data_3RS9
# 
_entry.id   3RS9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.357 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3RS9         pdb_00003rs9 10.2210/pdb3rs9/pdb 
RCSB  RCSB065316   ?            ?                   
WWPDB D_1000065316 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2AX3 Apo-protein unspecified 
PDB 3RNO .           unspecified 
PDB 3RO7 .           unspecified 
PDB 3ROE .           unspecified 
PDB 3ROG .           unspecified 
PDB 3ROX .           unspecified 
PDB 3ROZ .           unspecified 
PDB 3RRB .           unspecified 
PDB 3RRE .           unspecified 
PDB 3RRF .           unspecified 
PDB 3RRJ .           unspecified 
PDB 3RS8 .           unspecified 
PDB 3RSF .           unspecified 
PDB 3RSG .           unspecified 
PDB 3RSQ .           unspecified 
PDB 3RSS .           unspecified 
PDB 3RT7 .           unspecified 
PDB 3RT9 .           unspecified 
PDB 3RTA .           unspecified 
PDB 3RTB .           unspecified 
PDB 3RTC .           unspecified 
PDB 3RTD .           unspecified 
PDB 3RTE .           unspecified 
PDB 3RTG .           unspecified 
PDB 3RU2 .           unspecified 
PDB 3RU3 .           unspecified 
# 
_pdbx_database_status.entry_id                        3RS9 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-05-02 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Shumilin, I.A.'  1 ?                   
'Cymborowski, M.' 2 ?                   
'Lesley, S.A.'    3 ?                   
'Minor, W.'       4 0000-0001-7075-7090 
# 
_citation.id                        primary 
_citation.title                     'Identification of unknown protein function using metabolite cocktail screening.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            20 
_citation.page_first                1715 
_citation.page_last                 1725 
_citation.year                      2012 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22940582 
_citation.pdbx_database_id_DOI      10.1016/j.str.2012.07.016 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shumilin, I.A.'  1 ?                   
primary 'Cymborowski, M.' 2 ?                   
primary 'Chertihin, O.'   3 ?                   
primary 'Jha, K.N.'       4 ?                   
primary 'Herr, J.C.'      5 ?                   
primary 'Lesley, S.A.'    6 ?                   
primary 'Joachimiak, A.'  7 ?                   
primary 'Minor, W.'       8 0000-0001-7075-7090 
# 
_cell.entry_id           3RS9 
_cell.length_a           122.073 
_cell.length_b           122.073 
_cell.length_c           155.292 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3RS9 
_symmetry.space_group_name_H-M             'I 4 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                97 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Putative uncharacterized protein'               54527.617 1   4.2.1.93 ? ? ? 
2 polymer     nat 'Unknown peptide, probably from expression host' 735.826   1   ?        ? ? ? 
3 non-polymer syn 'POTASSIUM ION'                                  39.098    1   ?        ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                  24.305    1   ?        ? ? ? 
5 non-polymer syn "BIS(ADENOSINE)-5'-TRIPHOSPHATE"                 756.407   2   ?        ? ? ? 
6 non-polymer syn GLYCEROL                                         92.094    1   ?        ? ? ? 
7 water       nat water                                            18.015    132 ?        ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MGSDKIHHHHHHMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVK
DVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDV
PSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSH
KGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKD
VDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELA
EEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQD
ERGLTASELLRLIPEAIRRLKE
;
;MGSDKIHHHHHHMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVK
DVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDV
PSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSH
KGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKD
VDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELA
EEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQD
ERGLTASELLRLIPEAIRRLKE
;
A 282791 
2 'polypeptide(L)' no no AWLFEA AWLFEA B ?      
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   ASP n 
1 5   LYS n 
1 6   ILE n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  HIS n 
1 12  HIS n 
1 13  MET n 
1 14  LYS n 
1 15  GLU n 
1 16  ILE n 
1 17  ASP n 
1 18  GLU n 
1 19  LEU n 
1 20  THR n 
1 21  ILE n 
1 22  LYS n 
1 23  GLU n 
1 24  TYR n 
1 25  GLY n 
1 26  VAL n 
1 27  ASP n 
1 28  SER n 
1 29  ARG n 
1 30  ILE n 
1 31  LEU n 
1 32  MET n 
1 33  GLU n 
1 34  ARG n 
1 35  ALA n 
1 36  GLY n 
1 37  ILE n 
1 38  SER n 
1 39  VAL n 
1 40  VAL n 
1 41  LEU n 
1 42  ALA n 
1 43  MET n 
1 44  GLU n 
1 45  GLU n 
1 46  GLU n 
1 47  LEU n 
1 48  GLY n 
1 49  ASN n 
1 50  LEU n 
1 51  SER n 
1 52  ASP n 
1 53  TYR n 
1 54  ARG n 
1 55  PHE n 
1 56  LEU n 
1 57  VAL n 
1 58  LEU n 
1 59  CYS n 
1 60  GLY n 
1 61  GLY n 
1 62  GLY n 
1 63  ASN n 
1 64  ASN n 
1 65  GLY n 
1 66  GLY n 
1 67  ASP n 
1 68  GLY n 
1 69  PHE n 
1 70  VAL n 
1 71  VAL n 
1 72  ALA n 
1 73  ARG n 
1 74  ASN n 
1 75  LEU n 
1 76  LEU n 
1 77  GLY n 
1 78  VAL n 
1 79  VAL n 
1 80  LYS n 
1 81  ASP n 
1 82  VAL n 
1 83  LEU n 
1 84  VAL n 
1 85  VAL n 
1 86  PHE n 
1 87  LEU n 
1 88  GLY n 
1 89  LYS n 
1 90  LYS n 
1 91  LYS n 
1 92  THR n 
1 93  PRO n 
1 94  ASP n 
1 95  CYS n 
1 96  GLU n 
1 97  TYR n 
1 98  ASN n 
1 99  TYR n 
1 100 GLY n 
1 101 LEU n 
1 102 TYR n 
1 103 LYS n 
1 104 LYS n 
1 105 PHE n 
1 106 GLY n 
1 107 GLY n 
1 108 LYS n 
1 109 VAL n 
1 110 VAL n 
1 111 GLU n 
1 112 GLN n 
1 113 PHE n 
1 114 GLU n 
1 115 PRO n 
1 116 SER n 
1 117 ILE n 
1 118 LEU n 
1 119 ASN n 
1 120 GLU n 
1 121 PHE n 
1 122 ASP n 
1 123 VAL n 
1 124 VAL n 
1 125 VAL n 
1 126 ASP n 
1 127 ALA n 
1 128 ILE n 
1 129 PHE n 
1 130 GLY n 
1 131 THR n 
1 132 GLY n 
1 133 LEU n 
1 134 ARG n 
1 135 GLY n 
1 136 GLU n 
1 137 ILE n 
1 138 THR n 
1 139 GLY n 
1 140 GLU n 
1 141 TYR n 
1 142 ALA n 
1 143 GLU n 
1 144 ILE n 
1 145 ILE n 
1 146 ASN n 
1 147 LEU n 
1 148 VAL n 
1 149 ASN n 
1 150 LYS n 
1 151 SER n 
1 152 GLY n 
1 153 LYS n 
1 154 VAL n 
1 155 VAL n 
1 156 VAL n 
1 157 SER n 
1 158 VAL n 
1 159 ASP n 
1 160 VAL n 
1 161 PRO n 
1 162 SER n 
1 163 GLY n 
1 164 ILE n 
1 165 ASP n 
1 166 SER n 
1 167 ASN n 
1 168 THR n 
1 169 GLY n 
1 170 LYS n 
1 171 VAL n 
1 172 LEU n 
1 173 ARG n 
1 174 THR n 
1 175 ALA n 
1 176 VAL n 
1 177 LYS n 
1 178 ALA n 
1 179 ASP n 
1 180 LEU n 
1 181 THR n 
1 182 VAL n 
1 183 THR n 
1 184 PHE n 
1 185 GLY n 
1 186 VAL n 
1 187 PRO n 
1 188 LYS n 
1 189 ILE n 
1 190 GLY n 
1 191 HIS n 
1 192 ILE n 
1 193 LEU n 
1 194 PHE n 
1 195 PRO n 
1 196 GLY n 
1 197 ARG n 
1 198 ASP n 
1 199 LEU n 
1 200 THR n 
1 201 GLY n 
1 202 LYS n 
1 203 LEU n 
1 204 LYS n 
1 205 VAL n 
1 206 ALA n 
1 207 ASN n 
1 208 ILE n 
1 209 GLY n 
1 210 HIS n 
1 211 PRO n 
1 212 VAL n 
1 213 HIS n 
1 214 LEU n 
1 215 ILE n 
1 216 ASN n 
1 217 SER n 
1 218 ILE n 
1 219 ASN n 
1 220 ARG n 
1 221 TYR n 
1 222 VAL n 
1 223 ILE n 
1 224 THR n 
1 225 ARG n 
1 226 GLU n 
1 227 MET n 
1 228 VAL n 
1 229 ARG n 
1 230 SER n 
1 231 LEU n 
1 232 LEU n 
1 233 PRO n 
1 234 GLU n 
1 235 ARG n 
1 236 PRO n 
1 237 ARG n 
1 238 ASP n 
1 239 SER n 
1 240 HIS n 
1 241 LYS n 
1 242 GLY n 
1 243 THR n 
1 244 TYR n 
1 245 GLY n 
1 246 LYS n 
1 247 VAL n 
1 248 LEU n 
1 249 ILE n 
1 250 ILE n 
1 251 ALA n 
1 252 GLY n 
1 253 SER n 
1 254 ARG n 
1 255 LEU n 
1 256 TYR n 
1 257 SER n 
1 258 GLY n 
1 259 ALA n 
1 260 PRO n 
1 261 VAL n 
1 262 LEU n 
1 263 SER n 
1 264 GLY n 
1 265 MET n 
1 266 GLY n 
1 267 SER n 
1 268 LEU n 
1 269 LYS n 
1 270 VAL n 
1 271 GLY n 
1 272 THR n 
1 273 GLY n 
1 274 LEU n 
1 275 VAL n 
1 276 LYS n 
1 277 LEU n 
1 278 ALA n 
1 279 VAL n 
1 280 PRO n 
1 281 PHE n 
1 282 PRO n 
1 283 GLN n 
1 284 ASN n 
1 285 LEU n 
1 286 ILE n 
1 287 ALA n 
1 288 THR n 
1 289 SER n 
1 290 ARG n 
1 291 PHE n 
1 292 PRO n 
1 293 GLU n 
1 294 LEU n 
1 295 ILE n 
1 296 SER n 
1 297 VAL n 
1 298 PRO n 
1 299 ILE n 
1 300 ASP n 
1 301 THR n 
1 302 GLU n 
1 303 LYS n 
1 304 GLY n 
1 305 PHE n 
1 306 PHE n 
1 307 SER n 
1 308 LEU n 
1 309 GLN n 
1 310 ASN n 
1 311 LEU n 
1 312 GLN n 
1 313 GLU n 
1 314 CYS n 
1 315 LEU n 
1 316 GLU n 
1 317 LEU n 
1 318 SER n 
1 319 LYS n 
1 320 ASP n 
1 321 VAL n 
1 322 ASP n 
1 323 VAL n 
1 324 VAL n 
1 325 ALA n 
1 326 ILE n 
1 327 GLY n 
1 328 PRO n 
1 329 GLY n 
1 330 LEU n 
1 331 GLY n 
1 332 ASN n 
1 333 ASN n 
1 334 GLU n 
1 335 HIS n 
1 336 VAL n 
1 337 ARG n 
1 338 GLU n 
1 339 PHE n 
1 340 VAL n 
1 341 ASN n 
1 342 GLU n 
1 343 PHE n 
1 344 LEU n 
1 345 LYS n 
1 346 THR n 
1 347 LEU n 
1 348 GLU n 
1 349 LYS n 
1 350 PRO n 
1 351 ALA n 
1 352 VAL n 
1 353 ILE n 
1 354 ASP n 
1 355 ALA n 
1 356 ASP n 
1 357 ALA n 
1 358 ILE n 
1 359 ASN n 
1 360 VAL n 
1 361 LEU n 
1 362 ASP n 
1 363 THR n 
1 364 SER n 
1 365 VAL n 
1 366 LEU n 
1 367 LYS n 
1 368 GLU n 
1 369 ARG n 
1 370 LYS n 
1 371 SER n 
1 372 PRO n 
1 373 ALA n 
1 374 VAL n 
1 375 LEU n 
1 376 THR n 
1 377 PRO n 
1 378 HIS n 
1 379 PRO n 
1 380 GLY n 
1 381 GLU n 
1 382 MET n 
1 383 ALA n 
1 384 ARG n 
1 385 LEU n 
1 386 VAL n 
1 387 LYS n 
1 388 LYS n 
1 389 THR n 
1 390 VAL n 
1 391 GLY n 
1 392 ASP n 
1 393 VAL n 
1 394 LYS n 
1 395 TYR n 
1 396 ASN n 
1 397 TYR n 
1 398 GLU n 
1 399 LEU n 
1 400 ALA n 
1 401 GLU n 
1 402 GLU n 
1 403 PHE n 
1 404 ALA n 
1 405 LYS n 
1 406 GLU n 
1 407 ASN n 
1 408 ASP n 
1 409 CYS n 
1 410 VAL n 
1 411 LEU n 
1 412 VAL n 
1 413 LEU n 
1 414 LYS n 
1 415 SER n 
1 416 ALA n 
1 417 THR n 
1 418 THR n 
1 419 ILE n 
1 420 VAL n 
1 421 THR n 
1 422 ASP n 
1 423 GLY n 
1 424 GLU n 
1 425 LYS n 
1 426 THR n 
1 427 LEU n 
1 428 PHE n 
1 429 ASN n 
1 430 ILE n 
1 431 THR n 
1 432 GLY n 
1 433 ASN n 
1 434 THR n 
1 435 GLY n 
1 436 LEU n 
1 437 SER n 
1 438 LYS n 
1 439 GLY n 
1 440 GLY n 
1 441 SER n 
1 442 GLY n 
1 443 ASP n 
1 444 VAL n 
1 445 LEU n 
1 446 THR n 
1 447 GLY n 
1 448 MET n 
1 449 ILE n 
1 450 ALA n 
1 451 GLY n 
1 452 PHE n 
1 453 ILE n 
1 454 ALA n 
1 455 GLN n 
1 456 GLY n 
1 457 LEU n 
1 458 SER n 
1 459 PRO n 
1 460 LEU n 
1 461 GLU n 
1 462 ALA n 
1 463 SER n 
1 464 THR n 
1 465 VAL n 
1 466 SER n 
1 467 VAL n 
1 468 TYR n 
1 469 LEU n 
1 470 HIS n 
1 471 GLY n 
1 472 PHE n 
1 473 ALA n 
1 474 ALA n 
1 475 GLU n 
1 476 LEU n 
1 477 PHE n 
1 478 GLU n 
1 479 GLN n 
1 480 ASP n 
1 481 GLU n 
1 482 ARG n 
1 483 GLY n 
1 484 LEU n 
1 485 THR n 
1 486 ALA n 
1 487 SER n 
1 488 GLU n 
1 489 LEU n 
1 490 LEU n 
1 491 ARG n 
1 492 LEU n 
1 493 ILE n 
1 494 PRO n 
1 495 GLU n 
1 496 ALA n 
1 497 ILE n 
1 498 ARG n 
1 499 ARG n 
1 500 LEU n 
1 501 LYS n 
1 502 GLU n 
2 1   ALA n 
2 2   TRP n 
2 3   LEU n 
2 4   PHE n 
2 5   GLU n 
2 6   ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Thermotoga 
_entity_src_gen.pdbx_gene_src_gene                 'tm0922, TM_0922' 
_entity_src_gen.gene_src_species                   'Thermotoga maritima' 
_entity_src_gen.gene_src_strain                    MSB8 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermotoga maritima' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     243274 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pMH1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_entity_src_nat.entity_id                  2 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Escherichia coli' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      469008 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     'BL21(DE3)' 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    'Unknown peptide, probably from expression host' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q9X024_THEMA Q9X024 1 
;MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKT
PDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVL
RTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAG
SRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGN
NEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLV
LKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRL
IPEAIRRLKE
;
1 ? 
2 PDB 3RS9         3RS9   2 AWLFEA 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3RS9 A 13 ? 502 ? Q9X024 1 ? 490 ? 1 490 
2 2 3RS9 B 1  ? 6   ? 3RS9   3 ? 8   ? 3 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3RS9 MET A 1  ? UNP Q9X024 ? ? 'expression tag' -11 1  
1 3RS9 GLY A 2  ? UNP Q9X024 ? ? 'expression tag' -10 2  
1 3RS9 SER A 3  ? UNP Q9X024 ? ? 'expression tag' -9  3  
1 3RS9 ASP A 4  ? UNP Q9X024 ? ? 'expression tag' -8  4  
1 3RS9 LYS A 5  ? UNP Q9X024 ? ? 'expression tag' -7  5  
1 3RS9 ILE A 6  ? UNP Q9X024 ? ? 'expression tag' -6  6  
1 3RS9 HIS A 7  ? UNP Q9X024 ? ? 'expression tag' -5  7  
1 3RS9 HIS A 8  ? UNP Q9X024 ? ? 'expression tag' -4  8  
1 3RS9 HIS A 9  ? UNP Q9X024 ? ? 'expression tag' -3  9  
1 3RS9 HIS A 10 ? UNP Q9X024 ? ? 'expression tag' -2  10 
1 3RS9 HIS A 11 ? UNP Q9X024 ? ? 'expression tag' -1  11 
1 3RS9 HIS A 12 ? UNP Q9X024 ? ? 'expression tag' 0   12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                          ?                               'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE                         ?                               'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE                       ?                               'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                  ?                               'C4 H7 N O4'         133.103 
BA3 non-polymer         . "BIS(ADENOSINE)-5'-TRIPHOSPHATE" ?                               'C20 H27 N10 O16 P3' 756.407 
CYS 'L-peptide linking' y CYSTEINE                         ?                               'C3 H7 N O2 S'       121.158 
GLN 'L-peptide linking' y GLUTAMINE                        ?                               'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                  ?                               'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE                          ?                               'C2 H5 N O2'         75.067  
GOL non-polymer         . GLYCEROL                         'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'           92.094  
HIS 'L-peptide linking' y HISTIDINE                        ?                               'C6 H10 N3 O2 1'     156.162 
HOH non-polymer         . WATER                            ?                               'H2 O'               18.015  
ILE 'L-peptide linking' y ISOLEUCINE                       ?                               'C6 H13 N O2'        131.173 
K   non-polymer         . 'POTASSIUM ION'                  ?                               'K 1'                39.098  
LEU 'L-peptide linking' y LEUCINE                          ?                               'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE                           ?                               'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE                       ?                               'C5 H11 N O2 S'      149.211 
MG  non-polymer         . 'MAGNESIUM ION'                  ?                               'Mg 2'               24.305  
PHE 'L-peptide linking' y PHENYLALANINE                    ?                               'C9 H11 N O2'        165.189 
PRO 'L-peptide linking' y PROLINE                          ?                               'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE                           ?                               'C3 H7 N O3'         105.093 
THR 'L-peptide linking' y THREONINE                        ?                               'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                       ?                               'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE                         ?                               'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE                           ?                               'C5 H11 N O2'        117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3RS9 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.62 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   53.00 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    '0.1M Na Cacodylate, 1.6 M Na Citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.details                'BERYLLIUM LENSES' 
_diffrn_detector.pdbx_collection_date   2009-10-16 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DIAMOND [111]' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97872 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 21-ID-F' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-F 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97872 
# 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            2.10 
_reflns.number_obs                   34168 
_reflns.number_all                   34349 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.077 
_reflns.pdbx_Rsym_value              0.077 
_reflns.pdbx_netI_over_sigmaI        34.075 
_reflns.pdbx_redundancy              11.0 
_reflns.entry_id                     3RS9 
_reflns.B_iso_Wilson_estimate        32.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.14 
_reflns_shell.percent_possible_all   96.1 
_reflns_shell.Rmerge_I_obs           0.795 
_reflns_shell.pdbx_Rsym_value        0.795 
_reflns_shell.meanI_over_sigI_obs    2.143 
_reflns_shell.pdbx_redundancy        5.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3RS9 
_refine.ls_d_res_high                            2.103 
_refine.ls_d_res_low                             50.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.490 
_refine.ls_number_reflns_obs                     34168 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS   
 U VALUES      : RESIDUAL ONLY
;
_refine.ls_R_factor_obs                          0.159 
_refine.ls_R_factor_R_work                       0.158 
_refine.ls_R_factor_R_free                       0.193 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  1727 
_refine.B_iso_mean                               38.434 
_refine.aniso_B[1][1]                            -0.420 
_refine.aniso_B[2][2]                            -0.420 
_refine.aniso_B[3][3]                            0.840 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.967 
_refine.correlation_coeff_Fo_to_Fc_free          0.955 
_refine.pdbx_overall_ESU_R_Free                  0.145 
_refine.overall_SU_ML                            0.092 
_refine.overall_SU_B                             6.986 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.B_iso_max                                86.79 
_refine.B_iso_min                                20.78 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2AX3' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       0.166 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3777 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         66 
_refine_hist.number_atoms_solvent             132 
_refine_hist.number_atoms_total               3975 
_refine_hist.d_res_high                       2.103 
_refine_hist.d_res_low                        50.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       3904 0.020  0.022  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d         2627 0.000  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    5292 1.747  2.009  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      6457 4.203  3.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 494  6.020  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 152  37.354 24.539 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 684  14.685 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 21   16.953 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         621  0.107  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   4258 0.007  0.021  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     730  0.008  0.020  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            2446 0.881  1.500  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_other         1022 0.000  1.500  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           3947 1.643  2.000  ? ? 'X-RAY DIFFRACTION' 
r_scbond_it            1458 2.973  3.000  ? ? 'X-RAY DIFFRACTION' 
r_scangle_it           1345 4.807  4.500  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.103 
_refine_ls_shell.d_res_low                        2.158 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               95.220 
_refine_ls_shell.number_reflns_R_work             2239 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.203 
_refine_ls_shell.R_factor_R_free                  0.247 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             111 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2350 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3RS9 
_struct.title                     
;Crystal structure of tm0922, a fusion of a domain of unknown function and ADP/ATP-dependent NAD(P)H-hydrate dehydratase from Thermotoga maritima in complex with P1,P3-Di(adenosine-5') triphosphate
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3RS9 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            'Unknown function, ADP/ATP-dependent NAD(P)H-hydrate dehydratase, LYASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS A 12  ? GLU A 23  ? HIS A 0   GLU A 11  1 ? 12 
HELX_P HELX_P2  2  ASP A 27  ? GLY A 48  ? ASP A 15  GLY A 36  1 ? 22 
HELX_P HELX_P3  3  GLY A 62  ? LEU A 76  ? GLY A 50  LEU A 64  1 ? 15 
HELX_P HELX_P4  4  THR A 92  ? PHE A 105 ? THR A 80  PHE A 93  1 ? 14 
HELX_P HELX_P5  5  GLU A 114 ? PHE A 121 ? GLU A 102 PHE A 109 5 ? 8  
HELX_P HELX_P6  6  THR A 138 ? SER A 151 ? THR A 126 SER A 139 1 ? 14 
HELX_P HELX_P7  7  LYS A 188 ? LEU A 193 ? LYS A 176 LEU A 181 1 ? 6  
HELX_P HELX_P8  8  PRO A 195 ? GLY A 201 ? PRO A 183 GLY A 189 1 ? 7  
HELX_P HELX_P9  9  PRO A 211 ? ASN A 216 ? PRO A 199 ASN A 204 1 ? 6  
HELX_P HELX_P10 10 THR A 224 ? LEU A 232 ? THR A 212 LEU A 220 1 ? 9  
HELX_P HELX_P11 11 HIS A 240 ? TYR A 244 ? HIS A 228 TYR A 232 5 ? 5  
HELX_P HELX_P12 12 GLY A 258 ? VAL A 270 ? GLY A 246 VAL A 258 1 ? 13 
HELX_P HELX_P13 13 GLN A 283 ? PHE A 291 ? GLN A 271 PHE A 279 1 ? 9  
HELX_P HELX_P14 14 SER A 307 ? GLN A 309 ? SER A 295 GLN A 297 5 ? 3  
HELX_P HELX_P15 15 ASN A 310 ? ASP A 320 ? ASN A 298 ASP A 308 1 ? 11 
HELX_P HELX_P16 16 ASN A 333 ? LEU A 347 ? ASN A 321 LEU A 335 1 ? 15 
HELX_P HELX_P17 17 ASP A 354 ? VAL A 360 ? ASP A 342 VAL A 348 1 ? 7  
HELX_P HELX_P18 18 ASP A 362 ? ARG A 369 ? ASP A 350 ARG A 357 1 ? 8  
HELX_P HELX_P19 19 HIS A 378 ? LYS A 387 ? HIS A 366 LYS A 375 1 ? 10 
HELX_P HELX_P20 20 THR A 389 ? LYS A 394 ? THR A 377 LYS A 382 1 ? 6  
HELX_P HELX_P21 21 ASN A 396 ? ASP A 408 ? ASN A 384 ASP A 396 1 ? 13 
HELX_P HELX_P22 22 ASN A 433 ? SER A 437 ? ASN A 421 SER A 425 5 ? 5  
HELX_P HELX_P23 23 GLY A 440 ? GLN A 455 ? GLY A 428 GLN A 443 1 ? 16 
HELX_P HELX_P24 24 SER A 458 ? LEU A 476 ? SER A 446 LEU A 464 1 ? 19 
HELX_P HELX_P25 25 ASP A 480 ? LEU A 484 ? ASP A 468 LEU A 472 5 ? 5  
HELX_P HELX_P26 26 THR A 485 ? LYS A 501 ? THR A 473 LYS A 489 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A ASN 64  OD1 ? ? ? 1_555 C K   . K   ? ? A ASN 52  A K   491 1_555 ? ? ? ? ? ? ? 2.881 ? ? 
metalc2  metalc ? ? A ASP 126 O   ? ? ? 1_555 C K   . K   ? ? A ASP 114 A K   491 1_555 ? ? ? ? ? ? ? 2.946 ? ? 
metalc3  metalc ? ? A ASP 126 OD2 ? ? ? 1_555 C K   . K   ? ? A ASP 114 A K   491 1_555 ? ? ? ? ? ? ? 3.394 ? ? 
metalc4  metalc ? ? A ASP 126 OD1 ? ? ? 1_555 C K   . K   ? ? A ASP 114 A K   491 1_555 ? ? ? ? ? ? ? 3.497 ? ? 
metalc5  metalc ? ? A PHE 129 O   ? ? ? 1_555 C K   . K   ? ? A PHE 117 A K   491 1_555 ? ? ? ? ? ? ? 2.914 ? ? 
metalc6  metalc ? ? A VAL 158 O   ? ? ? 1_555 C K   . K   ? ? A VAL 146 A K   491 1_555 ? ? ? ? ? ? ? 2.922 ? ? 
metalc7  metalc ? ? A VAL 160 O   ? ? ? 1_555 C K   . K   ? ? A VAL 148 A K   491 1_555 ? ? ? ? ? ? ? 2.838 ? ? 
metalc8  metalc ? ? A SER 162 OG  ? ? ? 1_555 C K   . K   ? ? A SER 150 A K   491 1_555 ? ? ? ? ? ? ? 2.955 ? ? 
metalc9  metalc ? ? D MG  .   MG  ? ? ? 1_555 F BA3 . O2G ? ? A MG  492 A BA3 494 1_555 ? ? ? ? ? ? ? 2.208 ? ? 
metalc10 metalc ? ? D MG  .   MG  ? ? ? 1_555 H HOH . O   ? ? A MG  492 A HOH 573 1_555 ? ? ? ? ? ? ? 2.413 ? ? 
metalc11 metalc ? ? D MG  .   MG  ? ? ? 1_555 H HOH . O   ? ? A MG  492 A HOH 574 1_555 ? ? ? ? ? ? ? 2.302 ? ? 
metalc12 metalc ? ? D MG  .   MG  ? ? ? 1_555 H HOH . O   ? ? A MG  492 A HOH 579 1_555 ? ? ? ? ? ? ? 2.240 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 194 A . ? PHE 182 A PRO 195 A ? PRO 183 A 1 5.31 
2 PHE 281 A . ? PHE 269 A PRO 282 A ? PRO 270 A 1 0.40 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8  ? 
B ? 10 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? parallel      
A 2 3  ? parallel      
A 3 4  ? parallel      
A 4 5  ? parallel      
A 5 6  ? parallel      
A 6 7  ? parallel      
A 7 8  ? anti-parallel 
B 1 2  ? parallel      
B 2 3  ? anti-parallel 
B 3 4  ? anti-parallel 
B 4 5  ? parallel      
B 5 6  ? parallel      
B 6 7  ? parallel      
B 7 8  ? parallel      
B 8 9  ? parallel      
B 9 10 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  VAL A 109 ? VAL A 110 ? VAL A 97  VAL A 98  
A 2  ASP A 81  ? PHE A 86  ? ASP A 69  PHE A 74  
A 3  ARG A 54  ? CYS A 59  ? ARG A 42  CYS A 47  
A 4  VAL A 123 ? ALA A 127 ? VAL A 111 ALA A 115 
A 5  VAL A 154 ? VAL A 158 ? VAL A 142 VAL A 146 
A 6  LEU A 180 ? PHE A 184 ? LEU A 168 PHE A 172 
A 7  LYS A 202 ? ALA A 206 ? LYS A 190 ALA A 194 
A 8  PHE B 4   ? GLU B 5   ? PHE B 6   GLU B 7   
B 1  ARG A 220 ? VAL A 222 ? ARG A 208 VAL A 210 
B 2  THR A 426 ? ASN A 429 ? THR A 414 ASN A 417 
B 3  THR A 418 ? THR A 421 ? THR A 406 THR A 409 
B 4  VAL A 410 ? LEU A 413 ? VAL A 398 LEU A 401 
B 5  ALA A 373 ? LEU A 375 ? ALA A 361 LEU A 363 
B 6  ALA A 351 ? ILE A 353 ? ALA A 339 ILE A 341 
B 7  VAL A 323 ? ILE A 326 ? VAL A 311 ILE A 314 
B 8  LYS A 246 ? ILE A 250 ? LYS A 234 ILE A 238 
B 9  LEU A 274 ? PRO A 280 ? LEU A 262 PRO A 268 
B 10 ILE A 295 ? ILE A 299 ? ILE A 283 ILE A 287 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  O VAL A 110 ? O VAL A 98  N PHE A 86  ? N PHE A 74  
A 2 3  O ASP A 81  ? O ASP A 69  N PHE A 55  ? N PHE A 43  
A 3 4  N LEU A 56  ? N LEU A 44  O VAL A 125 ? O VAL A 113 
A 4 5  N ASP A 126 ? N ASP A 114 O VAL A 156 ? O VAL A 144 
A 5 6  N SER A 157 ? N SER A 145 O LEU A 180 ? O LEU A 168 
A 6 7  N THR A 183 ? N THR A 171 O ALA A 206 ? O ALA A 194 
A 7 8  N VAL A 205 ? N VAL A 193 O GLU B 5   ? O GLU B 7   
B 1 2  N TYR A 221 ? N TYR A 209 O PHE A 428 ? O PHE A 416 
B 2 3  O ASN A 429 ? O ASN A 417 N THR A 418 ? N THR A 406 
B 3 4  O THR A 421 ? O THR A 409 N LEU A 411 ? N LEU A 399 
B 4 5  O VAL A 412 ? O VAL A 400 N LEU A 375 ? N LEU A 363 
B 5 6  O VAL A 374 ? O VAL A 362 N ILE A 353 ? N ILE A 341 
B 6 7  O VAL A 352 ? O VAL A 340 N ILE A 326 ? N ILE A 314 
B 7 8  O ALA A 325 ? O ALA A 313 N ILE A 250 ? N ILE A 238 
B 8 9  N ILE A 249 ? N ILE A 237 O ALA A 278 ? O ALA A 266 
B 9 10 N LEU A 277 ? N LEU A 265 O VAL A 297 ? O VAL A 285 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A K   491 ? 6  'BINDING SITE FOR RESIDUE K A 491'   
AC2 Software A MG  492 ? 4  'BINDING SITE FOR RESIDUE MG A 492'  
AC3 Software A BA3 493 ? 16 'BINDING SITE FOR RESIDUE BA3 A 493' 
AC4 Software A BA3 494 ? 23 'BINDING SITE FOR RESIDUE BA3 A 494' 
AC5 Software A GOL 495 ? 3  'BINDING SITE FOR RESIDUE GOL A 495' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  ASN A 64  ? ASN A 52  . ? 1_555  ? 
2  AC1 6  ASP A 126 ? ASP A 114 . ? 1_555  ? 
3  AC1 6  PHE A 129 ? PHE A 117 . ? 1_555  ? 
4  AC1 6  VAL A 158 ? VAL A 146 . ? 1_555  ? 
5  AC1 6  VAL A 160 ? VAL A 148 . ? 1_555  ? 
6  AC1 6  SER A 162 ? SER A 150 . ? 1_555  ? 
7  AC2 4  BA3 F .   ? BA3 A 494 . ? 1_555  ? 
8  AC2 4  HOH H .   ? HOH A 573 . ? 1_555  ? 
9  AC2 4  HOH H .   ? HOH A 574 . ? 1_555  ? 
10 AC2 4  HOH H .   ? HOH A 579 . ? 1_555  ? 
11 AC3 16 LYS A 14  ? LYS A 2   . ? 1_555  ? 
12 AC3 16 GLY A 62  ? GLY A 50  . ? 1_555  ? 
13 AC3 16 ASN A 63  ? ASN A 51  . ? 1_555  ? 
14 AC3 16 ASN A 64  ? ASN A 52  . ? 1_555  ? 
15 AC3 16 PHE A 129 ? PHE A 117 . ? 1_555  ? 
16 AC3 16 GLY A 130 ? GLY A 118 . ? 1_555  ? 
17 AC3 16 THR A 131 ? THR A 119 . ? 1_555  ? 
18 AC3 16 GLY A 132 ? GLY A 120 . ? 1_555  ? 
19 AC3 16 ARG A 134 ? ARG A 122 . ? 1_555  ? 
20 AC3 16 GLY A 135 ? GLY A 123 . ? 1_555  ? 
21 AC3 16 GLU A 136 ? GLU A 124 . ? 1_555  ? 
22 AC3 16 TYR A 141 ? TYR A 129 . ? 1_555  ? 
23 AC3 16 LYS A 387 ? LYS A 375 . ? 15_455 ? 
24 AC3 16 HOH H .   ? HOH A 502 . ? 1_555  ? 
25 AC3 16 HOH H .   ? HOH A 522 . ? 1_555  ? 
26 AC3 16 HOH H .   ? HOH A 582 . ? 1_555  ? 
27 AC4 23 ARG A 237 ? ARG A 225 . ? 3_555  ? 
28 AC4 23 SER A 239 ? SER A 227 . ? 3_555  ? 
29 AC4 23 LYS A 241 ? LYS A 229 . ? 3_555  ? 
30 AC4 23 HIS A 378 ? HIS A 366 . ? 1_555  ? 
31 AC4 23 LYS A 414 ? LYS A 402 . ? 1_555  ? 
32 AC4 23 SER A 415 ? SER A 403 . ? 1_555  ? 
33 AC4 23 ALA A 416 ? ALA A 404 . ? 1_555  ? 
34 AC4 23 THR A 418 ? THR A 406 . ? 1_555  ? 
35 AC4 23 ASN A 433 ? ASN A 421 . ? 1_555  ? 
36 AC4 23 THR A 434 ? THR A 422 . ? 1_555  ? 
37 AC4 23 LEU A 436 ? LEU A 424 . ? 1_555  ? 
38 AC4 23 SER A 437 ? SER A 425 . ? 1_555  ? 
39 AC4 23 LYS A 438 ? LYS A 426 . ? 1_555  ? 
40 AC4 23 GLY A 439 ? GLY A 427 . ? 1_555  ? 
41 AC4 23 GLY A 440 ? GLY A 428 . ? 1_555  ? 
42 AC4 23 SER A 441 ? SER A 429 . ? 1_555  ? 
43 AC4 23 GLY A 442 ? GLY A 430 . ? 1_555  ? 
44 AC4 23 ASP A 443 ? ASP A 431 . ? 1_555  ? 
45 AC4 23 HIS A 470 ? HIS A 458 . ? 1_555  ? 
46 AC4 23 MG  D .   ? MG  A 492 . ? 1_555  ? 
47 AC4 23 HOH H .   ? HOH A 523 . ? 1_555  ? 
48 AC4 23 HOH H .   ? HOH A 573 . ? 1_555  ? 
49 AC4 23 HOH H .   ? HOH A 622 . ? 1_555  ? 
50 AC5 3  ASP A 17  ? ASP A 5   . ? 1_555  ? 
51 AC5 3  MET A 32  ? MET A 20  . ? 1_555  ? 
52 AC5 3  ASP A 67  ? ASP A 55  . ? 1_555  ? 
# 
_atom_sites.entry_id                    3RS9 
_atom_sites.fract_transf_matrix[1][1]   0.008192 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008192 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006439 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
K  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . HIS A 1 12  ? 1.580   49.216 23.252  1.00 78.88 ? 0   HIS A N   1 
ATOM   2    C  CA  . HIS A 1 12  ? 0.487   48.833 22.337  1.00 74.89 ? 0   HIS A CA  1 
ATOM   3    C  C   . HIS A 1 12  ? 0.868   48.986 20.881  1.00 69.53 ? 0   HIS A C   1 
ATOM   4    O  O   . HIS A 1 12  ? 1.743   49.780 20.507  1.00 67.30 ? 0   HIS A O   1 
ATOM   5    N  N   . MET A 1 13  ? 0.188   48.211 20.047  1.00 67.08 ? 1   MET A N   1 
ATOM   6    C  CA  . MET A 1 13  ? 0.220   48.404 18.613  1.00 62.64 ? 1   MET A CA  1 
ATOM   7    C  C   . MET A 1 13  ? -0.226  49.812 18.163  1.00 60.67 ? 1   MET A C   1 
ATOM   8    O  O   . MET A 1 13  ? 0.166   50.267 17.102  1.00 56.58 ? 1   MET A O   1 
ATOM   9    C  CB  . MET A 1 13  ? -0.680  47.372 17.905  1.00 61.34 ? 1   MET A CB  1 
ATOM   10   C  CG  . MET A 1 13  ? -0.006  46.090 17.493  1.00 62.45 ? 1   MET A CG  1 
ATOM   11   S  SD  . MET A 1 13  ? 1.438   46.293 16.417  1.00 64.24 ? 1   MET A SD  1 
ATOM   12   C  CE  . MET A 1 13  ? 2.680   45.700 17.564  1.00 65.10 ? 1   MET A CE  1 
ATOM   13   N  N   . LYS A 1 14  ? -1.073  50.495 18.935  1.00 63.77 ? 2   LYS A N   1 
ATOM   14   C  CA  . LYS A 1 14  ? -1.472  51.849 18.539  1.00 63.35 ? 2   LYS A CA  1 
ATOM   15   C  C   . LYS A 1 14  ? -0.191  52.724 18.454  1.00 61.49 ? 2   LYS A C   1 
ATOM   16   O  O   . LYS A 1 14  ? -0.017  53.505 17.508  1.00 59.01 ? 2   LYS A O   1 
ATOM   17   C  CB  . LYS A 1 14  ? -2.513  52.418 19.504  1.00 68.84 ? 2   LYS A CB  1 
ATOM   18   C  CG  . LYS A 1 14  ? -3.163  53.728 19.037  1.00 71.83 ? 2   LYS A CG  1 
ATOM   19   C  CD  . LYS A 1 14  ? -3.130  54.778 20.153  1.00 79.50 ? 2   LYS A CD  1 
ATOM   20   C  CE  . LYS A 1 14  ? -4.123  55.881 19.904  1.00 83.08 ? 2   LYS A CE  1 
ATOM   21   N  NZ  . LYS A 1 14  ? -5.490  55.373 20.158  1.00 86.79 ? 2   LYS A NZ  1 
ATOM   22   N  N   . GLU A 1 15  ? 0.722   52.529 19.406  1.00 62.69 ? 3   GLU A N   1 
ATOM   23   C  CA  . GLU A 1 15  ? 2.006   53.222 19.411  1.00 62.08 ? 3   GLU A CA  1 
ATOM   24   C  C   . GLU A 1 15  ? 2.934   52.762 18.299  1.00 56.44 ? 3   GLU A C   1 
ATOM   25   O  O   . GLU A 1 15  ? 3.718   53.546 17.767  1.00 54.40 ? 3   GLU A O   1 
ATOM   26   C  CB  . GLU A 1 15  ? 2.694   52.996 20.742  1.00 67.24 ? 3   GLU A CB  1 
ATOM   27   C  CG  . GLU A 1 15  ? 3.874   53.913 20.971  1.00 72.12 ? 3   GLU A CG  1 
ATOM   28   C  CD  . GLU A 1 15  ? 4.708   53.479 22.171  1.00 80.42 ? 3   GLU A CD  1 
ATOM   29   O  OE1 . GLU A 1 15  ? 4.117   53.074 23.210  1.00 85.02 ? 3   GLU A OE1 1 
ATOM   30   O  OE2 . GLU A 1 15  ? 5.959   53.540 22.058  1.00 83.25 ? 3   GLU A OE2 1 
ATOM   31   N  N   . ILE A 1 16  ? 2.853   51.483 17.965  1.00 53.52 ? 4   ILE A N   1 
ATOM   32   C  CA  . ILE A 1 16  ? 3.673   50.911 16.904  1.00 49.85 ? 4   ILE A CA  1 
ATOM   33   C  C   . ILE A 1 16  ? 3.218   51.439 15.567  1.00 46.19 ? 4   ILE A C   1 
ATOM   34   O  O   . ILE A 1 16  ? 4.054   51.823 14.743  1.00 44.40 ? 4   ILE A O   1 
ATOM   35   C  CB  . ILE A 1 16  ? 3.662   49.374 16.925  1.00 50.39 ? 4   ILE A CB  1 
ATOM   36   C  CG1 . ILE A 1 16  ? 4.263   48.862 18.257  1.00 56.51 ? 4   ILE A CG1 1 
ATOM   37   C  CG2 . ILE A 1 16  ? 4.411   48.783 15.757  1.00 47.33 ? 4   ILE A CG2 1 
ATOM   38   C  CD1 . ILE A 1 16  ? 5.543   49.513 18.649  1.00 57.83 ? 4   ILE A CD1 1 
ATOM   39   N  N   . ASP A 1 17  ? 1.910   51.470 15.347  1.00 44.68 ? 5   ASP A N   1 
ATOM   40   C  CA  . ASP A 1 17  ? 1.384   52.138 14.173  1.00 42.75 ? 5   ASP A CA  1 
ATOM   41   C  C   . ASP A 1 17  ? 1.886   53.612 14.079  1.00 42.54 ? 5   ASP A C   1 
ATOM   42   O  O   . ASP A 1 17  ? 2.355   54.025 13.004  1.00 40.54 ? 5   ASP A O   1 
ATOM   43   C  CB  . ASP A 1 17  ? -0.142  52.147 14.171  1.00 44.51 ? 5   ASP A CB  1 
ATOM   44   C  CG  . ASP A 1 17  ? -0.761  50.771 13.893  1.00 46.76 ? 5   ASP A CG  1 
ATOM   45   O  OD1 . ASP A 1 17  ? -0.139  49.899 13.233  1.00 48.39 ? 5   ASP A OD1 1 
ATOM   46   O  OD2 . ASP A 1 17  ? -1.912  50.578 14.340  1.00 53.64 ? 5   ASP A OD2 1 
ATOM   47   N  N   . GLU A 1 18  ? 1.791   54.366 15.179  1.00 43.86 ? 6   GLU A N   1 
ATOM   48   C  CA  . GLU A 1 18  ? 2.135   55.793 15.154  1.00 45.80 ? 6   GLU A CA  1 
ATOM   49   C  C   . GLU A 1 18  ? 3.579   56.033 14.784  1.00 43.77 ? 6   GLU A C   1 
ATOM   50   O  O   . GLU A 1 18  ? 3.856   56.887 13.965  1.00 43.33 ? 6   GLU A O   1 
ATOM   51   C  CB  . GLU A 1 18  ? 1.866   56.513 16.476  1.00 50.06 ? 6   GLU A CB  1 
ATOM   52   C  CG  . GLU A 1 18  ? 0.422   56.788 16.739  1.00 56.41 ? 6   GLU A CG  1 
ATOM   53   C  CD  . GLU A 1 18  ? 0.187   57.300 18.155  1.00 65.59 ? 6   GLU A CD  1 
ATOM   54   O  OE1 . GLU A 1 18  ? 0.952   58.203 18.598  1.00 72.97 ? 6   GLU A OE1 1 
ATOM   55   O  OE2 . GLU A 1 18  ? -0.748  56.805 18.832  1.00 71.53 ? 6   GLU A OE2 1 
ATOM   56   N  N   . LEU A 1 19  ? 4.483   55.303 15.422  1.00 43.23 ? 7   LEU A N   1 
ATOM   57   C  CA  . LEU A 1 19  ? 5.877   55.412 15.125  1.00 43.20 ? 7   LEU A CA  1 
ATOM   58   C  C   . LEU A 1 19  ? 6.141   55.029 13.658  1.00 39.69 ? 7   LEU A C   1 
ATOM   59   O  O   . LEU A 1 19  ? 6.875   55.729 12.974  1.00 39.33 ? 7   LEU A O   1 
ATOM   60   C  CB  . LEU A 1 19  ? 6.685   54.553 16.068  1.00 44.55 ? 7   LEU A CB  1 
ATOM   61   C  CG  . LEU A 1 19  ? 6.680   55.063 17.525  1.00 51.02 ? 7   LEU A CG  1 
ATOM   62   C  CD1 . LEU A 1 19  ? 7.254   54.007 18.506  1.00 51.79 ? 7   LEU A CD1 1 
ATOM   63   C  CD2 . LEU A 1 19  ? 7.419   56.388 17.658  1.00 50.32 ? 7   LEU A CD2 1 
ATOM   64   N  N   . THR A 1 20  ? 5.500   53.957 13.178  1.00 36.88 ? 8   THR A N   1 
ATOM   65   C  CA  . THR A 1 20  ? 5.751   53.489 11.823  1.00 34.66 ? 8   THR A CA  1 
ATOM   66   C  C   . THR A 1 20  ? 5.351   54.569 10.804  1.00 34.69 ? 8   THR A C   1 
ATOM   67   O  O   . THR A 1 20  ? 6.063   54.805 9.833   1.00 34.47 ? 8   THR A O   1 
ATOM   68   C  CB  . THR A 1 20  ? 5.065   52.157 11.564  1.00 33.81 ? 8   THR A CB  1 
ATOM   69   O  OG1 . THR A 1 20  ? 5.509   51.175 12.511  1.00 31.28 ? 8   THR A OG1 1 
ATOM   70   C  CG2 . THR A 1 20  ? 5.346   51.677 10.166  1.00 31.37 ? 8   THR A CG2 1 
ATOM   71   N  N   . ILE A 1 21  ? 4.249   55.274 11.076  1.00 35.20 ? 9   ILE A N   1 
ATOM   72   C  CA  . ILE A 1 21  ? 3.837   56.399 10.229  1.00 36.43 ? 9   ILE A CA  1 
ATOM   73   C  C   . ILE A 1 21  ? 4.701   57.646 10.469  1.00 38.57 ? 9   ILE A C   1 
ATOM   74   O  O   . ILE A 1 21  ? 5.404   58.107 9.589   1.00 38.81 ? 9   ILE A O   1 
ATOM   75   C  CB  . ILE A 1 21  ? 2.354   56.716 10.434  1.00 37.60 ? 9   ILE A CB  1 
ATOM   76   C  CG1 . ILE A 1 21  ? 1.512   55.486 10.016  1.00 37.00 ? 9   ILE A CG1 1 
ATOM   77   C  CG2 . ILE A 1 21  ? 1.965   58.005 9.646   1.00 40.22 ? 9   ILE A CG2 1 
ATOM   78   C  CD1 . ILE A 1 21  ? 0.189   55.348 10.805  1.00 39.69 ? 9   ILE A CD1 1 
ATOM   79   N  N   . LYS A 1 22  ? 4.703   58.138 11.683  1.00 39.82 ? 10  LYS A N   1 
ATOM   80   C  CA  . LYS A 1 22  ? 5.323   59.421 11.965  1.00 43.58 ? 10  LYS A CA  1 
ATOM   81   C  C   . LYS A 1 22  ? 6.859   59.419 11.919  1.00 43.79 ? 10  LYS A C   1 
ATOM   82   O  O   . LYS A 1 22  ? 7.445   60.391 11.489  1.00 45.00 ? 10  LYS A O   1 
ATOM   83   C  CB  . LYS A 1 22  ? 4.863   59.971 13.329  1.00 46.10 ? 10  LYS A CB  1 
ATOM   84   C  CG  . LYS A 1 22  ? 5.658   61.254 13.689  1.00 54.13 ? 10  LYS A CG  1 
ATOM   85   C  CD  . LYS A 1 22  ? 5.235   61.955 14.971  1.00 59.94 ? 10  LYS A CD  1 
ATOM   86   C  CE  . LYS A 1 22  ? 6.248   63.028 15.335  1.00 63.16 ? 10  LYS A CE  1 
ATOM   87   N  NZ  . LYS A 1 22  ? 5.776   63.594 16.587  1.00 67.35 ? 10  LYS A NZ  1 
ATOM   88   N  N   . GLU A 1 23  ? 7.522   58.375 12.404  1.00 43.58 ? 11  GLU A N   1 
ATOM   89   C  CA  . GLU A 1 23  ? 8.999   58.394 12.443  1.00 46.36 ? 11  GLU A CA  1 
ATOM   90   C  C   . GLU A 1 23  ? 9.625   57.627 11.290  1.00 43.44 ? 11  GLU A C   1 
ATOM   91   O  O   . GLU A 1 23  ? 10.657  58.013 10.809  1.00 45.81 ? 11  GLU A O   1 
ATOM   92   C  CB  . GLU A 1 23  ? 9.537   57.809 13.749  1.00 49.35 ? 11  GLU A CB  1 
ATOM   93   C  CG  . GLU A 1 23  ? 8.837   58.302 15.028  1.00 56.19 ? 11  GLU A CG  1 
ATOM   94   C  CD  . GLU A 1 23  ? 9.315   59.633 15.565  1.00 66.75 ? 11  GLU A CD  1 
ATOM   95   O  OE1 . GLU A 1 23  ? 10.032  60.374 14.839  1.00 72.88 ? 11  GLU A OE1 1 
ATOM   96   O  OE2 . GLU A 1 23  ? 8.947   59.941 16.736  1.00 73.13 ? 11  GLU A OE2 1 
ATOM   97   N  N   . TYR A 1 24  ? 9.035   56.516 10.885  1.00 39.50 ? 12  TYR A N   1 
ATOM   98   C  CA  . TYR A 1 24  ? 9.608   55.701 9.817   1.00 38.81 ? 12  TYR A CA  1 
ATOM   99   C  C   . TYR A 1 24  ? 9.088   56.192 8.493   1.00 37.80 ? 12  TYR A C   1 
ATOM   100  O  O   . TYR A 1 24  ? 9.732   56.061 7.507   1.00 38.84 ? 12  TYR A O   1 
ATOM   101  C  CB  . TYR A 1 24  ? 9.354   54.187 10.009  1.00 37.27 ? 12  TYR A CB  1 
ATOM   102  C  CG  . TYR A 1 24  ? 10.224  53.574 11.086  1.00 38.00 ? 12  TYR A CG  1 
ATOM   103  C  CD1 . TYR A 1 24  ? 9.879   53.684 12.419  1.00 38.55 ? 12  TYR A CD1 1 
ATOM   104  C  CD2 . TYR A 1 24  ? 11.404  52.912 10.771  1.00 40.83 ? 12  TYR A CD2 1 
ATOM   105  C  CE1 . TYR A 1 24  ? 10.675  53.132 13.423  1.00 42.50 ? 12  TYR A CE1 1 
ATOM   106  C  CE2 . TYR A 1 24  ? 12.203  52.326 11.776  1.00 42.13 ? 12  TYR A CE2 1 
ATOM   107  C  CZ  . TYR A 1 24  ? 11.835  52.461 13.097  1.00 44.05 ? 12  TYR A CZ  1 
ATOM   108  O  OH  . TYR A 1 24  ? 12.609  51.915 14.100  1.00 46.70 ? 12  TYR A OH  1 
ATOM   109  N  N   . GLY A 1 25  ? 7.924   56.794 8.460   1.00 37.12 ? 13  GLY A N   1 
ATOM   110  C  CA  . GLY A 1 25  ? 7.522   57.455 7.207   1.00 37.05 ? 13  GLY A CA  1 
ATOM   111  C  C   . GLY A 1 25  ? 6.662   56.620 6.312   1.00 33.84 ? 13  GLY A C   1 
ATOM   112  O  O   . GLY A 1 25  ? 6.450   56.970 5.167   1.00 32.83 ? 13  GLY A O   1 
ATOM   113  N  N   . VAL A 1 26  ? 6.138   55.512 6.833   1.00 33.07 ? 14  VAL A N   1 
ATOM   114  C  CA  . VAL A 1 26  ? 5.223   54.680 6.048   1.00 31.14 ? 14  VAL A CA  1 
ATOM   115  C  C   . VAL A 1 26  ? 3.871   55.350 6.022   1.00 31.76 ? 14  VAL A C   1 
ATOM   116  O  O   . VAL A 1 26  ? 3.300   55.610 7.070   1.00 33.10 ? 14  VAL A O   1 
ATOM   117  C  CB  . VAL A 1 26  ? 5.053   53.253 6.656   1.00 31.63 ? 14  VAL A CB  1 
ATOM   118  C  CG1 . VAL A 1 26  ? 4.107   52.394 5.785   1.00 28.98 ? 14  VAL A CG1 1 
ATOM   119  C  CG2 . VAL A 1 26  ? 6.405   52.587 6.814   1.00 29.27 ? 14  VAL A CG2 1 
ATOM   120  N  N   . ASP A 1 27  ? 3.341   55.621 4.844   1.00 32.15 ? 15  ASP A N   1 
ATOM   121  C  CA  . ASP A 1 27  ? 2.019   56.243 4.700   1.00 33.90 ? 15  ASP A CA  1 
ATOM   122  C  C   . ASP A 1 27  ? 0.969   55.366 5.393   1.00 31.70 ? 15  ASP A C   1 
ATOM   123  O  O   . ASP A 1 27  ? 0.980   54.136 5.213   1.00 30.31 ? 15  ASP A O   1 
ATOM   124  C  CB  . ASP A 1 27  ? 1.652   56.431 3.199   1.00 35.94 ? 15  ASP A CB  1 
ATOM   125  C  CG  . ASP A 1 27  ? 0.438   57.350 2.979   1.00 40.45 ? 15  ASP A CG  1 
ATOM   126  O  OD1 . ASP A 1 27  ? -0.722  57.031 3.342   1.00 39.83 ? 15  ASP A OD1 1 
ATOM   127  O  OD2 . ASP A 1 27  ? 0.635   58.415 2.391   1.00 50.89 ? 15  ASP A OD2 1 
ATOM   128  N  N   . SER A 1 28  ? 0.063   55.990 6.161   1.00 31.29 ? 16  SER A N   1 
ATOM   129  C  CA  . SER A 1 28  ? -0.981  55.231 6.869   1.00 30.16 ? 16  SER A CA  1 
ATOM   130  C  C   . SER A 1 28  ? -1.854  54.473 5.838   1.00 29.73 ? 16  SER A C   1 
ATOM   131  O  O   . SER A 1 28  ? -2.345  53.391 6.112   1.00 30.33 ? 16  SER A O   1 
ATOM   132  C  CB  . SER A 1 28  ? -1.862  56.176 7.702   1.00 32.19 ? 16  SER A CB  1 
ATOM   133  O  OG  . SER A 1 28  ? -2.568  57.069 6.853   1.00 33.14 ? 16  SER A OG  1 
ATOM   134  N  N   . ARG A 1 29  ? -2.032  55.027 4.641   1.00 29.03 ? 17  ARG A N   1 
ATOM   135  C  CA  . ARG A 1 29  ? -2.761  54.307 3.629   1.00 29.66 ? 17  ARG A CA  1 
ATOM   136  C  C   . ARG A 1 29  ? -2.139  52.958 3.226   1.00 28.09 ? 17  ARG A C   1 
ATOM   137  O  O   . ARG A 1 29  ? -2.869  52.056 2.845   1.00 27.65 ? 17  ARG A O   1 
ATOM   138  C  CB  . ARG A 1 29  ? -2.978  55.204 2.410   1.00 33.60 ? 17  ARG A CB  1 
ATOM   139  C  CG  . ARG A 1 29  ? -4.013  56.310 2.714   1.00 38.97 ? 17  ARG A CG  1 
ATOM   140  C  CD  . ARG A 1 29  ? -4.225  57.250 1.564   1.00 44.22 ? 17  ARG A CD  1 
ATOM   141  N  NE  . ARG A 1 29  ? -2.999  57.954 1.329   1.00 47.02 ? 17  ARG A NE  1 
ATOM   142  C  CZ  . ARG A 1 29  ? -2.778  58.775 0.306   1.00 53.92 ? 17  ARG A CZ  1 
ATOM   143  N  NH1 . ARG A 1 29  ? -3.720  59.012 -0.611  1.00 54.48 ? 17  ARG A NH1 1 
ATOM   144  N  NH2 . ARG A 1 29  ? -1.598  59.375 0.221   1.00 55.90 ? 17  ARG A NH2 1 
ATOM   145  N  N   . ILE A 1 30  ? -0.809  52.879 3.243   1.00 27.94 ? 18  ILE A N   1 
ATOM   146  C  CA  . ILE A 1 30  ? -0.045  51.670 2.911   1.00 28.86 ? 18  ILE A CA  1 
ATOM   147  C  C   . ILE A 1 30  ? -0.281  50.562 3.951   1.00 27.78 ? 18  ILE A C   1 
ATOM   148  O  O   . ILE A 1 30  ? -0.533  49.413 3.576   1.00 28.27 ? 18  ILE A O   1 
ATOM   149  C  CB  . ILE A 1 30  ? 1.503   51.988 2.736   1.00 29.74 ? 18  ILE A CB  1 
ATOM   150  C  CG1 . ILE A 1 30  ? 1.737   52.789 1.447   1.00 35.55 ? 18  ILE A CG1 1 
ATOM   151  C  CG2 . ILE A 1 30  ? 2.349   50.713 2.652   1.00 30.33 ? 18  ILE A CG2 1 
ATOM   152  C  CD1 . ILE A 1 30  ? 3.066   53.564 1.397   1.00 37.31 ? 18  ILE A CD1 1 
ATOM   153  N  N   . LEU A 1 31  ? -0.195  50.921 5.229   1.00 26.81 ? 19  LEU A N   1 
ATOM   154  C  CA  . LEU A 1 31  ? -0.521  50.027 6.328   1.00 28.37 ? 19  LEU A CA  1 
ATOM   155  C  C   . LEU A 1 31  ? -1.948  49.531 6.189   1.00 26.86 ? 19  LEU A C   1 
ATOM   156  O  O   . LEU A 1 31  ? -2.204  48.345 6.341   1.00 26.09 ? 19  LEU A O   1 
ATOM   157  C  CB  . LEU A 1 31  ? -0.386  50.700 7.686   1.00 28.99 ? 19  LEU A CB  1 
ATOM   158  C  CG  . LEU A 1 31  ? 1.066   50.982 8.084   1.00 34.28 ? 19  LEU A CG  1 
ATOM   159  C  CD1 . LEU A 1 31  ? 1.107   51.617 9.517   1.00 32.06 ? 19  LEU A CD1 1 
ATOM   160  C  CD2 . LEU A 1 31  ? 1.981   49.720 8.053   1.00 34.33 ? 19  LEU A CD2 1 
ATOM   161  N  N   . MET A 1 32  ? -2.863  50.437 5.872   1.00 27.20 ? 20  MET A N   1 
ATOM   162  C  CA  . MET A 1 32  ? -4.264  50.053 5.755   1.00 26.87 ? 20  MET A CA  1 
ATOM   163  C  C   . MET A 1 32  ? -4.476  49.091 4.537   1.00 26.26 ? 20  MET A C   1 
ATOM   164  O  O   . MET A 1 32  ? -5.205  48.099 4.644   1.00 25.32 ? 20  MET A O   1 
ATOM   165  C  CB  . MET A 1 32  ? -5.159  51.287 5.673   1.00 26.39 ? 20  MET A CB  1 
ATOM   166  C  CG  . MET A 1 32  ? -6.609  50.940 5.539   1.00 28.20 ? 20  MET A CG  1 
ATOM   167  S  SD  . MET A 1 32  ? -7.757  52.325 5.938   1.00 32.38 ? 20  MET A SD  1 
ATOM   168  C  CE  . MET A 1 32  ? -7.473  52.504 7.732   1.00 29.15 ? 20  MET A CE  1 
ATOM   169  N  N   . GLU A 1 33  ? -3.799  49.371 3.430   1.00 25.94 ? 21  GLU A N   1 
ATOM   170  C  CA  . GLU A 1 33  ? -3.885  48.473 2.283   1.00 26.99 ? 21  GLU A CA  1 
ATOM   171  C  C   . GLU A 1 33  ? -3.341  47.078 2.584   1.00 26.59 ? 21  GLU A C   1 
ATOM   172  O  O   . GLU A 1 33  ? -4.016  46.074 2.294   1.00 25.39 ? 21  GLU A O   1 
ATOM   173  C  CB  . GLU A 1 33  ? -3.180  49.050 1.067   1.00 27.57 ? 21  GLU A CB  1 
ATOM   174  C  CG  . GLU A 1 33  ? -3.363  48.253 -0.179  1.00 30.50 ? 21  GLU A CG  1 
ATOM   175  C  CD  . GLU A 1 33  ? -4.780  48.317 -0.820  1.00 35.52 ? 21  GLU A CD  1 
ATOM   176  O  OE1 . GLU A 1 33  ? -5.577  49.232 -0.524  1.00 34.04 ? 21  GLU A OE1 1 
ATOM   177  O  OE2 . GLU A 1 33  ? -5.086  47.406 -1.657  1.00 33.85 ? 21  GLU A OE2 1 
ATOM   178  N  N   . ARG A 1 34  ? -2.156  47.025 3.188   1.00 27.12 ? 22  ARG A N   1 
ATOM   179  C  CA  . ARG A 1 34  ? -1.593  45.749 3.593   1.00 27.76 ? 22  ARG A CA  1 
ATOM   180  C  C   . ARG A 1 34  ? -2.481  44.985 4.578   1.00 27.05 ? 22  ARG A C   1 
ATOM   181  O  O   . ARG A 1 34  ? -2.555  43.750 4.499   1.00 27.12 ? 22  ARG A O   1 
ATOM   182  C  CB  . ARG A 1 34  ? -0.243  45.931 4.243   1.00 28.65 ? 22  ARG A CB  1 
ATOM   183  C  CG  . ARG A 1 34  ? 0.778   46.681 3.474   1.00 32.28 ? 22  ARG A CG  1 
ATOM   184  C  CD  . ARG A 1 34  ? 1.894   45.933 2.963   1.00 33.44 ? 22  ARG A CD  1 
ATOM   185  N  NE  . ARG A 1 34  ? 2.427   44.852 3.778   1.00 32.74 ? 22  ARG A NE  1 
ATOM   186  C  CZ  . ARG A 1 34  ? 3.713   44.670 4.036   1.00 29.01 ? 22  ARG A CZ  1 
ATOM   187  N  NH1 . ARG A 1 34  ? 4.598   45.520 3.646   1.00 30.05 ? 22  ARG A NH1 1 
ATOM   188  N  NH2 . ARG A 1 34  ? 4.108   43.641 4.783   1.00 31.49 ? 22  ARG A NH2 1 
ATOM   189  N  N   . ALA A 1 35  ? -3.105  45.680 5.553   1.00 26.22 ? 23  ALA A N   1 
ATOM   190  C  CA  . ALA A 1 35  ? -4.059  45.040 6.485   1.00 25.70 ? 23  ALA A CA  1 
ATOM   191  C  C   . ALA A 1 35  ? -5.208  44.359 5.707   1.00 26.39 ? 23  ALA A C   1 
ATOM   192  O  O   . ALA A 1 35  ? -5.576  43.169 5.916   1.00 26.77 ? 23  ALA A O   1 
ATOM   193  C  CB  . ALA A 1 35  ? -4.634  46.080 7.539   1.00 25.71 ? 23  ALA A CB  1 
ATOM   194  N  N   . GLY A 1 36  ? -5.804  45.097 4.790   1.00 25.64 ? 24  GLY A N   1 
ATOM   195  C  CA  . GLY A 1 36  ? -6.976  44.559 4.111   1.00 25.31 ? 24  GLY A CA  1 
ATOM   196  C  C   . GLY A 1 36  ? -6.632  43.406 3.184   1.00 25.96 ? 24  GLY A C   1 
ATOM   197  O  O   . GLY A 1 36  ? -7.332  42.373 3.165   1.00 25.43 ? 24  GLY A O   1 
ATOM   198  N  N   . ILE A 1 37  ? -5.516  43.505 2.477   1.00 26.15 ? 25  ILE A N   1 
ATOM   199  C  CA  . ILE A 1 37  ? -5.126  42.372 1.642   1.00 27.04 ? 25  ILE A CA  1 
ATOM   200  C  C   . ILE A 1 37  ? -4.752  41.159 2.465   1.00 28.08 ? 25  ILE A C   1 
ATOM   201  O  O   . ILE A 1 37  ? -5.011  40.055 2.030   1.00 27.16 ? 25  ILE A O   1 
ATOM   202  C  CB  . ILE A 1 37  ? -4.033  42.640 0.633   1.00 28.84 ? 25  ILE A CB  1 
ATOM   203  C  CG1 . ILE A 1 37  ? -2.687  42.888 1.275   1.00 33.54 ? 25  ILE A CG1 1 
ATOM   204  C  CG2 . ILE A 1 37  ? -4.442  43.749 -0.257  1.00 26.71 ? 25  ILE A CG2 1 
ATOM   205  C  CD1 . ILE A 1 37  ? -1.684  43.581 0.277   1.00 41.26 ? 25  ILE A CD1 1 
ATOM   206  N  N   . SER A 1 38  ? -4.160  41.354 3.634   1.00 27.62 ? 26  SER A N   1 
ATOM   207  C  CA  . SER A 1 38  ? -3.871  40.247 4.544   1.00 28.05 ? 26  SER A CA  1 
ATOM   208  C  C   . SER A 1 38  ? -5.125  39.463 4.879   1.00 27.67 ? 26  SER A C   1 
ATOM   209  O  O   . SER A 1 38  ? -5.112  38.229 4.958   1.00 28.02 ? 26  SER A O   1 
ATOM   210  C  CB  . SER A 1 38  ? -3.279  40.784 5.848   1.00 28.03 ? 26  SER A CB  1 
ATOM   211  O  OG  . SER A 1 38  ? -1.984  41.227 5.479   1.00 34.68 ? 26  SER A OG  1 
ATOM   212  N  N   . VAL A 1 39  ? -6.203  40.199 5.125   1.00 27.70 ? 27  VAL A N   1 
ATOM   213  C  CA  . VAL A 1 39  ? -7.504  39.594 5.384   1.00 26.61 ? 27  VAL A CA  1 
ATOM   214  C  C   . VAL A 1 39  ? -7.983  38.728 4.208   1.00 27.20 ? 27  VAL A C   1 
ATOM   215  O  O   . VAL A 1 39  ? -8.424  37.607 4.422   1.00 27.47 ? 27  VAL A O   1 
ATOM   216  C  CB  . VAL A 1 39  ? -8.555  40.622 5.824   1.00 26.96 ? 27  VAL A CB  1 
ATOM   217  C  CG1 . VAL A 1 39  ? -9.974  39.876 5.942   1.00 24.52 ? 27  VAL A CG1 1 
ATOM   218  C  CG2 . VAL A 1 39  ? -8.081  41.302 7.165   1.00 24.05 ? 27  VAL A CG2 1 
ATOM   219  N  N   . VAL A 1 40  ? -7.840  39.227 2.988   1.00 27.36 ? 28  VAL A N   1 
ATOM   220  C  CA  . VAL A 1 40  ? -8.274  38.496 1.784   1.00 27.46 ? 28  VAL A CA  1 
ATOM   221  C  C   . VAL A 1 40  ? -7.487  37.222 1.698   1.00 27.66 ? 28  VAL A C   1 
ATOM   222  O  O   . VAL A 1 40  ? -8.083  36.150 1.561   1.00 26.73 ? 28  VAL A O   1 
ATOM   223  C  CB  . VAL A 1 40  ? -8.140  39.319 0.539   1.00 27.35 ? 28  VAL A CB  1 
ATOM   224  C  CG1 . VAL A 1 40  ? -8.307  38.472 -0.774  1.00 25.59 ? 28  VAL A CG1 1 
ATOM   225  C  CG2 . VAL A 1 40  ? -9.098  40.535 0.624   1.00 28.08 ? 28  VAL A CG2 1 
ATOM   226  N  N   . LEU A 1 41  ? -6.174  37.312 1.884   1.00 27.13 ? 29  LEU A N   1 
ATOM   227  C  CA  . LEU A 1 41  ? -5.325  36.139 1.729   1.00 29.03 ? 29  LEU A CA  1 
ATOM   228  C  C   . LEU A 1 41  ? -5.591  35.127 2.815   1.00 29.16 ? 29  LEU A C   1 
ATOM   229  O  O   . LEU A 1 41  ? -5.571  33.935 2.558   1.00 30.05 ? 29  LEU A O   1 
ATOM   230  C  CB  . LEU A 1 41  ? -3.839  36.517 1.691   1.00 29.18 ? 29  LEU A CB  1 
ATOM   231  C  CG  . LEU A 1 41  ? -3.364  37.177 0.375   1.00 30.33 ? 29  LEU A CG  1 
ATOM   232  C  CD1 . LEU A 1 41  ? -2.052  37.886 0.562   1.00 28.75 ? 29  LEU A CD1 1 
ATOM   233  C  CD2 . LEU A 1 41  ? -3.221  36.080 -0.704  1.00 29.03 ? 29  LEU A CD2 1 
ATOM   234  N  N   . ALA A 1 42  ? -5.823  35.595 4.038   1.00 27.20 ? 30  ALA A N   1 
ATOM   235  C  CA  . ALA A 1 42  ? -6.144  34.695 5.163   1.00 28.20 ? 30  ALA A CA  1 
ATOM   236  C  C   . ALA A 1 42  ? -7.493  33.946 4.873   1.00 29.28 ? 30  ALA A C   1 
ATOM   237  O  O   . ALA A 1 42  ? -7.666  32.742 5.129   1.00 29.29 ? 30  ALA A O   1 
ATOM   238  C  CB  . ALA A 1 42  ? -6.184  35.510 6.488   1.00 25.57 ? 30  ALA A CB  1 
ATOM   239  N  N   . MET A 1 43  ? -8.438  34.664 4.283   1.00 29.62 ? 31  MET A N   1 
ATOM   240  C  CA  . MET A 1 43  ? -9.720  34.057 3.974   1.00 31.77 ? 31  MET A CA  1 
ATOM   241  C  C   . MET A 1 43  ? -9.586  32.991 2.891   1.00 33.60 ? 31  MET A C   1 
ATOM   242  O  O   . MET A 1 43  ? -10.229 31.916 2.948   1.00 34.73 ? 31  MET A O   1 
ATOM   243  C  CB  . MET A 1 43  ? -10.731 35.111 3.542   1.00 31.22 ? 31  MET A CB  1 
ATOM   244  C  CG  . MET A 1 43  ? -11.196 35.989 4.672   1.00 30.01 ? 31  MET A CG  1 
ATOM   245  S  SD  . MET A 1 43  ? -12.697 36.852 4.228   1.00 33.60 ? 31  MET A SD  1 
ATOM   246  C  CE  . MET A 1 43  ? -12.176 38.021 2.953   1.00 30.61 ? 31  MET A CE  1 
ATOM   247  N  N   . GLU A 1 44  ? -8.750  33.267 1.906   1.00 33.98 ? 32  GLU A N   1 
ATOM   248  C  CA  . GLU A 1 44  ? -8.472  32.292 0.862   1.00 36.87 ? 32  GLU A CA  1 
ATOM   249  C  C   . GLU A 1 44  ? -7.824  30.992 1.398   1.00 39.02 ? 32  GLU A C   1 
ATOM   250  O  O   . GLU A 1 44  ? -8.184  29.893 0.996   1.00 38.65 ? 32  GLU A O   1 
ATOM   251  C  CB  . GLU A 1 44  ? -7.577  32.916 -0.193  1.00 36.98 ? 32  GLU A CB  1 
ATOM   252  C  CG  . GLU A 1 44  ? -7.399  32.075 -1.388  1.00 41.63 ? 32  GLU A CG  1 
ATOM   253  C  CD  . GLU A 1 44  ? -6.676  32.877 -2.479  1.00 44.84 ? 32  GLU A CD  1 
ATOM   254  O  OE1 . GLU A 1 44  ? -5.589  33.393 -2.184  1.00 43.94 ? 32  GLU A OE1 1 
ATOM   255  O  OE2 . GLU A 1 44  ? -7.219  33.007 -3.596  1.00 45.83 ? 32  GLU A OE2 1 
ATOM   256  N  N   . GLU A 1 45  ? -6.849  31.148 2.277   1.00 39.87 ? 33  GLU A N   1 
ATOM   257  C  CA  . GLU A 1 45  ? -6.209  30.058 3.002   1.00 42.96 ? 33  GLU A CA  1 
ATOM   258  C  C   . GLU A 1 45  ? -7.235  29.229 3.789   1.00 44.11 ? 33  GLU A C   1 
ATOM   259  O  O   . GLU A 1 45  ? -7.135  28.040 3.843   1.00 46.32 ? 33  GLU A O   1 
ATOM   260  C  CB  . GLU A 1 45  ? -5.193  30.710 3.952   1.00 43.55 ? 33  GLU A CB  1 
ATOM   261  C  CG  . GLU A 1 45  ? -4.079  29.878 4.495   1.00 49.50 ? 33  GLU A CG  1 
ATOM   262  C  CD  . GLU A 1 45  ? -2.849  30.742 4.861   1.00 53.31 ? 33  GLU A CD  1 
ATOM   263  O  OE1 . GLU A 1 45  ? -2.219  31.322 3.943   1.00 54.83 ? 33  GLU A OE1 1 
ATOM   264  O  OE2 . GLU A 1 45  ? -2.507  30.818 6.059   1.00 59.06 ? 33  GLU A OE2 1 
ATOM   265  N  N   . GLU A 1 46  ? -8.243  29.853 4.384   1.00 43.86 ? 34  GLU A N   1 
ATOM   266  C  CA  . GLU A 1 46  ? -9.245  29.116 5.130   1.00 45.34 ? 34  GLU A CA  1 
ATOM   267  C  C   . GLU A 1 46  ? -10.406 28.575 4.294   1.00 46.37 ? 34  GLU A C   1 
ATOM   268  O  O   . GLU A 1 46  ? -10.905 27.515 4.597   1.00 45.88 ? 34  GLU A O   1 
ATOM   269  C  CB  . GLU A 1 46  ? -9.844  29.977 6.226   1.00 45.38 ? 34  GLU A CB  1 
ATOM   270  C  CG  . GLU A 1 46  ? -8.902  30.192 7.372   1.00 49.10 ? 34  GLU A CG  1 
ATOM   271  C  CD  . GLU A 1 46  ? -8.460  28.875 8.016   1.00 54.88 ? 34  GLU A CD  1 
ATOM   272  O  OE1 . GLU A 1 46  ? -7.217  28.677 8.138   1.00 57.20 ? 34  GLU A OE1 1 
ATOM   273  O  OE2 . GLU A 1 46  ? -9.345  28.051 8.361   1.00 56.44 ? 34  GLU A OE2 1 
ATOM   274  N  N   . LEU A 1 47  ? -10.865 29.330 3.299   1.00 44.95 ? 35  LEU A N   1 
ATOM   275  C  CA  . LEU A 1 47  ? -12.035 28.952 2.523   1.00 46.09 ? 35  LEU A CA  1 
ATOM   276  C  C   . LEU A 1 47  ? -11.683 28.305 1.187   1.00 47.45 ? 35  LEU A C   1 
ATOM   277  O  O   . LEU A 1 47  ? -12.551 27.703 0.552   1.00 49.72 ? 35  LEU A O   1 
ATOM   278  C  CB  . LEU A 1 47  ? -12.887 30.190 2.251   1.00 45.40 ? 35  LEU A CB  1 
ATOM   279  C  CG  . LEU A 1 47  ? -13.407 30.903 3.503   1.00 44.57 ? 35  LEU A CG  1 
ATOM   280  C  CD1 . LEU A 1 47  ? -14.195 32.101 3.058   1.00 45.36 ? 35  LEU A CD1 1 
ATOM   281  C  CD2 . LEU A 1 47  ? -14.256 29.950 4.316   1.00 47.70 ? 35  LEU A CD2 1 
ATOM   282  N  N   . GLY A 1 48  ? -10.421 28.384 0.779   1.00 45.90 ? 36  GLY A N   1 
ATOM   283  C  CA  . GLY A 1 48  ? -10.037 27.917 -0.544  1.00 47.01 ? 36  GLY A CA  1 
ATOM   284  C  C   . GLY A 1 48  ? -10.413 29.025 -1.491  1.00 46.90 ? 36  GLY A C   1 
ATOM   285  O  O   . GLY A 1 48  ? -10.578 30.192 -1.074  1.00 46.38 ? 36  GLY A O   1 
ATOM   286  N  N   . ASN A 1 49  ? -10.576 28.693 -2.749  1.00 48.08 ? 37  ASN A N   1 
ATOM   287  C  CA  . ASN A 1 49  ? -11.010 29.657 -3.747  1.00 48.86 ? 37  ASN A CA  1 
ATOM   288  C  C   . ASN A 1 49  ? -12.240 30.482 -3.310  1.00 47.52 ? 37  ASN A C   1 
ATOM   289  O  O   . ASN A 1 49  ? -13.252 29.943 -2.907  1.00 49.07 ? 37  ASN A O   1 
ATOM   290  C  CB  . ASN A 1 49  ? -11.242 28.968 -5.101  1.00 51.04 ? 37  ASN A CB  1 
ATOM   291  C  CG  . ASN A 1 49  ? -11.283 29.966 -6.253  1.00 54.21 ? 37  ASN A CG  1 
ATOM   292  O  OD1 . ASN A 1 49  ? -12.221 30.764 -6.358  1.00 57.41 ? 37  ASN A OD1 1 
ATOM   293  N  ND2 . ASN A 1 49  ? -10.261 29.944 -7.111  1.00 56.96 ? 37  ASN A ND2 1 
ATOM   294  N  N   . LEU A 1 50  ? -12.105 31.802 -3.361  1.00 45.71 ? 38  LEU A N   1 
ATOM   295  C  CA  . LEU A 1 50  ? -13.121 32.738 -2.895  1.00 44.19 ? 38  LEU A CA  1 
ATOM   296  C  C   . LEU A 1 50  ? -14.201 33.026 -3.954  1.00 44.83 ? 38  LEU A C   1 
ATOM   297  O  O   . LEU A 1 50  ? -15.202 33.646 -3.663  1.00 44.22 ? 38  LEU A O   1 
ATOM   298  C  CB  . LEU A 1 50  ? -12.447 34.055 -2.480  1.00 42.39 ? 38  LEU A CB  1 
ATOM   299  C  CG  . LEU A 1 50  ? -11.528 33.970 -1.248  1.00 43.13 ? 38  LEU A CG  1 
ATOM   300  C  CD1 . LEU A 1 50  ? -11.084 35.325 -0.757  1.00 38.89 ? 38  LEU A CD1 1 
ATOM   301  C  CD2 . LEU A 1 50  ? -12.200 33.213 -0.108  1.00 43.99 ? 38  LEU A CD2 1 
ATOM   302  N  N   . SER A 1 51  ? -14.022 32.573 -5.181  1.00 45.64 ? 39  SER A N   1 
ATOM   303  C  CA  . SER A 1 51  ? -14.855 33.093 -6.246  1.00 46.60 ? 39  SER A CA  1 
ATOM   304  C  C   . SER A 1 51  ? -16.323 32.637 -6.181  1.00 48.96 ? 39  SER A C   1 
ATOM   305  O  O   . SER A 1 51  ? -17.164 33.329 -6.710  1.00 49.96 ? 39  SER A O   1 
ATOM   306  C  CB  . SER A 1 51  ? -14.238 32.807 -7.606  1.00 47.57 ? 39  SER A CB  1 
ATOM   307  O  OG  . SER A 1 51  ? -14.422 31.457 -7.882  1.00 46.64 ? 39  SER A OG  1 
ATOM   308  N  N   . ASP A 1 52  ? -16.643 31.525 -5.514  1.00 50.42 ? 40  ASP A N   1 
ATOM   309  C  CA  . ASP A 1 52  ? -18.047 31.120 -5.368  1.00 53.07 ? 40  ASP A CA  1 
ATOM   310  C  C   . ASP A 1 52  ? -18.786 31.752 -4.176  1.00 51.19 ? 40  ASP A C   1 
ATOM   311  O  O   . ASP A 1 52  ? -19.981 31.557 -4.043  1.00 52.58 ? 40  ASP A O   1 
ATOM   312  C  CB  . ASP A 1 52  ? -18.196 29.596 -5.216  1.00 56.34 ? 40  ASP A CB  1 
ATOM   313  C  CG  . ASP A 1 52  ? -17.477 28.825 -6.285  1.00 60.20 ? 40  ASP A CG  1 
ATOM   314  O  OD1 . ASP A 1 52  ? -17.981 28.771 -7.425  1.00 65.48 ? 40  ASP A OD1 1 
ATOM   315  O  OD2 . ASP A 1 52  ? -16.394 28.276 -5.966  1.00 64.95 ? 40  ASP A OD2 1 
ATOM   316  N  N   . TYR A 1 53  ? -18.113 32.505 -3.326  1.00 47.66 ? 41  TYR A N   1 
ATOM   317  C  CA  . TYR A 1 53  ? -18.750 33.028 -2.114  1.00 46.54 ? 41  TYR A CA  1 
ATOM   318  C  C   . TYR A 1 53  ? -19.308 34.453 -2.272  1.00 45.56 ? 41  TYR A C   1 
ATOM   319  O  O   . TYR A 1 53  ? -18.807 35.270 -3.037  1.00 44.88 ? 41  TYR A O   1 
ATOM   320  C  CB  . TYR A 1 53  ? -17.744 33.034 -0.946  1.00 45.30 ? 41  TYR A CB  1 
ATOM   321  C  CG  . TYR A 1 53  ? -17.336 31.661 -0.455  1.00 45.95 ? 41  TYR A CG  1 
ATOM   322  C  CD1 . TYR A 1 53  ? -18.032 31.024 0.575   1.00 49.16 ? 41  TYR A CD1 1 
ATOM   323  C  CD2 . TYR A 1 53  ? -16.234 31.026 -0.991  1.00 47.54 ? 41  TYR A CD2 1 
ATOM   324  C  CE1 . TYR A 1 53  ? -17.643 29.763 1.039   1.00 51.48 ? 41  TYR A CE1 1 
ATOM   325  C  CE2 . TYR A 1 53  ? -15.839 29.774 -0.558  1.00 50.95 ? 41  TYR A CE2 1 
ATOM   326  C  CZ  . TYR A 1 53  ? -16.539 29.150 0.462   1.00 53.22 ? 41  TYR A CZ  1 
ATOM   327  O  OH  . TYR A 1 53  ? -16.090 27.942 0.895   1.00 57.52 ? 41  TYR A OH  1 
ATOM   328  N  N   . ARG A 1 54  ? -20.372 34.734 -1.544  1.00 44.61 ? 42  ARG A N   1 
ATOM   329  C  CA  . ARG A 1 54  ? -20.902 36.068 -1.492  1.00 43.48 ? 42  ARG A CA  1 
ATOM   330  C  C   . ARG A 1 54  ? -20.491 36.656 -0.147  1.00 40.72 ? 42  ARG A C   1 
ATOM   331  O  O   . ARG A 1 54  ? -20.717 36.027 0.892   1.00 41.34 ? 42  ARG A O   1 
ATOM   332  C  CB  . ARG A 1 54  ? -22.421 36.020 -1.610  1.00 45.51 ? 42  ARG A CB  1 
ATOM   333  C  CG  . ARG A 1 54  ? -22.929 35.369 -2.879  1.00 48.75 ? 42  ARG A CG  1 
ATOM   334  C  CD  . ARG A 1 54  ? -24.400 35.038 -2.822  1.00 51.37 ? 42  ARG A CD  1 
ATOM   335  N  NE  . ARG A 1 54  ? -24.641 33.966 -1.869  1.00 54.17 ? 42  ARG A NE  1 
ATOM   336  C  CZ  . ARG A 1 54  ? -25.836 33.491 -1.525  1.00 61.59 ? 42  ARG A CZ  1 
ATOM   337  N  NH1 . ARG A 1 54  ? -26.964 33.975 -2.062  1.00 64.15 ? 42  ARG A NH1 1 
ATOM   338  N  NH2 . ARG A 1 54  ? -25.903 32.505 -0.630  1.00 63.52 ? 42  ARG A NH2 1 
ATOM   339  N  N   . PHE A 1 55  ? -19.903 37.850 -0.171  1.00 38.46 ? 43  PHE A N   1 
ATOM   340  C  CA  . PHE A 1 55  ? -19.402 38.546 1.042   1.00 36.74 ? 43  PHE A CA  1 
ATOM   341  C  C   . PHE A 1 55  ? -20.207 39.780 1.482   1.00 36.79 ? 43  PHE A C   1 
ATOM   342  O  O   . PHE A 1 55  ? -20.429 40.698 0.681   1.00 36.22 ? 43  PHE A O   1 
ATOM   343  C  CB  . PHE A 1 55  ? -17.927 38.987 0.825   1.00 34.90 ? 43  PHE A CB  1 
ATOM   344  C  CG  . PHE A 1 55  ? -16.996 37.842 0.600   1.00 34.50 ? 43  PHE A CG  1 
ATOM   345  C  CD1 . PHE A 1 55  ? -17.043 37.129 -0.590  1.00 34.49 ? 43  PHE A CD1 1 
ATOM   346  C  CD2 . PHE A 1 55  ? -16.136 37.418 1.612   1.00 31.36 ? 43  PHE A CD2 1 
ATOM   347  C  CE1 . PHE A 1 55  ? -16.181 36.059 -0.820  1.00 36.89 ? 43  PHE A CE1 1 
ATOM   348  C  CE2 . PHE A 1 55  ? -15.275 36.337 1.391   1.00 31.84 ? 43  PHE A CE2 1 
ATOM   349  C  CZ  . PHE A 1 55  ? -15.301 35.657 0.190   1.00 34.23 ? 43  PHE A CZ  1 
ATOM   350  N  N   . LEU A 1 56  ? -20.610 39.793 2.759   1.00 36.22 ? 44  LEU A N   1 
ATOM   351  C  CA  . LEU A 1 56  ? -21.213 40.955 3.419   1.00 36.32 ? 44  LEU A CA  1 
ATOM   352  C  C   . LEU A 1 56  ? -20.181 41.573 4.354   1.00 34.60 ? 44  LEU A C   1 
ATOM   353  O  O   . LEU A 1 56  ? -19.706 40.932 5.302   1.00 33.40 ? 44  LEU A O   1 
ATOM   354  C  CB  . LEU A 1 56  ? -22.434 40.553 4.226   1.00 37.52 ? 44  LEU A CB  1 
ATOM   355  C  CG  . LEU A 1 56  ? -23.244 41.682 4.856   1.00 38.70 ? 44  LEU A CG  1 
ATOM   356  C  CD1 . LEU A 1 56  ? -24.004 42.508 3.801   1.00 34.57 ? 44  LEU A CD1 1 
ATOM   357  C  CD2 . LEU A 1 56  ? -24.187 41.124 5.885   1.00 35.82 ? 44  LEU A CD2 1 
ATOM   358  N  N   . VAL A 1 57  ? -19.830 42.819 4.099   1.00 33.77 ? 45  VAL A N   1 
ATOM   359  C  CA  . VAL A 1 57  ? -18.764 43.457 4.862   1.00 31.36 ? 45  VAL A CA  1 
ATOM   360  C  C   . VAL A 1 57  ? -19.410 44.556 5.710   1.00 32.48 ? 45  VAL A C   1 
ATOM   361  O  O   . VAL A 1 57  ? -20.143 45.435 5.200   1.00 34.21 ? 45  VAL A O   1 
ATOM   362  C  CB  . VAL A 1 57  ? -17.668 43.964 3.868   1.00 30.86 ? 45  VAL A CB  1 
ATOM   363  C  CG1 . VAL A 1 57  ? -16.547 44.557 4.583   1.00 26.95 ? 45  VAL A CG1 1 
ATOM   364  C  CG2 . VAL A 1 57  ? -17.140 42.758 2.949   1.00 29.16 ? 45  VAL A CG2 1 
ATOM   365  N  N   . LEU A 1 58  ? -19.184 44.494 7.015   1.00 31.64 ? 46  LEU A N   1 
ATOM   366  C  CA  . LEU A 1 58  ? -19.825 45.388 7.946   1.00 31.55 ? 46  LEU A CA  1 
ATOM   367  C  C   . LEU A 1 58  ? -18.714 46.309 8.375   1.00 31.54 ? 46  LEU A C   1 
ATOM   368  O  O   . LEU A 1 58  ? -17.763 45.858 9.047   1.00 31.10 ? 46  LEU A O   1 
ATOM   369  C  CB  . LEU A 1 58  ? -20.441 44.605 9.122   1.00 31.42 ? 46  LEU A CB  1 
ATOM   370  C  CG  . LEU A 1 58  ? -21.462 43.524 8.800   1.00 33.26 ? 46  LEU A CG  1 
ATOM   371  C  CD1 . LEU A 1 58  ? -21.961 42.820 10.085  1.00 36.79 ? 46  LEU A CD1 1 
ATOM   372  C  CD2 . LEU A 1 58  ? -22.667 44.089 7.984   1.00 31.08 ? 46  LEU A CD2 1 
ATOM   373  N  N   . CYS A 1 59  ? -18.834 47.594 8.023   1.00 31.53 ? 47  CYS A N   1 
ATOM   374  C  CA  . CYS A 1 59  ? -17.801 48.571 8.267   1.00 31.23 ? 47  CYS A CA  1 
ATOM   375  C  C   . CYS A 1 59  ? -18.269 49.665 9.203   1.00 32.68 ? 47  CYS A C   1 
ATOM   376  O  O   . CYS A 1 59  ? -19.303 50.326 8.971   1.00 33.78 ? 47  CYS A O   1 
ATOM   377  C  CB  . CYS A 1 59  ? -17.363 49.234 6.949   1.00 31.80 ? 47  CYS A CB  1 
ATOM   378  S  SG  . CYS A 1 59  ? -16.499 48.204 5.753   1.00 31.76 ? 47  CYS A SG  1 
ATOM   379  N  N   . GLY A 1 60  ? -17.471 49.899 10.249  1.00 32.89 ? 48  GLY A N   1 
ATOM   380  C  CA  . GLY A 1 60  ? -17.640 51.076 11.119  1.00 32.91 ? 48  GLY A CA  1 
ATOM   381  C  C   . GLY A 1 60  ? -16.918 52.260 10.465  1.00 33.90 ? 48  GLY A C   1 
ATOM   382  O  O   . GLY A 1 60  ? -16.320 52.163 9.363   1.00 33.26 ? 48  GLY A O   1 
ATOM   383  N  N   . GLY A 1 61  ? -17.017 53.400 11.117  1.00 35.57 ? 49  GLY A N   1 
ATOM   384  C  CA  . GLY A 1 61  ? -16.430 54.623 10.627  1.00 36.35 ? 49  GLY A CA  1 
ATOM   385  C  C   . GLY A 1 61  ? -14.967 54.846 10.948  1.00 35.88 ? 49  GLY A C   1 
ATOM   386  O  O   . GLY A 1 61  ? -14.407 55.845 10.497  1.00 37.09 ? 49  GLY A O   1 
ATOM   387  N  N   . GLY A 1 62  ? -14.359 53.930 11.717  1.00 34.03 ? 50  GLY A N   1 
ATOM   388  C  CA  . GLY A 1 62  ? -12.979 54.032 12.145  1.00 33.31 ? 50  GLY A CA  1 
ATOM   389  C  C   . GLY A 1 62  ? -12.039 53.351 11.187  1.00 32.04 ? 50  GLY A C   1 
ATOM   390  O  O   . GLY A 1 62  ? -12.422 52.937 10.078  1.00 31.37 ? 50  GLY A O   1 
ATOM   391  N  N   . ASN A 1 63  ? -10.795 53.214 11.612  1.00 31.12 ? 51  ASN A N   1 
ATOM   392  C  CA  . ASN A 1 63  ? -9.822  52.562 10.776  1.00 32.14 ? 51  ASN A CA  1 
ATOM   393  C  C   . ASN A 1 63  ? -10.086 51.064 10.586  1.00 29.93 ? 51  ASN A C   1 
ATOM   394  O  O   . ASN A 1 63  ? -9.673  50.475 9.607   1.00 29.47 ? 51  ASN A O   1 
ATOM   395  C  CB  . ASN A 1 63  ? -8.432  52.853 11.304  1.00 33.41 ? 51  ASN A CB  1 
ATOM   396  C  CG  . ASN A 1 63  ? -7.972  54.332 11.022  1.00 39.34 ? 51  ASN A CG  1 
ATOM   397  O  OD1 . ASN A 1 63  ? -8.495  55.106 10.142  1.00 37.86 ? 51  ASN A OD1 1 
ATOM   398  N  ND2 . ASN A 1 63  ? -7.013  54.740 11.836  1.00 45.95 ? 51  ASN A ND2 1 
ATOM   399  N  N   . ASN A 1 64  ? -10.814 50.459 11.504  1.00 29.65 ? 52  ASN A N   1 
ATOM   400  C  CA  . ASN A 1 64  ? -11.185 49.081 11.364  1.00 29.46 ? 52  ASN A CA  1 
ATOM   401  C  C   . ASN A 1 64  ? -12.091 48.972 10.132  1.00 28.83 ? 52  ASN A C   1 
ATOM   402  O  O   . ASN A 1 64  ? -11.885 48.134 9.213   1.00 27.98 ? 52  ASN A O   1 
ATOM   403  C  CB  . ASN A 1 64  ? -11.861 48.574 12.639  1.00 29.75 ? 52  ASN A CB  1 
ATOM   404  C  CG  . ASN A 1 64  ? -11.888 47.074 12.712  1.00 28.36 ? 52  ASN A CG  1 
ATOM   405  O  OD1 . ASN A 1 64  ? -12.932 46.465 12.671  1.00 30.64 ? 52  ASN A OD1 1 
ATOM   406  N  ND2 . ASN A 1 64  ? -10.755 46.491 12.920  1.00 28.95 ? 52  ASN A ND2 1 
ATOM   407  N  N   . GLY A 1 65  ? -13.048 49.884 10.063  1.00 29.92 ? 53  GLY A N   1 
ATOM   408  C  CA  . GLY A 1 65  ? -13.916 49.908 8.911   1.00 29.87 ? 53  GLY A CA  1 
ATOM   409  C  C   . GLY A 1 65  ? -13.171 50.210 7.640   1.00 29.64 ? 53  GLY A C   1 
ATOM   410  O  O   . GLY A 1 65  ? -13.519 49.699 6.578   1.00 27.36 ? 53  GLY A O   1 
ATOM   411  N  N   . GLY A 1 66  ? -12.175 51.099 7.735   1.00 30.56 ? 54  GLY A N   1 
ATOM   412  C  CA  . GLY A 1 66  ? -11.341 51.406 6.555   1.00 29.78 ? 54  GLY A CA  1 
ATOM   413  C  C   . GLY A 1 66  ? -10.662 50.125 6.047   1.00 28.25 ? 54  GLY A C   1 
ATOM   414  O  O   . GLY A 1 66  ? -10.560 49.886 4.857   1.00 27.25 ? 54  GLY A O   1 
ATOM   415  N  N   . ASP A 1 67  ? -10.140 49.326 6.965   1.00 27.83 ? 55  ASP A N   1 
ATOM   416  C  CA  . ASP A 1 67  ? -9.569  48.032 6.580   1.00 28.07 ? 55  ASP A CA  1 
ATOM   417  C  C   . ASP A 1 67  ? -10.635 47.181 5.856   1.00 27.89 ? 55  ASP A C   1 
ATOM   418  O  O   . ASP A 1 67  ? -10.343 46.502 4.848   1.00 29.19 ? 55  ASP A O   1 
ATOM   419  C  CB  . ASP A 1 67  ? -9.064  47.211 7.769   1.00 27.86 ? 55  ASP A CB  1 
ATOM   420  C  CG  . ASP A 1 67  ? -7.937  47.855 8.548   1.00 29.34 ? 55  ASP A CG  1 
ATOM   421  O  OD1 . ASP A 1 67  ? -7.131  48.645 8.023   1.00 31.86 ? 55  ASP A OD1 1 
ATOM   422  O  OD2 . ASP A 1 67  ? -7.817  47.498 9.744   1.00 30.54 ? 55  ASP A OD2 1 
ATOM   423  N  N   . GLY A 1 68  ? -11.861 47.207 6.373   1.00 28.39 ? 56  GLY A N   1 
ATOM   424  C  CA  . GLY A 1 68  ? -12.978 46.526 5.730   1.00 28.70 ? 56  GLY A CA  1 
ATOM   425  C  C   . GLY A 1 68  ? -13.264 46.996 4.303   1.00 29.74 ? 56  GLY A C   1 
ATOM   426  O  O   . GLY A 1 68  ? -13.508 46.189 3.431   1.00 29.81 ? 56  GLY A O   1 
ATOM   427  N  N   . PHE A 1 69  ? -13.245 48.320 4.056   1.00 29.87 ? 57  PHE A N   1 
ATOM   428  C  CA  . PHE A 1 69  ? -13.394 48.835 2.689   1.00 29.46 ? 57  PHE A CA  1 
ATOM   429  C  C   . PHE A 1 69  ? -12.301 48.356 1.766   1.00 28.02 ? 57  PHE A C   1 
ATOM   430  O  O   . PHE A 1 69  ? -12.546 48.124 0.596   1.00 28.64 ? 57  PHE A O   1 
ATOM   431  C  CB  . PHE A 1 69  ? -13.468 50.366 2.654   1.00 29.64 ? 57  PHE A CB  1 
ATOM   432  C  CG  . PHE A 1 69  ? -14.805 50.904 3.045   1.00 30.38 ? 57  PHE A CG  1 
ATOM   433  C  CD1 . PHE A 1 69  ? -15.882 50.742 2.221   1.00 32.72 ? 57  PHE A CD1 1 
ATOM   434  C  CD2 . PHE A 1 69  ? -14.976 51.616 4.234   1.00 32.62 ? 57  PHE A CD2 1 
ATOM   435  C  CE1 . PHE A 1 69  ? -17.137 51.266 2.569   1.00 35.78 ? 57  PHE A CE1 1 
ATOM   436  C  CE2 . PHE A 1 69  ? -16.199 52.093 4.619   1.00 33.68 ? 57  PHE A CE2 1 
ATOM   437  C  CZ  . PHE A 1 69  ? -17.297 51.928 3.776   1.00 36.34 ? 57  PHE A CZ  1 
ATOM   438  N  N   . VAL A 1 70  ? -11.096 48.210 2.277   1.00 28.36 ? 58  VAL A N   1 
ATOM   439  C  CA  . VAL A 1 70  ? -9.996  47.619 1.476   1.00 27.09 ? 58  VAL A CA  1 
ATOM   440  C  C   . VAL A 1 70  ? -10.280 46.154 1.107   1.00 27.36 ? 58  VAL A C   1 
ATOM   441  O  O   . VAL A 1 70  ? -10.076 45.740 -0.027  1.00 26.77 ? 58  VAL A O   1 
ATOM   442  C  CB  . VAL A 1 70  ? -8.633  47.663 2.234   1.00 27.13 ? 58  VAL A CB  1 
ATOM   443  C  CG1 . VAL A 1 70  ? -7.569  46.870 1.457   1.00 24.18 ? 58  VAL A CG1 1 
ATOM   444  C  CG2 . VAL A 1 70  ? -8.156  49.124 2.413   1.00 24.83 ? 58  VAL A CG2 1 
ATOM   445  N  N   . VAL A 1 71  ? -10.753 45.385 2.079   1.00 27.37 ? 59  VAL A N   1 
ATOM   446  C  CA  . VAL A 1 71  ? -11.171 44.006 1.833   1.00 26.64 ? 59  VAL A CA  1 
ATOM   447  C  C   . VAL A 1 71  ? -12.222 43.974 0.743   1.00 28.28 ? 59  VAL A C   1 
ATOM   448  O  O   . VAL A 1 71  ? -12.076 43.257 -0.255  1.00 28.62 ? 59  VAL A O   1 
ATOM   449  C  CB  . VAL A 1 71  ? -11.696 43.336 3.141   1.00 25.63 ? 59  VAL A CB  1 
ATOM   450  C  CG1 . VAL A 1 71  ? -12.328 41.938 2.848   1.00 27.27 ? 59  VAL A CG1 1 
ATOM   451  C  CG2 . VAL A 1 71  ? -10.553 43.242 4.178   1.00 22.76 ? 59  VAL A CG2 1 
ATOM   452  N  N   . ALA A 1 72  ? -13.268 44.793 0.915   1.00 28.98 ? 60  ALA A N   1 
ATOM   453  C  CA  . ALA A 1 72  ? -14.406 44.776 -0.006  1.00 30.04 ? 60  ALA A CA  1 
ATOM   454  C  C   . ALA A 1 72  ? -13.936 45.163 -1.385  1.00 29.94 ? 60  ALA A C   1 
ATOM   455  O  O   . ALA A 1 72  ? -14.273 44.503 -2.376  1.00 30.41 ? 60  ALA A O   1 
ATOM   456  C  CB  . ALA A 1 72  ? -15.536 45.725 0.451   1.00 29.89 ? 60  ALA A CB  1 
ATOM   457  N  N   . ARG A 1 73  ? -13.123 46.197 -1.476  1.00 28.92 ? 61  ARG A N   1 
ATOM   458  C  CA  . ARG A 1 73  ? -12.655 46.636 -2.774  1.00 30.09 ? 61  ARG A CA  1 
ATOM   459  C  C   . ARG A 1 73  ? -11.850 45.558 -3.481  1.00 29.81 ? 61  ARG A C   1 
ATOM   460  O  O   . ARG A 1 73  ? -12.032 45.341 -4.648  1.00 30.18 ? 61  ARG A O   1 
ATOM   461  C  CB  . ARG A 1 73  ? -11.828 47.897 -2.641  1.00 30.45 ? 61  ARG A CB  1 
ATOM   462  C  CG  . ARG A 1 73  ? -11.483 48.544 -3.933  1.00 34.77 ? 61  ARG A CG  1 
ATOM   463  C  CD  . ARG A 1 73  ? -10.381 49.515 -3.720  1.00 37.20 ? 61  ARG A CD  1 
ATOM   464  N  NE  . ARG A 1 73  ? -9.109  48.859 -3.886  1.00 43.16 ? 61  ARG A NE  1 
ATOM   465  C  CZ  . ARG A 1 73  ? -8.124  48.878 -3.007  1.00 38.40 ? 61  ARG A CZ  1 
ATOM   466  N  NH1 . ARG A 1 73  ? -8.246  49.528 -1.870  1.00 37.66 ? 61  ARG A NH1 1 
ATOM   467  N  NH2 . ARG A 1 73  ? -7.014  48.237 -3.286  1.00 37.92 ? 61  ARG A NH2 1 
ATOM   468  N  N   . ASN A 1 74  ? -10.988 44.875 -2.750  1.00 28.55 ? 62  ASN A N   1 
ATOM   469  C  CA  . ASN A 1 74  ? -10.158 43.806 -3.303  1.00 29.93 ? 62  ASN A CA  1 
ATOM   470  C  C   . ASN A 1 74  ? -10.903 42.501 -3.665  1.00 31.68 ? 62  ASN A C   1 
ATOM   471  O  O   . ASN A 1 74  ? -10.357 41.657 -4.349  1.00 32.56 ? 62  ASN A O   1 
ATOM   472  C  CB  . ASN A 1 74  ? -9.025  43.538 -2.312  1.00 28.22 ? 62  ASN A CB  1 
ATOM   473  C  CG  . ASN A 1 74  ? -7.911  44.522 -2.497  1.00 30.17 ? 62  ASN A CG  1 
ATOM   474  O  OD1 . ASN A 1 74  ? -7.259  44.489 -3.530  1.00 28.81 ? 62  ASN A OD1 1 
ATOM   475  N  ND2 . ASN A 1 74  ? -7.708  45.428 -1.530  1.00 28.25 ? 62  ASN A ND2 1 
ATOM   476  N  N   . LEU A 1 75  ? -12.157 42.345 -3.208  1.00 32.11 ? 63  LEU A N   1 
ATOM   477  C  CA  . LEU A 1 75  ? -13.000 41.235 -3.639  1.00 32.59 ? 63  LEU A CA  1 
ATOM   478  C  C   . LEU A 1 75  ? -13.827 41.555 -4.875  1.00 35.00 ? 63  LEU A C   1 
ATOM   479  O  O   . LEU A 1 75  ? -14.300 40.624 -5.544  1.00 35.73 ? 63  LEU A O   1 
ATOM   480  C  CB  . LEU A 1 75  ? -13.930 40.804 -2.521  1.00 32.70 ? 63  LEU A CB  1 
ATOM   481  C  CG  . LEU A 1 75  ? -13.260 40.309 -1.255  1.00 32.58 ? 63  LEU A CG  1 
ATOM   482  C  CD1 . LEU A 1 75  ? -14.302 40.065 -0.218  1.00 33.34 ? 63  LEU A CD1 1 
ATOM   483  C  CD2 . LEU A 1 75  ? -12.476 39.031 -1.558  1.00 36.56 ? 63  LEU A CD2 1 
ATOM   484  N  N   . LEU A 1 76  ? -13.978 42.848 -5.205  1.00 35.71 ? 64  LEU A N   1 
ATOM   485  C  CA  . LEU A 1 76  ? -14.795 43.260 -6.335  1.00 38.19 ? 64  LEU A CA  1 
ATOM   486  C  C   . LEU A 1 76  ? -14.300 42.612 -7.622  1.00 39.88 ? 64  LEU A C   1 
ATOM   487  O  O   . LEU A 1 76  ? -13.100 42.510 -7.858  1.00 39.09 ? 64  LEU A O   1 
ATOM   488  C  CB  . LEU A 1 76  ? -14.825 44.795 -6.504  1.00 38.55 ? 64  LEU A CB  1 
ATOM   489  C  CG  . LEU A 1 76  ? -15.633 45.618 -5.496  1.00 36.59 ? 64  LEU A CG  1 
ATOM   490  C  CD1 . LEU A 1 76  ? -15.387 47.127 -5.674  1.00 32.47 ? 64  LEU A CD1 1 
ATOM   491  C  CD2 . LEU A 1 76  ? -17.127 45.298 -5.665  1.00 38.33 ? 64  LEU A CD2 1 
ATOM   492  N  N   . GLY A 1 77  ? -15.250 42.128 -8.418  1.00 42.09 ? 65  GLY A N   1 
ATOM   493  C  CA  . GLY A 1 77  ? -14.959 41.509 -9.691  1.00 44.61 ? 65  GLY A CA  1 
ATOM   494  C  C   . GLY A 1 77  ? -14.350 40.131 -9.659  1.00 45.06 ? 65  GLY A C   1 
ATOM   495  O  O   . GLY A 1 77  ? -14.110 39.550 -10.721 1.00 47.85 ? 65  GLY A O   1 
ATOM   496  N  N   . VAL A 1 78  ? -14.102 39.614 -8.467  1.00 43.78 ? 66  VAL A N   1 
ATOM   497  C  CA  . VAL A 1 78  ? -13.364 38.385 -8.274  1.00 45.03 ? 66  VAL A CA  1 
ATOM   498  C  C   . VAL A 1 78  ? -14.171 37.342 -7.496  1.00 44.94 ? 66  VAL A C   1 
ATOM   499  O  O   . VAL A 1 78  ? -13.900 36.155 -7.606  1.00 46.67 ? 66  VAL A O   1 
ATOM   500  C  CB  . VAL A 1 78  ? -12.018 38.704 -7.542  1.00 44.16 ? 66  VAL A CB  1 
ATOM   501  C  CG1 . VAL A 1 78  ? -11.802 37.795 -6.364  1.00 47.12 ? 66  VAL A CG1 1 
ATOM   502  C  CG2 . VAL A 1 78  ? -10.886 38.621 -8.525  1.00 46.11 ? 66  VAL A CG2 1 
ATOM   503  N  N   . VAL A 1 79  ? -15.180 37.773 -6.745  1.00 43.08 ? 67  VAL A N   1 
ATOM   504  C  CA  . VAL A 1 79  ? -16.081 36.863 -6.041  1.00 42.89 ? 67  VAL A CA  1 
ATOM   505  C  C   . VAL A 1 79  ? -17.531 36.997 -6.566  1.00 44.57 ? 67  VAL A C   1 
ATOM   506  O  O   . VAL A 1 79  ? -17.811 37.847 -7.375  1.00 44.78 ? 67  VAL A O   1 
ATOM   507  C  CB  . VAL A 1 79  ? -16.056 37.144 -4.524  1.00 41.25 ? 67  VAL A CB  1 
ATOM   508  C  CG1 . VAL A 1 79  ? -14.638 36.937 -3.975  1.00 40.59 ? 67  VAL A CG1 1 
ATOM   509  C  CG2 . VAL A 1 79  ? -16.547 38.550 -4.243  1.00 37.29 ? 67  VAL A CG2 1 
ATOM   510  N  N   . LYS A 1 80  ? -18.447 36.194 -6.052  1.00 44.86 ? 68  LYS A N   1 
ATOM   511  C  CA  . LYS A 1 80  ? -19.814 36.181 -6.543  1.00 47.50 ? 68  LYS A CA  1 
ATOM   512  C  C   . LYS A 1 80  ? -20.573 37.475 -6.280  1.00 46.27 ? 68  LYS A C   1 
ATOM   513  O  O   . LYS A 1 80  ? -21.227 37.994 -7.159  1.00 47.91 ? 68  LYS A O   1 
ATOM   514  C  CB  . LYS A 1 80  ? -20.560 35.000 -5.913  1.00 49.79 ? 68  LYS A CB  1 
ATOM   515  C  CG  . LYS A 1 80  ? -21.916 34.722 -6.490  1.00 55.98 ? 68  LYS A CG  1 
ATOM   516  C  CD  . LYS A 1 80  ? -22.156 33.218 -6.593  1.00 62.95 ? 68  LYS A CD  1 
ATOM   517  C  CE  . LYS A 1 80  ? -21.353 32.618 -7.757  1.00 67.88 ? 68  LYS A CE  1 
ATOM   518  N  NZ  . LYS A 1 80  ? -21.033 31.149 -7.581  1.00 71.49 ? 68  LYS A NZ  1 
ATOM   519  N  N   . ASP A 1 81  ? -20.504 37.977 -5.061  1.00 43.41 ? 69  ASP A N   1 
ATOM   520  C  CA  . ASP A 1 81  ? -21.141 39.221 -4.698  1.00 43.22 ? 69  ASP A CA  1 
ATOM   521  C  C   . ASP A 1 81  ? -20.424 39.786 -3.486  1.00 40.66 ? 69  ASP A C   1 
ATOM   522  O  O   . ASP A 1 81  ? -19.901 39.029 -2.633  1.00 39.08 ? 69  ASP A O   1 
ATOM   523  C  CB  . ASP A 1 81  ? -22.619 39.007 -4.350  1.00 45.32 ? 69  ASP A CB  1 
ATOM   524  C  CG  . ASP A 1 81  ? -23.424 40.317 -4.281  1.00 48.27 ? 69  ASP A CG  1 
ATOM   525  O  OD1 . ASP A 1 81  ? -23.068 41.328 -4.932  1.00 51.28 ? 69  ASP A OD1 1 
ATOM   526  O  OD2 . ASP A 1 81  ? -24.451 40.344 -3.572  1.00 54.35 ? 69  ASP A OD2 1 
ATOM   527  N  N   . VAL A 1 82  ? -20.386 41.118 -3.442  1.00 40.15 ? 70  VAL A N   1 
ATOM   528  C  CA  . VAL A 1 82  ? -19.886 41.889 -2.294  1.00 38.04 ? 70  VAL A CA  1 
ATOM   529  C  C   . VAL A 1 82  ? -20.848 43.006 -2.005  1.00 37.30 ? 70  VAL A C   1 
ATOM   530  O  O   . VAL A 1 82  ? -21.231 43.727 -2.902  1.00 37.22 ? 70  VAL A O   1 
ATOM   531  C  CB  . VAL A 1 82  ? -18.524 42.617 -2.589  1.00 37.28 ? 70  VAL A CB  1 
ATOM   532  C  CG1 . VAL A 1 82  ? -17.924 43.176 -1.276  1.00 36.35 ? 70  VAL A CG1 1 
ATOM   533  C  CG2 . VAL A 1 82  ? -17.591 41.736 -3.251  1.00 39.67 ? 70  VAL A CG2 1 
ATOM   534  N  N   . LEU A 1 83  ? -21.204 43.179 -0.747  1.00 36.26 ? 71  LEU A N   1 
ATOM   535  C  CA  . LEU A 1 83  ? -21.987 44.342 -0.308  1.00 36.91 ? 71  LEU A CA  1 
ATOM   536  C  C   . LEU A 1 83  ? -21.347 44.863 0.987   1.00 35.09 ? 71  LEU A C   1 
ATOM   537  O  O   . LEU A 1 83  ? -20.990 44.094 1.841   1.00 34.41 ? 71  LEU A O   1 
ATOM   538  C  CB  . LEU A 1 83  ? -23.451 43.939 -0.074  1.00 38.20 ? 71  LEU A CB  1 
ATOM   539  C  CG  . LEU A 1 83  ? -24.397 44.942 0.574   1.00 38.74 ? 71  LEU A CG  1 
ATOM   540  C  CD1 . LEU A 1 83  ? -24.518 46.175 -0.326  1.00 34.66 ? 71  LEU A CD1 1 
ATOM   541  C  CD2 . LEU A 1 83  ? -25.749 44.304 0.846   1.00 38.99 ? 71  LEU A CD2 1 
ATOM   542  N  N   . VAL A 1 84  ? -21.168 46.165 1.098   1.00 35.97 ? 72  VAL A N   1 
ATOM   543  C  CA  . VAL A 1 84  ? -20.794 46.803 2.362   1.00 34.18 ? 72  VAL A CA  1 
ATOM   544  C  C   . VAL A 1 84  ? -22.032 47.444 3.006   1.00 35.37 ? 72  VAL A C   1 
ATOM   545  O  O   . VAL A 1 84  ? -22.777 48.141 2.343   1.00 36.15 ? 72  VAL A O   1 
ATOM   546  C  CB  . VAL A 1 84  ? -19.721 47.894 2.129   1.00 33.90 ? 72  VAL A CB  1 
ATOM   547  C  CG1 . VAL A 1 84  ? -19.491 48.716 3.429   1.00 32.38 ? 72  VAL A CG1 1 
ATOM   548  C  CG2 . VAL A 1 84  ? -18.415 47.286 1.604   1.00 29.94 ? 72  VAL A CG2 1 
ATOM   549  N  N   . VAL A 1 85  ? -22.258 47.157 4.283   1.00 35.32 ? 73  VAL A N   1 
ATOM   550  C  CA  . VAL A 1 85  ? -23.176 47.923 5.122   1.00 36.96 ? 73  VAL A CA  1 
ATOM   551  C  C   . VAL A 1 85  ? -22.287 48.826 5.978   1.00 36.58 ? 73  VAL A C   1 
ATOM   552  O  O   . VAL A 1 85  ? -21.426 48.351 6.743   1.00 34.83 ? 73  VAL A O   1 
ATOM   553  C  CB  . VAL A 1 85  ? -24.019 47.054 6.052   1.00 37.20 ? 73  VAL A CB  1 
ATOM   554  C  CG1 . VAL A 1 85  ? -25.006 47.938 6.826   1.00 38.18 ? 73  VAL A CG1 1 
ATOM   555  C  CG2 . VAL A 1 85  ? -24.739 45.962 5.257   1.00 36.30 ? 73  VAL A CG2 1 
ATOM   556  N  N   . PHE A 1 86  ? -22.417 50.121 5.756   1.00 38.80 ? 74  PHE A N   1 
ATOM   557  C  CA  . PHE A 1 86  ? -21.624 51.105 6.468   1.00 39.14 ? 74  PHE A CA  1 
ATOM   558  C  C   . PHE A 1 86  ? -22.488 51.536 7.627   1.00 41.77 ? 74  PHE A C   1 
ATOM   559  O  O   . PHE A 1 86  ? -23.589 52.061 7.422   1.00 43.72 ? 74  PHE A O   1 
ATOM   560  C  CB  . PHE A 1 86  ? -21.238 52.296 5.594   1.00 39.64 ? 74  PHE A CB  1 
ATOM   561  C  CG  . PHE A 1 86  ? -20.605 53.373 6.371   1.00 39.48 ? 74  PHE A CG  1 
ATOM   562  C  CD1 . PHE A 1 86  ? -19.364 53.134 6.953   1.00 36.76 ? 74  PHE A CD1 1 
ATOM   563  C  CD2 . PHE A 1 86  ? -21.304 54.541 6.686   1.00 42.19 ? 74  PHE A CD2 1 
ATOM   564  C  CE1 . PHE A 1 86  ? -18.765 54.069 7.756   1.00 38.66 ? 74  PHE A CE1 1 
ATOM   565  C  CE2 . PHE A 1 86  ? -20.724 55.500 7.509   1.00 42.28 ? 74  PHE A CE2 1 
ATOM   566  C  CZ  . PHE A 1 86  ? -19.445 55.252 8.065   1.00 40.50 ? 74  PHE A CZ  1 
ATOM   567  N  N   . LEU A 1 87  ? -22.014 51.257 8.839   1.00 43.21 ? 75  LEU A N   1 
ATOM   568  C  CA  . LEU A 1 87  ? -22.798 51.443 10.080  1.00 45.43 ? 75  LEU A CA  1 
ATOM   569  C  C   . LEU A 1 87  ? -22.386 52.664 10.870  1.00 47.58 ? 75  LEU A C   1 
ATOM   570  O  O   . LEU A 1 87  ? -23.071 53.039 11.795  1.00 49.59 ? 75  LEU A O   1 
ATOM   571  C  CB  . LEU A 1 87  ? -22.644 50.233 11.001  1.00 44.04 ? 75  LEU A CB  1 
ATOM   572  C  CG  . LEU A 1 87  ? -23.021 48.909 10.364  1.00 45.31 ? 75  LEU A CG  1 
ATOM   573  C  CD1 . LEU A 1 87  ? -22.618 47.758 11.271  1.00 44.28 ? 75  LEU A CD1 1 
ATOM   574  C  CD2 . LEU A 1 87  ? -24.520 48.924 10.135  1.00 48.36 ? 75  LEU A CD2 1 
ATOM   575  N  N   . GLY A 1 88  ? -21.268 53.277 10.542  1.00 48.42 ? 76  GLY A N   1 
ATOM   576  C  CA  . GLY A 1 88  ? -20.835 54.452 11.283  1.00 50.07 ? 76  GLY A CA  1 
ATOM   577  C  C   . GLY A 1 88  ? -21.565 55.747 10.957  1.00 53.31 ? 76  GLY A C   1 
ATOM   578  O  O   . GLY A 1 88  ? -22.504 55.789 10.152  1.00 54.67 ? 76  GLY A O   1 
ATOM   579  N  N   . LYS A 1 89  ? -21.113 56.813 11.610  1.00 55.04 ? 77  LYS A N   1 
ATOM   580  C  CA  . LYS A 1 89  ? -21.611 58.144 11.369  1.00 58.79 ? 77  LYS A CA  1 
ATOM   581  C  C   . LYS A 1 89  ? -20.570 58.834 10.528  1.00 57.94 ? 77  LYS A C   1 
ATOM   582  O  O   . LYS A 1 89  ? -20.763 58.967 9.338   1.00 60.99 ? 77  LYS A O   1 
ATOM   583  C  CB  . LYS A 1 89  ? -21.902 58.870 12.689  1.00 61.38 ? 77  LYS A CB  1 
ATOM   584  C  CG  . LYS A 1 89  ? -23.354 58.679 13.226  1.00 67.05 ? 77  LYS A CG  1 
ATOM   585  C  CD  . LYS A 1 89  ? -24.008 57.265 12.962  1.00 70.54 ? 77  LYS A CD  1 
ATOM   586  C  CE  . LYS A 1 89  ? -25.043 57.300 11.781  1.00 73.71 ? 77  LYS A CE  1 
ATOM   587  N  NZ  . LYS A 1 89  ? -25.467 55.938 11.243  1.00 73.24 ? 77  LYS A NZ  1 
ATOM   588  N  N   . LYS A 1 90  ? -19.426 59.182 11.091  1.00 55.36 ? 78  LYS A N   1 
ATOM   589  C  CA  . LYS A 1 90  ? -18.386 59.832 10.309  1.00 53.65 ? 78  LYS A CA  1 
ATOM   590  C  C   . LYS A 1 90  ? -17.295 58.821 9.975   1.00 48.85 ? 78  LYS A C   1 
ATOM   591  O  O   . LYS A 1 90  ? -17.307 57.711 10.483  1.00 46.60 ? 78  LYS A O   1 
ATOM   592  C  CB  . LYS A 1 90  ? -17.826 61.032 11.063  1.00 55.64 ? 78  LYS A CB  1 
ATOM   593  C  CG  . LYS A 1 90  ? -17.020 60.698 12.323  1.00 58.07 ? 78  LYS A CG  1 
ATOM   594  C  CD  . LYS A 1 90  ? -17.234 61.786 13.428  1.00 66.08 ? 78  LYS A CD  1 
ATOM   595  C  CE  . LYS A 1 90  ? -16.130 61.763 14.513  1.00 67.43 ? 78  LYS A CE  1 
ATOM   596  N  NZ  . LYS A 1 90  ? -15.379 60.465 14.513  1.00 64.62 ? 78  LYS A NZ  1 
ATOM   597  N  N   . LYS A 1 91  ? -16.381 59.193 9.085   1.00 45.42 ? 79  LYS A N   1 
ATOM   598  C  CA  . LYS A 1 91  ? -15.305 58.309 8.701   1.00 42.45 ? 79  LYS A CA  1 
ATOM   599  C  C   . LYS A 1 91  ? -13.989 58.987 9.013   1.00 41.46 ? 79  LYS A C   1 
ATOM   600  O  O   . LYS A 1 91  ? -13.824 60.187 8.790   1.00 41.63 ? 79  LYS A O   1 
ATOM   601  C  CB  . LYS A 1 91  ? -15.380 57.971 7.213   1.00 42.44 ? 79  LYS A CB  1 
ATOM   602  C  CG  . LYS A 1 91  ? -16.654 57.260 6.788   1.00 42.00 ? 79  LYS A CG  1 
ATOM   603  C  CD  . LYS A 1 91  ? -16.669 57.030 5.289   1.00 42.25 ? 79  LYS A CD  1 
ATOM   604  C  CE  . LYS A 1 91  ? -17.970 56.371 4.836   1.00 43.53 ? 79  LYS A CE  1 
ATOM   605  N  NZ  . LYS A 1 91  ? -19.132 57.306 4.794   1.00 41.27 ? 79  LYS A NZ  1 
ATOM   606  N  N   . THR A 1 92  ? -13.040 58.237 9.543   1.00 38.02 ? 80  THR A N   1 
ATOM   607  C  CA  . THR A 1 92  ? -11.702 58.787 9.676   1.00 38.54 ? 80  THR A CA  1 
ATOM   608  C  C   . THR A 1 92  ? -11.126 59.023 8.247   1.00 38.31 ? 80  THR A C   1 
ATOM   609  O  O   . THR A 1 92  ? -11.653 58.506 7.246   1.00 36.53 ? 80  THR A O   1 
ATOM   610  C  CB  . THR A 1 92  ? -10.758 57.861 10.399  1.00 36.86 ? 80  THR A CB  1 
ATOM   611  O  OG1 . THR A 1 92  ? -10.633 56.685 9.626   1.00 35.28 ? 80  THR A OG1 1 
ATOM   612  C  CG2 . THR A 1 92  ? -11.219 57.511 11.819  1.00 38.09 ? 80  THR A CG2 1 
ATOM   613  N  N   . PRO A 1 93  ? -10.033 59.769 8.160   1.00 38.45 ? 81  PRO A N   1 
ATOM   614  C  CA  . PRO A 1 93  ? -9.508  60.090 6.821   1.00 38.95 ? 81  PRO A CA  1 
ATOM   615  C  C   . PRO A 1 93  ? -9.163  58.831 5.984   1.00 36.61 ? 81  PRO A C   1 
ATOM   616  O  O   . PRO A 1 93  ? -9.511  58.750 4.798   1.00 35.59 ? 81  PRO A O   1 
ATOM   617  C  CB  . PRO A 1 93  ? -8.267  60.934 7.123   1.00 40.54 ? 81  PRO A CB  1 
ATOM   618  C  CG  . PRO A 1 93  ? -8.639  61.659 8.507   1.00 42.40 ? 81  PRO A CG  1 
ATOM   619  C  CD  . PRO A 1 93  ? -9.472  60.620 9.235   1.00 40.60 ? 81  PRO A CD  1 
ATOM   620  N  N   . ASP A 1 94  ? -8.504  57.861 6.583   1.00 35.40 ? 82  ASP A N   1 
ATOM   621  C  CA  . ASP A 1 94  ? -8.193  56.647 5.825   1.00 34.52 ? 82  ASP A CA  1 
ATOM   622  C  C   . ASP A 1 94  ? -9.439  55.832 5.532   1.00 33.27 ? 82  ASP A C   1 
ATOM   623  O  O   . ASP A 1 94  ? -9.498  55.257 4.468   1.00 33.50 ? 82  ASP A O   1 
ATOM   624  C  CB  . ASP A 1 94  ? -7.116  55.817 6.508   1.00 34.12 ? 82  ASP A CB  1 
ATOM   625  C  CG  . ASP A 1 94  ? -5.752  56.545 6.565   1.00 38.00 ? 82  ASP A CG  1 
ATOM   626  O  OD1 . ASP A 1 94  ? -5.526  57.497 5.821   1.00 40.58 ? 82  ASP A OD1 1 
ATOM   627  O  OD2 . ASP A 1 94  ? -4.894  56.162 7.356   1.00 42.39 ? 82  ASP A OD2 1 
ATOM   628  N  N   . CYS A 1 95  ? -10.431 55.758 6.431   1.00 32.98 ? 83  CYS A N   1 
ATOM   629  C  CA  . CYS A 1 95  ? -11.667 55.057 6.101   1.00 31.68 ? 83  CYS A CA  1 
ATOM   630  C  C   . CYS A 1 95  ? -12.387 55.776 4.937   1.00 34.47 ? 83  CYS A C   1 
ATOM   631  O  O   . CYS A 1 95  ? -12.850 55.149 3.973   1.00 33.70 ? 83  CYS A O   1 
ATOM   632  C  CB  . CYS A 1 95  ? -12.569 55.001 7.304   1.00 32.85 ? 83  CYS A CB  1 
ATOM   633  S  SG  . CYS A 1 95  ? -14.119 54.141 6.992   1.00 34.17 ? 83  CYS A SG  1 
ATOM   634  N  N   . GLU A 1 96  ? -12.380 57.099 4.979   1.00 35.04 ? 84  GLU A N   1 
ATOM   635  C  CA  . GLU A 1 96  ? -12.957 57.895 3.910   1.00 37.45 ? 84  GLU A CA  1 
ATOM   636  C  C   . GLU A 1 96  ? -12.254 57.678 2.562   1.00 36.26 ? 84  GLU A C   1 
ATOM   637  O  O   . GLU A 1 96  ? -12.913 57.544 1.562   1.00 35.46 ? 84  GLU A O   1 
ATOM   638  C  CB  . GLU A 1 96  ? -12.915 59.378 4.272   1.00 39.28 ? 84  GLU A CB  1 
ATOM   639  C  CG  . GLU A 1 96  ? -13.470 60.294 3.213   1.00 47.37 ? 84  GLU A CG  1 
ATOM   640  C  CD  . GLU A 1 96  ? -14.963 60.211 3.116   1.00 54.16 ? 84  GLU A CD  1 
ATOM   641  O  OE1 . GLU A 1 96  ? -15.469 59.931 2.026   1.00 56.33 ? 84  GLU A OE1 1 
ATOM   642  O  OE2 . GLU A 1 96  ? -15.640 60.404 4.139   1.00 60.95 ? 84  GLU A OE2 1 
ATOM   643  N  N   . TYR A 1 97  ? -10.930 57.622 2.552   1.00 34.42 ? 85  TYR A N   1 
ATOM   644  C  CA  . TYR A 1 97  ? -10.201 57.397 1.311   1.00 34.91 ? 85  TYR A CA  1 
ATOM   645  C  C   . TYR A 1 97  ? -10.569 56.045 0.732   1.00 32.57 ? 85  TYR A C   1 
ATOM   646  O  O   . TYR A 1 97  ? -10.868 55.924 -0.431  1.00 31.63 ? 85  TYR A O   1 
ATOM   647  C  CB  . TYR A 1 97  ? -8.698  57.432 1.575   1.00 34.82 ? 85  TYR A CB  1 
ATOM   648  C  CG  . TYR A 1 97  ? -7.819  57.058 0.401   1.00 34.13 ? 85  TYR A CG  1 
ATOM   649  C  CD1 . TYR A 1 97  ? -7.692  57.899 -0.686  1.00 39.09 ? 85  TYR A CD1 1 
ATOM   650  C  CD2 . TYR A 1 97  ? -7.107  55.875 0.382   1.00 35.07 ? 85  TYR A CD2 1 
ATOM   651  C  CE1 . TYR A 1 97  ? -6.899  57.576 -1.748  1.00 37.78 ? 85  TYR A CE1 1 
ATOM   652  C  CE2 . TYR A 1 97  ? -6.306  55.550 -0.680  1.00 33.17 ? 85  TYR A CE2 1 
ATOM   653  C  CZ  . TYR A 1 97  ? -6.214  56.404 -1.745  1.00 35.46 ? 85  TYR A CZ  1 
ATOM   654  O  OH  . TYR A 1 97  ? -5.427  56.098 -2.804  1.00 38.74 ? 85  TYR A OH  1 
ATOM   655  N  N   . ASN A 1 98  ? -10.583 55.034 1.583   1.00 31.47 ? 86  ASN A N   1 
ATOM   656  C  CA  . ASN A 1 98  ? -10.946 53.696 1.177   1.00 31.42 ? 86  ASN A CA  1 
ATOM   657  C  C   . ASN A 1 98  ? -12.397 53.487 0.759   1.00 32.87 ? 86  ASN A C   1 
ATOM   658  O  O   . ASN A 1 98  ? -12.681 52.732 -0.147  1.00 31.73 ? 86  ASN A O   1 
ATOM   659  C  CB  . ASN A 1 98  ? -10.350 52.654 2.104   1.00 30.76 ? 86  ASN A CB  1 
ATOM   660  C  CG  . ASN A 1 98  ? -8.874  52.493 1.869   1.00 28.72 ? 86  ASN A CG  1 
ATOM   661  O  OD1 . ASN A 1 98  ? -8.462  52.114 0.796   1.00 31.86 ? 86  ASN A OD1 1 
ATOM   662  N  ND2 . ASN A 1 98  ? -8.077  52.846 2.839   1.00 27.29 ? 86  ASN A ND2 1 
ATOM   663  N  N   . TYR A 1 99  ? -13.306 54.176 1.428   1.00 32.86 ? 87  TYR A N   1 
ATOM   664  C  CA  . TYR A 1 99  ? -14.703 54.163 1.055   1.00 34.02 ? 87  TYR A CA  1 
ATOM   665  C  C   . TYR A 1 99  ? -14.834 54.742 -0.357  1.00 35.54 ? 87  TYR A C   1 
ATOM   666  O  O   . TYR A 1 99  ? -15.555 54.230 -1.187  1.00 36.45 ? 87  TYR A O   1 
ATOM   667  C  CB  . TYR A 1 99  ? -15.488 55.012 2.049   1.00 35.48 ? 87  TYR A CB  1 
ATOM   668  C  CG  . TYR A 1 99  ? -16.807 55.539 1.559   1.00 37.97 ? 87  TYR A CG  1 
ATOM   669  C  CD1 . TYR A 1 99  ? -17.869 54.698 1.369   1.00 39.83 ? 87  TYR A CD1 1 
ATOM   670  C  CD2 . TYR A 1 99  ? -16.996 56.885 1.327   1.00 44.41 ? 87  TYR A CD2 1 
ATOM   671  C  CE1 . TYR A 1 99  ? -19.072 55.161 0.945   1.00 44.90 ? 87  TYR A CE1 1 
ATOM   672  C  CE2 . TYR A 1 99  ? -18.207 57.366 0.900   1.00 48.06 ? 87  TYR A CE2 1 
ATOM   673  C  CZ  . TYR A 1 99  ? -19.244 56.495 0.710   1.00 49.25 ? 87  TYR A CZ  1 
ATOM   674  O  OH  . TYR A 1 99  ? -20.461 56.938 0.284   1.00 53.38 ? 87  TYR A OH  1 
ATOM   675  N  N   . GLY A 1 100 ? -14.098 55.807 -0.615  1.00 35.59 ? 88  GLY A N   1 
ATOM   676  C  CA  . GLY A 1 100 ? -14.103 56.426 -1.917  1.00 36.68 ? 88  GLY A CA  1 
ATOM   677  C  C   . GLY A 1 100 ? -13.583 55.503 -2.994  1.00 36.35 ? 88  GLY A C   1 
ATOM   678  O  O   . GLY A 1 100 ? -14.171 55.403 -4.048  1.00 36.37 ? 88  GLY A O   1 
ATOM   679  N  N   . LEU A 1 101 ? -12.503 54.794 -2.699  1.00 36.03 ? 89  LEU A N   1 
ATOM   680  C  CA  . LEU A 1 101 ? -11.951 53.821 -3.632  1.00 35.77 ? 89  LEU A CA  1 
ATOM   681  C  C   . LEU A 1 101 ? -12.918 52.691 -3.913  1.00 35.55 ? 89  LEU A C   1 
ATOM   682  O  O   . LEU A 1 101 ? -13.055 52.266 -5.043  1.00 33.95 ? 89  LEU A O   1 
ATOM   683  C  CB  . LEU A 1 101 ? -10.644 53.241 -3.120  1.00 34.68 ? 89  LEU A CB  1 
ATOM   684  C  CG  . LEU A 1 101 ? -9.371  54.063 -3.227  1.00 36.75 ? 89  LEU A CG  1 
ATOM   685  C  CD1 . LEU A 1 101 ? -8.200  53.256 -2.764  1.00 33.00 ? 89  LEU A CD1 1 
ATOM   686  C  CD2 . LEU A 1 101 ? -9.148  54.555 -4.618  1.00 37.71 ? 89  LEU A CD2 1 
ATOM   687  N  N   . TYR A 1 102 ? -13.596 52.216 -2.878  1.00 34.01 ? 90  TYR A N   1 
ATOM   688  C  CA  . TYR A 1 102 ? -14.517 51.111 -3.031  1.00 34.20 ? 90  TYR A CA  1 
ATOM   689  C  C   . TYR A 1 102 ? -15.617 51.515 -3.990  1.00 36.21 ? 90  TYR A C   1 
ATOM   690  O  O   . TYR A 1 102 ? -15.956 50.783 -4.889  1.00 37.86 ? 90  TYR A O   1 
ATOM   691  C  CB  . TYR A 1 102 ? -15.107 50.714 -1.678  1.00 32.63 ? 90  TYR A CB  1 
ATOM   692  C  CG  . TYR A 1 102 ? -16.198 49.676 -1.742  1.00 34.12 ? 90  TYR A CG  1 
ATOM   693  C  CD1 . TYR A 1 102 ? -15.917 48.364 -2.055  1.00 33.29 ? 90  TYR A CD1 1 
ATOM   694  C  CD2 . TYR A 1 102 ? -17.504 50.007 -1.482  1.00 36.72 ? 90  TYR A CD2 1 
ATOM   695  C  CE1 . TYR A 1 102 ? -16.899 47.426 -2.114  1.00 33.98 ? 90  TYR A CE1 1 
ATOM   696  C  CE2 . TYR A 1 102 ? -18.494 49.071 -1.540  1.00 37.71 ? 90  TYR A CE2 1 
ATOM   697  C  CZ  . TYR A 1 102 ? -18.188 47.782 -1.858  1.00 36.10 ? 90  TYR A CZ  1 
ATOM   698  O  OH  . TYR A 1 102 ? -19.167 46.847 -1.917  1.00 36.59 ? 90  TYR A OH  1 
ATOM   699  N  N   . LYS A 1 103 ? -16.140 52.713 -3.827  1.00 37.43 ? 91  LYS A N   1 
ATOM   700  C  CA  . LYS A 1 103 ? -17.183 53.194 -4.771  1.00 39.97 ? 91  LYS A CA  1 
ATOM   701  C  C   . LYS A 1 103 ? -16.678 53.470 -6.189  1.00 40.36 ? 91  LYS A C   1 
ATOM   702  O  O   . LYS A 1 103 ? -17.391 53.176 -7.143  1.00 41.53 ? 91  LYS A O   1 
ATOM   703  C  CB  . LYS A 1 103 ? -17.879 54.412 -4.229  1.00 40.84 ? 91  LYS A CB  1 
ATOM   704  C  CG  . LYS A 1 103 ? -18.506 54.091 -2.868  1.00 44.65 ? 91  LYS A CG  1 
ATOM   705  C  CD  . LYS A 1 103 ? -19.573 55.049 -2.490  1.00 52.38 ? 91  LYS A CD  1 
ATOM   706  C  CE  . LYS A 1 103 ? -20.821 54.850 -3.297  1.00 56.71 ? 91  LYS A CE  1 
ATOM   707  N  NZ  . LYS A 1 103 ? -21.571 56.126 -3.258  1.00 63.42 ? 91  LYS A NZ  1 
ATOM   708  N  N   . LYS A 1 104 ? -15.492 54.073 -6.327  1.00 40.62 ? 92  LYS A N   1 
ATOM   709  C  CA  . LYS A 1 104 ? -14.889 54.335 -7.644  1.00 42.24 ? 92  LYS A CA  1 
ATOM   710  C  C   . LYS A 1 104 ? -14.713 53.009 -8.390  1.00 40.77 ? 92  LYS A C   1 
ATOM   711  O  O   . LYS A 1 104 ? -14.892 52.946 -9.585  1.00 40.78 ? 92  LYS A O   1 
ATOM   712  C  CB  . LYS A 1 104 ? -13.537 55.069 -7.506  1.00 43.00 ? 92  LYS A CB  1 
ATOM   713  C  CG  . LYS A 1 104 ? -13.622 56.622 -7.431  1.00 46.85 ? 92  LYS A CG  1 
ATOM   714  C  CD  . LYS A 1 104 ? -13.776 57.214 -8.845  1.00 52.73 ? 92  LYS A CD  1 
ATOM   715  C  CE  . LYS A 1 104 ? -13.879 58.760 -8.918  1.00 56.56 ? 92  LYS A CE  1 
ATOM   716  N  NZ  . LYS A 1 104 ? -14.290 59.267 -10.339 1.00 58.86 ? 92  LYS A NZ  1 
ATOM   717  N  N   . PHE A 1 105 ? -14.402 51.940 -7.657  1.00 38.42 ? 93  PHE A N   1 
ATOM   718  C  CA  . PHE A 1 105 ? -14.250 50.631 -8.269  1.00 38.39 ? 93  PHE A CA  1 
ATOM   719  C  C   . PHE A 1 105 ? -15.584 49.970 -8.577  1.00 39.93 ? 93  PHE A C   1 
ATOM   720  O  O   . PHE A 1 105 ? -15.586 48.871 -9.055  1.00 40.19 ? 93  PHE A O   1 
ATOM   721  C  CB  . PHE A 1 105 ? -13.436 49.690 -7.385  1.00 35.50 ? 93  PHE A CB  1 
ATOM   722  C  CG  . PHE A 1 105 ? -11.949 49.811 -7.549  1.00 35.83 ? 93  PHE A CG  1 
ATOM   723  C  CD1 . PHE A 1 105 ? -11.313 51.020 -7.409  1.00 36.34 ? 93  PHE A CD1 1 
ATOM   724  C  CD2 . PHE A 1 105 ? -11.163 48.655 -7.775  1.00 36.96 ? 93  PHE A CD2 1 
ATOM   725  C  CE1 . PHE A 1 105 ? -9.916  51.084 -7.549  1.00 37.41 ? 93  PHE A CE1 1 
ATOM   726  C  CE2 . PHE A 1 105 ? -9.805  48.715 -7.895  1.00 34.50 ? 93  PHE A CE2 1 
ATOM   727  C  CZ  . PHE A 1 105 ? -9.175  49.911 -7.798  1.00 34.60 ? 93  PHE A CZ  1 
ATOM   728  N  N   . GLY A 1 106 ? -16.707 50.613 -8.283  1.00 41.39 ? 94  GLY A N   1 
ATOM   729  C  CA  . GLY A 1 106 ? -18.037 50.071 -8.587  1.00 42.77 ? 94  GLY A CA  1 
ATOM   730  C  C   . GLY A 1 106 ? -18.683 49.311 -7.435  1.00 41.75 ? 94  GLY A C   1 
ATOM   731  O  O   . GLY A 1 106 ? -19.627 48.578 -7.628  1.00 42.80 ? 94  GLY A O   1 
ATOM   732  N  N   . GLY A 1 107 ? -18.236 49.523 -6.214  1.00 40.10 ? 95  GLY A N   1 
ATOM   733  C  CA  . GLY A 1 107 ? -18.784 48.740 -5.119  1.00 39.17 ? 95  GLY A CA  1 
ATOM   734  C  C   . GLY A 1 107 ? -20.070 49.317 -4.573  1.00 40.80 ? 95  GLY A C   1 
ATOM   735  O  O   . GLY A 1 107 ? -20.245 50.521 -4.550  1.00 40.22 ? 95  GLY A O   1 
ATOM   736  N  N   . LYS A 1 108 ? -20.924 48.455 -4.045  1.00 42.25 ? 96  LYS A N   1 
ATOM   737  C  CA  . LYS A 1 108 ? -22.200 48.890 -3.460  1.00 45.27 ? 96  LYS A CA  1 
ATOM   738  C  C   . LYS A 1 108 ? -22.098 49.018 -1.936  1.00 44.02 ? 96  LYS A C   1 
ATOM   739  O  O   . LYS A 1 108 ? -21.555 48.128 -1.236  1.00 41.12 ? 96  LYS A O   1 
ATOM   740  C  CB  . LYS A 1 108 ? -23.325 47.923 -3.849  1.00 47.56 ? 96  LYS A CB  1 
ATOM   741  C  CG  . LYS A 1 108 ? -24.654 48.261 -3.214  1.00 53.89 ? 96  LYS A CG  1 
ATOM   742  C  CD  . LYS A 1 108 ? -25.802 47.525 -3.869  1.00 60.16 ? 96  LYS A CD  1 
ATOM   743  C  CE  . LYS A 1 108 ? -27.130 47.852 -3.201  1.00 62.99 ? 96  LYS A CE  1 
ATOM   744  N  NZ  . LYS A 1 108 ? -28.206 47.683 -4.185  1.00 67.65 ? 96  LYS A NZ  1 
ATOM   745  N  N   . VAL A 1 109 ? -22.602 50.145 -1.436  1.00 44.82 ? 97  VAL A N   1 
ATOM   746  C  CA  . VAL A 1 109 ? -22.689 50.394 -0.008  1.00 44.95 ? 97  VAL A CA  1 
ATOM   747  C  C   . VAL A 1 109 ? -24.133 50.646 0.322   1.00 47.19 ? 97  VAL A C   1 
ATOM   748  O  O   . VAL A 1 109 ? -24.824 51.288 -0.452  1.00 49.63 ? 97  VAL A O   1 
ATOM   749  C  CB  . VAL A 1 109 ? -21.918 51.660 0.422   1.00 45.00 ? 97  VAL A CB  1 
ATOM   750  C  CG1 . VAL A 1 109 ? -21.945 51.828 1.982   1.00 41.93 ? 97  VAL A CG1 1 
ATOM   751  C  CG2 . VAL A 1 109 ? -20.510 51.611 -0.101  1.00 42.35 ? 97  VAL A CG2 1 
ATOM   752  N  N   . VAL A 1 110 ? -24.604 50.149 1.455   1.00 46.98 ? 98  VAL A N   1 
ATOM   753  C  CA  . VAL A 1 110 ? -25.883 50.602 2.001   1.00 49.11 ? 98  VAL A CA  1 
ATOM   754  C  C   . VAL A 1 110 ? -25.584 51.009 3.446   1.00 49.87 ? 98  VAL A C   1 
ATOM   755  O  O   . VAL A 1 110 ? -24.563 50.571 4.010   1.00 46.08 ? 98  VAL A O   1 
ATOM   756  C  CB  . VAL A 1 110 ? -27.019 49.536 1.915   1.00 50.42 ? 98  VAL A CB  1 
ATOM   757  C  CG1 . VAL A 1 110 ? -27.400 49.258 0.449   1.00 49.64 ? 98  VAL A CG1 1 
ATOM   758  C  CG2 . VAL A 1 110 ? -26.632 48.257 2.652   1.00 46.56 ? 98  VAL A CG2 1 
ATOM   759  N  N   . GLU A 1 111 ? -26.439 51.869 4.004   1.00 52.78 ? 99  GLU A N   1 
ATOM   760  C  CA  . GLU A 1 111 ? -26.276 52.390 5.353   1.00 54.87 ? 99  GLU A CA  1 
ATOM   761  C  C   . GLU A 1 111 ? -27.335 51.900 6.318   1.00 57.32 ? 99  GLU A C   1 
ATOM   762  O  O   . GLU A 1 111 ? -27.368 52.323 7.442   1.00 58.03 ? 99  GLU A O   1 
ATOM   763  C  CB  . GLU A 1 111 ? -26.344 53.897 5.319   1.00 56.77 ? 99  GLU A CB  1 
ATOM   764  C  CG  . GLU A 1 111 ? -25.160 54.517 4.629   1.00 59.59 ? 99  GLU A CG  1 
ATOM   765  C  CD  . GLU A 1 111 ? -25.008 55.972 5.002   1.00 64.22 ? 99  GLU A CD  1 
ATOM   766  O  OE1 . GLU A 1 111 ? -23.888 56.507 4.922   1.00 64.06 ? 99  GLU A OE1 1 
ATOM   767  O  OE2 . GLU A 1 111 ? -26.021 56.572 5.412   1.00 70.56 ? 99  GLU A OE2 1 
ATOM   768  N  N   . GLN A 1 112 ? -28.225 51.040 5.863   1.00 60.33 ? 100 GLN A N   1 
ATOM   769  C  CA  . GLN A 1 112 ? -29.209 50.424 6.726   1.00 62.72 ? 100 GLN A CA  1 
ATOM   770  C  C   . GLN A 1 112 ? -29.078 48.902 6.625   1.00 62.58 ? 100 GLN A C   1 
ATOM   771  O  O   . GLN A 1 112 ? -28.964 48.327 5.529   1.00 62.58 ? 100 GLN A O   1 
ATOM   772  C  CB  . GLN A 1 112 ? -30.619 50.918 6.396   1.00 66.41 ? 100 GLN A CB  1 
ATOM   773  C  CG  . GLN A 1 112 ? -31.031 52.080 7.316   1.00 70.10 ? 100 GLN A CG  1 
ATOM   774  C  CD  . GLN A 1 112 ? -32.458 52.504 7.140   1.00 77.22 ? 100 GLN A CD  1 
ATOM   775  O  OE1 . GLN A 1 112 ? -32.887 52.837 6.033   1.00 81.78 ? 100 GLN A OE1 1 
ATOM   776  N  NE2 . GLN A 1 112 ? -33.220 52.505 8.240   1.00 80.18 ? 100 GLN A NE2 1 
ATOM   777  N  N   . PHE A 1 113 ? -29.044 48.277 7.797   1.00 62.64 ? 101 PHE A N   1 
ATOM   778  C  CA  . PHE A 1 113 ? -28.899 46.848 7.955   1.00 62.08 ? 101 PHE A CA  1 
ATOM   779  C  C   . PHE A 1 113 ? -30.283 46.260 8.018   1.00 65.06 ? 101 PHE A C   1 
ATOM   780  O  O   . PHE A 1 113 ? -31.067 46.548 8.929   1.00 66.44 ? 101 PHE A O   1 
ATOM   781  C  CB  . PHE A 1 113 ? -28.150 46.536 9.252   1.00 60.20 ? 101 PHE A CB  1 
ATOM   782  C  CG  . PHE A 1 113 ? -27.876 45.067 9.450   1.00 60.76 ? 101 PHE A CG  1 
ATOM   783  C  CD1 . PHE A 1 113 ? -28.830 44.236 10.041  1.00 62.21 ? 101 PHE A CD1 1 
ATOM   784  C  CD2 . PHE A 1 113 ? -26.661 44.508 9.038   1.00 59.95 ? 101 PHE A CD2 1 
ATOM   785  C  CE1 . PHE A 1 113 ? -28.581 42.867 10.223  1.00 62.06 ? 101 PHE A CE1 1 
ATOM   786  C  CE2 . PHE A 1 113 ? -26.398 43.125 9.224   1.00 60.61 ? 101 PHE A CE2 1 
ATOM   787  C  CZ  . PHE A 1 113 ? -27.368 42.310 9.820   1.00 60.46 ? 101 PHE A CZ  1 
ATOM   788  N  N   . GLU A 1 114 ? -30.602 45.438 7.043   1.00 66.31 ? 102 GLU A N   1 
ATOM   789  C  CA  . GLU A 1 114 ? -31.880 44.736 7.054   1.00 69.47 ? 102 GLU A CA  1 
ATOM   790  C  C   . GLU A 1 114 ? -31.637 43.278 7.522   1.00 67.97 ? 102 GLU A C   1 
ATOM   791  O  O   . GLU A 1 114 ? -30.844 42.559 6.906   1.00 66.75 ? 102 GLU A O   1 
ATOM   792  C  CB  . GLU A 1 114 ? -32.498 44.809 5.654   1.00 71.73 ? 102 GLU A CB  1 
ATOM   793  C  CG  . GLU A 1 114 ? -33.751 45.627 5.596   1.00 77.22 ? 102 GLU A CG  1 
ATOM   794  C  CD  . GLU A 1 114 ? -34.874 44.990 6.383   1.00 82.10 ? 102 GLU A CD  1 
ATOM   795  O  OE1 . GLU A 1 114 ? -35.792 45.724 6.800   1.00 85.37 ? 102 GLU A OE1 1 
ATOM   796  O  OE2 . GLU A 1 114 ? -34.835 43.751 6.596   1.00 84.40 ? 102 GLU A OE2 1 
ATOM   797  N  N   . PRO A 1 115 ? -32.288 42.846 8.617   1.00 68.48 ? 103 PRO A N   1 
ATOM   798  C  CA  . PRO A 1 115 ? -32.099 41.475 9.163   1.00 67.76 ? 103 PRO A CA  1 
ATOM   799  C  C   . PRO A 1 115 ? -32.068 40.348 8.115   1.00 67.88 ? 103 PRO A C   1 
ATOM   800  O  O   . PRO A 1 115 ? -31.168 39.504 8.146   1.00 66.41 ? 103 PRO A O   1 
ATOM   801  C  CB  . PRO A 1 115 ? -33.291 41.303 10.090  1.00 70.17 ? 103 PRO A CB  1 
ATOM   802  C  CG  . PRO A 1 115 ? -33.622 42.676 10.546  1.00 70.85 ? 103 PRO A CG  1 
ATOM   803  C  CD  . PRO A 1 115 ? -33.208 43.641 9.452   1.00 70.57 ? 103 PRO A CD  1 
ATOM   804  N  N   . SER A 1 116 ? -33.002 40.367 7.171   1.00 69.19 ? 104 SER A N   1 
ATOM   805  C  CA  . SER A 1 116 ? -32.990 39.416 6.056   1.00 69.47 ? 104 SER A CA  1 
ATOM   806  C  C   . SER A 1 116 ? -31.790 39.511 5.083   1.00 66.73 ? 104 SER A C   1 
ATOM   807  O  O   . SER A 1 116 ? -31.578 38.602 4.286   1.00 66.30 ? 104 SER A O   1 
ATOM   808  C  CB  . SER A 1 116 ? -34.270 39.576 5.250   1.00 72.82 ? 104 SER A CB  1 
ATOM   809  O  OG  . SER A 1 116 ? -34.395 40.913 4.813   1.00 72.85 ? 104 SER A OG  1 
ATOM   810  N  N   . ILE A 1 117 ? -31.025 40.602 5.115   1.00 64.60 ? 105 ILE A N   1 
ATOM   811  C  CA  . ILE A 1 117 ? -29.865 40.726 4.221   1.00 62.51 ? 105 ILE A CA  1 
ATOM   812  C  C   . ILE A 1 117 ? -28.873 39.565 4.411   1.00 60.40 ? 105 ILE A C   1 
ATOM   813  O  O   . ILE A 1 117 ? -28.252 39.133 3.427   1.00 59.94 ? 105 ILE A O   1 
ATOM   814  C  CB  . ILE A 1 117 ? -29.109 42.095 4.360   1.00 60.88 ? 105 ILE A CB  1 
ATOM   815  C  CG1 . ILE A 1 117 ? -28.174 42.325 3.161   1.00 60.60 ? 105 ILE A CG1 1 
ATOM   816  C  CG2 . ILE A 1 117 ? -28.315 42.186 5.673   1.00 57.32 ? 105 ILE A CG2 1 
ATOM   817  C  CD1 . ILE A 1 117 ? -28.866 42.253 1.749   1.00 63.42 ? 105 ILE A CD1 1 
ATOM   818  N  N   . LEU A 1 118 ? -28.751 39.067 5.649   1.00 58.95 ? 106 LEU A N   1 
ATOM   819  C  CA  . LEU A 1 118 ? -27.860 37.937 5.977   1.00 57.48 ? 106 LEU A CA  1 
ATOM   820  C  C   . LEU A 1 118 ? -28.120 36.722 5.103   1.00 59.23 ? 106 LEU A C   1 
ATOM   821  O  O   . LEU A 1 118 ? -27.179 36.013 4.728   1.00 58.83 ? 106 LEU A O   1 
ATOM   822  C  CB  . LEU A 1 118 ? -27.967 37.530 7.455   1.00 57.01 ? 106 LEU A CB  1 
ATOM   823  C  CG  . LEU A 1 118 ? -27.202 38.419 8.449   1.00 54.67 ? 106 LEU A CG  1 
ATOM   824  C  CD1 . LEU A 1 118 ? -27.586 38.127 9.895   1.00 54.01 ? 106 LEU A CD1 1 
ATOM   825  C  CD2 . LEU A 1 118 ? -25.713 38.271 8.283   1.00 51.39 ? 106 LEU A CD2 1 
ATOM   826  N  N   . ASN A 1 119 ? -29.384 36.498 4.762   1.00 61.77 ? 107 ASN A N   1 
ATOM   827  C  CA  . ASN A 1 119 ? -29.784 35.413 3.848   1.00 63.84 ? 107 ASN A CA  1 
ATOM   828  C  C   . ASN A 1 119 ? -29.067 35.321 2.526   1.00 62.37 ? 107 ASN A C   1 
ATOM   829  O  O   . ASN A 1 119 ? -28.921 34.230 1.988   1.00 63.72 ? 107 ASN A O   1 
ATOM   830  C  CB  . ASN A 1 119 ? -31.251 35.573 3.464   1.00 67.33 ? 107 ASN A CB  1 
ATOM   831  C  CG  . ASN A 1 119 ? -32.156 35.251 4.573   1.00 70.95 ? 107 ASN A CG  1 
ATOM   832  O  OD1 . ASN A 1 119 ? -31.703 34.792 5.630   1.00 73.47 ? 107 ASN A OD1 1 
ATOM   833  N  ND2 . ASN A 1 119 ? -33.452 35.493 4.377   1.00 74.88 ? 107 ASN A ND2 1 
ATOM   834  N  N   . GLU A 1 120 ? -28.726 36.467 1.948   1.00 59.86 ? 108 GLU A N   1 
ATOM   835  C  CA  . GLU A 1 120 ? -28.164 36.496 0.608   1.00 59.00 ? 108 GLU A CA  1 
ATOM   836  C  C   . GLU A 1 120 ? -26.623 36.407 0.598   1.00 54.04 ? 108 GLU A C   1 
ATOM   837  O  O   . GLU A 1 120 ? -26.006 36.623 -0.448  1.00 52.19 ? 108 GLU A O   1 
ATOM   838  C  CB  . GLU A 1 120 ? -28.637 37.767 -0.126  1.00 60.43 ? 108 GLU A CB  1 
ATOM   839  C  CG  . GLU A 1 120 ? -30.152 37.787 -0.478  1.00 67.81 ? 108 GLU A CG  1 
ATOM   840  C  CD  . GLU A 1 120 ? -30.794 39.148 -0.210  1.00 73.41 ? 108 GLU A CD  1 
ATOM   841  O  OE1 . GLU A 1 120 ? -30.026 40.126 -0.029  1.00 74.82 ? 108 GLU A OE1 1 
ATOM   842  O  OE2 . GLU A 1 120 ? -32.055 39.243 -0.141  1.00 78.15 ? 108 GLU A OE2 1 
ATOM   843  N  N   . PHE A 1 121 ? -26.002 36.092 1.742   1.00 50.29 ? 109 PHE A N   1 
ATOM   844  C  CA  . PHE A 1 121 ? -24.527 36.066 1.823   1.00 46.86 ? 109 PHE A CA  1 
ATOM   845  C  C   . PHE A 1 121 ? -23.987 34.840 2.555   1.00 45.43 ? 109 PHE A C   1 
ATOM   846  O  O   . PHE A 1 121 ? -24.690 34.230 3.321   1.00 47.54 ? 109 PHE A O   1 
ATOM   847  C  CB  . PHE A 1 121 ? -23.983 37.372 2.406   1.00 44.26 ? 109 PHE A CB  1 
ATOM   848  C  CG  . PHE A 1 121 ? -24.268 38.548 1.545   1.00 44.48 ? 109 PHE A CG  1 
ATOM   849  C  CD1 . PHE A 1 121 ? -23.425 38.878 0.492   1.00 44.31 ? 109 PHE A CD1 1 
ATOM   850  C  CD2 . PHE A 1 121 ? -25.445 39.280 1.723   1.00 46.57 ? 109 PHE A CD2 1 
ATOM   851  C  CE1 . PHE A 1 121 ? -23.757 39.941 -0.390  1.00 46.44 ? 109 PHE A CE1 1 
ATOM   852  C  CE2 . PHE A 1 121 ? -25.768 40.338 0.883   1.00 47.47 ? 109 PHE A CE2 1 
ATOM   853  C  CZ  . PHE A 1 121 ? -24.919 40.669 -0.181  1.00 47.19 ? 109 PHE A CZ  1 
ATOM   854  N  N   . ASP A 1 122 ? -22.757 34.453 2.241   1.00 43.30 ? 110 ASP A N   1 
ATOM   855  C  CA  . ASP A 1 122 ? -22.143 33.253 2.788   1.00 42.68 ? 110 ASP A CA  1 
ATOM   856  C  C   . ASP A 1 122 ? -21.102 33.594 3.873   1.00 41.07 ? 110 ASP A C   1 
ATOM   857  O  O   . ASP A 1 122 ? -20.860 32.792 4.793   1.00 40.64 ? 110 ASP A O   1 
ATOM   858  C  CB  . ASP A 1 122 ? -21.429 32.511 1.667   1.00 43.29 ? 110 ASP A CB  1 
ATOM   859  C  CG  . ASP A 1 122 ? -22.335 32.245 0.485   1.00 44.54 ? 110 ASP A CG  1 
ATOM   860  O  OD1 . ASP A 1 122 ? -23.363 31.601 0.668   1.00 47.29 ? 110 ASP A OD1 1 
ATOM   861  O  OD2 . ASP A 1 122 ? -22.054 32.723 -0.608  1.00 45.94 ? 110 ASP A OD2 1 
ATOM   862  N  N   . VAL A 1 123 ? -20.452 34.745 3.711   1.00 38.29 ? 111 VAL A N   1 
ATOM   863  C  CA  . VAL A 1 123 ? -19.393 35.185 4.609   1.00 36.68 ? 111 VAL A CA  1 
ATOM   864  C  C   . VAL A 1 123 ? -19.664 36.605 5.043   1.00 35.96 ? 111 VAL A C   1 
ATOM   865  O  O   . VAL A 1 123 ? -19.937 37.449 4.181   1.00 36.32 ? 111 VAL A O   1 
ATOM   866  C  CB  . VAL A 1 123 ? -18.007 35.125 3.924   1.00 35.48 ? 111 VAL A CB  1 
ATOM   867  C  CG1 . VAL A 1 123 ? -16.925 35.616 4.920   1.00 32.74 ? 111 VAL A CG1 1 
ATOM   868  C  CG2 . VAL A 1 123 ? -17.759 33.668 3.349   1.00 35.40 ? 111 VAL A CG2 1 
ATOM   869  N  N   . VAL A 1 124 ? -19.654 36.828 6.367   1.00 35.20 ? 112 VAL A N   1 
ATOM   870  C  CA  . VAL A 1 124 ? -19.704 38.141 6.979   1.00 34.23 ? 112 VAL A CA  1 
ATOM   871  C  C   . VAL A 1 124 ? -18.288 38.558 7.389   1.00 33.26 ? 112 VAL A C   1 
ATOM   872  O  O   . VAL A 1 124 ? -17.575 37.831 8.110   1.00 33.18 ? 112 VAL A O   1 
ATOM   873  C  CB  . VAL A 1 124 ? -20.668 38.197 8.235   1.00 36.37 ? 112 VAL A CB  1 
ATOM   874  C  CG1 . VAL A 1 124 ? -20.633 39.598 8.920   1.00 34.46 ? 112 VAL A CG1 1 
ATOM   875  C  CG2 . VAL A 1 124 ? -22.150 37.753 7.866   1.00 35.65 ? 112 VAL A CG2 1 
ATOM   876  N  N   . VAL A 1 125 ? -17.861 39.721 6.899   1.00 32.56 ? 113 VAL A N   1 
ATOM   877  C  CA  . VAL A 1 125 ? -16.580 40.289 7.273   1.00 30.25 ? 113 VAL A CA  1 
ATOM   878  C  C   . VAL A 1 125 ? -16.915 41.362 8.289   1.00 29.79 ? 113 VAL A C   1 
ATOM   879  O  O   . VAL A 1 125 ? -17.594 42.334 7.977   1.00 31.01 ? 113 VAL A O   1 
ATOM   880  C  CB  . VAL A 1 125 ? -15.791 40.822 6.082   1.00 30.76 ? 113 VAL A CB  1 
ATOM   881  C  CG1 . VAL A 1 125 ? -14.456 41.482 6.556   1.00 27.39 ? 113 VAL A CG1 1 
ATOM   882  C  CG2 . VAL A 1 125 ? -15.518 39.690 5.061   1.00 26.89 ? 113 VAL A CG2 1 
ATOM   883  N  N   . ASP A 1 126 ? -16.487 41.144 9.516   1.00 29.59 ? 114 ASP A N   1 
ATOM   884  C  CA  . ASP A 1 126 ? -16.770 42.046 10.660  1.00 29.85 ? 114 ASP A CA  1 
ATOM   885  C  C   . ASP A 1 126 ? -15.630 43.061 10.808  1.00 29.53 ? 114 ASP A C   1 
ATOM   886  O  O   . ASP A 1 126 ? -14.547 42.750 11.351  1.00 29.31 ? 114 ASP A O   1 
ATOM   887  C  CB  . ASP A 1 126 ? -16.903 41.239 11.934  1.00 30.35 ? 114 ASP A CB  1 
ATOM   888  C  CG  . ASP A 1 126 ? -16.648 42.061 13.197  1.00 32.30 ? 114 ASP A CG  1 
ATOM   889  O  OD1 . ASP A 1 126 ? -17.064 43.248 13.252  1.00 30.94 ? 114 ASP A OD1 1 
ATOM   890  O  OD2 . ASP A 1 126 ? -16.015 41.500 14.136  1.00 30.21 ? 114 ASP A OD2 1 
ATOM   891  N  N   . ALA A 1 127 ? -15.857 44.261 10.277  1.00 29.82 ? 115 ALA A N   1 
ATOM   892  C  CA  . ALA A 1 127 ? -14.923 45.386 10.385  1.00 29.05 ? 115 ALA A CA  1 
ATOM   893  C  C   . ALA A 1 127 ? -15.640 46.558 11.054  1.00 29.66 ? 115 ALA A C   1 
ATOM   894  O  O   . ALA A 1 127 ? -15.418 47.709 10.725  1.00 30.48 ? 115 ALA A O   1 
ATOM   895  C  CB  . ALA A 1 127 ? -14.340 45.758 9.006   1.00 27.93 ? 115 ALA A CB  1 
ATOM   896  N  N   . ILE A 1 128 ? -16.455 46.255 12.058  1.00 30.80 ? 116 ILE A N   1 
ATOM   897  C  CA  . ILE A 1 128 ? -17.244 47.281 12.742  1.00 31.95 ? 116 ILE A CA  1 
ATOM   898  C  C   . ILE A 1 128 ? -16.380 48.076 13.743  1.00 32.43 ? 116 ILE A C   1 
ATOM   899  O  O   . ILE A 1 128 ? -16.165 49.270 13.570  1.00 32.91 ? 116 ILE A O   1 
ATOM   900  C  CB  . ILE A 1 128 ? -18.455 46.691 13.472  1.00 32.84 ? 116 ILE A CB  1 
ATOM   901  C  CG1 . ILE A 1 128 ? -19.356 45.909 12.501  1.00 33.51 ? 116 ILE A CG1 1 
ATOM   902  C  CG2 . ILE A 1 128 ? -19.193 47.832 14.213  1.00 33.36 ? 116 ILE A CG2 1 
ATOM   903  C  CD1 . ILE A 1 128 ? -20.563 45.171 13.185  1.00 33.77 ? 116 ILE A CD1 1 
ATOM   904  N  N   . PHE A 1 129 ? -15.863 47.411 14.759  1.00 33.00 ? 117 PHE A N   1 
ATOM   905  C  CA  . PHE A 1 129 ? -14.951 48.042 15.749  1.00 35.03 ? 117 PHE A CA  1 
ATOM   906  C  C   . PHE A 1 129 ? -13.657 47.244 15.905  1.00 35.35 ? 117 PHE A C   1 
ATOM   907  O  O   . PHE A 1 129 ? -13.671 46.005 15.985  1.00 36.75 ? 117 PHE A O   1 
ATOM   908  C  CB  . PHE A 1 129 ? -15.582 48.114 17.134  1.00 36.33 ? 117 PHE A CB  1 
ATOM   909  C  CG  . PHE A 1 129 ? -16.942 48.765 17.177  1.00 39.63 ? 117 PHE A CG  1 
ATOM   910  C  CD1 . PHE A 1 129 ? -17.113 50.113 16.824  1.00 40.48 ? 117 PHE A CD1 1 
ATOM   911  C  CD2 . PHE A 1 129 ? -18.041 48.060 17.628  1.00 39.34 ? 117 PHE A CD2 1 
ATOM   912  C  CE1 . PHE A 1 129 ? -18.363 50.715 16.884  1.00 41.69 ? 117 PHE A CE1 1 
ATOM   913  C  CE2 . PHE A 1 129 ? -19.303 48.665 17.695  1.00 41.97 ? 117 PHE A CE2 1 
ATOM   914  C  CZ  . PHE A 1 129 ? -19.454 49.995 17.307  1.00 43.05 ? 117 PHE A CZ  1 
ATOM   915  N  N   . GLY A 1 130 ? -12.538 47.931 16.009  1.00 37.58 ? 118 GLY A N   1 
ATOM   916  C  CA  . GLY A 1 130 ? -11.303 47.212 16.290  1.00 38.01 ? 118 GLY A CA  1 
ATOM   917  C  C   . GLY A 1 130 ? -10.787 47.494 17.694  1.00 38.76 ? 118 GLY A C   1 
ATOM   918  O  O   . GLY A 1 130 ? -11.518 47.395 18.704  1.00 37.62 ? 118 GLY A O   1 
ATOM   919  N  N   . THR A 1 131 ? -9.524  47.894 17.752  1.00 39.76 ? 119 THR A N   1 
ATOM   920  C  CA  . THR A 1 131 ? -8.922  48.217 19.030  1.00 42.11 ? 119 THR A CA  1 
ATOM   921  C  C   . THR A 1 131 ? -9.373  49.591 19.523  1.00 43.80 ? 119 THR A C   1 
ATOM   922  O  O   . THR A 1 131 ? -9.063  49.969 20.623  1.00 46.65 ? 119 THR A O   1 
ATOM   923  C  CB  . THR A 1 131 ? -7.392  48.104 18.933  1.00 42.63 ? 119 THR A CB  1 
ATOM   924  O  OG1 . THR A 1 131 ? -6.936  49.074 18.008  1.00 44.13 ? 119 THR A OG1 1 
ATOM   925  C  CG2 . THR A 1 131 ? -6.981  46.694 18.453  1.00 41.31 ? 119 THR A CG2 1 
ATOM   926  N  N   . GLY A 1 132 ? -10.147 50.313 18.723  1.00 46.42 ? 120 GLY A N   1 
ATOM   927  C  CA  . GLY A 1 132 ? -10.677 51.636 19.087  1.00 49.09 ? 120 GLY A CA  1 
ATOM   928  C  C   . GLY A 1 132 ? -12.037 51.600 19.771  1.00 49.88 ? 120 GLY A C   1 
ATOM   929  O  O   . GLY A 1 132 ? -12.698 52.651 19.921  1.00 52.09 ? 120 GLY A O   1 
ATOM   930  N  N   . LEU A 1 133 ? -12.437 50.407 20.219  1.00 49.05 ? 121 LEU A N   1 
ATOM   931  C  CA  . LEU A 1 133 ? -13.702 50.203 20.934  1.00 48.78 ? 121 LEU A CA  1 
ATOM   932  C  C   . LEU A 1 133 ? -13.622 50.849 22.298  1.00 50.12 ? 121 LEU A C   1 
ATOM   933  O  O   . LEU A 1 133 ? -12.710 50.579 23.053  1.00 49.46 ? 121 LEU A O   1 
ATOM   934  C  CB  . LEU A 1 133 ? -13.962 48.714 21.134  1.00 47.24 ? 121 LEU A CB  1 
ATOM   935  C  CG  . LEU A 1 133 ? -15.211 48.356 21.960  1.00 48.11 ? 121 LEU A CG  1 
ATOM   936  C  CD1 . LEU A 1 133 ? -16.466 48.792 21.306  1.00 46.40 ? 121 LEU A CD1 1 
ATOM   937  C  CD2 . LEU A 1 133 ? -15.224 46.838 22.232  1.00 49.11 ? 121 LEU A CD2 1 
ATOM   938  N  N   . ARG A 1 134 ? -14.602 51.697 22.600  1.00 51.85 ? 122 ARG A N   1 
ATOM   939  C  CA  . ARG A 1 134 ? -14.710 52.350 23.881  1.00 53.44 ? 122 ARG A CA  1 
ATOM   940  C  C   . ARG A 1 134 ? -16.139 52.124 24.400  1.00 51.97 ? 122 ARG A C   1 
ATOM   941  O  O   . ARG A 1 134 ? -17.098 52.639 23.813  1.00 52.51 ? 122 ARG A O   1 
ATOM   942  C  CB  . ARG A 1 134 ? -14.421 53.858 23.735  1.00 56.74 ? 122 ARG A CB  1 
ATOM   943  C  CG  . ARG A 1 134 ? -12.990 54.214 23.295  1.00 60.73 ? 122 ARG A CG  1 
ATOM   944  C  CD  . ARG A 1 134 ? -11.914 53.833 24.361  1.00 65.30 ? 122 ARG A CD  1 
ATOM   945  N  NE  . ARG A 1 134 ? -10.561 54.051 23.820  1.00 68.69 ? 122 ARG A NE  1 
ATOM   946  C  CZ  . ARG A 1 134 ? -9.889  53.200 23.039  1.00 68.09 ? 122 ARG A CZ  1 
ATOM   947  N  NH1 . ARG A 1 134 ? -10.408 52.004 22.685  1.00 67.42 ? 122 ARG A NH1 1 
ATOM   948  N  NH2 . ARG A 1 134 ? -8.675  53.544 22.615  1.00 67.99 ? 122 ARG A NH2 1 
ATOM   949  N  N   . GLY A 1 135 ? -16.270 51.336 25.462  1.00 48.80 ? 123 GLY A N   1 
ATOM   950  C  CA  . GLY A 1 135 ? -17.518 51.224 26.140  1.00 48.60 ? 123 GLY A CA  1 
ATOM   951  C  C   . GLY A 1 135 ? -18.385 50.117 25.623  1.00 46.48 ? 123 GLY A C   1 
ATOM   952  O  O   . GLY A 1 135 ? -18.098 49.509 24.587  1.00 43.58 ? 123 GLY A O   1 
ATOM   953  N  N   . GLU A 1 136 ? -19.450 49.859 26.382  1.00 46.97 ? 124 GLU A N   1 
ATOM   954  C  CA  . GLU A 1 136 ? -20.443 48.821 26.091  1.00 47.15 ? 124 GLU A CA  1 
ATOM   955  C  C   . GLU A 1 136 ? -21.064 49.067 24.716  1.00 47.45 ? 124 GLU A C   1 
ATOM   956  O  O   . GLU A 1 136 ? -21.362 50.198 24.371  1.00 47.19 ? 124 GLU A O   1 
ATOM   957  C  CB  . GLU A 1 136 ? -21.567 48.839 27.159  1.00 49.49 ? 124 GLU A CB  1 
ATOM   958  C  CG  . GLU A 1 136 ? -21.087 48.631 28.619  1.00 51.54 ? 124 GLU A CG  1 
ATOM   959  C  CD  . GLU A 1 136 ? -20.582 47.208 28.919  1.00 55.88 ? 124 GLU A CD  1 
ATOM   960  O  OE1 . GLU A 1 136 ? -19.349 47.009 29.121  1.00 59.59 ? 124 GLU A OE1 1 
ATOM   961  O  OE2 . GLU A 1 136 ? -21.415 46.281 28.966  1.00 59.70 ? 124 GLU A OE2 1 
ATOM   962  N  N   . ILE A 1 137 ? -21.214 48.011 23.925  1.00 46.71 ? 125 ILE A N   1 
ATOM   963  C  CA  . ILE A 1 137 ? -21.962 48.101 22.666  1.00 47.73 ? 125 ILE A CA  1 
ATOM   964  C  C   . ILE A 1 137 ? -23.456 47.977 22.943  1.00 50.75 ? 125 ILE A C   1 
ATOM   965  O  O   . ILE A 1 137 ? -23.906 46.984 23.516  1.00 50.62 ? 125 ILE A O   1 
ATOM   966  C  CB  . ILE A 1 137 ? -21.534 47.015 21.679  1.00 45.59 ? 125 ILE A CB  1 
ATOM   967  C  CG1 . ILE A 1 137 ? -20.052 47.188 21.322  1.00 44.12 ? 125 ILE A CG1 1 
ATOM   968  C  CG2 . ILE A 1 137 ? -22.408 47.008 20.394  1.00 45.28 ? 125 ILE A CG2 1 
ATOM   969  C  CD1 . ILE A 1 137 ? -19.533 46.088 20.307  1.00 41.16 ? 125 ILE A CD1 1 
ATOM   970  N  N   . THR A 1 138 ? -24.217 48.993 22.549  1.00 53.94 ? 126 THR A N   1 
ATOM   971  C  CA  . THR A 1 138 ? -25.681 48.955 22.688  1.00 57.30 ? 126 THR A CA  1 
ATOM   972  C  C   . THR A 1 138 ? -26.358 49.368 21.383  1.00 58.69 ? 126 THR A C   1 
ATOM   973  O  O   . THR A 1 138 ? -25.696 49.644 20.365  1.00 59.08 ? 126 THR A O   1 
ATOM   974  C  CB  . THR A 1 138 ? -26.193 49.922 23.776  1.00 59.52 ? 126 THR A CB  1 
ATOM   975  O  OG1 . THR A 1 138 ? -25.540 51.184 23.616  1.00 62.15 ? 126 THR A OG1 1 
ATOM   976  C  CG2 . THR A 1 138 ? -25.983 49.373 25.173  1.00 59.40 ? 126 THR A CG2 1 
ATOM   977  N  N   . GLY A 1 139 ? -27.685 49.406 21.421  1.00 60.62 ? 127 GLY A N   1 
ATOM   978  C  CA  . GLY A 1 139 ? -28.461 49.961 20.336  1.00 62.12 ? 127 GLY A CA  1 
ATOM   979  C  C   . GLY A 1 139 ? -28.347 49.086 19.122  1.00 60.54 ? 127 GLY A C   1 
ATOM   980  O  O   . GLY A 1 139 ? -28.208 47.876 19.231  1.00 59.17 ? 127 GLY A O   1 
ATOM   981  N  N   . GLU A 1 140 ? -28.347 49.719 17.963  1.00 60.90 ? 128 GLU A N   1 
ATOM   982  C  CA  . GLU A 1 140 ? -28.404 49.009 16.712  1.00 60.06 ? 128 GLU A CA  1 
ATOM   983  C  C   . GLU A 1 140 ? -27.123 48.273 16.439  1.00 56.05 ? 128 GLU A C   1 
ATOM   984  O  O   . GLU A 1 140 ? -27.153 47.266 15.743  1.00 56.40 ? 128 GLU A O   1 
ATOM   985  C  CB  . GLU A 1 140 ? -28.731 49.961 15.554  1.00 62.24 ? 128 GLU A CB  1 
ATOM   986  C  CG  . GLU A 1 140 ? -30.045 50.710 15.762  1.00 68.17 ? 128 GLU A CG  1 
ATOM   987  C  CD  . GLU A 1 140 ? -30.371 51.672 14.618  1.00 73.70 ? 128 GLU A CD  1 
ATOM   988  O  OE1 . GLU A 1 140 ? -29.651 51.647 13.580  1.00 75.09 ? 128 GLU A OE1 1 
ATOM   989  O  OE2 . GLU A 1 140 ? -31.347 52.441 14.769  1.00 75.62 ? 128 GLU A OE2 1 
ATOM   990  N  N   . TYR A 1 141 ? -25.992 48.737 16.966  1.00 53.13 ? 129 TYR A N   1 
ATOM   991  C  CA  . TYR A 1 141 ? -24.735 47.970 16.792  1.00 49.31 ? 129 TYR A CA  1 
ATOM   992  C  C   . TYR A 1 141 ? -24.894 46.587 17.435  1.00 46.99 ? 129 TYR A C   1 
ATOM   993  O  O   . TYR A 1 141 ? -24.474 45.585 16.865  1.00 44.95 ? 129 TYR A O   1 
ATOM   994  C  CB  . TYR A 1 141 ? -23.499 48.675 17.379  1.00 47.90 ? 129 TYR A CB  1 
ATOM   995  C  CG  . TYR A 1 141 ? -23.023 49.908 16.640  1.00 49.52 ? 129 TYR A CG  1 
ATOM   996  C  CD1 . TYR A 1 141 ? -22.311 49.799 15.433  1.00 50.86 ? 129 TYR A CD1 1 
ATOM   997  C  CD2 . TYR A 1 141 ? -23.254 51.193 17.152  1.00 52.94 ? 129 TYR A CD2 1 
ATOM   998  C  CE1 . TYR A 1 141 ? -21.855 50.939 14.755  1.00 50.74 ? 129 TYR A CE1 1 
ATOM   999  C  CE2 . TYR A 1 141 ? -22.807 52.348 16.471  1.00 54.02 ? 129 TYR A CE2 1 
ATOM   1000 C  CZ  . TYR A 1 141 ? -22.096 52.191 15.273  1.00 55.36 ? 129 TYR A CZ  1 
ATOM   1001 O  OH  . TYR A 1 141 ? -21.637 53.305 14.586  1.00 61.87 ? 129 TYR A OH  1 
ATOM   1002 N  N   . ALA A 1 142 ? -25.498 46.554 18.622  1.00 46.76 ? 130 ALA A N   1 
ATOM   1003 C  CA  . ALA A 1 142 ? -25.733 45.314 19.352  1.00 45.87 ? 130 ALA A CA  1 
ATOM   1004 C  C   . ALA A 1 142 ? -26.673 44.373 18.598  1.00 46.82 ? 130 ALA A C   1 
ATOM   1005 O  O   . ALA A 1 142 ? -26.398 43.192 18.521  1.00 45.37 ? 130 ALA A O   1 
ATOM   1006 C  CB  . ALA A 1 142 ? -26.274 45.597 20.745  1.00 45.73 ? 130 ALA A CB  1 
ATOM   1007 N  N   . GLU A 1 143 ? -27.768 44.902 18.047  1.00 49.34 ? 131 GLU A N   1 
ATOM   1008 C  CA  . GLU A 1 143 ? -28.742 44.083 17.288  1.00 50.69 ? 131 GLU A CA  1 
ATOM   1009 C  C   . GLU A 1 143 ? -28.108 43.471 16.071  1.00 48.66 ? 131 GLU A C   1 
ATOM   1010 O  O   . GLU A 1 143 ? -28.375 42.307 15.745  1.00 48.49 ? 131 GLU A O   1 
ATOM   1011 C  CB  . GLU A 1 143 ? -29.964 44.884 16.827  1.00 53.33 ? 131 GLU A CB  1 
ATOM   1012 C  CG  . GLU A 1 143 ? -30.799 45.413 17.963  1.00 58.36 ? 131 GLU A CG  1 
ATOM   1013 C  CD  . GLU A 1 143 ? -31.913 46.360 17.506  1.00 65.31 ? 131 GLU A CD  1 
ATOM   1014 O  OE1 . GLU A 1 143 ? -32.348 46.222 16.333  1.00 69.01 ? 131 GLU A OE1 1 
ATOM   1015 O  OE2 . GLU A 1 143 ? -32.352 47.237 18.313  1.00 67.37 ? 131 GLU A OE2 1 
ATOM   1016 N  N   . ILE A 1 144 ? -27.262 44.244 15.393  1.00 46.56 ? 132 ILE A N   1 
ATOM   1017 C  CA  . ILE A 1 144 ? -26.580 43.734 14.220  1.00 44.08 ? 132 ILE A CA  1 
ATOM   1018 C  C   . ILE A 1 144 ? -25.637 42.579 14.635  1.00 41.62 ? 132 ILE A C   1 
ATOM   1019 O  O   . ILE A 1 144 ? -25.606 41.509 13.996  1.00 40.16 ? 132 ILE A O   1 
ATOM   1020 C  CB  . ILE A 1 144 ? -25.821 44.877 13.532  1.00 44.79 ? 132 ILE A CB  1 
ATOM   1021 C  CG1 . ILE A 1 144 ? -26.823 45.968 13.071  1.00 47.29 ? 132 ILE A CG1 1 
ATOM   1022 C  CG2 . ILE A 1 144 ? -24.972 44.355 12.408  1.00 42.17 ? 132 ILE A CG2 1 
ATOM   1023 C  CD1 . ILE A 1 144 ? -26.318 46.935 12.004  1.00 48.36 ? 132 ILE A CD1 1 
ATOM   1024 N  N   . ILE A 1 145 ? -24.876 42.792 15.708  1.00 38.23 ? 133 ILE A N   1 
ATOM   1025 C  CA  . ILE A 1 145 ? -23.929 41.781 16.168  1.00 36.74 ? 133 ILE A CA  1 
ATOM   1026 C  C   . ILE A 1 145 ? -24.667 40.520 16.613  1.00 36.70 ? 133 ILE A C   1 
ATOM   1027 O  O   . ILE A 1 145 ? -24.248 39.421 16.319  1.00 36.83 ? 133 ILE A O   1 
ATOM   1028 C  CB  . ILE A 1 145 ? -22.978 42.310 17.302  1.00 35.43 ? 133 ILE A CB  1 
ATOM   1029 C  CG1 . ILE A 1 145 ? -21.977 43.309 16.685  1.00 34.97 ? 133 ILE A CG1 1 
ATOM   1030 C  CG2 . ILE A 1 145 ? -22.309 41.093 18.087  1.00 33.81 ? 133 ILE A CG2 1 
ATOM   1031 C  CD1 . ILE A 1 145 ? -21.185 44.133 17.673  1.00 33.63 ? 133 ILE A CD1 1 
ATOM   1032 N  N   . ASN A 1 146 ? -25.786 40.689 17.293  1.00 38.36 ? 134 ASN A N   1 
ATOM   1033 C  CA  . ASN A 1 146 ? -26.614 39.551 17.710  1.00 39.61 ? 134 ASN A CA  1 
ATOM   1034 C  C   . ASN A 1 146 ? -27.214 38.775 16.508  1.00 40.59 ? 134 ASN A C   1 
ATOM   1035 O  O   . ASN A 1 146 ? -27.182 37.539 16.489  1.00 40.90 ? 134 ASN A O   1 
ATOM   1036 C  CB  . ASN A 1 146 ? -27.699 40.007 18.699  1.00 40.76 ? 134 ASN A CB  1 
ATOM   1037 C  CG  . ASN A 1 146 ? -27.101 40.480 20.035  1.00 41.96 ? 134 ASN A CG  1 
ATOM   1038 O  OD1 . ASN A 1 146 ? -25.983 40.108 20.401  1.00 43.82 ? 134 ASN A OD1 1 
ATOM   1039 N  ND2 . ASN A 1 146 ? -27.831 41.304 20.746  1.00 43.11 ? 134 ASN A ND2 1 
ATOM   1040 N  N   . LEU A 1 147 ? -27.706 39.502 15.508  1.00 41.24 ? 135 LEU A N   1 
ATOM   1041 C  CA  . LEU A 1 147 ? -28.142 38.926 14.232  1.00 42.76 ? 135 LEU A CA  1 
ATOM   1042 C  C   . LEU A 1 147 ? -27.021 38.161 13.531  1.00 41.41 ? 135 LEU A C   1 
ATOM   1043 O  O   . LEU A 1 147 ? -27.219 37.051 13.114  1.00 42.34 ? 135 LEU A O   1 
ATOM   1044 C  CB  . LEU A 1 147 ? -28.742 40.017 13.308  1.00 44.61 ? 135 LEU A CB  1 
ATOM   1045 C  CG  . LEU A 1 147 ? -30.103 40.540 13.876  1.00 48.75 ? 135 LEU A CG  1 
ATOM   1046 C  CD1 . LEU A 1 147 ? -30.476 41.948 13.380  1.00 51.52 ? 135 LEU A CD1 1 
ATOM   1047 C  CD2 . LEU A 1 147 ? -31.280 39.537 13.680  1.00 50.38 ? 135 LEU A CD2 1 
ATOM   1048 N  N   . VAL A 1 148 ? -25.827 38.736 13.445  1.00 39.67 ? 136 VAL A N   1 
ATOM   1049 C  CA  . VAL A 1 148 ? -24.705 38.042 12.833  1.00 38.76 ? 136 VAL A CA  1 
ATOM   1050 C  C   . VAL A 1 148 ? -24.394 36.710 13.586  1.00 38.60 ? 136 VAL A C   1 
ATOM   1051 O  O   . VAL A 1 148 ? -24.309 35.670 12.956  1.00 37.40 ? 136 VAL A O   1 
ATOM   1052 C  CB  . VAL A 1 148 ? -23.454 38.928 12.775  1.00 37.67 ? 136 VAL A CB  1 
ATOM   1053 C  CG1 . VAL A 1 148 ? -22.213 38.099 12.456  1.00 35.24 ? 136 VAL A CG1 1 
ATOM   1054 C  CG2 . VAL A 1 148 ? -23.692 40.063 11.772  1.00 38.75 ? 136 VAL A CG2 1 
ATOM   1055 N  N   . ASN A 1 149 ? -24.283 36.766 14.916  1.00 37.99 ? 137 ASN A N   1 
ATOM   1056 C  CA  . ASN A 1 149 ? -24.093 35.564 15.748  1.00 38.42 ? 137 ASN A CA  1 
ATOM   1057 C  C   . ASN A 1 149 ? -25.180 34.485 15.659  1.00 40.52 ? 137 ASN A C   1 
ATOM   1058 O  O   . ASN A 1 149 ? -24.910 33.344 15.924  1.00 40.00 ? 137 ASN A O   1 
ATOM   1059 C  CB  . ASN A 1 149 ? -23.939 35.948 17.246  1.00 37.69 ? 137 ASN A CB  1 
ATOM   1060 C  CG  . ASN A 1 149 ? -22.659 36.696 17.533  1.00 36.68 ? 137 ASN A CG  1 
ATOM   1061 O  OD1 . ASN A 1 149 ? -21.733 36.716 16.700  1.00 32.99 ? 137 ASN A OD1 1 
ATOM   1062 N  ND2 . ASN A 1 149 ? -22.596 37.354 18.714  1.00 33.46 ? 137 ASN A ND2 1 
ATOM   1063 N  N   . LYS A 1 150 ? -26.407 34.840 15.309  1.00 43.68 ? 138 LYS A N   1 
ATOM   1064 C  CA  . LYS A 1 150 ? -27.463 33.839 15.151  1.00 46.71 ? 138 LYS A CA  1 
ATOM   1065 C  C   . LYS A 1 150 ? -27.506 33.325 13.726  1.00 46.82 ? 138 LYS A C   1 
ATOM   1066 O  O   . LYS A 1 150 ? -28.297 32.466 13.444  1.00 48.33 ? 138 LYS A O   1 
ATOM   1067 C  CB  . LYS A 1 150 ? -28.856 34.417 15.454  1.00 48.88 ? 138 LYS A CB  1 
ATOM   1068 C  CG  . LYS A 1 150 ? -29.213 34.598 16.897  1.00 52.40 ? 138 LYS A CG  1 
ATOM   1069 C  CD  . LYS A 1 150 ? -30.520 35.403 16.950  1.00 58.69 ? 138 LYS A CD  1 
ATOM   1070 C  CE  . LYS A 1 150 ? -31.097 35.578 18.368  1.00 63.02 ? 138 LYS A CE  1 
ATOM   1071 N  NZ  . LYS A 1 150 ? -30.148 36.312 19.276  1.00 62.76 ? 138 LYS A NZ  1 
ATOM   1072 N  N   . SER A 1 151 ? -26.690 33.840 12.821  1.00 44.87 ? 139 SER A N   1 
ATOM   1073 C  CA  . SER A 1 151 ? -26.971 33.642 11.396  1.00 45.67 ? 139 SER A CA  1 
ATOM   1074 C  C   . SER A 1 151 ? -26.448 32.328 10.838  1.00 46.30 ? 139 SER A C   1 
ATOM   1075 O  O   . SER A 1 151 ? -26.846 31.930 9.748   1.00 47.27 ? 139 SER A O   1 
ATOM   1076 C  CB  . SER A 1 151 ? -26.327 34.762 10.604  1.00 44.68 ? 139 SER A CB  1 
ATOM   1077 O  OG  . SER A 1 151 ? -24.897 34.615 10.637  1.00 42.02 ? 139 SER A OG  1 
ATOM   1078 N  N   . GLY A 1 152 ? -25.498 31.708 11.540  1.00 45.32 ? 140 GLY A N   1 
ATOM   1079 C  CA  . GLY A 1 152 ? -24.811 30.514 11.041  1.00 45.86 ? 140 GLY A CA  1 
ATOM   1080 C  C   . GLY A 1 152 ? -23.875 30.715 9.842   1.00 45.20 ? 140 GLY A C   1 
ATOM   1081 O  O   . GLY A 1 152 ? -23.490 29.755 9.167   1.00 45.98 ? 140 GLY A O   1 
ATOM   1082 N  N   . LYS A 1 153 ? -23.525 31.954 9.537   1.00 43.08 ? 141 LYS A N   1 
ATOM   1083 C  CA  . LYS A 1 153 ? -22.627 32.210 8.426   1.00 41.90 ? 141 LYS A CA  1 
ATOM   1084 C  C   . LYS A 1 153 ? -21.196 32.149 8.919   1.00 39.10 ? 141 LYS A C   1 
ATOM   1085 O  O   . LYS A 1 153 ? -20.932 32.268 10.095  1.00 39.88 ? 141 LYS A O   1 
ATOM   1086 C  CB  . LYS A 1 153 ? -22.875 33.592 7.823   1.00 41.60 ? 141 LYS A CB  1 
ATOM   1087 C  CG  . LYS A 1 153 ? -24.289 33.842 7.321   1.00 43.93 ? 141 LYS A CG  1 
ATOM   1088 C  CD  . LYS A 1 153 ? -24.746 32.832 6.281   1.00 46.77 ? 141 LYS A CD  1 
ATOM   1089 C  CE  . LYS A 1 153 ? -26.224 33.051 5.966   1.00 48.10 ? 141 LYS A CE  1 
ATOM   1090 N  NZ  . LYS A 1 153 ? -26.565 32.537 4.612   1.00 49.77 ? 141 LYS A NZ  1 
ATOM   1091 N  N   . VAL A 1 154 ? -20.278 31.975 8.004   1.00 38.12 ? 142 VAL A N   1 
ATOM   1092 C  CA  . VAL A 1 154 ? -18.860 32.132 8.283   1.00 36.35 ? 142 VAL A CA  1 
ATOM   1093 C  C   . VAL A 1 154 ? -18.526 33.602 8.613   1.00 34.75 ? 142 VAL A C   1 
ATOM   1094 O  O   . VAL A 1 154 ? -18.823 34.495 7.832   1.00 35.45 ? 142 VAL A O   1 
ATOM   1095 C  CB  . VAL A 1 154 ? -18.034 31.687 7.051   1.00 37.02 ? 142 VAL A CB  1 
ATOM   1096 C  CG1 . VAL A 1 154 ? -16.532 31.957 7.284   1.00 33.79 ? 142 VAL A CG1 1 
ATOM   1097 C  CG2 . VAL A 1 154 ? -18.382 30.203 6.693   1.00 37.44 ? 142 VAL A CG2 1 
ATOM   1098 N  N   . VAL A 1 155 ? -17.922 33.833 9.771   1.00 33.26 ? 143 VAL A N   1 
ATOM   1099 C  CA  . VAL A 1 155 ? -17.571 35.181 10.234  1.00 32.08 ? 143 VAL A CA  1 
ATOM   1100 C  C   . VAL A 1 155 ? -16.057 35.349 10.337  1.00 30.38 ? 143 VAL A C   1 
ATOM   1101 O  O   . VAL A 1 155 ? -15.370 34.568 10.992  1.00 30.28 ? 143 VAL A O   1 
ATOM   1102 C  CB  . VAL A 1 155 ? -18.179 35.507 11.601  1.00 32.27 ? 143 VAL A CB  1 
ATOM   1103 C  CG1 . VAL A 1 155 ? -17.897 36.990 11.971  1.00 28.36 ? 143 VAL A CG1 1 
ATOM   1104 C  CG2 . VAL A 1 155 ? -19.699 35.208 11.589  1.00 33.34 ? 143 VAL A CG2 1 
ATOM   1105 N  N   . VAL A 1 156 ? -15.557 36.362 9.641   1.00 29.64 ? 144 VAL A N   1 
ATOM   1106 C  CA  . VAL A 1 156 ? -14.153 36.717 9.642   1.00 28.36 ? 144 VAL A CA  1 
ATOM   1107 C  C   . VAL A 1 156 ? -14.089 38.097 10.290  1.00 28.06 ? 144 VAL A C   1 
ATOM   1108 O  O   . VAL A 1 156 ? -14.674 39.043 9.769   1.00 28.12 ? 144 VAL A O   1 
ATOM   1109 C  CB  . VAL A 1 156 ? -13.631 36.781 8.176   1.00 28.97 ? 144 VAL A CB  1 
ATOM   1110 C  CG1 . VAL A 1 156 ? -12.191 37.268 8.127   1.00 27.64 ? 144 VAL A CG1 1 
ATOM   1111 C  CG2 . VAL A 1 156 ? -13.757 35.371 7.497   1.00 28.70 ? 144 VAL A CG2 1 
ATOM   1112 N  N   . SER A 1 157 ? -13.380 38.216 11.415  1.00 26.99 ? 145 SER A N   1 
ATOM   1113 C  CA  . SER A 1 157 ? -13.208 39.490 12.072  1.00 26.82 ? 145 SER A CA  1 
ATOM   1114 C  C   . SER A 1 157 ? -11.883 40.161 11.717  1.00 27.24 ? 145 SER A C   1 
ATOM   1115 O  O   . SER A 1 157 ? -10.806 39.532 11.688  1.00 27.69 ? 145 SER A O   1 
ATOM   1116 C  CB  . SER A 1 157 ? -13.336 39.317 13.593  1.00 27.11 ? 145 SER A CB  1 
ATOM   1117 O  OG  . SER A 1 157 ? -14.679 39.021 13.941  1.00 26.51 ? 145 SER A OG  1 
ATOM   1118 N  N   . VAL A 1 158 ? -11.975 41.444 11.416  1.00 27.26 ? 146 VAL A N   1 
ATOM   1119 C  CA  . VAL A 1 158 ? -10.826 42.232 11.126  1.00 27.19 ? 146 VAL A CA  1 
ATOM   1120 C  C   . VAL A 1 158 ? -10.232 42.745 12.443  1.00 27.77 ? 146 VAL A C   1 
ATOM   1121 O  O   . VAL A 1 158 ? -10.910 43.490 13.191  1.00 29.18 ? 146 VAL A O   1 
ATOM   1122 C  CB  . VAL A 1 158 ? -11.172 43.385 10.222  1.00 27.31 ? 146 VAL A CB  1 
ATOM   1123 C  CG1 . VAL A 1 158 ? -9.932  44.246 9.984   1.00 27.34 ? 146 VAL A CG1 1 
ATOM   1124 C  CG2 . VAL A 1 158 ? -11.778 42.851 8.869   1.00 25.45 ? 146 VAL A CG2 1 
ATOM   1125 N  N   . ASP A 1 159 ? -8.977  42.356 12.685  1.00 27.48 ? 147 ASP A N   1 
ATOM   1126 C  CA  . ASP A 1 159 ? -8.161  42.766 13.852  1.00 30.41 ? 147 ASP A CA  1 
ATOM   1127 C  C   . ASP A 1 159 ? -8.574  42.122 15.181  1.00 29.72 ? 147 ASP A C   1 
ATOM   1128 O  O   . ASP A 1 159 ? -7.815  41.381 15.750  1.00 29.27 ? 147 ASP A O   1 
ATOM   1129 C  CB  . ASP A 1 159 ? -8.081  44.295 14.012  1.00 31.29 ? 147 ASP A CB  1 
ATOM   1130 C  CG  . ASP A 1 159 ? -6.775  44.751 14.728  1.00 36.22 ? 147 ASP A CG  1 
ATOM   1131 O  OD1 . ASP A 1 159 ? -5.889  43.928 15.070  1.00 37.89 ? 147 ASP A OD1 1 
ATOM   1132 O  OD2 . ASP A 1 159 ? -6.651  45.961 14.939  1.00 40.38 ? 147 ASP A OD2 1 
ATOM   1133 N  N   . VAL A 1 160 ? -9.791  42.367 15.612  1.00 31.16 ? 148 VAL A N   1 
ATOM   1134 C  CA  . VAL A 1 160 ? -10.367 41.757 16.809  1.00 32.45 ? 148 VAL A CA  1 
ATOM   1135 C  C   . VAL A 1 160 ? -11.874 41.652 16.589  1.00 31.58 ? 148 VAL A C   1 
ATOM   1136 O  O   . VAL A 1 160 ? -12.472 42.540 16.011  1.00 32.34 ? 148 VAL A O   1 
ATOM   1137 C  CB  . VAL A 1 160 ? -10.198 42.609 18.103  1.00 34.90 ? 148 VAL A CB  1 
ATOM   1138 C  CG1 . VAL A 1 160 ? -8.775  42.628 18.576  1.00 39.11 ? 148 VAL A CG1 1 
ATOM   1139 C  CG2 . VAL A 1 160 ? -10.700 44.041 17.858  1.00 36.16 ? 148 VAL A CG2 1 
ATOM   1140 N  N   . PRO A 1 161 ? -12.504 40.581 17.044  1.00 30.21 ? 149 PRO A N   1 
ATOM   1141 C  CA  . PRO A 1 161 ? -13.959 40.525 16.930  1.00 29.98 ? 149 PRO A CA  1 
ATOM   1142 C  C   . PRO A 1 161 ? -14.612 41.736 17.592  1.00 30.78 ? 149 PRO A C   1 
ATOM   1143 O  O   . PRO A 1 161 ? -14.248 42.099 18.725  1.00 31.01 ? 149 PRO A O   1 
ATOM   1144 C  CB  . PRO A 1 161 ? -14.314 39.249 17.668  1.00 31.21 ? 149 PRO A CB  1 
ATOM   1145 C  CG  . PRO A 1 161 ? -13.037 38.484 17.711  1.00 31.18 ? 149 PRO A CG  1 
ATOM   1146 C  CD  . PRO A 1 161 ? -11.965 39.503 17.861  1.00 30.46 ? 149 PRO A CD  1 
ATOM   1147 N  N   . SER A 1 162 ? -15.528 42.402 16.889  1.00 30.19 ? 150 SER A N   1 
ATOM   1148 C  CA  . SER A 1 162 ? -16.107 43.632 17.394  1.00 29.58 ? 150 SER A CA  1 
ATOM   1149 C  C   . SER A 1 162 ? -16.813 43.391 18.720  1.00 30.71 ? 150 SER A C   1 
ATOM   1150 O  O   . SER A 1 162 ? -17.617 42.482 18.843  1.00 30.26 ? 150 SER A O   1 
ATOM   1151 C  CB  . SER A 1 162 ? -17.059 44.195 16.324  1.00 31.08 ? 150 SER A CB  1 
ATOM   1152 O  OG  . SER A 1 162 ? -16.300 44.608 15.157  1.00 29.63 ? 150 SER A OG  1 
ATOM   1153 N  N   . GLY A 1 163 ? -16.487 44.184 19.734  1.00 30.83 ? 151 GLY A N   1 
ATOM   1154 C  CA  . GLY A 1 163 ? -17.043 43.962 21.027  1.00 31.40 ? 151 GLY A CA  1 
ATOM   1155 C  C   . GLY A 1 163 ? -16.075 43.344 22.014  1.00 31.58 ? 151 GLY A C   1 
ATOM   1156 O  O   . GLY A 1 163 ? -16.330 43.384 23.199  1.00 32.25 ? 151 GLY A O   1 
ATOM   1157 N  N   . ILE A 1 164 ? -14.957 42.797 21.567  1.00 30.31 ? 152 ILE A N   1 
ATOM   1158 C  CA  . ILE A 1 164 ? -13.927 42.408 22.536  1.00 31.10 ? 152 ILE A CA  1 
ATOM   1159 C  C   . ILE A 1 164 ? -13.019 43.602 22.858  1.00 32.24 ? 152 ILE A C   1 
ATOM   1160 O  O   . ILE A 1 164 ? -12.522 44.262 21.937  1.00 33.20 ? 152 ILE A O   1 
ATOM   1161 C  CB  . ILE A 1 164 ? -13.092 41.255 21.969  1.00 30.46 ? 152 ILE A CB  1 
ATOM   1162 C  CG1 . ILE A 1 164 ? -13.972 39.995 21.890  1.00 31.21 ? 152 ILE A CG1 1 
ATOM   1163 C  CG2 . ILE A 1 164 ? -11.879 40.957 22.828  1.00 32.04 ? 152 ILE A CG2 1 
ATOM   1164 C  CD1 . ILE A 1 164 ? -14.646 39.628 23.202  1.00 34.67 ? 152 ILE A CD1 1 
ATOM   1165 N  N   . ASP A 1 165 ? -12.790 43.884 24.133  1.00 32.68 ? 153 ASP A N   1 
ATOM   1166 C  CA  . ASP A 1 165 ? -11.745 44.851 24.539  1.00 33.40 ? 153 ASP A CA  1 
ATOM   1167 C  C   . ASP A 1 165 ? -10.390 44.230 24.331  1.00 33.00 ? 153 ASP A C   1 
ATOM   1168 O  O   . ASP A 1 165 ? -10.041 43.208 24.927  1.00 32.18 ? 153 ASP A O   1 
ATOM   1169 C  CB  . ASP A 1 165 ? -11.900 45.192 26.021  1.00 36.35 ? 153 ASP A CB  1 
ATOM   1170 C  CG  . ASP A 1 165 ? -10.880 46.226 26.510  1.00 38.31 ? 153 ASP A CG  1 
ATOM   1171 O  OD1 . ASP A 1 165 ? -9.764  46.393 25.955  1.00 42.79 ? 153 ASP A OD1 1 
ATOM   1172 O  OD2 . ASP A 1 165 ? -11.232 46.861 27.481  1.00 43.21 ? 153 ASP A OD2 1 
ATOM   1173 N  N   . SER A 1 166 ? -9.607  44.856 23.478  1.00 33.60 ? 154 SER A N   1 
ATOM   1174 C  CA  . SER A 1 166 ? -8.425  44.260 23.012  1.00 33.94 ? 154 SER A CA  1 
ATOM   1175 C  C   . SER A 1 166 ? -7.287  44.272 24.037  1.00 34.70 ? 154 SER A C   1 
ATOM   1176 O  O   . SER A 1 166 ? -6.288  43.623 23.823  1.00 33.92 ? 154 SER A O   1 
ATOM   1177 C  CB  . SER A 1 166 ? -8.006  44.944 21.711  1.00 34.96 ? 154 SER A CB  1 
ATOM   1178 O  OG  . SER A 1 166 ? -7.430  46.175 22.007  1.00 38.12 ? 154 SER A OG  1 
ATOM   1179 N  N   . ASN A 1 167 ? -7.439  45.025 25.119  1.00 36.22 ? 155 ASN A N   1 
ATOM   1180 C  CA  . ASN A 1 167 ? -6.484  45.015 26.215  1.00 38.25 ? 155 ASN A CA  1 
ATOM   1181 C  C   . ASN A 1 167 ? -6.797  44.033 27.330  1.00 36.91 ? 155 ASN A C   1 
ATOM   1182 O  O   . ASN A 1 167 ? -5.928  43.777 28.134  1.00 38.05 ? 155 ASN A O   1 
ATOM   1183 C  CB  . ASN A 1 167 ? -6.441  46.386 26.914  1.00 40.34 ? 155 ASN A CB  1 
ATOM   1184 C  CG  . ASN A 1 167 ? -6.015  47.494 25.977  1.00 45.85 ? 155 ASN A CG  1 
ATOM   1185 O  OD1 . ASN A 1 167 ? -5.076  47.329 25.199  1.00 50.36 ? 155 ASN A OD1 1 
ATOM   1186 N  ND2 . ASN A 1 167 ? -6.728  48.614 26.018  1.00 50.28 ? 155 ASN A ND2 1 
ATOM   1187 N  N   . THR A 1 168 ? -8.029  43.564 27.429  1.00 34.22 ? 156 THR A N   1 
ATOM   1188 C  CA  . THR A 1 168 ? -8.412  42.702 28.534  1.00 34.84 ? 156 THR A CA  1 
ATOM   1189 C  C   . THR A 1 168 ? -9.037  41.333 28.084  1.00 33.61 ? 156 THR A C   1 
ATOM   1190 O  O   . THR A 1 168 ? -9.110  40.400 28.879  1.00 33.98 ? 156 THR A O   1 
ATOM   1191 C  CB  . THR A 1 168 ? -9.497  43.367 29.391  1.00 35.35 ? 156 THR A CB  1 
ATOM   1192 O  OG1 . THR A 1 168 ? -10.673 43.534 28.576  1.00 33.09 ? 156 THR A OG1 1 
ATOM   1193 C  CG2 . THR A 1 168 ? -9.032  44.721 29.930  1.00 38.19 ? 156 THR A CG2 1 
ATOM   1194 N  N   . GLY A 1 169 ? -9.595  41.279 26.877  1.00 31.52 ? 157 GLY A N   1 
ATOM   1195 C  CA  . GLY A 1 169 ? -10.356 40.101 26.423  1.00 30.92 ? 157 GLY A CA  1 
ATOM   1196 C  C   . GLY A 1 169 ? -11.799 40.022 26.940  1.00 30.55 ? 157 GLY A C   1 
ATOM   1197 O  O   . GLY A 1 169 ? -12.482 39.038 26.701  1.00 28.45 ? 157 GLY A O   1 
ATOM   1198 N  N   . LYS A 1 170 ? -12.259 41.055 27.636  1.00 30.74 ? 158 LYS A N   1 
ATOM   1199 C  CA  . LYS A 1 170 ? -13.642 41.135 28.050  1.00 32.83 ? 158 LYS A CA  1 
ATOM   1200 C  C   . LYS A 1 170 ? -14.604 41.483 26.940  1.00 32.72 ? 158 LYS A C   1 
ATOM   1201 O  O   . LYS A 1 170 ? -14.251 42.171 25.988  1.00 32.09 ? 158 LYS A O   1 
ATOM   1202 C  CB  . LYS A 1 170 ? -13.774 42.126 29.235  1.00 34.94 ? 158 LYS A CB  1 
ATOM   1203 C  CG  . LYS A 1 170 ? -13.015 41.552 30.456  1.00 39.08 ? 158 LYS A CG  1 
ATOM   1204 C  CD  . LYS A 1 170 ? -13.179 42.300 31.735  1.00 48.49 ? 158 LYS A CD  1 
ATOM   1205 C  CE  . LYS A 1 170 ? -12.971 41.317 32.954  1.00 52.40 ? 158 LYS A CE  1 
ATOM   1206 N  NZ  . LYS A 1 170 ? -13.168 42.031 34.266  1.00 58.40 ? 158 LYS A NZ  1 
ATOM   1207 N  N   . VAL A 1 171 ? -15.835 41.004 27.084  1.00 33.71 ? 159 VAL A N   1 
ATOM   1208 C  CA  . VAL A 1 171 ? -16.912 41.314 26.158  1.00 34.02 ? 159 VAL A CA  1 
ATOM   1209 C  C   . VAL A 1 171 ? -17.569 42.598 26.654  1.00 35.88 ? 159 VAL A C   1 
ATOM   1210 O  O   . VAL A 1 171 ? -18.024 42.664 27.805  1.00 36.09 ? 159 VAL A O   1 
ATOM   1211 C  CB  . VAL A 1 171 ? -18.000 40.174 26.117  1.00 34.73 ? 159 VAL A CB  1 
ATOM   1212 C  CG1 . VAL A 1 171 ? -19.297 40.666 25.367  1.00 35.30 ? 159 VAL A CG1 1 
ATOM   1213 C  CG2 . VAL A 1 171 ? -17.424 38.899 25.457  1.00 32.20 ? 159 VAL A CG2 1 
ATOM   1214 N  N   . LEU A 1 172 ? -17.626 43.607 25.788  1.00 35.95 ? 160 LEU A N   1 
ATOM   1215 C  CA  . LEU A 1 172 ? -18.257 44.881 26.147  1.00 38.14 ? 160 LEU A CA  1 
ATOM   1216 C  C   . LEU A 1 172 ? -19.754 44.808 25.734  1.00 38.43 ? 160 LEU A C   1 
ATOM   1217 O  O   . LEU A 1 172 ? -20.178 45.286 24.657  1.00 36.98 ? 160 LEU A O   1 
ATOM   1218 C  CB  . LEU A 1 172 ? -17.513 46.051 25.511  1.00 38.56 ? 160 LEU A CB  1 
ATOM   1219 C  CG  . LEU A 1 172 ? -16.043 46.188 25.995  1.00 41.12 ? 160 LEU A CG  1 
ATOM   1220 C  CD1 . LEU A 1 172 ? -15.406 47.477 25.422  1.00 44.15 ? 160 LEU A CD1 1 
ATOM   1221 C  CD2 . LEU A 1 172 ? -15.949 46.239 27.499  1.00 41.45 ? 160 LEU A CD2 1 
ATOM   1222 N  N   . ARG A 1 173 ? -20.491 44.145 26.617  1.00 38.29 ? 161 ARG A N   1 
ATOM   1223 C  CA  . ARG A 1 173 ? -21.913 43.817 26.506  1.00 41.11 ? 161 ARG A CA  1 
ATOM   1224 C  C   . ARG A 1 173 ? -22.227 42.753 25.466  1.00 40.50 ? 161 ARG A C   1 
ATOM   1225 O  O   . ARG A 1 173 ? -22.836 41.755 25.780  1.00 40.83 ? 161 ARG A O   1 
ATOM   1226 C  CB  . ARG A 1 173 ? -22.789 45.054 26.294  1.00 43.49 ? 161 ARG A CB  1 
ATOM   1227 C  CG  . ARG A 1 173 ? -24.253 44.781 26.650  1.00 47.34 ? 161 ARG A CG  1 
ATOM   1228 C  CD  . ARG A 1 173 ? -25.063 46.053 26.595  1.00 53.74 ? 161 ARG A CD  1 
ATOM   1229 N  NE  . ARG A 1 173 ? -26.497 45.794 26.492  1.00 60.81 ? 161 ARG A NE  1 
ATOM   1230 C  CZ  . ARG A 1 173 ? -27.177 45.595 25.356  1.00 64.63 ? 161 ARG A CZ  1 
ATOM   1231 N  NH1 . ARG A 1 173 ? -26.585 45.615 24.170  1.00 63.61 ? 161 ARG A NH1 1 
ATOM   1232 N  NH2 . ARG A 1 173 ? -28.491 45.388 25.412  1.00 70.41 ? 161 ARG A NH2 1 
ATOM   1233 N  N   . THR A 1 174 ? -21.830 42.966 24.225  1.00 40.17 ? 162 THR A N   1 
ATOM   1234 C  CA  . THR A 1 174 ? -21.971 41.925 23.228  1.00 40.14 ? 162 THR A CA  1 
ATOM   1235 C  C   . THR A 1 174 ? -20.791 41.990 22.263  1.00 37.08 ? 162 THR A C   1 
ATOM   1236 O  O   . THR A 1 174 ? -20.180 43.056 22.075  1.00 36.47 ? 162 THR A O   1 
ATOM   1237 C  CB  . THR A 1 174 ? -23.351 42.002 22.497  1.00 42.70 ? 162 THR A CB  1 
ATOM   1238 O  OG1 . THR A 1 174 ? -23.570 40.759 21.819  1.00 47.02 ? 162 THR A OG1 1 
ATOM   1239 C  CG2 . THR A 1 174 ? -23.413 43.135 21.446  1.00 42.63 ? 162 THR A CG2 1 
ATOM   1240 N  N   . ALA A 1 175 ? -20.460 40.842 21.677  1.00 35.32 ? 163 ALA A N   1 
ATOM   1241 C  CA  . ALA A 1 175 ? -19.309 40.724 20.784  1.00 33.06 ? 163 ALA A CA  1 
ATOM   1242 C  C   . ALA A 1 175 ? -19.548 39.679 19.698  1.00 31.70 ? 163 ALA A C   1 
ATOM   1243 O  O   . ALA A 1 175 ? -20.325 38.780 19.840  1.00 31.03 ? 163 ALA A O   1 
ATOM   1244 C  CB  . ALA A 1 175 ? -18.023 40.365 21.550  1.00 32.04 ? 163 ALA A CB  1 
ATOM   1245 N  N   . VAL A 1 176 ? -18.911 39.897 18.575  1.00 30.14 ? 164 VAL A N   1 
ATOM   1246 C  CA  . VAL A 1 176 ? -19.018 39.016 17.444  1.00 30.16 ? 164 VAL A CA  1 
ATOM   1247 C  C   . VAL A 1 176 ? -18.291 37.735 17.778  1.00 30.06 ? 164 VAL A C   1 
ATOM   1248 O  O   . VAL A 1 176 ? -17.206 37.783 18.379  1.00 30.44 ? 164 VAL A O   1 
ATOM   1249 C  CB  . VAL A 1 176 ? -18.366 39.662 16.203  1.00 29.72 ? 164 VAL A CB  1 
ATOM   1250 C  CG1 . VAL A 1 176 ? -18.108 38.615 15.103  1.00 28.28 ? 164 VAL A CG1 1 
ATOM   1251 C  CG2 . VAL A 1 176 ? -19.265 40.800 15.699  1.00 30.35 ? 164 VAL A CG2 1 
ATOM   1252 N  N   . LYS A 1 177 ? -18.874 36.599 17.413  1.00 30.25 ? 165 LYS A N   1 
ATOM   1253 C  CA  . LYS A 1 177 ? -18.173 35.334 17.515  1.00 32.34 ? 165 LYS A CA  1 
ATOM   1254 C  C   . LYS A 1 177 ? -17.632 34.961 16.145  1.00 31.18 ? 165 LYS A C   1 
ATOM   1255 O  O   . LYS A 1 177 ? -18.377 34.606 15.276  1.00 31.81 ? 165 LYS A O   1 
ATOM   1256 C  CB  . LYS A 1 177 ? -19.123 34.230 18.013  1.00 34.98 ? 165 LYS A CB  1 
ATOM   1257 C  CG  . LYS A 1 177 ? -18.393 32.876 18.223  1.00 41.15 ? 165 LYS A CG  1 
ATOM   1258 C  CD  . LYS A 1 177 ? -19.280 31.790 18.814  1.00 46.72 ? 165 LYS A CD  1 
ATOM   1259 C  CE  . LYS A 1 177 ? -18.432 30.693 19.491  1.00 48.65 ? 165 LYS A CE  1 
ATOM   1260 N  NZ  . LYS A 1 177 ? -17.373 30.222 18.595  1.00 48.63 ? 165 LYS A NZ  1 
ATOM   1261 N  N   . ALA A 1 178 ? -16.324 34.984 15.979  1.00 31.17 ? 166 ALA A N   1 
ATOM   1262 C  CA  . ALA A 1 178 ? -15.675 34.797 14.666  1.00 30.47 ? 166 ALA A CA  1 
ATOM   1263 C  C   . ALA A 1 178 ? -15.209 33.354 14.447  1.00 31.40 ? 166 ALA A C   1 
ATOM   1264 O  O   . ALA A 1 178 ? -14.782 32.655 15.387  1.00 31.55 ? 166 ALA A O   1 
ATOM   1265 C  CB  . ALA A 1 178 ? -14.462 35.745 14.557  1.00 29.20 ? 166 ALA A CB  1 
ATOM   1266 N  N   . ASP A 1 179 ? -15.237 32.921 13.201  1.00 31.74 ? 167 ASP A N   1 
ATOM   1267 C  CA  . ASP A 1 179 ? -14.546 31.649 12.822  1.00 32.44 ? 167 ASP A CA  1 
ATOM   1268 C  C   . ASP A 1 179 ? -13.072 31.894 12.606  1.00 31.65 ? 167 ASP A C   1 
ATOM   1269 O  O   . ASP A 1 179 ? -12.228 31.061 12.920  1.00 32.05 ? 167 ASP A O   1 
ATOM   1270 C  CB  . ASP A 1 179 ? -15.182 31.068 11.576  1.00 34.25 ? 167 ASP A CB  1 
ATOM   1271 C  CG  . ASP A 1 179 ? -16.656 30.721 11.795  1.00 37.20 ? 167 ASP A CG  1 
ATOM   1272 O  OD1 . ASP A 1 179 ? -16.903 29.726 12.466  1.00 43.73 ? 167 ASP A OD1 1 
ATOM   1273 O  OD2 . ASP A 1 179 ? -17.564 31.453 11.339  1.00 38.14 ? 167 ASP A OD2 1 
ATOM   1274 N  N   . LEU A 1 180 ? -12.752 33.082 12.108  1.00 31.32 ? 168 LEU A N   1 
ATOM   1275 C  CA  . LEU A 1 180 ? -11.386 33.456 11.753  1.00 31.52 ? 168 LEU A CA  1 
ATOM   1276 C  C   . LEU A 1 180 ? -11.203 34.935 12.108  1.00 30.26 ? 168 LEU A C   1 
ATOM   1277 O  O   . LEU A 1 180 ? -12.066 35.751 11.794  1.00 30.81 ? 168 LEU A O   1 
ATOM   1278 C  CB  . LEU A 1 180 ? -11.153 33.249 10.244  1.00 32.12 ? 168 LEU A CB  1 
ATOM   1279 C  CG  . LEU A 1 180 ? -9.862  33.829 9.682   1.00 34.04 ? 168 LEU A CG  1 
ATOM   1280 C  CD1 . LEU A 1 180 ? -8.658  33.003 10.234  1.00 32.96 ? 168 LEU A CD1 1 
ATOM   1281 C  CD2 . LEU A 1 180 ? -9.912  33.846 8.095   1.00 31.45 ? 168 LEU A CD2 1 
ATOM   1282 N  N   . THR A 1 181 ? -10.127 35.250 12.820  1.00 29.40 ? 169 THR A N   1 
ATOM   1283 C  CA  . THR A 1 181 ? -9.753  36.623 13.111  1.00 28.82 ? 169 THR A CA  1 
ATOM   1284 C  C   . THR A 1 181 ? -8.368  36.856 12.522  1.00 28.49 ? 169 THR A C   1 
ATOM   1285 O  O   . THR A 1 181 ? -7.432  36.021 12.704  1.00 28.64 ? 169 THR A O   1 
ATOM   1286 C  CB  . THR A 1 181 ? -9.739  36.896 14.610  1.00 28.65 ? 169 THR A CB  1 
ATOM   1287 O  OG1 . THR A 1 181 ? -11.052 36.674 15.126  1.00 27.40 ? 169 THR A OG1 1 
ATOM   1288 C  CG2 . THR A 1 181 ? -9.280  38.370 14.932  1.00 29.45 ? 169 THR A CG2 1 
ATOM   1289 N  N   . VAL A 1 182 ? -8.232  37.961 11.788  1.00 27.68 ? 170 VAL A N   1 
ATOM   1290 C  CA  . VAL A 1 182 ? -6.940  38.337 11.238  1.00 26.78 ? 170 VAL A CA  1 
ATOM   1291 C  C   . VAL A 1 182 ? -6.464  39.604 11.913  1.00 27.22 ? 170 VAL A C   1 
ATOM   1292 O  O   . VAL A 1 182 ? -7.075  40.660 11.749  1.00 26.82 ? 170 VAL A O   1 
ATOM   1293 C  CB  . VAL A 1 182 ? -7.019  38.548 9.709   1.00 27.98 ? 170 VAL A CB  1 
ATOM   1294 C  CG1 . VAL A 1 182 ? -5.647  38.834 9.137   1.00 27.74 ? 170 VAL A CG1 1 
ATOM   1295 C  CG2 . VAL A 1 182 ? -7.652  37.341 9.026   1.00 27.14 ? 170 VAL A CG2 1 
ATOM   1296 N  N   . THR A 1 183 ? -5.383  39.523 12.683  1.00 26.34 ? 171 THR A N   1 
ATOM   1297 C  CA  . THR A 1 183 ? -4.872  40.702 13.366  1.00 27.42 ? 171 THR A CA  1 
ATOM   1298 C  C   . THR A 1 183 ? -3.510  41.116 12.806  1.00 27.85 ? 171 THR A C   1 
ATOM   1299 O  O   . THR A 1 183 ? -2.946  40.433 11.977  1.00 29.55 ? 171 THR A O   1 
ATOM   1300 C  CB  . THR A 1 183 ? -4.808  40.508 14.903  1.00 27.99 ? 171 THR A CB  1 
ATOM   1301 O  OG1 . THR A 1 183 ? -4.657  41.792 15.529  1.00 27.47 ? 171 THR A OG1 1 
ATOM   1302 C  CG2 . THR A 1 183 ? -3.649  39.611 15.292  1.00 27.14 ? 171 THR A CG2 1 
ATOM   1303 N  N   . PHE A 1 184 ? -3.009  42.260 13.205  1.00 28.25 ? 172 PHE A N   1 
ATOM   1304 C  CA  . PHE A 1 184 ? -1.860  42.857 12.491  1.00 29.62 ? 172 PHE A CA  1 
ATOM   1305 C  C   . PHE A 1 184 ? -0.664  43.075 13.406  1.00 30.27 ? 172 PHE A C   1 
ATOM   1306 O  O   . PHE A 1 184 ? -0.782  43.569 14.548  1.00 31.59 ? 172 PHE A O   1 
ATOM   1307 C  CB  . PHE A 1 184 ? -2.322  44.133 11.781  1.00 30.07 ? 172 PHE A CB  1 
ATOM   1308 C  CG  . PHE A 1 184 ? -3.612  43.959 11.093  1.00 30.04 ? 172 PHE A CG  1 
ATOM   1309 C  CD1 . PHE A 1 184 ? -3.726  43.036 10.057  1.00 27.63 ? 172 PHE A CD1 1 
ATOM   1310 C  CD2 . PHE A 1 184 ? -4.730  44.682 11.473  1.00 28.93 ? 172 PHE A CD2 1 
ATOM   1311 C  CE1 . PHE A 1 184 ? -4.951  42.823 9.434   1.00 25.52 ? 172 PHE A CE1 1 
ATOM   1312 C  CE2 . PHE A 1 184 ? -5.931  44.479 10.848  1.00 27.20 ? 172 PHE A CE2 1 
ATOM   1313 C  CZ  . PHE A 1 184 ? -6.051  43.549 9.838   1.00 29.25 ? 172 PHE A CZ  1 
ATOM   1314 N  N   . GLY A 1 185 ? 0.500   42.655 12.961  1.00 31.22 ? 173 GLY A N   1 
ATOM   1315 C  CA  . GLY A 1 185 ? 1.722   42.881 13.771  1.00 32.23 ? 173 GLY A CA  1 
ATOM   1316 C  C   . GLY A 1 185 ? 1.949   41.829 14.856  1.00 33.07 ? 173 GLY A C   1 
ATOM   1317 O  O   . GLY A 1 185 ? 2.890   41.046 14.772  1.00 34.28 ? 173 GLY A O   1 
ATOM   1318 N  N   . VAL A 1 186 ? 1.111   41.834 15.883  1.00 32.22 ? 174 VAL A N   1 
ATOM   1319 C  CA  . VAL A 1 186 ? 1.239   40.942 17.030  1.00 33.43 ? 174 VAL A CA  1 
ATOM   1320 C  C   . VAL A 1 186 ? -0.171  40.568 17.540  1.00 32.88 ? 174 VAL A C   1 
ATOM   1321 O  O   . VAL A 1 186 ? -1.161  41.311 17.292  1.00 31.84 ? 174 VAL A O   1 
ATOM   1322 C  CB  . VAL A 1 186 ? 2.007   41.599 18.222  1.00 34.47 ? 174 VAL A CB  1 
ATOM   1323 C  CG1 . VAL A 1 186 ? 3.467   41.784 17.874  1.00 37.29 ? 174 VAL A CG1 1 
ATOM   1324 C  CG2 . VAL A 1 186 ? 1.384   42.913 18.622  1.00 34.34 ? 174 VAL A CG2 1 
ATOM   1325 N  N   . PRO A 1 187 ? -0.285  39.408 18.215  1.00 32.83 ? 175 PRO A N   1 
ATOM   1326 C  CA  . PRO A 1 187 ? -1.555  39.107 18.866  1.00 32.41 ? 175 PRO A CA  1 
ATOM   1327 C  C   . PRO A 1 187 ? -1.840  40.156 19.940  1.00 32.11 ? 175 PRO A C   1 
ATOM   1328 O  O   . PRO A 1 187 ? -0.913  40.685 20.518  1.00 33.28 ? 175 PRO A O   1 
ATOM   1329 C  CB  . PRO A 1 187 ? -1.332  37.725 19.506  1.00 34.15 ? 175 PRO A CB  1 
ATOM   1330 C  CG  . PRO A 1 187 ? 0.116   37.362 19.284  1.00 34.98 ? 175 PRO A CG  1 
ATOM   1331 C  CD  . PRO A 1 187 ? 0.764   38.396 18.449  1.00 34.41 ? 175 PRO A CD  1 
ATOM   1332 N  N   . LYS A 1 188 ? -3.094  40.490 20.160  1.00 31.33 ? 176 LYS A N   1 
ATOM   1333 C  CA  . LYS A 1 188 ? -3.452  41.411 21.221  1.00 32.18 ? 176 LYS A CA  1 
ATOM   1334 C  C   . LYS A 1 188 ? -3.878  40.604 22.425  1.00 31.62 ? 176 LYS A C   1 
ATOM   1335 O  O   . LYS A 1 188 ? -4.274  39.431 22.296  1.00 30.54 ? 176 LYS A O   1 
ATOM   1336 C  CB  . LYS A 1 188 ? -4.599  42.319 20.816  1.00 33.01 ? 176 LYS A CB  1 
ATOM   1337 C  CG  . LYS A 1 188 ? -4.502  43.009 19.410  1.00 35.66 ? 176 LYS A CG  1 
ATOM   1338 C  CD  . LYS A 1 188 ? -3.297  43.776 19.173  1.00 41.46 ? 176 LYS A CD  1 
ATOM   1339 C  CE  . LYS A 1 188 ? -3.328  44.424 17.696  1.00 40.79 ? 176 LYS A CE  1 
ATOM   1340 N  NZ  . LYS A 1 188 ? -2.647  43.521 16.690  1.00 39.28 ? 176 LYS A NZ  1 
ATOM   1341 N  N   . ILE A 1 189 ? -3.824  41.237 23.589  1.00 32.08 ? 177 ILE A N   1 
ATOM   1342 C  CA  . ILE A 1 189 ? -4.197  40.554 24.826  1.00 32.95 ? 177 ILE A CA  1 
ATOM   1343 C  C   . ILE A 1 189 ? -5.614  39.985 24.761  1.00 32.45 ? 177 ILE A C   1 
ATOM   1344 O  O   . ILE A 1 189 ? -5.842  38.909 25.289  1.00 29.62 ? 177 ILE A O   1 
ATOM   1345 C  CB  . ILE A 1 189 ? -4.018  41.481 26.058  1.00 35.21 ? 177 ILE A CB  1 
ATOM   1346 C  CG1 . ILE A 1 189 ? -2.512  41.727 26.266  1.00 36.82 ? 177 ILE A CG1 1 
ATOM   1347 C  CG2 . ILE A 1 189 ? -4.588  40.848 27.333  1.00 33.95 ? 177 ILE A CG2 1 
ATOM   1348 C  CD1 . ILE A 1 189 ? -2.199  42.687 27.311  1.00 40.91 ? 177 ILE A CD1 1 
ATOM   1349 N  N   . GLY A 1 190 ? -6.536  40.702 24.092  1.00 31.11 ? 178 GLY A N   1 
ATOM   1350 C  CA  . GLY A 1 190 ? -7.915  40.243 23.945  1.00 31.22 ? 178 GLY A CA  1 
ATOM   1351 C  C   . GLY A 1 190 ? -8.147  39.015 23.069  1.00 30.24 ? 178 GLY A C   1 
ATOM   1352 O  O   . GLY A 1 190 ? -9.207  38.410 23.138  1.00 30.13 ? 178 GLY A O   1 
ATOM   1353 N  N   . HIS A 1 191 ? -7.147  38.619 22.278  1.00 29.34 ? 179 HIS A N   1 
ATOM   1354 C  CA  . HIS A 1 191 ? -7.187  37.341 21.589  1.00 28.91 ? 179 HIS A CA  1 
ATOM   1355 C  C   . HIS A 1 191 ? -6.698  36.197 22.508  1.00 29.77 ? 179 HIS A C   1 
ATOM   1356 O  O   . HIS A 1 191 ? -6.919  35.023 22.231  1.00 28.86 ? 179 HIS A O   1 
ATOM   1357 C  CB  . HIS A 1 191 ? -6.188  37.350 20.438  1.00 29.51 ? 179 HIS A CB  1 
ATOM   1358 C  CG  . HIS A 1 191 ? -6.445  38.378 19.379  1.00 27.21 ? 179 HIS A CG  1 
ATOM   1359 N  ND1 . HIS A 1 191 ? -5.441  39.190 18.893  1.00 26.36 ? 179 HIS A ND1 1 
ATOM   1360 C  CD2 . HIS A 1 191 ? -7.563  38.694 18.676  1.00 29.31 ? 179 HIS A CD2 1 
ATOM   1361 C  CE1 . HIS A 1 191 ? -5.936  39.981 17.949  1.00 29.18 ? 179 HIS A CE1 1 
ATOM   1362 N  NE2 . HIS A 1 191 ? -7.218  39.693 17.782  1.00 26.58 ? 179 HIS A NE2 1 
ATOM   1363 N  N   . ILE A 1 192 ? -5.958  36.559 23.564  1.00 28.49 ? 180 ILE A N   1 
ATOM   1364 C  CA  . ILE A 1 192 ? -5.190  35.608 24.331  1.00 29.98 ? 180 ILE A CA  1 
ATOM   1365 C  C   . ILE A 1 192 ? -5.944  35.213 25.632  1.00 30.53 ? 180 ILE A C   1 
ATOM   1366 O  O   . ILE A 1 192 ? -5.882  34.062 26.053  1.00 30.83 ? 180 ILE A O   1 
ATOM   1367 C  CB  . ILE A 1 192 ? -3.806  36.233 24.673  1.00 31.20 ? 180 ILE A CB  1 
ATOM   1368 C  CG1 . ILE A 1 192 ? -2.972  36.452 23.416  1.00 31.39 ? 180 ILE A CG1 1 
ATOM   1369 C  CG2 . ILE A 1 192 ? -3.057  35.406 25.699  1.00 31.67 ? 180 ILE A CG2 1 
ATOM   1370 C  CD1 . ILE A 1 192 ? -1.659  37.358 23.710  1.00 36.14 ? 180 ILE A CD1 1 
ATOM   1371 N  N   . LEU A 1 193 ? -6.624  36.187 26.251  1.00 29.39 ? 181 LEU A N   1 
ATOM   1372 C  CA  . LEU A 1 193 ? -7.383  35.978 27.441  1.00 30.32 ? 181 LEU A CA  1 
ATOM   1373 C  C   . LEU A 1 193 ? -8.846  35.704 27.085  1.00 30.54 ? 181 LEU A C   1 
ATOM   1374 O  O   . LEU A 1 193 ? -9.345  36.130 26.070  1.00 29.46 ? 181 LEU A O   1 
ATOM   1375 C  CB  . LEU A 1 193 ? -7.266  37.170 28.373  1.00 30.68 ? 181 LEU A CB  1 
ATOM   1376 C  CG  . LEU A 1 193 ? -5.824  37.556 28.788  1.00 31.31 ? 181 LEU A CG  1 
ATOM   1377 C  CD1 . LEU A 1 193 ? -5.811  38.840 29.664  1.00 28.65 ? 181 LEU A CD1 1 
ATOM   1378 C  CD2 . LEU A 1 193 ? -5.124  36.416 29.493  1.00 31.13 ? 181 LEU A CD2 1 
ATOM   1379 N  N   . PHE A 1 194 ? -9.517  34.944 27.934  1.00 31.71 ? 182 PHE A N   1 
ATOM   1380 C  CA  . PHE A 1 194 ? -10.939 34.622 27.712  1.00 31.64 ? 182 PHE A CA  1 
ATOM   1381 C  C   . PHE A 1 194 ? -11.763 35.715 28.366  1.00 31.70 ? 182 PHE A C   1 
ATOM   1382 O  O   . PHE A 1 194 ? -11.334 36.255 29.379  1.00 31.22 ? 182 PHE A O   1 
ATOM   1383 C  CB  . PHE A 1 194 ? -11.278 33.260 28.347  1.00 32.49 ? 182 PHE A CB  1 
ATOM   1384 C  CG  . PHE A 1 194 ? -10.713 32.088 27.599  1.00 30.68 ? 182 PHE A CG  1 
ATOM   1385 C  CD1 . PHE A 1 194 ? -9.513  31.544 27.962  1.00 33.17 ? 182 PHE A CD1 1 
ATOM   1386 C  CD2 . PHE A 1 194 ? -11.379 31.563 26.507  1.00 29.58 ? 182 PHE A CD2 1 
ATOM   1387 C  CE1 . PHE A 1 194 ? -8.980  30.454 27.272  1.00 35.20 ? 182 PHE A CE1 1 
ATOM   1388 C  CE2 . PHE A 1 194 ? -10.878 30.473 25.811  1.00 32.75 ? 182 PHE A CE2 1 
ATOM   1389 C  CZ  . PHE A 1 194 ? -9.675  29.911 26.199  1.00 37.09 ? 182 PHE A CZ  1 
ATOM   1390 N  N   . PRO A 1 195 ? -12.973 35.981 27.865  1.00 32.58 ? 183 PRO A N   1 
ATOM   1391 C  CA  . PRO A 1 195 ? -13.668 35.243 26.783  1.00 32.73 ? 183 PRO A CA  1 
ATOM   1392 C  C   . PRO A 1 195 ? -13.177 35.542 25.371  1.00 31.58 ? 183 PRO A C   1 
ATOM   1393 O  O   . PRO A 1 195 ? -13.486 34.792 24.422  1.00 32.87 ? 183 PRO A O   1 
ATOM   1394 C  CB  . PRO A 1 195 ? -15.156 35.653 26.949  1.00 32.90 ? 183 PRO A CB  1 
ATOM   1395 C  CG  . PRO A 1 195 ? -15.148 36.890 27.780  1.00 34.20 ? 183 PRO A CG  1 
ATOM   1396 C  CD  . PRO A 1 195 ? -13.871 36.913 28.593  1.00 32.46 ? 183 PRO A CD  1 
ATOM   1397 N  N   . GLY A 1 196 ? -12.421 36.618 25.208  1.00 30.57 ? 184 GLY A N   1 
ATOM   1398 C  CA  . GLY A 1 196 ? -12.040 37.042 23.889  1.00 29.77 ? 184 GLY A CA  1 
ATOM   1399 C  C   . GLY A 1 196 ? -11.368 35.930 23.100  1.00 28.87 ? 184 GLY A C   1 
ATOM   1400 O  O   . GLY A 1 196 ? -11.590 35.777 21.896  1.00 28.19 ? 184 GLY A O   1 
ATOM   1401 N  N   . ARG A 1 197 ? -10.567 35.120 23.762  1.00 28.81 ? 185 ARG A N   1 
ATOM   1402 C  CA  . ARG A 1 197 ? -9.851  34.063 23.082  1.00 29.94 ? 185 ARG A CA  1 
ATOM   1403 C  C   . ARG A 1 197 ? -10.839 33.124 22.424  1.00 31.44 ? 185 ARG A C   1 
ATOM   1404 O  O   . ARG A 1 197 ? -10.598 32.597 21.368  1.00 30.65 ? 185 ARG A O   1 
ATOM   1405 C  CB  . ARG A 1 197 ? -8.942  33.297 24.043  1.00 30.86 ? 185 ARG A CB  1 
ATOM   1406 C  CG  . ARG A 1 197 ? -8.102  32.239 23.377  1.00 29.57 ? 185 ARG A CG  1 
ATOM   1407 C  CD  . ARG A 1 197 ? -7.037  31.672 24.283  1.00 33.09 ? 185 ARG A CD  1 
ATOM   1408 N  NE  . ARG A 1 197 ? -6.712  30.328 23.858  1.00 35.64 ? 185 ARG A NE  1 
ATOM   1409 C  CZ  . ARG A 1 197 ? -6.218  29.373 24.626  1.00 37.94 ? 185 ARG A CZ  1 
ATOM   1410 N  NH1 . ARG A 1 197 ? -5.966  29.585 25.901  1.00 35.64 ? 185 ARG A NH1 1 
ATOM   1411 N  NH2 . ARG A 1 197 ? -5.988  28.193 24.097  1.00 41.20 ? 185 ARG A NH2 1 
ATOM   1412 N  N   . ASP A 1 198 ? -11.958 32.901 23.072  1.00 32.93 ? 186 ASP A N   1 
ATOM   1413 C  CA  . ASP A 1 198 ? -12.944 31.989 22.519  1.00 35.39 ? 186 ASP A CA  1 
ATOM   1414 C  C   . ASP A 1 198 ? -13.645 32.618 21.284  1.00 34.58 ? 186 ASP A C   1 
ATOM   1415 O  O   . ASP A 1 198 ? -13.977 31.952 20.303  1.00 36.32 ? 186 ASP A O   1 
ATOM   1416 C  CB  . ASP A 1 198 ? -13.969 31.672 23.601  1.00 36.41 ? 186 ASP A CB  1 
ATOM   1417 C  CG  . ASP A 1 198 ? -14.780 30.484 23.280  1.00 43.71 ? 186 ASP A CG  1 
ATOM   1418 O  OD1 . ASP A 1 198 ? -14.189 29.362 23.111  1.00 47.70 ? 186 ASP A OD1 1 
ATOM   1419 O  OD2 . ASP A 1 198 ? -16.015 30.672 23.244  1.00 49.64 ? 186 ASP A OD2 1 
ATOM   1420 N  N   . LEU A 1 199 ? -13.874 33.898 21.347  1.00 32.80 ? 187 LEU A N   1 
ATOM   1421 C  CA  . LEU A 1 199 ? -14.653 34.573 20.338  1.00 33.41 ? 187 LEU A CA  1 
ATOM   1422 C  C   . LEU A 1 199 ? -13.847 34.868 19.050  1.00 32.65 ? 187 LEU A C   1 
ATOM   1423 O  O   . LEU A 1 199 ? -14.432 35.115 17.986  1.00 32.22 ? 187 LEU A O   1 
ATOM   1424 C  CB  . LEU A 1 199 ? -15.268 35.853 20.962  1.00 33.52 ? 187 LEU A CB  1 
ATOM   1425 C  CG  . LEU A 1 199 ? -16.423 35.631 21.970  1.00 37.41 ? 187 LEU A CG  1 
ATOM   1426 C  CD1 . LEU A 1 199 ? -17.152 36.848 22.120  1.00 38.26 ? 187 LEU A CD1 1 
ATOM   1427 C  CD2 . LEU A 1 199 ? -17.417 34.531 21.568  1.00 39.11 ? 187 LEU A CD2 1 
ATOM   1428 N  N   . THR A 1 200 ? -12.524 34.795 19.178  1.00 32.14 ? 188 THR A N   1 
ATOM   1429 C  CA  . THR A 1 200 ? -11.537 35.036 18.147  1.00 30.72 ? 188 THR A CA  1 
ATOM   1430 C  C   . THR A 1 200 ? -11.525 33.914 17.150  1.00 32.34 ? 188 THR A C   1 
ATOM   1431 O  O   . THR A 1 200 ? -11.282 34.159 15.957  1.00 31.36 ? 188 THR A O   1 
ATOM   1432 C  CB  . THR A 1 200 ? -10.103 35.205 18.808  1.00 31.14 ? 188 THR A CB  1 
ATOM   1433 O  OG1 . THR A 1 200 ? -10.049 36.450 19.525  1.00 30.27 ? 188 THR A OG1 1 
ATOM   1434 C  CG2 . THR A 1 200 ? -8.994  35.191 17.826  1.00 31.06 ? 188 THR A CG2 1 
ATOM   1435 N  N   . GLY A 1 201 ? -11.806 32.685 17.620  1.00 32.90 ? 189 GLY A N   1 
ATOM   1436 C  CA  . GLY A 1 201 ? -11.719 31.501 16.777  1.00 34.06 ? 189 GLY A CA  1 
ATOM   1437 C  C   . GLY A 1 201 ? -10.280 31.322 16.314  1.00 34.94 ? 189 GLY A C   1 
ATOM   1438 O  O   . GLY A 1 201 ? -9.362  31.519 17.096  1.00 34.29 ? 189 GLY A O   1 
ATOM   1439 N  N   . LYS A 1 202 ? -10.077 30.943 15.051  1.00 35.09 ? 190 LYS A N   1 
ATOM   1440 C  CA  . LYS A 1 202 ? -8.729  30.746 14.554  1.00 35.12 ? 190 LYS A CA  1 
ATOM   1441 C  C   . LYS A 1 202 ? -8.063  32.109 14.324  1.00 33.64 ? 190 LYS A C   1 
ATOM   1442 O  O   . LYS A 1 202 ? -8.648  32.978 13.665  1.00 33.48 ? 190 LYS A O   1 
ATOM   1443 C  CB  . LYS A 1 202 ? -8.818  29.961 13.281  1.00 37.36 ? 190 LYS A CB  1 
ATOM   1444 C  CG  . LYS A 1 202 ? -7.479  29.547 12.731  1.00 42.28 ? 190 LYS A CG  1 
ATOM   1445 C  CD  . LYS A 1 202 ? -7.602  28.884 11.359  1.00 48.23 ? 190 LYS A CD  1 
ATOM   1446 C  CE  . LYS A 1 202 ? -8.037  27.436 11.423  1.00 51.98 ? 190 LYS A CE  1 
ATOM   1447 N  NZ  . LYS A 1 202 ? -7.721  26.686 10.119  1.00 55.66 ? 190 LYS A NZ  1 
ATOM   1448 N  N   . LEU A 1 203 ? -6.870  32.318 14.878  1.00 31.72 ? 191 LEU A N   1 
ATOM   1449 C  CA  . LEU A 1 203 ? -6.200  33.592 14.763  1.00 31.28 ? 191 LEU A CA  1 
ATOM   1450 C  C   . LEU A 1 203 ? -5.028  33.522 13.818  1.00 31.01 ? 191 LEU A C   1 
ATOM   1451 O  O   . LEU A 1 203 ? -4.139  32.722 14.037  1.00 30.08 ? 191 LEU A O   1 
ATOM   1452 C  CB  . LEU A 1 203 ? -5.670  34.084 16.122  1.00 30.94 ? 191 LEU A CB  1 
ATOM   1453 C  CG  . LEU A 1 203 ? -5.029  35.501 16.177  1.00 30.60 ? 191 LEU A CG  1 
ATOM   1454 C  CD1 . LEU A 1 203 ? -6.064  36.653 15.980  1.00 26.38 ? 191 LEU A CD1 1 
ATOM   1455 C  CD2 . LEU A 1 203 ? -4.308  35.709 17.512  1.00 32.46 ? 191 LEU A CD2 1 
ATOM   1456 N  N   . LYS A 1 204 ? -5.003  34.418 12.829  1.00 30.16 ? 192 LYS A N   1 
ATOM   1457 C  CA  . LYS A 1 204 ? -3.808  34.639 12.025  1.00 30.58 ? 192 LYS A CA  1 
ATOM   1458 C  C   . LYS A 1 204 ? -3.227  36.026 12.330  1.00 29.41 ? 192 LYS A C   1 
ATOM   1459 O  O   . LYS A 1 204 ? -3.962  37.023 12.435  1.00 29.06 ? 192 LYS A O   1 
ATOM   1460 C  CB  . LYS A 1 204 ? -4.128  34.456 10.561  1.00 31.96 ? 192 LYS A CB  1 
ATOM   1461 C  CG  . LYS A 1 204 ? -4.629  33.063 10.152  1.00 36.04 ? 192 LYS A CG  1 
ATOM   1462 C  CD  . LYS A 1 204 ? -4.631  32.941 8.666   1.00 44.73 ? 192 LYS A CD  1 
ATOM   1463 C  CE  . LYS A 1 204 ? -5.414  31.685 8.136   1.00 49.90 ? 192 LYS A CE  1 
ATOM   1464 N  NZ  . LYS A 1 204 ? -4.961  30.469 8.853   1.00 52.84 ? 192 LYS A NZ  1 
ATOM   1465 N  N   . VAL A 1 205 ? -1.916  36.094 12.514  1.00 29.47 ? 193 VAL A N   1 
ATOM   1466 C  CA  . VAL A 1 205 ? -1.204  37.369 12.755  1.00 29.43 ? 193 VAL A CA  1 
ATOM   1467 C  C   . VAL A 1 205 ? -0.423  37.753 11.488  1.00 30.50 ? 193 VAL A C   1 
ATOM   1468 O  O   . VAL A 1 205 ? 0.505   37.055 11.069  1.00 30.99 ? 193 VAL A O   1 
ATOM   1469 C  CB  . VAL A 1 205 ? -0.269  37.241 13.959  1.00 31.40 ? 193 VAL A CB  1 
ATOM   1470 C  CG1 . VAL A 1 205 ? 0.565   38.580 14.229  1.00 32.91 ? 193 VAL A CG1 1 
ATOM   1471 C  CG2 . VAL A 1 205 ? -1.084  36.762 15.227  1.00 30.16 ? 193 VAL A CG2 1 
ATOM   1472 N  N   . ALA A 1 206 ? -0.833  38.855 10.852  1.00 29.24 ? 194 ALA A N   1 
ATOM   1473 C  CA  . ALA A 1 206 ? -0.265  39.257 9.583   1.00 28.86 ? 194 ALA A CA  1 
ATOM   1474 C  C   . ALA A 1 206 ? 0.787   40.312 9.793   1.00 28.98 ? 194 ALA A C   1 
ATOM   1475 O  O   . ALA A 1 206 ? 0.595   41.228 10.593  1.00 29.64 ? 194 ALA A O   1 
ATOM   1476 C  CB  . ALA A 1 206 ? -1.359  39.789 8.629   1.00 28.02 ? 194 ALA A CB  1 
ATOM   1477 N  N   . ASN A 1 207 ? 1.853   40.194 9.021   1.00 32.32 ? 195 ASN A N   1 
ATOM   1478 C  CA  . ASN A 1 207 ? 2.845   41.200 8.910   1.00 32.66 ? 195 ASN A CA  1 
ATOM   1479 C  C   . ASN A 1 207 ? 2.338   42.231 7.880   1.00 31.18 ? 195 ASN A C   1 
ATOM   1480 O  O   . ASN A 1 207 ? 2.181   41.920 6.691   1.00 30.98 ? 195 ASN A O   1 
ATOM   1481 C  CB  . ASN A 1 207 ? 4.204   40.519 8.530   1.00 33.13 ? 195 ASN A CB  1 
ATOM   1482 C  CG  . ASN A 1 207 ? 5.185   41.451 7.840   1.00 33.43 ? 195 ASN A CG  1 
ATOM   1483 O  OD1 . ASN A 1 207 ? 5.228   42.651 8.091   1.00 31.65 ? 195 ASN A OD1 1 
ATOM   1484 N  ND2 . ASN A 1 207 ? 5.998   40.877 6.960   1.00 33.69 ? 195 ASN A ND2 1 
ATOM   1485 N  N   . ILE A 1 208 ? 2.085   43.451 8.337   1.00 29.61 ? 196 ILE A N   1 
ATOM   1486 C  CA  . ILE A 1 208 ? 1.600   44.541 7.451   1.00 29.79 ? 196 ILE A CA  1 
ATOM   1487 C  C   . ILE A 1 208 ? 2.632   45.652 7.231   1.00 30.03 ? 196 ILE A C   1 
ATOM   1488 O  O   . ILE A 1 208 ? 2.309   46.700 6.689   1.00 30.16 ? 196 ILE A O   1 
ATOM   1489 C  CB  . ILE A 1 208 ? 0.238   45.110 7.910   1.00 28.37 ? 196 ILE A CB  1 
ATOM   1490 C  CG1 . ILE A 1 208 ? 0.357   45.871 9.216   1.00 30.17 ? 196 ILE A CG1 1 
ATOM   1491 C  CG2 . ILE A 1 208 ? -0.749  43.985 8.009   1.00 28.01 ? 196 ILE A CG2 1 
ATOM   1492 C  CD1 . ILE A 1 208 ? -0.949  46.669 9.568   1.00 27.91 ? 196 ILE A CD1 1 
ATOM   1493 N  N   . GLY A 1 209 ? 3.881   45.395 7.621   1.00 31.16 ? 197 GLY A N   1 
ATOM   1494 C  CA  . GLY A 1 209 ? 4.994   46.283 7.259   1.00 31.50 ? 197 GLY A CA  1 
ATOM   1495 C  C   . GLY A 1 209 ? 5.634   47.078 8.377   1.00 32.40 ? 197 GLY A C   1 
ATOM   1496 O  O   . GLY A 1 209 ? 6.543   47.862 8.075   1.00 30.95 ? 197 GLY A O   1 
ATOM   1497 N  N   . HIS A 1 210 ? 5.202   46.878 9.657   1.00 32.44 ? 198 HIS A N   1 
ATOM   1498 C  CA  . HIS A 1 210 ? 5.919   47.478 10.797  1.00 34.27 ? 198 HIS A CA  1 
ATOM   1499 C  C   . HIS A 1 210 ? 7.365   47.018 10.869  1.00 35.93 ? 198 HIS A C   1 
ATOM   1500 O  O   . HIS A 1 210 ? 7.634   45.854 10.653  1.00 34.73 ? 198 HIS A O   1 
ATOM   1501 C  CB  . HIS A 1 210 ? 5.264   47.095 12.128  1.00 34.67 ? 198 HIS A CB  1 
ATOM   1502 C  CG  . HIS A 1 210 ? 3.826   47.489 12.200  1.00 35.01 ? 198 HIS A CG  1 
ATOM   1503 N  ND1 . HIS A 1 210 ? 2.808   46.574 12.067  1.00 37.27 ? 198 HIS A ND1 1 
ATOM   1504 C  CD2 . HIS A 1 210 ? 3.233   48.699 12.337  1.00 37.03 ? 198 HIS A CD2 1 
ATOM   1505 C  CE1 . HIS A 1 210 ? 1.646   47.205 12.147  1.00 37.30 ? 198 HIS A CE1 1 
ATOM   1506 N  NE2 . HIS A 1 210 ? 1.874   48.492 12.320  1.00 36.05 ? 198 HIS A NE2 1 
ATOM   1507 N  N   . PRO A 1 211 ? 8.293   47.910 11.228  1.00 38.04 ? 199 PRO A N   1 
ATOM   1508 C  CA  . PRO A 1 211 ? 9.675   47.508 11.452  1.00 40.61 ? 199 PRO A CA  1 
ATOM   1509 C  C   . PRO A 1 211 ? 9.729   46.389 12.440  1.00 41.76 ? 199 PRO A C   1 
ATOM   1510 O  O   . PRO A 1 211 ? 9.039   46.426 13.491  1.00 41.05 ? 199 PRO A O   1 
ATOM   1511 C  CB  . PRO A 1 211 ? 10.338  48.764 12.086  1.00 42.31 ? 199 PRO A CB  1 
ATOM   1512 C  CG  . PRO A 1 211 ? 9.531   49.878 11.606  1.00 41.53 ? 199 PRO A CG  1 
ATOM   1513 C  CD  . PRO A 1 211 ? 8.103   49.351 11.418  1.00 40.06 ? 199 PRO A CD  1 
ATOM   1514 N  N   . VAL A 1 212 ? 10.553  45.407 12.141  1.00 44.43 ? 200 VAL A N   1 
ATOM   1515 C  CA  . VAL A 1 212 ? 10.704  44.256 13.035  1.00 47.25 ? 200 VAL A CA  1 
ATOM   1516 C  C   . VAL A 1 212 ? 11.146  44.637 14.456  1.00 49.52 ? 200 VAL A C   1 
ATOM   1517 O  O   . VAL A 1 212 ? 10.713  44.026 15.395  1.00 49.39 ? 200 VAL A O   1 
ATOM   1518 C  CB  . VAL A 1 212 ? 11.670  43.192 12.465  1.00 48.80 ? 200 VAL A CB  1 
ATOM   1519 C  CG1 . VAL A 1 212 ? 11.921  42.064 13.550  1.00 51.76 ? 200 VAL A CG1 1 
ATOM   1520 C  CG2 . VAL A 1 212 ? 11.080  42.603 11.164  1.00 48.44 ? 200 VAL A CG2 1 
ATOM   1521 N  N   . HIS A 1 213 ? 11.968  45.667 14.587  1.00 52.72 ? 201 HIS A N   1 
ATOM   1522 C  CA  . HIS A 1 213 ? 12.418  46.193 15.875  1.00 55.80 ? 201 HIS A CA  1 
ATOM   1523 C  C   . HIS A 1 213 ? 11.264  46.656 16.753  1.00 54.58 ? 201 HIS A C   1 
ATOM   1524 O  O   . HIS A 1 213 ? 11.284  46.456 17.971  1.00 55.62 ? 201 HIS A O   1 
ATOM   1525 C  CB  . HIS A 1 213 ? 13.379  47.380 15.653  1.00 58.58 ? 201 HIS A CB  1 
ATOM   1526 C  CG  . HIS A 1 213 ? 13.970  47.926 16.923  1.00 65.05 ? 201 HIS A CG  1 
ATOM   1527 N  ND1 . HIS A 1 213 ? 14.108  49.280 17.166  1.00 68.45 ? 201 HIS A ND1 1 
ATOM   1528 C  CD2 . HIS A 1 213 ? 14.462  47.295 18.023  1.00 69.22 ? 201 HIS A CD2 1 
ATOM   1529 C  CE1 . HIS A 1 213 ? 14.665  49.457 18.359  1.00 71.84 ? 201 HIS A CE1 1 
ATOM   1530 N  NE2 . HIS A 1 213 ? 14.899  48.271 18.893  1.00 72.01 ? 201 HIS A NE2 1 
ATOM   1531 N  N   . LEU A 1 214 ? 10.262  47.289 16.156  1.00 52.61 ? 202 LEU A N   1 
ATOM   1532 C  CA  . LEU A 1 214 ? 9.096   47.689 16.942  1.00 51.84 ? 202 LEU A CA  1 
ATOM   1533 C  C   . LEU A 1 214 ? 8.257   46.524 17.388  1.00 50.81 ? 202 LEU A C   1 
ATOM   1534 O  O   . LEU A 1 214 ? 7.833   46.477 18.545  1.00 51.65 ? 202 LEU A O   1 
ATOM   1535 C  CB  . LEU A 1 214 ? 8.234   48.698 16.201  1.00 50.32 ? 202 LEU A CB  1 
ATOM   1536 C  CG  . LEU A 1 214 ? 8.858   50.053 15.954  1.00 50.71 ? 202 LEU A CG  1 
ATOM   1537 C  CD1 . LEU A 1 214 ? 7.847   50.937 15.182  1.00 47.72 ? 202 LEU A CD1 1 
ATOM   1538 C  CD2 . LEU A 1 214 ? 9.362   50.737 17.269  1.00 53.35 ? 202 LEU A CD2 1 
ATOM   1539 N  N   . ILE A 1 215 ? 8.006   45.585 16.481  1.00 50.07 ? 203 ILE A N   1 
ATOM   1540 C  CA  . ILE A 1 215 ? 7.217   44.389 16.784  1.00 49.06 ? 203 ILE A CA  1 
ATOM   1541 C  C   . ILE A 1 215 ? 7.859   43.632 17.918  1.00 52.03 ? 203 ILE A C   1 
ATOM   1542 O  O   . ILE A 1 215 ? 7.171   43.020 18.745  1.00 51.19 ? 203 ILE A O   1 
ATOM   1543 C  CB  . ILE A 1 215 ? 7.148   43.434 15.579  1.00 47.87 ? 203 ILE A CB  1 
ATOM   1544 C  CG1 . ILE A 1 215 ? 6.411   44.079 14.401  1.00 45.54 ? 203 ILE A CG1 1 
ATOM   1545 C  CG2 . ILE A 1 215 ? 6.500   42.102 15.984  1.00 46.30 ? 203 ILE A CG2 1 
ATOM   1546 C  CD1 . ILE A 1 215 ? 4.953   44.423 14.674  1.00 44.70 ? 203 ILE A CD1 1 
ATOM   1547 N  N   . ASN A 1 216 ? 9.188   43.697 17.990  1.00 55.45 ? 204 ASN A N   1 
ATOM   1548 C  CA  . ASN A 1 216 ? 9.934   43.008 19.067  1.00 57.93 ? 204 ASN A CA  1 
ATOM   1549 C  C   . ASN A 1 216 ? 10.103  43.768 20.361  1.00 60.11 ? 204 ASN A C   1 
ATOM   1550 O  O   . ASN A 1 216 ? 10.580  43.200 21.309  1.00 61.76 ? 204 ASN A O   1 
ATOM   1551 C  CB  . ASN A 1 216 ? 11.310  42.585 18.549  1.00 59.42 ? 204 ASN A CB  1 
ATOM   1552 C  CG  . ASN A 1 216 ? 11.201  41.466 17.582  1.00 59.21 ? 204 ASN A CG  1 
ATOM   1553 O  OD1 . ASN A 1 216 ? 10.241  40.696 17.635  1.00 58.98 ? 204 ASN A OD1 1 
ATOM   1554 N  ND2 . ASN A 1 216 ? 12.139  41.375 16.668  1.00 60.76 ? 204 ASN A ND2 1 
ATOM   1555 N  N   . SER A 1 217 ? 9.747   45.049 20.395  1.00 61.48 ? 205 SER A N   1 
ATOM   1556 C  CA  . SER A 1 217 ? 9.822   45.840 21.609  1.00 64.02 ? 205 SER A CA  1 
ATOM   1557 C  C   . SER A 1 217 ? 8.610   45.572 22.535  1.00 64.00 ? 205 SER A C   1 
ATOM   1558 O  O   . SER A 1 217 ? 8.441   46.231 23.554  1.00 65.48 ? 205 SER A O   1 
ATOM   1559 C  CB  . SER A 1 217 ? 9.868   47.309 21.251  1.00 65.28 ? 205 SER A CB  1 
ATOM   1560 O  OG  . SER A 1 217 ? 8.700   47.656 20.530  1.00 64.84 ? 205 SER A OG  1 
ATOM   1561 N  N   . ILE A 1 218 ? 7.781   44.596 22.186  1.00 62.60 ? 206 ILE A N   1 
ATOM   1562 C  CA  . ILE A 1 218 ? 6.598   44.255 22.971  1.00 61.84 ? 206 ILE A CA  1 
ATOM   1563 C  C   . ILE A 1 218 ? 7.064   43.456 24.180  1.00 62.28 ? 206 ILE A C   1 
ATOM   1564 O  O   . ILE A 1 218 ? 7.921   42.597 24.032  1.00 63.92 ? 206 ILE A O   1 
ATOM   1565 C  CB  . ILE A 1 218 ? 5.588   43.490 22.048  1.00 60.33 ? 206 ILE A CB  1 
ATOM   1566 C  CG1 . ILE A 1 218 ? 4.303   44.315 21.871  1.00 59.54 ? 206 ILE A CG1 1 
ATOM   1567 C  CG2 . ILE A 1 218 ? 5.384   42.025 22.464  1.00 60.94 ? 206 ILE A CG2 1 
ATOM   1568 C  CD1 . ILE A 1 218 ? 4.427   45.298 20.738  1.00 58.36 ? 206 ILE A CD1 1 
ATOM   1569 N  N   . ASN A 1 219 ? 6.538   43.747 25.367  1.00 61.65 ? 207 ASN A N   1 
ATOM   1570 C  CA  . ASN A 1 219 ? 7.050   43.186 26.631  1.00 62.21 ? 207 ASN A CA  1 
ATOM   1571 C  C   . ASN A 1 219 ? 6.212   41.989 27.151  1.00 58.42 ? 207 ASN A C   1 
ATOM   1572 O  O   . ASN A 1 219 ? 6.544   41.332 28.147  1.00 58.77 ? 207 ASN A O   1 
ATOM   1573 C  CB  . ASN A 1 219 ? 7.023   44.296 27.678  1.00 65.18 ? 207 ASN A CB  1 
ATOM   1574 C  CG  . ASN A 1 219 ? 8.324   44.413 28.475  1.00 71.24 ? 207 ASN A CG  1 
ATOM   1575 O  OD1 . ASN A 1 219 ? 8.914   45.511 28.570  1.00 73.90 ? 207 ASN A OD1 1 
ATOM   1576 N  ND2 . ASN A 1 219 ? 8.767   43.303 29.070  1.00 71.55 ? 207 ASN A ND2 1 
ATOM   1577 N  N   . ARG A 1 220 ? 5.088   41.749 26.510  1.00 54.16 ? 208 ARG A N   1 
ATOM   1578 C  CA  . ARG A 1 220 ? 4.231   40.669 26.874  1.00 51.42 ? 208 ARG A CA  1 
ATOM   1579 C  C   . ARG A 1 220 ? 4.230   39.736 25.646  1.00 50.13 ? 208 ARG A C   1 
ATOM   1580 O  O   . ARG A 1 220 ? 4.335   40.228 24.511  1.00 50.59 ? 208 ARG A O   1 
ATOM   1581 C  CB  . ARG A 1 220 ? 2.867   41.224 27.236  1.00 50.46 ? 208 ARG A CB  1 
ATOM   1582 C  CG  . ARG A 1 220 ? 2.932   42.274 28.346  1.00 49.79 ? 208 ARG A CG  1 
ATOM   1583 C  CD  . ARG A 1 220 ? 1.633   42.361 29.088  1.00 48.22 ? 208 ARG A CD  1 
ATOM   1584 N  NE  . ARG A 1 220 ? 1.677   43.241 30.259  1.00 47.68 ? 208 ARG A NE  1 
ATOM   1585 C  CZ  . ARG A 1 220 ? 1.370   44.538 30.249  1.00 49.13 ? 208 ARG A CZ  1 
ATOM   1586 N  NH1 . ARG A 1 220 ? 1.442   45.245 31.370  1.00 49.66 ? 208 ARG A NH1 1 
ATOM   1587 N  NH2 . ARG A 1 220 ? 0.979   45.133 29.128  1.00 45.70 ? 208 ARG A NH2 1 
ATOM   1588 N  N   . TYR A 1 221 ? 4.207   38.415 25.872  1.00 47.80 ? 209 TYR A N   1 
ATOM   1589 C  CA  . TYR A 1 221 ? 4.531   37.429 24.802  1.00 46.04 ? 209 TYR A CA  1 
ATOM   1590 C  C   . TYR A 1 221 ? 3.669   36.212 24.975  1.00 41.57 ? 209 TYR A C   1 
ATOM   1591 O  O   . TYR A 1 221 ? 3.450   35.782 26.093  1.00 39.47 ? 209 TYR A O   1 
ATOM   1592 C  CB  . TYR A 1 221 ? 5.962   36.848 24.935  1.00 47.95 ? 209 TYR A CB  1 
ATOM   1593 C  CG  . TYR A 1 221 ? 7.107   37.799 24.971  1.00 52.42 ? 209 TYR A CG  1 
ATOM   1594 C  CD1 . TYR A 1 221 ? 7.400   38.567 23.877  1.00 58.81 ? 209 TYR A CD1 1 
ATOM   1595 C  CD2 . TYR A 1 221 ? 7.927   37.890 26.085  1.00 55.44 ? 209 TYR A CD2 1 
ATOM   1596 C  CE1 . TYR A 1 221 ? 8.475   39.446 23.886  1.00 62.56 ? 209 TYR A CE1 1 
ATOM   1597 C  CE2 . TYR A 1 221 ? 8.984   38.746 26.114  1.00 61.81 ? 209 TYR A CE2 1 
ATOM   1598 C  CZ  . TYR A 1 221 ? 9.258   39.531 25.005  1.00 64.42 ? 209 TYR A CZ  1 
ATOM   1599 O  OH  . TYR A 1 221 ? 10.319  40.414 24.998  1.00 69.37 ? 209 TYR A OH  1 
ATOM   1600 N  N   . VAL A 1 222 ? 3.283   35.597 23.867  1.00 38.47 ? 210 VAL A N   1 
ATOM   1601 C  CA  . VAL A 1 222 ? 2.702   34.280 23.920  1.00 36.24 ? 210 VAL A CA  1 
ATOM   1602 C  C   . VAL A 1 222 ? 3.827   33.231 23.995  1.00 34.82 ? 210 VAL A C   1 
ATOM   1603 O  O   . VAL A 1 222 ? 4.834   33.367 23.306  1.00 34.45 ? 210 VAL A O   1 
ATOM   1604 C  CB  . VAL A 1 222 ? 1.748   34.063 22.770  1.00 36.51 ? 210 VAL A CB  1 
ATOM   1605 C  CG1 . VAL A 1 222 ? 1.184   32.632 22.835  1.00 34.09 ? 210 VAL A CG1 1 
ATOM   1606 C  CG2 . VAL A 1 222 ? 0.569   35.109 22.859  1.00 37.23 ? 210 VAL A CG2 1 
ATOM   1607 N  N   . ILE A 1 223 ? 3.707   32.242 24.885  1.00 32.22 ? 211 ILE A N   1 
ATOM   1608 C  CA  . ILE A 1 223 ? 4.777   31.215 25.005  1.00 33.03 ? 211 ILE A CA  1 
ATOM   1609 C  C   . ILE A 1 223 ? 4.653   30.297 23.769  1.00 32.91 ? 211 ILE A C   1 
ATOM   1610 O  O   . ILE A 1 223 ? 3.571   29.756 23.515  1.00 32.09 ? 211 ILE A O   1 
ATOM   1611 C  CB  . ILE A 1 223 ? 4.664   30.386 26.270  1.00 32.12 ? 211 ILE A CB  1 
ATOM   1612 C  CG1 . ILE A 1 223 ? 4.805   31.321 27.496  1.00 33.46 ? 211 ILE A CG1 1 
ATOM   1613 C  CG2 . ILE A 1 223 ? 5.799   29.301 26.294  1.00 31.97 ? 211 ILE A CG2 1 
ATOM   1614 C  CD1 . ILE A 1 223 ? 4.542   30.656 28.826  1.00 32.79 ? 211 ILE A CD1 1 
ATOM   1615 N  N   . THR A 1 224 ? 5.716   30.169 23.000  1.00 33.57 ? 212 THR A N   1 
ATOM   1616 C  CA  . THR A 1 224 ? 5.684   29.359 21.766  1.00 34.09 ? 212 THR A CA  1 
ATOM   1617 C  C   . THR A 1 224 ? 6.557   28.143 21.845  1.00 35.24 ? 212 THR A C   1 
ATOM   1618 O  O   . THR A 1 224 ? 7.440   28.027 22.685  1.00 35.15 ? 212 THR A O   1 
ATOM   1619 C  CB  . THR A 1 224 ? 6.163   30.151 20.538  1.00 34.21 ? 212 THR A CB  1 
ATOM   1620 O  OG1 . THR A 1 224 ? 7.495   30.534 20.774  1.00 36.60 ? 212 THR A OG1 1 
ATOM   1621 C  CG2 . THR A 1 224 ? 5.394   31.405 20.330  1.00 34.73 ? 212 THR A CG2 1 
ATOM   1622 N  N   . ARG A 1 225 ? 6.323   27.230 20.914  1.00 35.45 ? 213 ARG A N   1 
ATOM   1623 C  CA  . ARG A 1 225 ? 7.044   26.023 20.840  1.00 37.24 ? 213 ARG A CA  1 
ATOM   1624 C  C   . ARG A 1 225 ? 8.536   26.363 20.684  1.00 37.22 ? 213 ARG A C   1 
ATOM   1625 O  O   . ARG A 1 225 ? 9.377   25.695 21.267  1.00 34.24 ? 213 ARG A O   1 
ATOM   1626 C  CB  . ARG A 1 225 ? 6.512   25.220 19.653  1.00 41.35 ? 213 ARG A CB  1 
ATOM   1627 C  CG  . ARG A 1 225 ? 7.243   23.913 19.374  1.00 47.38 ? 213 ARG A CG  1 
ATOM   1628 C  CD  . ARG A 1 225 ? 6.719   23.336 18.053  1.00 57.47 ? 213 ARG A CD  1 
ATOM   1629 N  NE  . ARG A 1 225 ? 6.477   21.889 18.116  1.00 63.97 ? 213 ARG A NE  1 
ATOM   1630 C  CZ  . ARG A 1 225 ? 5.276   21.293 18.171  1.00 69.29 ? 213 ARG A CZ  1 
ATOM   1631 N  NH1 . ARG A 1 225 ? 4.132   21.996 18.220  1.00 70.46 ? 213 ARG A NH1 1 
ATOM   1632 N  NH2 . ARG A 1 225 ? 5.221   19.957 18.190  1.00 71.56 ? 213 ARG A NH2 1 
ATOM   1633 N  N   . GLU A 1 226 ? 8.854   27.408 19.917  1.00 39.92 ? 214 GLU A N   1 
ATOM   1634 C  CA  . GLU A 1 226 ? 10.254  27.697 19.573  1.00 41.87 ? 214 GLU A CA  1 
ATOM   1635 C  C   . GLU A 1 226 ? 10.939  28.256 20.819  1.00 38.13 ? 214 GLU A C   1 
ATOM   1636 O  O   . GLU A 1 226 ? 12.055  27.921 21.147  1.00 35.78 ? 214 GLU A O   1 
ATOM   1637 C  CB  . GLU A 1 226 ? 10.397  28.723 18.424  1.00 46.71 ? 214 GLU A CB  1 
ATOM   1638 C  CG  . GLU A 1 226 ? 9.428   28.570 17.226  1.00 56.27 ? 214 GLU A CG  1 
ATOM   1639 C  CD  . GLU A 1 226 ? 7.971   29.049 17.551  1.00 62.42 ? 214 GLU A CD  1 
ATOM   1640 O  OE1 . GLU A 1 226 ? 7.074   28.167 17.644  1.00 62.94 ? 214 GLU A OE1 1 
ATOM   1641 O  OE2 . GLU A 1 226 ? 7.728   30.290 17.730  1.00 70.40 ? 214 GLU A OE2 1 
ATOM   1642 N  N   . MET A 1 227 ? 10.258  29.115 21.518  1.00 37.72 ? 215 MET A N   1 
ATOM   1643 C  CA  . MET A 1 227 ? 10.762  29.606 22.793  1.00 38.09 ? 215 MET A CA  1 
ATOM   1644 C  C   . MET A 1 227 ? 11.068  28.462 23.813  1.00 35.94 ? 215 MET A C   1 
ATOM   1645 O  O   . MET A 1 227 ? 12.137  28.415 24.431  1.00 35.13 ? 215 MET A O   1 
ATOM   1646 C  CB  . MET A 1 227 ? 9.724   30.592 23.342  1.00 38.47 ? 215 MET A CB  1 
ATOM   1647 C  CG  . MET A 1 227 ? 10.094  31.244 24.644  1.00 41.57 ? 215 MET A CG  1 
ATOM   1648 S  SD  . MET A 1 227 ? 8.711   32.220 25.328  1.00 45.78 ? 215 MET A SD  1 
ATOM   1649 C  CE  . MET A 1 227 ? 8.178   33.104 23.793  1.00 35.44 ? 215 MET A CE  1 
ATOM   1650 N  N   . VAL A 1 228 ? 10.150  27.521 23.967  1.00 35.12 ? 216 VAL A N   1 
ATOM   1651 C  CA  . VAL A 1 228 ? 10.330  26.449 24.914  1.00 33.79 ? 216 VAL A CA  1 
ATOM   1652 C  C   . VAL A 1 228 ? 11.471  25.546 24.463  1.00 35.91 ? 216 VAL A C   1 
ATOM   1653 O  O   . VAL A 1 228 ? 12.265  25.129 25.294  1.00 33.92 ? 216 VAL A O   1 
ATOM   1654 C  CB  . VAL A 1 228 ? 8.991   25.643 25.095  1.00 34.33 ? 216 VAL A CB  1 
ATOM   1655 C  CG1 . VAL A 1 228 ? 9.205   24.344 25.831  1.00 31.42 ? 216 VAL A CG1 1 
ATOM   1656 C  CG2 . VAL A 1 228 ? 7.948   26.493 25.836  1.00 33.06 ? 216 VAL A CG2 1 
ATOM   1657 N  N   . ARG A 1 229 ? 11.545  25.237 23.155  1.00 37.92 ? 217 ARG A N   1 
ATOM   1658 C  CA  . ARG A 1 229 ? 12.639  24.403 22.634  1.00 40.12 ? 217 ARG A CA  1 
ATOM   1659 C  C   . ARG A 1 229 ? 13.983  25.039 22.933  1.00 39.48 ? 217 ARG A C   1 
ATOM   1660 O  O   . ARG A 1 229 ? 14.904  24.356 23.343  1.00 39.31 ? 217 ARG A O   1 
ATOM   1661 C  CB  . ARG A 1 229 ? 12.515  24.181 21.102  1.00 43.37 ? 217 ARG A CB  1 
ATOM   1662 C  CG  . ARG A 1 229 ? 13.495  23.183 20.557  1.00 48.11 ? 217 ARG A CG  1 
ATOM   1663 C  CD  . ARG A 1 229 ? 13.191  22.760 19.092  1.00 56.66 ? 217 ARG A CD  1 
ATOM   1664 N  NE  . ARG A 1 229 ? 13.324  23.853 18.117  1.00 64.26 ? 217 ARG A NE  1 
ATOM   1665 C  CZ  . ARG A 1 229 ? 12.323  24.626 17.663  1.00 69.94 ? 217 ARG A CZ  1 
ATOM   1666 N  NH1 . ARG A 1 229 ? 12.591  25.594 16.781  1.00 72.97 ? 217 ARG A NH1 1 
ATOM   1667 N  NH2 . ARG A 1 229 ? 11.051  24.455 18.072  1.00 70.84 ? 217 ARG A NH2 1 
ATOM   1668 N  N   . SER A 1 230 ? 14.098  26.346 22.763  1.00 40.00 ? 218 SER A N   1 
ATOM   1669 C  CA  . SER A 1 230 ? 15.382  26.997 23.027  1.00 41.70 ? 218 SER A CA  1 
ATOM   1670 C  C   . SER A 1 230 ? 15.697  27.072 24.518  1.00 39.90 ? 218 SER A C   1 
ATOM   1671 O  O   . SER A 1 230 ? 16.864  27.244 24.857  1.00 40.53 ? 218 SER A O   1 
ATOM   1672 C  CB  . SER A 1 230 ? 15.463  28.412 22.408  1.00 43.83 ? 218 SER A CB  1 
ATOM   1673 O  OG  . SER A 1 230 ? 14.617  29.257 23.179  1.00 47.79 ? 218 SER A OG  1 
ATOM   1674 N  N   . LEU A 1 231 ? 14.696  26.933 25.406  1.00 37.54 ? 219 LEU A N   1 
ATOM   1675 C  CA  . LEU A 1 231 ? 14.948  26.971 26.842  1.00 37.25 ? 219 LEU A CA  1 
ATOM   1676 C  C   . LEU A 1 231 ? 15.231  25.600 27.491  1.00 36.85 ? 219 LEU A C   1 
ATOM   1677 O  O   . LEU A 1 231 ? 15.770  25.544 28.584  1.00 37.43 ? 219 LEU A O   1 
ATOM   1678 C  CB  . LEU A 1 231 ? 13.794  27.662 27.588  1.00 36.89 ? 219 LEU A CB  1 
ATOM   1679 C  CG  . LEU A 1 231 ? 13.586  29.164 27.391  1.00 37.89 ? 219 LEU A CG  1 
ATOM   1680 C  CD1 . LEU A 1 231 ? 12.256  29.603 28.048  1.00 35.48 ? 219 LEU A CD1 1 
ATOM   1681 C  CD2 . LEU A 1 231 ? 14.798  30.011 27.880  1.00 37.54 ? 219 LEU A CD2 1 
ATOM   1682 N  N   . LEU A 1 232 ? 14.855  24.503 26.845  1.00 37.04 ? 220 LEU A N   1 
ATOM   1683 C  CA  . LEU A 1 232 ? 15.062  23.187 27.411  1.00 37.50 ? 220 LEU A CA  1 
ATOM   1684 C  C   . LEU A 1 232 ? 16.515  22.949 27.811  1.00 37.24 ? 220 LEU A C   1 
ATOM   1685 O  O   . LEU A 1 232 ? 17.389  23.167 27.024  1.00 38.10 ? 220 LEU A O   1 
ATOM   1686 C  CB  . LEU A 1 232 ? 14.713  22.113 26.400  1.00 38.54 ? 220 LEU A CB  1 
ATOM   1687 C  CG  . LEU A 1 232 ? 13.347  21.474 26.405  1.00 41.82 ? 220 LEU A CG  1 
ATOM   1688 C  CD1 . LEU A 1 232 ? 13.490  20.214 25.523  1.00 44.01 ? 220 LEU A CD1 1 
ATOM   1689 C  CD2 . LEU A 1 232 ? 12.755  21.143 27.806  1.00 39.39 ? 220 LEU A CD2 1 
ATOM   1690 N  N   . PRO A 1 233 ? 16.782  22.480 29.037  1.00 37.15 ? 221 PRO A N   1 
ATOM   1691 C  CA  . PRO A 1 233 ? 18.219  22.231 29.358  1.00 37.32 ? 221 PRO A CA  1 
ATOM   1692 C  C   . PRO A 1 233 ? 18.889  21.178 28.480  1.00 37.28 ? 221 PRO A C   1 
ATOM   1693 O  O   . PRO A 1 233 ? 18.236  20.288 27.984  1.00 35.18 ? 221 PRO A O   1 
ATOM   1694 C  CB  . PRO A 1 233 ? 18.186  21.726 30.821  1.00 36.77 ? 221 PRO A CB  1 
ATOM   1695 C  CG  . PRO A 1 233 ? 16.827  21.572 31.211  1.00 35.40 ? 221 PRO A CG  1 
ATOM   1696 C  CD  . PRO A 1 233 ? 15.930  22.332 30.225  1.00 37.26 ? 221 PRO A CD  1 
ATOM   1697 N  N   . GLU A 1 234 ? 20.193  21.316 28.315  1.00 39.30 ? 222 GLU A N   1 
ATOM   1698 C  CA  . GLU A 1 234 ? 21.025  20.364 27.630  1.00 40.59 ? 222 GLU A CA  1 
ATOM   1699 C  C   . GLU A 1 234 ? 21.185  19.069 28.428  1.00 38.45 ? 222 GLU A C   1 
ATOM   1700 O  O   . GLU A 1 234 ? 21.058  19.050 29.654  1.00 39.59 ? 222 GLU A O   1 
ATOM   1701 C  CB  . GLU A 1 234 ? 22.393  20.983 27.344  1.00 43.46 ? 222 GLU A CB  1 
ATOM   1702 C  CG  . GLU A 1 234 ? 22.301  22.029 26.269  1.00 48.87 ? 222 GLU A CG  1 
ATOM   1703 C  CD  . GLU A 1 234 ? 23.652  22.610 25.916  1.00 59.11 ? 222 GLU A CD  1 
ATOM   1704 O  OE1 . GLU A 1 234 ? 24.497  21.853 25.398  1.00 64.68 ? 222 GLU A OE1 1 
ATOM   1705 O  OE2 . GLU A 1 234 ? 23.871  23.825 26.152  1.00 65.62 ? 222 GLU A OE2 1 
ATOM   1706 N  N   . ARG A 1 235 ? 21.349  17.971 27.710  1.00 36.57 ? 223 ARG A N   1 
ATOM   1707 C  CA  . ARG A 1 235 ? 21.569  16.671 28.337  1.00 34.84 ? 223 ARG A CA  1 
ATOM   1708 C  C   . ARG A 1 235 ? 22.930  16.173 27.865  1.00 34.91 ? 223 ARG A C   1 
ATOM   1709 O  O   . ARG A 1 235 ? 22.969  15.350 26.959  1.00 33.37 ? 223 ARG A O   1 
ATOM   1710 C  CB  . ARG A 1 235 ? 20.471  15.662 27.934  1.00 34.44 ? 223 ARG A CB  1 
ATOM   1711 C  CG  . ARG A 1 235 ? 19.001  16.063 28.217  1.00 32.66 ? 223 ARG A CG  1 
ATOM   1712 C  CD  . ARG A 1 235 ? 18.689  16.038 29.663  1.00 30.45 ? 223 ARG A CD  1 
ATOM   1713 N  NE  . ARG A 1 235 ? 18.736  14.692 30.251  1.00 27.99 ? 223 ARG A NE  1 
ATOM   1714 C  CZ  . ARG A 1 235 ? 18.280  14.427 31.469  1.00 27.76 ? 223 ARG A CZ  1 
ATOM   1715 N  NH1 . ARG A 1 235 ? 17.742  15.360 32.202  1.00 27.07 ? 223 ARG A NH1 1 
ATOM   1716 N  NH2 . ARG A 1 235 ? 18.334  13.228 31.967  1.00 28.48 ? 223 ARG A NH2 1 
ATOM   1717 N  N   . PRO A 1 236 ? 24.037  16.675 28.461  1.00 34.28 ? 224 PRO A N   1 
ATOM   1718 C  CA  . PRO A 1 236 ? 25.333  16.241 27.938  1.00 36.18 ? 224 PRO A CA  1 
ATOM   1719 C  C   . PRO A 1 236 ? 25.494  14.750 28.233  1.00 34.77 ? 224 PRO A C   1 
ATOM   1720 O  O   . PRO A 1 236 ? 25.068  14.269 29.314  1.00 32.21 ? 224 PRO A O   1 
ATOM   1721 C  CB  . PRO A 1 236 ? 26.364  17.047 28.761  1.00 36.76 ? 224 PRO A CB  1 
ATOM   1722 C  CG  . PRO A 1 236 ? 25.645  17.502 29.965  1.00 37.14 ? 224 PRO A CG  1 
ATOM   1723 C  CD  . PRO A 1 236 ? 24.173  17.611 29.598  1.00 35.66 ? 224 PRO A CD  1 
ATOM   1724 N  N   . ARG A 1 237 ? 26.085  14.044 27.296  1.00 34.43 ? 225 ARG A N   1 
ATOM   1725 C  CA  . ARG A 1 237 ? 26.241  12.607 27.419  1.00 35.76 ? 225 ARG A CA  1 
ATOM   1726 C  C   . ARG A 1 237 ? 27.034  12.192 28.636  1.00 34.36 ? 225 ARG A C   1 
ATOM   1727 O  O   . ARG A 1 237 ? 26.644  11.230 29.291  1.00 33.50 ? 225 ARG A O   1 
ATOM   1728 C  CB  . ARG A 1 237 ? 26.835  11.988 26.187  1.00 37.03 ? 225 ARG A CB  1 
ATOM   1729 C  CG  . ARG A 1 237 ? 25.883  12.120 25.063  1.00 43.02 ? 225 ARG A CG  1 
ATOM   1730 C  CD  . ARG A 1 237 ? 26.197  11.116 23.986  1.00 49.93 ? 225 ARG A CD  1 
ATOM   1731 N  NE  . ARG A 1 237 ? 27.217  11.637 23.110  1.00 54.37 ? 225 ARG A NE  1 
ATOM   1732 C  CZ  . ARG A 1 237 ? 28.077  10.894 22.424  1.00 56.03 ? 225 ARG A CZ  1 
ATOM   1733 N  NH1 . ARG A 1 237 ? 28.091  9.575  22.535  1.00 56.65 ? 225 ARG A NH1 1 
ATOM   1734 N  NH2 . ARG A 1 237 ? 28.946  11.498 21.642  1.00 58.82 ? 225 ARG A NH2 1 
ATOM   1735 N  N   . ASP A 1 238 ? 28.059  12.956 28.997  1.00 33.25 ? 226 ASP A N   1 
ATOM   1736 C  CA  . ASP A 1 238 ? 28.847  12.571 30.131  1.00 34.03 ? 226 ASP A CA  1 
ATOM   1737 C  C   . ASP A 1 238 ? 28.228  13.252 31.336  1.00 33.66 ? 226 ASP A C   1 
ATOM   1738 O  O   . ASP A 1 238 ? 28.657  14.300 31.732  1.00 36.23 ? 226 ASP A O   1 
ATOM   1739 C  CB  . ASP A 1 238 ? 30.300  13.001 29.999  1.00 35.31 ? 226 ASP A CB  1 
ATOM   1740 C  CG  . ASP A 1 238 ? 31.181  12.413 31.105  1.00 36.47 ? 226 ASP A CG  1 
ATOM   1741 O  OD1 . ASP A 1 238 ? 30.870  11.329 31.718  1.00 33.74 ? 226 ASP A OD1 1 
ATOM   1742 O  OD2 . ASP A 1 238 ? 32.245  12.998 31.282  1.00 39.12 ? 226 ASP A OD2 1 
ATOM   1743 N  N   . SER A 1 239 ? 27.220  12.648 31.908  1.00 32.63 ? 227 SER A N   1 
ATOM   1744 C  CA  . SER A 1 239 ? 26.465  13.272 32.987  1.00 32.17 ? 227 SER A CA  1 
ATOM   1745 C  C   . SER A 1 239 ? 26.151  12.174 34.012  1.00 32.57 ? 227 SER A C   1 
ATOM   1746 O  O   . SER A 1 239 ? 26.409  10.982 33.791  1.00 32.81 ? 227 SER A O   1 
ATOM   1747 C  CB  . SER A 1 239 ? 25.185  13.914 32.424  1.00 31.23 ? 227 SER A CB  1 
ATOM   1748 O  OG  . SER A 1 239 ? 24.418  12.981 31.689  1.00 32.18 ? 227 SER A OG  1 
ATOM   1749 N  N   . HIS A 1 240 ? 25.651  12.592 35.153  1.00 32.57 ? 228 HIS A N   1 
ATOM   1750 C  CA  . HIS A 1 240 ? 25.219  11.653 36.174  1.00 33.05 ? 228 HIS A CA  1 
ATOM   1751 C  C   . HIS A 1 240 ? 24.033  12.346 36.840  1.00 31.67 ? 228 HIS A C   1 
ATOM   1752 O  O   . HIS A 1 240 ? 23.707  13.499 36.529  1.00 31.16 ? 228 HIS A O   1 
ATOM   1753 C  CB  . HIS A 1 240 ? 26.353  11.372 37.169  1.00 35.07 ? 228 HIS A CB  1 
ATOM   1754 C  CG  . HIS A 1 240 ? 26.998  12.594 37.689  1.00 38.87 ? 228 HIS A CG  1 
ATOM   1755 N  ND1 . HIS A 1 240 ? 26.662  13.157 38.900  1.00 51.42 ? 228 HIS A ND1 1 
ATOM   1756 C  CD2 . HIS A 1 240 ? 27.951  13.398 37.156  1.00 46.74 ? 228 HIS A CD2 1 
ATOM   1757 C  CE1 . HIS A 1 240 ? 27.381  14.251 39.105  1.00 50.41 ? 228 HIS A CE1 1 
ATOM   1758 N  NE2 . HIS A 1 240 ? 28.163  14.426 38.052  1.00 51.59 ? 228 HIS A NE2 1 
ATOM   1759 N  N   . LYS A 1 241 ? 23.391  11.678 37.758  1.00 30.87 ? 229 LYS A N   1 
ATOM   1760 C  CA  . LYS A 1 241 ? 22.197  12.233 38.285  1.00 31.88 ? 229 LYS A CA  1 
ATOM   1761 C  C   . LYS A 1 241 ? 22.386  13.602 38.934  1.00 31.94 ? 229 LYS A C   1 
ATOM   1762 O  O   . LYS A 1 241 ? 21.503  14.435 38.827  1.00 30.18 ? 229 LYS A O   1 
ATOM   1763 C  CB  . LYS A 1 241 ? 21.509  11.249 39.204  1.00 34.65 ? 229 LYS A CB  1 
ATOM   1764 C  CG  . LYS A 1 241 ? 21.997  11.080 40.530  1.00 37.49 ? 229 LYS A CG  1 
ATOM   1765 C  CD  . LYS A 1 241 ? 20.861  10.273 41.265  1.00 43.21 ? 229 LYS A CD  1 
ATOM   1766 C  CE  . LYS A 1 241 ? 21.285  9.803  42.620  1.00 45.71 ? 229 LYS A CE  1 
ATOM   1767 N  NZ  . LYS A 1 241 ? 22.312  8.817  42.420  1.00 52.96 ? 229 LYS A NZ  1 
ATOM   1768 N  N   . GLY A 1 242 ? 23.542  13.817 39.576  1.00 32.97 ? 230 GLY A N   1 
ATOM   1769 C  CA  . GLY A 1 242 ? 23.891  15.112 40.160  1.00 34.86 ? 230 GLY A CA  1 
ATOM   1770 C  C   . GLY A 1 242 ? 23.920  16.233 39.118  1.00 33.07 ? 230 GLY A C   1 
ATOM   1771 O  O   . GLY A 1 242 ? 23.544  17.335 39.418  1.00 34.65 ? 230 GLY A O   1 
ATOM   1772 N  N   . THR A 1 243 ? 24.307  15.939 37.887  1.00 31.14 ? 231 THR A N   1 
ATOM   1773 C  CA  . THR A 1 243 ? 24.148  16.910 36.796  1.00 31.61 ? 231 THR A CA  1 
ATOM   1774 C  C   . THR A 1 243 ? 22.737  17.530 36.677  1.00 31.33 ? 231 THR A C   1 
ATOM   1775 O  O   . THR A 1 243 ? 22.598  18.682 36.264  1.00 30.58 ? 231 THR A O   1 
ATOM   1776 C  CB  . THR A 1 243 ? 24.464  16.269 35.435  1.00 31.62 ? 231 THR A CB  1 
ATOM   1777 O  OG1 . THR A 1 243 ? 25.686  15.538 35.542  1.00 33.38 ? 231 THR A OG1 1 
ATOM   1778 C  CG2 . THR A 1 243 ? 24.568  17.375 34.329  1.00 31.16 ? 231 THR A CG2 1 
ATOM   1779 N  N   . TYR A 1 244 ? 21.694  16.738 36.985  1.00 30.41 ? 232 TYR A N   1 
ATOM   1780 C  CA  . TYR A 1 244 ? 20.329  17.122 36.701  1.00 30.08 ? 232 TYR A CA  1 
ATOM   1781 C  C   . TYR A 1 244 ? 19.602  17.563 37.974  1.00 31.98 ? 232 TYR A C   1 
ATOM   1782 O  O   . TYR A 1 244 ? 18.389  17.639 37.982  1.00 29.53 ? 232 TYR A O   1 
ATOM   1783 C  CB  . TYR A 1 244 ? 19.623  15.964 35.959  1.00 28.62 ? 232 TYR A CB  1 
ATOM   1784 C  CG  . TYR A 1 244 ? 20.336  15.725 34.649  1.00 27.94 ? 232 TYR A CG  1 
ATOM   1785 C  CD1 . TYR A 1 244 ? 20.406  16.732 33.685  1.00 27.22 ? 232 TYR A CD1 1 
ATOM   1786 C  CD2 . TYR A 1 244 ? 20.974  14.524 34.392  1.00 25.94 ? 232 TYR A CD2 1 
ATOM   1787 C  CE1 . TYR A 1 244 ? 21.112  16.514 32.486  1.00 26.99 ? 232 TYR A CE1 1 
ATOM   1788 C  CE2 . TYR A 1 244 ? 21.671  14.309 33.243  1.00 27.05 ? 232 TYR A CE2 1 
ATOM   1789 C  CZ  . TYR A 1 244 ? 21.730  15.308 32.277  1.00 26.41 ? 232 TYR A CZ  1 
ATOM   1790 O  OH  . TYR A 1 244 ? 22.421  15.059 31.100  1.00 27.45 ? 232 TYR A OH  1 
ATOM   1791 N  N   . GLY A 1 245 ? 20.350  17.823 39.051  1.00 31.07 ? 233 GLY A N   1 
ATOM   1792 C  CA  . GLY A 1 245 ? 19.753  18.428 40.238  1.00 31.01 ? 233 GLY A CA  1 
ATOM   1793 C  C   . GLY A 1 245 ? 18.900  17.557 41.143  1.00 31.06 ? 233 GLY A C   1 
ATOM   1794 O  O   . GLY A 1 245 ? 18.500  16.412 40.813  1.00 30.69 ? 233 GLY A O   1 
ATOM   1795 N  N   . LYS A 1 246 ? 18.562  18.149 42.281  1.00 31.52 ? 234 LYS A N   1 
ATOM   1796 C  CA  . LYS A 1 246 ? 17.838  17.504 43.342  1.00 31.31 ? 234 LYS A CA  1 
ATOM   1797 C  C   . LYS A 1 246 ? 16.712  18.397 43.845  1.00 29.89 ? 234 LYS A C   1 
ATOM   1798 O  O   . LYS A 1 246 ? 16.908  19.589 44.060  1.00 28.84 ? 234 LYS A O   1 
ATOM   1799 C  CB  . LYS A 1 246 ? 18.803  17.249 44.495  1.00 33.51 ? 234 LYS A CB  1 
ATOM   1800 C  CG  . LYS A 1 246 ? 19.952  16.369 44.117  1.00 38.44 ? 234 LYS A CG  1 
ATOM   1801 C  CD  . LYS A 1 246 ? 20.933  16.221 45.263  1.00 46.13 ? 234 LYS A CD  1 
ATOM   1802 C  CE  . LYS A 1 246 ? 22.359  15.950 44.774  1.00 50.59 ? 234 LYS A CE  1 
ATOM   1803 N  NZ  . LYS A 1 246 ? 23.293  16.532 45.828  1.00 57.59 ? 234 LYS A NZ  1 
ATOM   1804 N  N   . VAL A 1 247 ? 15.528  17.800 43.998  1.00 28.52 ? 235 VAL A N   1 
ATOM   1805 C  CA  . VAL A 1 247 ? 14.325  18.465 44.474  1.00 27.98 ? 235 VAL A CA  1 
ATOM   1806 C  C   . VAL A 1 247 ? 13.890  17.839 45.808  1.00 28.24 ? 235 VAL A C   1 
ATOM   1807 O  O   . VAL A 1 247 ? 13.920  16.606 45.941  1.00 27.39 ? 235 VAL A O   1 
ATOM   1808 C  CB  . VAL A 1 247 ? 13.192  18.323 43.417  1.00 28.34 ? 235 VAL A CB  1 
ATOM   1809 C  CG1 . VAL A 1 247 ? 11.856  18.744 43.950  1.00 24.86 ? 235 VAL A CG1 1 
ATOM   1810 C  CG2 . VAL A 1 247 ? 13.580  19.087 42.059  1.00 26.16 ? 235 VAL A CG2 1 
ATOM   1811 N  N   . LEU A 1 248 ? 13.497  18.685 46.772  1.00 27.94 ? 236 LEU A N   1 
ATOM   1812 C  CA  . LEU A 1 248 ? 12.737  18.244 47.961  1.00 27.88 ? 236 LEU A CA  1 
ATOM   1813 C  C   . LEU A 1 248 ? 11.323  18.760 47.796  1.00 28.03 ? 236 LEU A C   1 
ATOM   1814 O  O   . LEU A 1 248 ? 11.118  19.909 47.457  1.00 29.63 ? 236 LEU A O   1 
ATOM   1815 C  CB  . LEU A 1 248 ? 13.325  18.762 49.262  1.00 28.57 ? 236 LEU A CB  1 
ATOM   1816 C  CG  . LEU A 1 248 ? 12.597  18.497 50.588  1.00 27.23 ? 236 LEU A CG  1 
ATOM   1817 C  CD1 . LEU A 1 248 ? 12.661  16.968 50.979  1.00 25.62 ? 236 LEU A CD1 1 
ATOM   1818 C  CD2 . LEU A 1 248 ? 13.138  19.357 51.716  1.00 26.59 ? 236 LEU A CD2 1 
ATOM   1819 N  N   . ILE A 1 249 ? 10.365  17.881 47.947  1.00 26.70 ? 237 ILE A N   1 
ATOM   1820 C  CA  . ILE A 1 249 ? 8.988   18.222 47.952  1.00 27.93 ? 237 ILE A CA  1 
ATOM   1821 C  C   . ILE A 1 249 ? 8.447   17.976 49.380  1.00 27.46 ? 237 ILE A C   1 
ATOM   1822 O  O   . ILE A 1 249 ? 8.556   16.878 49.889  1.00 27.73 ? 237 ILE A O   1 
ATOM   1823 C  CB  . ILE A 1 249 ? 8.215   17.397 46.885  1.00 28.30 ? 237 ILE A CB  1 
ATOM   1824 C  CG1 . ILE A 1 249 ? 8.741   17.791 45.490  1.00 30.65 ? 237 ILE A CG1 1 
ATOM   1825 C  CG2 . ILE A 1 249 ? 6.714   17.700 47.037  1.00 28.75 ? 237 ILE A CG2 1 
ATOM   1826 C  CD1 . ILE A 1 249 ? 8.294   17.033 44.357  1.00 32.72 ? 237 ILE A CD1 1 
ATOM   1827 N  N   . ILE A 1 250 ? 7.970   19.038 50.021  1.00 27.57 ? 238 ILE A N   1 
ATOM   1828 C  CA  . ILE A 1 250 ? 7.329   19.007 51.359  1.00 27.53 ? 238 ILE A CA  1 
ATOM   1829 C  C   . ILE A 1 250 ? 5.821   19.085 51.097  1.00 27.53 ? 238 ILE A C   1 
ATOM   1830 O  O   . ILE A 1 250 ? 5.311   20.104 50.619  1.00 29.15 ? 238 ILE A O   1 
ATOM   1831 C  CB  . ILE A 1 250 ? 7.779   20.181 52.262  1.00 27.58 ? 238 ILE A CB  1 
ATOM   1832 C  CG1 . ILE A 1 250 ? 9.275   20.112 52.559  1.00 28.30 ? 238 ILE A CG1 1 
ATOM   1833 C  CG2 . ILE A 1 250 ? 6.975   20.195 53.582  1.00 26.77 ? 238 ILE A CG2 1 
ATOM   1834 C  CD1 . ILE A 1 250 ? 9.855   21.315 53.284  1.00 28.94 ? 238 ILE A CD1 1 
ATOM   1835 N  N   . ALA A 1 251 ? 5.119   17.990 51.354  1.00 27.68 ? 239 ALA A N   1 
ATOM   1836 C  CA  . ALA A 1 251 ? 3.759   17.849 50.871  1.00 28.30 ? 239 ALA A CA  1 
ATOM   1837 C  C   . ALA A 1 251 ? 3.026   16.717 51.596  1.00 29.00 ? 239 ALA A C   1 
ATOM   1838 O  O   . ALA A 1 251 ? 3.649   15.841 52.240  1.00 29.35 ? 239 ALA A O   1 
ATOM   1839 C  CB  . ALA A 1 251 ? 3.758   17.610 49.363  1.00 28.20 ? 239 ALA A CB  1 
ATOM   1840 N  N   . GLY A 1 252 ? 1.696   16.789 51.535  1.00 28.25 ? 240 GLY A N   1 
ATOM   1841 C  CA  . GLY A 1 252 ? 0.829   15.710 52.015  1.00 28.15 ? 240 GLY A CA  1 
ATOM   1842 C  C   . GLY A 1 252 ? 0.479   15.844 53.487  1.00 28.64 ? 240 GLY A C   1 
ATOM   1843 O  O   . GLY A 1 252 ? 1.036   16.634 54.235  1.00 28.88 ? 240 GLY A O   1 
ATOM   1844 N  N   . SER A 1 253 ? -0.441  15.002 53.882  1.00 29.27 ? 241 SER A N   1 
ATOM   1845 C  CA  . SER A 1 253 ? -1.059  14.986 55.176  1.00 28.96 ? 241 SER A CA  1 
ATOM   1846 C  C   . SER A 1 253 ? -1.901  13.711 55.234  1.00 28.99 ? 241 SER A C   1 
ATOM   1847 O  O   . SER A 1 253 ? -2.032  12.963 54.224  1.00 27.88 ? 241 SER A O   1 
ATOM   1848 C  CB  . SER A 1 253 ? -1.953  16.229 55.356  1.00 29.55 ? 241 SER A CB  1 
ATOM   1849 O  OG  . SER A 1 253 ? -3.103  16.159 54.516  1.00 30.44 ? 241 SER A OG  1 
ATOM   1850 N  N   . ARG A 1 254 ? -2.463  13.449 56.400  1.00 30.44 ? 242 ARG A N   1 
ATOM   1851 C  CA  . ARG A 1 254 ? -3.303  12.288 56.596  1.00 32.56 ? 242 ARG A CA  1 
ATOM   1852 C  C   . ARG A 1 254 ? -4.565  12.425 55.713  1.00 32.45 ? 242 ARG A C   1 
ATOM   1853 O  O   . ARG A 1 254 ? -5.073  11.415 55.241  1.00 31.33 ? 242 ARG A O   1 
ATOM   1854 C  CB  . ARG A 1 254 ? -3.684  12.091 58.053  1.00 34.63 ? 242 ARG A CB  1 
ATOM   1855 C  CG  . ARG A 1 254 ? -4.685  13.107 58.496  1.00 40.74 ? 242 ARG A CG  1 
ATOM   1856 C  CD  . ARG A 1 254 ? -4.802  13.149 60.032  1.00 48.79 ? 242 ARG A CD  1 
ATOM   1857 N  NE  . ARG A 1 254 ? -5.421  11.934 60.486  1.00 51.99 ? 242 ARG A NE  1 
ATOM   1858 C  CZ  . ARG A 1 254 ? -6.722  11.746 60.509  1.00 54.63 ? 242 ARG A CZ  1 
ATOM   1859 N  NH1 . ARG A 1 254 ? -7.205  10.575 60.927  1.00 54.83 ? 242 ARG A NH1 1 
ATOM   1860 N  NH2 . ARG A 1 254 ? -7.532  12.738 60.128  1.00 57.17 ? 242 ARG A NH2 1 
ATOM   1861 N  N   . LEU A 1 255 ? -5.009  13.656 55.470  1.00 32.62 ? 243 LEU A N   1 
ATOM   1862 C  CA  . LEU A 1 255 ? -6.161  13.924 54.609  1.00 34.08 ? 243 LEU A CA  1 
ATOM   1863 C  C   . LEU A 1 255 ? -5.802  13.798 53.126  1.00 31.38 ? 243 LEU A C   1 
ATOM   1864 O  O   . LEU A 1 255 ? -6.622  13.312 52.335  1.00 33.25 ? 243 LEU A O   1 
ATOM   1865 C  CB  . LEU A 1 255 ? -6.768  15.326 54.844  1.00 34.20 ? 243 LEU A CB  1 
ATOM   1866 C  CG  . LEU A 1 255 ? -7.308  15.660 56.227  1.00 40.15 ? 243 LEU A CG  1 
ATOM   1867 C  CD1 . LEU A 1 255 ? -7.940  17.061 56.201  1.00 42.16 ? 243 LEU A CD1 1 
ATOM   1868 C  CD2 . LEU A 1 255 ? -8.372  14.590 56.778  1.00 43.18 ? 243 LEU A CD2 1 
ATOM   1869 N  N   . TYR A 1 256 ? -4.619  14.252 52.743  1.00 30.08 ? 244 TYR A N   1 
ATOM   1870 C  CA  . TYR A 1 256 ? -4.273  14.426 51.318  1.00 29.82 ? 244 TYR A CA  1 
ATOM   1871 C  C   . TYR A 1 256 ? -3.020  13.667 51.008  1.00 30.96 ? 244 TYR A C   1 
ATOM   1872 O  O   . TYR A 1 256 ? -1.941  14.264 50.939  1.00 31.33 ? 244 TYR A O   1 
ATOM   1873 C  CB  . TYR A 1 256 ? -4.042  15.914 50.949  1.00 30.08 ? 244 TYR A CB  1 
ATOM   1874 C  CG  . TYR A 1 256 ? -5.220  16.733 51.259  1.00 28.43 ? 244 TYR A CG  1 
ATOM   1875 C  CD1 . TYR A 1 256 ? -6.446  16.438 50.674  1.00 30.65 ? 244 TYR A CD1 1 
ATOM   1876 C  CD2 . TYR A 1 256 ? -5.162  17.741 52.207  1.00 32.40 ? 244 TYR A CD2 1 
ATOM   1877 C  CE1 . TYR A 1 256 ? -7.603  17.161 51.025  1.00 35.73 ? 244 TYR A CE1 1 
ATOM   1878 C  CE2 . TYR A 1 256 ? -6.308  18.478 52.569  1.00 32.44 ? 244 TYR A CE2 1 
ATOM   1879 C  CZ  . TYR A 1 256 ? -7.518  18.181 51.953  1.00 34.93 ? 244 TYR A CZ  1 
ATOM   1880 O  OH  . TYR A 1 256 ? -8.643  18.877 52.288  1.00 40.91 ? 244 TYR A OH  1 
ATOM   1881 N  N   . SER A 1 257 ? -3.147  12.349 50.820  1.00 30.23 ? 245 SER A N   1 
ATOM   1882 C  CA  . SER A 1 257 ? -1.964  11.499 50.672  1.00 30.39 ? 245 SER A CA  1 
ATOM   1883 C  C   . SER A 1 257 ? -1.480  11.355 49.239  1.00 30.19 ? 245 SER A C   1 
ATOM   1884 O  O   . SER A 1 257 ? -0.383  10.896 49.018  1.00 30.56 ? 245 SER A O   1 
ATOM   1885 C  CB  . SER A 1 257 ? -2.255  10.111 51.283  1.00 31.03 ? 245 SER A CB  1 
ATOM   1886 O  OG  . SER A 1 257 ? -3.487  9.567  50.729  1.00 30.52 ? 245 SER A OG  1 
ATOM   1887 N  N   . GLY A 1 258 ? -2.281  11.727 48.252  1.00 30.22 ? 246 GLY A N   1 
ATOM   1888 C  CA  . GLY A 1 258 ? -1.857  11.597 46.849  1.00 29.08 ? 246 GLY A CA  1 
ATOM   1889 C  C   . GLY A 1 258 ? -1.029  12.717 46.270  1.00 28.97 ? 246 GLY A C   1 
ATOM   1890 O  O   . GLY A 1 258 ? -0.229  12.481 45.362  1.00 28.32 ? 246 GLY A O   1 
ATOM   1891 N  N   . ALA A 1 259 ? -1.199  13.940 46.774  1.00 28.01 ? 247 ALA A N   1 
ATOM   1892 C  CA  . ALA A 1 259 ? -0.510  15.085 46.189  1.00 28.49 ? 247 ALA A CA  1 
ATOM   1893 C  C   . ALA A 1 259 ? 1.028   14.931 46.058  1.00 28.95 ? 247 ALA A C   1 
ATOM   1894 O  O   . ALA A 1 259 ? 1.585   15.326 44.990  1.00 29.49 ? 247 ALA A O   1 
ATOM   1895 C  CB  . ALA A 1 259 ? -0.859  16.390 46.935  1.00 28.03 ? 247 ALA A CB  1 
ATOM   1896 N  N   . PRO A 1 260 ? 1.719   14.402 47.108  1.00 28.34 ? 248 PRO A N   1 
ATOM   1897 C  CA  . PRO A 1 260 ? 3.204   14.220 47.038  1.00 28.35 ? 248 PRO A CA  1 
ATOM   1898 C  C   . PRO A 1 260 ? 3.699   13.381 45.862  1.00 28.68 ? 248 PRO A C   1 
ATOM   1899 O  O   . PRO A 1 260 ? 4.712   13.695 45.234  1.00 28.40 ? 248 PRO A O   1 
ATOM   1900 C  CB  . PRO A 1 260 ? 3.549   13.507 48.366  1.00 28.50 ? 248 PRO A CB  1 
ATOM   1901 C  CG  . PRO A 1 260 ? 2.394   13.861 49.337  1.00 28.04 ? 248 PRO A CG  1 
ATOM   1902 C  CD  . PRO A 1 260 ? 1.185   13.886 48.389  1.00 29.22 ? 248 PRO A CD  1 
ATOM   1903 N  N   . VAL A 1 261 ? 2.947   12.338 45.562  1.00 28.23 ? 249 VAL A N   1 
ATOM   1904 C  CA  . VAL A 1 261 ? 3.266   11.393 44.551  1.00 28.31 ? 249 VAL A CA  1 
ATOM   1905 C  C   . VAL A 1 261 ? 3.202   12.075 43.154  1.00 27.05 ? 249 VAL A C   1 
ATOM   1906 O  O   . VAL A 1 261 ? 4.090   11.907 42.339  1.00 26.08 ? 249 VAL A O   1 
ATOM   1907 C  CB  . VAL A 1 261 ? 2.277   10.211 44.622  1.00 29.06 ? 249 VAL A CB  1 
ATOM   1908 C  CG1 . VAL A 1 261 ? 2.817   9.114  43.804  1.00 31.19 ? 249 VAL A CG1 1 
ATOM   1909 C  CG2 . VAL A 1 261 ? 2.050   9.784  46.140  1.00 32.24 ? 249 VAL A CG2 1 
ATOM   1910 N  N   . LEU A 1 262 ? 2.160   12.856 42.929  1.00 25.26 ? 250 LEU A N   1 
ATOM   1911 C  CA  . LEU A 1 262 ? 1.972   13.577 41.673  1.00 25.19 ? 250 LEU A CA  1 
ATOM   1912 C  C   . LEU A 1 262 ? 3.039   14.661 41.459  1.00 25.31 ? 250 LEU A C   1 
ATOM   1913 O  O   . LEU A 1 262 ? 3.580   14.789 40.361  1.00 24.45 ? 250 LEU A O   1 
ATOM   1914 C  CB  . LEU A 1 262 ? 0.559   14.152 41.595  1.00 25.40 ? 250 LEU A CB  1 
ATOM   1915 C  CG  . LEU A 1 262 ? -0.562  13.109 41.591  1.00 27.11 ? 250 LEU A CG  1 
ATOM   1916 C  CD1 . LEU A 1 262 ? -1.883  13.821 41.707  1.00 26.18 ? 250 LEU A CD1 1 
ATOM   1917 C  CD2 . LEU A 1 262 ? -0.552  12.267 40.301  1.00 25.64 ? 250 LEU A CD2 1 
ATOM   1918 N  N   . SER A 1 263 ? 3.391   15.378 42.516  1.00 25.34 ? 251 SER A N   1 
ATOM   1919 C  CA  . SER A 1 263 ? 4.455   16.367 42.417  1.00 27.06 ? 251 SER A CA  1 
ATOM   1920 C  C   . SER A 1 263 ? 5.823   15.759 42.170  1.00 26.89 ? 251 SER A C   1 
ATOM   1921 O  O   . SER A 1 263 ? 6.548   16.241 41.319  1.00 25.40 ? 251 SER A O   1 
ATOM   1922 C  CB  . SER A 1 263 ? 4.531   17.228 43.673  1.00 27.24 ? 251 SER A CB  1 
ATOM   1923 O  OG  . SER A 1 263 ? 3.359   18.032 43.775  1.00 29.48 ? 251 SER A OG  1 
ATOM   1924 N  N   . GLY A 1 264 ? 6.136   14.706 42.920  1.00 26.19 ? 252 GLY A N   1 
ATOM   1925 C  CA  . GLY A 1 264 ? 7.424   14.021 42.794  1.00 26.87 ? 252 GLY A CA  1 
ATOM   1926 C  C   . GLY A 1 264 ? 7.633   13.509 41.396  1.00 25.62 ? 252 GLY A C   1 
ATOM   1927 O  O   . GLY A 1 264 ? 8.652   13.795 40.785  1.00 25.85 ? 252 GLY A O   1 
ATOM   1928 N  N   . MET A 1 265 ? 6.640   12.804 40.853  1.00 25.49 ? 253 MET A N   1 
ATOM   1929 C  CA  . MET A 1 265 ? 6.779   12.299 39.504  1.00 26.83 ? 253 MET A CA  1 
ATOM   1930 C  C   . MET A 1 265 ? 6.792   13.405 38.453  1.00 25.87 ? 253 MET A C   1 
ATOM   1931 O  O   . MET A 1 265 ? 7.429   13.259 37.414  1.00 26.19 ? 253 MET A O   1 
ATOM   1932 C  CB  . MET A 1 265 ? 5.706   11.252 39.182  1.00 28.51 ? 253 MET A CB  1 
ATOM   1933 C  CG  . MET A 1 265 ? 5.906   9.969  39.944  1.00 32.46 ? 253 MET A CG  1 
ATOM   1934 S  SD  . MET A 1 265 ? 7.513   9.160  39.666  1.00 44.28 ? 253 MET A SD  1 
ATOM   1935 C  CE  . MET A 1 265 ? 7.621   9.427  37.817  1.00 21.37 ? 253 MET A CE  1 
ATOM   1936 N  N   . GLY A 1 266 ? 6.106   14.513 38.720  1.00 25.19 ? 254 GLY A N   1 
ATOM   1937 C  CA  . GLY A 1 266 ? 6.219   15.672 37.851  1.00 25.97 ? 254 GLY A CA  1 
ATOM   1938 C  C   . GLY A 1 266 ? 7.695   16.124 37.717  1.00 25.98 ? 254 GLY A C   1 
ATOM   1939 O  O   . GLY A 1 266 ? 8.167   16.421 36.633  1.00 26.53 ? 254 GLY A O   1 
ATOM   1940 N  N   . SER A 1 267 ? 8.427   16.167 38.816  1.00 26.17 ? 255 SER A N   1 
ATOM   1941 C  CA  . SER A 1 267 ? 9.868   16.498 38.729  1.00 26.79 ? 255 SER A CA  1 
ATOM   1942 C  C   . SER A 1 267 ? 10.644  15.419 37.986  1.00 27.14 ? 255 SER A C   1 
ATOM   1943 O  O   . SER A 1 267 ? 11.505  15.737 37.182  1.00 26.04 ? 255 SER A O   1 
ATOM   1944 C  CB  . SER A 1 267 ? 10.500  16.675 40.120  1.00 26.54 ? 255 SER A CB  1 
ATOM   1945 O  OG  . SER A 1 267 ? 9.823   17.619 40.885  1.00 27.05 ? 255 SER A OG  1 
ATOM   1946 N  N   . LEU A 1 268 ? 10.335  14.133 38.235  1.00 26.61 ? 256 LEU A N   1 
ATOM   1947 C  CA  . LEU A 1 268 ? 11.103  13.087 37.556  1.00 26.82 ? 256 LEU A CA  1 
ATOM   1948 C  C   . LEU A 1 268 ? 10.878  13.038 36.051  1.00 26.62 ? 256 LEU A C   1 
ATOM   1949 O  O   . LEU A 1 268 ? 11.819  12.822 35.315  1.00 25.38 ? 256 LEU A O   1 
ATOM   1950 C  CB  . LEU A 1 268 ? 10.871  11.704 38.153  1.00 27.11 ? 256 LEU A CB  1 
ATOM   1951 C  CG  . LEU A 1 268 ? 11.524  11.433 39.519  1.00 29.77 ? 256 LEU A CG  1 
ATOM   1952 C  CD1 . LEU A 1 268 ? 11.073  10.006 40.041  1.00 33.54 ? 256 LEU A CD1 1 
ATOM   1953 C  CD2 . LEU A 1 268 ? 13.086  11.567 39.537  1.00 28.96 ? 256 LEU A CD2 1 
ATOM   1954 N  N   . LYS A 1 269 ? 9.635   13.192 35.609  1.00 25.80 ? 257 LYS A N   1 
ATOM   1955 C  CA  . LYS A 1 269 ? 9.299   13.146 34.162  1.00 26.53 ? 257 LYS A CA  1 
ATOM   1956 C  C   . LYS A 1 269 ? 9.915   14.294 33.330  1.00 25.93 ? 257 LYS A C   1 
ATOM   1957 O  O   . LYS A 1 269 ? 10.035  14.133 32.123  1.00 26.98 ? 257 LYS A O   1 
ATOM   1958 C  CB  . LYS A 1 269 ? 7.778   13.133 33.959  1.00 27.32 ? 257 LYS A CB  1 
ATOM   1959 C  CG  . LYS A 1 269 ? 7.065   11.878 34.490  1.00 29.28 ? 257 LYS A CG  1 
ATOM   1960 C  CD  . LYS A 1 269 ? 7.464   10.640 33.678  1.00 35.04 ? 257 LYS A CD  1 
ATOM   1961 C  CE  . LYS A 1 269 ? 6.632   9.417  34.042  1.00 38.40 ? 257 LYS A CE  1 
ATOM   1962 N  NZ  . LYS A 1 269 ? 6.834   8.379  32.945  1.00 39.33 ? 257 LYS A NZ  1 
ATOM   1963 N  N   . VAL A 1 270 ? 10.305  15.418 33.948  1.00 25.53 ? 258 VAL A N   1 
ATOM   1964 C  CA  . VAL A 1 270 ? 10.939  16.505 33.216  1.00 25.80 ? 258 VAL A CA  1 
ATOM   1965 C  C   . VAL A 1 270 ? 12.488  16.390 33.208  1.00 26.30 ? 258 VAL A C   1 
ATOM   1966 O  O   . VAL A 1 270 ? 13.166  17.222 32.650  1.00 25.41 ? 258 VAL A O   1 
ATOM   1967 C  CB  . VAL A 1 270 ? 10.483  17.903 33.677  1.00 26.15 ? 258 VAL A CB  1 
ATOM   1968 C  CG1 . VAL A 1 270 ? 8.975   18.048 33.451  1.00 25.09 ? 258 VAL A CG1 1 
ATOM   1969 C  CG2 . VAL A 1 270 ? 10.943  18.216 35.156  1.00 22.00 ? 258 VAL A CG2 1 
ATOM   1970 N  N   . GLY A 1 271 ? 13.019  15.348 33.834  1.00 26.21 ? 259 GLY A N   1 
ATOM   1971 C  CA  . GLY A 1 271 ? 14.451  15.010 33.734  1.00 26.91 ? 259 GLY A CA  1 
ATOM   1972 C  C   . GLY A 1 271 ? 15.289  15.262 34.974  1.00 26.62 ? 259 GLY A C   1 
ATOM   1973 O  O   . GLY A 1 271 ? 16.518  15.213 34.916  1.00 27.22 ? 259 GLY A O   1 
ATOM   1974 N  N   . THR A 1 272 ? 14.648  15.507 36.112  1.00 26.93 ? 260 THR A N   1 
ATOM   1975 C  CA  . THR A 1 272 ? 15.397  15.760 37.367  1.00 27.59 ? 260 THR A CA  1 
ATOM   1976 C  C   . THR A 1 272 ? 16.142  14.533 37.841  1.00 27.71 ? 260 THR A C   1 
ATOM   1977 O  O   . THR A 1 272 ? 15.693  13.452 37.639  1.00 28.30 ? 260 THR A O   1 
ATOM   1978 C  CB  . THR A 1 272 ? 14.470  16.311 38.459  1.00 28.15 ? 260 THR A CB  1 
ATOM   1979 O  OG1 . THR A 1 272 ? 13.705  17.364 37.860  1.00 30.03 ? 260 THR A OG1 1 
ATOM   1980 C  CG2 . THR A 1 272 ? 15.269  16.844 39.639  1.00 27.28 ? 260 THR A CG2 1 
ATOM   1981 N  N   . GLY A 1 273 ? 17.313  14.713 38.421  1.00 27.96 ? 261 GLY A N   1 
ATOM   1982 C  CA  . GLY A 1 273 ? 18.164  13.600 38.760  1.00 30.38 ? 261 GLY A CA  1 
ATOM   1983 C  C   . GLY A 1 273 ? 17.683  12.857 39.989  1.00 29.86 ? 261 GLY A C   1 
ATOM   1984 O  O   . GLY A 1 273 ? 17.660  11.649 40.031  1.00 30.23 ? 261 GLY A O   1 
ATOM   1985 N  N   . LEU A 1 274 ? 17.314  13.604 41.001  1.00 30.56 ? 262 LEU A N   1 
ATOM   1986 C  CA  . LEU A 1 274 ? 16.863  13.031 42.254  1.00 30.70 ? 262 LEU A CA  1 
ATOM   1987 C  C   . LEU A 1 274 ? 15.695  13.812 42.864  1.00 29.47 ? 262 LEU A C   1 
ATOM   1988 O  O   . LEU A 1 274 ? 15.750  15.051 42.960  1.00 28.24 ? 262 LEU A O   1 
ATOM   1989 C  CB  . LEU A 1 274 ? 18.016  13.019 43.236  1.00 31.66 ? 262 LEU A CB  1 
ATOM   1990 C  CG  . LEU A 1 274 ? 17.892  12.127 44.473  1.00 36.63 ? 262 LEU A CG  1 
ATOM   1991 C  CD1 . LEU A 1 274 ? 17.698  10.645 43.989  1.00 42.73 ? 262 LEU A CD1 1 
ATOM   1992 C  CD2 . LEU A 1 274 ? 19.183  12.250 45.342  1.00 38.91 ? 262 LEU A CD2 1 
ATOM   1993 N  N   . VAL A 1 275 ? 14.672  13.083 43.308  1.00 29.27 ? 263 VAL A N   1 
ATOM   1994 C  CA  . VAL A 1 275 ? 13.527  13.667 43.947  1.00 29.58 ? 263 VAL A CA  1 
ATOM   1995 C  C   . VAL A 1 275 ? 13.228  12.989 45.273  1.00 30.60 ? 263 VAL A C   1 
ATOM   1996 O  O   . VAL A 1 275 ? 13.142  11.723 45.367  1.00 29.54 ? 263 VAL A O   1 
ATOM   1997 C  CB  . VAL A 1 275 ? 12.259  13.673 43.075  1.00 30.48 ? 263 VAL A CB  1 
ATOM   1998 C  CG1 . VAL A 1 275 ? 11.132  14.386 43.853  1.00 28.90 ? 263 VAL A CG1 1 
ATOM   1999 C  CG2 . VAL A 1 275 ? 12.552  14.395 41.751  1.00 30.61 ? 263 VAL A CG2 1 
ATOM   2000 N  N   . LYS A 1 276 ? 13.129  13.840 46.285  1.00 29.34 ? 264 LYS A N   1 
ATOM   2001 C  CA  . LYS A 1 276 ? 12.843  13.432 47.643  1.00 31.97 ? 264 LYS A CA  1 
ATOM   2002 C  C   . LYS A 1 276 ? 11.563  14.080 48.103  1.00 29.98 ? 264 LYS A C   1 
ATOM   2003 O  O   . LYS A 1 276 ? 11.429  15.275 47.965  1.00 30.44 ? 264 LYS A O   1 
ATOM   2004 C  CB  . LYS A 1 276 ? 13.905  13.981 48.588  1.00 32.76 ? 264 LYS A CB  1 
ATOM   2005 C  CG  . LYS A 1 276 ? 15.081  13.138 48.737  1.00 40.21 ? 264 LYS A CG  1 
ATOM   2006 C  CD  . LYS A 1 276 ? 16.033  13.718 49.819  1.00 47.24 ? 264 LYS A CD  1 
ATOM   2007 C  CE  . LYS A 1 276 ? 16.406  12.682 50.898  1.00 51.44 ? 264 LYS A CE  1 
ATOM   2008 N  NZ  . LYS A 1 276 ? 17.894  12.672 51.243  1.00 56.86 ? 264 LYS A NZ  1 
ATOM   2009 N  N   . LEU A 1 277 ? 10.685  13.303 48.706  1.00 29.41 ? 265 LEU A N   1 
ATOM   2010 C  CA  . LEU A 1 277 ? 9.458   13.810 49.333  1.00 28.67 ? 265 LEU A CA  1 
ATOM   2011 C  C   . LEU A 1 277 ? 9.609   13.746 50.837  1.00 28.92 ? 265 LEU A C   1 
ATOM   2012 O  O   . LEU A 1 277 ? 10.239  12.810 51.348  1.00 30.73 ? 265 LEU A O   1 
ATOM   2013 C  CB  . LEU A 1 277 ? 8.259   13.009 48.924  1.00 27.20 ? 265 LEU A CB  1 
ATOM   2014 C  CG  . LEU A 1 277 ? 8.182   12.494 47.500  1.00 30.07 ? 265 LEU A CG  1 
ATOM   2015 C  CD1 . LEU A 1 277 ? 7.014   11.591 47.436  1.00 26.89 ? 265 LEU A CD1 1 
ATOM   2016 C  CD2 . LEU A 1 277 ? 8.070   13.601 46.483  1.00 26.14 ? 265 LEU A CD2 1 
ATOM   2017 N  N   . ALA A 1 278 ? 9.068   14.741 51.524  1.00 27.24 ? 266 ALA A N   1 
ATOM   2018 C  CA  . ALA A 1 278 ? 8.906   14.686 52.971  1.00 28.92 ? 266 ALA A CA  1 
ATOM   2019 C  C   . ALA A 1 278 ? 7.411   14.701 53.223  1.00 26.64 ? 266 ALA A C   1 
ATOM   2020 O  O   . ALA A 1 278 ? 6.756   15.657 52.868  1.00 28.58 ? 266 ALA A O   1 
ATOM   2021 C  CB  . ALA A 1 278 ? 9.592   15.846 53.667  1.00 27.67 ? 266 ALA A CB  1 
ATOM   2022 N  N   . VAL A 1 279 ? 6.889   13.609 53.756  1.00 26.25 ? 267 VAL A N   1 
ATOM   2023 C  CA  . VAL A 1 279 ? 5.460   13.371 53.860  1.00 26.83 ? 267 VAL A CA  1 
ATOM   2024 C  C   . VAL A 1 279 ? 5.182   12.721 55.230  1.00 28.44 ? 267 VAL A C   1 
ATOM   2025 O  O   . VAL A 1 279 ? 5.963   11.850 55.677  1.00 27.78 ? 267 VAL A O   1 
ATOM   2026 C  CB  . VAL A 1 279 ? 4.971   12.432 52.752  1.00 26.58 ? 267 VAL A CB  1 
ATOM   2027 C  CG1 . VAL A 1 279 ? 3.443   12.160 52.874  1.00 26.95 ? 267 VAL A CG1 1 
ATOM   2028 C  CG2 . VAL A 1 279 ? 5.279   13.009 51.368  1.00 25.27 ? 267 VAL A CG2 1 
ATOM   2029 N  N   . PRO A 1 280 ? 4.082   13.124 55.908  1.00 29.73 ? 268 PRO A N   1 
ATOM   2030 C  CA  . PRO A 1 280 ? 3.783   12.472 57.206  1.00 31.24 ? 268 PRO A CA  1 
ATOM   2031 C  C   . PRO A 1 280 ? 3.625   10.958 57.088  1.00 31.65 ? 268 PRO A C   1 
ATOM   2032 O  O   . PRO A 1 280 ? 2.957   10.469 56.182  1.00 30.17 ? 268 PRO A O   1 
ATOM   2033 C  CB  . PRO A 1 280 ? 2.475   13.124 57.624  1.00 32.29 ? 268 PRO A CB  1 
ATOM   2034 C  CG  . PRO A 1 280 ? 2.540   14.548 56.934  1.00 32.29 ? 268 PRO A CG  1 
ATOM   2035 C  CD  . PRO A 1 280 ? 3.151   14.239 55.612  1.00 30.15 ? 268 PRO A CD  1 
ATOM   2036 N  N   . PHE A 1 281 ? 4.276   10.239 57.981  1.00 32.26 ? 269 PHE A N   1 
ATOM   2037 C  CA  . PHE A 1 281 ? 4.126   8.790  58.115  1.00 32.73 ? 269 PHE A CA  1 
ATOM   2038 C  C   . PHE A 1 281 ? 2.719   8.478  58.537  1.00 33.34 ? 269 PHE A C   1 
ATOM   2039 O  O   . PHE A 1 281 ? 2.216   9.144  59.456  1.00 33.62 ? 269 PHE A O   1 
ATOM   2040 C  CB  . PHE A 1 281 ? 5.055   8.268  59.225  1.00 33.24 ? 269 PHE A CB  1 
ATOM   2041 C  CG  . PHE A 1 281 ? 4.992   6.779  59.420  1.00 34.67 ? 269 PHE A CG  1 
ATOM   2042 C  CD1 . PHE A 1 281 ? 5.573   5.922  58.502  1.00 35.19 ? 269 PHE A CD1 1 
ATOM   2043 C  CD2 . PHE A 1 281 ? 4.332   6.242  60.507  1.00 37.83 ? 269 PHE A CD2 1 
ATOM   2044 C  CE1 . PHE A 1 281 ? 5.494   4.519  58.679  1.00 37.83 ? 269 PHE A CE1 1 
ATOM   2045 C  CE2 . PHE A 1 281 ? 4.264   4.861  60.714  1.00 39.94 ? 269 PHE A CE2 1 
ATOM   2046 C  CZ  . PHE A 1 281 ? 4.843   3.995  59.821  1.00 38.55 ? 269 PHE A CZ  1 
ATOM   2047 N  N   . PRO A 1 282 ? 2.116   7.402  57.985  1.00 33.44 ? 270 PRO A N   1 
ATOM   2048 C  CA  . PRO A 1 282 ? 2.594   6.415  57.002  1.00 33.36 ? 270 PRO A CA  1 
ATOM   2049 C  C   . PRO A 1 282 ? 2.210   6.784  55.596  1.00 32.31 ? 270 PRO A C   1 
ATOM   2050 O  O   . PRO A 1 282 ? 2.412   5.988  54.680  1.00 32.02 ? 270 PRO A O   1 
ATOM   2051 C  CB  . PRO A 1 282 ? 1.866   5.130  57.417  1.00 34.75 ? 270 PRO A CB  1 
ATOM   2052 C  CG  . PRO A 1 282 ? 0.521   5.599  57.958  1.00 35.75 ? 270 PRO A CG  1 
ATOM   2053 C  CD  . PRO A 1 282 ? 0.855   6.964  58.629  1.00 34.51 ? 270 PRO A CD  1 
ATOM   2054 N  N   . GLN A 1 283 ? 1.710   8.011  55.401  1.00 31.91 ? 271 GLN A N   1 
ATOM   2055 C  CA  . GLN A 1 283 ? 1.248   8.432  54.079  1.00 30.79 ? 271 GLN A CA  1 
ATOM   2056 C  C   . GLN A 1 283 ? 2.418   8.510  53.127  1.00 29.93 ? 271 GLN A C   1 
ATOM   2057 O  O   . GLN A 1 283 ? 2.213   8.390  51.935  1.00 30.05 ? 271 GLN A O   1 
ATOM   2058 C  CB  . GLN A 1 283 ? 0.499   9.762  54.095  1.00 31.31 ? 271 GLN A CB  1 
ATOM   2059 C  CG  . GLN A 1 283 ? -0.890  9.693  54.639  1.00 29.89 ? 271 GLN A CG  1 
ATOM   2060 C  CD  . GLN A 1 283 ? -0.948  9.524  56.162  1.00 34.10 ? 271 GLN A CD  1 
ATOM   2061 O  OE1 . GLN A 1 283 ? -0.080  10.022 56.889  1.00 33.69 ? 271 GLN A OE1 1 
ATOM   2062 N  NE2 . GLN A 1 283 ? -1.963  8.788  56.649  1.00 31.15 ? 271 GLN A NE2 1 
ATOM   2063 N  N   . ASN A 1 284 ? 3.639   8.671  53.632  1.00 29.53 ? 272 ASN A N   1 
ATOM   2064 C  CA  . ASN A 1 284 ? 4.811   8.625  52.762  1.00 29.08 ? 272 ASN A CA  1 
ATOM   2065 C  C   . ASN A 1 284 ? 4.963   7.323  51.958  1.00 28.17 ? 272 ASN A C   1 
ATOM   2066 O  O   . ASN A 1 284 ? 5.500   7.355  50.853  1.00 27.05 ? 272 ASN A O   1 
ATOM   2067 C  CB  . ASN A 1 284 ? 6.139   8.844  53.521  1.00 28.74 ? 272 ASN A CB  1 
ATOM   2068 C  CG  . ASN A 1 284 ? 6.441   7.728  54.447  1.00 28.51 ? 272 ASN A CG  1 
ATOM   2069 O  OD1 . ASN A 1 284 ? 5.660   7.480  55.357  1.00 28.23 ? 272 ASN A OD1 1 
ATOM   2070 N  ND2 . ASN A 1 284 ? 7.532   7.035  54.234  1.00 26.82 ? 272 ASN A ND2 1 
ATOM   2071 N  N   . LEU A 1 285 ? 4.472   6.222  52.503  1.00 29.17 ? 273 LEU A N   1 
ATOM   2072 C  CA  . LEU A 1 285 ? 4.588   4.928  51.845  1.00 31.17 ? 273 LEU A CA  1 
ATOM   2073 C  C   . LEU A 1 285 ? 3.715   4.763  50.602  1.00 31.25 ? 273 LEU A C   1 
ATOM   2074 O  O   . LEU A 1 285 ? 4.004   3.922  49.754  1.00 31.74 ? 273 LEU A O   1 
ATOM   2075 C  CB  . LEU A 1 285 ? 4.303   3.807  52.847  1.00 32.90 ? 273 LEU A CB  1 
ATOM   2076 C  CG  . LEU A 1 285 ? 5.373   3.735  53.909  1.00 35.39 ? 273 LEU A CG  1 
ATOM   2077 C  CD1 . LEU A 1 285 ? 4.911   2.773  54.987  1.00 40.44 ? 273 LEU A CD1 1 
ATOM   2078 C  CD2 . LEU A 1 285 ? 6.728   3.341  53.306  1.00 38.74 ? 273 LEU A CD2 1 
ATOM   2079 N  N   . ILE A 1 286 ? 2.695   5.608  50.472  1.00 31.42 ? 274 ILE A N   1 
ATOM   2080 C  CA  . ILE A 1 286 ? 1.850   5.657  49.314  1.00 32.12 ? 274 ILE A CA  1 
ATOM   2081 C  C   . ILE A 1 286 ? 2.686   5.947  48.076  1.00 31.42 ? 274 ILE A C   1 
ATOM   2082 O  O   . ILE A 1 286 ? 2.458   5.294  47.035  1.00 30.44 ? 274 ILE A O   1 
ATOM   2083 C  CB  . ILE A 1 286 ? 0.706   6.749  49.495  1.00 33.45 ? 274 ILE A CB  1 
ATOM   2084 C  CG1 . ILE A 1 286 ? -0.265  6.259  50.546  1.00 35.86 ? 274 ILE A CG1 1 
ATOM   2085 C  CG2 . ILE A 1 286 ? -0.028  7.117  48.200  1.00 33.83 ? 274 ILE A CG2 1 
ATOM   2086 C  CD1 . ILE A 1 286 ? -0.702  4.930  50.352  1.00 39.82 ? 274 ILE A CD1 1 
ATOM   2087 N  N   . ALA A 1 287 ? 3.652   6.878  48.187  1.00 29.29 ? 275 ALA A N   1 
ATOM   2088 C  CA  . ALA A 1 287 ? 4.410   7.301  47.013  1.00 28.23 ? 275 ALA A CA  1 
ATOM   2089 C  C   . ALA A 1 287 ? 5.262   6.212  46.401  1.00 28.62 ? 275 ALA A C   1 
ATOM   2090 O  O   . ALA A 1 287 ? 5.323   6.075  45.175  1.00 28.64 ? 275 ALA A O   1 
ATOM   2091 C  CB  . ALA A 1 287 ? 5.296   8.527  47.305  1.00 27.39 ? 275 ALA A CB  1 
ATOM   2092 N  N   . THR A 1 288 ? 5.967   5.470  47.237  1.00 28.90 ? 276 THR A N   1 
ATOM   2093 C  CA  . THR A 1 288 ? 6.862   4.467  46.750  1.00 29.59 ? 276 THR A CA  1 
ATOM   2094 C  C   . THR A 1 288 ? 6.128   3.188  46.354  1.00 30.60 ? 276 THR A C   1 
ATOM   2095 O  O   . THR A 1 288 ? 6.644   2.435  45.560  1.00 28.96 ? 276 THR A O   1 
ATOM   2096 C  CB  . THR A 1 288 ? 7.988   4.157  47.803  1.00 30.15 ? 276 THR A CB  1 
ATOM   2097 O  OG1 . THR A 1 288 ? 7.415   3.939  49.099  1.00 32.21 ? 276 THR A OG1 1 
ATOM   2098 C  CG2 . THR A 1 288 ? 9.012   5.333  47.881  1.00 28.34 ? 276 THR A CG2 1 
ATOM   2099 N  N   . SER A 1 289 ? 4.946   2.916  46.914  1.00 31.06 ? 277 SER A N   1 
ATOM   2100 C  CA  . SER A 1 289 ? 4.135   1.830  46.395  1.00 33.20 ? 277 SER A CA  1 
ATOM   2101 C  C   . SER A 1 289 ? 3.752   2.101  44.943  1.00 33.17 ? 277 SER A C   1 
ATOM   2102 O  O   . SER A 1 289 ? 3.666   1.183  44.166  1.00 33.98 ? 277 SER A O   1 
ATOM   2103 C  CB  . SER A 1 289 ? 2.838   1.588  47.205  1.00 33.92 ? 277 SER A CB  1 
ATOM   2104 O  OG  . SER A 1 289 ? 1.982   2.692  47.014  1.00 38.09 ? 277 SER A OG  1 
ATOM   2105 N  N   . ARG A 1 290 ? 3.568   3.343  44.577  1.00 33.11 ? 278 ARG A N   1 
ATOM   2106 C  CA  . ARG A 1 290 ? 3.139   3.693  43.196  1.00 35.61 ? 278 ARG A CA  1 
ATOM   2107 C  C   . ARG A 1 290 ? 4.409   3.882  42.287  1.00 34.47 ? 278 ARG A C   1 
ATOM   2108 O  O   . ARG A 1 290 ? 4.507   3.276  41.233  1.00 33.12 ? 278 ARG A O   1 
ATOM   2109 C  CB  . ARG A 1 290 ? 2.278   4.972  43.315  1.00 36.48 ? 278 ARG A CB  1 
ATOM   2110 C  CG  . ARG A 1 290 ? 1.517   5.491  42.122  1.00 42.76 ? 278 ARG A CG  1 
ATOM   2111 C  CD  . ARG A 1 290 ? 0.494   4.482  41.589  1.00 50.13 ? 278 ARG A CD  1 
ATOM   2112 N  NE  . ARG A 1 290 ? 1.009   4.010  40.312  1.00 54.25 ? 278 ARG A NE  1 
ATOM   2113 C  CZ  . ARG A 1 290 ? 0.689   4.524  39.131  1.00 59.67 ? 278 ARG A CZ  1 
ATOM   2114 N  NH1 . ARG A 1 290 ? -0.221  5.518  39.031  1.00 62.00 ? 278 ARG A NH1 1 
ATOM   2115 N  NH2 . ARG A 1 290 ? 1.265   4.018  38.027  1.00 62.57 ? 278 ARG A NH2 1 
ATOM   2116 N  N   . PHE A 1 291 ? 5.401   4.628  42.770  1.00 32.07 ? 279 PHE A N   1 
ATOM   2117 C  CA  . PHE A 1 291 ? 6.603   4.920  42.009  1.00 31.91 ? 279 PHE A CA  1 
ATOM   2118 C  C   . PHE A 1 291 ? 7.862   4.760  42.889  1.00 30.41 ? 279 PHE A C   1 
ATOM   2119 O  O   . PHE A 1 291 ? 8.254   5.699  43.571  1.00 29.22 ? 279 PHE A O   1 
ATOM   2120 C  CB  . PHE A 1 291 ? 6.542   6.349  41.494  1.00 31.65 ? 279 PHE A CB  1 
ATOM   2121 C  CG  . PHE A 1 291 ? 5.439   6.578  40.493  1.00 34.93 ? 279 PHE A CG  1 
ATOM   2122 C  CD1 . PHE A 1 291 ? 5.420   5.884  39.301  1.00 42.15 ? 279 PHE A CD1 1 
ATOM   2123 C  CD2 . PHE A 1 291 ? 4.434   7.444  40.759  1.00 38.75 ? 279 PHE A CD2 1 
ATOM   2124 C  CE1 . PHE A 1 291 ? 4.388   6.072  38.407  1.00 42.77 ? 279 PHE A CE1 1 
ATOM   2125 C  CE2 . PHE A 1 291 ? 3.424   7.647  39.852  1.00 41.50 ? 279 PHE A CE2 1 
ATOM   2126 C  CZ  . PHE A 1 291 ? 3.398   6.950  38.699  1.00 39.91 ? 279 PHE A CZ  1 
ATOM   2127 N  N   . PRO A 1 292 ? 8.450   3.570  42.882  1.00 29.90 ? 280 PRO A N   1 
ATOM   2128 C  CA  . PRO A 1 292 ? 9.546   3.200  43.748  1.00 30.85 ? 280 PRO A CA  1 
ATOM   2129 C  C   . PRO A 1 292 ? 10.851  3.915  43.453  1.00 31.58 ? 280 PRO A C   1 
ATOM   2130 O  O   . PRO A 1 292 ? 11.748  3.817  44.281  1.00 32.18 ? 280 PRO A O   1 
ATOM   2131 C  CB  . PRO A 1 292 ? 9.673   1.676  43.570  1.00 31.06 ? 280 PRO A CB  1 
ATOM   2132 C  CG  . PRO A 1 292 ? 8.896   1.348  42.354  1.00 31.36 ? 280 PRO A CG  1 
ATOM   2133 C  CD  . PRO A 1 292 ? 8.013   2.458  41.999  1.00 31.21 ? 280 PRO A CD  1 
ATOM   2134 N  N   . GLU A 1 293 ? 10.914  4.649  42.326  1.00 31.84 ? 281 GLU A N   1 
ATOM   2135 C  CA  . GLU A 1 293 ? 12.019  5.568  41.966  1.00 33.09 ? 281 GLU A CA  1 
ATOM   2136 C  C   . GLU A 1 293 ? 12.056  6.798  42.872  1.00 30.96 ? 281 GLU A C   1 
ATOM   2137 O  O   . GLU A 1 293 ? 13.051  7.492  42.933  1.00 30.72 ? 281 GLU A O   1 
ATOM   2138 C  CB  . GLU A 1 293 ? 11.796  6.175  40.555  1.00 33.07 ? 281 GLU A CB  1 
ATOM   2139 C  CG  . GLU A 1 293 ? 11.694  5.260  39.488  1.00 38.41 ? 281 GLU A CG  1 
ATOM   2140 C  CD  . GLU A 1 293 ? 10.272  4.793  39.129  1.00 38.61 ? 281 GLU A CD  1 
ATOM   2141 O  OE1 . GLU A 1 293 ? 10.078  4.447  37.961  1.00 44.82 ? 281 GLU A OE1 1 
ATOM   2142 O  OE2 . GLU A 1 293 ? 9.407   4.696  39.961  1.00 37.86 ? 281 GLU A OE2 1 
ATOM   2143 N  N   . LEU A 1 294 ? 10.933  7.130  43.477  1.00 29.90 ? 282 LEU A N   1 
ATOM   2144 C  CA  . LEU A 1 294 ? 10.899  8.264  44.432  1.00 29.05 ? 282 LEU A CA  1 
ATOM   2145 C  C   . LEU A 1 294 ? 11.524  7.886  45.776  1.00 29.26 ? 282 LEU A C   1 
ATOM   2146 O  O   . LEU A 1 294 ? 11.526  6.727  46.186  1.00 30.11 ? 282 LEU A O   1 
ATOM   2147 C  CB  . LEU A 1 294 ? 9.451   8.726  44.654  1.00 27.70 ? 282 LEU A CB  1 
ATOM   2148 C  CG  . LEU A 1 294 ? 8.758   9.380  43.470  1.00 27.91 ? 282 LEU A CG  1 
ATOM   2149 C  CD1 . LEU A 1 294 ? 7.277   9.476  43.777  1.00 23.89 ? 282 LEU A CD1 1 
ATOM   2150 C  CD2 . LEU A 1 294 ? 9.311   10.772 43.131  1.00 24.01 ? 282 LEU A CD2 1 
ATOM   2151 N  N   . ILE A 1 295 ? 12.092  8.874  46.447  1.00 28.90 ? 283 ILE A N   1 
ATOM   2152 C  CA  . ILE A 1 295 ? 12.480  8.754  47.831  1.00 28.91 ? 283 ILE A CA  1 
ATOM   2153 C  C   . ILE A 1 295 ? 11.359  9.440  48.609  1.00 28.87 ? 283 ILE A C   1 
ATOM   2154 O  O   . ILE A 1 295 ? 11.009  10.588 48.307  1.00 27.38 ? 283 ILE A O   1 
ATOM   2155 C  CB  . ILE A 1 295 ? 13.832  9.431  48.144  1.00 29.43 ? 283 ILE A CB  1 
ATOM   2156 C  CG1 . ILE A 1 295 ? 14.958  8.676  47.408  1.00 31.29 ? 283 ILE A CG1 1 
ATOM   2157 C  CG2 . ILE A 1 295 ? 14.086  9.398  49.682  1.00 28.40 ? 283 ILE A CG2 1 
ATOM   2158 C  CD1 . ILE A 1 295 ? 16.333  9.377  47.295  1.00 28.83 ? 283 ILE A CD1 1 
ATOM   2159 N  N   . SER A 1 296 ? 10.760  8.732  49.554  1.00 27.89 ? 284 SER A N   1 
ATOM   2160 C  CA  . SER A 1 296 ? 9.651   9.307  50.297  1.00 29.34 ? 284 SER A CA  1 
ATOM   2161 C  C   . SER A 1 296 ? 9.947   9.144  51.790  1.00 30.14 ? 284 SER A C   1 
ATOM   2162 O  O   . SER A 1 296 ? 9.780   8.080  52.344  1.00 30.10 ? 284 SER A O   1 
ATOM   2163 C  CB  . SER A 1 296 ? 8.323   8.669  49.888  1.00 29.08 ? 284 SER A CB  1 
ATOM   2164 O  OG  . SER A 1 296 ? 7.267   9.452  50.386  1.00 30.19 ? 284 SER A OG  1 
ATOM   2165 N  N   . VAL A 1 297 ? 10.472  10.216 52.382  1.00 29.72 ? 285 VAL A N   1 
ATOM   2166 C  CA  . VAL A 1 297 ? 10.970  10.237 53.744  1.00 30.59 ? 285 VAL A CA  1 
ATOM   2167 C  C   . VAL A 1 297 ? 9.766   10.330 54.696  1.00 29.98 ? 285 VAL A C   1 
ATOM   2168 O  O   . VAL A 1 297 ? 8.927   11.194 54.535  1.00 28.82 ? 285 VAL A O   1 
ATOM   2169 C  CB  . VAL A 1 297 ? 11.877  11.497 53.933  1.00 31.62 ? 285 VAL A CB  1 
ATOM   2170 C  CG1 . VAL A 1 297 ? 12.257  11.655 55.414  1.00 35.10 ? 285 VAL A CG1 1 
ATOM   2171 C  CG2 . VAL A 1 297 ? 13.152  11.415 52.996  1.00 32.48 ? 285 VAL A CG2 1 
ATOM   2172 N  N   . PRO A 1 298 ? 9.674   9.437  55.686  1.00 30.72 ? 286 PRO A N   1 
ATOM   2173 C  CA  . PRO A 1 298 ? 8.572   9.534  56.638  1.00 31.23 ? 286 PRO A CA  1 
ATOM   2174 C  C   . PRO A 1 298 ? 8.788   10.674 57.653  1.00 31.96 ? 286 PRO A C   1 
ATOM   2175 O  O   . PRO A 1 298 ? 9.819   10.734 58.283  1.00 32.23 ? 286 PRO A O   1 
ATOM   2176 C  CB  . PRO A 1 298 ? 8.660   8.211  57.375  1.00 31.90 ? 286 PRO A CB  1 
ATOM   2177 C  CG  . PRO A 1 298 ? 10.115  7.892  57.363  1.00 32.62 ? 286 PRO A CG  1 
ATOM   2178 C  CD  . PRO A 1 298 ? 10.536  8.288  55.979  1.00 31.65 ? 286 PRO A CD  1 
ATOM   2179 N  N   . ILE A 1 299 ? 7.809   11.528 57.856  1.00 31.93 ? 287 ILE A N   1 
ATOM   2180 C  CA  . ILE A 1 299 ? 7.966   12.597 58.849  1.00 32.39 ? 287 ILE A CA  1 
ATOM   2181 C  C   . ILE A 1 299 ? 7.017   12.261 59.983  1.00 34.02 ? 287 ILE A C   1 
ATOM   2182 O  O   . ILE A 1 299 ? 5.815   12.025 59.775  1.00 32.67 ? 287 ILE A O   1 
ATOM   2183 C  CB  . ILE A 1 299 ? 7.628   13.954 58.253  1.00 31.53 ? 287 ILE A CB  1 
ATOM   2184 C  CG1 . ILE A 1 299 ? 8.533   14.237 57.045  1.00 30.36 ? 287 ILE A CG1 1 
ATOM   2185 C  CG2 . ILE A 1 299 ? 7.658   15.051 59.357  1.00 28.86 ? 287 ILE A CG2 1 
ATOM   2186 C  CD1 . ILE A 1 299 ? 9.988   14.574 57.402  1.00 27.36 ? 287 ILE A CD1 1 
ATOM   2187 N  N   . ASP A 1 300 ? 7.549   12.224 61.190  1.00 36.79 ? 288 ASP A N   1 
ATOM   2188 C  CA  . ASP A 1 300 ? 6.737   11.821 62.323  1.00 39.67 ? 288 ASP A CA  1 
ATOM   2189 C  C   . ASP A 1 300 ? 5.980   13.050 62.796  1.00 39.39 ? 288 ASP A C   1 
ATOM   2190 O  O   . ASP A 1 300 ? 6.563   14.076 63.085  1.00 39.85 ? 288 ASP A O   1 
ATOM   2191 C  CB  . ASP A 1 300 ? 7.603   11.145 63.390  1.00 43.06 ? 288 ASP A CB  1 
ATOM   2192 C  CG  . ASP A 1 300 ? 8.120   9.717  62.917  1.00 49.14 ? 288 ASP A CG  1 
ATOM   2193 O  OD1 . ASP A 1 300 ? 7.347   8.911  62.274  1.00 52.25 ? 288 ASP A OD1 1 
ATOM   2194 O  OD2 . ASP A 1 300 ? 9.313   9.402  63.201  1.00 59.82 ? 288 ASP A OD2 1 
ATOM   2195 N  N   . THR A 1 301 ? 4.662   12.976 62.799  1.00 38.86 ? 289 THR A N   1 
ATOM   2196 C  CA  . THR A 1 301 ? 3.856   14.131 63.160  1.00 39.46 ? 289 THR A CA  1 
ATOM   2197 C  C   . THR A 1 301 ? 2.919   13.710 64.263  1.00 41.82 ? 289 THR A C   1 
ATOM   2198 O  O   . THR A 1 301 ? 2.633   12.531 64.416  1.00 41.99 ? 289 THR A O   1 
ATOM   2199 C  CB  . THR A 1 301 ? 2.977   14.644 61.985  1.00 38.34 ? 289 THR A CB  1 
ATOM   2200 O  OG1 . THR A 1 301 ? 1.976   13.645 61.670  1.00 35.73 ? 289 THR A OG1 1 
ATOM   2201 C  CG2 . THR A 1 301 ? 3.852   15.020 60.748  1.00 34.72 ? 289 THR A CG2 1 
ATOM   2202 N  N   . GLU A 1 302 ? 2.383   14.685 64.978  1.00 44.52 ? 290 GLU A N   1 
ATOM   2203 C  CA  . GLU A 1 302 ? 1.499   14.394 66.109  1.00 47.71 ? 290 GLU A CA  1 
ATOM   2204 C  C   . GLU A 1 302 ? 0.129   13.911 65.655  1.00 46.84 ? 290 GLU A C   1 
ATOM   2205 O  O   . GLU A 1 302 ? -0.387  12.954 66.199  1.00 48.21 ? 290 GLU A O   1 
ATOM   2206 C  CB  . GLU A 1 302 ? 1.355   15.641 66.989  1.00 49.65 ? 290 GLU A CB  1 
ATOM   2207 C  CG  . GLU A 1 302 ? 1.019   15.321 68.482  1.00 57.35 ? 290 GLU A CG  1 
ATOM   2208 C  CD  . GLU A 1 302 ? 2.218   14.705 69.284  1.00 63.20 ? 290 GLU A CD  1 
ATOM   2209 O  OE1 . GLU A 1 302 ? 2.183   14.776 70.530  1.00 68.34 ? 290 GLU A OE1 1 
ATOM   2210 O  OE2 . GLU A 1 302 ? 3.183   14.153 68.679  1.00 65.46 ? 290 GLU A OE2 1 
ATOM   2211 N  N   . LYS A 1 303 ? -0.448  14.589 64.668  1.00 44.61 ? 291 LYS A N   1 
ATOM   2212 C  CA  . LYS A 1 303 ? -1.826  14.358 64.214  1.00 44.09 ? 291 LYS A CA  1 
ATOM   2213 C  C   . LYS A 1 303 ? -1.962  14.280 62.691  1.00 40.92 ? 291 LYS A C   1 
ATOM   2214 O  O   . LYS A 1 303 ? -3.044  14.502 62.175  1.00 40.92 ? 291 LYS A O   1 
ATOM   2215 C  CB  . LYS A 1 303 ? -2.710  15.532 64.652  1.00 45.34 ? 291 LYS A CB  1 
ATOM   2216 C  CG  . LYS A 1 303 ? -2.712  15.799 66.114  1.00 51.18 ? 291 LYS A CG  1 
ATOM   2217 C  CD  . LYS A 1 303 ? -3.276  17.216 66.395  1.00 57.91 ? 291 LYS A CD  1 
ATOM   2218 C  CE  . LYS A 1 303 ? -3.069  17.676 67.857  1.00 61.44 ? 291 LYS A CE  1 
ATOM   2219 N  NZ  . LYS A 1 303 ? -4.321  17.625 68.652  1.00 64.99 ? 291 LYS A NZ  1 
ATOM   2220 N  N   . GLY A 1 304 ? -0.891  13.990 61.969  1.00 37.67 ? 292 GLY A N   1 
ATOM   2221 C  CA  . GLY A 1 304 ? -0.987  13.795 60.512  1.00 36.12 ? 292 GLY A CA  1 
ATOM   2222 C  C   . GLY A 1 304 ? -0.720  15.017 59.670  1.00 34.54 ? 292 GLY A C   1 
ATOM   2223 O  O   . GLY A 1 304 ? -0.894  14.961 58.429  1.00 33.45 ? 292 GLY A O   1 
ATOM   2224 N  N   . PHE A 1 305 ? -0.296  16.113 60.313  1.00 34.38 ? 293 PHE A N   1 
ATOM   2225 C  CA  . PHE A 1 305 ? 0.051   17.342 59.596  1.00 34.28 ? 293 PHE A CA  1 
ATOM   2226 C  C   . PHE A 1 305 ? 1.394   17.882 60.035  1.00 33.88 ? 293 PHE A C   1 
ATOM   2227 O  O   . PHE A 1 305 ? 1.757   17.772 61.197  1.00 31.82 ? 293 PHE A O   1 
ATOM   2228 C  CB  . PHE A 1 305 ? -0.975  18.454 59.854  1.00 36.37 ? 293 PHE A CB  1 
ATOM   2229 C  CG  . PHE A 1 305 ? -2.353  18.102 59.439  1.00 38.31 ? 293 PHE A CG  1 
ATOM   2230 C  CD1 . PHE A 1 305 ? -2.788  18.412 58.154  1.00 36.31 ? 293 PHE A CD1 1 
ATOM   2231 C  CD2 . PHE A 1 305 ? -3.217  17.427 60.318  1.00 39.58 ? 293 PHE A CD2 1 
ATOM   2232 C  CE1 . PHE A 1 305 ? -4.050  18.077 57.743  1.00 36.78 ? 293 PHE A CE1 1 
ATOM   2233 C  CE2 . PHE A 1 305 ? -4.514  17.065 59.909  1.00 40.40 ? 293 PHE A CE2 1 
ATOM   2234 C  CZ  . PHE A 1 305 ? -4.938  17.394 58.645  1.00 39.34 ? 293 PHE A CZ  1 
ATOM   2235 N  N   . PHE A 1 306 ? 2.109   18.499 59.084  1.00 32.17 ? 294 PHE A N   1 
ATOM   2236 C  CA  . PHE A 1 306 ? 3.318   19.226 59.422  1.00 32.10 ? 294 PHE A CA  1 
ATOM   2237 C  C   . PHE A 1 306 ? 3.021   20.288 60.466  1.00 33.31 ? 294 PHE A C   1 
ATOM   2238 O  O   . PHE A 1 306 ? 1.970   20.893 60.453  1.00 33.09 ? 294 PHE A O   1 
ATOM   2239 C  CB  . PHE A 1 306 ? 3.951   19.905 58.205  1.00 30.25 ? 294 PHE A CB  1 
ATOM   2240 C  CG  . PHE A 1 306 ? 4.697   18.976 57.313  1.00 30.02 ? 294 PHE A CG  1 
ATOM   2241 C  CD1 . PHE A 1 306 ? 6.013   18.652 57.580  1.00 31.60 ? 294 PHE A CD1 1 
ATOM   2242 C  CD2 . PHE A 1 306 ? 4.093   18.417 56.187  1.00 29.39 ? 294 PHE A CD2 1 
ATOM   2243 C  CE1 . PHE A 1 306 ? 6.716   17.815 56.737  1.00 30.54 ? 294 PHE A CE1 1 
ATOM   2244 C  CE2 . PHE A 1 306 ? 4.811   17.571 55.363  1.00 28.13 ? 294 PHE A CE2 1 
ATOM   2245 C  CZ  . PHE A 1 306 ? 6.110   17.267 55.651  1.00 28.01 ? 294 PHE A CZ  1 
ATOM   2246 N  N   . SER A 1 307 ? 3.979   20.497 61.363  1.00 34.74 ? 295 SER A N   1 
ATOM   2247 C  CA  . SER A 1 307 ? 3.918   21.563 62.369  1.00 35.70 ? 295 SER A CA  1 
ATOM   2248 C  C   . SER A 1 307 ? 5.342   22.039 62.632  1.00 36.46 ? 295 SER A C   1 
ATOM   2249 O  O   . SER A 1 307 ? 6.322   21.513 62.059  1.00 35.67 ? 295 SER A O   1 
ATOM   2250 C  CB  . SER A 1 307 ? 3.301   21.038 63.682  1.00 37.51 ? 295 SER A CB  1 
ATOM   2251 O  OG  . SER A 1 307 ? 4.206   20.181 64.354  1.00 35.57 ? 295 SER A OG  1 
ATOM   2252 N  N   . LEU A 1 308 ? 5.475   23.023 63.513  1.00 36.93 ? 296 LEU A N   1 
ATOM   2253 C  CA  . LEU A 1 308 ? 6.793   23.491 63.908  1.00 38.22 ? 296 LEU A CA  1 
ATOM   2254 C  C   . LEU A 1 308 ? 7.717   22.398 64.417  1.00 38.77 ? 296 LEU A C   1 
ATOM   2255 O  O   . LEU A 1 308 ? 8.929   22.546 64.311  1.00 38.74 ? 296 LEU A O   1 
ATOM   2256 C  CB  . LEU A 1 308 ? 6.744   24.598 64.969  1.00 39.40 ? 296 LEU A CB  1 
ATOM   2257 C  CG  . LEU A 1 308 ? 6.501   26.005 64.420  1.00 40.87 ? 296 LEU A CG  1 
ATOM   2258 C  CD1 . LEU A 1 308 ? 6.305   26.967 65.683  1.00 39.17 ? 296 LEU A CD1 1 
ATOM   2259 C  CD2 . LEU A 1 308 ? 7.605   26.510 63.437  1.00 42.12 ? 296 LEU A CD2 1 
ATOM   2260 N  N   . GLN A 1 309 ? 7.163   21.322 64.956  1.00 38.81 ? 297 GLN A N   1 
ATOM   2261 C  CA  . GLN A 1 309 ? 7.982   20.224 65.429  1.00 40.71 ? 297 GLN A CA  1 
ATOM   2262 C  C   . GLN A 1 309 ? 8.814   19.594 64.275  1.00 39.49 ? 297 GLN A C   1 
ATOM   2263 O  O   . GLN A 1 309 ? 9.832   18.938 64.496  1.00 39.78 ? 297 GLN A O   1 
ATOM   2264 C  CB  . GLN A 1 309 ? 7.080   19.224 66.171  1.00 42.61 ? 297 GLN A CB  1 
ATOM   2265 C  CG  . GLN A 1 309 ? 7.328   17.762 65.865  1.00 48.26 ? 297 GLN A CG  1 
ATOM   2266 C  CD  . GLN A 1 309 ? 6.285   16.780 66.473  1.00 54.87 ? 297 GLN A CD  1 
ATOM   2267 O  OE1 . GLN A 1 309 ? 5.616   17.089 67.472  1.00 62.42 ? 297 GLN A OE1 1 
ATOM   2268 N  NE2 . GLN A 1 309 ? 6.177   15.585 65.868  1.00 56.20 ? 297 GLN A NE2 1 
ATOM   2269 N  N   . ASN A 1 310 ? 8.408   19.821 63.032  1.00 37.70 ? 298 ASN A N   1 
ATOM   2270 C  CA  . ASN A 1 310 ? 9.118   19.242 61.922  1.00 36.27 ? 298 ASN A CA  1 
ATOM   2271 C  C   . ASN A 1 310 ? 10.028  20.231 61.206  1.00 36.17 ? 298 ASN A C   1 
ATOM   2272 O  O   . ASN A 1 310 ? 10.609  19.896 60.162  1.00 34.73 ? 298 ASN A O   1 
ATOM   2273 C  CB  . ASN A 1 310 ? 8.110   18.705 60.919  1.00 34.50 ? 298 ASN A CB  1 
ATOM   2274 C  CG  . ASN A 1 310 ? 7.162   17.714 61.528  1.00 35.83 ? 298 ASN A CG  1 
ATOM   2275 O  OD1 . ASN A 1 310 ? 5.963   17.951 61.558  1.00 34.28 ? 298 ASN A OD1 1 
ATOM   2276 N  ND2 . ASN A 1 310 ? 7.698   16.617 62.062  1.00 34.66 ? 298 ASN A ND2 1 
ATOM   2277 N  N   . LEU A 1 311 ? 10.127  21.451 61.724  1.00 37.24 ? 299 LEU A N   1 
ATOM   2278 C  CA  . LEU A 1 311 ? 10.901  22.508 61.069  1.00 37.64 ? 299 LEU A CA  1 
ATOM   2279 C  C   . LEU A 1 311 ? 12.361  22.092 60.906  1.00 38.03 ? 299 LEU A C   1 
ATOM   2280 O  O   . LEU A 1 311 ? 12.917  22.169 59.822  1.00 38.19 ? 299 LEU A O   1 
ATOM   2281 C  CB  . LEU A 1 311 ? 10.806  23.824 61.862  1.00 38.54 ? 299 LEU A CB  1 
ATOM   2282 C  CG  . LEU A 1 311 ? 11.622  25.032 61.372  1.00 39.67 ? 299 LEU A CG  1 
ATOM   2283 C  CD1 . LEU A 1 311 ? 11.162  25.482 59.991  1.00 38.36 ? 299 LEU A CD1 1 
ATOM   2284 C  CD2 . LEU A 1 311 ? 11.582  26.187 62.418  1.00 36.50 ? 299 LEU A CD2 1 
ATOM   2285 N  N   . GLN A 1 312 ? 12.971  21.629 61.974  1.00 39.41 ? 300 GLN A N   1 
ATOM   2286 C  CA  . GLN A 1 312 ? 14.392  21.369 61.945  1.00 41.47 ? 300 GLN A CA  1 
ATOM   2287 C  C   . GLN A 1 312 ? 14.691  20.235 60.950  1.00 40.62 ? 300 GLN A C   1 
ATOM   2288 O  O   . GLN A 1 312 ? 15.618  20.351 60.150  1.00 40.83 ? 300 GLN A O   1 
ATOM   2289 C  CB  . GLN A 1 312 ? 14.920  21.038 63.334  1.00 42.89 ? 300 GLN A CB  1 
ATOM   2290 C  CG  . GLN A 1 312 ? 16.424  20.839 63.381  1.00 50.76 ? 300 GLN A CG  1 
ATOM   2291 C  CD  . GLN A 1 312 ? 17.189  21.938 62.597  1.00 58.57 ? 300 GLN A CD  1 
ATOM   2292 O  OE1 . GLN A 1 312 ? 17.872  21.634 61.587  1.00 63.11 ? 300 GLN A OE1 1 
ATOM   2293 N  NE2 . GLN A 1 312 ? 17.016  23.217 63.007  1.00 57.11 ? 300 GLN A NE2 1 
ATOM   2294 N  N   . GLU A 1 313 ? 13.900  19.157 60.977  1.00 39.64 ? 301 GLU A N   1 
ATOM   2295 C  CA  . GLU A 1 313 ? 14.143  18.044 60.046  1.00 39.56 ? 301 GLU A CA  1 
ATOM   2296 C  C   . GLU A 1 313 ? 13.986  18.479 58.571  1.00 38.06 ? 301 GLU A C   1 
ATOM   2297 O  O   . GLU A 1 313 ? 14.732  18.031 57.705  1.00 38.34 ? 301 GLU A O   1 
ATOM   2298 C  CB  . GLU A 1 313 ? 13.243  16.873 60.365  1.00 39.06 ? 301 GLU A CB  1 
ATOM   2299 C  CG  . GLU A 1 313 ? 13.290  15.807 59.353  1.00 41.82 ? 301 GLU A CG  1 
ATOM   2300 C  CD  . GLU A 1 313 ? 12.696  14.486 59.835  1.00 45.26 ? 301 GLU A CD  1 
ATOM   2301 O  OE1 . GLU A 1 313 ? 13.125  13.418 59.306  1.00 46.92 ? 301 GLU A OE1 1 
ATOM   2302 O  OE2 . GLU A 1 313 ? 11.772  14.538 60.693  1.00 44.66 ? 301 GLU A OE2 1 
ATOM   2303 N  N   . CYS A 1 314 ? 13.008  19.326 58.280  1.00 36.55 ? 302 CYS A N   1 
ATOM   2304 C  CA  . CYS A 1 314 ? 12.821  19.798 56.933  1.00 35.72 ? 302 CYS A CA  1 
ATOM   2305 C  C   . CYS A 1 314 ? 13.977  20.706 56.449  1.00 36.26 ? 302 CYS A C   1 
ATOM   2306 O  O   . CYS A 1 314 ? 14.393  20.627 55.283  1.00 34.69 ? 302 CYS A O   1 
ATOM   2307 C  CB  . CYS A 1 314 ? 11.462  20.479 56.786  1.00 34.95 ? 302 CYS A CB  1 
ATOM   2308 S  SG  . CYS A 1 314 ? 10.114  19.282 56.806  1.00 36.41 ? 302 CYS A SG  1 
ATOM   2309 N  N   . LEU A 1 315 ? 14.492  21.564 57.330  1.00 36.93 ? 303 LEU A N   1 
ATOM   2310 C  CA  . LEU A 1 315 ? 15.675  22.355 56.986  1.00 37.67 ? 303 LEU A CA  1 
ATOM   2311 C  C   . LEU A 1 315 ? 16.900  21.486 56.748  1.00 38.92 ? 303 LEU A C   1 
ATOM   2312 O  O   . LEU A 1 315 ? 17.616  21.718 55.775  1.00 40.12 ? 303 LEU A O   1 
ATOM   2313 C  CB  . LEU A 1 315 ? 15.952  23.421 58.025  1.00 38.76 ? 303 LEU A CB  1 
ATOM   2314 C  CG  . LEU A 1 315 ? 14.893  24.513 58.145  1.00 37.32 ? 303 LEU A CG  1 
ATOM   2315 C  CD1 . LEU A 1 315 ? 15.050  25.318 59.511  1.00 39.56 ? 303 LEU A CD1 1 
ATOM   2316 C  CD2 . LEU A 1 315 ? 14.959  25.465 56.944  1.00 37.29 ? 303 LEU A CD2 1 
ATOM   2317 N  N   . GLU A 1 316 ? 17.101  20.429 57.533  1.00 39.43 ? 304 GLU A N   1 
ATOM   2318 C  CA  . GLU A 1 316 ? 18.242  19.528 57.285  1.00 41.12 ? 304 GLU A CA  1 
ATOM   2319 C  C   . GLU A 1 316 ? 18.137  18.828 55.929  1.00 38.84 ? 304 GLU A C   1 
ATOM   2320 O  O   . GLU A 1 316 ? 19.121  18.754 55.210  1.00 38.26 ? 304 GLU A O   1 
ATOM   2321 C  CB  . GLU A 1 316 ? 18.439  18.456 58.379  1.00 42.17 ? 304 GLU A CB  1 
ATOM   2322 C  CG  . GLU A 1 316 ? 19.015  19.038 59.640  1.00 50.25 ? 304 GLU A CG  1 
ATOM   2323 C  CD  . GLU A 1 316 ? 20.453  19.571 59.435  1.00 57.28 ? 304 GLU A CD  1 
ATOM   2324 O  OE1 . GLU A 1 316 ? 20.714  20.764 59.745  1.00 62.36 ? 304 GLU A OE1 1 
ATOM   2325 O  OE2 . GLU A 1 316 ? 21.315  18.798 58.938  1.00 61.15 ? 304 GLU A OE2 1 
ATOM   2326 N  N   . LEU A 1 317 ? 16.945  18.325 55.623  1.00 37.43 ? 305 LEU A N   1 
ATOM   2327 C  CA  . LEU A 1 317 ? 16.650  17.684 54.367  1.00 37.05 ? 305 LEU A CA  1 
ATOM   2328 C  C   . LEU A 1 317 ? 16.888  18.655 53.186  1.00 36.92 ? 305 LEU A C   1 
ATOM   2329 O  O   . LEU A 1 317 ? 17.279  18.264 52.112  1.00 36.24 ? 305 LEU A O   1 
ATOM   2330 C  CB  . LEU A 1 317 ? 15.198  17.186 54.367  1.00 35.92 ? 305 LEU A CB  1 
ATOM   2331 C  CG  . LEU A 1 317 ? 14.926  15.887 55.139  1.00 37.25 ? 305 LEU A CG  1 
ATOM   2332 C  CD1 . LEU A 1 317 ? 13.409  15.607 55.132  1.00 32.28 ? 305 LEU A CD1 1 
ATOM   2333 C  CD2 . LEU A 1 317 ? 15.745  14.651 54.579  1.00 34.11 ? 305 LEU A CD2 1 
ATOM   2334 N  N   . SER A 1 318 ? 16.645  19.938 53.403  1.00 37.55 ? 306 SER A N   1 
ATOM   2335 C  CA  . SER A 1 318 ? 16.787  20.908 52.327  1.00 38.51 ? 306 SER A CA  1 
ATOM   2336 C  C   . SER A 1 318 ? 18.263  21.288 52.024  1.00 39.23 ? 306 SER A C   1 
ATOM   2337 O  O   . SER A 1 318 ? 18.558  21.742 50.940  1.00 39.32 ? 306 SER A O   1 
ATOM   2338 C  CB  . SER A 1 318 ? 15.910  22.142 52.612  1.00 38.04 ? 306 SER A CB  1 
ATOM   2339 O  OG  . SER A 1 318 ? 16.704  23.020 53.358  1.00 44.05 ? 306 SER A OG  1 
ATOM   2340 N  N   . LYS A 1 319 ? 19.190  21.024 52.932  1.00 41.03 ? 307 LYS A N   1 
ATOM   2341 C  CA  . LYS A 1 319 ? 20.590  21.377 52.706  1.00 44.07 ? 307 LYS A CA  1 
ATOM   2342 C  C   . LYS A 1 319 ? 21.187  20.660 51.501  1.00 43.94 ? 307 LYS A C   1 
ATOM   2343 O  O   . LYS A 1 319 ? 21.978  21.212 50.820  1.00 44.75 ? 307 LYS A O   1 
ATOM   2344 C  CB  . LYS A 1 319 ? 21.437  21.089 53.958  1.00 45.86 ? 307 LYS A CB  1 
ATOM   2345 C  CG  . LYS A 1 319 ? 20.911  21.856 55.141  1.00 50.03 ? 307 LYS A CG  1 
ATOM   2346 C  CD  . LYS A 1 319 ? 21.903  21.900 56.310  1.00 56.76 ? 307 LYS A CD  1 
ATOM   2347 C  CE  . LYS A 1 319 ? 21.451  22.933 57.365  1.00 58.36 ? 307 LYS A CE  1 
ATOM   2348 N  NZ  . LYS A 1 319 ? 22.486  23.137 58.443  1.00 64.56 ? 307 LYS A NZ  1 
ATOM   2349 N  N   . ASP A 1 320 ? 20.754  19.442 51.236  1.00 44.23 ? 308 ASP A N   1 
ATOM   2350 C  CA  . ASP A 1 320 ? 21.325  18.622 50.190  1.00 45.62 ? 308 ASP A CA  1 
ATOM   2351 C  C   . ASP A 1 320 ? 20.534  18.700 48.883  1.00 44.00 ? 308 ASP A C   1 
ATOM   2352 O  O   . ASP A 1 320 ? 20.671  17.791 48.076  1.00 44.79 ? 308 ASP A O   1 
ATOM   2353 C  CB  . ASP A 1 320 ? 21.354  17.149 50.657  1.00 45.87 ? 308 ASP A CB  1 
ATOM   2354 C  CG  . ASP A 1 320 ? 21.753  17.009 52.171  1.00 53.14 ? 308 ASP A CG  1 
ATOM   2355 O  OD1 . ASP A 1 320 ? 22.960  17.201 52.450  1.00 58.74 ? 308 ASP A OD1 1 
ATOM   2356 O  OD2 . ASP A 1 320 ? 20.861  16.757 53.074  1.00 58.30 ? 308 ASP A OD2 1 
ATOM   2357 N  N   . VAL A 1 321 ? 19.674  19.718 48.684  1.00 41.15 ? 309 VAL A N   1 
ATOM   2358 C  CA  . VAL A 1 321 ? 18.924  19.818 47.442  1.00 38.05 ? 309 VAL A CA  1 
ATOM   2359 C  C   . VAL A 1 321 ? 19.115  21.185 46.820  1.00 37.18 ? 309 VAL A C   1 
ATOM   2360 O  O   . VAL A 1 321 ? 19.656  22.096 47.446  1.00 37.17 ? 309 VAL A O   1 
ATOM   2361 C  CB  . VAL A 1 321 ? 17.388  19.515 47.627  1.00 37.08 ? 309 VAL A CB  1 
ATOM   2362 C  CG1 . VAL A 1 321 ? 17.166  18.135 48.256  1.00 35.09 ? 309 VAL A CG1 1 
ATOM   2363 C  CG2 . VAL A 1 321 ? 16.723  20.629 48.367  1.00 36.48 ? 309 VAL A CG2 1 
ATOM   2364 N  N   . ASP A 1 322 ? 18.685  21.316 45.571  1.00 34.22 ? 310 ASP A N   1 
ATOM   2365 C  CA  . ASP A 1 322 ? 18.804  22.582 44.836  1.00 34.68 ? 310 ASP A CA  1 
ATOM   2366 C  C   . ASP A 1 322 ? 17.556  23.439 44.944  1.00 33.05 ? 310 ASP A C   1 
ATOM   2367 O  O   . ASP A 1 322 ? 17.639  24.640 44.840  1.00 34.48 ? 310 ASP A O   1 
ATOM   2368 C  CB  . ASP A 1 322 ? 19.080  22.285 43.369  1.00 34.31 ? 310 ASP A CB  1 
ATOM   2369 C  CG  . ASP A 1 322 ? 20.341  21.464 43.199  1.00 37.35 ? 310 ASP A CG  1 
ATOM   2370 O  OD1 . ASP A 1 322 ? 21.368  21.962 43.673  1.00 39.76 ? 310 ASP A OD1 1 
ATOM   2371 O  OD2 . ASP A 1 322 ? 20.306  20.312 42.705  1.00 35.37 ? 310 ASP A OD2 1 
ATOM   2372 N  N   . VAL A 1 323 ? 16.404  22.818 45.112  1.00 31.45 ? 311 VAL A N   1 
ATOM   2373 C  CA  . VAL A 1 323 ? 15.106  23.514 45.120  1.00 30.92 ? 311 VAL A CA  1 
ATOM   2374 C  C   . VAL A 1 323 ? 14.168  22.759 46.054  1.00 29.56 ? 311 VAL A C   1 
ATOM   2375 O  O   . VAL A 1 323 ? 14.272  21.519 46.191  1.00 29.23 ? 311 VAL A O   1 
ATOM   2376 C  CB  . VAL A 1 323 ? 14.488  23.587 43.691  1.00 30.86 ? 311 VAL A CB  1 
ATOM   2377 C  CG1 . VAL A 1 323 ? 14.265  22.261 43.179  1.00 32.87 ? 311 VAL A CG1 1 
ATOM   2378 C  CG2 . VAL A 1 323 ? 13.128  24.341 43.671  1.00 28.63 ? 311 VAL A CG2 1 
ATOM   2379 N  N   . VAL A 1 324 ? 13.285  23.508 46.713  1.00 28.43 ? 312 VAL A N   1 
ATOM   2380 C  CA  . VAL A 1 324 ? 12.257  22.945 47.523  1.00 27.65 ? 312 VAL A CA  1 
ATOM   2381 C  C   . VAL A 1 324 ? 10.878  23.397 47.020  1.00 27.35 ? 312 VAL A C   1 
ATOM   2382 O  O   . VAL A 1 324 ? 10.656  24.596 46.867  1.00 28.26 ? 312 VAL A O   1 
ATOM   2383 C  CB  . VAL A 1 324 ? 12.403  23.348 49.004  1.00 27.31 ? 312 VAL A CB  1 
ATOM   2384 C  CG1 . VAL A 1 324 ? 11.301  22.672 49.822  1.00 27.57 ? 312 VAL A CG1 1 
ATOM   2385 C  CG2 . VAL A 1 324 ? 13.820  23.004 49.519  1.00 28.74 ? 312 VAL A CG2 1 
ATOM   2386 N  N   . ALA A 1 325 ? 9.995   22.435 46.749  1.00 25.42 ? 313 ALA A N   1 
ATOM   2387 C  CA  . ALA A 1 325 ? 8.559   22.663 46.506  1.00 25.07 ? 313 ALA A CA  1 
ATOM   2388 C  C   . ALA A 1 325 ? 7.812   22.326 47.796  1.00 25.59 ? 313 ALA A C   1 
ATOM   2389 O  O   . ALA A 1 325 ? 8.137   21.355 48.481  1.00 26.40 ? 313 ALA A O   1 
ATOM   2390 C  CB  . ALA A 1 325 ? 8.024   21.817 45.371  1.00 23.42 ? 313 ALA A CB  1 
ATOM   2391 N  N   . ILE A 1 326 ? 6.848   23.163 48.128  1.00 25.50 ? 314 ILE A N   1 
ATOM   2392 C  CA  . ILE A 1 326 ? 6.047   23.044 49.347  1.00 26.16 ? 314 ILE A CA  1 
ATOM   2393 C  C   . ILE A 1 326 ? 4.598   23.410 49.080  1.00 25.92 ? 314 ILE A C   1 
ATOM   2394 O  O   . ILE A 1 326 ? 4.342   24.337 48.327  1.00 27.25 ? 314 ILE A O   1 
ATOM   2395 C  CB  . ILE A 1 326 ? 6.654   23.934 50.458  1.00 27.10 ? 314 ILE A CB  1 
ATOM   2396 C  CG1 . ILE A 1 326 ? 5.931   23.731 51.817  1.00 27.77 ? 314 ILE A CG1 1 
ATOM   2397 C  CG2 . ILE A 1 326 ? 6.736   25.435 50.032  1.00 23.72 ? 314 ILE A CG2 1 
ATOM   2398 C  CD1 . ILE A 1 326 ? 6.768   24.315 52.959  1.00 27.09 ? 314 ILE A CD1 1 
ATOM   2399 N  N   . GLY A 1 327 ? 3.664   22.648 49.671  1.00 26.89 ? 315 GLY A N   1 
ATOM   2400 C  CA  . GLY A 1 327 ? 2.265   23.024 49.744  1.00 26.44 ? 315 GLY A CA  1 
ATOM   2401 C  C   . GLY A 1 327 ? 1.185   22.026 49.352  1.00 26.98 ? 315 GLY A C   1 
ATOM   2402 O  O   . GLY A 1 327 ? 0.130   21.971 49.981  1.00 26.08 ? 315 GLY A O   1 
ATOM   2403 N  N   . PRO A 1 328 ? 1.400   21.255 48.278  1.00 27.57 ? 316 PRO A N   1 
ATOM   2404 C  CA  . PRO A 1 328 ? 0.313   20.343 47.833  1.00 27.88 ? 316 PRO A CA  1 
ATOM   2405 C  C   . PRO A 1 328 ? -0.070  19.349 48.944  1.00 28.24 ? 316 PRO A C   1 
ATOM   2406 O  O   . PRO A 1 328 ? 0.791   18.644 49.488  1.00 27.31 ? 316 PRO A O   1 
ATOM   2407 C  CB  . PRO A 1 328 ? 0.918   19.611 46.643  1.00 27.85 ? 316 PRO A CB  1 
ATOM   2408 C  CG  . PRO A 1 328 ? 2.016   20.519 46.156  1.00 27.92 ? 316 PRO A CG  1 
ATOM   2409 C  CD  . PRO A 1 328 ? 2.571   21.206 47.387  1.00 27.31 ? 316 PRO A CD  1 
ATOM   2410 N  N   . GLY A 1 329 ? -1.353  19.349 49.275  1.00 28.80 ? 317 GLY A N   1 
ATOM   2411 C  CA  . GLY A 1 329 ? -1.890  18.445 50.276  1.00 30.14 ? 317 GLY A CA  1 
ATOM   2412 C  C   . GLY A 1 329 ? -1.441  18.661 51.706  1.00 30.06 ? 317 GLY A C   1 
ATOM   2413 O  O   . GLY A 1 329 ? -1.661  17.783 52.531  1.00 30.97 ? 317 GLY A O   1 
ATOM   2414 N  N   . LEU A 1 330 ? -0.881  19.820 52.051  1.00 29.94 ? 318 LEU A N   1 
ATOM   2415 C  CA  . LEU A 1 330 ? -0.436  20.017 53.452  1.00 30.48 ? 318 LEU A CA  1 
ATOM   2416 C  C   . LEU A 1 330 ? -1.596  20.192 54.420  1.00 31.87 ? 318 LEU A C   1 
ATOM   2417 O  O   . LEU A 1 330 ? -1.472  19.943 55.609  1.00 31.92 ? 318 LEU A O   1 
ATOM   2418 C  CB  . LEU A 1 330 ? 0.455   21.257 53.612  1.00 31.25 ? 318 LEU A CB  1 
ATOM   2419 C  CG  . LEU A 1 330 ? 1.852   21.247 53.031  1.00 31.01 ? 318 LEU A CG  1 
ATOM   2420 C  CD1 . LEU A 1 330 ? 2.565   22.526 53.442  1.00 30.29 ? 318 LEU A CD1 1 
ATOM   2421 C  CD2 . LEU A 1 330 ? 2.569   20.045 53.489  1.00 29.69 ? 318 LEU A CD2 1 
ATOM   2422 N  N   . GLY A 1 331 ? -2.730  20.651 53.922  1.00 33.30 ? 319 GLY A N   1 
ATOM   2423 C  CA  . GLY A 1 331 ? -3.821  21.003 54.809  1.00 34.70 ? 319 GLY A CA  1 
ATOM   2424 C  C   . GLY A 1 331 ? -3.610  22.449 55.212  1.00 36.90 ? 319 GLY A C   1 
ATOM   2425 O  O   . GLY A 1 331 ? -2.543  23.031 55.046  1.00 35.51 ? 319 GLY A O   1 
ATOM   2426 N  N   . ASN A 1 332 ? -4.644  23.048 55.739  1.00 39.86 ? 320 ASN A N   1 
ATOM   2427 C  CA  . ASN A 1 332 ? -4.598  24.426 56.098  1.00 42.59 ? 320 ASN A CA  1 
ATOM   2428 C  C   . ASN A 1 332 ? -5.138  24.567 57.526  1.00 44.44 ? 320 ASN A C   1 
ATOM   2429 O  O   . ASN A 1 332 ? -6.341  24.607 57.701  1.00 48.06 ? 320 ASN A O   1 
ATOM   2430 C  CB  . ASN A 1 332 ? -5.492  25.215 55.161  1.00 43.19 ? 320 ASN A CB  1 
ATOM   2431 C  CG  . ASN A 1 332 ? -5.761  26.584 55.681  1.00 50.04 ? 320 ASN A CG  1 
ATOM   2432 O  OD1 . ASN A 1 332 ? -5.269  26.948 56.772  1.00 57.33 ? 320 ASN A OD1 1 
ATOM   2433 N  ND2 . ASN A 1 332 ? -6.536  27.366 54.944  1.00 55.71 ? 320 ASN A ND2 1 
ATOM   2434 N  N   . ASN A 1 333 ? -4.264  24.539 58.519  1.00 43.45 ? 321 ASN A N   1 
ATOM   2435 C  CA  . ASN A 1 333 ? -4.601  24.831 59.916  1.00 44.06 ? 321 ASN A CA  1 
ATOM   2436 C  C   . ASN A 1 333 ? -3.443  25.668 60.467  1.00 42.85 ? 321 ASN A C   1 
ATOM   2437 O  O   . ASN A 1 333 ? -2.412  25.891 59.777  1.00 40.72 ? 321 ASN A O   1 
ATOM   2438 C  CB  . ASN A 1 333 ? -4.826  23.545 60.737  1.00 44.24 ? 321 ASN A CB  1 
ATOM   2439 C  CG  . ASN A 1 333 ? -3.641  22.585 60.663  1.00 45.81 ? 321 ASN A CG  1 
ATOM   2440 O  OD1 . ASN A 1 333 ? -2.504  22.966 60.978  1.00 48.06 ? 321 ASN A OD1 1 
ATOM   2441 N  ND2 . ASN A 1 333 ? -3.896  21.337 60.256  1.00 46.46 ? 321 ASN A ND2 1 
ATOM   2442 N  N   . GLU A 1 334 ? -3.577  26.102 61.701  1.00 43.23 ? 322 GLU A N   1 
ATOM   2443 C  CA  . GLU A 1 334 ? -2.646  27.037 62.282  1.00 44.52 ? 322 GLU A CA  1 
ATOM   2444 C  C   . GLU A 1 334 ? -1.240  26.495 62.419  1.00 42.47 ? 322 GLU A C   1 
ATOM   2445 O  O   . GLU A 1 334 ? -0.293  27.234 62.236  1.00 41.79 ? 322 GLU A O   1 
ATOM   2446 C  CB  . GLU A 1 334 ? -3.149  27.516 63.646  1.00 47.15 ? 322 GLU A CB  1 
ATOM   2447 C  CG  . GLU A 1 334 ? -4.114  28.701 63.513  1.00 55.52 ? 322 GLU A CG  1 
ATOM   2448 C  CD  . GLU A 1 334 ? -3.490  29.922 62.791  1.00 63.21 ? 322 GLU A CD  1 
ATOM   2449 O  OE1 . GLU A 1 334 ? -2.423  30.430 63.233  1.00 69.61 ? 322 GLU A OE1 1 
ATOM   2450 O  OE2 . GLU A 1 334 ? -4.074  30.373 61.774  1.00 69.54 ? 322 GLU A OE2 1 
ATOM   2451 N  N   . HIS A 1 335 ? -1.106  25.208 62.721  1.00 41.31 ? 323 HIS A N   1 
ATOM   2452 C  CA  . HIS A 1 335 ? 0.209   24.611 62.873  1.00 40.94 ? 323 HIS A CA  1 
ATOM   2453 C  C   . HIS A 1 335 ? 0.927   24.483 61.536  1.00 38.46 ? 323 HIS A C   1 
ATOM   2454 O  O   . HIS A 1 335 ? 2.132   24.682 61.468  1.00 37.14 ? 323 HIS A O   1 
ATOM   2455 C  CB  . HIS A 1 335 ? 0.095   23.274 63.600  1.00 42.00 ? 323 HIS A CB  1 
ATOM   2456 C  CG  . HIS A 1 335 ? -0.339  23.429 65.031  1.00 47.64 ? 323 HIS A CG  1 
ATOM   2457 N  ND1 . HIS A 1 335 ? -0.918  22.408 65.756  1.00 52.36 ? 323 HIS A ND1 1 
ATOM   2458 C  CD2 . HIS A 1 335 ? -0.286  24.499 65.862  1.00 51.28 ? 323 HIS A CD2 1 
ATOM   2459 C  CE1 . HIS A 1 335 ? -1.174  22.833 66.980  1.00 52.66 ? 323 HIS A CE1 1 
ATOM   2460 N  NE2 . HIS A 1 335 ? -0.819  24.103 67.063  1.00 54.85 ? 323 HIS A NE2 1 
ATOM   2461 N  N   . VAL A 1 336 ? 0.172   24.187 60.475  1.00 36.48 ? 324 VAL A N   1 
ATOM   2462 C  CA  . VAL A 1 336 ? 0.725   24.218 59.126  1.00 35.53 ? 324 VAL A CA  1 
ATOM   2463 C  C   . VAL A 1 336 ? 1.169   25.641 58.739  1.00 34.79 ? 324 VAL A C   1 
ATOM   2464 O  O   . VAL A 1 336 ? 2.250   25.821 58.231  1.00 33.99 ? 324 VAL A O   1 
ATOM   2465 C  CB  . VAL A 1 336 ? -0.232  23.618 58.059  1.00 35.06 ? 324 VAL A CB  1 
ATOM   2466 C  CG1 . VAL A 1 336 ? 0.333   23.860 56.630  1.00 33.31 ? 324 VAL A CG1 1 
ATOM   2467 C  CG2 . VAL A 1 336 ? -0.477  22.108 58.338  1.00 35.41 ? 324 VAL A CG2 1 
ATOM   2468 N  N   . ARG A 1 337 ? 0.335   26.634 59.003  1.00 36.26 ? 325 ARG A N   1 
ATOM   2469 C  CA  . ARG A 1 337 ? 0.690   28.049 58.788  1.00 36.82 ? 325 ARG A CA  1 
ATOM   2470 C  C   . ARG A 1 337 ? 1.997   28.452 59.492  1.00 37.62 ? 325 ARG A C   1 
ATOM   2471 O  O   . ARG A 1 337 ? 2.850   29.078 58.870  1.00 37.36 ? 325 ARG A O   1 
ATOM   2472 C  CB  . ARG A 1 337 ? -0.449  28.941 59.242  1.00 37.88 ? 325 ARG A CB  1 
ATOM   2473 C  CG  . ARG A 1 337 ? -0.150  30.430 59.226  1.00 40.67 ? 325 ARG A CG  1 
ATOM   2474 C  CD  . ARG A 1 337 ? -1.316  31.216 59.808  1.00 45.93 ? 325 ARG A CD  1 
ATOM   2475 N  NE  . ARG A 1 337 ? -2.554  30.884 59.104  1.00 49.65 ? 325 ARG A NE  1 
ATOM   2476 C  CZ  . ARG A 1 337 ? -2.975  31.458 57.971  1.00 53.35 ? 325 ARG A CZ  1 
ATOM   2477 N  NH1 . ARG A 1 337 ? -2.278  32.452 57.404  1.00 53.46 ? 325 ARG A NH1 1 
ATOM   2478 N  NH2 . ARG A 1 337 ? -4.109  31.034 57.397  1.00 54.11 ? 325 ARG A NH2 1 
ATOM   2479 N  N   . GLU A 1 338 ? 2.152   28.061 60.765  1.00 37.66 ? 326 GLU A N   1 
ATOM   2480 C  CA  . GLU A 1 338 ? 3.383   28.347 61.530  1.00 38.71 ? 326 GLU A CA  1 
ATOM   2481 C  C   . GLU A 1 338 ? 4.584   27.695 60.886  1.00 36.49 ? 326 GLU A C   1 
ATOM   2482 O  O   . GLU A 1 338 ? 5.610   28.321 60.670  1.00 35.79 ? 326 GLU A O   1 
ATOM   2483 C  CB  . GLU A 1 338 ? 3.288   27.828 62.976  1.00 40.31 ? 326 GLU A CB  1 
ATOM   2484 C  CG  . GLU A 1 338 ? 2.412   28.655 63.885  1.00 45.48 ? 326 GLU A CG  1 
ATOM   2485 C  CD  . GLU A 1 338 ? 1.968   27.889 65.180  1.00 51.70 ? 326 GLU A CD  1 
ATOM   2486 O  OE1 . GLU A 1 338 ? 2.438   26.762 65.476  1.00 51.23 ? 326 GLU A OE1 1 
ATOM   2487 O  OE2 . GLU A 1 338 ? 1.118   28.429 65.908  1.00 55.93 ? 326 GLU A OE2 1 
ATOM   2488 N  N   . PHE A 1 339 ? 4.450   26.417 60.568  1.00 35.53 ? 327 PHE A N   1 
ATOM   2489 C  CA  . PHE A 1 339 ? 5.525   25.693 59.936  1.00 34.38 ? 327 PHE A CA  1 
ATOM   2490 C  C   . PHE A 1 339 ? 5.920   26.302 58.580  1.00 34.23 ? 327 PHE A C   1 
ATOM   2491 O  O   . PHE A 1 339 ? 7.100   26.611 58.335  1.00 35.26 ? 327 PHE A O   1 
ATOM   2492 C  CB  . PHE A 1 339 ? 5.164   24.218 59.834  1.00 34.88 ? 327 PHE A CB  1 
ATOM   2493 C  CG  . PHE A 1 339 ? 5.968   23.451 58.829  1.00 33.20 ? 327 PHE A CG  1 
ATOM   2494 C  CD1 . PHE A 1 339 ? 7.209   22.932 59.174  1.00 35.36 ? 327 PHE A CD1 1 
ATOM   2495 C  CD2 . PHE A 1 339 ? 5.469   23.211 57.573  1.00 33.40 ? 327 PHE A CD2 1 
ATOM   2496 C  CE1 . PHE A 1 339 ? 7.936   22.237 58.268  1.00 34.53 ? 327 PHE A CE1 1 
ATOM   2497 C  CE2 . PHE A 1 339 ? 6.203   22.515 56.636  1.00 32.63 ? 327 PHE A CE2 1 
ATOM   2498 C  CZ  . PHE A 1 339 ? 7.450   22.042 56.990  1.00 35.58 ? 327 PHE A CZ  1 
ATOM   2499 N  N   . VAL A 1 340 ? 4.963   26.468 57.692  1.00 32.64 ? 328 VAL A N   1 
ATOM   2500 C  CA  . VAL A 1 340 ? 5.248   26.964 56.352  1.00 32.13 ? 328 VAL A CA  1 
ATOM   2501 C  C   . VAL A 1 340 ? 6.007   28.304 56.365  1.00 33.54 ? 328 VAL A C   1 
ATOM   2502 O  O   . VAL A 1 340 ? 7.016   28.456 55.658  1.00 32.10 ? 328 VAL A O   1 
ATOM   2503 C  CB  . VAL A 1 340 ? 3.952   27.075 55.527  1.00 31.56 ? 328 VAL A CB  1 
ATOM   2504 C  CG1 . VAL A 1 340 ? 4.134   27.902 54.218  1.00 30.78 ? 328 VAL A CG1 1 
ATOM   2505 C  CG2 . VAL A 1 340 ? 3.436   25.688 55.198  1.00 31.18 ? 328 VAL A CG2 1 
ATOM   2506 N  N   . ASN A 1 341 ? 5.509   29.268 57.157  1.00 34.97 ? 329 ASN A N   1 
ATOM   2507 C  CA  . ASN A 1 341 ? 6.077   30.605 57.196  1.00 36.36 ? 329 ASN A CA  1 
ATOM   2508 C  C   . ASN A 1 341 ? 7.458   30.602 57.852  1.00 37.71 ? 329 ASN A C   1 
ATOM   2509 O  O   . ASN A 1 341 ? 8.363   31.228 57.325  1.00 37.33 ? 329 ASN A O   1 
ATOM   2510 C  CB  . ASN A 1 341 ? 5.096   31.567 57.863  1.00 38.23 ? 329 ASN A CB  1 
ATOM   2511 C  CG  . ASN A 1 341 ? 3.910   31.851 56.950  1.00 39.29 ? 329 ASN A CG  1 
ATOM   2512 O  OD1 . ASN A 1 341 ? 4.108   32.344 55.829  1.00 42.44 ? 329 ASN A OD1 1 
ATOM   2513 N  ND2 . ASN A 1 341 ? 2.711   31.446 57.358  1.00 38.33 ? 329 ASN A ND2 1 
ATOM   2514 N  N   . GLU A 1 342 ? 7.629   29.891 58.971  1.00 37.22 ? 330 GLU A N   1 
ATOM   2515 C  CA  . GLU A 1 342 ? 8.958   29.775 59.555  1.00 39.43 ? 330 GLU A CA  1 
ATOM   2516 C  C   . GLU A 1 342 ? 9.929   29.026 58.641  1.00 37.72 ? 330 GLU A C   1 
ATOM   2517 O  O   . GLU A 1 342 ? 11.102  29.406 58.548  1.00 38.65 ? 330 GLU A O   1 
ATOM   2518 C  CB  . GLU A 1 342 ? 8.951   29.118 60.938  1.00 39.98 ? 330 GLU A CB  1 
ATOM   2519 C  CG  . GLU A 1 342 ? 8.511   30.005 62.011  1.00 48.24 ? 330 GLU A CG  1 
ATOM   2520 C  CD  . GLU A 1 342 ? 9.347   31.295 62.101  1.00 55.17 ? 330 GLU A CD  1 
ATOM   2521 O  OE1 . GLU A 1 342 ? 10.596  31.219 62.260  1.00 58.43 ? 330 GLU A OE1 1 
ATOM   2522 O  OE2 . GLU A 1 342 ? 8.734   32.380 61.980  1.00 61.28 ? 330 GLU A OE2 1 
ATOM   2523 N  N   . PHE A 1 343 ? 9.462   27.989 57.963  1.00 35.81 ? 331 PHE A N   1 
ATOM   2524 C  CA  . PHE A 1 343 ? 10.315  27.284 57.039  1.00 34.98 ? 331 PHE A CA  1 
ATOM   2525 C  C   . PHE A 1 343 ? 10.816  28.212 55.945  1.00 35.45 ? 331 PHE A C   1 
ATOM   2526 O  O   . PHE A 1 343 ? 12.029  28.329 55.711  1.00 35.90 ? 331 PHE A O   1 
ATOM   2527 C  CB  . PHE A 1 343 ? 9.569   26.097 56.406  1.00 34.40 ? 331 PHE A CB  1 
ATOM   2528 C  CG  . PHE A 1 343 ? 10.401  25.315 55.439  1.00 31.45 ? 331 PHE A CG  1 
ATOM   2529 C  CD1 . PHE A 1 343 ? 11.436  24.530 55.889  1.00 32.39 ? 331 PHE A CD1 1 
ATOM   2530 C  CD2 . PHE A 1 343 ? 10.156  25.387 54.077  1.00 30.02 ? 331 PHE A CD2 1 
ATOM   2531 C  CE1 . PHE A 1 343 ? 12.260  23.800 54.972  1.00 32.94 ? 331 PHE A CE1 1 
ATOM   2532 C  CE2 . PHE A 1 343 ? 10.919  24.681 53.174  1.00 31.13 ? 331 PHE A CE2 1 
ATOM   2533 C  CZ  . PHE A 1 343 ? 12.006  23.882 53.620  1.00 31.56 ? 331 PHE A CZ  1 
ATOM   2534 N  N   . LEU A 1 344 ? 9.887   28.851 55.242  1.00 35.57 ? 332 LEU A N   1 
ATOM   2535 C  CA  . LEU A 1 344 ? 10.246  29.694 54.078  1.00 35.67 ? 332 LEU A CA  1 
ATOM   2536 C  C   . LEU A 1 344 ? 11.104  30.882 54.488  1.00 37.09 ? 332 LEU A C   1 
ATOM   2537 O  O   . LEU A 1 344 ? 11.997  31.276 53.790  1.00 35.30 ? 332 LEU A O   1 
ATOM   2538 C  CB  . LEU A 1 344 ? 8.994   30.175 53.353  1.00 34.78 ? 332 LEU A CB  1 
ATOM   2539 C  CG  . LEU A 1 344 ? 8.287   29.061 52.577  1.00 34.26 ? 332 LEU A CG  1 
ATOM   2540 C  CD1 . LEU A 1 344 ? 6.876   29.570 52.090  1.00 33.20 ? 332 LEU A CD1 1 
ATOM   2541 C  CD2 . LEU A 1 344 ? 9.154   28.587 51.408  1.00 30.71 ? 332 LEU A CD2 1 
ATOM   2542 N  N   . LYS A 1 345 ? 10.835  31.426 55.665  1.00 39.28 ? 333 LYS A N   1 
ATOM   2543 C  CA  . LYS A 1 345 ? 11.651  32.499 56.204  1.00 41.93 ? 333 LYS A CA  1 
ATOM   2544 C  C   . LYS A 1 345 ? 13.107  32.036 56.395  1.00 41.60 ? 333 LYS A C   1 
ATOM   2545 O  O   . LYS A 1 345 ? 14.030  32.806 56.245  1.00 42.57 ? 333 LYS A O   1 
ATOM   2546 C  CB  . LYS A 1 345 ? 10.997  32.998 57.524  1.00 43.52 ? 333 LYS A CB  1 
ATOM   2547 C  CG  . LYS A 1 345 ? 11.723  34.046 58.325  1.00 49.89 ? 333 LYS A CG  1 
ATOM   2548 C  CD  . LYS A 1 345 ? 10.871  34.432 59.591  1.00 55.32 ? 333 LYS A CD  1 
ATOM   2549 C  CE  . LYS A 1 345 ? 11.693  34.617 60.855  1.00 61.00 ? 333 LYS A CE  1 
ATOM   2550 N  NZ  . LYS A 1 345 ? 12.286  35.974 61.042  1.00 64.86 ? 333 LYS A NZ  1 
ATOM   2551 N  N   . THR A 1 346 ? 13.319  30.777 56.721  1.00 40.79 ? 334 THR A N   1 
ATOM   2552 C  CA  . THR A 1 346 ? 14.661  30.295 57.011  1.00 42.00 ? 334 THR A CA  1 
ATOM   2553 C  C   . THR A 1 346 ? 15.318  29.626 55.797  1.00 40.14 ? 334 THR A C   1 
ATOM   2554 O  O   . THR A 1 346 ? 16.530  29.594 55.679  1.00 40.66 ? 334 THR A O   1 
ATOM   2555 C  CB  . THR A 1 346 ? 14.642  29.274 58.193  1.00 42.19 ? 334 THR A CB  1 
ATOM   2556 O  OG1 . THR A 1 346 ? 13.968  29.869 59.297  1.00 47.75 ? 334 THR A OG1 1 
ATOM   2557 C  CG2 . THR A 1 346 ? 16.066  28.940 58.654  1.00 42.64 ? 334 THR A CG2 1 
ATOM   2558 N  N   . LEU A 1 347 ? 14.525  29.071 54.898  1.00 37.67 ? 335 LEU A N   1 
ATOM   2559 C  CA  . LEU A 1 347 ? 15.093  28.336 53.778  1.00 36.58 ? 335 LEU A CA  1 
ATOM   2560 C  C   . LEU A 1 347 ? 15.880  29.232 52.805  1.00 37.28 ? 335 LEU A C   1 
ATOM   2561 O  O   . LEU A 1 347 ? 15.303  30.131 52.152  1.00 36.53 ? 335 LEU A O   1 
ATOM   2562 C  CB  . LEU A 1 347 ? 13.943  27.617 53.028  1.00 35.11 ? 335 LEU A CB  1 
ATOM   2563 C  CG  . LEU A 1 347 ? 14.340  26.816 51.788  1.00 33.26 ? 335 LEU A CG  1 
ATOM   2564 C  CD1 . LEU A 1 347 ? 15.184  25.564 52.195  1.00 30.86 ? 335 LEU A CD1 1 
ATOM   2565 C  CD2 . LEU A 1 347 ? 13.129  26.472 50.970  1.00 32.72 ? 335 LEU A CD2 1 
ATOM   2566 N  N   . GLU A 1 348 ? 17.168  28.939 52.633  1.00 38.28 ? 336 GLU A N   1 
ATOM   2567 C  CA  . GLU A 1 348 ? 17.987  29.667 51.658  1.00 39.72 ? 336 GLU A CA  1 
ATOM   2568 C  C   . GLU A 1 348 ? 18.196  28.864 50.386  1.00 39.20 ? 336 GLU A C   1 
ATOM   2569 O  O   . GLU A 1 348 ? 19.335  28.607 49.965  1.00 40.53 ? 336 GLU A O   1 
ATOM   2570 C  CB  . GLU A 1 348 ? 19.325  30.119 52.272  1.00 42.19 ? 336 GLU A CB  1 
ATOM   2571 C  CG  . GLU A 1 348 ? 19.073  31.117 53.439  1.00 46.57 ? 336 GLU A CG  1 
ATOM   2572 C  CD  . GLU A 1 348 ? 20.346  31.743 54.018  1.00 55.06 ? 336 GLU A CD  1 
ATOM   2573 O  OE1 . GLU A 1 348 ? 21.418  31.094 53.960  1.00 58.21 ? 336 GLU A OE1 1 
ATOM   2574 O  OE2 . GLU A 1 348 ? 20.262  32.893 54.527  1.00 60.92 ? 336 GLU A OE2 1 
ATOM   2575 N  N   . LYS A 1 349 ? 17.077  28.460 49.787  1.00 37.64 ? 337 LYS A N   1 
ATOM   2576 C  CA  . LYS A 1 349 ? 17.051  27.776 48.511  1.00 36.18 ? 337 LYS A CA  1 
ATOM   2577 C  C   . LYS A 1 349 ? 15.858  28.361 47.752  1.00 35.04 ? 337 LYS A C   1 
ATOM   2578 O  O   . LYS A 1 349 ? 14.899  28.841 48.374  1.00 34.65 ? 337 LYS A O   1 
ATOM   2579 C  CB  . LYS A 1 349 ? 16.756  26.282 48.677  1.00 35.61 ? 337 LYS A CB  1 
ATOM   2580 C  CG  . LYS A 1 349 ? 17.749  25.414 49.443  1.00 35.54 ? 337 LYS A CG  1 
ATOM   2581 C  CD  . LYS A 1 349 ? 19.098  25.415 48.811  1.00 37.80 ? 337 LYS A CD  1 
ATOM   2582 C  CE  . LYS A 1 349 ? 19.974  24.406 49.526  1.00 38.45 ? 337 LYS A CE  1 
ATOM   2583 N  NZ  . LYS A 1 349 ? 21.161  24.282 48.809  1.00 36.60 ? 337 LYS A NZ  1 
ATOM   2584 N  N   . PRO A 1 350 ? 15.884  28.274 46.419  1.00 34.14 ? 338 PRO A N   1 
ATOM   2585 C  CA  . PRO A 1 350 ? 14.661  28.574 45.658  1.00 32.42 ? 338 PRO A CA  1 
ATOM   2586 C  C   . PRO A 1 350 ? 13.489  27.740 46.155  1.00 31.31 ? 338 PRO A C   1 
ATOM   2587 O  O   . PRO A 1 350 ? 13.645  26.585 46.495  1.00 30.19 ? 338 PRO A O   1 
ATOM   2588 C  CB  . PRO A 1 350 ? 15.014  28.210 44.219  1.00 32.49 ? 338 PRO A CB  1 
ATOM   2589 C  CG  . PRO A 1 350 ? 16.563  28.112 44.177  1.00 34.55 ? 338 PRO A CG  1 
ATOM   2590 C  CD  . PRO A 1 350 ? 17.066  27.951 45.574  1.00 34.00 ? 338 PRO A CD  1 
ATOM   2591 N  N   . ALA A 1 351 ? 12.316  28.344 46.202  1.00 31.05 ? 339 ALA A N   1 
ATOM   2592 C  CA  . ALA A 1 351 ? 11.111  27.696 46.699  1.00 30.56 ? 339 ALA A CA  1 
ATOM   2593 C  C   . ALA A 1 351 ? 10.042  27.757 45.632  1.00 29.80 ? 339 ALA A C   1 
ATOM   2594 O  O   . ALA A 1 351 ? 9.908   28.796 44.974  1.00 30.97 ? 339 ALA A O   1 
ATOM   2595 C  CB  . ALA A 1 351 ? 10.624  28.388 47.989  1.00 30.32 ? 339 ALA A CB  1 
ATOM   2596 N  N   . VAL A 1 352 ? 9.312   26.648 45.428  1.00 27.84 ? 340 VAL A N   1 
ATOM   2597 C  CA  . VAL A 1 352 ? 8.141   26.641 44.605  1.00 26.53 ? 340 VAL A CA  1 
ATOM   2598 C  C   . VAL A 1 352 ? 6.963   26.473 45.585  1.00 27.98 ? 340 VAL A C   1 
ATOM   2599 O  O   . VAL A 1 352 ? 6.888   25.490 46.371  1.00 28.30 ? 340 VAL A O   1 
ATOM   2600 C  CB  . VAL A 1 352 ? 8.191   25.537 43.511  1.00 26.46 ? 340 VAL A CB  1 
ATOM   2601 C  CG1 . VAL A 1 352 ? 6.899   25.541 42.652  1.00 21.54 ? 340 VAL A CG1 1 
ATOM   2602 C  CG2 . VAL A 1 352 ? 9.484   25.688 42.626  1.00 23.52 ? 340 VAL A CG2 1 
ATOM   2603 N  N   . ILE A 1 353 ? 6.072   27.466 45.601  1.00 28.00 ? 341 ILE A N   1 
ATOM   2604 C  CA  . ILE A 1 353 ? 5.068   27.577 46.657  1.00 27.11 ? 341 ILE A CA  1 
ATOM   2605 C  C   . ILE A 1 353 ? 3.693   27.402 46.018  1.00 28.21 ? 341 ILE A C   1 
ATOM   2606 O  O   . ILE A 1 353 ? 3.301   28.222 45.211  1.00 29.38 ? 341 ILE A O   1 
ATOM   2607 C  CB  . ILE A 1 353 ? 5.183   28.919 47.407  1.00 28.25 ? 341 ILE A CB  1 
ATOM   2608 C  CG1 . ILE A 1 353 ? 6.615   29.147 47.927  1.00 30.40 ? 341 ILE A CG1 1 
ATOM   2609 C  CG2 . ILE A 1 353 ? 4.191   28.994 48.606  1.00 26.98 ? 341 ILE A CG2 1 
ATOM   2610 C  CD1 . ILE A 1 353 ? 6.899   30.596 48.362  1.00 28.68 ? 341 ILE A CD1 1 
ATOM   2611 N  N   . ASP A 1 354 ? 2.965   26.348 46.408  1.00 29.05 ? 342 ASP A N   1 
ATOM   2612 C  CA  . ASP A 1 354 ? 1.686   25.972 45.793  1.00 29.55 ? 342 ASP A CA  1 
ATOM   2613 C  C   . ASP A 1 354 ? 0.626   25.688 46.870  1.00 29.45 ? 342 ASP A C   1 
ATOM   2614 O  O   . ASP A 1 354 ? 0.959   25.415 48.048  1.00 29.09 ? 342 ASP A O   1 
ATOM   2615 C  CB  . ASP A 1 354 ? 1.904   24.730 44.913  1.00 29.49 ? 342 ASP A CB  1 
ATOM   2616 C  CG  . ASP A 1 354 ? 0.655   24.315 44.050  1.00 33.80 ? 342 ASP A CG  1 
ATOM   2617 O  OD1 . ASP A 1 354 ? -0.211  25.200 43.743  1.00 38.24 ? 342 ASP A OD1 1 
ATOM   2618 O  OD2 . ASP A 1 354 ? 0.552   23.073 43.693  1.00 33.01 ? 342 ASP A OD2 1 
ATOM   2619 N  N   . ALA A 1 355 ? -0.633  25.754 46.438  1.00 28.68 ? 343 ALA A N   1 
ATOM   2620 C  CA  . ALA A 1 355 ? -1.768  25.102 47.102  1.00 28.93 ? 343 ALA A CA  1 
ATOM   2621 C  C   . ALA A 1 355 ? -1.852  25.615 48.534  1.00 28.84 ? 343 ALA A C   1 
ATOM   2622 O  O   . ALA A 1 355 ? -1.879  26.847 48.763  1.00 29.50 ? 343 ALA A O   1 
ATOM   2623 C  CB  . ALA A 1 355 ? -1.638  23.504 47.015  1.00 28.75 ? 343 ALA A CB  1 
ATOM   2624 N  N   . ASP A 1 356 ? -1.825  24.715 49.502  1.00 29.36 ? 344 ASP A N   1 
ATOM   2625 C  CA  . ASP A 1 356 ? -2.027  25.113 50.897  1.00 30.47 ? 344 ASP A CA  1 
ATOM   2626 C  C   . ASP A 1 356 ? -0.931  25.961 51.489  1.00 30.05 ? 344 ASP A C   1 
ATOM   2627 O  O   . ASP A 1 356 ? -1.211  26.756 52.385  1.00 31.97 ? 344 ASP A O   1 
ATOM   2628 C  CB  . ASP A 1 356 ? -2.261  23.897 51.771  1.00 31.21 ? 344 ASP A CB  1 
ATOM   2629 C  CG  . ASP A 1 356 ? -3.703  23.389 51.687  1.00 34.13 ? 344 ASP A CG  1 
ATOM   2630 O  OD1 . ASP A 1 356 ? -4.653  24.232 51.660  1.00 38.73 ? 344 ASP A OD1 1 
ATOM   2631 O  OD2 . ASP A 1 356 ? -3.848  22.145 51.621  1.00 36.75 ? 344 ASP A OD2 1 
ATOM   2632 N  N   . ALA A 1 357 ? 0.306   25.820 51.001  1.00 28.94 ? 345 ALA A N   1 
ATOM   2633 C  CA  . ALA A 1 357 ? 1.391   26.763 51.354  1.00 29.11 ? 345 ALA A CA  1 
ATOM   2634 C  C   . ALA A 1 357 ? 1.061   28.208 50.925  1.00 30.53 ? 345 ALA A C   1 
ATOM   2635 O  O   . ALA A 1 357 ? 1.374   29.148 51.646  1.00 31.53 ? 345 ALA A O   1 
ATOM   2636 C  CB  . ALA A 1 357 ? 2.730   26.302 50.799  1.00 28.29 ? 345 ALA A CB  1 
ATOM   2637 N  N   . ILE A 1 358 ? 0.355   28.388 49.796  1.00 30.34 ? 346 ILE A N   1 
ATOM   2638 C  CA  . ILE A 1 358 ? -0.170  29.734 49.427  1.00 30.53 ? 346 ILE A CA  1 
ATOM   2639 C  C   . ILE A 1 358 ? -1.269  30.196 50.387  1.00 31.92 ? 346 ILE A C   1 
ATOM   2640 O  O   . ILE A 1 358 ? -1.235  31.313 50.879  1.00 32.12 ? 346 ILE A O   1 
ATOM   2641 C  CB  . ILE A 1 358 ? -0.665  29.790 47.961  1.00 30.99 ? 346 ILE A CB  1 
ATOM   2642 C  CG1 . ILE A 1 358 ? 0.481   29.435 47.002  1.00 30.10 ? 346 ILE A CG1 1 
ATOM   2643 C  CG2 . ILE A 1 358 ? -1.208  31.229 47.578  1.00 31.08 ? 346 ILE A CG2 1 
ATOM   2644 C  CD1 . ILE A 1 358 ? 0.059   29.262 45.554  1.00 26.79 ? 346 ILE A CD1 1 
ATOM   2645 N  N   . ASN A 1 359 ? -2.245  29.344 50.640  1.00 32.21 ? 347 ASN A N   1 
ATOM   2646 C  CA  . ASN A 1 359 ? -3.372  29.653 51.556  1.00 34.05 ? 347 ASN A CA  1 
ATOM   2647 C  C   . ASN A 1 359 ? -2.935  30.111 52.956  1.00 34.92 ? 347 ASN A C   1 
ATOM   2648 O  O   . ASN A 1 359 ? -3.657  30.797 53.593  1.00 36.04 ? 347 ASN A O   1 
ATOM   2649 C  CB  . ASN A 1 359 ? -4.325  28.418 51.697  1.00 32.78 ? 347 ASN A CB  1 
ATOM   2650 C  CG  . ASN A 1 359 ? -5.020  28.078 50.396  1.00 33.76 ? 347 ASN A CG  1 
ATOM   2651 O  OD1 . ASN A 1 359 ? -5.282  28.971 49.581  1.00 35.75 ? 347 ASN A OD1 1 
ATOM   2652 N  ND2 . ASN A 1 359 ? -5.296  26.789 50.165  1.00 31.22 ? 347 ASN A ND2 1 
ATOM   2653 N  N   . VAL A 1 360 ? -1.765  29.693 53.436  1.00 34.44 ? 348 VAL A N   1 
ATOM   2654 C  CA  . VAL A 1 360 ? -1.300  30.084 54.748  1.00 35.44 ? 348 VAL A CA  1 
ATOM   2655 C  C   . VAL A 1 360 ? -0.154  31.076 54.699  1.00 35.44 ? 348 VAL A C   1 
ATOM   2656 O  O   . VAL A 1 360 ? 0.318   31.512 55.726  1.00 35.77 ? 348 VAL A O   1 
ATOM   2657 C  CB  . VAL A 1 360 ? -0.912  28.836 55.603  1.00 35.06 ? 348 VAL A CB  1 
ATOM   2658 C  CG1 . VAL A 1 360 ? -2.094  27.870 55.685  1.00 37.13 ? 348 VAL A CG1 1 
ATOM   2659 C  CG2 . VAL A 1 360 ? 0.344   28.136 55.066  1.00 32.84 ? 348 VAL A CG2 1 
ATOM   2660 N  N   . LEU A 1 361 ? 0.289   31.428 53.502  1.00 35.09 ? 349 LEU A N   1 
ATOM   2661 C  CA  . LEU A 1 361 ? 1.454   32.260 53.345  1.00 35.43 ? 349 LEU A CA  1 
ATOM   2662 C  C   . LEU A 1 361 ? 1.277   33.635 53.942  1.00 36.82 ? 349 LEU A C   1 
ATOM   2663 O  O   . LEU A 1 361 ? 0.274   34.295 53.728  1.00 36.22 ? 349 LEU A O   1 
ATOM   2664 C  CB  . LEU A 1 361 ? 1.803   32.412 51.862  1.00 34.50 ? 349 LEU A CB  1 
ATOM   2665 C  CG  . LEU A 1 361 ? 3.151   33.026 51.486  1.00 34.41 ? 349 LEU A CG  1 
ATOM   2666 C  CD1 . LEU A 1 361 ? 4.282   32.229 52.141  1.00 36.16 ? 349 LEU A CD1 1 
ATOM   2667 C  CD2 . LEU A 1 361 ? 3.299   33.060 49.947  1.00 34.50 ? 349 LEU A CD2 1 
ATOM   2668 N  N   . ASP A 1 362 ? 2.275   34.064 54.691  1.00 37.63 ? 350 ASP A N   1 
ATOM   2669 C  CA  . ASP A 1 362 ? 2.395   35.462 55.064  1.00 40.06 ? 350 ASP A CA  1 
ATOM   2670 C  C   . ASP A 1 362 ? 3.269   36.162 54.002  1.00 40.85 ? 350 ASP A C   1 
ATOM   2671 O  O   . ASP A 1 362 ? 4.443   35.859 53.842  1.00 39.80 ? 350 ASP A O   1 
ATOM   2672 C  CB  . ASP A 1 362 ? 3.013   35.529 56.470  1.00 41.57 ? 350 ASP A CB  1 
ATOM   2673 C  CG  . ASP A 1 362 ? 3.249   36.929 56.957  1.00 44.38 ? 350 ASP A CG  1 
ATOM   2674 O  OD1 . ASP A 1 362 ? 3.082   37.910 56.194  1.00 45.84 ? 350 ASP A OD1 1 
ATOM   2675 O  OD2 . ASP A 1 362 ? 3.619   37.022 58.133  1.00 49.64 ? 350 ASP A OD2 1 
ATOM   2676 N  N   . THR A 1 363 ? 2.713   37.101 53.255  1.00 43.31 ? 351 THR A N   1 
ATOM   2677 C  CA  . THR A 1 363 ? 3.492   37.639 52.126  1.00 44.20 ? 351 THR A CA  1 
ATOM   2678 C  C   . THR A 1 363 ? 4.697   38.496 52.570  1.00 45.21 ? 351 THR A C   1 
ATOM   2679 O  O   . THR A 1 363 ? 5.619   38.709 51.780  1.00 45.07 ? 351 THR A O   1 
ATOM   2680 C  CB  . THR A 1 363 ? 2.633   38.402 51.111  1.00 44.42 ? 351 THR A CB  1 
ATOM   2681 O  OG1 . THR A 1 363 ? 2.113   39.526 51.748  1.00 47.07 ? 351 THR A OG1 1 
ATOM   2682 C  CG2 . THR A 1 363 ? 1.485   37.551 50.597  1.00 43.82 ? 351 THR A CG2 1 
ATOM   2683 N  N   . SER A 1 364 ? 4.701   38.947 53.822  1.00 46.88 ? 352 SER A N   1 
ATOM   2684 C  CA  . SER A 1 364 ? 5.889   39.599 54.419  1.00 49.04 ? 352 SER A CA  1 
ATOM   2685 C  C   . SER A 1 364 ? 7.102   38.715 54.301  1.00 48.42 ? 352 SER A C   1 
ATOM   2686 O  O   . SER A 1 364 ? 8.186   39.172 53.983  1.00 48.91 ? 352 SER A O   1 
ATOM   2687 C  CB  . SER A 1 364 ? 5.678   39.856 55.910  1.00 49.88 ? 352 SER A CB  1 
ATOM   2688 O  OG  . SER A 1 364 ? 4.549   40.666 56.093  1.00 53.35 ? 352 SER A OG  1 
ATOM   2689 N  N   . VAL A 1 365 ? 6.889   37.426 54.539  1.00 45.38 ? 353 VAL A N   1 
ATOM   2690 C  CA  . VAL A 1 365 ? 7.930   36.432 54.388  1.00 45.92 ? 353 VAL A CA  1 
ATOM   2691 C  C   . VAL A 1 365 ? 8.572   36.443 53.020  1.00 44.56 ? 353 VAL A C   1 
ATOM   2692 O  O   . VAL A 1 365 ? 9.772   36.289 52.912  1.00 43.96 ? 353 VAL A O   1 
ATOM   2693 C  CB  . VAL A 1 365 ? 7.402   35.027 54.731  1.00 46.42 ? 353 VAL A CB  1 
ATOM   2694 C  CG1 . VAL A 1 365 ? 8.447   33.951 54.381  1.00 48.44 ? 353 VAL A CG1 1 
ATOM   2695 C  CG2 . VAL A 1 365 ? 6.996   34.962 56.203  1.00 47.35 ? 353 VAL A CG2 1 
ATOM   2696 N  N   . LEU A 1 366 ? 7.802   36.619 51.953  1.00 45.51 ? 354 LEU A N   1 
ATOM   2697 C  CA  . LEU A 1 366 ? 8.414   36.628 50.593  1.00 44.86 ? 354 LEU A CA  1 
ATOM   2698 C  C   . LEU A 1 366 ? 9.320   37.777 50.355  1.00 47.95 ? 354 LEU A C   1 
ATOM   2699 O  O   . LEU A 1 366 ? 10.299  37.666 49.625  1.00 48.87 ? 354 LEU A O   1 
ATOM   2700 C  CB  . LEU A 1 366 ? 7.370   36.790 49.535  1.00 44.41 ? 354 LEU A CB  1 
ATOM   2701 C  CG  . LEU A 1 366 ? 6.599   35.571 49.176  1.00 40.17 ? 354 LEU A CG  1 
ATOM   2702 C  CD1 . LEU A 1 366 ? 5.520   36.023 48.252  1.00 36.05 ? 354 LEU A CD1 1 
ATOM   2703 C  CD2 . LEU A 1 366 ? 7.615   34.586 48.502  1.00 37.86 ? 354 LEU A CD2 1 
ATOM   2704 N  N   . LYS A 1 367 ? 8.954   38.923 50.920  1.00 50.79 ? 355 LYS A N   1 
ATOM   2705 C  CA  . LYS A 1 367 ? 9.769   40.109 50.799  1.00 53.18 ? 355 LYS A CA  1 
ATOM   2706 C  C   . LYS A 1 367 ? 11.065  39.948 51.551  1.00 54.39 ? 355 LYS A C   1 
ATOM   2707 O  O   . LYS A 1 367 ? 12.085  40.493 51.133  1.00 56.58 ? 355 LYS A O   1 
ATOM   2708 C  CB  . LYS A 1 367 ? 9.015   41.330 51.309  1.00 54.17 ? 355 LYS A CB  1 
ATOM   2709 C  CG  . LYS A 1 367 ? 7.693   41.564 50.554  1.00 55.12 ? 355 LYS A CG  1 
ATOM   2710 C  CD  . LYS A 1 367 ? 6.849   42.699 51.175  1.00 57.93 ? 355 LYS A CD  1 
ATOM   2711 C  CE  . LYS A 1 367 ? 5.513   42.976 50.391  1.00 58.49 ? 355 LYS A CE  1 
ATOM   2712 N  NZ  . LYS A 1 367 ? 4.476   41.856 50.426  1.00 56.49 ? 355 LYS A NZ  1 
ATOM   2713 N  N   . GLU A 1 368 ? 11.075  39.212 52.655  1.00 54.40 ? 356 GLU A N   1 
ATOM   2714 C  CA  . GLU A 1 368 ? 12.332  39.108 53.411  1.00 55.14 ? 356 GLU A CA  1 
ATOM   2715 C  C   . GLU A 1 368 ? 13.280  38.029 52.871  1.00 52.99 ? 356 GLU A C   1 
ATOM   2716 O  O   . GLU A 1 368 ? 14.448  38.020 53.217  1.00 53.67 ? 356 GLU A O   1 
ATOM   2717 C  CB  . GLU A 1 368 ? 12.083  38.964 54.930  1.00 56.66 ? 356 GLU A CB  1 
ATOM   2718 C  CG  . GLU A 1 368 ? 11.548  37.574 55.401  1.00 61.21 ? 356 GLU A CG  1 
ATOM   2719 C  CD  . GLU A 1 368 ? 11.107  37.575 56.899  1.00 66.10 ? 356 GLU A CD  1 
ATOM   2720 O  OE1 . GLU A 1 368 ? 9.880   37.656 57.206  1.00 68.10 ? 356 GLU A OE1 1 
ATOM   2721 O  OE2 . GLU A 1 368 ? 12.000  37.501 57.771  1.00 71.23 ? 356 GLU A OE2 1 
ATOM   2722 N  N   . ARG A 1 369 ? 12.798  37.135 52.006  1.00 50.17 ? 357 ARG A N   1 
ATOM   2723 C  CA  . ARG A 1 369 ? 13.617  36.030 51.528  1.00 48.27 ? 357 ARG A CA  1 
ATOM   2724 C  C   . ARG A 1 369 ? 14.686  36.596 50.617  1.00 48.27 ? 357 ARG A C   1 
ATOM   2725 O  O   . ARG A 1 369 ? 14.393  37.427 49.770  1.00 47.97 ? 357 ARG A O   1 
ATOM   2726 C  CB  . ARG A 1 369 ? 12.763  34.999 50.752  1.00 46.58 ? 357 ARG A CB  1 
ATOM   2727 C  CG  . ARG A 1 369 ? 11.851  34.174 51.661  1.00 45.46 ? 357 ARG A CG  1 
ATOM   2728 C  CD  . ARG A 1 369 ? 11.099  33.008 50.964  1.00 40.67 ? 357 ARG A CD  1 
ATOM   2729 N  NE  . ARG A 1 369 ? 11.844  32.389 49.861  1.00 39.42 ? 357 ARG A NE  1 
ATOM   2730 C  CZ  . ARG A 1 369 ? 12.679  31.383 49.977  1.00 39.06 ? 357 ARG A CZ  1 
ATOM   2731 N  NH1 . ARG A 1 369 ? 12.907  30.816 51.151  1.00 39.35 ? 357 ARG A NH1 1 
ATOM   2732 N  NH2 . ARG A 1 369 ? 13.291  30.926 48.904  1.00 41.27 ? 357 ARG A NH2 1 
ATOM   2733 N  N   . LYS A 1 370 ? 15.916  36.158 50.801  1.00 48.23 ? 358 LYS A N   1 
ATOM   2734 C  CA  . LYS A 1 370 ? 16.989  36.496 49.873  1.00 49.72 ? 358 LYS A CA  1 
ATOM   2735 C  C   . LYS A 1 370 ? 16.900  35.563 48.665  1.00 47.53 ? 358 LYS A C   1 
ATOM   2736 O  O   . LYS A 1 370 ? 17.227  35.942 47.571  1.00 48.65 ? 358 LYS A O   1 
ATOM   2737 C  CB  . LYS A 1 370 ? 18.388  36.326 50.505  1.00 50.96 ? 358 LYS A CB  1 
ATOM   2738 C  CG  . LYS A 1 370 ? 18.563  36.913 51.909  1.00 55.72 ? 358 LYS A CG  1 
ATOM   2739 C  CD  . LYS A 1 370 ? 18.326  38.410 51.971  1.00 59.80 ? 358 LYS A CD  1 
ATOM   2740 C  CE  . LYS A 1 370 ? 18.686  38.949 53.353  1.00 63.20 ? 358 LYS A CE  1 
ATOM   2741 N  NZ  . LYS A 1 370 ? 19.050  40.379 53.291  1.00 65.27 ? 358 LYS A NZ  1 
ATOM   2742 N  N   . SER A 1 371 ? 16.467  34.331 48.883  1.00 45.39 ? 359 SER A N   1 
ATOM   2743 C  CA  . SER A 1 371 ? 16.373  33.361 47.811  1.00 42.93 ? 359 SER A CA  1 
ATOM   2744 C  C   . SER A 1 371 ? 15.104  33.564 46.960  1.00 40.10 ? 359 SER A C   1 
ATOM   2745 O  O   . SER A 1 371 ? 14.119  34.102 47.419  1.00 39.80 ? 359 SER A O   1 
ATOM   2746 C  CB  . SER A 1 371 ? 16.396  31.957 48.391  1.00 42.22 ? 359 SER A CB  1 
ATOM   2747 O  OG  . SER A 1 371 ? 17.709  31.513 48.616  1.00 44.42 ? 359 SER A OG  1 
ATOM   2748 N  N   . PRO A 1 372 ? 15.129  33.073 45.711  1.00 38.46 ? 360 PRO A N   1 
ATOM   2749 C  CA  . PRO A 1 372 ? 13.971  33.175 44.796  1.00 36.49 ? 360 PRO A CA  1 
ATOM   2750 C  C   . PRO A 1 372 ? 12.763  32.307 45.195  1.00 34.12 ? 360 PRO A C   1 
ATOM   2751 O  O   . PRO A 1 372 ? 12.889  31.369 45.989  1.00 33.49 ? 360 PRO A O   1 
ATOM   2752 C  CB  . PRO A 1 372 ? 14.518  32.717 43.462  1.00 36.64 ? 360 PRO A CB  1 
ATOM   2753 C  CG  . PRO A 1 372 ? 15.978  32.274 43.720  1.00 38.05 ? 360 PRO A CG  1 
ATOM   2754 C  CD  . PRO A 1 372 ? 16.339  32.483 45.094  1.00 37.50 ? 360 PRO A CD  1 
ATOM   2755 N  N   . ALA A 1 373 ? 11.611  32.663 44.653  1.00 32.50 ? 361 ALA A N   1 
ATOM   2756 C  CA  . ALA A 1 373 ? 10.410  31.867 44.783  1.00 32.26 ? 361 ALA A CA  1 
ATOM   2757 C  C   . ALA A 1 373 ? 9.581   31.957 43.523  1.00 31.16 ? 361 ALA A C   1 
ATOM   2758 O  O   . ALA A 1 373 ? 9.525   33.020 42.870  1.00 31.83 ? 361 ALA A O   1 
ATOM   2759 C  CB  . ALA A 1 373 ? 9.566   32.340 45.965  1.00 31.98 ? 361 ALA A CB  1 
ATOM   2760 N  N   . VAL A 1 374 ? 8.831   30.895 43.275  1.00 29.04 ? 362 VAL A N   1 
ATOM   2761 C  CA  . VAL A 1 374 ? 7.752   30.896 42.324  1.00 29.17 ? 362 VAL A CA  1 
ATOM   2762 C  C   . VAL A 1 374 ? 6.468   30.525 43.076  1.00 29.12 ? 362 VAL A C   1 
ATOM   2763 O  O   . VAL A 1 374 ? 6.460   29.540 43.809  1.00 29.90 ? 362 VAL A O   1 
ATOM   2764 C  CB  . VAL A 1 374 ? 7.958   29.817 41.227  1.00 28.26 ? 362 VAL A CB  1 
ATOM   2765 C  CG1 . VAL A 1 374 ? 6.770   29.778 40.283  1.00 29.17 ? 362 VAL A CG1 1 
ATOM   2766 C  CG2 . VAL A 1 374 ? 9.269   29.996 40.512  1.00 29.57 ? 362 VAL A CG2 1 
ATOM   2767 N  N   . LEU A 1 375 ? 5.386   31.291 42.867  1.00 29.24 ? 363 LEU A N   1 
ATOM   2768 C  CA  . LEU A 1 375 ? 4.060   30.988 43.427  1.00 28.63 ? 363 LEU A CA  1 
ATOM   2769 C  C   . LEU A 1 375 ? 3.142   30.561 42.332  1.00 27.67 ? 363 LEU A C   1 
ATOM   2770 O  O   . LEU A 1 375 ? 3.161   31.172 41.269  1.00 28.15 ? 363 LEU A O   1 
ATOM   2771 C  CB  . LEU A 1 375 ? 3.465   32.186 44.148  1.00 29.61 ? 363 LEU A CB  1 
ATOM   2772 C  CG  . LEU A 1 375 ? 3.975   32.450 45.564  1.00 32.05 ? 363 LEU A CG  1 
ATOM   2773 C  CD1 . LEU A 1 375 ? 5.444   32.922 45.507  1.00 30.82 ? 363 LEU A CD1 1 
ATOM   2774 C  CD2 . LEU A 1 375 ? 3.036   33.443 46.310  1.00 33.71 ? 363 LEU A CD2 1 
ATOM   2775 N  N   . THR A 1 376 ? 2.360   29.504 42.562  1.00 27.01 ? 364 THR A N   1 
ATOM   2776 C  CA  . THR A 1 376 ? 1.512   28.922 41.521  1.00 27.09 ? 364 THR A CA  1 
ATOM   2777 C  C   . THR A 1 376 ? 0.042   28.828 41.919  1.00 27.50 ? 364 THR A C   1 
ATOM   2778 O  O   . THR A 1 376 ? -0.526  27.726 41.930  1.00 29.06 ? 364 THR A O   1 
ATOM   2779 C  CB  . THR A 1 376 ? 1.987   27.489 41.170  1.00 28.64 ? 364 THR A CB  1 
ATOM   2780 O  OG1 . THR A 1 376 ? 1.839   26.631 42.329  1.00 29.58 ? 364 THR A OG1 1 
ATOM   2781 C  CG2 . THR A 1 376 ? 3.463   27.537 40.725  1.00 28.17 ? 364 THR A CG2 1 
ATOM   2782 N  N   . PRO A 1 377 ? -0.617  29.971 42.187  1.00 26.67 ? 365 PRO A N   1 
ATOM   2783 C  CA  . PRO A 1 377 ? -2.039  29.926 42.543  1.00 27.39 ? 365 PRO A CA  1 
ATOM   2784 C  C   . PRO A 1 377 ? -2.992  29.806 41.348  1.00 27.68 ? 365 PRO A C   1 
ATOM   2785 O  O   . PRO A 1 377 ? -2.705  30.356 40.274  1.00 26.63 ? 365 PRO A O   1 
ATOM   2786 C  CB  . PRO A 1 377 ? -2.261  31.289 43.205  1.00 28.23 ? 365 PRO A CB  1 
ATOM   2787 C  CG  . PRO A 1 377 ? -1.351  32.211 42.434  1.00 27.33 ? 365 PRO A CG  1 
ATOM   2788 C  CD  . PRO A 1 377 ? -0.127  31.353 42.076  1.00 26.67 ? 365 PRO A CD  1 
ATOM   2789 N  N   . HIS A 1 378 ? -4.122  29.104 41.548  1.00 27.70 ? 366 HIS A N   1 
ATOM   2790 C  CA  . HIS A 1 378 ? -5.316  29.366 40.738  1.00 27.78 ? 366 HIS A CA  1 
ATOM   2791 C  C   . HIS A 1 378 ? -5.992  30.655 41.262  1.00 29.10 ? 366 HIS A C   1 
ATOM   2792 O  O   . HIS A 1 378 ? -5.586  31.195 42.311  1.00 28.13 ? 366 HIS A O   1 
ATOM   2793 C  CB  . HIS A 1 378 ? -6.265  28.151 40.629  1.00 28.71 ? 366 HIS A CB  1 
ATOM   2794 C  CG  . HIS A 1 378 ? -6.857  27.684 41.920  1.00 27.56 ? 366 HIS A CG  1 
ATOM   2795 N  ND1 . HIS A 1 378 ? -7.801  28.415 42.608  1.00 31.52 ? 366 HIS A ND1 1 
ATOM   2796 C  CD2 . HIS A 1 378 ? -6.679  26.537 42.622  1.00 29.43 ? 366 HIS A CD2 1 
ATOM   2797 C  CE1 . HIS A 1 378 ? -8.162  27.748 43.700  1.00 32.46 ? 366 HIS A CE1 1 
ATOM   2798 N  NE2 . HIS A 1 378 ? -7.496  26.607 43.735  1.00 30.29 ? 366 HIS A NE2 1 
ATOM   2799 N  N   . PRO A 1 379 ? -6.960  31.190 40.519  1.00 29.31 ? 367 PRO A N   1 
ATOM   2800 C  CA  . PRO A 1 379 ? -7.552  32.461 40.921  1.00 30.05 ? 367 PRO A CA  1 
ATOM   2801 C  C   . PRO A 1 379 ? -8.161  32.500 42.321  1.00 29.61 ? 367 PRO A C   1 
ATOM   2802 O  O   . PRO A 1 379 ? -8.140  33.538 42.950  1.00 28.79 ? 367 PRO A O   1 
ATOM   2803 C  CB  . PRO A 1 379 ? -8.656  32.686 39.858  1.00 30.73 ? 367 PRO A CB  1 
ATOM   2804 C  CG  . PRO A 1 379 ? -8.063  32.027 38.586  1.00 30.50 ? 367 PRO A CG  1 
ATOM   2805 C  CD  . PRO A 1 379 ? -7.447  30.761 39.182  1.00 31.06 ? 367 PRO A CD  1 
ATOM   2806 N  N   . GLY A 1 380 ? -8.751  31.412 42.773  1.00 29.79 ? 368 GLY A N   1 
ATOM   2807 C  CA  . GLY A 1 380 ? -9.295  31.370 44.146  1.00 30.85 ? 368 GLY A CA  1 
ATOM   2808 C  C   . GLY A 1 380 ? -8.193  31.562 45.185  1.00 31.13 ? 368 GLY A C   1 
ATOM   2809 O  O   . GLY A 1 380 ? -8.336  32.305 46.168  1.00 31.09 ? 368 GLY A O   1 
ATOM   2810 N  N   . GLU A 1 381 ? -7.071  30.910 44.955  1.00 30.99 ? 369 GLU A N   1 
ATOM   2811 C  CA  . GLU A 1 381 ? -5.923  31.053 45.835  1.00 31.49 ? 369 GLU A CA  1 
ATOM   2812 C  C   . GLU A 1 381 ? -5.316  32.457 45.749  1.00 31.40 ? 369 GLU A C   1 
ATOM   2813 O  O   . GLU A 1 381 ? -4.916  33.017 46.761  1.00 31.24 ? 369 GLU A O   1 
ATOM   2814 C  CB  . GLU A 1 381 ? -4.853  29.990 45.461  1.00 30.82 ? 369 GLU A CB  1 
ATOM   2815 C  CG  . GLU A 1 381 ? -5.149  28.605 46.033  1.00 30.60 ? 369 GLU A CG  1 
ATOM   2816 C  CD  . GLU A 1 381 ? -4.456  27.451 45.283  1.00 32.86 ? 369 GLU A CD  1 
ATOM   2817 O  OE1 . GLU A 1 381 ? -3.854  27.689 44.225  1.00 28.01 ? 369 GLU A OE1 1 
ATOM   2818 O  OE2 . GLU A 1 381 ? -4.547  26.300 45.758  1.00 33.88 ? 369 GLU A OE2 1 
ATOM   2819 N  N   . MET A 1 382 ? -5.210  33.005 44.536  1.00 31.26 ? 370 MET A N   1 
ATOM   2820 C  CA  . MET A 1 382 ? -4.730  34.392 44.350  1.00 31.90 ? 370 MET A CA  1 
ATOM   2821 C  C   . MET A 1 382 ? -5.678  35.382 45.020  1.00 32.80 ? 370 MET A C   1 
ATOM   2822 O  O   . MET A 1 382 ? -5.263  36.310 45.692  1.00 33.64 ? 370 MET A O   1 
ATOM   2823 C  CB  . MET A 1 382 ? -4.697  34.734 42.865  1.00 32.24 ? 370 MET A CB  1 
ATOM   2824 C  CG  . MET A 1 382 ? -4.111  36.106 42.530  1.00 33.62 ? 370 MET A CG  1 
ATOM   2825 S  SD  . MET A 1 382 ? -2.365  36.190 42.992  1.00 39.68 ? 370 MET A SD  1 
ATOM   2826 C  CE  . MET A 1 382 ? -2.049  37.915 42.510  1.00 41.42 ? 370 MET A CE  1 
ATOM   2827 N  N   . ALA A 1 383 ? -6.969  35.193 44.808  1.00 32.46 ? 371 ALA A N   1 
ATOM   2828 C  CA  . ALA A 1 383 ? -7.971  36.037 45.461  1.00 34.56 ? 371 ALA A CA  1 
ATOM   2829 C  C   . ALA A 1 383 ? -7.738  36.066 46.989  1.00 35.77 ? 371 ALA A C   1 
ATOM   2830 O  O   . ALA A 1 383 ? -7.621  37.114 47.572  1.00 36.00 ? 371 ALA A O   1 
ATOM   2831 C  CB  . ALA A 1 383 ? -9.405  35.507 45.137  1.00 33.02 ? 371 ALA A CB  1 
ATOM   2832 N  N   . ARG A 1 384 ? -7.677  34.900 47.633  1.00 37.52 ? 372 ARG A N   1 
ATOM   2833 C  CA  . ARG A 1 384 ? -7.428  34.837 49.092  1.00 40.01 ? 372 ARG A CA  1 
ATOM   2834 C  C   . ARG A 1 384 ? -6.066  35.463 49.417  1.00 39.52 ? 372 ARG A C   1 
ATOM   2835 O  O   . ARG A 1 384 ? -5.952  36.164 50.377  1.00 38.03 ? 372 ARG A O   1 
ATOM   2836 C  CB  . ARG A 1 384 ? -7.462  33.392 49.631  1.00 40.74 ? 372 ARG A CB  1 
ATOM   2837 C  CG  . ARG A 1 384 ? -8.878  32.821 49.827  1.00 46.96 ? 372 ARG A CG  1 
ATOM   2838 C  CD  . ARG A 1 384 ? -8.927  31.420 50.525  1.00 49.78 ? 372 ARG A CD  1 
ATOM   2839 N  NE  . ARG A 1 384 ? -8.227  30.364 49.769  1.00 54.94 ? 372 ARG A NE  1 
ATOM   2840 C  CZ  . ARG A 1 384 ? -8.736  29.655 48.756  1.00 55.89 ? 372 ARG A CZ  1 
ATOM   2841 N  NH1 . ARG A 1 384 ? -9.980  29.865 48.320  1.00 59.22 ? 372 ARG A NH1 1 
ATOM   2842 N  NH2 . ARG A 1 384 ? -7.996  28.739 48.159  1.00 54.09 ? 372 ARG A NH2 1 
ATOM   2843 N  N   . LEU A 1 385 ? -5.046  35.225 48.589  1.00 38.30 ? 373 LEU A N   1 
ATOM   2844 C  CA  . LEU A 1 385 ? -3.723  35.749 48.906  1.00 39.22 ? 373 LEU A CA  1 
ATOM   2845 C  C   . LEU A 1 385 ? -3.698  37.298 48.942  1.00 39.78 ? 373 LEU A C   1 
ATOM   2846 O  O   . LEU A 1 385 ? -3.106  37.865 49.837  1.00 40.71 ? 373 LEU A O   1 
ATOM   2847 C  CB  . LEU A 1 385 ? -2.684  35.217 47.911  1.00 39.52 ? 373 LEU A CB  1 
ATOM   2848 C  CG  . LEU A 1 385 ? -1.176  35.500 48.131  1.00 41.21 ? 373 LEU A CG  1 
ATOM   2849 C  CD1 . LEU A 1 385 ? -0.722  34.900 49.419  1.00 40.65 ? 373 LEU A CD1 1 
ATOM   2850 C  CD2 . LEU A 1 385 ? -0.358  34.989 46.966  1.00 39.48 ? 373 LEU A CD2 1 
ATOM   2851 N  N   . VAL A 1 386 ? -4.347  37.990 47.996  1.00 37.69 ? 374 VAL A N   1 
ATOM   2852 C  CA  . VAL A 1 386 ? -4.307  39.455 47.997  1.00 36.24 ? 374 VAL A CA  1 
ATOM   2853 C  C   . VAL A 1 386 ? -5.615  40.023 48.573  1.00 36.46 ? 374 VAL A C   1 
ATOM   2854 O  O   . VAL A 1 386 ? -5.835  41.229 48.574  1.00 36.50 ? 374 VAL A O   1 
ATOM   2855 C  CB  . VAL A 1 386 ? -4.015  40.012 46.582  1.00 36.28 ? 374 VAL A CB  1 
ATOM   2856 C  CG1 . VAL A 1 386 ? -2.628  39.467 46.065  1.00 33.98 ? 374 VAL A CG1 1 
ATOM   2857 C  CG2 . VAL A 1 386 ? -5.154  39.607 45.621  1.00 33.21 ? 374 VAL A CG2 1 
ATOM   2858 N  N   . LYS A 1 387 ? -6.512  39.162 49.048  1.00 36.02 ? 375 LYS A N   1 
ATOM   2859 C  CA  . LYS A 1 387 ? -7.782  39.672 49.675  1.00 37.61 ? 375 LYS A CA  1 
ATOM   2860 C  C   . LYS A 1 387 ? -8.702  40.423 48.691  1.00 36.98 ? 375 LYS A C   1 
ATOM   2861 O  O   . LYS A 1 387 ? -9.297  41.441 49.030  1.00 37.82 ? 375 LYS A O   1 
ATOM   2862 C  CB  . LYS A 1 387 ? -7.479  40.540 50.916  1.00 38.29 ? 375 LYS A CB  1 
ATOM   2863 C  CG  . LYS A 1 387 ? -6.683  39.758 51.931  1.00 41.77 ? 375 LYS A CG  1 
ATOM   2864 C  CD  . LYS A 1 387 ? -6.435  40.496 53.193  1.00 49.56 ? 375 LYS A CD  1 
ATOM   2865 C  CE  . LYS A 1 387 ? -6.123  39.502 54.283  1.00 53.63 ? 375 LYS A CE  1 
ATOM   2866 N  NZ  . LYS A 1 387 ? -7.424  38.951 54.803  1.00 59.29 ? 375 LYS A NZ  1 
ATOM   2867 N  N   . LYS A 1 388 ? -8.847  39.876 47.493  1.00 35.43 ? 376 LYS A N   1 
ATOM   2868 C  CA  . LYS A 1 388 ? -9.776  40.401 46.514  1.00 36.21 ? 376 LYS A CA  1 
ATOM   2869 C  C   . LYS A 1 388 ? -10.748 39.287 46.073  1.00 35.79 ? 376 LYS A C   1 
ATOM   2870 O  O   . LYS A 1 388 ? -10.670 38.170 46.551  1.00 34.61 ? 376 LYS A O   1 
ATOM   2871 C  CB  . LYS A 1 388 ? -8.974  40.927 45.337  1.00 36.55 ? 376 LYS A CB  1 
ATOM   2872 C  CG  . LYS A 1 388 ? -8.118  42.160 45.751  1.00 38.92 ? 376 LYS A CG  1 
ATOM   2873 C  CD  . LYS A 1 388 ? -7.235  42.562 44.609  1.00 41.30 ? 376 LYS A CD  1 
ATOM   2874 C  CE  . LYS A 1 388 ? -6.095  43.460 45.077  1.00 45.82 ? 376 LYS A CE  1 
ATOM   2875 N  NZ  . LYS A 1 388 ? -6.557  44.844 45.107  1.00 45.18 ? 376 LYS A NZ  1 
ATOM   2876 N  N   . THR A 1 389 ? -11.676 39.599 45.181  1.00 35.90 ? 377 THR A N   1 
ATOM   2877 C  CA  . THR A 1 389 ? -12.629 38.627 44.709  1.00 36.01 ? 377 THR A CA  1 
ATOM   2878 C  C   . THR A 1 389 ? -11.942 37.904 43.556  1.00 34.93 ? 377 THR A C   1 
ATOM   2879 O  O   . THR A 1 389 ? -10.995 38.444 42.943  1.00 35.15 ? 377 THR A O   1 
ATOM   2880 C  CB  . THR A 1 389 ? -13.911 39.314 44.215  1.00 37.76 ? 377 THR A CB  1 
ATOM   2881 O  OG1 . THR A 1 389 ? -13.589 40.016 43.016  1.00 36.49 ? 377 THR A OG1 1 
ATOM   2882 C  CG2 . THR A 1 389 ? -14.483 40.324 45.270  1.00 37.93 ? 377 THR A CG2 1 
ATOM   2883 N  N   . VAL A 1 390 ? -12.378 36.675 43.300  1.00 35.03 ? 378 VAL A N   1 
ATOM   2884 C  CA  . VAL A 1 390 ? -11.938 35.903 42.132  1.00 34.74 ? 378 VAL A CA  1 
ATOM   2885 C  C   . VAL A 1 390 ? -12.080 36.721 40.846  1.00 35.83 ? 378 VAL A C   1 
ATOM   2886 O  O   . VAL A 1 390 ? -11.159 36.771 40.059  1.00 36.18 ? 378 VAL A O   1 
ATOM   2887 C  CB  . VAL A 1 390 ? -12.725 34.585 41.988  1.00 35.60 ? 378 VAL A CB  1 
ATOM   2888 C  CG1 . VAL A 1 390 ? -12.364 33.862 40.673  1.00 34.16 ? 378 VAL A CG1 1 
ATOM   2889 C  CG2 . VAL A 1 390 ? -12.485 33.657 43.220  1.00 34.39 ? 378 VAL A CG2 1 
ATOM   2890 N  N   . GLY A 1 391 ? -13.240 37.340 40.632  1.00 36.59 ? 379 GLY A N   1 
ATOM   2891 C  CA  . GLY A 1 391 ? -13.504 38.201 39.478  1.00 36.98 ? 379 GLY A CA  1 
ATOM   2892 C  C   . GLY A 1 391 ? -12.537 39.375 39.278  1.00 37.31 ? 379 GLY A C   1 
ATOM   2893 O  O   . GLY A 1 391 ? -12.251 39.738 38.162  1.00 36.85 ? 379 GLY A O   1 
ATOM   2894 N  N   . ASP A 1 392 ? -12.010 39.939 40.353  1.00 37.49 ? 380 ASP A N   1 
ATOM   2895 C  CA  . ASP A 1 392 ? -11.045 41.016 40.272  1.00 37.83 ? 380 ASP A CA  1 
ATOM   2896 C  C   . ASP A 1 392 ? -9.634  40.521 39.922  1.00 36.12 ? 380 ASP A C   1 
ATOM   2897 O  O   . ASP A 1 392 ? -8.854  41.288 39.393  1.00 37.51 ? 380 ASP A O   1 
ATOM   2898 C  CB  . ASP A 1 392 ? -10.949 41.724 41.630  1.00 40.09 ? 380 ASP A CB  1 
ATOM   2899 C  CG  . ASP A 1 392 ? -12.166 42.654 41.932  1.00 47.74 ? 380 ASP A CG  1 
ATOM   2900 O  OD1 . ASP A 1 392 ? -12.950 43.031 40.988  1.00 53.69 ? 380 ASP A OD1 1 
ATOM   2901 O  OD2 . ASP A 1 392 ? -12.305 43.010 43.133  1.00 55.89 ? 380 ASP A OD2 1 
ATOM   2902 N  N   . VAL A 1 393 ? -9.288  39.270 40.225  1.00 33.03 ? 381 VAL A N   1 
ATOM   2903 C  CA  . VAL A 1 393 ? -7.937  38.787 40.002  1.00 32.08 ? 381 VAL A CA  1 
ATOM   2904 C  C   . VAL A 1 393 ? -7.853  37.926 38.740  1.00 31.43 ? 381 VAL A C   1 
ATOM   2905 O  O   . VAL A 1 393 ? -6.791  37.819 38.152  1.00 29.65 ? 381 VAL A O   1 
ATOM   2906 C  CB  . VAL A 1 393 ? -7.338  37.991 41.210  1.00 31.74 ? 381 VAL A CB  1 
ATOM   2907 C  CG1 . VAL A 1 393 ? -7.539  38.731 42.524  1.00 28.16 ? 381 VAL A CG1 1 
ATOM   2908 C  CG2 . VAL A 1 393 ? -7.899  36.609 41.295  1.00 32.14 ? 381 VAL A CG2 1 
ATOM   2909 N  N   . LYS A 1 394 ? -8.974  37.344 38.313  1.00 31.69 ? 382 LYS A N   1 
ATOM   2910 C  CA  . LYS A 1 394 ? -8.908  36.398 37.220  1.00 32.23 ? 382 LYS A CA  1 
ATOM   2911 C  C   . LYS A 1 394 ? -8.462  37.101 35.934  1.00 31.13 ? 382 LYS A C   1 
ATOM   2912 O  O   . LYS A 1 394 ? -9.069  38.057 35.534  1.00 30.39 ? 382 LYS A O   1 
ATOM   2913 C  CB  . LYS A 1 394 ? -10.272 35.767 36.963  1.00 33.27 ? 382 LYS A CB  1 
ATOM   2914 C  CG  . LYS A 1 394 ? -10.099 34.451 36.254  1.00 37.76 ? 382 LYS A CG  1 
ATOM   2915 C  CD  . LYS A 1 394 ? -11.413 33.759 35.987  1.00 45.13 ? 382 LYS A CD  1 
ATOM   2916 C  CE  . LYS A 1 394 ? -11.123 32.539 35.055  1.00 45.54 ? 382 LYS A CE  1 
ATOM   2917 N  NZ  . LYS A 1 394 ? -12.365 32.136 34.335  1.00 49.50 ? 382 LYS A NZ  1 
ATOM   2918 N  N   . TYR A 1 395 ? -7.434  36.595 35.277  1.00 30.06 ? 383 TYR A N   1 
ATOM   2919 C  CA  . TYR A 1 395 ? -6.884  37.239 34.039  1.00 30.40 ? 383 TYR A CA  1 
ATOM   2920 C  C   . TYR A 1 395 ? -6.412  38.665 34.257  1.00 31.43 ? 383 TYR A C   1 
ATOM   2921 O  O   . TYR A 1 395 ? -6.277  39.411 33.300  1.00 30.60 ? 383 TYR A O   1 
ATOM   2922 C  CB  . TYR A 1 395 ? -7.888  37.197 32.877  1.00 30.63 ? 383 TYR A CB  1 
ATOM   2923 C  CG  . TYR A 1 395 ? -8.202  35.793 32.444  1.00 30.79 ? 383 TYR A CG  1 
ATOM   2924 C  CD1 . TYR A 1 395 ? -7.178  34.887 32.230  1.00 28.95 ? 383 TYR A CD1 1 
ATOM   2925 C  CD2 . TYR A 1 395 ? -9.528  35.352 32.283  1.00 31.45 ? 383 TYR A CD2 1 
ATOM   2926 C  CE1 . TYR A 1 395 ? -7.435  33.593 31.856  1.00 30.23 ? 383 TYR A CE1 1 
ATOM   2927 C  CE2 . TYR A 1 395 ? -9.803  34.009 31.908  1.00 29.99 ? 383 TYR A CE2 1 
ATOM   2928 C  CZ  . TYR A 1 395 ? -8.747  33.147 31.710  1.00 31.37 ? 383 TYR A CZ  1 
ATOM   2929 O  OH  . TYR A 1 395 ? -8.935  31.828 31.333  1.00 31.39 ? 383 TYR A OH  1 
ATOM   2930 N  N   . ASN A 1 396 ? -6.166  39.051 35.521  1.00 31.41 ? 384 ASN A N   1 
ATOM   2931 C  CA  . ASN A 1 396 ? -5.718  40.417 35.804  1.00 32.18 ? 384 ASN A CA  1 
ATOM   2932 C  C   . ASN A 1 396 ? -4.192  40.435 35.745  1.00 31.69 ? 384 ASN A C   1 
ATOM   2933 O  O   . ASN A 1 396 ? -3.502  40.225 36.754  1.00 31.02 ? 384 ASN A O   1 
ATOM   2934 C  CB  . ASN A 1 396 ? -6.230  40.852 37.178  1.00 32.76 ? 384 ASN A CB  1 
ATOM   2935 C  CG  . ASN A 1 396 ? -6.055  42.362 37.412  1.00 34.79 ? 384 ASN A CG  1 
ATOM   2936 O  OD1 . ASN A 1 396 ? -5.182  43.012 36.812  1.00 36.99 ? 384 ASN A OD1 1 
ATOM   2937 N  ND2 . ASN A 1 396 ? -6.874  42.906 38.286  1.00 31.98 ? 384 ASN A ND2 1 
ATOM   2938 N  N   . TYR A 1 397 ? -3.657  40.563 34.542  1.00 30.65 ? 385 TYR A N   1 
ATOM   2939 C  CA  . TYR A 1 397 ? -2.203  40.466 34.387  1.00 30.76 ? 385 TYR A CA  1 
ATOM   2940 C  C   . TYR A 1 397 ? -1.488  41.643 35.051  1.00 30.91 ? 385 TYR A C   1 
ATOM   2941 O  O   . TYR A 1 397 ? -0.397  41.446 35.542  1.00 31.29 ? 385 TYR A O   1 
ATOM   2942 C  CB  . TYR A 1 397 ? -1.770  40.313 32.925  1.00 29.06 ? 385 TYR A CB  1 
ATOM   2943 C  CG  . TYR A 1 397 ? -2.281  41.404 32.025  1.00 34.02 ? 385 TYR A CG  1 
ATOM   2944 C  CD1 . TYR A 1 397 ? -3.526  41.309 31.436  1.00 33.15 ? 385 TYR A CD1 1 
ATOM   2945 C  CD2 . TYR A 1 397 ? -1.532  42.571 31.801  1.00 39.10 ? 385 TYR A CD2 1 
ATOM   2946 C  CE1 . TYR A 1 397 ? -4.018  42.324 30.623  1.00 38.84 ? 385 TYR A CE1 1 
ATOM   2947 C  CE2 . TYR A 1 397 ? -2.021  43.613 30.986  1.00 40.46 ? 385 TYR A CE2 1 
ATOM   2948 C  CZ  . TYR A 1 397 ? -3.263  43.462 30.398  1.00 41.07 ? 385 TYR A CZ  1 
ATOM   2949 O  OH  . TYR A 1 397 ? -3.767  44.415 29.578  1.00 40.11 ? 385 TYR A OH  1 
ATOM   2950 N  N   . GLU A 1 398 ? -2.083  42.840 35.096  1.00 32.55 ? 386 GLU A N   1 
ATOM   2951 C  CA  . GLU A 1 398 ? -1.411  43.971 35.753  1.00 35.17 ? 386 GLU A CA  1 
ATOM   2952 C  C   . GLU A 1 398 ? -1.282  43.753 37.252  1.00 34.90 ? 386 GLU A C   1 
ATOM   2953 O  O   . GLU A 1 398 ? -0.251  44.052 37.805  1.00 35.27 ? 386 GLU A O   1 
ATOM   2954 C  CB  . GLU A 1 398 ? -2.094  45.315 35.462  1.00 36.54 ? 386 GLU A CB  1 
ATOM   2955 C  CG  . GLU A 1 398 ? -1.972  45.681 33.970  1.00 41.12 ? 386 GLU A CG  1 
ATOM   2956 C  CD  . GLU A 1 398 ? -2.591  46.996 33.625  1.00 46.81 ? 386 GLU A CD  1 
ATOM   2957 O  OE1 . GLU A 1 398 ? -3.578  47.340 34.254  1.00 51.90 ? 386 GLU A OE1 1 
ATOM   2958 O  OE2 . GLU A 1 398 ? -2.123  47.660 32.699  1.00 52.99 ? 386 GLU A OE2 1 
ATOM   2959 N  N   . LEU A 1 399 ? -2.301  43.191 37.892  1.00 34.65 ? 387 LEU A N   1 
ATOM   2960 C  CA  . LEU A 1 399 ? -2.190  42.834 39.300  1.00 34.60 ? 387 LEU A CA  1 
ATOM   2961 C  C   . LEU A 1 399 ? -1.168  41.734 39.498  1.00 34.37 ? 387 LEU A C   1 
ATOM   2962 O  O   . LEU A 1 399 ? -0.386  41.781 40.447  1.00 34.26 ? 387 LEU A O   1 
ATOM   2963 C  CB  . LEU A 1 399 ? -3.519  42.355 39.833  1.00 35.45 ? 387 LEU A CB  1 
ATOM   2964 C  CG  . LEU A 1 399 ? -3.560  41.957 41.320  1.00 37.95 ? 387 LEU A CG  1 
ATOM   2965 C  CD1 . LEU A 1 399 ? -3.409  43.171 42.242  1.00 36.90 ? 387 LEU A CD1 1 
ATOM   2966 C  CD2 . LEU A 1 399 ? -4.872  41.212 41.583  1.00 40.59 ? 387 LEU A CD2 1 
ATOM   2967 N  N   . ALA A 1 400 ? -1.143  40.734 38.615  1.00 32.30 ? 388 ALA A N   1 
ATOM   2968 C  CA  . ALA A 1 400 ? -0.093  39.723 38.751  1.00 31.86 ? 388 ALA A CA  1 
ATOM   2969 C  C   . ALA A 1 400 ? 1.310   40.336 38.675  1.00 32.53 ? 388 ALA A C   1 
ATOM   2970 O  O   . ALA A 1 400 ? 2.201   39.968 39.476  1.00 32.47 ? 388 ALA A O   1 
ATOM   2971 C  CB  . ALA A 1 400 ? -0.238  38.640 37.740  1.00 30.52 ? 388 ALA A CB  1 
ATOM   2972 N  N   . GLU A 1 401 ? 1.518   41.224 37.695  1.00 32.96 ? 389 GLU A N   1 
ATOM   2973 C  CA  . GLU A 1 401 ? 2.799   41.929 37.538  1.00 34.30 ? 389 GLU A CA  1 
ATOM   2974 C  C   . GLU A 1 401 ? 3.207   42.711 38.802  1.00 35.81 ? 389 GLU A C   1 
ATOM   2975 O  O   . GLU A 1 401 ? 4.363   42.612 39.236  1.00 34.83 ? 389 GLU A O   1 
ATOM   2976 C  CB  . GLU A 1 401 ? 2.789   42.862 36.301  1.00 34.73 ? 389 GLU A CB  1 
ATOM   2977 C  CG  . GLU A 1 401 ? 2.743   42.041 35.017  1.00 36.80 ? 389 GLU A CG  1 
ATOM   2978 C  CD  . GLU A 1 401 ? 2.243   42.781 33.792  1.00 38.34 ? 389 GLU A CD  1 
ATOM   2979 O  OE1 . GLU A 1 401 ? 1.818   43.937 33.901  1.00 39.87 ? 389 GLU A OE1 1 
ATOM   2980 O  OE2 . GLU A 1 401 ? 2.313   42.187 32.693  1.00 39.52 ? 389 GLU A OE2 1 
ATOM   2981 N  N   . GLU A 1 402 ? 2.292   43.523 39.336  1.00 37.30 ? 390 GLU A N   1 
ATOM   2982 C  CA  . GLU A 1 402 ? 2.568   44.288 40.569  1.00 38.61 ? 390 GLU A CA  1 
ATOM   2983 C  C   . GLU A 1 402 ? 2.926   43.371 41.723  1.00 37.29 ? 390 GLU A C   1 
ATOM   2984 O  O   . GLU A 1 402 ? 3.836   43.652 42.481  1.00 37.14 ? 390 GLU A O   1 
ATOM   2985 C  CB  . GLU A 1 402 ? 1.332   44.981 41.075  1.00 39.91 ? 390 GLU A CB  1 
ATOM   2986 C  CG  . GLU A 1 402 ? 0.819   46.105 40.285  1.00 49.36 ? 390 GLU A CG  1 
ATOM   2987 C  CD  . GLU A 1 402 ? -0.491  46.619 40.909  1.00 58.60 ? 390 GLU A CD  1 
ATOM   2988 O  OE1 . GLU A 1 402 ? -0.472  46.803 42.165  1.00 62.66 ? 390 GLU A OE1 1 
ATOM   2989 O  OE2 . GLU A 1 402 ? -1.508  46.795 40.157  1.00 62.49 ? 390 GLU A OE2 1 
ATOM   2990 N  N   . PHE A 1 403 ? 2.139   42.312 41.911  1.00 35.42 ? 391 PHE A N   1 
ATOM   2991 C  CA  . PHE A 1 403 ? 2.433   41.378 42.972  1.00 35.29 ? 391 PHE A CA  1 
ATOM   2992 C  C   . PHE A 1 403 ? 3.851   40.789 42.823  1.00 34.94 ? 391 PHE A C   1 
ATOM   2993 O  O   . PHE A 1 403 ? 4.601   40.691 43.820  1.00 35.21 ? 391 PHE A O   1 
ATOM   2994 C  CB  . PHE A 1 403 ? 1.387   40.273 43.014  1.00 34.24 ? 391 PHE A CB  1 
ATOM   2995 C  CG  . PHE A 1 403 ? 1.584   39.308 44.169  1.00 35.14 ? 391 PHE A CG  1 
ATOM   2996 C  CD1 . PHE A 1 403 ? 1.004   39.554 45.414  1.00 36.64 ? 391 PHE A CD1 1 
ATOM   2997 C  CD2 . PHE A 1 403 ? 2.397   38.205 44.024  1.00 32.76 ? 391 PHE A CD2 1 
ATOM   2998 C  CE1 . PHE A 1 403 ? 1.196   38.693 46.475  1.00 36.61 ? 391 PHE A CE1 1 
ATOM   2999 C  CE2 . PHE A 1 403 ? 2.593   37.327 45.100  1.00 33.84 ? 391 PHE A CE2 1 
ATOM   3000 C  CZ  . PHE A 1 403 ? 2.001   37.575 46.314  1.00 34.04 ? 391 PHE A CZ  1 
ATOM   3001 N  N   . ALA A 1 404 ? 4.200   40.361 41.605  1.00 34.06 ? 392 ALA A N   1 
ATOM   3002 C  CA  . ALA A 1 404 ? 5.486   39.700 41.370  1.00 34.65 ? 392 ALA A CA  1 
ATOM   3003 C  C   . ALA A 1 404 ? 6.590   40.700 41.677  1.00 36.48 ? 392 ALA A C   1 
ATOM   3004 O  O   . ALA A 1 404 ? 7.547   40.396 42.388  1.00 35.88 ? 392 ALA A O   1 
ATOM   3005 C  CB  . ALA A 1 404 ? 5.609   39.169 39.907  1.00 34.09 ? 392 ALA A CB  1 
ATOM   3006 N  N   . LYS A 1 405 ? 6.409   41.919 41.182  1.00 38.53 ? 393 LYS A N   1 
ATOM   3007 C  CA  . LYS A 1 405 ? 7.410   42.971 41.358  1.00 41.29 ? 393 LYS A CA  1 
ATOM   3008 C  C   . LYS A 1 405 ? 7.552   43.343 42.868  1.00 41.20 ? 393 LYS A C   1 
ATOM   3009 O  O   . LYS A 1 405 ? 8.642   43.368 43.395  1.00 42.17 ? 393 LYS A O   1 
ATOM   3010 C  CB  . LYS A 1 405 ? 7.065   44.181 40.474  1.00 42.15 ? 393 LYS A CB  1 
ATOM   3011 C  CG  . LYS A 1 405 ? 8.086   45.279 40.531  1.00 47.84 ? 393 LYS A CG  1 
ATOM   3012 C  CD  . LYS A 1 405 ? 7.741   46.422 39.613  1.00 54.64 ? 393 LYS A CD  1 
ATOM   3013 C  CE  . LYS A 1 405 ? 9.021   47.115 39.053  1.00 59.47 ? 393 LYS A CE  1 
ATOM   3014 N  NZ  . LYS A 1 405 ? 9.553   48.226 39.913  1.00 62.97 ? 393 LYS A NZ  1 
ATOM   3015 N  N   . GLU A 1 406 ? 6.452   43.602 43.557  1.00 41.29 ? 394 GLU A N   1 
ATOM   3016 C  CA  . GLU A 1 406 ? 6.479   43.933 45.000  1.00 42.45 ? 394 GLU A CA  1 
ATOM   3017 C  C   . GLU A 1 406 ? 7.032   42.853 45.919  1.00 41.06 ? 394 GLU A C   1 
ATOM   3018 O  O   . GLU A 1 406 ? 7.552   43.151 46.998  1.00 39.61 ? 394 GLU A O   1 
ATOM   3019 C  CB  . GLU A 1 406 ? 5.079   44.220 45.523  1.00 42.98 ? 394 GLU A CB  1 
ATOM   3020 C  CG  . GLU A 1 406 ? 4.433   45.356 44.817  1.00 51.35 ? 394 GLU A CG  1 
ATOM   3021 C  CD  . GLU A 1 406 ? 3.198   45.869 45.535  1.00 58.97 ? 394 GLU A CD  1 
ATOM   3022 O  OE1 . GLU A 1 406 ? 2.783   47.029 45.250  1.00 61.67 ? 394 GLU A OE1 1 
ATOM   3023 O  OE2 . GLU A 1 406 ? 2.665   45.099 46.379  1.00 64.57 ? 394 GLU A OE2 1 
ATOM   3024 N  N   . ASN A 1 407 ? 6.849   41.597 45.531  1.00 39.44 ? 395 ASN A N   1 
ATOM   3025 C  CA  . ASN A 1 407 ? 7.257   40.494 46.392  1.00 39.93 ? 395 ASN A CA  1 
ATOM   3026 C  C   . ASN A 1 407 ? 8.497   39.785 45.884  1.00 39.31 ? 395 ASN A C   1 
ATOM   3027 O  O   . ASN A 1 407 ? 8.883   38.756 46.431  1.00 39.97 ? 395 ASN A O   1 
ATOM   3028 C  CB  . ASN A 1 407 ? 6.104   39.511 46.555  1.00 38.81 ? 395 ASN A CB  1 
ATOM   3029 C  CG  . ASN A 1 407 ? 4.981   40.078 47.383  1.00 41.12 ? 395 ASN A CG  1 
ATOM   3030 O  OD1 . ASN A 1 407 ? 5.123   40.201 48.592  1.00 47.97 ? 395 ASN A OD1 1 
ATOM   3031 N  ND2 . ASN A 1 407 ? 3.862   40.439 46.748  1.00 37.25 ? 395 ASN A ND2 1 
ATOM   3032 N  N   . ASP A 1 408 ? 9.112   40.330 44.841  1.00 40.04 ? 396 ASP A N   1 
ATOM   3033 C  CA  . ASP A 1 408 ? 10.326  39.758 44.266  1.00 40.77 ? 396 ASP A CA  1 
ATOM   3034 C  C   . ASP A 1 408 ? 10.195  38.277 43.903  1.00 39.00 ? 396 ASP A C   1 
ATOM   3035 O  O   . ASP A 1 408 ? 11.093  37.519 44.183  1.00 38.70 ? 396 ASP A O   1 
ATOM   3036 C  CB  . ASP A 1 408 ? 11.515  39.873 45.225  1.00 42.60 ? 396 ASP A CB  1 
ATOM   3037 C  CG  . ASP A 1 408 ? 11.850  41.288 45.556  1.00 48.51 ? 396 ASP A CG  1 
ATOM   3038 O  OD1 . ASP A 1 408 ? 11.595  42.176 44.704  1.00 55.80 ? 396 ASP A OD1 1 
ATOM   3039 O  OD2 . ASP A 1 408 ? 12.381  41.533 46.672  1.00 59.39 ? 396 ASP A OD2 1 
ATOM   3040 N  N   . CYS A 1 409 ? 9.105   37.889 43.270  1.00 36.58 ? 397 CYS A N   1 
ATOM   3041 C  CA  . CYS A 1 409 ? 8.887   36.482 42.938  1.00 36.16 ? 397 CYS A CA  1 
ATOM   3042 C  C   . CYS A 1 409 ? 8.443   36.327 41.501  1.00 35.07 ? 397 CYS A C   1 
ATOM   3043 O  O   . CYS A 1 409 ? 8.284   37.304 40.798  1.00 35.75 ? 397 CYS A O   1 
ATOM   3044 C  CB  . CYS A 1 409 ? 7.841   35.865 43.872  1.00 35.25 ? 397 CYS A CB  1 
ATOM   3045 S  SG  . CYS A 1 409 ? 6.224   36.579 43.756  1.00 37.99 ? 397 CYS A SG  1 
ATOM   3046 N  N   . VAL A 1 410 ? 8.276   35.083 41.066  1.00 35.13 ? 398 VAL A N   1 
ATOM   3047 C  CA  . VAL A 1 410 ? 7.617   34.781 39.817  1.00 33.70 ? 398 VAL A CA  1 
ATOM   3048 C  C   . VAL A 1 410 ? 6.246   34.330 40.231  1.00 33.35 ? 398 VAL A C   1 
ATOM   3049 O  O   . VAL A 1 410 ? 6.091   33.513 41.148  1.00 33.82 ? 398 VAL A O   1 
ATOM   3050 C  CB  . VAL A 1 410 ? 8.300   33.664 39.006  1.00 33.20 ? 398 VAL A CB  1 
ATOM   3051 C  CG1 . VAL A 1 410 ? 7.403   33.274 37.819  1.00 29.76 ? 398 VAL A CG1 1 
ATOM   3052 C  CG2 . VAL A 1 410 ? 9.687   34.108 38.520  1.00 34.40 ? 398 VAL A CG2 1 
ATOM   3053 N  N   . LEU A 1 411 ? 5.249   34.861 39.543  1.00 32.64 ? 399 LEU A N   1 
ATOM   3054 C  CA  . LEU A 1 411 ? 3.872   34.473 39.764  1.00 31.49 ? 399 LEU A CA  1 
ATOM   3055 C  C   . LEU A 1 411 ? 3.347   33.756 38.551  1.00 30.38 ? 399 LEU A C   1 
ATOM   3056 O  O   . LEU A 1 411 ? 3.468   34.226 37.406  1.00 30.29 ? 399 LEU A O   1 
ATOM   3057 C  CB  . LEU A 1 411 ? 3.033   35.713 40.080  1.00 32.11 ? 399 LEU A CB  1 
ATOM   3058 C  CG  . LEU A 1 411 ? 1.633   35.404 40.594  1.00 33.90 ? 399 LEU A CG  1 
ATOM   3059 C  CD1 . LEU A 1 411 ? 1.655   34.690 41.991  1.00 32.78 ? 399 LEU A CD1 1 
ATOM   3060 C  CD2 . LEU A 1 411 ? 0.926   36.725 40.648  1.00 36.53 ? 399 LEU A CD2 1 
ATOM   3061 N  N   . VAL A 1 412 ? 2.825   32.567 38.795  1.00 29.61 ? 400 VAL A N   1 
ATOM   3062 C  CA  . VAL A 1 412 ? 2.196   31.752 37.782  1.00 28.59 ? 400 VAL A CA  1 
ATOM   3063 C  C   . VAL A 1 412 ? 0.725   31.667 38.158  1.00 28.51 ? 400 VAL A C   1 
ATOM   3064 O  O   . VAL A 1 412 ? 0.345   30.845 38.983  1.00 28.05 ? 400 VAL A O   1 
ATOM   3065 C  CB  . VAL A 1 412 ? 2.803   30.322 37.702  1.00 27.88 ? 400 VAL A CB  1 
ATOM   3066 C  CG1 . VAL A 1 412 ? 2.053   29.418 36.681  1.00 25.33 ? 400 VAL A CG1 1 
ATOM   3067 C  CG2 . VAL A 1 412 ? 4.347   30.387 37.404  1.00 27.45 ? 400 VAL A CG2 1 
ATOM   3068 N  N   . LEU A 1 413 ? -0.092  32.501 37.525  1.00 27.94 ? 401 LEU A N   1 
ATOM   3069 C  CA  . LEU A 1 413 ? -1.547  32.539 37.771  1.00 27.43 ? 401 LEU A CA  1 
ATOM   3070 C  C   . LEU A 1 413 ? -2.255  31.612 36.804  1.00 26.66 ? 401 LEU A C   1 
ATOM   3071 O  O   . LEU A 1 413 ? -2.358  31.913 35.622  1.00 25.63 ? 401 LEU A O   1 
ATOM   3072 C  CB  . LEU A 1 413 ? -2.069  33.969 37.598  1.00 28.00 ? 401 LEU A CB  1 
ATOM   3073 C  CG  . LEU A 1 413 ? -3.574  34.138 37.880  1.00 28.82 ? 401 LEU A CG  1 
ATOM   3074 C  CD1 . LEU A 1 413 ? -3.946  33.753 39.302  1.00 28.12 ? 401 LEU A CD1 1 
ATOM   3075 C  CD2 . LEU A 1 413 ? -4.029  35.549 37.543  1.00 28.65 ? 401 LEU A CD2 1 
ATOM   3076 N  N   . LYS A 1 414 ? -2.699  30.461 37.317  1.00 26.93 ? 402 LYS A N   1 
ATOM   3077 C  CA  . LYS A 1 414 ? -3.242  29.362 36.502  1.00 28.32 ? 402 LYS A CA  1 
ATOM   3078 C  C   . LYS A 1 414 ? -4.683  29.623 36.000  1.00 28.48 ? 402 LYS A C   1 
ATOM   3079 O  O   . LYS A 1 414 ? -5.464  30.210 36.709  1.00 31.92 ? 402 LYS A O   1 
ATOM   3080 C  CB  . LYS A 1 414 ? -3.167  28.074 37.286  1.00 27.50 ? 402 LYS A CB  1 
ATOM   3081 C  CG  . LYS A 1 414 ? -1.742  27.743 37.574  1.00 30.94 ? 402 LYS A CG  1 
ATOM   3082 C  CD  . LYS A 1 414 ? -1.446  26.477 38.359  1.00 37.19 ? 402 LYS A CD  1 
ATOM   3083 C  CE  . LYS A 1 414 ? -2.288  26.268 39.563  1.00 36.99 ? 402 LYS A CE  1 
ATOM   3084 N  NZ  . LYS A 1 414 ? -1.547  25.303 40.446  1.00 35.24 ? 402 LYS A NZ  1 
ATOM   3085 N  N   . SER A 1 415 ? -4.978  29.271 34.760  1.00 26.70 ? 403 SER A N   1 
ATOM   3086 C  CA  . SER A 1 415 ? -6.336  29.321 34.188  1.00 26.95 ? 403 SER A CA  1 
ATOM   3087 C  C   . SER A 1 415 ? -6.180  28.793 32.768  1.00 26.22 ? 403 SER A C   1 
ATOM   3088 O  O   . SER A 1 415 ? -5.061  28.432 32.369  1.00 26.06 ? 403 SER A O   1 
ATOM   3089 C  CB  . SER A 1 415 ? -6.909  30.765 34.164  1.00 28.59 ? 403 SER A CB  1 
ATOM   3090 O  OG  . SER A 1 415 ? -7.415  31.196 35.429  1.00 28.89 ? 403 SER A OG  1 
ATOM   3091 N  N   . ALA A 1 416 ? -7.249  28.774 31.985  1.00 26.28 ? 404 ALA A N   1 
ATOM   3092 C  CA  . ALA A 1 416 ? -7.144  28.184 30.664  1.00 28.41 ? 404 ALA A CA  1 
ATOM   3093 C  C   . ALA A 1 416 ? -6.043  28.900 29.872  1.00 28.34 ? 404 ALA A C   1 
ATOM   3094 O  O   . ALA A 1 416 ? -5.300  28.238 29.149  1.00 29.86 ? 404 ALA A O   1 
ATOM   3095 C  CB  . ALA A 1 416 ? -8.510  28.159 29.920  1.00 28.53 ? 404 ALA A CB  1 
ATOM   3096 N  N   . THR A 1 417 ? -5.894  30.214 30.072  1.00 27.03 ? 405 THR A N   1 
ATOM   3097 C  CA  . THR A 1 417 ? -4.689  30.912 29.688  1.00 26.74 ? 405 THR A CA  1 
ATOM   3098 C  C   . THR A 1 417 ? -3.970  31.237 30.969  1.00 26.99 ? 405 THR A C   1 
ATOM   3099 O  O   . THR A 1 417 ? -4.549  31.868 31.886  1.00 27.04 ? 405 THR A O   1 
ATOM   3100 C  CB  . THR A 1 417 ? -4.942  32.230 28.922  1.00 28.26 ? 405 THR A CB  1 
ATOM   3101 O  OG1 . THR A 1 417 ? -5.687  31.950 27.716  1.00 29.35 ? 405 THR A OG1 1 
ATOM   3102 C  CG2 . THR A 1 417 ? -3.592  32.936 28.538  1.00 24.70 ? 405 THR A CG2 1 
ATOM   3103 N  N   . THR A 1 418 ? -2.741  30.753 31.076  1.00 25.26 ? 406 THR A N   1 
ATOM   3104 C  CA  . THR A 1 418 ? -1.940  30.944 32.277  1.00 25.42 ? 406 THR A CA  1 
ATOM   3105 C  C   . THR A 1 418 ? -1.011  32.119 32.053  1.00 26.46 ? 406 THR A C   1 
ATOM   3106 O  O   . THR A 1 418 ? -0.472  32.306 30.955  1.00 25.45 ? 406 THR A O   1 
ATOM   3107 C  CB  . THR A 1 418 ? -1.152  29.655 32.631  1.00 26.10 ? 406 THR A CB  1 
ATOM   3108 O  OG1 . THR A 1 418 ? -2.115  28.707 33.066  1.00 26.09 ? 406 THR A OG1 1 
ATOM   3109 C  CG2 . THR A 1 418 ? -0.067  29.863 33.751  1.00 23.80 ? 406 THR A CG2 1 
ATOM   3110 N  N   . ILE A 1 419 ? -0.924  32.963 33.088  1.00 26.79 ? 407 ILE A N   1 
ATOM   3111 C  CA  . ILE A 1 419 ? -0.055  34.127 33.099  1.00 27.24 ? 407 ILE A CA  1 
ATOM   3112 C  C   . ILE A 1 419 ? 1.176   33.837 33.947  1.00 26.73 ? 407 ILE A C   1 
ATOM   3113 O  O   . ILE A 1 419 ? 1.041   33.415 35.080  1.00 27.34 ? 407 ILE A O   1 
ATOM   3114 C  CB  . ILE A 1 419 ? -0.796  35.342 33.689  1.00 26.53 ? 407 ILE A CB  1 
ATOM   3115 C  CG1 . ILE A 1 419 ? -1.968  35.704 32.773  1.00 27.49 ? 407 ILE A CG1 1 
ATOM   3116 C  CG2 . ILE A 1 419 ? 0.164   36.532 33.845  1.00 25.87 ? 407 ILE A CG2 1 
ATOM   3117 C  CD1 . ILE A 1 419 ? -3.051  36.664 33.421  1.00 22.43 ? 407 ILE A CD1 1 
ATOM   3118 N  N   . VAL A 1 420 ? 2.361   34.095 33.406  1.00 27.64 ? 408 VAL A N   1 
ATOM   3119 C  CA  . VAL A 1 420 ? 3.640   33.854 34.075  1.00 27.06 ? 408 VAL A CA  1 
ATOM   3120 C  C   . VAL A 1 420 ? 4.361   35.171 34.061  1.00 28.75 ? 408 VAL A C   1 
ATOM   3121 O  O   . VAL A 1 420 ? 4.587   35.754 32.995  1.00 29.56 ? 408 VAL A O   1 
ATOM   3122 C  CB  . VAL A 1 420 ? 4.486   32.793 33.346  1.00 27.49 ? 408 VAL A CB  1 
ATOM   3123 C  CG1 . VAL A 1 420 ? 5.850   32.602 34.023  1.00 26.84 ? 408 VAL A CG1 1 
ATOM   3124 C  CG2 . VAL A 1 420 ? 3.708   31.444 33.210  1.00 25.37 ? 408 VAL A CG2 1 
ATOM   3125 N  N   . THR A 1 421 ? 4.679   35.713 35.225  1.00 30.46 ? 409 THR A N   1 
ATOM   3126 C  CA  . THR A 1 421 ? 5.334   37.037 35.232  1.00 31.45 ? 409 THR A CA  1 
ATOM   3127 C  C   . THR A 1 421 ? 6.318   37.149 36.391  1.00 31.58 ? 409 THR A C   1 
ATOM   3128 O  O   . THR A 1 421 ? 6.155   36.511 37.402  1.00 30.56 ? 409 THR A O   1 
ATOM   3129 C  CB  . THR A 1 421 ? 4.284   38.178 35.222  1.00 32.14 ? 409 THR A CB  1 
ATOM   3130 O  OG1 . THR A 1 421 ? 4.919   39.448 35.035  1.00 31.69 ? 409 THR A OG1 1 
ATOM   3131 C  CG2 . THR A 1 421 ? 3.410   38.216 36.502  1.00 33.54 ? 409 THR A CG2 1 
ATOM   3132 N  N   . ASP A 1 422 ? 7.380   37.915 36.182  1.00 33.42 ? 410 ASP A N   1 
ATOM   3133 C  CA  . ASP A 1 422 ? 8.242   38.337 37.246  1.00 34.84 ? 410 ASP A CA  1 
ATOM   3134 C  C   . ASP A 1 422 ? 8.110   39.859 37.474  1.00 37.93 ? 410 ASP A C   1 
ATOM   3135 O  O   . ASP A 1 422 ? 8.915   40.475 38.198  1.00 37.27 ? 410 ASP A O   1 
ATOM   3136 C  CB  . ASP A 1 422 ? 9.676   37.989 36.904  1.00 35.50 ? 410 ASP A CB  1 
ATOM   3137 C  CG  . ASP A 1 422 ? 10.196  38.770 35.708  1.00 36.15 ? 410 ASP A CG  1 
ATOM   3138 O  OD1 . ASP A 1 422 ? 9.488   39.623 35.123  1.00 35.55 ? 410 ASP A OD1 1 
ATOM   3139 O  OD2 . ASP A 1 422 ? 11.327  38.497 35.310  1.00 41.22 ? 410 ASP A OD2 1 
ATOM   3140 N  N   . GLY A 1 423 ? 7.107   40.484 36.866  1.00 38.96 ? 411 GLY A N   1 
ATOM   3141 C  CA  . GLY A 1 423 ? 6.936   41.915 37.093  1.00 41.48 ? 411 GLY A CA  1 
ATOM   3142 C  C   . GLY A 1 423 ? 7.546   42.749 35.983  1.00 43.41 ? 411 GLY A C   1 
ATOM   3143 O  O   . GLY A 1 423 ? 7.217   43.893 35.860  1.00 43.46 ? 411 GLY A O   1 
ATOM   3144 N  N   . GLU A 1 424 ? 8.451   42.180 35.191  1.00 44.93 ? 412 GLU A N   1 
ATOM   3145 C  CA  . GLU A 1 424 ? 9.114   42.924 34.110  1.00 47.14 ? 412 GLU A CA  1 
ATOM   3146 C  C   . GLU A 1 424 ? 8.756   42.303 32.782  1.00 45.54 ? 412 GLU A C   1 
ATOM   3147 O  O   . GLU A 1 424 ? 8.559   42.995 31.793  1.00 46.70 ? 412 GLU A O   1 
ATOM   3148 C  CB  . GLU A 1 424 ? 10.650  42.877 34.243  1.00 49.10 ? 412 GLU A CB  1 
ATOM   3149 C  CG  . GLU A 1 424 ? 11.227  43.412 35.553  1.00 55.80 ? 412 GLU A CG  1 
ATOM   3150 C  CD  . GLU A 1 424 ? 10.978  44.904 35.781  1.00 62.43 ? 412 GLU A CD  1 
ATOM   3151 O  OE1 . GLU A 1 424 ? 11.638  45.723 35.137  1.00 67.33 ? 412 GLU A OE1 1 
ATOM   3152 O  OE2 . GLU A 1 424 ? 10.121  45.270 36.625  1.00 70.68 ? 412 GLU A OE2 1 
ATOM   3153 N  N   . LYS A 1 425 ? 8.760   40.982 32.758  1.00 43.65 ? 413 LYS A N   1 
ATOM   3154 C  CA  . LYS A 1 425 ? 8.400   40.208 31.610  1.00 43.25 ? 413 LYS A CA  1 
ATOM   3155 C  C   . LYS A 1 425 ? 7.125   39.415 31.994  1.00 40.81 ? 413 LYS A C   1 
ATOM   3156 O  O   . LYS A 1 425 ? 7.024   38.922 33.105  1.00 40.60 ? 413 LYS A O   1 
ATOM   3157 C  CB  . LYS A 1 425 ? 9.585   39.301 31.288  1.00 43.79 ? 413 LYS A CB  1 
ATOM   3158 C  CG  . LYS A 1 425 ? 9.421   38.473 30.032  1.00 48.12 ? 413 LYS A CG  1 
ATOM   3159 C  CD  . LYS A 1 425 ? 10.775  38.267 29.252  1.00 54.98 ? 413 LYS A CD  1 
ATOM   3160 C  CE  . LYS A 1 425 ? 11.484  36.955 29.573  1.00 57.28 ? 413 LYS A CE  1 
ATOM   3161 N  NZ  . LYS A 1 425 ? 11.895  36.211 28.323  1.00 60.19 ? 413 LYS A NZ  1 
ATOM   3162 N  N   . THR A 1 426 ? 6.148   39.382 31.098  1.00 39.50 ? 414 THR A N   1 
ATOM   3163 C  CA  . THR A 1 426 ? 4.918   38.616 31.254  1.00 38.47 ? 414 THR A CA  1 
ATOM   3164 C  C   . THR A 1 426 ? 4.728   37.731 30.031  1.00 36.86 ? 414 THR A C   1 
ATOM   3165 O  O   . THR A 1 426 ? 4.810   38.223 28.912  1.00 37.30 ? 414 THR A O   1 
ATOM   3166 C  CB  . THR A 1 426 ? 3.707   39.571 31.419  1.00 39.70 ? 414 THR A CB  1 
ATOM   3167 O  OG1 . THR A 1 426 ? 3.905   40.284 32.623  1.00 37.10 ? 414 THR A OG1 1 
ATOM   3168 C  CG2 . THR A 1 426 ? 2.337   38.805 31.466  1.00 37.47 ? 414 THR A CG2 1 
ATOM   3169 N  N   . LEU A 1 427 ? 4.570   36.428 30.270  1.00 34.17 ? 415 LEU A N   1 
ATOM   3170 C  CA  . LEU A 1 427 ? 4.262   35.472 29.238  1.00 33.54 ? 415 LEU A CA  1 
ATOM   3171 C  C   . LEU A 1 427 ? 2.852   34.852 29.396  1.00 31.33 ? 415 LEU A C   1 
ATOM   3172 O  O   . LEU A 1 427 ? 2.353   34.661 30.507  1.00 30.29 ? 415 LEU A O   1 
ATOM   3173 C  CB  . LEU A 1 427 ? 5.339   34.393 29.181  1.00 33.06 ? 415 LEU A CB  1 
ATOM   3174 C  CG  . LEU A 1 427 ? 6.788   34.958 29.120  1.00 37.05 ? 415 LEU A CG  1 
ATOM   3175 C  CD1 . LEU A 1 427 ? 7.470   34.795 30.453  1.00 37.97 ? 415 LEU A CD1 1 
ATOM   3176 C  CD2 . LEU A 1 427 ? 7.630   34.285 28.102  1.00 38.38 ? 415 LEU A CD2 1 
ATOM   3177 N  N   . PHE A 1 428 ? 2.209   34.563 28.275  1.00 31.01 ? 416 PHE A N   1 
ATOM   3178 C  CA  . PHE A 1 428 ? 0.898   33.928 28.312  1.00 29.97 ? 416 PHE A CA  1 
ATOM   3179 C  C   . PHE A 1 428 ? 0.989   32.542 27.713  1.00 29.79 ? 416 PHE A C   1 
ATOM   3180 O  O   . PHE A 1 428 ? 1.504   32.359 26.590  1.00 28.66 ? 416 PHE A O   1 
ATOM   3181 C  CB  . PHE A 1 428 ? -0.111  34.714 27.520  1.00 30.81 ? 416 PHE A CB  1 
ATOM   3182 C  CG  . PHE A 1 428 ? -0.283  36.134 27.969  1.00 31.11 ? 416 PHE A CG  1 
ATOM   3183 C  CD1 . PHE A 1 428 ? -1.092  36.432 29.033  1.00 31.38 ? 416 PHE A CD1 1 
ATOM   3184 C  CD2 . PHE A 1 428 ? 0.339   37.174 27.291  1.00 31.83 ? 416 PHE A CD2 1 
ATOM   3185 C  CE1 . PHE A 1 428 ? -1.275  37.747 29.463  1.00 34.37 ? 416 PHE A CE1 1 
ATOM   3186 C  CE2 . PHE A 1 428 ? 0.168   38.517 27.698  1.00 32.62 ? 416 PHE A CE2 1 
ATOM   3187 C  CZ  . PHE A 1 428 ? -0.647  38.805 28.793  1.00 33.10 ? 416 PHE A CZ  1 
ATOM   3188 N  N   . ASN A 1 429 ? 0.409   31.582 28.416  1.00 28.91 ? 417 ASN A N   1 
ATOM   3189 C  CA  . ASN A 1 429 ? 0.371   30.193 27.925  1.00 27.92 ? 417 ASN A CA  1 
ATOM   3190 C  C   . ASN A 1 429 ? -1.016  29.833 27.437  1.00 28.09 ? 417 ASN A C   1 
ATOM   3191 O  O   . ASN A 1 429 ? -1.993  30.048 28.170  1.00 26.14 ? 417 ASN A O   1 
ATOM   3192 C  CB  . ASN A 1 429 ? 0.753   29.191 29.025  1.00 27.71 ? 417 ASN A CB  1 
ATOM   3193 C  CG  . ASN A 1 429 ? 0.931   27.792 28.456  1.00 27.87 ? 417 ASN A CG  1 
ATOM   3194 O  OD1 . ASN A 1 429 ? 1.844   27.556 27.661  1.00 29.75 ? 417 ASN A OD1 1 
ATOM   3195 N  ND2 . ASN A 1 429 ? 0.000   26.914 28.753  1.00 24.97 ? 417 ASN A ND2 1 
ATOM   3196 N  N   . ILE A 1 430 ? -1.089  29.300 26.207  1.00 28.27 ? 418 ILE A N   1 
ATOM   3197 C  CA  . ILE A 1 430 ? -2.329  28.894 25.623  1.00 29.02 ? 418 ILE A CA  1 
ATOM   3198 C  C   . ILE A 1 430 ? -2.434  27.380 25.296  1.00 29.57 ? 418 ILE A C   1 
ATOM   3199 O  O   . ILE A 1 430 ? -3.376  26.980 24.653  1.00 31.63 ? 418 ILE A O   1 
ATOM   3200 C  CB  . ILE A 1 430 ? -2.640  29.741 24.351  1.00 29.97 ? 418 ILE A CB  1 
ATOM   3201 C  CG1 . ILE A 1 430 ? -1.582  29.531 23.257  1.00 32.72 ? 418 ILE A CG1 1 
ATOM   3202 C  CG2 . ILE A 1 430 ? -2.832  31.247 24.738  1.00 28.94 ? 418 ILE A CG2 1 
ATOM   3203 C  CD1 . ILE A 1 430 ? -1.921  30.243 21.910  1.00 34.29 ? 418 ILE A CD1 1 
ATOM   3204 N  N   . THR A 1 431 ? -1.500  26.541 25.736  1.00 28.48 ? 419 THR A N   1 
ATOM   3205 C  CA  . THR A 1 431 ? -1.655  25.104 25.552  1.00 27.50 ? 419 THR A CA  1 
ATOM   3206 C  C   . THR A 1 431 ? -2.524  24.525 26.625  1.00 27.55 ? 419 THR A C   1 
ATOM   3207 O  O   . THR A 1 431 ? -2.732  25.146 27.669  1.00 28.37 ? 419 THR A O   1 
ATOM   3208 C  CB  . THR A 1 431 ? -0.279  24.365 25.574  1.00 28.02 ? 419 THR A CB  1 
ATOM   3209 O  OG1 . THR A 1 431 ? 0.291   24.422 26.908  1.00 24.96 ? 419 THR A OG1 1 
ATOM   3210 C  CG2 . THR A 1 431 ? 0.655   25.007 24.495  1.00 27.13 ? 419 THR A CG2 1 
ATOM   3211 N  N   . GLY A 1 432 ? -3.040  23.323 26.400  1.00 27.67 ? 420 GLY A N   1 
ATOM   3212 C  CA  . GLY A 1 432 ? -3.880  22.642 27.410  1.00 28.20 ? 420 GLY A CA  1 
ATOM   3213 C  C   . GLY A 1 432 ? -5.317  22.479 26.952  1.00 29.21 ? 420 GLY A C   1 
ATOM   3214 O  O   . GLY A 1 432 ? -5.664  22.885 25.834  1.00 29.68 ? 420 GLY A O   1 
ATOM   3215 N  N   . ASN A 1 433 ? -6.129  21.843 27.789  1.00 28.26 ? 421 ASN A N   1 
ATOM   3216 C  CA  . ASN A 1 433 ? -7.558  21.692 27.509  1.00 28.15 ? 421 ASN A CA  1 
ATOM   3217 C  C   . ASN A 1 433 ? -8.260  21.461 28.842  1.00 28.66 ? 421 ASN A C   1 
ATOM   3218 O  O   . ASN A 1 433 ? -7.592  21.490 29.888  1.00 27.72 ? 421 ASN A O   1 
ATOM   3219 C  CB  . ASN A 1 433 ? -7.806  20.569 26.500  1.00 27.22 ? 421 ASN A CB  1 
ATOM   3220 C  CG  . ASN A 1 433 ? -7.278  19.209 26.974  1.00 27.75 ? 421 ASN A CG  1 
ATOM   3221 O  OD1 . ASN A 1 433 ? -7.367  18.870 28.146  1.00 30.44 ? 421 ASN A OD1 1 
ATOM   3222 N  ND2 . ASN A 1 433 ? -6.737  18.429 26.045  1.00 29.29 ? 421 ASN A ND2 1 
ATOM   3223 N  N   . THR A 1 434 ? -9.580  21.211 28.814  1.00 28.85 ? 422 THR A N   1 
ATOM   3224 C  CA  . THR A 1 434 ? -10.334 21.057 30.050  1.00 28.19 ? 422 THR A CA  1 
ATOM   3225 C  C   . THR A 1 434 ? -10.058 19.768 30.826  1.00 29.42 ? 422 THR A C   1 
ATOM   3226 O  O   . THR A 1 434 ? -10.591 19.607 31.934  1.00 30.03 ? 422 THR A O   1 
ATOM   3227 C  CB  . THR A 1 434 ? -11.847 21.134 29.810  1.00 29.03 ? 422 THR A CB  1 
ATOM   3228 O  OG1 . THR A 1 434 ? -12.295 19.906 29.180  1.00 27.41 ? 422 THR A OG1 1 
ATOM   3229 C  CG2 . THR A 1 434 ? -12.193 22.433 28.949  1.00 27.01 ? 422 THR A CG2 1 
ATOM   3230 N  N   . GLY A 1 435 ? -9.217  18.851 30.299  1.00 28.95 ? 423 GLY A N   1 
ATOM   3231 C  CA  . GLY A 1 435 ? -8.870  17.697 31.088  1.00 29.14 ? 423 GLY A CA  1 
ATOM   3232 C  C   . GLY A 1 435 ? -7.972  18.061 32.270  1.00 29.02 ? 423 GLY A C   1 
ATOM   3233 O  O   . GLY A 1 435 ? -7.818  17.267 33.196  1.00 29.30 ? 423 GLY A O   1 
ATOM   3234 N  N   . LEU A 1 436 ? -7.384  19.261 32.244  1.00 28.35 ? 424 LEU A N   1 
ATOM   3235 C  CA  . LEU A 1 436 ? -6.563  19.756 33.355  1.00 28.01 ? 424 LEU A CA  1 
ATOM   3236 C  C   . LEU A 1 436 ? -7.397  20.375 34.473  1.00 29.36 ? 424 LEU A C   1 
ATOM   3237 O  O   . LEU A 1 436 ? -6.885  20.660 35.537  1.00 28.40 ? 424 LEU A O   1 
ATOM   3238 C  CB  . LEU A 1 436 ? -5.556  20.790 32.830  1.00 27.88 ? 424 LEU A CB  1 
ATOM   3239 C  CG  . LEU A 1 436 ? -4.472  20.303 31.839  1.00 26.58 ? 424 LEU A CG  1 
ATOM   3240 C  CD1 . LEU A 1 436 ? -3.704  21.534 31.322  1.00 23.69 ? 424 LEU A CD1 1 
ATOM   3241 C  CD2 . LEU A 1 436 ? -3.562  19.331 32.518  1.00 25.01 ? 424 LEU A CD2 1 
ATOM   3242 N  N   . SER A 1 437 ? -8.689  20.604 34.222  1.00 30.70 ? 425 SER A N   1 
ATOM   3243 C  CA  . SER A 1 437 ? -9.614  21.103 35.221  1.00 29.84 ? 425 SER A CA  1 
ATOM   3244 C  C   . SER A 1 437 ? -10.113 19.954 36.116  1.00 30.78 ? 425 SER A C   1 
ATOM   3245 O  O   . SER A 1 437 ? -11.325 19.610 36.150  1.00 30.88 ? 425 SER A O   1 
ATOM   3246 C  CB  . SER A 1 437 ? -10.802 21.751 34.534  1.00 31.50 ? 425 SER A CB  1 
ATOM   3247 O  OG  . SER A 1 437 ? -10.389 22.885 33.739  1.00 36.89 ? 425 SER A OG  1 
ATOM   3248 N  N   . LYS A 1 438 ? -9.189  19.408 36.883  1.00 30.58 ? 426 LYS A N   1 
ATOM   3249 C  CA  . LYS A 1 438 ? -9.427  18.236 37.676  1.00 31.65 ? 426 LYS A CA  1 
ATOM   3250 C  C   . LYS A 1 438 ? -8.331  18.146 38.738  1.00 31.96 ? 426 LYS A C   1 
ATOM   3251 O  O   . LYS A 1 438 ? -7.172  18.428 38.483  1.00 32.25 ? 426 LYS A O   1 
ATOM   3252 C  CB  . LYS A 1 438 ? -9.370  17.021 36.736  1.00 32.89 ? 426 LYS A CB  1 
ATOM   3253 C  CG  . LYS A 1 438 ? -10.052 15.768 37.207  1.00 34.37 ? 426 LYS A CG  1 
ATOM   3254 C  CD  . LYS A 1 438 ? -9.848  14.562 36.247  1.00 34.71 ? 426 LYS A CD  1 
ATOM   3255 C  CE  . LYS A 1 438 ? -10.970 14.370 35.198  1.00 34.94 ? 426 LYS A CE  1 
ATOM   3256 N  NZ  . LYS A 1 438 ? -10.769 15.175 33.993  1.00 39.59 ? 426 LYS A NZ  1 
ATOM   3257 N  N   . GLY A 1 439 ? -8.702  17.776 39.947  1.00 32.22 ? 427 GLY A N   1 
ATOM   3258 C  CA  . GLY A 1 439 ? -7.733  17.519 41.015  1.00 31.74 ? 427 GLY A CA  1 
ATOM   3259 C  C   . GLY A 1 439 ? -6.485  16.775 40.572  1.00 30.05 ? 427 GLY A C   1 
ATOM   3260 O  O   . GLY A 1 439 ? -6.530  15.710 39.949  1.00 29.01 ? 427 GLY A O   1 
ATOM   3261 N  N   . GLY A 1 440 ? -5.338  17.328 40.913  1.00 29.09 ? 428 GLY A N   1 
ATOM   3262 C  CA  . GLY A 1 440 ? -4.084  16.624 40.637  1.00 27.43 ? 428 GLY A CA  1 
ATOM   3263 C  C   . GLY A 1 440 ? -3.221  17.320 39.621  1.00 26.78 ? 428 GLY A C   1 
ATOM   3264 O  O   . GLY A 1 440 ? -2.021  17.183 39.671  1.00 27.38 ? 428 GLY A O   1 
ATOM   3265 N  N   . SER A 1 441 ? -3.836  18.066 38.719  1.00 26.90 ? 429 SER A N   1 
ATOM   3266 C  CA  . SER A 1 441 ? -3.161  18.738 37.595  1.00 28.50 ? 429 SER A CA  1 
ATOM   3267 C  C   . SER A 1 441 ? -2.105  19.713 38.080  1.00 27.69 ? 429 SER A C   1 
ATOM   3268 O  O   . SER A 1 441 ? -0.960  19.744 37.582  1.00 27.45 ? 429 SER A O   1 
ATOM   3269 C  CB  . SER A 1 441 ? -4.215  19.542 36.771  1.00 28.87 ? 429 SER A CB  1 
ATOM   3270 O  OG  . SER A 1 441 ? -5.111  18.533 36.235  1.00 37.27 ? 429 SER A OG  1 
ATOM   3271 N  N   . GLY A 1 442 ? -2.519  20.516 39.037  1.00 25.60 ? 430 GLY A N   1 
ATOM   3272 C  CA  . GLY A 1 442 ? -1.682  21.510 39.635  1.00 25.37 ? 430 GLY A CA  1 
ATOM   3273 C  C   . GLY A 1 442 ? -0.527  20.875 40.376  1.00 26.23 ? 430 GLY A C   1 
ATOM   3274 O  O   . GLY A 1 442 ? 0.569   21.433 40.395  1.00 27.78 ? 430 GLY A O   1 
ATOM   3275 N  N   . ASP A 1 443 ? -0.748  19.742 41.019  1.00 25.76 ? 431 ASP A N   1 
ATOM   3276 C  CA  . ASP A 1 443 ? 0.308   19.136 41.779  1.00 25.86 ? 431 ASP A CA  1 
ATOM   3277 C  C   . ASP A 1 443 ? 1.461   18.703 40.797  1.00 25.09 ? 431 ASP A C   1 
ATOM   3278 O  O   . ASP A 1 443 ? 2.604   18.837 41.098  1.00 25.20 ? 431 ASP A O   1 
ATOM   3279 C  CB  . ASP A 1 443 ? -0.176  17.925 42.525  1.00 26.66 ? 431 ASP A CB  1 
ATOM   3280 C  CG  . ASP A 1 443 ? -1.272  18.220 43.535  1.00 30.51 ? 431 ASP A CG  1 
ATOM   3281 O  OD1 . ASP A 1 443 ? -1.361  19.371 43.979  1.00 33.41 ? 431 ASP A OD1 1 
ATOM   3282 O  OD2 . ASP A 1 443 ? -2.056  17.268 43.844  1.00 33.21 ? 431 ASP A OD2 1 
ATOM   3283 N  N   . VAL A 1 444 ? 1.104   18.199 39.630  1.00 24.30 ? 432 VAL A N   1 
ATOM   3284 C  CA  . VAL A 1 444 ? 2.074   17.851 38.603  1.00 23.16 ? 432 VAL A CA  1 
ATOM   3285 C  C   . VAL A 1 444 ? 2.870   19.054 38.173  1.00 23.70 ? 432 VAL A C   1 
ATOM   3286 O  O   . VAL A 1 444 ? 4.096   18.980 38.101  1.00 25.15 ? 432 VAL A O   1 
ATOM   3287 C  CB  . VAL A 1 444 ? 1.383   17.171 37.393  1.00 23.09 ? 432 VAL A CB  1 
ATOM   3288 C  CG1 . VAL A 1 444 ? 2.386   16.944 36.252  1.00 21.08 ? 432 VAL A CG1 1 
ATOM   3289 C  CG2 . VAL A 1 444 ? 0.729   15.844 37.860  1.00 20.80 ? 432 VAL A CG2 1 
ATOM   3290 N  N   . LEU A 1 445 ? 2.203   20.159 37.871  1.00 23.50 ? 433 LEU A N   1 
ATOM   3291 C  CA  . LEU A 1 445 ? 2.909   21.356 37.404  1.00 23.25 ? 433 LEU A CA  1 
ATOM   3292 C  C   . LEU A 1 445 ? 3.924   21.855 38.455  1.00 23.96 ? 433 LEU A C   1 
ATOM   3293 O  O   . LEU A 1 445 ? 5.027   22.254 38.127  1.00 24.40 ? 433 LEU A O   1 
ATOM   3294 C  CB  . LEU A 1 445 ? 1.917   22.472 37.142  1.00 23.34 ? 433 LEU A CB  1 
ATOM   3295 C  CG  . LEU A 1 445 ? 2.510   23.785 36.645  1.00 24.53 ? 433 LEU A CG  1 
ATOM   3296 C  CD1 . LEU A 1 445 ? 3.045   23.593 35.201  1.00 20.78 ? 433 LEU A CD1 1 
ATOM   3297 C  CD2 . LEU A 1 445 ? 1.433   24.862 36.765  1.00 25.13 ? 433 LEU A CD2 1 
ATOM   3298 N  N   . THR A 1 446 ? 3.559   21.818 39.720  1.00 24.44 ? 434 THR A N   1 
ATOM   3299 C  CA  . THR A 1 446 ? 4.489   22.232 40.786  1.00 25.11 ? 434 THR A CA  1 
ATOM   3300 C  C   . THR A 1 446 ? 5.828   21.448 40.740  1.00 25.38 ? 434 THR A C   1 
ATOM   3301 O  O   . THR A 1 446 ? 6.907   22.039 40.860  1.00 25.66 ? 434 THR A O   1 
ATOM   3302 C  CB  . THR A 1 446 ? 3.845   22.034 42.140  1.00 25.76 ? 434 THR A CB  1 
ATOM   3303 O  OG1 . THR A 1 446 ? 2.738   22.932 42.248  1.00 27.82 ? 434 THR A OG1 1 
ATOM   3304 C  CG2 . THR A 1 446 ? 4.828   22.306 43.304  1.00 26.14 ? 434 THR A CG2 1 
ATOM   3305 N  N   . GLY A 1 447 ? 5.722   20.122 40.585  1.00 24.05 ? 435 GLY A N   1 
ATOM   3306 C  CA  . GLY A 1 447 ? 6.845   19.267 40.408  1.00 23.89 ? 435 GLY A CA  1 
ATOM   3307 C  C   . GLY A 1 447 ? 7.657   19.594 39.165  1.00 24.04 ? 435 GLY A C   1 
ATOM   3308 O  O   . GLY A 1 447 ? 8.883   19.613 39.215  1.00 24.47 ? 435 GLY A O   1 
ATOM   3309 N  N   . MET A 1 448 ? 6.992   19.802 38.042  1.00 22.83 ? 436 MET A N   1 
ATOM   3310 C  CA  . MET A 1 448 ? 7.704   20.198 36.812  1.00 22.82 ? 436 MET A CA  1 
ATOM   3311 C  C   . MET A 1 448 ? 8.521   21.463 36.997  1.00 23.11 ? 436 MET A C   1 
ATOM   3312 O  O   . MET A 1 448 ? 9.673   21.553 36.585  1.00 23.51 ? 436 MET A O   1 
ATOM   3313 C  CB  . MET A 1 448 ? 6.712   20.429 35.675  1.00 21.34 ? 436 MET A CB  1 
ATOM   3314 C  CG  . MET A 1 448 ? 5.890   19.194 35.334  1.00 24.09 ? 436 MET A CG  1 
ATOM   3315 S  SD  . MET A 1 448 ? 4.571   19.465 34.135  1.00 26.80 ? 436 MET A SD  1 
ATOM   3316 C  CE  . MET A 1 448 ? 5.535   19.705 32.600  1.00 22.10 ? 436 MET A CE  1 
ATOM   3317 N  N   . ILE A 1 449 ? 7.911   22.481 37.590  1.00 23.92 ? 437 ILE A N   1 
ATOM   3318 C  CA  . ILE A 1 449 ? 8.636   23.739 37.782  1.00 24.51 ? 437 ILE A CA  1 
ATOM   3319 C  C   . ILE A 1 449 ? 9.900   23.538 38.658  1.00 25.48 ? 437 ILE A C   1 
ATOM   3320 O  O   . ILE A 1 449 ? 11.004  23.996 38.295  1.00 26.42 ? 437 ILE A O   1 
ATOM   3321 C  CB  . ILE A 1 449 ? 7.735   24.822 38.351  1.00 24.98 ? 437 ILE A CB  1 
ATOM   3322 C  CG1 . ILE A 1 449 ? 6.625   25.127 37.337  1.00 23.94 ? 437 ILE A CG1 1 
ATOM   3323 C  CG2 . ILE A 1 449 ? 8.556   26.139 38.648  1.00 21.81 ? 437 ILE A CG2 1 
ATOM   3324 C  CD1 . ILE A 1 449 ? 5.540   26.103 37.851  1.00 25.80 ? 437 ILE A CD1 1 
ATOM   3325 N  N   . ALA A 1 450 ? 9.730   22.868 39.809  1.00 25.35 ? 438 ALA A N   1 
ATOM   3326 C  CA  . ALA A 1 450 ? 10.827  22.584 40.725  1.00 26.04 ? 438 ALA A CA  1 
ATOM   3327 C  C   . ALA A 1 450 ? 11.915  21.862 39.975  1.00 26.67 ? 438 ALA A C   1 
ATOM   3328 O  O   . ALA A 1 450 ? 13.096  22.160 40.153  1.00 28.21 ? 438 ALA A O   1 
ATOM   3329 C  CB  . ALA A 1 450 ? 10.363  21.715 41.905  1.00 24.68 ? 438 ALA A CB  1 
ATOM   3330 N  N   . GLY A 1 451 ? 11.518  20.895 39.147  1.00 26.18 ? 439 GLY A N   1 
ATOM   3331 C  CA  . GLY A 1 451 ? 12.465  20.084 38.398  1.00 26.03 ? 439 GLY A CA  1 
ATOM   3332 C  C   . GLY A 1 451 ? 13.319  20.867 37.416  1.00 26.93 ? 439 GLY A C   1 
ATOM   3333 O  O   . GLY A 1 451 ? 14.554  20.698 37.336  1.00 27.93 ? 439 GLY A O   1 
ATOM   3334 N  N   . PHE A 1 452 ? 12.703  21.784 36.706  1.00 26.97 ? 440 PHE A N   1 
ATOM   3335 C  CA  . PHE A 1 452 ? 13.457  22.573 35.754  1.00 26.52 ? 440 PHE A CA  1 
ATOM   3336 C  C   . PHE A 1 452 ? 14.370  23.545 36.473  1.00 27.68 ? 440 PHE A C   1 
ATOM   3337 O  O   . PHE A 1 452 ? 15.484  23.845 35.996  1.00 28.27 ? 440 PHE A O   1 
ATOM   3338 C  CB  . PHE A 1 452 ? 12.512  23.290 34.801  1.00 27.22 ? 440 PHE A CB  1 
ATOM   3339 C  CG  . PHE A 1 452 ? 12.022  22.412 33.667  1.00 25.89 ? 440 PHE A CG  1 
ATOM   3340 C  CD1 . PHE A 1 452 ? 12.901  21.908 32.750  1.00 26.59 ? 440 PHE A CD1 1 
ATOM   3341 C  CD2 . PHE A 1 452 ? 10.707  22.069 33.552  1.00 23.90 ? 440 PHE A CD2 1 
ATOM   3342 C  CE1 . PHE A 1 452 ? 12.457  21.131 31.666  1.00 26.65 ? 440 PHE A CE1 1 
ATOM   3343 C  CE2 . PHE A 1 452 ? 10.295  21.259 32.519  1.00 24.88 ? 440 PHE A CE2 1 
ATOM   3344 C  CZ  . PHE A 1 452 ? 11.159  20.795 31.598  1.00 25.71 ? 440 PHE A CZ  1 
ATOM   3345 N  N   . ILE A 1 453 ? 13.943  24.039 37.623  1.00 27.71 ? 441 ILE A N   1 
ATOM   3346 C  CA  . ILE A 1 453 ? 14.820  24.885 38.405  1.00 28.68 ? 441 ILE A CA  1 
ATOM   3347 C  C   . ILE A 1 453 ? 16.054  24.098 38.861  1.00 28.78 ? 441 ILE A C   1 
ATOM   3348 O  O   . ILE A 1 453 ? 17.169  24.552 38.728  1.00 29.07 ? 441 ILE A O   1 
ATOM   3349 C  CB  . ILE A 1 453 ? 14.129  25.531 39.629  1.00 27.98 ? 441 ILE A CB  1 
ATOM   3350 C  CG1 . ILE A 1 453 ? 13.037  26.511 39.145  1.00 28.33 ? 441 ILE A CG1 1 
ATOM   3351 C  CG2 . ILE A 1 453 ? 15.195  26.240 40.494  1.00 28.66 ? 441 ILE A CG2 1 
ATOM   3352 C  CD1 . ILE A 1 453 ? 12.132  27.122 40.290  1.00 25.08 ? 441 ILE A CD1 1 
ATOM   3353 N  N   . ALA A 1 454 ? 15.828  22.899 39.337  1.00 28.56 ? 442 ALA A N   1 
ATOM   3354 C  CA  . ALA A 1 454 ? 16.893  22.021 39.745  1.00 29.12 ? 442 ALA A CA  1 
ATOM   3355 C  C   . ALA A 1 454 ? 17.901  21.760 38.613  1.00 30.21 ? 442 ALA A C   1 
ATOM   3356 O  O   . ALA A 1 454 ? 19.087  21.568 38.896  1.00 28.95 ? 442 ALA A O   1 
ATOM   3357 C  CB  . ALA A 1 454 ? 16.316  20.675 40.298  1.00 27.78 ? 442 ALA A CB  1 
ATOM   3358 N  N   . GLN A 1 455 ? 17.414  21.732 37.368  1.00 29.73 ? 443 GLN A N   1 
ATOM   3359 C  CA  . GLN A 1 455 ? 18.263  21.488 36.211  1.00 31.15 ? 443 GLN A CA  1 
ATOM   3360 C  C   . GLN A 1 455 ? 18.960  22.751 35.712  1.00 31.64 ? 443 GLN A C   1 
ATOM   3361 O  O   . GLN A 1 455 ? 19.718  22.691 34.781  1.00 34.29 ? 443 GLN A O   1 
ATOM   3362 C  CB  . GLN A 1 455 ? 17.457  20.835 35.061  1.00 30.84 ? 443 GLN A CB  1 
ATOM   3363 C  CG  . GLN A 1 455 ? 16.864  19.480 35.430  1.00 32.04 ? 443 GLN A CG  1 
ATOM   3364 C  CD  . GLN A 1 455 ? 15.897  18.994 34.365  1.00 34.98 ? 443 GLN A CD  1 
ATOM   3365 O  OE1 . GLN A 1 455 ? 16.261  18.860 33.219  1.00 39.23 ? 443 GLN A OE1 1 
ATOM   3366 N  NE2 . GLN A 1 455 ? 14.671  18.752 34.739  1.00 30.14 ? 443 GLN A NE2 1 
ATOM   3367 N  N   . GLY A 1 456 ? 18.742  23.887 36.341  1.00 32.40 ? 444 GLY A N   1 
ATOM   3368 C  CA  . GLY A 1 456 ? 19.537  25.076 36.036  1.00 32.93 ? 444 GLY A CA  1 
ATOM   3369 C  C   . GLY A 1 456 ? 18.731  26.178 35.381  1.00 33.14 ? 444 GLY A C   1 
ATOM   3370 O  O   . GLY A 1 456 ? 19.256  27.218 35.193  1.00 33.20 ? 444 GLY A O   1 
ATOM   3371 N  N   . LEU A 1 457 ? 17.440  25.990 35.076  1.00 32.84 ? 445 LEU A N   1 
ATOM   3372 C  CA  . LEU A 1 457 ? 16.665  27.103 34.539  1.00 33.08 ? 445 LEU A CA  1 
ATOM   3373 C  C   . LEU A 1 457 ? 16.358  28.110 35.665  1.00 32.90 ? 445 LEU A C   1 
ATOM   3374 O  O   . LEU A 1 457 ? 16.123  27.755 36.805  1.00 30.60 ? 445 LEU A O   1 
ATOM   3375 C  CB  . LEU A 1 457 ? 15.356  26.668 33.856  1.00 32.80 ? 445 LEU A CB  1 
ATOM   3376 C  CG  . LEU A 1 457 ? 15.326  25.621 32.701  1.00 35.74 ? 445 LEU A CG  1 
ATOM   3377 C  CD1 . LEU A 1 457 ? 14.088  25.741 31.746  1.00 31.73 ? 445 LEU A CD1 1 
ATOM   3378 C  CD2 . LEU A 1 457 ? 16.629  25.526 31.974  1.00 35.60 ? 445 LEU A CD2 1 
ATOM   3379 N  N   . SER A 1 458 ? 16.375  29.386 35.320  1.00 33.76 ? 446 SER A N   1 
ATOM   3380 C  CA  . SER A 1 458 ? 15.855  30.419 36.200  1.00 33.98 ? 446 SER A CA  1 
ATOM   3381 C  C   . SER A 1 458 ? 14.388  30.112 36.597  1.00 33.30 ? 446 SER A C   1 
ATOM   3382 O  O   . SER A 1 458 ? 13.632  29.429 35.876  1.00 33.75 ? 446 SER A O   1 
ATOM   3383 C  CB  . SER A 1 458 ? 15.980  31.816 35.521  1.00 35.19 ? 446 SER A CB  1 
ATOM   3384 O  OG  . SER A 1 458 ? 14.889  32.062 34.595  1.00 33.65 ? 446 SER A OG  1 
ATOM   3385 N  N   . PRO A 1 459 ? 13.957  30.616 37.753  1.00 32.84 ? 447 PRO A N   1 
ATOM   3386 C  CA  . PRO A 1 459 ? 12.504  30.493 38.112  1.00 31.38 ? 447 PRO A CA  1 
ATOM   3387 C  C   . PRO A 1 459 ? 11.492  30.876 36.988  1.00 30.76 ? 447 PRO A C   1 
ATOM   3388 O  O   . PRO A 1 459 ? 10.470  30.156 36.744  1.00 30.16 ? 447 PRO A O   1 
ATOM   3389 C  CB  . PRO A 1 459 ? 12.379  31.417 39.316  1.00 31.23 ? 447 PRO A CB  1 
ATOM   3390 C  CG  . PRO A 1 459 ? 13.795  31.363 39.944  1.00 33.27 ? 447 PRO A CG  1 
ATOM   3391 C  CD  . PRO A 1 459 ? 14.740  31.344 38.779  1.00 32.79 ? 447 PRO A CD  1 
ATOM   3392 N  N   . LEU A 1 460 ? 11.763  31.975 36.289  1.00 30.62 ? 448 LEU A N   1 
ATOM   3393 C  CA  . LEU A 1 460 ? 10.889  32.410 35.223  1.00 29.98 ? 448 LEU A CA  1 
ATOM   3394 C  C   . LEU A 1 460 ? 10.943  31.440 34.043  1.00 28.97 ? 448 LEU A C   1 
ATOM   3395 O  O   . LEU A 1 460 ? 9.904   31.114 33.488  1.00 27.53 ? 448 LEU A O   1 
ATOM   3396 C  CB  . LEU A 1 460 ? 11.230  33.847 34.761  1.00 31.17 ? 448 LEU A CB  1 
ATOM   3397 C  CG  . LEU A 1 460 ? 10.337  34.443 33.646  1.00 32.04 ? 448 LEU A CG  1 
ATOM   3398 C  CD1 . LEU A 1 460 ? 8.888   34.664 34.192  1.00 31.86 ? 448 LEU A CD1 1 
ATOM   3399 C  CD2 . LEU A 1 460 ? 10.930  35.809 33.001  1.00 31.54 ? 448 LEU A CD2 1 
ATOM   3400 N  N   . GLU A 1 461 ? 12.148  31.055 33.628  1.00 29.69 ? 449 GLU A N   1 
ATOM   3401 C  CA  . GLU A 1 461 ? 12.332  30.084 32.521  1.00 30.25 ? 449 GLU A CA  1 
ATOM   3402 C  C   . GLU A 1 461 ? 11.706  28.749 32.860  1.00 29.02 ? 449 GLU A C   1 
ATOM   3403 O  O   . GLU A 1 461 ? 11.008  28.178 32.050  1.00 30.11 ? 449 GLU A O   1 
ATOM   3404 C  CB  . GLU A 1 461 ? 13.811  29.862 32.200  1.00 31.05 ? 449 GLU A CB  1 
ATOM   3405 C  CG  . GLU A 1 461 ? 14.510  31.047 31.548  1.00 33.71 ? 449 GLU A CG  1 
ATOM   3406 C  CD  . GLU A 1 461 ? 16.064  30.924 31.644  1.00 38.42 ? 449 GLU A CD  1 
ATOM   3407 O  OE1 . GLU A 1 461 ? 16.627  30.094 32.417  1.00 39.53 ? 449 GLU A OE1 1 
ATOM   3408 O  OE2 . GLU A 1 461 ? 16.740  31.681 30.955  1.00 43.94 ? 449 GLU A OE2 1 
ATOM   3409 N  N   . ALA A 1 462 ? 11.932  28.271 34.078  1.00 28.47 ? 450 ALA A N   1 
ATOM   3410 C  CA  . ALA A 1 462 ? 11.353  27.018 34.527  1.00 26.96 ? 450 ALA A CA  1 
ATOM   3411 C  C   . ALA A 1 462 ? 9.833   27.042 34.460  1.00 27.24 ? 450 ALA A C   1 
ATOM   3412 O  O   . ALA A 1 462 ? 9.185   26.045 34.061  1.00 26.32 ? 450 ALA A O   1 
ATOM   3413 C  CB  . ALA A 1 462 ? 11.822  26.720 35.917  1.00 25.76 ? 450 ALA A CB  1 
ATOM   3414 N  N   . SER A 1 463 ? 9.261   28.185 34.863  1.00 27.64 ? 451 SER A N   1 
ATOM   3415 C  CA  . SER A 1 463 ? 7.820   28.355 34.866  1.00 27.30 ? 451 SER A CA  1 
ATOM   3416 C  C   . SER A 1 463 ? 7.273   28.400 33.437  1.00 27.65 ? 451 SER A C   1 
ATOM   3417 O  O   . SER A 1 463 ? 6.242   27.798 33.154  1.00 28.11 ? 451 SER A O   1 
ATOM   3418 C  CB  . SER A 1 463 ? 7.387   29.585 35.698  1.00 28.36 ? 451 SER A CB  1 
ATOM   3419 O  OG  . SER A 1 463 ? 7.883   29.574 37.027  1.00 27.59 ? 451 SER A OG  1 
ATOM   3420 N  N   . THR A 1 464 ? 8.002   29.039 32.524  1.00 28.26 ? 452 THR A N   1 
ATOM   3421 C  CA  . THR A 1 464 ? 7.565   29.195 31.126  1.00 27.98 ? 452 THR A CA  1 
ATOM   3422 C  C   . THR A 1 464 ? 7.501   27.840 30.404  1.00 28.16 ? 452 THR A C   1 
ATOM   3423 O  O   . THR A 1 464 ? 6.477   27.464 29.780  1.00 26.83 ? 452 THR A O   1 
ATOM   3424 C  CB  . THR A 1 464 ? 8.554   30.102 30.427  1.00 29.19 ? 452 THR A CB  1 
ATOM   3425 O  OG1 . THR A 1 464 ? 8.554   31.376 31.110  1.00 29.42 ? 452 THR A OG1 1 
ATOM   3426 C  CG2 . THR A 1 464 ? 8.253   30.259 28.922  1.00 30.53 ? 452 THR A CG2 1 
ATOM   3427 N  N   . VAL A 1 465 ? 8.554   27.069 30.606  1.00 27.42 ? 453 VAL A N   1 
ATOM   3428 C  CA  . VAL A 1 465 ? 8.707   25.772 29.960  1.00 27.68 ? 453 VAL A CA  1 
ATOM   3429 C  C   . VAL A 1 465 ? 7.680   24.798 30.540  1.00 26.44 ? 453 VAL A C   1 
ATOM   3430 O  O   . VAL A 1 465 ? 7.066   24.036 29.780  1.00 25.32 ? 453 VAL A O   1 
ATOM   3431 C  CB  . VAL A 1 465 ? 10.160  25.236 30.172  1.00 28.60 ? 453 VAL A CB  1 
ATOM   3432 C  CG1 . VAL A 1 465 ? 10.222  23.736 29.939  1.00 31.29 ? 453 VAL A CG1 1 
ATOM   3433 C  CG2 . VAL A 1 465 ? 11.102  26.004 29.215  1.00 26.68 ? 453 VAL A CG2 1 
ATOM   3434 N  N   . SER A 1 466 ? 7.459   24.874 31.856  1.00 25.55 ? 454 SER A N   1 
ATOM   3435 C  CA  . SER A 1 466 ? 6.600   23.920 32.538  1.00 25.48 ? 454 SER A CA  1 
ATOM   3436 C  C   . SER A 1 466 ? 5.135   24.139 32.188  1.00 25.81 ? 454 SER A C   1 
ATOM   3437 O  O   . SER A 1 466 ? 4.414   23.163 31.925  1.00 25.98 ? 454 SER A O   1 
ATOM   3438 C  CB  . SER A 1 466 ? 6.747   23.950 34.079  1.00 25.72 ? 454 SER A CB  1 
ATOM   3439 O  OG  . SER A 1 466 ? 8.041   23.607 34.504  1.00 25.69 ? 454 SER A OG  1 
ATOM   3440 N  N   . VAL A 1 467 ? 4.665   25.389 32.193  1.00 26.09 ? 455 VAL A N   1 
ATOM   3441 C  CA  . VAL A 1 467 ? 3.253   25.623 31.838  1.00 24.66 ? 455 VAL A CA  1 
ATOM   3442 C  C   . VAL A 1 467 ? 2.940   25.170 30.423  1.00 24.72 ? 455 VAL A C   1 
ATOM   3443 O  O   . VAL A 1 467 ? 1.876   24.549 30.165  1.00 24.64 ? 455 VAL A O   1 
ATOM   3444 C  CB  . VAL A 1 467 ? 2.768   27.067 32.114  1.00 24.59 ? 455 VAL A CB  1 
ATOM   3445 C  CG1 . VAL A 1 467 ? 2.866   27.394 33.565  1.00 23.67 ? 455 VAL A CG1 1 
ATOM   3446 C  CG2 . VAL A 1 467 ? 3.481   28.112 31.221  1.00 22.94 ? 455 VAL A CG2 1 
ATOM   3447 N  N   . TYR A 1 468 ? 3.851   25.433 29.503  1.00 25.57 ? 456 TYR A N   1 
ATOM   3448 C  CA  . TYR A 1 468 ? 3.677   24.977 28.128  1.00 26.24 ? 456 TYR A CA  1 
ATOM   3449 C  C   . TYR A 1 468 ? 3.607   23.453 27.969  1.00 25.85 ? 456 TYR A C   1 
ATOM   3450 O  O   . TYR A 1 468 ? 2.690   22.927 27.350  1.00 24.94 ? 456 TYR A O   1 
ATOM   3451 C  CB  . TYR A 1 468 ? 4.824   25.502 27.248  1.00 27.11 ? 456 TYR A CB  1 
ATOM   3452 C  CG  . TYR A 1 468 ? 4.600   25.225 25.779  1.00 27.55 ? 456 TYR A CG  1 
ATOM   3453 C  CD1 . TYR A 1 468 ? 5.043   24.044 25.198  1.00 28.68 ? 456 TYR A CD1 1 
ATOM   3454 C  CD2 . TYR A 1 468 ? 4.006   26.173 24.971  1.00 31.77 ? 456 TYR A CD2 1 
ATOM   3455 C  CE1 . TYR A 1 468 ? 4.802   23.769 23.866  1.00 32.18 ? 456 TYR A CE1 1 
ATOM   3456 C  CE2 . TYR A 1 468 ? 3.766   25.932 23.648  1.00 33.09 ? 456 TYR A CE2 1 
ATOM   3457 C  CZ  . TYR A 1 468 ? 4.206   24.733 23.100  1.00 35.68 ? 456 TYR A CZ  1 
ATOM   3458 O  OH  . TYR A 1 468 ? 4.037   24.523 21.792  1.00 39.21 ? 456 TYR A OH  1 
ATOM   3459 N  N   . LEU A 1 469 ? 4.607   22.747 28.478  1.00 27.10 ? 457 LEU A N   1 
ATOM   3460 C  CA  . LEU A 1 469 ? 4.701   21.287 28.348  1.00 25.77 ? 457 LEU A CA  1 
ATOM   3461 C  C   . LEU A 1 469 ? 3.566   20.624 29.094  1.00 25.68 ? 457 LEU A C   1 
ATOM   3462 O  O   . LEU A 1 469 ? 3.052   19.633 28.635  1.00 25.77 ? 457 LEU A O   1 
ATOM   3463 C  CB  . LEU A 1 469 ? 5.984   20.797 28.939  1.00 27.56 ? 457 LEU A CB  1 
ATOM   3464 C  CG  . LEU A 1 469 ? 7.224   21.048 28.091  1.00 31.27 ? 457 LEU A CG  1 
ATOM   3465 C  CD1 . LEU A 1 469 ? 8.476   20.831 28.974  1.00 34.04 ? 457 LEU A CD1 1 
ATOM   3466 C  CD2 . LEU A 1 469 ? 7.197   20.140 26.765  1.00 32.15 ? 457 LEU A CD2 1 
ATOM   3467 N  N   . HIS A 1 470 ? 3.152   21.187 30.231  1.00 24.83 ? 458 HIS A N   1 
ATOM   3468 C  CA  . HIS A 1 470 ? 1.992   20.638 31.040  1.00 25.11 ? 458 HIS A CA  1 
ATOM   3469 C  C   . HIS A 1 470 ? 0.715   20.679 30.193  1.00 25.22 ? 458 HIS A C   1 
ATOM   3470 O  O   . HIS A 1 470 ? -0.010  19.686 30.080  1.00 25.85 ? 458 HIS A O   1 
ATOM   3471 C  CB  . HIS A 1 470 ? 1.886   21.502 32.312  1.00 25.12 ? 458 HIS A CB  1 
ATOM   3472 C  CG  . HIS A 1 470 ? 0.755   21.191 33.241  1.00 24.96 ? 458 HIS A CG  1 
ATOM   3473 N  ND1 . HIS A 1 470 ? -0.343  22.011 33.338  1.00 27.31 ? 458 HIS A ND1 1 
ATOM   3474 C  CD2 . HIS A 1 470 ? 0.641   20.295 34.261  1.00 24.22 ? 458 HIS A CD2 1 
ATOM   3475 C  CE1 . HIS A 1 470 ? -1.111  21.611 34.342  1.00 26.16 ? 458 HIS A CE1 1 
ATOM   3476 N  NE2 . HIS A 1 470 ? -0.557  20.542 34.891  1.00 26.22 ? 458 HIS A NE2 1 
ATOM   3477 N  N   . GLY A 1 471 ? 0.449   21.825 29.565  1.00 25.12 ? 459 GLY A N   1 
ATOM   3478 C  CA  . GLY A 1 471 ? -0.715  21.954 28.676  1.00 25.03 ? 459 GLY A CA  1 
ATOM   3479 C  C   . GLY A 1 471 ? -0.601  21.085 27.434  1.00 26.48 ? 459 GLY A C   1 
ATOM   3480 O  O   . GLY A 1 471 ? -1.555  20.430 27.043  1.00 27.33 ? 459 GLY A O   1 
ATOM   3481 N  N   . PHE A 1 472 ? 0.560   21.067 26.801  1.00 26.43 ? 460 PHE A N   1 
ATOM   3482 C  CA  . PHE A 1 472 ? 0.763   20.285 25.601  1.00 27.27 ? 460 PHE A CA  1 
ATOM   3483 C  C   . PHE A 1 472 ? 0.637   18.749 25.862  1.00 26.91 ? 460 PHE A C   1 
ATOM   3484 O  O   . PHE A 1 472 ? 0.053   18.032 25.045  1.00 26.85 ? 460 PHE A O   1 
ATOM   3485 C  CB  . PHE A 1 472 ? 2.136   20.623 25.031  1.00 28.43 ? 460 PHE A CB  1 
ATOM   3486 C  CG  . PHE A 1 472 ? 2.481   19.949 23.703  1.00 31.83 ? 460 PHE A CG  1 
ATOM   3487 C  CD1 . PHE A 1 472 ? 1.565   19.794 22.715  1.00 39.56 ? 460 PHE A CD1 1 
ATOM   3488 C  CD2 . PHE A 1 472 ? 3.769   19.547 23.448  1.00 37.69 ? 460 PHE A CD2 1 
ATOM   3489 C  CE1 . PHE A 1 472 ? 1.917   19.193 21.463  1.00 41.39 ? 460 PHE A CE1 1 
ATOM   3490 C  CE2 . PHE A 1 472 ? 4.132   18.945 22.207  1.00 38.87 ? 460 PHE A CE2 1 
ATOM   3491 C  CZ  . PHE A 1 472 ? 3.191   18.787 21.229  1.00 39.38 ? 460 PHE A CZ  1 
ATOM   3492 N  N   . ALA A 1 473 ? 1.202   18.253 26.961  1.00 25.72 ? 461 ALA A N   1 
ATOM   3493 C  CA  . ALA A 1 473 ? 0.976   16.850 27.368  1.00 25.45 ? 461 ALA A CA  1 
ATOM   3494 C  C   . ALA A 1 473 ? -0.554  16.503 27.436  1.00 25.13 ? 461 ALA A C   1 
ATOM   3495 O  O   . ALA A 1 473 ? -0.958  15.440 26.982  1.00 27.30 ? 461 ALA A O   1 
ATOM   3496 C  CB  . ALA A 1 473 ? 1.689   16.532 28.723  1.00 24.48 ? 461 ALA A CB  1 
ATOM   3497 N  N   . ALA A 1 474 ? -1.360  17.391 28.014  1.00 24.35 ? 462 ALA A N   1 
ATOM   3498 C  CA  . ALA A 1 474 ? -2.818  17.246 28.101  1.00 24.61 ? 462 ALA A CA  1 
ATOM   3499 C  C   . ALA A 1 474 ? -3.423  17.101 26.698  1.00 25.45 ? 462 ALA A C   1 
ATOM   3500 O  O   . ALA A 1 474 ? -4.218  16.215 26.488  1.00 25.06 ? 462 ALA A O   1 
ATOM   3501 C  CB  . ALA A 1 474 ? -3.477  18.390 28.911  1.00 23.92 ? 462 ALA A CB  1 
ATOM   3502 N  N   . GLU A 1 475 ? -2.923  17.838 25.708  1.00 24.73 ? 463 GLU A N   1 
ATOM   3503 C  CA  . GLU A 1 475 ? -3.457  17.743 24.387  1.00 26.71 ? 463 GLU A CA  1 
ATOM   3504 C  C   . GLU A 1 475 ? -3.060  16.472 23.688  1.00 27.12 ? 463 GLU A C   1 
ATOM   3505 O  O   . GLU A 1 475 ? -3.594  16.204 22.664  1.00 26.16 ? 463 GLU A O   1 
ATOM   3506 C  CB  . GLU A 1 475 ? -2.964  18.944 23.523  1.00 27.54 ? 463 GLU A CB  1 
ATOM   3507 C  CG  . GLU A 1 475 ? -3.512  20.281 24.070  1.00 31.56 ? 463 GLU A CG  1 
ATOM   3508 C  CD  . GLU A 1 475 ? -2.893  21.507 23.336  1.00 37.44 ? 463 GLU A CD  1 
ATOM   3509 O  OE1 . GLU A 1 475 ? -2.387  21.356 22.209  1.00 45.97 ? 463 GLU A OE1 1 
ATOM   3510 O  OE2 . GLU A 1 475 ? -2.837  22.598 23.910  1.00 38.10 ? 463 GLU A OE2 1 
ATOM   3511 N  N   . LEU A 1 476 ? -2.069  15.745 24.190  1.00 26.35 ? 464 LEU A N   1 
ATOM   3512 C  CA  . LEU A 1 476 ? -1.613  14.555 23.525  1.00 28.46 ? 464 LEU A CA  1 
ATOM   3513 C  C   . LEU A 1 476 ? -2.412  13.370 24.019  1.00 27.90 ? 464 LEU A C   1 
ATOM   3514 O  O   . LEU A 1 476 ? -2.266  12.321 23.494  1.00 28.96 ? 464 LEU A O   1 
ATOM   3515 C  CB  . LEU A 1 476 ? -0.106  14.331 23.735  1.00 27.52 ? 464 LEU A CB  1 
ATOM   3516 C  CG  . LEU A 1 476 ? 0.812   15.363 23.037  1.00 30.85 ? 464 LEU A CG  1 
ATOM   3517 C  CD1 . LEU A 1 476 ? 2.233   15.161 23.606  1.00 27.56 ? 464 LEU A CD1 1 
ATOM   3518 C  CD2 . LEU A 1 476 ? 0.735   15.232 21.479  1.00 27.57 ? 464 LEU A CD2 1 
ATOM   3519 N  N   . PHE A 1 477 ? -3.272  13.542 25.005  1.00 28.05 ? 465 PHE A N   1 
ATOM   3520 C  CA  . PHE A 1 477 ? -4.099  12.444 25.461  1.00 28.06 ? 465 PHE A CA  1 
ATOM   3521 C  C   . PHE A 1 477 ? -4.930  11.935 24.278  1.00 30.40 ? 465 PHE A C   1 
ATOM   3522 O  O   . PHE A 1 477 ? -5.564  12.708 23.573  1.00 30.79 ? 465 PHE A O   1 
ATOM   3523 C  CB  . PHE A 1 477 ? -5.032  12.940 26.574  1.00 27.78 ? 465 PHE A CB  1 
ATOM   3524 C  CG  . PHE A 1 477 ? -5.817  11.856 27.240  1.00 29.46 ? 465 PHE A CG  1 
ATOM   3525 C  CD1 . PHE A 1 477 ? -5.171  10.783 27.852  1.00 31.99 ? 465 PHE A CD1 1 
ATOM   3526 C  CD2 . PHE A 1 477 ? -7.214  11.911 27.305  1.00 29.89 ? 465 PHE A CD2 1 
ATOM   3527 C  CE1 . PHE A 1 477 ? -5.915  9.769  28.499  1.00 34.92 ? 465 PHE A CE1 1 
ATOM   3528 C  CE2 . PHE A 1 477 ? -7.949  10.893 27.968  1.00 29.23 ? 465 PHE A CE2 1 
ATOM   3529 C  CZ  . PHE A 1 477 ? -7.331  9.860  28.561  1.00 30.23 ? 465 PHE A CZ  1 
ATOM   3530 N  N   . GLU A 1 478 ? -4.992  10.635 24.126  1.00 31.50 ? 466 GLU A N   1 
ATOM   3531 C  CA  . GLU A 1 478 ? -5.515  10.019 22.922  1.00 35.02 ? 466 GLU A CA  1 
ATOM   3532 C  C   . GLU A 1 478 ? -7.051  9.846  22.968  1.00 34.51 ? 466 GLU A C   1 
ATOM   3533 O  O   . GLU A 1 478 ? -7.677  9.579  21.974  1.00 34.94 ? 466 GLU A O   1 
ATOM   3534 C  CB  . GLU A 1 478 ? -4.868  8.616  22.785  1.00 35.90 ? 466 GLU A CB  1 
ATOM   3535 C  CG  . GLU A 1 478 ? -3.310  8.620  22.936  1.00 40.84 ? 466 GLU A CG  1 
ATOM   3536 C  CD  . GLU A 1 478 ? -2.710  8.396  24.394  1.00 45.21 ? 466 GLU A CD  1 
ATOM   3537 O  OE1 . GLU A 1 478 ? -3.399  8.645  25.466  1.00 34.40 ? 466 GLU A OE1 1 
ATOM   3538 O  OE2 . GLU A 1 478 ? -1.494  7.955  24.420  1.00 47.12 ? 466 GLU A OE2 1 
ATOM   3539 N  N   . GLN A 1 479 ? -7.654  9.917  24.137  1.00 32.54 ? 467 GLN A N   1 
ATOM   3540 C  CA  . GLN A 1 479 ? -9.083  9.718  24.193  1.00 32.87 ? 467 GLN A CA  1 
ATOM   3541 C  C   . GLN A 1 479 ? -9.734  11.069 24.572  1.00 31.83 ? 467 GLN A C   1 
ATOM   3542 O  O   . GLN A 1 479 ? -9.069  12.088 24.504  1.00 28.67 ? 467 GLN A O   1 
ATOM   3543 C  CB  . GLN A 1 479 ? -9.395  8.565  25.147  1.00 32.89 ? 467 GLN A CB  1 
ATOM   3544 C  CG  . GLN A 1 479 ? -8.797  7.217  24.696  1.00 35.14 ? 467 GLN A CG  1 
ATOM   3545 C  CD  . GLN A 1 479 ? -9.152  6.843  23.223  1.00 40.14 ? 467 GLN A CD  1 
ATOM   3546 O  OE1 . GLN A 1 479 ? -10.225 7.192  22.684  1.00 39.44 ? 467 GLN A OE1 1 
ATOM   3547 N  NE2 . GLN A 1 479 ? -8.233  6.143  22.573  1.00 44.13 ? 467 GLN A NE2 1 
ATOM   3548 N  N   . ASP A 1 480 ? -11.021 11.089 24.934  1.00 30.47 ? 468 ASP A N   1 
ATOM   3549 C  CA  . ASP A 1 480 ? -11.673 12.377 25.227  1.00 29.80 ? 468 ASP A CA  1 
ATOM   3550 C  C   . ASP A 1 480 ? -11.054 13.085 26.447  1.00 28.49 ? 468 ASP A C   1 
ATOM   3551 O  O   . ASP A 1 480 ? -10.734 12.472 27.479  1.00 26.97 ? 468 ASP A O   1 
ATOM   3552 C  CB  . ASP A 1 480 ? -13.148 12.237 25.428  1.00 30.66 ? 468 ASP A CB  1 
ATOM   3553 C  CG  . ASP A 1 480 ? -13.834 13.597 25.508  1.00 32.12 ? 468 ASP A CG  1 
ATOM   3554 O  OD1 . ASP A 1 480 ? -13.834 14.275 26.591  1.00 28.34 ? 468 ASP A OD1 1 
ATOM   3555 O  OD2 . ASP A 1 480 ? -14.363 13.980 24.464  1.00 34.10 ? 468 ASP A OD2 1 
ATOM   3556 N  N   . GLU A 1 481 ? -10.859 14.382 26.303  1.00 28.24 ? 469 GLU A N   1 
ATOM   3557 C  CA  . GLU A 1 481 ? -10.086 15.147 27.302  1.00 28.99 ? 469 GLU A CA  1 
ATOM   3558 C  C   . GLU A 1 481 ? -10.734 15.093 28.657  1.00 29.19 ? 469 GLU A C   1 
ATOM   3559 O  O   . GLU A 1 481 ? -10.084 15.219 29.662  1.00 29.90 ? 469 GLU A O   1 
ATOM   3560 C  CB  . GLU A 1 481 ? -9.924  16.614 26.853  1.00 28.18 ? 469 GLU A CB  1 
ATOM   3561 C  CG  . GLU A 1 481 ? -11.194 17.399 26.892  1.00 32.44 ? 469 GLU A CG  1 
ATOM   3562 C  CD  . GLU A 1 481 ? -11.048 18.802 26.234  1.00 33.30 ? 469 GLU A CD  1 
ATOM   3563 O  OE1 . GLU A 1 481 ? -10.584 18.827 25.084  1.00 35.44 ? 469 GLU A OE1 1 
ATOM   3564 O  OE2 . GLU A 1 481 ? -11.370 19.843 26.890  1.00 31.82 ? 469 GLU A OE2 1 
ATOM   3565 N  N   . ARG A 1 482 ? -12.042 14.918 28.725  1.00 29.97 ? 470 ARG A N   1 
ATOM   3566 C  CA  . ARG A 1 482 ? -12.632 14.939 30.038  1.00 30.01 ? 470 ARG A CA  1 
ATOM   3567 C  C   . ARG A 1 482 ? -12.263 13.766 30.916  1.00 30.90 ? 470 ARG A C   1 
ATOM   3568 O  O   . ARG A 1 482 ? -12.428 13.861 32.121  1.00 30.03 ? 470 ARG A O   1 
ATOM   3569 C  CB  . ARG A 1 482 ? -14.132 15.114 29.977  1.00 31.78 ? 470 ARG A CB  1 
ATOM   3570 C  CG  . ARG A 1 482 ? -14.914 13.928 29.693  1.00 30.82 ? 470 ARG A CG  1 
ATOM   3571 C  CD  . ARG A 1 482 ? -16.315 14.410 29.396  1.00 34.56 ? 470 ARG A CD  1 
ATOM   3572 N  NE  . ARG A 1 482 ? -16.455 15.023 28.072  1.00 33.29 ? 470 ARG A NE  1 
ATOM   3573 C  CZ  . ARG A 1 482 ? -17.522 15.718 27.684  1.00 34.86 ? 470 ARG A CZ  1 
ATOM   3574 N  NH1 . ARG A 1 482 ? -18.548 15.955 28.498  1.00 33.27 ? 470 ARG A NH1 1 
ATOM   3575 N  NH2 . ARG A 1 482 ? -17.549 16.223 26.483  1.00 34.50 ? 470 ARG A NH2 1 
ATOM   3576 N  N   . GLY A 1 483 ? -11.744 12.682 30.318  1.00 30.55 ? 471 GLY A N   1 
ATOM   3577 C  CA  . GLY A 1 483 ? -11.295 11.558 31.052  1.00 29.36 ? 471 GLY A CA  1 
ATOM   3578 C  C   . GLY A 1 483 ? -9.832  11.623 31.424  1.00 28.85 ? 471 GLY A C   1 
ATOM   3579 O  O   . GLY A 1 483 ? -9.345  10.679 31.999  1.00 29.06 ? 471 GLY A O   1 
ATOM   3580 N  N   . LEU A 1 484 ? -9.114  12.700 31.089  1.00 28.24 ? 472 LEU A N   1 
ATOM   3581 C  CA  . LEU A 1 484 ? -7.692  12.809 31.443  1.00 28.06 ? 472 LEU A CA  1 
ATOM   3582 C  C   . LEU A 1 484 ? -7.583  12.914 32.950  1.00 28.74 ? 472 LEU A C   1 
ATOM   3583 O  O   . LEU A 1 484 ? -8.362  13.648 33.578  1.00 28.00 ? 472 LEU A O   1 
ATOM   3584 C  CB  . LEU A 1 484 ? -7.048  14.070 30.864  1.00 28.15 ? 472 LEU A CB  1 
ATOM   3585 C  CG  . LEU A 1 484 ? -5.579  14.351 31.235  1.00 28.76 ? 472 LEU A CG  1 
ATOM   3586 C  CD1 . LEU A 1 484 ? -4.675  13.287 30.540  1.00 28.79 ? 472 LEU A CD1 1 
ATOM   3587 C  CD2 . LEU A 1 484 ? -5.157  15.767 30.833  1.00 25.93 ? 472 LEU A CD2 1 
ATOM   3588 N  N   . THR A 1 485 ? -6.630  12.190 33.508  1.00 28.08 ? 473 THR A N   1 
ATOM   3589 C  CA  . THR A 1 485 ? -6.282  12.317 34.926  1.00 28.64 ? 473 THR A CA  1 
ATOM   3590 C  C   . THR A 1 485 ? -4.793  12.610 35.023  1.00 27.87 ? 473 THR A C   1 
ATOM   3591 O  O   . THR A 1 485 ? -4.042  12.369 34.080  1.00 27.07 ? 473 THR A O   1 
ATOM   3592 C  CB  . THR A 1 485 ? -6.517  11.003 35.681  1.00 29.32 ? 473 THR A CB  1 
ATOM   3593 O  OG1 . THR A 1 485 ? -5.748  10.016 35.007  1.00 33.44 ? 473 THR A OG1 1 
ATOM   3594 C  CG2 . THR A 1 485 ? -7.968  10.652 35.657  1.00 30.69 ? 473 THR A CG2 1 
ATOM   3595 N  N   . ALA A 1 486 ? -4.388  13.099 36.190  1.00 27.20 ? 474 ALA A N   1 
ATOM   3596 C  CA  . ALA A 1 486 ? -3.013  13.455 36.461  1.00 27.27 ? 474 ALA A CA  1 
ATOM   3597 C  C   . ALA A 1 486 ? -2.001  12.352 36.206  1.00 26.46 ? 474 ALA A C   1 
ATOM   3598 O  O   . ALA A 1 486 ? -0.911  12.639 35.750  1.00 26.85 ? 474 ALA A O   1 
ATOM   3599 C  CB  . ALA A 1 486 ? -2.884  13.994 37.918  1.00 26.67 ? 474 ALA A CB  1 
ATOM   3600 N  N   . SER A 1 487 ? -2.365  11.119 36.512  1.00 27.34 ? 475 SER A N   1 
ATOM   3601 C  CA  . SER A 1 487 ? -1.527  9.970  36.298  1.00 29.05 ? 475 SER A CA  1 
ATOM   3602 C  C   . SER A 1 487 ? -1.257  9.778  34.788  1.00 29.86 ? 475 SER A C   1 
ATOM   3603 O  O   . SER A 1 487 ? -0.137  9.432  34.385  1.00 30.03 ? 475 SER A O   1 
ATOM   3604 C  CB  . SER A 1 487 ? -2.171  8.698  36.866  1.00 29.74 ? 475 SER A CB  1 
ATOM   3605 O  OG  . SER A 1 487 ? -2.035  8.710  38.269  1.00 32.87 ? 475 SER A OG  1 
ATOM   3606 N  N   . GLU A 1 488 ? -2.282  10.024 33.965  1.00 29.87 ? 476 GLU A N   1 
ATOM   3607 C  CA  . GLU A 1 488 ? -2.131  9.887  32.541  1.00 30.46 ? 476 GLU A CA  1 
ATOM   3608 C  C   . GLU A 1 488 ? -1.280  11.068 32.053  1.00 28.50 ? 476 GLU A C   1 
ATOM   3609 O  O   . GLU A 1 488 ? -0.466  10.942 31.122  1.00 28.87 ? 476 GLU A O   1 
ATOM   3610 C  CB  . GLU A 1 488 ? -3.509  9.872  31.848  1.00 33.32 ? 476 GLU A CB  1 
ATOM   3611 C  CG  . GLU A 1 488 ? -4.315  8.619  32.044  1.00 40.62 ? 476 GLU A CG  1 
ATOM   3612 C  CD  . GLU A 1 488 ? -3.506  7.377  31.688  1.00 46.68 ? 476 GLU A CD  1 
ATOM   3613 O  OE1 . GLU A 1 488 ? -3.641  6.380  32.430  1.00 53.22 ? 476 GLU A OE1 1 
ATOM   3614 O  OE2 . GLU A 1 488 ? -2.697  7.429  30.717  1.00 45.83 ? 476 GLU A OE2 1 
ATOM   3615 N  N   . LEU A 1 489 ? -1.487  12.236 32.650  1.00 27.40 ? 477 LEU A N   1 
ATOM   3616 C  CA  . LEU A 1 489 ? -0.722  13.408 32.264  1.00 26.80 ? 477 LEU A CA  1 
ATOM   3617 C  C   . LEU A 1 489 ? 0.764   13.166 32.434  1.00 26.99 ? 477 LEU A C   1 
ATOM   3618 O  O   . LEU A 1 489 ? 1.576   13.516 31.561  1.00 27.24 ? 477 LEU A O   1 
ATOM   3619 C  CB  . LEU A 1 489 ? -1.161  14.597 33.100  1.00 28.51 ? 477 LEU A CB  1 
ATOM   3620 C  CG  . LEU A 1 489 ? -0.543  15.956 32.862  1.00 25.78 ? 477 LEU A CG  1 
ATOM   3621 C  CD1 . LEU A 1 489 ? -0.966  16.453 31.442  1.00 30.49 ? 477 LEU A CD1 1 
ATOM   3622 C  CD2 . LEU A 1 489 ? -1.086  16.924 33.964  1.00 29.73 ? 477 LEU A CD2 1 
ATOM   3623 N  N   . LEU A 1 490 ? 1.128   12.618 33.595  1.00 26.15 ? 478 LEU A N   1 
ATOM   3624 C  CA  . LEU A 1 490 ? 2.505   12.274 33.876  1.00 26.82 ? 478 LEU A CA  1 
ATOM   3625 C  C   . LEU A 1 490 ? 3.116   11.385 32.786  1.00 27.89 ? 478 LEU A C   1 
ATOM   3626 O  O   . LEU A 1 490 ? 4.272   11.603 32.362  1.00 28.00 ? 478 LEU A O   1 
ATOM   3627 C  CB  . LEU A 1 490 ? 2.597   11.546 35.224  1.00 27.78 ? 478 LEU A CB  1 
ATOM   3628 C  CG  . LEU A 1 490 ? 2.433   12.369 36.499  1.00 27.02 ? 478 LEU A CG  1 
ATOM   3629 C  CD1 . LEU A 1 490 ? 2.253   11.414 37.752  1.00 24.15 ? 478 LEU A CD1 1 
ATOM   3630 C  CD2 . LEU A 1 490 ? 3.686   13.277 36.640  1.00 24.16 ? 478 LEU A CD2 1 
ATOM   3631 N  N   . ARG A 1 491 ? 2.341   10.380 32.354  1.00 27.74 ? 479 ARG A N   1 
ATOM   3632 C  CA  . ARG A 1 491 ? 2.759   9.448  31.303  1.00 29.88 ? 479 ARG A CA  1 
ATOM   3633 C  C   . ARG A 1 491 ? 3.047   10.185 30.002  1.00 29.11 ? 479 ARG A C   1 
ATOM   3634 O  O   . ARG A 1 491 ? 3.914   9.782  29.242  1.00 30.56 ? 479 ARG A O   1 
ATOM   3635 C  CB  . ARG A 1 491 ? 1.649   8.388  31.088  1.00 32.60 ? 479 ARG A CB  1 
ATOM   3636 C  CG  . ARG A 1 491 ? 1.934   7.321  30.060  1.00 39.60 ? 479 ARG A CG  1 
ATOM   3637 C  CD  . ARG A 1 491 ? 0.741   6.315  29.821  1.00 45.13 ? 479 ARG A CD  1 
ATOM   3638 N  NE  . ARG A 1 491 ? -0.534  6.982  29.485  1.00 50.09 ? 479 ARG A NE  1 
ATOM   3639 C  CZ  . ARG A 1 491 ? -0.866  7.487  28.274  1.00 54.61 ? 479 ARG A CZ  1 
ATOM   3640 N  NH1 . ARG A 1 491 ? -0.022  7.434  27.238  1.00 52.06 ? 479 ARG A NH1 1 
ATOM   3641 N  NH2 . ARG A 1 491 ? -2.063  8.073  28.098  1.00 55.35 ? 479 ARG A NH2 1 
ATOM   3642 N  N   . LEU A 1 492 ? 2.342   11.290 29.765  1.00 28.08 ? 480 LEU A N   1 
ATOM   3643 C  CA  . LEU A 1 492 ? 2.386   12.002 28.497  1.00 27.24 ? 480 LEU A CA  1 
ATOM   3644 C  C   . LEU A 1 492 ? 3.494   13.085 28.423  1.00 27.12 ? 480 LEU A C   1 
ATOM   3645 O  O   . LEU A 1 492 ? 3.884   13.509 27.335  1.00 28.69 ? 480 LEU A O   1 
ATOM   3646 C  CB  . LEU A 1 492 ? 1.011   12.586 28.181  1.00 27.94 ? 480 LEU A CB  1 
ATOM   3647 C  CG  . LEU A 1 492 ? -0.068  11.589 27.697  1.00 28.99 ? 480 LEU A CG  1 
ATOM   3648 C  CD1 . LEU A 1 492 ? -1.470  12.213 27.855  1.00 27.82 ? 480 LEU A CD1 1 
ATOM   3649 C  CD2 . LEU A 1 492 ? 0.138   11.040 26.272  1.00 29.60 ? 480 LEU A CD2 1 
ATOM   3650 N  N   . ILE A 1 493 ? 4.011   13.498 29.569  1.00 25.53 ? 481 ILE A N   1 
ATOM   3651 C  CA  . ILE A 1 493 ? 5.069   14.485 29.630  1.00 25.53 ? 481 ILE A CA  1 
ATOM   3652 C  C   . ILE A 1 493 ? 6.303   14.189 28.714  1.00 25.50 ? 481 ILE A C   1 
ATOM   3653 O  O   . ILE A 1 493 ? 6.665   15.035 27.959  1.00 26.34 ? 481 ILE A O   1 
ATOM   3654 C  CB  . ILE A 1 493 ? 5.466   14.781 31.088  1.00 25.67 ? 481 ILE A CB  1 
ATOM   3655 C  CG1 . ILE A 1 493 ? 4.369   15.606 31.754  1.00 26.43 ? 481 ILE A CG1 1 
ATOM   3656 C  CG2 . ILE A 1 493 ? 6.766   15.646 31.173  1.00 27.57 ? 481 ILE A CG2 1 
ATOM   3657 C  CD1 . ILE A 1 493 ? 4.537   15.772 33.320  1.00 27.89 ? 481 ILE A CD1 1 
ATOM   3658 N  N   . PRO A 1 494 ? 6.906   12.993 28.777  1.00 26.45 ? 482 PRO A N   1 
ATOM   3659 C  CA  . PRO A 1 494 ? 8.084   12.748 27.919  1.00 28.72 ? 482 PRO A CA  1 
ATOM   3660 C  C   . PRO A 1 494 ? 7.771   12.766 26.418  1.00 28.80 ? 482 PRO A C   1 
ATOM   3661 O  O   . PRO A 1 494 ? 8.644   13.012 25.610  1.00 28.25 ? 482 PRO A O   1 
ATOM   3662 C  CB  . PRO A 1 494 ? 8.581   11.368 28.377  1.00 30.45 ? 482 PRO A CB  1 
ATOM   3663 C  CG  . PRO A 1 494 ? 7.982   11.170 29.776  1.00 29.58 ? 482 PRO A CG  1 
ATOM   3664 C  CD  . PRO A 1 494 ? 6.638   11.858 29.679  1.00 26.18 ? 482 PRO A CD  1 
ATOM   3665 N  N   . GLU A 1 495 ? 6.532   12.440 26.064  1.00 28.67 ? 483 GLU A N   1 
ATOM   3666 C  CA  . GLU A 1 495 ? 6.093   12.596 24.698  1.00 29.70 ? 483 GLU A CA  1 
ATOM   3667 C  C   . GLU A 1 495 ? 5.968   14.095 24.298  1.00 28.92 ? 483 GLU A C   1 
ATOM   3668 O  O   . GLU A 1 495 ? 6.373   14.482 23.199  1.00 29.81 ? 483 GLU A O   1 
ATOM   3669 C  CB  . GLU A 1 495 ? 4.775   11.821 24.443  1.00 31.19 ? 483 GLU A CB  1 
ATOM   3670 C  CG  . GLU A 1 495 ? 4.434   11.855 22.949  1.00 36.92 ? 483 GLU A CG  1 
ATOM   3671 C  CD  . GLU A 1 495 ? 3.075   11.328 22.578  1.00 43.06 ? 483 GLU A CD  1 
ATOM   3672 O  OE1 . GLU A 1 495 ? 2.392   10.719 23.406  1.00 47.71 ? 483 GLU A OE1 1 
ATOM   3673 O  OE2 . GLU A 1 495 ? 2.690   11.539 21.416  1.00 49.38 ? 483 GLU A OE2 1 
ATOM   3674 N  N   . ALA A 1 496 ? 5.435   14.934 25.192  1.00 27.11 ? 484 ALA A N   1 
ATOM   3675 C  CA  . ALA A 1 496 ? 5.391   16.352 24.942  1.00 27.43 ? 484 ALA A CA  1 
ATOM   3676 C  C   . ALA A 1 496 ? 6.830   16.885 24.710  1.00 27.57 ? 484 ALA A C   1 
ATOM   3677 O  O   . ALA A 1 496 ? 7.079   17.659 23.772  1.00 29.10 ? 484 ALA A O   1 
ATOM   3678 C  CB  . ALA A 1 496 ? 4.666   17.086 26.102  1.00 26.70 ? 484 ALA A CB  1 
ATOM   3679 N  N   . ILE A 1 497 ? 7.763   16.469 25.546  1.00 26.50 ? 485 ILE A N   1 
ATOM   3680 C  CA  . ILE A 1 497 ? 9.158   16.859 25.400  1.00 29.33 ? 485 ILE A CA  1 
ATOM   3681 C  C   . ILE A 1 497 ? 9.704   16.409 24.051  1.00 29.72 ? 485 ILE A C   1 
ATOM   3682 O  O   . ILE A 1 497 ? 10.307  17.205 23.312  1.00 30.22 ? 485 ILE A O   1 
ATOM   3683 C  CB  . ILE A 1 497 ? 10.033  16.378 26.546  1.00 29.95 ? 485 ILE A CB  1 
ATOM   3684 C  CG1 . ILE A 1 497 ? 9.565   17.031 27.870  1.00 30.44 ? 485 ILE A CG1 1 
ATOM   3685 C  CG2 . ILE A 1 497 ? 11.508  16.709 26.272  1.00 30.76 ? 485 ILE A CG2 1 
ATOM   3686 C  CD1 . ILE A 1 497 ? 10.263  16.545 29.115  1.00 29.25 ? 485 ILE A CD1 1 
ATOM   3687 N  N   . ARG A 1 498 ? 9.479   15.161 23.693  1.00 30.24 ? 486 ARG A N   1 
ATOM   3688 C  CA  . ARG A 1 498 ? 10.003  14.669 22.404  1.00 31.98 ? 486 ARG A CA  1 
ATOM   3689 C  C   . ARG A 1 498 ? 9.374   15.460 21.276  1.00 34.12 ? 486 ARG A C   1 
ATOM   3690 O  O   . ARG A 1 498 ? 10.076  15.837 20.344  1.00 32.76 ? 486 ARG A O   1 
ATOM   3691 C  CB  . ARG A 1 498 ? 9.779   13.160 22.185  1.00 32.65 ? 486 ARG A CB  1 
ATOM   3692 C  CG  . ARG A 1 498 ? 10.144  12.655 20.748  1.00 37.58 ? 486 ARG A CG  1 
ATOM   3693 C  CD  . ARG A 1 498 ? 9.829   11.177 20.550  1.00 42.24 ? 486 ARG A CD  1 
ATOM   3694 N  NE  . ARG A 1 498 ? 8.387   10.976 20.391  1.00 47.89 ? 486 ARG A NE  1 
ATOM   3695 C  CZ  . ARG A 1 498 ? 7.686   11.188 19.269  1.00 51.67 ? 486 ARG A CZ  1 
ATOM   3696 N  NH1 . ARG A 1 498 ? 8.280   11.605 18.170  1.00 54.44 ? 486 ARG A NH1 1 
ATOM   3697 N  NH2 . ARG A 1 498 ? 6.378   10.979 19.252  1.00 53.69 ? 486 ARG A NH2 1 
ATOM   3698 N  N   . ARG A 1 499 ? 8.067   15.743 21.355  1.00 35.76 ? 487 ARG A N   1 
ATOM   3699 C  CA  . ARG A 1 499 ? 7.440   16.503 20.263  1.00 40.54 ? 487 ARG A CA  1 
ATOM   3700 C  C   . ARG A 1 499 ? 7.910   17.953 20.131  1.00 44.15 ? 487 ARG A C   1 
ATOM   3701 O  O   . ARG A 1 499 ? 7.928   18.480 19.009  1.00 47.83 ? 487 ARG A O   1 
ATOM   3702 C  CB  . ARG A 1 499 ? 5.926   16.383 20.261  1.00 41.95 ? 487 ARG A CB  1 
ATOM   3703 C  CG  . ARG A 1 499 ? 5.476   15.028 19.774  1.00 44.38 ? 487 ARG A CG  1 
ATOM   3704 C  CD  . ARG A 1 499 ? 4.009   14.867 19.948  1.00 49.30 ? 487 ARG A CD  1 
ATOM   3705 N  NE  . ARG A 1 499 ? 3.509   13.559 19.520  1.00 54.06 ? 487 ARG A NE  1 
ATOM   3706 C  CZ  . ARG A 1 499 ? 3.438   13.147 18.252  1.00 61.04 ? 487 ARG A CZ  1 
ATOM   3707 N  NH1 . ARG A 1 499 ? 3.871   13.912 17.254  1.00 64.88 ? 487 ARG A NH1 1 
ATOM   3708 N  NH2 . ARG A 1 499 ? 2.960   11.939 17.960  1.00 64.29 ? 487 ARG A NH2 1 
ATOM   3709 N  N   . LEU A 1 500 ? 8.377   18.583 21.197  1.00 45.61 ? 488 LEU A N   1 
ATOM   3710 C  CA  . LEU A 1 500 ? 9.008   19.907 21.047  1.00 51.08 ? 488 LEU A CA  1 
ATOM   3711 C  C   . LEU A 1 500 ? 10.178  19.912 20.125  1.00 54.01 ? 488 LEU A C   1 
ATOM   3712 O  O   . LEU A 1 500 ? 10.469  20.933 19.499  1.00 56.84 ? 488 LEU A O   1 
ATOM   3713 C  CB  . LEU A 1 500 ? 9.623   20.385 22.326  1.00 52.32 ? 488 LEU A CB  1 
ATOM   3714 C  CG  . LEU A 1 500 ? 8.767   21.058 23.324  1.00 53.08 ? 488 LEU A CG  1 
ATOM   3715 C  CD1 . LEU A 1 500 ? 9.753   21.269 24.464  1.00 58.52 ? 488 LEU A CD1 1 
ATOM   3716 C  CD2 . LEU A 1 500 ? 8.231   22.345 22.770  1.00 57.05 ? 488 LEU A CD2 1 
ATOM   3717 N  N   . LYS A 1 501 ? 10.897  18.786 20.116  1.00 54.06 ? 489 LYS A N   1 
ATOM   3718 C  CA  . LYS A 1 501 ? 12.101  18.589 19.305  1.00 55.83 ? 489 LYS A CA  1 
ATOM   3719 C  C   . LYS A 1 501 ? 11.812  17.685 18.135  1.00 55.51 ? 489 LYS A C   1 
ATOM   3720 O  O   . LYS A 1 501 ? 11.881  18.123 17.011  1.00 59.63 ? 489 LYS A O   1 
ATOM   3721 C  CB  . LYS A 1 501 ? 13.160  17.909 20.156  1.00 55.86 ? 489 LYS A CB  1 
ATOM   3722 C  CG  . LYS A 1 501 ? 13.440  18.562 21.494  1.00 57.75 ? 489 LYS A CG  1 
ATOM   3723 C  CD  . LYS A 1 501 ? 13.956  17.536 22.479  1.00 58.08 ? 489 LYS A CD  1 
ATOM   3724 C  CE  . LYS A 1 501 ? 15.090  18.083 23.319  1.00 63.91 ? 489 LYS A CE  1 
ATOM   3725 N  NZ  . LYS A 1 501 ? 16.400  18.101 22.593  1.00 67.38 ? 489 LYS A NZ  1 
ATOM   3726 N  N   . ALA B 2 1   ? 5.720   31.479 6.079   1.00 39.08 ? 3   ALA B N   1 
ATOM   3727 C  CA  . ALA B 2 1   ? 5.802   32.416 7.258   1.00 39.22 ? 3   ALA B CA  1 
ATOM   3728 C  C   . ALA B 2 1   ? 6.058   33.906 7.041   1.00 38.13 ? 3   ALA B C   1 
ATOM   3729 O  O   . ALA B 2 1   ? 6.037   34.642 8.020   1.00 39.14 ? 3   ALA B O   1 
ATOM   3730 C  CB  . ALA B 2 1   ? 6.848   31.880 8.314   1.00 39.54 ? 3   ALA B CB  1 
ATOM   3731 N  N   . TRP B 2 2   ? 6.346   34.411 5.833   1.00 36.09 ? 4   TRP B N   1 
ATOM   3732 C  CA  . TRP B 2 2   ? 6.627   35.883 5.736   1.00 34.07 ? 4   TRP B CA  1 
ATOM   3733 C  C   . TRP B 2 2   ? 5.380   36.699 6.087   1.00 33.44 ? 4   TRP B C   1 
ATOM   3734 O  O   . TRP B 2 2   ? 5.484   37.703 6.733   1.00 33.20 ? 4   TRP B O   1 
ATOM   3735 C  CB  . TRP B 2 2   ? 7.086   36.296 4.322   1.00 34.43 ? 4   TRP B CB  1 
ATOM   3736 C  CG  . TRP B 2 2   ? 7.249   37.740 4.180   1.00 32.31 ? 4   TRP B CG  1 
ATOM   3737 C  CD1 . TRP B 2 2   ? 8.342   38.465 4.514   1.00 32.13 ? 4   TRP B CD1 1 
ATOM   3738 C  CD2 . TRP B 2 2   ? 6.304   38.661 3.649   1.00 31.16 ? 4   TRP B CD2 1 
ATOM   3739 N  NE1 . TRP B 2 2   ? 8.137   39.782 4.247   1.00 32.69 ? 4   TRP B NE1 1 
ATOM   3740 C  CE2 . TRP B 2 2   ? 6.892   39.936 3.706   1.00 31.82 ? 4   TRP B CE2 1 
ATOM   3741 C  CE3 . TRP B 2 2   ? 5.003   38.545 3.174   1.00 34.21 ? 4   TRP B CE3 1 
ATOM   3742 C  CZ2 . TRP B 2 2   ? 6.224   41.087 3.323   1.00 31.04 ? 4   TRP B CZ2 1 
ATOM   3743 C  CZ3 . TRP B 2 2   ? 4.348   39.703 2.739   1.00 32.73 ? 4   TRP B CZ3 1 
ATOM   3744 C  CH2 . TRP B 2 2   ? 4.984   40.958 2.803   1.00 30.31 ? 4   TRP B CH2 1 
ATOM   3745 N  N   . LEU B 2 3   ? 4.205   36.273 5.611   1.00 32.79 ? 5   LEU B N   1 
ATOM   3746 C  CA  . LEU B 2 3   ? 2.968   37.022 5.829   1.00 33.41 ? 5   LEU B CA  1 
ATOM   3747 C  C   . LEU B 2 3   ? 2.273   36.739 7.186   1.00 34.50 ? 5   LEU B C   1 
ATOM   3748 O  O   . LEU B 2 3   ? 1.855   37.683 7.877   1.00 33.47 ? 5   LEU B O   1 
ATOM   3749 C  CB  . LEU B 2 3   ? 1.970   36.797 4.698   1.00 32.42 ? 5   LEU B CB  1 
ATOM   3750 C  CG  . LEU B 2 3   ? 0.671   37.629 4.770   1.00 33.95 ? 5   LEU B CG  1 
ATOM   3751 C  CD1 . LEU B 2 3   ? 0.968   39.188 4.910   1.00 32.36 ? 5   LEU B CD1 1 
ATOM   3752 C  CD2 . LEU B 2 3   ? -0.209  37.353 3.581   1.00 33.85 ? 5   LEU B CD2 1 
ATOM   3753 N  N   . PHE B 2 4   ? 2.159   35.465 7.547   1.00 34.54 ? 6   PHE B N   1 
ATOM   3754 C  CA  . PHE B 2 4   ? 1.288   35.047 8.637   1.00 37.77 ? 6   PHE B CA  1 
ATOM   3755 C  C   . PHE B 2 4   ? 2.076   34.285 9.686   1.00 39.78 ? 6   PHE B C   1 
ATOM   3756 O  O   . PHE B 2 4   ? 2.914   33.458 9.327   1.00 39.29 ? 6   PHE B O   1 
ATOM   3757 C  CB  . PHE B 2 4   ? 0.168   34.115 8.155   1.00 36.92 ? 6   PHE B CB  1 
ATOM   3758 C  CG  . PHE B 2 4   ? -0.861  34.775 7.340   1.00 35.66 ? 6   PHE B CG  1 
ATOM   3759 C  CD1 . PHE B 2 4   ? -1.592  35.841 7.845   1.00 34.78 ? 6   PHE B CD1 1 
ATOM   3760 C  CD2 . PHE B 2 4   ? -1.089  34.365 6.047   1.00 33.07 ? 6   PHE B CD2 1 
ATOM   3761 C  CE1 . PHE B 2 4   ? -2.541  36.467 7.075   1.00 32.32 ? 6   PHE B CE1 1 
ATOM   3762 C  CE2 . PHE B 2 4   ? -2.062  34.972 5.262   1.00 33.65 ? 6   PHE B CE2 1 
ATOM   3763 C  CZ  . PHE B 2 4   ? -2.760  36.041 5.745   1.00 33.70 ? 6   PHE B CZ  1 
ATOM   3764 N  N   . GLU B 2 5   ? 1.847   34.614 10.949  1.00 43.45 ? 7   GLU B N   1 
ATOM   3765 C  CA  . GLU B 2 5   ? 2.073   33.669 12.078  1.00 47.34 ? 7   GLU B CA  1 
ATOM   3766 C  C   . GLU B 2 5   ? 0.726   33.001 12.510  1.00 49.00 ? 7   GLU B C   1 
ATOM   3767 O  O   . GLU B 2 5   ? -0.311  33.664 12.573  1.00 48.67 ? 7   GLU B O   1 
ATOM   3768 C  CB  . GLU B 2 5   ? 2.737   34.352 13.243  1.00 48.10 ? 7   GLU B CB  1 
ATOM   3769 C  CG  . GLU B 2 5   ? 3.359   33.339 14.199  1.00 52.61 ? 7   GLU B CG  1 
ATOM   3770 C  CD  . GLU B 2 5   ? 2.995   33.536 15.661  1.00 56.40 ? 7   GLU B CD  1 
ATOM   3771 O  OE1 . GLU B 2 5   ? 2.656   34.678 16.074  1.00 56.14 ? 7   GLU B OE1 1 
ATOM   3772 O  OE2 . GLU B 2 5   ? 3.078   32.509 16.399  1.00 58.50 ? 7   GLU B OE2 1 
ATOM   3773 N  N   . ALA B 2 6   ? 0.744   31.676 12.737  1.00 51.76 ? 8   ALA B N   1 
ATOM   3774 C  CA  . ALA B 2 6   ? -0.498  30.807 12.809  1.00 52.94 ? 8   ALA B CA  1 
ATOM   3775 C  C   . ALA B 2 6   ? -1.210  30.844 14.157  1.00 53.68 ? 8   ALA B C   1 
ATOM   3776 O  O   . ALA B 2 6   ? -0.598  31.138 15.190  1.00 54.87 ? 8   ALA B O   1 
ATOM   3777 C  CB  . ALA B 2 6   ? -0.161  29.345 12.457  1.00 53.05 ? 8   ALA B CB  1 
HETATM 3778 K  K   . K   C 3 .   ? -13.704 43.974 13.895  1.00 52.23 ? 491 K   A K   1 
HETATM 3779 MG MG  . MG  D 4 .   ? -3.627  23.454 42.988  1.00 47.78 ? 492 MG  A MG  1 
HETATM 3780 N  N9A . BA3 E 5 .   ? -17.252 53.444 18.690  1.00 64.35 ? 493 BA3 A N9A 1 
HETATM 3781 C  C8A . BA3 E 5 .   ? -16.285 53.047 19.607  1.00 64.06 ? 493 BA3 A C8A 1 
HETATM 3782 N  N7A . BA3 E 5 .   ? -16.914 52.464 20.648  1.00 63.71 ? 493 BA3 A N7A 1 
HETATM 3783 C  C5A . BA3 E 5 .   ? -18.255 52.489 20.423  1.00 62.77 ? 493 BA3 A C5A 1 
HETATM 3784 C  C6A . BA3 E 5 .   ? -19.317 52.029 21.184  1.00 61.31 ? 493 BA3 A C6A 1 
HETATM 3785 N  N6A . BA3 E 5 .   ? -19.044 51.316 22.285  1.00 61.00 ? 493 BA3 A N6A 1 
HETATM 3786 N  N1A . BA3 E 5 .   ? -20.606 52.184 20.710  1.00 61.22 ? 493 BA3 A N1A 1 
HETATM 3787 C  C2A . BA3 E 5 .   ? -20.832 52.796 19.497  1.00 60.61 ? 493 BA3 A C2A 1 
HETATM 3788 N  N3A . BA3 E 5 .   ? -19.760 53.240 18.749  1.00 60.37 ? 493 BA3 A N3A 1 
HETATM 3789 C  C4A . BA3 E 5 .   ? -18.490 53.110 19.203  1.00 61.69 ? 493 BA3 A C4A 1 
HETATM 3790 O  O5B . BA3 E 5 .   ? -13.436 52.254 15.691  1.00 66.34 ? 493 BA3 A O5B 1 
HETATM 3791 C  C5B . BA3 E 5 .   ? -13.681 53.111 16.791  1.00 67.96 ? 493 BA3 A C5B 1 
HETATM 3792 C  C4B . BA3 E 5 .   ? -14.799 54.110 16.514  1.00 68.32 ? 493 BA3 A C4B 1 
HETATM 3793 O  O4B . BA3 E 5 .   ? -16.049 53.446 16.549  1.00 65.47 ? 493 BA3 A O4B 1 
HETATM 3794 C  C3B . BA3 E 5 .   ? -14.852 55.195 17.611  1.00 69.90 ? 493 BA3 A C3B 1 
HETATM 3795 O  O3B . BA3 E 5 .   ? -14.111 56.377 17.361  1.00 72.35 ? 493 BA3 A O3B 1 
HETATM 3796 C  C2B . BA3 E 5 .   ? -16.338 55.477 17.777  1.00 67.95 ? 493 BA3 A C2B 1 
HETATM 3797 O  O2B . BA3 E 5 .   ? -16.804 56.489 16.931  1.00 67.38 ? 493 BA3 A O2B 1 
HETATM 3798 C  C1B . BA3 E 5 .   ? -16.972 54.137 17.403  1.00 66.81 ? 493 BA3 A C1B 1 
HETATM 3799 P  PE  . BA3 E 5 .   ? -11.959 51.667 15.435  1.00 63.98 ? 493 BA3 A PE  1 
HETATM 3800 O  O1E . BA3 E 5 .   ? -11.695 51.446 13.978  1.00 59.09 ? 493 BA3 A O1E 1 
HETATM 3801 O  O2E . BA3 E 5 .   ? -11.688 50.468 16.338  1.00 66.00 ? 493 BA3 A O2E 1 
HETATM 3802 O  O3E . BA3 E 5 .   ? -11.139 52.949 15.930  1.00 66.17 ? 493 BA3 A O3E 1 
HETATM 3803 P  PF  . BA3 E 5 .   ? -9.821  53.475 15.202  1.00 66.58 ? 493 BA3 A PF  1 
HETATM 3804 O  O1F . BA3 E 5 .   ? -10.214 54.337 14.035  1.00 57.22 ? 493 BA3 A O1F 1 
HETATM 3805 O  O2F . BA3 E 5 .   ? -8.994  52.266 14.793  1.00 68.17 ? 493 BA3 A O2F 1 
HETATM 3806 O  O3F . BA3 E 5 .   ? -9.311  54.332 16.466  1.00 71.47 ? 493 BA3 A O3F 1 
HETATM 3807 P  PG  . BA3 E 5 .   ? -8.087  53.933 17.433  1.00 76.14 ? 493 BA3 A PG  1 
HETATM 3808 O  O1G . BA3 E 5 .   ? -8.145  52.515 17.994  1.00 74.98 ? 493 BA3 A O1G 1 
HETATM 3809 O  O2G . BA3 E 5 .   ? -8.055  54.950 18.558  1.00 76.74 ? 493 BA3 A O2G 1 
HETATM 3810 O  O5D . BA3 E 5 .   ? -6.798  54.056 16.437  1.00 77.68 ? 493 BA3 A O5D 1 
HETATM 3811 O  O3E . BA3 F 5 .   ? -6.782  20.541 41.832  1.00 62.50 ? 494 BA3 A O3E 1 
HETATM 3812 P  PF  . BA3 F 5 .   ? -5.554  20.977 40.899  1.00 64.61 ? 494 BA3 A PF  1 
HETATM 3813 O  O1F . BA3 F 5 .   ? -4.256  20.406 41.488  1.00 66.18 ? 494 BA3 A O1F 1 
HETATM 3814 O  O2F . BA3 F 5 .   ? -5.698  20.578 39.459  1.00 68.16 ? 494 BA3 A O2F 1 
HETATM 3815 O  O3F . BA3 F 5 .   ? -5.836  22.579 40.967  1.00 69.07 ? 494 BA3 A O3F 1 
HETATM 3816 P  PG  . BA3 F 5 .   ? -5.093  23.765 40.125  1.00 67.65 ? 494 BA3 A PG  1 
HETATM 3817 O  O1G . BA3 F 5 .   ? -6.250  24.680 39.705  1.00 71.54 ? 494 BA3 A O1G 1 
HETATM 3818 O  O2G . BA3 F 5 .   ? -4.008  24.335 40.999  1.00 69.48 ? 494 BA3 A O2G 1 
HETATM 3819 O  O5D . BA3 F 5 .   ? -4.303  23.247 38.803  1.00 66.10 ? 494 BA3 A O5D 1 
HETATM 3820 C  C5D . BA3 F 5 .   ? -4.918  23.186 37.527  1.00 65.30 ? 494 BA3 A C5D 1 
HETATM 3821 C  C4D . BA3 F 5 .   ? -3.893  23.186 36.387  1.00 65.07 ? 494 BA3 A C4D 1 
HETATM 3822 O  O4D . BA3 F 5 .   ? -4.618  22.916 35.211  1.00 67.06 ? 494 BA3 A O4D 1 
HETATM 3823 C  C3D . BA3 F 5 .   ? -3.302  24.569 36.096  1.00 65.85 ? 494 BA3 A C3D 1 
HETATM 3824 O  O3D . BA3 F 5 .   ? -2.067  24.503 35.449  1.00 61.70 ? 494 BA3 A O3D 1 
HETATM 3825 C  C2D . BA3 F 5 .   ? -4.222  25.248 35.110  1.00 65.12 ? 494 BA3 A C2D 1 
HETATM 3826 O  O2D . BA3 F 5 .   ? -3.491  26.109 34.307  1.00 65.50 ? 494 BA3 A O2D 1 
HETATM 3827 C  C1D . BA3 F 5 .   ? -4.706  24.066 34.324  1.00 67.25 ? 494 BA3 A C1D 1 
HETATM 3828 N  N9G . BA3 F 5 .   ? -6.067  24.224 33.763  1.00 67.71 ? 494 BA3 A N9G 1 
HETATM 3829 C  C8G . BA3 F 5 .   ? -7.260  24.179 34.460  1.00 68.99 ? 494 BA3 A C8G 1 
HETATM 3830 N  N7G . BA3 F 5 .   ? -8.271  24.297 33.570  1.00 68.25 ? 494 BA3 A N7G 1 
HETATM 3831 C  C5G . BA3 F 5 .   ? -7.742  24.405 32.324  1.00 66.84 ? 494 BA3 A C5G 1 
HETATM 3832 C  C6G . BA3 F 5 .   ? -8.337  24.553 31.075  1.00 65.86 ? 494 BA3 A C6G 1 
HETATM 3833 N  N6G . BA3 F 5 .   ? -9.674  24.479 30.974  1.00 65.53 ? 494 BA3 A N6G 1 
HETATM 3834 N  N1G . BA3 F 5 .   ? -7.516  24.645 29.952  1.00 65.73 ? 494 BA3 A N1G 1 
HETATM 3835 C  C2G . BA3 F 5 .   ? -6.122  24.595 30.063  1.00 65.42 ? 494 BA3 A C2G 1 
HETATM 3836 N  N3G . BA3 F 5 .   ? -5.528  24.456 31.313  1.00 66.00 ? 494 BA3 A N3G 1 
HETATM 3837 C  C4G . BA3 F 5 .   ? -6.342  24.358 32.424  1.00 67.53 ? 494 BA3 A C4G 1 
HETATM 3838 C  C1  . GOL G 6 .   ? -4.064  49.790 9.961   1.00 65.43 ? 495 GOL A C1  1 
HETATM 3839 O  O1  . GOL G 6 .   ? -5.093  50.261 9.131   1.00 64.11 ? 495 GOL A O1  1 
HETATM 3840 C  C2  . GOL G 6 .   ? -4.630  48.731 10.906  1.00 67.22 ? 495 GOL A C2  1 
HETATM 3841 O  O2  . GOL G 6 .   ? -6.024  48.842 11.155  1.00 65.92 ? 495 GOL A O2  1 
HETATM 3842 C  C3  . GOL G 6 .   ? -3.947  48.837 12.255  1.00 69.09 ? 495 GOL A C3  1 
HETATM 3843 O  O3  . GOL G 6 .   ? -2.589  49.111 12.049  1.00 71.19 ? 495 GOL A O3  1 
HETATM 3844 O  O   . HOH H 7 .   ? 0.600   18.434 56.430  1.00 28.37 ? 496 HOH A O   1 
HETATM 3845 O  O   . HOH H 7 .   ? -0.304  24.427 31.916  1.00 25.95 ? 497 HOH A O   1 
HETATM 3846 O  O   . HOH H 7 .   ? -7.633  57.635 9.179   1.00 40.69 ? 498 HOH A O   1 
HETATM 3847 O  O   . HOH H 7 .   ? 12.808  5.027  48.002  1.00 24.50 ? 499 HOH A O   1 
HETATM 3848 O  O   . HOH H 7 .   ? -4.294  33.390 34.234  1.00 24.41 ? 500 HOH A O   1 
HETATM 3849 O  O   . HOH H 7 .   ? 11.695  6.175  50.181  1.00 24.20 ? 501 HOH A O   1 
HETATM 3850 O  O   . HOH H 7 .   ? -14.287 51.183 12.552  1.00 29.19 ? 502 HOH A O   1 
HETATM 3851 O  O   . HOH H 7 .   ? -10.958 50.445 -0.713  1.00 34.51 ? 503 HOH A O   1 
HETATM 3852 O  O   . HOH H 7 .   ? -6.211  15.995 35.220  1.00 33.17 ? 504 HOH A O   1 
HETATM 3853 O  O   . HOH H 7 .   ? 10.409  12.756 61.466  1.00 35.94 ? 505 HOH A O   1 
HETATM 3854 O  O   . HOH H 7 .   ? -4.746  43.501 34.126  1.00 35.57 ? 506 HOH A O   1 
HETATM 3855 O  O   . HOH H 7 .   ? 12.088  35.129 42.801  1.00 39.55 ? 507 HOH A O   1 
HETATM 3856 O  O   . HOH H 7 .   ? 3.036   11.123 61.178  1.00 31.97 ? 508 HOH A O   1 
HETATM 3857 O  O   . HOH H 7 .   ? -2.412  8.553  59.681  1.00 38.61 ? 509 HOH A O   1 
HETATM 3858 O  O   . HOH H 7 .   ? -15.004 16.497 24.681  1.00 47.65 ? 510 HOH A O   1 
HETATM 3859 O  O   . HOH H 7 .   ? -2.513  27.678 30.335  1.00 28.36 ? 511 HOH A O   1 
HETATM 3860 O  O   . HOH H 7 .   ? 3.241   44.134 10.863  1.00 35.03 ? 512 HOH A O   1 
HETATM 3861 O  O   . HOH H 7 .   ? 8.709   4.684  55.852  1.00 29.46 ? 513 HOH A O   1 
HETATM 3862 O  O   . HOH H 7 .   ? 12.136  18.501 63.294  1.00 36.79 ? 514 HOH A O   1 
HETATM 3863 O  O   . HOH H 7 .   ? -5.925  30.086 16.412  1.00 39.53 ? 515 HOH A O   1 
HETATM 3864 O  O   . HOH H 7 .   ? -9.617  45.106 -6.525  1.00 44.87 ? 516 HOH A O   1 
HETATM 3865 O  O   . HOH H 7 .   ? -23.176 55.396 0.319   1.00 51.80 ? 517 HOH A O   1 
HETATM 3866 O  O   . HOH H 7 .   ? -8.559  24.063 37.718  1.00 49.43 ? 518 HOH A O   1 
HETATM 3867 O  O   . HOH H 7 .   ? -13.771 45.495 19.369  1.00 31.26 ? 519 HOH A O   1 
HETATM 3868 O  O   . HOH H 7 .   ? 0.952   24.345 40.412  1.00 32.72 ? 520 HOH A O   1 
HETATM 3869 O  O   . HOH H 7 .   ? 0.370   16.908 63.325  1.00 31.94 ? 521 HOH A O   1 
HETATM 3870 O  O   . HOH H 7 .   ? -8.852  49.466 15.176  1.00 53.84 ? 522 HOH A O   1 
HETATM 3871 O  O   . HOH H 7 .   ? -0.881  26.333 33.889  1.00 29.54 ? 523 HOH A O   1 
HETATM 3872 O  O   . HOH H 7 .   ? -6.468  14.605 37.439  1.00 29.92 ? 524 HOH A O   1 
HETATM 3873 O  O   . HOH H 7 .   ? 0.183   58.953 6.588   1.00 35.86 ? 525 HOH A O   1 
HETATM 3874 O  O   . HOH H 7 .   ? 0.564   42.620 4.470   1.00 33.40 ? 526 HOH A O   1 
HETATM 3875 O  O   . HOH H 7 .   ? -16.453 39.682 29.598  1.00 32.00 ? 527 HOH A O   1 
HETATM 3876 O  O   . HOH H 7 .   ? -4.146  15.097 47.217  1.00 33.46 ? 528 HOH A O   1 
HETATM 3877 O  O   . HOH H 7 .   ? 13.515  34.272 37.111  1.00 33.84 ? 529 HOH A O   1 
HETATM 3878 O  O   . HOH H 7 .   ? -4.279  14.782 44.674  1.00 41.29 ? 530 HOH A O   1 
HETATM 3879 O  O   . HOH H 7 .   ? 10.478  16.131 62.048  1.00 40.66 ? 531 HOH A O   1 
HETATM 3880 O  O   . HOH H 7 .   ? -15.234 31.552 17.816  1.00 36.92 ? 532 HOH A O   1 
HETATM 3881 O  O   . HOH H 7 .   ? 18.569  27.057 54.487  1.00 53.85 ? 533 HOH A O   1 
HETATM 3882 O  O   . HOH H 7 .   ? -8.652  61.057 3.322   1.00 49.32 ? 534 HOH A O   1 
HETATM 3883 O  O   . HOH H 7 .   ? -5.385  52.595 1.990   1.00 29.57 ? 535 HOH A O   1 
HETATM 3884 O  O   . HOH H 7 .   ? -2.686  19.667 46.378  1.00 34.26 ? 536 HOH A O   1 
HETATM 3885 O  O   . HOH H 7 .   ? -2.946  43.899 23.382  1.00 35.15 ? 537 HOH A O   1 
HETATM 3886 O  O   . HOH H 7 .   ? 27.792  17.114 35.521  1.00 40.45 ? 538 HOH A O   1 
HETATM 3887 O  O   . HOH H 7 .   ? -18.697 14.860 31.032  1.00 30.67 ? 539 HOH A O   1 
HETATM 3888 O  O   . HOH H 7 .   ? -6.479  34.146 35.746  1.00 26.87 ? 540 HOH A O   1 
HETATM 3889 O  O   . HOH H 7 .   ? -6.477  25.848 47.588  1.00 38.62 ? 541 HOH A O   1 
HETATM 3890 O  O   . HOH H 7 .   ? -21.910 30.267 5.000   1.00 47.14 ? 542 HOH A O   1 
HETATM 3891 O  O   . HOH H 7 .   ? -22.335 38.401 22.781  1.00 55.43 ? 543 HOH A O   1 
HETATM 3892 O  O   . HOH H 7 .   ? -7.888  47.012 -5.810  1.00 34.47 ? 544 HOH A O   1 
HETATM 3893 O  O   . HOH H 7 .   ? -9.791  29.026 33.269  1.00 31.28 ? 545 HOH A O   1 
HETATM 3894 O  O   . HOH H 7 .   ? 1.447   28.627 25.062  1.00 29.83 ? 546 HOH A O   1 
HETATM 3895 O  O   . HOH H 7 .   ? 10.060  5.379  52.646  1.00 34.13 ? 547 HOH A O   1 
HETATM 3896 O  O   . HOH H 7 .   ? 3.908   17.697 63.086  1.00 38.80 ? 548 HOH A O   1 
HETATM 3897 O  O   . HOH H 7 .   ? 14.911  34.311 33.613  1.00 42.28 ? 549 HOH A O   1 
HETATM 3898 O  O   . HOH H 7 .   ? 11.771  21.577 64.582  1.00 38.86 ? 550 HOH A O   1 
HETATM 3899 O  O   . HOH H 7 .   ? 14.069  10.185 43.421  1.00 37.92 ? 551 HOH A O   1 
HETATM 3900 O  O   . HOH H 7 .   ? -12.694 17.725 34.733  1.00 30.56 ? 552 HOH A O   1 
HETATM 3901 O  O   . HOH H 7 .   ? -0.179  10.600 59.615  1.00 38.22 ? 553 HOH A O   1 
HETATM 3902 O  O   . HOH H 7 .   ? -6.322  8.193  61.067  1.00 45.43 ? 554 HOH A O   1 
HETATM 3903 O  O   . HOH H 7 .   ? -6.692  15.712 43.876  1.00 44.04 ? 555 HOH A O   1 
HETATM 3904 O  O   . HOH H 7 .   ? -3.376  21.343 49.213  1.00 40.03 ? 556 HOH A O   1 
HETATM 3905 O  O   . HOH H 7 .   ? 18.116  27.580 38.990  1.00 48.67 ? 557 HOH A O   1 
HETATM 3906 O  O   . HOH H 7 .   ? -24.711 37.518 20.358  1.00 42.87 ? 558 HOH A O   1 
HETATM 3907 O  O   . HOH H 7 .   ? -5.985  51.842 -0.296  1.00 33.20 ? 559 HOH A O   1 
HETATM 3908 O  O   . HOH H 7 .   ? 29.341  14.949 27.592  1.00 39.33 ? 560 HOH A O   1 
HETATM 3909 O  O   . HOH H 7 .   ? -7.161  29.263 21.100  1.00 43.90 ? 561 HOH A O   1 
HETATM 3910 O  O   . HOH H 7 .   ? -18.649 53.389 13.508  1.00 43.46 ? 562 HOH A O   1 
HETATM 3911 O  O   . HOH H 7 .   ? -4.456  17.122 44.503  1.00 44.85 ? 563 HOH A O   1 
HETATM 3912 O  O   . HOH H 7 .   ? -4.226  17.967 47.864  1.00 42.93 ? 564 HOH A O   1 
HETATM 3913 O  O   . HOH H 7 .   ? -0.478  30.199 7.807   1.00 54.97 ? 565 HOH A O   1 
HETATM 3914 O  O   . HOH H 7 .   ? 24.056  7.953  45.109  1.00 52.05 ? 566 HOH A O   1 
HETATM 3915 O  O   . HOH H 7 .   ? -11.055 46.650 21.375  1.00 33.46 ? 567 HOH A O   1 
HETATM 3916 O  O   . HOH H 7 .   ? 10.960  32.864 30.075  1.00 41.45 ? 568 HOH A O   1 
HETATM 3917 O  O   . HOH H 7 .   ? 1.661   7.846  35.884  1.00 35.52 ? 569 HOH A O   1 
HETATM 3918 O  O   . HOH H 7 .   ? -12.373 45.408 29.635  1.00 42.77 ? 570 HOH A O   1 
HETATM 3919 O  O   . HOH H 7 .   ? -14.503 35.856 44.906  1.00 45.39 ? 571 HOH A O   1 
HETATM 3920 O  O   . HOH H 7 .   ? -5.016  24.605 23.661  1.00 49.03 ? 572 HOH A O   1 
HETATM 3921 O  O   . HOH H 7 .   ? -2.622  25.615 43.363  1.00 40.71 ? 573 HOH A O   1 
HETATM 3922 O  O   . HOH H 7 .   ? -1.637  22.298 43.033  1.00 36.09 ? 574 HOH A O   1 
HETATM 3923 O  O   . HOH H 7 .   ? 6.255   8.115  30.325  1.00 40.60 ? 575 HOH A O   1 
HETATM 3924 O  O   . HOH H 7 .   ? 33.144  14.827 29.535  1.00 40.70 ? 576 HOH A O   1 
HETATM 3925 O  O   . HOH H 7 .   ? 17.946  27.048 29.009  1.00 46.83 ? 577 HOH A O   1 
HETATM 3926 O  O   . HOH H 7 .   ? -18.184 41.354 -7.202  1.00 55.65 ? 578 HOH A O   1 
HETATM 3927 O  O   . HOH H 7 .   ? -4.879  24.022 44.756  1.00 36.60 ? 579 HOH A O   1 
HETATM 3928 O  O   . HOH H 7 .   ? -8.190  47.844 13.324  1.00 48.00 ? 580 HOH A O   1 
HETATM 3929 O  O   . HOH H 7 .   ? -9.387  26.032 46.421  1.00 65.83 ? 581 HOH A O   1 
HETATM 3930 O  O   . HOH H 7 .   ? -22.911 51.189 20.823  1.00 52.06 ? 582 HOH A O   1 
HETATM 3931 O  O   . HOH H 7 .   ? 5.798   49.201 23.541  1.00 61.37 ? 583 HOH A O   1 
HETATM 3932 O  O   . HOH H 7 .   ? -9.475  32.910 -4.326  1.00 42.44 ? 584 HOH A O   1 
HETATM 3933 O  O   . HOH H 7 .   ? -12.912 35.061 -9.790  1.00 53.85 ? 585 HOH A O   1 
HETATM 3934 O  O   . HOH H 7 .   ? -20.675 45.608 -4.772  1.00 39.01 ? 586 HOH A O   1 
HETATM 3935 O  O   . HOH H 7 .   ? -11.965 45.553 -9.694  1.00 44.86 ? 587 HOH A O   1 
HETATM 3936 O  O   . HOH H 7 .   ? -24.358 54.244 9.237   1.00 55.38 ? 588 HOH A O   1 
HETATM 3937 O  O   . HOH H 7 .   ? -17.730 57.051 -7.008  1.00 54.28 ? 589 HOH A O   1 
HETATM 3938 O  O   . HOH H 7 .   ? -22.880 49.413 -7.444  1.00 63.06 ? 590 HOH A O   1 
HETATM 3939 O  O   . HOH H 7 .   ? -28.804 52.691 2.635   1.00 54.30 ? 591 HOH A O   1 
HETATM 3940 O  O   . HOH H 7 .   ? -21.827 32.556 12.774  1.00 56.84 ? 592 HOH A O   1 
HETATM 3941 O  O   . HOH H 7 .   ? -20.914 34.662 14.737  1.00 42.58 ? 593 HOH A O   1 
HETATM 3942 O  O   . HOH H 7 .   ? -7.707  40.919 31.510  1.00 38.50 ? 594 HOH A O   1 
HETATM 3943 O  O   . HOH H 7 .   ? -10.405 38.646 30.370  1.00 39.96 ? 595 HOH A O   1 
HETATM 3944 O  O   . HOH H 7 .   ? -14.954 31.971 27.187  1.00 39.28 ? 596 HOH A O   1 
HETATM 3945 O  O   . HOH H 7 .   ? 5.953   43.702 10.585  1.00 40.22 ? 597 HOH A O   1 
HETATM 3946 O  O   . HOH H 7 .   ? 7.186   43.294 5.899   1.00 48.31 ? 598 HOH A O   1 
HETATM 3947 O  O   . HOH H 7 .   ? 5.041   45.373 31.392  1.00 58.78 ? 599 HOH A O   1 
HETATM 3948 O  O   . HOH H 7 .   ? -0.580  23.654 21.330  1.00 58.52 ? 600 HOH A O   1 
HETATM 3949 O  O   . HOH H 7 .   ? -7.521  14.680 24.386  1.00 46.45 ? 601 HOH A O   1 
HETATM 3950 O  O   . HOH H 7 .   ? -10.957 15.526 23.706  1.00 39.42 ? 602 HOH A O   1 
HETATM 3951 O  O   . HOH H 7 .   ? 13.797  27.523 19.039  1.00 56.19 ? 603 HOH A O   1 
HETATM 3952 O  O   . HOH H 7 .   ? 20.874  20.137 34.356  1.00 40.00 ? 604 HOH A O   1 
HETATM 3953 O  O   . HOH H 7 .   ? 21.023  17.919 24.831  1.00 45.52 ? 605 HOH A O   1 
HETATM 3954 O  O   . HOH H 7 .   ? -7.075  21.150 56.523  1.00 52.77 ? 606 HOH A O   1 
HETATM 3955 O  O   . HOH H 7 .   ? 4.942   9.975  27.108  1.00 41.58 ? 607 HOH A O   1 
HETATM 3956 O  O   . HOH H 7 .   ? 3.435   24.355 64.450  1.00 42.47 ? 608 HOH A O   1 
HETATM 3957 O  O   . HOH H 7 .   ? 19.737  26.149 44.371  1.00 45.99 ? 609 HOH A O   1 
HETATM 3958 O  O   . HOH H 7 .   ? 18.866  30.505 46.430  1.00 50.53 ? 610 HOH A O   1 
HETATM 3959 O  O   . HOH H 7 .   ? 11.570  34.169 47.669  1.00 40.12 ? 611 HOH A O   1 
HETATM 3960 O  O   . HOH H 7 .   ? 10.868  36.744 47.422  1.00 49.02 ? 612 HOH A O   1 
HETATM 3961 O  O   . HOH H 7 .   ? -10.732 19.015 50.264  1.00 54.71 ? 613 HOH A O   1 
HETATM 3962 O  O   . HOH H 7 .   ? -0.047  33.655 57.583  1.00 52.08 ? 614 HOH A O   1 
HETATM 3963 O  O   . HOH H 7 .   ? -4.788  31.753 49.048  1.00 39.62 ? 615 HOH A O   1 
HETATM 3964 O  O   . HOH H 7 .   ? -0.042  37.402 53.615  1.00 58.63 ? 616 HOH A O   1 
HETATM 3965 O  O   . HOH H 7 .   ? -9.497  29.167 36.336  1.00 46.88 ? 617 HOH A O   1 
HETATM 3966 O  O   . HOH H 7 .   ? -7.880  27.322 37.235  1.00 46.33 ? 618 HOH A O   1 
HETATM 3967 O  O   . HOH H 7 .   ? -11.061 32.906 46.940  1.00 54.47 ? 619 HOH A O   1 
HETATM 3968 O  O   . HOH H 7 .   ? -4.351  38.618 39.025  1.00 40.99 ? 620 HOH A O   1 
HETATM 3969 O  O   . HOH H 7 .   ? -5.482  26.510 26.901  1.00 48.05 ? 621 HOH A O   1 
HETATM 3970 O  O   . HOH H 7 .   ? -2.709  24.897 30.635  1.00 44.50 ? 622 HOH A O   1 
HETATM 3971 O  O   . HOH H 7 .   ? 9.972   39.510 40.141  1.00 44.99 ? 623 HOH A O   1 
HETATM 3972 O  O   . HOH H 7 .   ? -6.669  19.290 23.249  1.00 44.91 ? 624 HOH A O   1 
HETATM 3973 O  O   . HOH H 7 .   ? -7.151  9.290  32.527  1.00 45.91 ? 625 HOH A O   1 
HETATM 3974 O  O   . HOH H 7 .   ? 11.497  19.026 12.958  1.00 61.81 ? 626 HOH A O   1 
HETATM 3975 O  O   . HOH I 7 .   ? 3.665   34.013 3.677   1.00 33.67 ? 1   HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . HIS A 12  ? 1.3962 1.0943 0.5065 -0.2739 0.1474  0.0651  0   HIS A N   
2    C CA  . HIS A 12  ? 1.3150 1.0109 0.5195 -0.2476 0.1831  0.0604  0   HIS A CA  
3    C C   . HIS A 12  ? 1.2109 0.9070 0.5239 -0.2074 0.1613  0.0494  0   HIS A C   
4    O O   . HIS A 12  ? 1.1783 0.8774 0.5011 -0.1990 0.1377  0.0287  0   HIS A O   
5    N N   . MET A 13  ? 1.1542 0.8486 0.5459 -0.1874 0.1701  0.0631  1   MET A N   
6    C CA  . MET A 13  ? 1.0657 0.7635 0.5507 -0.1536 0.1617  0.0454  1   MET A CA  
7    C C   . MET A 13  ? 1.0325 0.7338 0.5388 -0.1433 0.1884  -0.0033 1   MET A C   
8    O O   . MET A 13  ? 0.9630 0.6663 0.5205 -0.1223 0.1722  -0.0150 1   MET A O   
9    C CB  . MET A 13  ? 1.0268 0.7220 0.5815 -0.1422 0.1713  0.0608  1   MET A CB  
10   C CG  . MET A 13  ? 1.0348 0.7156 0.6224 -0.1314 0.1330  0.0970  1   MET A CG  
11   S SD  . MET A 13  ? 1.0390 0.7304 0.6712 -0.1008 0.0920  0.0870  1   MET A SD  
12   C CE  . MET A 13  ? 1.0683 0.7556 0.6495 -0.1127 0.0509  0.1311  1   MET A CE  
13   N N   . LYS A 14  ? 1.0834 0.7844 0.5549 -0.1573 0.2311  -0.0314 2   LYS A N   
14   C CA  . LYS A 14  ? 1.0698 0.7644 0.5727 -0.1428 0.2536  -0.0770 2   LYS A CA  
15   C C   . LYS A 14  ? 1.0616 0.7400 0.5346 -0.1465 0.2213  -0.0895 2   LYS A C   
16   O O   . LYS A 14  ? 1.0159 0.6853 0.5406 -0.1284 0.2121  -0.1034 2   LYS A O   
17   C CB  . LYS A 14  ? 1.1484 0.8456 0.6213 -0.1554 0.3094  -0.1122 2   LYS A CB  
18   C CG  . LYS A 14  ? 1.1698 0.8562 0.7031 -0.1316 0.3362  -0.1589 2   LYS A CG  
19   C CD  . LYS A 14  ? 1.2978 0.9628 0.7598 -0.1492 0.3693  -0.2090 2   LYS A CD  
20   C CE  . LYS A 14  ? 1.3218 0.9768 0.8578 -0.1222 0.4100  -0.2568 2   LYS A CE  
21   N NZ  . LYS A 14  ? 1.3385 1.0362 0.9227 -0.1162 0.4601  -0.2606 2   LYS A NZ  
22   N N   . GLU A 15  ? 1.1036 0.7820 0.4960 -0.1732 0.1996  -0.0779 3   GLU A N   
23   C CA  . GLU A 15  ? 1.1055 0.7790 0.4742 -0.1837 0.1637  -0.0855 3   GLU A CA  
24   C C   . GLU A 15  ? 1.0061 0.6981 0.4400 -0.1646 0.1233  -0.0563 3   GLU A C   
25   O O   . GLU A 15  ? 0.9730 0.6653 0.4285 -0.1648 0.1053  -0.0677 3   GLU A O   
26   C CB  . GLU A 15  ? 1.2027 0.8816 0.4704 -0.2195 0.1440  -0.0754 3   GLU A CB  
27   C CG  . GLU A 15  ? 1.2759 0.9520 0.5121 -0.2400 0.1112  -0.0945 3   GLU A CG  
28   C CD  . GLU A 15  ? 1.4062 1.0998 0.5496 -0.2755 0.0742  -0.0718 3   GLU A CD  
29   O OE1 . GLU A 15  ? 1.4935 1.1840 0.5529 -0.2972 0.0941  -0.0671 3   GLU A OE1 
30   O OE2 . GLU A 15  ? 1.4300 1.1462 0.5868 -0.2835 0.0240  -0.0559 3   GLU A OE2 
31   N N   . ILE A 16  ? 0.9535 0.6602 0.4195 -0.1505 0.1119  -0.0206 4   ILE A N   
32   C CA  . ILE A 16  ? 0.8789 0.6055 0.4097 -0.1293 0.0812  0.0000  4   ILE A CA  
33   C C   . ILE A 16  ? 0.8121 0.5371 0.4058 -0.1081 0.0962  -0.0186 4   ILE A C   
34   O O   . ILE A 16  ? 0.7737 0.5141 0.3991 -0.1022 0.0794  -0.0203 4   ILE A O   
35   C CB  . ILE A 16  ? 0.8774 0.6082 0.4288 -0.1186 0.0664  0.0374  4   ILE A CB  
36   C CG1 . ILE A 16  ? 0.9764 0.7088 0.4619 -0.1412 0.0404  0.0685  4   ILE A CG1 
37   C CG2 . ILE A 16  ? 0.8078 0.5574 0.4330 -0.0922 0.0441  0.0461  4   ILE A CG2 
38   C CD1 . ILE A 16  ? 0.9938 0.7487 0.4545 -0.1553 0.0062  0.0665  4   ILE A CD1 
39   N N   . ASP A 17  ? 0.7908 0.5031 0.4036 -0.0994 0.1263  -0.0297 5   ASP A N   
40   C CA  . ASP A 17  ? 0.7495 0.4597 0.4150 -0.0823 0.1352  -0.0442 5   ASP A CA  
41   C C   . ASP A 17  ? 0.7557 0.4498 0.4107 -0.0900 0.1335  -0.0642 5   ASP A C   
42   O O   . ASP A 17  ? 0.7177 0.4179 0.4046 -0.0835 0.1197  -0.0594 5   ASP A O   
43   C CB  . ASP A 17  ? 0.7641 0.4691 0.4577 -0.0739 0.1659  -0.0548 5   ASP A CB  
44   C CG  . ASP A 17  ? 0.7778 0.4965 0.5021 -0.0683 0.1657  -0.0356 5   ASP A CG  
45   O OD1 . ASP A 17  ? 0.7905 0.5164 0.5317 -0.0614 0.1414  -0.0198 5   ASP A OD1 
46   O OD2 . ASP A 17  ? 0.8594 0.5817 0.5966 -0.0720 0.1931  -0.0399 5   ASP A OD2 
47   N N   . GLU A 18  ? 0.7959 0.4673 0.4032 -0.1073 0.1485  -0.0870 6   GLU A N   
48   C CA  . GLU A 18  ? 0.8323 0.4740 0.4339 -0.1169 0.1489  -0.1114 6   GLU A CA  
49   C C   . GLU A 18  ? 0.8029 0.4584 0.4014 -0.1322 0.1156  -0.0988 6   GLU A C   
50   O O   . GLU A 18  ? 0.7916 0.4340 0.4204 -0.1325 0.1097  -0.0994 6   GLU A O   
51   C CB  . GLU A 18  ? 0.9158 0.5274 0.4585 -0.1364 0.1719  -0.1483 6   GLU A CB  
52   C CG  . GLU A 18  ? 0.9944 0.5904 0.5583 -0.1201 0.2151  -0.1739 6   GLU A CG  
53   C CD  . GLU A 18  ? 1.1417 0.7162 0.6341 -0.1420 0.2458  -0.2165 6   GLU A CD  
54   O OE1 . GLU A 18  ? 1.2599 0.8032 0.7092 -0.1641 0.2351  -0.2432 6   GLU A OE1 
55   O OE2 . GLU A 18  ? 1.2171 0.8075 0.6930 -0.1415 0.2821  -0.2256 6   GLU A OE2 
56   N N   . LEU A 19  ? 0.7974 0.4816 0.3633 -0.1466 0.0932  -0.0844 7   LEU A N   
57   C CA  . LEU A 19  ? 0.7829 0.4967 0.3615 -0.1603 0.0617  -0.0715 7   LEU A CA  
58   C C   . LEU A 19  ? 0.7070 0.4503 0.3505 -0.1393 0.0574  -0.0516 7   LEU A C   
59   O O   . LEU A 19  ? 0.6910 0.4450 0.3582 -0.1502 0.0494  -0.0498 7   LEU A O   
60   C CB  . LEU A 19  ? 0.8002 0.5462 0.3462 -0.1728 0.0341  -0.0539 7   LEU A CB  
61   C CG  . LEU A 19  ? 0.9175 0.6411 0.3797 -0.2050 0.0318  -0.0746 7   LEU A CG  
62   C CD1 . LEU A 19  ? 0.9307 0.6857 0.3513 -0.2159 0.0002  -0.0447 7   LEU A CD1 
63   C CD2 . LEU A 19  ? 0.9176 0.6269 0.3672 -0.2354 0.0199  -0.1015 7   LEU A CD2 
64   N N   . THR A 20  ? 0.6598 0.4140 0.3273 -0.1138 0.0653  -0.0393 8   THR A N   
65   C CA  . THR A 20  ? 0.6058 0.3891 0.3219 -0.0966 0.0627  -0.0280 8   THR A CA  
66   C C   . THR A 20  ? 0.6073 0.3730 0.3377 -0.0982 0.0730  -0.0324 8   THR A C   
67   O O   . THR A 20  ? 0.5891 0.3808 0.3398 -0.1029 0.0681  -0.0239 8   THR A O   
68   C CB  . THR A 20  ? 0.5872 0.3753 0.3221 -0.0736 0.0676  -0.0207 8   THR A CB  
69   O OG1 . THR A 20  ? 0.5559 0.3526 0.2797 -0.0734 0.0532  -0.0074 8   THR A OG1 
70   C CG2 . THR A 20  ? 0.5335 0.3500 0.3084 -0.0586 0.0668  -0.0191 8   THR A CG2 
71   N N   . ILE A 21  ? 0.6311 0.3537 0.3525 -0.0956 0.0877  -0.0440 9   ILE A N   
72   C CA  . ILE A 21  ? 0.6495 0.3452 0.3893 -0.0956 0.0910  -0.0418 9   ILE A CA  
73   C C   . ILE A 21  ? 0.6888 0.3605 0.4158 -0.1227 0.0840  -0.0463 9   ILE A C   
74   O O   . ILE A 21  ? 0.6836 0.3676 0.4232 -0.1359 0.0750  -0.0293 9   ILE A O   
75   C CB  . ILE A 21  ? 0.6706 0.3320 0.4259 -0.0777 0.1077  -0.0530 9   ILE A CB  
76   C CG1 . ILE A 21  ? 0.6460 0.3365 0.4234 -0.0576 0.1108  -0.0455 9   ILE A CG1 
77   C CG2 . ILE A 21  ? 0.7069 0.3316 0.4895 -0.0752 0.1040  -0.0452 9   ILE A CG2 
78   C CD1 . ILE A 21  ? 0.6797 0.3571 0.4710 -0.0459 0.1334  -0.0609 9   ILE A CD1 
79   N N   . LYS A 22  ? 0.7249 0.3653 0.4226 -0.1359 0.0888  -0.0702 10  LYS A N   
80   C CA  . LYS A 22  ? 0.7887 0.3911 0.4760 -0.1642 0.0826  -0.0825 10  LYS A CA  
81   C C   . LYS A 22  ? 0.7784 0.4224 0.4629 -0.1950 0.0604  -0.0710 10  LYS A C   
82   O O   . LYS A 22  ? 0.7952 0.4216 0.4928 -0.2194 0.0531  -0.0651 10  LYS A O   
83   C CB  . LYS A 22  ? 0.8494 0.4039 0.4980 -0.1729 0.0965  -0.1226 10  LYS A CB  
84   C CG  . LYS A 22  ? 0.9706 0.4811 0.6048 -0.2091 0.0857  -0.1422 10  LYS A CG  
85   C CD  . LYS A 22  ? 1.0778 0.5318 0.6678 -0.2213 0.1022  -0.1933 10  LYS A CD  
86   C CE  . LYS A 22  ? 1.1367 0.5544 0.7084 -0.2656 0.0833  -0.2137 10  LYS A CE  
87   N NZ  . LYS A 22  ? 1.2253 0.5891 0.7442 -0.2766 0.1028  -0.2719 10  LYS A NZ  
88   N N   . GLU A 23  ? 0.7607 0.4595 0.4354 -0.1955 0.0481  -0.0659 11  GLU A N   
89   C CA  . GLU A 23  ? 0.7743 0.5240 0.4631 -0.2230 0.0248  -0.0562 11  GLU A CA  
90   C C   . GLU A 23  ? 0.6985 0.5154 0.4364 -0.2094 0.0244  -0.0308 11  GLU A C   
91   O O   . GLU A 23  ? 0.7056 0.5614 0.4734 -0.2322 0.0174  -0.0207 11  GLU A O   
92   C CB  . GLU A 23  ? 0.8144 0.5897 0.4710 -0.2344 0.0033  -0.0637 11  GLU A CB  
93   C CG  . GLU A 23  ? 0.9430 0.6601 0.5316 -0.2474 0.0095  -0.0950 11  GLU A CG  
94   C CD  . GLU A 23  ? 1.0985 0.7762 0.6615 -0.2889 0.0002  -0.1233 11  GLU A CD  
95   O OE1 . GLU A 23  ? 1.1610 0.8431 0.7650 -0.3093 -0.0082 -0.1152 11  GLU A OE1 
96   O OE2 . GLU A 23  ? 1.2135 0.8535 0.7113 -0.3046 0.0035  -0.1561 11  GLU A OE2 
97   N N   . TYR A 24  ? 0.6400 0.4732 0.3875 -0.1751 0.0339  -0.0242 12  TYR A N   
98   C CA  . TYR A 24  ? 0.5966 0.4909 0.3868 -0.1601 0.0379  -0.0109 12  TYR A CA  
99   C C   . TYR A 24  ? 0.5875 0.4685 0.3800 -0.1585 0.0551  -0.0029 12  TYR A C   
100  O O   . TYR A 24  ? 0.5773 0.5058 0.3925 -0.1628 0.0627  0.0057  12  TYR A O   
101  C CB  . TYR A 24  ? 0.5662 0.4808 0.3688 -0.1269 0.0361  -0.0106 12  TYR A CB  
102  C CG  . TYR A 24  ? 0.5614 0.5079 0.3744 -0.1289 0.0112  -0.0053 12  TYR A CG  
103  C CD1 . TYR A 24  ? 0.5961 0.5077 0.3606 -0.1402 -0.0024 -0.0071 12  TYR A CD1 
104  C CD2 . TYR A 24  ? 0.5541 0.5703 0.4267 -0.1202 0.0007  0.0021  12  TYR A CD2 
105  C CE1 . TYR A 24  ? 0.6359 0.5779 0.4008 -0.1457 -0.0334 0.0051  12  TYR A CE1 
106  C CE2 . TYR A 24  ? 0.5532 0.6020 0.4455 -0.1190 -0.0310 0.0141  12  TYR A CE2 
107  C CZ  . TYR A 24  ? 0.6102 0.6201 0.4431 -0.1340 -0.0516 0.0189  12  TYR A CZ  
108  O OH  . TYR A 24  ? 0.6300 0.6723 0.4719 -0.1370 -0.0903 0.0376  12  TYR A OH  
109  N N   . GLY A 25  ? 0.6069 0.4268 0.3766 -0.1533 0.0611  -0.0046 13  GLY A N   
110  C CA  . GLY A 25  ? 0.6105 0.4162 0.3810 -0.1574 0.0677  0.0126  13  GLY A CA  
111  C C   . GLY A 25  ? 0.5657 0.3836 0.3365 -0.1311 0.0735  0.0159  13  GLY A C   
112  O O   . GLY A 25  ? 0.5540 0.3752 0.3180 -0.1364 0.0745  0.0336  13  GLY A O   
113  N N   . VAL A 26  ? 0.5529 0.3756 0.3279 -0.1067 0.0749  0.0010  14  VAL A N   
114  C CA  . VAL A 26  ? 0.5252 0.3545 0.3034 -0.0855 0.0775  -0.0006 14  VAL A CA  
115  C C   . VAL A 26  ? 0.5482 0.3315 0.3269 -0.0782 0.0745  0.0051  14  VAL A C   
116  O O   . VAL A 26  ? 0.5751 0.3249 0.3576 -0.0728 0.0788  -0.0048 14  VAL A O   
117  C CB  . VAL A 26  ? 0.5235 0.3644 0.3139 -0.0652 0.0788  -0.0157 14  VAL A CB  
118  C CG1 . VAL A 26  ? 0.4866 0.3311 0.2833 -0.0495 0.0795  -0.0217 14  VAL A CG1 
119  C CG2 . VAL A 26  ? 0.4732 0.3583 0.2805 -0.0654 0.0777  -0.0199 14  VAL A CG2 
120  N N   . ASP A 27  ? 0.5531 0.3388 0.3294 -0.0778 0.0672  0.0209  15  ASP A N   
121  C CA  . ASP A 27  ? 0.5811 0.3315 0.3752 -0.0662 0.0581  0.0313  15  ASP A CA  
122  C C   . ASP A 27  ? 0.5452 0.2951 0.3641 -0.0453 0.0642  0.0119  15  ASP A C   
123  O O   . ASP A 27  ? 0.5186 0.2976 0.3354 -0.0403 0.0656  0.0007  15  ASP A O   
124  C CB  . ASP A 27  ? 0.6058 0.3717 0.3878 -0.0709 0.0402  0.0571  15  ASP A CB  
125  C CG  . ASP A 27  ? 0.6649 0.3944 0.4775 -0.0592 0.0217  0.0792  15  ASP A CG  
126  O OD1 . ASP A 27  ? 0.6445 0.3714 0.4973 -0.0376 0.0193  0.0687  15  ASP A OD1 
127  O OD2 . ASP A 27  ? 0.8081 0.5135 0.6119 -0.0720 0.0082  0.1110  15  ASP A OD2 
128  N N   . SER A 28  ? 0.5418 0.2585 0.3883 -0.0343 0.0707  0.0065  16  SER A N   
129  C CA  . SER A 28  ? 0.5162 0.2393 0.3903 -0.0195 0.0830  -0.0099 16  SER A CA  
130  C C   . SER A 28  ? 0.4919 0.2462 0.3912 -0.0117 0.0666  -0.0018 16  SER A C   
131  O O   . SER A 28  ? 0.4891 0.2611 0.4021 -0.0089 0.0726  -0.0134 16  SER A O   
132  C CB  . SER A 28  ? 0.5416 0.2320 0.4495 -0.0079 0.0984  -0.0208 16  SER A CB  
133  O OG  . SER A 28  ? 0.5438 0.2219 0.4934 0.0045  0.0810  -0.0020 16  SER A OG  
134  N N   . ARG A 29  ? 0.4806 0.2403 0.3819 -0.0128 0.0428  0.0200  17  ARG A N   
135  C CA  . ARG A 29  ? 0.4739 0.2666 0.3865 -0.0117 0.0214  0.0252  17  ARG A CA  
136  C C   . ARG A 29  ? 0.4570 0.2759 0.3343 -0.0220 0.0238  0.0069  17  ARG A C   
137  O O   . ARG A 29  ? 0.4391 0.2778 0.3334 -0.0219 0.0136  -0.0032 17  ARG A O   
138  C CB  . ARG A 29  ? 0.5255 0.3193 0.4318 -0.0156 -0.0097 0.0583  17  ARG A CB  
139  C CG  . ARG A 29  ? 0.5797 0.3488 0.5520 0.0042  -0.0192 0.0755  17  ARG A CG  
140  C CD  . ARG A 29  ? 0.6493 0.4111 0.6197 0.0016  -0.0571 0.1191  17  ARG A CD  
141  N NE  . ARG A 29  ? 0.7134 0.4466 0.6264 -0.0182 -0.0522 0.1358  17  ARG A NE  
142  C CZ  . ARG A 29  ? 0.8142 0.5351 0.6991 -0.0325 -0.0802 0.1804  17  ARG A CZ  
143  N NH1 . ARG A 29  ? 0.8103 0.5443 0.7153 -0.0265 -0.1218 0.2159  17  ARG A NH1 
144  N NH2 . ARG A 29  ? 0.8628 0.5604 0.7006 -0.0560 -0.0686 0.1934  17  ARG A NH2 
145  N N   . ILE A 30  ? 0.4683 0.2882 0.3049 -0.0311 0.0356  0.0019  18  ILE A N   
146  C CA  . ILE A 30  ? 0.4798 0.3221 0.2946 -0.0347 0.0424  -0.0196 18  ILE A CA  
147  C C   . ILE A 30  ? 0.4608 0.2919 0.3024 -0.0254 0.0540  -0.0376 18  ILE A C   
148  O O   . ILE A 30  ? 0.4623 0.3004 0.3114 -0.0244 0.0504  -0.0551 18  ILE A O   
149  C CB  . ILE A 30  ? 0.4966 0.3534 0.2797 -0.0446 0.0546  -0.0184 18  ILE A CB  
150  C CG1 . ILE A 30  ? 0.5767 0.4512 0.3228 -0.0616 0.0450  0.0012  18  ILE A CG1 
151  C CG2 . ILE A 30  ? 0.4965 0.3762 0.2797 -0.0392 0.0667  -0.0455 18  ILE A CG2 
152  C CD1 . ILE A 30  ? 0.6016 0.4880 0.3279 -0.0784 0.0582  0.0138  18  ILE A CD1 
153  N N   . LEU A 31  ? 0.4312 0.2873 0.3000 -0.0666 0.0564  0.0051  19  LEU A N   
154  C CA  . LEU A 31  ? 0.4459 0.3134 0.3186 -0.0632 0.0445  0.0026  19  LEU A CA  
155  C C   . LEU A 31  ? 0.4341 0.2885 0.2979 -0.0467 0.0440  0.0040  19  LEU A C   
156  O O   . LEU A 31  ? 0.4167 0.2851 0.2894 -0.0380 0.0369  0.0049  19  LEU A O   
157  C CB  . LEU A 31  ? 0.4606 0.3188 0.3221 -0.0788 0.0411  -0.0034 19  LEU A CB  
158  C CG  . LEU A 31  ? 0.5156 0.3972 0.3896 -0.0980 0.0369  -0.0065 19  LEU A CG  
159  C CD1 . LEU A 31  ? 0.4963 0.3678 0.3540 -0.1150 0.0318  -0.0147 19  LEU A CD1 
160  C CD2 . LEU A 31  ? 0.4927 0.4176 0.3940 -0.0919 0.0263  -0.0022 19  LEU A CD2 
161  N N   . MET A 32  ? 0.4528 0.2808 0.2998 -0.0425 0.0524  0.0047  20  MET A N   
162  C CA  . MET A 32  ? 0.4524 0.2743 0.2941 -0.0276 0.0518  0.0059  20  MET A CA  
163  C C   . MET A 32  ? 0.4357 0.2742 0.2876 -0.0152 0.0495  0.0090  20  MET A C   
164  O O   . MET A 32  ? 0.4189 0.2668 0.2763 -0.0080 0.0438  0.0078  20  MET A O   
165  C CB  . MET A 32  ? 0.4621 0.2551 0.2852 -0.0229 0.0616  0.0071  20  MET A CB  
166  C CG  . MET A 32  ? 0.4849 0.2794 0.3069 -0.0071 0.0607  0.0088  20  MET A CG  
167  S SD  . MET A 32  ? 0.5551 0.3178 0.3571 0.0014  0.0723  0.0100  20  MET A SD  
168  C CE  . MET A 32  ? 0.5212 0.2717 0.3145 -0.0140 0.0721  0.0009  20  MET A CE  
169  N N   . GLU A 33  ? 0.4305 0.2716 0.2834 -0.0150 0.0547  0.0122  21  GLU A N   
170  C CA  . GLU A 33  ? 0.4370 0.2926 0.2957 -0.0048 0.0532  0.0134  21  GLU A CA  
171  C C   . GLU A 33  ? 0.4198 0.2953 0.2949 -0.0048 0.0459  0.0101  21  GLU A C   
172  O O   . GLU A 33  ? 0.4022 0.2828 0.2794 0.0031  0.0418  0.0078  21  GLU A O   
173  C CB  . GLU A 33  ? 0.4465 0.3005 0.3004 -0.0049 0.0620  0.0176  21  GLU A CB  
174  C CG  . GLU A 33  ? 0.4800 0.3453 0.3332 0.0058  0.0617  0.0179  21  GLU A CG  
175  C CD  . GLU A 33  ? 0.5499 0.4100 0.3895 0.0183  0.0593  0.0193  21  GLU A CD  
176  O OE1 . GLU A 33  ? 0.5394 0.3849 0.3687 0.0216  0.0611  0.0230  21  GLU A OE1 
177  O OE2 . GLU A 33  ? 0.5247 0.3971 0.3639 0.0251  0.0557  0.0162  21  GLU A OE2 
178  N N   . ARG A 34  ? 0.4191 0.3056 0.3056 -0.0137 0.0444  0.0100  22  ARG A N   
179  C CA  . ARG A 34  ? 0.4163 0.3205 0.3179 -0.0108 0.0378  0.0092  22  ARG A CA  
180  C C   . ARG A 34  ? 0.4101 0.3086 0.3090 -0.0079 0.0306  0.0077  22  ARG A C   
181  O O   . ARG A 34  ? 0.4074 0.3105 0.3125 -0.0006 0.0277  0.0073  22  ARG A O   
182  C CB  . ARG A 34  ? 0.4170 0.3391 0.3322 -0.0203 0.0354  0.0105  22  ARG A CB  
183  C CG  . ARG A 34  ? 0.4576 0.3893 0.3793 -0.0272 0.0435  0.0119  22  ARG A CG  
184  C CD  . ARG A 34  ? 0.4569 0.4150 0.3986 -0.0225 0.0450  0.0135  22  ARG A CD  
185  N NE  . ARG A 34  ? 0.4360 0.4142 0.3938 -0.0169 0.0358  0.0149  22  ARG A NE  
186  C CZ  . ARG A 34  ? 0.3709 0.3806 0.3508 -0.0192 0.0337  0.0174  22  ARG A CZ  
187  N NH1 . ARG A 34  ? 0.3754 0.4011 0.3653 -0.0309 0.0400  0.0175  22  ARG A NH1 
188  N NH2 . ARG A 34  ? 0.3925 0.4189 0.3849 -0.0102 0.0249  0.0207  22  ARG A NH2 
189  N N   . ALA A 35  ? 0.4070 0.2934 0.2955 -0.0139 0.0292  0.0070  23  ALA A N   
190  C CA  . ALA A 35  ? 0.4040 0.2843 0.2880 -0.0119 0.0249  0.0061  23  ALA A CA  
191  C C   . ALA A 35  ? 0.4139 0.2912 0.2974 -0.0032 0.0263  0.0043  23  ALA A C   
192  O O   . ALA A 35  ? 0.4171 0.2954 0.3044 -0.0003 0.0234  0.0035  23  ALA A O   
193  C CB  . ALA A 35  ? 0.4137 0.2796 0.2835 -0.0190 0.0264  0.0045  23  ALA A CB  
194  N N   . GLY A 36  ? 0.4078 0.2809 0.2852 0.0004  0.0308  0.0038  24  GLY A N   
195  C CA  . GLY A 36  ? 0.4029 0.2787 0.2799 0.0070  0.0302  0.0014  24  GLY A CA  
196  C C   . GLY A 36  ? 0.4067 0.2899 0.2894 0.0104  0.0288  -0.0015 24  GLY A C   
197  O O   . GLY A 36  ? 0.3988 0.2832 0.2841 0.0107  0.0263  -0.0056 24  GLY A O   
198  N N   . ILE A 37  ? 0.4073 0.2943 0.2919 0.0117  0.0315  -0.0003 25  ILE A N   
199  C CA  . ILE A 37  ? 0.4160 0.3072 0.3042 0.0161  0.0321  -0.0041 25  ILE A CA  
200  C C   . ILE A 37  ? 0.4271 0.3159 0.3238 0.0161  0.0296  -0.0047 25  ILE A C   
201  O O   . ILE A 37  ? 0.4174 0.3012 0.3134 0.0189  0.0301  -0.0096 25  ILE A O   
202  C CB  . ILE A 37  ? 0.4366 0.3338 0.3252 0.0191  0.0379  -0.0029 25  ILE A CB  
203  C CG1 . ILE A 37  ? 0.4894 0.3947 0.3901 0.0157  0.0393  0.0015  25  ILE A CG1 
204  C CG2 . ILE A 37  ? 0.4143 0.3098 0.2905 0.0205  0.0415  -0.0007 25  ILE A CG2 
205  C CD1 . ILE A 37  ? 0.5841 0.4977 0.4857 0.0155  0.0476  0.0039  25  ILE A CD1 
206  N N   . SER A 38  ? 0.4189 0.3095 0.3210 0.0128  0.0269  0.0002  26  SER A N   
207  C CA  . SER A 38  ? 0.4238 0.3110 0.3309 0.0147  0.0238  0.0025  26  SER A CA  
208  C C   . SER A 38  ? 0.4255 0.2993 0.3265 0.0127  0.0232  -0.0005 26  SER A C   
209  O O   . SER A 38  ? 0.4330 0.2967 0.3347 0.0159  0.0243  -0.0012 26  SER A O   
210  C CB  . SER A 38  ? 0.4208 0.3141 0.3300 0.0099  0.0190  0.0085  26  SER A CB  
211  O OG  . SER A 38  ? 0.4961 0.4058 0.4155 0.0106  0.0197  0.0107  26  SER A OG  
212  N N   . VAL A 39  ? 0.4280 0.3011 0.3233 0.0074  0.0227  -0.0020 27  VAL A N   
213  C CA  . VAL A 39  ? 0.4171 0.2838 0.3099 0.0035  0.0231  -0.0055 27  VAL A CA  
214  C C   . VAL A 39  ? 0.4250 0.2903 0.3180 0.0040  0.0245  -0.0134 27  VAL A C   
215  O O   . VAL A 39  ? 0.4322 0.2866 0.3249 0.0003  0.0260  -0.0165 27  VAL A O   
216  C CB  . VAL A 39  ? 0.4212 0.2923 0.3106 0.0001  0.0234  -0.0053 27  VAL A CB  
217  C CG1 . VAL A 39  ? 0.3893 0.2611 0.2811 -0.0049 0.0247  -0.0098 27  VAL A CG1 
218  C CG2 . VAL A 39  ? 0.3874 0.2543 0.2719 -0.0026 0.0228  0.0002  27  VAL A CG2 
219  N N   . VAL A 40  ? 0.4249 0.2987 0.3160 0.0077  0.0249  -0.0167 28  VAL A N   
220  C CA  . VAL A 40  ? 0.4275 0.3014 0.3145 0.0073  0.0254  -0.0259 28  VAL A CA  
221  C C   . VAL A 40  ? 0.4352 0.2935 0.3220 0.0096  0.0292  -0.0287 28  VAL A C   
222  O O   . VAL A 40  ? 0.4284 0.2749 0.3121 0.0043  0.0307  -0.0361 28  VAL A O   
223  C CB  . VAL A 40  ? 0.4244 0.3096 0.3052 0.0123  0.0254  -0.0271 28  VAL A CB  
224  C CG1 . VAL A 40  ? 0.4052 0.2896 0.2774 0.0121  0.0261  -0.0378 28  VAL A CG1 
225  C CG2 . VAL A 40  ? 0.4298 0.3273 0.3095 0.0126  0.0224  -0.0233 28  VAL A CG2 
226  N N   . LEU A 41  ? 0.4273 0.2851 0.3184 0.0172  0.0315  -0.0225 29  LEU A N   
227  C CA  . LEU A 41  ? 0.4554 0.2997 0.3475 0.0240  0.0365  -0.0238 29  LEU A CA  
228  C C   . LEU A 41  ? 0.4633 0.2889 0.3554 0.0221  0.0369  -0.0207 29  LEU A C   
229  O O   . LEU A 41  ? 0.4833 0.2880 0.3705 0.0241  0.0423  -0.0256 29  LEU A O   
230  C CB  . LEU A 41  ? 0.4504 0.3064 0.3516 0.0336  0.0387  -0.0168 29  LEU A CB  
231  C CG  . LEU A 41  ? 0.4616 0.3301 0.3603 0.0367  0.0429  -0.0204 29  LEU A CG  
232  C CD1 . LEU A 41  ? 0.4315 0.3180 0.3427 0.0411  0.0446  -0.0122 29  LEU A CD1 
233  C CD2 . LEU A 41  ? 0.4524 0.3076 0.3428 0.0425  0.0504  -0.0302 29  LEU A CD2 
234  N N   . ALA A 42  ? 0.4363 0.2660 0.3311 0.0183  0.0325  -0.0126 30  ALA A N   
235  C CA  . ALA A 42  ? 0.4563 0.2674 0.3478 0.0160  0.0336  -0.0076 30  ALA A CA  
236  C C   . ALA A 42  ? 0.4770 0.2732 0.3622 0.0044  0.0371  -0.0172 30  ALA A C   
237  O O   . ALA A 42  ? 0.4876 0.2582 0.3671 0.0024  0.0427  -0.0180 30  ALA A O   
238  C CB  . ALA A 42  ? 0.4196 0.2405 0.3114 0.0131  0.0283  0.0017  30  ALA A CB  
239  N N   . MET A 43  ? 0.4753 0.2882 0.3619 -0.0034 0.0343  -0.0245 31  MET A N   
240  C CA  . MET A 43  ? 0.5045 0.3131 0.3892 -0.0162 0.0360  -0.0343 31  MET A CA  
241  C C   . MET A 43  ? 0.5358 0.3273 0.4133 -0.0178 0.0404  -0.0459 31  MET A C   
242  O O   . MET A 43  ? 0.5584 0.3296 0.4313 -0.0288 0.0452  -0.0529 31  MET A O   
243  C CB  . MET A 43  ? 0.4865 0.3234 0.3763 -0.0213 0.0307  -0.0383 31  MET A CB  
244  C CG  . MET A 43  ? 0.4659 0.3138 0.3605 -0.0222 0.0295  -0.0298 31  MET A CG  
245  S SD  . MET A 43  ? 0.4985 0.3769 0.4012 -0.0274 0.0260  -0.0349 31  MET A SD  
246  C CE  . MET A 43  ? 0.4565 0.3508 0.3555 -0.0154 0.0209  -0.0348 31  MET A CE  
247  N N   . GLU A 44  ? 0.5397 0.3367 0.4147 -0.0081 0.0402  -0.0487 32  GLU A N   
248  C CA  . GLU A 44  ? 0.5858 0.3642 0.4506 -0.0075 0.0460  -0.0604 32  GLU A CA  
249  C C   . GLU A 44  ? 0.6269 0.3686 0.4869 -0.0020 0.0552  -0.0577 32  GLU A C   
250  O O   . GLU A 44  ? 0.6349 0.3493 0.4843 -0.0093 0.0619  -0.0687 32  GLU A O   
251  C CB  . GLU A 44  ? 0.5834 0.3757 0.4458 0.0038  0.0460  -0.0616 32  GLU A CB  
252  C CG  . GLU A 44  ? 0.6524 0.4285 0.5009 0.0041  0.0523  -0.0756 32  GLU A CG  
253  C CD  . GLU A 44  ? 0.6881 0.4830 0.5324 0.0138  0.0527  -0.0762 32  GLU A CD  
254  O OE1 . GLU A 44  ? 0.6707 0.4739 0.5246 0.0259  0.0550  -0.0651 32  GLU A OE1 
255  O OE2 . GLU A 44  ? 0.7022 0.5054 0.5336 0.0082  0.0504  -0.0874 32  GLU A OE2 
256  N N   . GLU A 45  ? 0.6356 0.3768 0.5024 0.0112  0.0555  -0.0431 33  GLU A N   
257  C CA  . GLU A 45  ? 0.6861 0.3964 0.5495 0.0205  0.0627  -0.0352 33  GLU A CA  
258  C C   . GLU A 45  ? 0.7121 0.3957 0.5679 0.0067  0.0665  -0.0355 33  GLU A C   
259  O O   . GLU A 45  ? 0.7560 0.4022 0.6015 0.0082  0.0760  -0.0370 33  GLU A O   
260  C CB  . GLU A 45  ? 0.6836 0.4129 0.5581 0.0342  0.0573  -0.0181 33  GLU A CB  
261  C CG  . GLU A 45  ? 0.7643 0.4766 0.6397 0.0523  0.0622  -0.0067 33  GLU A CG  
262  C CD  . GLU A 45  ? 0.7959 0.5426 0.6867 0.0656  0.0552  0.0051  33  GLU A CD  
263  O OE1 . GLU A 45  ? 0.8051 0.5735 0.7044 0.0703  0.0556  0.0003  33  GLU A OE1 
264  O OE2 . GLU A 45  ? 0.8659 0.6185 0.7594 0.0703  0.0495  0.0189  33  GLU A OE2 
265  N N   . GLU A 46  ? 0.7017 0.4028 0.5619 -0.0069 0.0608  -0.0341 34  GLU A N   
266  C CA  . GLU A 46  ? 0.7296 0.4091 0.5841 -0.0219 0.0660  -0.0341 34  GLU A CA  
267  C C   . GLU A 46  ? 0.7458 0.4190 0.5969 -0.0424 0.0692  -0.0522 34  GLU A C   
268  O O   . GLU A 46  ? 0.7532 0.3941 0.5959 -0.0540 0.0782  -0.0553 34  GLU A O   
269  C CB  . GLU A 46  ? 0.7203 0.4224 0.5815 -0.0276 0.0605  -0.0245 34  GLU A CB  
270  C CG  . GLU A 46  ? 0.7688 0.4687 0.6279 -0.0132 0.0584  -0.0069 34  GLU A CG  
271  C CD  . GLU A 46  ? 0.8600 0.5186 0.7066 -0.0066 0.0672  0.0023  34  GLU A CD  
272  O OE1 . GLU A 46  ? 0.8912 0.5449 0.7371 0.0126  0.0661  0.0119  34  GLU A OE1 
273  O OE2 . GLU A 46  ? 0.8913 0.5235 0.7293 -0.0205 0.0757  0.0003  34  GLU A OE2 
274  N N   . LEU A 47  ? 0.7151 0.4204 0.5721 -0.0477 0.0617  -0.0634 35  LEU A N   
275  C CA  . LEU A 47  ? 0.7282 0.4388 0.5840 -0.0684 0.0614  -0.0807 35  LEU A CA  
276  C C   . LEU A 47  ? 0.7555 0.4495 0.5979 -0.0688 0.0644  -0.0969 35  LEU A C   
277  O O   . LEU A 47  ? 0.7875 0.4772 0.6244 -0.0882 0.0654  -0.1136 35  LEU A O   
278  C CB  . LEU A 47  ? 0.6986 0.4583 0.5678 -0.0731 0.0502  -0.0824 35  LEU A CB  
279  C CG  . LEU A 47  ? 0.6781 0.4557 0.5594 -0.0739 0.0485  -0.0694 35  LEU A CG  
280  C CD1 . LEU A 47  ? 0.6691 0.4919 0.5624 -0.0747 0.0390  -0.0717 35  LEU A CD1 
281  C CD2 . LEU A 47  ? 0.7241 0.4824 0.6056 -0.0919 0.0570  -0.0704 35  LEU A CD2 
282  N N   . GLY A 48  ? 0.7406 0.4257 0.5774 -0.0488 0.0668  -0.0929 36  GLY A N   
283  C CA  . GLY A 48  ? 0.7637 0.4363 0.5862 -0.0469 0.0706  -0.1083 36  GLY A CA  
284  C C   . GLY A 48  ? 0.7466 0.4631 0.5721 -0.0487 0.0592  -0.1141 36  GLY A C   
285  O O   . GLY A 48  ? 0.7241 0.4746 0.5633 -0.0441 0.0504  -0.1026 36  GLY A O   
286  N N   . ASN A 49  ? 0.7673 0.4816 0.5777 -0.0549 0.0594  -0.1315 37  ASN A N   
287  C CA  . ASN A 49  ? 0.7644 0.5190 0.5730 -0.0566 0.0482  -0.1370 37  ASN A CA  
288  C C   . ASN A 49  ? 0.7286 0.5229 0.5539 -0.0673 0.0361  -0.1325 37  ASN A C   
289  O O   . ASN A 49  ? 0.7463 0.5405 0.5774 -0.0858 0.0352  -0.1390 37  ASN A O   
290  C CB  . ASN A 49  ? 0.8030 0.5475 0.5885 -0.0669 0.0496  -0.1593 37  ASN A CB  
291  C CG  . ASN A 49  ? 0.8336 0.6149 0.6109 -0.0611 0.0400  -0.1617 37  ASN A CG  
292  O OD1 . ASN A 49  ? 0.8583 0.6789 0.6441 -0.0674 0.0271  -0.1596 37  ASN A OD1 
293  N ND2 . ASN A 49  ? 0.8782 0.6474 0.6385 -0.0474 0.0473  -0.1647 37  ASN A ND2 
294  N N   . LEU A 50  ? 0.6922 0.5189 0.5255 -0.0548 0.0286  -0.1205 38  LEU A N   
295  C CA  . LEU A 50  ? 0.6554 0.5185 0.5049 -0.0585 0.0191  -0.1132 38  LEU A CA  
296  C C   . LEU A 50  ? 0.6528 0.5514 0.4990 -0.0678 0.0079  -0.1245 38  LEU A C   
297  O O   . LEU A 50  ? 0.6291 0.5608 0.4902 -0.0714 0.0002  -0.1205 38  LEU A O   
298  C CB  . LEU A 50  ? 0.6259 0.5021 0.4826 -0.0401 0.0177  -0.0954 38  LEU A CB  
299  C CG  . LEU A 50  ? 0.6407 0.4937 0.5043 -0.0322 0.0251  -0.0826 38  LEU A CG  
300  C CD1 . LEU A 50  ? 0.5793 0.4480 0.4503 -0.0198 0.0227  -0.0677 38  LEU A CD1 
301  C CD2 . LEU A 50  ? 0.6532 0.4930 0.5250 -0.0444 0.0284  -0.0820 38  LEU A CD2 
302  N N   . SER A 51  ? 0.6713 0.5652 0.4975 -0.0709 0.0067  -0.1386 39  SER A N   
303  C CA  . SER A 51  ? 0.6724 0.6055 0.4925 -0.0745 -0.0061 -0.1456 39  SER A CA  
304  C C   . SER A 51  ? 0.6890 0.6497 0.5214 -0.0968 -0.0148 -0.1573 39  SER A C   
305  O O   . SER A 51  ? 0.6853 0.6903 0.5225 -0.0962 -0.0277 -0.1569 39  SER A O   
306  C CB  . SER A 51  ? 0.6978 0.6204 0.4891 -0.0714 -0.0051 -0.1574 39  SER A CB  
307  O OG  . SER A 51  ? 0.6987 0.5954 0.4779 -0.0901 -0.0004 -0.1777 39  SER A OG  
308  N N   . ASP A 52  ? 0.7134 0.6501 0.5521 -0.1157 -0.0076 -0.1664 40  ASP A N   
309  C CA  . ASP A 52  ? 0.7318 0.6980 0.5864 -0.1396 -0.0145 -0.1771 40  ASP A CA  
310  C C   . ASP A 52  ? 0.6890 0.6820 0.5739 -0.1381 -0.0152 -0.1622 40  ASP A C   
311  O O   . ASP A 52  ? 0.6895 0.7158 0.5923 -0.1562 -0.0206 -0.1691 40  ASP A O   
312  C CB  . ASP A 52  ? 0.7891 0.7158 0.6357 -0.1653 -0.0046 -0.1950 40  ASP A CB  
313  C CG  . ASP A 52  ? 0.8603 0.7520 0.6750 -0.1678 -0.0002 -0.2120 40  ASP A CG  
314  O OD1 . ASP A 52  ? 0.9231 0.8401 0.7247 -0.1786 -0.0110 -0.2283 40  ASP A OD1 
315  O OD2 . ASP A 52  ? 0.9420 0.7817 0.7441 -0.1579 0.0142  -0.2086 40  ASP A OD2 
316  N N   . TYR A 53  ? 0.6462 0.6274 0.5370 -0.1181 -0.0094 -0.1430 41  TYR A N   
317  C CA  . TYR A 53  ? 0.6179 0.6171 0.5330 -0.1169 -0.0073 -0.1302 41  TYR A CA  
318  C C   . TYR A 53  ? 0.5853 0.6321 0.5134 -0.1004 -0.0171 -0.1188 41  TYR A C   
319  O O   . TYR A 53  ? 0.5783 0.6324 0.4944 -0.0828 -0.0228 -0.1134 41  TYR A O   
320  C CB  . TYR A 53  ? 0.6169 0.5748 0.5292 -0.1057 0.0048  -0.1160 41  TYR A CB  
321  C CG  . TYR A 53  ? 0.6441 0.5544 0.5473 -0.1190 0.0165  -0.1221 41  TYR A CG  
322  C CD1 . TYR A 53  ? 0.6837 0.5859 0.5983 -0.1355 0.0242  -0.1215 41  TYR A CD1 
323  C CD2 . TYR A 53  ? 0.6839 0.5557 0.5664 -0.1134 0.0216  -0.1270 41  TYR A CD2 
324  C CE1 . TYR A 53  ? 0.7335 0.5861 0.6364 -0.1462 0.0364  -0.1248 41  TYR A CE1 
325  C CE2 . TYR A 53  ? 0.7464 0.5705 0.6188 -0.1221 0.0336  -0.1311 41  TYR A CE2 
326  C CZ  . TYR A 53  ? 0.7759 0.5886 0.6575 -0.1383 0.0408  -0.1294 41  TYR A CZ  
327  O OH  . TYR A 53  ? 0.8523 0.6125 0.7207 -0.1443 0.0539  -0.1309 41  TYR A OH  
328  N N   . ARG A 54  ? 0.5547 0.6330 0.5071 -0.1056 -0.0175 -0.1148 42  ARG A N   
329  C CA  . ARG A 54  ? 0.5229 0.6404 0.4886 -0.0871 -0.0234 -0.1022 42  ARG A CA  
330  C C   . ARG A 54  ? 0.4938 0.5889 0.4645 -0.0754 -0.0121 -0.0870 42  ARG A C   
331  O O   . ARG A 54  ? 0.5035 0.5843 0.4829 -0.0883 -0.0027 -0.0874 42  ARG A O   
332  C CB  . ARG A 54  ? 0.5211 0.6950 0.5128 -0.0992 -0.0310 -0.1084 42  ARG A CB  
333  C CG  . ARG A 54  ? 0.5546 0.7556 0.5418 -0.1153 -0.0439 -0.1258 42  ARG A CG  
334  C CD  . ARG A 54  ? 0.5594 0.8159 0.5765 -0.1346 -0.0501 -0.1346 42  ARG A CD  
335  N NE  . ARG A 54  ? 0.5991 0.8322 0.6266 -0.1603 -0.0372 -0.1420 42  ARG A NE  
336  C CZ  . ARG A 54  ? 0.6709 0.9426 0.7265 -0.1829 -0.0368 -0.1498 42  ARG A CZ  
337  N NH1 . ARG A 54  ? 0.6711 1.0147 0.7515 -0.1828 -0.0505 -0.1520 42  ARG A NH1 
338  N NH2 . ARG A 54  ? 0.7049 0.9441 0.7642 -0.2058 -0.0220 -0.1546 42  ARG A NH2 
339  N N   . PHE A 55  ? 0.4692 0.5600 0.4320 -0.0526 -0.0124 -0.0741 43  PHE A N   
340  C CA  . PHE A 55  ? 0.4551 0.5229 0.4178 -0.0413 -0.0025 -0.0609 43  PHE A CA  
341  C C   . PHE A 55  ? 0.4416 0.5380 0.4181 -0.0264 -0.0016 -0.0506 43  PHE A C   
342  O O   . PHE A 55  ? 0.4277 0.5459 0.4025 -0.0106 -0.0083 -0.0457 43  PHE A O   
343  C CB  . PHE A 55  ? 0.4507 0.4832 0.3919 -0.0284 -0.0005 -0.0545 43  PHE A CB  
344  C CG  . PHE A 55  ? 0.4606 0.4610 0.3890 -0.0383 0.0018  -0.0621 43  PHE A CG  
345  C CD1 . PHE A 55  ? 0.4615 0.4669 0.3819 -0.0459 -0.0039 -0.0743 43  PHE A CD1 
346  C CD2 . PHE A 55  ? 0.4339 0.3998 0.3577 -0.0399 0.0101  -0.0575 43  PHE A CD2 
347  C CE1 . PHE A 55  ? 0.5075 0.4794 0.4147 -0.0529 0.0005  -0.0820 43  PHE A CE1 
348  C CE2 . PHE A 55  ? 0.4536 0.3896 0.3664 -0.0455 0.0133  -0.0632 43  PHE A CE2 
349  C CZ  . PHE A 55  ? 0.4862 0.4232 0.3909 -0.0516 0.0097  -0.0757 43  PHE A CZ  
350  N N   . LEU A 56  ? 0.4318 0.5249 0.4193 -0.0301 0.0080  -0.0467 44  LEU A N   
351  C CA  . LEU A 56  ? 0.4245 0.5337 0.4217 -0.0146 0.0134  -0.0369 44  LEU A CA  
352  C C   . LEU A 56  ? 0.4226 0.4898 0.4021 -0.0061 0.0223  -0.0286 44  LEU A C   
353  O O   . LEU A 56  ? 0.4185 0.4588 0.3918 -0.0170 0.0289  -0.0292 44  LEU A O   
354  C CB  . LEU A 56  ? 0.4224 0.5596 0.4434 -0.0256 0.0198  -0.0395 44  LEU A CB  
355  C CG  . LEU A 56  ? 0.4253 0.5854 0.4596 -0.0086 0.0270  -0.0308 44  LEU A CG  
356  C CD1 . LEU A 56  ? 0.3540 0.5586 0.4008 0.0092  0.0174  -0.0275 44  LEU A CD1 
357  C CD2 . LEU A 56  ? 0.3763 0.5541 0.4305 -0.0225 0.0375  -0.0334 44  LEU A CD2 
358  N N   . VAL A 57  ? 0.4174 0.4784 0.3870 0.0126  0.0224  -0.0206 45  VAL A N   
359  C CA  . VAL A 57  ? 0.4061 0.4281 0.3573 0.0179  0.0295  -0.0146 45  VAL A CA  
360  C C   . VAL A 57  ? 0.4184 0.4432 0.3724 0.0304  0.0391  -0.0085 45  VAL A C   
361  O O   . VAL A 57  ? 0.4309 0.4771 0.3916 0.0466  0.0389  -0.0039 45  VAL A O   
362  C CB  . VAL A 57  ? 0.4111 0.4158 0.3453 0.0261  0.0244  -0.0117 45  VAL A CB  
363  C CG1 . VAL A 57  ? 0.3787 0.3484 0.2969 0.0278  0.0305  -0.0072 45  VAL A CG1 
364  C CG2 . VAL A 57  ? 0.3905 0.3950 0.3223 0.0145  0.0164  -0.0197 45  VAL A CG2 
365  N N   . LEU A 58  ? 0.4170 0.4203 0.3646 0.0241  0.0482  -0.0081 46  LEU A N   
366  C CA  . LEU A 58  ? 0.4159 0.4189 0.3638 0.0338  0.0597  -0.0045 46  LEU A CA  
367  C C   . LEU A 58  ? 0.4373 0.4005 0.3603 0.0388  0.0638  -0.0014 46  LEU A C   
368  O O   . LEU A 58  ? 0.4445 0.3830 0.3541 0.0270  0.0635  -0.0030 46  LEU A O   
369  C CB  . LEU A 58  ? 0.4097 0.4184 0.3655 0.0207  0.0679  -0.0074 46  LEU A CB  
370  C CG  . LEU A 58  ? 0.4123 0.4579 0.3933 0.0089  0.0652  -0.0121 46  LEU A CG  
371  C CD1 . LEU A 58  ? 0.4566 0.5002 0.4410 -0.0050 0.0767  -0.0133 46  LEU A CD1 
372  C CD2 . LEU A 58  ? 0.3613 0.4535 0.3660 0.0223  0.0624  -0.0112 46  LEU A CD2 
373  N N   . CYS A 59  ? 0.4416 0.3985 0.3578 0.0561  0.0679  0.0033  47  CYS A N   
374  C CA  . CYS A 59  ? 0.4587 0.3770 0.3510 0.0591  0.0724  0.0053  47  CYS A CA  
375  C C   . CYS A 59  ? 0.4864 0.3870 0.3681 0.0693  0.0868  0.0063  47  CYS A C   
376  O O   . CYS A 59  ? 0.4923 0.4079 0.3830 0.0871  0.0933  0.0102  47  CYS A O   
377  C CB  . CYS A 59  ? 0.4691 0.3833 0.3556 0.0699  0.0673  0.0105  47  CYS A CB  
378  S SG  . CYS A 59  ? 0.4643 0.3884 0.3541 0.0595  0.0530  0.0086  47  CYS A SG  
379  N N   . GLY A 60  ? 0.5067 0.3751 0.3679 0.0591  0.0921  0.0026  48  GLY A N   
380  C CA  . GLY A 60  ? 0.5227 0.3625 0.3648 0.0666  0.1068  0.0012  48  GLY A CA  
381  C C   . GLY A 60  ? 0.5513 0.3603 0.3761 0.0739  0.1092  0.0041  48  GLY A C   
382  O O   . GLY A 60  ? 0.5409 0.3537 0.3690 0.0735  0.0999  0.0080  48  GLY A O   
383  N N   . GLY A 61  ? 0.5902 0.3665 0.3947 0.0807  0.1235  0.0020  49  GLY A N   
384  C CA  . GLY A 61  ? 0.6190 0.3584 0.4037 0.0867  0.1298  0.0045  49  GLY A CA  
385  C C   . GLY A 61  ? 0.6303 0.3386 0.3942 0.0654  0.1269  -0.0014 49  GLY A C   
386  O O   . GLY A 61  ? 0.6617 0.3380 0.4093 0.0668  0.1329  0.0003  49  GLY A O   
387  N N   . GLY A 62  ? 0.6031 0.3218 0.3679 0.0460  0.1180  -0.0075 50  GLY A N   
388  C CA  . GLY A 62  ? 0.6057 0.3051 0.3547 0.0251  0.1130  -0.0134 50  GLY A CA  
389  C C   . GLY A 62  ? 0.5784 0.2967 0.3420 0.0175  0.0991  -0.0092 50  GLY A C   
390  O O   . GLY A 62  ? 0.5568 0.2968 0.3381 0.0285  0.0943  -0.0023 50  GLY A O   
391  N N   . ASN A 63  ? 0.5709 0.2839 0.3273 -0.0012 0.0924  -0.0138 51  ASN A N   
392  C CA  . ASN A 63  ? 0.5725 0.3046 0.3437 -0.0078 0.0810  -0.0103 51  ASN A CA  
393  C C   . ASN A 63  ? 0.5263 0.2922 0.3186 -0.0050 0.0700  -0.0070 51  ASN A C   
394  O O   . ASN A 63  ? 0.5103 0.2927 0.3167 -0.0034 0.0632  -0.0032 51  ASN A O   
395  C CB  . ASN A 63  ? 0.5951 0.3177 0.3563 -0.0278 0.0770  -0.0158 51  ASN A CB  
396  C CG  . ASN A 63  ? 0.6880 0.3755 0.4311 -0.0336 0.0884  -0.0184 51  ASN A CG  
397  O OD1 . ASN A 63  ? 0.6767 0.3461 0.4157 -0.0203 0.0986  -0.0130 51  ASN A OD1 
398  N ND2 . ASN A 63  ? 0.7798 0.4563 0.5098 -0.0539 0.0869  -0.0267 51  ASN A ND2 
399  N N   . ASN A 64  ? 0.5201 0.2934 0.3127 -0.0045 0.0702  -0.0088 52  ASN A N   
400  C CA  . ASN A 64  ? 0.5034 0.3023 0.3134 -0.0030 0.0627  -0.0061 52  ASN A CA  
401  C C   . ASN A 64  ? 0.4849 0.2995 0.3108 0.0104  0.0635  -0.0023 52  ASN A C   
402  O O   . ASN A 64  ? 0.4637 0.2956 0.3035 0.0109  0.0558  -0.0003 52  ASN A O   
403  C CB  . ASN A 64  ? 0.5087 0.3088 0.3129 -0.0061 0.0658  -0.0080 52  ASN A CB  
404  C CG  . ASN A 64  ? 0.4806 0.2993 0.2977 -0.0098 0.0582  -0.0051 52  ASN A CG  
405  O OD1 . ASN A 64  ? 0.5015 0.3329 0.3295 -0.0061 0.0613  -0.0041 52  ASN A OD1 
406  N ND2 . ASN A 64  ? 0.4884 0.3078 0.3037 -0.0176 0.0493  -0.0037 52  ASN A ND2 
407  N N   . GLY A 65  ? 0.5020 0.3102 0.3243 0.0221  0.0731  -0.0014 53  GLY A N   
408  C CA  . GLY A 65  ? 0.4905 0.3173 0.3267 0.0364  0.0725  0.0030  53  GLY A CA  
409  C C   . GLY A 65  ? 0.4891 0.3130 0.3240 0.0390  0.0682  0.0068  53  GLY A C   
410  O O   . GLY A 65  ? 0.4489 0.2947 0.2958 0.0452  0.0619  0.0094  53  GLY A O   
411  N N   . GLY A 66  ? 0.5152 0.3118 0.3339 0.0336  0.0725  0.0067  54  GLY A N   
412  C CA  . GLY A 66  ? 0.5075 0.2999 0.3238 0.0339  0.0706  0.0109  54  GLY A CA  
413  C C   . GLY A 66  ? 0.4759 0.2911 0.3060 0.0260  0.0594  0.0095  54  GLY A C   
414  O O   . GLY A 66  ? 0.4581 0.2846 0.2925 0.0314  0.0561  0.0127  54  GLY A O   
415  N N   . ASP A 67  ? 0.4677 0.2874 0.3020 0.0142  0.0545  0.0050  55  ASP A N   
416  C CA  . ASP A 67  ? 0.4604 0.2984 0.3074 0.0095  0.0457  0.0041  55  ASP A CA  
417  C C   . ASP A 67  ? 0.4477 0.3056 0.3061 0.0173  0.0420  0.0038  55  ASP A C   
418  O O   . ASP A 67  ? 0.4586 0.3276 0.3229 0.0184  0.0374  0.0033  55  ASP A O   
419  C CB  . ASP A 67  ? 0.4566 0.2964 0.3056 -0.0006 0.0411  0.0015  55  ASP A CB  
420  C CG  . ASP A 67  ? 0.4823 0.3105 0.3218 -0.0111 0.0413  0.0004  55  ASP A CG  
421  O OD1 . ASP A 67  ? 0.5174 0.3391 0.3537 -0.0145 0.0438  0.0010  55  ASP A OD1 
422  O OD2 . ASP A 67  ? 0.4994 0.3265 0.3342 -0.0177 0.0384  -0.0011 55  ASP A OD2 
423  N N   . GLY A 68  ? 0.4512 0.3147 0.3125 0.0215  0.0446  0.0031  56  GLY A N   
424  C CA  . GLY A 68  ? 0.4431 0.3301 0.3171 0.0266  0.0410  0.0019  56  GLY A CA  
425  C C   . GLY A 68  ? 0.4530 0.3505 0.3264 0.0377  0.0389  0.0050  56  GLY A C   
426  O O   . GLY A 68  ? 0.4454 0.3610 0.3259 0.0371  0.0323  0.0022  56  GLY A O   
427  N N   . PHE A 69  ? 0.4630 0.3467 0.3251 0.0478  0.0450  0.0110  57  PHE A N   
428  C CA  . PHE A 69  ? 0.4575 0.3475 0.3141 0.0598  0.0434  0.0166  57  PHE A CA  
429  C C   . PHE A 69  ? 0.4413 0.3298 0.2933 0.0538  0.0395  0.0156  57  PHE A C   
430  O O   . PHE A 69  ? 0.4447 0.3484 0.2950 0.0598  0.0346  0.0167  57  PHE A O   
431  C CB  . PHE A 69  ? 0.4726 0.3394 0.3141 0.0721  0.0532  0.0248  57  PHE A CB  
432  C CG  . PHE A 69  ? 0.4774 0.3530 0.3239 0.0865  0.0574  0.0280  57  PHE A CG  
433  C CD1 . PHE A 69  ? 0.4930 0.4005 0.3496 0.1000  0.0512  0.0317  57  PHE A CD1 
434  C CD2 . PHE A 69  ? 0.5151 0.3683 0.3557 0.0872  0.0680  0.0270  57  PHE A CD2 
435  C CE1 . PHE A 69  ? 0.5241 0.4458 0.3893 0.1158  0.0555  0.0357  57  PHE A CE1 
436  C CE2 . PHE A 69  ? 0.5236 0.3858 0.3700 0.1022  0.0739  0.0298  57  PHE A CE2 
437  C CZ  . PHE A 69  ? 0.5404 0.4388 0.4012 0.1176  0.0679  0.0349  57  PHE A CZ  
438  N N   . VAL A 70  ? 0.4516 0.3244 0.3014 0.0424  0.0417  0.0134  58  VAL A N   
439  C CA  . VAL A 70  ? 0.4349 0.3099 0.2841 0.0371  0.0394  0.0118  58  VAL A CA  
440  C C   . VAL A 70  ? 0.4287 0.3227 0.2880 0.0340  0.0317  0.0047  58  VAL A C   
441  O O   . VAL A 70  ? 0.4197 0.3217 0.2754 0.0364  0.0294  0.0031  58  VAL A O   
442  C CB  . VAL A 70  ? 0.4395 0.3014 0.2897 0.0255  0.0423  0.0108  58  VAL A CB  
443  C CG1 . VAL A 70  ? 0.3980 0.2680 0.2526 0.0223  0.0406  0.0089  58  VAL A CG1 
444  C CG2 . VAL A 70  ? 0.4220 0.2617 0.2596 0.0243  0.0510  0.0158  58  VAL A CG2 
445  N N   . VAL A 71  ? 0.4241 0.3222 0.2935 0.0279  0.0291  0.0003  59  VAL A N   
446  C CA  . VAL A 71  ? 0.4079 0.3185 0.2856 0.0231  0.0237  -0.0069 59  VAL A CA  
447  C C   . VAL A 71  ? 0.4221 0.3529 0.2995 0.0287  0.0190  -0.0091 59  VAL A C   
448  O O   . VAL A 71  ? 0.4252 0.3628 0.2994 0.0271  0.0154  -0.0146 59  VAL A O   
449  C CB  . VAL A 71  ? 0.3926 0.3019 0.2791 0.0154  0.0239  -0.0093 59  VAL A CB  
450  C CG1 . VAL A 71  ? 0.4076 0.3268 0.3017 0.0083  0.0201  -0.0172 59  VAL A CG1 
451  C CG2 . VAL A 71  ? 0.3627 0.2550 0.2470 0.0102  0.0261  -0.0067 59  VAL A CG2 
452  N N   . ALA A 72  ? 0.4265 0.3681 0.3064 0.0362  0.0193  -0.0049 60  ALA A N   
453  C CA  . ALA A 72  ? 0.4296 0.3988 0.3127 0.0426  0.0128  -0.0060 60  ALA A CA  
454  C C   . ALA A 72  ? 0.4333 0.4032 0.3009 0.0505  0.0105  -0.0030 60  ALA A C   
455  O O   . ALA A 72  ? 0.4340 0.4222 0.2990 0.0488  0.0032  -0.0091 60  ALA A O   
456  C CB  . ALA A 72  ? 0.4212 0.4034 0.3111 0.0538  0.0149  0.0003  60  ALA A CB  
457  N N   . ARG A 73  ? 0.4318 0.3805 0.2866 0.0574  0.0174  0.0057  61  ARG A N   
458  C CA  . ARG A 73  ? 0.4530 0.3999 0.2903 0.0650  0.0176  0.0105  61  ARG A CA  
459  C C   . ARG A 73  ? 0.4508 0.3979 0.2839 0.0562  0.0156  0.0017  61  ARG A C   
460  O O   . ARG A 73  ? 0.4551 0.4146 0.2767 0.0599  0.0111  -0.0001 61  ARG A O   
461  C CB  . ARG A 73  ? 0.4709 0.3903 0.2957 0.0702  0.0281  0.0209  61  ARG A CB  
462  C CG  . ARG A 73  ? 0.5340 0.4489 0.3383 0.0796  0.0308  0.0290  61  ARG A CG  
463  C CD  . ARG A 73  ? 0.5782 0.4625 0.3724 0.0772  0.0431  0.0364  61  ARG A CD  
464  N NE  . ARG A 73  ? 0.6541 0.5348 0.4506 0.0651  0.0461  0.0306  61  ARG A NE  
465  C CZ  . ARG A 73  ? 0.5951 0.4631 0.4008 0.0535  0.0514  0.0282  61  ARG A CZ  
466  N NH1 . ARG A 73  ? 0.5889 0.4429 0.3989 0.0502  0.0545  0.0297  61  ARG A NH1 
467  N NH2 . ARG A 73  ? 0.5864 0.4576 0.3966 0.0457  0.0537  0.0240  61  ARG A NH2 
468  N N   . ASN A 74  ? 0.4364 0.3703 0.2778 0.0457  0.0192  -0.0034 62  ASN A N   
469  C CA  . ASN A 74  ? 0.4558 0.3866 0.2946 0.0396  0.0197  -0.0115 62  ASN A CA  
470  C C   . ASN A 74  ? 0.4726 0.4165 0.3145 0.0329  0.0126  -0.0241 62  ASN A C   
471  O O   . ASN A 74  ? 0.4876 0.4270 0.3223 0.0298  0.0138  -0.0320 62  ASN A O   
472  C CB  . ASN A 74  ? 0.4362 0.3510 0.2847 0.0333  0.0255  -0.0110 62  ASN A CB  
473  C CG  . ASN A 74  ? 0.4665 0.3709 0.3089 0.0358  0.0333  -0.0029 62  ASN A CG  
474  O OD1 . ASN A 74  ? 0.4523 0.3571 0.2852 0.0385  0.0373  -0.0029 62  ASN A OD1 
475  N ND2 . ASN A 74  ? 0.4442 0.3387 0.2903 0.0338  0.0365  0.0033  62  ASN A ND2 
476  N N   . LEU A 75  ? 0.4693 0.4289 0.3217 0.0300  0.0063  -0.0267 63  LEU A N   
477  C CA  . LEU A 75  ? 0.4693 0.4444 0.3244 0.0208  -0.0006 -0.0393 63  LEU A CA  
478  C C   . LEU A 75  ? 0.4943 0.4962 0.3391 0.0262  -0.0095 -0.0408 63  LEU A C   
479  O O   . LEU A 75  ? 0.5007 0.5149 0.3417 0.0169  -0.0158 -0.0536 63  LEU A O   
480  C CB  . LEU A 75  ? 0.4619 0.4446 0.3359 0.0120  -0.0022 -0.0419 63  LEU A CB  
481  C CG  . LEU A 75  ? 0.4660 0.4241 0.3476 0.0059  0.0049  -0.0407 63  LEU A CG  
482  C CD1 . LEU A 75  ? 0.4674 0.4348 0.3644 -0.0015 0.0047  -0.0414 63  LEU A CD1 
483  C CD2 . LEU A 75  ? 0.5249 0.4637 0.4005 -0.0014 0.0077  -0.0498 63  LEU A CD2 
484  N N   . LEU A 76  ? 0.5033 0.5125 0.3410 0.0409  -0.0098 -0.0280 64  LEU A N   
485  C CA  . LEU A 76  ? 0.5291 0.5662 0.3556 0.0497  -0.0192 -0.0260 64  LEU A CA  
486  C C   . LEU A 76  ? 0.5582 0.5945 0.3626 0.0459  -0.0218 -0.0352 64  LEU A C   
487  O O   . LEU A 76  ? 0.5608 0.5714 0.3531 0.0457  -0.0126 -0.0351 64  LEU A O   
488  C CB  . LEU A 76  ? 0.5375 0.5723 0.3549 0.0691  -0.0160 -0.0079 64  LEU A CB  
489  C CG  . LEU A 76  ? 0.5047 0.5460 0.3393 0.0776  -0.0144 0.0012  64  LEU A CG  
490  C CD1 . LEU A 76  ? 0.4632 0.4874 0.2829 0.0966  -0.0070 0.0188  64  LEU A CD1 
491  C CD2 . LEU A 76  ? 0.5067 0.5926 0.3568 0.0786  -0.0268 -0.0029 64  LEU A CD2 
492  N N   . GLY A 77  ? 0.5774 0.6441 0.3774 0.0417  -0.0341 -0.0444 65  GLY A N   
493  C CA  . GLY A 77  ? 0.6172 0.6858 0.3921 0.0373  -0.0378 -0.0553 65  GLY A CA  
494  C C   . GLY A 77  ? 0.6311 0.6772 0.4035 0.0204  -0.0323 -0.0733 65  GLY A C   
495  O O   . GLY A 77  ? 0.6748 0.7192 0.4239 0.0161  -0.0338 -0.0848 65  GLY A O   
496  N N   . VAL A 78  ? 0.6142 0.6413 0.4076 0.0122  -0.0253 -0.0754 66  VAL A N   
497  C CA  . VAL A 78  ? 0.6405 0.6384 0.4320 0.0007  -0.0170 -0.0884 66  VAL A CA  
498  C C   . VAL A 78  ? 0.6330 0.6319 0.4424 -0.0168 -0.0197 -0.1000 66  VAL A C   
499  O O   . VAL A 78  ? 0.6643 0.6416 0.4673 -0.0288 -0.0151 -0.1144 66  VAL A O   
500  C CB  . VAL A 78  ? 0.6375 0.6056 0.4345 0.0092  -0.0037 -0.0773 66  VAL A CB  
501  C CG1 . VAL A 78  ? 0.6762 0.6236 0.4905 0.0000  0.0018  -0.0813 66  VAL A CG1 
502  C CG2 . VAL A 78  ? 0.6744 0.6274 0.4498 0.0155  0.0044  -0.0794 66  VAL A CG2 
503  N N   . VAL A 79  ? 0.5945 0.6171 0.4252 -0.0185 -0.0256 -0.0940 67  VAL A N   
504  C CA  . VAL A 79  ? 0.5840 0.6129 0.4327 -0.0369 -0.0275 -0.1041 67  VAL A CA  
505  C C   . VAL A 79  ? 0.5862 0.6638 0.4434 -0.0438 -0.0418 -0.1100 67  VAL A C   
506  O O   . VAL A 79  ? 0.5825 0.6874 0.4313 -0.0312 -0.0506 -0.1038 67  VAL A O   
507  C CB  . VAL A 79  ? 0.5597 0.5777 0.4297 -0.0347 -0.0202 -0.0924 67  VAL A CB  
508  C CG1 . VAL A 79  ? 0.5674 0.5437 0.4309 -0.0289 -0.0084 -0.0870 67  VAL A CG1 
509  C CG2 . VAL A 79  ? 0.4976 0.5413 0.3777 -0.0193 -0.0239 -0.0770 67  VAL A CG2 
510  N N   . LYS A 80  ? 0.5799 0.6698 0.4548 -0.0634 -0.0437 -0.1204 68  LYS A N   
511  C CA  . LYS A 80  ? 0.5919 0.7338 0.4789 -0.0733 -0.0577 -0.1280 68  LYS A CA  
512  C C   . LYS A 80  ? 0.5561 0.7399 0.4619 -0.0550 -0.0641 -0.1111 68  LYS A C   
513  O O   . LYS A 80  ? 0.5636 0.7894 0.4672 -0.0476 -0.0774 -0.1100 68  LYS A O   
514  C CB  . LYS A 80  ? 0.6149 0.7574 0.5195 -0.1012 -0.0549 -0.1426 68  LYS A CB  
515  C CG  . LYS A 80  ? 0.6704 0.8679 0.5886 -0.1185 -0.0693 -0.1554 68  LYS A CG  
516  C CD  . LYS A 80  ? 0.7663 0.9451 0.6801 -0.1516 -0.0662 -0.1789 68  LYS A CD  
517  C CE  . LYS A 80  ? 0.8516 0.9992 0.7280 -0.1553 -0.0671 -0.1939 68  LYS A CE  
518  N NZ  . LYS A 80  ? 0.9184 1.0151 0.7827 -0.1804 -0.0548 -0.2127 68  LYS A NZ  
519  N N   . ASP A 81  ? 0.5181 0.6900 0.4410 -0.0469 -0.0544 -0.0982 69  ASP A N   
520  C CA  . ASP A 81  ? 0.5003 0.7027 0.4391 -0.0274 -0.0566 -0.0821 69  ASP A CA  
521  C C   . ASP A 81  ? 0.4794 0.6446 0.4207 -0.0169 -0.0423 -0.0690 69  ASP A C   
522  O O   . ASP A 81  ? 0.4703 0.6016 0.4127 -0.0295 -0.0325 -0.0732 69  ASP A O   
523  C CB  . ASP A 81  ? 0.4992 0.7531 0.4694 -0.0382 -0.0627 -0.0866 69  ASP A CB  
524  C CG  . ASP A 81  ? 0.5174 0.8127 0.5036 -0.0138 -0.0671 -0.0706 69  ASP A CG  
525  O OD1 . ASP A 81  ? 0.5617 0.8555 0.5309 0.0097  -0.0706 -0.0582 69  ASP A OD1 
526  O OD2 . ASP A 81  ? 0.5731 0.9025 0.5893 -0.0174 -0.0657 -0.0696 69  ASP A OD2 
527  N N   . VAL A 82  ? 0.4720 0.6420 0.4113 0.0064  -0.0411 -0.0531 70  VAL A N   
528  C CA  . VAL A 82  ? 0.4543 0.5951 0.3957 0.0171  -0.0286 -0.0408 70  VAL A CA  
529  C C   . VAL A 82  ? 0.4303 0.6007 0.3863 0.0351  -0.0287 -0.0292 70  VAL A C   
530  O O   . VAL A 82  ? 0.4229 0.6175 0.3739 0.0512  -0.0364 -0.0224 70  VAL A O   
531  C CB  . VAL A 82  ? 0.4660 0.5678 0.3825 0.0301  -0.0230 -0.0319 70  VAL A CB  
532  C CG1 . VAL A 82  ? 0.4644 0.5339 0.3827 0.0339  -0.0105 -0.0236 70  VAL A CG1 
533  C CG2 . VAL A 82  ? 0.5088 0.5895 0.4090 0.0196  -0.0238 -0.0413 70  VAL A CG2 
534  N N   . LEU A 83  ? 0.4133 0.5795 0.3849 0.0344  -0.0190 -0.0259 71  LEU A N   
535  C CA  . LEU A 83  ? 0.4112 0.5964 0.3946 0.0547  -0.0146 -0.0141 71  LEU A CA  
536  C C   . LEU A 83  ? 0.4047 0.5473 0.3812 0.0577  0.0005  -0.0084 71  LEU A C   
537  O O   . LEU A 83  ? 0.4022 0.5248 0.3801 0.0409  0.0061  -0.0146 71  LEU A O   
538  C CB  . LEU A 83  ? 0.3990 0.6380 0.4143 0.0488  -0.0183 -0.0188 71  LEU A CB  
539  C CG  . LEU A 83  ? 0.3917 0.6548 0.4254 0.0688  -0.0109 -0.0082 71  LEU A CG  
540  C CD1 . LEU A 83  ? 0.3398 0.6137 0.3633 0.0985  -0.0161 0.0052  71  LEU A CD1 
541  C CD2 . LEU A 83  ? 0.3642 0.6838 0.4335 0.0574  -0.0135 -0.0150 71  LEU A CD2 
542  N N   . VAL A 84  ? 0.4249 0.5511 0.3906 0.0787  0.0070  0.0032  72  VAL A N   
543  C CA  . VAL A 84  ? 0.4158 0.5073 0.3753 0.0820  0.0214  0.0074  72  VAL A CA  
544  C C   . VAL A 84  ? 0.4163 0.5333 0.3941 0.0962  0.0289  0.0123  72  VAL A C   
545  O O   . VAL A 84  ? 0.4148 0.5593 0.3994 0.1161  0.0256  0.0199  72  VAL A O   
546  C CB  . VAL A 84  ? 0.4351 0.4846 0.3680 0.0940  0.0267  0.0158  72  VAL A CB  
547  C CG1 . VAL A 84  ? 0.4299 0.4457 0.3547 0.0979  0.0416  0.0189  72  VAL A CG1 
548  C CG2 . VAL A 84  ? 0.3982 0.4239 0.3154 0.0804  0.0219  0.0113  72  VAL A CG2 
549  N N   . VAL A 85  ? 0.4155 0.5252 0.4010 0.0866  0.0392  0.0084  73  VAL A N   
550  C CA  . VAL A 85  ? 0.4291 0.5495 0.4257 0.1012  0.0517  0.0131  73  VAL A CA  
551  C C   . VAL A 85  ? 0.4516 0.5169 0.4212 0.1064  0.0646  0.0162  73  VAL A C   
552  O O   . VAL A 85  ? 0.4444 0.4784 0.4006 0.0890  0.0675  0.0109  73  VAL A O   
553  C CB  . VAL A 85  ? 0.4157 0.5622 0.4353 0.0861  0.0573  0.0063  73  VAL A CB  
554  C CG1 . VAL A 85  ? 0.4192 0.5803 0.4509 0.1048  0.0721  0.0116  73  VAL A CG1 
555  C CG2 . VAL A 85  ? 0.3794 0.5757 0.4241 0.0722  0.0442  -0.0001 73  VAL A CG2 
556  N N   . PHE A 86  ? 0.4874 0.5396 0.4469 0.1301  0.0714  0.0250  74  PHE A N   
557  C CA  . PHE A 86  ? 0.5189 0.5172 0.4509 0.1344  0.0843  0.0268  74  PHE A CA  
558  C C   . PHE A 86  ? 0.5495 0.5495 0.4878 0.1430  0.1002  0.0259  74  PHE A C   
559  O O   . PHE A 86  ? 0.5592 0.5880 0.5140 0.1647  0.1051  0.0320  74  PHE A O   
560  C CB  . PHE A 86  ? 0.5398 0.5134 0.4527 0.1541  0.0858  0.0367  74  PHE A CB  
561  C CG  . PHE A 86  ? 0.5651 0.4838 0.4511 0.1576  0.1013  0.0371  74  PHE A CG  
562  C CD1 . PHE A 86  ? 0.5485 0.4317 0.4162 0.1352  0.1015  0.0297  74  PHE A CD1 
563  C CD2 . PHE A 86  ? 0.6061 0.5105 0.4863 0.1817  0.1165  0.0433  74  PHE A CD2 
564  C CE1 . PHE A 86  ? 0.5973 0.4319 0.4396 0.1336  0.1147  0.0274  74  PHE A CE1 
565  C CE2 . PHE A 86  ? 0.6352 0.4838 0.4874 0.1814  0.1324  0.0407  74  PHE A CE2 
566  C CZ  . PHE A 86  ? 0.6304 0.4448 0.4632 0.1552  0.1309  0.0317  74  PHE A CZ  
567  N N   . LEU A 87  ? 0.5808 0.5540 0.5068 0.1264  0.1080  0.0186  75  LEU A N   
568  C CA  . LEU A 87  ? 0.6071 0.5822 0.5367 0.1298  0.1242  0.0156  75  LEU A CA  
569  C C   . LEU A 87  ? 0.6615 0.5854 0.5608 0.1389  0.1404  0.0148  75  LEU A C   
570  O O   . LEU A 87  ? 0.6881 0.6096 0.5864 0.1466  0.1563  0.0127  75  LEU A O   
571  C CB  . LEU A 87  ? 0.5868 0.5668 0.5195 0.1043  0.1232  0.0080  75  LEU A CB  
572  C CG  . LEU A 87  ? 0.5797 0.6026 0.5392 0.0905  0.1096  0.0064  75  LEU A CG  
573  C CD1 . LEU A 87  ? 0.5719 0.5845 0.5261 0.0655  0.1098  0.0006  75  LEU A CD1 
574  C CD2 . LEU A 87  ? 0.5895 0.6656 0.5821 0.1031  0.1135  0.0088  75  LEU A CD2 
575  N N   . GLY A 88  ? 0.6948 0.5766 0.5683 0.1363  0.1379  0.0154  76  GLY A N   
576  C CA  . GLY A 88  ? 0.7436 0.5728 0.5858 0.1411  0.1537  0.0126  76  GLY A CA  
577  C C   . GLY A 88  ? 0.7905 0.6064 0.6284 0.1715  0.1681  0.0200  76  GLY A C   
578  O O   . GLY A 88  ? 0.7870 0.6409 0.6490 0.1925  0.1653  0.0291  76  GLY A O   
579  N N   . LYS A 89  ? 0.8416 0.6021 0.6473 0.1737  0.1837  0.0157  77  LYS A N   
580  C CA  . LYS A 89  ? 0.9028 0.6345 0.6962 0.2022  0.2004  0.0224  77  LYS A CA  
581  C C   . LYS A 89  ? 0.9133 0.6040 0.6840 0.1995  0.1969  0.0271  77  LYS A C   
582  O O   . LYS A 89  ? 0.9428 0.6503 0.7242 0.2152  0.1895  0.0394  77  LYS A O   
583  C CB  . LYS A 89  ? 0.9561 0.6495 0.7264 0.2062  0.2234  0.0131  77  LYS A CB  
584  C CG  . LYS A 89  ? 1.0060 0.7401 0.8014 0.2260  0.2352  0.0144  77  LYS A CG  
585  C CD  . LYS A 89  ? 1.0110 0.8200 0.8492 0.2178  0.2188  0.0171  77  LYS A CD  
586  C CE  . LYS A 89  ? 1.0213 0.8835 0.8955 0.2455  0.2122  0.0311  77  LYS A CE  
587  N NZ  . LYS A 89  ? 0.9798 0.9105 0.8923 0.2322  0.1923  0.0324  77  LYS A NZ  
588  N N   . LYS A 90  ? 0.9069 0.5489 0.6475 0.1772  0.2004  0.0174  78  LYS A N   
589  C CA  . LYS A 90  ? 0.9046 0.5086 0.6251 0.1711  0.1987  0.0214  78  LYS A CA  
590  C C   . LYS A 90  ? 0.8340 0.4591 0.5629 0.1430  0.1783  0.0180  78  LYS A C   
591  O O   . LYS A 90  ? 0.7886 0.4481 0.5337 0.1285  0.1675  0.0119  78  LYS A O   
592  C CB  . LYS A 90  ? 0.9661 0.5002 0.6475 0.1647  0.2180  0.0126  78  LYS A CB  
593  C CG  . LYS A 90  ? 1.0076 0.5262 0.6723 0.1329  0.2165  -0.0048 78  LYS A CG  
594  C CD  . LYS A 90  ? 1.1394 0.6017 0.7696 0.1358  0.2403  -0.0161 78  LYS A CD  
595  C CE  . LYS A 90  ? 1.1748 0.6094 0.7778 0.1005  0.2383  -0.0339 78  LYS A CE  
596  N NZ  . LYS A 90  ? 1.1171 0.5979 0.7401 0.0766  0.2139  -0.0351 78  LYS A NZ  
597  N N   . LYS A 91  ? 0.8009 0.4057 0.5192 0.1370  0.1745  0.0230  79  LYS A N   
598  C CA  . LYS A 91  ? 0.7539 0.3781 0.4807 0.1132  0.1575  0.0205  79  LYS A CA  
599  C C   . LYS A 91  ? 0.7653 0.3436 0.4662 0.0908  0.1629  0.0133  79  LYS A C   
600  O O   . LYS A 91  ? 0.7908 0.3224 0.4685 0.0968  0.1776  0.0162  79  LYS A O   
601  C CB  . LYS A 91  ? 0.7392 0.3919 0.4812 0.1246  0.1465  0.0330  79  LYS A CB  
602  C CG  . LYS A 91  ? 0.7072 0.4118 0.4766 0.1437  0.1384  0.0390  79  LYS A CG  
603  C CD  . LYS A 91  ? 0.6994 0.4286 0.4773 0.1539  0.1273  0.0503  79  LYS A CD  
604  C CE  . LYS A 91  ? 0.6880 0.4725 0.4933 0.1711  0.1180  0.0551  79  LYS A CE  
605  N NZ  . LYS A 91  ? 0.6594 0.4434 0.4651 0.2022  0.1293  0.0649  79  LYS A NZ  
606  N N   . THR A 92  ? 0.7163 0.3072 0.4208 0.0647  0.1517  0.0042  80  THR A N   
607  C CA  . THR A 92  ? 0.7397 0.2987 0.4257 0.0412  0.1537  -0.0020 80  THR A CA  
608  C C   . THR A 92  ? 0.7362 0.2937 0.4255 0.0439  0.1518  0.0090  80  THR A C   
609  O O   . THR A 92  ? 0.6977 0.2857 0.4042 0.0608  0.1447  0.0196  80  THR A O   
610  C CB  . THR A 92  ? 0.7081 0.2904 0.4017 0.0155  0.1394  -0.0114 80  THR A CB  
611  O OG1 . THR A 92  ? 0.6643 0.2913 0.3846 0.0176  0.1240  -0.0048 80  THR A OG1 
612  C CG2 . THR A 92  ? 0.7247 0.3104 0.4120 0.0107  0.1399  -0.0213 80  THR A CG2 
613  N N   . PRO A 93  ? 0.7548 0.2789 0.4271 0.0255  0.1583  0.0058  81  PRO A N   
614  C CA  . PRO A 93  ? 0.7631 0.2815 0.4350 0.0281  0.1601  0.0171  81  PRO A CA  
615  C C   . PRO A 93  ? 0.7071 0.2781 0.4059 0.0271  0.1425  0.0220  81  PRO A C   
616  O O   . PRO A 93  ? 0.6888 0.2714 0.3920 0.0439  0.1412  0.0341  81  PRO A O   
617  C CB  . PRO A 93  ? 0.8026 0.2823 0.4553 0.0006  0.1692  0.0092  81  PRO A CB  
618  C CG  . PRO A 93  ? 0.8468 0.2876 0.4765 -0.0049 0.1806  -0.0039 81  PRO A CG  
619  C CD  . PRO A 93  ? 0.8047 0.2859 0.4517 0.0051  0.1689  -0.0075 81  PRO A CD  
620  N N   . ASP A 94  ? 0.6765 0.2775 0.3909 0.0089  0.1295  0.0132  82  ASP A N   
621  C CA  . ASP A 94  ? 0.6428 0.2883 0.3806 0.0093  0.1150  0.0169  82  ASP A CA  
622  C C   . ASP A 94  ? 0.6119 0.2877 0.3643 0.0301  0.1075  0.0214  82  ASP A C   
623  O O   . ASP A 94  ? 0.6034 0.3030 0.3663 0.0380  0.1008  0.0276  82  ASP A O   
624  C CB  . ASP A 94  ? 0.6256 0.2941 0.3764 -0.0128 0.1038  0.0081  82  ASP A CB  
625  C CG  . ASP A 94  ? 0.6836 0.3338 0.4262 -0.0357 0.1092  0.0041  82  ASP A CG  
626  O OD1 . ASP A 94  ? 0.7299 0.3525 0.4595 -0.0355 0.1212  0.0096  82  ASP A OD1 
627  O OD2 . ASP A 94  ? 0.7320 0.3970 0.4816 -0.0546 0.1015  -0.0039 82  ASP A OD2 
628  N N   . CYS A 95  ? 0.6076 0.2848 0.3605 0.0378  0.1089  0.0176  83  CYS A N   
629  C CA  . CYS A 95  ? 0.5751 0.2841 0.3442 0.0560  0.1029  0.0218  83  CYS A CA  
630  C C   . CYS A 95  ? 0.6139 0.3181 0.3777 0.0791  0.1084  0.0339  83  CYS A C   
631  O O   . CYS A 95  ? 0.5892 0.3252 0.3659 0.0896  0.0993  0.0395  83  CYS A O   
632  C CB  . CYS A 95  ? 0.5894 0.2990 0.3594 0.0595  0.1069  0.0161  83  CYS A CB  
633  S SG  . CYS A 95  ? 0.5832 0.3375 0.3775 0.0781  0.1007  0.0202  83  CYS A SG  
634  N N   . GLU A 96  ? 0.6425 0.3044 0.3844 0.0860  0.1233  0.0380  84  GLU A N   
635  C CA  . GLU A 96  ? 0.6800 0.3307 0.4120 0.1096  0.1300  0.0519  84  GLU A CA  
636  C C   . GLU A 96  ? 0.6622 0.3225 0.3929 0.1075  0.1239  0.0598  84  GLU A C   
637  O O   . GLU A 96  ? 0.6437 0.3258 0.3779 0.1262  0.1187  0.0698  84  GLU A O   
638  C CB  . GLU A 96  ? 0.7316 0.3245 0.4360 0.1153  0.1499  0.0546  84  GLU A CB  
639  C CG  . GLU A 96  ? 0.8452 0.4191 0.5352 0.1422  0.1589  0.0716  84  GLU A CG  
640  C CD  . GLU A 96  ? 0.9172 0.5200 0.6204 0.1724  0.1567  0.0790  84  GLU A CD  
641  O OE1 . GLU A 96  ? 0.9313 0.5659 0.6428 0.1898  0.1474  0.0906  84  GLU A OE1 
642  O OE2 . GLU A 96  ? 1.0042 0.6013 0.7101 0.1784  0.1641  0.0727  84  GLU A OE2 
643  N N   . TYR A 97  ? 0.6446 0.2924 0.3707 0.0846  0.1245  0.0549  85  TYR A N   
644  C CA  . TYR A 97  ? 0.6481 0.3053 0.3727 0.0816  0.1211  0.0617  85  TYR A CA  
645  C C   . TYR A 97  ? 0.5947 0.3025 0.3402 0.0860  0.1043  0.0601  85  TYR A C   
646  O O   . TYR A 97  ? 0.5789 0.3015 0.3211 0.0990  0.1005  0.0687  85  TYR A O   
647  C CB  . TYR A 97  ? 0.6519 0.2960 0.3749 0.0543  0.1242  0.0546  85  TYR A CB  
648  C CG  . TYR A 97  ? 0.6377 0.2963 0.3627 0.0486  0.1219  0.0596  85  TYR A CG  
649  C CD1 . TYR A 97  ? 0.7152 0.3502 0.4198 0.0574  0.1327  0.0725  85  TYR A CD1 
650  C CD2 . TYR A 97  ? 0.6311 0.3248 0.3763 0.0357  0.1106  0.0520  85  TYR A CD2 
651  C CE1 . TYR A 97  ? 0.6945 0.3423 0.3986 0.0523  0.1326  0.0769  85  TYR A CE1 
652  C CE2 . TYR A 97  ? 0.6025 0.3087 0.3489 0.0319  0.1109  0.0558  85  TYR A CE2 
653  C CZ  . TYR A 97  ? 0.6459 0.3300 0.3714 0.0397  0.1220  0.0679  85  TYR A CZ  
654  O OH  . TYR A 97  ? 0.6838 0.3799 0.4081 0.0359  0.1241  0.0718  85  TYR A OH  
655  N N   . ASN A 98  ? 0.5663 0.2983 0.3309 0.0747  0.0949  0.0489  86  ASN A N   
656  C CA  . ASN A 98  ? 0.5453 0.3194 0.3287 0.0759  0.0806  0.0452  86  ASN A CA  
657  C C   . ASN A 98  ? 0.5526 0.3528 0.3433 0.0957  0.0747  0.0495  86  ASN A C   
658  O O   . ASN A 98  ? 0.5262 0.3557 0.3236 0.0997  0.0647  0.0500  86  ASN A O   
659  C CB  . ASN A 98  ? 0.5274 0.3149 0.3262 0.0574  0.0737  0.0339  86  ASN A CB  
660  C CG  . ASN A 98  ? 0.5036 0.2859 0.3017 0.0416  0.0743  0.0318  86  ASN A CG  
661  O OD1 . ASN A 98  ? 0.5393 0.3334 0.3379 0.0433  0.0719  0.0346  86  ASN A OD1 
662  N ND2 . ASN A 98  ? 0.4916 0.2576 0.2876 0.0266  0.0782  0.0270  86  ASN A ND2 
663  N N   . TYR A 99  ? 0.5562 0.3469 0.3454 0.1077  0.0812  0.0520  87  TYR A N   
664  C CA  . TYR A 99  ? 0.5585 0.3770 0.3569 0.1286  0.0770  0.0576  87  TYR A CA  
665  C C   . TYR A 99  ? 0.5824 0.4013 0.3664 0.1463  0.0763  0.0710  87  TYR A C   
666  O O   . TYR A 99  ? 0.5787 0.4349 0.3711 0.1565  0.0651  0.0740  87  TYR A O   
667  C CB  . TYR A 99  ? 0.5834 0.3845 0.3799 0.1404  0.0886  0.0590  87  TYR A CB  
668  C CG  . TYR A 99  ? 0.6073 0.4271 0.4081 0.1688  0.0895  0.0699  87  TYR A CG  
669  C CD1 . TYR A 99  ? 0.6052 0.4774 0.4308 0.1749  0.0778  0.0682  87  TYR A CD1 
670  C CD2 . TYR A 99  ? 0.7071 0.4924 0.4877 0.1895  0.1029  0.0821  87  TYR A CD2 
671  C CE1 . TYR A 99  ? 0.6583 0.5557 0.4918 0.2012  0.0773  0.0783  87  TYR A CE1 
672  C CE2 . TYR A 99  ? 0.7449 0.5502 0.5308 0.2191  0.1035  0.0937  87  TYR A CE2 
673  C CZ  . TYR A 99  ? 0.7306 0.5959 0.5447 0.2251  0.0898  0.0918  87  TYR A CZ  
674  O OH  . TYR A 99  ? 0.7698 0.6644 0.5937 0.2549  0.0887  0.1036  87  TYR A OH  
675  N N   . GLY A 100 ? 0.6052 0.3815 0.3655 0.1481  0.0887  0.0789  88  GLY A N   
676  C CA  . GLY A 100 ? 0.6277 0.3970 0.3688 0.1643  0.0905  0.0935  88  GLY A CA  
677  C C   . GLY A 100 ? 0.6141 0.4106 0.3563 0.1558  0.0788  0.0916  88  GLY A C   
678  O O   . GLY A 100 ? 0.6080 0.4286 0.3451 0.1712  0.0709  0.0996  88  GLY A O   
679  N N   . LEU A 101 ? 0.6084 0.4031 0.3572 0.1319  0.0776  0.0803  89  LEU A N   
680  C CA  . LEU A 101 ? 0.5967 0.4152 0.3472 0.1234  0.0686  0.0761  89  LEU A CA  
681  C C   . LEU A 101 ? 0.5729 0.4373 0.3403 0.1272  0.0524  0.0692  89  LEU A C   
682  O O   . LEU A 101 ? 0.5481 0.4334 0.3081 0.1321  0.0446  0.0708  89  LEU A O   
683  C CB  . LEU A 101 ? 0.5829 0.3932 0.3415 0.0996  0.0710  0.0654  89  LEU A CB  
684  C CG  . LEU A 101 ? 0.6254 0.4016 0.3694 0.0892  0.0848  0.0699  89  LEU A CG  
685  C CD1 . LEU A 101 ? 0.5703 0.3542 0.3293 0.0679  0.0832  0.0589  89  LEU A CD1 
686  C CD2 . LEU A 101 ? 0.6475 0.4161 0.3690 0.0989  0.0901  0.0820  89  LEU A CD2 
687  N N   . TYR A 102 ? 0.5415 0.4207 0.3299 0.1234  0.0482  0.0610  90  TYR A N   
688  C CA  . TYR A 102 ? 0.5237 0.4454 0.3304 0.1226  0.0344  0.0530  90  TYR A CA  
689  C C   . TYR A 102 ? 0.5419 0.4900 0.3436 0.1438  0.0274  0.0627  90  TYR A C   
690  O O   . TYR A 102 ? 0.5521 0.5317 0.3547 0.1432  0.0153  0.0589  90  TYR A O   
691  C CB  . TYR A 102 ? 0.4940 0.4235 0.3223 0.1157  0.0345  0.0450  90  TYR A CB  
692  C CG  . TYR A 102 ? 0.4913 0.4644 0.3405 0.1134  0.0225  0.0372  90  TYR A CG  
693  C CD1 . TYR A 102 ? 0.4734 0.4619 0.3293 0.0972  0.0140  0.0257  90  TYR A CD1 
694  C CD2 . TYR A 102 ? 0.5112 0.5097 0.3740 0.1269  0.0210  0.0411  90  TYR A CD2 
695  C CE1 . TYR A 102 ? 0.4642 0.4890 0.3378 0.0916  0.0043  0.0174  90  TYR A CE1 
696  C CE2 . TYR A 102 ? 0.5022 0.5440 0.3865 0.1218  0.0105  0.0334  90  TYR A CE2 
697  C CZ  . TYR A 102 ? 0.4763 0.5299 0.3652 0.1026  0.0021  0.0211  90  TYR A CZ  
698  O OH  . TYR A 102 ? 0.4625 0.5561 0.3717 0.0940  -0.0072 0.0121  90  TYR A OH  
699  N N   . LYS A 103 ? 0.5645 0.4986 0.3590 0.1634  0.0352  0.0756  91  LYS A N   
700  C CA  . LYS A 103 ? 0.5894 0.5506 0.3784 0.1883  0.0282  0.0882  91  LYS A CA  
701  C C   . LYS A 103 ? 0.6058 0.5611 0.3667 0.1957  0.0259  0.0981  91  LYS A C   
702  O O   . LYS A 103 ? 0.6085 0.6021 0.3673 0.2063  0.0123  0.1013  91  LYS A O   
703  C CB  . LYS A 103 ? 0.6064 0.5512 0.3940 0.2111  0.0389  0.1009  91  LYS A CB  
704  C CG  . LYS A 103 ? 0.6419 0.5981 0.4565 0.2050  0.0415  0.0908  91  LYS A CG  
705  C CD  . LYS A 103 ? 0.7370 0.6962 0.5569 0.2317  0.0489  0.1018  91  LYS A CD  
706  C CE  . LYS A 103 ? 0.7672 0.7852 0.6023 0.2515  0.0345  0.1088  91  LYS A CE  
707  N NZ  . LYS A 103 ? 0.8574 0.8653 0.6868 0.2855  0.0447  0.1263  91  LYS A NZ  
708  N N   . LYS A 104 ? 0.6318 0.5412 0.3704 0.1901  0.0393  0.1033  92  LYS A N   
709  C CA  . LYS A 104 ? 0.6653 0.5649 0.3746 0.1949  0.0404  0.1130  92  LYS A CA  
710  C C   . LYS A 104 ? 0.6338 0.5684 0.3467 0.1810  0.0263  0.0997  92  LYS A C   
711  O O   . LYS A 104 ? 0.6347 0.5864 0.3283 0.1901  0.0190  0.1055  92  LYS A O   
712  C CB  . LYS A 104 ? 0.6988 0.5452 0.3895 0.1844  0.0591  0.1175  92  LYS A CB  
713  C CG  . LYS A 104 ? 0.7698 0.5715 0.4386 0.2024  0.0754  0.1361  92  LYS A CG  
714  C CD  . LYS A 104 ? 0.8560 0.6545 0.4928 0.2231  0.0759  0.1553  92  LYS A CD  
715  C CE  . LYS A 104 ? 0.9302 0.6786 0.5400 0.2439  0.0936  0.1767  92  LYS A CE  
716  N NZ  . LYS A 104 ? 0.9688 0.7216 0.5461 0.2701  0.0909  0.1987  92  LYS A NZ  
717  N N   . PHE A 105 ? 0.5935 0.5373 0.3290 0.1595  0.0229  0.0817  93  PHE A N   
718  C CA  . PHE A 105 ? 0.5831 0.5537 0.3216 0.1458  0.0117  0.0673  93  PHE A CA  
719  C C   . PHE A 105 ? 0.5820 0.6014 0.3335 0.1503  -0.0058 0.0613  93  PHE A C   
720  O O   . PHE A 105 ? 0.5779 0.6183 0.3309 0.1376  -0.0151 0.0475  93  PHE A O   
721  C CB  . PHE A 105 ? 0.5439 0.5040 0.3007 0.1230  0.0152  0.0516  93  PHE A CB  
722  C CG  . PHE A 105 ? 0.5625 0.4917 0.3071 0.1134  0.0276  0.0521  93  PHE A CG  
723  C CD1 . PHE A 105 ? 0.5844 0.4803 0.3161 0.1179  0.0415  0.0648  93  PHE A CD1 
724  C CD2 . PHE A 105 ? 0.5740 0.5076 0.3224 0.0985  0.0265  0.0388  93  PHE A CD2 
725  C CE1 . PHE A 105 ? 0.6076 0.4813 0.3325 0.1062  0.0530  0.0643  93  PHE A CE1 
726  C CE2 . PHE A 105 ? 0.5520 0.4643 0.2943 0.0906  0.0380  0.0391  93  PHE A CE2 
727  C CZ  . PHE A 105 ? 0.5656 0.4512 0.2976 0.0934  0.0507  0.0516  93  PHE A CZ  
728  N N   . GLY A 106 ? 0.5910 0.6289 0.3528 0.1674  -0.0095 0.0706  94  GLY A N   
729  C CA  . GLY A 106 ? 0.5847 0.6772 0.3628 0.1719  -0.0268 0.0659  94  GLY A CA  
730  C C   . GLY A 106 ? 0.5532 0.6661 0.3667 0.1580  -0.0296 0.0524  94  GLY A C   
731  O O   . GLY A 106 ? 0.5456 0.7041 0.3762 0.1528  -0.0432 0.0436  94  GLY A O   
732  N N   . GLY A 107 ? 0.5394 0.6203 0.3635 0.1516  -0.0165 0.0512  95  GLY A N   
733  C CA  . GLY A 107 ? 0.5123 0.6096 0.3661 0.1372  -0.0177 0.0390  95  GLY A CA  
734  C C   . GLY A 107 ? 0.5166 0.6424 0.3912 0.1534  -0.0181 0.0461  95  GLY A C   
735  O O   . GLY A 107 ? 0.5168 0.6288 0.3825 0.1759  -0.0107 0.0613  95  GLY A O   
736  N N   . LYS A 108 ? 0.5136 0.6753 0.4162 0.1412  -0.0242 0.0350  96  LYS A N   
737  C CA  . LYS A 108 ? 0.5320 0.7281 0.4600 0.1552  -0.0234 0.0404  96  LYS A CA  
738  C C   . LYS A 108 ? 0.5213 0.6901 0.4609 0.1491  -0.0079 0.0379  96  LYS A C   
739  O O   . LYS A 108 ? 0.4893 0.6404 0.4326 0.1255  -0.0047 0.0259  96  LYS A O   
740  C CB  . LYS A 108 ? 0.5310 0.7909 0.4851 0.1448  -0.0391 0.0301  96  LYS A CB  
741  C CG  . LYS A 108 ? 0.5859 0.8893 0.5722 0.1573  -0.0376 0.0346  96  LYS A CG  
742  C CD  . LYS A 108 ? 0.6330 1.0084 0.6444 0.1502  -0.0555 0.0271  96  LYS A CD  
743  C CE  . LYS A 108 ? 0.6397 1.0649 0.6885 0.1627  -0.0527 0.0318  96  LYS A CE  
744  N NZ  . LYS A 108 ? 0.6675 1.1677 0.7351 0.1690  -0.0725 0.0324  96  LYS A NZ  
745  N N   . VAL A 109 ? 0.5324 0.6956 0.4747 0.1720  0.0023  0.0498  97  VAL A N   
746  C CA  . VAL A 109 ? 0.5384 0.6798 0.4895 0.1696  0.0176  0.0476  97  VAL A CA  
747  C C   . VAL A 109 ? 0.5415 0.7302 0.5213 0.1856  0.0188  0.0516  97  VAL A C   
748  O O   . VAL A 109 ? 0.5615 0.7793 0.5448 0.2101  0.0133  0.0631  97  VAL A O   
749  C CB  . VAL A 109 ? 0.5675 0.6500 0.4922 0.1830  0.0336  0.0571  97  VAL A CB  
750  C CG1 . VAL A 109 ? 0.5352 0.5930 0.4649 0.1767  0.0493  0.0517  97  VAL A CG1 
751  C CG2 . VAL A 109 ? 0.5562 0.5985 0.4541 0.1709  0.0326  0.0560  97  VAL A CG2 
752  N N   . VAL A 110 ? 0.5285 0.7274 0.5290 0.1733  0.0264  0.0434  98  VAL A N   
753  C CA  . VAL A 110 ? 0.5342 0.7704 0.5612 0.1912  0.0338  0.0483  98  VAL A CA  
754  C C   . VAL A 110 ? 0.5616 0.7530 0.5799 0.1889  0.0543  0.0460  98  VAL A C   
755  O O   . VAL A 110 ? 0.5339 0.6827 0.5342 0.1672  0.0577  0.0381  98  VAL A O   
756  C CB  . VAL A 110 ? 0.5143 0.8212 0.5800 0.1774  0.0233  0.0397  98  VAL A CB  
757  C CG1 . VAL A 110 ? 0.4863 0.8415 0.5583 0.1814  0.0018  0.0416  98  VAL A CG1 
758  C CG2 . VAL A 110 ? 0.4681 0.7630 0.5380 0.1418  0.0249  0.0244  98  VAL A CG2 
759  N N   . GLU A 111 ? 0.5917 0.7927 0.6209 0.2127  0.0678  0.0531  99  GLU A N   
760  C CA  . GLU A 111 ? 0.6359 0.7951 0.6536 0.2138  0.0888  0.0507  99  GLU A CA  
761  C C   . GLU A 111 ? 0.6437 0.8422 0.6919 0.2089  0.0979  0.0450  99  GLU A C   
762  O O   . GLU A 111 ? 0.6650 0.8352 0.7045 0.2116  0.1162  0.0428  99  GLU A O   
763  C CB  . GLU A 111 ? 0.6772 0.8033 0.6764 0.2468  0.1025  0.0629  99  GLU A CB  
764  C CG  . GLU A 111 ? 0.7428 0.8153 0.7060 0.2486  0.0998  0.0683  99  GLU A CG  
765  C CD  . GLU A 111 ? 0.8283 0.8463 0.7654 0.2728  0.1196  0.0766  99  GLU A CD  
766  O OE1 . GLU A 111 ? 0.8568 0.8164 0.7607 0.2662  0.1240  0.0769  99  GLU A OE1 
767  O OE2 . GLU A 111 ? 0.8990 0.9325 0.8494 0.2977  0.1321  0.0820  99  GLU A OE2 
768  N N   . GLN A 112 ? 0.6481 0.9128 0.7312 0.2013  0.0860  0.0422  100 GLN A N   
769  C CA  . GLN A 112 ? 0.6540 0.9602 0.7688 0.1912  0.0946  0.0361  100 GLN A CA  
770  C C   . GLN A 112 ? 0.6412 0.9681 0.7682 0.1542  0.0822  0.0241  100 GLN A C   
771  O O   . GLN A 112 ? 0.6318 0.9822 0.7637 0.1450  0.0630  0.0218  100 GLN A O   
772  C CB  . GLN A 112 ? 0.6659 1.0395 0.8178 0.2185  0.0959  0.0445  100 GLN A CB  
773  C CG  . GLN A 112 ? 0.7214 1.0735 0.8686 0.2473  0.1204  0.0513  100 GLN A CG  
774  C CD  . GLN A 112 ? 0.7743 1.1968 0.9626 0.2757  0.1244  0.0598  100 GLN A CD  
775  O OE1 . GLN A 112 ? 0.8141 1.2770 1.0161 0.2968  0.1098  0.0698  100 GLN A OE1 
776  N NE2 . GLN A 112 ? 0.7991 1.2397 1.0075 0.2777  0.1447  0.0565  100 GLN A NE2 
777  N N   . PHE A 113 ? 0.6470 0.9587 0.7742 0.1335  0.0948  0.0166  101 PHE A N   
778  C CA  . PHE A 113 ? 0.6352 0.9539 0.7695 0.0986  0.0886  0.0060  101 PHE A CA  
779  C C   . PHE A 113 ? 0.6346 1.0240 0.8131 0.0908  0.0901  0.0028  101 PHE A C   
780  O O   . PHE A 113 ? 0.6405 1.0482 0.8355 0.0978  0.1075  0.0046  101 PHE A O   
781  C CB  . PHE A 113 ? 0.6383 0.9020 0.7469 0.0823  0.1027  0.0021  101 PHE A CB  
782  C CG  . PHE A 113 ? 0.6462 0.9059 0.7563 0.0486  0.0980  -0.0065 101 PHE A CG  
783  C CD1 . PHE A 113 ? 0.6440 0.9391 0.7806 0.0307  0.1065  -0.0109 101 PHE A CD1 
784  C CD2 . PHE A 113 ? 0.6579 0.8771 0.7428 0.0350  0.0866  -0.0097 101 PHE A CD2 
785  C CE1 . PHE A 113 ? 0.6462 0.9306 0.7811 -0.0006 0.1041  -0.0181 101 PHE A CE1 
786  C CE2 . PHE A 113 ? 0.6695 0.8796 0.7537 0.0061  0.0839  -0.0168 101 PHE A CE2 
787  C CZ  . PHE A 113 ? 0.6497 0.8898 0.7576 -0.0118 0.0929  -0.0209 101 PHE A CZ  
788  N N   . GLU A 114 ? 0.6300 1.0613 0.8279 0.0752  0.0724  -0.0029 102 GLU A N   
789  C CA  . GLU A 114 ? 0.6317 1.1340 0.8737 0.0607  0.0721  -0.0083 102 GLU A CA  
790  C C   . GLU A 114 ? 0.6192 1.1042 0.8590 0.0198  0.0744  -0.0202 102 GLU A C   
791  O O   . GLU A 114 ? 0.6196 1.0765 0.8399 0.0023  0.0615  -0.0268 102 GLU A O   
792  C CB  . GLU A 114 ? 0.6316 1.1969 0.8969 0.0692  0.0505  -0.0077 102 GLU A CB  
793  C CG  . GLU A 114 ? 0.6658 1.2993 0.9685 0.0969  0.0539  0.0010  102 GLU A CG  
794  C CD  . GLU A 114 ? 0.6958 1.3831 1.0405 0.0786  0.0663  -0.0048 102 GLU A CD  
795  O OE1 . GLU A 114 ? 0.7137 1.4433 1.0864 0.1029  0.0785  0.0030  102 GLU A OE1 
796  O OE2 . GLU A 114 ? 0.7239 1.4096 1.0733 0.0401  0.0657  -0.0172 102 GLU A OE2 
797  N N   . PRO A 115 ? 0.6157 1.1132 0.8729 0.0056  0.0925  -0.0224 103 PRO A N   
798  C CA  . PRO A 115 ? 0.6154 1.0909 0.8681 -0.0321 0.0980  -0.0315 103 PRO A CA  
799  C C   . PRO A 115 ? 0.6090 1.1009 0.8691 -0.0598 0.0797  -0.0430 103 PRO A C   
800  O O   . PRO A 115 ? 0.6170 1.0564 0.8496 -0.0795 0.0777  -0.0482 103 PRO A O   
801  C CB  . PRO A 115 ? 0.6201 1.1397 0.9063 -0.0402 0.1173  -0.0314 103 PRO A CB  
802  C CG  . PRO A 115 ? 0.6246 1.1535 0.9138 -0.0036 0.1290  -0.0211 103 PRO A CG  
803  C CD  . PRO A 115 ? 0.6247 1.1527 0.9037 0.0257  0.1114  -0.0156 103 PRO A CD  
804  N N   . SER A 116 ? 0.5903 1.1534 0.8850 -0.0595 0.0661  -0.0469 104 SER A N   
805  C CA  . SER A 116 ? 0.5867 1.1675 0.8853 -0.0844 0.0470  -0.0596 104 SER A CA  
806  C C   . SER A 116 ? 0.5800 1.1146 0.8405 -0.0761 0.0303  -0.0606 104 SER A C   
807  O O   . SER A 116 ? 0.5775 1.1096 0.8317 -0.0991 0.0178  -0.0727 104 SER A O   
808  C CB  . SER A 116 ? 0.5829 1.2574 0.9265 -0.0826 0.0340  -0.0629 104 SER A CB  
809  O OG  . SER A 116 ? 0.5744 1.2728 0.9206 -0.0416 0.0273  -0.0500 104 SER A OG  
810  N N   . ILE A 117 ? 0.5737 1.0721 0.8086 -0.0446 0.0312  -0.0488 105 ILE A N   
811  C CA  . ILE A 117 ? 0.5730 1.0289 0.7729 -0.0372 0.0178  -0.0488 105 ILE A CA  
812  C C   . ILE A 117 ? 0.5749 0.9716 0.7483 -0.0640 0.0201  -0.0579 105 ILE A C   
813  O O   . ILE A 117 ? 0.5801 0.9615 0.7357 -0.0706 0.0070  -0.0648 105 ILE A O   
814  C CB  . ILE A 117 ? 0.5732 0.9917 0.7480 -0.0022 0.0218  -0.0345 105 ILE A CB  
815  C CG1 . ILE A 117 ? 0.5868 0.9819 0.7337 0.0068  0.0063  -0.0339 105 ILE A CG1 
816  C CG2 . ILE A 117 ? 0.5566 0.9129 0.7083 -0.0032 0.0399  -0.0304 105 ILE A CG2 
817  C CD1 . ILE A 117 ? 0.5975 1.0525 0.7595 0.0087  -0.0141 -0.0378 105 ILE A CD1 
818  N N   . LEU A 118 ? 0.5684 0.9330 0.7381 -0.0776 0.0373  -0.0573 106 LEU A N   
819  C CA  . LEU A 118 ? 0.5772 0.8843 0.7223 -0.1005 0.0418  -0.0633 106 LEU A CA  
820  C C   . LEU A 118 ? 0.5926 0.9132 0.7444 -0.1290 0.0321  -0.0786 106 LEU A C   
821  O O   . LEU A 118 ? 0.6117 0.8860 0.7375 -0.1385 0.0286  -0.0843 106 LEU A O   
822  C CB  . LEU A 118 ? 0.5803 0.8618 0.7240 -0.1120 0.0620  -0.0593 106 LEU A CB  
823  C CG  . LEU A 118 ? 0.5726 0.8123 0.6922 -0.0901 0.0724  -0.0469 106 LEU A CG  
824  C CD1 . LEU A 118 ? 0.5678 0.7958 0.6885 -0.1001 0.0925  -0.0428 106 LEU A CD1 
825  C CD2 . LEU A 118 ? 0.5626 0.7432 0.6465 -0.0861 0.0667  -0.0452 106 LEU A CD2 
826  N N   . ASN A 119 ? 0.5920 0.9766 0.7783 -0.1425 0.0279  -0.0860 107 ASN A N   
827  C CA  . ASN A 119 ? 0.6083 1.0143 0.8030 -0.1723 0.0171  -0.1033 107 ASN A CA  
828  C C   . ASN A 119 ? 0.6021 0.9945 0.7729 -0.1685 -0.0006 -0.1107 107 ASN A C   
829  O O   . ASN A 119 ? 0.6280 1.0038 0.7890 -0.1947 -0.0044 -0.1258 107 ASN A O   
830  C CB  . ASN A 119 ? 0.6086 1.1023 0.8472 -0.1796 0.0098  -0.1085 107 ASN A CB  
831  C CG  . ASN A 119 ? 0.6372 1.1536 0.9048 -0.1960 0.0277  -0.1073 107 ASN A CG  
832  O OD1 . ASN A 119 ? 0.6926 1.1549 0.9439 -0.2050 0.0459  -0.1033 107 ASN A OD1 
833  N ND2 . ASN A 119 ? 0.6448 1.2439 0.9561 -0.1994 0.0235  -0.1097 107 ASN A ND2 
834  N N   . GLU A 120 ? 0.5697 0.9726 0.7320 -0.1368 -0.0108 -0.1009 108 GLU A N   
835  C CA  . GLU A 120 ? 0.5674 0.9665 0.7078 -0.1313 -0.0277 -0.1068 108 GLU A CA  
836  C C   . GLU A 120 ? 0.5429 0.8669 0.6434 -0.1228 -0.0232 -0.1036 108 GLU A C   
837  O O   . GLU A 120 ? 0.5293 0.8450 0.6085 -0.1128 -0.0344 -0.1054 108 GLU A O   
838  C CB  . GLU A 120 ? 0.5644 1.0161 0.7152 -0.1014 -0.0412 -0.0967 108 GLU A CB  
839  C CG  . GLU A 120 ? 0.6152 1.1542 0.8067 -0.1087 -0.0515 -0.1015 108 GLU A CG  
840  C CD  . GLU A 120 ? 0.6645 1.2468 0.8777 -0.0742 -0.0506 -0.0837 108 GLU A CD  
841  O OE1 . GLU A 120 ? 0.7030 1.2458 0.8937 -0.0448 -0.0452 -0.0692 108 GLU A OE1 
842  O OE2 . GLU A 120 ? 0.6872 1.3416 0.9405 -0.0763 -0.0538 -0.0842 108 GLU A OE2 
843  N N   . PHE A 121 ? 0.5158 0.7886 0.6063 -0.1263 -0.0071 -0.0983 109 PHE A N   
844  C CA  . PHE A 121 ? 0.5050 0.7135 0.5620 -0.1162 -0.0030 -0.0935 109 PHE A CA  
845  C C   . PHE A 121 ? 0.5083 0.6648 0.5529 -0.1366 0.0092  -0.0984 109 PHE A C   
846  O O   . PHE A 121 ? 0.5283 0.6901 0.5878 -0.1551 0.0187  -0.1008 109 PHE A O   
847  C CB  . PHE A 121 ? 0.4789 0.6740 0.5287 -0.0870 0.0016  -0.0765 109 PHE A CB  
848  C CG  . PHE A 121 ? 0.4684 0.6999 0.5217 -0.0640 -0.0094 -0.0703 109 PHE A CG  
849  C CD1 . PHE A 121 ? 0.4789 0.6953 0.5092 -0.0521 -0.0185 -0.0697 109 PHE A CD1 
850  C CD2 . PHE A 121 ? 0.4685 0.7522 0.5487 -0.0539 -0.0102 -0.0648 109 PHE A CD2 
851  C CE1 . PHE A 121 ? 0.4944 0.7445 0.5253 -0.0305 -0.0288 -0.0626 109 PHE A CE1 
852  C CE2 . PHE A 121 ? 0.4676 0.7854 0.5504 -0.0302 -0.0206 -0.0574 109 PHE A CE2 
853  C CZ  . PHE A 121 ? 0.4791 0.7783 0.5356 -0.0187 -0.0301 -0.0558 109 PHE A CZ  
854  N N   . ASP A 122 ? 0.5068 0.6144 0.5240 -0.1329 0.0095  -0.0995 110 ASP A N   
855  C CA  . ASP A 122 ? 0.5215 0.5764 0.5237 -0.1483 0.0205  -0.1030 110 ASP A CA  
856  C C   . ASP A 122 ? 0.5199 0.5331 0.5075 -0.1318 0.0298  -0.0875 110 ASP A C   
857  O O   . ASP A 122 ? 0.5288 0.5061 0.5092 -0.1415 0.0413  -0.0844 110 ASP A O   
858  C CB  . ASP A 122 ? 0.5449 0.5738 0.5261 -0.1536 0.0152  -0.1155 110 ASP A CB  
859  C CG  . ASP A 122 ? 0.5441 0.6143 0.5338 -0.1693 0.0034  -0.1322 110 ASP A CG  
860  O OD1 . ASP A 122 ? 0.5662 0.6573 0.5731 -0.1937 0.0055  -0.1417 110 ASP A OD1 
861  O OD2 . ASP A 122 ? 0.5601 0.6454 0.5398 -0.1579 -0.0080 -0.1354 110 ASP A OD2 
862  N N   . VAL A 123 ? 0.4856 0.5023 0.4667 -0.1079 0.0246  -0.0780 111 VAL A N   
863  C CA  . VAL A 123 ? 0.4812 0.4642 0.4482 -0.0930 0.0305  -0.0650 111 VAL A CA  
864  C C   . VAL A 123 ? 0.4618 0.4682 0.4361 -0.0759 0.0300  -0.0549 111 VAL A C   
865  O O   . VAL A 123 ? 0.4552 0.4900 0.4346 -0.0647 0.0218  -0.0553 111 VAL A O   
866  C CB  . VAL A 123 ? 0.4823 0.4361 0.4295 -0.0819 0.0266  -0.0648 111 VAL A CB  
867  C CG1 . VAL A 123 ? 0.4605 0.3870 0.3965 -0.0683 0.0314  -0.0515 111 VAL A CG1 
868  C CG2 . VAL A 123 ? 0.4934 0.4205 0.4310 -0.0973 0.0286  -0.0769 111 VAL A CG2 
869  N N   . VAL A 124 ? 0.4571 0.4502 0.4299 -0.0742 0.0395  -0.0461 112 VAL A N   
870  C CA  . VAL A 124 ? 0.4419 0.4436 0.4149 -0.0580 0.0422  -0.0369 112 VAL A CA  
871  C C   . VAL A 124 ? 0.4488 0.4147 0.4002 -0.0471 0.0422  -0.0296 112 VAL A C   
872  O O   . VAL A 124 ? 0.4618 0.3975 0.4011 -0.0528 0.0462  -0.0266 112 VAL A O   
873  C CB  . VAL A 124 ? 0.4620 0.4745 0.4452 -0.0638 0.0540  -0.0333 112 VAL A CB  
874  C CG1 . VAL A 124 ? 0.4391 0.4529 0.4172 -0.0457 0.0587  -0.0251 112 VAL A CG1 
875  C CG2 . VAL A 124 ? 0.4290 0.4856 0.4398 -0.0771 0.0547  -0.0410 112 VAL A CG2 
876  N N   . VAL A 125 ? 0.4401 0.4104 0.3867 -0.0314 0.0378  -0.0261 113 VAL A N   
877  C CA  . VAL A 125 ? 0.4256 0.3686 0.3550 -0.0230 0.0379  -0.0199 113 VAL A CA  
878  C C   . VAL A 125 ? 0.4210 0.3637 0.3471 -0.0160 0.0450  -0.0144 113 VAL A C   
879  O O   . VAL A 125 ? 0.4283 0.3891 0.3607 -0.0057 0.0461  -0.0134 113 VAL A O   
880  C CB  . VAL A 125 ? 0.4343 0.3766 0.3578 -0.0134 0.0308  -0.0201 113 VAL A CB  
881  C CG1 . VAL A 125 ? 0.4046 0.3225 0.3133 -0.0074 0.0319  -0.0141 113 VAL A CG1 
882  C CG2 . VAL A 125 ? 0.3854 0.3268 0.3095 -0.0205 0.0255  -0.0275 113 VAL A CG2 
883  N N   . ASP A 126 ? 0.4292 0.3510 0.3439 -0.0208 0.0503  -0.0109 114 ASP A N   
884  C CA  . ASP A 126 ? 0.4372 0.3535 0.3434 -0.0165 0.0587  -0.0074 114 ASP A CA  
885  C C   . ASP A 126 ? 0.4456 0.3418 0.3345 -0.0093 0.0564  -0.0047 114 ASP A C   
886  O O   . ASP A 126 ? 0.4534 0.3308 0.3291 -0.0139 0.0533  -0.0025 114 ASP A O   
887  C CB  . ASP A 126 ? 0.4502 0.3542 0.3487 -0.0271 0.0655  -0.0050 114 ASP A CB  
888  C CG  . ASP A 126 ? 0.4868 0.3747 0.3658 -0.0241 0.0722  -0.0018 114 ASP A CG  
889  O OD1 . ASP A 126 ? 0.4683 0.3610 0.3461 -0.0148 0.0773  -0.0031 114 ASP A OD1 
890  O OD2 . ASP A 126 ? 0.4721 0.3410 0.3347 -0.0305 0.0724  0.0019  114 ASP A OD2 
891  N N   . ALA A 127 ? 0.4474 0.3485 0.3368 0.0018  0.0579  -0.0046 115 ALA A N   
892  C CA  . ALA A 127 ? 0.4501 0.3305 0.3230 0.0067  0.0583  -0.0031 115 ALA A CA  
893  C C   . ALA A 127 ? 0.4625 0.3366 0.3276 0.0148  0.0694  -0.0032 115 ALA A C   
894  O O   . ALA A 127 ? 0.4800 0.3416 0.3364 0.0233  0.0725  -0.0023 115 ALA A O   
895  C CB  . ALA A 127 ? 0.4343 0.3170 0.3098 0.0129  0.0519  -0.0022 115 ALA A CB  
896  N N   . ILE A 128 ? 0.4752 0.3540 0.3410 0.0118  0.0772  -0.0041 116 ILE A N   
897  C CA  . ILE A 128 ? 0.4938 0.3674 0.3527 0.0209  0.0903  -0.0049 116 ILE A CA  
898  C C   . ILE A 128 ? 0.5209 0.3606 0.3507 0.0167  0.0949  -0.0075 116 ILE A C   
899  O O   . ILE A 128 ? 0.5371 0.3582 0.3550 0.0244  0.0998  -0.0087 116 ILE A O   
900  C CB  . ILE A 128 ? 0.4946 0.3879 0.3650 0.0187  0.0994  -0.0054 116 ILE A CB  
901  C CG1 . ILE A 128 ? 0.4806 0.4112 0.3812 0.0192  0.0943  -0.0048 116 ILE A CG1 
902  C CG2 . ILE A 128 ? 0.5068 0.3925 0.3681 0.0305  0.1153  -0.0067 116 ILE A CG2 
903  C CD1 . ILE A 128 ? 0.4705 0.4255 0.3872 0.0124  0.1038  -0.0056 116 ILE A CD1 
904  N N   . PHE A 129 ? 0.5355 0.3660 0.3520 0.0040  0.0930  -0.0084 117 PHE A N   
905  C CA  . PHE A 129 ? 0.5803 0.3830 0.3675 -0.0032 0.0942  -0.0119 117 PHE A CA  
906  C C   . PHE A 129 ? 0.5868 0.3876 0.3687 -0.0152 0.0803  -0.0098 117 PHE A C   
907  O O   . PHE A 129 ? 0.5975 0.4102 0.3883 -0.0195 0.0750  -0.0054 117 PHE A O   
908  C CB  . PHE A 129 ? 0.6056 0.3998 0.3747 -0.0058 0.1062  -0.0146 117 PHE A CB  
909  C CG  . PHE A 129 ? 0.6430 0.4432 0.4193 0.0073  0.1223  -0.0162 117 PHE A CG  
910  C CD1 . PHE A 129 ? 0.6611 0.4454 0.4312 0.0197  0.1307  -0.0194 117 PHE A CD1 
911  C CD2 . PHE A 129 ? 0.6284 0.4491 0.4170 0.0078  0.1309  -0.0142 117 PHE A CD2 
912  C CE1 . PHE A 129 ? 0.6717 0.4628 0.4494 0.0356  0.1463  -0.0196 117 PHE A CE1 
913  C CE2 . PHE A 129 ? 0.6544 0.4867 0.4533 0.0214  0.1465  -0.0153 117 PHE A CE2 
914  C CZ  . PHE A 129 ? 0.6743 0.4927 0.4684 0.0369  0.1538  -0.0177 117 PHE A CZ  
915  N N   . GLY A 130 ? 0.5994 0.3598 0.4686 0.0017  0.0265  0.0164  118 GLY A N   
916  C CA  . GLY A 130 ? 0.5990 0.3739 0.4711 -0.0120 0.0291  0.0153  118 GLY A CA  
917  C C   . GLY A 130 ? 0.6103 0.3830 0.4795 -0.0170 0.0316  0.0078  118 GLY A C   
918  O O   . GLY A 130 ? 0.5932 0.3701 0.4660 -0.0086 0.0334  0.0020  118 GLY A O   
919  N N   . THR A 131 ? 0.6268 0.3952 0.4885 -0.0315 0.0317  0.0074  119 THR A N   
920  C CA  . THR A 131 ? 0.6579 0.4269 0.5150 -0.0387 0.0325  -0.0006 119 THR A CA  
921  C C   . THR A 131 ? 0.6963 0.4301 0.5378 -0.0372 0.0323  -0.0073 119 THR A C   
922  O O   . THR A 131 ? 0.7358 0.4663 0.5704 -0.0421 0.0328  -0.0165 119 THR A O   
923  C CB  . THR A 131 ? 0.6592 0.4440 0.5166 -0.0559 0.0321  0.0002  119 THR A CB  
924  O OG1 . THR A 131 ? 0.6891 0.4519 0.5357 -0.0675 0.0317  0.0042  119 THR A OG1 
925  C CG2 . THR A 131 ? 0.6267 0.4440 0.4986 -0.0526 0.0331  0.0059  119 THR A CG2 
926  N N   . GLY A 132 ? 0.7408 0.4478 0.5752 -0.0285 0.0313  -0.0030 120 GLY A N   
927  C CA  . GLY A 132 ? 0.7936 0.4603 0.6112 -0.0224 0.0315  -0.0087 120 GLY A CA  
928  C C   . GLY A 132 ? 0.8009 0.4706 0.6236 -0.0006 0.0332  -0.0148 120 GLY A C   
929  O O   . GLY A 132 ? 0.8441 0.4808 0.6542 0.0113  0.0337  -0.0189 120 GLY A O   
930  N N   . LEU A 133 ? 0.7717 0.4799 0.6121 0.0046  0.0349  -0.0154 121 LEU A N   
931  C CA  . LEU A 133 ? 0.7610 0.4825 0.6096 0.0223  0.0382  -0.0208 121 LEU A CA  
932  C C   . LEU A 133 ? 0.7866 0.4954 0.6222 0.0228  0.0418  -0.0340 121 LEU A C   
933  O O   . LEU A 133 ? 0.7767 0.4944 0.6079 0.0091  0.0423  -0.0384 121 LEU A O   
934  C CB  . LEU A 133 ? 0.7215 0.4842 0.5891 0.0217  0.0403  -0.0174 121 LEU A CB  
935  C CG  . LEU A 133 ? 0.7222 0.5059 0.5998 0.0354  0.0454  -0.0223 121 LEU A CG  
936  C CD1 . LEU A 133 ? 0.6980 0.4817 0.5831 0.0526  0.0443  -0.0208 121 LEU A CD1 
937  C CD2 . LEU A 133 ? 0.7189 0.5362 0.6107 0.0290  0.0483  -0.0177 121 LEU A CD2 
938  N N   . ARG A 134 ? 0.8168 0.5070 0.6461 0.0403  0.0442  -0.0407 122 ARG A N   
939  C CA  . ARG A 134 ? 0.8462 0.5230 0.6612 0.0443  0.0487  -0.0556 122 ARG A CA  
940  C C   . ARG A 134 ? 0.8159 0.5160 0.6426 0.0668  0.0544  -0.0598 122 ARG A C   
941  O O   . ARG A 134 ? 0.8244 0.5155 0.6550 0.0860  0.0541  -0.0577 122 ARG A O   
942  C CB  . ARG A 134 ? 0.9148 0.5356 0.7051 0.0444  0.0472  -0.0622 122 ARG A CB  
943  C CG  . ARG A 134 ? 0.9771 0.5752 0.7548 0.0183  0.0428  -0.0592 122 ARG A CG  
944  C CD  . ARG A 134 ? 1.0297 0.6476 0.8035 -0.0022 0.0428  -0.0683 122 ARG A CD  
945  N NE  . ARG A 134 ? 1.0777 0.6863 0.8458 -0.0277 0.0385  -0.0641 122 ARG A NE  
946  C CZ  . ARG A 134 ? 1.0553 0.6928 0.8387 -0.0381 0.0359  -0.0515 122 ARG A CZ  
947  N NH1 . ARG A 134 ? 1.0279 0.7016 0.8320 -0.0267 0.0364  -0.0420 122 ARG A NH1 
948  N NH2 . ARG A 134 ? 1.0584 0.6888 0.8358 -0.0612 0.0333  -0.0493 122 ARG A NH2 
949  N N   . GLY A 135 ? 0.7629 0.4958 0.5952 0.0645  0.0597  -0.0644 123 GLY A N   
950  C CA  . GLY A 135 ? 0.7498 0.5061 0.5905 0.0826  0.0672  -0.0703 123 GLY A CA  
951  C C   . GLY A 135 ? 0.7002 0.4981 0.5674 0.0868  0.0685  -0.0596 123 GLY A C   
952  O O   . GLY A 135 ? 0.6580 0.4616 0.5361 0.0782  0.0628  -0.0480 123 GLY A O   
953  N N   . GLU A 136 ? 0.6932 0.5214 0.5699 0.0988  0.0769  -0.0647 124 GLU A N   
954  C CA  . GLU A 136 ? 0.6719 0.5447 0.5747 0.1009  0.0800  -0.0569 124 GLU A CA  
955  C C   . GLU A 136 ? 0.6706 0.5440 0.5881 0.1114  0.0729  -0.0501 124 GLU A C   
956  O O   . GLU A 136 ? 0.6779 0.5270 0.5879 0.1288  0.0702  -0.0541 124 GLU A O   
957  C CB  . GLU A 136 ? 0.6890 0.5934 0.5979 0.1144  0.0916  -0.0657 124 GLU A CB  
958  C CG  . GLU A 136 ? 0.7198 0.6274 0.6109 0.1061  0.0995  -0.0728 124 GLU A CG  
959  C CD  . GLU A 136 ? 0.7663 0.6953 0.6614 0.0851  0.1010  -0.0615 124 GLU A CD  
960  O OE1 . GLU A 136 ? 0.8247 0.7347 0.7044 0.0713  0.0960  -0.0590 124 GLU A OE1 
961  O OE2 . GLU A 136 ? 0.7967 0.7616 0.7100 0.0823  0.1072  -0.0550 124 GLU A OE2 
962  N N   . ILE A 137 ? 0.6471 0.5451 0.5825 0.1008  0.0695  -0.0399 125 ILE A N   
963  C CA  . ILE A 137 ? 0.6509 0.5606 0.6017 0.1104  0.0625  -0.0339 125 ILE A CA  
964  C C   . ILE A 137 ? 0.6666 0.6217 0.6397 0.1253  0.0680  -0.0376 125 ILE A C   
965  O O   . ILE A 137 ? 0.6481 0.6396 0.6353 0.1148  0.0753  -0.0375 125 ILE A O   
966  C CB  . ILE A 137 ? 0.6180 0.5366 0.5774 0.0921  0.0565  -0.0239 125 ILE A CB  
967  C CG1 . ILE A 137 ? 0.6189 0.4986 0.5585 0.0792  0.0516  -0.0202 125 ILE A CG1 
968  C CG2 . ILE A 137 ? 0.6022 0.5408 0.5775 0.1008  0.0487  -0.0187 125 ILE A CG2 
969  C CD1 . ILE A 137 ? 0.5769 0.4639 0.5229 0.0628  0.0466  -0.0115 125 ILE A CD1 
970  N N   . THR A 138 ? 0.7066 0.6601 0.6825 0.1500  0.0650  -0.0403 126 THR A N   
971  C CA  . THR A 138 ? 0.7241 0.7283 0.7248 0.1674  0.0692  -0.0439 126 THR A CA  
972  C C   . THR A 138 ? 0.7339 0.7491 0.7466 0.1842  0.0579  -0.0376 126 THR A C   
973  O O   . THR A 138 ? 0.7544 0.7360 0.7541 0.1811  0.0476  -0.0297 126 THR A O   
974  C CB  . THR A 138 ? 0.7555 0.7567 0.7490 0.1910  0.0787  -0.0563 126 THR A CB  
975  O OG1 . THR A 138 ? 0.8180 0.7590 0.7842 0.2044  0.0741  -0.0593 126 THR A OG1 
976  C CG2 . THR A 138 ? 0.7517 0.7652 0.7398 0.1776  0.0916  -0.0632 126 THR A CG2 
977  N N   . GLY A 139 ? 0.7331 0.7995 0.7705 0.2021  0.0601  -0.0407 127 GLY A N   
978  C CA  . GLY A 139 ? 0.7430 0.8254 0.7916 0.2249  0.0492  -0.0356 127 GLY A CA  
979  C C   . GLY A 139 ? 0.7139 0.8136 0.7724 0.2053  0.0382  -0.0259 127 GLY A C   
980  O O   . GLY A 139 ? 0.6854 0.8080 0.7547 0.1776  0.0413  -0.0255 127 GLY A O   
981  N N   . GLU A 140 ? 0.7268 0.8095 0.7775 0.2197  0.0253  -0.0179 128 GLU A N   
982  C CA  . GLU A 140 ? 0.7061 0.8105 0.7653 0.2059  0.0137  -0.0099 128 GLU A CA  
983  C C   . GLU A 140 ? 0.6728 0.7417 0.7148 0.1748  0.0134  -0.0062 128 GLU A C   
984  O O   . GLU A 140 ? 0.6657 0.7591 0.7178 0.1550  0.0085  -0.0040 128 GLU A O   
985  C CB  . GLU A 140 ? 0.7396 0.8343 0.7908 0.2321  0.0000  -0.0008 128 GLU A CB  
986  C CG  . GLU A 140 ? 0.7956 0.9292 0.8652 0.2683  -0.0008 -0.0038 128 GLU A CG  
987  C CD  . GLU A 140 ? 0.8733 0.9947 0.9322 0.2979  -0.0153 0.0074  128 GLU A CD  
988  O OE1 . GLU A 140 ? 0.9081 0.9980 0.9469 0.2866  -0.0251 0.0180  128 GLU A OE1 
989  O OE2 . GLU A 140 ? 0.8862 1.0306 0.9560 0.3335  -0.0165 0.0062  128 GLU A OE2 
990  N N   . TYR A 141 ? 0.6629 0.6763 0.6794 0.1699  0.0185  -0.0066 129 TYR A N   
991  C CA  . TYR A 141 ? 0.6279 0.6146 0.6309 0.1413  0.0191  -0.0037 129 TYR A CA  
992  C C   . TYR A 141 ? 0.5811 0.6022 0.6018 0.1190  0.0269  -0.0084 129 TYR A C   
993  O O   . TYR A 141 ? 0.5536 0.5785 0.5757 0.0983  0.0243  -0.0056 129 TYR A O   
994  C CB  . TYR A 141 ? 0.6382 0.5679 0.6139 0.1379  0.0236  -0.0046 129 TYR A CB  
995  C CG  . TYR A 141 ? 0.6822 0.5650 0.6342 0.1507  0.0166  0.0019  129 TYR A CG  
996  C CD1 . TYR A 141 ? 0.7090 0.5743 0.6489 0.1397  0.0087  0.0118  129 TYR A CD1 
997  C CD2 . TYR A 141 ? 0.7402 0.5923 0.6790 0.1731  0.0189  -0.0015 129 TYR A CD2 
998  C CE1 . TYR A 141 ? 0.7308 0.5505 0.6463 0.1491  0.0034  0.0199  129 TYR A CE1 
999  C CE2 . TYR A 141 ? 0.7794 0.5802 0.6929 0.1835  0.0132  0.0059  129 TYR A CE2 
1000 C CZ  . TYR A 141 ? 0.8051 0.5908 0.7072 0.1699  0.0056  0.0176  129 TYR A CZ  
1001 O OH  . TYR A 141 ? 0.9139 0.6480 0.7889 0.1773  0.0010  0.0270  129 TYR A OH  
1002 N N   . ALA A 142 ? 0.5673 0.6105 0.5989 0.1239  0.0372  -0.0154 130 ALA A N   
1003 C CA  . ALA A 142 ? 0.5411 0.6147 0.5870 0.1035  0.0463  -0.0182 130 ALA A CA  
1004 C C   . ALA A 142 ? 0.5285 0.6508 0.5994 0.0927  0.0420  -0.0172 130 ALA A C   
1005 O O   . ALA A 142 ? 0.5082 0.6339 0.5817 0.0683  0.0442  -0.0160 130 ALA A O   
1006 C CB  . ALA A 142 ? 0.5321 0.6225 0.5828 0.1128  0.0588  -0.0254 130 ALA A CB  
1007 N N   . GLU A 143 ? 0.5423 0.7015 0.6306 0.1112  0.0356  -0.0182 131 GLU A N   
1008 C CA  . GLU A 143 ? 0.5330 0.7460 0.6469 0.1004  0.0298  -0.0188 131 GLU A CA  
1009 C C   . GLU A 143 ? 0.5169 0.7114 0.6205 0.0834  0.0193  -0.0146 131 GLU A C   
1010 O O   . GLU A 143 ? 0.5030 0.7212 0.6182 0.0595  0.0190  -0.0169 131 GLU A O   
1011 C CB  . GLU A 143 ? 0.5445 0.8033 0.6782 0.1274  0.0223  -0.0199 131 GLU A CB  
1012 C CG  . GLU A 143 ? 0.5929 0.8827 0.7417 0.1463  0.0335  -0.0260 131 GLU A CG  
1013 C CD  . GLU A 143 ? 0.6614 0.9922 0.8277 0.1804  0.0257  -0.0265 131 GLU A CD  
1014 O OE1 . GLU A 143 ? 0.6956 1.0541 0.8723 0.1814  0.0116  -0.0226 131 GLU A OE1 
1015 O OE2 . GLU A 143 ? 0.6850 1.0209 0.8536 0.2074  0.0334  -0.0312 131 GLU A OE2 
1016 N N   . ILE A 144 ? 0.5127 0.6633 0.5928 0.0945  0.0115  -0.0090 132 ILE A N   
1017 C CA  . ILE A 144 ? 0.4917 0.6241 0.5590 0.0800  0.0027  -0.0052 132 ILE A CA  
1018 C C   . ILE A 144 ? 0.4716 0.5794 0.5304 0.0529  0.0110  -0.0070 132 ILE A C   
1019 O O   . ILE A 144 ? 0.4492 0.5658 0.5108 0.0329  0.0083  -0.0091 132 ILE A O   
1020 C CB  . ILE A 144 ? 0.5235 0.6127 0.5656 0.0968  -0.0047 0.0024  132 ILE A CB  
1021 C CG1 . ILE A 144 ? 0.5455 0.6568 0.5943 0.1265  -0.0137 0.0059  132 ILE A CG1 
1022 C CG2 . ILE A 144 ? 0.5024 0.5714 0.5282 0.0812  -0.0113 0.0061  132 ILE A CG2 
1023 C CD1 . ILE A 144 ? 0.5792 0.6551 0.6031 0.1412  -0.0242 0.0163  132 ILE A CD1 
1024 N N   . ILE A 145 ? 0.4429 0.5194 0.4899 0.0532  0.0207  -0.0066 133 ILE A N   
1025 C CA  . ILE A 145 ? 0.4353 0.4878 0.4726 0.0325  0.0280  -0.0065 133 ILE A CA  
1026 C C   . ILE A 145 ? 0.4187 0.5019 0.4737 0.0137  0.0348  -0.0101 133 ILE A C   
1027 O O   . ILE A 145 ? 0.4255 0.4975 0.4762 -0.0053 0.0359  -0.0103 133 ILE A O   
1028 C CB  . ILE A 145 ? 0.4356 0.4539 0.4565 0.0373  0.0359  -0.0054 133 ILE A CB  
1029 C CG1 . ILE A 145 ? 0.4493 0.4299 0.4494 0.0466  0.0293  -0.0015 133 ILE A CG1 
1030 C CG2 . ILE A 145 ? 0.4204 0.4275 0.4367 0.0180  0.0449  -0.0047 133 ILE A CG2 
1031 C CD1 . ILE A 145 ? 0.4476 0.3979 0.4321 0.0528  0.0345  -0.0023 133 ILE A CD1 
1032 N N   . ASN A 146 ? 0.4205 0.5420 0.4947 0.0190  0.0399  -0.0132 134 ASN A N   
1033 C CA  . ASN A 146 ? 0.4190 0.5743 0.5116 -0.0012 0.0474  -0.0160 134 ASN A CA  
1034 C C   . ASN A 146 ? 0.4187 0.5997 0.5238 -0.0170 0.0385  -0.0195 134 ASN A C   
1035 O O   . ASN A 146 ? 0.4238 0.6006 0.5293 -0.0421 0.0427  -0.0211 134 ASN A O   
1036 C CB  . ASN A 146 ? 0.4132 0.6105 0.5248 0.0090  0.0558  -0.0189 134 ASN A CB  
1037 C CG  . ASN A 146 ? 0.4421 0.6137 0.5383 0.0181  0.0668  -0.0175 134 ASN A CG  
1038 O OD1 . ASN A 146 ? 0.4866 0.6165 0.5619 0.0096  0.0699  -0.0137 134 ASN A OD1 
1039 N ND2 . ASN A 146 ? 0.4447 0.6427 0.5505 0.0365  0.0722  -0.0213 134 ASN A ND2 
1040 N N   . LEU A 147 ? 0.4171 0.6205 0.5291 -0.0023 0.0259  -0.0206 135 LEU A N   
1041 C CA  . LEU A 147 ? 0.4266 0.6526 0.5455 -0.0148 0.0145  -0.0246 135 LEU A CA  
1042 C C   . LEU A 147 ? 0.4324 0.6128 0.5281 -0.0305 0.0122  -0.0245 135 LEU A C   
1043 O O   . LEU A 147 ? 0.4412 0.6275 0.5399 -0.0538 0.0118  -0.0302 135 LEU A O   
1044 C CB  . LEU A 147 ? 0.4383 0.6928 0.5636 0.0094  0.0003  -0.0232 135 LEU A CB  
1045 C CG  . LEU A 147 ? 0.4610 0.7753 0.6159 0.0241  0.0021  -0.0256 135 LEU A CG  
1046 C CD1 . LEU A 147 ? 0.4921 0.8183 0.6471 0.0597  -0.0084 -0.0210 135 LEU A CD1 
1047 C CD2 . LEU A 147 ? 0.4511 0.8279 0.6351 0.0006  0.0012  -0.0333 135 LEU A CD2 
1048 N N   . VAL A 148 ? 0.4333 0.5681 0.5057 -0.0185 0.0116  -0.0190 136 VAL A N   
1049 C CA  . VAL A 148 ? 0.4419 0.5372 0.4934 -0.0306 0.0108  -0.0192 136 VAL A CA  
1050 C C   . VAL A 148 ? 0.4467 0.5234 0.4963 -0.0524 0.0224  -0.0215 136 VAL A C   
1051 O O   . VAL A 148 ? 0.4357 0.5043 0.4808 -0.0702 0.0213  -0.0269 136 VAL A O   
1052 C CB  . VAL A 148 ? 0.4489 0.5038 0.4783 -0.0152 0.0102  -0.0124 136 VAL A CB  
1053 C CG1 . VAL A 148 ? 0.4368 0.4546 0.4474 -0.0272 0.0132  -0.0128 136 VAL A CG1 
1054 C CG2 . VAL A 148 ? 0.4610 0.5253 0.4861 0.0026  -0.0017 -0.0088 136 VAL A CG2 
1055 N N   . ASN A 149 ? 0.4409 0.5103 0.4923 -0.0502 0.0334  -0.0174 137 ASN A N   
1056 C CA  . ASN A 149 ? 0.4530 0.5053 0.5013 -0.0688 0.0448  -0.0166 137 ASN A CA  
1057 C C   . ASN A 149 ? 0.4656 0.5441 0.5296 -0.0929 0.0478  -0.0222 137 ASN A C   
1058 O O   . ASN A 149 ? 0.4702 0.5235 0.5258 -0.1109 0.0549  -0.0219 137 ASN A O   
1059 C CB  . ASN A 149 ? 0.4456 0.4937 0.4927 -0.0607 0.0556  -0.0105 137 ASN A CB  
1060 C CG  . ASN A 149 ? 0.4505 0.4648 0.4785 -0.0444 0.0548  -0.0058 137 ASN A CG  
1061 O OD1 . ASN A 149 ? 0.4163 0.4059 0.4310 -0.0420 0.0487  -0.0056 137 ASN A OD1 
1062 N ND2 . ASN A 149 ? 0.4098 0.4255 0.4360 -0.0340 0.0612  -0.0029 137 ASN A ND2 
1063 N N   . LYS A 150 ? 0.4813 0.6104 0.5679 -0.0935 0.0424  -0.0270 138 LYS A N   
1064 C CA  . LYS A 150 ? 0.5038 0.6636 0.6073 -0.1201 0.0443  -0.0337 138 LYS A CA  
1065 C C   . LYS A 150 ? 0.5066 0.6663 0.6059 -0.1322 0.0325  -0.0426 138 LYS A C   
1066 O O   . LYS A 150 ? 0.5146 0.6961 0.6253 -0.1571 0.0324  -0.0503 138 LYS A O   
1067 C CB  . LYS A 150 ? 0.4989 0.7253 0.6329 -0.1161 0.0439  -0.0359 138 LYS A CB  
1068 C CG  . LYS A 150 ? 0.5358 0.7763 0.6787 -0.1132 0.0582  -0.0305 138 LYS A CG  
1069 C CD  . LYS A 150 ? 0.5817 0.8926 0.7554 -0.1010 0.0554  -0.0342 138 LYS A CD  
1070 C CE  . LYS A 150 ? 0.6234 0.9613 0.8096 -0.0987 0.0711  -0.0310 138 LYS A CE  
1071 N NZ  . LYS A 150 ? 0.6414 0.9375 0.8056 -0.0764 0.0775  -0.0246 138 LYS A NZ  
1072 N N   . SER A 151 ? 0.4950 0.6323 0.5775 -0.1168 0.0229  -0.0424 139 SER A N   
1073 C CA  . SER A 151 ? 0.5005 0.6534 0.5812 -0.1238 0.0096  -0.0514 139 SER A CA  
1074 C C   . SER A 151 ? 0.5271 0.6422 0.5898 -0.1468 0.0116  -0.0598 139 SER A C   
1075 O O   . SER A 151 ? 0.5345 0.6653 0.5962 -0.1593 0.0019  -0.0705 139 SER A O   
1076 C CB  . SER A 151 ? 0.4952 0.6399 0.5624 -0.0981 -0.0007 -0.0468 139 SER A CB  
1077 O OG  . SER A 151 ? 0.4885 0.5777 0.5301 -0.0932 0.0045  -0.0427 139 SER A OG  
1078 N N   . GLY A 152 ? 0.5373 0.6012 0.5833 -0.1497 0.0232  -0.0553 140 GLY A N   
1079 C CA  . GLY A 152 ? 0.5666 0.5844 0.5911 -0.1651 0.0262  -0.0625 140 GLY A CA  
1080 C C   . GLY A 152 ? 0.5725 0.5692 0.5758 -0.1532 0.0180  -0.0669 140 GLY A C   
1081 O O   . GLY A 152 ? 0.5978 0.5649 0.5841 -0.1656 0.0185  -0.0768 140 GLY A O   
1082 N N   . LYS A 153 ? 0.5411 0.5519 0.5437 -0.1299 0.0111  -0.0601 141 LYS A N   
1083 C CA  . LYS A 153 ? 0.5388 0.5326 0.5206 -0.1194 0.0047  -0.0624 141 LYS A CA  
1084 C C   . LYS A 153 ? 0.5237 0.4729 0.4888 -0.1076 0.0140  -0.0553 141 LYS A C   
1085 O O   . LYS A 153 ? 0.5357 0.4736 0.5058 -0.1023 0.0223  -0.0466 141 LYS A O   
1086 C CB  . LYS A 153 ? 0.5230 0.5489 0.5087 -0.1007 -0.0065 -0.0564 141 LYS A CB  
1087 C CG  . LYS A 153 ? 0.5285 0.6076 0.5328 -0.1061 -0.0178 -0.0614 141 LYS A CG  
1088 C CD  . LYS A 153 ? 0.5630 0.6522 0.5618 -0.1281 -0.0245 -0.0770 141 LYS A CD  
1089 C CE  . LYS A 153 ? 0.5513 0.7024 0.5737 -0.1351 -0.0358 -0.0819 141 LYS A CE  
1090 N NZ  . LYS A 153 ? 0.5700 0.7390 0.5820 -0.1492 -0.0479 -0.0959 141 LYS A NZ  
1091 N N   . VAL A 154 ? 0.5249 0.4532 0.4700 -0.1031 0.0124  -0.0595 142 VAL A N   
1092 C CA  . VAL A 154 ? 0.5174 0.4148 0.4486 -0.0888 0.0192  -0.0526 142 VAL A CA  
1093 C C   . VAL A 154 ? 0.4911 0.4021 0.4268 -0.0710 0.0164  -0.0400 142 VAL A C   
1094 O O   . VAL A 154 ? 0.4933 0.4254 0.4281 -0.0647 0.0075  -0.0383 142 VAL A O   
1095 C CB  . VAL A 154 ? 0.5387 0.4195 0.4482 -0.0877 0.0179  -0.0615 142 VAL A CB  
1096 C CG1 . VAL A 154 ? 0.5088 0.3677 0.4072 -0.0718 0.0248  -0.0540 142 VAL A CG1 
1097 C CG2 . VAL A 154 ? 0.5535 0.4139 0.4550 -0.1059 0.0208  -0.0767 142 VAL A CG2 
1098 N N   . VAL A 155 ? 0.4760 0.3731 0.4146 -0.0634 0.0239  -0.0312 143 VAL A N   
1099 C CA  . VAL A 155 ? 0.4580 0.3617 0.3991 -0.0492 0.0225  -0.0210 143 VAL A CA  
1100 C C   . VAL A 155 ? 0.4479 0.3301 0.3760 -0.0409 0.0273  -0.0164 143 VAL A C   
1101 O O   . VAL A 155 ? 0.4539 0.3177 0.3789 -0.0413 0.0347  -0.0160 143 VAL A O   
1102 C CB  . VAL A 155 ? 0.4526 0.3650 0.4084 -0.0475 0.0266  -0.0158 143 VAL A CB  
1103 C CG1 . VAL A 155 ? 0.4018 0.3180 0.3576 -0.0328 0.0242  -0.0079 143 VAL A CG1 
1104 C CG2 . VAL A 155 ? 0.4512 0.3917 0.4236 -0.0574 0.0236  -0.0209 143 VAL A CG2 
1105 N N   . VAL A 156 ? 0.4399 0.3262 0.3601 -0.0335 0.0228  -0.0123 144 VAL A N   
1106 C CA  . VAL A 156 ? 0.4310 0.3052 0.3410 -0.0277 0.0267  -0.0077 144 VAL A CA  
1107 C C   . VAL A 156 ? 0.4254 0.3019 0.3386 -0.0212 0.0250  0.0009  144 VAL A C   
1108 O O   . VAL A 156 ? 0.4243 0.3081 0.3359 -0.0178 0.0186  0.0041  144 VAL A O   
1109 C CB  . VAL A 156 ? 0.4431 0.3194 0.3381 -0.0279 0.0240  -0.0102 144 VAL A CB  
1110 C CG1 . VAL A 156 ? 0.4309 0.3018 0.3175 -0.0235 0.0287  -0.0048 144 VAL A CG1 
1111 C CG2 . VAL A 156 ? 0.4435 0.3143 0.3327 -0.0344 0.0257  -0.0221 144 VAL A CG2 
1112 N N   . SER A 157 ? 0.4137 0.2824 0.3293 -0.0189 0.0304  0.0043  145 SER A N   
1113 C CA  . SER A 157 ? 0.4122 0.2787 0.3278 -0.0145 0.0294  0.0100  145 SER A CA  
1114 C C   . SER A 157 ? 0.4231 0.2836 0.3282 -0.0153 0.0305  0.0141  145 SER A C   
1115 O O   . SER A 157 ? 0.4293 0.2907 0.3320 -0.0168 0.0349  0.0131  145 SER A O   
1116 C CB  . SER A 157 ? 0.4136 0.2790 0.3371 -0.0133 0.0339  0.0103  145 SER A CB  
1117 O OG  . SER A 157 ? 0.3995 0.2742 0.3334 -0.0136 0.0334  0.0078  145 SER A OG  
1118 N N   . VAL A 158 ? 0.4274 0.2823 0.3259 -0.0139 0.0267  0.0189  146 VAL A N   
1119 C CA  . VAL A 158 ? 0.4322 0.2805 0.3204 -0.0182 0.0282  0.0235  146 VAL A CA  
1120 C C   . VAL A 158 ? 0.4404 0.2833 0.3315 -0.0201 0.0310  0.0235  146 VAL A C   
1121 O O   . VAL A 158 ? 0.4610 0.2945 0.3531 -0.0164 0.0292  0.0232  146 VAL A O   
1122 C CB  . VAL A 158 ? 0.4412 0.2792 0.3171 -0.0173 0.0234  0.0300  146 VAL A CB  
1123 C CG1 . VAL A 158 ? 0.4486 0.2773 0.3127 -0.0259 0.0264  0.0357  146 VAL A CG1 
1124 C CG2 . VAL A 158 ? 0.4159 0.2641 0.2870 -0.0154 0.0192  0.0297  146 VAL A CG2 
1125 N N   . ASP A 159 ? 0.4335 0.2849 0.3254 -0.0250 0.0351  0.0229  147 ASP A N   
1126 C CA  . ASP A 159 ? 0.4695 0.3227 0.3632 -0.0290 0.0368  0.0222  147 ASP A CA  
1127 C C   . ASP A 159 ? 0.4568 0.3137 0.3586 -0.0233 0.0378  0.0189  147 ASP A C   
1128 O O   . ASP A 159 ? 0.4458 0.3147 0.3516 -0.0223 0.0402  0.0184  147 ASP A O   
1129 C CB  . ASP A 159 ? 0.4894 0.3255 0.3737 -0.0354 0.0347  0.0242  147 ASP A CB  
1130 C CG  . ASP A 159 ? 0.5498 0.3931 0.4331 -0.0463 0.0364  0.0228  147 ASP A CG  
1131 O OD1 . ASP A 159 ? 0.5606 0.4270 0.4519 -0.0467 0.0385  0.0214  147 ASP A OD1 
1132 O OD2 . ASP A 159 ? 0.6117 0.4370 0.4856 -0.0542 0.0352  0.0229  147 ASP A OD2 
1133 N N   . VAL A 160 ? 0.4773 0.3259 0.3808 -0.0185 0.0364  0.0175  148 VAL A N   
1134 C CA  . VAL A 160 ? 0.4900 0.3430 0.3997 -0.0140 0.0386  0.0153  148 VAL A CA  
1135 C C   . VAL A 160 ? 0.4775 0.3296 0.3928 -0.0091 0.0378  0.0141  148 VAL A C   
1136 O O   . VAL A 160 ? 0.4899 0.3358 0.4029 -0.0065 0.0343  0.0144  148 VAL A O   
1137 C CB  . VAL A 160 ? 0.5237 0.3731 0.4290 -0.0147 0.0389  0.0127  148 VAL A CB  
1138 C CG1 . VAL A 160 ? 0.5751 0.4333 0.4773 -0.0206 0.0389  0.0128  148 VAL A CG1 
1139 C CG2 . VAL A 160 ? 0.5477 0.3798 0.4461 -0.0142 0.0362  0.0110  148 VAL A CG2 
1140 N N   . PRO A 161 ? 0.4552 0.3147 0.3779 -0.0081 0.0409  0.0133  149 PRO A N   
1141 C CA  . PRO A 161 ? 0.4472 0.3135 0.3782 -0.0056 0.0404  0.0114  149 PRO A CA  
1142 C C   . PRO A 161 ? 0.4576 0.3230 0.3886 0.0009  0.0397  0.0095  149 PRO A C   
1143 O O   . PRO A 161 ? 0.4633 0.3253 0.3896 0.0019  0.0427  0.0081  149 PRO A O   
1144 C CB  . PRO A 161 ? 0.4591 0.3310 0.3956 -0.0089 0.0460  0.0116  149 PRO A CB  
1145 C CG  . PRO A 161 ? 0.4634 0.3277 0.3932 -0.0105 0.0479  0.0142  149 PRO A CG  
1146 C CD  . PRO A 161 ? 0.4574 0.3196 0.3803 -0.0088 0.0454  0.0149  149 PRO A CD  
1147 N N   . SER A 162 ? 0.4482 0.3162 0.3825 0.0070  0.0355  0.0090  150 SER A N   
1148 C CA  . SER A 162 ? 0.4430 0.3057 0.3752 0.0171  0.0349  0.0069  150 SER A CA  
1149 C C   . SER A 162 ? 0.4503 0.3266 0.3900 0.0202  0.0413  0.0027  150 SER A C   
1150 O O   . SER A 162 ? 0.4334 0.3303 0.3857 0.0176  0.0442  0.0024  150 SER A O   
1151 C CB  . SER A 162 ? 0.4591 0.3266 0.3950 0.0262  0.0286  0.0086  150 SER A CB  
1152 O OG  . SER A 162 ? 0.4503 0.3015 0.3738 0.0233  0.0234  0.0138  150 SER A OG  
1153 N N   . GLY A 163 ? 0.4587 0.3235 0.3891 0.0240  0.0441  -0.0008 151 GLY A N   
1154 C CA  . GLY A 163 ? 0.4603 0.3386 0.3940 0.0266  0.0510  -0.0048 151 GLY A CA  
1155 C C   . GLY A 163 ? 0.4660 0.3426 0.3913 0.0180  0.0549  -0.0039 151 GLY A C   
1156 O O   . GLY A 163 ? 0.4732 0.3570 0.3949 0.0202  0.0605  -0.0073 151 GLY A O   
1157 N N   . ILE A 164 ? 0.4537 0.3232 0.3748 0.0096  0.0520  0.0005  152 ILE A N   
1158 C CA  . ILE A 164 ? 0.4666 0.3363 0.3785 0.0047  0.0540  0.0017  152 ILE A CA  
1159 C C   . ILE A 164 ? 0.4899 0.3460 0.3887 0.0032  0.0504  -0.0035 152 ILE A C   
1160 O O   . ILE A 164 ? 0.5073 0.3502 0.4036 0.0004  0.0458  -0.0033 152 ILE A O   
1161 C CB  . ILE A 164 ? 0.4573 0.3284 0.3713 -0.0008 0.0529  0.0084  152 ILE A CB  
1162 C CG1 . ILE A 164 ? 0.4613 0.3402 0.3842 -0.0023 0.0575  0.0123  152 ILE A CG1 
1163 C CG2 . ILE A 164 ? 0.4794 0.3535 0.3843 -0.0030 0.0528  0.0105  152 ILE A CG2 
1164 C CD1 . ILE A 164 ? 0.5022 0.3910 0.4238 -0.0017 0.0645  0.0133  152 ILE A CD1 
1165 N N   . ASP A 165 ? 0.4979 0.3568 0.3869 0.0033  0.0527  -0.0082 153 ASP A N   
1166 C CA  . ASP A 165 ? 0.5152 0.3633 0.3906 -0.0026 0.0488  -0.0144 153 ASP A CA  
1167 C C   . ASP A 165 ? 0.5064 0.3646 0.3824 -0.0109 0.0451  -0.0089 153 ASP A C   
1168 O O   . ASP A 165 ? 0.4903 0.3650 0.3671 -0.0100 0.0464  -0.0037 153 ASP A O   
1169 C CB  . ASP A 165 ? 0.5550 0.4077 0.4182 -0.0005 0.0520  -0.0223 153 ASP A CB  
1170 C CG  . ASP A 165 ? 0.5887 0.4303 0.4363 -0.0092 0.0475  -0.0315 153 ASP A CG  
1171 O OD1 . ASP A 165 ? 0.6461 0.4858 0.4937 -0.0198 0.0421  -0.0297 153 ASP A OD1 
1172 O OD2 . ASP A 165 ? 0.6566 0.4932 0.4918 -0.0064 0.0500  -0.0416 153 ASP A OD2 
1173 N N   . SER A 166 ? 0.5176 0.3664 0.3925 -0.0184 0.0409  -0.0093 154 SER A N   
1174 C CA  . SER A 166 ? 0.5157 0.3785 0.3952 -0.0245 0.0383  -0.0039 154 SER A CA  
1175 C C   . SER A 166 ? 0.5214 0.4021 0.3948 -0.0306 0.0353  -0.0068 154 SER A C   
1176 O O   . SER A 166 ? 0.5032 0.4034 0.3823 -0.0324 0.0334  -0.0018 154 SER A O   
1177 C CB  . SER A 166 ? 0.5326 0.3829 0.4127 -0.0317 0.0360  -0.0027 154 SER A CB  
1178 O OG  . SER A 166 ? 0.5803 0.4185 0.4496 -0.0426 0.0336  -0.0093 154 SER A OG  
1179 N N   . ASN A 167 ? 0.5462 0.4224 0.4076 -0.0330 0.0348  -0.0155 155 ASN A N   
1180 C CA  . ASN A 167 ? 0.5674 0.4646 0.4212 -0.0387 0.0310  -0.0193 155 ASN A CA  
1181 C C   . ASN A 167 ? 0.5459 0.4603 0.3959 -0.0285 0.0331  -0.0148 155 ASN A C   
1182 O O   . ASN A 167 ? 0.5546 0.4919 0.3992 -0.0305 0.0289  -0.0146 155 ASN A O   
1183 C CB  . ASN A 167 ? 0.6044 0.4861 0.4422 -0.0483 0.0290  -0.0335 155 ASN A CB  
1184 C CG  . ASN A 167 ? 0.6822 0.5414 0.5184 -0.0616 0.0270  -0.0378 155 ASN A CG  
1185 O OD1 . ASN A 167 ? 0.7320 0.6042 0.5771 -0.0704 0.0245  -0.0324 155 ASN A OD1 
1186 N ND2 . ASN A 167 ? 0.7540 0.5785 0.5780 -0.0619 0.0289  -0.0467 155 ASN A ND2 
1187 N N   . THR A 168 ? 0.5144 0.4196 0.3659 -0.0188 0.0395  -0.0114 156 THR A N   
1188 C CA  . THR A 168 ? 0.5202 0.4385 0.3650 -0.0114 0.0432  -0.0062 156 THR A CA  
1189 C C   . THR A 168 ? 0.5016 0.4190 0.3565 -0.0038 0.0487  0.0068  156 THR A C   
1190 O O   . THR A 168 ? 0.5053 0.4317 0.3538 0.0011  0.0517  0.0151  156 THR A O   
1191 C CB  . THR A 168 ? 0.5327 0.4434 0.3668 -0.0086 0.0487  -0.0152 156 THR A CB  
1192 O OG1 . THR A 168 ? 0.5056 0.4010 0.3507 -0.0041 0.0538  -0.0156 156 THR A OG1 
1193 C CG2 . THR A 168 ? 0.5757 0.4798 0.3955 -0.0160 0.0444  -0.0306 156 THR A CG2 
1194 N N   . GLY A 169 ? 0.4751 0.3794 0.3428 -0.0038 0.0504  0.0078  157 GLY A N   
1195 C CA  . GLY A 169 ? 0.4660 0.3664 0.3423 0.0000  0.0558  0.0167  157 GLY A CA  
1196 C C   . GLY A 169 ? 0.4612 0.3612 0.3381 0.0017  0.0634  0.0158  157 GLY A C   
1197 O O   . GLY A 169 ? 0.4331 0.3315 0.3163 0.0014  0.0685  0.0226  157 GLY A O   
1198 N N   . LYS A 170 ? 0.4652 0.3673 0.3353 0.0028  0.0648  0.0065  158 LYS A N   
1199 C CA  . LYS A 170 ? 0.4889 0.3963 0.3621 0.0060  0.0727  0.0039  158 LYS A CA  
1200 C C   . LYS A 170 ? 0.4836 0.3867 0.3729 0.0080  0.0730  0.0006  158 LYS A C   
1201 O O   . LYS A 170 ? 0.4785 0.3694 0.3712 0.0082  0.0667  -0.0028 158 LYS A O   
1202 C CB  . LYS A 170 ? 0.5191 0.4308 0.3774 0.0093  0.0749  -0.0066 158 LYS A CB  
1203 C CG  . LYS A 170 ? 0.5735 0.4966 0.4146 0.0076  0.0751  -0.0014 158 LYS A CG  
1204 C CD  . LYS A 170 ? 0.6962 0.6269 0.5192 0.0099  0.0781  -0.0116 158 LYS A CD  
1205 C CE  . LYS A 170 ? 0.7455 0.6929 0.5525 0.0099  0.0821  -0.0010 158 LYS A CE  
1206 N NZ  . LYS A 170 ? 0.8250 0.7829 0.6108 0.0121  0.0857  -0.0120 158 LYS A NZ  
1207 N N   . VAL A 171 ? 0.4888 0.4046 0.3875 0.0089  0.0803  0.0024  159 VAL A N   
1208 C CA  . VAL A 171 ? 0.4854 0.4062 0.4009 0.0121  0.0803  -0.0008 159 VAL A CA  
1209 C C   . VAL A 171 ? 0.5087 0.4329 0.4216 0.0230  0.0825  -0.0117 159 VAL A C   
1210 O O   . VAL A 171 ? 0.5091 0.4464 0.4155 0.0260  0.0903  -0.0151 159 VAL A O   
1211 C CB  . VAL A 171 ? 0.4838 0.4229 0.4129 0.0059  0.0876  0.0051  159 VAL A CB  
1212 C CG1 . VAL A 171 ? 0.4789 0.4351 0.4272 0.0111  0.0874  -0.0004 159 VAL A CG1 
1213 C CG2 . VAL A 171 ? 0.4551 0.3827 0.3854 -0.0038 0.0855  0.0143  159 VAL A CG2 
1214 N N   . LEU A 172 ? 0.5131 0.4238 0.4287 0.0299  0.0763  -0.0169 160 LEU A N   
1215 C CA  . LEU A 172 ? 0.5436 0.4503 0.4552 0.0435  0.0781  -0.0276 160 LEU A CA  
1216 C C   . LEU A 172 ? 0.5319 0.4641 0.4640 0.0530  0.0817  -0.0280 160 LEU A C   
1217 O O   . LEU A 172 ? 0.5116 0.4402 0.4531 0.0606  0.0757  -0.0276 160 LEU A O   
1218 C CB  . LEU A 172 ? 0.5636 0.4376 0.4638 0.0463  0.0700  -0.0318 160 LEU A CB  
1219 C CG  . LEU A 172 ? 0.6078 0.4645 0.4899 0.0348  0.0665  -0.0331 160 LEU A CG  
1220 C CD1 . LEU A 172 ? 0.6615 0.4844 0.5314 0.0346  0.0601  -0.0382 160 LEU A CD1 
1221 C CD2 . LEU A 172 ? 0.6138 0.4787 0.4821 0.0348  0.0723  -0.0403 160 LEU A CD2 
1222 N N   . ARG A 173 ? 0.5186 0.4792 0.4569 0.0511  0.0915  -0.0277 161 ARG A N   
1223 C CA  . ARG A 173 ? 0.5348 0.5318 0.4951 0.0554  0.0975  -0.0278 161 ARG A CA  
1224 C C   . ARG A 173 ? 0.5167 0.5271 0.4951 0.0430  0.0939  -0.0192 161 ARG A C   
1225 O O   . ARG A 173 ? 0.5090 0.5442 0.4980 0.0318  0.1011  -0.0150 161 ARG A O   
1226 C CB  . ARG A 173 ? 0.5606 0.5639 0.5276 0.0772  0.0969  -0.0371 161 ARG A CB  
1227 C CG  . ARG A 173 ? 0.5860 0.6378 0.5748 0.0834  0.1063  -0.0396 161 ARG A CG  
1228 C CD  . ARG A 173 ? 0.6632 0.7216 0.6569 0.1100  0.1066  -0.0496 161 ARG A CD  
1229 N NE  . ARG A 173 ? 0.7252 0.8377 0.7474 0.1173  0.1121  -0.0506 161 ARG A NE  
1230 C CZ  . ARG A 173 ? 0.7578 0.8946 0.8031 0.1191  0.1044  -0.0464 161 ARG A CZ  
1231 N NH1 . ARG A 173 ? 0.7552 0.8648 0.7968 0.1150  0.0912  -0.0402 161 ARG A NH1 
1232 N NH2 . ARG A 173 ? 0.8030 0.9966 0.8755 0.1251  0.1101  -0.0488 161 ARG A NH2 
1233 N N   . THR A 174 ? 0.5175 0.5107 0.4979 0.0435  0.0831  -0.0171 162 THR A N   
1234 C CA  . THR A 174 ? 0.5103 0.5118 0.5031 0.0304  0.0791  -0.0108 162 THR A CA  
1235 C C   . THR A 174 ? 0.4860 0.4553 0.4673 0.0268  0.0694  -0.0073 162 THR A C   
1236 O O   . THR A 174 ? 0.4900 0.4364 0.4593 0.0361  0.0644  -0.0097 162 THR A O   
1237 C CB  . THR A 174 ? 0.5227 0.5600 0.5395 0.0358  0.0770  -0.0133 162 THR A CB  
1238 O OG1 . THR A 174 ? 0.5699 0.6188 0.5975 0.0175  0.0756  -0.0091 162 THR A OG1 
1239 C CG2 . THR A 174 ? 0.5252 0.5525 0.5418 0.0526  0.0660  -0.0152 162 THR A CG2 
1240 N N   . ALA A 175 ? 0.4639 0.4303 0.4476 0.0126  0.0679  -0.0022 163 ALA A N   
1241 C CA  . ALA A 175 ? 0.4473 0.3881 0.4206 0.0086  0.0607  0.0008  163 ALA A CA  
1242 C C   . ALA A 175 ? 0.4254 0.3717 0.4071 -0.0022 0.0576  0.0026  163 ALA A C   
1243 O O   . ALA A 175 ? 0.4079 0.3709 0.4001 -0.0117 0.0620  0.0026  163 ALA A O   
1244 C CB  . ALA A 175 ? 0.4463 0.3673 0.4038 0.0038  0.0636  0.0042  163 ALA A CB  
1245 N N   . VAL A 176 ? 0.4123 0.3445 0.3881 -0.0014 0.0500  0.0032  164 VAL A N   
1246 C CA  . VAL A 176 ? 0.4107 0.3450 0.3901 -0.0106 0.0461  0.0028  164 VAL A CA  
1247 C C   . VAL A 176 ? 0.4170 0.3355 0.3894 -0.0214 0.0517  0.0052  164 VAL A C   
1248 O O   . VAL A 176 ? 0.4313 0.3329 0.3922 -0.0185 0.0541  0.0086  164 VAL A O   
1249 C CB  . VAL A 176 ? 0.4122 0.3342 0.3825 -0.0058 0.0376  0.0035  164 VAL A CB  
1250 C CG1 . VAL A 176 ? 0.3960 0.3145 0.3638 -0.0160 0.0350  0.0019  164 VAL A CG1 
1251 C CG2 . VAL A 176 ? 0.4136 0.3496 0.3897 0.0060  0.0311  0.0029  164 VAL A CG2 
1252 N N   . LYS A 177 ? 0.4157 0.3391 0.3943 -0.0336 0.0535  0.0034  165 LYS A N   
1253 C CA  . LYS A 177 ? 0.4531 0.3535 0.4220 -0.0421 0.0583  0.0056  165 LYS A CA  
1254 C C   . LYS A 177 ? 0.4447 0.3329 0.4071 -0.0441 0.0526  0.0014  165 LYS A C   
1255 O O   . LYS A 177 ? 0.4474 0.3454 0.4156 -0.0523 0.0490  -0.0043 165 LYS A O   
1256 C CB  . LYS A 177 ? 0.4826 0.3880 0.4583 -0.0570 0.0655  0.0058  165 LYS A CB  
1257 C CG  . LYS A 177 ? 0.5765 0.4488 0.5381 -0.0640 0.0715  0.0096  165 LYS A CG  
1258 C CD  . LYS A 177 ? 0.6469 0.5167 0.6113 -0.0811 0.0801  0.0119  165 LYS A CD  
1259 C CE  . LYS A 177 ? 0.6903 0.5219 0.6361 -0.0817 0.0875  0.0205  165 LYS A CE  
1260 N NZ  . LYS A 177 ? 0.7035 0.5071 0.6372 -0.0750 0.0836  0.0174  165 LYS A NZ  
1261 N N   . ALA A 178 ? 0.4547 0.3245 0.4048 -0.0373 0.0523  0.0038  166 ALA A N   
1262 C CA  . ALA A 178 ? 0.4513 0.3126 0.3935 -0.0367 0.0479  -0.0003 166 ALA A CA  
1263 C C   . ALA A 178 ? 0.4737 0.3121 0.4071 -0.0418 0.0527  -0.0029 166 ALA A C   
1264 O O   . ALA A 178 ? 0.4825 0.3048 0.4112 -0.0403 0.0592  0.0021  166 ALA A O   
1265 C CB  . ALA A 178 ? 0.4386 0.2974 0.3735 -0.0264 0.0456  0.0032  166 ALA A CB  
1266 N N   . ASP A 179 ? 0.4810 0.3154 0.4094 -0.0461 0.0495  -0.0107 167 ASP A N   
1267 C CA  . ASP A 179 ? 0.5033 0.3103 0.4190 -0.0469 0.0543  -0.0151 167 ASP A CA  
1268 C C   . ASP A 179 ? 0.4978 0.2997 0.4048 -0.0329 0.0554  -0.0125 167 ASP A C   
1269 O O   . ASP A 179 ? 0.5122 0.2943 0.4112 -0.0258 0.0610  -0.0110 167 ASP A O   
1270 C CB  . ASP A 179 ? 0.5279 0.3334 0.4398 -0.0580 0.0508  -0.0271 167 ASP A CB  
1271 C CG  . ASP A 179 ? 0.5581 0.3740 0.4811 -0.0749 0.0498  -0.0307 167 ASP A CG  
1272 O OD1 . ASP A 179 ? 0.6485 0.4435 0.5695 -0.0838 0.0567  -0.0299 167 ASP A OD1 
1273 O OD2 . ASP A 179 ? 0.5562 0.4026 0.4901 -0.0790 0.0424  -0.0332 167 ASP A OD2 
1274 N N   . LEU A 180 ? 0.4865 0.3078 0.3954 -0.0284 0.0502  -0.0110 168 LEU A N   
1275 C CA  . LEU A 180 ? 0.4904 0.3145 0.3927 -0.0186 0.0512  -0.0090 168 LEU A CA  
1276 C C   . LEU A 180 ? 0.4669 0.3080 0.3745 -0.0166 0.0474  -0.0020 168 LEU A C   
1277 O O   . LEU A 180 ? 0.4697 0.3201 0.3808 -0.0204 0.0421  -0.0018 168 LEU A O   
1278 C CB  . LEU A 180 ? 0.5009 0.3260 0.3933 -0.0196 0.0497  -0.0173 168 LEU A CB  
1279 C CG  . LEU A 180 ? 0.5234 0.3596 0.4102 -0.0122 0.0511  -0.0152 168 LEU A CG  
1280 C CD1 . LEU A 180 ? 0.5128 0.3412 0.3980 -0.0010 0.0584  -0.0144 168 LEU A CD1 
1281 C CD2 . LEU A 180 ? 0.4927 0.3346 0.3674 -0.0153 0.0490  -0.0229 168 LEU A CD2 
1282 N N   . THR A 181 ? 0.4550 0.2993 0.3628 -0.0103 0.0498  0.0032  169 THR A N   
1283 C CA  . THR A 181 ? 0.4431 0.2989 0.3528 -0.0106 0.0469  0.0081  169 THR A CA  
1284 C C   . THR A 181 ? 0.4374 0.3026 0.3425 -0.0083 0.0486  0.0089  169 THR A C   
1285 O O   . THR A 181 ? 0.4385 0.3060 0.3434 -0.0015 0.0530  0.0083  169 THR A O   
1286 C CB  . THR A 181 ? 0.4390 0.2958 0.3535 -0.0088 0.0478  0.0126  169 THR A CB  
1287 O OG1 . THR A 181 ? 0.4231 0.2755 0.3424 -0.0116 0.0478  0.0119  169 THR A OG1 
1288 C CG2 . THR A 181 ? 0.4470 0.3112 0.3607 -0.0109 0.0448  0.0153  169 THR A CG2 
1289 N N   . VAL A 182 ? 0.4265 0.2976 0.3274 -0.0131 0.0457  0.0107  170 VAL A N   
1290 C CA  . VAL A 182 ? 0.4120 0.2961 0.3092 -0.0144 0.0484  0.0123  170 VAL A CA  
1291 C C   . VAL A 182 ? 0.4156 0.3041 0.3143 -0.0206 0.0467  0.0174  170 VAL A C   
1292 O O   . VAL A 182 ? 0.4155 0.2939 0.3094 -0.0257 0.0429  0.0203  170 VAL A O   
1293 C CB  . VAL A 182 ? 0.4301 0.3161 0.3168 -0.0178 0.0480  0.0111  170 VAL A CB  
1294 C CG1 . VAL A 182 ? 0.4224 0.3259 0.3056 -0.0202 0.0529  0.0129  170 VAL A CG1 
1295 C CG2 . VAL A 182 ? 0.4230 0.3022 0.3060 -0.0140 0.0485  0.0033  170 VAL A CG2 
1296 N N   . THR A 183 ? 0.3979 0.3007 0.3022 -0.0199 0.0489  0.0182  171 THR A N   
1297 C CA  . THR A 183 ? 0.4099 0.3174 0.3146 -0.0288 0.0470  0.0209  171 THR A CA  
1298 C C   . THR A 183 ? 0.4079 0.3374 0.3128 -0.0368 0.0501  0.0224  171 THR A C   
1299 O O   . THR A 183 ? 0.4243 0.3683 0.3301 -0.0325 0.0544  0.0213  171 THR A O   
1300 C CB  . THR A 183 ? 0.4139 0.3248 0.3245 -0.0251 0.0455  0.0202  171 THR A CB  
1301 O OG1 . THR A 183 ? 0.4096 0.3171 0.3170 -0.0356 0.0426  0.0201  171 THR A OG1 
1302 C CG2 . THR A 183 ? 0.3928 0.3279 0.3105 -0.0179 0.0479  0.0203  171 THR A CG2 
1303 N N   . PHE A 184 ? 0.4126 0.3446 0.3160 -0.0497 0.0487  0.0241  172 PHE A N   
1304 C CA  . PHE A 184 ? 0.4239 0.3754 0.3261 -0.0627 0.0524  0.0265  172 PHE A CA  
1305 C C   . PHE A 184 ? 0.4189 0.3998 0.3314 -0.0704 0.0521  0.0246  172 PHE A C   
1306 O O   . PHE A 184 ? 0.4377 0.4121 0.3505 -0.0748 0.0476  0.0223  172 PHE A O   
1307 C CB  . PHE A 184 ? 0.4433 0.3684 0.3306 -0.0758 0.0515  0.0314  172 PHE A CB  
1308 C CG  . PHE A 184 ? 0.4541 0.3545 0.3326 -0.0662 0.0491  0.0331  172 PHE A CG  
1309 C CD1 . PHE A 184 ? 0.4210 0.3307 0.2981 -0.0580 0.0518  0.0323  172 PHE A CD1 
1310 C CD2 . PHE A 184 ? 0.4523 0.3227 0.3241 -0.0643 0.0441  0.0343  172 PHE A CD2 
1311 C CE1 . PHE A 184 ? 0.4025 0.2944 0.2725 -0.0505 0.0482  0.0325  172 PHE A CE1 
1312 C CE2 . PHE A 184 ? 0.4369 0.2928 0.3036 -0.0546 0.0410  0.0356  172 PHE A CE2 
1313 C CZ  . PHE A 184 ? 0.4591 0.3268 0.3252 -0.0489 0.0424  0.0346  172 PHE A CZ  
1314 N N   . GLY A 185 ? 0.4157 0.4333 0.3370 -0.0710 0.0568  0.0245  173 GLY A N   
1315 C CA  . GLY A 185 ? 0.4117 0.4673 0.3454 -0.0793 0.0558  0.0226  173 GLY A CA  
1316 C C   . GLY A 185 ? 0.4121 0.4873 0.3571 -0.0607 0.0524  0.0202  173 GLY A C   
1317 O O   . GLY A 185 ? 0.4108 0.5238 0.3679 -0.0500 0.0551  0.0199  173 GLY A O   
1318 N N   . VAL A 186 ? 0.4113 0.4618 0.3511 -0.0560 0.0470  0.0193  174 VAL A N   
1319 C CA  . VAL A 186 ? 0.4201 0.4840 0.3658 -0.0400 0.0435  0.0192  174 VAL A CA  
1320 C C   . VAL A 186 ? 0.4298 0.4536 0.3659 -0.0304 0.0419  0.0200  174 VAL A C   
1321 O O   . VAL A 186 ? 0.4302 0.4221 0.3572 -0.0388 0.0415  0.0189  174 VAL A O   
1322 C CB  . VAL A 186 ? 0.4227 0.5140 0.3727 -0.0511 0.0373  0.0165  174 VAL A CB  
1323 C CG1 . VAL A 186 ? 0.4370 0.5790 0.4009 -0.0599 0.0385  0.0155  174 VAL A CG1 
1324 C CG2 . VAL A 186 ? 0.4351 0.4966 0.3731 -0.0703 0.0341  0.0125  174 VAL A CG2 
1325 N N   . PRO A 187 ? 0.4279 0.4536 0.3657 -0.0122 0.0415  0.0226  175 PRO A N   
1326 C CA  . PRO A 187 ? 0.4361 0.4297 0.3655 -0.0067 0.0407  0.0237  175 PRO A CA  
1327 C C   . PRO A 187 ? 0.4354 0.4253 0.3592 -0.0181 0.0361  0.0208  175 PRO A C   
1328 O O   . PRO A 187 ? 0.4407 0.4565 0.3670 -0.0255 0.0322  0.0186  175 PRO A O   
1329 C CB  . PRO A 187 ? 0.4560 0.4552 0.3864 0.0126  0.0415  0.0288  175 PRO A CB  
1330 C CG  . PRO A 187 ? 0.4502 0.4880 0.3906 0.0205  0.0414  0.0298  175 PRO A CG  
1331 C CD  . PRO A 187 ? 0.4343 0.4920 0.3810 0.0039  0.0420  0.0253  175 PRO A CD  
1332 N N   . LYS A 188 ? 0.4379 0.3982 0.3542 -0.0200 0.0365  0.0194  176 LYS A N   
1333 C CA  . LYS A 188 ? 0.4534 0.4072 0.3620 -0.0276 0.0333  0.0150  176 LYS A CA  
1334 C C   . LYS A 188 ? 0.4472 0.4023 0.3517 -0.0164 0.0334  0.0180  176 LYS A C   
1335 O O   . LYS A 188 ? 0.4352 0.3837 0.3413 -0.0045 0.0368  0.0240  176 LYS A O   
1336 C CB  . LYS A 188 ? 0.4762 0.3992 0.3787 -0.0333 0.0345  0.0115  176 LYS A CB  
1337 C CG  . LYS A 188 ? 0.5133 0.4255 0.4159 -0.0419 0.0353  0.0118  176 LYS A CG  
1338 C CD  . LYS A 188 ? 0.5819 0.5087 0.4846 -0.0563 0.0339  0.0102  176 LYS A CD  
1339 C CE  . LYS A 188 ? 0.5796 0.4915 0.4786 -0.0648 0.0362  0.0131  176 LYS A CE  
1340 N NZ  . LYS A 188 ? 0.5501 0.4847 0.4574 -0.0605 0.0396  0.0172  176 LYS A NZ  
1341 N N   . ILE A 189 ? 0.4537 0.4145 0.3503 -0.0212 0.0301  0.0137  177 ILE A N   
1342 C CA  . ILE A 189 ? 0.4662 0.4303 0.3553 -0.0116 0.0304  0.0175  177 ILE A CA  
1343 C C   . ILE A 189 ? 0.4688 0.4078 0.3560 -0.0050 0.0367  0.0210  177 ILE A C   
1344 O O   . ILE A 189 ? 0.4342 0.3730 0.3182 0.0044  0.0394  0.0288  177 ILE A O   
1345 C CB  . ILE A 189 ? 0.4956 0.4689 0.3733 -0.0196 0.0261  0.0097  177 ILE A CB  
1346 C CG1 . ILE A 189 ? 0.5032 0.5111 0.3846 -0.0261 0.0190  0.0076  177 ILE A CG1 
1347 C CG2 . ILE A 189 ? 0.4829 0.4577 0.3492 -0.0101 0.0278  0.0140  177 ILE A CG2 
1348 C CD1 . ILE A 189 ? 0.5553 0.5735 0.4254 -0.0377 0.0136  -0.0024 177 ILE A CD1 
1349 N N   . GLY A 190 ? 0.4579 0.3770 0.3470 -0.0104 0.0389  0.0158  178 GLY A N   
1350 C CA  . GLY A 190 ? 0.4642 0.3669 0.3550 -0.0059 0.0442  0.0178  178 GLY A CA  
1351 C C   . GLY A 190 ? 0.4516 0.3478 0.3494 -0.0010 0.0474  0.0243  178 GLY A C   
1352 O O   . GLY A 190 ? 0.4530 0.3397 0.3521 0.0006  0.0519  0.0266  178 GLY A O   
1353 N N   . HIS A 191 ? 0.4367 0.3392 0.3388 0.0006  0.0456  0.0264  179 HIS A N   
1354 C CA  . HIS A 191 ? 0.4330 0.3274 0.3382 0.0070  0.0489  0.0311  179 HIS A CA  
1355 C C   . HIS A 191 ? 0.4449 0.3421 0.3442 0.0174  0.0506  0.0394  179 HIS A C   
1356 O O   . HIS A 191 ? 0.4390 0.3207 0.3366 0.0234  0.0546  0.0440  179 HIS A O   
1357 C CB  . HIS A 191 ? 0.4360 0.3387 0.3463 0.0075  0.0474  0.0294  179 HIS A CB  
1358 C CG  . HIS A 191 ? 0.4074 0.3063 0.3202 -0.0016 0.0458  0.0241  179 HIS A CG  
1359 N ND1 . HIS A 191 ? 0.3914 0.3042 0.3058 -0.0078 0.0435  0.0221  179 HIS A ND1 
1360 C CD2 . HIS A 191 ? 0.4387 0.3227 0.3520 -0.0055 0.0462  0.0215  179 HIS A CD2 
1361 C CE1 . HIS A 191 ? 0.4313 0.3328 0.3442 -0.0149 0.0429  0.0198  179 HIS A CE1 
1362 N NE2 . HIS A 191 ? 0.4040 0.2893 0.3166 -0.0122 0.0438  0.0194  179 HIS A NE2 
1363 N N   . ILE A 192 ? 0.4238 0.3399 0.3185 0.0196  0.0469  0.0411  180 ILE A N   
1364 C CA  . ILE A 192 ? 0.4418 0.3667 0.3304 0.0321  0.0461  0.0502  180 ILE A CA  
1365 C C   . ILE A 192 ? 0.4559 0.3725 0.3316 0.0340  0.0491  0.0570  180 ILE A C   
1366 O O   . ILE A 192 ? 0.4659 0.3719 0.3334 0.0443  0.0520  0.0678  180 ILE A O   
1367 C CB  . ILE A 192 ? 0.4447 0.4041 0.3363 0.0330  0.0389  0.0480  180 ILE A CB  
1368 C CG1 . ILE A 192 ? 0.4390 0.4106 0.3430 0.0314  0.0379  0.0434  180 ILE A CG1 
1369 C CG2 . ILE A 192 ? 0.4480 0.4232 0.3319 0.0477  0.0360  0.0581  180 ILE A CG2 
1370 C CD1 . ILE A 192 ? 0.4837 0.4954 0.3937 0.0250  0.0308  0.0389  180 ILE A CD1 
1371 N N   . LEU A 193 ? 0.4413 0.3614 0.3137 0.0245  0.0490  0.0509  181 LEU A N   
1372 C CA  . LEU A 193 ? 0.4584 0.3751 0.3184 0.0247  0.0530  0.0557  181 LEU A CA  
1373 C C   . LEU A 193 ? 0.4668 0.3630 0.3306 0.0185  0.0610  0.0552  181 LEU A C   
1374 O O   . LEU A 193 ? 0.4514 0.3410 0.3267 0.0128  0.0613  0.0478  181 LEU A O   
1375 C CB  . LEU A 193 ? 0.4594 0.3940 0.3122 0.0193  0.0490  0.0474  181 LEU A CB  
1376 C CG  . LEU A 193 ? 0.4593 0.4209 0.3092 0.0213  0.0398  0.0457  181 LEU A CG  
1377 C CD1 . LEU A 193 ? 0.4245 0.3989 0.2651 0.0121  0.0360  0.0338  181 LEU A CD1 
1378 C CD2 . LEU A 193 ? 0.4565 0.4288 0.2972 0.0350  0.0379  0.0597  181 LEU A CD2 
1379 N N   . PHE A 194 ? 0.4874 0.3762 0.3410 0.0193  0.0676  0.0641  182 PHE A N   
1380 C CA  . PHE A 194 ? 0.4891 0.3651 0.3477 0.0109  0.0760  0.0639  182 PHE A CA  
1381 C C   . PHE A 194 ? 0.4849 0.3759 0.3434 0.0061  0.0782  0.0554  182 PHE A C   
1382 O O   . PHE A 194 ? 0.4783 0.3828 0.3249 0.0092  0.0761  0.0542  182 PHE A O   
1383 C CB  . PHE A 194 ? 0.5096 0.3691 0.3556 0.0116  0.0837  0.0786  182 PHE A CB  
1384 C CG  . PHE A 194 ? 0.4951 0.3305 0.3400 0.0170  0.0835  0.0857  182 PHE A CG  
1385 C CD1 . PHE A 194 ? 0.5310 0.3644 0.3648 0.0312  0.0794  0.0949  182 PHE A CD1 
1386 C CD2 . PHE A 194 ? 0.4841 0.3005 0.3390 0.0090  0.0870  0.0818  182 PHE A CD2 
1387 C CE1 . PHE A 194 ? 0.5656 0.3744 0.3973 0.0397  0.0801  0.1006  182 PHE A CE1 
1388 C CE2 . PHE A 194 ? 0.5343 0.3244 0.3856 0.0144  0.0876  0.0860  182 PHE A CE2 
1389 C CZ  . PHE A 194 ? 0.5952 0.3795 0.4345 0.0310  0.0848  0.0955  182 PHE A CZ  
1390 N N   . PRO A 195 ? 0.4921 0.3827 0.3629 -0.0004 0.0828  0.0494  183 PRO A N   
1391 C CA  . PRO A 195 ? 0.4938 0.3722 0.3773 -0.0066 0.0856  0.0504  183 PRO A CA  
1392 C C   . PRO A 195 ? 0.4779 0.3500 0.3720 -0.0056 0.0782  0.0439  183 PRO A C   
1393 O O   . PRO A 195 ? 0.4958 0.3561 0.3967 -0.0101 0.0792  0.0444  183 PRO A O   
1394 C CB  . PRO A 195 ? 0.4881 0.3804 0.3814 -0.0130 0.0920  0.0450  183 PRO A CB  
1395 C CG  . PRO A 195 ? 0.5012 0.4090 0.3891 -0.0072 0.0911  0.0376  183 PRO A CG  
1396 C CD  . PRO A 195 ? 0.4857 0.3915 0.3559 -0.0016 0.0869  0.0417  183 PRO A CD  
1397 N N   . GLY A 196 ? 0.4627 0.3419 0.3568 -0.0015 0.0713  0.0375  184 GLY A N   
1398 C CA  . GLY A 196 ? 0.4511 0.3262 0.3537 -0.0020 0.0656  0.0320  184 GLY A CA  
1399 C C   . GLY A 196 ? 0.4434 0.3070 0.3462 -0.0004 0.0651  0.0368  184 GLY A C   
1400 O O   . GLY A 196 ? 0.4346 0.2919 0.3445 -0.0032 0.0638  0.0332  184 GLY A O   
1401 N N   . ARG A 197 ? 0.4468 0.3073 0.3404 0.0056  0.0663  0.0448  185 ARG A N   
1402 C CA  . ARG A 197 ? 0.4660 0.3135 0.3580 0.0111  0.0665  0.0488  185 ARG A CA  
1403 C C   . ARG A 197 ? 0.4910 0.3180 0.3853 0.0044  0.0717  0.0485  185 ARG A C   
1404 O O   . ARG A 197 ? 0.4843 0.2996 0.3804 0.0052  0.0712  0.0452  185 ARG A O   
1405 C CB  . ARG A 197 ? 0.4819 0.3285 0.3621 0.0221  0.0669  0.0593  185 ARG A CB  
1406 C CG  . ARG A 197 ? 0.4709 0.3036 0.3487 0.0325  0.0673  0.0629  185 ARG A CG  
1407 C CD  . ARG A 197 ? 0.5172 0.3554 0.3846 0.0479  0.0656  0.0736  185 ARG A CD  
1408 N NE  . ARG A 197 ? 0.5608 0.3720 0.4213 0.0592  0.0695  0.0795  185 ARG A NE  
1409 C CZ  . ARG A 197 ? 0.5987 0.3973 0.4452 0.0739  0.0710  0.0925  185 ARG A CZ  
1410 N NH1 . ARG A 197 ? 0.5670 0.3822 0.4046 0.0786  0.0682  0.1018  185 ARG A NH1 
1411 N NH2 . ARG A 197 ? 0.6530 0.4200 0.4923 0.0846  0.0752  0.0960  185 ARG A NH2 
1412 N N   . ASP A 198 ? 0.5110 0.3355 0.4047 -0.0033 0.0771  0.0511  186 ASP A N   
1413 C CA  . ASP A 198 ? 0.5467 0.3545 0.4432 -0.0138 0.0822  0.0503  186 ASP A CA  
1414 C C   . ASP A 198 ? 0.5282 0.3466 0.4390 -0.0211 0.0780  0.0388  186 ASP A C   
1415 O O   . ASP A 198 ? 0.5536 0.3596 0.4666 -0.0276 0.0782  0.0343  186 ASP A O   
1416 C CB  . ASP A 198 ? 0.5600 0.3696 0.4536 -0.0224 0.0899  0.0566  186 ASP A CB  
1417 C CG  . ASP A 198 ? 0.6600 0.4482 0.5525 -0.0355 0.0965  0.0586  186 ASP A CG  
1418 O OD1 . ASP A 198 ? 0.7253 0.4817 0.6052 -0.0323 0.0988  0.0643  186 ASP A OD1 
1419 O OD2 . ASP A 198 ? 0.7262 0.5296 0.6301 -0.0487 0.0998  0.0544  186 ASP A OD2 
1420 N N   . LEU A 199 ? 0.4961 0.3357 0.4142 -0.0195 0.0740  0.0342  187 LEU A N   
1421 C CA  . LEU A 199 ? 0.4961 0.3472 0.4261 -0.0239 0.0698  0.0258  187 LEU A CA  
1422 C C   . LEU A 199 ? 0.4881 0.3350 0.4173 -0.0201 0.0634  0.0213  187 LEU A C   
1423 O O   . LEU A 199 ? 0.4788 0.3310 0.4142 -0.0240 0.0595  0.0156  187 LEU A O   
1424 C CB  . LEU A 199 ? 0.4889 0.3599 0.4247 -0.0209 0.0689  0.0232  187 LEU A CB  
1425 C CG  . LEU A 199 ? 0.5324 0.4160 0.4728 -0.0260 0.0764  0.0251  187 LEU A CG  
1426 C CD1 . LEU A 199 ? 0.5340 0.4370 0.4825 -0.0209 0.0748  0.0193  187 LEU A CD1 
1427 C CD2 . LEU A 199 ? 0.5514 0.4351 0.4995 -0.0392 0.0808  0.0253  187 LEU A CD2 
1428 N N   . THR A 200 ? 0.4863 0.3272 0.4075 -0.0126 0.0625  0.0244  188 THR A N   
1429 C CA  . THR A 200 ? 0.4691 0.3098 0.3883 -0.0087 0.0585  0.0215  188 THR A CA  
1430 C C   . THR A 200 ? 0.4954 0.3216 0.4118 -0.0103 0.0602  0.0183  188 THR A C   
1431 O O   . THR A 200 ? 0.4821 0.3110 0.3983 -0.0107 0.0571  0.0130  188 THR A O   
1432 C CB  . THR A 200 ? 0.4743 0.3206 0.3882 -0.0003 0.0579  0.0260  188 THR A CB  
1433 O OG1 . THR A 200 ? 0.4587 0.3178 0.3734 -0.0014 0.0550  0.0257  188 THR A OG1 
1434 C CG2 . THR A 200 ? 0.4723 0.3224 0.3852 0.0036  0.0561  0.0239  188 THR A CG2 
1435 N N   . GLY A 201 ? 0.5099 0.3182 0.4218 -0.0119 0.0656  0.0211  189 GLY A N   
1436 C CA  . GLY A 201 ? 0.5341 0.3204 0.4394 -0.0131 0.0683  0.0168  189 GLY A CA  
1437 C C   . GLY A 201 ? 0.5479 0.3322 0.4471 0.0002  0.0681  0.0164  189 GLY A C   
1438 O O   . GLY A 201 ? 0.5374 0.3298 0.4354 0.0104  0.0681  0.0232  189 GLY A O   
1439 N N   . LYS A 202 ? 0.5535 0.3309 0.4488 0.0003  0.0679  0.0079  190 LYS A N   
1440 C CA  . LYS A 202 ? 0.5546 0.3347 0.4451 0.0139  0.0692  0.0065  190 LYS A CA  
1441 C C   . LYS A 202 ? 0.5229 0.3346 0.4206 0.0149  0.0647  0.0077  190 LYS A C   
1442 O O   . LYS A 202 ? 0.5164 0.3385 0.4172 0.0055  0.0606  0.0043  190 LYS A O   
1443 C CB  . LYS A 202 ? 0.5913 0.3547 0.4734 0.0127  0.0713  -0.0044 190 LYS A CB  
1444 C CG  . LYS A 202 ? 0.6551 0.4199 0.5313 0.0289  0.0748  -0.0074 190 LYS A CG  
1445 C CD  . LYS A 202 ? 0.7391 0.4889 0.6044 0.0273  0.0771  -0.0211 190 LYS A CD  
1446 C CE  . LYS A 202 ? 0.8054 0.5115 0.6580 0.0275  0.0823  -0.0264 190 LYS A CE  
1447 N NZ  . LYS A 202 ? 0.8623 0.5521 0.7005 0.0321  0.0861  -0.0418 190 LYS A NZ  
1448 N N   . LEU A 203 ? 0.4928 0.3198 0.3925 0.0254  0.0651  0.0131  191 LEU A N   
1449 C CA  . LEU A 203 ? 0.4758 0.3308 0.3816 0.0226  0.0615  0.0142  191 LEU A CA  
1450 C C   . LEU A 203 ? 0.4673 0.3383 0.3727 0.0294  0.0639  0.0107  191 LEU A C   
1451 O O   . LEU A 203 ? 0.4546 0.3287 0.3596 0.0434  0.0673  0.0118  191 LEU A O   
1452 C CB  . LEU A 203 ? 0.4651 0.3352 0.3752 0.0254  0.0593  0.0215  191 LEU A CB  
1453 C CG  . LEU A 203 ? 0.4505 0.3462 0.3658 0.0181  0.0553  0.0219  191 LEU A CG  
1454 C CD1 . LEU A 203 ? 0.3995 0.2882 0.3144 0.0050  0.0520  0.0200  191 LEU A CD1 
1455 C CD2 . LEU A 203 ? 0.4675 0.3804 0.3853 0.0220  0.0530  0.0269  191 LEU A CD2 
1456 N N   . LYS A 204 ? 0.4525 0.3356 0.3577 0.0204  0.0624  0.0076  192 LYS A N   
1457 C CA  . LYS A 204 ? 0.4498 0.3564 0.3556 0.0236  0.0655  0.0057  192 LYS A CA  
1458 C C   . LYS A 204 ? 0.4249 0.3555 0.3368 0.0133  0.0625  0.0107  192 LYS A C   
1459 O O   . LYS A 204 ? 0.4238 0.3462 0.3339 0.0016  0.0581  0.0129  192 LYS A O   
1460 C CB  . LYS A 204 ? 0.4725 0.3728 0.3689 0.0206  0.0676  -0.0013 192 LYS A CB  
1461 C CG  . LYS A 204 ? 0.5356 0.4100 0.4235 0.0283  0.0708  -0.0094 192 LYS A CG  
1462 C CD  . LYS A 204 ? 0.6488 0.5250 0.5258 0.0261  0.0732  -0.0181 192 LYS A CD  
1463 C CE  . LYS A 204 ? 0.7283 0.5737 0.5937 0.0280  0.0749  -0.0292 192 LYS A CE  
1464 N NZ  . LYS A 204 ? 0.7723 0.5980 0.6372 0.0429  0.0802  -0.0303 192 LYS A NZ  
1465 N N   . VAL A 205 ? 0.4136 0.3736 0.3325 0.0177  0.0648  0.0122  193 VAL A N   
1466 C CA  . VAL A 205 ? 0.4028 0.3876 0.3274 0.0045  0.0626  0.0156  193 VAL A CA  
1467 C C   . VAL A 205 ? 0.4096 0.4161 0.3328 -0.0016 0.0678  0.0142  193 VAL A C   
1468 O O   . VAL A 205 ? 0.4064 0.4367 0.3343 0.0092  0.0735  0.0114  193 VAL A O   
1469 C CB  . VAL A 205 ? 0.4157 0.4263 0.3508 0.0106  0.0607  0.0183  193 VAL A CB  
1470 C CG1 . VAL A 205 ? 0.4233 0.4625 0.3645 -0.0073 0.0582  0.0198  193 VAL A CG1 
1471 C CG2 . VAL A 205 ? 0.4084 0.3963 0.3410 0.0175  0.0566  0.0210  193 VAL A CG2 
1472 N N   . ALA A 206 ? 0.3996 0.3966 0.3147 -0.0179 0.0665  0.0165  194 ALA A N   
1473 C CA  . ALA A 206 ? 0.3915 0.4043 0.3007 -0.0257 0.0720  0.0170  194 ALA A CA  
1474 C C   . ALA A 206 ? 0.3818 0.4220 0.2972 -0.0419 0.0734  0.0212  194 ALA A C   
1475 O O   . ALA A 206 ? 0.3934 0.4232 0.3093 -0.0538 0.0682  0.0243  194 ALA A O   
1476 C CB  . ALA A 206 ? 0.3957 0.3801 0.2886 -0.0332 0.0697  0.0189  194 ALA A CB  
1477 N N   . ASN A 207 ? 0.4455 0.4044 0.3780 -0.0115 0.0562  0.0561  195 ASN A N   
1478 C CA  . ASN A 207 ? 0.4478 0.4174 0.3754 -0.0203 0.0552  0.0582  195 ASN A CA  
1479 C C   . ASN A 207 ? 0.4397 0.3870 0.3578 -0.0228 0.0533  0.0495  195 ASN A C   
1480 O O   . ASN A 207 ? 0.4422 0.3754 0.3593 -0.0161 0.0537  0.0483  195 ASN A O   
1481 C CB  . ASN A 207 ? 0.4441 0.4363 0.3782 -0.0144 0.0597  0.0718  195 ASN A CB  
1482 C CG  . ASN A 207 ? 0.4456 0.4475 0.3770 -0.0211 0.0586  0.0768  195 ASN A CG  
1483 O OD1 . ASN A 207 ? 0.4268 0.4268 0.3486 -0.0361 0.0526  0.0720  195 ASN A OD1 
1484 N ND2 . ASN A 207 ? 0.4453 0.4538 0.3806 -0.0091 0.0661  0.0883  195 ASN A ND2 
1485 N N   . ILE A 208 ? 0.4271 0.3657 0.3322 -0.0324 0.0522  0.0442  196 ILE A N   
1486 C CA  . ILE A 208 ? 0.4407 0.3575 0.3335 -0.0338 0.0523  0.0363  196 ILE A CA  
1487 C C   . ILE A 208 ? 0.4498 0.3669 0.3243 -0.0464 0.0506  0.0352  196 ILE A C   
1488 O O   . ILE A 208 ? 0.4639 0.3604 0.3215 -0.0490 0.0518  0.0277  196 ILE A O   
1489 C CB  . ILE A 208 ? 0.4315 0.3290 0.3174 -0.0305 0.0564  0.0328  196 ILE A CB  
1490 C CG1 . ILE A 208 ? 0.4658 0.3528 0.3276 -0.0388 0.0606  0.0334  196 ILE A CG1 
1491 C CG2 . ILE A 208 ? 0.4180 0.3209 0.3254 -0.0208 0.0557  0.0373  196 ILE A CG2 
1492 C CD1 . ILE A 208 ? 0.4514 0.3111 0.2978 -0.0309 0.0708  0.0332  196 ILE A CD1 
1493 N N   . GLY A 209 ? 0.4542 0.3970 0.3326 -0.0544 0.0475  0.0453  197 GLY A N   
1494 C CA  . GLY A 209 ? 0.4597 0.4110 0.3259 -0.0682 0.0435  0.0495  197 GLY A CA  
1495 C C   . GLY A 209 ? 0.4783 0.4329 0.3197 -0.0915 0.0371  0.0559  197 GLY A C   
1496 O O   . GLY A 209 ? 0.4621 0.4237 0.2900 -0.1073 0.0314  0.0614  197 GLY A O   
1497 N N   . HIS A 210 ? 0.4848 0.4315 0.3162 -0.0960 0.0371  0.0567  198 HIS A N   
1498 C CA  . HIS A 210 ? 0.5183 0.4636 0.3201 -0.1220 0.0289  0.0661  198 HIS A CA  
1499 C C   . HIS A 210 ? 0.5150 0.5109 0.3393 -0.1340 0.0197  0.0874  198 HIS A C   
1500 O O   . HIS A 210 ? 0.4754 0.5055 0.3384 -0.1173 0.0236  0.0960  198 HIS A O   
1501 C CB  . HIS A 210 ? 0.5325 0.4611 0.3237 -0.1216 0.0316  0.0651  198 HIS A CB  
1502 C CG  . HIS A 210 ? 0.5576 0.4421 0.3304 -0.1072 0.0432  0.0510  198 HIS A CG  
1503 N ND1 . HIS A 210 ? 0.5738 0.4639 0.3782 -0.0839 0.0507  0.0466  198 HIS A ND1 
1504 C CD2 . HIS A 210 ? 0.6153 0.4506 0.3410 -0.1117 0.0501  0.0439  198 HIS A CD2 
1505 C CE1 . HIS A 210 ? 0.5930 0.4467 0.3774 -0.0746 0.0609  0.0400  198 HIS A CE1 
1506 N NE2 . HIS A 210 ? 0.6054 0.4235 0.3408 -0.0888 0.0628  0.0381  198 HIS A NE2 
1507 N N   . PRO A 211 ? 0.5495 0.5493 0.3463 -0.1637 0.0080  0.0992  199 PRO A N   
1508 C CA  . PRO A 211 ? 0.5552 0.6112 0.3764 -0.1782 -0.0021 0.1268  199 PRO A CA  
1509 C C   . PRO A 211 ? 0.5537 0.6347 0.3981 -0.1723 -0.0017 0.1373  199 PRO A C   
1510 O O   . PRO A 211 ? 0.5644 0.6121 0.3831 -0.1782 -0.0022 0.1278  199 PRO A O   
1511 C CB  . PRO A 211 ? 0.5990 0.6388 0.3696 -0.2199 -0.0185 0.1366  199 PRO A CB  
1512 C CG  . PRO A 211 ? 0.6244 0.6040 0.3494 -0.2205 -0.0130 0.1131  199 PRO A CG  
1513 C CD  . PRO A 211 ? 0.6113 0.5617 0.3488 -0.1863 0.0040  0.0903  199 PRO A CD  
1514 N N   . VAL A 212 ? 0.5540 0.6905 0.4436 -0.1594 0.0010  0.1581  200 VAL A N   
1515 C CA  . VAL A 212 ? 0.5722 0.7372 0.4858 -0.1514 0.0031  0.1702  200 VAL A CA  
1516 C C   . VAL A 212 ? 0.6079 0.7761 0.4974 -0.1853 -0.0130 0.1836  200 VAL A C   
1517 O O   . VAL A 212 ? 0.6095 0.7689 0.4980 -0.1816 -0.0114 0.1793  200 VAL A O   
1518 C CB  . VAL A 212 ? 0.5563 0.7807 0.5170 -0.1306 0.0120  0.1966  200 VAL A CB  
1519 C CG1 . VAL A 212 ? 0.5766 0.8322 0.5576 -0.1252 0.0137  0.2119  200 VAL A CG1 
1520 C CG2 . VAL A 212 ? 0.5544 0.7587 0.5273 -0.0956 0.0298  0.1816  200 VAL A CG2 
1521 N N   . HIS A 213 ? 0.6543 0.8295 0.5193 -0.2201 -0.0292 0.1994  201 HIS A N   
1522 C CA  . HIS A 213 ? 0.7085 0.8753 0.5363 -0.2605 -0.0482 0.2138  201 HIS A CA  
1523 C C   . HIS A 213 ? 0.7378 0.8260 0.5097 -0.2665 -0.0459 0.1870  201 HIS A C   
1524 O O   . HIS A 213 ? 0.7618 0.8377 0.5138 -0.2830 -0.0534 0.1932  201 HIS A O   
1525 C CB  . HIS A 213 ? 0.7505 0.9257 0.5495 -0.3001 -0.0669 0.2331  201 HIS A CB  
1526 C CG  . HIS A 213 ? 0.8509 1.0161 0.6046 -0.3488 -0.0903 0.2535  201 HIS A CG  
1527 N ND1 . HIS A 213 ? 0.9358 1.0485 0.6164 -0.3907 -0.1061 0.2527  201 HIS A ND1 
1528 C CD2 . HIS A 213 ? 0.8898 1.0853 0.6547 -0.3644 -0.1013 0.2761  201 HIS A CD2 
1529 C CE1 . HIS A 213 ? 0.9921 1.1000 0.6373 -0.4325 -0.1272 0.2749  201 HIS A CE1 
1530 N NE2 . HIS A 213 ? 0.9586 1.1198 0.6575 -0.4175 -0.1253 0.2897  201 HIS A NE2 
1531 N N   . LEU A 214 ? 0.7400 0.7738 0.4849 -0.2524 -0.0343 0.1597  202 LEU A N   
1532 C CA  . LEU A 214 ? 0.7716 0.7318 0.4663 -0.2508 -0.0265 0.1382  202 LEU A CA  
1533 C C   . LEU A 214 ? 0.7461 0.7102 0.4739 -0.2205 -0.0137 0.1280  202 LEU A C   
1534 O O   . LEU A 214 ? 0.7789 0.7069 0.4765 -0.2277 -0.0134 0.1251  202 LEU A O   
1535 C CB  . LEU A 214 ? 0.7829 0.6878 0.4411 -0.2417 -0.0153 0.1166  202 LEU A CB  
1536 C CG  . LEU A 214 ? 0.8156 0.6928 0.4183 -0.2749 -0.0265 0.1218  202 LEU A CG  
1537 C CD1 . LEU A 214 ? 0.8070 0.6287 0.3772 -0.2575 -0.0105 0.0984  202 LEU A CD1 
1538 C CD2 . LEU A 214 ? 0.8876 0.7216 0.4178 -0.3192 -0.0421 0.1355  202 LEU A CD2 
1539 N N   . ILE A 215 ? 0.7056 0.7075 0.4894 -0.1878 -0.0031 0.1231  203 ILE A N   
1540 C CA  . ILE A 215 ? 0.6805 0.6880 0.4955 -0.1598 0.0081  0.1142  203 ILE A CA  
1541 C C   . ILE A 215 ? 0.7052 0.7408 0.5308 -0.1703 0.0007  0.1301  203 ILE A C   
1542 O O   . ILE A 215 ? 0.7006 0.7187 0.5257 -0.1601 0.0065  0.1218  203 ILE A O   
1543 C CB  . ILE A 215 ? 0.6368 0.6804 0.5014 -0.1297 0.0177  0.1125  203 ILE A CB  
1544 C CG1 . ILE A 215 ? 0.6191 0.6347 0.4763 -0.1180 0.0245  0.0963  203 ILE A CG1 
1545 C CG2 . ILE A 215 ? 0.6060 0.6565 0.4964 -0.1062 0.0267  0.1071  203 ILE A CG2 
1546 C CD1 . ILE A 215 ? 0.6324 0.5979 0.4678 -0.1078 0.0332  0.0778  203 ILE A CD1 
1547 N N   . ASN A 216 ? 0.7300 0.8111 0.5657 -0.1920 -0.0125 0.1554  204 ASN A N   
1548 C CA  . ASN A 216 ? 0.7454 0.8616 0.5940 -0.2051 -0.0215 0.1762  204 ASN A CA  
1549 C C   . ASN A 216 ? 0.8041 0.8815 0.5982 -0.2433 -0.0371 0.1820  204 ASN A C   
1550 O O   . ASN A 216 ? 0.8151 0.9146 0.6167 -0.2546 -0.0449 0.1972  204 ASN A O   
1551 C CB  . ASN A 216 ? 0.7240 0.9174 0.6162 -0.2079 -0.0272 0.2085  204 ASN A CB  
1552 C CG  . ASN A 216 ? 0.6945 0.9203 0.6347 -0.1669 -0.0084 0.2069  204 ASN A CG  
1553 O OD1 . ASN A 216 ? 0.6978 0.8997 0.6434 -0.1410 0.0045  0.1863  204 ASN A OD1 
1554 N ND2 . ASN A 216 ? 0.6881 0.9624 0.6577 -0.1607 -0.0061 0.2292  204 ASN A ND2 
1555 N N   . SER A 217 ? 0.8622 0.8776 0.5961 -0.2640 -0.0410 0.1715  205 SER A N   
1556 C CA  . SER A 217 ? 0.9369 0.8947 0.6006 -0.3013 -0.0537 0.1759  205 SER A CA  
1557 C C   . SER A 217 ? 0.9669 0.8618 0.6029 -0.2843 -0.0393 0.1549  205 SER A C   
1558 O O   . SER A 217 ? 1.0312 0.8586 0.5981 -0.3091 -0.0439 0.1547  205 SER A O   
1559 C CB  . SER A 217 ? 0.9923 0.8968 0.5910 -0.3272 -0.0594 0.1728  205 SER A CB  
1560 O OG  . SER A 217 ? 1.0036 0.8657 0.5941 -0.2961 -0.0384 0.1459  205 SER A OG  
1561 N N   . ILE A 218 ? 0.9262 0.8402 0.6122 -0.2432 -0.0217 0.1395  206 ILE A N   
1562 C CA  . ILE A 218 ? 0.9381 0.8029 0.6085 -0.2236 -0.0070 0.1223  206 ILE A CA  
1563 C C   . ILE A 218 ? 0.9366 0.8167 0.6130 -0.2351 -0.0157 0.1333  206 ILE A C   
1564 O O   . ILE A 218 ? 0.9170 0.8676 0.6439 -0.2344 -0.0236 0.1486  206 ILE A O   
1565 C CB  . ILE A 218 ? 0.8943 0.7803 0.6174 -0.1800 0.0113  0.1055  206 ILE A CB  
1566 C CG1 . ILE A 218 ? 0.9180 0.7394 0.6048 -0.1656 0.0274  0.0892  206 ILE A CG1 
1567 C CG2 . ILE A 218 ? 0.8742 0.7965 0.6448 -0.1584 0.0162  0.1041  206 ILE A CG2 
1568 C CD1 . ILE A 218 ? 0.9091 0.7251 0.5830 -0.1698 0.0271  0.0872  206 ILE A CD1 
1569 N N   . ASN A 219 ? 0.9691 0.7816 0.5915 -0.2450 -0.0130 0.1278  207 ASN A N   
1570 C CA  . ASN A 219 ? 0.9783 0.7930 0.5922 -0.2637 -0.0244 0.1393  207 ASN A CA  
1571 C C   . ASN A 219 ? 0.9164 0.7368 0.5666 -0.2302 -0.0093 0.1255  207 ASN A C   
1572 O O   . ASN A 219 ? 0.9174 0.7452 0.5702 -0.2387 -0.0159 0.1321  207 ASN A O   
1573 C CB  . ASN A 219 ? 1.0788 0.8008 0.5966 -0.2990 -0.0311 0.1425  207 ASN A CB  
1574 C CG  . ASN A 219 ? 1.1592 0.8957 0.6516 -0.3475 -0.0593 0.1689  207 ASN A CG  
1575 O OD1 . ASN A 219 ? 1.2273 0.9253 0.6550 -0.3885 -0.0753 0.1821  207 ASN A OD1 
1576 N ND2 . ASN A 219 ? 1.1300 0.9196 0.6688 -0.3451 -0.0662 0.1787  207 ASN A ND2 
1577 N N   . ARG A 220 ? 0.8567 0.6701 0.5308 -0.1941 0.0101  0.1073  208 ARG A N   
1578 C CA  . ARG A 220 ? 0.8091 0.6283 0.5162 -0.1639 0.0236  0.0954  208 ARG A CA  
1579 C C   . ARG A 220 ? 0.7466 0.6355 0.5224 -0.1373 0.0280  0.0927  208 ARG A C   
1580 O O   . ARG A 220 ? 0.7444 0.6483 0.5294 -0.1350 0.0280  0.0932  208 ARG A O   
1581 C CB  . ARG A 220 ? 0.8341 0.5801 0.5031 -0.1476 0.0423  0.0820  208 ARG A CB  
1582 C CG  . ARG A 220 ? 0.8820 0.5433 0.4662 -0.1741 0.0410  0.0865  208 ARG A CG  
1583 C CD  . ARG A 220 ? 0.8947 0.4886 0.4488 -0.1513 0.0634  0.0774  208 ARG A CD  
1584 N NE  . ARG A 220 ? 0.9497 0.4491 0.4126 -0.1742 0.0654  0.0824  208 ARG A NE  
1585 C CZ  . ARG A 220 ? 1.0195 0.4402 0.4067 -0.1818 0.0759  0.0848  208 ARG A CZ  
1586 N NH1 . ARG A 220 ? 1.0894 0.4139 0.3832 -0.2039 0.0784  0.0903  208 ARG A NH1 
1587 N NH2 . ARG A 220 ? 0.9689 0.4003 0.3670 -0.1673 0.0851  0.0822  208 ARG A NH2 
1588 N N   . TYR A 221 ? 0.6910 0.6175 0.5076 -0.1197 0.0314  0.0911  209 TYR A N   
1589 C CA  . TYR A 221 ? 0.6307 0.6188 0.4996 -0.0996 0.0344  0.0939  209 TYR A CA  
1590 C C   . TYR A 221 ? 0.5650 0.5563 0.4582 -0.0727 0.0460  0.0818  209 TYR A C   
1591 O O   . TYR A 221 ? 0.5466 0.5216 0.4312 -0.0733 0.0472  0.0783  209 TYR A O   
1592 C CB  . TYR A 221 ? 0.6279 0.6743 0.5196 -0.1106 0.0245  0.1152  209 TYR A CB  
1593 C CG  . TYR A 221 ? 0.6856 0.7459 0.5599 -0.1431 0.0082  0.1357  209 TYR A CG  
1594 C CD1 . TYR A 221 ? 0.7635 0.8330 0.6380 -0.1479 0.0058  0.1401  209 TYR A CD1 
1595 C CD2 . TYR A 221 ? 0.7274 0.7938 0.5851 -0.1712 -0.0061 0.1527  209 TYR A CD2 
1596 C CE1 . TYR A 221 ? 0.8113 0.8961 0.6692 -0.1805 -0.0106 0.1610  209 TYR A CE1 
1597 C CE2 . TYR A 221 ? 0.8088 0.8904 0.6490 -0.2060 -0.0242 0.1755  209 TYR A CE2 
1598 C CZ  . TYR A 221 ? 0.8384 0.9301 0.6789 -0.2107 -0.0264 0.1798  209 TYR A CZ  
1599 O OH  . TYR A 221 ? 0.9019 1.0100 0.7235 -0.2480 -0.0458 0.2042  209 TYR A OH  
1600 N N   . VAL A 222 ? 0.5097 0.5217 0.4301 -0.0516 0.0533  0.0771  210 VAL A N   
1601 C CA  . VAL A 222 ? 0.4717 0.4928 0.4121 -0.0300 0.0618  0.0695  210 VAL A CA  
1602 C C   . VAL A 222 ? 0.4329 0.4987 0.3913 -0.0256 0.0619  0.0819  210 VAL A C   
1603 O O   . VAL A 222 ? 0.4141 0.5125 0.3822 -0.0291 0.0594  0.0968  210 VAL A O   
1604 C CB  . VAL A 222 ? 0.4738 0.4885 0.4248 -0.0136 0.0680  0.0614  210 VAL A CB  
1605 C CG1 . VAL A 222 ? 0.4374 0.4572 0.4006 0.0042  0.0747  0.0554  210 VAL A CG1 
1606 C CG2 . VAL A 222 ? 0.5014 0.4757 0.4374 -0.0152 0.0704  0.0540  210 VAL A CG2 
1607 N N   . ILE A 223 ? 0.3980 0.4659 0.3601 -0.0175 0.0660  0.0783  211 ILE A N   
1608 C CA  . ILE A 223 ? 0.3889 0.4995 0.3664 -0.0100 0.0694  0.0927  211 ILE A CA  
1609 C C   . ILE A 223 ? 0.3816 0.5019 0.3668 0.0136  0.0816  0.0925  211 ILE A C   
1610 O O   . ILE A 223 ? 0.3825 0.4756 0.3612 0.0256  0.0871  0.0770  211 ILE A O   
1611 C CB  . ILE A 223 ? 0.3792 0.4860 0.3549 -0.0067 0.0716  0.0879  211 ILE A CB  
1612 C CG1 . ILE A 223 ? 0.4095 0.4948 0.3670 -0.0326 0.0593  0.0892  211 ILE A CG1 
1613 C CG2 . ILE A 223 ? 0.3562 0.5105 0.3479 0.0049  0.0784  0.1063  211 ILE A CG2 
1614 C CD1 . ILE A 223 ? 0.4084 0.4781 0.3593 -0.0313 0.0607  0.0815  211 ILE A CD1 
1615 N N   . THR A 224 ? 0.3755 0.5297 0.3702 0.0188  0.0856  0.1117  212 THR A N   
1616 C CA  . THR A 224 ? 0.3845 0.5358 0.3747 0.0412  0.0994  0.1139  212 THR A CA  
1617 C C   . THR A 224 ? 0.3900 0.5674 0.3815 0.0611  0.1146  0.1309  212 THR A C   
1618 O O   . THR A 224 ? 0.3719 0.5858 0.3778 0.0572  0.1135  0.1474  212 THR A O   
1619 C CB  . THR A 224 ? 0.3822 0.5420 0.3756 0.0383  0.0982  0.1243  212 THR A CB  
1620 O OG1 . THR A 224 ? 0.3913 0.5974 0.4018 0.0300  0.0951  0.1496  212 THR A OG1 
1621 C CG2 . THR A 224 ? 0.3985 0.5331 0.3878 0.0209  0.0857  0.1101  212 THR A CG2 
1622 N N   . ARG A 225 ? 0.4772 0.4372 0.4323 0.1408  0.0391  -0.0069 213 ARG A N   
1623 C CA  . ARG A 225 ? 0.5002 0.4666 0.4479 0.1398  0.0346  -0.0149 213 ARG A CA  
1624 C C   . ARG A 225 ? 0.5111 0.4749 0.4279 0.1400  0.0670  0.0119  213 ARG A C   
1625 O O   . ARG A 225 ? 0.4661 0.4385 0.3963 0.1214  0.0764  0.0122  213 ARG A O   
1626 C CB  . ARG A 225 ? 0.5641 0.5248 0.4822 0.1776  -0.0019 -0.0381 213 ARG A CB  
1627 C CG  . ARG A 225 ? 0.6449 0.6077 0.5473 0.1860  -0.0133 -0.0510 213 ARG A CG  
1628 C CD  . ARG A 225 ? 0.7905 0.7413 0.6515 0.2351  -0.0551 -0.0773 213 ARG A CD  
1629 N NE  . ARG A 225 ? 0.8617 0.8129 0.7559 0.2336  -0.0928 -0.1097 213 ARG A NE  
1630 C CZ  . ARG A 225 ? 0.9094 0.8601 0.8629 0.2309  -0.1361 -0.1393 213 ARG A CZ  
1631 N NH1 . ARG A 225 ? 0.9121 0.8657 0.8992 0.2288  -0.1471 -0.1426 213 ARG A NH1 
1632 N NH2 . ARG A 225 ? 0.9274 0.8750 0.9165 0.2297  -0.1699 -0.1653 213 ARG A NH2 
1633 N N   . GLU A 226 ? 0.5603 0.5133 0.4428 0.1612  0.0849  0.0370  214 GLU A N   
1634 C CA  . GLU A 226 ? 0.5910 0.5455 0.4541 0.1664  0.1178  0.0683  214 GLU A CA  
1635 C C   . GLU A 226 ? 0.5243 0.4821 0.4423 0.1244  0.1383  0.0802  214 GLU A C   
1636 O O   . GLU A 226 ? 0.4866 0.4538 0.4188 0.1113  0.1540  0.0894  214 GLU A O   
1637 C CB  . GLU A 226 ? 0.6709 0.6128 0.4907 0.2020  0.1368  0.1007  214 GLU A CB  
1638 C CG  . GLU A 226 ? 0.8159 0.7468 0.5750 0.2510  0.1106  0.0870  214 GLU A CG  
1639 C CD  . GLU A 226 ? 0.8886 0.8106 0.6725 0.2434  0.0823  0.0648  214 GLU A CD  
1640 O OE1 . GLU A 226 ? 0.8894 0.8163 0.6857 0.2449  0.0450  0.0275  214 GLU A OE1 
1641 O OE2 . GLU A 226 ? 0.9885 0.8989 0.7874 0.2358  0.0967  0.0851  214 GLU A OE2 
1642 N N   . MET A 227 ? 0.5117 0.4611 0.4603 0.1069  0.1347  0.0771  215 MET A N   
1643 C CA  . MET A 227 ? 0.5006 0.4494 0.4970 0.0732  0.1440  0.0786  215 MET A CA  
1644 C C   . MET A 227 ? 0.4627 0.4259 0.4770 0.0518  0.1365  0.0575  215 MET A C   
1645 O O   . MET A 227 ? 0.4442 0.4107 0.4798 0.0350  0.1471  0.0631  215 MET A O   
1646 C CB  . MET A 227 ? 0.5030 0.4398 0.5187 0.0673  0.1349  0.0709  215 MET A CB  
1647 C CG  . MET A 227 ? 0.5308 0.4614 0.5873 0.0421  0.1379  0.0670  215 MET A CG  
1648 S SD  . MET A 227 ? 0.5832 0.5027 0.6532 0.0434  0.1244  0.0514  215 MET A SD  
1649 C CE  . MET A 227 ? 0.4666 0.3697 0.5101 0.0712  0.1261  0.0732  215 MET A CE  
1650 N N   . VAL A 228 ? 0.4508 0.4219 0.4616 0.0536  0.1175  0.0349  216 VAL A N   
1651 C CA  . VAL A 228 ? 0.4241 0.4064 0.4530 0.0357  0.1125  0.0203  216 VAL A CA  
1652 C C   . VAL A 228 ? 0.4546 0.4429 0.4667 0.0402  0.1168  0.0239  216 VAL A C   
1653 O O   . VAL A 228 ? 0.4227 0.4160 0.4499 0.0234  0.1226  0.0226  216 VAL A O   
1654 C CB  . VAL A 228 ? 0.4230 0.4132 0.4679 0.0368  0.0923  0.0011  216 VAL A CB  
1655 C CG1 . VAL A 228 ? 0.3768 0.3767 0.4399 0.0230  0.0883  -0.0079 216 VAL A CG1 
1656 C CG2 . VAL A 228 ? 0.3987 0.3894 0.4679 0.0307  0.0937  -0.0010 216 VAL A CG2 
1657 N N   . ARG A 229 ? 0.4923 0.4798 0.4686 0.0679  0.1126  0.0270  217 ARG A N   
1658 C CA  . ARG A 229 ? 0.5251 0.5198 0.4794 0.0796  0.1182  0.0306  217 ARG A CA  
1659 C C   . ARG A 229 ? 0.5095 0.5096 0.4809 0.0673  0.1463  0.0549  217 ARG A C   
1660 O O   . ARG A 229 ? 0.5006 0.5102 0.4826 0.0579  0.1505  0.0528  217 ARG A O   
1661 C CB  . ARG A 229 ? 0.5852 0.5766 0.4858 0.1227  0.1113  0.0320  217 ARG A CB  
1662 C CG  . ARG A 229 ? 0.6520 0.6518 0.5242 0.1421  0.1134  0.0303  217 ARG A CG  
1663 C CD  . ARG A 229 ? 0.7838 0.7773 0.5916 0.1946  0.0969  0.0215  217 ARG A CD  
1664 N NE  . ARG A 229 ? 0.8946 0.8849 0.6619 0.2262  0.1209  0.0517  217 ARG A NE  
1665 C CZ  . ARG A 229 ? 0.9765 0.9533 0.7274 0.2414  0.1110  0.0524  217 ARG A CZ  
1666 N NH1 . ARG A 229 ? 1.0292 1.0020 0.7411 0.2723  0.1379  0.0865  217 ARG A NH1 
1667 N NH2 . ARG A 229 ? 0.9820 0.9504 0.7591 0.2278  0.0765  0.0228  217 ARG A NH2 
1668 N N   . SER A 230 ? 0.5144 0.5076 0.4975 0.0667  0.1633  0.0776  218 SER A N   
1669 C CA  . SER A 230 ? 0.5222 0.5204 0.5417 0.0534  0.1870  0.1020  218 SER A CA  
1670 C C   . SER A 230 ? 0.4847 0.4812 0.5499 0.0206  0.1782  0.0867  218 SER A C   
1671 O O   . SER A 230 ? 0.4783 0.4815 0.5799 0.0088  0.1887  0.0974  218 SER A O   
1672 C CB  . SER A 230 ? 0.5484 0.5365 0.5804 0.0615  0.2073  0.1349  218 SER A CB  
1673 O OG  . SER A 230 ? 0.5965 0.5676 0.6516 0.0446  0.1933  0.1230  218 SER A OG  
1674 N N   . LEU A 231 ? 0.4574 0.4465 0.5223 0.0098  0.1593  0.0626  219 LEU A N   
1675 C CA  . LEU A 231 ? 0.4454 0.4315 0.5384 -0.0111 0.1508  0.0473  219 LEU A CA  
1676 C C   . LEU A 231 ? 0.4399 0.4359 0.5240 -0.0166 0.1427  0.0310  219 LEU A C   
1677 O O   . LEU A 231 ? 0.4423 0.4366 0.5430 -0.0281 0.1376  0.0216  219 LEU A O   
1678 C CB  . LEU A 231 ? 0.4437 0.4178 0.5398 -0.0143 0.1406  0.0348  219 LEU A CB  
1679 C CG  . LEU A 231 ? 0.4557 0.4134 0.5702 -0.0127 0.1433  0.0458  219 LEU A CG  
1680 C CD1 . LEU A 231 ? 0.4299 0.3801 0.5379 -0.0095 0.1324  0.0298  219 LEU A CD1 
1681 C CD2 . LEU A 231 ? 0.4391 0.3872 0.5999 -0.0251 0.1442  0.0528  219 LEU A CD2 
1682 N N   . LEU A 232 ? 0.4485 0.4518 0.5069 -0.0058 0.1379  0.0260  220 LEU A N   
1683 C CA  . LEU A 232 ? 0.4536 0.4626 0.5084 -0.0108 0.1291  0.0129  220 LEU A CA  
1684 C C   . LEU A 232 ? 0.4441 0.4592 0.5116 -0.0175 0.1347  0.0157  220 LEU A C   
1685 O O   . LEU A 232 ? 0.4512 0.4742 0.5221 -0.0103 0.1463  0.0293  220 LEU A O   
1686 C CB  . LEU A 232 ? 0.4733 0.4858 0.5052 0.0055  0.1192  0.0069  220 LEU A CB  
1687 C CG  . LEU A 232 ? 0.5147 0.5238 0.5503 0.0076  0.1014  -0.0063 220 LEU A CG  
1688 C CD1 . LEU A 232 ? 0.5478 0.5571 0.5672 0.0244  0.0845  -0.0176 220 LEU A CD1 
1689 C CD2 . LEU A 232 ? 0.4750 0.4845 0.5368 -0.0104 0.1005  -0.0106 220 LEU A CD2 
1690 N N   . PRO A 233 ? 0.4411 0.4541 0.5163 -0.0282 0.1276  0.0044  221 PRO A N   
1691 C CA  . PRO A 233 ? 0.4358 0.4554 0.5266 -0.0322 0.1286  0.0046  221 PRO A CA  
1692 C C   . PRO A 233 ? 0.4354 0.4672 0.5138 -0.0219 0.1316  0.0076  221 PRO A C   
1693 O O   . PRO A 233 ? 0.4172 0.4475 0.4717 -0.0128 0.1248  0.0017  221 PRO A O   
1694 C CB  . PRO A 233 ? 0.4329 0.4448 0.5192 -0.0379 0.1170  -0.0101 221 PRO A CB  
1695 C CG  . PRO A 233 ? 0.4229 0.4283 0.4936 -0.0364 0.1157  -0.0128 221 PRO A CG  
1696 C CD  . PRO A 233 ? 0.4460 0.4516 0.5180 -0.0332 0.1209  -0.0055 221 PRO A CD  
1697 N N   . GLU A 234 ? 0.4493 0.4934 0.5504 -0.0218 0.1399  0.0157  222 GLU A N   
1698 C CA  . GLU A 234 ? 0.4639 0.5227 0.5554 -0.0088 0.1444  0.0181  222 GLU A CA  
1699 C C   . GLU A 234 ? 0.4426 0.4964 0.5219 -0.0115 0.1274  -0.0003 222 GLU A C   
1700 O O   . GLU A 234 ? 0.4583 0.5015 0.5442 -0.0236 0.1167  -0.0103 222 GLU A O   
1701 C CB  . GLU A 234 ? 0.4796 0.5576 0.6139 -0.0091 0.1616  0.0361  222 GLU A CB  
1702 C CG  . GLU A 234 ? 0.5431 0.6276 0.6859 0.0003  0.1848  0.0631  222 GLU A CG  
1703 C CD  . GLU A 234 ? 0.6461 0.7537 0.8459 0.0003  0.2077  0.0894  222 GLU A CD  
1704 O OE1 . GLU A 234 ? 0.7107 0.8399 0.9067 0.0160  0.2193  0.0959  222 GLU A OE1 
1705 O OE2 . GLU A 234 ? 0.7110 0.8157 0.9663 -0.0142 0.2138  0.1042  222 GLU A OE2 
1706 N N   . ARG A 235 ? 0.4250 0.4835 0.4809 0.0042  0.1238  -0.0048 223 ARG A N   
1707 C CA  . ARG A 235 ? 0.4081 0.4598 0.4558 0.0035  0.1076  -0.0196 223 ARG A CA  
1708 C C   . ARG A 235 ? 0.4012 0.4712 0.4538 0.0168  0.1133  -0.0179 223 ARG A C   
1709 O O   . ARG A 235 ? 0.3895 0.4619 0.4164 0.0380  0.1095  -0.0229 223 ARG A O   
1710 C CB  . ARG A 235 ? 0.4158 0.4524 0.4401 0.0118  0.0910  -0.0305 223 ARG A CB  
1711 C CG  . ARG A 235 ? 0.3962 0.4201 0.4244 0.0016  0.0867  -0.0301 223 ARG A CG  
1712 C CD  . ARG A 235 ? 0.3669 0.3820 0.4080 -0.0153 0.0863  -0.0290 223 ARG A CD  
1713 N NE  . ARG A 235 ? 0.3387 0.3435 0.3811 -0.0161 0.0744  -0.0339 223 ARG A NE  
1714 C CZ  . ARG A 235 ? 0.3371 0.3324 0.3851 -0.0245 0.0762  -0.0281 223 ARG A CZ  
1715 N NH1 . ARG A 235 ? 0.3281 0.3240 0.3763 -0.0299 0.0871  -0.0215 223 ARG A NH1 
1716 N NH2 . ARG A 235 ? 0.3486 0.3331 0.4003 -0.0240 0.0682  -0.0270 223 ARG A NH2 
1717 N N   . PRO A 236 ? 0.3769 0.4600 0.4656 0.0076  0.1198  -0.0130 224 PRO A N   
1718 C CA  . PRO A 236 ? 0.3882 0.4950 0.4912 0.0217  0.1287  -0.0083 224 PRO A CA  
1719 C C   . PRO A 236 ? 0.3821 0.4792 0.4595 0.0304  0.1091  -0.0269 224 PRO A C   
1720 O O   . PRO A 236 ? 0.3593 0.4348 0.4297 0.0180  0.0909  -0.0390 224 PRO A O   
1721 C CB  . PRO A 236 ? 0.3719 0.4910 0.5337 0.0057  0.1306  -0.0040 224 PRO A CB  
1722 C CG  . PRO A 236 ? 0.3856 0.4799 0.5457 -0.0119 0.1133  -0.0162 224 PRO A CG  
1723 C CD  . PRO A 236 ? 0.3855 0.4627 0.5064 -0.0116 0.1155  -0.0143 224 PRO A CD  
1724 N N   . ARG A 237 ? 0.3781 0.4896 0.4403 0.0547  0.1140  -0.0272 225 ARG A N   
1725 C CA  . ARG A 237 ? 0.4067 0.5063 0.4456 0.0666  0.0930  -0.0458 225 ARG A CA  
1726 C C   . ARG A 237 ? 0.3820 0.4793 0.4442 0.0539  0.0810  -0.0538 225 ARG A C   
1727 O O   . ARG A 237 ? 0.3851 0.4574 0.4301 0.0508  0.0602  -0.0664 225 ARG A O   
1728 C CB  . ARG A 237 ? 0.4250 0.5417 0.4402 0.1017  0.0993  -0.0473 225 ARG A CB  
1729 C CG  . ARG A 237 ? 0.5165 0.6253 0.4923 0.1222  0.0999  -0.0473 225 ARG A CG  
1730 C CD  . ARG A 237 ? 0.6172 0.7288 0.5509 0.1650  0.0911  -0.0610 225 ARG A CD  
1731 N NE  . ARG A 237 ? 0.6616 0.8111 0.5931 0.1930  0.1258  -0.0394 225 ARG A NE  
1732 C CZ  . ARG A 237 ? 0.6844 0.8515 0.5928 0.2313  0.1301  -0.0443 225 ARG A CZ  
1733 N NH1 . ARG A 237 ? 0.7066 0.8530 0.5927 0.2448  0.0968  -0.0743 225 ARG A NH1 
1734 N NH2 . ARG A 237 ? 0.7052 0.9117 0.6178 0.2574  0.1701  -0.0161 225 ARG A NH2 
1735 N N   . ASP A 238 ? 0.3457 0.4660 0.4516 0.0464  0.0920  -0.0456 226 ASP A N   
1736 C CA  . ASP A 238 ? 0.3499 0.4672 0.4758 0.0397  0.0751  -0.0573 226 ASP A CA  
1737 C C   . ASP A 238 ? 0.3516 0.4469 0.4802 0.0197  0.0641  -0.0610 226 ASP A C   
1738 O O   . ASP A 238 ? 0.3676 0.4726 0.5361 0.0097  0.0659  -0.0583 226 ASP A O   
1739 C CB  . ASP A 238 ? 0.3351 0.4882 0.5181 0.0435  0.0855  -0.0508 226 ASP A CB  
1740 C CG  . ASP A 238 ? 0.3453 0.4947 0.5454 0.0429  0.0613  -0.0682 226 ASP A CG  
1741 O OD1 . ASP A 238 ? 0.3342 0.4561 0.4913 0.0481  0.0407  -0.0827 226 ASP A OD1 
1742 O OD2 . ASP A 238 ? 0.3494 0.5250 0.6119 0.0398  0.0631  -0.0657 226 ASP A OD2 
1743 N N   . SER A 239 ? 0.3614 0.4270 0.4510 0.0169  0.0526  -0.0664 227 SER A N   
1744 C CA  . SER A 239 ? 0.3651 0.4110 0.4460 0.0054  0.0474  -0.0669 227 SER A CA  
1745 C C   . SER A 239 ? 0.3899 0.4096 0.4377 0.0107  0.0329  -0.0717 227 SER A C   
1746 O O   . SER A 239 ? 0.3985 0.4125 0.4355 0.0193  0.0255  -0.0746 227 SER A O   
1747 C CB  . SER A 239 ? 0.3581 0.3990 0.4293 -0.0022 0.0605  -0.0567 227 SER A CB  
1748 O OG  . SER A 239 ? 0.3805 0.4127 0.4295 0.0035  0.0598  -0.0552 227 SER A OG  
1749 N N   . HIS A 240 ? 0.4009 0.4040 0.4324 0.0094  0.0292  -0.0715 228 HIS A N   
1750 C CA  . HIS A 240 ? 0.4268 0.4050 0.4238 0.0182  0.0230  -0.0672 228 HIS A CA  
1751 C C   . HIS A 240 ? 0.4192 0.3861 0.3978 0.0163  0.0337  -0.0574 228 HIS A C   
1752 O O   . HIS A 240 ? 0.4049 0.3815 0.3976 0.0084  0.0402  -0.0591 228 HIS A O   
1753 C CB  . HIS A 240 ? 0.4576 0.4303 0.4446 0.0332  0.0042  -0.0800 228 HIS A CB  
1754 C CG  . HIS A 240 ? 0.4971 0.4783 0.5012 0.0357  -0.0072 -0.0953 228 HIS A CG  
1755 N ND1 . HIS A 240 ? 0.6723 0.6357 0.6454 0.0491  -0.0159 -0.1010 228 HIS A ND1 
1756 C CD2 . HIS A 240 ? 0.5716 0.5767 0.6273 0.0286  -0.0128 -0.1058 228 HIS A CD2 
1757 C CE1 . HIS A 240 ? 0.6460 0.6178 0.6512 0.0498  -0.0333 -0.1201 228 HIS A CE1 
1758 N NE2 . HIS A 240 ? 0.6330 0.6311 0.6961 0.0344  -0.0302 -0.1207 228 HIS A NE2 
1759 N N   . LYS A 241 ? 0.4254 0.3726 0.3745 0.0258  0.0378  -0.0445 229 LYS A N   
1760 C CA  . LYS A 241 ? 0.4450 0.3865 0.3797 0.0271  0.0534  -0.0310 229 LYS A CA  
1761 C C   . LYS A 241 ? 0.4496 0.3931 0.3706 0.0363  0.0480  -0.0452 229 LYS A C   
1762 O O   . LYS A 241 ? 0.4250 0.3724 0.3493 0.0316  0.0595  -0.0406 229 LYS A O   
1763 C CB  . LYS A 241 ? 0.4946 0.4175 0.4044 0.0396  0.0650  -0.0071 229 LYS A CB  
1764 C CG  . LYS A 241 ? 0.5511 0.4589 0.4143 0.0666  0.0602  -0.0065 229 LYS A CG  
1765 C CD  . LYS A 241 ? 0.6332 0.5274 0.4811 0.0771  0.0863  0.0312  229 LYS A CD  
1766 C CE  . LYS A 241 ? 0.6905 0.5652 0.4809 0.1118  0.0864  0.0410  229 LYS A CE  
1767 N NZ  . LYS A 241 ? 0.7838 0.6486 0.5797 0.1107  0.0664  0.0325  229 LYS A NZ  
1768 N N   . GLY A 242 ? 0.4673 0.4072 0.3783 0.0506  0.0263  -0.0651 230 GLY A N   
1769 C CA  . GLY A 242 ? 0.4922 0.4304 0.4016 0.0610  0.0100  -0.0861 230 GLY A CA  
1770 C C   . GLY A 242 ? 0.4464 0.4019 0.4079 0.0382  0.0121  -0.0917 230 GLY A C   
1771 O O   . GLY A 242 ? 0.4677 0.4188 0.4297 0.0418  0.0083  -0.0996 230 GLY A O   
1772 N N   . THR A 243 ? 0.4028 0.3766 0.4038 0.0188  0.0197  -0.0855 231 THR A N   
1773 C CA  . THR A 243 ? 0.3897 0.3793 0.4320 0.0011  0.0301  -0.0811 231 THR A CA  
1774 C C   . THR A 243 ? 0.3931 0.3768 0.4202 -0.0029 0.0458  -0.0705 231 THR A C   
1775 O O   . THR A 243 ? 0.3735 0.3617 0.4266 -0.0107 0.0477  -0.0716 231 THR A O   
1776 C CB  . THR A 243 ? 0.3760 0.3844 0.4410 -0.0093 0.0427  -0.0703 231 THR A CB  
1777 O OG1 . THR A 243 ? 0.3919 0.4076 0.4686 -0.0030 0.0308  -0.0786 231 THR A OG1 
1778 C CG2 . THR A 243 ? 0.3503 0.3765 0.4571 -0.0209 0.0550  -0.0625 231 THR A CG2 
1779 N N   . TYR A 244 ? 0.3955 0.3704 0.3891 0.0017  0.0579  -0.0575 232 TYR A N   
1780 C CA  . TYR A 244 ? 0.3923 0.3675 0.3829 -0.0033 0.0743  -0.0450 232 TYR A CA  
1781 C C   . TYR A 244 ? 0.4319 0.3948 0.3881 0.0146  0.0778  -0.0442 232 TYR A C   
1782 O O   . TYR A 244 ? 0.4017 0.3663 0.3537 0.0146  0.0945  -0.0301 232 TYR A O   
1783 C CB  . TYR A 244 ? 0.3708 0.3488 0.3678 -0.0114 0.0846  -0.0297 232 TYR A CB  
1784 C CG  . TYR A 244 ? 0.3507 0.3405 0.3704 -0.0198 0.0798  -0.0345 232 TYR A CG  
1785 C CD1 . TYR A 244 ? 0.3314 0.3329 0.3700 -0.0259 0.0842  -0.0355 232 TYR A CD1 
1786 C CD2 . TYR A 244 ? 0.3258 0.3148 0.3449 -0.0170 0.0723  -0.0363 232 TYR A CD2 
1787 C CE1 . TYR A 244 ? 0.3195 0.3343 0.3714 -0.0256 0.0852  -0.0355 232 TYR A CE1 
1788 C CE2 . TYR A 244 ? 0.3313 0.3328 0.3636 -0.0168 0.0696  -0.0411 232 TYR A CE2 
1789 C CZ  . TYR A 244 ? 0.3137 0.3295 0.3602 -0.0195 0.0781  -0.0393 232 TYR A CZ  
1790 O OH  . TYR A 244 ? 0.3199 0.3506 0.3724 -0.0118 0.0807  -0.0395 232 TYR A OH  
1791 N N   . GLY A 245 ? 0.3204 0.4221 0.4380 -0.0249 0.0484  -0.0372 233 GLY A N   
1792 C CA  . GLY A 245 ? 0.3236 0.4194 0.4350 -0.0276 0.0371  -0.0383 233 GLY A CA  
1793 C C   . GLY A 245 ? 0.3302 0.4214 0.4286 -0.0199 0.0259  -0.0380 233 GLY A C   
1794 O O   . GLY A 245 ? 0.3292 0.4175 0.4191 -0.0123 0.0260  -0.0361 233 GLY A O   
1795 N N   . LYS A 246 ? 0.3382 0.4264 0.4329 -0.0227 0.0169  -0.0399 234 LYS A N   
1796 C CA  . LYS A 246 ? 0.3407 0.4253 0.4235 -0.0173 0.0066  -0.0398 234 LYS A CA  
1797 C C   . LYS A 246 ? 0.3334 0.4034 0.3987 -0.0200 0.0045  -0.0395 234 LYS A C   
1798 O O   . LYS A 246 ? 0.3202 0.3871 0.3883 -0.0266 0.0051  -0.0421 234 LYS A O   
1799 C CB  . LYS A 246 ? 0.3586 0.4578 0.4566 -0.0169 -0.0039 -0.0437 234 LYS A CB  
1800 C CG  . LYS A 246 ? 0.4088 0.5245 0.5273 -0.0126 -0.0030 -0.0445 234 LYS A CG  
1801 C CD  . LYS A 246 ? 0.4952 0.6270 0.6305 -0.0120 -0.0152 -0.0483 234 LYS A CD  
1802 C CE  . LYS A 246 ? 0.5343 0.6879 0.6997 -0.0113 -0.0122 -0.0507 234 LYS A CE  
1803 N NZ  . LYS A 246 ? 0.6115 0.7809 0.7957 -0.0164 -0.0238 -0.0558 234 LYS A NZ  
1804 N N   . VAL A 247 ? 0.3248 0.3858 0.3727 -0.0148 0.0028  -0.0365 235 VAL A N   
1805 C CA  . VAL A 247 ? 0.3273 0.3765 0.3593 -0.0152 0.0015  -0.0361 235 VAL A CA  
1806 C C   . VAL A 247 ? 0.3330 0.3831 0.3566 -0.0117 -0.0071 -0.0369 235 VAL A C   
1807 O O   . VAL A 247 ? 0.3213 0.3751 0.3439 -0.0072 -0.0101 -0.0347 235 VAL A O   
1808 C CB  . VAL A 247 ? 0.3393 0.3786 0.3587 -0.0125 0.0079  -0.0315 235 VAL A CB  
1809 C CG1 . VAL A 247 ? 0.3028 0.3334 0.3083 -0.0109 0.0062  -0.0307 235 VAL A CG1 
1810 C CG2 . VAL A 247 ? 0.3119 0.3469 0.3348 -0.0162 0.0170  -0.0299 235 VAL A CG2 
1811 N N   . LEU A 248 ? 0.3335 0.3784 0.3495 -0.0138 -0.0105 -0.0400 236 LEU A N   
1812 C CA  . LEU A 248 ? 0.3383 0.3804 0.3403 -0.0106 -0.0160 -0.0399 236 LEU A CA  
1813 C C   . LEU A 248 ? 0.3477 0.3800 0.3370 -0.0093 -0.0106 -0.0384 236 LEU A C   
1814 O O   . LEU A 248 ? 0.3704 0.3960 0.3595 -0.0115 -0.0068 -0.0402 236 LEU A O   
1815 C CB  . LEU A 248 ? 0.3470 0.3906 0.3477 -0.0131 -0.0240 -0.0454 236 LEU A CB  
1816 C CG  . LEU A 248 ? 0.3377 0.3766 0.3203 -0.0105 -0.0288 -0.0460 236 LEU A CG  
1817 C CD1 . LEU A 248 ? 0.3172 0.3604 0.2957 -0.0058 -0.0336 -0.0413 236 LEU A CD1 
1818 C CD2 . LEU A 248 ? 0.3315 0.3687 0.3101 -0.0140 -0.0359 -0.0530 236 LEU A CD2 
1819 N N   . ILE A 249 ? 0.3342 0.3657 0.3143 -0.0056 -0.0102 -0.0346 237 ILE A N   
1820 C CA  . ILE A 249 ? 0.3548 0.3809 0.3254 -0.0037 -0.0060 -0.0332 237 ILE A CA  
1821 C C   . ILE A 249 ? 0.3530 0.3786 0.3115 -0.0024 -0.0089 -0.0344 237 ILE A C   
1822 O O   . ILE A 249 ? 0.3569 0.3852 0.3113 -0.0015 -0.0124 -0.0319 237 ILE A O   
1823 C CB  . ILE A 249 ? 0.3590 0.3860 0.3299 -0.0018 -0.0023 -0.0279 237 ILE A CB  
1824 C CG1 . ILE A 249 ? 0.3867 0.4121 0.3654 -0.0030 0.0012  -0.0271 237 ILE A CG1 
1825 C CG2 . ILE A 249 ? 0.3678 0.3928 0.3315 0.0003  0.0009  -0.0266 237 ILE A CG2 
1826 C CD1 . ILE A 249 ? 0.4133 0.4384 0.3913 -0.0016 0.0037  -0.0231 237 ILE A CD1 
1827 N N   . ILE A 250 ? 0.3585 0.3788 0.3101 -0.0022 -0.0072 -0.0386 238 ILE A N   
1828 C CA  . ILE A 250 ? 0.3635 0.3818 0.3008 -0.0007 -0.0077 -0.0405 238 ILE A CA  
1829 C C   . ILE A 250 ? 0.3642 0.3829 0.2987 0.0024  -0.0003 -0.0379 238 ILE A C   
1830 O O   . ILE A 250 ? 0.3851 0.4000 0.3224 0.0043  0.0037  -0.0398 238 ILE A O   
1831 C CB  . ILE A 250 ? 0.3685 0.3801 0.2992 -0.0021 -0.0103 -0.0481 238 ILE A CB  
1832 C CG1 . ILE A 250 ? 0.3749 0.3890 0.3111 -0.0060 -0.0190 -0.0511 238 ILE A CG1 
1833 C CG2 . ILE A 250 ? 0.3654 0.3736 0.2781 0.0002  -0.0088 -0.0504 238 ILE A CG2 
1834 C CD1 . ILE A 250 ? 0.3867 0.3939 0.3188 -0.0092 -0.0229 -0.0595 238 ILE A CD1 
1835 N N   . ALA A 251 ? 0.3660 0.3893 0.2961 0.0030  0.0010  -0.0332 239 ALA A N   
1836 C CA  . ALA A 251 ? 0.3715 0.3992 0.3045 0.0050  0.0072  -0.0299 239 ALA A CA  
1837 C C   . ALA A 251 ? 0.3813 0.4133 0.3070 0.0038  0.0091  -0.0258 239 ALA A C   
1838 O O   . ALA A 251 ? 0.3892 0.4189 0.3070 0.0019  0.0050  -0.0239 239 ALA A O   
1839 C CB  . ALA A 251 ? 0.3656 0.3955 0.3104 0.0046  0.0070  -0.0264 239 ALA A CB  
1840 N N   . GLY A 252 ? 0.3690 0.4070 0.2972 0.0053  0.0156  -0.0244 240 GLY A N   
1841 C CA  . GLY A 252 ? 0.3671 0.4107 0.2916 0.0027  0.0192  -0.0196 240 GLY A CA  
1842 C C   . GLY A 252 ? 0.3788 0.4210 0.2884 0.0031  0.0238  -0.0214 240 GLY A C   
1843 O O   . GLY A 252 ? 0.3872 0.4230 0.2869 0.0053  0.0225  -0.0267 240 GLY A O   
1844 N N   . SER A 253 ? 0.3856 0.4335 0.2929 0.0003  0.0292  -0.0169 241 SER A N   
1845 C CA  . SER A 253 ? 0.3861 0.4347 0.2795 0.0001  0.0365  -0.0172 241 SER A CA  
1846 C C   . SER A 253 ? 0.3840 0.4385 0.2789 -0.0057 0.0412  -0.0098 241 SER A C   
1847 O O   . SER A 253 ? 0.3646 0.4223 0.2722 -0.0091 0.0380  -0.0056 241 SER A O   
1848 C CB  . SER A 253 ? 0.3898 0.4449 0.2879 0.0056  0.0446  -0.0229 241 SER A CB  
1849 O OG  . SER A 253 ? 0.3900 0.4591 0.3075 0.0060  0.0494  -0.0205 241 SER A OG  
1850 N N   . ARG A 254 ? 0.4069 0.4616 0.2879 -0.0075 0.0489  -0.0082 242 ARG A N   
1851 C CA  . ARG A 254 ? 0.4322 0.4915 0.3133 -0.0144 0.0550  -0.0009 242 ARG A CA  
1852 C C   . ARG A 254 ? 0.4164 0.4939 0.3224 -0.0154 0.0609  -0.0007 242 ARG A C   
1853 O O   . ARG A 254 ? 0.3978 0.4797 0.3126 -0.0223 0.0612  0.0049  242 ARG A O   
1854 C CB  . ARG A 254 ? 0.4668 0.5226 0.3264 -0.0163 0.0640  0.0008  242 ARG A CB  
1855 C CG  . ARG A 254 ? 0.5388 0.6067 0.4025 -0.0120 0.0758  -0.0046 242 ARG A CG  
1856 C CD  . ARG A 254 ? 0.6522 0.7131 0.4885 -0.0120 0.0844  -0.0050 242 ARG A CD  
1857 N NE  . ARG A 254 ? 0.6944 0.7563 0.5243 -0.0205 0.0917  0.0038  242 ARG A NE  
1858 C CZ  . ARG A 254 ? 0.7179 0.7964 0.5613 -0.0243 0.1048  0.0062  242 ARG A CZ  
1859 N NH1 . ARG A 254 ? 0.7230 0.8003 0.5597 -0.0339 0.1113  0.0150  242 ARG A NH1 
1860 N NH2 . ARG A 254 ? 0.7373 0.8332 0.6014 -0.0185 0.1114  -0.0001 242 ARG A NH2 
1861 N N   . LEU A 255 ? 0.4119 0.4985 0.3288 -0.0085 0.0641  -0.0068 243 LEU A N   
1862 C CA  . LEU A 255 ? 0.4161 0.5209 0.3577 -0.0074 0.0677  -0.0071 243 LEU A CA  
1863 C C   . LEU A 255 ? 0.3774 0.4816 0.3332 -0.0076 0.0572  -0.0062 243 LEU A C   
1864 O O   . LEU A 255 ? 0.3912 0.5077 0.3642 -0.0112 0.0568  -0.0033 243 LEU A O   
1865 C CB  . LEU A 255 ? 0.4127 0.5259 0.3607 0.0019  0.0745  -0.0139 243 LEU A CB  
1866 C CG  . LEU A 255 ? 0.4914 0.6072 0.4268 0.0040  0.0871  -0.0166 243 LEU A CG  
1867 C CD1 . LEU A 255 ? 0.5107 0.6345 0.4564 0.0149  0.0929  -0.0239 243 LEU A CD1 
1868 C CD2 . LEU A 255 ? 0.5239 0.6534 0.4630 -0.0043 0.0980  -0.0103 243 LEU A CD2 
1869 N N   . TYR A 256 ? 0.3676 0.4586 0.3166 -0.0040 0.0489  -0.0089 244 TYR A N   
1870 C CA  . TYR A 256 ? 0.3607 0.4507 0.3215 -0.0025 0.0407  -0.0091 244 TYR A CA  
1871 C C   . TYR A 256 ? 0.3827 0.4590 0.3345 -0.0059 0.0327  -0.0071 244 TYR A C   
1872 O O   . TYR A 256 ? 0.3925 0.4591 0.3385 -0.0025 0.0282  -0.0102 244 TYR A O   
1873 C CB  . TYR A 256 ? 0.3637 0.4512 0.3279 0.0060  0.0396  -0.0147 244 TYR A CB  
1874 C CG  . TYR A 256 ? 0.3356 0.4355 0.3090 0.0116  0.0472  -0.0173 244 TYR A CG  
1875 C CD1 . TYR A 256 ? 0.3518 0.4690 0.3434 0.0109  0.0493  -0.0147 244 TYR A CD1 
1876 C CD2 . TYR A 256 ? 0.3906 0.4858 0.3547 0.0175  0.0528  -0.0229 244 TYR A CD2 
1877 C CE1 . TYR A 256 ? 0.4075 0.5394 0.4106 0.0171  0.0572  -0.0172 244 TYR A CE1 
1878 C CE2 . TYR A 256 ? 0.3842 0.4912 0.3570 0.0240  0.0614  -0.0259 244 TYR A CE2 
1879 C CZ  . TYR A 256 ? 0.4023 0.5287 0.3960 0.0242  0.0636  -0.0228 244 TYR A CZ  
1880 O OH  . TYR A 256 ? 0.4694 0.6100 0.4748 0.0315  0.0722  -0.0258 244 TYR A OH  
1881 N N   . SER A 257 ? 0.3739 0.4491 0.3254 -0.0127 0.0311  -0.0020 245 SER A N   
1882 C CA  . SER A 257 ? 0.3837 0.4450 0.3258 -0.0150 0.0243  0.0000  245 SER A CA  
1883 C C   . SER A 257 ? 0.3794 0.4378 0.3297 -0.0144 0.0177  -0.0004 245 SER A C   
1884 O O   . SER A 257 ? 0.3894 0.4375 0.3342 -0.0141 0.0126  -0.0001 245 SER A O   
1885 C CB  . SER A 257 ? 0.3960 0.4530 0.3301 -0.0221 0.0261  0.0059  245 SER A CB  
1886 O OG  . SER A 257 ? 0.3817 0.4492 0.3286 -0.0280 0.0292  0.0085  245 SER A OG  
1887 N N   . GLY A 258 ? 0.3725 0.4400 0.3356 -0.0138 0.0176  -0.0012 246 GLY A N   
1888 C CA  . GLY A 258 ? 0.3580 0.4214 0.3256 -0.0133 0.0117  -0.0017 246 GLY A CA  
1889 C C   . GLY A 258 ? 0.3580 0.4170 0.3257 -0.0072 0.0096  -0.0051 246 GLY A C   
1890 O O   . GLY A 258 ? 0.3527 0.4043 0.3189 -0.0070 0.0057  -0.0053 246 GLY A O   
1891 N N   . ALA A 259 ? 0.3444 0.4066 0.3132 -0.0025 0.0129  -0.0078 247 ALA A N   
1892 C CA  . ALA A 259 ? 0.3522 0.4088 0.3213 0.0021  0.0114  -0.0107 247 ALA A CA  
1893 C C   . ALA A 259 ? 0.3635 0.4096 0.3269 0.0013  0.0083  -0.0118 247 ALA A C   
1894 O O   . ALA A 259 ? 0.3711 0.4127 0.3365 0.0025  0.0066  -0.0122 247 ALA A O   
1895 C CB  . ALA A 259 ? 0.3458 0.4040 0.3149 0.0071  0.0155  -0.0142 247 ALA A CB  
1896 N N   . PRO A 260 ? 0.3591 0.4020 0.3157 -0.0003 0.0075  -0.0121 248 PRO A N   
1897 C CA  . PRO A 260 ? 0.3621 0.3983 0.3167 -0.0005 0.0038  -0.0134 248 PRO A CA  
1898 C C   . PRO A 260 ? 0.3663 0.3995 0.3239 -0.0015 0.0015  -0.0115 248 PRO A C   
1899 O O   . PRO A 260 ? 0.3627 0.3929 0.3234 -0.0005 0.0007  -0.0132 248 PRO A O   
1900 C CB  . PRO A 260 ? 0.3675 0.4018 0.3135 -0.0017 0.0021  -0.0125 248 PRO A CB  
1901 C CG  . PRO A 260 ? 0.3618 0.4005 0.3029 -0.0018 0.0069  -0.0126 248 PRO A CG  
1902 C CD  . PRO A 260 ? 0.3715 0.4170 0.3217 -0.0021 0.0099  -0.0108 248 PRO A CD  
1903 N N   . VAL A 261 ? 0.3607 0.3945 0.3174 -0.0040 0.0012  -0.0085 249 VAL A N   
1904 C CA  . VAL A 261 ? 0.3633 0.3922 0.3201 -0.0051 -0.0008 -0.0074 249 VAL A CA  
1905 C C   . VAL A 261 ? 0.3463 0.3750 0.3063 -0.0036 -0.0002 -0.0085 249 VAL A C   
1906 O O   . VAL A 261 ? 0.3360 0.3596 0.2953 -0.0026 -0.0004 -0.0096 249 VAL A O   
1907 C CB  . VAL A 261 ? 0.3737 0.4022 0.3282 -0.0094 -0.0014 -0.0042 249 VAL A CB  
1908 C CG1 . VAL A 261 ? 0.4045 0.4241 0.3562 -0.0103 -0.0040 -0.0040 249 VAL A CG1 
1909 C CG2 . VAL A 261 ? 0.4157 0.4445 0.3647 -0.0113 -0.0003 -0.0019 249 VAL A CG2 
1910 N N   . LEU A 262 ? 0.3209 0.3550 0.2837 -0.0029 0.0008  -0.0082 250 LEU A N   
1911 C CA  . LEU A 262 ? 0.3203 0.3530 0.2837 -0.0009 0.0005  -0.0083 250 LEU A CA  
1912 C C   . LEU A 262 ? 0.3236 0.3512 0.2866 0.0015  0.0028  -0.0101 250 LEU A C   
1913 O O   . LEU A 262 ? 0.3155 0.3375 0.2757 0.0019  0.0035  -0.0099 250 LEU A O   
1914 C CB  . LEU A 262 ? 0.3188 0.3595 0.2867 0.0003  0.0001  -0.0072 250 LEU A CB  
1915 C CG  . LEU A 262 ? 0.3370 0.3848 0.3081 -0.0036 -0.0021 -0.0055 250 LEU A CG  
1916 C CD1 . LEU A 262 ? 0.3183 0.3780 0.2981 -0.0013 -0.0019 -0.0049 250 LEU A CD1 
1917 C CD2 . LEU A 262 ? 0.3216 0.3640 0.2884 -0.0062 -0.0064 -0.0051 250 LEU A CD2 
1918 N N   . SER A 263 ? 0.3231 0.3518 0.2880 0.0024  0.0043  -0.0119 251 SER A N   
1919 C CA  . SER A 263 ? 0.3461 0.3699 0.3120 0.0030  0.0062  -0.0140 251 SER A CA  
1920 C C   . SER A 263 ? 0.3440 0.3660 0.3116 0.0013  0.0062  -0.0150 251 SER A C   
1921 O O   . SER A 263 ? 0.3260 0.3442 0.2947 0.0010  0.0088  -0.0152 251 SER A O   
1922 C CB  . SER A 263 ? 0.3479 0.3724 0.3145 0.0037  0.0068  -0.0170 251 SER A CB  
1923 O OG  . SER A 263 ? 0.3761 0.4016 0.3423 0.0068  0.0083  -0.0168 251 SER A OG  
1924 N N   . GLY A 264 ? 0.3342 0.3588 0.3020 0.0007  0.0037  -0.0151 252 GLY A N   
1925 C CA  . GLY A 264 ? 0.3416 0.3660 0.3130 0.0007  0.0030  -0.0162 252 GLY A CA  
1926 C C   . GLY A 264 ? 0.3275 0.3481 0.2976 0.0012  0.0053  -0.0154 252 GLY A C   
1927 O O   . GLY A 264 ? 0.3291 0.3495 0.3035 0.0013  0.0085  -0.0167 252 GLY A O   
1928 N N   . MET A 265 ? 0.3290 0.3467 0.2928 0.0008  0.0042  -0.0135 253 MET A N   
1929 C CA  . MET A 265 ? 0.3494 0.3616 0.3085 0.0012  0.0060  -0.0134 253 MET A CA  
1930 C C   . MET A 265 ? 0.3391 0.3484 0.2953 0.0014  0.0097  -0.0130 253 MET A C   
1931 O O   . MET A 265 ? 0.3460 0.3507 0.2984 0.0020  0.0133  -0.0136 253 MET A O   
1932 C CB  . MET A 265 ? 0.3739 0.3828 0.3264 -0.0002 0.0026  -0.0122 253 MET A CB  
1933 C CG  . MET A 265 ? 0.4247 0.4314 0.3772 -0.0006 0.0000  -0.0121 253 MET A CG  
1934 S SD  . MET A 265 ? 0.5753 0.5772 0.5298 0.0032  0.0019  -0.0145 253 MET A SD  
1935 C CE  . MET A 265 ? 0.2895 0.2856 0.2368 0.0038  0.0066  -0.0164 253 MET A CE  
1936 N N   . GLY A 266 ? 0.3298 0.3407 0.2866 0.0015  0.0093  -0.0118 254 GLY A N   
1937 C CA  . GLY A 266 ? 0.3426 0.3482 0.2958 0.0020  0.0127  -0.0106 254 GLY A CA  
1938 C C   . GLY A 266 ? 0.3414 0.3458 0.2996 0.0005  0.0182  -0.0121 254 GLY A C   
1939 O O   . GLY A 266 ? 0.3519 0.3507 0.3052 0.0000  0.0230  -0.0111 254 GLY A O   
1940 N N   . SER A 267 ? 0.3385 0.3489 0.3066 -0.0004 0.0175  -0.0146 255 SER A N   
1941 C CA  . SER A 267 ? 0.3426 0.3556 0.3196 -0.0025 0.0220  -0.0166 255 SER A CA  
1942 C C   . SER A 267 ? 0.3461 0.3606 0.3243 -0.0012 0.0251  -0.0174 255 SER A C   
1943 O O   . SER A 267 ? 0.3316 0.3456 0.3123 -0.0025 0.0318  -0.0176 255 SER A O   
1944 C CB  . SER A 267 ? 0.3332 0.3537 0.3211 -0.0038 0.0184  -0.0197 255 SER A CB  
1945 O OG  . SER A 267 ? 0.3415 0.3594 0.3269 -0.0045 0.0161  -0.0201 255 SER A OG  
1946 N N   . LEU A 268 ? 0.3399 0.3554 0.3158 0.0013  0.0210  -0.0178 256 LEU A N   
1947 C CA  . LEU A 268 ? 0.3424 0.3575 0.3190 0.0038  0.0241  -0.0194 256 LEU A CA  
1948 C C   . LEU A 268 ? 0.3470 0.3534 0.3111 0.0040  0.0295  -0.0186 256 LEU A C   
1949 O O   . LEU A 268 ? 0.3306 0.3371 0.2964 0.0051  0.0363  -0.0202 256 LEU A O   
1950 C CB  . LEU A 268 ? 0.3466 0.3610 0.3221 0.0066  0.0185  -0.0199 256 LEU A CB  
1951 C CG  . LEU A 268 ? 0.3739 0.3962 0.3608 0.0080  0.0137  -0.0209 256 LEU A CG  
1952 C CD1 . LEU A 268 ? 0.4255 0.4423 0.4064 0.0105  0.0081  -0.0199 256 LEU A CD1 
1953 C CD2 . LEU A 268 ? 0.3553 0.3870 0.3579 0.0097  0.0168  -0.0236 256 LEU A CD2 
1954 N N   . LYS A 269 ? 0.3432 0.3426 0.2944 0.0033  0.0264  -0.0163 257 LYS A N   
1955 C CA  . LYS A 269 ? 0.3609 0.3506 0.2965 0.0036  0.0296  -0.0153 257 LYS A CA  
1956 C C   . LYS A 269 ? 0.3557 0.3417 0.2878 0.0021  0.0377  -0.0135 257 LYS A C   
1957 O O   . LYS A 269 ? 0.3762 0.3541 0.2948 0.0027  0.0425  -0.0133 257 LYS A O   
1958 C CB  . LYS A 269 ? 0.3758 0.3612 0.3008 0.0032  0.0223  -0.0131 257 LYS A CB  
1959 C CG  . LYS A 269 ? 0.4002 0.3867 0.3255 0.0030  0.0155  -0.0145 257 LYS A CG  
1960 C CD  . LYS A 269 ? 0.4788 0.4573 0.3952 0.0042  0.0170  -0.0176 257 LYS A CD  
1961 C CE  . LYS A 269 ? 0.5231 0.4987 0.4371 0.0027  0.0100  -0.0186 257 LYS A CE  
1962 N NZ  . LYS A 269 ? 0.5436 0.5069 0.4438 0.0037  0.0111  -0.0223 257 LYS A NZ  
1963 N N   . VAL A 270 ? 0.3457 0.3361 0.2882 -0.0002 0.0395  -0.0124 258 VAL A N   
1964 C CA  . VAL A 270 ? 0.3517 0.3371 0.2915 -0.0030 0.0479  -0.0102 258 VAL A CA  
1965 C C   . VAL A 270 ? 0.3504 0.3442 0.3046 -0.0048 0.0566  -0.0130 258 VAL A C   
1966 O O   . VAL A 270 ? 0.3397 0.3311 0.2944 -0.0085 0.0651  -0.0114 258 VAL A O   
1967 C CB  . VAL A 270 ? 0.3569 0.3386 0.2979 -0.0052 0.0460  -0.0073 258 VAL A CB  
1968 C CG1 . VAL A 270 ? 0.3503 0.3250 0.2780 -0.0020 0.0387  -0.0044 258 VAL A CG1 
1969 C CG2 . VAL A 270 ? 0.2947 0.2867 0.2544 -0.0072 0.0428  -0.0105 258 VAL A CG2 
1970 N N   . GLY A 271 ? 0.3419 0.3456 0.3081 -0.0022 0.0543  -0.0169 259 GLY A N   
1971 C CA  . GLY A 271 ? 0.3422 0.3563 0.3237 -0.0021 0.0619  -0.0200 259 GLY A CA  
1972 C C   . GLY A 271 ? 0.3258 0.3546 0.3308 -0.0038 0.0586  -0.0224 259 GLY A C   
1973 O O   . GLY A 271 ? 0.3240 0.3643 0.3457 -0.0045 0.0646  -0.0249 259 GLY A O   
1974 N N   . THR A 272 ? 0.3290 0.3585 0.3356 -0.0044 0.0489  -0.0222 260 THR A N   
1975 C CA  . THR A 272 ? 0.3267 0.3689 0.3525 -0.0061 0.0439  -0.0249 260 THR A CA  
1976 C C   . THR A 272 ? 0.3206 0.3736 0.3586 -0.0008 0.0406  -0.0278 260 THR A C   
1977 O O   . THR A 272 ? 0.3329 0.3806 0.3618 0.0043  0.0385  -0.0275 260 THR A O   
1978 C CB  . THR A 272 ? 0.3367 0.3751 0.3574 -0.0075 0.0351  -0.0243 260 THR A CB  
1979 O OG1 . THR A 272 ? 0.3686 0.3952 0.3770 -0.0104 0.0384  -0.0213 260 THR A OG1 
1980 C CG2 . THR A 272 ? 0.3169 0.3657 0.3538 -0.0107 0.0303  -0.0275 260 THR A CG2 
1981 N N   . GLY A 273 ? 0.3119 0.3796 0.3709 -0.0020 0.0399  -0.0306 261 GLY A N   
1982 C CA  . GLY A 273 ? 0.3341 0.4131 0.4070 0.0043  0.0371  -0.0332 261 GLY A CA  
1983 C C   . GLY A 273 ? 0.3294 0.4068 0.3981 0.0086  0.0246  -0.0328 261 GLY A C   
1984 O O   . GLY A 273 ? 0.3359 0.4108 0.4017 0.0155  0.0218  -0.0327 261 GLY A O   
1985 N N   . LEU A 274 ? 0.3388 0.4162 0.4060 0.0044  0.0175  -0.0327 262 LEU A N   
1986 C CA  . LEU A 274 ? 0.3432 0.4187 0.4043 0.0075  0.0064  -0.0320 262 LEU A CA  
1987 C C   . LEU A 274 ? 0.3358 0.4018 0.3819 0.0032  0.0032  -0.0306 262 LEU A C   
1988 O O   . LEU A 274 ? 0.3192 0.3858 0.3680 -0.0025 0.0048  -0.0320 262 LEU A O   
1989 C CB  . LEU A 274 ? 0.3443 0.4347 0.4237 0.0086  -0.0012 -0.0349 262 LEU A CB  
1990 C CG  . LEU A 274 ? 0.4095 0.4988 0.4834 0.0140  -0.0129 -0.0337 262 LEU A CG  
1991 C CD1 . LEU A 274 ? 0.4915 0.5731 0.5588 0.0221  -0.0118 -0.0311 262 LEU A CD1 
1992 C CD2 . LEU A 274 ? 0.4259 0.5322 0.5201 0.0151  -0.0216 -0.0370 262 LEU A CD2 
1993 N N   . VAL A 275 ? 0.3413 0.3985 0.3723 0.0060  -0.0010 -0.0279 263 VAL A N   
1994 C CA  . VAL A 275 ? 0.3518 0.4020 0.3698 0.0032  -0.0033 -0.0267 263 VAL A CA  
1995 C C   . VAL A 275 ? 0.3675 0.4167 0.3783 0.0055  -0.0116 -0.0257 263 VAL A C   
1996 O O   . VAL A 275 ? 0.3567 0.4025 0.3631 0.0097  -0.0142 -0.0232 263 VAL A O   
1997 C CB  . VAL A 275 ? 0.3708 0.4112 0.3759 0.0026  0.0016  -0.0239 263 VAL A CB  
1998 C CG1 . VAL A 275 ? 0.3553 0.3918 0.3509 0.0006  -0.0004 -0.0233 263 VAL A CG1 
1999 C CG2 . VAL A 275 ? 0.3718 0.4110 0.3802 0.0004  0.0096  -0.0242 263 VAL A CG2 
2000 N N   . LYS A 276 ? 0.3520 0.4023 0.3603 0.0028  -0.0155 -0.0276 264 LYS A N   
2001 C CA  . LYS A 276 ? 0.3894 0.4377 0.3876 0.0042  -0.0228 -0.0269 264 LYS A CA  
2002 C C   . LYS A 276 ? 0.3709 0.4126 0.3554 0.0019  -0.0204 -0.0265 264 LYS A C   
2003 O O   . LYS A 276 ? 0.3764 0.4175 0.3626 -0.0010 -0.0174 -0.0294 264 LYS A O   
2004 C CB  . LYS A 276 ? 0.3943 0.4503 0.4000 0.0031  -0.0302 -0.0310 264 LYS A CB  
2005 C CG  . LYS A 276 ? 0.4820 0.5463 0.4993 0.0073  -0.0364 -0.0310 264 LYS A CG  
2006 C CD  . LYS A 276 ? 0.5660 0.6388 0.5899 0.0057  -0.0462 -0.0354 264 LYS A CD  
2007 C CE  . LYS A 276 ? 0.6212 0.6944 0.6387 0.0116  -0.0574 -0.0330 264 LYS A CE  
2008 N NZ  . LYS A 276 ? 0.6782 0.7667 0.7153 0.0135  -0.0670 -0.0365 264 LYS A NZ  
2009 N N   . LEU A 277 ? 0.3697 0.4063 0.3412 0.0032  -0.0215 -0.0230 265 LEU A N   
2010 C CA  . LEU A 277 ? 0.3658 0.3983 0.3251 0.0017  -0.0187 -0.0227 265 LEU A CA  
2011 C C   . LEU A 277 ? 0.3732 0.4043 0.3212 0.0021  -0.0245 -0.0236 265 LEU A C   
2012 O O   . LEU A 277 ? 0.3971 0.4277 0.3425 0.0043  -0.0307 -0.0213 265 LEU A O   
2013 C CB  . LEU A 277 ? 0.3503 0.3794 0.3036 0.0016  -0.0145 -0.0180 265 LEU A CB  
2014 C CG  . LEU A 277 ? 0.3846 0.4131 0.3448 0.0019  -0.0114 -0.0162 265 LEU A CG  
2015 C CD1 . LEU A 277 ? 0.3479 0.3728 0.3009 0.0007  -0.0096 -0.0121 265 LEU A CD1 
2016 C CD2 . LEU A 277 ? 0.3321 0.3620 0.2989 0.0010  -0.0068 -0.0184 265 LEU A CD2 
2017 N N   . ALA A 278 ? 0.3551 0.3843 0.2953 0.0007  -0.0227 -0.0269 266 ALA A N   
2018 C CA  . ALA A 278 ? 0.3831 0.4086 0.3068 0.0010  -0.0263 -0.0276 266 ALA A CA  
2019 C C   . ALA A 278 ? 0.3587 0.3815 0.2719 0.0008  -0.0184 -0.0254 266 ALA A C   
2020 O O   . ALA A 278 ? 0.3820 0.4054 0.2984 0.0006  -0.0126 -0.0283 266 ALA A O   
2021 C CB  . ALA A 278 ? 0.3679 0.3931 0.2901 -0.0003 -0.0309 -0.0348 266 ALA A CB  
2022 N N   . VAL A 279 ? 0.3583 0.3784 0.2606 0.0008  -0.0179 -0.0199 267 VAL A N   
2023 C CA  . VAL A 279 ? 0.3676 0.3878 0.2639 -0.0004 -0.0095 -0.0166 267 VAL A CA  
2024 C C   . VAL A 279 ? 0.3968 0.4113 0.2726 -0.0010 -0.0098 -0.0134 267 VAL A C   
2025 O O   . VAL A 279 ? 0.3926 0.4017 0.2609 -0.0003 -0.0171 -0.0100 267 VAL A O   
2026 C CB  . VAL A 279 ? 0.3605 0.3825 0.2666 -0.0018 -0.0069 -0.0115 267 VAL A CB  
2027 C CG1 . VAL A 279 ? 0.3652 0.3902 0.2683 -0.0043 0.0013  -0.0082 267 VAL A CG1 
2028 C CG2 . VAL A 279 ? 0.3372 0.3631 0.2598 -0.0010 -0.0066 -0.0141 267 VAL A CG2 
2029 N N   . PRO A 280 ? 0.4161 0.4315 0.2820 -0.0018 -0.0017 -0.0140 268 PRO A N   
2030 C CA  . PRO A 280 ? 0.4448 0.4536 0.2885 -0.0030 -0.0003 -0.0101 268 PRO A CA  
2031 C C   . PRO A 280 ? 0.4525 0.4567 0.2931 -0.0057 -0.0010 -0.0011 268 PRO A C   
2032 O O   . PRO A 280 ? 0.4281 0.4365 0.2816 -0.0083 0.0034  0.0020  268 PRO A O   
2033 C CB  . PRO A 280 ? 0.4579 0.4714 0.2974 -0.0034 0.0114  -0.0122 268 PRO A CB  
2034 C CG  . PRO A 280 ? 0.4513 0.4700 0.3056 -0.0002 0.0121  -0.0204 268 PRO A CG  
2035 C CD  . PRO A 280 ? 0.4170 0.4383 0.2900 -0.0007 0.0065  -0.0186 268 PRO A CD  
2036 N N   . PHE A 281 ? 0.4695 0.4638 0.2925 -0.0050 -0.0075 0.0027  269 PHE A N   
2037 C CA  . PHE A 281 ? 0.4814 0.4664 0.2958 -0.0074 -0.0081 0.0119  269 PHE A CA  
2038 C C   . PHE A 281 ? 0.4918 0.4772 0.2978 -0.0129 0.0042  0.0163  269 PHE A C   
2039 O O   . PHE A 281 ? 0.4993 0.4863 0.2919 -0.0130 0.0104  0.0138  269 PHE A O   
2040 C CB  . PHE A 281 ? 0.4991 0.4720 0.2916 -0.0045 -0.0178 0.0152  269 PHE A CB  
2041 C CG  . PHE A 281 ? 0.5256 0.4850 0.3067 -0.0061 -0.0193 0.0253  269 PHE A CG  
2042 C CD1 . PHE A 281 ? 0.5288 0.4848 0.3235 -0.0042 -0.0251 0.0281  269 PHE A CD1 
2043 C CD2 . PHE A 281 ? 0.5775 0.5264 0.3334 -0.0095 -0.0139 0.0321  269 PHE A CD2 
2044 C CE1 . PHE A 281 ? 0.5714 0.5115 0.3544 -0.0055 -0.0264 0.0375  269 PHE A CE1 
2045 C CE2 . PHE A 281 ? 0.6135 0.5468 0.3569 -0.0116 -0.0150 0.0423  269 PHE A CE2 
2046 C CZ  . PHE A 281 ? 0.5934 0.5213 0.3501 -0.0095 -0.0217 0.0450  269 PHE A CZ  
2047 N N   . PRO A 282 ? 0.4919 0.4748 0.3036 -0.0177 0.0078  0.0230  270 PRO A N   
2048 C CA  . PRO A 282 ? 0.4892 0.4664 0.3119 -0.0180 0.0016  0.0264  270 PRO A CA  
2049 C C   . PRO A 282 ? 0.4637 0.4526 0.3111 -0.0189 0.0040  0.0221  270 PRO A C   
2050 O O   . PRO A 282 ? 0.4586 0.4431 0.3148 -0.0199 0.0007  0.0241  270 PRO A O   
2051 C CB  . PRO A 282 ? 0.5148 0.4805 0.3248 -0.0246 0.0066  0.0358  270 PRO A CB  
2052 C CG  . PRO A 282 ? 0.5251 0.5007 0.3325 -0.0302 0.0197  0.0359  270 PRO A CG  
2053 C CD  . PRO A 282 ? 0.5091 0.4917 0.3105 -0.0243 0.0195  0.0284  270 PRO A CD  
2054 N N   . GLN A 283 ? 0.4509 0.4531 0.3081 -0.0179 0.0090  0.0159  271 GLN A N   
2055 C CA  . GLN A 283 ? 0.4262 0.4390 0.3048 -0.0184 0.0110  0.0125  271 GLN A CA  
2056 C C   . GLN A 283 ? 0.4128 0.4232 0.3010 -0.0141 0.0027  0.0094  271 GLN A C   
2057 O O   . GLN A 283 ? 0.4088 0.4226 0.3103 -0.0150 0.0026  0.0086  271 GLN A O   
2058 C CB  . GLN A 283 ? 0.4259 0.4516 0.3121 -0.0166 0.0175  0.0070  271 GLN A CB  
2059 C CG  . GLN A 283 ? 0.4057 0.4391 0.2907 -0.0209 0.0279  0.0094  271 GLN A CG  
2060 C CD  . GLN A 283 ? 0.4686 0.4955 0.3312 -0.0218 0.0322  0.0119  271 GLN A CD  
2061 O OE1 . GLN A 283 ? 0.4704 0.4902 0.3192 -0.0175 0.0277  0.0088  271 GLN A OE1 
2062 N NE2 . GLN A 283 ? 0.4322 0.4609 0.2903 -0.0282 0.0409  0.0176  271 GLN A NE2 
2063 N N   . ASN A 284 ? 0.4117 0.4169 0.2933 -0.0097 -0.0043 0.0077  272 ASN A N   
2064 C CA  . ASN A 284 ? 0.4027 0.4071 0.2952 -0.0059 -0.0112 0.0052  272 ASN A CA  
2065 C C   . ASN A 284 ? 0.3925 0.3892 0.2884 -0.0066 -0.0134 0.0093  272 ASN A C   
2066 O O   . ASN A 284 ? 0.3736 0.3723 0.2817 -0.0045 -0.0152 0.0066  272 ASN A O   
2067 C CB  . ASN A 284 ? 0.4011 0.4028 0.2880 -0.0013 -0.0196 0.0032  272 ASN A CB  
2068 C CG  . ASN A 284 ? 0.4072 0.3977 0.2780 -0.0004 -0.0245 0.0093  272 ASN A CG  
2069 O OD1 . ASN A 284 ? 0.4107 0.3962 0.2655 -0.0034 -0.0205 0.0132  272 ASN A OD1 
2070 N ND2 . ASN A 284 ? 0.3863 0.3722 0.2605 0.0040  -0.0324 0.0105  272 ASN A ND2 
2071 N N   . LEU A 285 ? 0.4124 0.3993 0.2964 -0.0099 -0.0125 0.0157  273 LEU A N   
2072 C CA  . LEU A 285 ? 0.4413 0.4171 0.3259 -0.0108 -0.0147 0.0194  273 LEU A CA  
2073 C C   . LEU A 285 ? 0.4372 0.4166 0.3332 -0.0156 -0.0103 0.0181  273 LEU A C   
2074 O O   . LEU A 285 ? 0.4453 0.4163 0.3441 -0.0152 -0.0128 0.0184  273 LEU A O   
2075 C CB  . LEU A 285 ? 0.4741 0.4352 0.3407 -0.0138 -0.0150 0.0272  273 LEU A CB  
2076 C CG  . LEU A 285 ? 0.5120 0.4664 0.3659 -0.0075 -0.0224 0.0290  273 LEU A CG  
2077 C CD1 . LEU A 285 ? 0.5884 0.5273 0.4206 -0.0111 -0.0213 0.0377  273 LEU A CD1 
2078 C CD2 . LEU A 285 ? 0.5528 0.5036 0.4154 0.0003  -0.0309 0.0270  273 LEU A CD2 
2079 N N   . ILE A 286 ? 0.4331 0.4250 0.3355 -0.0192 -0.0045 0.0161  274 ILE A N   
2080 C CA  . ILE A 286 ? 0.4360 0.4343 0.3500 -0.0230 -0.0019 0.0143  274 ILE A CA  
2081 C C   . ILE A 286 ? 0.4242 0.4227 0.3469 -0.0182 -0.0056 0.0097  274 ILE A C   
2082 O O   . ILE A 286 ? 0.4122 0.4060 0.3380 -0.0205 -0.0066 0.0093  274 ILE A O   
2083 C CB  . ILE A 286 ? 0.4451 0.4594 0.3662 -0.0250 0.0042  0.0124  274 ILE A CB  
2084 C CG1 . ILE A 286 ? 0.4778 0.4928 0.3918 -0.0311 0.0099  0.0173  274 ILE A CG1 
2085 C CG2 . ILE A 286 ? 0.4422 0.4658 0.3772 -0.0265 0.0047  0.0097  274 ILE A CG2 
2086 C CD1 . ILE A 286 ? 0.5320 0.5377 0.4432 -0.0382 0.0098  0.0221  274 ILE A CD1 
2087 N N   . ALA A 287 ? 0.3949 0.3977 0.3204 -0.0123 -0.0074 0.0061  275 ALA A N   
2088 C CA  . ALA A 287 ? 0.3778 0.3824 0.3121 -0.0086 -0.0088 0.0019  275 ALA A CA  
2089 C C   . ALA A 287 ? 0.3866 0.3806 0.3199 -0.0061 -0.0121 0.0021  275 ALA A C   
2090 O O   . ALA A 287 ? 0.3862 0.3785 0.3235 -0.0058 -0.0114 -0.0001 275 ALA A O   
2091 C CB  . ALA A 287 ? 0.3635 0.3749 0.3023 -0.0043 -0.0095 -0.0018 275 ALA A CB  
2092 N N   . THR A 288 ? 0.3949 0.3811 0.3219 -0.0034 -0.0158 0.0047  276 THR A N   
2093 C CA  . THR A 288 ? 0.4071 0.3831 0.3341 0.0009  -0.0189 0.0046  276 THR A CA  
2094 C C   . THR A 288 ? 0.4270 0.3890 0.3466 -0.0033 -0.0186 0.0075  276 THR A C   
2095 O O   . THR A 288 ? 0.4093 0.3618 0.3291 -0.0002 -0.0197 0.0058  276 THR A O   
2096 C CB  . THR A 288 ? 0.4162 0.3891 0.3401 0.0070  -0.0247 0.0064  276 THR A CB  
2097 O OG1 . THR A 288 ? 0.4480 0.4164 0.3592 0.0040  -0.0259 0.0115  276 THR A OG1 
2098 C CG2 . THR A 288 ? 0.3849 0.3717 0.3201 0.0113  -0.0262 0.0018  276 THR A CG2 
2099 N N   . SER A 289 ? 0.4357 0.3957 0.3487 -0.0106 -0.0166 0.0115  277 SER A N   
2100 C CA  . SER A 289 ? 0.4682 0.4164 0.3767 -0.0169 -0.0160 0.0134  277 SER A CA  
2101 C C   . SER A 289 ? 0.4639 0.4166 0.3796 -0.0188 -0.0149 0.0083  277 SER A C   
2102 O O   . SER A 289 ? 0.4795 0.4198 0.3916 -0.0206 -0.0162 0.0071  277 SER A O   
2103 C CB  . SER A 289 ? 0.4787 0.4277 0.3821 -0.0262 -0.0128 0.0185  277 SER A CB  
2104 O OG  . SER A 289 ? 0.5223 0.4896 0.4351 -0.0293 -0.0090 0.0162  277 SER A OG  
2105 N N   . ARG A 290 ? 0.4552 0.4235 0.3792 -0.0178 -0.0128 0.0053  278 ARG A N   
2106 C CA  . ARG A 290 ? 0.4840 0.4562 0.4125 -0.0193 -0.0124 0.0012  278 ARG A CA  
2107 C C   . ARG A 290 ? 0.4703 0.4392 0.4000 -0.0118 -0.0124 -0.0030 278 ARG A C   
2108 O O   . ARG A 290 ? 0.4575 0.4173 0.3833 -0.0117 -0.0130 -0.0058 278 ARG A O   
2109 C CB  . ARG A 290 ? 0.4868 0.4762 0.4229 -0.0212 -0.0100 0.0010  278 ARG A CB  
2110 C CG  . ARG A 290 ? 0.5626 0.5587 0.5032 -0.0231 -0.0105 -0.0014 278 ARG A CG  
2111 C CD  . ARG A 290 ? 0.6581 0.6493 0.5970 -0.0308 -0.0132 -0.0010 278 ARG A CD  
2112 N NE  . ARG A 290 ? 0.7162 0.6961 0.6487 -0.0291 -0.0157 -0.0048 278 ARG A NE  
2113 C CZ  . ARG A 290 ? 0.7837 0.7671 0.7162 -0.0286 -0.0176 -0.0077 278 ARG A CZ  
2114 N NH1 . ARG A 290 ? 0.8056 0.8042 0.7459 -0.0295 -0.0181 -0.0069 278 ARG A NH1 
2115 N NH2 . ARG A 290 ? 0.8277 0.7985 0.7510 -0.0267 -0.0189 -0.0115 278 ARG A NH2 
2116 N N   . PHE A 291 ? 0.4360 0.4118 0.3706 -0.0060 -0.0116 -0.0037 279 PHE A N   
2117 C CA  . PHE A 291 ? 0.4323 0.4087 0.3712 0.0001  -0.0102 -0.0076 279 PHE A CA  
2118 C C   . PHE A 291 ? 0.4117 0.3888 0.3547 0.0062  -0.0121 -0.0071 279 PHE A C   
2119 O O   . PHE A 291 ? 0.3912 0.3787 0.3400 0.0074  -0.0124 -0.0072 279 PHE A O   
2120 C CB  . PHE A 291 ? 0.4232 0.4113 0.3680 0.0001  -0.0071 -0.0096 279 PHE A CB  
2121 C CG  . PHE A 291 ? 0.4659 0.4540 0.4072 -0.0040 -0.0065 -0.0101 279 PHE A CG  
2122 C CD1 . PHE A 291 ? 0.5627 0.5413 0.4974 -0.0042 -0.0065 -0.0125 279 PHE A CD1 
2123 C CD2 . PHE A 291 ? 0.5103 0.5075 0.4543 -0.0070 -0.0064 -0.0086 279 PHE A CD2 
2124 C CE1 . PHE A 291 ? 0.5718 0.5507 0.5023 -0.0081 -0.0079 -0.0130 279 PHE A CE1 
2125 C CE2 . PHE A 291 ? 0.5452 0.5440 0.4874 -0.0099 -0.0074 -0.0089 279 PHE A CE2 
2126 C CZ  . PHE A 291 ? 0.5304 0.5202 0.4656 -0.0108 -0.0088 -0.0110 279 PHE A CZ  
2127 N N   . PRO A 292 ? 0.4104 0.3757 0.3500 0.0103  -0.0142 -0.0068 280 PRO A N   
2128 C CA  . PRO A 292 ? 0.4214 0.3862 0.3644 0.0169  -0.0180 -0.0056 280 PRO A CA  
2129 C C   . PRO A 292 ? 0.4219 0.3991 0.3787 0.0230  -0.0166 -0.0096 280 PRO A C   
2130 O O   . PRO A 292 ? 0.4263 0.4075 0.3888 0.0282  -0.0210 -0.0088 280 PRO A O   
2131 C CB  . PRO A 292 ? 0.4330 0.3790 0.3680 0.0200  -0.0201 -0.0044 280 PRO A CB  
2132 C CG  . PRO A 292 ? 0.4415 0.3794 0.3706 0.0153  -0.0166 -0.0071 280 PRO A CG  
2133 C CD  . PRO A 292 ? 0.4348 0.3848 0.3661 0.0087  -0.0139 -0.0078 280 PRO A CD  
2134 N N   . GLU A 293 ? 0.4214 0.4049 0.3833 0.0217  -0.0108 -0.0134 281 GLU A N   
2135 C CA  . GLU A 293 ? 0.4281 0.4251 0.4039 0.0248  -0.0074 -0.0169 281 GLU A CA  
2136 C C   . GLU A 293 ? 0.3950 0.4043 0.3769 0.0215  -0.0094 -0.0163 281 GLU A C   
2137 O O   . GLU A 293 ? 0.3839 0.4045 0.3787 0.0232  -0.0087 -0.0188 281 GLU A O   
2138 C CB  . GLU A 293 ? 0.4280 0.4256 0.4025 0.0222  0.0000  -0.0197 281 GLU A CB  
2139 C CG  . GLU A 293 ? 0.5023 0.4881 0.4687 0.0242  0.0030  -0.0217 281 GLU A CG  
2140 C CD  . GLU A 293 ? 0.5139 0.4877 0.4651 0.0185  0.0010  -0.0202 281 GLU A CD  
2141 O OE1 . GLU A 293 ? 0.5981 0.5636 0.5411 0.0184  0.0042  -0.0230 281 GLU A OE1 
2142 O OE2 . GLU A 293 ? 0.5060 0.4787 0.4536 0.0144  -0.0033 -0.0168 281 GLU A OE2 
2143 N N   . LEU A 294 ? 0.3851 0.3924 0.3582 0.0164  -0.0111 -0.0136 282 LEU A N   
2144 C CA  . LEU A 294 ? 0.3704 0.3867 0.3464 0.0138  -0.0131 -0.0138 282 LEU A CA  
2145 C C   . LEU A 294 ? 0.3726 0.3904 0.3486 0.0169  -0.0203 -0.0124 282 LEU A C   
2146 O O   . LEU A 294 ? 0.3884 0.3975 0.3578 0.0198  -0.0241 -0.0094 282 LEU A O   
2147 C CB  . LEU A 294 ? 0.3571 0.3714 0.3237 0.0085  -0.0115 -0.0118 282 LEU A CB  
2148 C CG  . LEU A 294 ? 0.3597 0.3743 0.3263 0.0058  -0.0063 -0.0128 282 LEU A CG  
2149 C CD1 . LEU A 294 ? 0.3115 0.3252 0.2709 0.0019  -0.0062 -0.0104 282 LEU A CD1 
2150 C CD2 . LEU A 294 ? 0.3054 0.3270 0.2798 0.0054  -0.0032 -0.0156 282 LEU A CD2 
2151 N N   . ILE A 295 ? 0.3627 0.3900 0.3452 0.0162  -0.0228 -0.0147 283 ILE A N   
2152 C CA  . ILE A 295 ? 0.3636 0.3922 0.3424 0.0180  -0.0307 -0.0137 283 ILE A CA  
2153 C C   . ILE A 295 ? 0.3682 0.3942 0.3343 0.0130  -0.0297 -0.0127 283 ILE A C   
2154 O O   . ILE A 295 ? 0.3469 0.3772 0.3160 0.0094  -0.0253 -0.0156 283 ILE A O   
2155 C CB  . ILE A 295 ? 0.3609 0.4023 0.3550 0.0197  -0.0353 -0.0179 283 ILE A CB  
2156 C CG1 . ILE A 295 ? 0.3778 0.4240 0.3869 0.0258  -0.0355 -0.0189 283 ILE A CG1 
2157 C CG2 . ILE A 295 ? 0.3505 0.3920 0.3365 0.0210  -0.0453 -0.0170 283 ILE A CG2 
2158 C CD1 . ILE A 295 ? 0.3337 0.3968 0.3649 0.0266  -0.0371 -0.0237 283 ILE A CD1 
2159 N N   . SER A 296 ? 0.3633 0.3815 0.3147 0.0129  -0.0326 -0.0085 284 SER A N   
2160 C CA  . SER A 296 ? 0.3863 0.4028 0.3256 0.0087  -0.0298 -0.0077 284 SER A CA  
2161 C C   . SER A 296 ? 0.4017 0.4152 0.3282 0.0101  -0.0367 -0.0062 284 SER A C   
2162 O O   . SER A 296 ? 0.4080 0.4125 0.3229 0.0113  -0.0394 -0.0009 284 SER A O   
2163 C CB  . SER A 296 ? 0.3875 0.3977 0.3198 0.0053  -0.0240 -0.0037 284 SER A CB  
2164 O OG  . SER A 296 ? 0.4026 0.4156 0.3289 0.0018  -0.0194 -0.0042 284 SER A OG  
2165 N N   . VAL A 297 ? 0.3937 0.4135 0.3219 0.0097  -0.0400 -0.0110 285 VAL A N   
2166 C CA  . VAL A 297 ? 0.4092 0.4272 0.3255 0.0113  -0.0483 -0.0112 285 VAL A CA  
2167 C C   . VAL A 297 ? 0.4111 0.4218 0.3061 0.0084  -0.0439 -0.0089 285 VAL A C   
2168 O O   . VAL A 297 ? 0.3956 0.4086 0.2905 0.0053  -0.0364 -0.0117 285 VAL A O   
2169 C CB  . VAL A 297 ? 0.4158 0.4431 0.3422 0.0103  -0.0529 -0.0188 285 VAL A CB  
2170 C CG1 . VAL A 297 ? 0.4661 0.4907 0.3766 0.0112  -0.0623 -0.0201 285 VAL A CG1 
2171 C CG2 . VAL A 297 ? 0.4154 0.4528 0.3657 0.0127  -0.0560 -0.0211 285 VAL A CG2 
2172 N N   . PRO A 298 ? 0.4297 0.4312 0.3063 0.0098  -0.0480 -0.0033 286 PRO A N   
2173 C CA  . PRO A 298 ? 0.4453 0.4405 0.3009 0.0066  -0.0423 -0.0011 286 PRO A CA  
2174 C C   . PRO A 298 ? 0.4576 0.4545 0.3023 0.0064  -0.0452 -0.0074 286 PRO A C   
2175 O O   . PRO A 298 ? 0.4624 0.4590 0.3030 0.0091  -0.0561 -0.0093 286 PRO A O   
2176 C CB  . PRO A 298 ? 0.4637 0.4466 0.3017 0.0084  -0.0470 0.0071  286 PRO A CB  
2177 C CG  . PRO A 298 ? 0.4696 0.4541 0.3156 0.0143  -0.0597 0.0063  286 PRO A CG  
2178 C CD  . PRO A 298 ? 0.4445 0.4401 0.3178 0.0147  -0.0573 0.0014  286 PRO A CD  
2179 N N   . ILE A 299 ? 0.4585 0.4567 0.2978 0.0036  -0.0362 -0.0107 287 ILE A N   
2180 C CA  . ILE A 299 ? 0.4692 0.4660 0.2953 0.0036  -0.0385 -0.0176 287 ILE A CA  
2181 C C   . ILE A 299 ? 0.5015 0.4900 0.3008 0.0026  -0.0324 -0.0138 287 ILE A C   
2182 O O   . ILE A 299 ? 0.4844 0.4737 0.2832 0.0004  -0.0207 -0.0103 287 ILE A O   
2183 C CB  . ILE A 299 ? 0.4520 0.4546 0.2911 0.0023  -0.0321 -0.0253 287 ILE A CB  
2184 C CG1 . ILE A 299 ? 0.4263 0.4363 0.2909 0.0024  -0.0363 -0.0278 287 ILE A CG1 
2185 C CG2 . ILE A 299 ? 0.4255 0.4234 0.2475 0.0022  -0.0334 -0.0332 287 ILE A CG2 
2186 C CD1 . ILE A 299 ? 0.3859 0.3984 0.2550 0.0028  -0.0488 -0.0326 287 ILE A CD1 
2187 N N   . ASP A 300 ? 0.5467 0.5275 0.3235 0.0040  -0.0403 -0.0145 288 ASP A N   
2188 C CA  . ASP A 300 ? 0.5961 0.5673 0.3438 0.0029  -0.0343 -0.0100 288 ASP A CA  
2189 C C   . ASP A 300 ? 0.5950 0.5673 0.3341 0.0021  -0.0249 -0.0182 288 ASP A C   
2190 O O   . ASP A 300 ? 0.6015 0.5736 0.3388 0.0032  -0.0307 -0.0272 288 ASP A O   
2191 C CB  . ASP A 300 ? 0.6504 0.6110 0.3745 0.0054  -0.0472 -0.0060 288 ASP A CB  
2192 C CG  . ASP A 300 ? 0.7263 0.6831 0.4576 0.0074  -0.0541 0.0038  288 ASP A CG  
2193 O OD1 . ASP A 300 ? 0.7636 0.7192 0.5023 0.0049  -0.0449 0.0107  288 ASP A OD1 
2194 O OD2 . ASP A 300 ? 0.8626 0.8176 0.5926 0.0116  -0.0692 0.0043  288 ASP A OD2 
2195 N N   . THR A 301 ? 0.5887 0.5628 0.3250 0.0002  -0.0100 -0.0155 289 THR A N   
2196 C CA  . THR A 301 ? 0.5973 0.5735 0.3283 0.0009  0.0004  -0.0234 289 THR A CA  
2197 C C   . THR A 301 ? 0.6382 0.6084 0.3421 -0.0003 0.0112  -0.0192 289 THR A C   
2198 O O   . THR A 301 ? 0.6439 0.6108 0.3404 -0.0031 0.0135  -0.0091 289 THR A O   
2199 C CB  . THR A 301 ? 0.5697 0.5582 0.3287 0.0009  0.0107  -0.0252 289 THR A CB  
2200 O OG1 . THR A 301 ? 0.5331 0.5266 0.2975 -0.0021 0.0201  -0.0163 289 THR A OG1 
2201 C CG2 . THR A 301 ? 0.5132 0.5069 0.2988 0.0016  0.0018  -0.0282 289 THR A CG2 
2202 N N   . GLU A 302 ? 0.6778 0.6462 0.3674 0.0015  0.0194  -0.0270 290 GLU A N   
2203 C CA  . GLU A 302 ? 0.7295 0.6923 0.3908 0.0005  0.0316  -0.0240 290 GLU A CA  
2204 C C   . GLU A 302 ? 0.7096 0.6840 0.3859 -0.0023 0.0483  -0.0177 290 GLU A C   
2205 O O   . GLU A 302 ? 0.7332 0.7041 0.3944 -0.0063 0.0553  -0.0089 290 GLU A O   
2206 C CB  . GLU A 302 ? 0.7627 0.7196 0.4040 0.0042  0.0360  -0.0357 290 GLU A CB  
2207 C CG  . GLU A 302 ? 0.8784 0.8228 0.4777 0.0037  0.0425  -0.0338 290 GLU A CG  
2208 C CD  . GLU A 302 ? 0.9671 0.8961 0.5380 0.0030  0.0250  -0.0301 290 GLU A CD  
2209 O OE1 . GLU A 302 ? 1.0492 0.9652 0.5820 0.0037  0.0267  -0.0318 290 GLU A OE1 
2210 O OE2 . GLU A 302 ? 0.9902 0.9203 0.5764 0.0024  0.0098  -0.0258 290 GLU A OE2 
2211 N N   . LYS A 303 ? 0.6670 0.6551 0.3728 -0.0006 0.0542  -0.0222 291 LYS A N   
2212 C CA  . LYS A 303 ? 0.6495 0.6523 0.3734 -0.0026 0.0696  -0.0184 291 LYS A CA  
2213 C C   . LYS A 303 ? 0.5929 0.6084 0.3532 -0.0032 0.0663  -0.0168 291 LYS A C   
2214 O O   . LYS A 303 ? 0.5816 0.6115 0.3616 -0.0029 0.0767  -0.0171 291 LYS A O   
2215 C CB  . LYS A 303 ? 0.6639 0.6726 0.3859 0.0025  0.0831  -0.0275 291 LYS A CB  
2216 C CG  . LYS A 303 ? 0.7542 0.7508 0.4395 0.0041  0.0886  -0.0313 291 LYS A CG  
2217 C CD  . LYS A 303 ? 0.8387 0.8378 0.5237 0.0115  0.0984  -0.0436 291 LYS A CD  
2218 C CE  . LYS A 303 ? 0.9024 0.8853 0.5465 0.0140  0.1017  -0.0504 291 LYS A CE  
2219 N NZ  . LYS A 303 ? 0.9495 0.9385 0.5811 0.0149  0.1229  -0.0500 291 LYS A NZ  
2220 N N   . GLY A 304 ? 0.5503 0.5612 0.3195 -0.0036 0.0520  -0.0154 292 GLY A N   
2221 C CA  . GLY A 304 ? 0.5172 0.5381 0.3169 -0.0046 0.0490  -0.0133 292 GLY A CA  
2222 C C   . GLY A 304 ? 0.4898 0.5150 0.3075 0.0002  0.0455  -0.0214 292 GLY A C   
2223 O O   . GLY A 304 ? 0.4655 0.4986 0.3067 0.0000  0.0438  -0.0198 292 GLY A O   
2224 N N   . PHE A 305 ? 0.4942 0.5123 0.2996 0.0044  0.0440  -0.0299 293 PHE A N   
2225 C CA  . PHE A 305 ? 0.4882 0.5064 0.3078 0.0086  0.0405  -0.0377 293 PHE A CA  
2226 C C   . PHE A 305 ? 0.4912 0.4973 0.2987 0.0089  0.0290  -0.0437 293 PHE A C   
2227 O O   . PHE A 305 ? 0.4760 0.4734 0.2594 0.0084  0.0266  -0.0454 293 PHE A O   
2228 C CB  . PHE A 305 ? 0.5132 0.5349 0.3339 0.0141  0.0520  -0.0444 293 PHE A CB  
2229 C CG  . PHE A 305 ? 0.5273 0.5644 0.3637 0.0145  0.0633  -0.0398 293 PHE A CG  
2230 C CD1 . PHE A 305 ? 0.4900 0.5369 0.3526 0.0167  0.0630  -0.0390 293 PHE A CD1 
2231 C CD2 . PHE A 305 ? 0.5454 0.5878 0.3706 0.0121  0.0741  -0.0359 293 PHE A CD2 
2232 C CE1 . PHE A 305 ? 0.4848 0.5481 0.3643 0.0168  0.0716  -0.0350 293 PHE A CE1 
2233 C CE2 . PHE A 305 ? 0.5438 0.6036 0.3876 0.0113  0.0846  -0.0317 293 PHE A CE2 
2234 C CZ  . PHE A 305 ? 0.5173 0.5883 0.3889 0.0138  0.0828  -0.0316 293 PHE A CZ  
2235 N N   . PHE A 306 ? 0.4640 0.4698 0.2885 0.0094  0.0221  -0.0469 294 PHE A N   
2236 C CA  . PHE A 306 ? 0.4685 0.4647 0.2861 0.0088  0.0120  -0.0539 294 PHE A CA  
2237 C C   . PHE A 306 ? 0.4934 0.4803 0.2918 0.0117  0.0163  -0.0633 294 PHE A C   
2238 O O   . PHE A 306 ? 0.4894 0.4780 0.2895 0.0158  0.0273  -0.0660 294 PHE A O   
2239 C CB  . PHE A 306 ? 0.4374 0.4347 0.2770 0.0084  0.0073  -0.0563 294 PHE A CB  
2240 C CG  . PHE A 306 ? 0.4275 0.4308 0.2820 0.0054  0.0004  -0.0496 294 PHE A CG  
2241 C CD1 . PHE A 306 ? 0.4489 0.4502 0.3016 0.0029  -0.0109 -0.0503 294 PHE A CD1 
2242 C CD2 . PHE A 306 ? 0.4114 0.4228 0.2824 0.0056  0.0049  -0.0432 294 PHE A CD2 
2243 C CE1 . PHE A 306 ? 0.4285 0.4357 0.2961 0.0014  -0.0163 -0.0448 294 PHE A CE1 
2244 C CE2 . PHE A 306 ? 0.3903 0.4054 0.2731 0.0034  -0.0009 -0.0381 294 PHE A CE2 
2245 C CZ  . PHE A 306 ? 0.3900 0.4030 0.2712 0.0018  -0.0107 -0.0390 294 PHE A CZ  
2246 N N   . SER A 307 ? 0.5207 0.4980 0.3011 0.0099  0.0069  -0.0685 295 SER A N   
2247 C CA  . SER A 307 ? 0.5440 0.5091 0.3033 0.0120  0.0086  -0.0792 295 SER A CA  
2248 C C   . SER A 307 ? 0.5575 0.5147 0.3130 0.0081  -0.0065 -0.0858 295 SER A C   
2249 O O   . SER A 307 ? 0.5405 0.5037 0.3111 0.0045  -0.0169 -0.0816 295 SER A O   
2250 C CB  . SER A 307 ? 0.5780 0.5392 0.3077 0.0133  0.0148  -0.0781 295 SER A CB  
2251 O OG  . SER A 307 ? 0.5600 0.5175 0.2737 0.0099  0.0031  -0.0743 295 SER A OG  
2252 N N   . LEU A 308 ? 0.5745 0.5184 0.3103 0.0087  -0.0078 -0.0967 296 LEU A N   
2253 C CA  . LEU A 308 ? 0.5950 0.5315 0.3255 0.0039  -0.0230 -0.1040 296 LEU A CA  
2254 C C   . LEU A 308 ? 0.6029 0.5443 0.3257 0.0010  -0.0364 -0.0985 296 LEU A C   
2255 O O   . LEU A 308 ? 0.5989 0.5419 0.3310 -0.0033 -0.0504 -0.1015 296 LEU A O   
2256 C CB  . LEU A 308 ? 0.6244 0.5437 0.3287 0.0047  -0.0231 -0.1172 296 LEU A CB  
2257 C CG  . LEU A 308 ? 0.6427 0.5523 0.3577 0.0057  -0.0175 -0.1261 296 LEU A CG  
2258 C CD1 . LEU A 308 ? 0.6388 0.5284 0.3208 0.0077  -0.0162 -0.1399 296 LEU A CD1 
2259 C CD2 . LEU A 308 ? 0.6492 0.5604 0.3908 -0.0007 -0.0276 -0.1275 296 LEU A CD2 
2260 N N   . GLN A 309 ? 0.6079 0.5515 0.3149 0.0033  -0.0323 -0.0903 297 GLN A N   
2261 C CA  . GLN A 309 ? 0.6340 0.5800 0.3324 0.0019  -0.0450 -0.0838 297 GLN A CA  
2262 C C   . GLN A 309 ? 0.6035 0.5626 0.3343 0.0000  -0.0528 -0.0770 297 GLN A C   
2263 O O   . GLN A 309 ? 0.6058 0.5682 0.3373 -0.0007 -0.0667 -0.0741 297 GLN A O   
2264 C CB  . GLN A 309 ? 0.6672 0.6103 0.3412 0.0044  -0.0363 -0.0753 297 GLN A CB  
2265 C CG  . GLN A 309 ? 0.7344 0.6840 0.4152 0.0042  -0.0407 -0.0623 297 GLN A CG  
2266 C CD  . GLN A 309 ? 0.8267 0.7724 0.4857 0.0052  -0.0293 -0.0529 297 GLN A CD  
2267 O OE1 . GLN A 309 ? 0.9346 0.8716 0.5653 0.0062  -0.0211 -0.0561 297 GLN A OE1 
2268 N NE2 . GLN A 309 ? 0.8372 0.7887 0.5091 0.0045  -0.0284 -0.0414 297 GLN A NE2 
2269 N N   . ASN A 310 ? 0.5694 0.5359 0.3270 0.0000  -0.0442 -0.0750 298 ASN A N   
2270 C CA  . ASN A 310 ? 0.5382 0.5160 0.3239 -0.0012 -0.0494 -0.0692 298 ASN A CA  
2271 C C   . ASN A 310 ? 0.5286 0.5093 0.3363 -0.0049 -0.0551 -0.0763 298 ASN A C   
2272 O O   . ASN A 310 ? 0.4987 0.4892 0.3315 -0.0062 -0.0572 -0.0723 298 ASN A O   
2273 C CB  . ASN A 310 ? 0.5089 0.4930 0.3090 0.0005  -0.0367 -0.0612 298 ASN A CB  
2274 C CG  . ASN A 310 ? 0.5324 0.5146 0.3143 0.0024  -0.0297 -0.0537 298 ASN A CG  
2275 O OD1 . ASN A 310 ? 0.5143 0.4961 0.2918 0.0038  -0.0169 -0.0535 298 ASN A OD1 
2276 N ND2 . ASN A 310 ? 0.5217 0.5024 0.2926 0.0026  -0.0380 -0.0474 298 ASN A ND2 
2277 N N   . LEU A 311 ? 0.5484 0.5196 0.3467 -0.0070 -0.0563 -0.0868 299 LEU A N   
2278 C CA  . LEU A 311 ? 0.5470 0.5182 0.3649 -0.0119 -0.0602 -0.0937 299 LEU A CA  
2279 C C   . LEU A 311 ? 0.5425 0.5249 0.3774 -0.0161 -0.0746 -0.0931 299 LEU A C   
2280 O O   . LEU A 311 ? 0.5326 0.5239 0.3943 -0.0188 -0.0742 -0.0911 299 LEU A O   
2281 C CB  . LEU A 311 ? 0.5694 0.5251 0.3697 -0.0139 -0.0607 -0.1060 299 LEU A CB  
2282 C CG  . LEU A 311 ? 0.5797 0.5311 0.3963 -0.0206 -0.0652 -0.1144 299 LEU A CG  
2283 C CD1 . LEU A 311 ? 0.5554 0.5077 0.3941 -0.0201 -0.0538 -0.1106 299 LEU A CD1 
2284 C CD2 . LEU A 311 ? 0.5537 0.4865 0.3465 -0.0227 -0.0681 -0.1276 299 LEU A CD2 
2285 N N   . GLN A 312 ? 0.5652 0.5477 0.3845 -0.0160 -0.0872 -0.0945 300 GLN A N   
2286 C CA  . GLN A 312 ? 0.5816 0.5760 0.4181 -0.0194 -0.1025 -0.0956 300 GLN A CA  
2287 C C   . GLN A 312 ? 0.5580 0.5671 0.4182 -0.0163 -0.1011 -0.0851 300 GLN A C   
2288 O O   . GLN A 312 ? 0.5472 0.5684 0.4357 -0.0196 -0.1047 -0.0858 300 GLN A O   
2289 C CB  . GLN A 312 ? 0.6086 0.5998 0.4211 -0.0186 -0.1177 -0.0985 300 GLN A CB  
2290 C CG  . GLN A 312 ? 0.6968 0.7025 0.5291 -0.0217 -0.1355 -0.1006 300 GLN A CG  
2291 C CD  . GLN A 312 ? 0.7834 0.7961 0.6455 -0.0302 -0.1364 -0.1084 300 GLN A CD  
2292 O OE1 . GLN A 312 ? 0.8248 0.8535 0.7194 -0.0315 -0.1360 -0.1044 300 GLN A OE1 
2293 N NE2 . GLN A 312 ? 0.7735 0.7724 0.6239 -0.0361 -0.1356 -0.1192 300 GLN A NE2 
2294 N N   . GLU A 313 ? 0.5499 0.5572 0.3988 -0.0104 -0.0949 -0.0758 301 GLU A N   
2295 C CA  . GLU A 313 ? 0.5386 0.5568 0.4075 -0.0072 -0.0934 -0.0666 301 GLU A CA  
2296 C C   . GLU A 313 ? 0.5092 0.5329 0.4038 -0.0094 -0.0824 -0.0660 301 GLU A C   
2297 O O   . GLU A 313 ? 0.5012 0.5363 0.4193 -0.0093 -0.0841 -0.0631 301 GLU A O   
2298 C CB  . GLU A 313 ? 0.5405 0.5527 0.3907 -0.0019 -0.0883 -0.0573 301 GLU A CB  
2299 C CG  . GLU A 313 ? 0.5671 0.5865 0.4351 0.0010  -0.0848 -0.0488 301 GLU A CG  
2300 C CD  . GLU A 313 ? 0.6193 0.6316 0.4686 0.0054  -0.0838 -0.0393 301 GLU A CD  
2301 O OE1 . GLU A 313 ? 0.6352 0.6515 0.4959 0.0088  -0.0868 -0.0328 301 GLU A OE1 
2302 O OE2 . GLU A 313 ? 0.6238 0.6257 0.4471 0.0052  -0.0789 -0.0385 301 GLU A OE2 
2303 N N   . CYS A 314 ? 0.4946 0.5099 0.3840 -0.0108 -0.0710 -0.0686 302 CYS A N   
2304 C CA  . CYS A 314 ? 0.4765 0.4945 0.3862 -0.0125 -0.0615 -0.0676 302 CYS A CA  
2305 C C   . CYS A 314 ? 0.4746 0.4979 0.4052 -0.0189 -0.0661 -0.0738 302 CYS A C   
2306 O O   . CYS A 314 ? 0.4449 0.4759 0.3971 -0.0203 -0.0621 -0.0708 302 CYS A O   
2307 C CB  . CYS A 314 ? 0.4738 0.4815 0.3726 -0.0111 -0.0492 -0.0684 302 CYS A CB  
2308 S SG  . CYS A 314 ? 0.4963 0.5040 0.3830 -0.0054 -0.0407 -0.0591 302 CYS A SG  
2309 N N   . LEU A 315 ? 0.4871 0.5056 0.4104 -0.0233 -0.0741 -0.0825 303 LEU A N   
2310 C CA  . LEU A 315 ? 0.4874 0.5120 0.4317 -0.0309 -0.0798 -0.0885 303 LEU A CA  
2311 C C   . LEU A 315 ? 0.4897 0.5333 0.4558 -0.0310 -0.0889 -0.0855 303 LEU A C   
2312 O O   . LEU A 315 ? 0.4930 0.5465 0.4847 -0.0352 -0.0861 -0.0853 303 LEU A O   
2313 C CB  . LEU A 315 ? 0.5089 0.5235 0.4400 -0.0364 -0.0877 -0.0992 303 LEU A CB  
2314 C CG  . LEU A 315 ? 0.5031 0.4980 0.4168 -0.0365 -0.0780 -0.1040 303 LEU A CG  
2315 C CD1 . LEU A 315 ? 0.5434 0.5252 0.4344 -0.0398 -0.0871 -0.1153 303 LEU A CD1 
2316 C CD2 . LEU A 315 ? 0.4979 0.4886 0.4302 -0.0415 -0.0690 -0.1045 303 LEU A CD2 
2317 N N   . GLU A 316 ? 0.4976 0.5463 0.4543 -0.0255 -0.0984 -0.0822 304 GLU A N   
2318 C CA  . GLU A 316 ? 0.5055 0.5725 0.4841 -0.0233 -0.1071 -0.0790 304 GLU A CA  
2319 C C   . GLU A 316 ? 0.4682 0.5422 0.4651 -0.0198 -0.0961 -0.0715 304 GLU A C   
2320 O O   . GLU A 316 ? 0.4469 0.5359 0.4709 -0.0216 -0.0969 -0.0718 304 GLU A O   
2321 C CB  . GLU A 316 ? 0.5237 0.5920 0.4864 -0.0165 -0.1199 -0.0756 304 GLU A CB  
2322 C CG  . GLU A 316 ? 0.6305 0.6973 0.5812 -0.0202 -0.1350 -0.0837 304 GLU A CG  
2323 C CD  . GLU A 316 ? 0.7032 0.7883 0.6849 -0.0267 -0.1456 -0.0903 304 GLU A CD  
2324 O OE1 . GLU A 316 ? 0.7685 0.8500 0.7506 -0.0356 -0.1489 -0.0997 304 GLU A OE1 
2325 O OE2 . GLU A 316 ? 0.7376 0.8410 0.7447 -0.0231 -0.1498 -0.0864 304 GLU A OE2 
2326 N N   . LEU A 317 ? 0.4589 0.5225 0.4406 -0.0151 -0.0860 -0.0653 305 LEU A N   
2327 C CA  . LEU A 317 ? 0.4493 0.5158 0.4426 -0.0121 -0.0756 -0.0588 305 LEU A CA  
2328 C C   . LEU A 317 ? 0.4404 0.5096 0.4525 -0.0181 -0.0664 -0.0614 305 LEU A C   
2329 O O   . LEU A 317 ? 0.4234 0.5005 0.4528 -0.0172 -0.0608 -0.0582 305 LEU A O   
2330 C CB  . LEU A 317 ? 0.4462 0.5001 0.4183 -0.0080 -0.0672 -0.0532 305 LEU A CB  
2331 C CG  . LEU A 317 ? 0.4694 0.5203 0.4255 -0.0018 -0.0726 -0.0473 305 LEU A CG  
2332 C CD1 . LEU A 317 ? 0.4165 0.4559 0.3538 -0.0003 -0.0626 -0.0427 305 LEU A CD1 
2333 C CD2 . LEU A 317 ? 0.4212 0.4814 0.3932 0.0033  -0.0765 -0.0423 305 LEU A CD2 
2334 N N   . SER A 318 ? 0.4532 0.5137 0.4599 -0.0241 -0.0644 -0.0672 306 SER A N   
2335 C CA  . SER A 318 ? 0.4612 0.5201 0.4819 -0.0301 -0.0553 -0.0686 306 SER A CA  
2336 C C   . SER A 318 ? 0.4566 0.5300 0.5039 -0.0370 -0.0596 -0.0726 306 SER A C   
2337 O O   . SER A 318 ? 0.4521 0.5276 0.5143 -0.0413 -0.0509 -0.0716 306 SER A O   
2338 C CB  . SER A 318 ? 0.4666 0.5078 0.4709 -0.0331 -0.0508 -0.0728 306 SER A CB  
2339 O OG  . SER A 318 ? 0.5418 0.5825 0.5492 -0.0402 -0.0591 -0.0811 306 SER A OG  
2340 N N   . LYS A 319 ? 0.4733 0.5582 0.5275 -0.0378 -0.0728 -0.0766 307 LYS A N   
2341 C CA  . LYS A 319 ? 0.4964 0.5986 0.5794 -0.0448 -0.0776 -0.0808 307 LYS A CA  
2342 C C   . LYS A 319 ? 0.4816 0.5991 0.5885 -0.0422 -0.0699 -0.0756 307 LYS A C   
2343 O O   . LYS A 319 ? 0.4813 0.6085 0.6106 -0.0493 -0.0653 -0.0776 307 LYS A O   
2344 C CB  . LYS A 319 ? 0.5143 0.6280 0.6001 -0.0446 -0.0955 -0.0857 307 LYS A CB  
2345 C CG  . LYS A 319 ? 0.5811 0.6784 0.6412 -0.0477 -0.1027 -0.0919 307 LYS A CG  
2346 C CD  . LYS A 319 ? 0.6614 0.7695 0.7255 -0.0506 -0.1216 -0.0987 307 LYS A CD  
2347 C CE  . LYS A 319 ? 0.6965 0.7858 0.7348 -0.0561 -0.1273 -0.1072 307 LYS A CE  
2348 N NZ  . LYS A 319 ? 0.7703 0.8696 0.8128 -0.0609 -0.1469 -0.1152 307 LYS A NZ  
2349 N N   . ASP A 320 ? 0.4874 0.6054 0.5877 -0.0322 -0.0676 -0.0691 308 ASP A N   
2350 C CA  . ASP A 320 ? 0.4939 0.6252 0.6140 -0.0280 -0.0611 -0.0650 308 ASP A CA  
2351 C C   . ASP A 320 ? 0.4793 0.5995 0.5930 -0.0277 -0.0451 -0.0603 308 ASP A C   
2352 O O   . ASP A 320 ? 0.4851 0.6107 0.6057 -0.0218 -0.0393 -0.0562 308 ASP A O   
2353 C CB  . ASP A 320 ? 0.4972 0.6330 0.6126 -0.0166 -0.0688 -0.0609 308 ASP A CB  
2354 C CG  . ASP A 320 ? 0.5900 0.7297 0.6992 -0.0150 -0.0866 -0.0641 308 ASP A CG  
2355 O OD1 . ASP A 320 ? 0.6471 0.8052 0.7796 -0.0177 -0.0955 -0.0686 308 ASP A OD1 
2356 O OD2 . ASP A 320 ? 0.6699 0.7944 0.7507 -0.0117 -0.0914 -0.0623 308 ASP A OD2 
2357 N N   . VAL A 321 ? 0.4536 0.5572 0.5526 -0.0329 -0.0385 -0.0607 309 VAL A N   
2358 C CA  . VAL A 321 ? 0.4201 0.5133 0.5122 -0.0321 -0.0251 -0.0559 309 VAL A CA  
2359 C C   . VAL A 321 ? 0.4093 0.4962 0.5071 -0.0417 -0.0174 -0.0579 309 VAL A C   
2360 O O   . VAL A 321 ? 0.4066 0.4945 0.5111 -0.0494 -0.0225 -0.0634 309 VAL A O   
2361 C CB  . VAL A 321 ? 0.4222 0.4988 0.4877 -0.0263 -0.0235 -0.0521 309 VAL A CB  
2362 C CG1 . VAL A 321 ? 0.3982 0.4784 0.4563 -0.0180 -0.0304 -0.0494 309 VAL A CG1 
2363 C CG2 . VAL A 321 ? 0.4238 0.4873 0.4750 -0.0301 -0.0255 -0.0558 309 VAL A CG2 
2364 N N   . ASP A 322 ? 0.3756 0.4548 0.4697 -0.0415 -0.0054 -0.0532 310 ASP A N   
2365 C CA  . ASP A 322 ? 0.3838 0.4536 0.4802 -0.0502 0.0032  -0.0533 310 ASP A CA  
2366 C C   . ASP A 322 ? 0.3780 0.4255 0.4520 -0.0497 0.0049  -0.0524 310 ASP A C   
2367 O O   . ASP A 322 ? 0.4001 0.4365 0.4735 -0.0569 0.0079  -0.0542 310 ASP A O   
2368 C CB  . ASP A 322 ? 0.3761 0.4486 0.4787 -0.0499 0.0156  -0.0483 310 ASP A CB  
2369 C CG  . ASP A 322 ? 0.3989 0.4943 0.5258 -0.0494 0.0157  -0.0497 310 ASP A CG  
2370 O OD1 . ASP A 322 ? 0.4186 0.5265 0.5656 -0.0567 0.0120  -0.0543 310 ASP A OD1 
2371 O OD2 . ASP A 322 ? 0.3718 0.4733 0.4986 -0.0413 0.0182  -0.0469 310 ASP A OD2 
2372 N N   . VAL A 323 ? 0.3656 0.4068 0.4224 -0.0412 0.0034  -0.0494 311 VAL A N   
2373 C CA  . VAL A 323 ? 0.3715 0.3942 0.4089 -0.0386 0.0057  -0.0480 311 VAL A CA  
2374 C C   . VAL A 323 ? 0.3584 0.3817 0.3827 -0.0311 -0.0004 -0.0482 311 VAL A C   
2375 O O   . VAL A 323 ? 0.3500 0.3840 0.3765 -0.0267 -0.0036 -0.0462 311 VAL A O   
2376 C CB  . VAL A 323 ? 0.3760 0.3899 0.4066 -0.0363 0.0154  -0.0414 311 VAL A CB  
2377 C CG1 . VAL A 323 ? 0.3988 0.4213 0.4285 -0.0302 0.0163  -0.0375 311 VAL A CG1 
2378 C CG2 . VAL A 323 ? 0.3595 0.3557 0.3724 -0.0324 0.0169  -0.0397 311 VAL A CG2 
2379 N N   . VAL A 324 ? 0.3527 0.3637 0.3634 -0.0298 -0.0016 -0.0506 312 VAL A N   
2380 C CA  . VAL A 324 ? 0.3476 0.3579 0.3448 -0.0233 -0.0048 -0.0503 312 VAL A CA  
2381 C C   . VAL A 324 ? 0.3514 0.3503 0.3372 -0.0184 0.0011  -0.0471 312 VAL A C   
2382 O O   . VAL A 324 ? 0.3682 0.3545 0.3507 -0.0199 0.0041  -0.0490 312 VAL A O   
2383 C CB  . VAL A 324 ? 0.3464 0.3544 0.3366 -0.0248 -0.0121 -0.0572 312 VAL A CB  
2384 C CG1 . VAL A 324 ? 0.3549 0.3626 0.3298 -0.0181 -0.0134 -0.0560 312 VAL A CG1 
2385 C CG2 . VAL A 324 ? 0.3561 0.3764 0.3591 -0.0296 -0.0201 -0.0608 312 VAL A CG2 
2386 N N   . ALA A 325 ? 0.3270 0.3306 0.3082 -0.0128 0.0024  -0.0423 313 ALA A N   
2387 C CA  . ALA A 325 ? 0.3275 0.3252 0.2997 -0.0072 0.0061  -0.0397 313 ALA A CA  
2388 C C   . ALA A 325 ? 0.3362 0.3365 0.2994 -0.0039 0.0036  -0.0421 313 ALA A C   
2389 O O   . ALA A 325 ? 0.3442 0.3523 0.3064 -0.0044 -0.0004 -0.0421 313 ALA A O   
2390 C CB  . ALA A 325 ? 0.3047 0.3067 0.2781 -0.0044 0.0087  -0.0333 313 ALA A CB  
2391 N N   . ILE A 326 ? 0.3399 0.3328 0.2960 -0.0001 0.0065  -0.0441 314 ILE A N   
2392 C CA  . ILE A 326 ? 0.3510 0.3454 0.2974 0.0033  0.0067  -0.0470 314 ILE A CA  
2393 C C   . ILE A 326 ? 0.3490 0.3423 0.2934 0.0099  0.0121  -0.0452 314 ILE A C   
2394 O O   . ILE A 326 ? 0.3678 0.3528 0.3146 0.0123  0.0146  -0.0447 314 ILE A O   
2395 C CB  . ILE A 326 ? 0.3683 0.3539 0.3073 0.0009  0.0038  -0.0550 314 ILE A CB  
2396 C CG1 . ILE A 326 ? 0.3811 0.3675 0.3063 0.0043  0.0045  -0.0584 314 ILE A CG1 
2397 C CG2 . ILE A 326 ? 0.3304 0.3009 0.2700 0.0004  0.0064  -0.0587 314 ILE A CG2 
2398 C CD1 . ILE A 326 ? 0.3783 0.3570 0.2939 0.0006  -0.0008 -0.0666 314 ILE A CD1 
2399 N N   . GLY A 327 ? 0.3594 0.3617 0.3003 0.0129  0.0140  -0.0436 315 GLY A N   
2400 C CA  . GLY A 327 ? 0.3531 0.3577 0.2937 0.0194  0.0194  -0.0434 315 GLY A CA  
2401 C C   . GLY A 327 ? 0.3533 0.3716 0.3000 0.0212  0.0215  -0.0376 315 GLY A C   
2402 O O   . GLY A 327 ? 0.3400 0.3652 0.2858 0.0248  0.0262  -0.0382 315 GLY A O   
2403 N N   . PRO A 328 ? 0.3570 0.3797 0.3106 0.0184  0.0185  -0.0322 316 PRO A N   
2404 C CA  . PRO A 328 ? 0.3547 0.3897 0.3147 0.0191  0.0196  -0.0272 316 PRO A CA  
2405 C C   . PRO A 328 ? 0.3582 0.4011 0.3136 0.0164  0.0217  -0.0267 316 PRO A C   
2406 O O   . PRO A 328 ? 0.3496 0.3897 0.2983 0.0121  0.0189  -0.0265 316 PRO A O   
2407 C CB  . PRO A 328 ? 0.3533 0.3877 0.3169 0.0153  0.0154  -0.0230 316 PRO A CB  
2408 C CG  . PRO A 328 ? 0.3587 0.3814 0.3208 0.0148  0.0141  -0.0250 316 PRO A CG  
2409 C CD  . PRO A 328 ? 0.3549 0.3717 0.3110 0.0144  0.0148  -0.0308 316 PRO A CD  
2410 N N   . GLY A 329 ? 0.3606 0.4134 0.3202 0.0194  0.0267  -0.0262 317 GLY A N   
2411 C CA  . GLY A 329 ? 0.3764 0.4370 0.3317 0.0164  0.0307  -0.0247 317 GLY A CA  
2412 C C   . GLY A 329 ? 0.3826 0.4366 0.3227 0.0162  0.0332  -0.0288 317 GLY A C   
2413 O O   . GLY A 329 ? 0.3955 0.4529 0.3281 0.0126  0.0358  -0.0265 317 GLY A O   
2414 N N   . LEU A 330 ? 0.3867 0.4304 0.3204 0.0197  0.0327  -0.0348 318 LEU A N   
2415 C CA  . LEU A 330 ? 0.4017 0.4382 0.3182 0.0191  0.0339  -0.0396 318 LEU A CA  
2416 C C   . LEU A 330 ? 0.4191 0.4616 0.3299 0.0228  0.0436  -0.0417 318 LEU A C   
2417 O O   . LEU A 330 ? 0.4265 0.4655 0.3207 0.0213  0.0460  -0.0435 318 LEU A O   
2418 C CB  . LEU A 330 ? 0.4179 0.4406 0.3285 0.0209  0.0305  -0.0467 318 LEU A CB  
2419 C CG  . LEU A 330 ? 0.4162 0.4321 0.3296 0.0164  0.0218  -0.0466 318 LEU A CG  
2420 C CD1 . LEU A 330 ? 0.4138 0.4163 0.3205 0.0170  0.0197  -0.0545 318 LEU A CD1 
2421 C CD2 . LEU A 330 ? 0.4006 0.4190 0.3082 0.0115  0.0166  -0.0433 318 LEU A CD2 
2422 N N   . GLY A 331 ? 0.4297 0.4815 0.3539 0.0281  0.0495  -0.0415 319 GLY A N   
2423 C CA  . GLY A 331 ? 0.4461 0.5048 0.3675 0.0330  0.0602  -0.0448 319 GLY A CA  
2424 C C   . GLY A 331 ? 0.4811 0.5265 0.3943 0.0401  0.0619  -0.0536 319 GLY A C   
2425 O O   . GLY A 331 ? 0.4707 0.5010 0.3774 0.0389  0.0547  -0.0569 319 GLY A O   
2426 N N   . ASN A 332 ? 0.5164 0.5672 0.4308 0.0475  0.0718  -0.0577 320 ASN A N   
2427 C CA  . ASN A 332 ? 0.5581 0.5950 0.4649 0.0554  0.0744  -0.0665 320 ASN A CA  
2428 C C   . ASN A 332 ? 0.5870 0.6240 0.4772 0.0586  0.0854  -0.0725 320 ASN A C   
2429 O O   . ASN A 332 ? 0.6248 0.6763 0.5248 0.0646  0.0960  -0.0726 320 ASN A O   
2430 C CB  . ASN A 332 ? 0.5570 0.5999 0.4839 0.0648  0.0767  -0.0663 320 ASN A CB  
2431 C CG  . ASN A 332 ? 0.6506 0.6803 0.5701 0.0751  0.0824  -0.0756 320 ASN A CG  
2432 O OD1 . ASN A 332 ? 0.7548 0.7704 0.6528 0.0743  0.0848  -0.0830 320 ASN A OD1 
2433 N ND2 . ASN A 332 ? 0.7162 0.7487 0.6517 0.0852  0.0842  -0.0757 320 ASN A ND2 
2434 N N   . ASN A 333 ? 0.5874 0.6100 0.4532 0.0542  0.0828  -0.0769 321 ASN A N   
2435 C CA  . ASN A 333 ? 0.6045 0.6216 0.4479 0.0574  0.0924  -0.0841 321 ASN A CA  
2436 C C   . ASN A 333 ? 0.6045 0.5972 0.4262 0.0563  0.0845  -0.0932 321 ASN A C   
2437 O O   . ASN A 333 ? 0.5790 0.5624 0.4057 0.0519  0.0725  -0.0927 321 ASN A O   
2438 C CB  . ASN A 333 ? 0.6074 0.6343 0.4389 0.0507  0.0973  -0.0782 321 ASN A CB  
2439 C CG  . ASN A 333 ? 0.6319 0.6531 0.4552 0.0406  0.0844  -0.0722 321 ASN A CG  
2440 O OD1 . ASN A 333 ? 0.6709 0.6758 0.4792 0.0383  0.0747  -0.0771 321 ASN A OD1 
2441 N ND2 . ASN A 333 ? 0.6322 0.6667 0.4661 0.0346  0.0841  -0.0621 321 ASN A ND2 
2442 N N   . GLU A 334 ? 0.6208 0.6034 0.4181 0.0593  0.0911  -0.1016 322 GLU A N   
2443 C CA  . GLU A 334 ? 0.6520 0.6109 0.4283 0.0589  0.0844  -0.1121 322 GLU A CA  
2444 C C   . GLU A 334 ? 0.6320 0.5834 0.3979 0.0484  0.0694  -0.1101 322 GLU A C   
2445 O O   . GLU A 334 ? 0.6291 0.5656 0.3929 0.0458  0.0596  -0.1159 322 GLU A O   
2446 C CB  . GLU A 334 ? 0.6976 0.6471 0.4465 0.0645  0.0952  -0.1220 322 GLU A CB  
2447 C CG  . GLU A 334 ? 0.8023 0.7480 0.5590 0.0771  0.1066  -0.1299 322 GLU A CG  
2448 C CD  . GLU A 334 ? 0.9038 0.8300 0.6676 0.0794  0.0978  -0.1360 322 GLU A CD  
2449 O OE1 . GLU A 334 ? 0.9983 0.9033 0.7432 0.0740  0.0882  -0.1436 322 GLU A OE1 
2450 O OE2 . GLU A 334 ? 0.9740 0.9058 0.7624 0.0862  0.1002  -0.1330 322 GLU A OE2 
2451 N N   . HIS A 335 ? 0.6155 0.5776 0.3765 0.0424  0.0675  -0.1018 323 HIS A N   
2452 C CA  . HIS A 335 ? 0.6153 0.5721 0.3679 0.0339  0.0528  -0.0993 323 HIS A CA  
2453 C C   . HIS A 335 ? 0.5735 0.5352 0.3523 0.0299  0.0428  -0.0939 323 HIS A C   
2454 O O   . HIS A 335 ? 0.5601 0.5137 0.3374 0.0248  0.0306  -0.0966 323 HIS A O   
2455 C CB  . HIS A 335 ? 0.6313 0.5954 0.3691 0.0299  0.0541  -0.0915 323 HIS A CB  
2456 C CG  . HIS A 335 ? 0.7164 0.6718 0.4218 0.0324  0.0624  -0.0974 323 HIS A CG  
2457 N ND1 . HIS A 335 ? 0.7791 0.7408 0.4695 0.0308  0.0704  -0.0904 323 HIS A ND1 
2458 C CD2 . HIS A 335 ? 0.7750 0.7146 0.4586 0.0364  0.0645  -0.1098 323 HIS A CD2 
2459 C CE1 . HIS A 335 ? 0.7969 0.7475 0.4565 0.0337  0.0773  -0.0980 323 HIS A CE1 
2460 N NE2 . HIS A 335 ? 0.8306 0.7677 0.4856 0.0375  0.0739  -0.1103 323 HIS A NE2 
2461 N N   . VAL A 336 ? 0.5359 0.5112 0.3387 0.0322  0.0483  -0.0867 324 VAL A N   
2462 C CA  . VAL A 336 ? 0.5152 0.4935 0.3411 0.0296  0.0409  -0.0823 324 VAL A CA  
2463 C C   . VAL A 336 ? 0.5097 0.4731 0.3388 0.0317  0.0380  -0.0904 324 VAL A C   
2464 O O   . VAL A 336 ? 0.4993 0.4573 0.3347 0.0263  0.0286  -0.0906 324 VAL A O   
2465 C CB  . VAL A 336 ? 0.4962 0.4911 0.3446 0.0317  0.0465  -0.0734 324 VAL A CB  
2466 C CG1 . VAL A 336 ? 0.4675 0.4621 0.3360 0.0300  0.0395  -0.0701 324 VAL A CG1 
2467 C CG2 . VAL A 336 ? 0.4973 0.5045 0.3434 0.0270  0.0476  -0.0647 324 VAL A CG2 
2468 N N   . ARG A 337 ? 0.5320 0.4884 0.3571 0.0395  0.0467  -0.0969 325 ARG A N   
2469 C CA  . ARG A 337 ? 0.5457 0.4833 0.3699 0.0419  0.0448  -0.1054 325 ARG A CA  
2470 C C   . ARG A 337 ? 0.5666 0.4882 0.3743 0.0345  0.0346  -0.1133 325 ARG A C   
2471 O O   . ARG A 337 ? 0.5638 0.4757 0.3798 0.0299  0.0275  -0.1151 325 ARG A O   
2472 C CB  . ARG A 337 ? 0.5633 0.4947 0.3812 0.0528  0.0564  -0.1122 325 ARG A CB  
2473 C CG  . ARG A 337 ? 0.6085 0.5158 0.4206 0.0561  0.0552  -0.1222 325 ARG A CG  
2474 C CD  . ARG A 337 ? 0.6799 0.5812 0.4840 0.0685  0.0677  -0.1297 325 ARG A CD  
2475 N NE  . ARG A 337 ? 0.7134 0.6344 0.5386 0.0769  0.0762  -0.1219 325 ARG A NE  
2476 C CZ  . ARG A 337 ? 0.7540 0.6744 0.5987 0.0832  0.0763  -0.1182 325 ARG A CZ  
2477 N NH1 . ARG A 337 ? 0.7628 0.6612 0.6073 0.0821  0.0699  -0.1211 325 ARG A NH1 
2478 N NH2 . ARG A 337 ? 0.7499 0.6916 0.6142 0.0903  0.0826  -0.1111 325 ARG A NH2 
2479 N N   . GLU A 338 ? 0.5754 0.4950 0.3602 0.0328  0.0336  -0.1175 326 GLU A N   
2480 C CA  . GLU A 338 ? 0.5986 0.5051 0.3668 0.0255  0.0220  -0.1252 326 GLU A CA  
2481 C C   . GLU A 338 ? 0.5627 0.4777 0.3461 0.0166  0.0095  -0.1189 326 GLU A C   
2482 O O   . GLU A 338 ? 0.5551 0.4613 0.3432 0.0105  0.0005  -0.1237 326 GLU A O   
2483 C CB  . GLU A 338 ? 0.6292 0.5341 0.3682 0.0256  0.0224  -0.1288 326 GLU A CB  
2484 C CG  . GLU A 338 ? 0.7063 0.5980 0.4234 0.0333  0.0334  -0.1389 326 GLU A CG  
2485 C CD  . GLU A 338 ? 0.7936 0.6881 0.4823 0.0347  0.0387  -0.1388 326 GLU A CD  
2486 O OE1 . GLU A 338 ? 0.7866 0.6900 0.4697 0.0293  0.0319  -0.1313 326 GLU A OE1 
2487 O OE2 . GLU A 338 ? 0.8557 0.7425 0.5269 0.0419  0.0506  -0.1461 326 GLU A OE2 
2488 N N   . PHE A 339 ? 0.5418 0.4740 0.3339 0.0158  0.0095  -0.1082 327 PHE A N   
2489 C CA  . PHE A 339 ? 0.5191 0.4605 0.3265 0.0090  -0.0008 -0.1020 327 PHE A CA  
2490 C C   . PHE A 339 ? 0.5094 0.4501 0.3409 0.0068  -0.0018 -0.1004 327 PHE A C   
2491 O O   . PHE A 339 ? 0.5208 0.4588 0.3600 0.0000  -0.0109 -0.1030 327 PHE A O   
2492 C CB  . PHE A 339 ? 0.5192 0.4762 0.3297 0.0096  0.0007  -0.0911 327 PHE A CB  
2493 C CG  . PHE A 339 ? 0.4875 0.4550 0.3188 0.0054  -0.0061 -0.0834 327 PHE A CG  
2494 C CD1 . PHE A 339 ? 0.5145 0.4843 0.3446 0.0004  -0.0184 -0.0833 327 PHE A CD1 
2495 C CD2 . PHE A 339 ? 0.4807 0.4563 0.3320 0.0070  -0.0006 -0.0766 327 PHE A CD2 
2496 C CE1 . PHE A 339 ? 0.4941 0.4739 0.3437 -0.0022 -0.0235 -0.0770 327 PHE A CE1 
2497 C CE2 . PHE A 339 ? 0.4624 0.4465 0.3309 0.0035  -0.0059 -0.0704 327 PHE A CE2 
2498 C CZ  . PHE A 339 ? 0.4991 0.4853 0.3672 -0.0008 -0.0168 -0.0708 327 PHE A CZ  
2499 N N   . VAL A 340 ? 0.4842 0.4282 0.3277 0.0122  0.0073  -0.0958 328 VAL A N   
2500 C CA  . VAL A 340 ? 0.4717 0.4141 0.3350 0.0106  0.0071  -0.0926 328 VAL A CA  
2501 C C   . VAL A 340 ? 0.4961 0.4204 0.3577 0.0066  0.0033  -0.1013 328 VAL A C   
2502 O O   . VAL A 340 ? 0.4735 0.3976 0.3482 -0.0004 -0.0021 -0.0999 328 VAL A O   
2503 C CB  . VAL A 340 ? 0.4599 0.4065 0.3326 0.0185  0.0168  -0.0874 328 VAL A CB  
2504 C CG1 . VAL A 340 ? 0.4478 0.3866 0.3350 0.0184  0.0172  -0.0852 328 VAL A CG1 
2505 C CG2 . VAL A 340 ? 0.4464 0.4117 0.3264 0.0192  0.0186  -0.0779 328 VAL A CG2 
2506 N N   . ASN A 341 ? 0.5247 0.4334 0.3704 0.0108  0.0071  -0.1104 329 ASN A N   
2507 C CA  . ASN A 341 ? 0.5505 0.4382 0.3926 0.0072  0.0044  -0.1192 329 ASN A CA  
2508 C C   . ASN A 341 ? 0.5700 0.4553 0.4075 -0.0035 -0.0075 -0.1254 329 ASN A C   
2509 O O   . ASN A 341 ? 0.5639 0.4421 0.4121 -0.0113 -0.0123 -0.1273 329 ASN A O   
2510 C CB  . ASN A 341 ? 0.5854 0.4562 0.4109 0.0160  0.0123  -0.1276 329 ASN A CB  
2511 C CG  . ASN A 341 ? 0.5947 0.4666 0.4313 0.0262  0.0223  -0.1218 329 ASN A CG  
2512 O OD1 . ASN A 341 ? 0.6319 0.4980 0.4824 0.0249  0.0220  -0.1174 329 ASN A OD1 
2513 N ND2 . ASN A 341 ? 0.5807 0.4626 0.4128 0.0357  0.0308  -0.1204 329 ASN A ND2 
2514 N N   . GLU A 342 ? 0.5666 0.4585 0.3889 -0.0041 -0.0126 -0.1280 330 GLU A N   
2515 C CA  . GLU A 342 ? 0.5950 0.4880 0.4150 -0.0137 -0.0261 -0.1329 330 GLU A CA  
2516 C C   . GLU A 342 ? 0.5592 0.4698 0.4041 -0.0201 -0.0323 -0.1246 330 GLU A C   
2517 O O   . GLU A 342 ? 0.5678 0.4778 0.4229 -0.0293 -0.0412 -0.1286 330 GLU A O   
2518 C CB  . GLU A 342 ? 0.6091 0.5046 0.4051 -0.0123 -0.0313 -0.1364 330 GLU A CB  
2519 C CG  . GLU A 342 ? 0.7293 0.6051 0.4984 -0.0095 -0.0291 -0.1482 330 GLU A CG  
2520 C CD  . GLU A 342 ? 0.8235 0.6805 0.5921 -0.0174 -0.0364 -0.1599 330 GLU A CD  
2521 O OE1 . GLU A 342 ? 0.8612 0.7226 0.6363 -0.0273 -0.0501 -0.1626 330 GLU A OE1 
2522 O OE2 . GLU A 342 ? 0.9090 0.7471 0.6720 -0.0135 -0.0283 -0.1661 330 GLU A OE2 
2523 N N   . PHE A 343 ? 0.5263 0.4524 0.3818 -0.0157 -0.0274 -0.1136 331 PHE A N   
2524 C CA  . PHE A 343 ? 0.5032 0.4445 0.3813 -0.0203 -0.0316 -0.1062 331 PHE A CA  
2525 C C   . PHE A 343 ? 0.5053 0.4402 0.4011 -0.0258 -0.0294 -0.1066 331 PHE A C   
2526 O O   . PHE A 343 ? 0.5047 0.4446 0.4146 -0.0344 -0.0364 -0.1082 331 PHE A O   
2527 C CB  . PHE A 343 ? 0.4892 0.4443 0.3735 -0.0142 -0.0253 -0.0951 331 PHE A CB  
2528 C CG  . PHE A 343 ? 0.4399 0.4094 0.3455 -0.0178 -0.0286 -0.0880 331 PHE A CG  
2529 C CD1 . PHE A 343 ? 0.4468 0.4272 0.3563 -0.0212 -0.0388 -0.0876 331 PHE A CD1 
2530 C CD2 . PHE A 343 ? 0.4161 0.3876 0.3369 -0.0171 -0.0216 -0.0819 331 PHE A CD2 
2531 C CE1 . PHE A 343 ? 0.4421 0.4364 0.3728 -0.0234 -0.0411 -0.0817 331 PHE A CE1 
2532 C CE2 . PHE A 343 ? 0.4201 0.4038 0.3587 -0.0199 -0.0233 -0.0761 331 PHE A CE2 
2533 C CZ  . PHE A 343 ? 0.4195 0.4152 0.3642 -0.0230 -0.0327 -0.0763 331 PHE A CZ  
2534 N N   . LEU A 344 ? 0.5103 0.4350 0.4062 -0.0209 -0.0194 -0.1044 332 LEU A N   
2535 C CA  . LEU A 344 ? 0.5096 0.4259 0.4199 -0.0253 -0.0159 -0.1026 332 LEU A CA  
2536 C C   . LEU A 344 ? 0.5335 0.4337 0.4419 -0.0343 -0.0209 -0.1124 332 LEU A C   
2537 O O   . LEU A 344 ? 0.5061 0.4056 0.4296 -0.0430 -0.0222 -0.1115 332 LEU A O   
2538 C CB  . LEU A 344 ? 0.5025 0.4090 0.4100 -0.0166 -0.0056 -0.0984 332 LEU A CB  
2539 C CG  . LEU A 344 ? 0.4877 0.4109 0.4029 -0.0104 -0.0011 -0.0878 332 LEU A CG  
2540 C CD1 . LEU A 344 ? 0.4783 0.3933 0.3895 -0.0002 0.0075  -0.0850 332 LEU A CD1 
2541 C CD2 . LEU A 344 ? 0.4336 0.3666 0.3665 -0.0164 -0.0022 -0.0808 332 LEU A CD2 
2542 N N   . LYS A 345 ? 0.5721 0.4592 0.4611 -0.0328 -0.0236 -0.1222 333 LYS A N   
2543 C CA  . LYS A 345 ? 0.6125 0.4833 0.4973 -0.0422 -0.0301 -0.1330 333 LYS A CA  
2544 C C   . LYS A 345 ? 0.5981 0.4850 0.4974 -0.0536 -0.0419 -0.1346 333 LYS A C   
2545 O O   . LYS A 345 ? 0.6093 0.4894 0.5185 -0.0646 -0.0463 -0.1397 333 LYS A O   
2546 C CB  . LYS A 345 ? 0.6472 0.5017 0.5045 -0.0368 -0.0307 -0.1438 333 LYS A CB  
2547 C CG  . LYS A 345 ? 0.7378 0.5731 0.5846 -0.0458 -0.0387 -0.1572 333 LYS A CG  
2548 C CD  . LYS A 345 ? 0.8224 0.6411 0.6381 -0.0377 -0.0369 -0.1674 333 LYS A CD  
2549 C CE  . LYS A 345 ? 0.9018 0.7147 0.7011 -0.0455 -0.0500 -0.1797 333 LYS A CE  
2550 N NZ  . LYS A 345 ? 0.9606 0.7480 0.7556 -0.0552 -0.0548 -0.1919 333 LYS A NZ  
2551 N N   . THR A 346 ? 0.5798 0.4881 0.4817 -0.0510 -0.0472 -0.1301 334 THR A N   
2552 C CA  . THR A 346 ? 0.5849 0.5099 0.5007 -0.0596 -0.0596 -0.1319 334 THR A CA  
2553 C C   . THR A 346 ? 0.5454 0.4901 0.4894 -0.0625 -0.0572 -0.1223 334 THR A C   
2554 O O   . THR A 346 ? 0.5416 0.4985 0.5048 -0.0714 -0.0646 -0.1241 334 THR A O   
2555 C CB  . THR A 346 ? 0.5890 0.5247 0.4892 -0.0547 -0.0688 -0.1329 334 THR A CB  
2556 O OG1 . THR A 346 ? 0.6753 0.5923 0.5466 -0.0514 -0.0691 -0.1417 334 THR A OG1 
2557 C CG2 . THR A 346 ? 0.5852 0.5364 0.4983 -0.0630 -0.0843 -0.1366 334 THR A CG2 
2558 N N   . LEU A 347 ? 0.5119 0.4605 0.4589 -0.0548 -0.0469 -0.1126 335 LEU A N   
2559 C CA  . LEU A 347 ? 0.4845 0.4507 0.4545 -0.0563 -0.0441 -0.1039 335 LEU A CA  
2560 C C   . LEU A 347 ? 0.4885 0.4507 0.4772 -0.0664 -0.0401 -0.1042 335 LEU A C   
2561 O O   . LEU A 347 ? 0.4867 0.4307 0.4706 -0.0665 -0.0312 -0.1029 335 LEU A O   
2562 C CB  . LEU A 347 ? 0.4668 0.4347 0.4322 -0.0460 -0.0342 -0.0943 335 LEU A CB  
2563 C CG  . LEU A 347 ? 0.4320 0.4149 0.4165 -0.0460 -0.0298 -0.0854 335 LEU A CG  
2564 C CD1 . LEU A 347 ? 0.3914 0.3954 0.3858 -0.0455 -0.0385 -0.0840 335 LEU A CD1 
2565 C CD2 . LEU A 347 ? 0.4286 0.4077 0.4066 -0.0377 -0.0202 -0.0777 335 LEU A CD2 
2566 N N   . GLU A 348 ? 0.4879 0.4677 0.4988 -0.0744 -0.0458 -0.1048 336 GLU A N   
2567 C CA  . GLU A 348 ? 0.4996 0.4789 0.5307 -0.0851 -0.0404 -0.1039 336 GLU A CA  
2568 C C   . GLU A 348 ? 0.4823 0.4769 0.5300 -0.0826 -0.0319 -0.0940 336 GLU A C   
2569 O O   . GLU A 348 ? 0.4852 0.4978 0.5569 -0.0894 -0.0327 -0.0934 336 GLU A O   
2570 C CB  . GLU A 348 ? 0.5224 0.5106 0.5700 -0.0979 -0.0511 -0.1126 336 GLU A CB  
2571 C CG  . GLU A 348 ? 0.5916 0.5587 0.6191 -0.1016 -0.0587 -0.1237 336 GLU A CG  
2572 C CD  . GLU A 348 ? 0.6922 0.6647 0.7349 -0.1162 -0.0701 -0.1335 336 GLU A CD  
2573 O OE1 . GLU A 348 ? 0.7149 0.7142 0.7824 -0.1206 -0.0768 -0.1327 336 GLU A OE1 
2574 O OE2 . GLU A 348 ? 0.7780 0.7278 0.8085 -0.1232 -0.0726 -0.1423 336 GLU A OE2 
2575 N N   . LYS A 349 ? 0.4691 0.4570 0.5039 -0.0726 -0.0237 -0.0867 337 LYS A N   
2576 C CA  . LYS A 349 ? 0.4446 0.4414 0.4887 -0.0693 -0.0148 -0.0776 337 LYS A CA  
2577 C C   . LYS A 349 ? 0.4423 0.4184 0.4703 -0.0643 -0.0051 -0.0726 337 LYS A C   
2578 O O   . LYS A 349 ? 0.4484 0.4095 0.4586 -0.0593 -0.0063 -0.0754 337 LYS A O   
2579 C CB  . LYS A 349 ? 0.4326 0.4453 0.4751 -0.0595 -0.0179 -0.0735 337 LYS A CB  
2580 C CG  . LYS A 349 ? 0.4203 0.4539 0.4758 -0.0601 -0.0286 -0.0766 337 LYS A CG  
2581 C CD  . LYS A 349 ? 0.4345 0.4845 0.5172 -0.0679 -0.0273 -0.0768 337 LYS A CD  
2582 C CE  . LYS A 349 ? 0.4308 0.5030 0.5269 -0.0654 -0.0385 -0.0789 337 LYS A CE  
2583 N NZ  . LYS A 349 ? 0.3920 0.4825 0.5162 -0.0708 -0.0355 -0.0784 337 LYS A NZ  
2584 N N   . PRO A 350 ? 0.4291 0.4051 0.4627 -0.0645 0.0042  -0.0652 338 PRO A N   
2585 C CA  . PRO A 350 ? 0.4181 0.3777 0.4358 -0.0573 0.0114  -0.0591 338 PRO A CA  
2586 C C   . PRO A 350 ? 0.4071 0.3704 0.4120 -0.0457 0.0083  -0.0578 338 PRO A C   
2587 O O   . PRO A 350 ? 0.3860 0.3659 0.3950 -0.0425 0.0041  -0.0573 338 PRO A O   
2588 C CB  . PRO A 350 ? 0.4148 0.3794 0.4401 -0.0586 0.0201  -0.0513 338 PRO A CB  
2589 C CG  . PRO A 350 ? 0.4281 0.4085 0.4759 -0.0692 0.0199  -0.0541 338 PRO A CG  
2590 C CD  . PRO A 350 ? 0.4154 0.4065 0.4699 -0.0715 0.0085  -0.0624 338 PRO A CD  
2591 N N   . ALA A 351 ? 0.4142 0.3616 0.4040 -0.0394 0.0106  -0.0572 339 ALA A N   
2592 C CA  . ALA A 351 ? 0.4104 0.3614 0.3893 -0.0293 0.0089  -0.0562 339 ALA A CA  
2593 C C   . ALA A 351 ? 0.4051 0.3492 0.3778 -0.0222 0.0149  -0.0490 339 ALA A C   
2594 O O   . ALA A 351 ? 0.4266 0.3541 0.3957 -0.0231 0.0191  -0.0472 339 ALA A O   
2595 C CB  . ALA A 351 ? 0.4146 0.3553 0.3820 -0.0272 0.0054  -0.0640 339 ALA A CB  
2596 N N   . VAL A 352 ? 0.3767 0.3328 0.3480 -0.0158 0.0146  -0.0447 340 VAL A N   
2597 C CA  . VAL A 352 ? 0.3636 0.3156 0.3288 -0.0084 0.0179  -0.0388 340 VAL A CA  
2598 C C   . VAL A 352 ? 0.3831 0.3382 0.3417 -0.0010 0.0162  -0.0415 340 VAL A C   
2599 O O   . VAL A 352 ? 0.3827 0.3507 0.3416 -0.0005 0.0133  -0.0429 340 VAL A O   
2600 C CB  . VAL A 352 ? 0.3578 0.3205 0.3268 -0.0079 0.0192  -0.0323 340 VAL A CB  
2601 C CG1 . VAL A 352 ? 0.2990 0.2579 0.2612 -0.0003 0.0208  -0.0266 340 VAL A CG1 
2602 C CG2 . VAL A 352 ? 0.3189 0.2799 0.2948 -0.0156 0.0227  -0.0305 340 VAL A CG2 
2603 N N   . ILE A 353 ? 0.3896 0.3322 0.3419 0.0048  0.0185  -0.0423 341 ILE A N   
2604 C CA  . ILE A 353 ? 0.3798 0.3238 0.3264 0.0115  0.0187  -0.0465 341 ILE A CA  
2605 C C   . ILE A 353 ? 0.3918 0.3406 0.3392 0.0206  0.0208  -0.0411 341 ILE A C   
2606 O O   . ILE A 353 ? 0.4110 0.3482 0.3571 0.0248  0.0223  -0.0381 341 ILE A O   
2607 C CB  . ILE A 353 ? 0.4026 0.3284 0.3420 0.0118  0.0195  -0.0539 341 ILE A CB  
2608 C CG1 . ILE A 353 ? 0.4309 0.3526 0.3715 0.0013  0.0160  -0.0594 341 ILE A CG1 
2609 C CG2 . ILE A 353 ? 0.3884 0.3163 0.3204 0.0192  0.0210  -0.0595 341 ILE A CG2 
2610 C CD1 . ILE A 353 ? 0.4188 0.3181 0.3526 -0.0009 0.0165  -0.0664 341 ILE A CD1 
2611 N N   . ASP A 354 ? 0.3962 0.3616 0.3458 0.0233  0.0204  -0.0399 342 ASP A N   
2612 C CA  . ASP A 354 ? 0.3980 0.3728 0.3519 0.0302  0.0212  -0.0348 342 ASP A CA  
2613 C C   . ASP A 354 ? 0.3930 0.3788 0.3471 0.0354  0.0238  -0.0379 342 ASP A C   
2614 O O   . ASP A 354 ? 0.3895 0.3774 0.3383 0.0324  0.0246  -0.0426 342 ASP A O   
2615 C CB  . ASP A 354 ? 0.3920 0.3780 0.3504 0.0260  0.0186  -0.0289 342 ASP A CB  
2616 C CG  . ASP A 354 ? 0.4419 0.4373 0.4051 0.0316  0.0176  -0.0235 342 ASP A CG  
2617 O OD1 . ASP A 354 ? 0.4991 0.4901 0.4634 0.0393  0.0183  -0.0227 342 ASP A OD1 
2618 O OD2 . ASP A 354 ? 0.4269 0.4340 0.3933 0.0282  0.0155  -0.0203 342 ASP A OD2 
2619 N N   . ALA A 355 ? 0.3786 0.3719 0.3390 0.0429  0.0252  -0.0349 343 ALA A N   
2620 C CA  . ALA A 355 ? 0.3741 0.3850 0.3399 0.0464  0.0282  -0.0352 343 ALA A CA  
2621 C C   . ALA A 355 ? 0.3768 0.3838 0.3350 0.0488  0.0332  -0.0426 343 ALA A C   
2622 O O   . ALA A 355 ? 0.3915 0.3841 0.3451 0.0544  0.0354  -0.0473 343 ALA A O   
2623 C CB  . ALA A 355 ? 0.3659 0.3915 0.3347 0.0388  0.0258  -0.0310 343 ALA A CB  
2624 N N   . ASP A 356 ? 0.3815 0.3980 0.3358 0.0444  0.0351  -0.0439 344 ASP A N   
2625 C CA  . ASP A 356 ? 0.3998 0.4135 0.3441 0.0469  0.0405  -0.0508 344 ASP A CA  
2626 C C   . ASP A 356 ? 0.4054 0.3998 0.3364 0.0444  0.0384  -0.0576 344 ASP A C   
2627 O O   . ASP A 356 ? 0.4355 0.4217 0.3574 0.0492  0.0429  -0.0647 344 ASP A O   
2628 C CB  . ASP A 356 ? 0.4061 0.4331 0.3466 0.0423  0.0431  -0.0493 344 ASP A CB  
2629 C CG  . ASP A 356 ? 0.4325 0.4788 0.3853 0.0463  0.0489  -0.0458 344 ASP A CG  
2630 O OD1 . ASP A 356 ? 0.4874 0.5368 0.4472 0.0554  0.0541  -0.0483 344 ASP A OD1 
2631 O OD2 . ASP A 356 ? 0.4606 0.5186 0.4169 0.0400  0.0481  -0.0405 344 ASP A OD2 
2632 N N   . ALA A 357 ? 0.3939 0.3812 0.3242 0.0370  0.0319  -0.0562 345 ALA A N   
2633 C CA  . ALA A 357 ? 0.4050 0.3742 0.3267 0.0334  0.0289  -0.0626 345 ALA A CA  
2634 C C   . ALA A 357 ? 0.4285 0.3811 0.3501 0.0398  0.0315  -0.0656 345 ALA A C   
2635 O O   . ALA A 357 ? 0.4498 0.3866 0.3613 0.0402  0.0321  -0.0735 345 ALA A O   
2636 C CB  . ALA A 357 ? 0.3935 0.3622 0.3190 0.0242  0.0223  -0.0598 345 ALA A CB  
2637 N N   . ILE A 358 ? 0.4221 0.3769 0.3537 0.0454  0.0326  -0.0596 346 ILE A N   
2638 C CA  . ILE A 358 ? 0.4301 0.3686 0.3610 0.0540  0.0352  -0.0615 346 ILE A CA  
2639 C C   . ILE A 358 ? 0.4484 0.3883 0.3759 0.0642  0.0416  -0.0676 346 ILE A C   
2640 O O   . ILE A 358 ? 0.4602 0.3812 0.3789 0.0685  0.0440  -0.0747 346 ILE A O   
2641 C CB  . ILE A 358 ? 0.4320 0.3725 0.3727 0.0583  0.0335  -0.0527 346 ILE A CB  
2642 C CG1 . ILE A 358 ? 0.4218 0.3585 0.3633 0.0484  0.0289  -0.0475 346 ILE A CG1 
2643 C CG2 . ILE A 358 ? 0.4405 0.3612 0.3790 0.0686  0.0353  -0.0538 346 ILE A CG2 
2644 C CD1 . ILE A 358 ? 0.3769 0.3165 0.3245 0.0513  0.0267  -0.0385 346 ILE A CD1 
2645 N N   . ASN A 359 ? 0.4425 0.4041 0.3772 0.0680  0.0451  -0.0651 347 ASN A N   
2646 C CA  . ASN A 359 ? 0.4640 0.4317 0.3979 0.0778  0.0533  -0.0705 347 ASN A CA  
2647 C C   . ASN A 359 ? 0.4855 0.4401 0.4011 0.0766  0.0568  -0.0808 347 ASN A C   
2648 O O   . ASN A 359 ? 0.5025 0.4527 0.4139 0.0858  0.0637  -0.0871 347 ASN A O   
2649 C CB  . ASN A 359 ? 0.4347 0.4308 0.3798 0.0780  0.0568  -0.0656 347 ASN A CB  
2650 C CG  . ASN A 359 ? 0.4365 0.4463 0.3999 0.0811  0.0534  -0.0571 347 ASN A CG  
2651 O OD1 . ASN A 359 ? 0.4631 0.4636 0.4314 0.0888  0.0512  -0.0557 347 ASN A OD1 
2652 N ND2 . ASN A 359 ? 0.3947 0.4248 0.3666 0.0750  0.0520  -0.0512 347 ASN A ND2 
2653 N N   . VAL A 360 ? 0.4849 0.4341 0.3895 0.0655  0.0518  -0.0827 348 VAL A N   
2654 C CA  . VAL A 360 ? 0.5081 0.4447 0.3934 0.0635  0.0531  -0.0926 348 VAL A CA  
2655 C C   . VAL A 360 ? 0.5194 0.4312 0.3960 0.0582  0.0470  -0.0984 348 VAL A C   
2656 O O   . VAL A 360 ? 0.5334 0.4323 0.3934 0.0558  0.0463  -0.1076 348 VAL A O   
2657 C CB  . VAL A 360 ? 0.5018 0.4515 0.3785 0.0555  0.0515  -0.0913 348 VAL A CB  
2658 C CG1 . VAL A 360 ? 0.5175 0.4903 0.4027 0.0594  0.0587  -0.0854 348 VAL A CG1 
2659 C CG2 . VAL A 360 ? 0.4718 0.4234 0.3526 0.0443  0.0414  -0.0861 348 VAL A CG2 
2660 N N   . LEU A 361 ? 0.5135 0.4186 0.4008 0.0558  0.0427  -0.0931 349 LEU A N   
2661 C CA  . LEU A 361 ? 0.5267 0.4104 0.4087 0.0482  0.0371  -0.0972 349 LEU A CA  
2662 C C   . LEU A 361 ? 0.5571 0.4155 0.4263 0.0537  0.0403  -0.1075 349 LEU A C   
2663 O O   . LEU A 361 ? 0.5510 0.4030 0.4219 0.0656  0.0462  -0.1080 349 LEU A O   
2664 C CB  . LEU A 361 ? 0.5116 0.3924 0.4067 0.0454  0.0342  -0.0884 349 LEU A CB  
2665 C CG  . LEU A 361 ? 0.5165 0.3802 0.4106 0.0344  0.0290  -0.0899 349 LEU A CG  
2666 C CD1 . LEU A 361 ? 0.5355 0.4098 0.4284 0.0228  0.0229  -0.0926 349 LEU A CD1 
2667 C CD2 . LEU A 361 ? 0.5141 0.3768 0.4196 0.0330  0.0285  -0.0797 349 LEU A CD2 
2668 N N   . ASP A 362 ? 0.5766 0.4200 0.4332 0.0451  0.0356  -0.1161 350 ASP A N   
2669 C CA  . ASP A 362 ? 0.6213 0.4350 0.4657 0.0472  0.0366  -0.1261 350 ASP A CA  
2670 C C   . ASP A 362 ? 0.6342 0.4312 0.4865 0.0392  0.0321  -0.1224 350 ASP A C   
2671 O O   . ASP A 362 ? 0.6184 0.4186 0.4752 0.0259  0.0254  -0.1212 350 ASP A O   
2672 C CB  . ASP A 362 ? 0.6493 0.4556 0.4745 0.0410  0.0330  -0.1380 350 ASP A CB  
2673 C CG  . ASP A 362 ? 0.7008 0.4744 0.5109 0.0412  0.0329  -0.1501 350 ASP A CG  
2674 O OD1 . ASP A 362 ? 0.7245 0.4782 0.5391 0.0448  0.0352  -0.1491 350 ASP A OD1 
2675 O OD2 . ASP A 362 ? 0.7758 0.5423 0.5678 0.0374  0.0301  -0.1608 350 ASP A OD2 
2676 N N   . THR A 363 ? 0.6706 0.4497 0.5251 0.0472  0.0361  -0.1200 351 THR A N   
2677 C CA  . THR A 363 ? 0.6843 0.4489 0.5459 0.0391  0.0330  -0.1139 351 THR A CA  
2678 C C   . THR A 363 ? 0.7081 0.4485 0.5612 0.0259  0.0284  -0.1229 351 THR A C   
2679 O O   . THR A 363 ? 0.7058 0.4399 0.5666 0.0147  0.0255  -0.1181 351 THR A O   
2680 C CB  . THR A 363 ? 0.6910 0.4408 0.5557 0.0508  0.0374  -0.1072 351 THR A CB  
2681 O OG1 . THR A 363 ? 0.7373 0.4615 0.5893 0.0599  0.0410  -0.1166 351 THR A OG1 
2682 C CG2 . THR A 363 ? 0.6711 0.4469 0.5469 0.0625  0.0403  -0.0984 351 THR A CG2 
2683 N N   . SER A 364 ? 0.7384 0.4666 0.5760 0.0265  0.0278  -0.1359 352 SER A N   
2684 C CA  . SER A 364 ? 0.7749 0.4840 0.6043 0.0122  0.0213  -0.1461 352 SER A CA  
2685 C C   . SER A 364 ? 0.7557 0.4867 0.5974 -0.0030 0.0136  -0.1425 352 SER A C   
2686 O O   . SER A 364 ? 0.7631 0.4842 0.6108 -0.0167 0.0090  -0.1436 352 SER A O   
2687 C CB  . SER A 364 ? 0.7953 0.4954 0.6042 0.0154  0.0205  -0.1607 352 SER A CB  
2688 O OG  . SER A 364 ? 0.8495 0.5302 0.6474 0.0308  0.0287  -0.1652 352 SER A OG  
2689 N N   . VAL A 365 ? 0.6445 0.5371 0.5427 0.0297  -0.0140 -0.1073 353 VAL A N   
2690 C CA  . VAL A 365 ? 0.6442 0.5476 0.5528 0.0240  -0.0182 -0.1044 353 VAL A CA  
2691 C C   . VAL A 365 ? 0.6189 0.5243 0.5497 0.0143  -0.0154 -0.0994 353 VAL A C   
2692 O O   . VAL A 365 ? 0.6054 0.5149 0.5497 0.0081  -0.0214 -0.1023 353 VAL A O   
2693 C CB  . VAL A 365 ? 0.6500 0.5655 0.5480 0.0287  -0.0148 -0.0962 353 VAL A CB  
2694 C CG1 . VAL A 365 ? 0.6679 0.5938 0.5785 0.0232  -0.0186 -0.0924 353 VAL A CG1 
2695 C CG2 . VAL A 365 ? 0.6699 0.5842 0.5449 0.0378  -0.0183 -0.1015 353 VAL A CG2 
2696 N N   . LEU A 366 ? 0.6301 0.5335 0.5652 0.0131  -0.0063 -0.0918 354 LEU A N   
2697 C CA  . LEU A 366 ? 0.6149 0.5200 0.5693 0.0040  -0.0028 -0.0865 354 LEU A CA  
2698 C C   . LEU A 366 ? 0.6531 0.5484 0.6201 -0.0030 -0.0071 -0.0930 354 LEU A C   
2699 O O   . LEU A 366 ? 0.6576 0.5576 0.6417 -0.0113 -0.0073 -0.0914 354 LEU A O   
2700 C CB  . LEU A 366 ? 0.6103 0.5125 0.5645 0.0047  0.0066  -0.0781 354 LEU A CB  
2701 C CG  . LEU A 366 ? 0.5543 0.4677 0.5042 0.0079  0.0125  -0.0688 354 LEU A CG  
2702 C CD1 . LEU A 366 ? 0.5041 0.4123 0.4531 0.0094  0.0201  -0.0627 354 LEU A CD1 
2703 C CD2 . LEU A 366 ? 0.5169 0.4410 0.4805 0.0013  0.0119  -0.0648 354 LEU A CD2 
2704 N N   . LYS A 367 ? 0.6965 0.5778 0.6555 0.0001  -0.0099 -0.1002 355 LYS A N   
2705 C CA  . LYS A 367 ? 0.7270 0.5962 0.6973 -0.0067 -0.0148 -0.1072 355 LYS A CA  
2706 C C   . LYS A 367 ? 0.7377 0.6125 0.7161 -0.0108 -0.0253 -0.1157 355 LYS A C   
2707 O O   . LYS A 367 ? 0.7603 0.6327 0.7566 -0.0202 -0.0284 -0.1185 355 LYS A O   
2708 C CB  . LYS A 367 ? 0.7494 0.6010 0.7078 -0.0010 -0.0163 -0.1138 355 LYS A CB  
2709 C CG  . LYS A 367 ? 0.7653 0.6116 0.7170 0.0037  -0.0066 -0.1058 355 LYS A CG  
2710 C CD  . LYS A 367 ? 0.8109 0.6407 0.7494 0.0117  -0.0082 -0.1131 355 LYS A CD  
2711 C CE  . LYS A 367 ? 0.8213 0.6463 0.7547 0.0173  0.0007  -0.1052 355 LYS A CE  
2712 N NZ  . LYS A 367 ? 0.7937 0.6344 0.7179 0.0245  0.0076  -0.0978 355 LYS A NZ  
2713 N N   . GLU A 368 ? 0.7395 0.6219 0.7056 -0.0041 -0.0309 -0.1197 356 GLU A N   
2714 C CA  . GLU A 368 ? 0.7447 0.6320 0.7183 -0.0074 -0.0425 -0.1286 356 GLU A CA  
2715 C C   . GLU A 368 ? 0.7062 0.6104 0.6965 -0.0130 -0.0426 -0.1233 356 GLU A C   
2716 O O   . GLU A 368 ? 0.7088 0.6183 0.7118 -0.0176 -0.0516 -0.1299 356 GLU A O   
2717 C CB  . GLU A 368 ? 0.7716 0.6573 0.7237 0.0022  -0.0507 -0.1369 356 GLU A CB  
2718 C CG  . GLU A 368 ? 0.8303 0.7284 0.7670 0.0100  -0.0481 -0.1301 356 GLU A CG  
2719 C CD  . GLU A 368 ? 0.9019 0.7963 0.8131 0.0204  -0.0543 -0.1374 356 GLU A CD  
2720 O OE1 . GLU A 368 ? 0.9347 0.8250 0.8275 0.0283  -0.0475 -0.1350 356 GLU A OE1 
2721 O OE2 . GLU A 368 ? 0.9669 0.8629 0.8764 0.0209  -0.0659 -0.1458 356 GLU A OE2 
2722 N N   . ARG A 369 ? 0.6672 0.5800 0.6587 -0.0127 -0.0332 -0.1121 357 ARG A N   
2723 C CA  . ARG A 369 ? 0.6333 0.5618 0.6387 -0.0163 -0.0332 -0.1076 357 ARG A CA  
2724 C C   . ARG A 369 ? 0.6243 0.5547 0.6547 -0.0273 -0.0324 -0.1086 357 ARG A C   
2725 O O   . ARG A 369 ? 0.6219 0.5434 0.6574 -0.0321 -0.0256 -0.1054 357 ARG A O   
2726 C CB  . ARG A 369 ? 0.6114 0.5466 0.6115 -0.0133 -0.0231 -0.0958 357 ARG A CB  
2727 C CG  . ARG A 369 ? 0.6040 0.5409 0.5823 -0.0035 -0.0237 -0.0935 357 ARG A CG  
2728 C CD  . ARG A 369 ? 0.5418 0.4864 0.5169 -0.0012 -0.0153 -0.0822 357 ARG A CD  
2729 N NE  . ARG A 369 ? 0.5168 0.4707 0.5101 -0.0073 -0.0124 -0.0777 357 ARG A NE  
2730 C CZ  . ARG A 369 ? 0.5062 0.4708 0.5069 -0.0075 -0.0170 -0.0776 357 ARG A CZ  
2731 N NH1 . ARG A 369 ? 0.5122 0.4795 0.5033 -0.0022 -0.0253 -0.0810 357 ARG A NH1 
2732 N NH2 . ARG A 369 ? 0.5261 0.4988 0.5432 -0.0125 -0.0132 -0.0740 357 ARG A NH2 
2733 N N   . LYS A 370 ? 0.6146 0.5568 0.6608 -0.0312 -0.0393 -0.1128 358 LYS A N   
2734 C CA  . LYS A 370 ? 0.6227 0.5711 0.6951 -0.0420 -0.0371 -0.1126 358 LYS A CA  
2735 C C   . LYS A 370 ? 0.5890 0.5484 0.6682 -0.0433 -0.0266 -0.1020 358 LYS A C   
2736 O O   . LYS A 370 ? 0.5981 0.5585 0.6916 -0.0509 -0.0191 -0.0978 358 LYS A O   
2737 C CB  . LYS A 370 ? 0.6288 0.5887 0.7185 -0.0454 -0.0487 -0.1215 358 LYS A CB  
2738 C CG  . LYS A 370 ? 0.6948 0.6469 0.7753 -0.0419 -0.0622 -0.1333 358 LYS A CG  
2739 C CD  . LYS A 370 ? 0.7527 0.6867 0.8324 -0.0465 -0.0629 -0.1386 358 LYS A CD  
2740 C CE  . LYS A 370 ? 0.8004 0.7278 0.8731 -0.0434 -0.0777 -0.1520 358 LYS A CE  
2741 N NZ  . LYS A 370 ? 0.8273 0.7410 0.9115 -0.0518 -0.0811 -0.1592 358 LYS A NZ  
2742 N N   . SER A 371 ? 0.5632 0.5301 0.6311 -0.0357 -0.0262 -0.0977 359 SER A N   
2743 C CA  . SER A 371 ? 0.5271 0.5037 0.6001 -0.0359 -0.0176 -0.0888 359 SER A CA  
2744 C C   . SER A 371 ? 0.4984 0.4657 0.5592 -0.0346 -0.0067 -0.0801 359 SER A C   
2745 O O   . SER A 371 ? 0.5040 0.4595 0.5486 -0.0304 -0.0064 -0.0803 359 SER A O   
2746 C CB  . SER A 371 ? 0.5172 0.5037 0.5832 -0.0285 -0.0223 -0.0877 359 SER A CB  
2747 O OG  . SER A 371 ? 0.5348 0.5343 0.6184 -0.0306 -0.0296 -0.0930 359 SER A OG  
2748 N N   . PRO A 372 ? 0.4731 0.4467 0.5415 -0.0375 0.0020  -0.0728 360 PRO A N   
2749 C CA  . PRO A 372 ? 0.4542 0.4203 0.5119 -0.0361 0.0116  -0.0644 360 PRO A CA  
2750 C C   . PRO A 372 ? 0.4307 0.3959 0.4695 -0.0273 0.0121  -0.0601 360 PRO A C   
2751 O O   . PRO A 372 ? 0.4220 0.3939 0.4565 -0.0225 0.0064  -0.0618 360 PRO A O   
2752 C CB  . PRO A 372 ? 0.4486 0.4239 0.5195 -0.0409 0.0192  -0.0591 360 PRO A CB  
2753 C CG  . PRO A 372 ? 0.4554 0.4449 0.5453 -0.0443 0.0138  -0.0649 360 PRO A CG  
2754 C CD  . PRO A 372 ? 0.4492 0.4377 0.5379 -0.0422 0.0028  -0.0731 360 PRO A CD  
2755 N N   . ALA A 373 ? 0.4165 0.3732 0.4449 -0.0254 0.0186  -0.0545 361 ALA A N   
2756 C CA  . ALA A 373 ? 0.4182 0.3754 0.4320 -0.0184 0.0208  -0.0492 361 ALA A CA  
2757 C C   . ALA A 373 ? 0.4061 0.3600 0.4177 -0.0191 0.0293  -0.0415 361 ALA A C   
2758 O O   . ALA A 373 ? 0.4166 0.3620 0.4309 -0.0228 0.0330  -0.0406 361 ALA A O   
2759 C CB  . ALA A 373 ? 0.4222 0.3717 0.4208 -0.0125 0.0173  -0.0525 361 ALA A CB  
2760 N N   . VAL A 374 ? 0.3797 0.3387 0.3848 -0.0150 0.0316  -0.0361 362 VAL A N   
2761 C CA  . VAL A 374 ? 0.3843 0.3400 0.3838 -0.0136 0.0379  -0.0293 362 VAL A CA  
2762 C C   . VAL A 374 ? 0.3882 0.3432 0.3747 -0.0068 0.0372  -0.0273 362 VAL A C   
2763 O O   . VAL A 374 ? 0.3971 0.3584 0.3802 -0.0041 0.0340  -0.0274 362 VAL A O   
2764 C CB  . VAL A 374 ? 0.3683 0.3321 0.3730 -0.0150 0.0413  -0.0244 362 VAL A CB  
2765 C CG1 . VAL A 374 ? 0.3834 0.3437 0.3812 -0.0130 0.0464  -0.0179 362 VAL A CG1 
2766 C CG2 . VAL A 374 ? 0.3792 0.3468 0.3973 -0.0212 0.0429  -0.0263 362 VAL A CG2 
2767 N N   . LEU A 375 ? 0.3945 0.3422 0.3742 -0.0042 0.0406  -0.0250 363 LEU A N   
2768 C CA  . LEU A 375 ? 0.3898 0.3386 0.3591 0.0020  0.0415  -0.0225 363 LEU A CA  
2769 C C   . LEU A 375 ? 0.3771 0.3280 0.3463 0.0027  0.0460  -0.0155 363 LEU A C   
2770 O O   . LEU A 375 ? 0.3838 0.3296 0.3561 0.0003  0.0489  -0.0134 363 LEU A O   
2771 C CB  . LEU A 375 ? 0.4075 0.3477 0.3696 0.0059  0.0412  -0.0265 363 LEU A CB  
2772 C CG  . LEU A 375 ? 0.4405 0.3793 0.3977 0.0078  0.0359  -0.0339 363 LEU A CG  
2773 C CD1 . LEU A 375 ? 0.4228 0.3586 0.3895 0.0017  0.0317  -0.0394 363 LEU A CD1 
2774 C CD2 . LEU A 375 ? 0.4674 0.3988 0.4144 0.0140  0.0366  -0.0374 363 LEU A CD2 
2775 N N   . THR A 376 ? 0.3673 0.3256 0.3330 0.0056  0.0464  -0.0117 364 THR A N   
2776 C CA  . THR A 376 ? 0.3670 0.3284 0.3338 0.0060  0.0494  -0.0055 364 THR A CA  
2777 C C   . THR A 376 ? 0.3729 0.3373 0.3345 0.0109  0.0512  -0.0024 364 THR A C   
2778 O O   . THR A 376 ? 0.3902 0.3617 0.3521 0.0114  0.0513  0.0015  364 THR A O   
2779 C CB  . THR A 376 ? 0.3828 0.3514 0.3538 0.0036  0.0479  -0.0031 364 THR A CB  
2780 O OG1 . THR A 376 ? 0.3943 0.3679 0.3616 0.0056  0.0453  -0.0031 364 THR A OG1 
2781 C CG2 . THR A 376 ? 0.3747 0.3428 0.3528 -0.0008 0.0467  -0.0064 364 THR A CG2 
2782 N N   . PRO A 377 ? 0.3655 0.3245 0.3232 0.0146  0.0528  -0.0041 365 PRO A N   
2783 C CA  . PRO A 377 ? 0.3740 0.3378 0.3286 0.0199  0.0552  -0.0015 365 PRO A CA  
2784 C C   . PRO A 377 ? 0.3757 0.3417 0.3342 0.0206  0.0570  0.0037  365 PRO A C   
2785 O O   . PRO A 377 ? 0.3641 0.3234 0.3243 0.0188  0.0571  0.0044  365 PRO A O   
2786 C CB  . PRO A 377 ? 0.3888 0.3451 0.3384 0.0243  0.0557  -0.0066 365 PRO A CB  
2787 C CG  . PRO A 377 ? 0.3803 0.3254 0.3326 0.0207  0.0545  -0.0088 365 PRO A CG  
2788 C CD  . PRO A 377 ? 0.3691 0.3174 0.3265 0.0142  0.0526  -0.0083 365 PRO A CD  
2789 N N   . HIS A 378 ? 0.3725 0.3478 0.3321 0.0230  0.0585  0.0074  366 HIS A N   
2790 C CA  . HIS A 378 ? 0.3716 0.3493 0.3346 0.0261  0.0598  0.0109  366 HIS A CA  
2791 C C   . HIS A 378 ? 0.3906 0.3645 0.3504 0.0325  0.0617  0.0078  366 HIS A C   
2792 O O   . HIS A 378 ? 0.3812 0.3515 0.3357 0.0344  0.0621  0.0029  366 HIS A O   
2793 C CB  . HIS A 378 ? 0.3776 0.3673 0.3459 0.0254  0.0601  0.0159  366 HIS A CB  
2794 C CG  . HIS A 378 ? 0.3604 0.3590 0.3275 0.0274  0.0626  0.0165  366 HIS A CG  
2795 N ND1 . HIS A 378 ? 0.4096 0.4122 0.3755 0.0333  0.0660  0.0153  366 HIS A ND1 
2796 C CD2 . HIS A 378 ? 0.3823 0.3867 0.3489 0.0244  0.0626  0.0188  366 HIS A CD2 
2797 C CE1 . HIS A 378 ? 0.4192 0.4305 0.3834 0.0337  0.0687  0.0168  366 HIS A CE1 
2798 N NE2 . HIS A 378 ? 0.3916 0.4034 0.3558 0.0281  0.0665  0.0194  366 HIS A NE2 
2799 N N   . PRO A 379 ? 0.3923 0.3661 0.3550 0.0364  0.0621  0.0099  367 PRO A N   
2800 C CA  . PRO A 379 ? 0.4042 0.3730 0.3643 0.0434  0.0634  0.0065  367 PRO A CA  
2801 C C   . PRO A 379 ? 0.3969 0.3735 0.3547 0.0485  0.0665  0.0035  367 PRO A C   
2802 O O   . PRO A 379 ? 0.3905 0.3600 0.3432 0.0534  0.0671  -0.0017 367 PRO A O   
2803 C CB  . PRO A 379 ? 0.4104 0.3815 0.3757 0.0471  0.0627  0.0105  367 PRO A CB  
2804 C CG  . PRO A 379 ? 0.4078 0.3764 0.3745 0.0407  0.0601  0.0145  367 PRO A CG  
2805 C CD  . PRO A 379 ? 0.4120 0.3882 0.3796 0.0351  0.0605  0.0148  367 PRO A CD  
2806 N N   . GLY A 380 ? 0.3933 0.3840 0.3544 0.0476  0.0686  0.0068  368 GLY A N   
2807 C CA  . GLY A 380 ? 0.4051 0.4043 0.3626 0.0521  0.0727  0.0047  368 GLY A CA  
2808 C C   . GLY A 380 ? 0.4146 0.4063 0.3617 0.0511  0.0718  -0.0004 368 GLY A C   
2809 O O   . GLY A 380 ? 0.4173 0.4069 0.3571 0.0569  0.0736  -0.0058 368 GLY A O   
2810 N N   . GLU A 381 ? 0.4145 0.4021 0.3608 0.0442  0.0684  0.0004  369 GLU A N   
2811 C CA  . GLU A 381 ? 0.4258 0.4066 0.3639 0.0428  0.0660  -0.0046 369 GLU A CA  
2812 C C   . GLU A 381 ? 0.4304 0.3969 0.3654 0.0447  0.0636  -0.0114 369 GLU A C   
2813 O O   . GLU A 381 ? 0.4328 0.3944 0.3598 0.0475  0.0626  -0.0177 369 GLU A O   
2814 C CB  . GLU A 381 ? 0.4165 0.3972 0.3571 0.0352  0.0626  -0.0019 369 GLU A CB  
2815 C CG  . GLU A 381 ? 0.4104 0.4018 0.3504 0.0334  0.0638  0.0031  369 GLU A CG  
2816 C CD  . GLU A 381 ? 0.4369 0.4290 0.3826 0.0268  0.0606  0.0071  369 GLU A CD  
2817 O OE1 . GLU A 381 ? 0.3757 0.3621 0.3264 0.0238  0.0583  0.0062  369 GLU A OE1 
2818 O OE2 . GLU A 381 ? 0.4480 0.4462 0.3930 0.0249  0.0605  0.0112  369 GLU A OE2 
2819 N N   . MET A 382 ? 0.4293 0.3883 0.3699 0.0428  0.0624  -0.0100 370 MET A N   
2820 C CA  . MET A 382 ? 0.4431 0.3870 0.3816 0.0441  0.0604  -0.0152 370 MET A CA  
2821 C C   . MET A 382 ? 0.4569 0.3983 0.3908 0.0531  0.0623  -0.0197 370 MET A C   
2822 O O   . MET A 382 ? 0.4729 0.4041 0.4011 0.0557  0.0604  -0.0267 370 MET A O   
2823 C CB  . MET A 382 ? 0.4478 0.3850 0.3920 0.0412  0.0598  -0.0109 370 MET A CB  
2824 C CG  . MET A 382 ? 0.4715 0.3914 0.4143 0.0408  0.0578  -0.0146 370 MET A CG  
2825 S SD  . MET A 382 ? 0.5507 0.4635 0.4933 0.0330  0.0544  -0.0199 370 MET A SD  
2826 C CE  . MET A 382 ? 0.5799 0.4717 0.5221 0.0330  0.0529  -0.0229 370 MET A CE  
2827 N N   . ALA A 383 ? 0.4482 0.3993 0.3856 0.0582  0.0656  -0.0159 371 ALA A N   
2828 C CA  . ALA A 383 ? 0.4757 0.4274 0.4099 0.0679  0.0682  -0.0201 371 ALA A CA  
2829 C C   . ALA A 383 ? 0.4937 0.4474 0.4179 0.0713  0.0694  -0.0266 371 ALA A C   
2830 O O   . ALA A 383 ? 0.5022 0.4457 0.4199 0.0765  0.0682  -0.0342 371 ALA A O   
2831 C CB  . ALA A 383 ? 0.4483 0.4159 0.3903 0.0721  0.0722  -0.0145 371 ALA A CB  
2832 N N   . ARG A 384 ? 0.5125 0.4785 0.4345 0.0684  0.0714  -0.0237 372 ARG A N   
2833 C CA  . ARG A 384 ? 0.5474 0.5153 0.4575 0.0716  0.0723  -0.0290 372 ARG A CA  
2834 C C   . ARG A 384 ? 0.5483 0.5010 0.4520 0.0687  0.0660  -0.0364 372 ARG A C   
2835 O O   . ARG A 384 ? 0.5347 0.4816 0.4285 0.0740  0.0651  -0.0442 372 ARG A O   
2836 C CB  . ARG A 384 ? 0.5526 0.5343 0.4609 0.0677  0.0748  -0.0230 372 ARG A CB  
2837 C CG  . ARG A 384 ? 0.6244 0.6231 0.5367 0.0715  0.0820  -0.0173 372 ARG A CG  
2838 C CD  . ARG A 384 ? 0.6572 0.6679 0.5661 0.0676  0.0849  -0.0109 372 ARG A CD  
2839 N NE  . ARG A 384 ? 0.7207 0.7306 0.6362 0.0584  0.0808  -0.0049 372 ARG A NE  
2840 C CZ  . ARG A 384 ? 0.7263 0.7429 0.6544 0.0540  0.0814  0.0020  372 ARG A CZ  
2841 N NH1 . ARG A 384 ? 0.7624 0.7880 0.6995 0.0574  0.0855  0.0045  372 ARG A NH1 
2842 N NH2 . ARG A 384 ? 0.7030 0.7172 0.6350 0.0465  0.0773  0.0060  372 ARG A NH2 
2843 N N   . LEU A 385 ? 0.5329 0.4794 0.4429 0.0603  0.0617  -0.0341 373 LEU A N   
2844 C CA  . LEU A 385 ? 0.5497 0.4840 0.4564 0.0566  0.0557  -0.0408 373 LEU A CA  
2845 C C   . LEU A 385 ? 0.5628 0.4813 0.4672 0.0609  0.0535  -0.0486 373 LEU A C   
2846 O O   . LEU A 385 ? 0.5798 0.4904 0.4765 0.0625  0.0496  -0.0570 373 LEU A O   
2847 C CB  . LEU A 385 ? 0.5509 0.4834 0.4669 0.0470  0.0527  -0.0366 373 LEU A CB  
2848 C CG  . LEU A 385 ? 0.5750 0.4989 0.4918 0.0412  0.0465  -0.0423 373 LEU A CG  
2849 C CD1 . LEU A 385 ? 0.5691 0.4983 0.4771 0.0424  0.0436  -0.0461 373 LEU A CD1 
2850 C CD2 . LEU A 385 ? 0.5491 0.4737 0.4770 0.0326  0.0456  -0.0371 373 LEU A CD2 
2851 N N   . VAL A 386 ? 0.5362 0.4490 0.4465 0.0630  0.0552  -0.0461 374 VAL A N   
2852 C CA  . VAL A 386 ? 0.5244 0.4199 0.4325 0.0670  0.0526  -0.0530 374 VAL A CA  
2853 C C   . VAL A 386 ? 0.5282 0.4261 0.4308 0.0788  0.0563  -0.0566 374 VAL A C   
2854 O O   . VAL A 386 ? 0.5340 0.4179 0.4346 0.0843  0.0545  -0.0622 374 VAL A O   
2855 C CB  . VAL A 386 ? 0.5258 0.4098 0.4428 0.0617  0.0513  -0.0483 374 VAL A CB  
2856 C CG1 . VAL A 386 ? 0.4951 0.3781 0.4180 0.0500  0.0485  -0.0457 374 VAL A CG1 
2857 C CG2 . VAL A 386 ? 0.4820 0.3751 0.4045 0.0645  0.0555  -0.0397 374 VAL A CG2 
2858 N N   . LYS A 387 ? 0.5173 0.4329 0.4182 0.0830  0.0616  -0.0532 375 LYS A N   
2859 C CA  . LYS A 387 ? 0.5371 0.4581 0.4337 0.0950  0.0663  -0.0570 375 LYS A CA  
2860 C C   . LYS A 387 ? 0.5278 0.4445 0.4327 0.1002  0.0673  -0.0545 375 LYS A C   
2861 O O   . LYS A 387 ? 0.5418 0.4516 0.4434 0.1098  0.0676  -0.0610 375 LYS A O   
2862 C CB  . LYS A 387 ? 0.5534 0.4643 0.4369 0.1015  0.0640  -0.0689 375 LYS A CB  
2863 C CG  . LYS A 387 ? 0.5989 0.5152 0.4728 0.0977  0.0626  -0.0710 375 LYS A CG  
2864 C CD  . LYS A 387 ? 0.7052 0.6132 0.5645 0.1046  0.0600  -0.0829 375 LYS A CD  
2865 C CE  . LYS A 387 ? 0.7567 0.6762 0.6046 0.1037  0.0611  -0.0827 375 LYS A CE  
2866 N NZ  . LYS A 387 ? 0.8237 0.7614 0.6676 0.1112  0.0706  -0.0787 375 LYS A NZ  
2867 N N   . LYS A 388 ? 0.5031 0.4245 0.4183 0.0945  0.0674  -0.0453 376 LYS A N   
2868 C CA  . LYS A 388 ? 0.5110 0.4307 0.4339 0.0995  0.0679  -0.0417 376 LYS A CA  
2869 C C   . LYS A 388 ? 0.4955 0.4366 0.4275 0.0990  0.0722  -0.0333 376 LYS A C   
2870 O O   . LYS A 388 ? 0.4759 0.4311 0.4078 0.0947  0.0750  -0.0303 376 LYS A O   
2871 C CB  . LYS A 388 ? 0.5203 0.4224 0.4461 0.0928  0.0629  -0.0387 376 LYS A CB  
2872 C CG  . LYS A 388 ? 0.5600 0.4398 0.4789 0.0932  0.0585  -0.0472 376 LYS A CG  
2873 C CD  . LYS A 388 ? 0.5943 0.4582 0.5166 0.0847  0.0547  -0.0429 376 LYS A CD  
2874 C CE  . LYS A 388 ? 0.6594 0.5041 0.5773 0.0809  0.0501  -0.0504 376 LYS A CE  
2875 N NZ  . LYS A 388 ? 0.6584 0.4849 0.5733 0.0890  0.0478  -0.0556 376 LYS A NZ  
2876 N N   . THR A 389 ? 0.4936 0.4367 0.4337 0.1036  0.0721  -0.0295 377 THR A N   
2877 C CA  . THR A 389 ? 0.4849 0.4477 0.4353 0.1032  0.0750  -0.0222 377 THR A CA  
2878 C C   . THR A 389 ? 0.4710 0.4309 0.4250 0.0926  0.0715  -0.0150 377 THR A C   
2879 O O   . THR A 389 ? 0.4810 0.4233 0.4310 0.0882  0.0674  -0.0153 377 THR A O   
2880 C CB  . THR A 389 ? 0.5033 0.4697 0.4616 0.1134  0.0752  -0.0220 377 THR A CB  
2881 O OG1 . THR A 389 ? 0.4930 0.4419 0.4514 0.1122  0.0694  -0.0195 377 THR A OG1 
2882 C CG2 . THR A 389 ? 0.5076 0.4723 0.4613 0.1256  0.0780  -0.0310 377 THR A CG2 
2883 N N   . VAL A 390 ? 0.4642 0.4411 0.4256 0.0883  0.0733  -0.0088 378 VAL A N   
2884 C CA  . VAL A 390 ? 0.4594 0.4356 0.4248 0.0798  0.0701  -0.0022 378 VAL A CA  
2885 C C   . VAL A 390 ? 0.4768 0.4407 0.4436 0.0819  0.0658  0.0000  378 VAL A C   
2886 O O   . VAL A 390 ? 0.4865 0.4384 0.4497 0.0757  0.0629  0.0020  378 VAL A O   
2887 C CB  . VAL A 390 ? 0.4604 0.4568 0.4353 0.0769  0.0720  0.0035  378 VAL A CB  
2888 C CG1 . VAL A 390 ? 0.4416 0.4361 0.4202 0.0695  0.0679  0.0093  378 VAL A CG1 
2889 C CG2 . VAL A 390 ? 0.4425 0.4495 0.4146 0.0735  0.0763  0.0031  378 VAL A CG2 
2890 N N   . GLY A 391 ? 0.4836 0.4510 0.4555 0.0910  0.0656  -0.0002 379 GLY A N   
2891 C CA  . GLY A 391 ? 0.4927 0.4476 0.4647 0.0949  0.0610  0.0019  379 GLY A CA  
2892 C C   . GLY A 391 ? 0.5084 0.4385 0.4706 0.0943  0.0585  -0.0006 379 GLY A C   
2893 O O   . GLY A 391 ? 0.5076 0.4252 0.4672 0.0922  0.0550  0.0035  379 GLY A O   
2894 N N   . ASP A 392 ? 0.5152 0.4378 0.4715 0.0956  0.0602  -0.0074 380 ASP A N   
2895 C CA  . ASP A 392 ? 0.5299 0.4290 0.4784 0.0938  0.0576  -0.0105 380 ASP A CA  
2896 C C   . ASP A 392 ? 0.5113 0.4043 0.4567 0.0814  0.0570  -0.0081 380 ASP A C   
2897 O O   . ASP A 392 ? 0.5364 0.4109 0.4777 0.0778  0.0547  -0.0075 380 ASP A O   
2898 C CB  . ASP A 392 ? 0.5618 0.4560 0.5053 0.0994  0.0590  -0.0199 380 ASP A CB  
2899 C CG  . ASP A 392 ? 0.6584 0.5518 0.6035 0.1132  0.0591  -0.0241 380 ASP A CG  
2900 O OD1 . ASP A 392 ? 0.7331 0.6243 0.6826 0.1185  0.0567  -0.0198 380 ASP A OD1 
2901 O OD2 . ASP A 392 ? 0.7626 0.6573 0.7037 0.1191  0.0613  -0.0322 380 ASP A OD2 
2902 N N   . VAL A 393 ? 0.4665 0.3743 0.4142 0.0751  0.0590  -0.0066 381 VAL A N   
2903 C CA  . VAL A 393 ? 0.4565 0.3600 0.4024 0.0645  0.0585  -0.0055 381 VAL A CA  
2904 C C   . VAL A 393 ? 0.4454 0.3541 0.3944 0.0588  0.0580  0.0021  381 VAL A C   
2905 O O   . VAL A 393 ? 0.4258 0.3274 0.3733 0.0511  0.0574  0.0041  381 VAL A O   
2906 C CB  . VAL A 393 ? 0.4493 0.3625 0.3940 0.0608  0.0600  -0.0097 381 VAL A CB  
2907 C CG1 . VAL A 393 ? 0.4067 0.3166 0.3463 0.0676  0.0606  -0.0178 381 VAL A CG1 
2908 C CG2 . VAL A 393 ? 0.4463 0.3791 0.3956 0.0596  0.0622  -0.0056 381 VAL A CG2 
2909 N N   . LYS A 394 ? 0.4429 0.3644 0.3968 0.0627  0.0580  0.0061  382 LYS A N   
2910 C CA  . LYS A 394 ? 0.4468 0.3744 0.4031 0.0575  0.0569  0.0122  382 LYS A CA  
2911 C C   . LYS A 394 ? 0.4399 0.3516 0.3911 0.0556  0.0549  0.0161  382 LYS A C   
2912 O O   . LYS A 394 ? 0.4342 0.3368 0.3834 0.0618  0.0531  0.0172  382 LYS A O   
2913 C CB  . LYS A 394 ? 0.4525 0.3956 0.4158 0.0623  0.0563  0.0151  382 LYS A CB  
2914 C CG  . LYS A 394 ? 0.5052 0.4577 0.4716 0.0557  0.0552  0.0194  382 LYS A CG  
2915 C CD  . LYS A 394 ? 0.5904 0.5587 0.5655 0.0591  0.0538  0.0222  382 LYS A CD  
2916 C CE  . LYS A 394 ? 0.5936 0.5667 0.5700 0.0523  0.0514  0.0260  382 LYS A CE  
2917 N NZ  . LYS A 394 ? 0.6377 0.6213 0.6216 0.0557  0.0477  0.0290  382 LYS A NZ  
2918 N N   . TYR A 395 ? 0.4281 0.3370 0.3771 0.0475  0.0553  0.0187  383 TYR A N   
2919 C CA  . TYR A 395 ? 0.4394 0.3332 0.3822 0.0447  0.0546  0.0232  383 TYR A CA  
2920 C C   . TYR A 395 ? 0.4601 0.3351 0.3987 0.0455  0.0548  0.0214  383 TYR A C   
2921 O O   . TYR A 395 ? 0.4563 0.3171 0.3892 0.0453  0.0541  0.0259  383 TYR A O   
2922 C CB  . TYR A 395 ? 0.4426 0.3374 0.3834 0.0496  0.0517  0.0287  383 TYR A CB  
2923 C CG  . TYR A 395 ? 0.4382 0.3490 0.3827 0.0474  0.0507  0.0307  383 TYR A CG  
2924 C CD1 . TYR A 395 ? 0.4138 0.3282 0.3578 0.0395  0.0525  0.0309  383 TYR A CD1 
2925 C CD2 . TYR A 395 ? 0.4408 0.3635 0.3907 0.0532  0.0476  0.0319  383 TYR A CD2 
2926 C CE1 . TYR A 395 ? 0.4247 0.3519 0.3720 0.0375  0.0511  0.0320  383 TYR A CE1 
2927 C CE2 . TYR A 395 ? 0.4162 0.3528 0.3704 0.0503  0.0460  0.0332  383 TYR A CE2 
2928 C CZ  . TYR A 395 ? 0.4339 0.3717 0.3862 0.0425  0.0477  0.0332  383 TYR A CZ  
2929 O OH  . TYR A 395 ? 0.4292 0.3783 0.3852 0.0396  0.0457  0.0340  383 TYR A OH  
2930 N N   . ASN A 396 ? 0.4597 0.3334 0.4003 0.0464  0.0554  0.0147  384 ASN A N   
2931 C CA  . ASN A 396 ? 0.4769 0.3315 0.4141 0.0470  0.0547  0.0118  384 ASN A CA  
2932 C C   . ASN A 396 ? 0.4727 0.3208 0.4103 0.0365  0.0563  0.0112  384 ASN A C   
2933 O O   . ASN A 396 ? 0.4619 0.3139 0.4026 0.0331  0.0565  0.0052  384 ASN A O   
2934 C CB  . ASN A 396 ? 0.4834 0.3396 0.4217 0.0539  0.0541  0.0040  384 ASN A CB  
2935 C CG  . ASN A 396 ? 0.5175 0.3520 0.4520 0.0568  0.0521  0.0005  384 ASN A CG  
2936 O OD1 . ASN A 396 ? 0.5515 0.3699 0.4838 0.0506  0.0518  0.0030  384 ASN A OD1 
2937 N ND2 . ASN A 396 ? 0.4822 0.3163 0.4162 0.0662  0.0511  -0.0053 384 ASN A ND2 
2938 N N   . TYR A 397 ? 0.4631 0.3034 0.3980 0.0311  0.0576  0.0177  385 TYR A N   
2939 C CA  . TYR A 397 ? 0.4645 0.3021 0.4019 0.0207  0.0600  0.0176  385 TYR A CA  
2940 C C   . TYR A 397 ? 0.4712 0.2929 0.4101 0.0177  0.0591  0.0129  385 TYR A C   
2941 O O   . TYR A 397 ? 0.4732 0.2978 0.4176 0.0106  0.0598  0.0090  385 TYR A O   
2942 C CB  . TYR A 397 ? 0.4454 0.2795 0.3790 0.0156  0.0628  0.0258  385 TYR A CB  
2943 C CG  . TYR A 397 ? 0.5169 0.3331 0.4425 0.0190  0.0621  0.0320  385 TYR A CG  
2944 C CD1 . TYR A 397 ? 0.5072 0.3250 0.4273 0.0274  0.0596  0.0360  385 TYR A CD1 
2945 C CD2 . TYR A 397 ? 0.5883 0.3851 0.5121 0.0139  0.0634  0.0340  385 TYR A CD2 
2946 C CE1 . TYR A 397 ? 0.5877 0.3882 0.4996 0.0315  0.0580  0.0419  385 TYR A CE1 
2947 C CE2 . TYR A 397 ? 0.6147 0.3926 0.5300 0.0174  0.0624  0.0405  385 TYR A CE2 
2948 C CZ  . TYR A 397 ? 0.6239 0.4038 0.5326 0.0266  0.0595  0.0445  385 TYR A CZ  
2949 O OH  . TYR A 397 ? 0.6208 0.3827 0.5204 0.0309  0.0577  0.0512  385 TYR A OH  
2950 N N   . GLU A 398 ? 0.4989 0.3040 0.4336 0.0233  0.0569  0.0127  386 GLU A N   
2951 C CA  . GLU A 398 ? 0.5371 0.3254 0.4734 0.0204  0.0551  0.0074  386 GLU A CA  
2952 C C   . GLU A 398 ? 0.5299 0.3263 0.4698 0.0224  0.0528  -0.0029 386 GLU A C   
2953 O O   . GLU A 398 ? 0.5347 0.3263 0.4790 0.0158  0.0517  -0.0079 386 GLU A O   
2954 C CB  . GLU A 398 ? 0.5637 0.3303 0.4942 0.0267  0.0526  0.0092  386 GLU A CB  
2955 C CG  . GLU A 398 ? 0.6274 0.3821 0.5526 0.0231  0.0548  0.0202  386 GLU A CG  
2956 C CD  . GLU A 398 ? 0.7095 0.4408 0.6283 0.0291  0.0519  0.0231  386 GLU A CD  
2957 O OE1 . GLU A 398 ? 0.7748 0.5048 0.6924 0.0398  0.0483  0.0181  386 GLU A OE1 
2958 O OE2 . GLU A 398 ? 0.7947 0.5093 0.7093 0.0237  0.0533  0.0307  386 GLU A OE2 
2959 N N   . LEU A 399 ? 0.5229 0.3323 0.4611 0.0312  0.0521  -0.0059 387 LEU A N   
2960 C CA  . LEU A 399 ? 0.5188 0.3375 0.4582 0.0332  0.0507  -0.0149 387 LEU A CA  
2961 C C   . LEU A 399 ? 0.5095 0.3423 0.4540 0.0249  0.0517  -0.0153 387 LEU A C   
2962 O O   . LEU A 399 ? 0.5075 0.3404 0.4538 0.0218  0.0495  -0.0224 387 LEU A O   
2963 C CB  . LEU A 399 ? 0.5261 0.3579 0.4630 0.0436  0.0512  -0.0162 387 LEU A CB  
2964 C CG  . LEU A 399 ? 0.5547 0.3969 0.4902 0.0470  0.0506  -0.0246 387 LEU A CG  
2965 C CD1 . LEU A 399 ? 0.5479 0.3745 0.4794 0.0510  0.0474  -0.0338 387 LEU A CD1 
2966 C CD2 . LEU A 399 ? 0.5826 0.4419 0.5175 0.0552  0.0530  -0.0229 387 LEU A CD2 
2967 N N   . ALA A 400 ? 0.4788 0.3232 0.4253 0.0215  0.0545  -0.0084 388 ALA A N   
2968 C CA  . ALA A 400 ? 0.4673 0.3238 0.4192 0.0140  0.0552  -0.0092 388 ALA A CA  
2969 C C   . ALA A 400 ? 0.4772 0.3240 0.4346 0.0048  0.0546  -0.0114 388 ALA A C   
2970 O O   . ALA A 400 ? 0.4727 0.3258 0.4349 0.0008  0.0526  -0.0171 388 ALA A O   
2971 C CB  . ALA A 400 ? 0.4462 0.3142 0.3991 0.0120  0.0579  -0.0021 388 ALA A CB  
2972 N N   . GLU A 401 ? 0.4875 0.3199 0.4446 0.0013  0.0564  -0.0064 389 GLU A N   
2973 C CA  . GLU A 401 ? 0.5057 0.3279 0.4694 -0.0082 0.0566  -0.0075 389 GLU A CA  
2974 C C   . GLU A 401 ? 0.5268 0.3405 0.4930 -0.0084 0.0515  -0.0174 389 GLU A C   
2975 O O   . GLU A 401 ? 0.5105 0.3277 0.4852 -0.0157 0.0499  -0.0219 389 GLU A O   
2976 C CB  . GLU A 401 ? 0.5177 0.3232 0.4786 -0.0113 0.0596  0.0005  389 GLU A CB  
2977 C CG  . GLU A 401 ? 0.5416 0.3562 0.5002 -0.0132 0.0646  0.0094  389 GLU A CG  
2978 C CD  . GLU A 401 ? 0.5688 0.3685 0.5192 -0.0121 0.0670  0.0185  389 GLU A CD  
2979 O OE1 . GLU A 401 ? 0.5955 0.3770 0.5420 -0.0090 0.0646  0.0185  389 GLU A OE1 
2980 O OE2 . GLU A 401 ? 0.5828 0.3885 0.5300 -0.0141 0.0710  0.0255  389 GLU A OE2 
2981 N N   . GLU A 402 ? 0.5519 0.3541 0.5111 -0.0001 0.0487  -0.0209 390 GLU A N   
2982 C CA  . GLU A 402 ? 0.5716 0.3644 0.5308 0.0012  0.0433  -0.0314 390 GLU A CA  
2983 C C   . GLU A 402 ? 0.5490 0.3583 0.5094 0.0020  0.0406  -0.0387 390 GLU A C   
2984 O O   . GLU A 402 ? 0.5465 0.3530 0.5114 -0.0023 0.0363  -0.0462 390 GLU A O   
2985 C CB  . GLU A 402 ? 0.5942 0.3777 0.5443 0.0128  0.0412  -0.0350 390 GLU A CB  
2986 C CG  . GLU A 402 ? 0.7217 0.4851 0.6686 0.0151  0.0415  -0.0304 390 GLU A CG  
2987 C CD  . GLU A 402 ? 0.8432 0.6014 0.7818 0.0287  0.0395  -0.0351 390 GLU A CD  
2988 O OE1 . GLU A 402 ? 0.8953 0.6538 0.8315 0.0329  0.0360  -0.0455 390 GLU A OE1 
2989 O OE2 . GLU A 402 ? 0.8947 0.6501 0.8293 0.0354  0.0412  -0.0287 390 GLU A OE2 
2990 N N   . PHE A 403 ? 0.5215 0.3470 0.4773 0.0083  0.0426  -0.0366 391 PHE A N   
2991 C CA  . PHE A 403 ? 0.5150 0.3553 0.4703 0.0093  0.0404  -0.0420 391 PHE A CA  
2992 C C   . PHE A 403 ? 0.5046 0.3527 0.4702 -0.0007 0.0394  -0.0422 391 PHE A C   
2993 O O   . PHE A 403 ? 0.5064 0.3574 0.4739 -0.0024 0.0345  -0.0499 391 PHE A O   
2994 C CB  . PHE A 403 ? 0.4982 0.3543 0.4484 0.0160  0.0435  -0.0377 391 PHE A CB  
2995 C CG  . PHE A 403 ? 0.5059 0.3758 0.4534 0.0177  0.0414  -0.0423 391 PHE A CG  
2996 C CD1 . PHE A 403 ? 0.5279 0.3975 0.4665 0.0256  0.0394  -0.0491 391 PHE A CD1 
2997 C CD2 . PHE A 403 ? 0.4697 0.3519 0.4231 0.0119  0.0413  -0.0400 391 PHE A CD2 
2998 C CE1 . PHE A 403 ? 0.5252 0.4063 0.4593 0.0273  0.0376  -0.0525 391 PHE A CE1 
2999 C CE2 . PHE A 403 ? 0.4809 0.3740 0.4307 0.0138  0.0387  -0.0435 391 PHE A CE2 
3000 C CZ  . PHE A 403 ? 0.4870 0.3794 0.4267 0.0212  0.0369  -0.0494 391 PHE A CZ  
3001 N N   . ALA A 404 ? 0.4900 0.3423 0.4616 -0.0066 0.0438  -0.0342 392 ALA A N   
3002 C CA  . ALA A 404 ? 0.4906 0.3529 0.4730 -0.0152 0.0439  -0.0341 392 ALA A CA  
3003 C C   . ALA A 404 ? 0.5144 0.3662 0.5054 -0.0226 0.0403  -0.0399 392 ALA A C   
3004 O O   . ALA A 404 ? 0.5020 0.3609 0.5001 -0.0263 0.0360  -0.0461 392 ALA A O   
3005 C CB  . ALA A 404 ? 0.4806 0.3480 0.4666 -0.0195 0.0502  -0.0246 392 ALA A CB  
3006 N N   . LYS A 405 ? 0.5466 0.3805 0.5367 -0.0243 0.0414  -0.0381 393 LYS A N   
3007 C CA  . LYS A 405 ? 0.5826 0.4041 0.5820 -0.0324 0.0382  -0.0428 393 LYS A CA  
3008 C C   . LYS A 405 ? 0.5834 0.4012 0.5805 -0.0288 0.0298  -0.0551 393 LYS A C   
3009 O O   . LYS A 405 ? 0.5913 0.4125 0.5984 -0.0351 0.0251  -0.0614 393 LYS A O   
3010 C CB  . LYS A 405 ? 0.6012 0.4020 0.5983 -0.0344 0.0411  -0.0371 393 LYS A CB  
3011 C CG  . LYS A 405 ? 0.6744 0.4609 0.6822 -0.0442 0.0385  -0.0406 393 LYS A CG  
3012 C CD  . LYS A 405 ? 0.7688 0.5337 0.7735 -0.0463 0.0416  -0.0335 393 LYS A CD  
3013 C CE  . LYS A 405 ? 0.8276 0.5846 0.8471 -0.0607 0.0435  -0.0310 393 LYS A CE  
3014 N NZ  . LYS A 405 ? 0.8752 0.6157 0.9014 -0.0650 0.0359  -0.0404 393 LYS A NZ  
3015 N N   . GLU A 406 ? 0.5910 0.4029 0.5750 -0.0184 0.0277  -0.0587 394 GLU A N   
3016 C CA  . GLU A 406 ? 0.6087 0.4171 0.5871 -0.0134 0.0202  -0.0706 394 GLU A CA  
3017 C C   . GLU A 406 ? 0.5850 0.4111 0.5639 -0.0129 0.0163  -0.0756 394 GLU A C   
3018 O O   . GLU A 406 ? 0.5678 0.3911 0.5459 -0.0125 0.0089  -0.0857 394 GLU A O   
3019 C CB  . GLU A 406 ? 0.6223 0.4251 0.5855 -0.0008 0.0206  -0.0727 394 GLU A CB  
3020 C CG  . GLU A 406 ? 0.7354 0.5191 0.6963 0.0010  0.0226  -0.0694 394 GLU A CG  
3021 C CD  . GLU A 406 ? 0.8388 0.6152 0.7865 0.0139  0.0214  -0.0746 394 GLU A CD  
3022 O OE1 . GLU A 406 ? 0.8803 0.6370 0.8258 0.0166  0.0205  -0.0753 394 GLU A OE1 
3023 O OE2 . GLU A 406 ? 0.9076 0.6981 0.8474 0.0214  0.0216  -0.0778 394 GLU A OE2 
3024 N N   . ASN A 407 ? 0.5588 0.4020 0.5377 -0.0120 0.0208  -0.0687 395 ASN A N   
3025 C CA  . ASN A 407 ? 0.5601 0.4191 0.5378 -0.0103 0.0172  -0.0722 395 ASN A CA  
3026 C C   . ASN A 407 ? 0.5433 0.4142 0.5360 -0.0193 0.0170  -0.0699 395 ASN A C   
3027 O O   . ASN A 407 ? 0.5470 0.4315 0.5399 -0.0180 0.0142  -0.0714 395 ASN A O   
3028 C CB  . ASN A 407 ? 0.5463 0.4159 0.5123 -0.0016 0.0212  -0.0672 395 ASN A CB  
3029 C CG  . ASN A 407 ? 0.5828 0.4449 0.5344 0.0082  0.0206  -0.0716 395 ASN A CG  
3030 O OD1 . ASN A 407 ? 0.6724 0.5337 0.6165 0.0122  0.0152  -0.0801 395 ASN A OD1 
3031 N ND2 . ASN A 407 ? 0.5369 0.3940 0.4843 0.0129  0.0260  -0.0663 395 ASN A ND2 
3032 N N   . ASP A 408 ? 0.5502 0.4159 0.5552 -0.0279 0.0204  -0.0660 396 ASP A N   
3033 C CA  . ASP A 408 ? 0.5500 0.4277 0.5711 -0.0366 0.0215  -0.0640 396 ASP A CA  
3034 C C   . ASP A 408 ? 0.5221 0.4172 0.5422 -0.0339 0.0251  -0.0581 396 ASP A C   
3035 O O   . ASP A 408 ? 0.5112 0.4191 0.5401 -0.0364 0.0220  -0.0608 396 ASP A O   
3036 C CB  . ASP A 408 ? 0.5685 0.4501 0.5997 -0.0409 0.0127  -0.0739 396 ASP A CB  
3037 C CG  . ASP A 408 ? 0.6477 0.5124 0.6829 -0.0453 0.0081  -0.0806 396 ASP A CG  
3038 O OD1 . ASP A 408 ? 0.7440 0.5953 0.7809 -0.0491 0.0131  -0.0756 396 ASP A OD1 
3039 O OD2 . ASP A 408 ? 0.7855 0.6491 0.8218 -0.0449 -0.0011 -0.0909 396 ASP A OD2 
3040 N N   . CYS A 409 ? 0.4947 0.3900 0.5051 -0.0289 0.0310  -0.0506 397 CYS A N   
3041 C CA  . CYS A 409 ? 0.4850 0.3950 0.4939 -0.0262 0.0338  -0.0455 397 CYS A CA  
3042 C C   . CYS A 409 ? 0.4713 0.3810 0.4802 -0.0277 0.0417  -0.0362 397 CYS A C   
3043 O O   . CYS A 409 ? 0.4837 0.3818 0.4927 -0.0305 0.0451  -0.0333 397 CYS A O   
3044 C CB  . CYS A 409 ? 0.4770 0.3902 0.4718 -0.0169 0.0316  -0.0464 397 CYS A CB  
3045 S SG  . CYS A 409 ? 0.5200 0.4220 0.5013 -0.0097 0.0353  -0.0432 397 CYS A SG  
3046 N N   . VAL A 410 ? 0.4682 0.3900 0.4764 -0.0258 0.0441  -0.0318 398 VAL A N   
3047 C CA  . VAL A 410 ? 0.4513 0.3732 0.4558 -0.0250 0.0504  -0.0237 398 VAL A CA  
3048 C C   . VAL A 410 ? 0.4506 0.3732 0.4432 -0.0169 0.0497  -0.0218 398 VAL A C   
3049 O O   . VAL A 410 ? 0.4550 0.3852 0.4446 -0.0131 0.0462  -0.0243 398 VAL A O   
3050 C CB  . VAL A 410 ? 0.4384 0.3729 0.4501 -0.0280 0.0533  -0.0207 398 VAL A CB  
3051 C CG1 . VAL A 410 ? 0.3973 0.3314 0.4018 -0.0255 0.0586  -0.0131 398 VAL A CG1 
3052 C CG2 . VAL A 410 ? 0.4482 0.3846 0.4739 -0.0364 0.0554  -0.0222 398 VAL A CG2 
3053 N N   . LEU A 411 ? 0.4465 0.3612 0.4324 -0.0141 0.0531  -0.0169 399 LEU A N   
3054 C CA  . LEU A 411 ? 0.4343 0.3510 0.4111 -0.0067 0.0532  -0.0144 399 LEU A CA  
3055 C C   . LEU A 411 ? 0.4190 0.3405 0.3946 -0.0063 0.0569  -0.0073 399 LEU A C   
3056 O O   . LEU A 411 ? 0.4198 0.3353 0.3957 -0.0091 0.0602  -0.0031 399 LEU A O   
3057 C CB  . LEU A 411 ? 0.4484 0.3526 0.4188 -0.0022 0.0529  -0.0158 399 LEU A CB  
3058 C CG  . LEU A 411 ? 0.4723 0.3806 0.4351 0.0060  0.0529  -0.0149 399 LEU A CG  
3059 C CD1 . LEU A 411 ? 0.4560 0.3733 0.4161 0.0088  0.0499  -0.0197 399 LEU A CD1 
3060 C CD2 . LEU A 411 ? 0.5116 0.4066 0.4696 0.0104  0.0529  -0.0162 399 LEU A CD2 
3061 N N   . VAL A 412 ? 0.4064 0.3384 0.3802 -0.0031 0.0560  -0.0060 400 VAL A N   
3062 C CA  . VAL A 412 ? 0.3922 0.3293 0.3646 -0.0020 0.0580  -0.0003 400 VAL A CA  
3063 C C   . VAL A 412 ? 0.3925 0.3312 0.3594 0.0043  0.0575  0.0015  400 VAL A C   
3064 O O   . VAL A 412 ? 0.3843 0.3309 0.3506 0.0065  0.0559  0.0007  400 VAL A O   
3065 C CB  . VAL A 412 ? 0.3781 0.3261 0.3549 -0.0041 0.0570  -0.0003 400 VAL A CB  
3066 C CG1 . VAL A 412 ? 0.3451 0.2976 0.3197 -0.0026 0.0581  0.0047  400 VAL A CG1 
3067 C CG2 . VAL A 412 ? 0.3697 0.3187 0.3543 -0.0101 0.0578  -0.0030 400 VAL A CG2 
3068 N N   . LEU A 413 ? 0.3889 0.3204 0.3522 0.0071  0.0589  0.0044  401 LEU A N   
3069 C CA  . LEU A 413 ? 0.3826 0.3167 0.3427 0.0137  0.0586  0.0061  401 LEU A CA  
3070 C C   . LEU A 413 ? 0.3703 0.3115 0.3310 0.0143  0.0587  0.0113  401 LEU A C   
3071 O O   . LEU A 413 ? 0.3596 0.2957 0.3183 0.0139  0.0594  0.0148  401 LEU A O   
3072 C CB  . LEU A 413 ? 0.3951 0.3172 0.3516 0.0174  0.0591  0.0060  401 LEU A CB  
3073 C CG  . LEU A 413 ? 0.4048 0.3304 0.3596 0.0252  0.0589  0.0070  401 LEU A CG  
3074 C CD1 . LEU A 413 ? 0.3931 0.3274 0.3479 0.0284  0.0589  0.0031  401 LEU A CD1 
3075 C CD2 . LEU A 413 ? 0.4083 0.3205 0.3597 0.0295  0.0587  0.0071  401 LEU A CD2 
3076 N N   . LYS A 414 ? 0.3692 0.3215 0.3322 0.0151  0.0577  0.0118  402 LYS A N   
3077 C CA  . LYS A 414 ? 0.3837 0.3433 0.3488 0.0146  0.0567  0.0157  402 LYS A CA  
3078 C C   . LYS A 414 ? 0.3851 0.3466 0.3501 0.0195  0.0562  0.0190  402 LYS A C   
3079 O O   . LYS A 414 ? 0.4283 0.3909 0.3935 0.0239  0.0569  0.0181  402 LYS A O   
3080 C CB  . LYS A 414 ? 0.3691 0.3381 0.3373 0.0130  0.0555  0.0153  402 LYS A CB  
3081 C CG  . LYS A 414 ? 0.4129 0.3806 0.3819 0.0089  0.0550  0.0123  402 LYS A CG  
3082 C CD  . LYS A 414 ? 0.4890 0.4637 0.4601 0.0075  0.0530  0.0119  402 LYS A CD  
3083 C CE  . LYS A 414 ? 0.4854 0.4651 0.4548 0.0103  0.0531  0.0126  402 LYS A CE  
3084 N NZ  . LYS A 414 ? 0.4623 0.4451 0.4315 0.0085  0.0509  0.0116  402 LYS A NZ  
3085 N N   . SER A 415 ? 0.3627 0.3243 0.3272 0.0191  0.0548  0.0222  403 SER A N   
3086 C CA  . SER A 415 ? 0.3643 0.3295 0.3301 0.0235  0.0528  0.0253  403 SER A CA  
3087 C C   . SER A 415 ? 0.3565 0.3200 0.3195 0.0216  0.0506  0.0277  403 SER A C   
3088 O O   . SER A 415 ? 0.3565 0.3168 0.3168 0.0173  0.0517  0.0268  403 SER A O   
3089 C CB  . SER A 415 ? 0.3885 0.3460 0.3515 0.0290  0.0534  0.0254  403 SER A CB  
3090 O OG  . SER A 415 ? 0.3903 0.3513 0.3560 0.0327  0.0550  0.0228  403 SER A OG  
3091 N N   . ALA A 416 ? 0.3565 0.3223 0.3197 0.0251  0.0475  0.0303  404 ALA A N   
3092 C CA  . ALA A 416 ? 0.3853 0.3498 0.3443 0.0238  0.0447  0.0319  404 ALA A CA  
3093 C C   . ALA A 416 ? 0.3916 0.3441 0.3409 0.0220  0.0476  0.0327  404 ALA A C   
3094 O O   . ALA A 416 ? 0.4123 0.3642 0.3580 0.0188  0.0479  0.0323  404 ALA A O   
3095 C CB  . ALA A 416 ? 0.3850 0.3534 0.3454 0.0284  0.0397  0.0343  404 ALA A CB  
3096 N N   . THR A 417 ? 0.3792 0.3224 0.3250 0.0237  0.0500  0.0334  405 THR A N   
3097 C CA  . THR A 417 ? 0.3812 0.3137 0.3208 0.0202  0.0540  0.0340  405 THR A CA  
3098 C C   . THR A 417 ? 0.3826 0.3149 0.3277 0.0175  0.0568  0.0302  405 THR A C   
3099 O O   . THR A 417 ? 0.3826 0.3141 0.3304 0.0210  0.0563  0.0287  405 THR A O   
3100 C CB  . THR A 417 ? 0.4078 0.3270 0.3388 0.0233  0.0543  0.0380  405 THR A CB  
3101 O OG1 . THR A 417 ? 0.4237 0.3430 0.3482 0.0268  0.0506  0.0415  405 THR A OG1 
3102 C CG2 . THR A 417 ? 0.3682 0.2763 0.2939 0.0180  0.0595  0.0393  405 THR A CG2 
3103 N N   . THR A 418 ? 0.3596 0.2935 0.3065 0.0121  0.0592  0.0281  406 THR A N   
3104 C CA  . THR A 418 ? 0.3597 0.2941 0.3119 0.0093  0.0608  0.0239  406 THR A CA  
3105 C C   . THR A 418 ? 0.3773 0.3004 0.3274 0.0060  0.0640  0.0241  406 THR A C   
3106 O O   . THR A 418 ? 0.3677 0.2859 0.3134 0.0033  0.0666  0.0272  406 THR A O   
3107 C CB  . THR A 418 ? 0.3633 0.3075 0.3209 0.0056  0.0605  0.0210  406 THR A CB  
3108 O OG1 . THR A 418 ? 0.3594 0.3123 0.3196 0.0083  0.0573  0.0212  406 THR A OG1 
3109 C CG2 . THR A 418 ? 0.3324 0.2768 0.2951 0.0023  0.0614  0.0165  406 THR A CG2 
3110 N N   . ILE A 419 ? 0.3824 0.3006 0.3347 0.0065  0.0638  0.0210  407 ILE A N   
3111 C CA  . ILE A 419 ? 0.3920 0.2986 0.3443 0.0028  0.0661  0.0204  407 ILE A CA  
3112 C C   . ILE A 419 ? 0.3814 0.2927 0.3412 -0.0024 0.0664  0.0151  407 ILE A C   
3113 O O   . ILE A 419 ? 0.3860 0.3037 0.3488 -0.0006 0.0639  0.0109  407 ILE A O   
3114 C CB  . ILE A 419 ? 0.3873 0.2834 0.3370 0.0075  0.0645  0.0193  407 ILE A CB  
3115 C CG1 . ILE A 419 ? 0.4035 0.2945 0.3465 0.0132  0.0635  0.0247  407 ILE A CG1 
3116 C CG2 . ILE A 419 ? 0.3830 0.2659 0.3339 0.0028  0.0659  0.0178  407 ILE A CG2 
3117 C CD1 . ILE A 419 ? 0.3420 0.2265 0.2835 0.0208  0.0610  0.0232  407 ILE A CD1 
3118 N N   . VAL A 420 ? 0.3929 0.3014 0.3558 -0.0088 0.0696  0.0156  408 VAL A N   
3119 C CA  . VAL A 420 ? 0.3807 0.2947 0.3527 -0.0142 0.0697  0.0106  408 VAL A CA  
3120 C C   . VAL A 420 ? 0.4051 0.3073 0.3799 -0.0192 0.0715  0.0102  408 VAL A C   
3121 O O   . VAL A 420 ? 0.4187 0.3133 0.3908 -0.0223 0.0757  0.0153  408 VAL A O   
3122 C CB  . VAL A 420 ? 0.3812 0.3057 0.3574 -0.0177 0.0723  0.0113  408 VAL A CB  
3123 C CG1 . VAL A 420 ? 0.3670 0.2980 0.3545 -0.0229 0.0719  0.0059  408 VAL A CG1 
3124 C CG2 . VAL A 420 ? 0.3522 0.2863 0.3251 -0.0130 0.0700  0.0122  408 VAL A CG2 
3125 N N   . THR A 421 ? 0.4263 0.3254 0.4056 -0.0199 0.0682  0.0043  409 THR A N   
3126 C CA  . THR A 421 ? 0.4420 0.3279 0.4247 -0.0252 0.0691  0.0035  409 THR A CA  
3127 C C   . THR A 421 ? 0.4393 0.3285 0.4319 -0.0291 0.0654  -0.0044 409 THR A C   
3128 O O   . THR A 421 ? 0.4238 0.3210 0.4163 -0.0252 0.0612  -0.0094 409 THR A O   
3129 C CB  . THR A 421 ? 0.4590 0.3289 0.4331 -0.0203 0.0679  0.0055  409 THR A CB  
3130 O OG1 . THR A 421 ? 0.4574 0.3122 0.4344 -0.0261 0.0690  0.0060  409 THR A OG1 
3131 C CG2 . THR A 421 ? 0.4778 0.3482 0.4483 -0.0127 0.0628  -0.0002 409 THR A CG2 
3132 N N   . ASP A 422 ? 0.4616 0.3452 0.4628 -0.0371 0.0670  -0.0051 410 ASP A N   
3133 C CA  . ASP A 422 ? 0.4766 0.3597 0.4872 -0.0410 0.0624  -0.0131 410 ASP A CA  
3134 C C   . ASP A 422 ? 0.5228 0.3862 0.5319 -0.0427 0.0606  -0.0145 410 ASP A C   
3135 O O   . ASP A 422 ? 0.5129 0.3723 0.5308 -0.0477 0.0567  -0.0209 410 ASP A O   
3136 C CB  . ASP A 422 ? 0.4765 0.3703 0.5018 -0.0496 0.0649  -0.0139 410 ASP A CB  
3137 C CG  . ASP A 422 ? 0.4860 0.3720 0.5154 -0.0575 0.0719  -0.0073 410 ASP A CG  
3138 O OD1 . ASP A 422 ? 0.4867 0.3572 0.5067 -0.0564 0.0743  -0.0017 410 ASP A OD1 
3139 O OD2 . ASP A 422 ? 0.5427 0.4388 0.5847 -0.0645 0.0755  -0.0073 410 ASP A OD2 
3140 N N   . GLY A 423 ? 0.5437 0.3941 0.5422 -0.0386 0.0628  -0.0088 411 GLY A N   
3141 C CA  . GLY A 423 ? 0.5831 0.4131 0.5796 -0.0393 0.0605  -0.0102 411 GLY A CA  
3142 C C   . GLY A 423 ? 0.6103 0.4284 0.6106 -0.0481 0.0658  -0.0031 411 GLY A C   
3143 O O   . GLY A 423 ? 0.6187 0.4175 0.6149 -0.0480 0.0649  -0.0014 411 GLY A O   
3144 N N   . GLU A 424 ? 0.6231 0.4525 0.6313 -0.0554 0.0715  0.0011  412 GLU A N   
3145 C CA  . GLU A 424 ? 0.6530 0.4728 0.6650 -0.0646 0.0779  0.0087  412 GLU A CA  
3146 C C   . GLU A 424 ? 0.6340 0.4592 0.6369 -0.0628 0.0851  0.0184  412 GLU A C   
3147 O O   . GLU A 424 ? 0.6557 0.4674 0.6512 -0.0649 0.0897  0.0270  412 GLU A O   
3148 C CB  . GLU A 424 ? 0.6683 0.4979 0.6991 -0.0760 0.0798  0.0054  412 GLU A CB  
3149 C CG  . GLU A 424 ? 0.7505 0.5769 0.7926 -0.0792 0.0719  -0.0051 412 GLU A CG  
3150 C CD  . GLU A 424 ? 0.8438 0.6449 0.8834 -0.0813 0.0686  -0.0056 412 GLU A CD  
3151 O OE1 . GLU A 424 ? 0.9068 0.6976 0.9538 -0.0912 0.0729  -0.0005 412 GLU A OE1 
3152 O OE2 . GLU A 424 ? 0.9546 0.7456 0.9851 -0.0730 0.0619  -0.0112 412 GLU A OE2 
3153 N N   . LYS A 425 ? 0.6034 0.4480 0.6068 -0.0594 0.0857  0.0167  413 LYS A N   
3154 C CA  . LYS A 425 ? 0.5990 0.4507 0.5935 -0.0566 0.0911  0.0238  413 LYS A CA  
3155 C C   . LYS A 425 ? 0.5696 0.4267 0.5541 -0.0454 0.0860  0.0217  413 LYS A C   
3156 O O   . LYS A 425 ? 0.5628 0.4279 0.5517 -0.0421 0.0807  0.0143  413 LYS A O   
3157 C CB  . LYS A 425 ? 0.5958 0.4661 0.6019 -0.0625 0.0959  0.0225  413 LYS A CB  
3158 C CG  . LYS A 425 ? 0.6508 0.5291 0.6483 -0.0603 0.1021  0.0289  413 LYS A CG  
3159 C CD  . LYS A 425 ? 0.7306 0.6195 0.7385 -0.0691 0.1108  0.0312  413 LYS A CD  
3160 C CE  . LYS A 425 ? 0.7488 0.6597 0.7678 -0.0684 0.1103  0.0246  413 LYS A CE  
3161 N NZ  . LYS A 425 ? 0.7832 0.7047 0.7989 -0.0689 0.1187  0.0289  413 LYS A NZ  
3162 N N   . THR A 426 ? 0.5593 0.4110 0.5304 -0.0399 0.0875  0.0285  414 THR A N   
3163 C CA  . THR A 426 ? 0.5469 0.4047 0.5099 -0.0303 0.0835  0.0278  414 THR A CA  
3164 C C   . THR A 426 ? 0.5263 0.3919 0.4820 -0.0288 0.0872  0.0334  414 THR A C   
3165 O O   . THR A 426 ? 0.5373 0.3942 0.4855 -0.0310 0.0917  0.0406  414 THR A O   
3166 C CB  . THR A 426 ? 0.5707 0.4130 0.5246 -0.0234 0.0797  0.0295  414 THR A CB  
3167 O OG1 . THR A 426 ? 0.5378 0.3737 0.4979 -0.0241 0.0758  0.0228  414 THR A OG1 
3168 C CG2 . THR A 426 ? 0.5422 0.3922 0.4891 -0.0136 0.0760  0.0296  414 THR A CG2 
3169 N N   . LEU A 427 ? 0.4863 0.3676 0.4441 -0.0257 0.0853  0.0299  415 LEU A N   
3170 C CA  . LEU A 427 ? 0.4782 0.3670 0.4290 -0.0230 0.0871  0.0335  415 LEU A CA  
3171 C C   . LEU A 427 ? 0.4512 0.3435 0.3957 -0.0145 0.0816  0.0332  415 LEU A C   
3172 O O   . LEU A 427 ? 0.4352 0.3313 0.3841 -0.0112 0.0771  0.0286  415 LEU A O   
3173 C CB  . LEU A 427 ? 0.4642 0.3682 0.4235 -0.0270 0.0899  0.0299  415 LEU A CB  
3174 C CG  . LEU A 427 ? 0.5114 0.4154 0.4808 -0.0359 0.0954  0.0294  415 LEU A CG  
3175 C CD1 . LEU A 427 ? 0.5159 0.4272 0.4995 -0.0383 0.0917  0.0216  415 LEU A CD1 
3176 C CD2 . LEU A 427 ? 0.5248 0.4383 0.4950 -0.0390 0.1020  0.0313  415 LEU A CD2 
3177 N N   . PHE A 428 ? 0.4509 0.3421 0.3851 -0.0110 0.0819  0.0382  416 PHE A N   
3178 C CA  . PHE A 428 ? 0.4375 0.3334 0.3677 -0.0038 0.0765  0.0380  416 PHE A CA  
3179 C C   . PHE A 428 ? 0.4316 0.3394 0.3608 -0.0034 0.0763  0.0370  416 PHE A C   
3180 O O   . PHE A 428 ? 0.4196 0.3267 0.3423 -0.0053 0.0802  0.0400  416 PHE A O   
3181 C CB  . PHE A 428 ? 0.4557 0.3402 0.3747 0.0011  0.0748  0.0439  416 PHE A CB  
3182 C CG  . PHE A 428 ? 0.4644 0.3344 0.3829 0.0017  0.0745  0.0452  416 PHE A CG  
3183 C CD1 . PHE A 428 ? 0.4663 0.3363 0.3894 0.0066  0.0702  0.0414  416 PHE A CD1 
3184 C CD2 . PHE A 428 ? 0.4802 0.3359 0.3930 -0.0023 0.0788  0.0504  416 PHE A CD2 
3185 C CE1 . PHE A 428 ? 0.5092 0.3649 0.4315 0.0082  0.0695  0.0417  416 PHE A CE1 
3186 C CE2 . PHE A 428 ? 0.4957 0.3356 0.4081 -0.0016 0.0778  0.0515  416 PHE A CE2 
3187 C CZ  . PHE A 428 ? 0.5004 0.3399 0.4173 0.0040  0.0728  0.0466  416 PHE A CZ  
3188 N N   . ASN A 429 ? 0.4154 0.3332 0.3499 -0.0004 0.0718  0.0332  417 ASN A N   
3189 C CA  . ASN A 429 ? 0.3995 0.3274 0.3338 0.0003  0.0702  0.0318  417 ASN A CA  
3190 C C   . ASN A 429 ? 0.4032 0.3319 0.3318 0.0060  0.0650  0.0339  417 ASN A C   
3191 O O   . ASN A 429 ? 0.3771 0.3067 0.3092 0.0094  0.0614  0.0336  417 ASN A O   
3192 C CB  . ASN A 429 ? 0.3898 0.3282 0.3347 -0.0010 0.0682  0.0263  417 ASN A CB  
3193 C CG  . ASN A 429 ? 0.3892 0.3357 0.3340 -0.0007 0.0669  0.0245  417 ASN A CG  
3194 O OD1 . ASN A 429 ? 0.4133 0.3608 0.3560 -0.0029 0.0707  0.0241  417 ASN A OD1 
3195 N ND2 . ASN A 429 ? 0.3500 0.3018 0.2967 0.0021  0.0617  0.0237  417 ASN A ND2 
3196 N N   . ILE A 430 ? 0.4083 0.3372 0.3284 0.0071  0.0647  0.0356  418 ILE A N   
3197 C CA  . ILE A 430 ? 0.4191 0.3493 0.3342 0.0122  0.0588  0.0371  418 ILE A CA  
3198 C C   . ILE A 430 ? 0.4225 0.3618 0.3393 0.0125  0.0551  0.0336  418 ILE A C   
3199 O O   . ILE A 430 ? 0.4496 0.3899 0.3621 0.0160  0.0498  0.0344  418 ILE A O   
3200 C CB  . ILE A 430 ? 0.4395 0.3591 0.3401 0.0149  0.0593  0.0427  418 ILE A CB  
3201 C CG1 . ILE A 430 ? 0.4783 0.3956 0.3691 0.0122  0.0646  0.0437  418 ILE A CG1 
3202 C CG2 . ILE A 430 ? 0.4303 0.3390 0.3299 0.0158  0.0610  0.0464  418 ILE A CG2 
3203 C CD1 . ILE A 430 ? 0.5076 0.4142 0.3809 0.0154  0.0649  0.0499  418 ILE A CD1 
3204 N N   . THR A 431 ? 0.4044 0.3498 0.3279 0.0091  0.0572  0.0295  419 THR A N   
3205 C CA  . THR A 431 ? 0.3888 0.3411 0.3147 0.0097  0.0528  0.0260  419 THR A CA  
3206 C C   . THR A 431 ? 0.3839 0.3424 0.3203 0.0101  0.0478  0.0248  419 THR A C   
3207 O O   . THR A 431 ? 0.3922 0.3512 0.3345 0.0097  0.0489  0.0257  419 THR A O   
3208 C CB  . THR A 431 ? 0.3930 0.3492 0.3222 0.0067  0.0566  0.0219  419 THR A CB  
3209 O OG1 . THR A 431 ? 0.3493 0.3091 0.2898 0.0038  0.0581  0.0200  419 THR A OG1 
3210 C CG2 . THR A 431 ? 0.3866 0.3382 0.3060 0.0057  0.0635  0.0235  419 THR A CG2 
3211 N N   . GLY A 432 ? 0.3831 0.3461 0.3218 0.0108  0.0424  0.0228  420 GLY A N   
3212 C CA  . GLY A 432 ? 0.3841 0.3535 0.3335 0.0103  0.0381  0.0225  420 GLY A CA  
3213 C C   . GLY A 432 ? 0.3960 0.3677 0.3461 0.0129  0.0320  0.0242  420 GLY A C   
3214 O O   . GLY A 432 ? 0.4063 0.3740 0.3474 0.0158  0.0301  0.0253  420 GLY A O   
3215 N N   . ASN A 433 ? 0.3781 0.3567 0.3389 0.0118  0.0287  0.0245  421 ASN A N   
3216 C CA  . ASN A 433 ? 0.3735 0.3569 0.3389 0.0137  0.0229  0.0261  421 ASN A CA  
3217 C C   . ASN A 433 ? 0.3730 0.3647 0.3512 0.0121  0.0234  0.0277  421 ASN A C   
3218 O O   . ASN A 433 ? 0.3603 0.3523 0.3407 0.0101  0.0279  0.0275  421 ASN A O   
3219 C CB  . ASN A 433 ? 0.3624 0.3456 0.3262 0.0133  0.0161  0.0235  421 ASN A CB  
3220 C CG  . ASN A 433 ? 0.3667 0.3512 0.3364 0.0094  0.0148  0.0207  421 ASN A CG  
3221 O OD1 . ASN A 433 ? 0.3962 0.3850 0.3753 0.0066  0.0163  0.0221  421 ASN A OD1 
3222 N ND2 . ASN A 433 ? 0.3898 0.3698 0.3531 0.0096  0.0118  0.0169  421 ASN A ND2 
3223 N N   . THR A 434 ? 0.3701 0.3692 0.3568 0.0128  0.0188  0.0292  422 THR A N   
3224 C CA  . THR A 434 ? 0.3545 0.3630 0.3534 0.0113  0.0205  0.0314  422 THR A CA  
3225 C C   . THR A 434 ? 0.3671 0.3782 0.3726 0.0061  0.0203  0.0314  422 THR A C   
3226 O O   . THR A 434 ? 0.3694 0.3879 0.3835 0.0044  0.0228  0.0340  422 THR A O   
3227 C CB  . THR A 434 ? 0.3588 0.3766 0.3674 0.0133  0.0161  0.0332  422 THR A CB  
3228 O OG1 . THR A 434 ? 0.3354 0.3559 0.3499 0.0100  0.0089  0.0321  422 THR A OG1 
3229 C CG2 . THR A 434 ? 0.3370 0.3509 0.3382 0.0197  0.0150  0.0335  422 THR A CG2 
3230 N N   . GLY A 435 ? 0.3646 0.3694 0.3657 0.0037  0.0176  0.0287  423 GLY A N   
3231 C CA  . GLY A 435 ? 0.3650 0.3703 0.3716 -0.0006 0.0172  0.0290  423 GLY A CA  
3232 C C   . GLY A 435 ? 0.3649 0.3688 0.3686 -0.0008 0.0234  0.0297  423 GLY A C   
3233 O O   . GLY A 435 ? 0.3667 0.3717 0.3746 -0.0038 0.0237  0.0313  423 GLY A O   
3234 N N   . LEU A 436 ? 0.3600 0.3607 0.3564 0.0021  0.0278  0.0286  424 LEU A N   
3235 C CA  . LEU A 436 ? 0.3569 0.3563 0.3508 0.0022  0.0329  0.0284  424 LEU A CA  
3236 C C   . LEU A 436 ? 0.3705 0.3764 0.3684 0.0034  0.0363  0.0312  424 LEU A C   
3237 O O   . LEU A 436 ? 0.3592 0.3648 0.3549 0.0035  0.0398  0.0310  424 LEU A O   
3238 C CB  . LEU A 436 ? 0.3602 0.3531 0.3458 0.0042  0.0359  0.0258  424 LEU A CB  
3239 C CG  . LEU A 436 ? 0.3472 0.3346 0.3279 0.0034  0.0348  0.0226  424 LEU A CG  
3240 C CD1 . LEU A 436 ? 0.3148 0.2969 0.2884 0.0048  0.0390  0.0215  424 LEU A CD1 
3241 C CD2 . LEU A 436 ? 0.3265 0.3137 0.3099 0.0011  0.0341  0.0208  424 LEU A CD2 
3242 N N   . SER A 437 ? 0.3834 0.3958 0.3870 0.0049  0.0352  0.0334  425 SER A N   
3243 C CA  . SER A 437 ? 0.3681 0.3887 0.3768 0.0066  0.0389  0.0358  425 SER A CA  
3244 C C   . SER A 437 ? 0.3749 0.4028 0.3915 0.0025  0.0391  0.0392  425 SER A C   
3245 O O   . SER A 437 ? 0.3696 0.4071 0.3964 0.0014  0.0383  0.0422  425 SER A O   
3246 C CB  . SER A 437 ? 0.3857 0.4116 0.3993 0.0102  0.0372  0.0366  425 SER A CB  
3247 O OG  . SER A 437 ? 0.4595 0.4772 0.4646 0.0143  0.0372  0.0345  425 SER A OG  
3248 N N   . LYS A 438 ? 0.3753 0.3989 0.3875 0.0002  0.0402  0.0392  426 LYS A N   
3249 C CA  . LYS A 438 ? 0.3861 0.4131 0.4031 -0.0041 0.0400  0.0431  426 LYS A CA  
3250 C C   . LYS A 438 ? 0.3947 0.4164 0.4033 -0.0041 0.0423  0.0426  426 LYS A C   
3251 O O   . LYS A 438 ? 0.4030 0.4171 0.4050 -0.0028 0.0412  0.0386  426 LYS A O   
3252 C CB  . LYS A 438 ? 0.4017 0.4248 0.4231 -0.0080 0.0335  0.0429  426 LYS A CB  
3253 C CG  . LYS A 438 ? 0.4162 0.4431 0.4464 -0.0134 0.0318  0.0477  426 LYS A CG  
3254 C CD  . LYS A 438 ? 0.4217 0.4419 0.4552 -0.0169 0.0243  0.0462  426 LYS A CD  
3255 C CE  . LYS A 438 ? 0.4196 0.4450 0.4628 -0.0183 0.0194  0.0458  426 LYS A CE  
3256 N NZ  . LYS A 438 ? 0.4813 0.5040 0.5187 -0.0137 0.0171  0.0407  426 LYS A NZ  
3257 N N   . GLY A 439 ? 0.3962 0.4226 0.4053 -0.0054 0.0455  0.0468  427 GLY A N   
3258 C CA  . GLY A 439 ? 0.3947 0.4161 0.3952 -0.0054 0.0464  0.0469  427 GLY A CA  
3259 C C   . GLY A 439 ? 0.3774 0.3892 0.3751 -0.0069 0.0411  0.0443  427 GLY A C   
3260 O O   . GLY A 439 ? 0.3636 0.3724 0.3662 -0.0101 0.0367  0.0455  427 GLY A O   
3261 N N   . GLY A 440 ? 0.3694 0.3762 0.3596 -0.0043 0.0413  0.0402  428 GLY A N   
3262 C CA  . GLY A 440 ? 0.3513 0.3508 0.3398 -0.0050 0.0367  0.0374  428 GLY A CA  
3263 C C   . GLY A 440 ? 0.3444 0.3406 0.3323 -0.0033 0.0360  0.0314  428 GLY A C   
3264 O O   . GLY A 440 ? 0.3540 0.3462 0.3399 -0.0027 0.0340  0.0279  428 GLY A O   
3265 N N   . SER A 441 ? 0.3447 0.3428 0.3345 -0.0025 0.0377  0.0305  429 SER A N   
3266 C CA  . SER A 441 ? 0.3665 0.3613 0.3551 -0.0013 0.0377  0.0260  429 SER A CA  
3267 C C   . SER A 441 ? 0.3584 0.3507 0.3428 0.0001  0.0400  0.0224  429 SER A C   
3268 O O   . SER A 441 ? 0.3564 0.3457 0.3407 -0.0001 0.0393  0.0186  429 SER A O   
3269 C CB  . SER A 441 ? 0.3700 0.3671 0.3596 0.0000  0.0393  0.0270  429 SER A CB  
3270 O OG  . SER A 441 ? 0.4738 0.4734 0.4688 -0.0019 0.0359  0.0296  429 SER A OG  
3271 N N   . GLY A 442 ? 0.3322 0.3265 0.3139 0.0017  0.0428  0.0231  430 GLY A N   
3272 C CA  . GLY A 442 ? 0.3314 0.3230 0.3092 0.0030  0.0444  0.0193  430 GLY A CA  
3273 C C   . GLY A 442 ? 0.3431 0.3335 0.3200 0.0022  0.0414  0.0172  430 GLY A C   
3274 O O   . GLY A 442 ? 0.3634 0.3515 0.3405 0.0021  0.0410  0.0128  430 GLY A O   
3275 N N   . ASP A 443 ? 0.3368 0.3286 0.3133 0.0017  0.0391  0.0205  431 ASP A N   
3276 C CA  . ASP A 443 ? 0.3392 0.3292 0.3141 0.0018  0.0355  0.0189  431 ASP A CA  
3277 C C   . ASP A 443 ? 0.3282 0.3164 0.3087 0.0010  0.0327  0.0150  431 ASP A C   
3278 O O   . ASP A 443 ? 0.3293 0.3171 0.3108 0.0016  0.0308  0.0110  431 ASP A O   
3279 C CB  . ASP A 443 ? 0.3499 0.3402 0.3229 0.0012  0.0334  0.0243  431 ASP A CB  
3280 C CG  . ASP A 443 ? 0.3993 0.3930 0.3668 0.0020  0.0370  0.0286  431 ASP A CG  
3281 O OD1 . ASP A 443 ? 0.4369 0.4319 0.4003 0.0043  0.0400  0.0259  431 ASP A OD1 
3282 O OD2 . ASP A 443 ? 0.4329 0.4279 0.4008 0.0002  0.0371  0.0347  431 ASP A OD2 
3283 N N   . VAL A 444 ? 0.3170 0.3048 0.3012 0.0000  0.0327  0.0160  432 VAL A N   
3284 C CA  . VAL A 444 ? 0.3016 0.2884 0.2900 -0.0001 0.0314  0.0120  432 VAL A CA  
3285 C C   . VAL A 444 ? 0.3078 0.2954 0.2973 -0.0003 0.0347  0.0078  432 VAL A C   
3286 O O   . VAL A 444 ? 0.3244 0.3132 0.3179 -0.0002 0.0338  0.0037  432 VAL A O   
3287 C CB  . VAL A 444 ? 0.3005 0.2861 0.2905 -0.0008 0.0307  0.0134  432 VAL A CB  
3288 C CG1 . VAL A 444 ? 0.2744 0.2594 0.2670 -0.0002 0.0306  0.0087  432 VAL A CG1 
3289 C CG2 . VAL A 444 ? 0.2718 0.2557 0.2627 -0.0017 0.0266  0.0175  432 VAL A CG2 
3290 N N   . LEU A 445 ? 0.3063 0.2932 0.2931 -0.0006 0.0386  0.0089  433 LEU A N   
3291 C CA  . LEU A 445 ? 0.3032 0.2891 0.2910 -0.0015 0.0420  0.0058  433 LEU A CA  
3292 C C   . LEU A 445 ? 0.3113 0.2979 0.3009 -0.0018 0.0409  0.0020  433 LEU A C   
3293 O O   . LEU A 445 ? 0.3150 0.3026 0.3096 -0.0033 0.0418  -0.0016 433 LEU A O   
3294 C CB  . LEU A 445 ? 0.3066 0.2898 0.2902 -0.0010 0.0454  0.0081  433 LEU A CB  
3295 C CG  . LEU A 445 ? 0.3229 0.3026 0.3066 -0.0023 0.0490  0.0061  433 LEU A CG  
3296 C CD1 . LEU A 445 ? 0.2751 0.2545 0.2599 -0.0037 0.0511  0.0058  433 LEU A CD1 
3297 C CD2 . LEU A 445 ? 0.3332 0.3091 0.3123 -0.0006 0.0509  0.0083  433 LEU A CD2 
3298 N N   . THR A 446 ? 0.3187 0.3053 0.3046 -0.0004 0.0388  0.0028  434 THR A N   
3299 C CA  . THR A 446 ? 0.3269 0.3138 0.3133 -0.0001 0.0362  -0.0012 434 THR A CA  
3300 C C   . THR A 446 ? 0.3269 0.3171 0.3203 -0.0005 0.0324  -0.0047 434 THR A C   
3301 O O   . THR A 446 ? 0.3280 0.3199 0.3270 -0.0018 0.0317  -0.0094 434 THR A O   
3302 C CB  . THR A 446 ? 0.3378 0.3244 0.3166 0.0021  0.0342  0.0006  434 THR A CB  
3303 O OG1 . THR A 446 ? 0.3661 0.3510 0.3399 0.0032  0.0381  0.0024  434 THR A OG1 
3304 C CG2 . THR A 446 ? 0.3429 0.3296 0.3205 0.0031  0.0299  -0.0039 434 THR A CG2 
3305 N N   . GLY A 447 ? 0.3096 0.3006 0.3035 0.0006  0.0297  -0.0024 435 GLY A N   
3306 C CA  . GLY A 447 ? 0.3043 0.2982 0.3051 0.0014  0.0261  -0.0055 435 GLY A CA  
3307 C C   . GLY A 447 ? 0.3024 0.2996 0.3113 -0.0002 0.0297  -0.0090 435 GLY A C   
3308 O O   . GLY A 447 ? 0.3035 0.3054 0.3207 -0.0002 0.0283  -0.0137 435 GLY A O   
3309 N N   . MET A 448 ? 0.2883 0.2838 0.2950 -0.0013 0.0344  -0.0068 436 MET A N   
3310 C CA  . MET A 448 ? 0.2856 0.2839 0.2976 -0.0029 0.0390  -0.0094 436 MET A CA  
3311 C C   . MET A 448 ? 0.2868 0.2871 0.3039 -0.0059 0.0419  -0.0123 436 MET A C   
3312 O O   . MET A 448 ? 0.2871 0.2930 0.3132 -0.0073 0.0436  -0.0160 436 MET A O   
3313 C CB  . MET A 448 ? 0.2701 0.2647 0.2757 -0.0034 0.0432  -0.0058 436 MET A CB  
3314 C CG  . MET A 448 ? 0.3069 0.2994 0.3088 -0.0012 0.0400  -0.0035 436 MET A CG  
3315 S SD  . MET A 448 ? 0.3451 0.3337 0.3394 -0.0014 0.0428  0.0003  436 MET A SD  
3316 C CE  . MET A 448 ? 0.2847 0.2753 0.2797 -0.0016 0.0480  -0.0028 436 MET A CE  
3317 N N   . ILE A 449 ? 0.3004 0.2960 0.3124 -0.0070 0.0426  -0.0107 437 ILE A N   
3318 C CA  . ILE A 449 ? 0.3062 0.3017 0.3232 -0.0103 0.0447  -0.0137 437 ILE A CA  
3319 C C   . ILE A 449 ? 0.3133 0.3149 0.3398 -0.0107 0.0399  -0.0192 437 ILE A C   
3320 O O   . ILE A 449 ? 0.3201 0.3266 0.3572 -0.0139 0.0419  -0.0226 437 ILE A O   
3321 C CB  . ILE A 449 ? 0.3172 0.3054 0.3266 -0.0104 0.0453  -0.0120 437 ILE A CB  
3322 C CG1 . ILE A 449 ? 0.3079 0.2912 0.3103 -0.0100 0.0498  -0.0070 437 ILE A CG1 
3323 C CG2 . ILE A 449 ? 0.2757 0.2620 0.2908 -0.0143 0.0462  -0.0158 437 ILE A CG2 
3324 C CD1 . ILE A 449 ? 0.3364 0.3128 0.3311 -0.0086 0.0504  -0.0051 437 ILE A CD1 
3325 N N   . ALA A 450 ? 0.3129 0.3144 0.3356 -0.0074 0.0335  -0.0196 438 ALA A N   
3326 C CA  . ALA A 450 ? 0.3176 0.3243 0.3474 -0.0065 0.0273  -0.0246 438 ALA A CA  
3327 C C   . ALA A 450 ? 0.3187 0.3336 0.3607 -0.0064 0.0276  -0.0274 438 ALA A C   
3328 O O   . ALA A 450 ? 0.3319 0.3538 0.3860 -0.0081 0.0259  -0.0325 438 ALA A O   
3329 C CB  . ALA A 450 ? 0.3041 0.3085 0.3251 -0.0021 0.0208  -0.0229 438 ALA A CB  
3330 N N   . GLY A 451 ? 0.3134 0.3282 0.3530 -0.0043 0.0295  -0.0246 439 GLY A N   
3331 C CA  . GLY A 451 ? 0.3055 0.3279 0.3554 -0.0029 0.0299  -0.0277 439 GLY A CA  
3332 C C   . GLY A 451 ? 0.3112 0.3403 0.3715 -0.0069 0.0369  -0.0304 439 GLY A C   
3333 O O   . GLY A 451 ? 0.3159 0.3549 0.3901 -0.0069 0.0364  -0.0353 439 GLY A O   
3334 N N   . PHE A 452 ? 0.3154 0.3395 0.3699 -0.0104 0.0436  -0.0270 440 PHE A N   
3335 C CA  . PHE A 452 ? 0.3052 0.3344 0.3680 -0.0149 0.0511  -0.0281 440 PHE A CA  
3336 C C   . PHE A 452 ? 0.3147 0.3479 0.3890 -0.0193 0.0498  -0.0318 440 PHE A C   
3337 O O   . PHE A 452 ? 0.3144 0.3569 0.4027 -0.0227 0.0538  -0.0348 440 PHE A O   
3338 C CB  . PHE A 452 ? 0.3204 0.3414 0.3721 -0.0170 0.0579  -0.0227 440 PHE A CB  
3339 C CG  . PHE A 452 ? 0.3063 0.3267 0.3507 -0.0137 0.0608  -0.0205 440 PHE A CG  
3340 C CD1 . PHE A 452 ? 0.3100 0.3388 0.3612 -0.0131 0.0651  -0.0232 440 PHE A CD1 
3341 C CD2 . PHE A 452 ? 0.2880 0.3003 0.3196 -0.0111 0.0588  -0.0165 440 PHE A CD2 
3342 C CE1 . PHE A 452 ? 0.3140 0.3415 0.3571 -0.0096 0.0674  -0.0221 440 PHE A CE1 
3343 C CE2 . PHE A 452 ? 0.3027 0.3142 0.3282 -0.0083 0.0603  -0.0154 440 PHE A CE2 
3344 C CZ  . PHE A 452 ? 0.3094 0.3277 0.3397 -0.0073 0.0643  -0.0185 440 PHE A CZ  
3345 N N   . ILE A 453 ? 0.3189 0.3458 0.3881 -0.0194 0.0443  -0.0321 441 ILE A N   
3346 C CA  . ILE A 453 ? 0.3264 0.3566 0.4064 -0.0231 0.0411  -0.0369 441 ILE A CA  
3347 C C   . ILE A 453 ? 0.3188 0.3613 0.4134 -0.0211 0.0355  -0.0427 441 ILE A C   
3348 O O   . ILE A 453 ? 0.3139 0.3656 0.4248 -0.0252 0.0366  -0.0468 441 ILE A O   
3349 C CB  . ILE A 453 ? 0.3241 0.3447 0.3941 -0.0224 0.0355  -0.0372 441 ILE A CB  
3350 C CG1 . ILE A 453 ? 0.3361 0.3452 0.3948 -0.0245 0.0413  -0.0323 441 ILE A CG1 
3351 C CG2 . ILE A 453 ? 0.3272 0.3520 0.4095 -0.0258 0.0302  -0.0438 441 ILE A CG2 
3352 C CD1 . ILE A 453 ? 0.3023 0.3016 0.3490 -0.0223 0.0368  -0.0325 441 ILE A CD1 
3353 N N   . ALA A 454 ? 0.3176 0.3605 0.4070 -0.0148 0.0295  -0.0427 442 ALA A N   
3354 C CA  . ALA A 454 ? 0.3171 0.3704 0.4187 -0.0113 0.0232  -0.0477 442 ALA A CA  
3355 C C   . ALA A 454 ? 0.3214 0.3874 0.4391 -0.0125 0.0294  -0.0504 442 ALA A C   
3356 O O   . ALA A 454 ? 0.2957 0.3738 0.4303 -0.0119 0.0257  -0.0561 442 ALA A O   
3357 C CB  . ALA A 454 ? 0.3054 0.3540 0.3961 -0.0040 0.0164  -0.0455 442 ALA A CB  
3358 N N   . GLN A 455 ? 0.3178 0.3815 0.4299 -0.0135 0.0385  -0.0465 443 GLN A N   
3359 C CA  . GLN A 455 ? 0.3280 0.4032 0.4522 -0.0141 0.0459  -0.0486 443 GLN A CA  
3360 C C   . GLN A 455 ? 0.3282 0.4096 0.4643 -0.0222 0.0538  -0.0491 443 GLN A C   
3361 O O   . GLN A 455 ? 0.3545 0.4467 0.5014 -0.0237 0.0613  -0.0504 443 GLN A O   
3362 C CB  . GLN A 455 ? 0.3302 0.3999 0.4413 -0.0110 0.0517  -0.0446 443 GLN A CB  
3363 C CG  . GLN A 455 ? 0.3504 0.4145 0.4524 -0.0036 0.0442  -0.0443 443 GLN A CG  
3364 C CD  . GLN A 455 ? 0.3947 0.4513 0.4828 -0.0015 0.0488  -0.0404 443 GLN A CD  
3365 O OE1 . GLN A 455 ? 0.4460 0.5079 0.5364 -0.0012 0.0558  -0.0416 443 GLN A OE1 
3366 N NE2 . GLN A 455 ? 0.3422 0.3869 0.4159 -0.0003 0.0449  -0.0359 443 GLN A NE2 
3367 N N   . GLY A 456 ? 0.3405 0.4151 0.4752 -0.0276 0.0522  -0.0481 444 GLY A N   
3368 C CA  . GLY A 456 ? 0.3407 0.4208 0.4896 -0.0361 0.0581  -0.0491 444 GLY A CA  
3369 C C   . GLY A 456 ? 0.3516 0.4189 0.4886 -0.0415 0.0658  -0.0426 444 GLY A C   
3370 O O   . GLY A 456 ? 0.3488 0.4173 0.4954 -0.0490 0.0702  -0.0425 444 GLY A O   
3371 N N   . LEU A 457 ? 0.3587 0.4134 0.4753 -0.0379 0.0668  -0.0373 445 LEU A N   
3372 C CA  . LEU A 457 ? 0.3698 0.4117 0.4753 -0.0423 0.0728  -0.0314 445 LEU A CA  
3373 C C   . LEU A 457 ? 0.3714 0.4034 0.4752 -0.0450 0.0666  -0.0327 445 LEU A C   
3374 O O   . LEU A 457 ? 0.3437 0.3743 0.4447 -0.0411 0.0577  -0.0360 445 LEU A O   
3375 C CB  . LEU A 457 ? 0.3761 0.4082 0.4616 -0.0375 0.0751  -0.0256 445 LEU A CB  
3376 C CG  . LEU A 457 ? 0.4130 0.4507 0.4942 -0.0333 0.0800  -0.0243 445 LEU A CG  
3377 C CD1 . LEU A 457 ? 0.3723 0.3987 0.4345 -0.0315 0.0842  -0.0177 445 LEU A CD1 
3378 C CD2 . LEU A 457 ? 0.4014 0.4532 0.4978 -0.0362 0.0869  -0.0269 445 LEU A CD2 
3379 N N   . SER A 458 ? 0.3844 0.4090 0.4892 -0.0518 0.0716  -0.0300 446 SER A N   
3380 C CA  . SER A 458 ? 0.3933 0.4049 0.4927 -0.0535 0.0667  -0.0307 446 SER A CA  
3381 C C   . SER A 458 ? 0.3951 0.3958 0.4743 -0.0463 0.0629  -0.0279 446 SER A C   
3382 O O   . SER A 458 ? 0.4047 0.4044 0.4732 -0.0420 0.0661  -0.0233 446 SER A O   
3383 C CB  . SER A 458 ? 0.4110 0.4134 0.5126 -0.0616 0.0737  -0.0267 446 SER A CB  
3384 O OG  . SER A 458 ? 0.4010 0.3919 0.4855 -0.0596 0.0797  -0.0190 446 SER A OG  
3385 N N   . PRO A 459 ? 0.3935 0.3864 0.4678 -0.0448 0.0560  -0.0309 447 PRO A N   
3386 C CA  . PRO A 459 ? 0.3844 0.3674 0.4404 -0.0384 0.0539  -0.0277 447 PRO A CA  
3387 C C   . PRO A 459 ? 0.3834 0.3572 0.4279 -0.0379 0.0608  -0.0203 447 PRO A C   
3388 O O   . PRO A 459 ? 0.3798 0.3527 0.4131 -0.0324 0.0610  -0.0167 447 PRO A O   
3389 C CB  . PRO A 459 ? 0.3859 0.3606 0.4398 -0.0386 0.0478  -0.0324 447 PRO A CB  
3390 C CG  . PRO A 459 ? 0.4031 0.3874 0.4736 -0.0425 0.0428  -0.0395 447 PRO A CG  
3391 C CD  . PRO A 459 ? 0.3894 0.3822 0.4741 -0.0485 0.0498  -0.0376 447 PRO A CD  
3392 N N   . LEU A 460 ? 0.3829 0.3499 0.4303 -0.0436 0.0662  -0.0178 448 LEU A N   
3393 C CA  . LEU A 460 ? 0.3818 0.3394 0.4179 -0.0430 0.0721  -0.0106 448 LEU A CA  
3394 C C   . LEU A 460 ? 0.3669 0.3326 0.4010 -0.0416 0.0773  -0.0068 448 LEU A C   
3395 O O   . LEU A 460 ? 0.3541 0.3158 0.3759 -0.0370 0.0783  -0.0024 448 LEU A O   
3396 C CB  . LEU A 460 ? 0.3995 0.3460 0.4386 -0.0498 0.0764  -0.0081 448 LEU A CB  
3397 C CG  . LEU A 460 ? 0.4189 0.3533 0.4449 -0.0489 0.0820  0.0000  448 LEU A CG  
3398 C CD1 . LEU A 460 ? 0.4245 0.3489 0.4370 -0.0414 0.0771  0.0006  448 LEU A CD1 
3399 C CD2 . LEU A 460 ? 0.4149 0.3382 0.4451 -0.0572 0.0877  0.0039  448 LEU A CD2 
3400 N N   . GLU A 461 ? 0.3682 0.3452 0.4147 -0.0456 0.0808  -0.0087 449 GLU A N   
3401 C CA  . GLU A 461 ? 0.3729 0.3586 0.4178 -0.0437 0.0860  -0.0065 449 GLU A CA  
3402 C C   . GLU A 461 ? 0.3577 0.3480 0.3967 -0.0363 0.0804  -0.0082 449 GLU A C   
3403 O O   . GLU A 461 ? 0.3755 0.3644 0.4042 -0.0326 0.0823  -0.0048 449 GLU A O   
3404 C CB  . GLU A 461 ? 0.3729 0.3722 0.4346 -0.0485 0.0903  -0.0097 449 GLU A CB  
3405 C CG  . GLU A 461 ? 0.4052 0.4018 0.4737 -0.0570 0.0982  -0.0064 449 GLU A CG  
3406 C CD  . GLU A 461 ? 0.4522 0.4648 0.5428 -0.0625 0.1008  -0.0113 449 GLU A CD  
3407 O OE1 . GLU A 461 ? 0.4586 0.4830 0.5601 -0.0597 0.0947  -0.0181 449 GLU A OE1 
3408 O OE2 . GLU A 461 ? 0.5193 0.5330 0.6172 -0.0699 0.1089  -0.0082 449 GLU A OE2 
3409 N N   . ALA A 462 ? 0.3473 0.3422 0.3922 -0.0343 0.0731  -0.0134 450 ALA A N   
3410 C CA  . ALA A 462 ? 0.3288 0.3268 0.3684 -0.0280 0.0675  -0.0144 450 ALA A CA  
3411 C C   . ALA A 462 ? 0.3406 0.3290 0.3651 -0.0241 0.0664  -0.0098 450 ALA A C   
3412 O O   . ALA A 462 ? 0.3307 0.3204 0.3489 -0.0200 0.0654  -0.0080 450 ALA A O   
3413 C CB  . ALA A 462 ? 0.3101 0.3122 0.3565 -0.0268 0.0599  -0.0198 450 ALA A CB  
3414 N N   . SER A 463 ? 0.3505 0.3294 0.3702 -0.0253 0.0662  -0.0083 451 SER A N   
3415 C CA  . SER A 463 ? 0.3529 0.3239 0.3603 -0.0214 0.0652  -0.0043 451 SER A CA  
3416 C C   . SER A 463 ? 0.3610 0.3285 0.3609 -0.0209 0.0702  0.0009  451 SER A C   
3417 O O   . SER A 463 ? 0.3696 0.3364 0.3618 -0.0167 0.0686  0.0035  451 SER A O   
3418 C CB  . SER A 463 ? 0.3703 0.3320 0.3749 -0.0217 0.0636  -0.0051 451 SER A CB  
3419 O OG  . SER A 463 ? 0.3581 0.3225 0.3677 -0.0217 0.0584  -0.0106 451 SER A OG  
3420 N N   . THR A 464 ? 0.3685 0.3344 0.3707 -0.0252 0.0762  0.0026  452 THR A N   
3421 C CA  . THR A 464 ? 0.3696 0.3311 0.3624 -0.0248 0.0812  0.0080  452 THR A CA  
3422 C C   . THR A 464 ? 0.3702 0.3394 0.3602 -0.0214 0.0811  0.0076  452 THR A C   
3423 O O   . THR A 464 ? 0.3579 0.3239 0.3376 -0.0174 0.0798  0.0106  452 THR A O   
3424 C CB  . THR A 464 ? 0.3842 0.3436 0.3811 -0.0309 0.0882  0.0099  452 THR A CB  
3425 O OG1 . THR A 464 ? 0.3894 0.3394 0.3888 -0.0342 0.0873  0.0100  452 THR A OG1 
3426 C CG2 . THR A 464 ? 0.4066 0.3614 0.3919 -0.0305 0.0942  0.0160  452 THR A CG2 
3427 N N   . VAL A 465 ? 0.3541 0.3336 0.3542 -0.0224 0.0812  0.0030  453 VAL A N   
3428 C CA  . VAL A 465 ? 0.3554 0.3419 0.3544 -0.0191 0.0810  0.0013  453 VAL A CA  
3429 C C   . VAL A 465 ? 0.3412 0.3270 0.3361 -0.0143 0.0736  0.0007  453 VAL A C   
3430 O O   . VAL A 465 ? 0.3298 0.3150 0.3173 -0.0110 0.0726  0.0018  453 VAL A O   
3431 C CB  . VAL A 465 ? 0.3584 0.3566 0.3715 -0.0209 0.0824  -0.0041 453 VAL A CB  
3432 C CG1 . VAL A 465 ? 0.3903 0.3948 0.4036 -0.0159 0.0793  -0.0074 453 VAL A CG1 
3433 C CG2 . VAL A 465 ? 0.3320 0.3329 0.3486 -0.0257 0.0917  -0.0026 453 VAL A CG2 
3434 N N   . SER A 466 ? 0.3289 0.3142 0.3276 -0.0141 0.0686  -0.0006 454 SER A N   
3435 C CA  . SER A 466 ? 0.3287 0.3144 0.3250 -0.0104 0.0624  -0.0006 454 SER A CA  
3436 C C   . SER A 466 ? 0.3383 0.3177 0.3247 -0.0082 0.0615  0.0038  454 SER A C   
3437 O O   . SER A 466 ? 0.3412 0.3214 0.3244 -0.0056 0.0583  0.0047  454 SER A O   
3438 C CB  . SER A 466 ? 0.3296 0.3166 0.3308 -0.0104 0.0577  -0.0030 454 SER A CB  
3439 O OG  . SER A 466 ? 0.3238 0.3174 0.3349 -0.0115 0.0566  -0.0075 454 SER A OG  
3440 N N   . VAL A 467 ? 0.3453 0.3183 0.3277 -0.0091 0.0637  0.0065  455 VAL A N   
3441 C CA  . VAL A 467 ? 0.3314 0.2996 0.3057 -0.0062 0.0625  0.0106  455 VAL A CA  
3442 C C   . VAL A 467 ? 0.3347 0.3021 0.3024 -0.0048 0.0635  0.0126  455 VAL A C   
3443 O O   . VAL A 467 ? 0.3347 0.3025 0.2988 -0.0020 0.0597  0.0142  455 VAL A O   
3444 C CB  . VAL A 467 ? 0.3342 0.2947 0.3053 -0.0063 0.0641  0.0128  455 VAL A CB  
3445 C CG1 . VAL A 467 ? 0.3208 0.2818 0.2965 -0.0064 0.0619  0.0100  455 VAL A CG1 
3446 C CG2 . VAL A 467 ? 0.3161 0.2704 0.2850 -0.0094 0.0695  0.0146  455 VAL A CG2 
3447 N N   . TYR A 468 ? 0.3461 0.3131 0.3123 -0.0068 0.0684  0.0125  456 TYR A N   
3448 C CA  . TYR A 468 ? 0.3576 0.3239 0.3154 -0.0050 0.0697  0.0138  456 TYR A CA  
3449 C C   . TYR A 468 ? 0.3503 0.3222 0.3096 -0.0026 0.0655  0.0103  456 TYR A C   
3450 O O   . TYR A 468 ? 0.3415 0.3117 0.2943 0.0001  0.0619  0.0113  456 TYR A O   
3451 C CB  . TYR A 468 ? 0.3692 0.3354 0.3255 -0.0079 0.0772  0.0142  456 TYR A CB  
3452 C CG  . TYR A 468 ? 0.3795 0.3436 0.3236 -0.0055 0.0793  0.0160  456 TYR A CG  
3453 C CD1 . TYR A 468 ? 0.3920 0.3621 0.3355 -0.0034 0.0791  0.0119  456 TYR A CD1 
3454 C CD2 . TYR A 468 ? 0.4397 0.3952 0.3721 -0.0049 0.0814  0.0216  456 TYR A CD2 
3455 C CE1 . TYR A 468 ? 0.4413 0.4092 0.3719 -0.0006 0.0804  0.0128  456 TYR A CE1 
3456 C CE2 . TYR A 468 ? 0.4617 0.4147 0.3809 -0.0022 0.0826  0.0233  456 TYR A CE2 
3457 C CZ  . TYR A 468 ? 0.4926 0.4522 0.4107 -0.0001 0.0824  0.0186  456 TYR A CZ  
3458 O OH  . TYR A 468 ? 0.5430 0.5001 0.4467 0.0028  0.0838  0.0196  456 TYR A OH  
3459 N N   . LEU A 469 ? 0.3611 0.3392 0.3291 -0.0035 0.0654  0.0060  457 LEU A N   
3460 C CA  . LEU A 469 ? 0.3424 0.3243 0.3124 -0.0010 0.0612  0.0023  457 LEU A CA  
3461 C C   . LEU A 469 ? 0.3414 0.3220 0.3123 0.0003  0.0542  0.0035  457 LEU A C   
3462 O O   . LEU A 469 ? 0.3435 0.3234 0.3120 0.0023  0.0501  0.0025  457 LEU A O   
3463 C CB  . LEU A 469 ? 0.3594 0.3478 0.3398 -0.0018 0.0619  -0.0022 457 LEU A CB  
3464 C CG  . LEU A 469 ? 0.4043 0.3973 0.3865 -0.0028 0.0689  -0.0045 457 LEU A CG  
3465 C CD1 . LEU A 469 ? 0.4321 0.4329 0.4282 -0.0041 0.0689  -0.0089 457 LEU A CD1 
3466 C CD2 . LEU A 469 ? 0.4179 0.4113 0.3921 0.0009  0.0696  -0.0069 457 LEU A CD2 
3467 N N   . HIS A 470 ? 0.3296 0.3096 0.3040 -0.0009 0.0531  0.0056  458 HIS A N   
3468 C CA  . HIS A 470 ? 0.3328 0.3128 0.3085 0.0000  0.0477  0.0077  458 HIS A CA  
3469 C C   . HIS A 470 ? 0.3370 0.3145 0.3067 0.0015  0.0458  0.0106  458 HIS A C   
3470 O O   . HIS A 470 ? 0.3444 0.3226 0.3151 0.0022  0.0410  0.0108  458 HIS A O   
3471 C CB  . HIS A 470 ? 0.3319 0.3120 0.3104 -0.0011 0.0487  0.0091  458 HIS A CB  
3472 C CG  . HIS A 470 ? 0.3291 0.3104 0.3086 -0.0003 0.0454  0.0117  458 HIS A CG  
3473 N ND1 . HIS A 470 ? 0.3602 0.3403 0.3371 0.0007  0.0462  0.0148  458 HIS A ND1 
3474 C CD2 . HIS A 470 ? 0.3178 0.3015 0.3009 -0.0005 0.0420  0.0120  458 HIS A CD2 
3475 C CE1 . HIS A 470 ? 0.3437 0.3269 0.3232 0.0011  0.0442  0.0166  458 HIS A CE1 
3476 N NE2 . HIS A 470 ? 0.3429 0.3279 0.3255 0.0000  0.0417  0.0155  458 HIS A NE2 
3477 N N   . GLY A 471 ? 0.3389 0.3129 0.3026 0.0019  0.0491  0.0130  459 GLY A N   
3478 C CA  . GLY A 471 ? 0.3407 0.3122 0.2980 0.0041  0.0467  0.0156  459 GLY A CA  
3479 C C   . GLY A 471 ? 0.3612 0.3320 0.3129 0.0056  0.0446  0.0134  459 GLY A C   
3480 O O   . GLY A 471 ? 0.3722 0.3433 0.3230 0.0070  0.0391  0.0135  459 GLY A O   
3481 N N   . PHE A 472 ? 0.3618 0.3321 0.3101 0.0052  0.0488  0.0109  460 PHE A N   
3482 C CA  . PHE A 472 ? 0.3751 0.3446 0.3164 0.0074  0.0477  0.0080  460 PHE A CA  
3483 C C   . PHE A 472 ? 0.3679 0.3395 0.3149 0.0081  0.0412  0.0039  460 PHE A C   
3484 O O   . PHE A 472 ? 0.3696 0.3391 0.3115 0.0102  0.0363  0.0020  460 PHE A O   
3485 C CB  . PHE A 472 ? 0.3905 0.3609 0.3287 0.0068  0.0551  0.0061  460 PHE A CB  
3486 C CG  . PHE A 472 ? 0.4369 0.4068 0.3655 0.0098  0.0558  0.0027  460 PHE A CG  
3487 C CD1 . PHE A 472 ? 0.5400 0.5056 0.4573 0.0127  0.0517  0.0033  460 PHE A CD1 
3488 C CD2 . PHE A 472 ? 0.5089 0.4832 0.4398 0.0100  0.0607  -0.0015 460 PHE A CD2 
3489 C CE1 . PHE A 472 ? 0.5672 0.5318 0.4734 0.0161  0.0523  -0.0005 460 PHE A CE1 
3490 C CE2 . PHE A 472 ? 0.5272 0.5014 0.4482 0.0136  0.0622  -0.0054 460 PHE A CE2 
3491 C CZ  . PHE A 472 ? 0.5398 0.5087 0.4475 0.0166  0.0580  -0.0049 460 PHE A CZ  
3492 N N   . ALA A 473 ? 0.3485 0.3232 0.3055 0.0065  0.0408  0.0023  461 ALA A N   
3493 C CA  . ALA A 473 ? 0.3431 0.3178 0.3058 0.0068  0.0342  -0.0001 461 ALA A CA  
3494 C C   . ALA A 473 ? 0.3392 0.3126 0.3029 0.0062  0.0279  0.0028  461 ALA A C   
3495 O O   . ALA A 473 ? 0.3675 0.3386 0.3312 0.0069  0.0219  0.0004  461 ALA A O   
3496 C CB  . ALA A 473 ? 0.3268 0.3042 0.2991 0.0052  0.0343  -0.0005 461 ALA A CB  
3497 N N   . ALA A 474 ? 0.3282 0.3033 0.2936 0.0050  0.0290  0.0075  462 ALA A N   
3498 C CA  . ALA A 474 ? 0.3302 0.3065 0.2984 0.0044  0.0241  0.0106  462 ALA A CA  
3499 C C   . ALA A 474 ? 0.3440 0.3178 0.3049 0.0067  0.0201  0.0091  462 ALA A C   
3500 O O   . ALA A 474 ? 0.3378 0.3118 0.3023 0.0061  0.0135  0.0082  462 ALA A O   
3501 C CB  . ALA A 474 ? 0.3195 0.2989 0.2904 0.0040  0.0273  0.0152  462 ALA A CB  
3502 N N   . GLU A 475 ? 0.3395 0.3104 0.2896 0.0091  0.0238  0.0083  463 GLU A N   
3503 C CA  . GLU A 475 ? 0.3687 0.3366 0.3093 0.0119  0.0198  0.0069  463 GLU A CA  
3504 C C   . GLU A 475 ? 0.3758 0.3412 0.3134 0.0131  0.0155  0.0010  463 GLU A C   
3505 O O   . GLU A 475 ? 0.3670 0.3297 0.2970 0.0154  0.0105  -0.0010 463 GLU A O   
3506 C CB  . GLU A 475 ? 0.3848 0.3492 0.3124 0.0142  0.0259  0.0087  463 GLU A CB  
3507 C CG  . GLU A 475 ? 0.4350 0.3996 0.3644 0.0139  0.0288  0.0144  463 GLU A CG  
3508 C CD  . GLU A 475 ? 0.5153 0.4745 0.4325 0.0152  0.0355  0.0171  463 GLU A CD  
3509 O OE1 . GLU A 475 ? 0.6283 0.5844 0.5339 0.0170  0.0370  0.0155  463 GLU A OE1 
3510 O OE2 . GLU A 475 ? 0.5235 0.4813 0.4428 0.0143  0.0398  0.0208  463 GLU A OE2 
3511 N N   . LEU A 476 ? 0.3643 0.3299 0.3069 0.0122  0.0173  -0.0022 464 LEU A N   
3512 C CA  . LEU A 476 ? 0.3931 0.3554 0.3327 0.0142  0.0134  -0.0086 464 LEU A CA  
3513 C C   . LEU A 476 ? 0.3832 0.3440 0.3325 0.0120  0.0046  -0.0095 464 LEU A C   
3514 O O   . LEU A 476 ? 0.3987 0.3552 0.3464 0.0136  -0.0005 -0.0150 464 LEU A O   
3515 C CB  . LEU A 476 ? 0.3804 0.3439 0.3211 0.0152  0.0193  -0.0122 464 LEU A CB  
3516 C CG  . LEU A 476 ? 0.4251 0.3903 0.3565 0.0169  0.0285  -0.0120 464 LEU A CG  
3517 C CD1 . LEU A 476 ? 0.3796 0.3489 0.3184 0.0167  0.0339  -0.0149 464 LEU A CD1 
3518 C CD2 . LEU A 476 ? 0.3900 0.3517 0.3059 0.0211  0.0278  -0.0155 464 LEU A CD2 
3519 N N   . PHE A 477 ? 0.3807 0.3448 0.3399 0.0084  0.0031  -0.0043 465 PHE A N   
3520 C CA  . PHE A 477 ? 0.3779 0.3409 0.3470 0.0053  -0.0045 -0.0040 465 PHE A CA  
3521 C C   . PHE A 477 ? 0.4100 0.3698 0.3748 0.0066  -0.0127 -0.0077 465 PHE A C   
3522 O O   . PHE A 477 ? 0.4164 0.3782 0.3751 0.0084  -0.0133 -0.0065 465 PHE A O   
3523 C CB  . PHE A 477 ? 0.3691 0.3382 0.3482 0.0015  -0.0033 0.0029  465 PHE A CB  
3524 C CG  . PHE A 477 ? 0.3864 0.3555 0.3774 -0.0028 -0.0093 0.0048  465 PHE A CG  
3525 C CD1 . PHE A 477 ? 0.4187 0.3828 0.4138 -0.0044 -0.0110 0.0036  465 PHE A CD1 
3526 C CD2 . PHE A 477 ? 0.3874 0.3618 0.3864 -0.0055 -0.0132 0.0083  465 PHE A CD2 
3527 C CE1 . PHE A 477 ? 0.4527 0.4154 0.4586 -0.0093 -0.0163 0.0066  465 PHE A CE1 
3528 C CE2 . PHE A 477 ? 0.3746 0.3496 0.3862 -0.0108 -0.0179 0.0110  465 PHE A CE2 
3529 C CZ  . PHE A 477 ? 0.3885 0.3571 0.4029 -0.0130 -0.0193 0.0106  465 PHE A CZ  
3530 N N   . GLU A 478 ? 0.4246 0.3790 0.3931 0.0056  -0.0200 -0.0120 466 GLU A N   
3531 C CA  . GLU A 478 ? 0.4728 0.4223 0.4355 0.0076  -0.0285 -0.0177 466 GLU A CA  
3532 C C   . GLU A 478 ? 0.4619 0.4147 0.4346 0.0036  -0.0364 -0.0149 466 GLU A C   
3533 O O   . GLU A 478 ? 0.4695 0.4200 0.4379 0.0050  -0.0442 -0.0190 466 GLU A O   
3534 C CB  . GLU A 478 ? 0.4866 0.4273 0.4501 0.0084  -0.0336 -0.0245 466 GLU A CB  
3535 C CG  . GLU A 478 ? 0.5514 0.4907 0.5095 0.0122  -0.0261 -0.0275 466 GLU A CG  
3536 C CD  . GLU A 478 ? 0.6026 0.5432 0.5719 0.0093  -0.0222 -0.0231 466 GLU A CD  
3537 O OE1 . GLU A 478 ? 0.4611 0.4057 0.4402 0.0042  -0.0215 -0.0157 466 GLU A OE1 
3538 O OE2 . GLU A 478 ? 0.6283 0.5661 0.5957 0.0128  -0.0198 -0.0277 466 GLU A OE2 
3539 N N   . GLN A 479 ? 0.4304 0.3889 0.4171 -0.0015 -0.0349 -0.0082 467 GLN A N   
3540 C CA  . GLN A 479 ? 0.4289 0.3925 0.4274 -0.0056 -0.0417 -0.0056 467 GLN A CA  
3541 C C   . GLN A 479 ? 0.4113 0.3855 0.4123 -0.0050 -0.0360 0.0006  467 GLN A C   
3542 O O   . GLN A 479 ? 0.3746 0.3492 0.3653 -0.0010 -0.0286 0.0016  467 GLN A O   
3543 C CB  . GLN A 479 ? 0.4248 0.3866 0.4383 -0.0122 -0.0451 -0.0031 467 GLN A CB  
3544 C CG  . GLN A 479 ? 0.4582 0.4075 0.4692 -0.0121 -0.0520 -0.0100 467 GLN A CG  
3545 C CD  . GLN A 479 ? 0.5259 0.4700 0.5292 -0.0090 -0.0617 -0.0183 467 GLN A CD  
3546 O OE1 . GLN A 479 ? 0.5141 0.4639 0.5205 -0.0097 -0.0669 -0.0181 467 GLN A OE1 
3547 N NE2 . GLN A 479 ? 0.5833 0.5169 0.5764 -0.0048 -0.0643 -0.0262 467 GLN A NE2 
3548 N N   . ASP A 480 ? 0.3867 0.3693 0.4016 -0.0087 -0.0395 0.0046  468 ASP A N   
3549 C CA  . ASP A 480 ? 0.3741 0.3667 0.3914 -0.0068 -0.0346 0.0096  468 ASP A CA  
3550 C C   . ASP A 480 ? 0.3566 0.3519 0.3739 -0.0070 -0.0237 0.0146  468 ASP A C   
3551 O O   . ASP A 480 ? 0.3353 0.3301 0.3592 -0.0110 -0.0208 0.0171  468 ASP A O   
3552 C CB  . ASP A 480 ? 0.3758 0.3789 0.4100 -0.0104 -0.0399 0.0125  468 ASP A CB  
3553 C CG  . ASP A 480 ? 0.3907 0.4035 0.4261 -0.0065 -0.0362 0.0163  468 ASP A CG  
3554 O OD1 . ASP A 480 ? 0.3393 0.3581 0.3791 -0.0068 -0.0275 0.0214  468 ASP A OD1 
3555 O OD2 . ASP A 480 ? 0.4170 0.4305 0.4479 -0.0026 -0.0424 0.0137  468 ASP A OD2 
3556 N N   . GLU A 481 ? 0.3557 0.3527 0.3646 -0.0023 -0.0181 0.0160  469 GLU A N   
3557 C CA  . GLU A 481 ? 0.3660 0.3633 0.3720 -0.0017 -0.0083 0.0192  469 GLU A CA  
3558 C C   . GLU A 481 ? 0.3612 0.3670 0.3806 -0.0054 -0.0051 0.0243  469 GLU A C   
3559 O O   . GLU A 481 ? 0.3707 0.3759 0.3894 -0.0063 0.0010  0.0263  469 GLU A O   
3560 C CB  . GLU A 481 ? 0.3595 0.3562 0.3550 0.0035  -0.0039 0.0200  469 GLU A CB  
3561 C CG  . GLU A 481 ? 0.4084 0.4134 0.4107 0.0054  -0.0052 0.0232  469 GLU A CG  
3562 C CD  . GLU A 481 ? 0.4246 0.4258 0.4147 0.0112  -0.0025 0.0239  469 GLU A CD  
3563 O OE1 . GLU A 481 ? 0.4584 0.4522 0.4358 0.0137  -0.0050 0.0213  469 GLU A OE1 
3564 O OE2 . GLU A 481 ? 0.4037 0.4086 0.3965 0.0133  0.0022  0.0271  469 GLU A OE2 
3565 N N   . ARG A 482 ? 0.3640 0.3787 0.3960 -0.0074 -0.0089 0.0266  470 ARG A N   
3566 C CA  . ARG A 482 ? 0.3575 0.3813 0.4013 -0.0106 -0.0040 0.0319  470 ARG A CA  
3567 C C   . ARG A 482 ? 0.3680 0.3890 0.4169 -0.0164 -0.0034 0.0340  470 ARG A C   
3568 O O   . ARG A 482 ? 0.3536 0.3800 0.4074 -0.0183 0.0024  0.0386  470 ARG A O   
3569 C CB  . ARG A 482 ? 0.3710 0.4074 0.4291 -0.0113 -0.0070 0.0343  470 ARG A CB  
3570 C CG  . ARG A 482 ? 0.3534 0.3930 0.4246 -0.0170 -0.0147 0.0342  470 ARG A CG  
3571 C CD  . ARG A 482 ? 0.3918 0.4451 0.4761 -0.0158 -0.0179 0.0353  470 ARG A CD  
3572 N NE  . ARG A 482 ? 0.3795 0.4298 0.4554 -0.0098 -0.0244 0.0310  470 ARG A NE  
3573 C CZ  . ARG A 482 ? 0.3933 0.4540 0.4770 -0.0062 -0.0276 0.0313  470 ARG A CZ  
3574 N NH1 . ARG A 482 ? 0.3622 0.4384 0.4633 -0.0076 -0.0243 0.0354  470 ARG A NH1 
3575 N NH2 . ARG A 482 ? 0.3938 0.4496 0.4671 -0.0006 -0.0338 0.0278  470 ARG A NH2 
3576 N N   . GLY A 483 ? 0.3676 0.3791 0.4139 -0.0185 -0.0096 0.0304  471 GLY A N   
3577 C CA  . GLY A 483 ? 0.3533 0.3594 0.4028 -0.0231 -0.0100 0.0321  471 GLY A CA  
3578 C C   . GLY A 483 ? 0.3536 0.3511 0.3913 -0.0205 -0.0058 0.0303  471 GLY A C   
3579 O O   . GLY A 483 ? 0.3578 0.3493 0.3968 -0.0233 -0.0068 0.0314  471 GLY A O   
3580 N N   . LEU A 484 ? 0.3498 0.3463 0.3767 -0.0151 -0.0014 0.0276  472 LEU A N   
3581 C CA  . LEU A 484 ? 0.3527 0.3428 0.3705 -0.0129 0.0024  0.0256  472 LEU A CA  
3582 C C   . LEU A 484 ? 0.3593 0.3527 0.3800 -0.0147 0.0077  0.0306  472 LEU A C   
3583 O O   . LEU A 484 ? 0.3459 0.3475 0.3703 -0.0149 0.0119  0.0346  472 LEU A O   
3584 C CB  . LEU A 484 ? 0.3573 0.3470 0.3650 -0.0079 0.0069  0.0228  472 LEU A CB  
3585 C CG  . LEU A 484 ? 0.3688 0.3542 0.3694 -0.0060 0.0115  0.0205  472 LEU A CG  
3586 C CD1 . LEU A 484 ? 0.3728 0.3507 0.3704 -0.0053 0.0073  0.0153  472 LEU A CD1 
3587 C CD2 . LEU A 484 ? 0.3354 0.3214 0.3283 -0.0026 0.0168  0.0195  472 LEU A CD2 
3588 N N   . THR A 485 ? 0.3538 0.3408 0.3722 -0.0154 0.0073  0.0302  473 THR A N   
3589 C CA  . THR A 485 ? 0.3608 0.3492 0.3782 -0.0161 0.0119  0.0343  473 THR A CA  
3590 C C   . THR A 485 ? 0.3552 0.3388 0.3647 -0.0125 0.0136  0.0301  473 THR A C   
3591 O O   . THR A 485 ? 0.3478 0.3264 0.3543 -0.0104 0.0111  0.0248  473 THR A O   
3592 C CB  . THR A 485 ? 0.3688 0.3535 0.3915 -0.0206 0.0087  0.0389  473 THR A CB  
3593 O OG1 . THR A 485 ? 0.4248 0.3996 0.4461 -0.0200 0.0026  0.0344  473 THR A OG1 
3594 C CG2 . THR A 485 ? 0.3808 0.3715 0.4138 -0.0253 0.0073  0.0435  473 THR A CG2 
3595 N N   . ALA A 486 ? 0.3470 0.3325 0.3536 -0.0118 0.0178  0.0324  474 ALA A N   
3596 C CA  . ALA A 486 ? 0.3508 0.3334 0.3519 -0.0088 0.0192  0.0286  474 ALA A CA  
3597 C C   . ALA A 486 ? 0.3428 0.3184 0.3440 -0.0081 0.0144  0.0253  474 ALA A C   
3598 O O   . ALA A 486 ? 0.3488 0.3233 0.3477 -0.0052 0.0150  0.0201  474 ALA A O   
3599 C CB  . ALA A 486 ? 0.3432 0.3288 0.3411 -0.0084 0.0230  0.0317  474 ALA A CB  
3600 N N   . SER A 487 ? 0.3544 0.3252 0.3589 -0.0105 0.0098  0.0285  475 SER A N   
3601 C CA  . SER A 487 ? 0.3786 0.3412 0.3838 -0.0093 0.0043  0.0255  475 SER A CA  
3602 C C   . SER A 487 ? 0.3896 0.3498 0.3950 -0.0073 0.0018  0.0187  475 SER A C   
3603 O O   . SER A 487 ? 0.3934 0.3502 0.3974 -0.0037 0.0001  0.0131  475 SER A O   
3604 C CB  . SER A 487 ? 0.3882 0.3446 0.3971 -0.0132 -0.0003 0.0312  475 SER A CB  
3605 O OG  . SER A 487 ? 0.4287 0.3853 0.4347 -0.0138 0.0015  0.0369  475 SER A OG  
3606 N N   . GLU A 488 ? 0.3949 0.3428 0.3972 -0.0364 0.0303  -0.0116 476 GLU A N   
3607 C CA  . GLU A 488 ? 0.3943 0.3705 0.3925 -0.0482 0.0232  -0.0215 476 GLU A CA  
3608 C C   . GLU A 488 ? 0.3636 0.3537 0.3653 -0.0252 0.0088  -0.0047 476 GLU A C   
3609 O O   . GLU A 488 ? 0.3730 0.3613 0.3623 -0.0247 0.0063  -0.0080 476 GLU A O   
3610 C CB  . GLU A 488 ? 0.3990 0.4529 0.4139 -0.0748 0.0164  -0.0307 476 GLU A CB  
3611 C CG  . GLU A 488 ? 0.4979 0.5432 0.5022 -0.1186 0.0378  -0.0604 476 GLU A CG  
3612 C CD  . GLU A 488 ? 0.6179 0.5773 0.5782 -0.1391 0.0701  -0.0860 476 GLU A CD  
3613 O OE1 . GLU A 488 ? 0.7320 0.6171 0.6731 -0.1511 0.1076  -0.0978 476 GLU A OE1 
3614 O OE2 . GLU A 488 ? 0.6144 0.5696 0.5572 -0.1360 0.0668  -0.0889 476 GLU A OE2 
3615 N N   . LEU A 489 ? 0.3448 0.3381 0.3581 -0.0094 0.0091  0.0111  477 LEU A N   
3616 C CA  . LEU A 489 ? 0.3415 0.3272 0.3494 0.0041  0.0115  0.0223  477 LEU A CA  
3617 C C   . LEU A 489 ? 0.3562 0.3209 0.3480 -0.0010 0.0088  0.0148  477 LEU A C   
3618 O O   . LEU A 489 ? 0.3593 0.3293 0.3462 0.0016  0.0070  0.0165  477 LEU A O   
3619 C CB  . LEU A 489 ? 0.3716 0.3314 0.3802 0.0134  0.0336  0.0334  477 LEU A CB  
3620 C CG  . LEU A 489 ? 0.3544 0.2779 0.3469 0.0199  0.0588  0.0409  477 LEU A CG  
3621 C CD1 . LEU A 489 ? 0.3987 0.3566 0.4032 0.0496  0.0623  0.0688  477 LEU A CD1 
3622 C CD2 . LEU A 489 ? 0.4271 0.2957 0.4067 0.0195  0.0993  0.0429  477 LEU A CD2 
3623 N N   . LEU A 490 ? 0.3513 0.3061 0.3362 -0.0056 0.0103  0.0124  478 LEU A N   
3624 C CA  . LEU A 490 ? 0.3563 0.3289 0.3336 -0.0033 0.0074  0.0176  478 LEU A CA  
3625 C C   . LEU A 490 ? 0.3698 0.3411 0.3487 0.0101  0.0096  0.0214  478 LEU A C   
3626 O O   . LEU A 490 ? 0.3622 0.3586 0.3431 0.0149  0.0080  0.0278  478 LEU A O   
3627 C CB  . LEU A 490 ? 0.3679 0.3499 0.3376 0.0015  0.0107  0.0277  478 LEU A CB  
3628 C CG  . LEU A 490 ? 0.3592 0.3532 0.3142 -0.0194 0.0116  0.0216  478 LEU A CG  
3629 C CD1 . LEU A 490 ? 0.3231 0.3273 0.2672 -0.0078 0.0157  0.0376  478 LEU A CD1 
3630 C CD2 . LEU A 490 ? 0.3096 0.3553 0.2529 -0.0447 0.0074  0.0150  478 LEU A CD2 
3631 N N   . ARG A 491 ? 0.3798 0.3204 0.3537 0.0092  0.0204  0.0135  479 ARG A N   
3632 C CA  . ARG A 491 ? 0.4198 0.3349 0.3803 0.0117  0.0381  0.0079  479 ARG A CA  
3633 C C   . ARG A 491 ? 0.4028 0.3403 0.3626 0.0049  0.0255  0.0011  479 ARG A C   
3634 O O   . ARG A 491 ? 0.4287 0.3539 0.3784 0.0123  0.0385  0.0020  479 ARG A O   
3635 C CB  . ARG A 491 ? 0.4735 0.3483 0.4166 -0.0118 0.0603  -0.0143 479 ARG A CB  
3636 C CG  . ARG A 491 ? 0.5898 0.4137 0.5011 -0.0251 0.0963  -0.0325 479 ARG A CG  
3637 C CD  . ARG A 491 ? 0.6823 0.4676 0.5647 -0.0740 0.1274  -0.0700 479 ARG A CD  
3638 N NE  . ARG A 491 ? 0.7113 0.5818 0.6099 -0.1108 0.0912  -0.0876 479 ARG A NE  
3639 C CZ  . ARG A 491 ? 0.7453 0.6896 0.6400 -0.1356 0.0676  -0.1001 479 ARG A CZ  
3640 N NH1 . ARG A 491 ? 0.7262 0.6555 0.5961 -0.1354 0.0748  -0.1057 479 ARG A NH1 
3641 N NH2 . ARG A 491 ? 0.7128 0.7599 0.6301 -0.1554 0.0383  -0.0999 479 ARG A NH2 
3642 N N   . LEU A 492 ? 0.3767 0.3442 0.3458 -0.0022 0.0075  0.0008  480 LEU A N   
3643 C CA  . LEU A 492 ? 0.3596 0.3516 0.3238 -0.0024 0.0006  0.0028  480 LEU A CA  
3644 C C   . LEU A 492 ? 0.3579 0.3472 0.3253 0.0087  0.0027  0.0145  480 LEU A C   
3645 O O   . LEU A 492 ? 0.3784 0.3746 0.3368 0.0123  0.0047  0.0182  480 LEU A O   
3646 C CB  . LEU A 492 ? 0.3504 0.3881 0.3231 -0.0042 -0.0085 0.0104  480 LEU A CB  
3647 C CG  . LEU A 492 ? 0.3526 0.4312 0.3176 -0.0333 -0.0124 -0.0081 480 LEU A CG  
3648 C CD1 . LEU A 492 ? 0.3041 0.4583 0.2946 -0.0274 -0.0224 0.0109  480 LEU A CD1 
3649 C CD2 . LEU A 492 ? 0.3625 0.4655 0.2965 -0.0578 -0.0115 -0.0261 480 LEU A CD2 
3650 N N   . ILE A 493 ? 0.3369 0.3214 0.3116 0.0061  0.0057  0.0167  481 ILE A N   
3651 C CA  . ILE A 493 ? 0.3358 0.3256 0.3084 -0.0029 0.0142  0.0169  481 ILE A CA  
3652 C C   . ILE A 493 ? 0.3288 0.3371 0.3027 0.0013  0.0159  0.0192  481 ILE A C   
3653 O O   . ILE A 493 ? 0.3449 0.3444 0.3115 -0.0028 0.0260  0.0192  481 ILE A O   
3654 C CB  . ILE A 493 ? 0.3321 0.3391 0.3041 -0.0233 0.0163  0.0107  481 ILE A CB  
3655 C CG1 . ILE A 493 ? 0.3588 0.3253 0.3200 -0.0316 0.0308  0.0056  481 ILE A CG1 
3656 C CG2 . ILE A 493 ? 0.3479 0.3854 0.3139 -0.0531 0.0273  0.0009  481 ILE A CG2 
3657 C CD1 . ILE A 493 ? 0.3771 0.3573 0.3253 -0.0603 0.0349  -0.0069 481 ILE A CD1 
3658 N N   . PRO A 494 ? 0.3325 0.3581 0.3141 0.0151  0.0154  0.0257  482 PRO A N   
3659 C CA  . PRO A 494 ? 0.3543 0.3970 0.3399 0.0250  0.0255  0.0326  482 PRO A CA  
3660 C C   . PRO A 494 ? 0.3744 0.3810 0.3388 0.0261  0.0317  0.0243  482 PRO A C   
3661 O O   . PRO A 494 ? 0.3655 0.3791 0.3285 0.0285  0.0414  0.0270  482 PRO A O   
3662 C CB  . PRO A 494 ? 0.3695 0.4230 0.3644 0.0532  0.0393  0.0516  482 PRO A CB  
3663 C CG  . PRO A 494 ? 0.3529 0.4188 0.3520 0.0524  0.0300  0.0571  482 PRO A CG  
3664 C CD  . PRO A 494 ? 0.3282 0.3526 0.3136 0.0285  0.0174  0.0337  482 PRO A CD  
3665 N N   . GLU A 495 ? 0.3863 0.3697 0.3331 0.0207  0.0265  0.0145  483 GLU A N   
3666 C CA  . GLU A 495 ? 0.4080 0.3907 0.3296 0.0145  0.0264  0.0085  483 GLU A CA  
3667 C C   . GLU A 495 ? 0.3934 0.3901 0.3152 0.0209  0.0235  0.0242  483 GLU A C   
3668 O O   . GLU A 495 ? 0.4098 0.4085 0.3143 0.0252  0.0312  0.0299  483 GLU A O   
3669 C CB  . GLU A 495 ? 0.4310 0.4207 0.3334 -0.0042 0.0211  -0.0075 483 GLU A CB  
3670 C CG  . GLU A 495 ? 0.5046 0.5251 0.3729 -0.0196 0.0193  -0.0150 483 GLU A CG  
3671 C CD  . GLU A 495 ? 0.5717 0.6443 0.4200 -0.0528 0.0092  -0.0325 483 GLU A CD  
3672 O OE1 . GLU A 495 ? 0.6297 0.6950 0.4878 -0.0682 0.0104  -0.0456 483 GLU A OE1 
3673 O OE2 . GLU A 495 ? 0.6400 0.7753 0.4607 -0.0674 0.0005  -0.0324 483 GLU A OE2 
3674 N N   . ALA A 496 ? 0.3671 0.3603 0.3024 0.0238  0.0234  0.0331  484 ALA A N   
3675 C CA  . ALA A 496 ? 0.3795 0.3547 0.3078 0.0341  0.0437  0.0509  484 ALA A CA  
3676 C C   . ALA A 496 ? 0.3895 0.3442 0.3138 0.0214  0.0634  0.0441  484 ALA A C   
3677 O O   . ALA A 496 ? 0.4210 0.3569 0.3274 0.0309  0.0847  0.0573  484 ALA A O   
3678 C CB  . ALA A 496 ? 0.3758 0.3267 0.3120 0.0351  0.0572  0.0564  484 ALA A CB  
3679 N N   . ILE A 497 ? 0.3644 0.3367 0.3058 0.0012  0.0584  0.0280  485 ILE A N   
3680 C CA  . ILE A 497 ? 0.3931 0.3814 0.3396 -0.0180 0.0736  0.0209  485 ILE A CA  
3681 C C   . ILE A 497 ? 0.3991 0.3908 0.3392 -0.0013 0.0758  0.0279  485 ILE A C   
3682 O O   . ILE A 497 ? 0.4149 0.3900 0.3431 -0.0076 0.0987  0.0298  485 ILE A O   
3683 C CB  . ILE A 497 ? 0.3710 0.4238 0.3430 -0.0378 0.0626  0.0130  485 ILE A CB  
3684 C CG1 . ILE A 497 ? 0.3814 0.4290 0.3461 -0.0675 0.0667  -0.0008 485 ILE A CG1 
3685 C CG2 . ILE A 497 ? 0.3589 0.4652 0.3444 -0.0599 0.0761  0.0090  485 ILE A CG2 
3686 C CD1 . ILE A 497 ? 0.3301 0.4676 0.3137 -0.0883 0.0503  -0.0040 485 ILE A CD1 
3687 N N   . ARG A 498 ? 0.4031 0.4031 0.3426 0.0156  0.0618  0.0289  486 ARG A N   
3688 C CA  . ARG A 498 ? 0.4335 0.4257 0.3560 0.0252  0.0729  0.0297  486 ARG A CA  
3689 C C   . ARG A 498 ? 0.4779 0.4518 0.3667 0.0292  0.0772  0.0372  486 ARG A C   
3690 O O   . ARG A 498 ? 0.4683 0.4338 0.3427 0.0314  0.0946  0.0418  486 ARG A O   
3691 C CB  . ARG A 498 ? 0.4506 0.4285 0.3613 0.0336  0.0755  0.0219  486 ARG A CB  
3692 C CG  . ARG A 498 ? 0.5334 0.4861 0.4083 0.0340  0.0967  0.0143  486 ARG A CG  
3693 C CD  . ARG A 498 ? 0.6161 0.5262 0.4624 0.0293  0.1186  -0.0033 486 ARG A CD  
3694 N NE  . ARG A 498 ? 0.6968 0.6105 0.5119 0.0016  0.1012  -0.0233 486 ARG A NE  
3695 C CZ  . ARG A 498 ? 0.7507 0.6900 0.5224 -0.0225 0.0921  -0.0358 486 ARG A CZ  
3696 N NH1 . ARG A 498 ? 0.7927 0.7355 0.5400 -0.0199 0.1015  -0.0314 486 ARG A NH1 
3697 N NH2 . ARG A 498 ? 0.7693 0.7478 0.5226 -0.0505 0.0736  -0.0500 486 ARG A NH2 
3698 N N   . ARG A 499 ? 0.5005 0.4798 0.3783 0.0353  0.0646  0.0457  487 ARG A N   
3699 C CA  . ARG A 499 ? 0.5671 0.5578 0.4151 0.0522  0.0709  0.0694  487 ARG A CA  
3700 C C   . ARG A 499 ? 0.6284 0.5779 0.4711 0.0651  0.1064  0.0911  487 ARG A C   
3701 O O   . ARG A 499 ? 0.6847 0.6344 0.4982 0.0840  0.1230  0.1145  487 ARG A O   
3702 C CB  . ARG A 499 ? 0.5698 0.6110 0.4129 0.0615  0.0506  0.0835  487 ARG A CB  
3703 C CG  . ARG A 499 ? 0.5934 0.6759 0.4167 0.0348  0.0293  0.0568  487 ARG A CG  
3704 C CD  . ARG A 499 ? 0.6304 0.7854 0.4573 0.0311  0.0079  0.0648  487 ARG A CD  
3705 N NE  . ARG A 499 ? 0.6873 0.8802 0.4863 -0.0140 -0.0035 0.0276  487 ARG A NE  
3706 C CZ  . ARG A 499 ? 0.7757 1.0170 0.5263 -0.0414 -0.0043 0.0137  487 ARG A CZ  
3707 N NH1 . ARG A 499 ? 0.8247 1.0871 0.5531 -0.0183 0.0005  0.0411  487 ARG A NH1 
3708 N NH2 . ARG A 499 ? 0.8221 1.0835 0.5368 -0.0990 -0.0024 -0.0320 487 ARG A NH2 
3709 N N   . LEU A 500 ? 0.6533 0.5646 0.5150 0.0488  0.1258  0.0808  488 LEU A N   
3710 C CA  . LEU A 500 ? 0.7478 0.5993 0.5934 0.0431  0.1766  0.0881  488 LEU A CA  
3711 C C   . LEU A 500 ? 0.7883 0.6388 0.6250 0.0332  0.1904  0.0821  488 LEU A C   
3712 O O   . LEU A 500 ? 0.8503 0.6489 0.6603 0.0394  0.2363  0.0979  488 LEU A O   
3713 C CB  . LEU A 500 ? 0.7672 0.5936 0.6269 -0.0003 0.1965  0.0588  488 LEU A CB  
3714 C CG  . LEU A 500 ? 0.7947 0.5749 0.6470 -0.0025 0.2193  0.0605  488 LEU A CG  
3715 C CD1 . LEU A 500 ? 0.8587 0.6459 0.7187 -0.0671 0.2306  0.0175  488 LEU A CD1 
3716 C CD2 . LEU A 500 ? 0.8861 0.5794 0.7020 0.0286  0.2840  0.0945  488 LEU A CD2 
3717 N N   . LYS A 501 ? 0.7651 0.6645 0.6241 0.0200  0.1611  0.0619  489 LYS A N   
3718 C CA  . LYS A 501 ? 0.7840 0.6937 0.6432 0.0126  0.1745  0.0563  489 LYS A CA  
3719 C C   . LYS A 501 ? 0.7847 0.7065 0.6177 0.0349  0.1593  0.0630  489 LYS A C   
3720 O O   . LYS A 501 ? 0.8541 0.7587 0.6526 0.0467  0.1777  0.0775  489 LYS A O   
3721 C CB  . LYS A 501 ? 0.7505 0.7169 0.6548 -0.0098 0.1637  0.0378  489 LYS A CB  
3722 C CG  . LYS A 501 ? 0.7594 0.7483 0.6864 -0.0478 0.1694  0.0221  489 LYS A CG  
3723 C CD  . LYS A 501 ? 0.7196 0.7969 0.6901 -0.0509 0.1411  0.0194  489 LYS A CD  
3724 C CE  . LYS A 501 ? 0.7560 0.9173 0.7549 -0.1007 0.1518  0.0043  489 LYS A CE  
3725 N NZ  . LYS A 501 ? 0.7740 0.9912 0.7947 -0.1087 0.1709  0.0082  489 LYS A NZ  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -11 ?   ?   ?   A . n 
A 1 2   GLY 2   -10 ?   ?   ?   A . n 
A 1 3   SER 3   -9  ?   ?   ?   A . n 
A 1 4   ASP 4   -8  ?   ?   ?   A . n 
A 1 5   LYS 5   -7  ?   ?   ?   A . n 
A 1 6   ILE 6   -6  ?   ?   ?   A . n 
A 1 7   HIS 7   -5  ?   ?   ?   A . n 
A 1 8   HIS 8   -4  ?   ?   ?   A . n 
A 1 9   HIS 9   -3  ?   ?   ?   A . n 
A 1 10  HIS 10  -2  ?   ?   ?   A . n 
A 1 11  HIS 11  -1  ?   ?   ?   A . n 
A 1 12  HIS 12  0   0   HIS HIS A . n 
A 1 13  MET 13  1   1   MET MET A . n 
A 1 14  LYS 14  2   2   LYS LYS A . n 
A 1 15  GLU 15  3   3   GLU GLU A . n 
A 1 16  ILE 16  4   4   ILE ILE A . n 
A 1 17  ASP 17  5   5   ASP ASP A . n 
A 1 18  GLU 18  6   6   GLU GLU A . n 
A 1 19  LEU 19  7   7   LEU LEU A . n 
A 1 20  THR 20  8   8   THR THR A . n 
A 1 21  ILE 21  9   9   ILE ILE A . n 
A 1 22  LYS 22  10  10  LYS LYS A . n 
A 1 23  GLU 23  11  11  GLU GLU A . n 
A 1 24  TYR 24  12  12  TYR TYR A . n 
A 1 25  GLY 25  13  13  GLY GLY A . n 
A 1 26  VAL 26  14  14  VAL VAL A . n 
A 1 27  ASP 27  15  15  ASP ASP A . n 
A 1 28  SER 28  16  16  SER SER A . n 
A 1 29  ARG 29  17  17  ARG ARG A . n 
A 1 30  ILE 30  18  18  ILE ILE A . n 
A 1 31  LEU 31  19  19  LEU LEU A . n 
A 1 32  MET 32  20  20  MET MET A . n 
A 1 33  GLU 33  21  21  GLU GLU A . n 
A 1 34  ARG 34  22  22  ARG ARG A . n 
A 1 35  ALA 35  23  23  ALA ALA A . n 
A 1 36  GLY 36  24  24  GLY GLY A . n 
A 1 37  ILE 37  25  25  ILE ILE A . n 
A 1 38  SER 38  26  26  SER SER A . n 
A 1 39  VAL 39  27  27  VAL VAL A . n 
A 1 40  VAL 40  28  28  VAL VAL A . n 
A 1 41  LEU 41  29  29  LEU LEU A . n 
A 1 42  ALA 42  30  30  ALA ALA A . n 
A 1 43  MET 43  31  31  MET MET A . n 
A 1 44  GLU 44  32  32  GLU GLU A . n 
A 1 45  GLU 45  33  33  GLU GLU A . n 
A 1 46  GLU 46  34  34  GLU GLU A . n 
A 1 47  LEU 47  35  35  LEU LEU A . n 
A 1 48  GLY 48  36  36  GLY GLY A . n 
A 1 49  ASN 49  37  37  ASN ASN A . n 
A 1 50  LEU 50  38  38  LEU LEU A . n 
A 1 51  SER 51  39  39  SER SER A . n 
A 1 52  ASP 52  40  40  ASP ASP A . n 
A 1 53  TYR 53  41  41  TYR TYR A . n 
A 1 54  ARG 54  42  42  ARG ARG A . n 
A 1 55  PHE 55  43  43  PHE PHE A . n 
A 1 56  LEU 56  44  44  LEU LEU A . n 
A 1 57  VAL 57  45  45  VAL VAL A . n 
A 1 58  LEU 58  46  46  LEU LEU A . n 
A 1 59  CYS 59  47  47  CYS CYS A . n 
A 1 60  GLY 60  48  48  GLY GLY A . n 
A 1 61  GLY 61  49  49  GLY GLY A . n 
A 1 62  GLY 62  50  50  GLY GLY A . n 
A 1 63  ASN 63  51  51  ASN ASN A . n 
A 1 64  ASN 64  52  52  ASN ASN A . n 
A 1 65  GLY 65  53  53  GLY GLY A . n 
A 1 66  GLY 66  54  54  GLY GLY A . n 
A 1 67  ASP 67  55  55  ASP ASP A . n 
A 1 68  GLY 68  56  56  GLY GLY A . n 
A 1 69  PHE 69  57  57  PHE PHE A . n 
A 1 70  VAL 70  58  58  VAL VAL A . n 
A 1 71  VAL 71  59  59  VAL VAL A . n 
A 1 72  ALA 72  60  60  ALA ALA A . n 
A 1 73  ARG 73  61  61  ARG ARG A . n 
A 1 74  ASN 74  62  62  ASN ASN A . n 
A 1 75  LEU 75  63  63  LEU LEU A . n 
A 1 76  LEU 76  64  64  LEU LEU A . n 
A 1 77  GLY 77  65  65  GLY GLY A . n 
A 1 78  VAL 78  66  66  VAL VAL A . n 
A 1 79  VAL 79  67  67  VAL VAL A . n 
A 1 80  LYS 80  68  68  LYS LYS A . n 
A 1 81  ASP 81  69  69  ASP ASP A . n 
A 1 82  VAL 82  70  70  VAL VAL A . n 
A 1 83  LEU 83  71  71  LEU LEU A . n 
A 1 84  VAL 84  72  72  VAL VAL A . n 
A 1 85  VAL 85  73  73  VAL VAL A . n 
A 1 86  PHE 86  74  74  PHE PHE A . n 
A 1 87  LEU 87  75  75  LEU LEU A . n 
A 1 88  GLY 88  76  76  GLY GLY A . n 
A 1 89  LYS 89  77  77  LYS LYS A . n 
A 1 90  LYS 90  78  78  LYS LYS A . n 
A 1 91  LYS 91  79  79  LYS LYS A . n 
A 1 92  THR 92  80  80  THR THR A . n 
A 1 93  PRO 93  81  81  PRO PRO A . n 
A 1 94  ASP 94  82  82  ASP ASP A . n 
A 1 95  CYS 95  83  83  CYS CYS A . n 
A 1 96  GLU 96  84  84  GLU GLU A . n 
A 1 97  TYR 97  85  85  TYR TYR A . n 
A 1 98  ASN 98  86  86  ASN ASN A . n 
A 1 99  TYR 99  87  87  TYR TYR A . n 
A 1 100 GLY 100 88  88  GLY GLY A . n 
A 1 101 LEU 101 89  89  LEU LEU A . n 
A 1 102 TYR 102 90  90  TYR TYR A . n 
A 1 103 LYS 103 91  91  LYS LYS A . n 
A 1 104 LYS 104 92  92  LYS LYS A . n 
A 1 105 PHE 105 93  93  PHE PHE A . n 
A 1 106 GLY 106 94  94  GLY GLY A . n 
A 1 107 GLY 107 95  95  GLY GLY A . n 
A 1 108 LYS 108 96  96  LYS LYS A . n 
A 1 109 VAL 109 97  97  VAL VAL A . n 
A 1 110 VAL 110 98  98  VAL VAL A . n 
A 1 111 GLU 111 99  99  GLU GLU A . n 
A 1 112 GLN 112 100 100 GLN GLN A . n 
A 1 113 PHE 113 101 101 PHE PHE A . n 
A 1 114 GLU 114 102 102 GLU GLU A . n 
A 1 115 PRO 115 103 103 PRO PRO A . n 
A 1 116 SER 116 104 104 SER SER A . n 
A 1 117 ILE 117 105 105 ILE ILE A . n 
A 1 118 LEU 118 106 106 LEU LEU A . n 
A 1 119 ASN 119 107 107 ASN ASN A . n 
A 1 120 GLU 120 108 108 GLU GLU A . n 
A 1 121 PHE 121 109 109 PHE PHE A . n 
A 1 122 ASP 122 110 110 ASP ASP A . n 
A 1 123 VAL 123 111 111 VAL VAL A . n 
A 1 124 VAL 124 112 112 VAL VAL A . n 
A 1 125 VAL 125 113 113 VAL VAL A . n 
A 1 126 ASP 126 114 114 ASP ASP A . n 
A 1 127 ALA 127 115 115 ALA ALA A . n 
A 1 128 ILE 128 116 116 ILE ILE A . n 
A 1 129 PHE 129 117 117 PHE PHE A . n 
A 1 130 GLY 130 118 118 GLY GLY A . n 
A 1 131 THR 131 119 119 THR THR A . n 
A 1 132 GLY 132 120 120 GLY GLY A . n 
A 1 133 LEU 133 121 121 LEU LEU A . n 
A 1 134 ARG 134 122 122 ARG ARG A . n 
A 1 135 GLY 135 123 123 GLY GLY A . n 
A 1 136 GLU 136 124 124 GLU GLU A . n 
A 1 137 ILE 137 125 125 ILE ILE A . n 
A 1 138 THR 138 126 126 THR THR A . n 
A 1 139 GLY 139 127 127 GLY GLY A . n 
A 1 140 GLU 140 128 128 GLU GLU A . n 
A 1 141 TYR 141 129 129 TYR TYR A . n 
A 1 142 ALA 142 130 130 ALA ALA A . n 
A 1 143 GLU 143 131 131 GLU GLU A . n 
A 1 144 ILE 144 132 132 ILE ILE A . n 
A 1 145 ILE 145 133 133 ILE ILE A . n 
A 1 146 ASN 146 134 134 ASN ASN A . n 
A 1 147 LEU 147 135 135 LEU LEU A . n 
A 1 148 VAL 148 136 136 VAL VAL A . n 
A 1 149 ASN 149 137 137 ASN ASN A . n 
A 1 150 LYS 150 138 138 LYS LYS A . n 
A 1 151 SER 151 139 139 SER SER A . n 
A 1 152 GLY 152 140 140 GLY GLY A . n 
A 1 153 LYS 153 141 141 LYS LYS A . n 
A 1 154 VAL 154 142 142 VAL VAL A . n 
A 1 155 VAL 155 143 143 VAL VAL A . n 
A 1 156 VAL 156 144 144 VAL VAL A . n 
A 1 157 SER 157 145 145 SER SER A . n 
A 1 158 VAL 158 146 146 VAL VAL A . n 
A 1 159 ASP 159 147 147 ASP ASP A . n 
A 1 160 VAL 160 148 148 VAL VAL A . n 
A 1 161 PRO 161 149 149 PRO PRO A . n 
A 1 162 SER 162 150 150 SER SER A . n 
A 1 163 GLY 163 151 151 GLY GLY A . n 
A 1 164 ILE 164 152 152 ILE ILE A . n 
A 1 165 ASP 165 153 153 ASP ASP A . n 
A 1 166 SER 166 154 154 SER SER A . n 
A 1 167 ASN 167 155 155 ASN ASN A . n 
A 1 168 THR 168 156 156 THR THR A . n 
A 1 169 GLY 169 157 157 GLY GLY A . n 
A 1 170 LYS 170 158 158 LYS LYS A . n 
A 1 171 VAL 171 159 159 VAL VAL A . n 
A 1 172 LEU 172 160 160 LEU LEU A . n 
A 1 173 ARG 173 161 161 ARG ARG A . n 
A 1 174 THR 174 162 162 THR THR A . n 
A 1 175 ALA 175 163 163 ALA ALA A . n 
A 1 176 VAL 176 164 164 VAL VAL A . n 
A 1 177 LYS 177 165 165 LYS LYS A . n 
A 1 178 ALA 178 166 166 ALA ALA A . n 
A 1 179 ASP 179 167 167 ASP ASP A . n 
A 1 180 LEU 180 168 168 LEU LEU A . n 
A 1 181 THR 181 169 169 THR THR A . n 
A 1 182 VAL 182 170 170 VAL VAL A . n 
A 1 183 THR 183 171 171 THR THR A . n 
A 1 184 PHE 184 172 172 PHE PHE A . n 
A 1 185 GLY 185 173 173 GLY GLY A . n 
A 1 186 VAL 186 174 174 VAL VAL A . n 
A 1 187 PRO 187 175 175 PRO PRO A . n 
A 1 188 LYS 188 176 176 LYS LYS A . n 
A 1 189 ILE 189 177 177 ILE ILE A . n 
A 1 190 GLY 190 178 178 GLY GLY A . n 
A 1 191 HIS 191 179 179 HIS HIS A . n 
A 1 192 ILE 192 180 180 ILE ILE A . n 
A 1 193 LEU 193 181 181 LEU LEU A . n 
A 1 194 PHE 194 182 182 PHE PHE A . n 
A 1 195 PRO 195 183 183 PRO PRO A . n 
A 1 196 GLY 196 184 184 GLY GLY A . n 
A 1 197 ARG 197 185 185 ARG ARG A . n 
A 1 198 ASP 198 186 186 ASP ASP A . n 
A 1 199 LEU 199 187 187 LEU LEU A . n 
A 1 200 THR 200 188 188 THR THR A . n 
A 1 201 GLY 201 189 189 GLY GLY A . n 
A 1 202 LYS 202 190 190 LYS LYS A . n 
A 1 203 LEU 203 191 191 LEU LEU A . n 
A 1 204 LYS 204 192 192 LYS LYS A . n 
A 1 205 VAL 205 193 193 VAL VAL A . n 
A 1 206 ALA 206 194 194 ALA ALA A . n 
A 1 207 ASN 207 195 195 ASN ASN A . n 
A 1 208 ILE 208 196 196 ILE ILE A . n 
A 1 209 GLY 209 197 197 GLY GLY A . n 
A 1 210 HIS 210 198 198 HIS HIS A . n 
A 1 211 PRO 211 199 199 PRO PRO A . n 
A 1 212 VAL 212 200 200 VAL VAL A . n 
A 1 213 HIS 213 201 201 HIS HIS A . n 
A 1 214 LEU 214 202 202 LEU LEU A . n 
A 1 215 ILE 215 203 203 ILE ILE A . n 
A 1 216 ASN 216 204 204 ASN ASN A . n 
A 1 217 SER 217 205 205 SER SER A . n 
A 1 218 ILE 218 206 206 ILE ILE A . n 
A 1 219 ASN 219 207 207 ASN ASN A . n 
A 1 220 ARG 220 208 208 ARG ARG A . n 
A 1 221 TYR 221 209 209 TYR TYR A . n 
A 1 222 VAL 222 210 210 VAL VAL A . n 
A 1 223 ILE 223 211 211 ILE ILE A . n 
A 1 224 THR 224 212 212 THR THR A . n 
A 1 225 ARG 225 213 213 ARG ARG A . n 
A 1 226 GLU 226 214 214 GLU GLU A . n 
A 1 227 MET 227 215 215 MET MET A . n 
A 1 228 VAL 228 216 216 VAL VAL A . n 
A 1 229 ARG 229 217 217 ARG ARG A . n 
A 1 230 SER 230 218 218 SER SER A . n 
A 1 231 LEU 231 219 219 LEU LEU A . n 
A 1 232 LEU 232 220 220 LEU LEU A . n 
A 1 233 PRO 233 221 221 PRO PRO A . n 
A 1 234 GLU 234 222 222 GLU GLU A . n 
A 1 235 ARG 235 223 223 ARG ARG A . n 
A 1 236 PRO 236 224 224 PRO PRO A . n 
A 1 237 ARG 237 225 225 ARG ARG A . n 
A 1 238 ASP 238 226 226 ASP ASP A . n 
A 1 239 SER 239 227 227 SER SER A . n 
A 1 240 HIS 240 228 228 HIS HIS A . n 
A 1 241 LYS 241 229 229 LYS LYS A . n 
A 1 242 GLY 242 230 230 GLY GLY A . n 
A 1 243 THR 243 231 231 THR THR A . n 
A 1 244 TYR 244 232 232 TYR TYR A . n 
A 1 245 GLY 245 233 233 GLY GLY A . n 
A 1 246 LYS 246 234 234 LYS LYS A . n 
A 1 247 VAL 247 235 235 VAL VAL A . n 
A 1 248 LEU 248 236 236 LEU LEU A . n 
A 1 249 ILE 249 237 237 ILE ILE A . n 
A 1 250 ILE 250 238 238 ILE ILE A . n 
A 1 251 ALA 251 239 239 ALA ALA A . n 
A 1 252 GLY 252 240 240 GLY GLY A . n 
A 1 253 SER 253 241 241 SER SER A . n 
A 1 254 ARG 254 242 242 ARG ARG A . n 
A 1 255 LEU 255 243 243 LEU LEU A . n 
A 1 256 TYR 256 244 244 TYR TYR A . n 
A 1 257 SER 257 245 245 SER SER A . n 
A 1 258 GLY 258 246 246 GLY GLY A . n 
A 1 259 ALA 259 247 247 ALA ALA A . n 
A 1 260 PRO 260 248 248 PRO PRO A . n 
A 1 261 VAL 261 249 249 VAL VAL A . n 
A 1 262 LEU 262 250 250 LEU LEU A . n 
A 1 263 SER 263 251 251 SER SER A . n 
A 1 264 GLY 264 252 252 GLY GLY A . n 
A 1 265 MET 265 253 253 MET MET A . n 
A 1 266 GLY 266 254 254 GLY GLY A . n 
A 1 267 SER 267 255 255 SER SER A . n 
A 1 268 LEU 268 256 256 LEU LEU A . n 
A 1 269 LYS 269 257 257 LYS LYS A . n 
A 1 270 VAL 270 258 258 VAL VAL A . n 
A 1 271 GLY 271 259 259 GLY GLY A . n 
A 1 272 THR 272 260 260 THR THR A . n 
A 1 273 GLY 273 261 261 GLY GLY A . n 
A 1 274 LEU 274 262 262 LEU LEU A . n 
A 1 275 VAL 275 263 263 VAL VAL A . n 
A 1 276 LYS 276 264 264 LYS LYS A . n 
A 1 277 LEU 277 265 265 LEU LEU A . n 
A 1 278 ALA 278 266 266 ALA ALA A . n 
A 1 279 VAL 279 267 267 VAL VAL A . n 
A 1 280 PRO 280 268 268 PRO PRO A . n 
A 1 281 PHE 281 269 269 PHE PHE A . n 
A 1 282 PRO 282 270 270 PRO PRO A . n 
A 1 283 GLN 283 271 271 GLN GLN A . n 
A 1 284 ASN 284 272 272 ASN ASN A . n 
A 1 285 LEU 285 273 273 LEU LEU A . n 
A 1 286 ILE 286 274 274 ILE ILE A . n 
A 1 287 ALA 287 275 275 ALA ALA A . n 
A 1 288 THR 288 276 276 THR THR A . n 
A 1 289 SER 289 277 277 SER SER A . n 
A 1 290 ARG 290 278 278 ARG ARG A . n 
A 1 291 PHE 291 279 279 PHE PHE A . n 
A 1 292 PRO 292 280 280 PRO PRO A . n 
A 1 293 GLU 293 281 281 GLU GLU A . n 
A 1 294 LEU 294 282 282 LEU LEU A . n 
A 1 295 ILE 295 283 283 ILE ILE A . n 
A 1 296 SER 296 284 284 SER SER A . n 
A 1 297 VAL 297 285 285 VAL VAL A . n 
A 1 298 PRO 298 286 286 PRO PRO A . n 
A 1 299 ILE 299 287 287 ILE ILE A . n 
A 1 300 ASP 300 288 288 ASP ASP A . n 
A 1 301 THR 301 289 289 THR THR A . n 
A 1 302 GLU 302 290 290 GLU GLU A . n 
A 1 303 LYS 303 291 291 LYS LYS A . n 
A 1 304 GLY 304 292 292 GLY GLY A . n 
A 1 305 PHE 305 293 293 PHE PHE A . n 
A 1 306 PHE 306 294 294 PHE PHE A . n 
A 1 307 SER 307 295 295 SER SER A . n 
A 1 308 LEU 308 296 296 LEU LEU A . n 
A 1 309 GLN 309 297 297 GLN GLN A . n 
A 1 310 ASN 310 298 298 ASN ASN A . n 
A 1 311 LEU 311 299 299 LEU LEU A . n 
A 1 312 GLN 312 300 300 GLN GLN A . n 
A 1 313 GLU 313 301 301 GLU GLU A . n 
A 1 314 CYS 314 302 302 CYS CYS A . n 
A 1 315 LEU 315 303 303 LEU LEU A . n 
A 1 316 GLU 316 304 304 GLU GLU A . n 
A 1 317 LEU 317 305 305 LEU LEU A . n 
A 1 318 SER 318 306 306 SER SER A . n 
A 1 319 LYS 319 307 307 LYS LYS A . n 
A 1 320 ASP 320 308 308 ASP ASP A . n 
A 1 321 VAL 321 309 309 VAL VAL A . n 
A 1 322 ASP 322 310 310 ASP ASP A . n 
A 1 323 VAL 323 311 311 VAL VAL A . n 
A 1 324 VAL 324 312 312 VAL VAL A . n 
A 1 325 ALA 325 313 313 ALA ALA A . n 
A 1 326 ILE 326 314 314 ILE ILE A . n 
A 1 327 GLY 327 315 315 GLY GLY A . n 
A 1 328 PRO 328 316 316 PRO PRO A . n 
A 1 329 GLY 329 317 317 GLY GLY A . n 
A 1 330 LEU 330 318 318 LEU LEU A . n 
A 1 331 GLY 331 319 319 GLY GLY A . n 
A 1 332 ASN 332 320 320 ASN ASN A . n 
A 1 333 ASN 333 321 321 ASN ASN A . n 
A 1 334 GLU 334 322 322 GLU GLU A . n 
A 1 335 HIS 335 323 323 HIS HIS A . n 
A 1 336 VAL 336 324 324 VAL VAL A . n 
A 1 337 ARG 337 325 325 ARG ARG A . n 
A 1 338 GLU 338 326 326 GLU GLU A . n 
A 1 339 PHE 339 327 327 PHE PHE A . n 
A 1 340 VAL 340 328 328 VAL VAL A . n 
A 1 341 ASN 341 329 329 ASN ASN A . n 
A 1 342 GLU 342 330 330 GLU GLU A . n 
A 1 343 PHE 343 331 331 PHE PHE A . n 
A 1 344 LEU 344 332 332 LEU LEU A . n 
A 1 345 LYS 345 333 333 LYS LYS A . n 
A 1 346 THR 346 334 334 THR THR A . n 
A 1 347 LEU 347 335 335 LEU LEU A . n 
A 1 348 GLU 348 336 336 GLU GLU A . n 
A 1 349 LYS 349 337 337 LYS LYS A . n 
A 1 350 PRO 350 338 338 PRO PRO A . n 
A 1 351 ALA 351 339 339 ALA ALA A . n 
A 1 352 VAL 352 340 340 VAL VAL A . n 
A 1 353 ILE 353 341 341 ILE ILE A . n 
A 1 354 ASP 354 342 342 ASP ASP A . n 
A 1 355 ALA 355 343 343 ALA ALA A . n 
A 1 356 ASP 356 344 344 ASP ASP A . n 
A 1 357 ALA 357 345 345 ALA ALA A . n 
A 1 358 ILE 358 346 346 ILE ILE A . n 
A 1 359 ASN 359 347 347 ASN ASN A . n 
A 1 360 VAL 360 348 348 VAL VAL A . n 
A 1 361 LEU 361 349 349 LEU LEU A . n 
A 1 362 ASP 362 350 350 ASP ASP A . n 
A 1 363 THR 363 351 351 THR THR A . n 
A 1 364 SER 364 352 352 SER SER A . n 
A 1 365 VAL 365 353 353 VAL VAL A . n 
A 1 366 LEU 366 354 354 LEU LEU A . n 
A 1 367 LYS 367 355 355 LYS LYS A . n 
A 1 368 GLU 368 356 356 GLU GLU A . n 
A 1 369 ARG 369 357 357 ARG ARG A . n 
A 1 370 LYS 370 358 358 LYS LYS A . n 
A 1 371 SER 371 359 359 SER SER A . n 
A 1 372 PRO 372 360 360 PRO PRO A . n 
A 1 373 ALA 373 361 361 ALA ALA A . n 
A 1 374 VAL 374 362 362 VAL VAL A . n 
A 1 375 LEU 375 363 363 LEU LEU A . n 
A 1 376 THR 376 364 364 THR THR A . n 
A 1 377 PRO 377 365 365 PRO PRO A . n 
A 1 378 HIS 378 366 366 HIS HIS A . n 
A 1 379 PRO 379 367 367 PRO PRO A . n 
A 1 380 GLY 380 368 368 GLY GLY A . n 
A 1 381 GLU 381 369 369 GLU GLU A . n 
A 1 382 MET 382 370 370 MET MET A . n 
A 1 383 ALA 383 371 371 ALA ALA A . n 
A 1 384 ARG 384 372 372 ARG ARG A . n 
A 1 385 LEU 385 373 373 LEU LEU A . n 
A 1 386 VAL 386 374 374 VAL VAL A . n 
A 1 387 LYS 387 375 375 LYS LYS A . n 
A 1 388 LYS 388 376 376 LYS LYS A . n 
A 1 389 THR 389 377 377 THR THR A . n 
A 1 390 VAL 390 378 378 VAL VAL A . n 
A 1 391 GLY 391 379 379 GLY GLY A . n 
A 1 392 ASP 392 380 380 ASP ASP A . n 
A 1 393 VAL 393 381 381 VAL VAL A . n 
A 1 394 LYS 394 382 382 LYS LYS A . n 
A 1 395 TYR 395 383 383 TYR TYR A . n 
A 1 396 ASN 396 384 384 ASN ASN A . n 
A 1 397 TYR 397 385 385 TYR TYR A . n 
A 1 398 GLU 398 386 386 GLU GLU A . n 
A 1 399 LEU 399 387 387 LEU LEU A . n 
A 1 400 ALA 400 388 388 ALA ALA A . n 
A 1 401 GLU 401 389 389 GLU GLU A . n 
A 1 402 GLU 402 390 390 GLU GLU A . n 
A 1 403 PHE 403 391 391 PHE PHE A . n 
A 1 404 ALA 404 392 392 ALA ALA A . n 
A 1 405 LYS 405 393 393 LYS LYS A . n 
A 1 406 GLU 406 394 394 GLU GLU A . n 
A 1 407 ASN 407 395 395 ASN ASN A . n 
A 1 408 ASP 408 396 396 ASP ASP A . n 
A 1 409 CYS 409 397 397 CYS CYS A . n 
A 1 410 VAL 410 398 398 VAL VAL A . n 
A 1 411 LEU 411 399 399 LEU LEU A . n 
A 1 412 VAL 412 400 400 VAL VAL A . n 
A 1 413 LEU 413 401 401 LEU LEU A . n 
A 1 414 LYS 414 402 402 LYS LYS A . n 
A 1 415 SER 415 403 403 SER SER A . n 
A 1 416 ALA 416 404 404 ALA ALA A . n 
A 1 417 THR 417 405 405 THR THR A . n 
A 1 418 THR 418 406 406 THR THR A . n 
A 1 419 ILE 419 407 407 ILE ILE A . n 
A 1 420 VAL 420 408 408 VAL VAL A . n 
A 1 421 THR 421 409 409 THR THR A . n 
A 1 422 ASP 422 410 410 ASP ASP A . n 
A 1 423 GLY 423 411 411 GLY GLY A . n 
A 1 424 GLU 424 412 412 GLU GLU A . n 
A 1 425 LYS 425 413 413 LYS LYS A . n 
A 1 426 THR 426 414 414 THR THR A . n 
A 1 427 LEU 427 415 415 LEU LEU A . n 
A 1 428 PHE 428 416 416 PHE PHE A . n 
A 1 429 ASN 429 417 417 ASN ASN A . n 
A 1 430 ILE 430 418 418 ILE ILE A . n 
A 1 431 THR 431 419 419 THR THR A . n 
A 1 432 GLY 432 420 420 GLY GLY A . n 
A 1 433 ASN 433 421 421 ASN ASN A . n 
A 1 434 THR 434 422 422 THR THR A . n 
A 1 435 GLY 435 423 423 GLY GLY A . n 
A 1 436 LEU 436 424 424 LEU LEU A . n 
A 1 437 SER 437 425 425 SER SER A . n 
A 1 438 LYS 438 426 426 LYS LYS A . n 
A 1 439 GLY 439 427 427 GLY GLY A . n 
A 1 440 GLY 440 428 428 GLY GLY A . n 
A 1 441 SER 441 429 429 SER SER A . n 
A 1 442 GLY 442 430 430 GLY GLY A . n 
A 1 443 ASP 443 431 431 ASP ASP A . n 
A 1 444 VAL 444 432 432 VAL VAL A . n 
A 1 445 LEU 445 433 433 LEU LEU A . n 
A 1 446 THR 446 434 434 THR THR A . n 
A 1 447 GLY 447 435 435 GLY GLY A . n 
A 1 448 MET 448 436 436 MET MET A . n 
A 1 449 ILE 449 437 437 ILE ILE A . n 
A 1 450 ALA 450 438 438 ALA ALA A . n 
A 1 451 GLY 451 439 439 GLY GLY A . n 
A 1 452 PHE 452 440 440 PHE PHE A . n 
A 1 453 ILE 453 441 441 ILE ILE A . n 
A 1 454 ALA 454 442 442 ALA ALA A . n 
A 1 455 GLN 455 443 443 GLN GLN A . n 
A 1 456 GLY 456 444 444 GLY GLY A . n 
A 1 457 LEU 457 445 445 LEU LEU A . n 
A 1 458 SER 458 446 446 SER SER A . n 
A 1 459 PRO 459 447 447 PRO PRO A . n 
A 1 460 LEU 460 448 448 LEU LEU A . n 
A 1 461 GLU 461 449 449 GLU GLU A . n 
A 1 462 ALA 462 450 450 ALA ALA A . n 
A 1 463 SER 463 451 451 SER SER A . n 
A 1 464 THR 464 452 452 THR THR A . n 
A 1 465 VAL 465 453 453 VAL VAL A . n 
A 1 466 SER 466 454 454 SER SER A . n 
A 1 467 VAL 467 455 455 VAL VAL A . n 
A 1 468 TYR 468 456 456 TYR TYR A . n 
A 1 469 LEU 469 457 457 LEU LEU A . n 
A 1 470 HIS 470 458 458 HIS HIS A . n 
A 1 471 GLY 471 459 459 GLY GLY A . n 
A 1 472 PHE 472 460 460 PHE PHE A . n 
A 1 473 ALA 473 461 461 ALA ALA A . n 
A 1 474 ALA 474 462 462 ALA ALA A . n 
A 1 475 GLU 475 463 463 GLU GLU A . n 
A 1 476 LEU 476 464 464 LEU LEU A . n 
A 1 477 PHE 477 465 465 PHE PHE A . n 
A 1 478 GLU 478 466 466 GLU GLU A . n 
A 1 479 GLN 479 467 467 GLN GLN A . n 
A 1 480 ASP 480 468 468 ASP ASP A . n 
A 1 481 GLU 481 469 469 GLU GLU A . n 
A 1 482 ARG 482 470 470 ARG ARG A . n 
A 1 483 GLY 483 471 471 GLY GLY A . n 
A 1 484 LEU 484 472 472 LEU LEU A . n 
A 1 485 THR 485 473 473 THR THR A . n 
A 1 486 ALA 486 474 474 ALA ALA A . n 
A 1 487 SER 487 475 475 SER SER A . n 
A 1 488 GLU 488 476 476 GLU GLU A . n 
A 1 489 LEU 489 477 477 LEU LEU A . n 
A 1 490 LEU 490 478 478 LEU LEU A . n 
A 1 491 ARG 491 479 479 ARG ARG A . n 
A 1 492 LEU 492 480 480 LEU LEU A . n 
A 1 493 ILE 493 481 481 ILE ILE A . n 
A 1 494 PRO 494 482 482 PRO PRO A . n 
A 1 495 GLU 495 483 483 GLU GLU A . n 
A 1 496 ALA 496 484 484 ALA ALA A . n 
A 1 497 ILE 497 485 485 ILE ILE A . n 
A 1 498 ARG 498 486 486 ARG ARG A . n 
A 1 499 ARG 499 487 487 ARG ARG A . n 
A 1 500 LEU 500 488 488 LEU LEU A . n 
A 1 501 LYS 501 489 489 LYS LYS A . n 
A 1 502 GLU 502 490 ?   ?   ?   A . n 
B 2 1   ALA 1   3   3   ALA ALA B . n 
B 2 2   TRP 2   4   4   TRP TRP B . n 
B 2 3   LEU 3   5   5   LEU LEU B . n 
B 2 4   PHE 4   6   6   PHE PHE B . n 
B 2 5   GLU 5   7   7   GLU GLU B . n 
B 2 6   ALA 6   8   8   ALA ALA B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 K   1   491 491 K   K   A . 
D 4 MG  1   492 492 MG  MG  A . 
E 5 BA3 1   493 493 BA3 BA3 A . 
F 5 BA3 1   494 494 BA3 BA3 A . 
G 6 GOL 1   495 495 GOL GOL A . 
H 7 HOH 1   496 496 HOH HOH A . 
H 7 HOH 2   497 497 HOH HOH A . 
H 7 HOH 3   498 498 HOH HOH A . 
H 7 HOH 4   499 499 HOH HOH A . 
H 7 HOH 5   500 500 HOH HOH A . 
H 7 HOH 6   501 501 HOH HOH A . 
H 7 HOH 7   502 502 HOH HOH A . 
H 7 HOH 8   503 503 HOH HOH A . 
H 7 HOH 9   504 504 HOH HOH A . 
H 7 HOH 10  505 505 HOH HOH A . 
H 7 HOH 11  506 506 HOH HOH A . 
H 7 HOH 12  507 507 HOH HOH A . 
H 7 HOH 13  508 508 HOH HOH A . 
H 7 HOH 14  509 509 HOH HOH A . 
H 7 HOH 15  510 510 HOH HOH A . 
H 7 HOH 16  511 511 HOH HOH A . 
H 7 HOH 17  512 512 HOH HOH A . 
H 7 HOH 18  513 513 HOH HOH A . 
H 7 HOH 19  514 514 HOH HOH A . 
H 7 HOH 20  515 515 HOH HOH A . 
H 7 HOH 21  516 516 HOH HOH A . 
H 7 HOH 22  517 517 HOH HOH A . 
H 7 HOH 23  518 518 HOH HOH A . 
H 7 HOH 24  519 519 HOH HOH A . 
H 7 HOH 25  520 520 HOH HOH A . 
H 7 HOH 26  521 521 HOH HOH A . 
H 7 HOH 27  522 522 HOH HOH A . 
H 7 HOH 28  523 523 HOH HOH A . 
H 7 HOH 29  524 524 HOH HOH A . 
H 7 HOH 30  525 525 HOH HOH A . 
H 7 HOH 31  526 526 HOH HOH A . 
H 7 HOH 32  527 527 HOH HOH A . 
H 7 HOH 33  528 528 HOH HOH A . 
H 7 HOH 34  529 529 HOH HOH A . 
H 7 HOH 35  530 530 HOH HOH A . 
H 7 HOH 36  531 531 HOH HOH A . 
H 7 HOH 37  532 532 HOH HOH A . 
H 7 HOH 38  533 533 HOH HOH A . 
H 7 HOH 39  534 534 HOH HOH A . 
H 7 HOH 40  535 535 HOH HOH A . 
H 7 HOH 41  536 536 HOH HOH A . 
H 7 HOH 42  537 537 HOH HOH A . 
H 7 HOH 43  538 538 HOH HOH A . 
H 7 HOH 44  539 539 HOH HOH A . 
H 7 HOH 45  540 540 HOH HOH A . 
H 7 HOH 46  541 541 HOH HOH A . 
H 7 HOH 47  542 542 HOH HOH A . 
H 7 HOH 48  543 543 HOH HOH A . 
H 7 HOH 49  544 544 HOH HOH A . 
H 7 HOH 50  545 545 HOH HOH A . 
H 7 HOH 51  546 546 HOH HOH A . 
H 7 HOH 52  547 547 HOH HOH A . 
H 7 HOH 53  548 548 HOH HOH A . 
H 7 HOH 54  549 549 HOH HOH A . 
H 7 HOH 55  550 550 HOH HOH A . 
H 7 HOH 56  551 551 HOH HOH A . 
H 7 HOH 57  552 552 HOH HOH A . 
H 7 HOH 58  553 553 HOH HOH A . 
H 7 HOH 59  554 554 HOH HOH A . 
H 7 HOH 60  555 555 HOH HOH A . 
H 7 HOH 61  556 556 HOH HOH A . 
H 7 HOH 62  557 557 HOH HOH A . 
H 7 HOH 63  558 558 HOH HOH A . 
H 7 HOH 64  559 559 HOH HOH A . 
H 7 HOH 65  560 560 HOH HOH A . 
H 7 HOH 66  561 561 HOH HOH A . 
H 7 HOH 67  562 562 HOH HOH A . 
H 7 HOH 68  563 563 HOH HOH A . 
H 7 HOH 69  564 564 HOH HOH A . 
H 7 HOH 70  565 565 HOH HOH A . 
H 7 HOH 71  566 566 HOH HOH A . 
H 7 HOH 72  567 567 HOH HOH A . 
H 7 HOH 73  568 568 HOH HOH A . 
H 7 HOH 74  569 569 HOH HOH A . 
H 7 HOH 75  570 570 HOH HOH A . 
H 7 HOH 76  571 571 HOH HOH A . 
H 7 HOH 77  572 572 HOH HOH A . 
H 7 HOH 78  573 573 HOH HOH A . 
H 7 HOH 79  574 574 HOH HOH A . 
H 7 HOH 80  575 575 HOH HOH A . 
H 7 HOH 81  576 576 HOH HOH A . 
H 7 HOH 82  577 577 HOH HOH A . 
H 7 HOH 83  578 578 HOH HOH A . 
H 7 HOH 84  579 579 HOH HOH A . 
H 7 HOH 85  580 580 HOH HOH A . 
H 7 HOH 86  581 581 HOH HOH A . 
H 7 HOH 87  582 582 HOH HOH A . 
H 7 HOH 88  583 583 HOH HOH A . 
H 7 HOH 89  584 584 HOH HOH A . 
H 7 HOH 90  585 585 HOH HOH A . 
H 7 HOH 91  586 586 HOH HOH A . 
H 7 HOH 92  587 587 HOH HOH A . 
H 7 HOH 93  588 588 HOH HOH A . 
H 7 HOH 94  589 589 HOH HOH A . 
H 7 HOH 95  590 590 HOH HOH A . 
H 7 HOH 96  591 591 HOH HOH A . 
H 7 HOH 97  592 592 HOH HOH A . 
H 7 HOH 98  593 593 HOH HOH A . 
H 7 HOH 99  594 594 HOH HOH A . 
H 7 HOH 100 595 595 HOH HOH A . 
H 7 HOH 101 596 596 HOH HOH A . 
H 7 HOH 102 597 597 HOH HOH A . 
H 7 HOH 103 598 598 HOH HOH A . 
H 7 HOH 104 599 599 HOH HOH A . 
H 7 HOH 105 600 600 HOH HOH A . 
H 7 HOH 106 601 601 HOH HOH A . 
H 7 HOH 107 602 602 HOH HOH A . 
H 7 HOH 108 603 603 HOH HOH A . 
H 7 HOH 109 604 604 HOH HOH A . 
H 7 HOH 110 605 605 HOH HOH A . 
H 7 HOH 111 606 606 HOH HOH A . 
H 7 HOH 112 607 607 HOH HOH A . 
H 7 HOH 113 608 608 HOH HOH A . 
H 7 HOH 114 609 609 HOH HOH A . 
H 7 HOH 115 610 610 HOH HOH A . 
H 7 HOH 116 611 611 HOH HOH A . 
H 7 HOH 117 612 612 HOH HOH A . 
H 7 HOH 118 613 613 HOH HOH A . 
H 7 HOH 119 614 614 HOH HOH A . 
H 7 HOH 120 615 615 HOH HOH A . 
H 7 HOH 121 616 616 HOH HOH A . 
H 7 HOH 122 617 617 HOH HOH A . 
H 7 HOH 123 618 618 HOH HOH A . 
H 7 HOH 124 619 619 HOH HOH A . 
H 7 HOH 125 620 620 HOH HOH A . 
H 7 HOH 126 621 621 HOH HOH A . 
H 7 HOH 127 622 622 HOH HOH A . 
H 7 HOH 128 623 623 HOH HOH A . 
H 7 HOH 129 624 624 HOH HOH A . 
H 7 HOH 130 625 625 HOH HOH A . 
H 7 HOH 131 626 626 HOH HOH A . 
I 7 HOH 1   1   1   HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   hexadecameric 
_pdbx_struct_assembly.oligomeric_count     16 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4,5,6,7,8 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 58360  ? 
1 MORE         -293   ? 
1 'SSA (A^2)'  132890 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_555 -x,-y,z  -1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
3 'crystal symmetry operation' 3_555 -y,x,z   0.0000000000  -1.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
4 'crystal symmetry operation' 4_555 y,-x,z   0.0000000000  1.0000000000  0.0000000000 0.0000000000 -1.0000000000 0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
5 'crystal symmetry operation' 5_555 -x,y,-z  -1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
6 'crystal symmetry operation' 6_555 x,-y,-z  1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
7 'crystal symmetry operation' 7_555 y,x,-z   0.0000000000  1.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
8 'crystal symmetry operation' 8_555 -y,-x,-z 0.0000000000  -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASN 64  ? A ASN 52  ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A ASP 126 ? A ASP 114 ? 1_555 94.0  ? 
2  OD1 ? A ASN 64  ? A ASN 52  ? 1_555 K  ? C K  . ? A K  491 ? 1_555 OD2 ? A ASP 126 ? A ASP 114 ? 1_555 147.4 ? 
3  O   ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 OD2 ? A ASP 126 ? A ASP 114 ? 1_555 64.1  ? 
4  OD1 ? A ASN 64  ? A ASN 52  ? 1_555 K  ? C K  . ? A K  491 ? 1_555 OD1 ? A ASP 126 ? A ASP 114 ? 1_555 111.0 ? 
5  O   ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 OD1 ? A ASP 126 ? A ASP 114 ? 1_555 58.7  ? 
6  OD2 ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 OD1 ? A ASP 126 ? A ASP 114 ? 1_555 37.6  ? 
7  OD1 ? A ASN 64  ? A ASN 52  ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A PHE 129 ? A PHE 117 ? 1_555 72.5  ? 
8  O   ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A PHE 129 ? A PHE 117 ? 1_555 155.8 ? 
9  OD2 ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A PHE 129 ? A PHE 117 ? 1_555 117.7 ? 
10 OD1 ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A PHE 129 ? A PHE 117 ? 1_555 106.7 ? 
11 OD1 ? A ASN 64  ? A ASN 52  ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A VAL 158 ? A VAL 146 ? 1_555 77.6  ? 
12 O   ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A VAL 158 ? A VAL 146 ? 1_555 89.8  ? 
13 OD2 ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A VAL 158 ? A VAL 146 ? 1_555 123.2 ? 
14 OD1 ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A VAL 158 ? A VAL 146 ? 1_555 147.2 ? 
15 O   ? A PHE 129 ? A PHE 117 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A VAL 158 ? A VAL 146 ? 1_555 106.1 ? 
16 OD1 ? A ASN 64  ? A ASN 52  ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A VAL 160 ? A VAL 148 ? 1_555 129.6 ? 
17 O   ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A VAL 160 ? A VAL 148 ? 1_555 123.9 ? 
18 OD2 ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A VAL 160 ? A VAL 148 ? 1_555 82.8  ? 
19 OD1 ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A VAL 160 ? A VAL 148 ? 1_555 116.7 ? 
20 O   ? A PHE 129 ? A PHE 117 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A VAL 160 ? A VAL 148 ? 1_555 79.2  ? 
21 O   ? A VAL 158 ? A VAL 146 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A VAL 160 ? A VAL 148 ? 1_555 71.4  ? 
22 OD1 ? A ASN 64  ? A ASN 52  ? 1_555 K  ? C K  . ? A K  491 ? 1_555 OG  ? A SER 162 ? A SER 150 ? 1_555 103.4 ? 
23 O   ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 OG  ? A SER 162 ? A SER 150 ? 1_555 101.9 ? 
24 OD2 ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 OG  ? A SER 162 ? A SER 150 ? 1_555 61.8  ? 
25 OD1 ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 OG  ? A SER 162 ? A SER 150 ? 1_555 43.9  ? 
26 O   ? A PHE 129 ? A PHE 117 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 OG  ? A SER 162 ? A SER 150 ? 1_555 63.5  ? 
27 O   ? A VAL 158 ? A VAL 146 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 OG  ? A SER 162 ? A SER 150 ? 1_555 168.1 ? 
28 O   ? A VAL 160 ? A VAL 148 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 OG  ? A SER 162 ? A SER 150 ? 1_555 99.9  ? 
29 O2G ? F BA3 .   ? A BA3 494 ? 1_555 MG ? D MG . ? A MG 492 ? 1_555 O   ? H HOH .   ? A HOH 573 ? 1_555 81.6  ? 
30 O2G ? F BA3 .   ? A BA3 494 ? 1_555 MG ? D MG . ? A MG 492 ? 1_555 O   ? H HOH .   ? A HOH 574 ? 1_555 111.5 ? 
31 O   ? H HOH .   ? A HOH 573 ? 1_555 MG ? D MG . ? A MG 492 ? 1_555 O   ? H HOH .   ? A HOH 574 ? 1_555 95.0  ? 
32 O2G ? F BA3 .   ? A BA3 494 ? 1_555 MG ? D MG . ? A MG 492 ? 1_555 O   ? H HOH .   ? A HOH 579 ? 1_555 120.9 ? 
33 O   ? H HOH .   ? A HOH 573 ? 1_555 MG ? D MG . ? A MG 492 ? 1_555 O   ? H HOH .   ? A HOH 579 ? 1_555 83.3  ? 
34 O   ? H HOH .   ? A HOH 574 ? 1_555 MG ? D MG . ? A MG 492 ? 1_555 O   ? H HOH .   ? A HOH 579 ? 1_555 126.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-06-22 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2012-09-19 
4 'Structure model' 1 3 2012-10-31 
5 'Structure model' 1 4 2022-04-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
3 4 'Structure model' 'Database references'       
4 5 'Structure model' 'Database references'       
5 5 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' audit_author           
2 5 'Structure model' citation_author        
3 5 'Structure model' database_2             
4 5 'Structure model' pdbx_struct_conn_angle 
5 5 'Structure model' struct_conn            
6 5 'Structure model' struct_ref_seq_dif     
7 5 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  5 'Structure model' '_audit_author.identifier_ORCID'              
2  5 'Structure model' '_citation_author.identifier_ORCID'           
3  5 'Structure model' '_database_2.pdbx_DOI'                        
4  5 'Structure model' '_database_2.pdbx_database_accession'         
5  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
6  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
7  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
8  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
9  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
17 5 'Structure model' '_pdbx_struct_conn_angle.value'               
18 5 'Structure model' '_struct_conn.pdbx_dist_value'                
19 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
20 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
21 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
22 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
23 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
24 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
25 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
26 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
27 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
28 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
29 5 'Structure model' '_struct_ref_seq_dif.details'                 
30 5 'Structure model' '_struct_site.pdbx_auth_asym_id'              
31 5 'Structure model' '_struct_site.pdbx_auth_comp_id'              
32 5 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
_diffrn_reflns.av_R_equivalents   0.077 
_diffrn_reflns.number             375736 
_diffrn_reflns.diffrn_id          1 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 2.9860   54.3380 12.5410 0.3761 0.0823 0.0698 -0.0867 0.1080  -0.0557 10.0914 8.5770 6.6851  2.9075  0.7988   -0.0558 
0.2667  -0.3063 0.0396  -0.6343 0.4513  0.2843  0.9105  -0.5690 0.3940  'X-RAY DIFFRACTION' 
2 ? refined -16.0240 44.9240 2.8300  0.1365 0.1110 0.0453 0.0372  0.0228  -0.0055 2.2161  2.2656 3.7115  0.0167  -1.1238  -0.0939 
0.1404  -0.0863 -0.0542 0.3460  -0.0101 0.2917  -0.0638 -0.1571 -0.5965 'X-RAY DIFFRACTION' 
3 ? refined -14.3800 40.2640 18.5960 0.1474 0.0196 0.0814 -0.0043 0.0466  0.0108  2.5127  1.6040 4.2232  -0.0113 -0.2965  0.1856  
-0.0652 -0.0100 0.0751  -0.0817 0.0021  0.1942  0.0320  -0.0799 -0.2073 'X-RAY DIFFRACTION' 
4 ? refined 6.6340   42.3340 18.5870 0.3780 0.4002 0.2243 -0.1395 0.0151  0.1142  -1.0550 2.7839 4.3293  0.4488  -0.9216  -3.3557 
0.1314  -0.5123 0.3809  -0.1054 -0.1242 -0.2146 0.4941  -0.7781 0.9120  'X-RAY DIFFRACTION' 
5 ? refined 18.6660  19.6150 28.4380 0.0899 0.1209 0.1453 -0.0155 0.1197  -0.0044 5.8794  6.5970 2.2196  -4.9470 1.6172   -0.5217 
0.3631  -0.2684 -0.0948 0.4209  0.2912  -0.2384 -0.2731 0.0179  0.2154  'X-RAY DIFFRACTION' 
6 ? refined 6.8390   18.8170 52.0120 0.0941 0.1120 0.0230 0.0004  -0.0070 -0.0404 1.0945  1.8841 1.7052  -0.0438 0.0088   0.1151  
0.0245  0.0318  -0.0563 -0.2349 0.1252  -0.1079 0.2861  -0.1139 0.0020  'X-RAY DIFFRACTION' 
7 ? refined 1.1390   29.3820 36.8580 0.1012 0.0541 0.0727 0.0006  0.0576  0.0063  1.0571  1.2349 1.0492  -0.2780 0.2869   0.1318  
0.0008  0.0614  -0.0623 -0.0340 0.1452  -0.0891 -0.0105 -0.1880 -0.0078 'X-RAY DIFFRACTION' 
8 ? refined 5.1410   13.7630 26.3730 0.1079 0.1008 0.0571 0.0157  0.0130  0.0200  9.6976  4.3073 15.2998 1.9493  -11.0733 -2.5560 
0.0920  -0.0267 -0.0653 0.4767  0.0394  -0.0675 -0.3559 0.0200  -0.1514 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 0   A 18  ? . . . . 'X-RAY DIFFRACTION' ? 
2 2 A 19  A 117 ? . . . . 'X-RAY DIFFRACTION' ? 
3 3 A 118 A 194 ? . . . . 'X-RAY DIFFRACTION' ? 
4 4 A 195 A 212 ? . . . . 'X-RAY DIFFRACTION' ? 
5 5 A 213 A 232 ? . . . . 'X-RAY DIFFRACTION' ? 
6 6 A 233 A 352 ? . . . . 'X-RAY DIFFRACTION' ? 
7 7 A 353 A 475 ? . . . . 'X-RAY DIFFRACTION' ? 
8 8 A 476 A 489 ? . . . . 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      5.5.0109 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 1 
PDB_EXTRACT 3.006    'June 11, 2008' package PDB                  help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 2 
HKL-3000    .        ?               ?       ?                    ?                     'data collection' ? ?          ? 3 
HKL-3000    .        ?               ?       ?                    ?                     'data reduction'  ? ?          ? 4 
HKL-3000    .        ?               ?       ?                    ?                     'data scaling'    ? ?          ? 5 
HKL-3000    MOLREP   ?               ?       ?                    ?                     phasing           ? ?          ? 6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 77  ? ? -102.73 -71.96  
2 1 ASP A 147 ? ? 73.05   -61.13  
3 1 ARG A 161 ? ? 71.06   -56.20  
4 1 ARG A 223 ? ? -119.17 79.32   
5 1 GLU A 336 ? ? -102.04 55.49   
6 1 ALA A 343 ? ? 58.07   -124.07 
7 1 TYR A 383 ? ? 58.89   18.84   
8 1 SER A 403 ? ? -178.57 -177.33 
9 1 GLN A 467 ? ? -111.82 -167.43 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A HIS 0   ? CB  ? A HIS 12 CB  
2  1 Y 1 A HIS 0   ? CG  ? A HIS 12 CG  
3  1 Y 1 A HIS 0   ? ND1 ? A HIS 12 ND1 
4  1 Y 1 A HIS 0   ? CD2 ? A HIS 12 CD2 
5  1 Y 1 A HIS 0   ? CE1 ? A HIS 12 CE1 
6  1 Y 1 A HIS 0   ? NE2 ? A HIS 12 NE2 
7  1 N 1 A BA3 493 ? C5D ? E BA3 1  C5D 
8  1 N 1 A BA3 493 ? C4D ? E BA3 1  C4D 
9  1 N 1 A BA3 493 ? O4D ? E BA3 1  O4D 
10 1 N 1 A BA3 493 ? C3D ? E BA3 1  C3D 
11 1 N 1 A BA3 493 ? O3D ? E BA3 1  O3D 
12 1 N 1 A BA3 493 ? C2D ? E BA3 1  C2D 
13 1 N 1 A BA3 493 ? O2D ? E BA3 1  O2D 
14 1 N 1 A BA3 493 ? C1D ? E BA3 1  C1D 
15 1 N 1 A BA3 493 ? N9G ? E BA3 1  N9G 
16 1 N 1 A BA3 493 ? C8G ? E BA3 1  C8G 
17 1 N 1 A BA3 493 ? N7G ? E BA3 1  N7G 
18 1 N 1 A BA3 493 ? C5G ? E BA3 1  C5G 
19 1 N 1 A BA3 493 ? C6G ? E BA3 1  C6G 
20 1 N 1 A BA3 493 ? N6G ? E BA3 1  N6G 
21 1 N 1 A BA3 493 ? N1G ? E BA3 1  N1G 
22 1 N 1 A BA3 493 ? C2G ? E BA3 1  C2G 
23 1 N 1 A BA3 493 ? N3G ? E BA3 1  N3G 
24 1 N 1 A BA3 493 ? C4G ? E BA3 1  C4G 
25 1 N 1 A BA3 494 ? N9A ? F BA3 1  N9A 
26 1 N 1 A BA3 494 ? C8A ? F BA3 1  C8A 
27 1 N 1 A BA3 494 ? N7A ? F BA3 1  N7A 
28 1 N 1 A BA3 494 ? C5A ? F BA3 1  C5A 
29 1 N 1 A BA3 494 ? C6A ? F BA3 1  C6A 
30 1 N 1 A BA3 494 ? N6A ? F BA3 1  N6A 
31 1 N 1 A BA3 494 ? N1A ? F BA3 1  N1A 
32 1 N 1 A BA3 494 ? C2A ? F BA3 1  C2A 
33 1 N 1 A BA3 494 ? N3A ? F BA3 1  N3A 
34 1 N 1 A BA3 494 ? C4A ? F BA3 1  C4A 
35 1 N 1 A BA3 494 ? O5B ? F BA3 1  O5B 
36 1 N 1 A BA3 494 ? C5B ? F BA3 1  C5B 
37 1 N 1 A BA3 494 ? C4B ? F BA3 1  C4B 
38 1 N 1 A BA3 494 ? O4B ? F BA3 1  O4B 
39 1 N 1 A BA3 494 ? C3B ? F BA3 1  C3B 
40 1 N 1 A BA3 494 ? O3B ? F BA3 1  O3B 
41 1 N 1 A BA3 494 ? C2B ? F BA3 1  C2B 
42 1 N 1 A BA3 494 ? O2B ? F BA3 1  O2B 
43 1 N 1 A BA3 494 ? C1B ? F BA3 1  C1B 
44 1 N 1 A BA3 494 ? PE  ? F BA3 1  PE  
45 1 N 1 A BA3 494 ? O1E ? F BA3 1  O1E 
46 1 N 1 A BA3 494 ? O2E ? F BA3 1  O2E 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -11 ? A MET 1   
2  1 Y 1 A GLY -10 ? A GLY 2   
3  1 Y 1 A SER -9  ? A SER 3   
4  1 Y 1 A ASP -8  ? A ASP 4   
5  1 Y 1 A LYS -7  ? A LYS 5   
6  1 Y 1 A ILE -6  ? A ILE 6   
7  1 Y 1 A HIS -5  ? A HIS 7   
8  1 Y 1 A HIS -4  ? A HIS 8   
9  1 Y 1 A HIS -3  ? A HIS 9   
10 1 Y 1 A HIS -2  ? A HIS 10  
11 1 Y 1 A HIS -1  ? A HIS 11  
12 1 Y 1 A GLU 490 ? A GLU 502 
# 
_cell_measurement.reflns_used   375736 
_cell_measurement.entry_id      3RS9 
# 
_diffrn_measurement.method      '\w scans' 
_diffrn_measurement.details     '1.00 degrees, 6.7 sec, detector distance 250.00 mm' 
_diffrn_measurement.diffrn_id   1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'POTASSIUM ION'                  K   
4 'MAGNESIUM ION'                  MG  
5 "BIS(ADENOSINE)-5'-TRIPHOSPHATE" BA3 
6 GLYCEROL                         GOL 
7 water                            HOH 
#