 -0.0215 0.0880  -0.4100 148 ARG A C   
856 O O   . ARG A 117 ? 0.6751 1.0195 0.6377 -0.0295 0.0936  -0.3938 148 ARG A O   
857 C CB  . ARG A 117 ? 0.5740 0.8358 0.5403 -0.0588 0.0594  -0.3710 148 ARG A CB  
858 C CG  . ARG A 117 ? 0.6241 0.8896 0.5756 -0.0718 0.0565  -0.4152 148 ARG A CG  
859 C CD  . ARG A 117 ? 0.5685 0.8569 0.4998 -0.0972 0.0396  -0.4028 148 ARG A CD  
860 N NE  . ARG A 117 ? 0.5302 0.7782 0.4858 -0.1036 0.0284  -0.3742 148 ARG A NE  
861 C CZ  . ARG A 117 ? 0.5124 0.7792 0.4620 -0.1205 0.0132  -0.3527 148 ARG A CZ  
862 N NH1 . ARG A 117 ? 0.4893 0.7212 0.4650 -0.1247 0.0069  -0.3303 148 ARG A NH1 
863 N NH2 . ARG A 117 ? 0.5212 0.8438 0.4389 -0.1319 0.0041  -0.3532 148 ARG A NH2 
864 N N   . ALA A 118 ? 0.7362 1.0076 0.7337 -0.0042 0.0967  -0.4534 149 ALA A N   
865 C CA  . ALA A 118 ? 0.7663 1.0869 0.7641 0.0113  0.1149  -0.4830 149 ALA A CA  
866 C C   . ALA A 118 ? 0.7922 1.1736 0.7501 -0.0062 0.1231  -0.5123 149 ALA A C   
867 O O   . ALA A 118 ? 0.8217 1.1959 0.7567 -0.0251 0.1131  -0.5261 149 ALA A O   
868 C CB  . ALA A 118 ? 0.8299 1.1081 0.8620 0.0415  0.1208  -0.5197 149 ALA A CB  
869 O O   . HOH B .   ? 0.4062 0.6708 0.4270 -0.0577 0.0276  -0.0968 1   HOH A O   
870 O O   . HOH B .   ? 0.3847 0.5528 0.5425 -0.0183 -0.0399 0.0322  2   HOH A O   
871 O O   . HOH B .   ? 0.4089 0.6149 0.4931 -0.0524 -0.0065 0.0062  3   HOH A O   
872 O O   . HOH B .   ? 0.4265 0.6075 0.6086 0.0225  -0.0182 -0.0825 4   HOH A O   
873 O O   . HOH B .   ? 0.2997 0.5000 0.4609 -0.0071 -0.0173 -0.0417 5   HOH A O   
874 O O   . HOH B .   ? 0.4189 0.8071 0.4371 0.1989  -0.1344 -0.0455 6   HOH A O   
875 O O   . HOH B .   ? 0.7079 0.8676 0.3234 0.0356  0.1112  0.2092  7   HOH A O   
876 O O   . HOH B .   ? 0.4220 0.6563 0.6268 0.0337  0.0095  -0.0598 8   HOH A O   
877 O O   . HOH B .   ? 0.4600 0.9255 0.4490 0.1558  -0.1393 -0.1107 9   HOH A O   
878 O O   . HOH B .   ? 0.2866 0.5052 0.4879 0.0137  -0.0016 -0.0279 10  HOH A O   
879 O O   . HOH B .   ? 0.5522 0.5308 0.6801 0.1310  0.0233  -0.1456 11  HOH A O   
880 O O   . HOH B .   ? 0.6550 0.5725 0.7637 -0.1152 0.0491  -0.0606 12  HOH A O   
881 O O   . HOH B .   ? 0.4443 0.8054 0.6575 -0.0260 0.0889  -0.0410 13  HOH A O   
882 O O   . HOH B .   ? 0.4513 0.7464 0.6302 0.0285  -0.0062 -0.0722 14  HOH A O   
883 O O   . HOH B .   ? 0.3975 0.7653 0.6770 -0.0348 -0.0860 -0.2506 15  HOH A O   
884 O O   . HOH B .   ? 0.3840 0.6738 0.6317 -0.0076 0.0026  -0.0250 16  HOH A O   
885 O O   . HOH B .   ? 0.3430 0.9098 0.4338 0.1166  -0.1633 -0.2073 17  HOH A O   
886 O O   . HOH B .   ? 0.5317 1.0866 0.4899 0.1645  -0.1702 -0.1563 18  HOH A O   
887 O O   . HOH B .   ? 0.6351 0.8770 0.8263 -0.0206 -0.0176 -0.0593 19  HOH A O   
888 O O   . HOH B .   ? 0.2703 0.6652 0.4522 0.0705  -0.0783 -0.1179 20  HOH A O   
889 O O   . HOH B .   ? 0.2687 0.6192 0.5313 -0.0254 0.0485  -0.0394 21  HOH A O   
890 O O   . HOH B .   ? 0.2727 0.4072 0.3959 -0.0926 0.0073  -0.0525 22  HOH A O   
891 O O   . HOH B .   ? 0.4191 0.5604 0.6135 -0.0010 -0.0362 0.0121  23  HOH A O   
892 O O   . HOH B .   ? 0.4038 0.6829 0.6310 0.0534  0.0256  -0.0960 24  HOH A O   
893 O O   . HOH B .   ? 0.3777 0.5411 0.5981 0.0228  -0.0260 -0.0253 25  HOH A O   
894 O O   . HOH B .   ? 0.4768 0.7312 0.6400 -0.1177 -0.0279 -0.0682 26  HOH A O   
895 O O   . HOH B .   ? 0.3277 0.8474 0.5235 0.0703  -0.1291 -0.1991 27  HOH A O   
896 O O   . HOH B .   ? 0.3630 0.5907 0.5013 -0.0045 0.0031  -0.0415 28  HOH A O   
897 O O   . HOH B .   ? 0.4313 0.7703 0.6183 0.0407  0.0283  -0.1124 29  HOH A O   
898 O O   . HOH B .   ? 0.4103 0.7490 0.6033 -0.0756 0.1133  -0.0113 30  HOH A O   
899 O O   . HOH B .   ? 0.3388 0.7848 0.4855 0.1624  -0.1208 -0.0992 31  HOH A O   
900 O O   . HOH B .   ? 0.2487 0.4933 0.4490 -0.0282 -0.0172 -0.0072 161 HOH A O   
901 O O   . HOH B .   ? 0.4741 0.8106 0.7045 0.1793  -0.0302 -0.1210 162 HOH A O   
902 O O   . HOH B .   ? 0.5253 0.7534 0.7530 -0.1842 0.1057  -0.0051 163 HOH A O   
903 O O   . HOH B .   ? 0.2035 0.4592 0.4101 -0.0545 0.0073  -0.0164 164 HOH A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   TRP 1   32  ?   ?   ?   A . n 
A 1 2   ASN 2   33  33  ASN ASN A . n 
A 1 3   PRO 3   34  34  PRO PRO A . n 
A 1 4   PRO 4   35  35  PRO PRO A . n 
A 1 5   THR 5   36  36  THR THR A . n 
A 1 6   PHE 6   37  37  PHE PHE A . n 
A 1 7   SER 7   38  38  SER SER A . n 
A 1 8   PRO 8   39  39  PRO PRO A . n 
A 1 9   ALA 9   40  40  ALA ALA A . n 
A 1 10  LEU 10  41  41  LEU LEU A . n 
A 1 11  LEU 11  42  42  LEU LEU A . n 
A 1 12  VAL 12  43  43  VAL VAL A . n 
A 1 13  VAL 13  44  44  VAL VAL A . n 
A 1 14  THR 14  45  45  THR THR A . n 
A 1 15  GLU 15  46  46  GLU GLU A . n 
A 1 16  GLY 16  47  47  GLY GLY A . n 
A 1 17  ASP 17  48  48  ASP ASP A . n 
A 1 18  ASN 18  49  49  ASN ASN A . n 
A 1 19  ALA 19  50  50  ALA ALA A . n 
A 1 20  THR 20  51  51  THR THR A . n 
A 1 21  PHE 21  52  52  PHE PHE A . n 
A 1 22  THR 22  53  53  THR THR A . n 
A 1 23  CYS 23  54  54  CYS CYS A . n 
A 1 24  SER 24  55  55  SER SER A . n 
A 1 25  PHE 25  56  56  PHE PHE A . n 
A 1 26  SER 26  57  57  SER SER A . n 
A 1 27  ASN 27  58  58  ASN ASN A . n 
A 1 28  THR 28  59  59  THR THR A . n 
A 1 29  SER 29  60  60  SER SER A . n 
A 1 30  GLU 30  61  ?   ?   ?   A . n 
A 1 31  SER 31  62  62  SER SER A . n 
A 1 32  PHE 32  63  63  PHE PHE A . n 
A 1 33  VAL 33  64  64  VAL VAL A . n 
A 1 34  LEU 34  65  65  LEU LEU A . n 
A 1 35  ASN 35  66  66  ASN ASN A . n 
A 1 36  TRP 36  67  67  TRP TRP A . n 
A 1 37  TYR 37  68  68  TYR TYR A . n 
A 1 38  ARG 38  69  69  ARG ARG A . n 
A 1 39  MET 39  70  70  MET MET A . n 
A 1 40  SER 40  71  71  SER SER A . n 
A 1 41  PRO 41  72  72  PRO PRO A . n 
A 1 42  SER 42  73  73  SER SER A . n 
A 1 43  ASN 43  74  74  ASN ASN A . n 
A 1 44  GLN 44  75  75  GLN GLN A . n 
A 1 45  THR 45  76  76  THR THR A . n 
A 1 46  ASP 46  77  77  ASP ASP A . n 
A 1 47  LYS 47  78  78  LYS LYS A . n 
A 1 48  LEU 48  79  79  LEU LEU A . n 
A 1 49  ALA 49  80  80  ALA ALA A . n 
A 1 50  ALA 50  81  81  ALA ALA A . n 
A 1 51  PHE 51  82  82  PHE PHE A . n 
A 1 52  PRO 52  83  83  PRO PRO A . n 
A 1 53  GLU 53  84  84  GLU GLU A . n 
A 1 54  ASP 54  85  ?   ?   ?   A . n 
A 1 55  ARG 55  86  ?   ?   ?   A . n 
A 1 56  SER 56  87  ?   ?   ?   A . n 
A 1 57  GLN 57  88  ?   ?   ?   A . n 
A 1 58  PRO 58  89  ?   ?   ?   A . n 
A 1 59  GLY 59  90  ?   ?   ?   A . n 
A 1 60  GLN 60  91  ?   ?   ?   A . n 
A 1 61  ASP 61  92  ?   ?   ?   A . n 
A 1 62  CYS 62  93  93  CYS CYS A . n 
A 1 63  ARG 63  94  94  ARG ARG A . n 
A 1 64  PHE 64  95  95  PHE PHE A . n 
A 1 65  ARG 65  96  96  ARG ARG A . n 
A 1 66  VAL 66  97  97  VAL VAL A . n 
A 1 67  THR 67  98  98  THR THR A . n 
A 1 68  GLN 68  99  99  GLN GLN A . n 
A 1 69  LEU 69  100 100 LEU LEU A . n 
A 1 70  PRO 70  101 101 PRO PRO A . n 
A 1 71  ASN 71  102 102 ASN ASN A . n 
A 1 72  GLY 72  103 103 GLY GLY A . n 
A 1 73  ARG 73  104 104 ARG ARG A . n 
A 1 74  ASP 74  105 105 ASP ASP A . n 
A 1 75  PHE 75  106 106 PHE PHE A . n 
A 1 76  HIS 76  107 107 HIS HIS A . n 
A 1 77  MET 77  108 108 MET MET A . n 
A 1 78  SER 78  109 109 SER SER A . n 
A 1 79  VAL 79  110 110 VAL VAL A . n 
A 1 80  VAL 80  111 111 VAL VAL A . n 
A 1 81  ARG 81  112 112 ARG ARG A . n 
A 1 82  ALA 82  113 113 ALA ALA A . n 
A 1 83  ARG 83  114 114 ARG ARG A . n 
A 1 84  ARG 84  115 115 ARG ARG A . n 
A 1 85  ASN 85  116 116 ASN ASN A . n 
A 1 86  ASP 86  117 117 ASP ASP A . n 
A 1 87  SER 87  118 118 SER SER A . n 
A 1 88  GLY 88  119 119 GLY GLY A . n 
A 1 89  THR 89  120 120 THR THR A . n 
A 1 90  TYR 90  121 121 TYR TYR A . n 
A 1 91  LEU 91  122 122 LEU LEU A . n 
A 1 92  CYS 92  123 123 CYS CYS A . n 
A 1 93  GLY 93  124 124 GLY GLY A . n 
A 1 94  ALA 94  125 125 ALA ALA A . n 
A 1 95  ILE 95  126 126 ILE ILE A . n 
A 1 96  SER 96  127 127 SER SER A . n 
A 1 97  LEU 97  128 128 LEU LEU A . n 
A 1 98  ALA 98  129 129 ALA ALA A . n 
A 1 99  PRO 99  130 130 PRO PRO A . n 
A 1 100 LYS 100 131 131 LYS LYS A . n 
A 1 101 LEU 101 132 132 LEU LEU A . n 
A 1 102 GLN 102 133 133 GLN GLN A . n 
A 1 103 ILE 103 134 134 ILE ILE A . n 
A 1 104 LYS 104 135 135 LYS LYS A . n 
A 1 105 GLU 105 136 136 GLU GLU A . n 
A 1 106 SER 106 137 137 SER SER A . n 
A 1 107 LEU 107 138 138 LEU LEU A . n 
A 1 108 ARG 108 139 139 ARG ARG A . n 
A 1 109 ALA 109 140 140 ALA ALA A . n 
A 1 110 GLU 110 141 141 GLU GLU A . n 
A 1 111 LEU 111 142 142 LEU LEU A . n 
A 1 112 ARG 112 143 143 ARG ARG A . n 
A 1 113 VAL 113 144 144 VAL VAL A . n 
A 1 114 THR 114 145 145 THR THR A . n 
A 1 115 GLU 115 146 146 GLU GLU A . n 
A 1 116 ARG 116 147 147 ARG ARG A . n 
A 1 117 ARG 117 148 148 ARG ARG A . n 
A 1 118 ALA 118 149 149 ALA ALA A . n 
A 1 119 GLU 119 150 ?   ?   ?   A . n 
A 1 120 VAL 120 151 ?   ?   ?   A . n 
A 1 121 PRO 121 152 ?   ?   ?   A . n 
A 1 122 THR 122 153 ?   ?   ?   A . n 
A 1 123 ALA 123 154 ?   ?   ?   A . n 
A 1 124 HIS 124 155 ?   ?   ?   A . n 
A 1 125 PRO 125 156 ?   ?   ?   A . n 
A 1 126 SER 126 157 ?   ?   ?   A . n 
A 1 127 PRO 127 158 ?   ?   ?   A . n 
A 1 128 SER 128 159 ?   ?   ?   A . n 
A 1 129 PRO 129 160 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2012-05-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -18.3360 
_pdbx_refine_tls.origin_y         16.2040 
_pdbx_refine_tls.origin_z         2.0490 
_pdbx_refine_tls.T[1][1]          0.1708 
_pdbx_refine_tls.T[2][2]          0.3065 
_pdbx_refine_tls.T[3][3]          0.2098 
_pdbx_refine_tls.T[1][2]          0.0315 
_pdbx_refine_tls.T[1][3]          0.0104 
_pdbx_refine_tls.T[2][3]          0.0118 
_pdbx_refine_tls.L[1][1]          5.2692 
_pdbx_refine_tls.L[2][2]          3.0542 
_pdbx_refine_tls.L[3][3]          4.4368 
_pdbx_refine_tls.L[1][2]          0.0450 
_pdbx_refine_tls.L[1][3]          -0.0111 
_pdbx_refine_tls.L[2][3]          1.2036 
_pdbx_refine_tls.S[1][1]          -0.1689 
_pdbx_refine_tls.S[2][2]          0.1661 
_pdbx_refine_tls.S[3][3]          0.0028 
_pdbx_refine_tls.S[1][2]          -0.5647 
_pdbx_refine_tls.S[1][3]          -0.2113 
_pdbx_refine_tls.S[2][3]          0.0476 
_pdbx_refine_tls.S[2][1]          0.4258 
_pdbx_refine_tls.S[3][1]          0.5330 
_pdbx_refine_tls.S[3][2]          0.0517 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     33 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     149 
_pdbx_refine_tls_group.selection_details   ? 
_pdbx_refine_tls_group.beg_label_asym_id   . 
_pdbx_refine_tls_group.beg_label_seq_id    . 
_pdbx_refine_tls_group.end_label_asym_id   . 
_pdbx_refine_tls_group.end_label_seq_id    . 
_pdbx_refine_tls_group.selection           ? 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 SCALEPACK   .    ?               program 'Zbyszek Otwinowski' hkl@hkl-xray.com         'data scaling'    
http://www.hkl-xray.com/                     ?          ? 
2 REFMAC      .    ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk    refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
3 PDB_EXTRACT 3.10 'June 10, 2010' package PDB                  deposit@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
4 CBASS       .    ?               ?       ?                    ?                        'data collection' ? ?          ? 
5 HKL-2000    .    ?               ?       ?                    ?                        'data reduction'  ? ?          ? 
6 MOLREP      .    ?               ?       ?                    ?                        phasing           ? ?          ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 112 ? ? 54.24   71.60  
2 1 PRO A 130 ? ? -28.18  94.89  
3 1 LYS A 131 ? ? -160.00 93.03  
4 1 LEU A 132 ? ? 65.75   114.63 
5 1 LEU A 132 ? ? 65.75   112.92 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A THR 59  ? OG1 ? A THR 28  OG1 
2 1 Y 1 A THR 59  ? CG2 ? A THR 28  CG2 
3 1 Y 1 A SER 60  ? OG  ? A SER 29  OG  
4 1 Y 1 A LYS 131 ? CD  ? A LYS 100 CD  
5 1 Y 1 A LYS 131 ? CE  ? A LYS 100 CE  
6 1 Y 1 A LYS 131 ? NZ  ? A LYS 100 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A TRP 32  ? A TRP 1   
2  1 Y 1 A GLU 61  ? A GLU 30  
3  1 Y 1 A ASP 85  ? A ASP 54  
4  1 Y 1 A ARG 86  ? A ARG 55  
5  1 Y 1 A SER 87  ? A SER 56  
6  1 Y 1 A GLN 88  ? A GLN 57  
7  1 Y 1 A PRO 89  ? A PRO 58  
8  1 Y 1 A GLY 90  ? A GLY 59  
9  1 Y 1 A GLN 91  ? A GLN 60  
10 1 Y 1 A ASP 92  ? A ASP 61  
11 1 Y 1 A GLU 150 ? A GLU 119 
12 1 Y 1 A VAL 151 ? A VAL 120 
13 1 Y 1 A PRO 152 ? A PRO 121 
14 1 Y 1 A THR 153 ? A THR 122 
15 1 Y 1 A ALA 154 ? A ALA 123 
16 1 Y 1 A HIS 155 ? A HIS 124 
17 1 Y 1 A PRO 156 ? A PRO 125 
18 1 Y 1 A SER 157 ? A SER 126 
19 1 Y 1 A PRO 158 ? A PRO 127 
20 1 Y 1 A SER 159 ? A SER 128 
21 1 Y 1 A PRO 160 ? A PRO 129 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  1   1  HOH HOH A . 
B 2 HOH 2  2   2  HOH HOH A . 
B 2 HOH 3  3   3  HOH HOH A . 
B 2 HOH 4  4   4  HOH HOH A . 
B 2 HOH 5  5   5  HOH HOH A . 
B 2 HOH 6  6   6  HOH HOH A . 
B 2 HOH 7  7   7  HOH HOH A . 
B 2 HOH 8  8   8  HOH HOH A . 
B 2 HOH 9  9   9  HOH HOH A . 
B 2 HOH 10 10  10 HOH HOH A . 
B 2 HOH 11 11  11 HOH HOH A . 
B 2 HOH 12 12  12 HOH HOH A . 
B 2 HOH 13 13  13 HOH HOH A . 
B 2 HOH 14 14  14 HOH HOH A . 
B 2 HOH 15 15  15 HOH HOH A . 
B 2 HOH 16 16  16 HOH HOH A . 
B 2 HOH 17 17  17 HOH HOH A . 
B 2 HOH 18 18  18 HOH HOH A . 
B 2 HOH 19 19  19 HOH HOH A . 
B 2 HOH 20 20  20 HOH HOH A . 
B 2 HOH 21 21  21 HOH HOH A . 
B 2 HOH 22 22  22 HOH HOH A . 
B 2 HOH 23 23  23 HOH HOH A . 
B 2 HOH 24 24  24 HOH HOH A . 
B 2 HOH 25 25  25 HOH HOH A . 
B 2 HOH 26 26  26 HOH HOH A . 
B 2 HOH 27 27  27 HOH HOH A . 
B 2 HOH 28 28  28 HOH HOH A . 
B 2 HOH 29 29  29 HOH HOH A . 
B 2 HOH 30 30  30 HOH HOH A . 
B 2 HOH 31 31  31 HOH HOH A . 
B 2 HOH 32 161 32 HOH HOH A . 
B 2 HOH 33 162 33 HOH HOH A . 
B 2 HOH 34 163 34 HOH HOH A . 
B 2 HOH 35 164 35 HOH HOH A . 
#