data_3RTC
# 
_entry.id   3RTC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.357 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   3RTC         pdb_00003rtc 10.2210/pdb3rtc/pdb 
RCSB  RCSB065351   ?            ?                   
WWPDB D_1000065351 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2AX3 Apo-protein unspecified 
PDB 3RNO .           unspecified 
PDB 3RO7 .           unspecified 
PDB 3ROE .           unspecified 
PDB 3ROG .           unspecified 
PDB 3ROX .           unspecified 
PDB 3ROZ .           unspecified 
PDB 3RRB .           unspecified 
PDB 3RRE .           unspecified 
PDB 3RRF .           unspecified 
PDB 3RRJ .           unspecified 
PDB 3RS8 .           unspecified 
PDB 3RS9 .           unspecified 
PDB 3RSF .           unspecified 
PDB 3RSG .           unspecified 
PDB 3RSQ .           unspecified 
PDB 3RSS .           unspecified 
PDB 3RT7 .           unspecified 
PDB 3RT9 .           unspecified 
PDB 3RTA .           unspecified 
PDB 3RTB .           unspecified 
PDB 3RTD .           unspecified 
PDB 3RTE .           unspecified 
PDB 3RTG .           unspecified 
PDB 3RU2 .           unspecified 
PDB 3RU3 .           unspecified 
# 
_pdbx_database_status.entry_id                        3RTC 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-05-03 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Shumilin, I.A.'  1 ?                   
'Cymborowski, M.' 2 ?                   
'Lesley, S.A.'    3 ?                   
'Minor, W.'       4 0000-0001-7075-7090 
# 
_citation.id                        primary 
_citation.title                     'Identification of unknown protein function using metabolite cocktail screening.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            20 
_citation.page_first                1715 
_citation.page_last                 1725 
_citation.year                      2012 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22940582 
_citation.pdbx_database_id_DOI      10.1016/j.str.2012.07.016 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shumilin, I.A.'  1 ?                   
primary 'Cymborowski, M.' 2 ?                   
primary 'Chertihin, O.'   3 ?                   
primary 'Jha, K.N.'       4 ?                   
primary 'Herr, J.C.'      5 ?                   
primary 'Lesley, S.A.'    6 ?                   
primary 'Joachimiak, A.'  7 ?                   
primary 'Minor, W.'       8 0000-0001-7075-7090 
# 
_cell.entry_id           3RTC 
_cell.length_a           122.399 
_cell.length_b           122.399 
_cell.length_c           155.122 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              16 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3RTC 
_symmetry.space_group_name_H-M             'I 4 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                97 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Putative uncharacterized protein'               54527.617 1   4.2.1.93 ? ? ? 
2 polymer     nat 'Unknown peptide, probably from expression host' 904.019   1   ?        ? ? ? 
3 non-polymer syn 'POTASSIUM ION'                                  39.098    1   ?        ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                  24.305    1   ?        ? ? ? 
5 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE                663.425   2   ?        ? ? ? 
6 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE"                      507.181   1   ?        ? ? ? 
7 water       nat water                                            18.015    125 ?        ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MGSDKIHHHHHHMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVK
DVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDV
PSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSH
KGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKD
VDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELA
EEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQD
ERGLTASELLRLIPEAIRRLKE
;
;MGSDKIHHHHHHMKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVK
DVLVVFLGKKKTPDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDV
PSGIDSNTGKVLRTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSH
KGTYGKVLIIAGSRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKD
VDVVAIGPGLGNNEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELA
EEFAKENDCVLVLKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQD
ERGLTASELLRLIPEAIRRLKE
;
A 282791 
2 'polypeptide(L)' no no APAWLFEA APAWLFEA B ?      
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   ASP n 
1 5   LYS n 
1 6   ILE n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  HIS n 
1 12  HIS n 
1 13  MET n 
1 14  LYS n 
1 15  GLU n 
1 16  ILE n 
1 17  ASP n 
1 18  GLU n 
1 19  LEU n 
1 20  THR n 
1 21  ILE n 
1 22  LYS n 
1 23  GLU n 
1 24  TYR n 
1 25  GLY n 
1 26  VAL n 
1 27  ASP n 
1 28  SER n 
1 29  ARG n 
1 30  ILE n 
1 31  LEU n 
1 32  MET n 
1 33  GLU n 
1 34  ARG n 
1 35  ALA n 
1 36  GLY n 
1 37  ILE n 
1 38  SER n 
1 39  VAL n 
1 40  VAL n 
1 41  LEU n 
1 42  ALA n 
1 43  MET n 
1 44  GLU n 
1 45  GLU n 
1 46  GLU n 
1 47  LEU n 
1 48  GLY n 
1 49  ASN n 
1 50  LEU n 
1 51  SER n 
1 52  ASP n 
1 53  TYR n 
1 54  ARG n 
1 55  PHE n 
1 56  LEU n 
1 57  VAL n 
1 58  LEU n 
1 59  CYS n 
1 60  GLY n 
1 61  GLY n 
1 62  GLY n 
1 63  ASN n 
1 64  ASN n 
1 65  GLY n 
1 66  GLY n 
1 67  ASP n 
1 68  GLY n 
1 69  PHE n 
1 70  VAL n 
1 71  VAL n 
1 72  ALA n 
1 73  ARG n 
1 74  ASN n 
1 75  LEU n 
1 76  LEU n 
1 77  GLY n 
1 78  VAL n 
1 79  VAL n 
1 80  LYS n 
1 81  ASP n 
1 82  VAL n 
1 83  LEU n 
1 84  VAL n 
1 85  VAL n 
1 86  PHE n 
1 87  LEU n 
1 88  GLY n 
1 89  LYS n 
1 90  LYS n 
1 91  LYS n 
1 92  THR n 
1 93  PRO n 
1 94  ASP n 
1 95  CYS n 
1 96  GLU n 
1 97  TYR n 
1 98  ASN n 
1 99  TYR n 
1 100 GLY n 
1 101 LEU n 
1 102 TYR n 
1 103 LYS n 
1 104 LYS n 
1 105 PHE n 
1 106 GLY n 
1 107 GLY n 
1 108 LYS n 
1 109 VAL n 
1 110 VAL n 
1 111 GLU n 
1 112 GLN n 
1 113 PHE n 
1 114 GLU n 
1 115 PRO n 
1 116 SER n 
1 117 ILE n 
1 118 LEU n 
1 119 ASN n 
1 120 GLU n 
1 121 PHE n 
1 122 ASP n 
1 123 VAL n 
1 124 VAL n 
1 125 VAL n 
1 126 ASP n 
1 127 ALA n 
1 128 ILE n 
1 129 PHE n 
1 130 GLY n 
1 131 THR n 
1 132 GLY n 
1 133 LEU n 
1 134 ARG n 
1 135 GLY n 
1 136 GLU n 
1 137 ILE n 
1 138 THR n 
1 139 GLY n 
1 140 GLU n 
1 141 TYR n 
1 142 ALA n 
1 143 GLU n 
1 144 ILE n 
1 145 ILE n 
1 146 ASN n 
1 147 LEU n 
1 148 VAL n 
1 149 ASN n 
1 150 LYS n 
1 151 SER n 
1 152 GLY n 
1 153 LYS n 
1 154 VAL n 
1 155 VAL n 
1 156 VAL n 
1 157 SER n 
1 158 VAL n 
1 159 ASP n 
1 160 VAL n 
1 161 PRO n 
1 162 SER n 
1 163 GLY n 
1 164 ILE n 
1 165 ASP n 
1 166 SER n 
1 167 ASN n 
1 168 THR n 
1 169 GLY n 
1 170 LYS n 
1 171 VAL n 
1 172 LEU n 
1 173 ARG n 
1 174 THR n 
1 175 ALA n 
1 176 VAL n 
1 177 LYS n 
1 178 ALA n 
1 179 ASP n 
1 180 LEU n 
1 181 THR n 
1 182 VAL n 
1 183 THR n 
1 184 PHE n 
1 185 GLY n 
1 186 VAL n 
1 187 PRO n 
1 188 LYS n 
1 189 ILE n 
1 190 GLY n 
1 191 HIS n 
1 192 ILE n 
1 193 LEU n 
1 194 PHE n 
1 195 PRO n 
1 196 GLY n 
1 197 ARG n 
1 198 ASP n 
1 199 LEU n 
1 200 THR n 
1 201 GLY n 
1 202 LYS n 
1 203 LEU n 
1 204 LYS n 
1 205 VAL n 
1 206 ALA n 
1 207 ASN n 
1 208 ILE n 
1 209 GLY n 
1 210 HIS n 
1 211 PRO n 
1 212 VAL n 
1 213 HIS n 
1 214 LEU n 
1 215 ILE n 
1 216 ASN n 
1 217 SER n 
1 218 ILE n 
1 219 ASN n 
1 220 ARG n 
1 221 TYR n 
1 222 VAL n 
1 223 ILE n 
1 224 THR n 
1 225 ARG n 
1 226 GLU n 
1 227 MET n 
1 228 VAL n 
1 229 ARG n 
1 230 SER n 
1 231 LEU n 
1 232 LEU n 
1 233 PRO n 
1 234 GLU n 
1 235 ARG n 
1 236 PRO n 
1 237 ARG n 
1 238 ASP n 
1 239 SER n 
1 240 HIS n 
1 241 LYS n 
1 242 GLY n 
1 243 THR n 
1 244 TYR n 
1 245 GLY n 
1 246 LYS n 
1 247 VAL n 
1 248 LEU n 
1 249 ILE n 
1 250 ILE n 
1 251 ALA n 
1 252 GLY n 
1 253 SER n 
1 254 ARG n 
1 255 LEU n 
1 256 TYR n 
1 257 SER n 
1 258 GLY n 
1 259 ALA n 
1 260 PRO n 
1 261 VAL n 
1 262 LEU n 
1 263 SER n 
1 264 GLY n 
1 265 MET n 
1 266 GLY n 
1 267 SER n 
1 268 LEU n 
1 269 LYS n 
1 270 VAL n 
1 271 GLY n 
1 272 THR n 
1 273 GLY n 
1 274 LEU n 
1 275 VAL n 
1 276 LYS n 
1 277 LEU n 
1 278 ALA n 
1 279 VAL n 
1 280 PRO n 
1 281 PHE n 
1 282 PRO n 
1 283 GLN n 
1 284 ASN n 
1 285 LEU n 
1 286 ILE n 
1 287 ALA n 
1 288 THR n 
1 289 SER n 
1 290 ARG n 
1 291 PHE n 
1 292 PRO n 
1 293 GLU n 
1 294 LEU n 
1 295 ILE n 
1 296 SER n 
1 297 VAL n 
1 298 PRO n 
1 299 ILE n 
1 300 ASP n 
1 301 THR n 
1 302 GLU n 
1 303 LYS n 
1 304 GLY n 
1 305 PHE n 
1 306 PHE n 
1 307 SER n 
1 308 LEU n 
1 309 GLN n 
1 310 ASN n 
1 311 LEU n 
1 312 GLN n 
1 313 GLU n 
1 314 CYS n 
1 315 LEU n 
1 316 GLU n 
1 317 LEU n 
1 318 SER n 
1 319 LYS n 
1 320 ASP n 
1 321 VAL n 
1 322 ASP n 
1 323 VAL n 
1 324 VAL n 
1 325 ALA n 
1 326 ILE n 
1 327 GLY n 
1 328 PRO n 
1 329 GLY n 
1 330 LEU n 
1 331 GLY n 
1 332 ASN n 
1 333 ASN n 
1 334 GLU n 
1 335 HIS n 
1 336 VAL n 
1 337 ARG n 
1 338 GLU n 
1 339 PHE n 
1 340 VAL n 
1 341 ASN n 
1 342 GLU n 
1 343 PHE n 
1 344 LEU n 
1 345 LYS n 
1 346 THR n 
1 347 LEU n 
1 348 GLU n 
1 349 LYS n 
1 350 PRO n 
1 351 ALA n 
1 352 VAL n 
1 353 ILE n 
1 354 ASP n 
1 355 ALA n 
1 356 ASP n 
1 357 ALA n 
1 358 ILE n 
1 359 ASN n 
1 360 VAL n 
1 361 LEU n 
1 362 ASP n 
1 363 THR n 
1 364 SER n 
1 365 VAL n 
1 366 LEU n 
1 367 LYS n 
1 368 GLU n 
1 369 ARG n 
1 370 LYS n 
1 371 SER n 
1 372 PRO n 
1 373 ALA n 
1 374 VAL n 
1 375 LEU n 
1 376 THR n 
1 377 PRO n 
1 378 HIS n 
1 379 PRO n 
1 380 GLY n 
1 381 GLU n 
1 382 MET n 
1 383 ALA n 
1 384 ARG n 
1 385 LEU n 
1 386 VAL n 
1 387 LYS n 
1 388 LYS n 
1 389 THR n 
1 390 VAL n 
1 391 GLY n 
1 392 ASP n 
1 393 VAL n 
1 394 LYS n 
1 395 TYR n 
1 396 ASN n 
1 397 TYR n 
1 398 GLU n 
1 399 LEU n 
1 400 ALA n 
1 401 GLU n 
1 402 GLU n 
1 403 PHE n 
1 404 ALA n 
1 405 LYS n 
1 406 GLU n 
1 407 ASN n 
1 408 ASP n 
1 409 CYS n 
1 410 VAL n 
1 411 LEU n 
1 412 VAL n 
1 413 LEU n 
1 414 LYS n 
1 415 SER n 
1 416 ALA n 
1 417 THR n 
1 418 THR n 
1 419 ILE n 
1 420 VAL n 
1 421 THR n 
1 422 ASP n 
1 423 GLY n 
1 424 GLU n 
1 425 LYS n 
1 426 THR n 
1 427 LEU n 
1 428 PHE n 
1 429 ASN n 
1 430 ILE n 
1 431 THR n 
1 432 GLY n 
1 433 ASN n 
1 434 THR n 
1 435 GLY n 
1 436 LEU n 
1 437 SER n 
1 438 LYS n 
1 439 GLY n 
1 440 GLY n 
1 441 SER n 
1 442 GLY n 
1 443 ASP n 
1 444 VAL n 
1 445 LEU n 
1 446 THR n 
1 447 GLY n 
1 448 MET n 
1 449 ILE n 
1 450 ALA n 
1 451 GLY n 
1 452 PHE n 
1 453 ILE n 
1 454 ALA n 
1 455 GLN n 
1 456 GLY n 
1 457 LEU n 
1 458 SER n 
1 459 PRO n 
1 460 LEU n 
1 461 GLU n 
1 462 ALA n 
1 463 SER n 
1 464 THR n 
1 465 VAL n 
1 466 SER n 
1 467 VAL n 
1 468 TYR n 
1 469 LEU n 
1 470 HIS n 
1 471 GLY n 
1 472 PHE n 
1 473 ALA n 
1 474 ALA n 
1 475 GLU n 
1 476 LEU n 
1 477 PHE n 
1 478 GLU n 
1 479 GLN n 
1 480 ASP n 
1 481 GLU n 
1 482 ARG n 
1 483 GLY n 
1 484 LEU n 
1 485 THR n 
1 486 ALA n 
1 487 SER n 
1 488 GLU n 
1 489 LEU n 
1 490 LEU n 
1 491 ARG n 
1 492 LEU n 
1 493 ILE n 
1 494 PRO n 
1 495 GLU n 
1 496 ALA n 
1 497 ILE n 
1 498 ARG n 
1 499 ARG n 
1 500 LEU n 
1 501 LYS n 
1 502 GLU n 
2 1   ALA n 
2 2   PRO n 
2 3   ALA n 
2 4   TRP n 
2 5   LEU n 
2 6   PHE n 
2 7   GLU n 
2 8   ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Thermotoga 
_entity_src_gen.pdbx_gene_src_gene                 'tm0922, TM_0922' 
_entity_src_gen.gene_src_species                   'Thermotoga maritima' 
_entity_src_gen.gene_src_strain                    MSB8 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermotoga maritima' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     243274 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pMH1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_entity_src_nat.entity_id                  2 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Escherichia coli' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      469008 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     'BL21(DE3)' 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    'Unknown peptide, probably from expression host' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q9X024_THEMA Q9X024 1 
;MKEIDELTIKEYGVDSRILMERAGISVVLAMEEELGNLSDYRFLVLCGGGNNGGDGFVVARNLLGVVKDVLVVFLGKKKT
PDCEYNYGLYKKFGGKVVEQFEPSILNEFDVVVDAIFGTGLRGEITGEYAEIINLVNKSGKVVVSVDVPSGIDSNTGKVL
RTAVKADLTVTFGVPKIGHILFPGRDLTGKLKVANIGHPVHLINSINRYVITREMVRSLLPERPRDSHKGTYGKVLIIAG
SRLYSGAPVLSGMGSLKVGTGLVKLAVPFPQNLIATSRFPELISVPIDTEKGFFSLQNLQECLELSKDVDVVAIGPGLGN
NEHVREFVNEFLKTLEKPAVIDADAINVLDTSVLKERKSPAVLTPHPGEMARLVKKTVGDVKYNYELAEEFAKENDCVLV
LKSATTIVTDGEKTLFNITGNTGLSKGGSGDVLTGMIAGFIAQGLSPLEASTVSVYLHGFAAELFEQDERGLTASELLRL
IPEAIRRLKE
;
1 ? 
2 PDB 3RTC         3RTC   2 APAWLFEA 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3RTC A 13 ? 502 ? Q9X024 1 ? 490 ? 1 490 
2 2 3RTC B 1  ? 8   ? 3RTC   0 ? 7   ? 0 7   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3RTC MET A 1  ? UNP Q9X024 ? ? 'expression tag' -11 1  
1 3RTC GLY A 2  ? UNP Q9X024 ? ? 'expression tag' -10 2  
1 3RTC SER A 3  ? UNP Q9X024 ? ? 'expression tag' -9  3  
1 3RTC ASP A 4  ? UNP Q9X024 ? ? 'expression tag' -8  4  
1 3RTC LYS A 5  ? UNP Q9X024 ? ? 'expression tag' -7  5  
1 3RTC ILE A 6  ? UNP Q9X024 ? ? 'expression tag' -6  6  
1 3RTC HIS A 7  ? UNP Q9X024 ? ? 'expression tag' -5  7  
1 3RTC HIS A 8  ? UNP Q9X024 ? ? 'expression tag' -4  8  
1 3RTC HIS A 9  ? UNP Q9X024 ? ? 'expression tag' -3  9  
1 3RTC HIS A 10 ? UNP Q9X024 ? ? 'expression tag' -2  10 
1 3RTC HIS A 11 ? UNP Q9X024 ? ? 'expression tag' -1  11 
1 3RTC HIS A 12 ? UNP Q9X024 ? ? 'expression tag' 0   12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                          ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ? 'C4 H7 N O4'        133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE"       ? 'C10 H16 N5 O13 P3' 507.181 
CYS 'L-peptide linking' y CYSTEINE                          ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                           ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                         ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                             ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ? 'C6 H13 N O2'       131.173 
K   non-polymer         . 'POTASSIUM ION'                   ? 'K 1'               39.098  
LEU 'L-peptide linking' y LEUCINE                           ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                            ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                        ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                   ? 'Mg 2'              24.305  
NAD non-polymer         . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ? 'C21 H27 N7 O14 P2' 663.425 
PHE 'L-peptide linking' y PHENYLALANINE                     ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                           ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                            ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                         ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                          ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                            ? 'C5 H11 N O2'       117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3RTC 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.62 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   53.06 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    '0.1M Na Cacodylate, 1.6 M Na Citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 210r' 
_diffrn_detector.details                MIRRORS 
_diffrn_detector.pdbx_collection_date   2009-06-11 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
# 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            2.10 
_reflns.number_obs                   34258 
_reflns.number_all                   34592 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            0.054 
_reflns.pdbx_Rsym_value              0.054 
_reflns.pdbx_netI_over_sigmaI        42.952 
_reflns.pdbx_redundancy              9.0 
_reflns.entry_id                     3RTC 
_reflns.B_iso_Wilson_estimate        38.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.10 
_reflns_shell.d_res_low              2.14 
_reflns_shell.percent_possible_all   98.6 
_reflns_shell.Rmerge_I_obs           0.745 
_reflns_shell.pdbx_Rsym_value        0.745 
_reflns_shell.meanI_over_sigI_obs    2.923 
_reflns_shell.pdbx_redundancy        8.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3RTC 
_refine.ls_d_res_high                            2.101 
_refine.ls_d_res_low                             50.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.050 
_refine.ls_number_reflns_obs                     34258 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
;HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS   
U VALUES      : RESIDUAL ONLY
;
_refine.ls_R_factor_obs                          0.171 
_refine.ls_R_factor_R_work                       0.169 
_refine.ls_R_factor_R_free                       0.209 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1722 
_refine.B_iso_mean                               45.939 
_refine.aniso_B[1][1]                            0.060 
_refine.aniso_B[2][2]                            0.060 
_refine.aniso_B[3][3]                            -0.120 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.968 
_refine.correlation_coeff_Fo_to_Fc_free          0.951 
_refine.pdbx_overall_ESU_R_Free                  0.158 
_refine.overall_SU_ML                            0.106 
_refine.overall_SU_B                             8.315 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.200 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.B_iso_max                                121.83 
_refine.B_iso_min                                25.00 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2AX3' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       0.259 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3785 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         96 
_refine_hist.number_atoms_solvent             125 
_refine_hist.number_atoms_total               4006 
_refine_hist.d_res_high                       2.101 
_refine_hist.d_res_low                        50.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
_refine_ls_restr.pdbx_refine_id 
r_bond_refined_d       3947 0.019  0.022  ? ? 'X-RAY DIFFRACTION' 
r_bond_other_d         2643 0.000  0.020  ? ? 'X-RAY DIFFRACTION' 
r_angle_refined_deg    5361 1.763  2.019  ? ? 'X-RAY DIFFRACTION' 
r_angle_other_deg      6500 4.206  3.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_1_deg 495  6.044  5.000  ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_2_deg 152  37.475 24.539 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_3_deg 684  14.174 15.000 ? ? 'X-RAY DIFFRACTION' 
r_dihedral_angle_4_deg 21   14.625 15.000 ? ? 'X-RAY DIFFRACTION' 
r_chiral_restr         631  0.104  0.200  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_refined   4279 0.007  0.021  ? ? 'X-RAY DIFFRACTION' 
r_gen_planes_other     736  0.008  0.020  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_it            2453 0.891  1.500  ? ? 'X-RAY DIFFRACTION' 
r_mcbond_other         1022 0.000  1.500  ? ? 'X-RAY DIFFRACTION' 
r_mcangle_it           3960 1.631  2.000  ? ? 'X-RAY DIFFRACTION' 
r_scbond_it            1494 2.891  3.000  ? ? 'X-RAY DIFFRACTION' 
r_scangle_it           1401 4.849  4.500  ? ? 'X-RAY DIFFRACTION' 
# 
_refine_ls_shell.d_res_high                       2.101 
_refine_ls_shell.d_res_low                        2.156 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               96.830 
_refine_ls_shell.number_reflns_R_work             2303 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.216 
_refine_ls_shell.R_factor_R_free                  0.265 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             137 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2440 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3RTC 
_struct.title                     
;Crystal structure of tm0922, a fusion of a domain of unknown function and ADP/ATP-dependent NAD(P)H-hydrate dehydratase from Thermotoga maritima soaked with NAD and ATP.
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3RTC 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            'Unknown function, ADP/ATP-dependent NAD(P)H-hydrate dehydratase, LYASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 5 ? 
H N N 7 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  MET A 13  ? GLU A 23  ? MET A 1   GLU A 11  1 ? 11 
HELX_P HELX_P2  2  ASP A 27  ? GLY A 48  ? ASP A 15  GLY A 36  1 ? 22 
HELX_P HELX_P3  3  GLY A 62  ? LEU A 76  ? GLY A 50  LEU A 64  1 ? 15 
HELX_P HELX_P4  4  THR A 92  ? PHE A 105 ? THR A 80  PHE A 93  1 ? 14 
HELX_P HELX_P5  5  GLU A 114 ? PHE A 121 ? GLU A 102 PHE A 109 5 ? 8  
HELX_P HELX_P6  6  THR A 138 ? LYS A 150 ? THR A 126 LYS A 138 1 ? 13 
HELX_P HELX_P7  7  LYS A 188 ? LEU A 193 ? LYS A 176 LEU A 181 1 ? 6  
HELX_P HELX_P8  8  PRO A 195 ? GLY A 201 ? PRO A 183 GLY A 189 1 ? 7  
HELX_P HELX_P9  9  PRO A 211 ? ASN A 216 ? PRO A 199 ASN A 204 1 ? 6  
HELX_P HELX_P10 10 THR A 224 ? LEU A 232 ? THR A 212 LEU A 220 1 ? 9  
HELX_P HELX_P11 11 HIS A 240 ? TYR A 244 ? HIS A 228 TYR A 232 5 ? 5  
HELX_P HELX_P12 12 GLY A 258 ? VAL A 270 ? GLY A 246 VAL A 258 1 ? 13 
HELX_P HELX_P13 13 ASN A 284 ? PHE A 291 ? ASN A 272 PHE A 279 1 ? 8  
HELX_P HELX_P14 14 SER A 307 ? GLN A 309 ? SER A 295 GLN A 297 5 ? 3  
HELX_P HELX_P15 15 ASN A 310 ? LYS A 319 ? ASN A 298 LYS A 307 1 ? 10 
HELX_P HELX_P16 16 ASN A 333 ? LEU A 347 ? ASN A 321 LEU A 335 1 ? 15 
HELX_P HELX_P17 17 ASP A 354 ? VAL A 360 ? ASP A 342 VAL A 348 1 ? 7  
HELX_P HELX_P18 18 ASP A 362 ? ARG A 369 ? ASP A 350 ARG A 357 1 ? 8  
HELX_P HELX_P19 19 HIS A 378 ? LYS A 387 ? HIS A 366 LYS A 375 1 ? 10 
HELX_P HELX_P20 20 THR A 389 ? LYS A 394 ? THR A 377 LYS A 382 1 ? 6  
HELX_P HELX_P21 21 ASN A 396 ? ASP A 408 ? ASN A 384 ASP A 396 1 ? 13 
HELX_P HELX_P22 22 ASN A 433 ? SER A 437 ? ASN A 421 SER A 425 5 ? 5  
HELX_P HELX_P23 23 GLY A 440 ? GLN A 455 ? GLY A 428 GLN A 443 1 ? 16 
HELX_P HELX_P24 24 SER A 458 ? LEU A 476 ? SER A 446 LEU A 464 1 ? 19 
HELX_P HELX_P25 25 ASP A 480 ? LEU A 484 ? ASP A 468 LEU A 472 5 ? 5  
HELX_P HELX_P26 26 THR A 485 ? LYS A 501 ? THR A 473 LYS A 489 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A ASN 64  OD1 ? ? ? 1_555 C K   . K   ? ? A ASN 52  A K   491 1_555 ? ? ? ? ? ? ? 2.932 ? ? 
metalc2  metalc ? ? A ASP 126 O   ? ? ? 1_555 C K   . K   ? ? A ASP 114 A K   491 1_555 ? ? ? ? ? ? ? 2.937 ? ? 
metalc3  metalc ? ? A ASP 126 OD2 ? ? ? 1_555 C K   . K   ? ? A ASP 114 A K   491 1_555 ? ? ? ? ? ? ? 3.324 ? ? 
metalc4  metalc ? ? A PHE 129 O   ? ? ? 1_555 C K   . K   ? ? A PHE 117 A K   491 1_555 ? ? ? ? ? ? ? 2.794 ? ? 
metalc5  metalc ? ? A VAL 158 O   ? ? ? 1_555 C K   . K   ? ? A VAL 146 A K   491 1_555 ? ? ? ? ? ? ? 2.891 ? ? 
metalc6  metalc ? ? A VAL 160 O   ? ? ? 1_555 C K   . K   ? ? A VAL 148 A K   491 1_555 ? ? ? ? ? ? ? 2.793 ? ? 
metalc7  metalc ? ? A SER 162 OG  ? ? ? 1_555 C K   . K   ? ? A SER 150 A K   491 1_555 ? ? ? ? ? ? ? 2.911 ? ? 
metalc8  metalc ? ? D MG  .   MG  ? ? ? 1_555 F ATP . O1A ? ? A MG  492 A ATP 494 1_555 ? ? ? ? ? ? ? 2.066 ? ? 
metalc9  metalc ? ? D MG  .   MG  ? ? ? 1_555 F ATP . O1B ? ? A MG  492 A ATP 494 1_555 ? ? ? ? ? ? ? 2.486 ? ? 
metalc10 metalc ? ? D MG  .   MG  ? ? ? 1_555 F ATP . O2G ? ? A MG  492 A ATP 494 1_555 ? ? ? ? ? ? ? 2.540 ? ? 
metalc11 metalc ? ? D MG  .   MG  ? ? ? 1_555 H HOH . O   ? ? A MG  492 A HOH 541 1_555 ? ? ? ? ? ? ? 2.373 ? ? 
metalc12 metalc ? ? D MG  .   MG  ? ? ? 1_555 H HOH . O   ? ? A MG  492 A HOH 553 1_555 ? ? ? ? ? ? ? 2.411 ? ? 
metalc13 metalc ? ? D MG  .   MG  ? ? ? 1_555 H HOH . O   ? ? A MG  492 A HOH 559 1_555 ? ? ? ? ? ? ? 2.281 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 194 A . ? PHE 182 A PRO 195 A ? PRO 183 A 1 6.00 
2 PHE 281 A . ? PHE 269 A PRO 282 A ? PRO 270 A 1 1.11 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8  ? 
B ? 10 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? parallel      
A 2 3  ? parallel      
A 3 4  ? parallel      
A 4 5  ? parallel      
A 5 6  ? parallel      
A 6 7  ? parallel      
A 7 8  ? anti-parallel 
B 1 2  ? parallel      
B 2 3  ? anti-parallel 
B 3 4  ? anti-parallel 
B 4 5  ? parallel      
B 5 6  ? parallel      
B 6 7  ? parallel      
B 7 8  ? parallel      
B 8 9  ? parallel      
B 9 10 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  VAL A 109 ? VAL A 110 ? VAL A 97  VAL A 98  
A 2  ASP A 81  ? PHE A 86  ? ASP A 69  PHE A 74  
A 3  ARG A 54  ? CYS A 59  ? ARG A 42  CYS A 47  
A 4  VAL A 123 ? ALA A 127 ? VAL A 111 ALA A 115 
A 5  VAL A 154 ? VAL A 158 ? VAL A 142 VAL A 146 
A 6  LEU A 180 ? PHE A 184 ? LEU A 168 PHE A 172 
A 7  LYS A 202 ? ALA A 206 ? LYS A 190 ALA A 194 
A 8  PHE B 6   ? GLU B 7   ? PHE B 5   GLU B 6   
B 1  ARG A 220 ? VAL A 222 ? ARG A 208 VAL A 210 
B 2  THR A 426 ? ASN A 429 ? THR A 414 ASN A 417 
B 3  THR A 418 ? THR A 421 ? THR A 406 THR A 409 
B 4  VAL A 410 ? LEU A 413 ? VAL A 398 LEU A 401 
B 5  ALA A 373 ? LEU A 375 ? ALA A 361 LEU A 363 
B 6  ALA A 351 ? ILE A 353 ? ALA A 339 ILE A 341 
B 7  VAL A 323 ? ILE A 326 ? VAL A 311 ILE A 314 
B 8  LYS A 246 ? ILE A 250 ? LYS A 234 ILE A 238 
B 9  LEU A 274 ? PRO A 280 ? LEU A 262 PRO A 268 
B 10 ILE A 295 ? ILE A 299 ? ILE A 283 ILE A 287 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  O VAL A 110 ? O VAL A 98  N PHE A 86  ? N PHE A 74  
A 2 3  O ASP A 81  ? O ASP A 69  N PHE A 55  ? N PHE A 43  
A 3 4  N LEU A 56  ? N LEU A 44  O VAL A 125 ? O VAL A 113 
A 4 5  N ASP A 126 ? N ASP A 114 O VAL A 156 ? O VAL A 144 
A 5 6  N SER A 157 ? N SER A 145 O LEU A 180 ? O LEU A 168 
A 6 7  N THR A 183 ? N THR A 171 O ALA A 206 ? O ALA A 194 
A 7 8  N VAL A 205 ? N VAL A 193 O GLU B 7   ? O GLU B 6   
B 1 2  N TYR A 221 ? N TYR A 209 O PHE A 428 ? O PHE A 416 
B 2 3  O ASN A 429 ? O ASN A 417 N THR A 418 ? N THR A 406 
B 3 4  O THR A 421 ? O THR A 409 N LEU A 411 ? N LEU A 399 
B 4 5  O VAL A 412 ? O VAL A 400 N LEU A 375 ? N LEU A 363 
B 5 6  O VAL A 374 ? O VAL A 362 N ILE A 353 ? N ILE A 341 
B 6 7  O VAL A 352 ? O VAL A 340 N ILE A 326 ? N ILE A 314 
B 7 8  O ALA A 325 ? O ALA A 313 N ILE A 250 ? N ILE A 238 
B 8 9  N ILE A 249 ? N ILE A 237 O ALA A 278 ? O ALA A 266 
B 9 10 N LEU A 277 ? N LEU A 265 O VAL A 297 ? O VAL A 285 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A K   491 ? 6  'BINDING SITE FOR RESIDUE K A 491'   
AC2 Software A MG  492 ? 4  'BINDING SITE FOR RESIDUE MG A 492'  
AC3 Software A NAD 493 ? 17 'BINDING SITE FOR RESIDUE NAD A 493' 
AC4 Software A ATP 494 ? 24 'BINDING SITE FOR RESIDUE ATP A 494' 
AC5 Software A NAD 495 ? 10 'BINDING SITE FOR RESIDUE NAD A 495' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  ASN A 64  ? ASN A 52  . ? 1_555  ? 
2  AC1 6  ASP A 126 ? ASP A 114 . ? 1_555  ? 
3  AC1 6  PHE A 129 ? PHE A 117 . ? 1_555  ? 
4  AC1 6  VAL A 158 ? VAL A 146 . ? 1_555  ? 
5  AC1 6  VAL A 160 ? VAL A 148 . ? 1_555  ? 
6  AC1 6  SER A 162 ? SER A 150 . ? 1_555  ? 
7  AC2 4  ATP F .   ? ATP A 494 . ? 1_555  ? 
8  AC2 4  HOH H .   ? HOH A 541 . ? 1_555  ? 
9  AC2 4  HOH H .   ? HOH A 553 . ? 1_555  ? 
10 AC2 4  HOH H .   ? HOH A 559 . ? 1_555  ? 
11 AC3 17 GLY A 62  ? GLY A 50  . ? 1_555  ? 
12 AC3 17 ASN A 63  ? ASN A 51  . ? 1_555  ? 
13 AC3 17 ASN A 64  ? ASN A 52  . ? 1_555  ? 
14 AC3 17 ASP A 67  ? ASP A 55  . ? 1_555  ? 
15 AC3 17 PHE A 129 ? PHE A 117 . ? 1_555  ? 
16 AC3 17 GLY A 130 ? GLY A 118 . ? 1_555  ? 
17 AC3 17 THR A 131 ? THR A 119 . ? 1_555  ? 
18 AC3 17 GLY A 132 ? GLY A 120 . ? 1_555  ? 
19 AC3 17 ARG A 134 ? ARG A 122 . ? 1_555  ? 
20 AC3 17 GLY A 135 ? GLY A 123 . ? 1_555  ? 
21 AC3 17 GLU A 136 ? GLU A 124 . ? 1_555  ? 
22 AC3 17 TYR A 141 ? TYR A 129 . ? 1_555  ? 
23 AC3 17 ASP A 159 ? ASP A 147 . ? 1_555  ? 
24 AC3 17 LYS A 387 ? LYS A 375 . ? 15_454 ? 
25 AC3 17 HOH H .   ? HOH A 510 . ? 1_555  ? 
26 AC3 17 HOH H .   ? HOH A 568 . ? 1_555  ? 
27 AC3 17 HOH H .   ? HOH A 570 . ? 1_555  ? 
28 AC4 24 ARG A 237 ? ARG A 225 . ? 4_555  ? 
29 AC4 24 SER A 239 ? SER A 227 . ? 4_555  ? 
30 AC4 24 LYS A 241 ? LYS A 229 . ? 4_555  ? 
31 AC4 24 HIS A 378 ? HIS A 366 . ? 1_555  ? 
32 AC4 24 LYS A 414 ? LYS A 402 . ? 1_555  ? 
33 AC4 24 SER A 415 ? SER A 403 . ? 1_555  ? 
34 AC4 24 ALA A 416 ? ALA A 404 . ? 1_555  ? 
35 AC4 24 THR A 418 ? THR A 406 . ? 1_555  ? 
36 AC4 24 ASN A 433 ? ASN A 421 . ? 1_555  ? 
37 AC4 24 LEU A 436 ? LEU A 424 . ? 1_555  ? 
38 AC4 24 SER A 437 ? SER A 425 . ? 1_555  ? 
39 AC4 24 GLY A 439 ? GLY A 427 . ? 1_555  ? 
40 AC4 24 GLY A 440 ? GLY A 428 . ? 1_555  ? 
41 AC4 24 SER A 441 ? SER A 429 . ? 1_555  ? 
42 AC4 24 GLY A 442 ? GLY A 430 . ? 1_555  ? 
43 AC4 24 ASP A 443 ? ASP A 431 . ? 1_555  ? 
44 AC4 24 HIS A 470 ? HIS A 458 . ? 1_555  ? 
45 AC4 24 MG  D .   ? MG  A 492 . ? 1_555  ? 
46 AC4 24 HOH H .   ? HOH A 531 . ? 1_555  ? 
47 AC4 24 HOH H .   ? HOH A 553 . ? 1_555  ? 
48 AC4 24 HOH H .   ? HOH A 559 . ? 1_555  ? 
49 AC4 24 HOH H .   ? HOH A 569 . ? 1_555  ? 
50 AC4 24 HOH H .   ? HOH A 602 . ? 4_555  ? 
51 AC4 24 HOH H .   ? HOH A 617 . ? 1_555  ? 
52 AC5 10 HIS A 240 ? HIS A 228 . ? 4_555  ? 
53 AC5 10 LYS A 241 ? LYS A 229 . ? 4_555  ? 
54 AC5 10 HIS A 378 ? HIS A 366 . ? 1_555  ? 
55 AC5 10 PRO A 379 ? PRO A 367 . ? 1_555  ? 
56 AC5 10 GLY A 380 ? GLY A 368 . ? 1_555  ? 
57 AC5 10 ARG A 384 ? ARG A 372 . ? 1_555  ? 
58 AC5 10 VAL A 390 ? VAL A 378 . ? 1_555  ? 
59 AC5 10 LYS A 394 ? LYS A 382 . ? 1_555  ? 
60 AC5 10 SER A 415 ? SER A 403 . ? 1_555  ? 
61 AC5 10 HOH H .   ? HOH A 562 . ? 1_555  ? 
# 
_atom_sites.entry_id                    3RTC 
_atom_sites.fract_transf_matrix[1][1]   0.008170 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008170 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006447 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
K  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 13  ? -49.046 -1.174  -20.644 1.00 82.96  ? 1   MET A N     1 
ATOM   2    C  CA    . MET A 1 13  ? -48.769 -0.889  -19.208 1.00 79.36  ? 1   MET A CA    1 
ATOM   3    C  C     . MET A 1 13  ? -49.981 -0.266  -18.534 1.00 77.71  ? 1   MET A C     1 
ATOM   4    O  O     . MET A 1 13  ? -50.239 -0.527  -17.355 1.00 73.09  ? 1   MET A O     1 
ATOM   5    C  CB    . MET A 1 13  ? -47.540 0.015   -19.034 1.00 82.94  ? 1   MET A CB    1 
ATOM   6    C  CG    . MET A 1 13  ? -46.979 0.207   -17.565 1.00 82.01  ? 1   MET A CG    1 
ATOM   7    S  SD    . MET A 1 13  ? -46.524 -1.275  -16.555 1.00 83.84  ? 1   MET A SD    1 
ATOM   8    C  CE    . MET A 1 13  ? -45.744 -2.321  -17.777 1.00 86.16  ? 1   MET A CE    1 
ATOM   9    N  N     . LYS A 1 14  ? -50.718 0.569   -19.264 1.00 82.78  ? 2   LYS A N     1 
ATOM   10   C  CA    . LYS A 1 14  ? -52.002 1.054   -18.774 1.00 83.40  ? 2   LYS A CA    1 
ATOM   11   C  C     . LYS A 1 14  ? -52.939 -0.161  -18.626 1.00 79.89  ? 2   LYS A C     1 
ATOM   12   O  O     . LYS A 1 14  ? -53.721 -0.236  -17.672 1.00 76.83  ? 2   LYS A O     1 
ATOM   13   C  CB    . LYS A 1 14  ? -52.603 2.125   -19.700 1.00 91.74  ? 2   LYS A CB    1 
ATOM   14   C  CG    . LYS A 1 14  ? -53.808 2.846   -19.078 1.00 94.51  ? 2   LYS A CG    1 
ATOM   15   C  CD    . LYS A 1 14  ? -54.436 3.867   -20.024 1.00 106.00 ? 2   LYS A CD    1 
ATOM   16   C  CE    . LYS A 1 14  ? -55.349 4.826   -19.275 1.00 109.81 ? 2   LYS A CE    1 
ATOM   17   N  NZ    . LYS A 1 14  ? -56.034 4.139   -18.133 1.00 103.39 ? 2   LYS A NZ    1 
ATOM   18   N  N     . GLU A 1 15  ? -52.802 -1.107  -19.566 1.00 81.92  ? 3   GLU A N     1 
ATOM   19   C  CA    . GLU A 1 15  ? -53.499 -2.389  -19.548 1.00 81.23  ? 3   GLU A CA    1 
ATOM   20   C  C     . GLU A 1 15  ? -53.022 -3.202  -18.378 1.00 73.60  ? 3   GLU A C     1 
ATOM   21   O  O     . GLU A 1 15  ? -53.798 -3.927  -17.768 1.00 71.83  ? 3   GLU A O     1 
ATOM   22   C  CB    . GLU A 1 15  ? -53.270 -3.169  -20.863 1.00 88.63  ? 3   GLU A CB    1 
ATOM   23   C  CG    . GLU A 1 15  ? -51.854 -3.822  -21.018 1.00 88.84  ? 3   GLU A CG    1 
ATOM   24   C  CD    . GLU A 1 15  ? -51.485 -4.220  -22.470 1.00 100.82 ? 3   GLU A CD    1 
ATOM   25   O  OE1   . GLU A 1 15  ? -52.213 -3.830  -23.429 1.00 106.74 ? 3   GLU A OE1   1 
ATOM   26   O  OE2   . GLU A 1 15  ? -50.443 -4.914  -22.644 1.00 104.00 ? 3   GLU A OE2   1 
ATOM   27   N  N     . ILE A 1 16  ? -51.741 -3.083  -18.064 1.00 70.88  ? 4   ILE A N     1 
ATOM   28   C  CA    . ILE A 1 16  ? -51.148 -3.843  -16.946 1.00 66.60  ? 4   ILE A CA    1 
ATOM   29   C  C     . ILE A 1 16  ? -51.635 -3.340  -15.590 1.00 62.51  ? 4   ILE A C     1 
ATOM   30   O  O     . ILE A 1 16  ? -52.005 -4.144  -14.733 1.00 60.79  ? 4   ILE A O     1 
ATOM   31   C  CB    . ILE A 1 16  ? -49.632 -3.868  -17.056 1.00 68.36  ? 4   ILE A CB    1 
ATOM   32   C  CG1   . ILE A 1 16  ? -49.243 -4.655  -18.324 1.00 73.28  ? 4   ILE A CG1   1 
ATOM   33   C  CG2   . ILE A 1 16  ? -48.993 -4.455  -15.835 1.00 65.79  ? 4   ILE A CG2   1 
ATOM   34   C  CD1   . ILE A 1 16  ? -47.928 -5.390  -18.207 1.00 77.00  ? 4   ILE A CD1   1 
ATOM   35   N  N     . ASP A 1 17  ? -51.679 -2.025  -15.413 1.00 62.31  ? 5   ASP A N     1 
ATOM   36   C  CA    . ASP A 1 17  ? -52.338 -1.446  -14.250 1.00 60.87  ? 5   ASP A CA    1 
ATOM   37   C  C     . ASP A 1 17  ? -53.777 -1.955  -14.133 1.00 59.14  ? 5   ASP A C     1 
ATOM   38   O  O     . ASP A 1 17  ? -54.166 -2.435  -13.057 1.00 56.09  ? 5   ASP A O     1 
ATOM   39   C  CB    . ASP A 1 17  ? -52.354 0.085   -14.323 1.00 65.64  ? 5   ASP A CB    1 
ATOM   40   C  CG    . ASP A 1 17  ? -50.992 0.698   -14.092 1.00 70.20  ? 5   ASP A CG    1 
ATOM   41   O  OD1   . ASP A 1 17  ? -50.168 0.082   -13.379 1.00 72.41  ? 5   ASP A OD1   1 
ATOM   42   O  OD2   . ASP A 1 17  ? -50.741 1.800   -14.618 1.00 78.12  ? 5   ASP A OD2   1 
ATOM   43   N  N     . GLU A 1 18  ? -54.557 -1.847  -15.225 1.00 60.87  ? 6   GLU A N     1 
ATOM   44   C  CA    . GLU A 1 18  ? -55.975 -2.213  -15.172 1.00 61.95  ? 6   GLU A CA    1 
ATOM   45   C  C     . GLU A 1 18  ? -56.196 -3.655  -14.763 1.00 59.84  ? 6   GLU A C     1 
ATOM   46   O  O     . GLU A 1 18  ? -57.124 -3.941  -13.971 1.00 60.09  ? 6   GLU A O     1 
ATOM   47   C  CB    . GLU A 1 18  ? -56.705 -1.990  -16.496 1.00 68.52  ? 6   GLU A CB    1 
ATOM   48   C  CG    . GLU A 1 18  ? -56.956 -0.549  -16.835 1.00 74.28  ? 6   GLU A CG    1 
ATOM   49   C  CD    . GLU A 1 18  ? -57.499 -0.385  -18.239 1.00 85.52  ? 6   GLU A CD    1 
ATOM   50   O  OE1   . GLU A 1 18  ? -58.542 -1.002  -18.534 1.00 91.55  ? 6   GLU A OE1   1 
ATOM   51   O  OE2   . GLU A 1 18  ? -56.892 0.353   -19.047 1.00 90.59  ? 6   GLU A OE2   1 
ATOM   52   N  N     . LEU A 1 19  ? -55.417 -4.559  -15.353 1.00 59.00  ? 7   LEU A N     1 
ATOM   53   C  CA    . LEU A 1 19  ? -55.594 -5.957  -15.098 1.00 59.34  ? 7   LEU A CA    1 
ATOM   54   C  C     . LEU A 1 19  ? -55.206 -6.264  -13.629 1.00 55.48  ? 7   LEU A C     1 
ATOM   55   O  O     . LEU A 1 19  ? -55.947 -6.990  -12.949 1.00 55.31  ? 7   LEU A O     1 
ATOM   56   C  CB    . LEU A 1 19  ? -54.800 -6.816  -16.067 1.00 62.36  ? 7   LEU A CB    1 
ATOM   57   C  CG    . LEU A 1 19  ? -55.233 -6.898  -17.536 1.00 70.85  ? 7   LEU A CG    1 
ATOM   58   C  CD1   . LEU A 1 19  ? -54.150 -7.653  -18.315 1.00 73.04  ? 7   LEU A CD1   1 
ATOM   59   C  CD2   . LEU A 1 19  ? -56.628 -7.544  -17.724 1.00 73.40  ? 7   LEU A CD2   1 
ATOM   60   N  N     . THR A 1 20  ? -54.088 -5.677  -13.162 1.00 53.13  ? 8   THR A N     1 
ATOM   61   C  CA    . THR A 1 20  ? -53.609 -5.859  -11.790 1.00 50.82  ? 8   THR A CA    1 
ATOM   62   C  C     . THR A 1 20  ? -54.737 -5.407  -10.805 1.00 50.76  ? 8   THR A C     1 
ATOM   63   O  O     . THR A 1 20  ? -54.995 -6.085  -9.823  1.00 50.95  ? 8   THR A O     1 
ATOM   64   C  CB    . THR A 1 20  ? -52.274 -5.128  -11.527 1.00 52.55  ? 8   THR A CB    1 
ATOM   65   O  OG1   . THR A 1 20  ? -51.238 -5.544  -12.444 1.00 51.96  ? 8   THR A OG1   1 
ATOM   66   C  CG2   . THR A 1 20  ? -51.740 -5.375  -10.062 1.00 51.91  ? 8   THR A CG2   1 
ATOM   67   N  N     . ILE A 1 21  ? -55.420 -4.291  -11.077 1.00 49.74  ? 9   ILE A N     1 
ATOM   68   C  CA    . ILE A 1 21  ? -56.560 -3.880  -10.245 1.00 51.05  ? 9   ILE A CA    1 
ATOM   69   C  C     . ILE A 1 21  ? -57.799 -4.752  -10.448 1.00 52.05  ? 9   ILE A C     1 
ATOM   70   O  O     . ILE A 1 21  ? -58.215 -5.505  -9.561  1.00 52.94  ? 9   ILE A O     1 
ATOM   71   C  CB    . ILE A 1 21  ? -56.942 -2.397  -10.499 1.00 53.73  ? 9   ILE A CB    1 
ATOM   72   C  CG1   . ILE A 1 21  ? -55.795 -1.481  -10.047 1.00 54.75  ? 9   ILE A CG1   1 
ATOM   73   C  CG2   . ILE A 1 21  ? -58.240 -2.070  -9.740  1.00 55.53  ? 9   ILE A CG2   1 
ATOM   74   C  CD1   . ILE A 1 21  ? -55.495 -0.282  -10.980 1.00 57.36  ? 9   ILE A CD1   1 
ATOM   75   N  N     . LYS A 1 22  ? -58.354 -4.716  -11.647 1.00 53.91  ? 10  LYS A N     1 
ATOM   76   C  CA    . LYS A 1 22  ? -59.647 -5.323  -11.899 1.00 58.16  ? 10  LYS A CA    1 
ATOM   77   C  C     . LYS A 1 22  ? -59.660 -6.854  -11.858 1.00 59.44  ? 10  LYS A C     1 
ATOM   78   O  O     . LYS A 1 22  ? -60.681 -7.445  -11.475 1.00 62.45  ? 10  LYS A O     1 
ATOM   79   C  CB    . LYS A 1 22  ? -60.229 -4.863  -13.258 1.00 63.89  ? 10  LYS A CB    1 
ATOM   80   C  CG    . LYS A 1 22  ? -61.636 -5.406  -13.474 1.00 72.12  ? 10  LYS A CG    1 
ATOM   81   C  CD    . LYS A 1 22  ? -62.294 -5.024  -14.803 1.00 83.65  ? 10  LYS A CD    1 
ATOM   82   C  CE    . LYS A 1 22  ? -63.505 -5.891  -15.049 1.00 91.76  ? 10  LYS A CE    1 
ATOM   83   N  NZ    . LYS A 1 22  ? -64.150 -5.523  -16.337 1.00 105.75 ? 10  LYS A NZ    1 
ATOM   84   N  N     . GLU A 1 23  ? -58.582 -7.512  -12.274 1.00 58.67  ? 11  GLU A N     1 
ATOM   85   C  CA    . GLU A 1 23  ? -58.628 -8.981  -12.293 1.00 63.92  ? 11  GLU A CA    1 
ATOM   86   C  C     . GLU A 1 23  ? -57.791 -9.642  -11.193 1.00 60.41  ? 11  GLU A C     1 
ATOM   87   O  O     . GLU A 1 23  ? -58.192 -10.668 -10.680 1.00 64.61  ? 11  GLU A O     1 
ATOM   88   C  CB    . GLU A 1 23  ? -58.296 -9.565  -13.675 1.00 70.37  ? 11  GLU A CB    1 
ATOM   89   C  CG    . GLU A 1 23  ? -59.322 -9.241  -14.809 1.00 80.80  ? 11  GLU A CG    1 
ATOM   90   C  CD    . GLU A 1 23  ? -60.786 -9.700  -14.557 1.00 92.18  ? 11  GLU A CD    1 
ATOM   91   O  OE1   . GLU A 1 23  ? -61.039 -10.632 -13.749 1.00 98.79  ? 11  GLU A OE1   1 
ATOM   92   O  OE2   . GLU A 1 23  ? -61.709 -9.128  -15.192 1.00 100.64 ? 11  GLU A OE2   1 
ATOM   93   N  N     . TYR A 1 24  ? -56.647 -9.089  -10.837 1.00 55.84  ? 12  TYR A N     1 
ATOM   94   C  CA    . TYR A 1 24  ? -55.858 -9.652  -9.707  1.00 56.05  ? 12  TYR A CA    1 
ATOM   95   C  C     . TYR A 1 24  ? -56.398 -9.126  -8.369  1.00 54.77  ? 12  TYR A C     1 
ATOM   96   O  O     . TYR A 1 24  ? -56.281 -9.749  -7.375  1.00 57.49  ? 12  TYR A O     1 
ATOM   97   C  CB    . TYR A 1 24  ? -54.360 -9.433  -9.880  1.00 55.16  ? 12  TYR A CB    1 
ATOM   98   C  CG    . TYR A 1 24  ? -53.748 -10.274 -10.997 1.00 57.10  ? 12  TYR A CG    1 
ATOM   99   C  CD1   . TYR A 1 24  ? -53.906 -9.919  -12.342 1.00 55.93  ? 12  TYR A CD1   1 
ATOM   100  C  CD2   . TYR A 1 24  ? -53.061 -11.440 -10.713 1.00 60.70  ? 12  TYR A CD2   1 
ATOM   101  C  CE1   . TYR A 1 24  ? -53.368 -10.719 -13.366 1.00 61.07  ? 12  TYR A CE1   1 
ATOM   102  C  CE2   . TYR A 1 24  ? -52.508 -12.229 -11.719 1.00 64.65  ? 12  TYR A CE2   1 
ATOM   103  C  CZ    . TYR A 1 24  ? -52.672 -11.872 -13.045 1.00 65.07  ? 12  TYR A CZ    1 
ATOM   104  O  OH    . TYR A 1 24  ? -52.120 -12.671 -14.028 1.00 70.28  ? 12  TYR A OH    1 
ATOM   105  N  N     . GLY A 1 25  ? -57.037 -7.978  -8.375  1.00 53.53  ? 13  GLY A N     1 
ATOM   106  C  CA    . GLY A 1 25  ? -57.737 -7.482  -7.183  1.00 53.83  ? 13  GLY A CA    1 
ATOM   107  C  C     . GLY A 1 25  ? -56.862 -6.631  -6.286  1.00 52.79  ? 13  GLY A C     1 
ATOM   108  O  O     . GLY A 1 25  ? -57.218 -6.394  -5.135  1.00 53.64  ? 13  GLY A O     1 
ATOM   109  N  N     . VAL A 1 26  ? -55.732 -6.155  -6.813  1.00 44.69  ? 14  VAL A N     1 
ATOM   110  C  CA    . VAL A 1 26  ? -54.898 -5.215  -6.049  1.00 41.58  ? 14  VAL A CA    1 
ATOM   111  C  C     . VAL A 1 26  ? -55.599 -3.870  -6.017  1.00 42.55  ? 14  VAL A C     1 
ATOM   112  O  O     . VAL A 1 26  ? -55.888 -3.290  -7.068  1.00 43.67  ? 14  VAL A O     1 
ATOM   113  C  CB    . VAL A 1 26  ? -53.469 -5.071  -6.624  1.00 41.59  ? 14  VAL A CB    1 
ATOM   114  C  CG1   . VAL A 1 26  ? -52.580 -4.144  -5.685  1.00 35.74  ? 14  VAL A CG1   1 
ATOM   115  C  CG2   . VAL A 1 26  ? -52.839 -6.452  -6.848  1.00 39.28  ? 14  VAL A CG2   1 
ATOM   116  N  N     . ASP A 1 27  ? -55.895 -3.366  -4.826  1.00 42.45  ? 15  ASP A N     1 
ATOM   117  C  CA    . ASP A 1 27  ? -56.498 -2.036  -4.688  1.00 43.42  ? 15  ASP A CA    1 
ATOM   118  C  C     . ASP A 1 27  ? -55.641 -0.991  -5.404  1.00 41.11  ? 15  ASP A C     1 
ATOM   119  O  O     . ASP A 1 27  ? -54.400 -0.980  -5.240  1.00 39.43  ? 15  ASP A O     1 
ATOM   120  C  CB    . ASP A 1 27  ? -56.650 -1.618  -3.222  1.00 43.61  ? 15  ASP A CB    1 
ATOM   121  C  CG    . ASP A 1 27  ? -57.675 -0.472  -3.025  1.00 49.95  ? 15  ASP A CG    1 
ATOM   122  O  OD1   . ASP A 1 27  ? -57.501 0.684   -3.533  1.00 47.85  ? 15  ASP A OD1   1 
ATOM   123  O  OD2   . ASP A 1 27  ? -58.697 -0.740  -2.348  1.00 58.90  ? 15  ASP A OD2   1 
ATOM   124  N  N     . SER A 1 28  ? -56.285 -0.100  -6.170  1.00 39.63  ? 16  SER A N     1 
ATOM   125  C  CA    . SER A 1 28  ? -55.544 0.963   -6.861  1.00 38.86  ? 16  SER A CA    1 
ATOM   126  C  C     . SER A 1 28  ? -54.725 1.820   -5.874  1.00 36.71  ? 16  SER A C     1 
ATOM   127  O  O     . SER A 1 28  ? -53.625 2.284   -6.201  1.00 35.12  ? 16  SER A O     1 
ATOM   128  C  CB    . SER A 1 28  ? -56.492 1.863   -7.724  1.00 39.74  ? 16  SER A CB    1 
ATOM   129  O  OG    . SER A 1 28  ? -57.262 2.721   -6.877  1.00 41.28  ? 16  SER A OG    1 
ATOM   130  N  N     . ARG A 1 29  ? -55.207 1.993   -4.649  1.00 35.41  ? 17  ARG A N     1 
ATOM   131  C  CA    . ARG A 1 29  ? -54.469 2.775   -3.672  1.00 36.03  ? 17  ARG A CA    1 
ATOM   132  C  C     . ARG A 1 29  ? -53.125 2.162   -3.213  1.00 34.70  ? 17  ARG A C     1 
ATOM   133  O  O     . ARG A 1 29  ? -52.205 2.900   -2.858  1.00 33.65  ? 17  ARG A O     1 
ATOM   134  C  CB    . ARG A 1 29  ? -55.350 3.070   -2.473  1.00 38.57  ? 17  ARG A CB    1 
ATOM   135  C  CG    . ARG A 1 29  ? -56.483 4.014   -2.878  1.00 43.90  ? 17  ARG A CG    1 
ATOM   136  C  CD    . ARG A 1 29  ? -57.545 4.253   -1.793  1.00 51.51  ? 17  ARG A CD    1 
ATOM   137  N  NE    . ARG A 1 29  ? -58.159 3.023   -1.367  1.00 57.23  ? 17  ARG A NE    1 
ATOM   138  C  CZ    . ARG A 1 29  ? -59.025 2.949   -0.354  1.00 64.67  ? 17  ARG A CZ    1 
ATOM   139  N  NH1   . ARG A 1 29  ? -59.383 4.055   0.305   1.00 66.07  ? 17  ARG A NH1   1 
ATOM   140  N  NH2   . ARG A 1 29  ? -59.541 1.781   -0.005  1.00 65.14  ? 17  ARG A NH2   1 
ATOM   141  N  N     . ILE A 1 30  ? -53.079 0.838   -3.179  1.00 34.84  ? 18  ILE A N     1 
ATOM   142  C  CA    . ILE A 1 30  ? -51.901 0.045   -2.861  1.00 35.62  ? 18  ILE A CA    1 
ATOM   143  C  C     . ILE A 1 30  ? -50.841 0.247   -3.928  1.00 34.63  ? 18  ILE A C     1 
ATOM   144  O  O     . ILE A 1 30  ? -49.691 0.459   -3.583  1.00 34.08  ? 18  ILE A O     1 
ATOM   145  C  CB    . ILE A 1 30  ? -52.277 -1.483  -2.702  1.00 37.72  ? 18  ILE A CB    1 
ATOM   146  C  CG1   . ILE A 1 30  ? -53.067 -1.691  -1.393  1.00 39.57  ? 18  ILE A CG1   1 
ATOM   147  C  CG2   . ILE A 1 30  ? -51.043 -2.403  -2.686  1.00 36.68  ? 18  ILE A CG2   1 
ATOM   148  C  CD1   . ILE A 1 30  ? -53.753 -3.086  -1.254  1.00 41.63  ? 18  ILE A CD1   1 
ATOM   149  N  N     . LEU A 1 31  ? -51.235 0.238   -5.208  1.00 35.15  ? 19  LEU A N     1 
ATOM   150  C  CA    . LEU A 1 31  ? -50.322 0.514   -6.296  1.00 35.57  ? 19  LEU A CA    1 
ATOM   151  C  C     . LEU A 1 31  ? -49.743 1.923   -6.190  1.00 34.27  ? 19  LEU A C     1 
ATOM   152  O  O     . LEU A 1 31  ? -48.536 2.112   -6.353  1.00 32.45  ? 19  LEU A O     1 
ATOM   153  C  CB    . LEU A 1 31  ? -50.959 0.325   -7.670  1.00 36.64  ? 19  LEU A CB    1 
ATOM   154  C  CG    . LEU A 1 31  ? -51.163 -1.133  -8.079  1.00 40.63  ? 19  LEU A CG    1 
ATOM   155  C  CD1   . LEU A 1 31  ? -51.715 -1.175  -9.535  1.00 42.17  ? 19  LEU A CD1   1 
ATOM   156  C  CD2   . LEU A 1 31  ? -49.896 -1.951  -7.988  1.00 40.42  ? 19  LEU A CD2   1 
ATOM   157  N  N     . MET A 1 32  ? -50.595 2.879   -5.865  1.00 34.21  ? 20  MET A N     1 
ATOM   158  C  CA    . MET A 1 32  ? -50.201 4.255   -5.722  1.00 33.17  ? 20  MET A CA    1 
ATOM   159  C  C     . MET A 1 32  ? -49.239 4.446   -4.494  1.00 32.62  ? 20  MET A C     1 
ATOM   160  O  O     . MET A 1 32  ? -48.232 5.158   -4.600  1.00 31.41  ? 20  MET A O     1 
ATOM   161  C  CB    . MET A 1 32  ? -51.418 5.164   -5.647  1.00 33.34  ? 20  MET A CB    1 
ATOM   162  C  CG    . MET A 1 32  ? -51.055 6.641   -5.603  1.00 34.81  ? 20  MET A CG    1 
ATOM   163  S  SD    . MET A 1 32  ? -52.467 7.758   -5.931  1.00 41.44  ? 20  MET A SD    1 
ATOM   164  C  CE    . MET A 1 32  ? -52.627 7.628   -7.712  1.00 39.99  ? 20  MET A CE    1 
ATOM   165  N  N     . GLU A 1 33  ? -49.525 3.791   -3.381  1.00 31.68  ? 21  GLU A N     1 
ATOM   166  C  CA    . GLU A 1 33  ? -48.605 3.837   -2.239  1.00 32.64  ? 21  GLU A CA    1 
ATOM   167  C  C     . GLU A 1 33  ? -47.220 3.271   -2.617  1.00 32.32  ? 21  GLU A C     1 
ATOM   168  O  O     . GLU A 1 33  ? -46.197 3.926   -2.359  1.00 30.88  ? 21  GLU A O     1 
ATOM   169  C  CB    . GLU A 1 33  ? -49.137 3.104   -1.026  1.00 33.22  ? 21  GLU A CB    1 
ATOM   170  C  CG    . GLU A 1 33  ? -48.328 3.301   0.232   1.00 35.05  ? 21  GLU A CG    1 
ATOM   171  C  CD    . GLU A 1 33  ? -48.328 4.733   0.794   1.00 39.55  ? 21  GLU A CD    1 
ATOM   172  O  OE1   . GLU A 1 33  ? -49.256 5.518   0.495   1.00 36.90  ? 21  GLU A OE1   1 
ATOM   173  O  OE2   . GLU A 1 33  ? -47.356 5.083   1.550   1.00 37.58  ? 21  GLU A OE2   1 
ATOM   174  N  N     . ARG A 1 34  ? -47.221 2.079   -3.205  1.00 32.04  ? 22  ARG A N     1 
ATOM   175  C  CA    . ARG A 1 34  ? -46.002 1.465   -3.687  1.00 32.51  ? 22  ARG A CA    1 
ATOM   176  C  C     . ARG A 1 34  ? -45.217 2.391   -4.644  1.00 32.58  ? 22  ARG A C     1 
ATOM   177  O  O     . ARG A 1 34  ? -43.977 2.446   -4.508  1.00 32.58  ? 22  ARG A O     1 
ATOM   178  C  CB    . ARG A 1 34  ? -46.273 0.140   -4.361  1.00 33.26  ? 22  ARG A CB    1 
ATOM   179  C  CG    . ARG A 1 34  ? -46.826 -0.988  -3.439  1.00 34.47  ? 22  ARG A CG    1 
ATOM   180  C  CD    . ARG A 1 34  ? -45.742 -1.687  -2.690  1.00 36.19  ? 22  ARG A CD    1 
ATOM   181  N  NE    . ARG A 1 34  ? -44.730 -2.259  -3.562  1.00 34.78  ? 22  ARG A NE    1 
ATOM   182  C  CZ    . ARG A 1 34  ? -44.672 -3.529  -3.975  1.00 35.47  ? 22  ARG A CZ    1 
ATOM   183  N  NH1   . ARG A 1 34  ? -45.545 -4.426  -3.607  1.00 35.34  ? 22  ARG A NH1   1 
ATOM   184  N  NH2   . ARG A 1 34  ? -43.706 -3.910  -4.788  1.00 34.41  ? 22  ARG A NH2   1 
ATOM   185  N  N     . ALA A 1 35  ? -45.899 3.114   -5.556  1.00 30.63  ? 23  ALA A N     1 
ATOM   186  C  CA    . ALA A 1 35  ? -45.257 4.017   -6.491  1.00 31.02  ? 23  ALA A CA    1 
ATOM   187  C  C     . ALA A 1 35  ? -44.590 5.134   -5.734  1.00 31.88  ? 23  ALA A C     1 
ATOM   188  O  O     . ALA A 1 35  ? -43.372 5.397   -5.894  1.00 32.75  ? 23  ALA A O     1 
ATOM   189  C  CB    . ALA A 1 35  ? -46.277 4.603   -7.576  1.00 30.38  ? 23  ALA A CB    1 
ATOM   190  N  N     . GLY A 1 36  ? -45.348 5.774   -4.858  1.00 31.90  ? 24  GLY A N     1 
ATOM   191  C  CA    . GLY A 1 36  ? -44.781 6.877   -4.101  1.00 32.85  ? 24  GLY A CA    1 
ATOM   192  C  C     . GLY A 1 36  ? -43.584 6.527   -3.225  1.00 32.28  ? 24  GLY A C     1 
ATOM   193  O  O     . GLY A 1 36  ? -42.575 7.240   -3.234  1.00 32.60  ? 24  GLY A O     1 
ATOM   194  N  N     . ILE A 1 37  ? -43.673 5.445   -2.469  1.00 31.87  ? 25  ILE A N     1 
ATOM   195  C  CA    . ILE A 1 37  ? -42.529 5.047   -1.651  1.00 32.16  ? 25  ILE A CA    1 
ATOM   196  C  C     . ILE A 1 37  ? -41.308 4.667   -2.486  1.00 32.38  ? 25  ILE A C     1 
ATOM   197  O  O     . ILE A 1 37  ? -40.182 4.875   -2.054  1.00 31.75  ? 25  ILE A O     1 
ATOM   198  C  CB    . ILE A 1 37  ? -42.800 3.931   -0.647  1.00 33.47  ? 25  ILE A CB    1 
ATOM   199  C  CG1   . ILE A 1 37  ? -43.060 2.625   -1.375  1.00 37.48  ? 25  ILE A CG1   1 
ATOM   200  C  CG2   . ILE A 1 37  ? -43.922 4.348   0.327   1.00 33.48  ? 25  ILE A CG2   1 
ATOM   201  C  CD1   . ILE A 1 37  ? -43.326 1.454   -0.535  1.00 43.11  ? 25  ILE A CD1   1 
ATOM   202  N  N     . SER A 1 38  ? -41.509 4.111   -3.661  1.00 31.29  ? 26  SER A N     1 
ATOM   203  C  CA    . SER A 1 38  ? -40.369 3.724   -4.476  1.00 32.91  ? 26  SER A CA    1 
ATOM   204  C  C     . SER A 1 38  ? -39.610 5.024   -4.910  1.00 32.50  ? 26  SER A C     1 
ATOM   205  O  O     . SER A 1 38  ? -38.352 5.095   -4.955  1.00 33.68  ? 26  SER A O     1 
ATOM   206  C  CB    . SER A 1 38  ? -40.857 2.801   -5.598  1.00 31.88  ? 26  SER A CB    1 
ATOM   207  O  OG    . SER A 1 38  ? -41.308 3.591   -6.681  1.00 38.06  ? 26  SER A OG    1 
ATOM   208  N  N     . VAL A 1 39  ? -40.355 6.106   -5.097  1.00 31.95  ? 27  VAL A N     1 
ATOM   209  C  CA    . VAL A 1 39  ? -39.737 7.413   -5.422  1.00 31.87  ? 27  VAL A CA    1 
ATOM   210  C  C     . VAL A 1 39  ? -38.877 7.916   -4.254  1.00 32.86  ? 27  VAL A C     1 
ATOM   211  O  O     . VAL A 1 39  ? -37.771 8.344   -4.469  1.00 32.75  ? 27  VAL A O     1 
ATOM   212  C  CB    . VAL A 1 39  ? -40.748 8.463   -5.840  1.00 32.96  ? 27  VAL A CB    1 
ATOM   213  C  CG1   . VAL A 1 39  ? -40.028 9.867   -6.050  1.00 32.73  ? 27  VAL A CG1   1 
ATOM   214  C  CG2   . VAL A 1 39  ? -41.485 8.016   -7.132  1.00 31.50  ? 27  VAL A CG2   1 
ATOM   215  N  N     . VAL A 1 40  ? -39.368 7.771   -3.028  1.00 32.12  ? 28  VAL A N     1 
ATOM   216  C  CA    . VAL A 1 40  ? -38.664 8.196   -1.850  1.00 32.92  ? 28  VAL A CA    1 
ATOM   217  C  C     . VAL A 1 40  ? -37.379 7.402   -1.724  1.00 33.77  ? 28  VAL A C     1 
ATOM   218  O  O     . VAL A 1 40  ? -36.304 8.015   -1.537  1.00 33.89  ? 28  VAL A O     1 
ATOM   219  C  CB    . VAL A 1 40  ? -39.499 8.049   -0.575  1.00 32.43  ? 28  VAL A CB    1 
ATOM   220  C  CG1   . VAL A 1 40  ? -38.660 8.344   0.671   1.00 32.64  ? 28  VAL A CG1   1 
ATOM   221  C  CG2   . VAL A 1 40  ? -40.760 8.936   -0.628  1.00 32.37  ? 28  VAL A CG2   1 
ATOM   222  N  N     . LEU A 1 41  ? -37.473 6.075   -1.833  1.00 32.29  ? 29  LEU A N     1 
ATOM   223  C  CA    . LEU A 1 41  ? -36.277 5.211   -1.739  1.00 34.77  ? 29  LEU A CA    1 
ATOM   224  C  C     . LEU A 1 41  ? -35.224 5.479   -2.807  1.00 33.91  ? 29  LEU A C     1 
ATOM   225  O  O     . LEU A 1 41  ? -33.998 5.452   -2.542  1.00 35.26  ? 29  LEU A O     1 
ATOM   226  C  CB    . LEU A 1 41  ? -36.657 3.720   -1.709  1.00 34.99  ? 29  LEU A CB    1 
ATOM   227  C  CG    . LEU A 1 41  ? -37.336 3.284   -0.394  1.00 35.70  ? 29  LEU A CG    1 
ATOM   228  C  CD1   . LEU A 1 41  ? -38.082 1.988   -0.548  1.00 36.71  ? 29  LEU A CD1   1 
ATOM   229  C  CD2   . LEU A 1 41  ? -36.269 3.158   0.718   1.00 36.87  ? 29  LEU A CD2   1 
ATOM   230  N  N     . ALA A 1 42  ? -35.693 5.751   -4.010  1.00 32.67  ? 30  ALA A N     1 
ATOM   231  C  CA    . ALA A 1 42  ? -34.837 6.093   -5.140  1.00 32.97  ? 30  ALA A CA    1 
ATOM   232  C  C     . ALA A 1 42  ? -34.076 7.393   -4.860  1.00 34.40  ? 30  ALA A C     1 
ATOM   233  O  O     . ALA A 1 42  ? -32.892 7.504   -5.148  1.00 35.38  ? 30  ALA A O     1 
ATOM   234  C  CB    . ALA A 1 42  ? -35.644 6.191   -6.429  1.00 30.93  ? 30  ALA A CB    1 
ATOM   235  N  N     . MET A 1 43  ? -34.759 8.377   -4.290  1.00 35.93  ? 31  MET A N     1 
ATOM   236  C  CA    . MET A 1 43  ? -34.148 9.661   -4.006  1.00 38.32  ? 31  MET A CA    1 
ATOM   237  C  C     . MET A 1 43  ? -33.081 9.518   -2.934  1.00 41.26  ? 31  MET A C     1 
ATOM   238  O  O     . MET A 1 43  ? -32.000 10.143  -3.003  1.00 40.71  ? 31  MET A O     1 
ATOM   239  C  CB    . MET A 1 43  ? -35.173 10.670  -3.549  1.00 38.57  ? 31  MET A CB    1 
ATOM   240  C  CG    . MET A 1 43  ? -36.043 11.172  -4.663  1.00 37.64  ? 31  MET A CG    1 
ATOM   241  S  SD    . MET A 1 43  ? -37.005 12.614  -4.219  1.00 39.21  ? 31  MET A SD    1 
ATOM   242  C  CE    . MET A 1 43  ? -38.177 12.111  -2.949  1.00 34.47  ? 31  MET A CE    1 
ATOM   243  N  N     . GLU A 1 44  ? -33.365 8.674   -1.952  1.00 41.38  ? 32  GLU A N     1 
ATOM   244  C  CA    . GLU A 1 44  ? -32.403 8.408   -0.878  1.00 44.50  ? 32  GLU A CA    1 
ATOM   245  C  C     . GLU A 1 44  ? -31.098 7.726   -1.368  1.00 46.19  ? 32  GLU A C     1 
ATOM   246  O  O     . GLU A 1 44  ? -29.982 8.094   -0.990  1.00 46.25  ? 32  GLU A O     1 
ATOM   247  C  CB    . GLU A 1 44  ? -33.113 7.553   0.155   1.00 44.31  ? 32  GLU A CB    1 
ATOM   248  C  CG    . GLU A 1 44  ? -32.392 7.400   1.408   1.00 50.23  ? 32  GLU A CG    1 
ATOM   249  C  CD    . GLU A 1 44  ? -33.225 6.626   2.437   1.00 53.16  ? 32  GLU A CD    1 
ATOM   250  O  OE1   . GLU A 1 44  ? -33.989 5.718   2.041   1.00 54.89  ? 32  GLU A OE1   1 
ATOM   251  O  OE2   . GLU A 1 44  ? -33.137 6.959   3.627   1.00 55.51  ? 32  GLU A OE2   1 
ATOM   252  N  N     . GLU A 1 45  ? -31.267 6.725   -2.216  1.00 46.78  ? 33  GLU A N     1 
ATOM   253  C  CA    . GLU A 1 45  ? -30.197 6.043   -2.953  1.00 49.46  ? 33  GLU A CA    1 
ATOM   254  C  C     . GLU A 1 45  ? -29.355 7.025   -3.784  1.00 50.37  ? 33  GLU A C     1 
ATOM   255  O  O     . GLU A 1 45  ? -28.151 6.903   -3.861  1.00 51.03  ? 33  GLU A O     1 
ATOM   256  C  CB    . GLU A 1 45  ? -30.887 5.028   -3.865  1.00 49.56  ? 33  GLU A CB    1 
ATOM   257  C  CG    . GLU A 1 45  ? -30.086 3.959   -4.549  1.00 56.00  ? 33  GLU A CG    1 
ATOM   258  C  CD    . GLU A 1 45  ? -31.041 2.922   -5.158  1.00 62.17  ? 33  GLU A CD    1 
ATOM   259  O  OE1   . GLU A 1 45  ? -31.239 1.854   -4.536  1.00 65.00  ? 33  GLU A OE1   1 
ATOM   260  O  OE2   . GLU A 1 45  ? -31.666 3.219   -6.217  1.00 67.54  ? 33  GLU A OE2   1 
ATOM   261  N  N     . GLU A 1 46  ? -29.992 8.026   -4.367  1.00 49.65  ? 34  GLU A N     1 
ATOM   262  C  CA    . GLU A 1 46  ? -29.300 9.015   -5.184  1.00 50.93  ? 34  GLU A CA    1 
ATOM   263  C  C     . GLU A 1 46  ? -28.772 10.222  -4.372  1.00 52.49  ? 34  GLU A C     1 
ATOM   264  O  O     . GLU A 1 46  ? -27.685 10.745  -4.656  1.00 53.34  ? 34  GLU A O     1 
ATOM   265  C  CB    . GLU A 1 46  ? -30.245 9.456   -6.305  1.00 50.56  ? 34  GLU A CB    1 
ATOM   266  C  CG    . GLU A 1 46  ? -29.763 10.612  -7.172  1.00 55.91  ? 34  GLU A CG    1 
ATOM   267  C  CD    . GLU A 1 46  ? -28.652 10.212  -8.163  1.00 61.69  ? 34  GLU A CD    1 
ATOM   268  O  OE1   . GLU A 1 46  ? -28.246 9.017   -8.210  1.00 64.17  ? 34  GLU A OE1   1 
ATOM   269  O  OE2   . GLU A 1 46  ? -28.198 11.123  -8.899  1.00 65.20  ? 34  GLU A OE2   1 
ATOM   270  N  N     . LEU A 1 47  ? -29.499 10.677  -3.359  1.00 51.45  ? 35  LEU A N     1 
ATOM   271  C  CA    . LEU A 1 47  ? -29.086 11.869  -2.631  1.00 53.07  ? 35  LEU A CA    1 
ATOM   272  C  C     . LEU A 1 47  ? -28.442 11.599  -1.264  1.00 54.76  ? 35  LEU A C     1 
ATOM   273  O  O     . LEU A 1 47  ? -27.918 12.526  -0.634  1.00 56.82  ? 35  LEU A O     1 
ATOM   274  C  CB    . LEU A 1 47  ? -30.271 12.807  -2.452  1.00 51.92  ? 35  LEU A CB    1 
ATOM   275  C  CG    . LEU A 1 47  ? -30.924 13.289  -3.758  1.00 51.49  ? 35  LEU A CG    1 
ATOM   276  C  CD1   . LEU A 1 47  ? -32.163 14.062  -3.427  1.00 50.96  ? 35  LEU A CD1   1 
ATOM   277  C  CD2   . LEU A 1 47  ? -29.939 14.140  -4.555  1.00 54.59  ? 35  LEU A CD2   1 
ATOM   278  N  N     . GLY A 1 48  ? -28.454 10.348  -0.825  1.00 53.51  ? 36  GLY A N     1 
ATOM   279  C  CA    . GLY A 1 48  ? -28.030 10.029  0.529   1.00 54.66  ? 36  GLY A CA    1 
ATOM   280  C  C     . GLY A 1 48  ? -29.183 10.413  1.449   1.00 54.41  ? 36  GLY A C     1 
ATOM   281  O  O     . GLY A 1 48  ? -30.347 10.517  1.006   1.00 52.36  ? 36  GLY A O     1 
ATOM   282  N  N     . ASN A 1 49  ? -28.865 10.640  2.712   1.00 55.31  ? 37  ASN A N     1 
ATOM   283  C  CA    . ASN A 1 49  ? -29.851 11.019  3.712   1.00 55.85  ? 37  ASN A CA    1 
ATOM   284  C  C     . ASN A 1 49  ? -30.710 12.215  3.293   1.00 54.51  ? 37  ASN A C     1 
ATOM   285  O  O     . ASN A 1 49  ? -30.196 13.253  2.954   1.00 54.78  ? 37  ASN A O     1 
ATOM   286  C  CB    . ASN A 1 49  ? -29.156 11.335  5.048   1.00 58.26  ? 37  ASN A CB    1 
ATOM   287  C  CG    . ASN A 1 49  ? -30.096 11.208  6.237   1.00 60.43  ? 37  ASN A CG    1 
ATOM   288  O  OD1   . ASN A 1 49  ? -30.983 12.047  6.446   1.00 59.13  ? 37  ASN A OD1   1 
ATOM   289  N  ND2   . ASN A 1 49  ? -29.882 10.168  7.050   1.00 64.12  ? 37  ASN A ND2   1 
ATOM   290  N  N     . LEU A 1 50  ? -32.030 12.057  3.338   1.00 52.51  ? 38  LEU A N     1 
ATOM   291  C  CA    . LEU A 1 50  ? -32.932 13.111  2.866   1.00 51.37  ? 38  LEU A CA    1 
ATOM   292  C  C     . LEU A 1 50  ? -33.217 14.189  3.927   1.00 52.48  ? 38  LEU A C     1 
ATOM   293  O  O     . LEU A 1 50  ? -33.843 15.191  3.640   1.00 52.01  ? 38  LEU A O     1 
ATOM   294  C  CB    . LEU A 1 50  ? -34.241 12.503  2.383   1.00 49.22  ? 38  LEU A CB    1 
ATOM   295  C  CG    . LEU A 1 50  ? -34.144 11.532  1.191   1.00 48.49  ? 38  LEU A CG    1 
ATOM   296  C  CD1   . LEU A 1 50  ? -35.519 11.078  0.728   1.00 43.95  ? 38  LEU A CD1   1 
ATOM   297  C  CD2   . LEU A 1 50  ? -33.354 12.138  0.036   1.00 50.95  ? 38  LEU A CD2   1 
ATOM   298  N  N     . SER A 1 51  ? -32.733 14.021  5.143   1.00 53.66  ? 39  SER A N     1 
ATOM   299  C  CA    . SER A 1 51  ? -33.315 14.773  6.231   1.00 55.15  ? 39  SER A CA    1 
ATOM   300  C  C     . SER A 1 51  ? -32.918 16.255  6.218   1.00 57.75  ? 39  SER A C     1 
ATOM   301  O  O     . SER A 1 51  ? -33.621 17.064  6.804   1.00 58.29  ? 39  SER A O     1 
ATOM   302  C  CB    . SER A 1 51  ? -33.013 14.106  7.575   1.00 55.85  ? 39  SER A CB    1 
ATOM   303  O  OG    . SER A 1 51  ? -31.712 14.453  7.966   1.00 56.90  ? 39  SER A OG    1 
ATOM   304  N  N     . ASP A 1 52  ? -31.835 16.614  5.524   1.00 59.49  ? 40  ASP A N     1 
ATOM   305  C  CA    . ASP A 1 52  ? -31.453 18.007  5.417   1.00 62.61  ? 40  ASP A CA    1 
ATOM   306  C  C     . ASP A 1 52  ? -32.082 18.775  4.253   1.00 61.54  ? 40  ASP A C     1 
ATOM   307  O  O     . ASP A 1 52  ? -31.932 19.985  4.186   1.00 63.47  ? 40  ASP A O     1 
ATOM   308  C  CB    . ASP A 1 52  ? -29.937 18.117  5.273   1.00 65.85  ? 40  ASP A CB    1 
ATOM   309  C  CG    . ASP A 1 52  ? -29.212 17.719  6.517   1.00 70.69  ? 40  ASP A CG    1 
ATOM   310  O  OD1   . ASP A 1 52  ? -29.311 18.460  7.521   1.00 76.39  ? 40  ASP A OD1   1 
ATOM   311  O  OD2   . ASP A 1 52  ? -28.560 16.647  6.503   1.00 77.07  ? 40  ASP A OD2   1 
ATOM   312  N  N     . TYR A 1 53  ? -32.766 18.107  3.335   1.00 58.06  ? 41  TYR A N     1 
ATOM   313  C  CA    . TYR A 1 53  ? -33.249 18.766  2.119   1.00 56.68  ? 41  TYR A CA    1 
ATOM   314  C  C     . TYR A 1 53  ? -34.683 19.298  2.271   1.00 54.75  ? 41  TYR A C     1 
ATOM   315  O  O     . TYR A 1 53  ? -35.516 18.735  3.001   1.00 54.14  ? 41  TYR A O     1 
ATOM   316  C  CB    . TYR A 1 53  ? -33.230 17.796  0.913   1.00 55.50  ? 41  TYR A CB    1 
ATOM   317  C  CG    . TYR A 1 53  ? -31.871 17.338  0.444   1.00 57.81  ? 41  TYR A CG    1 
ATOM   318  C  CD1   . TYR A 1 53  ? -31.157 18.047  -0.516  1.00 62.66  ? 41  TYR A CD1   1 
ATOM   319  C  CD2   . TYR A 1 53  ? -31.321 16.175  0.931   1.00 60.49  ? 41  TYR A CD2   1 
ATOM   320  C  CE1   . TYR A 1 53  ? -29.906 17.605  -0.959  1.00 65.20  ? 41  TYR A CE1   1 
ATOM   321  C  CE2   . TYR A 1 53  ? -30.068 15.727  0.515   1.00 63.23  ? 41  TYR A CE2   1 
ATOM   322  C  CZ    . TYR A 1 53  ? -29.371 16.432  -0.438  1.00 65.51  ? 41  TYR A CZ    1 
ATOM   323  O  OH    . TYR A 1 53  ? -28.154 15.942  -0.851  1.00 68.98  ? 41  TYR A OH    1 
ATOM   324  N  N     . ARG A 1 54  ? -34.960 20.367  1.539   1.00 53.36  ? 42  ARG A N     1 
ATOM   325  C  CA    . ARG A 1 54  ? -36.290 20.924  1.436   1.00 51.94  ? 42  ARG A CA    1 
ATOM   326  C  C     . ARG A 1 54  ? -36.893 20.519  0.085   1.00 48.62  ? 42  ARG A C     1 
ATOM   327  O  O     . ARG A 1 54  ? -36.265 20.719  -0.948  1.00 47.59  ? 42  ARG A O     1 
ATOM   328  C  CB    . ARG A 1 54  ? -36.222 22.442  1.559   1.00 54.10  ? 42  ARG A CB    1 
ATOM   329  C  CG    . ARG A 1 54  ? -35.570 22.903  2.879   1.00 57.60  ? 42  ARG A CG    1 
ATOM   330  C  CD    . ARG A 1 54  ? -35.146 24.365  2.867   1.00 62.36  ? 42  ARG A CD    1 
ATOM   331  N  NE    . ARG A 1 54  ? -34.140 24.597  1.839   1.00 64.68  ? 42  ARG A NE    1 
ATOM   332  C  CZ    . ARG A 1 54  ? -33.654 25.789  1.495   1.00 71.21  ? 42  ARG A CZ    1 
ATOM   333  N  NH1   . ARG A 1 54  ? -34.061 26.908  2.102   1.00 72.66  ? 42  ARG A NH1   1 
ATOM   334  N  NH2   . ARG A 1 54  ? -32.747 25.861  0.517   1.00 72.96  ? 42  ARG A NH2   1 
ATOM   335  N  N     . PHE A 1 55  ? -38.112 19.982  0.109   1.00 45.41  ? 43  PHE A N     1 
ATOM   336  C  CA    . PHE A 1 55  ? -38.757 19.442  -1.097  1.00 43.36  ? 43  PHE A CA    1 
ATOM   337  C  C     . PHE A 1 55  ? -39.992 20.218  -1.547  1.00 43.21  ? 43  PHE A C     1 
ATOM   338  O  O     . PHE A 1 55  ? -40.918 20.446  -0.764  1.00 42.88  ? 43  PHE A O     1 
ATOM   339  C  CB    . PHE A 1 55  ? -39.159 17.968  -0.892  1.00 41.22  ? 43  PHE A CB    1 
ATOM   340  C  CG    . PHE A 1 55  ? -38.006 17.042  -0.675  1.00 40.40  ? 43  PHE A CG    1 
ATOM   341  C  CD1   . PHE A 1 55  ? -37.329 17.029  0.549   1.00 41.23  ? 43  PHE A CD1   1 
ATOM   342  C  CD2   . PHE A 1 55  ? -37.587 16.175  -1.686  1.00 38.88  ? 43  PHE A CD2   1 
ATOM   343  C  CE1   . PHE A 1 55  ? -36.287 16.148  0.763   1.00 42.45  ? 43  PHE A CE1   1 
ATOM   344  C  CE2   . PHE A 1 55  ? -36.556 15.283  -1.468  1.00 39.41  ? 43  PHE A CE2   1 
ATOM   345  C  CZ    . PHE A 1 55  ? -35.886 15.280  -0.248  1.00 41.10  ? 43  PHE A CZ    1 
ATOM   346  N  N     . LEU A 1 56  ? -39.995 20.579  -2.833  1.00 42.89  ? 44  LEU A N     1 
ATOM   347  C  CA    . LEU A 1 56  ? -41.144 21.171  -3.531  1.00 42.62  ? 44  LEU A CA    1 
ATOM   348  C  C     . LEU A 1 56  ? -41.700 20.102  -4.455  1.00 40.62  ? 44  LEU A C     1 
ATOM   349  O  O     . LEU A 1 56  ? -41.010 19.606  -5.352  1.00 39.01  ? 44  LEU A O     1 
ATOM   350  C  CB    . LEU A 1 56  ? -40.718 22.398  -4.339  1.00 44.25  ? 44  LEU A CB    1 
ATOM   351  C  CG    . LEU A 1 56  ? -41.856 23.230  -4.941  1.00 44.42  ? 44  LEU A CG    1 
ATOM   352  C  CD1   . LEU A 1 56  ? -42.596 23.948  -3.835  1.00 41.04  ? 44  LEU A CD1   1 
ATOM   353  C  CD2   . LEU A 1 56  ? -41.309 24.194  -5.974  1.00 42.14  ? 44  LEU A CD2   1 
ATOM   354  N  N     . VAL A 1 57  ? -42.946 19.723  -4.206  1.00 39.89  ? 45  VAL A N     1 
ATOM   355  C  CA    . VAL A 1 57  ? -43.597 18.652  -4.925  1.00 37.45  ? 45  VAL A CA    1 
ATOM   356  C  C     . VAL A 1 57  ? -44.709 19.287  -5.752  1.00 38.48  ? 45  VAL A C     1 
ATOM   357  O  O     . VAL A 1 57  ? -45.614 19.976  -5.223  1.00 40.32  ? 45  VAL A O     1 
ATOM   358  C  CB    . VAL A 1 57  ? -44.152 17.627  -3.916  1.00 36.68  ? 45  VAL A CB    1 
ATOM   359  C  CG1   . VAL A 1 57  ? -44.779 16.474  -4.629  1.00 33.52  ? 45  VAL A CG1   1 
ATOM   360  C  CG2   . VAL A 1 57  ? -43.027 17.116  -2.968  1.00 34.83  ? 45  VAL A CG2   1 
ATOM   361  N  N     . LEU A 1 58  ? -44.607 19.105  -7.061  1.00 38.40  ? 46  LEU A N     1 
ATOM   362  C  CA    . LEU A 1 58  ? -45.505 19.721  -8.023  1.00 38.28  ? 46  LEU A CA    1 
ATOM   363  C  C     . LEU A 1 58  ? -46.455 18.638  -8.492  1.00 37.56  ? 46  LEU A C     1 
ATOM   364  O  O     . LEU A 1 58  ? -46.026 17.658  -9.163  1.00 38.25  ? 46  LEU A O     1 
ATOM   365  C  CB    . LEU A 1 58  ? -44.692 20.308  -9.176  1.00 38.41  ? 46  LEU A CB    1 
ATOM   366  C  CG    . LEU A 1 58  ? -43.608 21.318  -8.840  1.00 41.01  ? 46  LEU A CG    1 
ATOM   367  C  CD1   . LEU A 1 58  ? -42.949 21.795  -10.101 1.00 44.47  ? 46  LEU A CD1   1 
ATOM   368  C  CD2   . LEU A 1 58  ? -44.198 22.509  -8.042  1.00 41.06  ? 46  LEU A CD2   1 
ATOM   369  N  N     . CYS A 1 59  ? -47.736 18.806  -8.167  1.00 38.55  ? 47  CYS A N     1 
ATOM   370  C  CA    . CYS A 1 59  ? -48.757 17.778  -8.373  1.00 38.19  ? 47  CYS A CA    1 
ATOM   371  C  C     . CYS A 1 59  ? -49.854 18.257  -9.325  1.00 39.39  ? 47  CYS A C     1 
ATOM   372  O  O     . CYS A 1 59  ? -50.498 19.294  -9.112  1.00 40.81  ? 47  CYS A O     1 
ATOM   373  C  CB    . CYS A 1 59  ? -49.408 17.413  -7.058  1.00 38.63  ? 47  CYS A CB    1 
ATOM   374  S  SG    . CYS A 1 59  ? -48.403 16.466  -5.928  1.00 38.43  ? 47  CYS A SG    1 
ATOM   375  N  N     . GLY A 1 60  ? -50.073 17.462  -10.374 1.00 39.08  ? 48  GLY A N     1 
ATOM   376  C  CA    . GLY A 1 60  ? -51.213 17.610  -11.225 1.00 39.34  ? 48  GLY A CA    1 
ATOM   377  C  C     . GLY A 1 60  ? -52.410 16.947  -10.564 1.00 39.96  ? 48  GLY A C     1 
ATOM   378  O  O     . GLY A 1 60  ? -52.331 16.343  -9.453  1.00 38.89  ? 48  GLY A O     1 
ATOM   379  N  N     . GLY A 1 61  ? -53.529 17.071  -11.261 1.00 41.11  ? 49  GLY A N     1 
ATOM   380  C  CA    . GLY A 1 61  ? -54.785 16.528  -10.811 1.00 41.78  ? 49  GLY A CA    1 
ATOM   381  C  C     . GLY A 1 61  ? -55.019 15.081  -11.111 1.00 41.26  ? 49  GLY A C     1 
ATOM   382  O  O     . GLY A 1 61  ? -56.051 14.521  -10.671 1.00 43.35  ? 49  GLY A O     1 
ATOM   383  N  N     . GLY A 1 62  ? -54.079 14.453  -11.825 1.00 39.45  ? 50  GLY A N     1 
ATOM   384  C  CA    . GLY A 1 62  ? -54.184 13.040  -12.176 1.00 38.43  ? 50  GLY A CA    1 
ATOM   385  C  C     . GLY A 1 62  ? -53.511 12.096  -11.193 1.00 37.27  ? 50  GLY A C     1 
ATOM   386  O  O     . GLY A 1 62  ? -53.107 12.499  -10.104 1.00 36.16  ? 50  GLY A O     1 
ATOM   387  N  N     . ASN A 1 63  ? -53.372 10.839  -11.600 1.00 36.84  ? 51  ASN A N     1 
ATOM   388  C  CA    . ASN A 1 63  ? -52.752 9.844   -10.753 1.00 37.91  ? 51  ASN A CA    1 
ATOM   389  C  C     . ASN A 1 63  ? -51.224 10.052  -10.644 1.00 36.65  ? 51  ASN A C     1 
ATOM   390  O  O     . ASN A 1 63  ? -50.591 9.559   -9.714  1.00 36.45  ? 51  ASN A O     1 
ATOM   391  C  CB    . ASN A 1 63  ? -53.102 8.436   -11.266 1.00 38.05  ? 51  ASN A CB    1 
ATOM   392  C  CG    . ASN A 1 63  ? -54.559 8.030   -10.962 1.00 42.15  ? 51  ASN A CG    1 
ATOM   393  O  OD1   . ASN A 1 63  ? -55.218 8.565   -10.058 1.00 41.39  ? 51  ASN A OD1   1 
ATOM   394  N  ND2   . ASN A 1 63  ? -55.060 7.067   -11.736 1.00 43.99  ? 51  ASN A ND2   1 
ATOM   395  N  N     . ASN A 1 64  ? -50.626 10.771  -11.595 1.00 35.93  ? 52  ASN A N     1 
ATOM   396  C  CA    . ASN A 1 64  ? -49.251 11.113  -11.459 1.00 35.59  ? 52  ASN A CA    1 
ATOM   397  C  C     . ASN A 1 64  ? -49.166 12.006  -10.219 1.00 35.99  ? 52  ASN A C     1 
ATOM   398  O  O     . ASN A 1 64  ? -48.339 11.780  -9.302  1.00 35.85  ? 52  ASN A O     1 
ATOM   399  C  CB    . ASN A 1 64  ? -48.735 11.839  -12.695 1.00 36.35  ? 52  ASN A CB    1 
ATOM   400  C  CG    . ASN A 1 64  ? -47.221 11.895  -12.742 1.00 32.48  ? 52  ASN A CG    1 
ATOM   401  O  OD1   . ASN A 1 64  ? -46.638 12.970  -12.766 1.00 33.67  ? 52  ASN A OD1   1 
ATOM   402  N  ND2   . ASN A 1 64  ? -46.604 10.763  -12.908 1.00 30.64  ? 52  ASN A ND2   1 
ATOM   403  N  N     . GLY A 1 65  ? -50.071 12.976  -10.153 1.00 35.62  ? 53  GLY A N     1 
ATOM   404  C  CA    . GLY A 1 65  ? -50.079 13.876  -9.018  1.00 36.71  ? 53  GLY A CA    1 
ATOM   405  C  C     . GLY A 1 65  ? -50.407 13.134  -7.743  1.00 37.00  ? 53  GLY A C     1 
ATOM   406  O  O     . GLY A 1 65  ? -49.878 13.464  -6.683  1.00 37.00  ? 53  GLY A O     1 
ATOM   407  N  N     . GLY A 1 66  ? -51.260 12.113  -7.842  1.00 36.81  ? 54  GLY A N     1 
ATOM   408  C  CA    . GLY A 1 66  ? -51.566 11.290  -6.659  1.00 36.43  ? 54  GLY A CA    1 
ATOM   409  C  C     . GLY A 1 66  ? -50.309 10.600  -6.138  1.00 35.49  ? 54  GLY A C     1 
ATOM   410  O  O     . GLY A 1 66  ? -50.094 10.493  -4.962  1.00 33.91  ? 54  GLY A O     1 
ATOM   411  N  N     . ASP A 1 67  ? -49.484 10.107  -7.056  1.00 35.37  ? 55  ASP A N     1 
ATOM   412  C  CA    . ASP A 1 67  ? -48.194 9.509   -6.717  1.00 34.55  ? 55  ASP A CA    1 
ATOM   413  C  C     . ASP A 1 67  ? -47.360 10.565  -5.977  1.00 33.71  ? 55  ASP A C     1 
ATOM   414  O  O     . ASP A 1 67  ? -46.727 10.300  -4.944  1.00 34.53  ? 55  ASP A O     1 
ATOM   415  C  CB    . ASP A 1 67  ? -47.459 9.015   -7.973  1.00 34.71  ? 55  ASP A CB    1 
ATOM   416  C  CG    . ASP A 1 67  ? -48.058 7.778   -8.617  1.00 36.16  ? 55  ASP A CG    1 
ATOM   417  O  OD1   . ASP A 1 67  ? -48.890 7.049   -8.024  1.00 36.50  ? 55  ASP A OD1   1 
ATOM   418  O  OD2   . ASP A 1 67  ? -47.571 7.445   -9.743  1.00 37.16  ? 55  ASP A OD2   1 
ATOM   419  N  N     . GLY A 1 68  ? -47.428 11.786  -6.463  1.00 34.21  ? 56  GLY A N     1 
ATOM   420  C  CA    . GLY A 1 68  ? -46.764 12.922  -5.851  1.00 34.30  ? 56  GLY A CA    1 
ATOM   421  C  C     . GLY A 1 68  ? -47.208 13.181  -4.408  1.00 35.09  ? 56  GLY A C     1 
ATOM   422  O  O     . GLY A 1 68  ? -46.392 13.435  -3.551  1.00 34.94  ? 56  GLY A O     1 
ATOM   423  N  N     . PHE A 1 69  ? -48.519 13.149  -4.152  1.00 35.75  ? 57  PHE A N     1 
ATOM   424  C  CA    . PHE A 1 69  ? -49.035 13.296  -2.807  1.00 36.27  ? 57  PHE A CA    1 
ATOM   425  C  C     . PHE A 1 69  ? -48.538 12.200  -1.887  1.00 35.18  ? 57  PHE A C     1 
ATOM   426  O  O     . PHE A 1 69  ? -48.261 12.470  -0.707  1.00 35.34  ? 57  PHE A O     1 
ATOM   427  C  CB    . PHE A 1 69  ? -50.567 13.372  -2.787  1.00 36.74  ? 57  PHE A CB    1 
ATOM   428  C  CG    . PHE A 1 69  ? -51.105 14.742  -3.136  1.00 37.78  ? 57  PHE A CG    1 
ATOM   429  C  CD1   . PHE A 1 69  ? -50.894 15.806  -2.301  1.00 39.60  ? 57  PHE A CD1   1 
ATOM   430  C  CD2   . PHE A 1 69  ? -51.787 14.957  -4.312  1.00 39.42  ? 57  PHE A CD2   1 
ATOM   431  C  CE1   . PHE A 1 69  ? -51.371 17.057  -2.621  1.00 44.30  ? 57  PHE A CE1   1 
ATOM   432  C  CE2   . PHE A 1 69  ? -52.251 16.188  -4.647  1.00 40.03  ? 57  PHE A CE2   1 
ATOM   433  C  CZ    . PHE A 1 69  ? -52.060 17.246  -3.795  1.00 42.90  ? 57  PHE A CZ    1 
ATOM   434  N  N     . VAL A 1 70  ? -48.397 10.978  -2.405  1.00 34.24  ? 58  VAL A N     1 
ATOM   435  C  CA    . VAL A 1 70  ? -47.799 9.893   -1.572  1.00 33.29  ? 58  VAL A CA    1 
ATOM   436  C  C     . VAL A 1 70  ? -46.347 10.223  -1.206  1.00 33.11  ? 58  VAL A C     1 
ATOM   437  O  O     . VAL A 1 70  ? -45.933 10.022  -0.060  1.00 34.16  ? 58  VAL A O     1 
ATOM   438  C  CB    . VAL A 1 70  ? -47.874 8.494   -2.259  1.00 32.51  ? 58  VAL A CB    1 
ATOM   439  C  CG1   . VAL A 1 70  ? -47.076 7.455   -1.494  1.00 32.39  ? 58  VAL A CG1   1 
ATOM   440  C  CG2   . VAL A 1 70  ? -49.301 8.081   -2.431  1.00 32.48  ? 58  VAL A CG2   1 
ATOM   441  N  N     . VAL A 1 71  ? -45.576 10.718  -2.188  1.00 33.30  ? 59  VAL A N     1 
ATOM   442  C  CA    . VAL A 1 71  ? -44.210 11.154  -1.939  1.00 33.05  ? 59  VAL A CA    1 
ATOM   443  C  C     . VAL A 1 71  ? -44.190 12.210  -0.822  1.00 35.29  ? 59  VAL A C     1 
ATOM   444  O  O     . VAL A 1 71  ? -43.501 12.046  0.207   1.00 34.97  ? 59  VAL A O     1 
ATOM   445  C  CB    . VAL A 1 71  ? -43.515 11.632  -3.242  1.00 33.01  ? 59  VAL A CB    1 
ATOM   446  C  CG1   . VAL A 1 71  ? -42.126 12.218  -2.948  1.00 30.70  ? 59  VAL A CG1   1 
ATOM   447  C  CG2   . VAL A 1 71  ? -43.397 10.474  -4.261  1.00 28.17  ? 59  VAL A CG2   1 
ATOM   448  N  N     . ALA A 1 72  ? -45.013 13.252  -1.000  1.00 36.06  ? 60  ALA A N     1 
ATOM   449  C  CA    . ALA A 1 72  ? -45.026 14.375  -0.086  1.00 36.36  ? 60  ALA A CA    1 
ATOM   450  C  C     . ALA A 1 72  ? -45.383 13.894  1.298   1.00 36.77  ? 60  ALA A C     1 
ATOM   451  O  O     . ALA A 1 72  ? -44.679 14.182  2.253   1.00 36.80  ? 60  ALA A O     1 
ATOM   452  C  CB    . ALA A 1 72  ? -46.017 15.457  -0.555  1.00 37.75  ? 60  ALA A CB    1 
ATOM   453  N  N     . ARG A 1 73  ? -46.440 13.113  1.415   1.00 35.73  ? 61  ARG A N     1 
ATOM   454  C  CA    . ARG A 1 73  ? -46.861 12.683  2.733   1.00 36.91  ? 61  ARG A CA    1 
ATOM   455  C  C     . ARG A 1 73  ? -45.784 11.844  3.444   1.00 37.20  ? 61  ARG A C     1 
ATOM   456  O  O     . ARG A 1 73  ? -45.610 11.960  4.634   1.00 34.91  ? 61  ARG A O     1 
ATOM   457  C  CB    . ARG A 1 73  ? -48.133 11.869  2.644   1.00 36.43  ? 61  ARG A CB    1 
ATOM   458  C  CG    . ARG A 1 73  ? -48.708 11.516  3.924   1.00 40.40  ? 61  ARG A CG    1 
ATOM   459  C  CD    . ARG A 1 73  ? -49.647 10.349  3.764   1.00 44.11  ? 61  ARG A CD    1 
ATOM   460  N  NE    . ARG A 1 73  ? -48.946 9.092   3.883   1.00 45.03  ? 61  ARG A NE    1 
ATOM   461  C  CZ    . ARG A 1 73  ? -48.944 8.094   3.000   1.00 42.31  ? 61  ARG A CZ    1 
ATOM   462  N  NH1   . ARG A 1 73  ? -49.572 8.152   1.841   1.00 41.52  ? 61  ARG A NH1   1 
ATOM   463  N  NH2   . ARG A 1 73  ? -48.260 7.021   3.307   1.00 40.93  ? 61  ARG A NH2   1 
ATOM   464  N  N     . ASN A 1 74  ? -45.106 10.976  2.706   1.00 36.79  ? 62  ASN A N     1 
ATOM   465  C  CA    . ASN A 1 74  ? -44.034 10.127  3.277   1.00 37.72  ? 62  ASN A CA    1 
ATOM   466  C  C     . ASN A 1 74  ? -42.750 10.864  3.671   1.00 39.68  ? 62  ASN A C     1 
ATOM   467  O  O     . ASN A 1 74  ? -41.933 10.324  4.418   1.00 41.12  ? 62  ASN A O     1 
ATOM   468  C  CB    . ASN A 1 74  ? -43.718 9.002   2.287   1.00 36.13  ? 62  ASN A CB    1 
ATOM   469  C  CG    . ASN A 1 74  ? -44.674 7.858   2.418   1.00 35.17  ? 62  ASN A CG    1 
ATOM   470  O  OD1   . ASN A 1 74  ? -44.700 7.203   3.434   1.00 37.15  ? 62  ASN A OD1   1 
ATOM   471  N  ND2   . ASN A 1 74  ? -45.468 7.620   1.414   1.00 34.49  ? 62  ASN A ND2   1 
ATOM   472  N  N     . LEU A 1 75  ? -42.548 12.087  3.163   1.00 40.18  ? 63  LEU A N     1 
ATOM   473  C  CA    . LEU A 1 75  ? -41.441 12.940  3.597   1.00 41.00  ? 63  LEU A CA    1 
ATOM   474  C  C     . LEU A 1 75  ? -41.779 13.784  4.856   1.00 43.58  ? 63  LEU A C     1 
ATOM   475  O  O     . LEU A 1 75  ? -40.865 14.255  5.548   1.00 43.74  ? 63  LEU A O     1 
ATOM   476  C  CB    . LEU A 1 75  ? -41.009 13.878  2.465   1.00 41.36  ? 63  LEU A CB    1 
ATOM   477  C  CG    . LEU A 1 75  ? -40.472 13.195  1.220   1.00 41.16  ? 63  LEU A CG    1 
ATOM   478  C  CD1   . LEU A 1 75  ? -40.299 14.187  0.088   1.00 43.24  ? 63  LEU A CD1   1 
ATOM   479  C  CD2   . LEU A 1 75  ? -39.186 12.499  1.519   1.00 43.95  ? 63  LEU A CD2   1 
ATOM   480  N  N     . LEU A 1 76  ? -43.067 13.985  5.142   1.00 43.94  ? 64  LEU A N     1 
ATOM   481  C  CA    . LEU A 1 76  ? -43.469 14.777  6.295   1.00 46.67  ? 64  LEU A CA    1 
ATOM   482  C  C     . LEU A 1 76  ? -42.826 14.274  7.582   1.00 47.70  ? 64  LEU A C     1 
ATOM   483  O  O     . LEU A 1 76  ? -42.775 13.073  7.860   1.00 47.14  ? 64  LEU A O     1 
ATOM   484  C  CB    . LEU A 1 76  ? -44.998 14.843  6.463   1.00 46.70  ? 64  LEU A CB    1 
ATOM   485  C  CG    . LEU A 1 76  ? -45.808 15.676  5.484   1.00 46.62  ? 64  LEU A CG    1 
ATOM   486  C  CD1   . LEU A 1 76  ? -47.300 15.427  5.717   1.00 43.80  ? 64  LEU A CD1   1 
ATOM   487  C  CD2   . LEU A 1 76  ? -45.471 17.191  5.603   1.00 46.32  ? 64  LEU A CD2   1 
ATOM   488  N  N     . GLY A 1 77  ? -42.283 15.218  8.335   1.00 50.51  ? 65  GLY A N     1 
ATOM   489  C  CA    . GLY A 1 77  ? -41.638 14.927  9.586   1.00 53.63  ? 65  GLY A CA    1 
ATOM   490  C  C     . GLY A 1 77  ? -40.249 14.345  9.463   1.00 54.73  ? 65  GLY A C     1 
ATOM   491  O  O     . GLY A 1 77  ? -39.555 14.233  10.466  1.00 57.34  ? 65  GLY A O     1 
ATOM   492  N  N     . VAL A 1 78  ? -39.832 13.983  8.257   1.00 53.56  ? 66  VAL A N     1 
ATOM   493  C  CA    . VAL A 1 78  ? -38.558 13.315  8.091   1.00 54.76  ? 66  VAL A CA    1 
ATOM   494  C  C     . VAL A 1 78  ? -37.512 14.192  7.384   1.00 54.36  ? 66  VAL A C     1 
ATOM   495  O  O     . VAL A 1 78  ? -36.325 14.010  7.553   1.00 55.85  ? 66  VAL A O     1 
ATOM   496  C  CB    . VAL A 1 78  ? -38.766 11.950  7.375   1.00 52.98  ? 66  VAL A CB    1 
ATOM   497  C  CG1   . VAL A 1 78  ? -37.588 11.609  6.518   1.00 55.34  ? 66  VAL A CG1   1 
ATOM   498  C  CG2   . VAL A 1 78  ? -38.982 10.891  8.444   1.00 55.03  ? 66  VAL A CG2   1 
ATOM   499  N  N     . VAL A 1 79  ? -37.956 15.184  6.652   1.00 52.84  ? 67  VAL A N     1 
ATOM   500  C  CA    . VAL A 1 79  ? -37.046 16.081  5.971   1.00 52.65  ? 67  VAL A CA    1 
ATOM   501  C  C     . VAL A 1 79  ? -37.296 17.483  6.520   1.00 54.44  ? 67  VAL A C     1 
ATOM   502  O  O     . VAL A 1 79  ? -38.230 17.695  7.280   1.00 54.52  ? 67  VAL A O     1 
ATOM   503  C  CB    . VAL A 1 79  ? -37.305 16.065  4.462   1.00 50.64  ? 67  VAL A CB    1 
ATOM   504  C  CG1   . VAL A 1 79  ? -37.232 14.638  3.920   1.00 47.78  ? 67  VAL A CG1   1 
ATOM   505  C  CG2   . VAL A 1 79  ? -38.649 16.673  4.160   1.00 48.58  ? 67  VAL A CG2   1 
ATOM   506  N  N     . LYS A 1 80  ? -36.494 18.428  6.081   1.00 54.87  ? 68  LYS A N     1 
ATOM   507  C  CA    . LYS A 1 80  ? -36.525 19.759  6.602   1.00 57.74  ? 68  LYS A CA    1 
ATOM   508  C  C     . LYS A 1 80  ? -37.802 20.539  6.274   1.00 56.89  ? 68  LYS A C     1 
ATOM   509  O  O     . LYS A 1 80  ? -38.302 21.271  7.099   1.00 58.42  ? 68  LYS A O     1 
ATOM   510  C  CB    . LYS A 1 80  ? -35.299 20.499  6.081   1.00 59.88  ? 68  LYS A CB    1 
ATOM   511  C  CG    . LYS A 1 80  ? -35.101 21.862  6.699   1.00 65.87  ? 68  LYS A CG    1 
ATOM   512  C  CD    . LYS A 1 80  ? -33.788 22.469  6.246   1.00 71.76  ? 68  LYS A CD    1 
ATOM   513  C  CE    . LYS A 1 80  ? -32.624 21.951  7.088   1.00 75.14  ? 68  LYS A CE    1 
ATOM   514  N  NZ    . LYS A 1 80  ? -31.324 22.170  6.387   1.00 77.14  ? 68  LYS A NZ    1 
ATOM   515  N  N     . ASP A 1 81  ? -38.317 20.394  5.069   1.00 54.10  ? 69  ASP A N     1 
ATOM   516  C  CA    . ASP A 1 81  ? -39.537 21.074  4.688   1.00 53.57  ? 69  ASP A CA    1 
ATOM   517  C  C     . ASP A 1 81  ? -40.096 20.366  3.447   1.00 50.55  ? 69  ASP A C     1 
ATOM   518  O  O     . ASP A 1 81  ? -39.336 19.921  2.574   1.00 47.92  ? 69  ASP A O     1 
ATOM   519  C  CB    . ASP A 1 81  ? -39.267 22.566  4.371   1.00 55.83  ? 69  ASP A CB    1 
ATOM   520  C  CG    . ASP A 1 81  ? -40.546 23.397  4.236   1.00 58.09  ? 69  ASP A CG    1 
ATOM   521  O  OD1   . ASP A 1 81  ? -41.546 23.072  4.899   1.00 61.78  ? 69  ASP A OD1   1 
ATOM   522  O  OD2   . ASP A 1 81  ? -40.567 24.389  3.460   1.00 62.04  ? 69  ASP A OD2   1 
ATOM   523  N  N     . VAL A 1 82  ? -41.422 20.249  3.413   1.00 49.00  ? 70  VAL A N     1 
ATOM   524  C  CA    . VAL A 1 82  ? -42.136 19.823  2.223   1.00 47.58  ? 70  VAL A CA    1 
ATOM   525  C  C     . VAL A 1 82  ? -43.204 20.846  1.918   1.00 47.37  ? 70  VAL A C     1 
ATOM   526  O  O     . VAL A 1 82  ? -43.915 21.232  2.797   1.00 47.90  ? 70  VAL A O     1 
ATOM   527  C  CB    . VAL A 1 82  ? -42.885 18.515  2.456   1.00 46.54  ? 70  VAL A CB    1 
ATOM   528  C  CG1   . VAL A 1 82  ? -43.425 17.987  1.114   1.00 44.87  ? 70  VAL A CG1   1 
ATOM   529  C  CG2   . VAL A 1 82  ? -42.025 17.553  3.144   1.00 46.50  ? 70  VAL A CG2   1 
ATOM   530  N  N     . LEU A 1 83  ? -43.326 21.254  0.669   1.00 46.71  ? 71  LEU A N     1 
ATOM   531  C  CA    . LEU A 1 83  ? -44.502 22.001  0.208   1.00 46.79  ? 71  LEU A CA    1 
ATOM   532  C  C     . LEU A 1 83  ? -45.044 21.349  -1.056  1.00 44.58  ? 71  LEU A C     1 
ATOM   533  O  O     . LEU A 1 83  ? -44.267 20.980  -1.922  1.00 43.80  ? 71  LEU A O     1 
ATOM   534  C  CB    . LEU A 1 83  ? -44.100 23.464  -0.062  1.00 47.87  ? 71  LEU A CB    1 
ATOM   535  C  CG    . LEU A 1 83  ? -45.180 24.375  -0.611  1.00 48.94  ? 71  LEU A CG    1 
ATOM   536  C  CD1   . LEU A 1 83  ? -46.318 24.488  0.441   1.00 45.44  ? 71  LEU A CD1   1 
ATOM   537  C  CD2   . LEU A 1 83  ? -44.555 25.719  -0.984  1.00 48.67  ? 71  LEU A CD2   1 
ATOM   538  N  N     . VAL A 1 84  ? -46.361 21.170  -1.158  1.00 44.44  ? 72  VAL A N     1 
ATOM   539  C  CA    . VAL A 1 84  ? -46.970 20.762  -2.412  1.00 42.40  ? 72  VAL A CA    1 
ATOM   540  C  C     . VAL A 1 84  ? -47.582 21.999  -3.102  1.00 44.49  ? 72  VAL A C     1 
ATOM   541  O  O     . VAL A 1 84  ? -48.305 22.751  -2.478  1.00 45.27  ? 72  VAL A O     1 
ATOM   542  C  CB    . VAL A 1 84  ? -48.078 19.729  -2.259  1.00 41.57  ? 72  VAL A CB    1 
ATOM   543  C  CG1   . VAL A 1 84  ? -48.830 19.536  -3.628  1.00 39.62  ? 72  VAL A CG1   1 
ATOM   544  C  CG2   . VAL A 1 84  ? -47.558 18.382  -1.705  1.00 39.22  ? 72  VAL A CG2   1 
ATOM   545  N  N     . VAL A 1 85  ? -47.273 22.183  -4.381  1.00 44.63  ? 73  VAL A N     1 
ATOM   546  C  CA    . VAL A 1 85  ? -48.044 23.093  -5.255  1.00 46.75  ? 73  VAL A CA    1 
ATOM   547  C  C     . VAL A 1 85  ? -48.977 22.242  -6.112  1.00 45.90  ? 73  VAL A C     1 
ATOM   548  O  O     . VAL A 1 85  ? -48.525 21.427  -6.930  1.00 44.33  ? 73  VAL A O     1 
ATOM   549  C  CB    . VAL A 1 85  ? -47.150 23.938  -6.191  1.00 47.00  ? 73  VAL A CB    1 
ATOM   550  C  CG1   . VAL A 1 85  ? -48.023 24.891  -7.031  1.00 48.31  ? 73  VAL A CG1   1 
ATOM   551  C  CG2   . VAL A 1 85  ? -46.113 24.699  -5.386  1.00 47.92  ? 73  VAL A CG2   1 
ATOM   552  N  N     . PHE A 1 86  ? -50.278 22.383  -5.886  1.00 47.60  ? 74  PHE A N     1 
ATOM   553  C  CA    . PHE A 1 86  ? -51.244 21.600  -6.615  1.00 47.07  ? 74  PHE A CA    1 
ATOM   554  C  C     . PHE A 1 86  ? -51.690 22.449  -7.821  1.00 49.25  ? 74  PHE A C     1 
ATOM   555  O  O     . PHE A 1 86  ? -52.220 23.524  -7.648  1.00 49.93  ? 74  PHE A O     1 
ATOM   556  C  CB    . PHE A 1 86  ? -52.422 21.190  -5.737  1.00 47.56  ? 74  PHE A CB    1 
ATOM   557  C  CG    . PHE A 1 86  ? -53.516 20.570  -6.515  1.00 48.12  ? 74  PHE A CG    1 
ATOM   558  C  CD1   . PHE A 1 86  ? -53.319 19.336  -7.115  1.00 45.61  ? 74  PHE A CD1   1 
ATOM   559  C  CD2   . PHE A 1 86  ? -54.693 21.268  -6.777  1.00 52.47  ? 74  PHE A CD2   1 
ATOM   560  C  CE1   . PHE A 1 86  ? -54.296 18.764  -7.886  1.00 46.78  ? 74  PHE A CE1   1 
ATOM   561  C  CE2   . PHE A 1 86  ? -55.672 20.709  -7.588  1.00 53.28  ? 74  PHE A CE2   1 
ATOM   562  C  CZ    . PHE A 1 86  ? -55.473 19.467  -8.156  1.00 50.15  ? 74  PHE A CZ    1 
ATOM   563  N  N     . LEU A 1 87  ? -51.442 21.945  -9.035  1.00 49.46  ? 75  LEU A N     1 
ATOM   564  C  CA    . LEU A 1 87  ? -51.573 22.737  -10.250 1.00 51.07  ? 75  LEU A CA    1 
ATOM   565  C  C     . LEU A 1 87  ? -52.776 22.319  -11.055 1.00 51.92  ? 75  LEU A C     1 
ATOM   566  O  O     . LEU A 1 87  ? -53.064 22.944  -12.066 1.00 52.30  ? 75  LEU A O     1 
ATOM   567  C  CB    . LEU A 1 87  ? -50.323 22.586  -11.125 1.00 50.03  ? 75  LEU A CB    1 
ATOM   568  C  CG    . LEU A 1 87  ? -49.049 23.132  -10.492 1.00 51.48  ? 75  LEU A CG    1 
ATOM   569  C  CD1   . LEU A 1 87  ? -47.834 22.579  -11.206 1.00 49.04  ? 75  LEU A CD1   1 
ATOM   570  C  CD2   . LEU A 1 87  ? -49.073 24.655  -10.586 1.00 52.58  ? 75  LEU A CD2   1 
ATOM   571  N  N     . GLY A 1 88  ? -53.476 21.279  -10.627 1.00 52.02  ? 76  GLY A N     1 
ATOM   572  C  CA    . GLY A 1 88  ? -54.634 20.809  -11.381 1.00 53.31  ? 76  GLY A CA    1 
ATOM   573  C  C     . GLY A 1 88  ? -55.924 21.532  -11.062 1.00 56.50  ? 76  GLY A C     1 
ATOM   574  O  O     . GLY A 1 88  ? -55.950 22.484  -10.241 1.00 57.40  ? 76  GLY A O     1 
ATOM   575  N  N     . LYS A 1 89  ? -56.994 21.069  -11.713 1.00 57.93  ? 77  LYS A N     1 
ATOM   576  C  CA    . LYS A 1 89  ? -58.333 21.628  -11.518 1.00 62.08  ? 77  LYS A CA    1 
ATOM   577  C  C     . LYS A 1 89  ? -59.145 20.746  -10.621 1.00 61.95  ? 77  LYS A C     1 
ATOM   578  O  O     . LYS A 1 89  ? -59.815 21.242  -9.728  1.00 66.27  ? 77  LYS A O     1 
ATOM   579  C  CB    . LYS A 1 89  ? -59.089 21.775  -12.852 1.00 63.93  ? 77  LYS A CB    1 
ATOM   580  C  CG    . LYS A 1 89  ? -58.792 23.060  -13.689 1.00 69.44  ? 77  LYS A CG    1 
ATOM   581  C  CD    . LYS A 1 89  ? -57.489 23.850  -13.281 1.00 73.49  ? 77  LYS A CD    1 
ATOM   582  C  CE    . LYS A 1 89  ? -57.802 24.976  -12.237 1.00 77.42  ? 77  LYS A CE    1 
ATOM   583  N  NZ    . LYS A 1 89  ? -56.627 25.390  -11.385 1.00 78.65  ? 77  LYS A NZ    1 
ATOM   584  N  N     . LYS A 1 90  ? -59.141 19.454  -10.911 1.00 58.96  ? 78  LYS A N     1 
ATOM   585  C  CA    . LYS A 1 90  ? -59.918 18.469  -10.183 1.00 58.27  ? 78  LYS A CA    1 
ATOM   586  C  C     . LYS A 1 90  ? -58.951 17.333  -9.924  1.00 53.73  ? 78  LYS A C     1 
ATOM   587  O  O     . LYS A 1 90  ? -57.857 17.304  -10.499 1.00 50.83  ? 78  LYS A O     1 
ATOM   588  C  CB    . LYS A 1 90  ? -61.119 17.983  -11.017 1.00 60.28  ? 78  LYS A CB    1 
ATOM   589  C  CG    . LYS A 1 90  ? -60.731 17.371  -12.413 1.00 62.92  ? 78  LYS A CG    1 
ATOM   590  C  CD    . LYS A 1 90  ? -61.970 17.224  -13.366 1.00 69.36  ? 78  LYS A CD    1 
ATOM   591  C  CE    . LYS A 1 90  ? -61.568 16.624  -14.747 1.00 70.22  ? 78  LYS A CE    1 
ATOM   592  N  NZ    . LYS A 1 90  ? -60.700 15.392  -14.616 1.00 68.05  ? 78  LYS A NZ    1 
ATOM   593  N  N     . LYS A 1 91  ? -59.348 16.407  -9.065  1.00 50.35  ? 79  LYS A N     1 
ATOM   594  C  CA    . LYS A 1 91  ? -58.494 15.347  -8.674  1.00 48.02  ? 79  LYS A CA    1 
ATOM   595  C  C     . LYS A 1 91  ? -59.169 14.052  -9.007  1.00 46.95  ? 79  LYS A C     1 
ATOM   596  O  O     . LYS A 1 91  ? -60.347 13.905  -8.738  1.00 48.42  ? 79  LYS A O     1 
ATOM   597  C  CB    . LYS A 1 91  ? -58.189 15.457  -7.171  1.00 48.00  ? 79  LYS A CB    1 
ATOM   598  C  CG    . LYS A 1 91  ? -57.363 16.689  -6.821  1.00 47.70  ? 79  LYS A CG    1 
ATOM   599  C  CD    . LYS A 1 91  ? -57.057 16.795  -5.327  1.00 48.46  ? 79  LYS A CD    1 
ATOM   600  C  CE    . LYS A 1 91  ? -56.527 18.178  -4.946  1.00 48.29  ? 79  LYS A CE    1 
ATOM   601  N  NZ    . LYS A 1 91  ? -57.626 19.204  -4.826  1.00 49.27  ? 79  LYS A NZ    1 
ATOM   602  N  N     . THR A 1 92  ? -58.432 13.083  -9.524  1.00 43.41  ? 80  THR A N     1 
ATOM   603  C  CA    . THR A 1 92  ? -58.959 11.739  -9.635  1.00 44.19  ? 80  THR A CA    1 
ATOM   604  C  C     . THR A 1 92  ? -59.158 11.143  -8.209  1.00 45.00  ? 80  THR A C     1 
ATOM   605  O  O     . THR A 1 92  ? -58.635 11.671  -7.206  1.00 44.28  ? 80  THR A O     1 
ATOM   606  C  CB    . THR A 1 92  ? -58.036 10.810  -10.386 1.00 43.46  ? 80  THR A CB    1 
ATOM   607  O  OG1   . THR A 1 92  ? -56.836 10.652  -9.629  1.00 41.04  ? 80  THR A OG1   1 
ATOM   608  C  CG2   . THR A 1 92  ? -57.703 11.295  -11.818 1.00 44.42  ? 80  THR A CG2   1 
ATOM   609  N  N     . PRO A 1 93  ? -59.892 10.032  -8.114  1.00 45.75  ? 81  PRO A N     1 
ATOM   610  C  CA    . PRO A 1 93  ? -60.226 9.485   -6.784  1.00 46.63  ? 81  PRO A CA    1 
ATOM   611  C  C     . PRO A 1 93  ? -58.960 9.182   -5.969  1.00 44.23  ? 81  PRO A C     1 
ATOM   612  O  O     . PRO A 1 93  ? -58.878 9.513   -4.790  1.00 44.03  ? 81  PRO A O     1 
ATOM   613  C  CB    . PRO A 1 93  ? -60.988 8.191   -7.105  1.00 47.33  ? 81  PRO A CB    1 
ATOM   614  C  CG    . PRO A 1 93  ? -61.622 8.453   -8.468  1.00 50.17  ? 81  PRO A CG    1 
ATOM   615  C  CD    . PRO A 1 93  ? -60.644 9.371   -9.202  1.00 47.97  ? 81  PRO A CD    1 
ATOM   616  N  N     . ASP A 1 94  ? -57.967 8.592   -6.603  1.00 43.55  ? 82  ASP A N     1 
ATOM   617  C  CA    . ASP A 1 94  ? -56.754 8.227   -5.842  1.00 42.14  ? 82  ASP A CA    1 
ATOM   618  C  C     . ASP A 1 94  ? -55.951 9.453   -5.531  1.00 40.73  ? 82  ASP A C     1 
ATOM   619  O  O     . ASP A 1 94  ? -55.364 9.504   -4.460  1.00 39.94  ? 82  ASP A O     1 
ATOM   620  C  CB    . ASP A 1 94  ? -55.953 7.158   -6.563  1.00 41.49  ? 82  ASP A CB    1 
ATOM   621  C  CG    . ASP A 1 94  ? -56.692 5.812   -6.592  1.00 43.99  ? 82  ASP A CG    1 
ATOM   622  O  OD1   . ASP A 1 94  ? -57.609 5.636   -5.797  1.00 47.43  ? 82  ASP A OD1   1 
ATOM   623  O  OD2   . ASP A 1 94  ? -56.351 4.926   -7.377  1.00 48.37  ? 82  ASP A OD2   1 
ATOM   624  N  N     . CYS A 1 95  ? -55.938 10.452  -6.429  1.00 39.58  ? 83  CYS A N     1 
ATOM   625  C  CA    . CYS A 1 95  ? -55.249 11.698  -6.126  1.00 39.21  ? 83  CYS A CA    1 
ATOM   626  C  C     . CYS A 1 95  ? -55.935 12.398  -4.957  1.00 41.21  ? 83  CYS A C     1 
ATOM   627  O  O     . CYS A 1 95  ? -55.282 12.894  -4.016  1.00 40.35  ? 83  CYS A O     1 
ATOM   628  C  CB    . CYS A 1 95  ? -55.182 12.597  -7.365  1.00 40.05  ? 83  CYS A CB    1 
ATOM   629  S  SG    . CYS A 1 95  ? -54.264 14.145  -7.086  1.00 41.38  ? 83  CYS A SG    1 
ATOM   630  N  N     . GLU A 1 96  ? -57.276 12.392  -4.979  1.00 42.49  ? 84  GLU A N     1 
ATOM   631  C  CA    . GLU A 1 96  ? -58.043 13.027  -3.940  1.00 44.33  ? 84  GLU A CA    1 
ATOM   632  C  C     . GLU A 1 96  ? -57.776 12.362  -2.572  1.00 43.58  ? 84  GLU A C     1 
ATOM   633  O  O     . GLU A 1 96  ? -57.575 13.060  -1.580  1.00 42.08  ? 84  GLU A O     1 
ATOM   634  C  CB    . GLU A 1 96  ? -59.541 13.008  -4.321  1.00 46.61  ? 84  GLU A CB    1 
ATOM   635  C  CG    . GLU A 1 96  ? -60.490 13.630  -3.307  1.00 54.17  ? 84  GLU A CG    1 
ATOM   636  C  CD    . GLU A 1 96  ? -60.352 15.140  -3.187  1.00 59.82  ? 84  GLU A CD    1 
ATOM   637  O  OE1   . GLU A 1 96  ? -60.181 15.591  -2.042  1.00 65.22  ? 84  GLU A OE1   1 
ATOM   638  O  OE2   . GLU A 1 96  ? -60.446 15.880  -4.209  1.00 66.33  ? 84  GLU A OE2   1 
ATOM   639  N  N     . TYR A 1 97  ? -57.793 11.029  -2.553  1.00 42.27  ? 85  TYR A N     1 
ATOM   640  C  CA    . TYR A 1 97  ? -57.570 10.243  -1.333  1.00 42.51  ? 85  TYR A CA    1 
ATOM   641  C  C     . TYR A 1 97  ? -56.206 10.575  -0.753  1.00 40.60  ? 85  TYR A C     1 
ATOM   642  O  O     . TYR A 1 97  ? -56.056 10.819  0.441   1.00 38.10  ? 85  TYR A O     1 
ATOM   643  C  CB    . TYR A 1 97  ? -57.641 8.726   -1.639  1.00 42.47  ? 85  TYR A CB    1 
ATOM   644  C  CG    . TYR A 1 97  ? -57.291 7.839   -0.437  1.00 43.10  ? 85  TYR A CG    1 
ATOM   645  C  CD1   . TYR A 1 97  ? -58.202 7.634   0.611   1.00 46.77  ? 85  TYR A CD1   1 
ATOM   646  C  CD2   . TYR A 1 97  ? -56.058 7.206   -0.353  1.00 42.42  ? 85  TYR A CD2   1 
ATOM   647  C  CE1   . TYR A 1 97  ? -57.869 6.854   1.719   1.00 45.58  ? 85  TYR A CE1   1 
ATOM   648  C  CE2   . TYR A 1 97  ? -55.743 6.395   0.726   1.00 43.96  ? 85  TYR A CE2   1 
ATOM   649  C  CZ    . TYR A 1 97  ? -56.628 6.242   1.765   1.00 44.14  ? 85  TYR A CZ    1 
ATOM   650  O  OH    . TYR A 1 97  ? -56.244 5.427   2.803   1.00 46.49  ? 85  TYR A OH    1 
ATOM   651  N  N     . ASN A 1 98  ? -55.201 10.637  -1.630  1.00 39.78  ? 86  ASN A N     1 
ATOM   652  C  CA    . ASN A 1 98  ? -53.835 10.891  -1.172  1.00 39.65  ? 86  ASN A CA    1 
ATOM   653  C  C     . ASN A 1 98  ? -53.515 12.343  -0.785  1.00 41.24  ? 86  ASN A C     1 
ATOM   654  O  O     . ASN A 1 98  ? -52.768 12.584  0.191   1.00 40.57  ? 86  ASN A O     1 
ATOM   655  C  CB    . ASN A 1 98  ? -52.852 10.255  -2.136  1.00 38.30  ? 86  ASN A CB    1 
ATOM   656  C  CG    . ASN A 1 98  ? -52.728 8.779   -1.882  1.00 35.81  ? 86  ASN A CG    1 
ATOM   657  O  OD1   . ASN A 1 98  ? -52.275 8.382   -0.803  1.00 36.67  ? 86  ASN A OD1   1 
ATOM   658  N  ND2   . ASN A 1 98  ? -53.094 7.950   -2.867  1.00 32.31  ? 86  ASN A ND2   1 
ATOM   659  N  N     . TYR A 1 99  ? -54.171 13.292  -1.469  1.00 42.34  ? 87  TYR A N     1 
ATOM   660  C  CA    . TYR A 1 99  ? -54.257 14.709  -1.040  1.00 43.58  ? 87  TYR A CA    1 
ATOM   661  C  C     . TYR A 1 99  ? -54.848 14.776  0.351   1.00 44.36  ? 87  TYR A C     1 
ATOM   662  O  O     . TYR A 1 99  ? -54.304 15.411  1.243   1.00 45.77  ? 87  TYR A O     1 
ATOM   663  C  CB    . TYR A 1 99  ? -55.161 15.491  -2.043  1.00 44.91  ? 87  TYR A CB    1 
ATOM   664  C  CG    . TYR A 1 99  ? -55.724 16.823  -1.581  1.00 48.77  ? 87  TYR A CG    1 
ATOM   665  C  CD1   . TYR A 1 99  ? -54.915 17.940  -1.530  1.00 51.02  ? 87  TYR A CD1   1 
ATOM   666  C  CD2   . TYR A 1 99  ? -57.093 16.975  -1.239  1.00 54.88  ? 87  TYR A CD2   1 
ATOM   667  C  CE1   . TYR A 1 99  ? -55.396 19.177  -1.155  1.00 54.83  ? 87  TYR A CE1   1 
ATOM   668  C  CE2   . TYR A 1 99  ? -57.612 18.239  -0.866  1.00 57.96  ? 87  TYR A CE2   1 
ATOM   669  C  CZ    . TYR A 1 99  ? -56.737 19.340  -0.830  1.00 59.26  ? 87  TYR A CZ    1 
ATOM   670  O  OH    . TYR A 1 99  ? -57.113 20.604  -0.447  1.00 62.49  ? 87  TYR A OH    1 
ATOM   671  N  N     . GLY A 1 100 ? -55.977 14.106  0.535   1.00 45.45  ? 88  GLY A N     1 
ATOM   672  C  CA    . GLY A 1 100 ? -56.639 14.019  1.850   1.00 46.13  ? 88  GLY A CA    1 
ATOM   673  C  C     . GLY A 1 100 ? -55.691 13.479  2.912   1.00 45.47  ? 88  GLY A C     1 
ATOM   674  O  O     . GLY A 1 100 ? -55.601 14.042  3.992   1.00 45.59  ? 88  GLY A O     1 
ATOM   675  N  N     . LEU A 1 101 ? -54.933 12.422  2.605   1.00 43.30  ? 89  LEU A N     1 
ATOM   676  C  CA    . LEU A 1 101 ? -53.936 11.900  3.614   1.00 42.45  ? 89  LEU A CA    1 
ATOM   677  C  C     . LEU A 1 101 ? -52.821 12.902  3.954   1.00 42.35  ? 89  LEU A C     1 
ATOM   678  O  O     . LEU A 1 101 ? -52.454 13.112  5.137   1.00 41.56  ? 89  LEU A O     1 
ATOM   679  C  CB    . LEU A 1 101 ? -53.299 10.605  3.155   1.00 40.17  ? 89  LEU A CB    1 
ATOM   680  C  CG    . LEU A 1 101 ? -54.207 9.388   3.114   1.00 42.71  ? 89  LEU A CG    1 
ATOM   681  C  CD1   . LEU A 1 101 ? -53.419 8.145   2.726   1.00 40.48  ? 89  LEU A CD1   1 
ATOM   682  C  CD2   . LEU A 1 101 ? -55.019 9.180   4.456   1.00 43.66  ? 89  LEU A CD2   1 
ATOM   683  N  N     . TYR A 1 102 ? -52.291 13.501  2.901   1.00 41.87  ? 90  TYR A N     1 
ATOM   684  C  CA    . TYR A 1 102 ? -51.219 14.493  3.019   1.00 42.32  ? 90  TYR A CA    1 
ATOM   685  C  C     . TYR A 1 102 ? -51.676 15.576  3.966   1.00 43.87  ? 90  TYR A C     1 
ATOM   686  O  O     . TYR A 1 102 ? -50.979 15.877  4.947   1.00 45.55  ? 90  TYR A O     1 
ATOM   687  C  CB    . TYR A 1 102 ? -50.858 15.077  1.662   1.00 40.59  ? 90  TYR A CB    1 
ATOM   688  C  CG    . TYR A 1 102 ? -49.817 16.201  1.708   1.00 41.76  ? 90  TYR A CG    1 
ATOM   689  C  CD1   . TYR A 1 102 ? -48.474 15.947  2.030   1.00 40.79  ? 90  TYR A CD1   1 
ATOM   690  C  CD2   . TYR A 1 102 ? -50.154 17.481  1.387   1.00 42.11  ? 90  TYR A CD2   1 
ATOM   691  C  CE1   . TYR A 1 102 ? -47.537 16.971  2.073   1.00 37.93  ? 90  TYR A CE1   1 
ATOM   692  C  CE2   . TYR A 1 102 ? -49.204 18.509  1.402   1.00 42.63  ? 90  TYR A CE2   1 
ATOM   693  C  CZ    . TYR A 1 102 ? -47.911 18.243  1.735   1.00 40.30  ? 90  TYR A CZ    1 
ATOM   694  O  OH    . TYR A 1 102 ? -47.015 19.297  1.760   1.00 43.47  ? 90  TYR A OH    1 
ATOM   695  N  N     . LYS A 1 103 ? -52.854 16.121  3.718   1.00 76.98  ? 91  LYS A N     1 
ATOM   696  C  CA    . LYS A 1 103 ? -53.384 17.179  4.612   1.00 79.91  ? 91  LYS A CA    1 
ATOM   697  C  C     . LYS A 1 103 ? -53.683 16.687  6.040   1.00 83.53  ? 91  LYS A C     1 
ATOM   698  O  O     . LYS A 1 103 ? -53.431 17.407  6.999   1.00 84.97  ? 91  LYS A O     1 
ATOM   699  C  CB    . LYS A 1 103 ? -54.617 17.839  4.011   1.00 80.91  ? 91  LYS A CB    1 
ATOM   700  C  CG    . LYS A 1 103 ? -54.317 18.536  2.678   1.00 81.16  ? 91  LYS A CG    1 
ATOM   701  C  CD    . LYS A 1 103 ? -55.443 19.448  2.178   1.00 87.64  ? 91  LYS A CD    1 
ATOM   702  C  CE    . LYS A 1 103 ? -55.583 20.798  2.904   1.00 93.87  ? 91  LYS A CE    1 
ATOM   703  N  NZ    . LYS A 1 103 ? -54.244 21.346  3.283   1.00 97.61  ? 91  LYS A NZ    1 
ATOM   704  N  N     . LYS A 1 104 ? -54.194 15.465  6.196   1.00 84.74  ? 92  LYS A N     1 
ATOM   705  C  CA    . LYS A 1 104 ? -54.495 14.939  7.554   1.00 90.52  ? 92  LYS A CA    1 
ATOM   706  C  C     . LYS A 1 104 ? -53.177 14.759  8.326   1.00 92.11  ? 92  LYS A C     1 
ATOM   707  O  O     . LYS A 1 104 ? -53.136 14.923  9.547   1.00 95.03  ? 92  LYS A O     1 
ATOM   708  C  CB    . LYS A 1 104 ? -55.213 13.582  7.491   1.00 92.20  ? 92  LYS A CB    1 
ATOM   709  C  CG    . LYS A 1 104 ? -56.716 13.660  7.338   1.00 94.90  ? 92  LYS A CG    1 
ATOM   710  C  CD    . LYS A 1 104 ? -57.415 13.847  8.671   1.00 102.94 ? 92  LYS A CD    1 
ATOM   711  C  CE    . LYS A 1 104 ? -58.940 13.773  8.541   1.00 104.68 ? 92  LYS A CE    1 
ATOM   712  N  NZ    . LYS A 1 104 ? -59.634 14.521  9.662   1.00 110.59 ? 92  LYS A NZ    1 
ATOM   713  N  N     . PHE A 1 105 ? -52.101 14.455  7.579   1.00 88.34  ? 93  PHE A N     1 
ATOM   714  C  CA    . PHE A 1 105 ? -50.787 14.264  8.191   1.00 90.88  ? 93  PHE A CA    1 
ATOM   715  C  C     . PHE A 1 105 ? -50.102 15.578  8.551   1.00 92.07  ? 93  PHE A C     1 
ATOM   716  O  O     . PHE A 1 105 ? -49.044 15.549  9.137   1.00 94.98  ? 93  PHE A O     1 
ATOM   717  C  CB    . PHE A 1 105 ? -49.872 13.420  7.309   1.00 86.55  ? 93  PHE A CB    1 
ATOM   718  C  CG    . PHE A 1 105 ? -49.977 11.925  7.541   1.00 88.96  ? 93  PHE A CG    1 
ATOM   719  C  CD1   . PHE A 1 105 ? -51.171 11.254  7.383   1.00 89.12  ? 93  PHE A CD1   1 
ATOM   720  C  CD2   . PHE A 1 105 ? -48.840 11.170  7.860   1.00 90.47  ? 93  PHE A CD2   1 
ATOM   721  C  CE1   . PHE A 1 105 ? -51.235 9.864   7.555   1.00 89.17  ? 93  PHE A CE1   1 
ATOM   722  C  CE2   . PHE A 1 105 ? -48.906 9.795   8.054   1.00 90.89  ? 93  PHE A CE2   1 
ATOM   723  C  CZ    . PHE A 1 105 ? -50.090 9.140   7.896   1.00 90.70  ? 93  PHE A CZ    1 
ATOM   724  N  N     . GLY A 1 106 ? -50.710 16.722  8.240   1.00 91.37  ? 94  GLY A N     1 
ATOM   725  C  CA    . GLY A 1 106 ? -50.135 18.040  8.550   1.00 92.04  ? 94  GLY A CA    1 
ATOM   726  C  C     . GLY A 1 106 ? -49.439 18.720  7.363   1.00 87.68  ? 94  GLY A C     1 
ATOM   727  O  O     . GLY A 1 106 ? -48.724 19.695  7.522   1.00 88.70  ? 94  GLY A O     1 
ATOM   728  N  N     . GLY A 1 107 ? -49.710 18.269  6.155   1.00 83.16  ? 95  GLY A N     1 
ATOM   729  C  CA    . GLY A 1 107 ? -49.005 18.813  4.982   1.00 80.30  ? 95  GLY A CA    1 
ATOM   730  C  C     . GLY A 1 107 ? -49.547 20.134  4.464   1.00 79.49  ? 95  GLY A C     1 
ATOM   731  O  O     . GLY A 1 107 ? -50.726 20.385  4.530   1.00 79.09  ? 95  GLY A O     1 
ATOM   732  N  N     . LYS A 1 108 ? -48.678 20.945  3.872   1.00 79.68  ? 96  LYS A N     1 
ATOM   733  C  CA    . LYS A 1 108 ? -49.071 22.261  3.324   1.00 80.33  ? 96  LYS A CA    1 
ATOM   734  C  C     . LYS A 1 108 ? -49.203 22.151  1.811   1.00 77.08  ? 96  LYS A C     1 
ATOM   735  O  O     . LYS A 1 108 ? -48.260 21.708  1.122   1.00 75.15  ? 96  LYS A O     1 
ATOM   736  C  CB    . LYS A 1 108 ? -48.034 23.330  3.704   1.00 82.45  ? 96  LYS A CB    1 
ATOM   737  C  CG    . LYS A 1 108 ? -48.357 24.759  3.289   1.00 88.21  ? 96  LYS A CG    1 
ATOM   738  C  CD    . LYS A 1 108 ? -47.208 25.733  3.708   1.00 94.43  ? 96  LYS A CD    1 
ATOM   739  C  CE    . LYS A 1 108 ? -47.693 27.141  4.023   1.00 98.48  ? 96  LYS A CE    1 
ATOM   740  N  NZ    . LYS A 1 108 ? -48.597 27.677  2.985   1.00 98.87  ? 96  LYS A NZ    1 
ATOM   741  N  N     . VAL A 1 109 ? -50.374 22.535  1.300   1.00 76.50  ? 97  VAL A N     1 
ATOM   742  C  CA    . VAL A 1 109 ? -50.603 22.616  -0.130  1.00 75.60  ? 97  VAL A CA    1 
ATOM   743  C  C     . VAL A 1 109 ? -50.845 24.052  -0.472  1.00 76.87  ? 97  VAL A C     1 
ATOM   744  O  O     . VAL A 1 109 ? -51.437 24.747  0.309   1.00 79.65  ? 97  VAL A O     1 
ATOM   745  C  CB    . VAL A 1 109 ? -51.838 21.843  -0.592  1.00 75.03  ? 97  VAL A CB    1 
ATOM   746  C  CG1   . VAL A 1 109 ? -51.998 21.994  -2.111  1.00 72.61  ? 97  VAL A CG1   1 
ATOM   747  C  CG2   . VAL A 1 109 ? -51.732 20.368  -0.190  1.00 72.86  ? 97  VAL A CG2   1 
ATOM   748  N  N     . VAL A 1 110 ? -50.364 24.514  -1.614  1.00 75.93  ? 98  VAL A N     1 
ATOM   749  C  CA    . VAL A 1 110 ? -50.814 25.807  -2.138  1.00 78.09  ? 98  VAL A CA    1 
ATOM   750  C  C     . VAL A 1 110 ? -51.222 25.538  -3.569  1.00 78.23  ? 98  VAL A C     1 
ATOM   751  O  O     . VAL A 1 110 ? -50.803 24.514  -4.139  1.00 76.14  ? 98  VAL A O     1 
ATOM   752  C  CB    . VAL A 1 110 ? -49.754 26.955  -2.028  1.00 79.90  ? 98  VAL A CB    1 
ATOM   753  C  CG1   . VAL A 1 110 ? -49.513 27.351  -0.559  1.00 79.51  ? 98  VAL A CG1   1 
ATOM   754  C  CG2   . VAL A 1 110 ? -48.451 26.565  -2.714  1.00 77.69  ? 98  VAL A CG2   1 
ATOM   755  N  N     . GLU A 1 111 ? -52.058 26.409  -4.126  1.00 80.71  ? 99  GLU A N     1 
ATOM   756  C  CA    . GLU A 1 111 ? -52.526 26.268  -5.510  1.00 82.84  ? 99  GLU A CA    1 
ATOM   757  C  C     . GLU A 1 111 ? -51.998 27.324  -6.443  1.00 85.97  ? 99  GLU A C     1 
ATOM   758  O  O     . GLU A 1 111 ? -52.204 27.251  -7.633  1.00 87.20  ? 99  GLU A O     1 
ATOM   759  C  CB    . GLU A 1 111 ? -54.043 26.269  -5.553  1.00 84.10  ? 99  GLU A CB    1 
ATOM   760  C  CG    . GLU A 1 111 ? -54.634 24.959  -5.047  1.00 85.04  ? 99  GLU A CG    1 
ATOM   761  C  CD    . GLU A 1 111 ? -56.121 24.854  -5.291  1.00 89.54  ? 99  GLU A CD    1 
ATOM   762  O  OE1   . GLU A 1 111 ? -56.633 23.714  -5.257  1.00 89.40  ? 99  GLU A OE1   1 
ATOM   763  O  OE2   . GLU A 1 111 ? -56.766 25.907  -5.526  1.00 93.42  ? 99  GLU A OE2   1 
ATOM   764  N  N     . GLN A 1 112 ? -51.324 28.319  -5.899  1.00 88.90  ? 100 GLN A N     1 
ATOM   765  C  CA    . GLN A 1 112 ? -50.653 29.332  -6.698  1.00 92.90  ? 100 GLN A CA    1 
ATOM   766  C  C     . GLN A 1 112 ? -49.164 29.309  -6.347  1.00 93.05  ? 100 GLN A C     1 
ATOM   767  O  O     . GLN A 1 112 ? -48.769 28.899  -5.248  1.00 91.63  ? 100 GLN A O     1 
ATOM   768  C  CB    . GLN A 1 112 ? -51.249 30.711  -6.415  1.00 96.29  ? 100 GLN A CB    1 
ATOM   769  C  CG    . GLN A 1 112 ? -52.399 31.098  -7.360  1.00 100.51 ? 100 GLN A CG    1 
ATOM   770  C  CD    . GLN A 1 112 ? -52.957 32.473  -7.058  1.00 105.86 ? 100 GLN A CD    1 
ATOM   771  O  OE1   . GLN A 1 112 ? -53.101 32.853  -5.892  1.00 108.65 ? 100 GLN A OE1   1 
ATOM   772  N  NE2   . GLN A 1 112 ? -53.272 33.233  -8.102  1.00 110.95 ? 100 GLN A NE2   1 
ATOM   773  N  N     . PHE A 1 113 ? -48.333 29.732  -7.287  1.00 96.03  ? 101 PHE A N     1 
ATOM   774  C  CA    . PHE A 1 113 ? -46.914 29.904  -7.015  1.00 96.81  ? 101 PHE A CA    1 
ATOM   775  C  C     . PHE A 1 113 ? -46.431 31.199  -7.635  1.00 101.03 ? 101 PHE A C     1 
ATOM   776  O  O     . PHE A 1 113 ? -47.000 31.698  -8.616  1.00 103.31 ? 101 PHE A O     1 
ATOM   777  C  CB    . PHE A 1 113 ? -46.120 28.740  -7.578  1.00 95.15  ? 101 PHE A CB    1 
ATOM   778  C  CG    . PHE A 1 113 ? -46.149 28.664  -9.057  1.00 98.72  ? 101 PHE A CG    1 
ATOM   779  C  CD1   . PHE A 1 113 ? -45.207 29.354  -9.808  1.00 104.40 ? 101 PHE A CD1   1 
ATOM   780  C  CD2   . PHE A 1 113 ? -47.126 27.927  -9.702  1.00 99.12  ? 101 PHE A CD2   1 
ATOM   781  C  CE1   . PHE A 1 113 ? -45.233 29.316  -11.189 1.00 108.89 ? 101 PHE A CE1   1 
ATOM   782  C  CE2   . PHE A 1 113 ? -47.163 27.862  -11.083 1.00 104.32 ? 101 PHE A CE2   1 
ATOM   783  C  CZ    . PHE A 1 113 ? -46.215 28.573  -11.841 1.00 108.85 ? 101 PHE A CZ    1 
ATOM   784  N  N     . GLU A 1 114 ? -45.382 31.746  -7.043  1.00 102.17 ? 102 GLU A N     1 
ATOM   785  C  CA    . GLU A 1 114 ? -44.638 32.823  -7.664  1.00 106.34 ? 102 GLU A CA    1 
ATOM   786  C  C     . GLU A 1 114 ? -43.289 32.257  -8.108  1.00 105.29 ? 102 GLU A C     1 
ATOM   787  O  O     . GLU A 1 114 ? -42.818 31.279  -7.519  1.00 101.64 ? 102 GLU A O     1 
ATOM   788  C  CB    . GLU A 1 114 ? -44.443 33.966  -6.679  1.00 109.31 ? 102 GLU A CB    1 
ATOM   789  C  CG    . GLU A 1 114 ? -45.647 34.875  -6.556  1.00 112.11 ? 102 GLU A CG    1 
ATOM   790  C  CD    . GLU A 1 114 ? -45.339 36.074  -5.705  1.00 116.23 ? 102 GLU A CD    1 
ATOM   791  O  OE1   . GLU A 1 114 ? -45.834 37.173  -6.017  1.00 121.83 ? 102 GLU A OE1   1 
ATOM   792  O  OE2   . GLU A 1 114 ? -44.576 35.920  -4.729  1.00 117.09 ? 102 GLU A OE2   1 
ATOM   793  N  N     . PRO A 1 115 ? -42.666 32.874  -9.137  1.00 108.51 ? 103 PRO A N     1 
ATOM   794  C  CA    . PRO A 1 115 ? -41.346 32.465  -9.634  1.00 108.66 ? 103 PRO A CA    1 
ATOM   795  C  C     . PRO A 1 115 ? -40.335 32.240  -8.513  1.00 106.72 ? 103 PRO A C     1 
ATOM   796  O  O     . PRO A 1 115 ? -39.554 31.286  -8.567  1.00 104.85 ? 103 PRO A O     1 
ATOM   797  C  CB    . PRO A 1 115 ? -40.920 33.640  -10.504 1.00 114.78 ? 103 PRO A CB    1 
ATOM   798  C  CG    . PRO A 1 115 ? -42.173 34.301  -10.911 1.00 116.98 ? 103 PRO A CG    1 
ATOM   799  C  CD    . PRO A 1 115 ? -43.157 34.085  -9.819  1.00 113.31 ? 103 PRO A CD    1 
ATOM   800  N  N     . SER A 1 116 ? -40.401 33.082  -7.487  1.00 107.26 ? 104 SER A N     1 
ATOM   801  C  CA    . SER A 1 116 ? -39.525 33.006  -6.318  1.00 106.71 ? 104 SER A CA    1 
ATOM   802  C  C     . SER A 1 116 ? -39.647 31.757  -5.443  1.00 101.87 ? 104 SER A C     1 
ATOM   803  O  O     . SER A 1 116 ? -38.838 31.578  -4.539  1.00 101.73 ? 104 SER A O     1 
ATOM   804  C  CB    . SER A 1 116 ? -39.789 34.209  -5.414  1.00 110.07 ? 104 SER A CB    1 
ATOM   805  O  OG    . SER A 1 116 ? -41.124 34.192  -4.938  1.00 107.52 ? 104 SER A OG    1 
ATOM   806  N  N     . ILE A 1 117 ? -40.658 30.919  -5.660  1.00 97.98  ? 105 ILE A N     1 
ATOM   807  C  CA    . ILE A 1 117 ? -40.880 29.800  -4.741  1.00 94.39  ? 105 ILE A CA    1 
ATOM   808  C  C     . ILE A 1 117 ? -39.714 28.829  -4.759  1.00 92.29  ? 105 ILE A C     1 
ATOM   809  O  O     . ILE A 1 117 ? -39.349 28.307  -3.722  1.00 91.92  ? 105 ILE A O     1 
ATOM   810  C  CB    . ILE A 1 117 ? -42.212 29.044  -4.993  1.00 91.25  ? 105 ILE A CB    1 
ATOM   811  C  CG1   . ILE A 1 117 ? -42.488 28.071  -3.843  1.00 89.28  ? 105 ILE A CG1   1 
ATOM   812  C  CG2   . ILE A 1 117 ? -42.204 28.336  -6.333  1.00 89.95  ? 105 ILE A CG2   1 
ATOM   813  C  CD1   . ILE A 1 117 ? -42.353 28.728  -2.419  1.00 92.59  ? 105 ILE A CD1   1 
ATOM   814  N  N     . LEU A 1 118 ? -39.116 28.623  -5.927  1.00 92.25  ? 106 LEU A N     1 
ATOM   815  C  CA    . LEU A 1 118 ? -37.965 27.736  -6.070  1.00 91.20  ? 106 LEU A CA    1 
ATOM   816  C  C     . LEU A 1 118 ? -36.830 28.081  -5.109  1.00 93.49  ? 106 LEU A C     1 
ATOM   817  O  O     . LEU A 1 118 ? -36.120 27.194  -4.656  1.00 92.36  ? 106 LEU A O     1 
ATOM   818  C  CB    . LEU A 1 118 ? -37.457 27.758  -7.508  1.00 92.64  ? 106 LEU A CB    1 
ATOM   819  C  CG    . LEU A 1 118 ? -38.414 27.127  -8.536  1.00 91.14  ? 106 LEU A CG    1 
ATOM   820  C  CD1   . LEU A 1 118 ? -38.044 27.547  -9.954  1.00 95.09  ? 106 LEU A CD1   1 
ATOM   821  C  CD2   . LEU A 1 118 ? -38.450 25.610  -8.417  1.00 87.20  ? 106 LEU A CD2   1 
ATOM   822  N  N     . ASN A 1 119 ? -36.684 29.364  -4.791  1.00 97.49  ? 107 ASN A N     1 
ATOM   823  C  CA    . ASN A 1 119 ? -35.687 29.843  -3.818  1.00 100.83 ? 107 ASN A CA    1 
ATOM   824  C  C     . ASN A 1 119 ? -35.529 29.021  -2.568  1.00 98.83  ? 107 ASN A C     1 
ATOM   825  O  O     . ASN A 1 119 ? -34.431 28.594  -2.267  1.00 100.00 ? 107 ASN A O     1 
ATOM   826  C  CB    . ASN A 1 119 ? -36.008 31.265  -3.370  1.00 104.73 ? 107 ASN A CB    1 
ATOM   827  C  CG    . ASN A 1 119 ? -35.881 32.244  -4.480  1.00 109.08 ? 107 ASN A CG    1 
ATOM   828  O  OD1   . ASN A 1 119 ? -35.466 31.867  -5.577  1.00 110.71 ? 107 ASN A OD1   1 
ATOM   829  N  ND2   . ASN A 1 119 ? -36.244 33.506  -4.229  1.00 111.23 ? 107 ASN A ND2   1 
ATOM   830  N  N     . GLU A 1 120 ? -36.617 28.816  -1.830  1.00 96.68  ? 108 GLU A N     1 
ATOM   831  C  CA    . GLU A 1 120 ? -36.524 28.151  -0.524  1.00 96.02  ? 108 GLU A CA    1 
ATOM   832  C  C     . GLU A 1 120 ? -36.542 26.627  -0.576  1.00 90.93  ? 108 GLU A C     1 
ATOM   833  O  O     . GLU A 1 120 ? -36.886 26.007  0.433   1.00 89.91  ? 108 GLU A O     1 
ATOM   834  C  CB    . GLU A 1 120 ? -37.644 28.603  0.440   1.00 96.97  ? 108 GLU A CB    1 
ATOM   835  C  CG    . GLU A 1 120 ? -37.929 30.082  0.501   1.00 102.72 ? 108 GLU A CG    1 
ATOM   836  C  CD    . GLU A 1 120 ? -39.191 30.448  -0.244  1.00 103.73 ? 108 GLU A CD    1 
ATOM   837  O  OE1   . GLU A 1 120 ? -39.741 29.562  -0.944  1.00 102.02 ? 108 GLU A OE1   1 
ATOM   838  O  OE2   . GLU A 1 120 ? -39.616 31.623  -0.154  1.00 108.08 ? 108 GLU A OE2   1 
ATOM   839  N  N     . PHE A 1 121 ? -36.165 26.023  -1.708  1.00 87.60  ? 109 PHE A N     1 
ATOM   840  C  CA    . PHE A 1 121 ? -36.235 24.571  -1.851  1.00 83.56  ? 109 PHE A CA    1 
ATOM   841  C  C     . PHE A 1 121 ? -35.001 24.001  -2.559  1.00 83.56  ? 109 PHE A C     1 
ATOM   842  O  O     . PHE A 1 121 ? -34.343 24.678  -3.318  1.00 85.21  ? 109 PHE A O     1 
ATOM   843  C  CB    . PHE A 1 121 ? -37.564 24.147  -2.528  1.00 79.66  ? 109 PHE A CB    1 
ATOM   844  C  CG    . PHE A 1 121 ? -38.764 24.399  -1.672  1.00 78.30  ? 109 PHE A CG    1 
ATOM   845  C  CD1   . PHE A 1 121 ? -39.065 23.549  -0.610  1.00 78.81  ? 109 PHE A CD1   1 
ATOM   846  C  CD2   . PHE A 1 121 ? -39.558 25.522  -1.867  1.00 79.38  ? 109 PHE A CD2   1 
ATOM   847  C  CE1   . PHE A 1 121 ? -40.150 23.822  0.244   1.00 78.24  ? 109 PHE A CE1   1 
ATOM   848  C  CE2   . PHE A 1 121 ? -40.639 25.787  -1.046  1.00 78.94  ? 109 PHE A CE2   1 
ATOM   849  C  CZ    . PHE A 1 121 ? -40.927 24.937  0.027   1.00 78.53  ? 109 PHE A CZ    1 
ATOM   850  N  N     . ASP A 1 122 ? -34.680 22.758  -2.265  1.00 47.09  ? 110 ASP A N     1 
ATOM   851  C  CA    . ASP A 1 122 ? -33.475 22.136  -2.792  1.00 47.02  ? 110 ASP A CA    1 
ATOM   852  C  C     . ASP A 1 122 ? -33.793 21.102  -3.846  1.00 45.33  ? 110 ASP A C     1 
ATOM   853  O  O     . ASP A 1 122 ? -32.986 20.856  -4.728  1.00 44.41  ? 110 ASP A O     1 
ATOM   854  C  CB    . ASP A 1 122 ? -32.735 21.421  -1.661  1.00 47.84  ? 110 ASP A CB    1 
ATOM   855  C  CG    . ASP A 1 122 ? -32.516 22.315  -0.473  1.00 50.27  ? 110 ASP A CG    1 
ATOM   856  O  OD1   . ASP A 1 122 ? -31.920 23.371  -0.654  1.00 52.30  ? 110 ASP A OD1   1 
ATOM   857  O  OD2   . ASP A 1 122 ? -32.992 21.994  0.614   1.00 53.88  ? 110 ASP A OD2   1 
ATOM   858  N  N     . VAL A 1 123 ? -34.920 20.420  -3.666  1.00 43.48  ? 111 VAL A N     1 
ATOM   859  C  CA    . VAL A 1 123 ? -35.324 19.351  -4.543  1.00 41.87  ? 111 VAL A CA    1 
ATOM   860  C  C     . VAL A 1 123 ? -36.728 19.643  -5.033  1.00 40.90  ? 111 VAL A C     1 
ATOM   861  O  O     . VAL A 1 123 ? -37.579 20.012  -4.233  1.00 42.19  ? 111 VAL A O     1 
ATOM   862  C  CB    . VAL A 1 123 ? -35.279 17.973  -3.839  1.00 41.49  ? 111 VAL A CB    1 
ATOM   863  C  CG1   . VAL A 1 123 ? -35.797 16.894  -4.783  1.00 37.10  ? 111 VAL A CG1   1 
ATOM   864  C  CG2   . VAL A 1 123 ? -33.843 17.677  -3.359  1.00 41.17  ? 111 VAL A CG2   1 
ATOM   865  N  N     . VAL A 1 124 ? -36.922 19.529  -6.345  1.00 40.27  ? 112 VAL A N     1 
ATOM   866  C  CA    . VAL A 1 124 ? -38.242 19.561  -6.996  1.00 39.93  ? 112 VAL A CA    1 
ATOM   867  C  C     . VAL A 1 124 ? -38.666 18.158  -7.376  1.00 37.74  ? 112 VAL A C     1 
ATOM   868  O  O     . VAL A 1 124 ? -37.964 17.462  -8.101  1.00 38.12  ? 112 VAL A O     1 
ATOM   869  C  CB    . VAL A 1 124 ? -38.271 20.447  -8.277  1.00 41.36  ? 112 VAL A CB    1 
ATOM   870  C  CG1   . VAL A 1 124 ? -39.714 20.497  -8.879  1.00 40.77  ? 112 VAL A CG1   1 
ATOM   871  C  CG2   . VAL A 1 124 ? -37.789 21.869  -7.945  1.00 43.59  ? 112 VAL A CG2   1 
ATOM   872  N  N     . VAL A 1 125 ? -39.822 17.729  -6.869  1.00 37.56  ? 113 VAL A N     1 
ATOM   873  C  CA    . VAL A 1 125 ? -40.390 16.469  -7.243  1.00 35.60  ? 113 VAL A CA    1 
ATOM   874  C  C     . VAL A 1 125 ? -41.451 16.784  -8.292  1.00 35.16  ? 113 VAL A C     1 
ATOM   875  O  O     . VAL A 1 125 ? -42.415 17.440  -7.996  1.00 37.18  ? 113 VAL A O     1 
ATOM   876  C  CB    . VAL A 1 125 ? -40.959 15.677  -6.023  1.00 36.53  ? 113 VAL A CB    1 
ATOM   877  C  CG1   . VAL A 1 125 ? -41.727 14.442  -6.525  1.00 32.97  ? 113 VAL A CG1   1 
ATOM   878  C  CG2   . VAL A 1 125 ? -39.855 15.279  -5.083  1.00 34.04  ? 113 VAL A CG2   1 
ATOM   879  N  N     . ASP A 1 126 ? -41.265 16.294  -9.515  1.00 34.26  ? 114 ASP A N     1 
ATOM   880  C  CA    . ASP A 1 126 ? -42.167 16.586  -10.663 1.00 34.70  ? 114 ASP A CA    1 
ATOM   881  C  C     . ASP A 1 126 ? -43.204 15.483  -10.838 1.00 33.92  ? 114 ASP A C     1 
ATOM   882  O  O     . ASP A 1 126 ? -42.930 14.409  -11.445 1.00 33.74  ? 114 ASP A O     1 
ATOM   883  C  CB    . ASP A 1 126 ? -41.337 16.727  -11.934 1.00 34.46  ? 114 ASP A CB    1 
ATOM   884  C  CG    . ASP A 1 126 ? -42.145 16.501  -13.217 1.00 36.03  ? 114 ASP A CG    1 
ATOM   885  O  OD1   . ASP A 1 126 ? -43.305 16.979  -13.321 1.00 33.60  ? 114 ASP A OD1   1 
ATOM   886  O  OD2   . ASP A 1 126 ? -41.588 15.823  -14.107 1.00 35.15  ? 114 ASP A OD2   1 
ATOM   887  N  N     . ALA A 1 127 ? -44.387 15.731  -10.277 1.00 35.39  ? 115 ALA A N     1 
ATOM   888  C  CA    . ALA A 1 127 ? -45.527 14.834  -10.406 1.00 34.80  ? 115 ALA A CA    1 
ATOM   889  C  C     . ALA A 1 127 ? -46.672 15.539  -11.130 1.00 34.82  ? 115 ALA A C     1 
ATOM   890  O  O     . ALA A 1 127 ? -47.829 15.358  -10.798 1.00 35.58  ? 115 ALA A O     1 
ATOM   891  C  CB    . ALA A 1 127 ? -45.989 14.346  -9.033  1.00 34.91  ? 115 ALA A CB    1 
ATOM   892  N  N     . ILE A 1 128 ? -46.353 16.323  -12.138 1.00 35.87  ? 116 ILE A N     1 
ATOM   893  C  CA    . ILE A 1 128 ? -47.377 17.117  -12.815 1.00 36.71  ? 116 ILE A CA    1 
ATOM   894  C  C     . ILE A 1 128 ? -48.128 16.221  -13.800 1.00 36.54  ? 116 ILE A C     1 
ATOM   895  O  O     . ILE A 1 128 ? -49.323 15.997  -13.619 1.00 37.22  ? 116 ILE A O     1 
ATOM   896  C  CB    . ILE A 1 128 ? -46.775 18.335  -13.542 1.00 36.91  ? 116 ILE A CB    1 
ATOM   897  C  CG1   . ILE A 1 128 ? -45.977 19.195  -12.587 1.00 37.97  ? 116 ILE A CG1   1 
ATOM   898  C  CG2   . ILE A 1 128 ? -47.898 19.117  -14.244 1.00 37.93  ? 116 ILE A CG2   1 
ATOM   899  C  CD1   . ILE A 1 128 ? -45.264 20.421  -13.298 1.00 40.63  ? 116 ILE A CD1   1 
ATOM   900  N  N     . PHE A 1 129 ? -47.441 15.725  -14.840 1.00 36.17  ? 117 PHE A N     1 
ATOM   901  C  CA    . PHE A 1 129 ? -48.041 14.754  -15.787 1.00 36.77  ? 117 PHE A CA    1 
ATOM   902  C  C     . PHE A 1 129 ? -47.184 13.512  -15.970 1.00 36.88  ? 117 PHE A C     1 
ATOM   903  O  O     . PHE A 1 129 ? -45.966 13.594  -16.088 1.00 36.05  ? 117 PHE A O     1 
ATOM   904  C  CB    . PHE A 1 129 ? -48.225 15.328  -17.194 1.00 37.67  ? 117 PHE A CB    1 
ATOM   905  C  CG    . PHE A 1 129 ? -48.896 16.647  -17.242 1.00 40.00  ? 117 PHE A CG    1 
ATOM   906  C  CD1   . PHE A 1 129 ? -50.219 16.783  -16.856 1.00 43.00  ? 117 PHE A CD1   1 
ATOM   907  C  CD2   . PHE A 1 129 ? -48.216 17.770  -17.734 1.00 39.47  ? 117 PHE A CD2   1 
ATOM   908  C  CE1   . PHE A 1 129 ? -50.854 18.038  -16.923 1.00 45.18  ? 117 PHE A CE1   1 
ATOM   909  C  CE2   . PHE A 1 129 ? -48.815 19.004  -17.789 1.00 39.63  ? 117 PHE A CE2   1 
ATOM   910  C  CZ    . PHE A 1 129 ? -50.150 19.147  -17.371 1.00 44.98  ? 117 PHE A CZ    1 
ATOM   911  N  N     . GLY A 1 130 ? -47.837 12.362  -16.078 1.00 37.54  ? 118 GLY A N     1 
ATOM   912  C  CA    . GLY A 1 130 ? -47.138 11.112  -16.388 1.00 37.14  ? 118 GLY A CA    1 
ATOM   913  C  C     . GLY A 1 130 ? -47.588 10.599  -17.757 1.00 37.39  ? 118 GLY A C     1 
ATOM   914  O  O     . GLY A 1 130 ? -47.531 11.318  -18.732 1.00 37.65  ? 118 GLY A O     1 
ATOM   915  N  N     . THR A 1 131 ? -48.060 9.363   -17.802 1.00 37.53  ? 119 THR A N     1 
ATOM   916  C  CA    . THR A 1 131 ? -48.493 8.746   -19.050 1.00 38.52  ? 119 THR A CA    1 
ATOM   917  C  C     . THR A 1 131 ? -49.808 9.333   -19.566 1.00 40.34  ? 119 THR A C     1 
ATOM   918  O  O     . THR A 1 131 ? -50.188 9.065   -20.698 1.00 40.80  ? 119 THR A O     1 
ATOM   919  C  CB    . THR A 1 131 ? -48.679 7.221   -18.869 1.00 38.79  ? 119 THR A CB    1 
ATOM   920  O  OG1   . THR A 1 131 ? -49.610 7.015   -17.809 1.00 37.51  ? 119 THR A OG1   1 
ATOM   921  C  CG2   . THR A 1 131 ? -47.349 6.561   -18.528 1.00 37.80  ? 119 THR A CG2   1 
ATOM   922  N  N     . GLY A 1 132 ? -50.491 10.134  -18.741 1.00 41.71  ? 120 GLY A N     1 
ATOM   923  C  CA    . GLY A 1 132 ? -51.760 10.782  -19.141 1.00 43.32  ? 120 GLY A CA    1 
ATOM   924  C  C     . GLY A 1 132 ? -51.592 12.123  -19.837 1.00 43.64  ? 120 GLY A C     1 
ATOM   925  O  O     . GLY A 1 132 ? -52.570 12.781  -20.182 1.00 44.34  ? 120 GLY A O     1 
ATOM   926  N  N     . LEU A 1 133 ? -50.366 12.544  -20.090 1.00 42.96  ? 121 LEU A N     1 
ATOM   927  C  CA    . LEU A 1 133 ? -50.152 13.736  -20.921 1.00 43.08  ? 121 LEU A CA    1 
ATOM   928  C  C     . LEU A 1 133 ? -50.900 13.602  -22.239 1.00 44.20  ? 121 LEU A C     1 
ATOM   929  O  O     . LEU A 1 133 ? -50.811 12.570  -22.874 1.00 43.44  ? 121 LEU A O     1 
ATOM   930  C  CB    . LEU A 1 133 ? -48.651 13.874  -21.207 1.00 42.25  ? 121 LEU A CB    1 
ATOM   931  C  CG    . LEU A 1 133 ? -48.257 15.026  -22.121 1.00 42.92  ? 121 LEU A CG    1 
ATOM   932  C  CD1   . LEU A 1 133 ? -48.626 16.343  -21.504 1.00 40.63  ? 121 LEU A CD1   1 
ATOM   933  C  CD2   . LEU A 1 133 ? -46.780 14.911  -22.470 1.00 39.49  ? 121 LEU A CD2   1 
ATOM   934  N  N     . ARG A 1 134 ? -51.705 14.599  -22.594 1.00 45.80  ? 122 ARG A N     1 
ATOM   935  C  CA    . ARG A 1 134 ? -52.350 14.677  -23.909 1.00 49.31  ? 122 ARG A CA    1 
ATOM   936  C  C     . ARG A 1 134 ? -52.195 16.113  -24.447 1.00 48.79  ? 122 ARG A C     1 
ATOM   937  O  O     . ARG A 1 134 ? -52.619 17.086  -23.805 1.00 50.08  ? 122 ARG A O     1 
ATOM   938  C  CB    . ARG A 1 134 ? -53.850 14.310  -23.875 1.00 51.45  ? 122 ARG A CB    1 
ATOM   939  C  CG    . ARG A 1 134 ? -54.152 12.845  -23.586 1.00 56.86  ? 122 ARG A CG    1 
ATOM   940  C  CD    . ARG A 1 134 ? -53.534 11.815  -24.603 1.00 60.43  ? 122 ARG A CD    1 
ATOM   941  N  NE    . ARG A 1 134 ? -53.863 10.452  -24.156 1.00 63.38  ? 122 ARG A NE    1 
ATOM   942  C  CZ    . ARG A 1 134 ? -53.185 9.732   -23.253 1.00 64.27  ? 122 ARG A CZ    1 
ATOM   943  N  NH1   . ARG A 1 134 ? -52.045 10.176  -22.700 1.00 63.54  ? 122 ARG A NH1   1 
ATOM   944  N  NH2   . ARG A 1 134 ? -53.633 8.522   -22.926 1.00 64.82  ? 122 ARG A NH2   1 
ATOM   945  N  N     . GLY A 1 135 ? -51.568 16.238  -25.602 1.00 47.91  ? 123 GLY A N     1 
ATOM   946  C  CA    . GLY A 1 135 ? -51.406 17.530  -26.207 1.00 48.28  ? 123 GLY A CA    1 
ATOM   947  C  C     . GLY A 1 135 ? -50.324 18.391  -25.580 1.00 47.61  ? 123 GLY A C     1 
ATOM   948  O  O     . GLY A 1 135 ? -49.753 18.069  -24.522 1.00 44.11  ? 123 GLY A O     1 
ATOM   949  N  N     . GLU A 1 136 ? -50.078 19.518  -26.251 1.00 47.90  ? 124 GLU A N     1 
ATOM   950  C  CA    . GLU A 1 136 ? -49.064 20.472  -25.872 1.00 48.61  ? 124 GLU A CA    1 
ATOM   951  C  C     . GLU A 1 136 ? -49.323 21.026  -24.473 1.00 48.62  ? 124 GLU A C     1 
ATOM   952  O  O     . GLU A 1 136 ? -50.452 21.274  -24.096 1.00 47.90  ? 124 GLU A O     1 
ATOM   953  C  CB    . GLU A 1 136 ? -49.033 21.636  -26.900 1.00 50.88  ? 124 GLU A CB    1 
ATOM   954  C  CG    . GLU A 1 136 ? -48.804 21.191  -28.366 1.00 54.43  ? 124 GLU A CG    1 
ATOM   955  C  CD    . GLU A 1 136 ? -47.322 20.958  -28.732 1.00 60.02  ? 124 GLU A CD    1 
ATOM   956  O  OE1   . GLU A 1 136 ? -46.910 19.790  -28.955 1.00 65.32  ? 124 GLU A OE1   1 
ATOM   957  O  OE2   . GLU A 1 136 ? -46.558 21.943  -28.800 1.00 64.86  ? 124 GLU A OE2   1 
ATOM   958  N  N     . ILE A 1 137 ? -48.246 21.227  -23.721 1.00 48.44  ? 125 ILE A N     1 
ATOM   959  C  CA    . ILE A 1 137 ? -48.297 21.922  -22.437 1.00 49.95  ? 125 ILE A CA    1 
ATOM   960  C  C     . ILE A 1 137 ? -48.198 23.437  -22.621 1.00 52.59  ? 125 ILE A C     1 
ATOM   961  O  O     . ILE A 1 137 ? -47.191 23.944  -23.136 1.00 53.71  ? 125 ILE A O     1 
ATOM   962  C  CB    . ILE A 1 137 ? -47.133 21.454  -21.503 1.00 48.13  ? 125 ILE A CB    1 
ATOM   963  C  CG1   . ILE A 1 137 ? -47.302 19.976  -21.145 1.00 46.86  ? 125 ILE A CG1   1 
ATOM   964  C  CG2   . ILE A 1 137 ? -47.017 22.323  -20.216 1.00 48.26  ? 125 ILE A CG2   1 
ATOM   965  C  CD1   . ILE A 1 137 ? -46.193 19.447  -20.138 1.00 43.91  ? 125 ILE A CD1   1 
ATOM   966  N  N     . THR A 1 138 ? -49.212 24.150  -22.145 1.00 55.38  ? 126 THR A N     1 
ATOM   967  C  CA    . THR A 1 138 ? -49.249 25.615  -22.158 1.00 58.37  ? 126 THR A CA    1 
ATOM   968  C  C     . THR A 1 138 ? -49.570 26.195  -20.770 1.00 59.68  ? 126 THR A C     1 
ATOM   969  O  O     . THR A 1 138 ? -49.735 25.450  -19.786 1.00 58.83  ? 126 THR A O     1 
ATOM   970  C  CB    . THR A 1 138 ? -50.373 26.101  -23.114 1.00 60.09  ? 126 THR A CB    1 
ATOM   971  O  OG1   . THR A 1 138 ? -51.560 25.325  -22.861 1.00 61.88  ? 126 THR A OG1   1 
ATOM   972  C  CG2   . THR A 1 138 ? -49.951 25.966  -24.567 1.00 59.44  ? 126 THR A CG2   1 
ATOM   973  N  N     . GLY A 1 139 ? -49.658 27.524  -20.697 1.00 61.60  ? 127 GLY A N     1 
ATOM   974  C  CA    . GLY A 1 139 ? -50.261 28.203  -19.547 1.00 63.45  ? 127 GLY A CA    1 
ATOM   975  C  C     . GLY A 1 139 ? -49.374 28.146  -18.335 1.00 63.29  ? 127 GLY A C     1 
ATOM   976  O  O     . GLY A 1 139 ? -48.164 28.105  -18.479 1.00 62.99  ? 127 GLY A O     1 
ATOM   977  N  N     . GLU A 1 140 ? -49.981 28.114  -17.149 1.00 63.87  ? 128 GLU A N     1 
ATOM   978  C  CA    . GLU A 1 140 ? -49.264 27.937  -15.880 1.00 63.46  ? 128 GLU A CA    1 
ATOM   979  C  C     . GLU A 1 140 ? -48.471 26.643  -15.836 1.00 60.28  ? 128 GLU A C     1 
ATOM   980  O  O     . GLU A 1 140 ? -47.493 26.528  -15.067 1.00 60.29  ? 128 GLU A O     1 
ATOM   981  C  CB    . GLU A 1 140 ? -50.241 27.834  -14.689 1.00 64.76  ? 128 GLU A CB    1 
ATOM   982  C  CG    . GLU A 1 140 ? -50.727 29.118  -14.070 1.00 70.03  ? 128 GLU A CG    1 
ATOM   983  C  CD    . GLU A 1 140 ? -51.595 28.846  -12.833 1.00 73.62  ? 128 GLU A CD    1 
ATOM   984  O  OE1   . GLU A 1 140 ? -51.303 27.874  -12.075 1.00 75.33  ? 128 GLU A OE1   1 
ATOM   985  O  OE2   . GLU A 1 140 ? -52.571 29.590  -12.626 1.00 76.44  ? 128 GLU A OE2   1 
ATOM   986  N  N     . TYR A 1 141 ? -48.932 25.617  -16.546 1.00 57.89  ? 129 TYR A N     1 
ATOM   987  C  CA    . TYR A 1 141 ? -48.169 24.361  -16.552 1.00 54.74  ? 129 TYR A CA    1 
ATOM   988  C  C     . TYR A 1 141 ? -46.803 24.628  -17.173 1.00 53.18  ? 129 TYR A C     1 
ATOM   989  O  O     . TYR A 1 141 ? -45.782 24.369  -16.546 1.00 52.37  ? 129 TYR A O     1 
ATOM   990  C  CB    . TYR A 1 141 ? -48.890 23.235  -17.288 1.00 53.62  ? 129 TYR A CB    1 
ATOM   991  C  CG    . TYR A 1 141 ? -50.100 22.715  -16.575 1.00 52.98  ? 129 TYR A CG    1 
ATOM   992  C  CD1   . TYR A 1 141 ? -49.975 21.961  -15.419 1.00 52.13  ? 129 TYR A CD1   1 
ATOM   993  C  CD2   . TYR A 1 141 ? -51.379 22.980  -17.044 1.00 55.75  ? 129 TYR A CD2   1 
ATOM   994  C  CE1   . TYR A 1 141 ? -51.081 21.463  -14.768 1.00 50.63  ? 129 TYR A CE1   1 
ATOM   995  C  CE2   . TYR A 1 141 ? -52.501 22.491  -16.381 1.00 55.41  ? 129 TYR A CE2   1 
ATOM   996  C  CZ    . TYR A 1 141 ? -52.323 21.723  -15.250 1.00 54.46  ? 129 TYR A CZ    1 
ATOM   997  O  OH    . TYR A 1 141 ? -53.412 21.218  -14.588 1.00 60.77  ? 129 TYR A OH    1 
ATOM   998  N  N     . ALA A 1 142 ? -46.803 25.186  -18.379 1.00 52.99  ? 130 ALA A N     1 
ATOM   999  C  CA    . ALA A 1 142 ? -45.578 25.488  -19.103 1.00 52.76  ? 130 ALA A CA    1 
ATOM   1000 C  C     . ALA A 1 142 ? -44.668 26.409  -18.296 1.00 54.33  ? 130 ALA A C     1 
ATOM   1001 O  O     . ALA A 1 142 ? -43.453 26.216  -18.239 1.00 52.47  ? 130 ALA A O     1 
ATOM   1002 C  CB    . ALA A 1 142 ? -45.903 26.127  -20.430 1.00 53.23  ? 130 ALA A CB    1 
ATOM   1003 N  N     . GLU A 1 143 ? -45.279 27.396  -17.645 1.00 56.34  ? 131 GLU A N     1 
ATOM   1004 C  CA    . GLU A 1 143 ? -44.531 28.395  -16.916 1.00 58.50  ? 131 GLU A CA    1 
ATOM   1005 C  C     . GLU A 1 143 ? -43.790 27.818  -15.735 1.00 56.96  ? 131 GLU A C     1 
ATOM   1006 O  O     . GLU A 1 143 ? -42.621 28.183  -15.532 1.00 57.86  ? 131 GLU A O     1 
ATOM   1007 C  CB    . GLU A 1 143 ? -45.440 29.509  -16.418 1.00 61.83  ? 131 GLU A CB    1 
ATOM   1008 C  CG    . GLU A 1 143 ? -44.755 30.826  -16.303 1.00 66.66  ? 131 GLU A CG    1 
ATOM   1009 C  CD    . GLU A 1 143 ? -45.747 31.973  -16.354 1.00 74.86  ? 131 GLU A CD    1 
ATOM   1010 O  OE1   . GLU A 1 143 ? -46.480 32.171  -15.339 1.00 79.27  ? 131 GLU A OE1   1 
ATOM   1011 O  OE2   . GLU A 1 143 ? -45.794 32.662  -17.407 1.00 77.69  ? 131 GLU A OE2   1 
ATOM   1012 N  N     . ILE A 1 144 ? -44.441 26.960  -14.944 1.00 54.32  ? 132 ILE A N     1 
ATOM   1013 C  CA    . ILE A 1 144 ? -43.745 26.366  -13.823 1.00 53.42  ? 132 ILE A CA    1 
ATOM   1014 C  C     . ILE A 1 144 ? -42.638 25.420  -14.341 1.00 50.48  ? 132 ILE A C     1 
ATOM   1015 O  O     . ILE A 1 144 ? -41.584 25.350  -13.719 1.00 49.80  ? 132 ILE A O     1 
ATOM   1016 C  CB    . ILE A 1 144 ? -44.656 25.608  -12.812 1.00 53.30  ? 132 ILE A CB    1 
ATOM   1017 C  CG1   . ILE A 1 144 ? -43.852 25.138  -11.577 1.00 55.10  ? 132 ILE A CG1   1 
ATOM   1018 C  CG2   . ILE A 1 144 ? -45.238 24.361  -13.401 1.00 50.87  ? 132 ILE A CG2   1 
ATOM   1019 C  CD1   . ILE A 1 144 ? -43.099 26.236  -10.744 1.00 58.52  ? 132 ILE A CD1   1 
ATOM   1020 N  N     . ILE A 1 145 ? -42.879 24.708  -15.457 1.00 47.31  ? 133 ILE A N     1 
ATOM   1021 C  CA    . ILE A 1 145 ? -41.889 23.793  -16.005 1.00 44.79  ? 133 ILE A CA    1 
ATOM   1022 C  C     . ILE A 1 145 ? -40.656 24.559  -16.481 1.00 45.38  ? 133 ILE A C     1 
ATOM   1023 O  O     . ILE A 1 145 ? -39.524 24.123  -16.250 1.00 43.48  ? 133 ILE A O     1 
ATOM   1024 C  CB    . ILE A 1 145 ? -42.450 22.881  -17.160 1.00 43.63  ? 133 ILE A CB    1 
ATOM   1025 C  CG1   . ILE A 1 145 ? -43.367 21.804  -16.567 1.00 42.62  ? 133 ILE A CG1   1 
ATOM   1026 C  CG2   . ILE A 1 145 ? -41.289 22.214  -17.955 1.00 41.03  ? 133 ILE A CG2   1 
ATOM   1027 C  CD1   . ILE A 1 145 ? -44.309 21.158  -17.565 1.00 42.78  ? 133 ILE A CD1   1 
ATOM   1028 N  N     . ASN A 1 146 ? -40.876 25.709  -17.111 1.00 46.80  ? 134 ASN A N     1 
ATOM   1029 C  CA    . ASN A 1 146 ? -39.753 26.550  -17.554 1.00 49.03  ? 134 ASN A CA    1 
ATOM   1030 C  C     . ASN A 1 146 ? -38.965 27.142  -16.369 1.00 50.23  ? 134 ASN A C     1 
ATOM   1031 O  O     . ASN A 1 146 ? -37.739 27.203  -16.418 1.00 50.86  ? 134 ASN A O     1 
ATOM   1032 C  CB    . ASN A 1 146 ? -40.223 27.634  -18.538 1.00 49.79  ? 134 ASN A CB    1 
ATOM   1033 C  CG    . ASN A 1 146 ? -40.757 27.036  -19.840 1.00 51.03  ? 134 ASN A CG    1 
ATOM   1034 O  OD1   . ASN A 1 146 ? -40.305 25.979  -20.286 1.00 49.95  ? 134 ASN A OD1   1 
ATOM   1035 N  ND2   . ASN A 1 146 ? -41.717 27.713  -20.455 1.00 51.91  ? 134 ASN A ND2   1 
ATOM   1036 N  N     . LEU A 1 147 ? -39.672 27.555  -15.322 1.00 51.59  ? 135 LEU A N     1 
ATOM   1037 C  CA    . LEU A 1 147 ? -39.046 27.986  -14.069 1.00 53.52  ? 135 LEU A CA    1 
ATOM   1038 C  C     . LEU A 1 147 ? -38.220 26.886  -13.401 1.00 52.02  ? 135 LEU A C     1 
ATOM   1039 O  O     . LEU A 1 147 ? -37.085 27.131  -13.033 1.00 53.11  ? 135 LEU A O     1 
ATOM   1040 C  CB    . LEU A 1 147 ? -40.089 28.494  -13.060 1.00 54.83  ? 135 LEU A CB    1 
ATOM   1041 C  CG    . LEU A 1 147 ? -40.771 29.813  -13.454 1.00 59.21  ? 135 LEU A CG    1 
ATOM   1042 C  CD1   . LEU A 1 147 ? -42.028 29.989  -12.626 1.00 59.99  ? 135 LEU A CD1   1 
ATOM   1043 C  CD2   . LEU A 1 147 ? -39.830 31.040  -13.357 1.00 62.02  ? 135 LEU A CD2   1 
ATOM   1044 N  N     . VAL A 1 148 ? -38.782 25.678  -13.263 1.00 50.34  ? 136 VAL A N     1 
ATOM   1045 C  CA    . VAL A 1 148 ? -38.038 24.542  -12.748 1.00 48.22  ? 136 VAL A CA    1 
ATOM   1046 C  C     . VAL A 1 148 ? -36.755 24.323  -13.574 1.00 48.10  ? 136 VAL A C     1 
ATOM   1047 O  O     . VAL A 1 148 ? -35.664 24.247  -12.999 1.00 47.72  ? 136 VAL A O     1 
ATOM   1048 C  CB    . VAL A 1 148 ? -38.852 23.227  -12.744 1.00 46.83  ? 136 VAL A CB    1 
ATOM   1049 C  CG1   . VAL A 1 148 ? -37.959 22.094  -12.394 1.00 45.23  ? 136 VAL A CG1   1 
ATOM   1050 C  CG2   . VAL A 1 148 ? -40.041 23.300  -11.760 1.00 47.41  ? 136 VAL A CG2   1 
ATOM   1051 N  N     . ASN A 1 149 ? -36.873 24.259  -14.905 1.00 47.45  ? 137 ASN A N     1 
ATOM   1052 C  CA    . ASN A 1 149 ? -35.687 24.074  -15.778 1.00 47.37  ? 137 ASN A CA    1 
ATOM   1053 C  C     . ASN A 1 149 ? -34.598 25.180  -15.678 1.00 49.38  ? 137 ASN A C     1 
ATOM   1054 O  O     . ASN A 1 149 ? -33.427 24.922  -15.949 1.00 48.22  ? 137 ASN A O     1 
ATOM   1055 C  CB    . ASN A 1 149 ? -36.094 23.902  -17.267 1.00 47.12  ? 137 ASN A CB    1 
ATOM   1056 C  CG    . ASN A 1 149 ? -36.845 22.607  -17.540 1.00 43.43  ? 137 ASN A CG    1 
ATOM   1057 O  OD1   . ASN A 1 149 ? -36.844 21.701  -16.728 1.00 38.60  ? 137 ASN A OD1   1 
ATOM   1058 N  ND2   . ASN A 1 149 ? -37.494 22.527  -18.704 1.00 42.91  ? 137 ASN A ND2   1 
ATOM   1059 N  N     . LYS A 1 150 ? -34.966 26.391  -15.276 1.00 51.75  ? 138 LYS A N     1 
ATOM   1060 C  CA    . LYS A 1 150 ? -33.966 27.452  -15.076 1.00 54.91  ? 138 LYS A CA    1 
ATOM   1061 C  C     . LYS A 1 150 ? -33.430 27.515  -13.649 1.00 55.67  ? 138 LYS A C     1 
ATOM   1062 O  O     . LYS A 1 150 ? -32.602 28.353  -13.356 1.00 57.65  ? 138 LYS A O     1 
ATOM   1063 C  CB    . LYS A 1 150 ? -34.541 28.837  -15.419 1.00 56.75  ? 138 LYS A CB    1 
ATOM   1064 C  CG    . LYS A 1 150 ? -34.721 29.095  -16.904 1.00 59.64  ? 138 LYS A CG    1 
ATOM   1065 C  CD    . LYS A 1 150 ? -35.329 30.484  -17.116 1.00 66.15  ? 138 LYS A CD    1 
ATOM   1066 C  CE    . LYS A 1 150 ? -35.608 30.803  -18.612 1.00 69.59  ? 138 LYS A CE    1 
ATOM   1067 N  NZ    . LYS A 1 150 ? -36.904 30.221  -19.133 1.00 70.45  ? 138 LYS A NZ    1 
ATOM   1068 N  N     . SER A 1 151 ? -33.895 26.655  -12.757 1.00 54.24  ? 139 SER A N     1 
ATOM   1069 C  CA    . SER A 1 151 ? -33.681 26.885  -11.331 1.00 55.03  ? 139 SER A CA    1 
ATOM   1070 C  C     . SER A 1 151 ? -32.363 26.312  -10.826 1.00 55.27  ? 139 SER A C     1 
ATOM   1071 O  O     . SER A 1 151 ? -31.889 26.716  -9.771  1.00 56.63  ? 139 SER A O     1 
ATOM   1072 C  CB    . SER A 1 151 ? -34.802 26.220  -10.553 1.00 53.63  ? 139 SER A CB    1 
ATOM   1073 O  OG    . SER A 1 151 ? -34.631 24.805  -10.591 1.00 50.50  ? 139 SER A OG    1 
ATOM   1074 N  N     . GLY A 1 152 ? -31.826 25.317  -11.540 1.00 54.07  ? 140 GLY A N     1 
ATOM   1075 C  CA    . GLY A 1 152 ? -30.642 24.584  -11.094 1.00 53.89  ? 140 GLY A CA    1 
ATOM   1076 C  C     . GLY A 1 152 ? -30.855 23.734  -9.839  1.00 52.63  ? 140 GLY A C     1 
ATOM   1077 O  O     . GLY A 1 152 ? -29.903 23.342  -9.167  1.00 53.41  ? 140 GLY A O     1 
ATOM   1078 N  N     . LYS A 1 153 ? -32.102 23.473  -9.486  1.00 50.77  ? 141 LYS A N     1 
ATOM   1079 C  CA    . LYS A 1 153 ? -32.401 22.543  -8.403  1.00 48.81  ? 141 LYS A CA    1 
ATOM   1080 C  C     . LYS A 1 153 ? -32.298 21.111  -8.893  1.00 45.75  ? 141 LYS A C     1 
ATOM   1081 O  O     . LYS A 1 153 ? -32.302 20.847  -10.091 1.00 45.38  ? 141 LYS A O     1 
ATOM   1082 C  CB    . LYS A 1 153 ? -33.803 22.775  -7.863  1.00 49.15  ? 141 LYS A CB    1 
ATOM   1083 C  CG    . LYS A 1 153 ? -34.072 24.162  -7.309  1.00 52.46  ? 141 LYS A CG    1 
ATOM   1084 C  CD    . LYS A 1 153 ? -33.017 24.644  -6.332  1.00 54.86  ? 141 LYS A CD    1 
ATOM   1085 C  CE    . LYS A 1 153 ? -33.207 26.126  -6.055  1.00 56.55  ? 141 LYS A CE    1 
ATOM   1086 N  NZ    . LYS A 1 153 ? -32.335 26.546  -4.949  1.00 58.10  ? 141 LYS A NZ    1 
ATOM   1087 N  N     . VAL A 1 154 ? -32.164 20.197  -7.952  1.00 44.28  ? 142 VAL A N     1 
ATOM   1088 C  CA    . VAL A 1 154 ? -32.251 18.750  -8.218  1.00 42.03  ? 142 VAL A CA    1 
ATOM   1089 C  C     . VAL A 1 154 ? -33.686 18.410  -8.576  1.00 40.24  ? 142 VAL A C     1 
ATOM   1090 O  O     . VAL A 1 154 ? -34.585 18.719  -7.799  1.00 40.67  ? 142 VAL A O     1 
ATOM   1091 C  CB    . VAL A 1 154 ? -31.816 17.926  -6.976  1.00 41.79  ? 142 VAL A CB    1 
ATOM   1092 C  CG1   . VAL A 1 154 ? -32.073 16.411  -7.226  1.00 38.54  ? 142 VAL A CG1   1 
ATOM   1093 C  CG2   . VAL A 1 154 ? -30.295 18.267  -6.652  1.00 40.87  ? 142 VAL A CG2   1 
ATOM   1094 N  N     . VAL A 1 155 ? -33.891 17.829  -9.765  1.00 39.01  ? 143 VAL A N     1 
ATOM   1095 C  CA    . VAL A 1 155 ? -35.229 17.474  -10.260 1.00 37.40  ? 143 VAL A CA    1 
ATOM   1096 C  C     . VAL A 1 155 ? -35.446 15.972  -10.344 1.00 35.84  ? 143 VAL A C     1 
ATOM   1097 O  O     . VAL A 1 155 ? -34.704 15.248  -10.977 1.00 36.06  ? 143 VAL A O     1 
ATOM   1098 C  CB    . VAL A 1 155 ? -35.527 18.136  -11.603 1.00 37.71  ? 143 VAL A CB    1 
ATOM   1099 C  CG1   . VAL A 1 155 ? -36.960 17.831  -12.083 1.00 33.99  ? 143 VAL A CG1   1 
ATOM   1100 C  CG2   . VAL A 1 155 ? -35.312 19.686  -11.471 1.00 39.98  ? 143 VAL A CG2   1 
ATOM   1101 N  N     . VAL A 1 156 ? -36.495 15.512  -9.664  1.00 35.41  ? 144 VAL A N     1 
ATOM   1102 C  CA    . VAL A 1 156 ? -36.854 14.117  -9.617  1.00 33.77  ? 144 VAL A CA    1 
ATOM   1103 C  C     . VAL A 1 156 ? -38.239 14.016  -10.227 1.00 34.03  ? 144 VAL A C     1 
ATOM   1104 O  O     . VAL A 1 156 ? -39.202 14.547  -9.673  1.00 34.17  ? 144 VAL A O     1 
ATOM   1105 C  CB    . VAL A 1 156 ? -36.914 13.597  -8.135  1.00 33.87  ? 144 VAL A CB    1 
ATOM   1106 C  CG1   . VAL A 1 156 ? -37.365 12.154  -8.110  1.00 32.02  ? 144 VAL A CG1   1 
ATOM   1107 C  CG2   . VAL A 1 156 ? -35.494 13.750  -7.443  1.00 35.04  ? 144 VAL A CG2   1 
ATOM   1108 N  N     . SER A 1 157 ? -38.339 13.307  -11.353 1.00 33.84  ? 145 SER A N     1 
ATOM   1109 C  CA    . SER A 1 157 ? -39.593 13.115  -12.041 1.00 32.30  ? 145 SER A CA    1 
ATOM   1110 C  C     . SER A 1 157 ? -40.292 11.782  -11.717 1.00 32.41  ? 145 SER A C     1 
ATOM   1111 O  O     . SER A 1 157 ? -39.699 10.693  -11.727 1.00 33.16  ? 145 SER A O     1 
ATOM   1112 C  CB    . SER A 1 157 ? -39.383 13.232  -13.566 1.00 32.49  ? 145 SER A CB    1 
ATOM   1113 O  OG    . SER A 1 157 ? -39.197 14.593  -13.965 1.00 31.84  ? 145 SER A OG    1 
ATOM   1114 N  N     . VAL A 1 158 ? -41.571 11.901  -11.435 1.00 32.27  ? 146 VAL A N     1 
ATOM   1115 C  CA    . VAL A 1 158 ? -42.401 10.773  -11.138 1.00 32.52  ? 146 VAL A CA    1 
ATOM   1116 C  C     . VAL A 1 158 ? -42.912 10.187  -12.475 1.00 31.95  ? 146 VAL A C     1 
ATOM   1117 O  O     . VAL A 1 158 ? -43.609 10.879  -13.231 1.00 33.50  ? 146 VAL A O     1 
ATOM   1118 C  CB    . VAL A 1 158 ? -43.576 11.170  -10.211 1.00 32.63  ? 146 VAL A CB    1 
ATOM   1119 C  CG1   . VAL A 1 158 ? -44.495 9.977   -9.986  1.00 31.67  ? 146 VAL A CG1   1 
ATOM   1120 C  CG2   . VAL A 1 158 ? -43.048 11.702  -8.856  1.00 30.74  ? 146 VAL A CG2   1 
ATOM   1121 N  N     . ASP A 1 159 ? -42.546 8.934   -12.714 1.00 31.51  ? 147 ASP A N     1 
ATOM   1122 C  CA    . ASP A 1 159 ? -42.871 8.103   -13.915 1.00 33.76  ? 147 ASP A CA    1 
ATOM   1123 C  C     . ASP A 1 159 ? -42.182 8.531   -15.241 1.00 33.73  ? 147 ASP A C     1 
ATOM   1124 O  O     . ASP A 1 159 ? -41.441 7.748   -15.814 1.00 34.07  ? 147 ASP A O     1 
ATOM   1125 C  CB    . ASP A 1 159 ? -44.363 7.949   -14.138 1.00 34.40  ? 147 ASP A CB    1 
ATOM   1126 C  CG    . ASP A 1 159 ? -44.747 6.589   -14.813 1.00 37.77  ? 147 ASP A CG    1 
ATOM   1127 O  OD1   . ASP A 1 159 ? -43.944 5.642   -14.858 1.00 37.39  ? 147 ASP A OD1   1 
ATOM   1128 O  OD2   . ASP A 1 159 ? -45.892 6.461   -15.285 1.00 37.49  ? 147 ASP A OD2   1 
ATOM   1129 N  N     . VAL A 1 160 ? -42.438 9.745   -15.694 1.00 34.46  ? 148 VAL A N     1 
ATOM   1130 C  CA    . VAL A 1 160 ? -41.863 10.275  -16.895 1.00 36.92  ? 148 VAL A CA    1 
ATOM   1131 C  C     . VAL A 1 160 ? -41.747 11.779  -16.680 1.00 35.64  ? 148 VAL A C     1 
ATOM   1132 O  O     . VAL A 1 160 ? -42.556 12.362  -16.011 1.00 36.35  ? 148 VAL A O     1 
ATOM   1133 C  CB    . VAL A 1 160 ? -42.732 10.019  -18.161 1.00 39.49  ? 148 VAL A CB    1 
ATOM   1134 C  CG1   . VAL A 1 160 ? -43.040 8.526   -18.331 1.00 42.81  ? 148 VAL A CG1   1 
ATOM   1135 C  CG2   . VAL A 1 160 ? -44.035 10.728  -18.005 1.00 40.91  ? 148 VAL A CG2   1 
ATOM   1136 N  N     . PRO A 1 161 ? -40.696 12.401  -17.170 1.00 35.30  ? 149 PRO A N     1 
ATOM   1137 C  CA    . PRO A 1 161 ? -40.619 13.854  -17.001 1.00 35.81  ? 149 PRO A CA    1 
ATOM   1138 C  C     . PRO A 1 161 ? -41.825 14.541  -17.695 1.00 35.82  ? 149 PRO A C     1 
ATOM   1139 O  O     . PRO A 1 161 ? -42.119 14.230  -18.864 1.00 35.58  ? 149 PRO A O     1 
ATOM   1140 C  CB    . PRO A 1 161 ? -39.326 14.221  -17.705 1.00 35.72  ? 149 PRO A CB    1 
ATOM   1141 C  CG    . PRO A 1 161 ? -38.578 12.966  -17.817 1.00 35.35  ? 149 PRO A CG    1 
ATOM   1142 C  CD    . PRO A 1 161 ? -39.547 11.858  -17.900 1.00 35.93  ? 149 PRO A CD    1 
ATOM   1143 N  N     . SER A 1 162 ? -42.524 15.410  -16.966 1.00 35.13  ? 150 SER A N     1 
ATOM   1144 C  CA    . SER A 1 162 ? -43.772 16.010  -17.457 1.00 35.05  ? 150 SER A CA    1 
ATOM   1145 C  C     . SER A 1 162 ? -43.523 16.751  -18.756 1.00 35.96  ? 150 SER A C     1 
ATOM   1146 O  O     . SER A 1 162 ? -42.635 17.572  -18.812 1.00 35.92  ? 150 SER A O     1 
ATOM   1147 C  CB    . SER A 1 162 ? -44.320 16.949  -16.384 1.00 36.18  ? 150 SER A CB    1 
ATOM   1148 O  OG    . SER A 1 162 ? -44.711 16.185  -15.248 1.00 33.61  ? 150 SER A OG    1 
ATOM   1149 N  N     . GLY A 1 163 ? -44.295 16.453  -19.799 1.00 35.85  ? 151 GLY A N     1 
ATOM   1150 C  CA    . GLY A 1 163 ? -44.058 17.041  -21.093 1.00 37.10  ? 151 GLY A CA    1 
ATOM   1151 C  C     . GLY A 1 163 ? -43.437 16.079  -22.100 1.00 36.80  ? 151 GLY A C     1 
ATOM   1152 O  O     . GLY A 1 163 ? -43.450 16.351  -23.289 1.00 36.87  ? 151 GLY A O     1 
ATOM   1153 N  N     . ILE A 1 164 ? -42.919 14.952  -21.643 1.00 36.00  ? 152 ILE A N     1 
ATOM   1154 C  CA    . ILE A 1 164 ? -42.543 13.881  -22.580 1.00 36.76  ? 152 ILE A CA    1 
ATOM   1155 C  C     . ILE A 1 164 ? -43.690 12.940  -22.854 1.00 36.63  ? 152 ILE A C     1 
ATOM   1156 O  O     . ILE A 1 164 ? -44.296 12.395  -21.912 1.00 38.09  ? 152 ILE A O     1 
ATOM   1157 C  CB    . ILE A 1 164 ? -41.362 13.057  -22.003 1.00 35.95  ? 152 ILE A CB    1 
ATOM   1158 C  CG1   . ILE A 1 164 ? -40.131 13.945  -21.870 1.00 37.23  ? 152 ILE A CG1   1 
ATOM   1159 C  CG2   . ILE A 1 164 ? -41.034 11.833  -22.857 1.00 36.79  ? 152 ILE A CG2   1 
ATOM   1160 C  CD1   . ILE A 1 164 ? -39.687 14.574  -23.128 1.00 41.74  ? 152 ILE A CD1   1 
ATOM   1161 N  N     . ASP A 1 165 ? -43.978 12.706  -24.119 1.00 37.61  ? 153 ASP A N     1 
ATOM   1162 C  CA    . ASP A 1 165 ? -44.951 11.683  -24.529 1.00 37.74  ? 153 ASP A CA    1 
ATOM   1163 C  C     . ASP A 1 165 ? -44.309 10.349  -24.315 1.00 37.72  ? 153 ASP A C     1 
ATOM   1164 O  O     . ASP A 1 165 ? -43.266 10.051  -24.891 1.00 36.64  ? 153 ASP A O     1 
ATOM   1165 C  CB    . ASP A 1 165 ? -45.252 11.847  -26.015 1.00 40.16  ? 153 ASP A CB    1 
ATOM   1166 C  CG    . ASP A 1 165 ? -46.330 10.881  -26.526 1.00 41.08  ? 153 ASP A CG    1 
ATOM   1167 O  OD1   . ASP A 1 165 ? -46.542 9.776   -25.987 1.00 46.51  ? 153 ASP A OD1   1 
ATOM   1168 O  OD2   . ASP A 1 165 ? -46.939 11.246  -27.511 1.00 48.22  ? 153 ASP A OD2   1 
ATOM   1169 N  N     . SER A 1 166 ? -44.922 9.541   -23.467 1.00 37.81  ? 154 SER A N     1 
ATOM   1170 C  CA    . SER A 1 166 ? -44.319 8.343   -23.005 1.00 38.19  ? 154 SER A CA    1 
ATOM   1171 C  C     . SER A 1 166 ? -44.317 7.210   -24.063 1.00 39.00  ? 154 SER A C     1 
ATOM   1172 O  O     . SER A 1 166 ? -43.654 6.220   -23.878 1.00 38.63  ? 154 SER A O     1 
ATOM   1173 C  CB    . SER A 1 166 ? -45.027 7.907   -21.714 1.00 38.90  ? 154 SER A CB    1 
ATOM   1174 O  OG    . SER A 1 166 ? -46.294 7.395   -22.029 1.00 41.75  ? 154 SER A OG    1 
ATOM   1175 N  N     . ASN A 1 167 ? -45.059 7.377   -25.152 1.00 40.65  ? 155 ASN A N     1 
ATOM   1176 C  CA    . ASN A 1 167 ? -45.084 6.422   -26.259 1.00 42.50  ? 155 ASN A CA    1 
ATOM   1177 C  C     . ASN A 1 167 ? -44.086 6.730   -27.360 1.00 41.47  ? 155 ASN A C     1 
ATOM   1178 O  O     . ASN A 1 167 ? -43.809 5.859   -28.197 1.00 42.21  ? 155 ASN A O     1 
ATOM   1179 C  CB    . ASN A 1 167 ? -46.447 6.462   -26.965 1.00 44.30  ? 155 ASN A CB    1 
ATOM   1180 C  CG    . ASN A 1 167 ? -47.585 6.235   -26.033 1.00 50.05  ? 155 ASN A CG    1 
ATOM   1181 O  OD1   . ASN A 1 167 ? -47.669 5.194   -25.401 1.00 55.66  ? 155 ASN A OD1   1 
ATOM   1182 N  ND2   . ASN A 1 167 ? -48.461 7.241   -25.897 1.00 56.97  ? 155 ASN A ND2   1 
ATOM   1183 N  N     . THR A 1 168 ? -43.601 7.963   -27.410 1.00 38.85  ? 156 THR A N     1 
ATOM   1184 C  CA    . THR A 1 168 ? -42.743 8.380   -28.508 1.00 39.30  ? 156 THR A CA    1 
ATOM   1185 C  C     . THR A 1 168 ? -41.398 9.039   -28.037 1.00 38.38  ? 156 THR A C     1 
ATOM   1186 O  O     . THR A 1 168 ? -40.426 9.039   -28.776 1.00 36.67  ? 156 THR A O     1 
ATOM   1187 C  CB    . THR A 1 168 ? -43.470 9.420   -29.390 1.00 40.13  ? 156 THR A CB    1 
ATOM   1188 O  OG1   . THR A 1 168 ? -43.609 10.630  -28.626 1.00 40.51  ? 156 THR A OG1   1 
ATOM   1189 C  CG2   . THR A 1 168 ? -44.873 8.893   -29.821 1.00 42.95  ? 156 THR A CG2   1 
ATOM   1190 N  N     . GLY A 1 169 ? -41.380 9.622   -26.840 1.00 36.43  ? 157 GLY A N     1 
ATOM   1191 C  CA    . GLY A 1 169 ? -40.234 10.410  -26.379 1.00 36.94  ? 157 GLY A CA    1 
ATOM   1192 C  C     . GLY A 1 169 ? -40.135 11.841  -26.908 1.00 36.87  ? 157 GLY A C     1 
ATOM   1193 O  O     . GLY A 1 169 ? -39.130 12.536  -26.668 1.00 35.17  ? 157 GLY A O     1 
ATOM   1194 N  N     . LYS A 1 170 ? -41.159 12.279  -27.621 1.00 36.92  ? 158 LYS A N     1 
ATOM   1195 C  CA    . LYS A 1 170 ? -41.259 13.660  -28.072 1.00 38.53  ? 158 LYS A CA    1 
ATOM   1196 C  C     . LYS A 1 170 ? -41.620 14.614  -26.959 1.00 38.07  ? 158 LYS A C     1 
ATOM   1197 O  O     . LYS A 1 170 ? -42.271 14.221  -25.958 1.00 35.47  ? 158 LYS A O     1 
ATOM   1198 C  CB    . LYS A 1 170 ? -42.292 13.721  -29.222 1.00 40.61  ? 158 LYS A CB    1 
ATOM   1199 C  CG    . LYS A 1 170 ? -41.688 13.022  -30.431 1.00 45.37  ? 158 LYS A CG    1 
ATOM   1200 C  CD    . LYS A 1 170 ? -42.470 13.086  -31.700 1.00 53.69  ? 158 LYS A CD    1 
ATOM   1201 C  CE    . LYS A 1 170 ? -41.441 12.992  -32.879 1.00 59.12  ? 158 LYS A CE    1 
ATOM   1202 N  NZ    . LYS A 1 170 ? -42.023 12.405  -34.145 1.00 64.63  ? 158 LYS A NZ    1 
ATOM   1203 N  N     . VAL A 1 171 ? -41.159 15.854  -27.102 1.00 38.79  ? 159 VAL A N     1 
ATOM   1204 C  CA    . VAL A 1 171 ? -41.484 16.931  -26.138 1.00 40.00  ? 159 VAL A CA    1 
ATOM   1205 C  C     . VAL A 1 171 ? -42.773 17.617  -26.636 1.00 41.53  ? 159 VAL A C     1 
ATOM   1206 O  O     . VAL A 1 171 ? -42.817 18.094  -27.740 1.00 41.66  ? 159 VAL A O     1 
ATOM   1207 C  CB    . VAL A 1 171 ? -40.324 17.993  -26.045 1.00 41.34  ? 159 VAL A CB    1 
ATOM   1208 C  CG1   . VAL A 1 171 ? -40.827 19.312  -25.372 1.00 43.09  ? 159 VAL A CG1   1 
ATOM   1209 C  CG2   . VAL A 1 171 ? -39.072 17.389  -25.303 1.00 39.51  ? 159 VAL A CG2   1 
ATOM   1210 N  N     . LEU A 1 172 ? -43.830 17.612  -25.833 1.00 42.14  ? 160 LEU A N     1 
ATOM   1211 C  CA    . LEU A 1 172 ? -45.068 18.302  -26.192 1.00 43.84  ? 160 LEU A CA    1 
ATOM   1212 C  C     . LEU A 1 172 ? -45.011 19.778  -25.721 1.00 44.20  ? 160 LEU A C     1 
ATOM   1213 O  O     . LEU A 1 172 ? -45.482 20.122  -24.622 1.00 43.33  ? 160 LEU A O     1 
ATOM   1214 C  CB    . LEU A 1 172 ? -46.283 17.523  -25.662 1.00 43.93  ? 160 LEU A CB    1 
ATOM   1215 C  CG    . LEU A 1 172 ? -46.278 16.051  -26.168 1.00 44.36  ? 160 LEU A CG    1 
ATOM   1216 C  CD1   . LEU A 1 172 ? -47.592 15.367  -25.834 1.00 43.54  ? 160 LEU A CD1   1 
ATOM   1217 C  CD2   . LEU A 1 172 ? -45.967 15.947  -27.679 1.00 45.73  ? 160 LEU A CD2   1 
ATOM   1218 N  N     . ARG A 1 173 ? -44.375 20.588  -26.575 1.00 44.32  ? 161 ARG A N     1 
ATOM   1219 C  CA    . ARG A 1 173 ? -44.058 22.002  -26.356 1.00 46.37  ? 161 ARG A CA    1 
ATOM   1220 C  C     . ARG A 1 173 ? -42.952 22.277  -25.354 1.00 45.73  ? 161 ARG A C     1 
ATOM   1221 O  O     . ARG A 1 173 ? -41.959 22.915  -25.671 1.00 46.37  ? 161 ARG A O     1 
ATOM   1222 C  CB    . ARG A 1 173 ? -45.294 22.838  -25.991 1.00 48.09  ? 161 ARG A CB    1 
ATOM   1223 C  CG    . ARG A 1 173 ? -45.089 24.340  -26.289 1.00 52.58  ? 161 ARG A CG    1 
ATOM   1224 C  CD    . ARG A 1 173 ? -46.387 25.125  -26.284 1.00 56.86  ? 161 ARG A CD    1 
ATOM   1225 N  NE    . ARG A 1 173 ? -46.100 26.551  -26.142 1.00 62.38  ? 161 ARG A NE    1 
ATOM   1226 C  CZ    . ARG A 1 173 ? -46.014 27.227  -24.989 1.00 64.37  ? 161 ARG A CZ    1 
ATOM   1227 N  NH1   . ARG A 1 173 ? -46.224 26.650  -23.811 1.00 63.40  ? 161 ARG A NH1   1 
ATOM   1228 N  NH2   . ARG A 1 173 ? -45.726 28.529  -25.023 1.00 67.54  ? 161 ARG A NH2   1 
ATOM   1229 N  N     . THR A 1 174 ? -43.114 21.817  -24.126 1.00 44.97  ? 162 THR A N     1 
ATOM   1230 C  CA    . THR A 1 174 ? -42.017 21.956  -23.183 1.00 44.53  ? 162 THR A CA    1 
ATOM   1231 C  C     . THR A 1 174 ? -42.069 20.782  -22.229 1.00 42.15  ? 162 THR A C     1 
ATOM   1232 O  O     . THR A 1 174 ? -43.123 20.140  -22.095 1.00 42.10  ? 162 THR A O     1 
ATOM   1233 C  CB    . THR A 1 174 ? -42.066 23.332  -22.461 1.00 46.52  ? 162 THR A CB    1 
ATOM   1234 O  OG1   . THR A 1 174 ? -40.873 23.501  -21.704 1.00 47.16  ? 162 THR A OG1   1 
ATOM   1235 C  CG2   . THR A 1 174 ? -43.278 23.449  -21.515 1.00 46.18  ? 162 THR A CG2   1 
ATOM   1236 N  N     . ALA A 1 175 ? -40.928 20.482  -21.598 1.00 40.33  ? 163 ALA A N     1 
ATOM   1237 C  CA    . ALA A 1 175 ? -40.826 19.329  -20.713 1.00 38.47  ? 163 ALA A CA    1 
ATOM   1238 C  C     . ALA A 1 175 ? -39.769 19.540  -19.671 1.00 37.45  ? 163 ALA A C     1 
ATOM   1239 O  O     . ALA A 1 175 ? -38.864 20.305  -19.831 1.00 37.48  ? 163 ALA A O     1 
ATOM   1240 C  CB    . ALA A 1 175 ? -40.541 18.022  -21.495 1.00 37.14  ? 163 ALA A CB    1 
ATOM   1241 N  N     . VAL A 1 176 ? -39.955 18.855  -18.568 1.00 37.09  ? 164 VAL A N     1 
ATOM   1242 C  CA    . VAL A 1 176 ? -39.076 18.926  -17.430 1.00 36.64  ? 164 VAL A CA    1 
ATOM   1243 C  C     . VAL A 1 176 ? -37.781 18.211  -17.788 1.00 36.86  ? 164 VAL A C     1 
ATOM   1244 O  O     . VAL A 1 176 ? -37.803 17.135  -18.396 1.00 35.82  ? 164 VAL A O     1 
ATOM   1245 C  CB    . VAL A 1 176 ? -39.729 18.242  -16.240 1.00 36.15  ? 164 VAL A CB    1 
ATOM   1246 C  CG1   . VAL A 1 176 ? -38.688 17.968  -15.081 1.00 33.73  ? 164 VAL A CG1   1 
ATOM   1247 C  CG2   . VAL A 1 176 ? -40.915 19.112  -15.759 1.00 36.16  ? 164 VAL A CG2   1 
ATOM   1248 N  N     . LYS A 1 177 ? -36.663 18.812  -17.427 1.00 36.75  ? 165 LYS A N     1 
ATOM   1249 C  CA    . LYS A 1 177 ? -35.422 18.115  -17.511 1.00 38.69  ? 165 LYS A CA    1 
ATOM   1250 C  C     . LYS A 1 177 ? -35.077 17.564  -16.131 1.00 38.14  ? 165 LYS A C     1 
ATOM   1251 O  O     . LYS A 1 177 ? -34.768 18.324  -15.232 1.00 39.67  ? 165 LYS A O     1 
ATOM   1252 C  CB    . LYS A 1 177 ? -34.313 19.039  -18.024 1.00 40.39  ? 165 LYS A CB    1 
ATOM   1253 C  CG    . LYS A 1 177 ? -33.022 18.245  -18.312 1.00 46.36  ? 165 LYS A CG    1 
ATOM   1254 C  CD    . LYS A 1 177 ? -31.919 19.093  -18.960 1.00 52.31  ? 165 LYS A CD    1 
ATOM   1255 C  CE    . LYS A 1 177 ? -30.819 18.180  -19.549 1.00 55.30  ? 165 LYS A CE    1 
ATOM   1256 N  NZ    . LYS A 1 177 ? -30.115 17.405  -18.522 1.00 55.49  ? 165 LYS A NZ    1 
ATOM   1257 N  N     . ALA A 1 178 ? -35.078 16.244  -15.989 1.00 36.94  ? 166 ALA A N     1 
ATOM   1258 C  CA    . ALA A 1 178 ? -34.871 15.574  -14.673 1.00 36.85  ? 166 ALA A CA    1 
ATOM   1259 C  C     . ALA A 1 178 ? -33.441 15.097  -14.460 1.00 36.74  ? 166 ALA A C     1 
ATOM   1260 O  O     . ALA A 1 178 ? -32.785 14.640  -15.386 1.00 37.32  ? 166 ALA A O     1 
ATOM   1261 C  CB    . ALA A 1 178 ? -35.787 14.377  -14.544 1.00 34.79  ? 166 ALA A CB    1 
ATOM   1262 N  N     . ASP A 1 179 ? -32.998 15.142  -13.220 1.00 37.18  ? 167 ASP A N     1 
ATOM   1263 C  CA    . ASP A 1 179 ? -31.743 14.453  -12.821 1.00 38.35  ? 167 ASP A CA    1 
ATOM   1264 C  C     . ASP A 1 179 ? -31.993 12.980  -12.585 1.00 37.13  ? 167 ASP A C     1 
ATOM   1265 O  O     . ASP A 1 179 ? -31.131 12.146  -12.851 1.00 38.11  ? 167 ASP A O     1 
ATOM   1266 C  CB    . ASP A 1 179 ? -31.149 15.083  -11.570 1.00 38.89  ? 167 ASP A CB    1 
ATOM   1267 C  CG    . ASP A 1 179 ? -30.829 16.569  -11.758 1.00 43.70  ? 167 ASP A CG    1 
ATOM   1268 O  OD1   . ASP A 1 179 ? -29.842 16.848  -12.417 1.00 51.09  ? 167 ASP A OD1   1 
ATOM   1269 O  OD2   . ASP A 1 179 ? -31.556 17.469  -11.265 1.00 49.84  ? 167 ASP A OD2   1 
ATOM   1270 N  N     . LEU A 1 180 ? -33.199 12.658  -12.108 1.00 36.04  ? 168 LEU A N     1 
ATOM   1271 C  CA    . LEU A 1 180 ? -33.587 11.286  -11.757 1.00 35.41  ? 168 LEU A CA    1 
ATOM   1272 C  C     . LEU A 1 180 ? -35.058 11.093  -12.148 1.00 33.83  ? 168 LEU A C     1 
ATOM   1273 O  O     . LEU A 1 180 ? -35.861 11.964  -11.870 1.00 34.69  ? 168 LEU A O     1 
ATOM   1274 C  CB    . LEU A 1 180 ? -33.413 11.097  -10.244 1.00 35.96  ? 168 LEU A CB    1 
ATOM   1275 C  CG    . LEU A 1 180 ? -33.980 9.806   -9.695  1.00 38.13  ? 168 LEU A CG    1 
ATOM   1276 C  CD1   . LEU A 1 180 ? -33.152 8.619   -10.246 1.00 41.18  ? 168 LEU A CD1   1 
ATOM   1277 C  CD2   . LEU A 1 180 ? -34.004 9.856   -8.157  1.00 40.10  ? 168 LEU A CD2   1 
ATOM   1278 N  N     . THR A 1 181 ? -35.386 10.019  -12.873 1.00 33.24  ? 169 THR A N     1 
ATOM   1279 C  CA    . THR A 1 181 ? -36.748 9.648   -13.168 1.00 32.19  ? 169 THR A CA    1 
ATOM   1280 C  C     . THR A 1 181 ? -36.984 8.291   -12.552 1.00 32.98  ? 169 THR A C     1 
ATOM   1281 O  O     . THR A 1 181 ? -36.161 7.377   -12.714 1.00 32.82  ? 169 THR A O     1 
ATOM   1282 C  CB    . THR A 1 181 ? -37.027 9.625   -14.682 1.00 32.68  ? 169 THR A CB    1 
ATOM   1283 O  OG1   . THR A 1 181 ? -36.855 10.939  -15.179 1.00 31.37  ? 169 THR A OG1   1 
ATOM   1284 C  CG2   . THR A 1 181 ? -38.502 9.184   -15.027 1.00 30.70  ? 169 THR A CG2   1 
ATOM   1285 N  N     . VAL A 1 182 ? -38.085 8.160   -11.803 1.00 33.08  ? 170 VAL A N     1 
ATOM   1286 C  CA    . VAL A 1 182 ? -38.465 6.881   -11.253 1.00 32.60  ? 170 VAL A CA    1 
ATOM   1287 C  C     . VAL A 1 182 ? -39.709 6.415   -11.966 1.00 32.74  ? 170 VAL A C     1 
ATOM   1288 O  O     . VAL A 1 182 ? -40.776 7.038   -11.816 1.00 32.41  ? 170 VAL A O     1 
ATOM   1289 C  CB    . VAL A 1 182 ? -38.718 6.922   -9.729  1.00 33.65  ? 170 VAL A CB    1 
ATOM   1290 C  CG1   . VAL A 1 182 ? -38.935 5.502   -9.199  1.00 31.35  ? 170 VAL A CG1   1 
ATOM   1291 C  CG2   . VAL A 1 182 ? -37.565 7.592   -8.990  1.00 33.09  ? 170 VAL A CG2   1 
ATOM   1292 N  N     . THR A 1 183 ? -39.594 5.334   -12.735 1.00 31.47  ? 171 THR A N     1 
ATOM   1293 C  CA    . THR A 1 183 ? -40.752 4.809   -13.485 1.00 33.09  ? 171 THR A CA    1 
ATOM   1294 C  C     . THR A 1 183 ? -41.217 3.456   -12.896 1.00 34.11  ? 171 THR A C     1 
ATOM   1295 O  O     . THR A 1 183 ? -40.517 2.840   -12.119 1.00 34.46  ? 171 THR A O     1 
ATOM   1296 C  CB    . THR A 1 183 ? -40.471 4.686   -14.996 1.00 33.33  ? 171 THR A CB    1 
ATOM   1297 O  OG1   . THR A 1 183 ? -41.709 4.510   -15.703 1.00 34.01  ? 171 THR A OG1   1 
ATOM   1298 C  CG2   . THR A 1 183 ? -39.555 3.533   -15.323 1.00 31.67  ? 171 THR A CG2   1 
ATOM   1299 N  N     . PHE A 1 184 ? -42.414 3.033   -13.245 1.00 34.35  ? 172 PHE A N     1 
ATOM   1300 C  CA    . PHE A 1 184 ? -43.065 1.948   -12.515 1.00 36.21  ? 172 PHE A CA    1 
ATOM   1301 C  C     . PHE A 1 184 ? -43.306 0.759   -13.437 1.00 37.55  ? 172 PHE A C     1 
ATOM   1302 O  O     . PHE A 1 184 ? -43.804 0.915   -14.574 1.00 38.88  ? 172 PHE A O     1 
ATOM   1303 C  CB    . PHE A 1 184 ? -44.344 2.491   -11.845 1.00 35.83  ? 172 PHE A CB    1 
ATOM   1304 C  CG    . PHE A 1 184 ? -44.105 3.756   -11.075 1.00 34.93  ? 172 PHE A CG    1 
ATOM   1305 C  CD1   . PHE A 1 184 ? -43.159 3.792   -10.091 1.00 32.39  ? 172 PHE A CD1   1 
ATOM   1306 C  CD2   . PHE A 1 184 ? -44.803 4.913   -11.350 1.00 33.84  ? 172 PHE A CD2   1 
ATOM   1307 C  CE1   . PHE A 1 184 ? -42.895 4.976   -9.363  1.00 31.30  ? 172 PHE A CE1   1 
ATOM   1308 C  CE2   . PHE A 1 184 ? -44.553 6.057   -10.639 1.00 32.55  ? 172 PHE A CE2   1 
ATOM   1309 C  CZ    . PHE A 1 184 ? -43.574 6.082   -9.644  1.00 33.37  ? 172 PHE A CZ    1 
ATOM   1310 N  N     . GLY A 1 185 ? -42.869 -0.408  -12.989 1.00 38.43  ? 173 GLY A N     1 
ATOM   1311 C  CA    . GLY A 1 185 ? -43.055 -1.639  -13.766 1.00 39.51  ? 173 GLY A CA    1 
ATOM   1312 C  C     . GLY A 1 185 ? -42.010 -1.845  -14.843 1.00 40.35  ? 173 GLY A C     1 
ATOM   1313 O  O     . GLY A 1 185 ? -41.243 -2.785  -14.779 1.00 40.77  ? 173 GLY A O     1 
ATOM   1314 N  N     . VAL A 1 186 ? -42.043 -0.999  -15.872 1.00 39.84  ? 174 VAL A N     1 
ATOM   1315 C  CA    . VAL A 1 186 ? -41.207 -1.159  -17.051 1.00 41.50  ? 174 VAL A CA    1 
ATOM   1316 C  C     . VAL A 1 186 ? -40.805 0.231   -17.545 1.00 40.52  ? 174 VAL A C     1 
ATOM   1317 O  O     . VAL A 1 186 ? -41.518 1.196   -17.295 1.00 39.17  ? 174 VAL A O     1 
ATOM   1318 C  CB    . VAL A 1 186 ? -41.928 -1.917  -18.226 1.00 42.75  ? 174 VAL A CB    1 
ATOM   1319 C  CG1   . VAL A 1 186 ? -42.132 -3.354  -17.869 1.00 45.83  ? 174 VAL A CG1   1 
ATOM   1320 C  CG2   . VAL A 1 186 ? -43.233 -1.250  -18.587 1.00 41.72  ? 174 VAL A CG2   1 
ATOM   1321 N  N     . PRO A 1 187 ? -39.638 0.338   -18.189 1.00 41.53  ? 175 PRO A N     1 
ATOM   1322 C  CA    . PRO A 1 187 ? -39.298 1.586   -18.879 1.00 41.15  ? 175 PRO A CA    1 
ATOM   1323 C  C     . PRO A 1 187 ? -40.331 1.877   -19.972 1.00 41.36  ? 175 PRO A C     1 
ATOM   1324 O  O     . PRO A 1 187 ? -40.906 0.961   -20.528 1.00 42.76  ? 175 PRO A O     1 
ATOM   1325 C  CB    . PRO A 1 187 ? -37.954 1.298   -19.522 1.00 42.28  ? 175 PRO A CB    1 
ATOM   1326 C  CG    . PRO A 1 187 ? -37.695 -0.154  -19.316 1.00 43.32  ? 175 PRO A CG    1 
ATOM   1327 C  CD    . PRO A 1 187 ? -38.582 -0.675  -18.285 1.00 42.61  ? 175 PRO A CD    1 
ATOM   1328 N  N     . LYS A 1 188 ? -40.596 3.140   -20.219 1.00 40.38  ? 176 LYS A N     1 
ATOM   1329 C  CA    . LYS A 1 188 ? -41.540 3.519   -21.256 1.00 40.71  ? 176 LYS A CA    1 
ATOM   1330 C  C     . LYS A 1 188 ? -40.719 3.931   -22.471 1.00 39.71  ? 176 LYS A C     1 
ATOM   1331 O  O     . LYS A 1 188 ? -39.554 4.330   -22.343 1.00 38.97  ? 176 LYS A O     1 
ATOM   1332 C  CB    . LYS A 1 188 ? -42.423 4.683   -20.801 1.00 40.40  ? 176 LYS A CB    1 
ATOM   1333 C  CG    . LYS A 1 188 ? -43.006 4.580   -19.363 1.00 43.39  ? 176 LYS A CG    1 
ATOM   1334 C  CD    . LYS A 1 188 ? -44.116 3.683   -19.220 1.00 45.97  ? 176 LYS A CD    1 
ATOM   1335 C  CE    . LYS A 1 188 ? -44.635 3.647   -17.723 1.00 43.96  ? 176 LYS A CE    1 
ATOM   1336 N  NZ    . LYS A 1 188 ? -43.800 2.820   -16.792 1.00 42.05  ? 176 LYS A NZ    1 
ATOM   1337 N  N     . ILE A 1 189 ? -41.328 3.832   -23.639 1.00 39.20  ? 177 ILE A N     1 
ATOM   1338 C  CA    . ILE A 1 189 ? -40.629 4.127   -24.865 1.00 39.05  ? 177 ILE A CA    1 
ATOM   1339 C  C     . ILE A 1 189 ? -40.041 5.541   -24.846 1.00 38.27  ? 177 ILE A C     1 
ATOM   1340 O  O     . ILE A 1 189 ? -38.943 5.744   -25.384 1.00 36.47  ? 177 ILE A O     1 
ATOM   1341 C  CB    . ILE A 1 189 ? -41.548 3.937   -26.109 1.00 41.69  ? 177 ILE A CB    1 
ATOM   1342 C  CG1   . ILE A 1 189 ? -41.820 2.438   -26.318 1.00 43.65  ? 177 ILE A CG1   1 
ATOM   1343 C  CG2   . ILE A 1 189 ? -40.881 4.512   -27.377 1.00 39.07  ? 177 ILE A CG2   1 
ATOM   1344 C  CD1   . ILE A 1 189 ? -42.631 2.154   -27.533 1.00 47.98  ? 177 ILE A CD1   1 
ATOM   1345 N  N     . GLY A 1 190 ? -40.734 6.479   -24.187 1.00 35.80  ? 178 GLY A N     1 
ATOM   1346 C  CA    . GLY A 1 190 ? -40.268 7.861   -24.065 1.00 36.10  ? 178 GLY A CA    1 
ATOM   1347 C  C     . GLY A 1 190 ? -39.077 8.127   -23.154 1.00 35.14  ? 178 GLY A C     1 
ATOM   1348 O  O     . GLY A 1 190 ? -38.548 9.222   -23.164 1.00 35.36  ? 178 GLY A O     1 
ATOM   1349 N  N     . HIS A 1 191 ? -38.667 7.144   -22.356 1.00 33.73  ? 179 HIS A N     1 
ATOM   1350 C  CA    . HIS A 1 191 ? -37.400 7.205   -21.639 1.00 33.91  ? 179 HIS A CA    1 
ATOM   1351 C  C     . HIS A 1 191 ? -36.273 6.710   -22.532 1.00 34.94  ? 179 HIS A C     1 
ATOM   1352 O  O     . HIS A 1 191 ? -35.127 6.901   -22.213 1.00 34.82  ? 179 HIS A O     1 
ATOM   1353 C  CB    . HIS A 1 191 ? -37.402 6.221   -20.471 1.00 33.86  ? 179 HIS A CB    1 
ATOM   1354 C  CG    . HIS A 1 191 ? -38.472 6.461   -19.453 1.00 32.82  ? 179 HIS A CG    1 
ATOM   1355 N  ND1   . HIS A 1 191 ? -39.278 5.448   -18.985 1.00 31.99  ? 179 HIS A ND1   1 
ATOM   1356 C  CD2   . HIS A 1 191 ? -38.816 7.574   -18.761 1.00 33.14  ? 179 HIS A CD2   1 
ATOM   1357 C  CE1   . HIS A 1 191 ? -40.071 5.929   -18.046 1.00 33.89  ? 179 HIS A CE1   1 
ATOM   1358 N  NE2   . HIS A 1 191 ? -39.803 7.212   -17.883 1.00 32.11  ? 179 HIS A NE2   1 
ATOM   1359 N  N     . ILE A 1 192 ? -36.618 6.007   -23.615 1.00 34.83  ? 180 ILE A N     1 
ATOM   1360 C  CA    . ILE A 1 192 ? -35.644 5.263   -24.429 1.00 36.62  ? 180 ILE A CA    1 
ATOM   1361 C  C     . ILE A 1 192 ? -35.282 6.011   -25.712 1.00 37.16  ? 180 ILE A C     1 
ATOM   1362 O  O     . ILE A 1 192 ? -34.129 5.963   -26.157 1.00 37.26  ? 180 ILE A O     1 
ATOM   1363 C  CB    . ILE A 1 192 ? -36.234 3.869   -24.754 1.00 37.57  ? 180 ILE A CB    1 
ATOM   1364 C  CG1   . ILE A 1 192 ? -36.396 3.061   -23.462 1.00 38.94  ? 180 ILE A CG1   1 
ATOM   1365 C  CG2   . ILE A 1 192 ? -35.413 3.127   -25.763 1.00 40.73  ? 180 ILE A CG2   1 
ATOM   1366 C  CD1   . ILE A 1 192 ? -37.300 1.747   -23.693 1.00 44.92  ? 180 ILE A CD1   1 
ATOM   1367 N  N     . LEU A 1 193 ? -36.270 6.695   -26.299 1.00 35.90  ? 181 LEU A N     1 
ATOM   1368 C  CA    . LEU A 1 193 ? -36.076 7.457   -27.505 1.00 36.65  ? 181 LEU A CA    1 
ATOM   1369 C  C     . LEU A 1 193 ? -35.833 8.908   -27.147 1.00 36.91  ? 181 LEU A C     1 
ATOM   1370 O  O     . LEU A 1 193 ? -36.318 9.405   -26.135 1.00 35.31  ? 181 LEU A O     1 
ATOM   1371 C  CB    . LEU A 1 193 ? -37.272 7.312   -28.456 1.00 36.43  ? 181 LEU A CB    1 
ATOM   1372 C  CG    . LEU A 1 193 ? -37.646 5.863   -28.852 1.00 35.68  ? 181 LEU A CG    1 
ATOM   1373 C  CD1   . LEU A 1 193 ? -38.847 5.776   -29.762 1.00 35.00  ? 181 LEU A CD1   1 
ATOM   1374 C  CD2   . LEU A 1 193 ? -36.480 5.159   -29.505 1.00 34.22  ? 181 LEU A CD2   1 
ATOM   1375 N  N     . PHE A 1 194 ? -35.053 9.586   -27.983 1.00 37.48  ? 182 PHE A N     1 
ATOM   1376 C  CA    . PHE A 1 194 ? -34.687 11.001  -27.734 1.00 37.34  ? 182 PHE A CA    1 
ATOM   1377 C  C     . PHE A 1 194 ? -35.777 11.816  -28.400 1.00 37.22  ? 182 PHE A C     1 
ATOM   1378 O  O     . PHE A 1 194 ? -36.277 11.366  -29.405 1.00 35.80  ? 182 PHE A O     1 
ATOM   1379 C  CB    . PHE A 1 194 ? -33.357 11.324  -28.409 1.00 38.14  ? 182 PHE A CB    1 
ATOM   1380 C  CG    . PHE A 1 194 ? -32.172 10.757  -27.699 1.00 38.42  ? 182 PHE A CG    1 
ATOM   1381 C  CD1   . PHE A 1 194 ? -31.664 9.541   -28.052 1.00 39.32  ? 182 PHE A CD1   1 
ATOM   1382 C  CD2   . PHE A 1 194 ? -31.616 11.424  -26.603 1.00 36.03  ? 182 PHE A CD2   1 
ATOM   1383 C  CE1   . PHE A 1 194 ? -30.570 9.019   -27.365 1.00 40.80  ? 182 PHE A CE1   1 
ATOM   1384 C  CE2   . PHE A 1 194 ? -30.526 10.929  -25.948 1.00 39.84  ? 182 PHE A CE2   1 
ATOM   1385 C  CZ    . PHE A 1 194 ? -29.988 9.721   -26.333 1.00 40.08  ? 182 PHE A CZ    1 
ATOM   1386 N  N     . PRO A 1 195 ? -36.081 13.005  -27.908 1.00 36.92  ? 183 PRO A N     1 
ATOM   1387 C  CA    . PRO A 1 195 ? -35.353 13.663  -26.826 1.00 37.41  ? 183 PRO A CA    1 
ATOM   1388 C  C     . PRO A 1 195 ? -35.667 13.193  -25.417 1.00 36.35  ? 183 PRO A C     1 
ATOM   1389 O  O     . PRO A 1 195 ? -34.982 13.584  -24.496 1.00 37.39  ? 183 PRO A O     1 
ATOM   1390 C  CB    . PRO A 1 195 ? -35.777 15.119  -26.980 1.00 37.81  ? 183 PRO A CB    1 
ATOM   1391 C  CG    . PRO A 1 195 ? -37.045 15.064  -27.660 1.00 38.50  ? 183 PRO A CG    1 
ATOM   1392 C  CD    . PRO A 1 195 ? -36.999 13.930  -28.578 1.00 36.74  ? 183 PRO A CD    1 
ATOM   1393 N  N     . GLY A 1 196 ? -36.676 12.359  -25.261 1.00 34.75  ? 184 GLY A N     1 
ATOM   1394 C  CA    . GLY A 1 196 ? -37.116 11.962  -23.948 1.00 34.96  ? 184 GLY A CA    1 
ATOM   1395 C  C     . GLY A 1 196 ? -36.033 11.290  -23.140 1.00 34.61  ? 184 GLY A C     1 
ATOM   1396 O  O     . GLY A 1 196 ? -35.932 11.511  -21.959 1.00 31.95  ? 184 GLY A O     1 
ATOM   1397 N  N     . ARG A 1 197 ? -35.213 10.488  -23.792 1.00 35.40  ? 185 ARG A N     1 
ATOM   1398 C  CA    . ARG A 1 197 ? -34.147 9.783   -23.118 1.00 36.41  ? 185 ARG A CA    1 
ATOM   1399 C  C     . ARG A 1 197 ? -33.206 10.782  -22.480 1.00 38.14  ? 185 ARG A C     1 
ATOM   1400 O  O     . ARG A 1 197 ? -32.702 10.563  -21.404 1.00 38.27  ? 185 ARG A O     1 
ATOM   1401 C  CB    . ARG A 1 197 ? -33.393 8.887   -24.093 1.00 37.24  ? 185 ARG A CB    1 
ATOM   1402 C  CG    . ARG A 1 197 ? -32.208 8.198   -23.490 1.00 36.41  ? 185 ARG A CG    1 
ATOM   1403 C  CD    . ARG A 1 197 ? -31.618 7.162   -24.411 1.00 39.58  ? 185 ARG A CD    1 
ATOM   1404 N  NE    . ARG A 1 197 ? -30.303 6.771   -23.943 1.00 41.18  ? 185 ARG A NE    1 
ATOM   1405 C  CZ    . ARG A 1 197 ? -29.354 6.232   -24.690 1.00 41.12  ? 185 ARG A CZ    1 
ATOM   1406 N  NH1   . ARG A 1 197 ? -29.554 6.000   -25.968 1.00 40.66  ? 185 ARG A NH1   1 
ATOM   1407 N  NH2   . ARG A 1 197 ? -28.198 5.936   -24.144 1.00 42.92  ? 185 ARG A NH2   1 
ATOM   1408 N  N     . ASP A 1 198 ? -32.950 11.876  -23.162 1.00 40.04  ? 186 ASP A N     1 
ATOM   1409 C  CA    . ASP A 1 198 ? -32.112 12.915  -22.601 1.00 42.94  ? 186 ASP A CA    1 
ATOM   1410 C  C     . ASP A 1 198 ? -32.693 13.601  -21.364 1.00 42.34  ? 186 ASP A C     1 
ATOM   1411 O  O     . ASP A 1 198 ? -31.977 13.880  -20.426 1.00 44.50  ? 186 ASP A O     1 
ATOM   1412 C  CB    . ASP A 1 198 ? -31.760 13.949  -23.660 1.00 44.84  ? 186 ASP A CB    1 
ATOM   1413 C  CG    . ASP A 1 198 ? -30.469 14.643  -23.369 1.00 51.96  ? 186 ASP A CG    1 
ATOM   1414 O  OD1   . ASP A 1 198 ? -29.420 13.983  -23.397 1.00 54.73  ? 186 ASP A OD1   1 
ATOM   1415 O  OD2   . ASP A 1 198 ? -30.509 15.851  -23.098 1.00 60.19  ? 186 ASP A OD2   1 
ATOM   1416 N  N     . LEU A 1 199 ? -33.989 13.873  -21.376 1.00 39.92  ? 187 LEU A N     1 
ATOM   1417 C  CA    . LEU A 1 199 ? -34.655 14.621  -20.300 1.00 39.16  ? 187 LEU A CA    1 
ATOM   1418 C  C     . LEU A 1 199 ? -34.925 13.793  -19.016 1.00 38.48  ? 187 LEU A C     1 
ATOM   1419 O  O     . LEU A 1 199 ? -35.235 14.361  -17.945 1.00 36.62  ? 187 LEU A O     1 
ATOM   1420 C  CB    . LEU A 1 199 ? -35.959 15.255  -20.844 1.00 39.27  ? 187 LEU A CB    1 
ATOM   1421 C  CG    . LEU A 1 199 ? -35.864 16.328  -21.944 1.00 42.43  ? 187 LEU A CG    1 
ATOM   1422 C  CD1   . LEU A 1 199 ? -37.179 16.990  -22.138 1.00 46.90  ? 187 LEU A CD1   1 
ATOM   1423 C  CD2   . LEU A 1 199 ? -34.836 17.392  -21.638 1.00 48.18  ? 187 LEU A CD2   1 
ATOM   1424 N  N     . THR A 1 200 ? -34.811 12.468  -19.151 1.00 38.10  ? 188 THR A N     1 
ATOM   1425 C  CA    . THR A 1 200 ? -35.079 11.485  -18.115 1.00 37.85  ? 188 THR A CA    1 
ATOM   1426 C  C     . THR A 1 200 ? -33.993 11.478  -17.070 1.00 38.70  ? 188 THR A C     1 
ATOM   1427 O  O     . THR A 1 200 ? -34.269 11.226  -15.870 1.00 37.04  ? 188 THR A O     1 
ATOM   1428 C  CB    . THR A 1 200 ? -35.293 10.060  -18.773 1.00 37.88  ? 188 THR A CB    1 
ATOM   1429 O  OG1   . THR A 1 200 ? -36.528 10.066  -19.521 1.00 39.25  ? 188 THR A OG1   1 
ATOM   1430 C  CG2   . THR A 1 200 ? -35.394 8.994   -17.772 1.00 38.11  ? 188 THR A CG2   1 
ATOM   1431 N  N     . GLY A 1 201 ? -32.758 11.807  -17.504 1.00 39.26  ? 189 GLY A N     1 
ATOM   1432 C  CA    . GLY A 1 201 ? -31.632 11.745  -16.631 1.00 39.77  ? 189 GLY A CA    1 
ATOM   1433 C  C     . GLY A 1 201 ? -31.442 10.284  -16.240 1.00 39.78  ? 189 GLY A C     1 
ATOM   1434 O  O     . GLY A 1 201 ? -31.604 9.410   -17.071 1.00 40.05  ? 189 GLY A O     1 
ATOM   1435 N  N     . LYS A 1 202 ? -31.071 10.030  -14.992 1.00 39.79  ? 190 LYS A N     1 
ATOM   1436 C  CA    . LYS A 1 202 ? -30.830 8.663   -14.553 1.00 40.68  ? 190 LYS A CA    1 
ATOM   1437 C  C     . LYS A 1 202 ? -32.180 7.984   -14.342 1.00 38.89  ? 190 LYS A C     1 
ATOM   1438 O  O     . LYS A 1 202 ? -33.035 8.538   -13.657 1.00 38.16  ? 190 LYS A O     1 
ATOM   1439 C  CB    . LYS A 1 202 ? -30.005 8.668   -13.283 1.00 42.00  ? 190 LYS A CB    1 
ATOM   1440 C  CG    . LYS A 1 202 ? -29.822 7.287   -12.629 1.00 47.08  ? 190 LYS A CG    1 
ATOM   1441 C  CD    . LYS A 1 202 ? -29.130 7.408   -11.275 1.00 53.62  ? 190 LYS A CD    1 
ATOM   1442 C  CE    . LYS A 1 202 ? -27.655 7.801   -11.464 1.00 59.23  ? 190 LYS A CE    1 
ATOM   1443 N  NZ    . LYS A 1 202 ? -26.824 7.676   -10.190 1.00 64.44  ? 190 LYS A NZ    1 
ATOM   1444 N  N     . LEU A 1 203 ? -32.382 6.812   -14.939 1.00 36.98  ? 191 LEU A N     1 
ATOM   1445 C  CA    . LEU A 1 203 ? -33.668 6.165   -14.863 1.00 37.51  ? 191 LEU A CA    1 
ATOM   1446 C  C     . LEU A 1 203 ? -33.612 5.028   -13.886 1.00 36.95  ? 191 LEU A C     1 
ATOM   1447 O  O     . LEU A 1 203 ? -32.832 4.135   -14.078 1.00 35.49  ? 191 LEU A O     1 
ATOM   1448 C  CB    . LEU A 1 203 ? -34.112 5.628   -16.235 1.00 37.67  ? 191 LEU A CB    1 
ATOM   1449 C  CG    . LEU A 1 203 ? -35.522 4.956   -16.305 1.00 37.87  ? 191 LEU A CG    1 
ATOM   1450 C  CD1   . LEU A 1 203 ? -36.652 5.940   -16.143 1.00 32.30  ? 191 LEU A CD1   1 
ATOM   1451 C  CD2   . LEU A 1 203 ? -35.679 4.193   -17.646 1.00 37.85  ? 191 LEU A CD2   1 
ATOM   1452 N  N     . LYS A 1 204 ? -34.504 5.021   -12.891 1.00 36.09  ? 192 LYS A N     1 
ATOM   1453 C  CA    . LYS A 1 204 ? -34.741 3.811   -12.113 1.00 36.38  ? 192 LYS A CA    1 
ATOM   1454 C  C     . LYS A 1 204 ? -36.139 3.235   -12.393 1.00 35.31  ? 192 LYS A C     1 
ATOM   1455 O  O     . LYS A 1 204 ? -37.114 3.988   -12.463 1.00 34.36  ? 192 LYS A O     1 
ATOM   1456 C  CB    . LYS A 1 204 ? -34.548 4.118   -10.648 1.00 38.62  ? 192 LYS A CB    1 
ATOM   1457 C  CG    . LYS A 1 204 ? -33.091 4.542   -10.277 1.00 42.28  ? 192 LYS A CG    1 
ATOM   1458 C  CD    . LYS A 1 204 ? -32.869 4.468   -8.782  1.00 50.21  ? 192 LYS A CD    1 
ATOM   1459 C  CE    . LYS A 1 204 ? -31.889 5.589   -8.196  1.00 53.21  ? 192 LYS A CE    1 
ATOM   1460 N  NZ    . LYS A 1 204 ? -30.454 5.215   -8.282  1.00 60.93  ? 192 LYS A NZ    1 
ATOM   1461 N  N     . VAL A 1 205 ? -36.208 1.915   -12.595 1.00 34.06  ? 193 VAL A N     1 
ATOM   1462 C  CA    . VAL A 1 205 ? -37.445 1.180   -12.817 1.00 33.72  ? 193 VAL A CA    1 
ATOM   1463 C  C     . VAL A 1 205 ? -37.810 0.416   -11.535 1.00 34.77  ? 193 VAL A C     1 
ATOM   1464 O  O     . VAL A 1 205 ? -37.079 -0.475  -11.108 1.00 34.25  ? 193 VAL A O     1 
ATOM   1465 C  CB    . VAL A 1 205 ? -37.259 0.177   -13.949 1.00 36.16  ? 193 VAL A CB    1 
ATOM   1466 C  CG1   . VAL A 1 205 ? -38.630 -0.553  -14.258 1.00 37.31  ? 193 VAL A CG1   1 
ATOM   1467 C  CG2   . VAL A 1 205 ? -36.627 0.894   -15.187 1.00 31.29  ? 193 VAL A CG2   1 
ATOM   1468 N  N     . ALA A 1 206 ? -38.929 0.807   -10.919 1.00 32.94  ? 194 ALA A N     1 
ATOM   1469 C  CA    . ALA A 1 206 ? -39.379 0.268   -9.662  1.00 33.14  ? 194 ALA A CA    1 
ATOM   1470 C  C     . ALA A 1 206 ? -40.462 -0.762  -9.843  1.00 33.71  ? 194 ALA A C     1 
ATOM   1471 O  O     . ALA A 1 206 ? -41.387 -0.580  -10.605 1.00 34.19  ? 194 ALA A O     1 
ATOM   1472 C  CB    . ALA A 1 206 ? -39.904 1.451   -8.715  1.00 31.98  ? 194 ALA A CB    1 
ATOM   1473 N  N     . ASN A 1 207 ? -40.352 -1.822  -9.051  1.00 35.09  ? 195 ASN A N     1 
ATOM   1474 C  CA    . ASN A 1 207 ? -41.342 -2.845  -8.920  1.00 35.82  ? 195 ASN A CA    1 
ATOM   1475 C  C     . ASN A 1 207 ? -42.415 -2.309  -7.928  1.00 35.05  ? 195 ASN A C     1 
ATOM   1476 O  O     . ASN A 1 207 ? -42.116 -2.067  -6.744  1.00 34.52  ? 195 ASN A O     1 
ATOM   1477 C  CB    . ASN A 1 207 ? -40.627 -4.120  -8.391  1.00 37.58  ? 195 ASN A CB    1 
ATOM   1478 C  CG    . ASN A 1 207 ? -41.581 -5.153  -7.820  1.00 38.45  ? 195 ASN A CG    1 
ATOM   1479 O  OD1   . ASN A 1 207 ? -42.753 -5.217  -8.189  1.00 34.84  ? 195 ASN A OD1   1 
ATOM   1480 N  ND2   . ASN A 1 207 ? -41.066 -5.972  -6.925  1.00 36.59  ? 195 ASN A ND2   1 
ATOM   1481 N  N     . ILE A 1 208 ? -43.631 -2.088  -8.401  1.00 34.38  ? 196 ILE A N     1 
ATOM   1482 C  CA    . ILE A 1 208 ? -44.732 -1.628  -7.501  1.00 35.50  ? 196 ILE A CA    1 
ATOM   1483 C  C     . ILE A 1 208 ? -45.817 -2.672  -7.269  1.00 36.78  ? 196 ILE A C     1 
ATOM   1484 O  O     . ILE A 1 208 ? -46.878 -2.389  -6.692  1.00 38.02  ? 196 ILE A O     1 
ATOM   1485 C  CB    . ILE A 1 208 ? -45.324 -0.275  -7.943  1.00 33.93  ? 196 ILE A CB    1 
ATOM   1486 C  CG1   . ILE A 1 208 ? -46.085 -0.413  -9.265  1.00 35.50  ? 196 ILE A CG1   1 
ATOM   1487 C  CG2   . ILE A 1 208 ? -44.234 0.748   -7.993  1.00 32.20  ? 196 ILE A CG2   1 
ATOM   1488 C  CD1   . ILE A 1 208 ? -46.894 0.853   -9.633  1.00 34.34  ? 196 ILE A CD1   1 
ATOM   1489 N  N     . GLY A 1 209 ? -45.533 -3.893  -7.712  1.00 39.19  ? 197 GLY A N     1 
ATOM   1490 C  CA    . GLY A 1 209 ? -46.275 -5.087  -7.299  1.00 40.14  ? 197 GLY A CA    1 
ATOM   1491 C  C     . GLY A 1 209 ? -47.156 -5.684  -8.370  1.00 41.70  ? 197 GLY A C     1 
ATOM   1492 O  O     . GLY A 1 209 ? -47.960 -6.561  -8.058  1.00 41.24  ? 197 GLY A O     1 
ATOM   1493 N  N     . HIS A 1 210 ? -47.003 -5.250  -9.632  1.00 40.81  ? 198 HIS A N     1 
ATOM   1494 C  CA    . HIS A 1 210 ? -47.619 -6.001  -10.755 1.00 42.23  ? 198 HIS A CA    1 
ATOM   1495 C  C     . HIS A 1 210 ? -47.151 -7.455  -10.809 1.00 43.77  ? 198 HIS A C     1 
ATOM   1496 O  O     . HIS A 1 210 ? -46.005 -7.748  -10.538 1.00 41.71  ? 198 HIS A O     1 
ATOM   1497 C  CB    . HIS A 1 210 ? -47.298 -5.372  -12.107 1.00 41.52  ? 198 HIS A CB    1 
ATOM   1498 C  CG    . HIS A 1 210 ? -47.637 -3.920  -12.182 1.00 41.92  ? 198 HIS A CG    1 
ATOM   1499 N  ND1   . HIS A 1 210 ? -46.678 -2.936  -12.089 1.00 44.20  ? 198 HIS A ND1   1 
ATOM   1500 C  CD2   . HIS A 1 210 ? -48.820 -3.284  -12.346 1.00 42.68  ? 198 HIS A CD2   1 
ATOM   1501 C  CE1   . HIS A 1 210 ? -47.264 -1.752  -12.207 1.00 45.45  ? 198 HIS A CE1   1 
ATOM   1502 N  NE2   . HIS A 1 210 ? -48.564 -1.938  -12.353 1.00 44.83  ? 198 HIS A NE2   1 
ATOM   1503 N  N     . PRO A 1 211 ? -48.040 -8.386  -11.173 1.00 45.54  ? 199 PRO A N     1 
ATOM   1504 C  CA    . PRO A 1 211 ? -47.582 -9.766  -11.319 1.00 47.82  ? 199 PRO A CA    1 
ATOM   1505 C  C     . PRO A 1 211 ? -46.420 -9.826  -12.310 1.00 49.54  ? 199 PRO A C     1 
ATOM   1506 O  O     . PRO A 1 211 ? -46.468 -9.182  -13.395 1.00 48.83  ? 199 PRO A O     1 
ATOM   1507 C  CB    . PRO A 1 211 ? -48.796 -10.487 -11.903 1.00 49.85  ? 199 PRO A CB    1 
ATOM   1508 C  CG    . PRO A 1 211 ? -49.967 -9.619  -11.577 1.00 48.63  ? 199 PRO A CG    1 
ATOM   1509 C  CD    . PRO A 1 211 ? -49.471 -8.218  -11.461 1.00 46.89  ? 199 PRO A CD    1 
ATOM   1510 N  N     . VAL A 1 212 ? -45.407 -10.611 -11.998 1.00 52.30  ? 200 VAL A N     1 
ATOM   1511 C  CA    . VAL A 1 212 ? -44.235 -10.655 -12.864 1.00 54.96  ? 200 VAL A CA    1 
ATOM   1512 C  C     . VAL A 1 212 ? -44.563 -11.134 -14.312 1.00 57.82  ? 200 VAL A C     1 
ATOM   1513 O  O     . VAL A 1 212 ? -44.030 -10.591 -15.274 1.00 56.89  ? 200 VAL A O     1 
ATOM   1514 C  CB    . VAL A 1 212 ? -43.074 -11.449 -12.229 1.00 56.04  ? 200 VAL A CB    1 
ATOM   1515 C  CG1   . VAL A 1 212 ? -41.878 -11.496 -13.204 1.00 57.45  ? 200 VAL A CG1   1 
ATOM   1516 C  CG2   . VAL A 1 212 ? -42.669 -10.801 -10.896 1.00 54.52  ? 200 VAL A CG2   1 
ATOM   1517 N  N     . HIS A 1 213 ? -45.476 -12.095 -14.440 1.00 60.93  ? 201 HIS A N     1 
ATOM   1518 C  CA    . HIS A 1 213 ? -45.990 -12.578 -15.732 1.00 64.01  ? 201 HIS A CA    1 
ATOM   1519 C  C     . HIS A 1 213 ? -46.512 -11.429 -16.605 1.00 62.35  ? 201 HIS A C     1 
ATOM   1520 O  O     . HIS A 1 213 ? -46.325 -11.437 -17.819 1.00 62.87  ? 201 HIS A O     1 
ATOM   1521 C  CB    . HIS A 1 213 ? -47.101 -13.636 -15.492 1.00 66.67  ? 201 HIS A CB    1 
ATOM   1522 C  CG    . HIS A 1 213 ? -47.682 -14.233 -16.751 1.00 74.24  ? 201 HIS A CG    1 
ATOM   1523 N  ND1   . HIS A 1 213 ? -48.614 -13.576 -17.537 1.00 78.28  ? 201 HIS A ND1   1 
ATOM   1524 C  CD2   . HIS A 1 213 ? -47.496 -15.449 -17.337 1.00 81.06  ? 201 HIS A CD2   1 
ATOM   1525 C  CE1   . HIS A 1 213 ? -48.954 -14.348 -18.562 1.00 81.90  ? 201 HIS A CE1   1 
ATOM   1526 N  NE2   . HIS A 1 213 ? -48.293 -15.490 -18.464 1.00 82.74  ? 201 HIS A NE2   1 
ATOM   1527 N  N     . LEU A 1 214 ? -47.155 -10.429 -16.013 1.00 60.64  ? 202 LEU A N     1 
ATOM   1528 C  CA    . LEU A 1 214 ? -47.607 -9.301  -16.828 1.00 59.37  ? 202 LEU A CA    1 
ATOM   1529 C  C     . LEU A 1 214 ? -46.457 -8.393  -17.281 1.00 58.67  ? 202 LEU A C     1 
ATOM   1530 O  O     . LEU A 1 214 ? -46.446 -7.940  -18.423 1.00 59.09  ? 202 LEU A O     1 
ATOM   1531 C  CB    . LEU A 1 214 ? -48.690 -8.492  -16.128 1.00 57.98  ? 202 LEU A CB    1 
ATOM   1532 C  CG    . LEU A 1 214 ? -50.061 -9.128  -15.916 1.00 58.88  ? 202 LEU A CG    1 
ATOM   1533 C  CD1   . LEU A 1 214 ? -50.943 -8.067  -15.257 1.00 56.74  ? 202 LEU A CD1   1 
ATOM   1534 C  CD2   . LEU A 1 214 ? -50.719 -9.664  -17.249 1.00 61.34  ? 202 LEU A CD2   1 
ATOM   1535 N  N     . ILE A 1 215 ? -45.518 -8.116  -16.381 1.00 58.39  ? 203 ILE A N     1 
ATOM   1536 C  CA    . ILE A 1 215 ? -44.364 -7.270  -16.667 1.00 57.83  ? 203 ILE A CA    1 
ATOM   1537 C  C     . ILE A 1 215 ? -43.558 -7.898  -17.797 1.00 60.65  ? 203 ILE A C     1 
ATOM   1538 O  O     . ILE A 1 215 ? -43.041 -7.208  -18.677 1.00 59.78  ? 203 ILE A O     1 
ATOM   1539 C  CB    . ILE A 1 215 ? -43.467 -7.108  -15.406 1.00 56.82  ? 203 ILE A CB    1 
ATOM   1540 C  CG1   . ILE A 1 215 ? -44.197 -6.339  -14.281 1.00 54.93  ? 203 ILE A CG1   1 
ATOM   1541 C  CG2   . ILE A 1 215 ? -42.157 -6.416  -15.736 1.00 56.60  ? 203 ILE A CG2   1 
ATOM   1542 C  CD1   . ILE A 1 215 ? -44.724 -4.961  -14.648 1.00 53.50  ? 203 ILE A CD1   1 
ATOM   1543 N  N     . ASN A 1 216 ? -43.486 -9.225  -17.789 1.00 64.29  ? 204 ASN A N     1 
ATOM   1544 C  CA    . ASN A 1 216 ? -42.686 -9.954  -18.776 1.00 67.09  ? 204 ASN A CA    1 
ATOM   1545 C  C     . ASN A 1 216 ? -43.341 -10.127 -20.126 1.00 68.76  ? 204 ASN A C     1 
ATOM   1546 O  O     . ASN A 1 216 ? -42.705 -10.627 -21.047 1.00 70.60  ? 204 ASN A O     1 
ATOM   1547 C  CB    . ASN A 1 216 ? -42.280 -11.317 -18.223 1.00 68.88  ? 204 ASN A CB    1 
ATOM   1548 C  CG    . ASN A 1 216 ? -41.140 -11.204 -17.264 1.00 70.12  ? 204 ASN A CG    1 
ATOM   1549 O  OD1   . ASN A 1 216 ? -41.114 -11.850 -16.226 1.00 73.56  ? 204 ASN A OD1   1 
ATOM   1550 N  ND2   . ASN A 1 216 ? -40.184 -10.343 -17.598 1.00 72.04  ? 204 ASN A ND2   1 
ATOM   1551 N  N     . SER A 1 217 ? -44.606 -9.741  -20.248 1.00 69.30  ? 205 SER A N     1 
ATOM   1552 C  CA    . SER A 1 217 ? -45.338 -9.965  -21.478 1.00 70.92  ? 205 SER A CA    1 
ATOM   1553 C  C     . SER A 1 217 ? -45.097 -8.828  -22.459 1.00 70.28  ? 205 SER A C     1 
ATOM   1554 O  O     . SER A 1 217 ? -45.389 -8.985  -23.616 1.00 71.63  ? 205 SER A O     1 
ATOM   1555 C  CB    . SER A 1 217 ? -46.831 -10.096 -21.199 1.00 71.43  ? 205 SER A CB    1 
ATOM   1556 O  OG    . SER A 1 217 ? -47.340 -8.875  -20.691 1.00 70.06  ? 205 SER A OG    1 
ATOM   1557 N  N     . ILE A 1 218 ? -44.577 -7.693  -21.997 1.00 68.94  ? 206 ILE A N     1 
ATOM   1558 C  CA    . ILE A 1 218 ? -44.312 -6.537  -22.872 1.00 68.38  ? 206 ILE A CA    1 
ATOM   1559 C  C     . ILE A 1 218 ? -43.439 -6.907  -24.091 1.00 68.95  ? 206 ILE A C     1 
ATOM   1560 O  O     . ILE A 1 218 ? -42.414 -7.572  -23.930 1.00 70.47  ? 206 ILE A O     1 
ATOM   1561 C  CB    . ILE A 1 218 ? -43.619 -5.399  -22.083 1.00 66.95  ? 206 ILE A CB    1 
ATOM   1562 C  CG1   . ILE A 1 218 ? -44.618 -4.278  -21.710 1.00 66.17  ? 206 ILE A CG1   1 
ATOM   1563 C  CG2   . ILE A 1 218 ? -42.473 -4.815  -22.897 1.00 67.85  ? 206 ILE A CG2   1 
ATOM   1564 C  CD1   . ILE A 1 218 ? -45.172 -4.379  -20.341 1.00 64.70  ? 206 ILE A CD1   1 
ATOM   1565 N  N     . ASN A 1 219 ? -43.844 -6.503  -25.286 1.00 68.22  ? 207 ASN A N     1 
ATOM   1566 C  CA    . ASN A 1 219 ? -43.180 -6.935  -26.512 1.00 68.80  ? 207 ASN A CA    1 
ATOM   1567 C  C     . ASN A 1 219 ? -42.089 -6.027  -27.056 1.00 65.96  ? 207 ASN A C     1 
ATOM   1568 O  O     . ASN A 1 219 ? -41.530 -6.301  -28.084 1.00 67.11  ? 207 ASN A O     1 
ATOM   1569 C  CB    . ASN A 1 219 ? -44.211 -7.168  -27.605 1.00 70.86  ? 207 ASN A CB    1 
ATOM   1570 C  CG    . ASN A 1 219 ? -44.017 -8.484  -28.337 1.00 76.70  ? 207 ASN A CG    1 
ATOM   1571 O  OD1   . ASN A 1 219 ? -42.949 -9.093  -28.303 1.00 80.91  ? 207 ASN A OD1   1 
ATOM   1572 N  ND2   . ASN A 1 219 ? -45.068 -8.932  -29.008 1.00 79.88  ? 207 ASN A ND2   1 
ATOM   1573 N  N     . ARG A 1 220 ? -41.780 -4.950  -26.372 1.00 62.02  ? 208 ARG A N     1 
ATOM   1574 C  CA    . ARG A 1 220 ? -40.746 -4.063  -26.837 1.00 59.98  ? 208 ARG A CA    1 
ATOM   1575 C  C     . ARG A 1 220 ? -39.767 -3.839  -25.699 1.00 58.74  ? 208 ARG A C     1 
ATOM   1576 O  O     . ARG A 1 220 ? -40.138 -3.299  -24.677 1.00 59.19  ? 208 ARG A O     1 
ATOM   1577 C  CB    . ARG A 1 220 ? -41.360 -2.757  -27.292 1.00 58.00  ? 208 ARG A CB    1 
ATOM   1578 C  CG    . ARG A 1 220 ? -42.208 -2.882  -28.509 1.00 57.94  ? 208 ARG A CG    1 
ATOM   1579 C  CD    . ARG A 1 220 ? -42.631 -1.551  -29.023 1.00 56.27  ? 208 ARG A CD    1 
ATOM   1580 N  NE    . ARG A 1 220 ? -43.448 -1.644  -30.216 1.00 56.96  ? 208 ARG A NE    1 
ATOM   1581 C  CZ    . ARG A 1 220 ? -44.725 -1.315  -30.262 1.00 56.01  ? 208 ARG A CZ    1 
ATOM   1582 N  NH1   . ARG A 1 220 ? -45.401 -1.423  -31.387 1.00 54.64  ? 208 ARG A NH1   1 
ATOM   1583 N  NH2   . ARG A 1 220 ? -45.316 -0.860  -29.182 1.00 52.18  ? 208 ARG A NH2   1 
ATOM   1584 N  N     . TYR A 1 221 ? -38.531 -4.276  -25.861 1.00 57.09  ? 209 TYR A N     1 
ATOM   1585 C  CA    . TYR A 1 221 ? -37.578 -4.237  -24.772 1.00 55.06  ? 209 TYR A CA    1 
ATOM   1586 C  C     . TYR A 1 221 ? -36.305 -3.510  -25.069 1.00 51.56  ? 209 TYR A C     1 
ATOM   1587 O  O     . TYR A 1 221 ? -35.966 -3.299  -26.187 1.00 48.61  ? 209 TYR A O     1 
ATOM   1588 C  CB    . TYR A 1 221 ? -37.098 -5.620  -24.358 1.00 57.71  ? 209 TYR A CB    1 
ATOM   1589 C  CG    . TYR A 1 221 ? -37.876 -6.832  -24.745 1.00 63.24  ? 209 TYR A CG    1 
ATOM   1590 C  CD1   . TYR A 1 221 ? -38.624 -7.492  -23.811 1.00 69.17  ? 209 TYR A CD1   1 
ATOM   1591 C  CD2   . TYR A 1 221 ? -37.785 -7.374  -25.990 1.00 68.24  ? 209 TYR A CD2   1 
ATOM   1592 C  CE1   . TYR A 1 221 ? -39.303 -8.618  -24.118 1.00 73.60  ? 209 TYR A CE1   1 
ATOM   1593 C  CE2   . TYR A 1 221 ? -38.462 -8.493  -26.313 1.00 73.73  ? 209 TYR A CE2   1 
ATOM   1594 C  CZ    . TYR A 1 221 ? -39.228 -9.121  -25.366 1.00 76.27  ? 209 TYR A CZ    1 
ATOM   1595 O  OH    . TYR A 1 221 ? -39.945 -10.267 -25.635 1.00 80.69  ? 209 TYR A OH    1 
ATOM   1596 N  N     . VAL A 1 222 ? -35.591 -3.202  -24.009 1.00 44.54  ? 210 VAL A N     1 
ATOM   1597 C  CA    . VAL A 1 222 ? -34.270 -2.659  -24.070 1.00 42.55  ? 210 VAL A CA    1 
ATOM   1598 C  C     . VAL A 1 222 ? -33.292 -3.802  -24.060 1.00 41.35  ? 210 VAL A C     1 
ATOM   1599 O  O     . VAL A 1 222 ? -33.436 -4.708  -23.301 1.00 41.16  ? 210 VAL A O     1 
ATOM   1600 C  CB    . VAL A 1 222 ? -34.010 -1.781  -22.875 1.00 43.89  ? 210 VAL A CB    1 
ATOM   1601 C  CG1   . VAL A 1 222 ? -32.646 -1.252  -22.903 1.00 41.19  ? 210 VAL A CG1   1 
ATOM   1602 C  CG2   . VAL A 1 222 ? -34.984 -0.668  -22.829 1.00 43.93  ? 210 VAL A CG2   1 
ATOM   1603 N  N     . ILE A 1 223 ? -32.301 -3.759  -24.927 1.00 38.91  ? 211 ILE A N     1 
ATOM   1604 C  CA    . ILE A 1 223 ? -31.290 -4.783  -24.973 1.00 37.86  ? 211 ILE A CA    1 
ATOM   1605 C  C     . ILE A 1 223 ? -30.375 -4.653  -23.773 1.00 39.10  ? 211 ILE A C     1 
ATOM   1606 O  O     . ILE A 1 223 ? -29.794 -3.629  -23.560 1.00 38.21  ? 211 ILE A O     1 
ATOM   1607 C  CB    . ILE A 1 223 ? -30.483 -4.686  -26.231 1.00 36.59  ? 211 ILE A CB    1 
ATOM   1608 C  CG1   . ILE A 1 223 ? -31.389 -4.832  -27.433 1.00 37.98  ? 211 ILE A CG1   1 
ATOM   1609 C  CG2   . ILE A 1 223 ? -29.432 -5.719  -26.246 1.00 35.32  ? 211 ILE A CG2   1 
ATOM   1610 C  CD1   . ILE A 1 223 ? -30.741 -4.511  -28.713 1.00 36.33  ? 211 ILE A CD1   1 
ATOM   1611 N  N     . THR A 1 224 ? -30.278 -5.699  -22.977 1.00 37.94  ? 212 THR A N     1 
ATOM   1612 C  CA    . THR A 1 224 ? -29.456 -5.636  -21.779 1.00 38.98  ? 212 THR A CA    1 
ATOM   1613 C  C     . THR A 1 224 ? -28.275 -6.556  -21.862 1.00 39.80  ? 212 THR A C     1 
ATOM   1614 O  O     . THR A 1 224 ? -28.204 -7.476  -22.699 1.00 39.01  ? 212 THR A O     1 
ATOM   1615 C  CB    . THR A 1 224 ? -30.224 -6.055  -20.497 1.00 39.36  ? 212 THR A CB    1 
ATOM   1616 O  OG1   . THR A 1 224 ? -30.555 -7.422  -20.662 1.00 38.44  ? 212 THR A OG1   1 
ATOM   1617 C  CG2   . THR A 1 224 ? -31.513 -5.270  -20.353 1.00 38.53  ? 212 THR A CG2   1 
ATOM   1618 N  N     . ARG A 1 225 ? -27.366 -6.311  -20.929 1.00 40.84  ? 213 ARG A N     1 
ATOM   1619 C  CA    . ARG A 1 225 ? -26.150 -7.032  -20.848 1.00 42.70  ? 213 ARG A CA    1 
ATOM   1620 C  C     . ARG A 1 225 ? -26.456 -8.525  -20.678 1.00 42.01  ? 213 ARG A C     1 
ATOM   1621 O  O     . ARG A 1 225 ? -25.795 -9.354  -21.298 1.00 39.65  ? 213 ARG A O     1 
ATOM   1622 C  CB    . ARG A 1 225 ? -25.347 -6.488  -19.674 1.00 44.63  ? 213 ARG A CB    1 
ATOM   1623 C  CG    . ARG A 1 225 ? -24.079 -7.246  -19.393 1.00 51.03  ? 213 ARG A CG    1 
ATOM   1624 C  CD    . ARG A 1 225 ? -23.567 -6.992  -17.960 1.00 58.44  ? 213 ARG A CD    1 
ATOM   1625 N  NE    . ARG A 1 225 ? -22.132 -6.732  -18.000 1.00 63.51  ? 213 ARG A NE    1 
ATOM   1626 C  CZ    . ARG A 1 225 ? -21.570 -5.577  -18.362 1.00 67.35  ? 213 ARG A CZ    1 
ATOM   1627 N  NH1   . ARG A 1 225 ? -22.314 -4.518  -18.710 1.00 70.53  ? 213 ARG A NH1   1 
ATOM   1628 N  NH2   . ARG A 1 225 ? -20.245 -5.473  -18.364 1.00 68.84  ? 213 ARG A NH2   1 
ATOM   1629 N  N     . GLU A 1 226 ? -27.480 -8.860  -19.892 1.00 42.00  ? 214 GLU A N     1 
ATOM   1630 C  CA    . GLU A 1 226 ? -27.783 -10.254 -19.601 1.00 43.68  ? 214 GLU A CA    1 
ATOM   1631 C  C     . GLU A 1 226 ? -28.326 -10.928 -20.858 1.00 41.78  ? 214 GLU A C     1 
ATOM   1632 O  O     . GLU A 1 226 ? -28.001 -12.067 -21.181 1.00 40.05  ? 214 GLU A O     1 
ATOM   1633 C  CB    . GLU A 1 226 ? -28.814 -10.415 -18.470 1.00 46.20  ? 214 GLU A CB    1 
ATOM   1634 C  CG    . GLU A 1 226 ? -28.643 -9.427  -17.273 1.00 53.90  ? 214 GLU A CG    1 
ATOM   1635 C  CD    . GLU A 1 226 ? -29.171 -7.963  -17.562 1.00 60.11  ? 214 GLU A CD    1 
ATOM   1636 O  OE1   . GLU A 1 226 ? -28.336 -7.001  -17.535 1.00 57.47  ? 214 GLU A OE1   1 
ATOM   1637 O  OE2   . GLU A 1 226 ? -30.415 -7.792  -17.822 1.00 67.38  ? 214 GLU A OE2   1 
ATOM   1638 N  N     . MET A 1 227 ? -29.169 -10.218 -21.582 1.00 41.02  ? 215 MET A N     1 
ATOM   1639 C  CA    . MET A 1 227 ? -29.701 -10.759 -22.826 1.00 40.68  ? 215 MET A CA    1 
ATOM   1640 C  C     . MET A 1 227 ? -28.563 -11.027 -23.835 1.00 38.89  ? 215 MET A C     1 
ATOM   1641 O  O     . MET A 1 227 ? -28.534 -12.057 -24.487 1.00 37.26  ? 215 MET A O     1 
ATOM   1642 C  CB    . MET A 1 227 ? -30.729 -9.777  -23.395 1.00 40.98  ? 215 MET A CB    1 
ATOM   1643 C  CG    . MET A 1 227 ? -31.313 -10.152 -24.716 1.00 43.94  ? 215 MET A CG    1 
ATOM   1644 S  SD    . MET A 1 227 ? -32.328 -8.770  -25.398 1.00 49.57  ? 215 MET A SD    1 
ATOM   1645 C  CE    . MET A 1 227 ? -33.084 -8.230  -23.761 1.00 40.20  ? 215 MET A CE    1 
ATOM   1646 N  N     . VAL A 1 228 ? -27.619 -10.115 -23.940 1.00 38.36  ? 216 VAL A N     1 
ATOM   1647 C  CA    . VAL A 1 228 ? -26.530 -10.275 -24.908 1.00 39.05  ? 216 VAL A CA    1 
ATOM   1648 C  C     . VAL A 1 228 ? -25.615 -11.399 -24.457 1.00 40.72  ? 216 VAL A C     1 
ATOM   1649 O  O     . VAL A 1 228 ? -25.201 -12.199 -25.284 1.00 39.75  ? 216 VAL A O     1 
ATOM   1650 C  CB    . VAL A 1 228 ? -25.780 -8.933  -25.150 1.00 38.73  ? 216 VAL A CB    1 
ATOM   1651 C  CG1   . VAL A 1 228 ? -24.489 -9.140  -25.934 1.00 37.09  ? 216 VAL A CG1   1 
ATOM   1652 C  CG2   . VAL A 1 228 ? -26.706 -7.983  -25.930 1.00 36.49  ? 216 VAL A CG2   1 
ATOM   1653 N  N     . ARG A 1 229 ? -25.353 -11.493 -23.145 1.00 42.24  ? 217 ARG A N     1 
ATOM   1654 C  CA    . ARG A 1 229 ? -24.497 -12.574 -22.611 1.00 44.38  ? 217 ARG A CA    1 
ATOM   1655 C  C     . ARG A 1 229 ? -25.077 -13.955 -22.910 1.00 44.24  ? 217 ARG A C     1 
ATOM   1656 O  O     . ARG A 1 229 ? -24.352 -14.854 -23.305 1.00 43.71  ? 217 ARG A O     1 
ATOM   1657 C  CB    . ARG A 1 229 ? -24.236 -12.444 -21.083 1.00 45.56  ? 217 ARG A CB    1 
ATOM   1658 C  CG    . ARG A 1 229 ? -23.271 -13.526 -20.507 1.00 51.41  ? 217 ARG A CG    1 
ATOM   1659 C  CD    . ARG A 1 229 ? -22.948 -13.372 -18.962 1.00 59.41  ? 217 ARG A CD    1 
ATOM   1660 N  NE    . ARG A 1 229 ? -24.153 -13.236 -18.116 1.00 67.06  ? 217 ARG A NE    1 
ATOM   1661 C  CZ    . ARG A 1 229 ? -24.752 -12.076 -17.763 1.00 72.92  ? 217 ARG A CZ    1 
ATOM   1662 N  NH1   . ARG A 1 229 ? -25.860 -12.098 -17.003 1.00 73.80  ? 217 ARG A NH1   1 
ATOM   1663 N  NH2   . ARG A 1 229 ? -24.281 -10.883 -18.171 1.00 74.00  ? 217 ARG A NH2   1 
ATOM   1664 N  N     . SER A 1 230 ? -26.378 -14.130 -22.740 1.00 43.84  ? 218 SER A N     1 
ATOM   1665 C  CA    . SER A 1 230 ? -26.945 -15.440 -23.019 1.00 44.91  ? 218 SER A CA    1 
ATOM   1666 C  C     . SER A 1 230 ? -27.049 -15.761 -24.514 1.00 44.45  ? 218 SER A C     1 
ATOM   1667 O  O     . SER A 1 230 ? -27.191 -16.928 -24.846 1.00 44.83  ? 218 SER A O     1 
ATOM   1668 C  CB    . SER A 1 230 ? -28.341 -15.572 -22.397 1.00 45.24  ? 218 SER A CB    1 
ATOM   1669 O  OG    . SER A 1 230 ? -29.181 -14.740 -23.122 1.00 49.16  ? 218 SER A OG    1 
ATOM   1670 N  N     . LEU A 1 231 ? -26.961 -14.762 -25.384 1.00 42.53  ? 219 LEU A N     1 
ATOM   1671 C  CA    . LEU A 1 231 ? -26.975 -14.958 -26.824 1.00 41.80  ? 219 LEU A CA    1 
ATOM   1672 C  C     . LEU A 1 231 ? -25.613 -15.220 -27.446 1.00 41.49  ? 219 LEU A C     1 
ATOM   1673 O  O     . LEU A 1 231 ? -25.525 -15.745 -28.509 1.00 41.74  ? 219 LEU A O     1 
ATOM   1674 C  CB    . LEU A 1 231 ? -27.613 -13.763 -27.532 1.00 40.68  ? 219 LEU A CB    1 
ATOM   1675 C  CG    . LEU A 1 231 ? -29.106 -13.518 -27.338 1.00 40.26  ? 219 LEU A CG    1 
ATOM   1676 C  CD1   . LEU A 1 231 ? -29.578 -12.262 -27.970 1.00 38.10  ? 219 LEU A CD1   1 
ATOM   1677 C  CD2   . LEU A 1 231 ? -29.890 -14.645 -27.802 1.00 37.09  ? 219 LEU A CD2   1 
ATOM   1678 N  N     . LEU A 1 232 ? -24.555 -14.834 -26.782 1.00 41.51  ? 220 LEU A N     1 
ATOM   1679 C  CA    . LEU A 1 232 ? -23.225 -15.020 -27.312 1.00 41.94  ? 220 LEU A CA    1 
ATOM   1680 C  C     . LEU A 1 232 ? -22.976 -16.471 -27.633 1.00 42.15  ? 220 LEU A C     1 
ATOM   1681 O  O     . LEU A 1 232 ? -23.193 -17.309 -26.825 1.00 42.10  ? 220 LEU A O     1 
ATOM   1682 C  CB    . LEU A 1 232 ? -22.222 -14.590 -26.283 1.00 42.04  ? 220 LEU A CB    1 
ATOM   1683 C  CG    . LEU A 1 232 ? -21.612 -13.224 -26.342 1.00 45.70  ? 220 LEU A CG    1 
ATOM   1684 C  CD1   . LEU A 1 232 ? -20.512 -13.199 -25.368 1.00 45.45  ? 220 LEU A CD1   1 
ATOM   1685 C  CD2   . LEU A 1 232 ? -21.118 -12.943 -27.692 1.00 45.45  ? 220 LEU A CD2   1 
ATOM   1686 N  N     . PRO A 1 233 ? -22.498 -16.773 -28.809 1.00 41.63  ? 221 PRO A N     1 
ATOM   1687 C  CA    . PRO A 1 233 ? -22.304 -18.167 -29.156 1.00 42.05  ? 221 PRO A CA    1 
ATOM   1688 C  C     . PRO A 1 233 ? -21.205 -18.851 -28.353 1.00 41.89  ? 221 PRO A C     1 
ATOM   1689 O  O     . PRO A 1 233 ? -20.362 -18.238 -27.773 1.00 39.61  ? 221 PRO A O     1 
ATOM   1690 C  CB    . PRO A 1 233 ? -21.944 -18.111 -30.630 1.00 42.07  ? 221 PRO A CB    1 
ATOM   1691 C  CG    . PRO A 1 233 ? -21.623 -16.745 -30.910 1.00 40.95  ? 221 PRO A CG    1 
ATOM   1692 C  CD    . PRO A 1 233 ? -22.369 -15.914 -29.979 1.00 42.04  ? 221 PRO A CD    1 
ATOM   1693 N  N     . GLU A 1 234 ? -21.270 -20.159 -28.322 1.00 43.76  ? 222 GLU A N     1 
ATOM   1694 C  CA    . GLU A 1 234 ? -20.341 -20.974 -27.588 1.00 44.99  ? 222 GLU A CA    1 
ATOM   1695 C  C     . GLU A 1 234 ? -19.058 -21.130 -28.364 1.00 43.13  ? 222 GLU A C     1 
ATOM   1696 O  O     . GLU A 1 234 ? -19.059 -21.093 -29.556 1.00 44.03  ? 222 GLU A O     1 
ATOM   1697 C  CB    . GLU A 1 234 ? -20.973 -22.337 -27.316 1.00 47.28  ? 222 GLU A CB    1 
ATOM   1698 C  CG    . GLU A 1 234 ? -22.131 -22.271 -26.353 1.00 52.99  ? 222 GLU A CG    1 
ATOM   1699 C  CD    . GLU A 1 234 ? -22.670 -23.630 -25.964 1.00 62.08  ? 222 GLU A CD    1 
ATOM   1700 O  OE1   . GLU A 1 234 ? -21.872 -24.480 -25.540 1.00 64.70  ? 222 GLU A OE1   1 
ATOM   1701 O  OE2   . GLU A 1 234 ? -23.888 -23.844 -26.079 1.00 67.67  ? 222 GLU A OE2   1 
ATOM   1702 N  N     . ARG A 1 235 ? -17.961 -21.287 -27.656 1.00 41.28  ? 223 ARG A N     1 
ATOM   1703 C  CA    . ARG A 1 235 ? -16.690 -21.600 -28.259 1.00 39.65  ? 223 ARG A CA    1 
ATOM   1704 C  C     . ARG A 1 235 ? -16.188 -22.966 -27.771 1.00 39.31  ? 223 ARG A C     1 
ATOM   1705 O  O     . ARG A 1 235 ? -15.378 -23.031 -26.896 1.00 37.71  ? 223 ARG A O     1 
ATOM   1706 C  CB    . ARG A 1 235 ? -15.655 -20.517 -27.931 1.00 39.00  ? 223 ARG A CB    1 
ATOM   1707 C  CG    . ARG A 1 235 ? -16.103 -19.097 -28.113 1.00 37.79  ? 223 ARG A CG    1 
ATOM   1708 C  CD    . ARG A 1 235 ? -16.097 -18.700 -29.530 1.00 36.10  ? 223 ARG A CD    1 
ATOM   1709 N  NE    . ARG A 1 235 ? -14.791 -18.757 -30.148 1.00 31.82  ? 223 ARG A NE    1 
ATOM   1710 C  CZ    . ARG A 1 235 ? -14.523 -18.291 -31.350 1.00 31.18  ? 223 ARG A CZ    1 
ATOM   1711 N  NH1   . ARG A 1 235 ? -15.461 -17.726 -32.057 1.00 30.30  ? 223 ARG A NH1   1 
ATOM   1712 N  NH2   . ARG A 1 235 ? -13.324 -18.375 -31.839 1.00 31.48  ? 223 ARG A NH2   1 
ATOM   1713 N  N     . PRO A 1 236 ? -16.670 -24.046 -28.350 1.00 38.68  ? 224 PRO A N     1 
ATOM   1714 C  CA    . PRO A 1 236 ? -16.218 -25.375 -27.915 1.00 40.45  ? 224 PRO A CA    1 
ATOM   1715 C  C     . PRO A 1 236 ? -14.747 -25.524 -28.241 1.00 39.13  ? 224 PRO A C     1 
ATOM   1716 O  O     . PRO A 1 236 ? -14.292 -25.046 -29.290 1.00 35.29  ? 224 PRO A O     1 
ATOM   1717 C  CB    . PRO A 1 236 ? -17.018 -26.354 -28.784 1.00 40.62  ? 224 PRO A CB    1 
ATOM   1718 C  CG    . PRO A 1 236 ? -17.473 -25.574 -29.916 1.00 41.10  ? 224 PRO A CG    1 
ATOM   1719 C  CD    . PRO A 1 236 ? -17.596 -24.142 -29.482 1.00 40.11  ? 224 PRO A CD    1 
ATOM   1720 N  N     . ARG A 1 237 ? -14.028 -26.168 -27.335 1.00 38.80  ? 225 ARG A N     1 
ATOM   1721 C  CA    . ARG A 1 237 ? -12.597 -26.243 -27.470 1.00 39.77  ? 225 ARG A CA    1 
ATOM   1722 C  C     . ARG A 1 237 ? -12.145 -27.042 -28.664 1.00 39.11  ? 225 ARG A C     1 
ATOM   1723 O  O     . ARG A 1 237 ? -11.162 -26.663 -29.312 1.00 38.23  ? 225 ARG A O     1 
ATOM   1724 C  CB    . ARG A 1 237 ? -11.975 -26.766 -26.214 1.00 40.81  ? 225 ARG A CB    1 
ATOM   1725 C  CG    . ARG A 1 237 ? -12.055 -25.748 -25.117 1.00 45.82  ? 225 ARG A CG    1 
ATOM   1726 C  CD    . ARG A 1 237 ? -11.020 -26.061 -24.055 1.00 51.66  ? 225 ARG A CD    1 
ATOM   1727 N  NE    . ARG A 1 237 ? -11.406 -27.216 -23.266 1.00 53.48  ? 225 ARG A NE    1 
ATOM   1728 C  CZ    . ARG A 1 237 ? -10.552 -28.022 -22.639 1.00 53.67  ? 225 ARG A CZ    1 
ATOM   1729 N  NH1   . ARG A 1 237 ? -9.249  -27.844 -22.733 1.00 55.88  ? 225 ARG A NH1   1 
ATOM   1730 N  NH2   . ARG A 1 237 ? -11.018 -29.030 -21.945 1.00 53.41  ? 225 ARG A NH2   1 
ATOM   1731 N  N     . ASP A 1 238 ? -12.896 -28.084 -29.005 1.00 38.53  ? 226 ASP A N     1 
ATOM   1732 C  CA    . ASP A 1 238 ? -12.551 -28.876 -30.182 1.00 39.19  ? 226 ASP A CA    1 
ATOM   1733 C  C     . ASP A 1 238 ? -13.193 -28.261 -31.401 1.00 38.64  ? 226 ASP A C     1 
ATOM   1734 O  O     . ASP A 1 238 ? -14.246 -28.700 -31.825 1.00 39.54  ? 226 ASP A O     1 
ATOM   1735 C  CB    . ASP A 1 238 ? -13.039 -30.326 -30.096 1.00 39.12  ? 226 ASP A CB    1 
ATOM   1736 C  CG    . ASP A 1 238 ? -12.424 -31.189 -31.173 1.00 38.97  ? 226 ASP A CG    1 
ATOM   1737 O  OD1   . ASP A 1 238 ? -11.329 -30.885 -31.714 1.00 41.16  ? 226 ASP A OD1   1 
ATOM   1738 O  OD2   . ASP A 1 238 ? -12.974 -32.238 -31.394 1.00 45.55  ? 226 ASP A OD2   1 
ATOM   1739 N  N     . SER A 1 239 ? -12.592 -27.227 -31.936 1.00 37.86  ? 227 SER A N     1 
ATOM   1740 C  CA    . SER A 1 239 ? -13.255 -26.440 -32.995 1.00 36.80  ? 227 SER A CA    1 
ATOM   1741 C  C     . SER A 1 239 ? -12.154 -26.067 -33.992 1.00 36.76  ? 227 SER A C     1 
ATOM   1742 O  O     . SER A 1 239 ? -10.973 -26.355 -33.764 1.00 37.47  ? 227 SER A O     1 
ATOM   1743 C  CB    . SER A 1 239 ? -13.919 -25.178 -32.400 1.00 36.43  ? 227 SER A CB    1 
ATOM   1744 O  OG    . SER A 1 239 ? -12.984 -24.425 -31.605 1.00 36.14  ? 227 SER A OG    1 
ATOM   1745 N  N     . HIS A 1 240 ? -12.551 -25.497 -35.120 1.00 35.94  ? 228 HIS A N     1 
ATOM   1746 C  CA    . HIS A 1 240 ? -11.614 -25.037 -36.124 1.00 35.82  ? 228 HIS A CA    1 
ATOM   1747 C  C     . HIS A 1 240 ? -12.341 -23.895 -36.827 1.00 34.54  ? 228 HIS A C     1 
ATOM   1748 O  O     . HIS A 1 240 ? -13.505 -23.589 -36.508 1.00 33.66  ? 228 HIS A O     1 
ATOM   1749 C  CB    . HIS A 1 240 ? -11.254 -26.183 -37.093 1.00 35.97  ? 228 HIS A CB    1 
ATOM   1750 C  CG    . HIS A 1 240 ? -12.443 -26.813 -37.722 1.00 39.17  ? 228 HIS A CG    1 
ATOM   1751 N  ND1   . HIS A 1 240 ? -12.946 -26.392 -38.938 1.00 44.39  ? 228 HIS A ND1   1 
ATOM   1752 C  CD2   . HIS A 1 240 ? -13.259 -27.815 -37.300 1.00 43.29  ? 228 HIS A CD2   1 
ATOM   1753 C  CE1   . HIS A 1 240 ? -14.031 -27.095 -39.227 1.00 44.28  ? 228 HIS A CE1   1 
ATOM   1754 N  NE2   . HIS A 1 240 ? -14.239 -27.963 -38.247 1.00 43.10  ? 228 HIS A NE2   1 
ATOM   1755 N  N     . LYS A 1 241 ? -11.674 -23.247 -37.746 1.00 33.55  ? 229 LYS A N     1 
ATOM   1756 C  CA    . LYS A 1 241 ? -12.242 -22.043 -38.292 1.00 34.69  ? 229 LYS A CA    1 
ATOM   1757 C  C     . LYS A 1 241 ? -13.639 -22.243 -38.894 1.00 33.74  ? 229 LYS A C     1 
ATOM   1758 O  O     . LYS A 1 241 ? -14.505 -21.411 -38.746 1.00 32.07  ? 229 LYS A O     1 
ATOM   1759 C  CB    . LYS A 1 241 ? -11.273 -21.385 -39.259 1.00 35.73  ? 229 LYS A CB    1 
ATOM   1760 C  CG    . LYS A 1 241 ? -11.053 -22.034 -40.577 1.00 38.23  ? 229 LYS A CG    1 
ATOM   1761 C  CD    . LYS A 1 241 ? -10.412 -20.959 -41.482 1.00 42.86  ? 229 LYS A CD    1 
ATOM   1762 C  CE    . LYS A 1 241 ? -9.801  -21.555 -42.720 1.00 44.54  ? 229 LYS A CE    1 
ATOM   1763 N  NZ    . LYS A 1 241 ? -8.812  -22.603 -42.335 1.00 49.53  ? 229 LYS A NZ    1 
ATOM   1764 N  N     . GLY A 1 242 ? -13.849 -23.385 -39.514 1.00 34.85  ? 230 GLY A N     1 
ATOM   1765 C  CA    . GLY A 1 242 ? -15.147 -23.739 -40.055 1.00 36.13  ? 230 GLY A CA    1 
ATOM   1766 C  C     . GLY A 1 242 ? -16.270 -23.782 -39.032 1.00 36.12  ? 230 GLY A C     1 
ATOM   1767 O  O     . GLY A 1 242 ? -17.389 -23.429 -39.366 1.00 37.93  ? 230 GLY A O     1 
ATOM   1768 N  N     . THR A 1 243 ? -15.985 -24.195 -37.794 1.00 35.35  ? 231 THR A N     1 
ATOM   1769 C  CA    . THR A 1 243 ? -16.947 -24.064 -36.686 1.00 34.76  ? 231 THR A CA    1 
ATOM   1770 C  C     . THR A 1 243 ? -17.567 -22.661 -36.566 1.00 34.90  ? 231 THR A C     1 
ATOM   1771 O  O     . THR A 1 243 ? -18.741 -22.524 -36.198 1.00 33.95  ? 231 THR A O     1 
ATOM   1772 C  CB    . THR A 1 243 ? -16.290 -24.428 -35.353 1.00 34.87  ? 231 THR A CB    1 
ATOM   1773 O  OG1   . THR A 1 243 ? -15.516 -25.621 -35.528 1.00 36.11  ? 231 THR A OG1   1 
ATOM   1774 C  CG2   . THR A 1 243 ? -17.338 -24.657 -34.256 1.00 34.38  ? 231 THR A CG2   1 
ATOM   1775 N  N     . TYR A 1 244 ? -16.769 -21.620 -36.858 1.00 33.66  ? 232 TYR A N     1 
ATOM   1776 C  CA    . TYR A 1 244 ? -17.138 -20.263 -36.586 1.00 33.23  ? 232 TYR A CA    1 
ATOM   1777 C  C     . TYR A 1 244 ? -17.599 -19.496 -37.837 1.00 34.16  ? 232 TYR A C     1 
ATOM   1778 O  O     . TYR A 1 244 ? -17.741 -18.288 -37.796 1.00 31.97  ? 232 TYR A O     1 
ATOM   1779 C  CB    . TYR A 1 244 ? -15.963 -19.592 -35.842 1.00 33.16  ? 232 TYR A CB    1 
ATOM   1780 C  CG    . TYR A 1 244 ? -15.734 -20.323 -34.515 1.00 31.39  ? 232 TYR A CG    1 
ATOM   1781 C  CD1   . TYR A 1 244 ? -16.778 -20.457 -33.565 1.00 31.34  ? 232 TYR A CD1   1 
ATOM   1782 C  CD2   . TYR A 1 244 ? -14.520 -20.911 -34.231 1.00 30.39  ? 232 TYR A CD2   1 
ATOM   1783 C  CE1   . TYR A 1 244 ? -16.560 -21.187 -32.374 1.00 31.13  ? 232 TYR A CE1   1 
ATOM   1784 C  CE2   . TYR A 1 244 ? -14.316 -21.648 -33.080 1.00 28.61  ? 232 TYR A CE2   1 
ATOM   1785 C  CZ    . TYR A 1 244 ? -15.330 -21.752 -32.143 1.00 29.86  ? 232 TYR A CZ    1 
ATOM   1786 O  OH    . TYR A 1 244 ? -15.062 -22.444 -30.977 1.00 32.07  ? 232 TYR A OH    1 
ATOM   1787 N  N     . GLY A 1 245 ? -17.826 -20.230 -38.935 1.00 36.16  ? 233 GLY A N     1 
ATOM   1788 C  CA    . GLY A 1 245 ? -18.405 -19.682 -40.172 1.00 35.90  ? 233 GLY A CA    1 
ATOM   1789 C  C     . GLY A 1 245 ? -17.498 -18.854 -41.082 1.00 36.43  ? 233 GLY A C     1 
ATOM   1790 O  O     . GLY A 1 245 ? -16.365 -18.442 -40.721 1.00 35.33  ? 233 GLY A O     1 
ATOM   1791 N  N     . LYS A 1 246 ? -18.053 -18.579 -42.253 1.00 36.27  ? 234 LYS A N     1 
ATOM   1792 C  CA    . LYS A 1 246 ? -17.423 -17.831 -43.308 1.00 36.29  ? 234 LYS A CA    1 
ATOM   1793 C  C     . LYS A 1 246 ? -18.346 -16.733 -43.798 1.00 34.28  ? 234 LYS A C     1 
ATOM   1794 O  O     . LYS A 1 246 ? -19.548 -16.950 -43.992 1.00 32.65  ? 234 LYS A O     1 
ATOM   1795 C  CB    . LYS A 1 246 ? -17.136 -18.780 -44.468 1.00 37.82  ? 234 LYS A CB    1 
ATOM   1796 C  CG    . LYS A 1 246 ? -16.448 -20.095 -44.047 1.00 43.29  ? 234 LYS A CG    1 
ATOM   1797 C  CD    . LYS A 1 246 ? -16.218 -21.002 -45.277 1.00 48.15  ? 234 LYS A CD    1 
ATOM   1798 C  CE    . LYS A 1 246 ? -16.260 -22.484 -44.921 1.00 54.13  ? 234 LYS A CE    1 
ATOM   1799 N  NZ    . LYS A 1 246 ? -16.954 -23.281 -46.031 1.00 57.69  ? 234 LYS A NZ    1 
ATOM   1800 N  N     . VAL A 1 247 ? -17.767 -15.540 -43.969 1.00 33.85  ? 235 VAL A N     1 
ATOM   1801 C  CA    . VAL A 1 247 ? -18.450 -14.350 -44.429 1.00 32.88  ? 235 VAL A CA    1 
ATOM   1802 C  C     . VAL A 1 247 ? -17.818 -13.893 -45.749 1.00 33.21  ? 235 VAL A C     1 
ATOM   1803 O  O     . VAL A 1 247 ? -16.584 -13.928 -45.890 1.00 32.18  ? 235 VAL A O     1 
ATOM   1804 C  CB    . VAL A 1 247 ? -18.293 -13.221 -43.404 1.00 33.40  ? 235 VAL A CB    1 
ATOM   1805 C  CG1   . VAL A 1 247 ? -18.747 -11.896 -44.004 1.00 31.51  ? 235 VAL A CG1   1 
ATOM   1806 C  CG2   . VAL A 1 247 ? -18.999 -13.595 -42.060 1.00 32.95  ? 235 VAL A CG2   1 
ATOM   1807 N  N     . LEU A 1 248 ? -18.658 -13.482 -46.705 1.00 32.82  ? 236 LEU A N     1 
ATOM   1808 C  CA    . LEU A 1 248 ? -18.212 -12.757 -47.893 1.00 33.07  ? 236 LEU A CA    1 
ATOM   1809 C  C     . LEU A 1 248 ? -18.726 -11.338 -47.735 1.00 32.99  ? 236 LEU A C     1 
ATOM   1810 O  O     . LEU A 1 248 ? -19.895 -11.137 -47.432 1.00 33.74  ? 236 LEU A O     1 
ATOM   1811 C  CB    . LEU A 1 248 ? -18.759 -13.360 -49.199 1.00 33.27  ? 236 LEU A CB    1 
ATOM   1812 C  CG    . LEU A 1 248 ? -18.423 -12.616 -50.518 1.00 33.65  ? 236 LEU A CG    1 
ATOM   1813 C  CD1   . LEU A 1 248 ? -16.921 -12.697 -50.875 1.00 31.79  ? 236 LEU A CD1   1 
ATOM   1814 C  CD2   . LEU A 1 248 ? -19.237 -13.066 -51.714 1.00 29.88  ? 236 LEU A CD2   1 
ATOM   1815 N  N     . ILE A 1 249 ? -17.856 -10.370 -47.926 1.00 31.70  ? 237 ILE A N     1 
ATOM   1816 C  CA    . ILE A 1 249 ? -18.234 -8.984  -47.959 1.00 32.79  ? 237 ILE A CA    1 
ATOM   1817 C  C     . ILE A 1 249 ? -17.976 -8.433  -49.352 1.00 32.22  ? 237 ILE A C     1 
ATOM   1818 O  O     . ILE A 1 249 ? -16.848 -8.468  -49.838 1.00 34.06  ? 237 ILE A O     1 
ATOM   1819 C  CB    . ILE A 1 249 ? -17.443 -8.191  -46.910 1.00 33.65  ? 237 ILE A CB    1 
ATOM   1820 C  CG1   . ILE A 1 249 ? -17.719 -8.819  -45.532 1.00 35.17  ? 237 ILE A CG1   1 
ATOM   1821 C  CG2   . ILE A 1 249 ? -17.797 -6.712  -46.974 1.00 32.83  ? 237 ILE A CG2   1 
ATOM   1822 C  CD1   . ILE A 1 249 ? -17.184 -8.104  -44.372 1.00 39.91  ? 237 ILE A CD1   1 
ATOM   1823 N  N     . ILE A 1 250 ? -19.036 -7.952  -49.981 1.00 32.14  ? 238 ILE A N     1 
ATOM   1824 C  CA    . ILE A 1 250 ? -18.990 -7.319  -51.317 1.00 33.26  ? 238 ILE A CA    1 
ATOM   1825 C  C     . ILE A 1 250 ? -19.089 -5.828  -51.087 1.00 33.04  ? 238 ILE A C     1 
ATOM   1826 O  O     . ILE A 1 250 ? -20.133 -5.325  -50.676 1.00 33.95  ? 238 ILE A O     1 
ATOM   1827 C  CB    . ILE A 1 250 ? -20.164 -7.774  -52.221 1.00 32.71  ? 238 ILE A CB    1 
ATOM   1828 C  CG1   . ILE A 1 250 ? -20.072 -9.277  -52.508 1.00 34.28  ? 238 ILE A CG1   1 
ATOM   1829 C  CG2   . ILE A 1 250 ? -20.212 -6.952  -53.499 1.00 32.96  ? 238 ILE A CG2   1 
ATOM   1830 C  CD1   . ILE A 1 250 ? -21.292 -9.910  -53.053 1.00 35.64  ? 238 ILE A CD1   1 
ATOM   1831 N  N     . ALA A 1 251 ? -18.003 -5.117  -51.361 1.00 33.70  ? 239 ALA A N     1 
ATOM   1832 C  CA    . ALA A 1 251 ? -17.869 -3.761  -50.897 1.00 33.48  ? 239 ALA A CA    1 
ATOM   1833 C  C     . ALA A 1 251 ? -16.768 -3.021  -51.631 1.00 34.02  ? 239 ALA A C     1 
ATOM   1834 O  O     . ALA A 1 251 ? -15.891 -3.617  -52.275 1.00 34.94  ? 239 ALA A O     1 
ATOM   1835 C  CB    . ALA A 1 251 ? -17.602 -3.747  -49.396 1.00 33.03  ? 239 ALA A CB    1 
ATOM   1836 N  N     . GLY A 1 252 ? -16.817 -1.709  -51.489 1.00 33.63  ? 240 GLY A N     1 
ATOM   1837 C  CA    . GLY A 1 252 ? -15.758 -0.831  -51.964 1.00 33.90  ? 240 GLY A CA    1 
ATOM   1838 C  C     . GLY A 1 252 ? -15.883 -0.479  -53.427 1.00 34.22  ? 240 GLY A C     1 
ATOM   1839 O  O     . GLY A 1 252 ? -16.679 -1.040  -54.171 1.00 34.29  ? 240 GLY A O     1 
ATOM   1840 N  N     . SER A 1 253 ? -15.023 0.434   -53.828 1.00 34.79  ? 241 SER A N     1 
ATOM   1841 C  CA    . SER A 1 253 ? -15.023 1.039   -55.142 1.00 35.27  ? 241 SER A CA    1 
ATOM   1842 C  C     . SER A 1 253 ? -13.769 1.886   -55.230 1.00 35.82  ? 241 SER A C     1 
ATOM   1843 O  O     . SER A 1 253 ? -13.038 2.033   -54.226 1.00 34.66  ? 241 SER A O     1 
ATOM   1844 C  CB    . SER A 1 253 ? -16.259 1.927   -55.315 1.00 35.76  ? 241 SER A CB    1 
ATOM   1845 O  OG    . SER A 1 253 ? -16.168 3.079   -54.492 1.00 35.13  ? 241 SER A OG    1 
ATOM   1846 N  N     . ARG A 1 254 ? -13.487 2.433   -56.406 1.00 37.02  ? 242 ARG A N     1 
ATOM   1847 C  CA    . ARG A 1 254 ? -12.322 3.294   -56.560 1.00 39.28  ? 242 ARG A CA    1 
ATOM   1848 C  C     . ARG A 1 254 ? -12.476 4.558   -55.681 1.00 39.36  ? 242 ARG A C     1 
ATOM   1849 O  O     . ARG A 1 254 ? -11.472 5.095   -55.206 1.00 39.31  ? 242 ARG A O     1 
ATOM   1850 C  CB    . ARG A 1 254 ? -12.095 3.706   -58.009 1.00 40.92  ? 242 ARG A CB    1 
ATOM   1851 C  CG    . ARG A 1 254 ? -13.188 4.631   -58.464 1.00 45.56  ? 242 ARG A CG    1 
ATOM   1852 C  CD    . ARG A 1 254 ? -13.181 4.802   -59.957 1.00 53.05  ? 242 ARG A CD    1 
ATOM   1853 N  NE    . ARG A 1 254 ? -11.947 5.429   -60.371 1.00 56.94  ? 242 ARG A NE    1 
ATOM   1854 C  CZ    . ARG A 1 254 ? -11.767 6.737   -60.456 1.00 59.49  ? 242 ARG A CZ    1 
ATOM   1855 N  NH1   . ARG A 1 254 ? -10.571 7.197   -60.853 1.00 59.23  ? 242 ARG A NH1   1 
ATOM   1856 N  NH2   . ARG A 1 254 ? -12.767 7.581   -60.161 1.00 60.07  ? 242 ARG A NH2   1 
ATOM   1857 N  N     . LEU A 1 255 ? -13.717 4.987   -55.438 1.00 39.33  ? 243 LEU A N     1 
ATOM   1858 C  CA    . LEU A 1 255 ? -13.967 6.122   -54.560 1.00 40.26  ? 243 LEU A CA    1 
ATOM   1859 C  C     . LEU A 1 255 ? -13.801 5.786   -53.084 1.00 38.46  ? 243 LEU A C     1 
ATOM   1860 O  O     . LEU A 1 255 ? -13.272 6.612   -52.320 1.00 39.14  ? 243 LEU A O     1 
ATOM   1861 C  CB    . LEU A 1 255 ? -15.355 6.724   -54.787 1.00 40.10  ? 243 LEU A CB    1 
ATOM   1862 C  CG    . LEU A 1 255 ? -15.648 7.353   -56.179 1.00 44.98  ? 243 LEU A CG    1 
ATOM   1863 C  CD1   . LEU A 1 255 ? -17.047 8.047   -56.106 1.00 45.03  ? 243 LEU A CD1   1 
ATOM   1864 C  CD2   . LEU A 1 255 ? -14.537 8.386   -56.752 1.00 45.11  ? 243 LEU A CD2   1 
ATOM   1865 N  N     . TYR A 1 256 ? -14.261 4.602   -52.680 1.00 36.65  ? 244 TYR A N     1 
ATOM   1866 C  CA    . TYR A 1 256 ? -14.425 4.275   -51.255 1.00 36.85  ? 244 TYR A CA    1 
ATOM   1867 C  C     . TYR A 1 256 ? -13.672 2.984   -50.966 1.00 36.73  ? 244 TYR A C     1 
ATOM   1868 O  O     . TYR A 1 256 ? -14.293 1.908   -50.962 1.00 37.26  ? 244 TYR A O     1 
ATOM   1869 C  CB    . TYR A 1 256 ? -15.918 4.073   -50.866 1.00 36.48  ? 244 TYR A CB    1 
ATOM   1870 C  CG    . TYR A 1 256 ? -16.741 5.247   -51.242 1.00 37.77  ? 244 TYR A CG    1 
ATOM   1871 C  CD1   . TYR A 1 256 ? -16.490 6.477   -50.662 1.00 38.70  ? 244 TYR A CD1   1 
ATOM   1872 C  CD2   . TYR A 1 256 ? -17.755 5.145   -52.199 1.00 38.31  ? 244 TYR A CD2   1 
ATOM   1873 C  CE1   . TYR A 1 256 ? -17.231 7.625   -51.048 1.00 43.49  ? 244 TYR A CE1   1 
ATOM   1874 C  CE2   . TYR A 1 256 ? -18.514 6.247   -52.575 1.00 40.58  ? 244 TYR A CE2   1 
ATOM   1875 C  CZ    . TYR A 1 256 ? -18.235 7.499   -51.974 1.00 43.12  ? 244 TYR A CZ    1 
ATOM   1876 O  OH    . TYR A 1 256 ? -18.925 8.609   -52.335 1.00 46.20  ? 244 TYR A OH    1 
ATOM   1877 N  N     . SER A 1 257 ? -12.364 3.090   -50.718 1.00 35.53  ? 245 SER A N     1 
ATOM   1878 C  CA    . SER A 1 257 ? -11.520 1.905   -50.602 1.00 35.86  ? 245 SER A CA    1 
ATOM   1879 C  C     . SER A 1 257 ? -11.414 1.412   -49.174 1.00 36.15  ? 245 SER A C     1 
ATOM   1880 O  O     . SER A 1 257 ? -11.010 0.272   -48.948 1.00 37.94  ? 245 SER A O     1 
ATOM   1881 C  CB    . SER A 1 257 ? -10.131 2.194   -51.188 1.00 36.57  ? 245 SER A CB    1 
ATOM   1882 O  OG    . SER A 1 257 ? -9.558  3.398   -50.627 1.00 36.03  ? 245 SER A OG    1 
ATOM   1883 N  N     . GLY A 1 258 ? -11.777 2.250   -48.199 1.00 35.15  ? 246 GLY A N     1 
ATOM   1884 C  CA    . GLY A 1 258 ? -11.619 1.889   -46.792 1.00 34.60  ? 246 GLY A CA    1 
ATOM   1885 C  C     . GLY A 1 258 ? -12.757 1.045   -46.219 1.00 34.53  ? 246 GLY A C     1 
ATOM   1886 O  O     . GLY A 1 258 ? -12.536 0.225   -45.323 1.00 33.97  ? 246 GLY A O     1 
ATOM   1887 N  N     . ALA A 1 259 ? -13.978 1.250   -46.713 1.00 32.87  ? 247 ALA A N     1 
ATOM   1888 C  CA    . ALA A 1 259 ? -15.124 0.540   -46.167 1.00 33.86  ? 247 ALA A CA    1 
ATOM   1889 C  C     . ALA A 1 259 ? -14.973 -1.002  -46.005 1.00 33.92  ? 247 ALA A C     1 
ATOM   1890 O  O     . ALA A 1 259 ? -15.299 -1.520  -44.947 1.00 34.90  ? 247 ALA A O     1 
ATOM   1891 C  CB    . ALA A 1 259 ? -16.395 0.887   -46.987 1.00 33.72  ? 247 ALA A CB    1 
ATOM   1892 N  N     . PRO A 1 260 ? -14.472 -1.740  -47.038 1.00 34.76  ? 248 PRO A N     1 
ATOM   1893 C  CA    . PRO A 1 260 ? -14.342 -3.211  -46.969 1.00 34.38  ? 248 PRO A CA    1 
ATOM   1894 C  C     . PRO A 1 260 ? -13.503 -3.725  -45.799 1.00 34.10  ? 248 PRO A C     1 
ATOM   1895 O  O     . PRO A 1 260 ? -13.803 -4.791  -45.218 1.00 33.29  ? 248 PRO A O     1 
ATOM   1896 C  CB    . PRO A 1 260 ? -13.603 -3.582  -48.284 1.00 35.21  ? 248 PRO A CB    1 
ATOM   1897 C  CG    . PRO A 1 260 ? -13.874 -2.435  -49.231 1.00 35.26  ? 248 PRO A CG    1 
ATOM   1898 C  CD    . PRO A 1 260 ? -13.906 -1.225  -48.293 1.00 35.36  ? 248 PRO A CD    1 
ATOM   1899 N  N     . VAL A 1 261 ? -12.464 -2.962  -45.499 1.00 32.93  ? 249 VAL A N     1 
ATOM   1900 C  CA    . VAL A 1 261 ? -11.491 -3.275  -44.495 1.00 33.27  ? 249 VAL A CA    1 
ATOM   1901 C  C     . VAL A 1 261 ? -12.172 -3.206  -43.102 1.00 32.43  ? 249 VAL A C     1 
ATOM   1902 O  O     . VAL A 1 261 ? -11.992 -4.085  -42.284 1.00 31.77  ? 249 VAL A O     1 
ATOM   1903 C  CB    . VAL A 1 261 ? -10.342 -2.262  -44.534 1.00 33.77  ? 249 VAL A CB    1 
ATOM   1904 C  CG1   . VAL A 1 261 ? -9.229  -2.725  -43.658 1.00 34.91  ? 249 VAL A CG1   1 
ATOM   1905 C  CG2   . VAL A 1 261 ? -9.868  -2.003  -45.993 1.00 34.13  ? 249 VAL A CG2   1 
ATOM   1906 N  N     . LEU A 1 262 ? -12.932 -2.144  -42.860 1.00 30.83  ? 250 LEU A N     1 
ATOM   1907 C  CA    . LEU A 1 262 ? -13.630 -1.997  -41.592 1.00 30.84  ? 250 LEU A CA    1 
ATOM   1908 C  C     . LEU A 1 262 ? -14.710 -3.054  -41.443 1.00 30.52  ? 250 LEU A C     1 
ATOM   1909 O  O     . LEU A 1 262 ? -14.848 -3.604  -40.394 1.00 30.43  ? 250 LEU A O     1 
ATOM   1910 C  CB    . LEU A 1 262 ? -14.205 -0.603  -41.455 1.00 30.98  ? 250 LEU A CB    1 
ATOM   1911 C  CG    . LEU A 1 262 ? -13.173 0.531   -41.473 1.00 32.00  ? 250 LEU A CG    1 
ATOM   1912 C  CD1   . LEU A 1 262 ? -13.913 1.851   -41.637 1.00 29.29  ? 250 LEU A CD1   1 
ATOM   1913 C  CD2   . LEU A 1 262 ? -12.319 0.523   -40.210 1.00 31.59  ? 250 LEU A CD2   1 
ATOM   1914 N  N     . SER A 1 263 ? -15.455 -3.358  -42.506 1.00 31.21  ? 251 SER A N     1 
ATOM   1915 C  CA    . SER A 1 263 ? -16.446 -4.411  -42.440 1.00 32.04  ? 251 SER A CA    1 
ATOM   1916 C  C     . SER A 1 263 ? -15.836 -5.800  -42.182 1.00 32.33  ? 251 SER A C     1 
ATOM   1917 O  O     . SER A 1 263 ? -16.265 -6.513  -41.280 1.00 29.70  ? 251 SER A O     1 
ATOM   1918 C  CB    . SER A 1 263 ? -17.322 -4.428  -43.695 1.00 32.84  ? 251 SER A CB    1 
ATOM   1919 O  OG    . SER A 1 263 ? -18.166 -3.280  -43.748 1.00 33.26  ? 251 SER A OG    1 
ATOM   1920 N  N     . GLY A 1 264 ? -14.806 -6.148  -42.947 1.00 32.76  ? 252 GLY A N     1 
ATOM   1921 C  CA    . GLY A 1 264 ? -14.090 -7.413  -42.757 1.00 33.17  ? 252 GLY A CA    1 
ATOM   1922 C  C     . GLY A 1 264 ? -13.552 -7.634  -41.346 1.00 32.26  ? 252 GLY A C     1 
ATOM   1923 O  O     . GLY A 1 264 ? -13.805 -8.683  -40.741 1.00 31.46  ? 252 GLY A O     1 
ATOM   1924 N  N     . MET A 1 265 ? -12.853 -6.641  -40.794 1.00 32.58  ? 253 MET A N     1 
ATOM   1925 C  CA    . MET A 1 265 ? -12.342 -6.764  -39.424 1.00 32.83  ? 253 MET A CA    1 
ATOM   1926 C  C     . MET A 1 265 ? -13.440 -6.786  -38.393 1.00 32.21  ? 253 MET A C     1 
ATOM   1927 O  O     . MET A 1 265 ? -13.325 -7.404  -37.331 1.00 31.06  ? 253 MET A O     1 
ATOM   1928 C  CB    . MET A 1 265 ? -11.330 -5.645  -39.116 1.00 33.95  ? 253 MET A CB    1 
ATOM   1929 C  CG    . MET A 1 265 ? -10.069 -5.809  -39.915 1.00 36.98  ? 253 MET A CG    1 
ATOM   1930 S  SD    . MET A 1 265 ? -9.303  -7.416  -39.728 1.00 44.16  ? 253 MET A SD    1 
ATOM   1931 C  CE    . MET A 1 265 ? -9.383  -7.486  -37.888 1.00 30.50  ? 253 MET A CE    1 
ATOM   1932 N  N     . GLY A 1 266 ? -14.527 -6.101  -38.694 1.00 32.35  ? 254 GLY A N     1 
ATOM   1933 C  CA    . GLY A 1 266 ? -15.681 -6.199  -37.835 1.00 32.33  ? 254 GLY A CA    1 
ATOM   1934 C  C     . GLY A 1 266 ? -16.128 -7.648  -37.674 1.00 31.56  ? 254 GLY A C     1 
ATOM   1935 O  O     . GLY A 1 266 ? -16.414 -8.096  -36.589 1.00 31.66  ? 254 GLY A O     1 
ATOM   1936 N  N     . SER A 1 267 ? -16.187 -8.391  -38.763 1.00 31.44  ? 255 SER A N     1 
ATOM   1937 C  CA    . SER A 1 267 ? -16.531 -9.803  -38.676 1.00 31.39  ? 255 SER A CA    1 
ATOM   1938 C  C     . SER A 1 267 ? -15.467 -10.578 -37.921 1.00 31.56  ? 255 SER A C     1 
ATOM   1939 O  O     . SER A 1 267 ? -15.790 -11.425 -37.115 1.00 31.04  ? 255 SER A O     1 
ATOM   1940 C  CB    . SER A 1 267 ? -16.703 -10.446 -40.078 1.00 31.51  ? 255 SER A CB    1 
ATOM   1941 O  OG    . SER A 1 267 ? -17.708 -9.818  -40.881 1.00 33.61  ? 255 SER A OG    1 
ATOM   1942 N  N     . LEU A 1 268 ? -14.184 -10.308 -38.184 1.00 31.48  ? 256 LEU A N     1 
ATOM   1943 C  CA    . LEU A 1 268 ? -13.141 -11.106 -37.527 1.00 31.72  ? 256 LEU A CA    1 
ATOM   1944 C  C     . LEU A 1 268 ? -13.089 -10.878 -36.026 1.00 31.54  ? 256 LEU A C     1 
ATOM   1945 O  O     . LEU A 1 268 ? -12.884 -11.822 -35.274 1.00 30.45  ? 256 LEU A O     1 
ATOM   1946 C  CB    . LEU A 1 268 ? -11.764 -10.861 -38.145 1.00 32.09  ? 256 LEU A CB    1 
ATOM   1947 C  CG    . LEU A 1 268 ? -11.503 -11.528 -39.527 1.00 33.87  ? 256 LEU A CG    1 
ATOM   1948 C  CD1   . LEU A 1 268 ? -10.132 -11.008 -39.998 1.00 33.57  ? 256 LEU A CD1   1 
ATOM   1949 C  CD2   . LEU A 1 268 ? -11.525 -13.079 -39.517 1.00 31.24  ? 256 LEU A CD2   1 
ATOM   1950 N  N     . LYS A 1 269 ? -13.270 -9.638  -35.598 1.00 30.49  ? 257 LYS A N     1 
ATOM   1951 C  CA    . LYS A 1 269 ? -13.132 -9.305  -34.173 1.00 30.99  ? 257 LYS A CA    1 
ATOM   1952 C  C     . LYS A 1 269 ? -14.264 -9.923  -33.325 1.00 30.25  ? 257 LYS A C     1 
ATOM   1953 O  O     . LYS A 1 269 ? -14.104 -10.012 -32.122 1.00 30.52  ? 257 LYS A O     1 
ATOM   1954 C  CB    . LYS A 1 269 ? -13.114 -7.798  -33.953 1.00 32.11  ? 257 LYS A CB    1 
ATOM   1955 C  CG    . LYS A 1 269 ? -11.865 -7.071  -34.446 1.00 34.95  ? 257 LYS A CG    1 
ATOM   1956 C  CD    . LYS A 1 269 ? -10.598 -7.538  -33.723 1.00 41.02  ? 257 LYS A CD    1 
ATOM   1957 C  CE    . LYS A 1 269 ? -9.471  -6.539  -33.890 1.00 46.41  ? 257 LYS A CE    1 
ATOM   1958 N  NZ    . LYS A 1 269 ? -8.476  -6.697  -32.785 1.00 47.74  ? 257 LYS A NZ    1 
ATOM   1959 N  N     . VAL A 1 270 ? -15.391 -10.337 -33.919 1.00 30.11  ? 258 VAL A N     1 
ATOM   1960 C  CA    . VAL A 1 270 ? -16.496 -10.946 -33.129 1.00 30.21  ? 258 VAL A CA    1 
ATOM   1961 C  C     . VAL A 1 270 ? -16.380 -12.491 -33.128 1.00 31.35  ? 258 VAL A C     1 
ATOM   1962 O  O     . VAL A 1 270 ? -17.219 -13.157 -32.576 1.00 30.21  ? 258 VAL A O     1 
ATOM   1963 C  CB    . VAL A 1 270 ? -17.909 -10.496 -33.587 1.00 30.47  ? 258 VAL A CB    1 
ATOM   1964 C  CG1   . VAL A 1 270 ? -18.067 -8.973  -33.354 1.00 27.44  ? 258 VAL A CG1   1 
ATOM   1965 C  CG2   . VAL A 1 270 ? -18.240 -10.939 -35.114 1.00 27.16  ? 258 VAL A CG2   1 
ATOM   1966 N  N     . GLY A 1 271 ? -15.338 -13.025 -33.780 1.00 31.40  ? 259 GLY A N     1 
ATOM   1967 C  CA    . GLY A 1 271 ? -14.984 -14.446 -33.704 1.00 33.02  ? 259 GLY A CA    1 
ATOM   1968 C  C     . GLY A 1 271 ? -15.346 -15.288 -34.896 1.00 32.72  ? 259 GLY A C     1 
ATOM   1969 O  O     . GLY A 1 271 ? -15.353 -16.522 -34.814 1.00 33.46  ? 259 GLY A O     1 
ATOM   1970 N  N     . THR A 1 272 ? -15.598 -14.637 -36.023 1.00 32.72  ? 260 THR A N     1 
ATOM   1971 C  CA    . THR A 1 272 ? -15.820 -15.364 -37.268 1.00 33.19  ? 260 THR A CA    1 
ATOM   1972 C  C     . THR A 1 272 ? -14.592 -16.100 -37.758 1.00 33.18  ? 260 THR A C     1 
ATOM   1973 O  O     . THR A 1 272 ? -13.496 -15.643 -37.556 1.00 33.31  ? 260 THR A O     1 
ATOM   1974 C  CB    . THR A 1 272 ? -16.333 -14.447 -38.360 1.00 34.13  ? 260 THR A CB    1 
ATOM   1975 O  OG1   . THR A 1 272 ? -17.374 -13.661 -37.789 1.00 35.48  ? 260 THR A OG1   1 
ATOM   1976 C  CG2   . THR A 1 272 ? -16.843 -15.251 -39.531 1.00 32.58  ? 260 THR A CG2   1 
ATOM   1977 N  N     . GLY A 1 273 ? -14.786 -17.266 -38.355 1.00 32.68  ? 261 GLY A N     1 
ATOM   1978 C  CA    . GLY A 1 273 ? -13.674 -18.104 -38.736 1.00 34.57  ? 261 GLY A CA    1 
ATOM   1979 C  C     . GLY A 1 273 ? -12.902 -17.652 -39.964 1.00 34.85  ? 261 GLY A C     1 
ATOM   1980 O  O     . GLY A 1 273 ? -11.668 -17.680 -40.015 1.00 34.97  ? 261 GLY A O     1 
ATOM   1981 N  N     . LEU A 1 274 ? -13.616 -17.231 -40.979 1.00 36.31  ? 262 LEU A N     1 
ATOM   1982 C  CA    . LEU A 1 274 ? -12.966 -16.810 -42.223 1.00 36.40  ? 262 LEU A CA    1 
ATOM   1983 C  C     . LEU A 1 274 ? -13.720 -15.674 -42.845 1.00 35.86  ? 262 LEU A C     1 
ATOM   1984 O  O     . LEU A 1 274 ? -14.953 -15.711 -42.917 1.00 35.18  ? 262 LEU A O     1 
ATOM   1985 C  CB    . LEU A 1 274 ? -12.907 -17.980 -43.203 1.00 38.14  ? 262 LEU A CB    1 
ATOM   1986 C  CG    . LEU A 1 274 ? -11.978 -17.834 -44.432 1.00 40.91  ? 262 LEU A CG    1 
ATOM   1987 C  CD1   . LEU A 1 274 ? -10.486 -17.614 -43.999 1.00 44.45  ? 262 LEU A CD1   1 
ATOM   1988 C  CD2   . LEU A 1 274 ? -12.082 -19.123 -45.281 1.00 44.80  ? 262 LEU A CD2   1 
ATOM   1989 N  N     . VAL A 1 275 ? -12.993 -14.646 -43.270 1.00 35.65  ? 263 VAL A N     1 
ATOM   1990 C  CA    . VAL A 1 275 ? -13.605 -13.513 -43.935 1.00 35.68  ? 263 VAL A CA    1 
ATOM   1991 C  C     . VAL A 1 275 ? -12.917 -13.233 -45.257 1.00 35.90  ? 263 VAL A C     1 
ATOM   1992 O  O     . VAL A 1 275 ? -11.664 -13.181 -45.344 1.00 34.57  ? 263 VAL A O     1 
ATOM   1993 C  CB    . VAL A 1 275 ? -13.644 -12.252 -43.087 1.00 36.42  ? 263 VAL A CB    1 
ATOM   1994 C  CG1   . VAL A 1 275 ? -14.430 -11.168 -43.823 1.00 35.74  ? 263 VAL A CG1   1 
ATOM   1995 C  CG2   . VAL A 1 275 ? -14.304 -12.578 -41.736 1.00 37.15  ? 263 VAL A CG2   1 
ATOM   1996 N  N     . LYS A 1 276 ? -13.761 -13.151 -46.280 1.00 35.45  ? 264 LYS A N     1 
ATOM   1997 C  CA    . LYS A 1 276 ? -13.358 -12.868 -47.642 1.00 37.38  ? 264 LYS A CA    1 
ATOM   1998 C  C     . LYS A 1 276 ? -14.004 -11.607 -48.075 1.00 35.13  ? 264 LYS A C     1 
ATOM   1999 O  O     . LYS A 1 276 ? -15.184 -11.458 -47.890 1.00 35.18  ? 264 LYS A O     1 
ATOM   2000 C  CB    . LYS A 1 276 ? -13.868 -13.952 -48.593 1.00 38.44  ? 264 LYS A CB    1 
ATOM   2001 C  CG    . LYS A 1 276 ? -13.006 -15.138 -48.662 1.00 45.28  ? 264 LYS A CG    1 
ATOM   2002 C  CD    . LYS A 1 276 ? -13.550 -16.195 -49.683 1.00 50.64  ? 264 LYS A CD    1 
ATOM   2003 C  CE    . LYS A 1 276 ? -12.436 -16.817 -50.565 1.00 56.51  ? 264 LYS A CE    1 
ATOM   2004 N  NZ    . LYS A 1 276 ? -12.336 -18.359 -50.632 1.00 60.16  ? 264 LYS A NZ    1 
ATOM   2005 N  N     . LEU A 1 277 ? -13.228 -10.704 -48.636 1.00 34.92  ? 265 LEU A N     1 
ATOM   2006 C  CA    . LEU A 1 277 ? -13.754 -9.490  -49.277 1.00 34.28  ? 265 LEU A CA    1 
ATOM   2007 C  C     . LEU A 1 277 ? -13.672 -9.626  -50.790 1.00 33.95  ? 265 LEU A C     1 
ATOM   2008 O  O     . LEU A 1 277 ? -12.751 -10.281 -51.303 1.00 35.65  ? 265 LEU A O     1 
ATOM   2009 C  CB    . LEU A 1 277 ? -12.991 -8.269  -48.814 1.00 33.69  ? 265 LEU A CB    1 
ATOM   2010 C  CG    . LEU A 1 277 ? -12.561 -8.156  -47.358 1.00 34.63  ? 265 LEU A CG    1 
ATOM   2011 C  CD1   . LEU A 1 277 ? -11.639 -6.959  -47.323 1.00 33.60  ? 265 LEU A CD1   1 
ATOM   2012 C  CD2   . LEU A 1 277 ? -13.643 -8.016  -46.310 1.00 29.67  ? 265 LEU A CD2   1 
ATOM   2013 N  N     . ALA A 1 278 ? -14.666 -9.081  -51.495 1.00 33.86  ? 266 ALA A N     1 
ATOM   2014 C  CA    . ALA A 1 278 ? -14.598 -8.862  -52.938 1.00 33.99  ? 266 ALA A CA    1 
ATOM   2015 C  C     . ALA A 1 278 ? -14.661 -7.343  -53.141 1.00 33.48  ? 266 ALA A C     1 
ATOM   2016 O  O     . ALA A 1 278 ? -15.622 -6.700  -52.751 1.00 35.12  ? 266 ALA A O     1 
ATOM   2017 C  CB    . ALA A 1 278 ? -15.752 -9.566  -53.673 1.00 34.26  ? 266 ALA A CB    1 
ATOM   2018 N  N     . VAL A 1 279 ? -13.588 -6.789  -53.673 1.00 33.05  ? 267 VAL A N     1 
ATOM   2019 C  CA    . VAL A 1 279 ? -13.370 -5.387  -53.793 1.00 33.21  ? 267 VAL A CA    1 
ATOM   2020 C  C     . VAL A 1 279 ? -12.728 -5.162  -55.163 1.00 34.08  ? 267 VAL A C     1 
ATOM   2021 O  O     . VAL A 1 279 ? -11.887 -5.947  -55.584 1.00 34.47  ? 267 VAL A O     1 
ATOM   2022 C  CB    . VAL A 1 279 ? -12.421 -4.897  -52.698 1.00 33.04  ? 267 VAL A CB    1 
ATOM   2023 C  CG1   . VAL A 1 279 ? -12.128 -3.419  -52.859 1.00 34.18  ? 267 VAL A CG1   1 
ATOM   2024 C  CG2   . VAL A 1 279 ? -13.021 -5.189  -51.320 1.00 31.50  ? 267 VAL A CG2   1 
ATOM   2025 N  N     . PRO A 1 280 ? -13.132 -4.101  -55.871 1.00 34.83  ? 268 PRO A N     1 
ATOM   2026 C  CA    . PRO A 1 280 ? -12.492 -3.789  -57.150 1.00 35.76  ? 268 PRO A CA    1 
ATOM   2027 C  C     . PRO A 1 280 ? -10.977 -3.627  -57.043 1.00 36.16  ? 268 PRO A C     1 
ATOM   2028 O  O     . PRO A 1 280 ? -10.478 -2.940  -56.149 1.00 34.51  ? 268 PRO A O     1 
ATOM   2029 C  CB    . PRO A 1 280 ? -13.156 -2.490  -57.565 1.00 36.37  ? 268 PRO A CB    1 
ATOM   2030 C  CG    . PRO A 1 280 ? -14.537 -2.540  -56.844 1.00 37.08  ? 268 PRO A CG    1 
ATOM   2031 C  CD    . PRO A 1 280 ? -14.232 -3.170  -55.547 1.00 34.89  ? 268 PRO A CD    1 
ATOM   2032 N  N     . PHE A 1 281 ? -10.270 -4.241  -57.980 1.00 36.45  ? 269 PHE A N     1 
ATOM   2033 C  CA    . PHE A 1 281 ? -8.819  -4.089  -58.115 1.00 36.90  ? 269 PHE A CA    1 
ATOM   2034 C  C     . PHE A 1 281 ? -8.482  -2.685  -58.560 1.00 38.15  ? 269 PHE A C     1 
ATOM   2035 O  O     . PHE A 1 281 ? -9.151  -2.182  -59.468 1.00 38.40  ? 269 PHE A O     1 
ATOM   2036 C  CB    . PHE A 1 281 ? -8.287  -5.063  -59.178 1.00 36.90  ? 269 PHE A CB    1 
ATOM   2037 C  CG    . PHE A 1 281 ? -6.813  -4.992  -59.363 1.00 38.11  ? 269 PHE A CG    1 
ATOM   2038 C  CD1   . PHE A 1 281 ? -5.968  -5.617  -58.480 1.00 38.04  ? 269 PHE A CD1   1 
ATOM   2039 C  CD2   . PHE A 1 281 ? -6.273  -4.269  -60.422 1.00 43.34  ? 269 PHE A CD2   1 
ATOM   2040 C  CE1   . PHE A 1 281 ? -4.594  -5.530  -58.630 1.00 42.78  ? 269 PHE A CE1   1 
ATOM   2041 C  CE2   . PHE A 1 281 ? -4.914  -4.185  -60.601 1.00 42.74  ? 269 PHE A CE2   1 
ATOM   2042 C  CZ    . PHE A 1 281 ? -4.065  -4.821  -59.719 1.00 44.20  ? 269 PHE A CZ    1 
ATOM   2043 N  N     . PRO A 1 282 ? -7.417  -2.072  -58.001 1.00 38.52  ? 270 PRO A N     1 
ATOM   2044 C  CA    . PRO A 1 282 ? -6.438  -2.532  -56.991 1.00 39.00  ? 270 PRO A CA    1 
ATOM   2045 C  C     . PRO A 1 282 ? -6.820  -2.171  -55.560 1.00 37.77  ? 270 PRO A C     1 
ATOM   2046 O  O     . PRO A 1 282 ? -5.992  -2.321  -54.648 1.00 38.03  ? 270 PRO A O     1 
ATOM   2047 C  CB    . PRO A 1 282 ? -5.148  -1.792  -57.391 1.00 40.35  ? 270 PRO A CB    1 
ATOM   2048 C  CG    . PRO A 1 282 ? -5.639  -0.431  -57.898 1.00 41.52  ? 270 PRO A CG    1 
ATOM   2049 C  CD    . PRO A 1 282 ? -7.038  -0.759  -58.562 1.00 40.52  ? 270 PRO A CD    1 
ATOM   2050 N  N     . GLN A 1 283 ? -8.061  -1.727  -55.342 1.00 37.56  ? 271 GLN A N     1 
ATOM   2051 C  CA    . GLN A 1 283 ? -8.469  -1.237  -54.022 1.00 36.46  ? 271 GLN A CA    1 
ATOM   2052 C  C     . GLN A 1 283 ? -8.511  -2.379  -53.032 1.00 35.85  ? 271 GLN A C     1 
ATOM   2053 O  O     . GLN A 1 283 ? -8.377  -2.137  -51.817 1.00 35.00  ? 271 GLN A O     1 
ATOM   2054 C  CB    . GLN A 1 283 ? -9.813  -0.500  -54.036 1.00 37.41  ? 271 GLN A CB    1 
ATOM   2055 C  CG    . GLN A 1 283 ? -9.766  0.920   -54.631 1.00 37.45  ? 271 GLN A CG    1 
ATOM   2056 C  CD    . GLN A 1 283 ? -9.574  0.934   -56.127 1.00 40.28  ? 271 GLN A CD    1 
ATOM   2057 O  OE1   . GLN A 1 283 ? -10.093 0.069   -56.830 1.00 40.90  ? 271 GLN A OE1   1 
ATOM   2058 N  NE2   . GLN A 1 283 ? -8.851  1.925   -56.630 1.00 37.44  ? 271 GLN A NE2   1 
ATOM   2059 N  N     . ASN A 1 284 ? -8.644  -3.613  -53.537 1.00 35.21  ? 272 ASN A N     1 
ATOM   2060 C  CA    . ASN A 1 284 ? -8.586  -4.798  -52.683 1.00 34.91  ? 272 ASN A CA    1 
ATOM   2061 C  C     . ASN A 1 284 ? -7.258  -4.946  -51.924 1.00 34.40  ? 272 ASN A C     1 
ATOM   2062 O  O     . ASN A 1 284 ? -7.262  -5.509  -50.821 1.00 33.29  ? 272 ASN A O     1 
ATOM   2063 C  CB    . ASN A 1 284 ? -8.843  -6.129  -53.438 1.00 34.78  ? 272 ASN A CB    1 
ATOM   2064 C  CG    . ASN A 1 284 ? -7.756  -6.442  -54.383 1.00 33.55  ? 272 ASN A CG    1 
ATOM   2065 O  OD1   . ASN A 1 284 ? -7.475  -5.624  -55.247 1.00 33.09  ? 272 ASN A OD1   1 
ATOM   2066 N  ND2   . ASN A 1 284 ? -7.106  -7.585  -54.224 1.00 29.48  ? 272 ASN A ND2   1 
ATOM   2067 N  N     . LEU A 1 285 ? -6.176  -4.427  -52.481 1.00 34.79  ? 273 LEU A N     1 
ATOM   2068 C  CA    . LEU A 1 285 ? -4.858  -4.562  -51.842 1.00 36.82  ? 273 LEU A CA    1 
ATOM   2069 C  C     . LEU A 1 285 ? -4.697  -3.731  -50.587 1.00 37.42  ? 273 LEU A C     1 
ATOM   2070 O  O     . LEU A 1 285 ? -3.893  -4.071  -49.698 1.00 36.74  ? 273 LEU A O     1 
ATOM   2071 C  CB    . LEU A 1 285 ? -3.724  -4.302  -52.844 1.00 39.03  ? 273 LEU A CB    1 
ATOM   2072 C  CG    . LEU A 1 285 ? -3.686  -5.411  -53.882 1.00 41.24  ? 273 LEU A CG    1 
ATOM   2073 C  CD1   . LEU A 1 285 ? -2.582  -5.097  -54.857 1.00 46.50  ? 273 LEU A CD1   1 
ATOM   2074 C  CD2   . LEU A 1 285 ? -3.512  -6.802  -53.223 1.00 43.43  ? 273 LEU A CD2   1 
ATOM   2075 N  N     . ILE A 1 286 ? -5.552  -2.717  -50.464 1.00 37.31  ? 274 ILE A N     1 
ATOM   2076 C  CA    . ILE A 1 286 ? -5.628  -1.901  -49.284 1.00 38.46  ? 274 ILE A CA    1 
ATOM   2077 C  C     . ILE A 1 286 ? -5.878  -2.745  -48.039 1.00 37.66  ? 274 ILE A C     1 
ATOM   2078 O  O     . ILE A 1 286 ? -5.293  -2.464  -46.972 1.00 36.17  ? 274 ILE A O     1 
ATOM   2079 C  CB    . ILE A 1 286 ? -6.759  -0.789  -49.458 1.00 39.41  ? 274 ILE A CB    1 
ATOM   2080 C  CG1   . ILE A 1 286 ? -6.310  0.192   -50.501 1.00 41.00  ? 274 ILE A CG1   1 
ATOM   2081 C  CG2   . ILE A 1 286 ? -7.137  -0.029  -48.173 1.00 40.48  ? 274 ILE A CG2   1 
ATOM   2082 C  CD1   . ILE A 1 286 ? -4.990  0.560   -50.317 1.00 41.10  ? 274 ILE A CD1   1 
ATOM   2083 N  N     . ALA A 1 287 ? -6.737  -3.755  -48.173 1.00 35.50  ? 275 ALA A N     1 
ATOM   2084 C  CA    . ALA A 1 287 ? -7.263  -4.435  -46.987 1.00 34.43  ? 275 ALA A CA    1 
ATOM   2085 C  C     . ALA A 1 287 ? -6.181  -5.272  -46.336 1.00 35.02  ? 275 ALA A C     1 
ATOM   2086 O  O     . ALA A 1 287 ? -6.039  -5.257  -45.124 1.00 35.36  ? 275 ALA A O     1 
ATOM   2087 C  CB    . ALA A 1 287 ? -8.439  -5.297  -47.337 1.00 32.53  ? 275 ALA A CB    1 
ATOM   2088 N  N     . THR A 1 288 ? -5.404  -5.981  -47.146 1.00 35.42  ? 276 THR A N     1 
ATOM   2089 C  CA    . THR A 1 288 ? -4.407  -6.910  -46.636 1.00 36.30  ? 276 THR A CA    1 
ATOM   2090 C  C     . THR A 1 288 ? -3.128  -6.213  -46.280 1.00 37.35  ? 276 THR A C     1 
ATOM   2091 O  O     . THR A 1 288 ? -2.367  -6.709  -45.516 1.00 37.68  ? 276 THR A O     1 
ATOM   2092 C  CB    . THR A 1 288 ? -4.135  -8.004  -47.665 1.00 37.08  ? 276 THR A CB    1 
ATOM   2093 O  OG1   . THR A 1 288 ? -3.853  -7.385  -48.939 1.00 38.96  ? 276 THR A OG1   1 
ATOM   2094 C  CG2   . THR A 1 288 ? -5.349  -8.941  -47.792 1.00 34.69  ? 276 THR A CG2   1 
ATOM   2095 N  N     . SER A 1 289 ? -2.862  -5.042  -46.832 1.00 38.69  ? 277 SER A N     1 
ATOM   2096 C  CA    . SER A 1 289 ? -1.782  -4.282  -46.318 1.00 40.94  ? 277 SER A CA    1 
ATOM   2097 C  C     . SER A 1 289 ? -2.064  -3.808  -44.885 1.00 41.09  ? 277 SER A C     1 
ATOM   2098 O  O     . SER A 1 289 ? -1.156  -3.600  -44.124 1.00 42.76  ? 277 SER A O     1 
ATOM   2099 C  CB    . SER A 1 289 ? -1.486  -3.063  -47.206 1.00 42.81  ? 277 SER A CB    1 
ATOM   2100 O  OG    . SER A 1 289 ? -2.492  -2.099  -47.053 1.00 46.07  ? 277 SER A OG    1 
ATOM   2101 N  N     . ARG A 1 290 ? -3.302  -3.613  -44.520 1.00 40.59  ? 278 ARG A N     1 
ATOM   2102 C  CA    . ARG A 1 290 ? -3.621  -3.154  -43.138 1.00 42.16  ? 278 ARG A CA    1 
ATOM   2103 C  C     . ARG A 1 290 ? -3.786  -4.405  -42.177 1.00 40.32  ? 278 ARG A C     1 
ATOM   2104 O  O     . ARG A 1 290 ? -3.196  -4.474  -41.111 1.00 39.58  ? 278 ARG A O     1 
ATOM   2105 C  CB    . ARG A 1 290 ? -4.901  -2.313  -43.265 1.00 42.81  ? 278 ARG A CB    1 
ATOM   2106 C  CG    . ARG A 1 290 ? -5.534  -1.775  -41.982 1.00 49.84  ? 278 ARG A CG    1 
ATOM   2107 C  CD    . ARG A 1 290 ? -4.962  -0.420  -41.592 1.00 57.93  ? 278 ARG A CD    1 
ATOM   2108 N  NE    . ARG A 1 290 ? -3.601  -0.604  -41.114 1.00 63.91  ? 278 ARG A NE    1 
ATOM   2109 C  CZ    . ARG A 1 290 ? -3.290  -1.066  -39.904 1.00 69.80  ? 278 ARG A CZ    1 
ATOM   2110 N  NH1   . ARG A 1 290 ? -4.246  -1.372  -39.030 1.00 70.31  ? 278 ARG A NH1   1 
ATOM   2111 N  NH2   . ARG A 1 290 ? -2.005  -1.215  -39.558 1.00 73.17  ? 278 ARG A NH2   1 
ATOM   2112 N  N     . PHE A 1 291 ? -4.598  -5.350  -42.634 1.00 37.61  ? 279 PHE A N     1 
ATOM   2113 C  CA    . PHE A 1 291 ? -4.808  -6.604  -41.956 1.00 37.76  ? 279 PHE A CA    1 
ATOM   2114 C  C     . PHE A 1 291 ? -4.629  -7.783  -42.908 1.00 36.21  ? 279 PHE A C     1 
ATOM   2115 O  O     . PHE A 1 291 ? -5.518  -8.102  -43.666 1.00 34.37  ? 279 PHE A O     1 
ATOM   2116 C  CB    . PHE A 1 291 ? -6.218  -6.623  -41.385 1.00 37.14  ? 279 PHE A CB    1 
ATOM   2117 C  CG    . PHE A 1 291 ? -6.505  -5.499  -40.443 1.00 40.49  ? 279 PHE A CG    1 
ATOM   2118 C  CD1   . PHE A 1 291 ? -5.889  -5.436  -39.222 1.00 45.61  ? 279 PHE A CD1   1 
ATOM   2119 C  CD2   . PHE A 1 291 ? -7.382  -4.512  -40.781 1.00 42.96  ? 279 PHE A CD2   1 
ATOM   2120 C  CE1   . PHE A 1 291 ? -6.147  -4.406  -38.363 1.00 49.93  ? 279 PHE A CE1   1 
ATOM   2121 C  CE2   . PHE A 1 291 ? -7.640  -3.491  -39.919 1.00 46.28  ? 279 PHE A CE2   1 
ATOM   2122 C  CZ    . PHE A 1 291 ? -7.024  -3.438  -38.712 1.00 44.87  ? 279 PHE A CZ    1 
ATOM   2123 N  N     . PRO A 1 292 ? -3.503  -8.469  -42.808 1.00 36.95  ? 280 PRO A N     1 
ATOM   2124 C  CA    . PRO A 1 292 ? -3.185  -9.588  -43.693 1.00 37.28  ? 280 PRO A CA    1 
ATOM   2125 C  C     . PRO A 1 292 ? -3.995  -10.840 -43.391 1.00 37.66  ? 280 PRO A C     1 
ATOM   2126 O  O     . PRO A 1 292 ? -3.958  -11.768 -44.166 1.00 37.67  ? 280 PRO A O     1 
ATOM   2127 C  CB    . PRO A 1 292 ? -1.688  -9.797  -43.494 1.00 38.92  ? 280 PRO A CB    1 
ATOM   2128 C  CG    . PRO A 1 292 ? -1.337  -9.071  -42.296 1.00 39.22  ? 280 PRO A CG    1 
ATOM   2129 C  CD    . PRO A 1 292 ? -2.348  -8.044  -42.014 1.00 36.96  ? 280 PRO A CD    1 
ATOM   2130 N  N     . GLU A 1 293 ? -4.693  -10.842 -42.263 1.00 37.63  ? 281 GLU A N     1 
ATOM   2131 C  CA    . GLU A 1 293 ? -5.610  -11.898 -41.863 1.00 38.80  ? 281 GLU A CA    1 
ATOM   2132 C  C     . GLU A 1 293 ? -6.761  -12.020 -42.837 1.00 36.52  ? 281 GLU A C     1 
ATOM   2133 O  O     . GLU A 1 293 ? -7.321  -13.075 -43.003 1.00 36.93  ? 281 GLU A O     1 
ATOM   2134 C  CB    . GLU A 1 293 ? -6.195  -11.619 -40.486 1.00 39.70  ? 281 GLU A CB    1 
ATOM   2135 C  CG    . GLU A 1 293 ? -5.204  -11.569 -39.407 1.00 44.02  ? 281 GLU A CG    1 
ATOM   2136 C  CD    . GLU A 1 293 ? -4.794  -10.176 -39.094 1.00 46.60  ? 281 GLU A CD    1 
ATOM   2137 O  OE1   . GLU A 1 293 ? -4.776  -9.818  -37.924 1.00 52.49  ? 281 GLU A OE1   1 
ATOM   2138 O  OE2   . GLU A 1 293 ? -4.492  -9.433  -40.018 1.00 45.00  ? 281 GLU A OE2   1 
ATOM   2139 N  N     . LEU A 1 294 ? -7.171  -10.900 -43.398 1.00 35.98  ? 282 LEU A N     1 
ATOM   2140 C  CA    . LEU A 1 294 ? -8.260  -10.873 -44.347 1.00 35.16  ? 282 LEU A CA    1 
ATOM   2141 C  C     . LEU A 1 294 ? -7.883  -11.488 -45.682 1.00 35.53  ? 282 LEU A C     1 
ATOM   2142 O  O     . LEU A 1 294 ? -6.740  -11.490 -46.071 1.00 35.81  ? 282 LEU A O     1 
ATOM   2143 C  CB    . LEU A 1 294 ? -8.711  -9.439  -44.576 1.00 34.60  ? 282 LEU A CB    1 
ATOM   2144 C  CG    . LEU A 1 294 ? -9.382  -8.728  -43.417 1.00 35.53  ? 282 LEU A CG    1 
ATOM   2145 C  CD1   . LEU A 1 294 ? -9.473  -7.284  -43.699 1.00 33.44  ? 282 LEU A CD1   1 
ATOM   2146 C  CD2   . LEU A 1 294 ? -10.738 -9.304  -43.127 1.00 31.58  ? 282 LEU A CD2   1 
ATOM   2147 N  N     . ILE A 1 295 ? -8.876  -11.996 -46.384 1.00 35.45  ? 283 ILE A N     1 
ATOM   2148 C  CA    . ILE A 1 295 ? -8.702  -12.425 -47.747 1.00 35.33  ? 283 ILE A CA    1 
ATOM   2149 C  C     . ILE A 1 295 ? -9.399  -11.339 -48.543 1.00 35.37  ? 283 ILE A C     1 
ATOM   2150 O  O     . ILE A 1 295 ? -10.549 -11.047 -48.308 1.00 33.56  ? 283 ILE A O     1 
ATOM   2151 C  CB    . ILE A 1 295 ? -9.372  -13.774 -47.996 1.00 36.09  ? 283 ILE A CB    1 
ATOM   2152 C  CG1   . ILE A 1 295 ? -8.649  -14.865 -47.216 1.00 38.72  ? 283 ILE A CG1   1 
ATOM   2153 C  CG2   . ILE A 1 295 ? -9.395  -14.104 -49.467 1.00 36.00  ? 283 ILE A CG2   1 
ATOM   2154 C  CD1   . ILE A 1 295 ? -9.275  -16.193 -47.315 1.00 38.32  ? 283 ILE A CD1   1 
ATOM   2155 N  N     . SER A 1 296 ? -8.698  -10.721 -49.474 1.00 34.54  ? 284 SER A N     1 
ATOM   2156 C  CA    . SER A 1 296 ? -9.298  -9.624  -50.235 1.00 34.59  ? 284 SER A CA    1 
ATOM   2157 C  C     . SER A 1 296 ? -9.135  -9.935  -51.715 1.00 36.11  ? 284 SER A C     1 
ATOM   2158 O  O     . SER A 1 296 ? -8.048  -9.753  -52.276 1.00 35.47  ? 284 SER A O     1 
ATOM   2159 C  CB    . SER A 1 296 ? -8.647  -8.289  -49.884 1.00 34.75  ? 284 SER A CB    1 
ATOM   2160 O  OG    . SER A 1 296 ? -9.414  -7.193  -50.390 1.00 35.05  ? 284 SER A OG    1 
ATOM   2161 N  N     . VAL A 1 297 ? -10.217 -10.461 -52.311 1.00 35.34  ? 285 VAL A N     1 
ATOM   2162 C  CA    . VAL A 1 297 ? -10.222 -10.952 -53.661 1.00 36.63  ? 285 VAL A CA    1 
ATOM   2163 C  C     . VAL A 1 297 ? -10.326 -9.774  -54.641 1.00 36.18  ? 285 VAL A C     1 
ATOM   2164 O  O     . VAL A 1 297 ? -11.174 -8.935  -54.495 1.00 35.54  ? 285 VAL A O     1 
ATOM   2165 C  CB    . VAL A 1 297 ? -11.427 -11.916 -53.860 1.00 37.66  ? 285 VAL A CB    1 
ATOM   2166 C  CG1   . VAL A 1 297 ? -11.635 -12.194 -55.338 1.00 39.58  ? 285 VAL A CG1   1 
ATOM   2167 C  CG2   . VAL A 1 297 ? -11.189 -13.267 -53.002 1.00 38.87  ? 285 VAL A CG2   1 
ATOM   2168 N  N     . PRO A 1 298 ? -9.467  -9.723  -55.653 1.00 37.31  ? 286 PRO A N     1 
ATOM   2169 C  CA    . PRO A 1 298 ? -9.568  -8.602  -56.572 1.00 37.87  ? 286 PRO A CA    1 
ATOM   2170 C  C     . PRO A 1 298 ? -10.665 -8.824  -57.609 1.00 38.98  ? 286 PRO A C     1 
ATOM   2171 O  O     . PRO A 1 298 ? -10.741 -9.864  -58.199 1.00 39.50  ? 286 PRO A O     1 
ATOM   2172 C  CB    . PRO A 1 298 ? -8.224  -8.611  -57.249 1.00 38.44  ? 286 PRO A CB    1 
ATOM   2173 C  CG    . PRO A 1 298 ? -7.853  -9.994  -57.289 1.00 38.56  ? 286 PRO A CG    1 
ATOM   2174 C  CD    . PRO A 1 298 ? -8.310  -10.557 -55.973 1.00 38.40  ? 286 PRO A CD    1 
ATOM   2175 N  N     . ILE A 1 299 ? -11.522 -7.849  -57.812 1.00 39.46  ? 287 ILE A N     1 
ATOM   2176 C  CA    . ILE A 1 299 ? -12.584 -7.982  -58.803 1.00 39.40  ? 287 ILE A CA    1 
ATOM   2177 C  C     . ILE A 1 299 ? -12.212 -7.001  -59.919 1.00 41.15  ? 287 ILE A C     1 
ATOM   2178 O  O     . ILE A 1 299 ? -11.957 -5.818  -59.660 1.00 39.60  ? 287 ILE A O     1 
ATOM   2179 C  CB    . ILE A 1 299 ? -13.942 -7.627  -58.208 1.00 38.55  ? 287 ILE A CB    1 
ATOM   2180 C  CG1   . ILE A 1 299 ? -14.293 -8.559  -57.045 1.00 37.94  ? 287 ILE A CG1   1 
ATOM   2181 C  CG2   . ILE A 1 299 ? -15.075 -7.652  -59.332 1.00 35.90  ? 287 ILE A CG2   1 
ATOM   2182 C  CD1   . ILE A 1 299 ? -14.507 -10.034 -57.448 1.00 35.61  ? 287 ILE A CD1   1 
ATOM   2183 N  N     . ASP A 1 300 ? -12.193 -7.490  -61.153 1.00 43.31  ? 288 ASP A N     1 
ATOM   2184 C  CA    . ASP A 1 300 ? -11.814 -6.670  -62.296 1.00 46.33  ? 288 ASP A CA    1 
ATOM   2185 C  C     . ASP A 1 300 ? -13.076 -5.973  -62.756 1.00 46.37  ? 288 ASP A C     1 
ATOM   2186 O  O     . ASP A 1 300 ? -14.052 -6.621  -63.096 1.00 47.44  ? 288 ASP A O     1 
ATOM   2187 C  CB    . ASP A 1 300 ? -11.173 -7.532  -63.401 1.00 49.04  ? 288 ASP A CB    1 
ATOM   2188 C  CG    . ASP A 1 300 ? -10.935 -6.752  -64.719 1.00 54.62  ? 288 ASP A CG    1 
ATOM   2189 O  OD1   . ASP A 1 300 ? -10.664 -5.517  -64.698 1.00 64.11  ? 288 ASP A OD1   1 
ATOM   2190 O  OD2   . ASP A 1 300 ? -11.060 -7.372  -65.795 1.00 62.66  ? 288 ASP A OD2   1 
ATOM   2191 N  N     . THR A 1 301 ? -13.074 -4.653  -62.711 1.00 45.66  ? 289 THR A N     1 
ATOM   2192 C  CA    . THR A 1 301 ? -14.225 -3.854  -63.047 1.00 45.65  ? 289 THR A CA    1 
ATOM   2193 C  C     . THR A 1 301 ? -13.825 -2.978  -64.207 1.00 48.34  ? 289 THR A C     1 
ATOM   2194 O  O     . THR A 1 301 ? -12.640 -2.681  -64.359 1.00 48.36  ? 289 THR A O     1 
ATOM   2195 C  CB    . THR A 1 301 ? -14.623 -2.895  -61.892 1.00 44.27  ? 289 THR A CB    1 
ATOM   2196 O  OG1   . THR A 1 301 ? -13.528 -1.996  -61.596 1.00 42.33  ? 289 THR A OG1   1 
ATOM   2197 C  CG2   . THR A 1 301 ? -15.010 -3.690  -60.629 1.00 41.36  ? 289 THR A CG2   1 
ATOM   2198 N  N     . GLU A 1 302 ? -14.817 -2.483  -64.955 1.00 50.41  ? 290 GLU A N     1 
ATOM   2199 C  CA    . GLU A 1 302 ? -14.540 -1.582  -66.077 1.00 53.22  ? 290 GLU A CA    1 
ATOM   2200 C  C     . GLU A 1 302 ? -14.035 -0.195  -65.645 1.00 52.39  ? 290 GLU A C     1 
ATOM   2201 O  O     . GLU A 1 302 ? -13.039 0.282   -66.172 1.00 52.97  ? 290 GLU A O     1 
ATOM   2202 C  CB    . GLU A 1 302 ? -15.777 -1.455  -66.972 1.00 55.41  ? 290 GLU A CB    1 
ATOM   2203 C  CG    . GLU A 1 302 ? -15.442 -1.074  -68.463 1.00 61.30  ? 290 GLU A CG    1 
ATOM   2204 C  CD    . GLU A 1 302 ? -14.826 -2.251  -69.286 1.00 67.58  ? 290 GLU A CD    1 
ATOM   2205 O  OE1   . GLU A 1 302 ? -14.838 -2.171  -70.531 1.00 72.69  ? 290 GLU A OE1   1 
ATOM   2206 O  OE2   . GLU A 1 302 ? -14.330 -3.250  -68.705 1.00 70.04  ? 290 GLU A OE2   1 
ATOM   2207 N  N     . LYS A 1 303 ? -14.719 0.422   -64.677 1.00 50.81  ? 291 LYS A N     1 
ATOM   2208 C  CA    . LYS A 1 303 ? -14.432 1.789   -64.226 1.00 50.81  ? 291 LYS A CA    1 
ATOM   2209 C  C     . LYS A 1 303 ? -14.293 1.935   -62.685 1.00 47.95  ? 291 LYS A C     1 
ATOM   2210 O  O     . LYS A 1 303 ? -14.351 3.043   -62.176 1.00 47.94  ? 291 LYS A O     1 
ATOM   2211 C  CB    . LYS A 1 303 ? -15.573 2.716   -64.664 1.00 52.41  ? 291 LYS A CB    1 
ATOM   2212 C  CG    . LYS A 1 303 ? -15.884 2.720   -66.146 1.00 57.72  ? 291 LYS A CG    1 
ATOM   2213 C  CD    . LYS A 1 303 ? -17.304 3.303   -66.401 1.00 62.91  ? 291 LYS A CD    1 
ATOM   2214 C  CE    . LYS A 1 303 ? -17.644 3.487   -67.900 1.00 65.62  ? 291 LYS A CE    1 
ATOM   2215 N  NZ    . LYS A 1 303 ? -16.762 4.484   -68.600 1.00 68.49  ? 291 LYS A NZ    1 
ATOM   2216 N  N     . GLY A 1 304 ? -14.111 0.843   -61.956 1.00 44.94  ? 292 GLY A N     1 
ATOM   2217 C  CA    . GLY A 1 304 ? -13.824 0.927   -60.516 1.00 43.14  ? 292 GLY A CA    1 
ATOM   2218 C  C     . GLY A 1 304 ? -15.041 0.673   -59.665 1.00 41.73  ? 292 GLY A C     1 
ATOM   2219 O  O     . GLY A 1 304 ? -14.951 0.802   -58.455 1.00 41.12  ? 292 GLY A O     1 
ATOM   2220 N  N     . PHE A 1 305 ? -16.159 0.276   -60.293 1.00 41.30  ? 293 PHE A N     1 
ATOM   2221 C  CA    . PHE A 1 305 ? -17.389 -0.052  -59.583 1.00 41.05  ? 293 PHE A CA    1 
ATOM   2222 C  C     . PHE A 1 305 ? -17.910 -1.425  -60.014 1.00 40.41  ? 293 PHE A C     1 
ATOM   2223 O  O     . PHE A 1 305 ? -17.816 -1.793  -61.177 1.00 39.99  ? 293 PHE A O     1 
ATOM   2224 C  CB    . PHE A 1 305 ? -18.494 0.977   -59.861 1.00 42.16  ? 293 PHE A CB    1 
ATOM   2225 C  CG    . PHE A 1 305 ? -18.154 2.375   -59.434 1.00 43.18  ? 293 PHE A CG    1 
ATOM   2226 C  CD1   . PHE A 1 305 ? -18.444 2.814   -58.136 1.00 41.53  ? 293 PHE A CD1   1 
ATOM   2227 C  CD2   . PHE A 1 305 ? -17.526 3.258   -60.319 1.00 45.65  ? 293 PHE A CD2   1 
ATOM   2228 C  CE1   . PHE A 1 305 ? -18.120 4.112   -57.744 1.00 42.86  ? 293 PHE A CE1   1 
ATOM   2229 C  CE2   . PHE A 1 305 ? -17.194 4.558   -59.935 1.00 45.92  ? 293 PHE A CE2   1 
ATOM   2230 C  CZ    . PHE A 1 305 ? -17.491 4.996   -58.674 1.00 44.52  ? 293 PHE A CZ    1 
ATOM   2231 N  N     . PHE A 1 306 ? -18.457 -2.177  -59.051 1.00 39.09  ? 294 PHE A N     1 
ATOM   2232 C  CA    . PHE A 1 306 ? -19.209 -3.376  -59.381 1.00 38.70  ? 294 PHE A CA    1 
ATOM   2233 C  C     . PHE A 1 306 ? -20.280 -3.110  -60.425 1.00 39.25  ? 294 PHE A C     1 
ATOM   2234 O  O     . PHE A 1 306 ? -20.898 -2.063  -60.416 1.00 38.74  ? 294 PHE A O     1 
ATOM   2235 C  CB    . PHE A 1 306 ? -19.870 -3.961  -58.150 1.00 37.51  ? 294 PHE A CB    1 
ATOM   2236 C  CG    . PHE A 1 306 ? -18.940 -4.728  -57.286 1.00 36.45  ? 294 PHE A CG    1 
ATOM   2237 C  CD1   . PHE A 1 306 ? -18.650 -6.036  -57.563 1.00 37.93  ? 294 PHE A CD1   1 
ATOM   2238 C  CD2   . PHE A 1 306 ? -18.353 -4.125  -56.179 1.00 37.49  ? 294 PHE A CD2   1 
ATOM   2239 C  CE1   . PHE A 1 306 ? -17.790 -6.765  -56.726 1.00 38.59  ? 294 PHE A CE1   1 
ATOM   2240 C  CE2   . PHE A 1 306 ? -17.544 -4.841  -55.355 1.00 36.55  ? 294 PHE A CE2   1 
ATOM   2241 C  CZ    . PHE A 1 306 ? -17.246 -6.141  -55.638 1.00 37.14  ? 294 PHE A CZ    1 
ATOM   2242 N  N     . SER A 1 307 ? -20.477 -4.082  -61.319 1.00 40.48  ? 295 SER A N     1 
ATOM   2243 C  CA    . SER A 1 307 ? -21.526 -4.039  -62.333 1.00 41.02  ? 295 SER A CA    1 
ATOM   2244 C  C     . SER A 1 307 ? -21.985 -5.449  -62.640 1.00 42.50  ? 295 SER A C     1 
ATOM   2245 O  O     . SER A 1 307 ? -21.414 -6.462  -62.140 1.00 41.58  ? 295 SER A O     1 
ATOM   2246 C  CB    . SER A 1 307 ? -21.027 -3.356  -63.639 1.00 42.86  ? 295 SER A CB    1 
ATOM   2247 O  OG    . SER A 1 307 ? -20.101 -4.159  -64.326 1.00 39.44  ? 295 SER A OG    1 
ATOM   2248 N  N     . LEU A 1 308 ? -23.001 -5.546  -63.493 1.00 43.51  ? 296 LEU A N     1 
ATOM   2249 C  CA    . LEU A 1 308 ? -23.447 -6.858  -63.929 1.00 44.63  ? 296 LEU A CA    1 
ATOM   2250 C  C     . LEU A 1 308 ? -22.318 -7.761  -64.424 1.00 45.30  ? 296 LEU A C     1 
ATOM   2251 O  O     . LEU A 1 308 ? -22.403 -8.965  -64.245 1.00 45.63  ? 296 LEU A O     1 
ATOM   2252 C  CB    . LEU A 1 308 ? -24.532 -6.775  -64.997 1.00 45.83  ? 296 LEU A CB    1 
ATOM   2253 C  CG    . LEU A 1 308 ? -25.962 -6.550  -64.535 1.00 47.10  ? 296 LEU A CG    1 
ATOM   2254 C  CD1   . LEU A 1 308 ? -26.814 -6.423  -65.835 1.00 44.21  ? 296 LEU A CD1   1 
ATOM   2255 C  CD2   . LEU A 1 308 ? -26.508 -7.631  -63.553 1.00 46.46  ? 296 LEU A CD2   1 
ATOM   2256 N  N     . GLN A 1 309 ? -21.256 -7.224  -65.010 1.00 45.87  ? 297 GLN A N     1 
ATOM   2257 C  CA    . GLN A 1 309 ? -20.177 -8.110  -65.435 1.00 47.62  ? 297 GLN A CA    1 
ATOM   2258 C  C     . GLN A 1 309 ? -19.511 -8.886  -64.258 1.00 46.22  ? 297 GLN A C     1 
ATOM   2259 O  O     . GLN A 1 309 ? -18.784 -9.853  -64.481 1.00 46.59  ? 297 GLN A O     1 
ATOM   2260 C  CB    . GLN A 1 309 ? -19.139 -7.361  -66.255 1.00 49.51  ? 297 GLN A CB    1 
ATOM   2261 C  CG    . GLN A 1 309 ? -17.957 -6.810  -65.478 1.00 53.93  ? 297 GLN A CG    1 
ATOM   2262 C  CD    . GLN A 1 309 ? -16.758 -6.409  -66.383 1.00 59.38  ? 297 GLN A CD    1 
ATOM   2263 O  OE1   . GLN A 1 309 ? -16.951 -5.928  -67.515 1.00 64.61  ? 297 GLN A OE1   1 
ATOM   2264 N  NE2   . GLN A 1 309 ? -15.520 -6.599  -65.870 1.00 57.14  ? 297 GLN A NE2   1 
ATOM   2265 N  N     . ASN A 1 310 ? -19.768 -8.480  -63.018 1.00 43.96  ? 298 ASN A N     1 
ATOM   2266 C  CA    . ASN A 1 310 ? -19.190 -9.164  -61.872 1.00 42.61  ? 298 ASN A CA    1 
ATOM   2267 C  C     . ASN A 1 310 ? -20.169 -10.091 -61.166 1.00 42.30  ? 298 ASN A C     1 
ATOM   2268 O  O     . ASN A 1 310 ? -19.837 -10.679 -60.119 1.00 40.84  ? 298 ASN A O     1 
ATOM   2269 C  CB    . ASN A 1 310 ? -18.684 -8.139  -60.861 1.00 40.56  ? 298 ASN A CB    1 
ATOM   2270 C  CG    . ASN A 1 310 ? -17.691 -7.170  -61.451 1.00 40.95  ? 298 ASN A CG    1 
ATOM   2271 O  OD1   . ASN A 1 310 ? -17.926 -5.972  -61.418 1.00 40.38  ? 298 ASN A OD1   1 
ATOM   2272 N  ND2   . ASN A 1 310 ? -16.580 -7.678  -62.008 1.00 40.20  ? 298 ASN A ND2   1 
ATOM   2273 N  N     . LEU A 1 311 ? -21.386 -10.173 -61.681 1.00 42.23  ? 299 LEU A N     1 
ATOM   2274 C  CA    . LEU A 1 311 ? -22.444 -10.961 -61.045 1.00 43.09  ? 299 LEU A CA    1 
ATOM   2275 C  C     . LEU A 1 311 ? -21.992 -12.400 -60.834 1.00 43.66  ? 299 LEU A C     1 
ATOM   2276 O  O     . LEU A 1 311 ? -22.054 -12.931 -59.709 1.00 43.85  ? 299 LEU A O     1 
ATOM   2277 C  CB    . LEU A 1 311 ? -23.743 -10.920 -61.897 1.00 43.75  ? 299 LEU A CB    1 
ATOM   2278 C  CG    . LEU A 1 311 ? -24.953 -11.742 -61.395 1.00 43.79  ? 299 LEU A CG    1 
ATOM   2279 C  CD1   . LEU A 1 311 ? -25.378 -11.279 -60.045 1.00 44.22  ? 299 LEU A CD1   1 
ATOM   2280 C  CD2   . LEU A 1 311 ? -26.162 -11.711 -62.401 1.00 40.31  ? 299 LEU A CD2   1 
ATOM   2281 N  N     . GLN A 1 312 ? -21.521 -13.027 -61.904 1.00 45.15  ? 300 GLN A N     1 
ATOM   2282 C  CA    . GLN A 1 312 ? -21.240 -14.434 -61.864 1.00 46.66  ? 300 GLN A CA    1 
ATOM   2283 C  C     . GLN A 1 312 ? -20.097 -14.723 -60.897 1.00 45.40  ? 300 GLN A C     1 
ATOM   2284 O  O     . GLN A 1 312 ? -20.190 -15.649 -60.071 1.00 44.55  ? 300 GLN A O     1 
ATOM   2285 C  CB    . GLN A 1 312 ? -20.921 -14.981 -63.254 1.00 48.76  ? 300 GLN A CB    1 
ATOM   2286 C  CG    . GLN A 1 312 ? -20.886 -16.496 -63.269 1.00 55.94  ? 300 GLN A CG    1 
ATOM   2287 C  CD    . GLN A 1 312 ? -22.123 -17.121 -62.558 1.00 64.05  ? 300 GLN A CD    1 
ATOM   2288 O  OE1   . GLN A 1 312 ? -23.293 -16.791 -62.883 1.00 66.75  ? 300 GLN A OE1   1 
ATOM   2289 N  NE2   . GLN A 1 312 ? -21.860 -18.003 -61.560 1.00 67.41  ? 300 GLN A NE2   1 
ATOM   2290 N  N     . GLU A 1 313 ? -19.033 -13.932 -60.961 1.00 44.75  ? 301 GLU A N     1 
ATOM   2291 C  CA    . GLU A 1 313 ? -17.925 -14.144 -59.999 1.00 45.07  ? 301 GLU A CA    1 
ATOM   2292 C  C     . GLU A 1 313 ? -18.368 -14.020 -58.517 1.00 43.34  ? 301 GLU A C     1 
ATOM   2293 O  O     . GLU A 1 313 ? -17.845 -14.714 -57.629 1.00 43.29  ? 301 GLU A O     1 
ATOM   2294 C  CB    . GLU A 1 313 ? -16.769 -13.210 -60.287 1.00 45.17  ? 301 GLU A CB    1 
ATOM   2295 C  CG    . GLU A 1 313 ? -15.596 -13.480 -59.405 1.00 47.50  ? 301 GLU A CG    1 
ATOM   2296 C  CD    . GLU A 1 313 ? -14.344 -12.731 -59.814 1.00 52.98  ? 301 GLU A CD    1 
ATOM   2297 O  OE1   . GLU A 1 313 ? -13.261 -13.113 -59.283 1.00 54.48  ? 301 GLU A OE1   1 
ATOM   2298 O  OE2   . GLU A 1 313 ? -14.445 -11.768 -60.632 1.00 53.01  ? 301 GLU A OE2   1 
ATOM   2299 N  N     . CYS A 1 314 ? -19.322 -13.134 -58.243 1.00 42.24  ? 302 CYS A N     1 
ATOM   2300 C  CA    . CYS A 1 314 ? -19.755 -12.904 -56.887 1.00 40.89  ? 302 CYS A CA    1 
ATOM   2301 C  C     . CYS A 1 314 ? -20.637 -14.046 -56.384 1.00 41.22  ? 302 CYS A C     1 
ATOM   2302 O  O     . CYS A 1 314 ? -20.585 -14.394 -55.210 1.00 39.61  ? 302 CYS A O     1 
ATOM   2303 C  CB    . CYS A 1 314 ? -20.454 -11.553 -56.754 1.00 40.40  ? 302 CYS A CB    1 
ATOM   2304 S  SG    . CYS A 1 314 ? -19.285 -10.147 -56.756 1.00 39.78  ? 302 CYS A SG    1 
ATOM   2305 N  N     . LEU A 1 315 ? -21.458 -14.621 -57.261 1.00 42.37  ? 303 LEU A N     1 
ATOM   2306 C  CA    . LEU A 1 315 ? -22.317 -15.739 -56.874 1.00 42.85  ? 303 LEU A CA    1 
ATOM   2307 C  C     . LEU A 1 315 ? -21.434 -16.939 -56.625 1.00 43.85  ? 303 LEU A C     1 
ATOM   2308 O  O     . LEU A 1 315 ? -21.613 -17.671 -55.667 1.00 44.58  ? 303 LEU A O     1 
ATOM   2309 C  CB    . LEU A 1 315 ? -23.380 -16.022 -57.954 1.00 44.44  ? 303 LEU A CB    1 
ATOM   2310 C  CG    . LEU A 1 315 ? -24.432 -14.920 -58.124 1.00 44.68  ? 303 LEU A CG    1 
ATOM   2311 C  CD1   . LEU A 1 315 ? -25.258 -15.029 -59.477 1.00 46.22  ? 303 LEU A CD1   1 
ATOM   2312 C  CD2   . LEU A 1 315 ? -25.356 -14.891 -56.878 1.00 44.87  ? 303 LEU A CD2   1 
ATOM   2313 N  N     . GLU A 1 316 ? -20.420 -17.119 -57.461 1.00 44.62  ? 304 GLU A N     1 
ATOM   2314 C  CA    . GLU A 1 316 ? -19.488 -18.192 -57.258 1.00 46.24  ? 304 GLU A CA    1 
ATOM   2315 C  C     . GLU A 1 316 ? -18.796 -18.120 -55.876 1.00 44.55  ? 304 GLU A C     1 
ATOM   2316 O  O     . GLU A 1 316 ? -18.749 -19.109 -55.141 1.00 43.81  ? 304 GLU A O     1 
ATOM   2317 C  CB    . GLU A 1 316 ? -18.442 -18.211 -58.361 1.00 47.84  ? 304 GLU A CB    1 
ATOM   2318 C  CG    . GLU A 1 316 ? -17.790 -19.526 -58.489 1.00 54.08  ? 304 GLU A CG    1 
ATOM   2319 C  CD    . GLU A 1 316 ? -18.778 -20.626 -58.977 1.00 63.79  ? 304 GLU A CD    1 
ATOM   2320 O  OE1   . GLU A 1 316 ? -19.872 -20.306 -59.552 1.00 68.46  ? 304 GLU A OE1   1 
ATOM   2321 O  OE2   . GLU A 1 316 ? -18.439 -21.823 -58.792 1.00 68.21  ? 304 GLU A OE2   1 
ATOM   2322 N  N     . LEU A 1 317 ? -18.324 -16.931 -55.531 1.00 42.94  ? 305 LEU A N     1 
ATOM   2323 C  CA    . LEU A 1 317 ? -17.653 -16.704 -54.293 1.00 42.66  ? 305 LEU A CA    1 
ATOM   2324 C  C     . LEU A 1 317 ? -18.614 -16.929 -53.103 1.00 42.36  ? 305 LEU A C     1 
ATOM   2325 O  O     . LEU A 1 317 ? -18.190 -17.345 -52.065 1.00 40.91  ? 305 LEU A O     1 
ATOM   2326 C  CB    . LEU A 1 317 ? -17.070 -15.273 -54.258 1.00 41.99  ? 305 LEU A CB    1 
ATOM   2327 C  CG    . LEU A 1 317 ? -15.802 -15.036 -55.091 1.00 41.43  ? 305 LEU A CG    1 
ATOM   2328 C  CD1   . LEU A 1 317 ? -15.521 -13.555 -55.085 1.00 38.34  ? 305 LEU A CD1   1 
ATOM   2329 C  CD2   . LEU A 1 317 ? -14.535 -15.899 -54.613 1.00 38.90  ? 305 LEU A CD2   1 
ATOM   2330 N  N     . SER A 1 318 ? -19.904 -16.649 -53.293 1.00 42.77  ? 306 SER A N     1 
ATOM   2331 C  CA    . SER A 1 318 ? -20.949 -16.889 -52.283 1.00 43.89  ? 306 SER A CA    1 
ATOM   2332 C  C     . SER A 1 318 ? -21.236 -18.338 -51.924 1.00 44.99  ? 306 SER A C     1 
ATOM   2333 O  O     . SER A 1 318 ? -21.748 -18.617 -50.831 1.00 44.19  ? 306 SER A O     1 
ATOM   2334 C  CB    . SER A 1 318 ? -22.280 -16.272 -52.764 1.00 44.16  ? 306 SER A CB    1 
ATOM   2335 O  OG    . SER A 1 318 ? -22.097 -14.866 -52.678 1.00 46.53  ? 306 SER A OG    1 
ATOM   2336 N  N     . LYS A 1 319 ? -20.940 -19.250 -52.842 1.00 46.07  ? 307 LYS A N     1 
ATOM   2337 C  CA    . LYS A 1 319 ? -21.271 -20.647 -52.628 1.00 48.66  ? 307 LYS A CA    1 
ATOM   2338 C  C     . LYS A 1 319 ? -20.561 -21.253 -51.417 1.00 48.64  ? 307 LYS A C     1 
ATOM   2339 O  O     . LYS A 1 319 ? -21.116 -22.079 -50.761 1.00 49.27  ? 307 LYS A O     1 
ATOM   2340 C  CB    . LYS A 1 319 ? -20.960 -21.458 -53.879 1.00 50.01  ? 307 LYS A CB    1 
ATOM   2341 C  CG    . LYS A 1 319 ? -21.932 -21.101 -54.960 1.00 54.13  ? 307 LYS A CG    1 
ATOM   2342 C  CD    . LYS A 1 319 ? -21.522 -21.684 -56.295 1.00 59.98  ? 307 LYS A CD    1 
ATOM   2343 C  CE    . LYS A 1 319 ? -22.561 -21.359 -57.378 1.00 63.00  ? 307 LYS A CE    1 
ATOM   2344 N  NZ    . LYS A 1 319 ? -22.154 -21.967 -58.692 1.00 65.74  ? 307 LYS A NZ    1 
ATOM   2345 N  N     . ASP A 1 320 ? -19.349 -20.807 -51.133 1.00 48.35  ? 308 ASP A N     1 
ATOM   2346 C  CA    . ASP A 1 320 ? -18.543 -21.376 -50.084 1.00 49.97  ? 308 ASP A CA    1 
ATOM   2347 C  C     . ASP A 1 320 ? -18.609 -20.538 -48.794 1.00 48.47  ? 308 ASP A C     1 
ATOM   2348 O  O     . ASP A 1 320 ? -17.683 -20.642 -47.994 1.00 49.35  ? 308 ASP A O     1 
ATOM   2349 C  CB    . ASP A 1 320 ? -17.082 -21.386 -50.559 1.00 51.11  ? 308 ASP A CB    1 
ATOM   2350 C  CG    . ASP A 1 320 ? -16.955 -21.795 -52.053 1.00 57.22  ? 308 ASP A CG    1 
ATOM   2351 O  OD1   . ASP A 1 320 ? -17.090 -23.031 -52.314 1.00 60.67  ? 308 ASP A OD1   1 
ATOM   2352 O  OD2   . ASP A 1 320 ? -16.760 -20.886 -52.939 1.00 60.99  ? 308 ASP A OD2   1 
ATOM   2353 N  N     . VAL A 1 321 ? -19.644 -19.690 -48.617 1.00 45.11  ? 309 VAL A N     1 
ATOM   2354 C  CA    . VAL A 1 321 ? -19.791 -18.928 -47.398 1.00 42.41  ? 309 VAL A CA    1 
ATOM   2355 C  C     . VAL A 1 321 ? -21.168 -19.147 -46.768 1.00 42.20  ? 309 VAL A C     1 
ATOM   2356 O  O     . VAL A 1 321 ? -22.091 -19.700 -47.398 1.00 41.58  ? 309 VAL A O     1 
ATOM   2357 C  CB    . VAL A 1 321 ? -19.503 -17.392 -47.594 1.00 41.94  ? 309 VAL A CB    1 
ATOM   2358 C  CG1   . VAL A 1 321 ? -18.041 -17.121 -48.179 1.00 39.11  ? 309 VAL A CG1   1 
ATOM   2359 C  CG2   . VAL A 1 321 ? -20.581 -16.755 -48.390 1.00 39.05  ? 309 VAL A CG2   1 
ATOM   2360 N  N     . ASP A 1 322 ? -21.287 -18.720 -45.512 1.00 39.50  ? 310 ASP A N     1 
ATOM   2361 C  CA    . ASP A 1 322 ? -22.537 -18.819 -44.760 1.00 40.33  ? 310 ASP A CA    1 
ATOM   2362 C  C     . ASP A 1 322 ? -23.388 -17.579 -44.863 1.00 39.20  ? 310 ASP A C     1 
ATOM   2363 O  O     . ASP A 1 322 ? -24.576 -17.670 -44.718 1.00 40.63  ? 310 ASP A O     1 
ATOM   2364 C  CB    . ASP A 1 322 ? -22.235 -19.091 -43.297 1.00 40.59  ? 310 ASP A CB    1 
ATOM   2365 C  CG    . ASP A 1 322 ? -21.415 -20.367 -43.132 1.00 44.55  ? 310 ASP A CG    1 
ATOM   2366 O  OD1   . ASP A 1 322 ? -21.920 -21.398 -43.592 1.00 48.83  ? 310 ASP A OD1   1 
ATOM   2367 O  OD2   . ASP A 1 322 ? -20.249 -20.323 -42.691 1.00 40.04  ? 310 ASP A OD2   1 
ATOM   2368 N  N     . VAL A 1 323 ? -22.780 -16.419 -45.066 1.00 36.88  ? 311 VAL A N     1 
ATOM   2369 C  CA    . VAL A 1 323 ? -23.506 -15.155 -45.094 1.00 36.49  ? 311 VAL A CA    1 
ATOM   2370 C  C     . VAL A 1 323 ? -22.755 -14.235 -46.039 1.00 34.52  ? 311 VAL A C     1 
ATOM   2371 O  O     . VAL A 1 323 ? -21.494 -14.327 -46.203 1.00 34.14  ? 311 VAL A O     1 
ATOM   2372 C  CB    . VAL A 1 323 ? -23.628 -14.495 -43.663 1.00 36.38  ? 311 VAL A CB    1 
ATOM   2373 C  CG1   . VAL A 1 323 ? -22.351 -14.242 -43.140 1.00 39.27  ? 311 VAL A CG1   1 
ATOM   2374 C  CG2   . VAL A 1 323 ? -24.355 -13.147 -43.693 1.00 34.86  ? 311 VAL A CG2   1 
ATOM   2375 N  N     . VAL A 1 324 ? -23.511 -13.360 -46.672 1.00 32.91  ? 312 VAL A N     1 
ATOM   2376 C  CA    . VAL A 1 324 ? -22.940 -12.299 -47.471 1.00 32.35  ? 312 VAL A CA    1 
ATOM   2377 C  C     . VAL A 1 324 ? -23.376 -10.931 -46.968 1.00 32.19  ? 312 VAL A C     1 
ATOM   2378 O  O     . VAL A 1 324 ? -24.581 -10.702 -46.834 1.00 33.35  ? 312 VAL A O     1 
ATOM   2379 C  CB    . VAL A 1 324 ? -23.342 -12.430 -48.966 1.00 32.32  ? 312 VAL A CB    1 
ATOM   2380 C  CG1   . VAL A 1 324 ? -22.641 -11.334 -49.782 1.00 31.46  ? 312 VAL A CG1   1 
ATOM   2381 C  CG2   . VAL A 1 324 ? -23.004 -13.806 -49.484 1.00 31.52  ? 312 VAL A CG2   1 
ATOM   2382 N  N     . ALA A 1 325 ? -22.413 -10.030 -46.714 1.00 31.02  ? 313 ALA A N     1 
ATOM   2383 C  CA    . ALA A 1 325 ? -22.682 -8.587  -46.438 1.00 30.06  ? 313 ALA A CA    1 
ATOM   2384 C  C     . ALA A 1 325 ? -22.388 -7.828  -47.747 1.00 30.68  ? 313 ALA A C     1 
ATOM   2385 O  O     . ALA A 1 325 ? -21.434 -8.139  -48.445 1.00 30.28  ? 313 ALA A O     1 
ATOM   2386 C  CB    . ALA A 1 325 ? -21.832 -8.038  -45.294 1.00 29.06  ? 313 ALA A CB    1 
ATOM   2387 N  N     . ILE A 1 326 ? -23.235 -6.873  -48.089 1.00 30.45  ? 314 ILE A N     1 
ATOM   2388 C  CA    . ILE A 1 326 ? -23.085 -6.085  -49.308 1.00 31.54  ? 314 ILE A CA    1 
ATOM   2389 C  C     . ILE A 1 326 ? -23.425 -4.612  -49.077 1.00 30.81  ? 314 ILE A C     1 
ATOM   2390 O  O     . ILE A 1 326 ? -24.324 -4.313  -48.310 1.00 31.49  ? 314 ILE A O     1 
ATOM   2391 C  CB    . ILE A 1 326 ? -23.968 -6.699  -50.429 1.00 33.25  ? 314 ILE A CB    1 
ATOM   2392 C  CG1   . ILE A 1 326 ? -23.733 -5.997  -51.754 1.00 33.80  ? 314 ILE A CG1   1 
ATOM   2393 C  CG2   . ILE A 1 326 ? -25.472 -6.743  -50.041 1.00 32.37  ? 314 ILE A CG2   1 
ATOM   2394 C  CD1   . ILE A 1 326 ? -24.209 -6.829  -52.930 1.00 33.63  ? 314 ILE A CD1   1 
ATOM   2395 N  N     . GLY A 1 327 ? -22.685 -3.694  -49.721 1.00 31.66  ? 315 GLY A N     1 
ATOM   2396 C  CA    . GLY A 1 327 ? -23.041 -2.278  -49.735 1.00 31.29  ? 315 GLY A CA    1 
ATOM   2397 C  C     . GLY A 1 327 ? -22.067 -1.219  -49.304 1.00 32.14  ? 315 GLY A C     1 
ATOM   2398 O  O     . GLY A 1 327 ? -22.057 -0.117  -49.886 1.00 33.92  ? 315 GLY A O     1 
ATOM   2399 N  N     . PRO A 1 328 ? -21.271 -1.474  -48.265 1.00 32.69  ? 316 PRO A N     1 
ATOM   2400 C  CA    . PRO A 1 328 ? -20.421 -0.378  -47.777 1.00 33.00  ? 316 PRO A CA    1 
ATOM   2401 C  C     . PRO A 1 328 ? -19.448 0.037   -48.895 1.00 33.47  ? 316 PRO A C     1 
ATOM   2402 O  O     . PRO A 1 328 ? -18.738 -0.824  -49.474 1.00 33.01  ? 316 PRO A O     1 
ATOM   2403 C  CB    . PRO A 1 328 ? -19.624 -1.020  -46.657 1.00 33.41  ? 316 PRO A CB    1 
ATOM   2404 C  CG    . PRO A 1 328 ? -20.429 -2.157  -46.186 1.00 32.78  ? 316 PRO A CG    1 
ATOM   2405 C  CD    . PRO A 1 328 ? -21.216 -2.654  -47.382 1.00 33.47  ? 316 PRO A CD    1 
ATOM   2406 N  N     . GLY A 1 329 ? -19.454 1.322   -49.210 1.00 34.05  ? 317 GLY A N     1 
ATOM   2407 C  CA    . GLY A 1 329 ? -18.569 1.864   -50.233 1.00 35.24  ? 317 GLY A CA    1 
ATOM   2408 C  C     . GLY A 1 329 ? -18.762 1.429   -51.688 1.00 35.41  ? 317 GLY A C     1 
ATOM   2409 O  O     . GLY A 1 329 ? -17.881 1.717   -52.515 1.00 35.59  ? 317 GLY A O     1 
ATOM   2410 N  N     . LEU A 1 330 ? -19.894 0.800   -52.045 1.00 35.25  ? 318 LEU A N     1 
ATOM   2411 C  CA    . LEU A 1 330 ? -20.109 0.384   -53.454 1.00 35.69  ? 318 LEU A CA    1 
ATOM   2412 C  C     . LEU A 1 330 ? -20.239 1.553   -54.426 1.00 37.73  ? 318 LEU A C     1 
ATOM   2413 O  O     . LEU A 1 330 ? -19.860 1.453   -55.598 1.00 37.70  ? 318 LEU A O     1 
ATOM   2414 C  CB    . LEU A 1 330 ? -21.378 -0.473  -53.625 1.00 36.15  ? 318 LEU A CB    1 
ATOM   2415 C  CG    . LEU A 1 330 ? -21.401 -1.882  -53.058 1.00 36.43  ? 318 LEU A CG    1 
ATOM   2416 C  CD1   . LEU A 1 330 ? -22.637 -2.675  -53.502 1.00 36.43  ? 318 LEU A CD1   1 
ATOM   2417 C  CD2   . LEU A 1 330 ? -20.156 -2.575  -53.423 1.00 37.09  ? 318 LEU A CD2   1 
ATOM   2418 N  N     . GLY A 1 331 ? -20.771 2.670   -53.940 1.00 39.55  ? 319 GLY A N     1 
ATOM   2419 C  CA    . GLY A 1 331 ? -21.182 3.760   -54.835 1.00 41.56  ? 319 GLY A CA    1 
ATOM   2420 C  C     . GLY A 1 331 ? -22.613 3.501   -55.249 1.00 43.33  ? 319 GLY A C     1 
ATOM   2421 O  O     . GLY A 1 331 ? -23.172 2.426   -55.048 1.00 42.91  ? 319 GLY A O     1 
ATOM   2422 N  N     . ASN A 1 332 ? -23.215 4.490   -55.841 1.00 46.49  ? 320 ASN A N     1 
ATOM   2423 C  CA    . ASN A 1 332 ? -24.597 4.390   -56.215 1.00 49.01  ? 320 ASN A CA    1 
ATOM   2424 C  C     . ASN A 1 332 ? -24.711 5.038   -57.602 1.00 50.24  ? 320 ASN A C     1 
ATOM   2425 O  O     . ASN A 1 332 ? -24.672 6.259   -57.741 1.00 53.84  ? 320 ASN A O     1 
ATOM   2426 C  CB    . ASN A 1 332 ? -25.433 5.053   -55.132 1.00 49.87  ? 320 ASN A CB    1 
ATOM   2427 C  CG    . ASN A 1 332 ? -26.561 5.832   -55.671 1.00 55.70  ? 320 ASN A CG    1 
ATOM   2428 O  OD1   . ASN A 1 332 ? -27.239 5.400   -56.617 1.00 64.34  ? 320 ASN A OD1   1 
ATOM   2429 N  ND2   . ASN A 1 332 ? -26.783 7.006   -55.101 1.00 59.75  ? 320 ASN A ND2   1 
ATOM   2430 N  N     . ASN A 1 333 ? -24.669 4.199   -58.611 1.00 49.20  ? 321 ASN A N     1 
ATOM   2431 C  CA    . ASN A 1 333 ? -24.899 4.578   -60.011 1.00 50.22  ? 321 ASN A CA    1 
ATOM   2432 C  C     . ASN A 1 333 ? -25.708 3.388   -60.539 1.00 49.82  ? 321 ASN A C     1 
ATOM   2433 O  O     . ASN A 1 333 ? -25.929 2.381   -59.789 1.00 47.26  ? 321 ASN A O     1 
ATOM   2434 C  CB    . ASN A 1 333 ? -23.587 4.789   -60.770 1.00 49.98  ? 321 ASN A CB    1 
ATOM   2435 C  CG    . ASN A 1 333 ? -22.660 3.579   -60.690 1.00 50.62  ? 321 ASN A CG    1 
ATOM   2436 O  OD1   . ASN A 1 333 ? -23.038 2.463   -61.073 1.00 51.88  ? 321 ASN A OD1   1 
ATOM   2437 N  ND2   . ASN A 1 333 ? -21.439 3.788   -60.177 1.00 52.97  ? 321 ASN A ND2   1 
ATOM   2438 N  N     . GLU A 1 334 ? -26.153 3.481   -61.775 1.00 49.99  ? 322 GLU A N     1 
ATOM   2439 C  CA    . GLU A 1 334 ? -27.089 2.514   -62.295 1.00 51.72  ? 322 GLU A CA    1 
ATOM   2440 C  C     . GLU A 1 334 ? -26.537 1.093   -62.426 1.00 49.91  ? 322 GLU A C     1 
ATOM   2441 O  O     . GLU A 1 334 ? -27.275 0.135   -62.200 1.00 49.70  ? 322 GLU A O     1 
ATOM   2442 C  CB    . GLU A 1 334 ? -27.676 2.992   -63.620 1.00 54.16  ? 322 GLU A CB    1 
ATOM   2443 C  CG    . GLU A 1 334 ? -29.045 3.704   -63.385 1.00 61.75  ? 322 GLU A CG    1 
ATOM   2444 C  CD    . GLU A 1 334 ? -30.246 2.730   -63.169 1.00 68.75  ? 322 GLU A CD    1 
ATOM   2445 O  OE1   . GLU A 1 334 ? -30.027 1.510   -62.912 1.00 74.62  ? 322 GLU A OE1   1 
ATOM   2446 O  OE2   . GLU A 1 334 ? -31.415 3.198   -63.275 1.00 74.53  ? 322 GLU A OE2   1 
ATOM   2447 N  N     . HIS A 1 335 ? -25.260 0.973   -62.774 1.00 48.22  ? 323 HIS A N     1 
ATOM   2448 C  CA    . HIS A 1 335 ? -24.594 -0.321  -62.909 1.00 47.79  ? 323 HIS A CA    1 
ATOM   2449 C  C     . HIS A 1 335 ? -24.504 -1.021  -61.559 1.00 45.34  ? 323 HIS A C     1 
ATOM   2450 O  O     . HIS A 1 335 ? -24.704 -2.236  -61.484 1.00 45.49  ? 323 HIS A O     1 
ATOM   2451 C  CB    . HIS A 1 335 ? -23.192 -0.126  -63.534 1.00 48.33  ? 323 HIS A CB    1 
ATOM   2452 C  CG    . HIS A 1 335 ? -23.239 0.320   -64.968 1.00 54.14  ? 323 HIS A CG    1 
ATOM   2453 N  ND1   . HIS A 1 335 ? -22.129 0.335   -65.795 1.00 57.93  ? 323 HIS A ND1   1 
ATOM   2454 C  CD2   . HIS A 1 335 ? -24.282 0.724   -65.731 1.00 56.56  ? 323 HIS A CD2   1 
ATOM   2455 C  CE1   . HIS A 1 335 ? -22.489 0.747   -66.996 1.00 60.05  ? 323 HIS A CE1   1 
ATOM   2456 N  NE2   . HIS A 1 335 ? -23.789 0.991   -66.984 1.00 60.32  ? 323 HIS A NE2   1 
ATOM   2457 N  N     . VAL A 1 336 ? -24.220 -0.261  -60.495 1.00 42.87  ? 324 VAL A N     1 
ATOM   2458 C  CA    . VAL A 1 336 ? -24.271 -0.809  -59.140 1.00 41.26  ? 324 VAL A CA    1 
ATOM   2459 C  C     . VAL A 1 336 ? -25.703 -1.261  -58.795 1.00 40.90  ? 324 VAL A C     1 
ATOM   2460 O  O     . VAL A 1 336 ? -25.907 -2.343  -58.277 1.00 40.08  ? 324 VAL A O     1 
ATOM   2461 C  CB    . VAL A 1 336 ? -23.656 0.152   -58.051 1.00 40.41  ? 324 VAL A CB    1 
ATOM   2462 C  CG1   . VAL A 1 336 ? -23.928 -0.356  -56.572 1.00 38.43  ? 324 VAL A CG1   1 
ATOM   2463 C  CG2   . VAL A 1 336 ? -22.138 0.360   -58.269 1.00 39.76  ? 324 VAL A CG2   1 
ATOM   2464 N  N     . ARG A 1 337 ? -26.693 -0.444  -59.105 1.00 42.31  ? 325 ARG A N     1 
ATOM   2465 C  CA    . ARG A 1 337 ? -28.093 -0.805  -58.846 1.00 42.58  ? 325 ARG A CA    1 
ATOM   2466 C  C     . ARG A 1 337 ? -28.431 -2.131  -59.524 1.00 43.35  ? 325 ARG A C     1 
ATOM   2467 O  O     . ARG A 1 337 ? -29.023 -3.017  -58.882 1.00 42.43  ? 325 ARG A O     1 
ATOM   2468 C  CB    . ARG A 1 337 ? -29.040 0.291   -59.328 1.00 43.88  ? 325 ARG A CB    1 
ATOM   2469 C  CG    . ARG A 1 337 ? -30.521 -0.069  -59.319 1.00 46.03  ? 325 ARG A CG    1 
ATOM   2470 C  CD    . ARG A 1 337 ? -31.359 1.105   -59.844 1.00 51.40  ? 325 ARG A CD    1 
ATOM   2471 N  NE    . ARG A 1 337 ? -31.011 2.359   -59.152 1.00 54.11  ? 325 ARG A NE    1 
ATOM   2472 C  CZ    . ARG A 1 337 ? -31.600 2.806   -58.037 1.00 57.78  ? 325 ARG A CZ    1 
ATOM   2473 N  NH1   . ARG A 1 337 ? -32.606 2.121   -57.477 1.00 58.74  ? 325 ARG A NH1   1 
ATOM   2474 N  NH2   . ARG A 1 337 ? -31.182 3.943   -57.464 1.00 58.42  ? 325 ARG A NH2   1 
ATOM   2475 N  N     . GLU A 1 338 ? -28.068 -2.276  -60.803 1.00 44.01  ? 326 GLU A N     1 
ATOM   2476 C  CA    . GLU A 1 338 ? -28.403 -3.518  -61.535 1.00 45.32  ? 326 GLU A CA    1 
ATOM   2477 C  C     . GLU A 1 338 ? -27.703 -4.726  -60.894 1.00 43.07  ? 326 GLU A C     1 
ATOM   2478 O  O     . GLU A 1 338 ? -28.296 -5.779  -60.673 1.00 42.71  ? 326 GLU A O     1 
ATOM   2479 C  CB    . GLU A 1 338 ? -28.006 -3.440  -63.022 1.00 47.23  ? 326 GLU A CB    1 
ATOM   2480 C  CG    . GLU A 1 338 ? -28.760 -2.447  -63.851 1.00 52.61  ? 326 GLU A CG    1 
ATOM   2481 C  CD    . GLU A 1 338 ? -27.983 -2.019  -65.152 1.00 59.53  ? 326 GLU A CD    1 
ATOM   2482 O  OE1   . GLU A 1 338 ? -26.981 -2.678  -65.547 1.00 60.34  ? 326 GLU A OE1   1 
ATOM   2483 O  OE2   . GLU A 1 338 ? -28.377 -1.003  -65.772 1.00 62.69  ? 326 GLU A OE2   1 
ATOM   2484 N  N     . PHE A 1 339 ? -26.421 -4.573  -60.607 1.00 42.04  ? 327 PHE A N     1 
ATOM   2485 C  CA    . PHE A 1 339 ? -25.660 -5.632  -59.948 1.00 40.35  ? 327 PHE A CA    1 
ATOM   2486 C  C     . PHE A 1 339 ? -26.253 -6.019  -58.585 1.00 39.80  ? 327 PHE A C     1 
ATOM   2487 O  O     . PHE A 1 339 ? -26.489 -7.182  -58.323 1.00 39.59  ? 327 PHE A O     1 
ATOM   2488 C  CB    . PHE A 1 339 ? -24.188 -5.235  -59.843 1.00 40.43  ? 327 PHE A CB    1 
ATOM   2489 C  CG    . PHE A 1 339 ? -23.405 -6.069  -58.879 1.00 39.19  ? 327 PHE A CG    1 
ATOM   2490 C  CD1   . PHE A 1 339 ? -22.968 -7.323  -59.237 1.00 42.28  ? 327 PHE A CD1   1 
ATOM   2491 C  CD2   . PHE A 1 339 ? -23.131 -5.598  -57.613 1.00 38.10  ? 327 PHE A CD2   1 
ATOM   2492 C  CE1   . PHE A 1 339 ? -22.255 -8.110  -58.332 1.00 43.51  ? 327 PHE A CE1   1 
ATOM   2493 C  CE2   . PHE A 1 339 ? -22.445 -6.375  -56.701 1.00 38.98  ? 327 PHE A CE2   1 
ATOM   2494 C  CZ    . PHE A 1 339 ? -21.985 -7.635  -57.078 1.00 40.98  ? 327 PHE A CZ    1 
ATOM   2495 N  N     . VAL A 1 340 ? -26.513 -5.048  -57.729 1.00 38.64  ? 328 VAL A N     1 
ATOM   2496 C  CA    . VAL A 1 340 ? -26.968 -5.337  -56.359 1.00 37.59  ? 328 VAL A CA    1 
ATOM   2497 C  C     . VAL A 1 340 ? -28.293 -6.099  -56.356 1.00 38.49  ? 328 VAL A C     1 
ATOM   2498 O  O     . VAL A 1 340 ? -28.444 -7.097  -55.638 1.00 37.04  ? 328 VAL A O     1 
ATOM   2499 C  CB    . VAL A 1 340 ? -27.101 -4.048  -55.544 1.00 36.37  ? 328 VAL A CB    1 
ATOM   2500 C  CG1   . VAL A 1 340 ? -27.947 -4.258  -54.280 1.00 35.90  ? 328 VAL A CG1   1 
ATOM   2501 C  CG2   . VAL A 1 340 ? -25.687 -3.507  -55.171 1.00 35.02  ? 328 VAL A CG2   1 
ATOM   2502 N  N     . ASN A 1 341 ? -29.243 -5.622  -57.167 1.00 40.06  ? 329 ASN A N     1 
ATOM   2503 C  CA    . ASN A 1 341 ? -30.580 -6.206  -57.240 1.00 41.96  ? 329 ASN A CA    1 
ATOM   2504 C  C     . ASN A 1 341 ? -30.570 -7.618  -57.890 1.00 43.35  ? 329 ASN A C     1 
ATOM   2505 O  O     . ASN A 1 341 ? -31.205 -8.532  -57.365 1.00 43.89  ? 329 ASN A O     1 
ATOM   2506 C  CB    . ASN A 1 341 ? -31.550 -5.208  -57.920 1.00 43.21  ? 329 ASN A CB    1 
ATOM   2507 C  CG    . ASN A 1 341 ? -31.825 -4.017  -57.019 1.00 44.61  ? 329 ASN A CG    1 
ATOM   2508 O  OD1   . ASN A 1 341 ? -32.272 -4.216  -55.886 1.00 47.00  ? 329 ASN A OD1   1 
ATOM   2509 N  ND2   . ASN A 1 341 ? -31.449 -2.806  -57.449 1.00 42.83  ? 329 ASN A ND2   1 
ATOM   2510 N  N     . GLU A 1 342 ? -29.841 -7.799  -58.992 1.00 43.97  ? 330 GLU A N     1 
ATOM   2511 C  CA    . GLU A 1 342 ? -29.707 -9.138  -59.602 1.00 46.14  ? 330 GLU A CA    1 
ATOM   2512 C  C     . GLU A 1 342 ? -28.946 -10.121 -58.696 1.00 44.34  ? 330 GLU A C     1 
ATOM   2513 O  O     . GLU A 1 342 ? -29.285 -11.307 -58.602 1.00 44.57  ? 330 GLU A O     1 
ATOM   2514 C  CB    . GLU A 1 342 ? -29.035 -9.071  -60.983 1.00 47.64  ? 330 GLU A CB    1 
ATOM   2515 C  CG    . GLU A 1 342 ? -30.015 -8.885  -62.122 1.00 55.57  ? 330 GLU A CG    1 
ATOM   2516 C  CD    . GLU A 1 342 ? -31.012 -10.044 -62.215 1.00 61.85  ? 330 GLU A CD    1 
ATOM   2517 O  OE1   . GLU A 1 342 ? -30.563 -11.198 -62.354 1.00 66.24  ? 330 GLU A OE1   1 
ATOM   2518 O  OE2   . GLU A 1 342 ? -32.237 -9.799  -62.108 1.00 67.87  ? 330 GLU A OE2   1 
ATOM   2519 N  N     . PHE A 1 343 ? -27.945 -9.625  -57.985 1.00 42.19  ? 331 PHE A N     1 
ATOM   2520 C  CA    . PHE A 1 343 ? -27.245 -10.469 -57.048 1.00 40.80  ? 331 PHE A CA    1 
ATOM   2521 C  C     . PHE A 1 343 ? -28.164 -10.947 -55.932 1.00 41.01  ? 331 PHE A C     1 
ATOM   2522 O  O     . PHE A 1 343 ? -28.242 -12.135 -55.656 1.00 41.56  ? 331 PHE A O     1 
ATOM   2523 C  CB    . PHE A 1 343 ? -26.058 -9.697  -56.463 1.00 40.02  ? 331 PHE A CB    1 
ATOM   2524 C  CG    . PHE A 1 343 ? -25.275 -10.478 -55.475 1.00 37.91  ? 331 PHE A CG    1 
ATOM   2525 C  CD1   . PHE A 1 343 ? -24.461 -11.499 -55.901 1.00 38.99  ? 331 PHE A CD1   1 
ATOM   2526 C  CD2   . PHE A 1 343 ? -25.380 -10.215 -54.109 1.00 36.02  ? 331 PHE A CD2   1 
ATOM   2527 C  CE1   . PHE A 1 343 ? -23.731 -12.240 -54.980 1.00 38.91  ? 331 PHE A CE1   1 
ATOM   2528 C  CE2   . PHE A 1 343 ? -24.665 -10.941 -53.198 1.00 37.70  ? 331 PHE A CE2   1 
ATOM   2529 C  CZ    . PHE A 1 343 ? -23.844 -11.979 -53.632 1.00 38.77  ? 331 PHE A CZ    1 
ATOM   2530 N  N     . LEU A 1 344 ? -28.809 -10.018 -55.237 1.00 40.59  ? 332 LEU A N     1 
ATOM   2531 C  CA    . LEU A 1 344 ? -29.651 -10.380 -54.094 1.00 40.94  ? 332 LEU A CA    1 
ATOM   2532 C  C     . LEU A 1 344 ? -30.849 -11.284 -54.514 1.00 42.33  ? 332 LEU A C     1 
ATOM   2533 O  O     . LEU A 1 344 ? -31.296 -12.125 -53.772 1.00 40.94  ? 332 LEU A O     1 
ATOM   2534 C  CB    . LEU A 1 344 ? -30.137 -9.130  -53.373 1.00 38.85  ? 332 LEU A CB    1 
ATOM   2535 C  CG    . LEU A 1 344 ? -29.046 -8.379  -52.614 1.00 39.60  ? 332 LEU A CG    1 
ATOM   2536 C  CD1   . LEU A 1 344 ? -29.618 -7.017  -52.127 1.00 39.47  ? 332 LEU A CD1   1 
ATOM   2537 C  CD2   . LEU A 1 344 ? -28.520 -9.219  -51.426 1.00 33.58  ? 332 LEU A CD2   1 
ATOM   2538 N  N     . LYS A 1 345 ? -31.327 -11.106 -55.729 1.00 44.90  ? 333 LYS A N     1 
ATOM   2539 C  CA    . LYS A 1 345 ? -32.416 -11.920 -56.261 1.00 47.60  ? 333 LYS A CA    1 
ATOM   2540 C  C     . LYS A 1 345 ? -31.978 -13.389 -56.432 1.00 47.45  ? 333 LYS A C     1 
ATOM   2541 O  O     . LYS A 1 345 ? -32.746 -14.286 -56.178 1.00 48.52  ? 333 LYS A O     1 
ATOM   2542 C  CB    . LYS A 1 345 ? -32.938 -11.265 -57.573 1.00 49.57  ? 333 LYS A CB    1 
ATOM   2543 C  CG    . LYS A 1 345 ? -33.910 -12.059 -58.443 1.00 55.25  ? 333 LYS A CG    1 
ATOM   2544 C  CD    . LYS A 1 345 ? -34.391 -11.189 -59.642 1.00 61.44  ? 333 LYS A CD    1 
ATOM   2545 C  CE    . LYS A 1 345 ? -34.940 -11.994 -60.839 1.00 67.77  ? 333 LYS A CE    1 
ATOM   2546 N  NZ    . LYS A 1 345 ? -36.152 -12.861 -60.573 1.00 69.84  ? 333 LYS A NZ    1 
ATOM   2547 N  N     . THR A 1 346 ? -30.725 -13.627 -56.797 1.00 46.60  ? 334 THR A N     1 
ATOM   2548 C  CA    . THR A 1 346 ? -30.210 -14.991 -57.010 1.00 47.22  ? 334 THR A CA    1 
ATOM   2549 C  C     . THR A 1 346 ? -29.526 -15.583 -55.781 1.00 45.07  ? 334 THR A C     1 
ATOM   2550 O  O     . THR A 1 346 ? -29.443 -16.779 -55.640 1.00 44.75  ? 334 THR A O     1 
ATOM   2551 C  CB    . THR A 1 346 ? -29.123 -15.004 -58.098 1.00 47.34  ? 334 THR A CB    1 
ATOM   2552 O  OG1   . THR A 1 346 ? -29.505 -14.138 -59.151 1.00 52.61  ? 334 THR A OG1   1 
ATOM   2553 C  CG2   . THR A 1 346 ? -28.927 -16.379 -58.652 1.00 49.29  ? 334 THR A CG2   1 
ATOM   2554 N  N     . LEU A 1 347 ? -28.979 -14.742 -54.911 1.00 42.78  ? 335 LEU A N     1 
ATOM   2555 C  CA    . LEU A 1 347 ? -28.261 -15.255 -53.745 1.00 41.85  ? 335 LEU A CA    1 
ATOM   2556 C  C     . LEU A 1 347 ? -29.169 -16.004 -52.787 1.00 42.87  ? 335 LEU A C     1 
ATOM   2557 O  O     . LEU A 1 347 ? -30.119 -15.417 -52.207 1.00 42.50  ? 335 LEU A O     1 
ATOM   2558 C  CB    . LEU A 1 347 ? -27.552 -14.088 -52.998 1.00 39.96  ? 335 LEU A CB    1 
ATOM   2559 C  CG    . LEU A 1 347 ? -26.779 -14.405 -51.706 1.00 38.99  ? 335 LEU A CG    1 
ATOM   2560 C  CD1   . LEU A 1 347 ? -25.533 -15.202 -52.001 1.00 37.41  ? 335 LEU A CD1   1 
ATOM   2561 C  CD2   . LEU A 1 347 ? -26.482 -13.105 -50.967 1.00 38.28  ? 335 LEU A CD2   1 
ATOM   2562 N  N     . GLU A 1 348 ? -28.861 -17.279 -52.564 1.00 43.84  ? 336 GLU A N     1 
ATOM   2563 C  CA    . GLU A 1 348 ? -29.642 -18.084 -51.615 1.00 45.53  ? 336 GLU A CA    1 
ATOM   2564 C  C     . GLU A 1 348 ? -28.888 -18.292 -50.300 1.00 45.28  ? 336 GLU A C     1 
ATOM   2565 O  O     . GLU A 1 348 ? -28.700 -19.433 -49.840 1.00 46.80  ? 336 GLU A O     1 
ATOM   2566 C  CB    . GLU A 1 348 ? -30.035 -19.421 -52.253 1.00 48.49  ? 336 GLU A CB    1 
ATOM   2567 C  CG    . GLU A 1 348 ? -31.025 -19.255 -53.417 1.00 52.44  ? 336 GLU A CG    1 
ATOM   2568 C  CD    . GLU A 1 348 ? -31.586 -20.592 -53.935 1.00 60.65  ? 336 GLU A CD    1 
ATOM   2569 O  OE1   . GLU A 1 348 ? -30.850 -21.604 -53.949 1.00 65.39  ? 336 GLU A OE1   1 
ATOM   2570 O  OE2   . GLU A 1 348 ? -32.773 -20.629 -54.308 1.00 66.14  ? 336 GLU A OE2   1 
ATOM   2571 N  N     . LYS A 1 349 ? -28.419 -17.178 -49.725 1.00 43.11  ? 337 LYS A N     1 
ATOM   2572 C  CA    . LYS A 1 349 ? -27.701 -17.155 -48.460 1.00 41.20  ? 337 LYS A CA    1 
ATOM   2573 C  C     . LYS A 1 349 ? -28.299 -15.975 -47.673 1.00 39.63  ? 337 LYS A C     1 
ATOM   2574 O  O     . LYS A 1 349 ? -28.755 -14.999 -48.278 1.00 39.81  ? 337 LYS A O     1 
ATOM   2575 C  CB    . LYS A 1 349 ? -26.205 -16.905 -48.706 1.00 40.27  ? 337 LYS A CB    1 
ATOM   2576 C  CG    . LYS A 1 349 ? -25.337 -18.066 -49.320 1.00 42.29  ? 337 LYS A CG    1 
ATOM   2577 C  CD    . LYS A 1 349 ? -25.512 -19.368 -48.515 1.00 45.56  ? 337 LYS A CD    1 
ATOM   2578 C  CE    . LYS A 1 349 ? -24.753 -20.626 -48.999 1.00 46.97  ? 337 LYS A CE    1 
ATOM   2579 N  NZ    . LYS A 1 349 ? -23.545 -20.346 -49.760 1.00 49.45  ? 337 LYS A NZ    1 
ATOM   2580 N  N     . PRO A 1 350 ? -28.257 -16.023 -46.338 1.00 38.29  ? 338 PRO A N     1 
ATOM   2581 C  CA    . PRO A 1 350 ? -28.545 -14.793 -45.606 1.00 37.17  ? 338 PRO A CA    1 
ATOM   2582 C  C     . PRO A 1 350 ? -27.732 -13.601 -46.112 1.00 35.58  ? 338 PRO A C     1 
ATOM   2583 O  O     . PRO A 1 350 ? -26.561 -13.745 -46.467 1.00 32.89  ? 338 PRO A O     1 
ATOM   2584 C  CB    . PRO A 1 350 ? -28.162 -15.125 -44.173 1.00 37.50  ? 338 PRO A CB    1 
ATOM   2585 C  CG    . PRO A 1 350 ? -28.252 -16.669 -44.100 1.00 39.05  ? 338 PRO A CG    1 
ATOM   2586 C  CD    . PRO A 1 350 ? -27.899 -17.150 -45.453 1.00 38.83  ? 338 PRO A CD    1 
ATOM   2587 N  N     . ALA A 1 351 ? -28.369 -12.428 -46.173 1.00 35.42  ? 339 ALA A N     1 
ATOM   2588 C  CA    . ALA A 1 351 ? -27.709 -11.210 -46.654 1.00 35.29  ? 339 ALA A CA    1 
ATOM   2589 C  C     . ALA A 1 351 ? -27.804 -10.114 -45.599 1.00 34.64  ? 339 ALA A C     1 
ATOM   2590 O  O     . ALA A 1 351 ? -28.856 -9.970  -44.992 1.00 35.75  ? 339 ALA A O     1 
ATOM   2591 C  CB    . ALA A 1 351 ? -28.327 -10.748 -47.983 1.00 34.62  ? 339 ALA A CB    1 
ATOM   2592 N  N     . VAL A 1 352 ? -26.715 -9.367  -45.390 1.00 32.67  ? 340 VAL A N     1 
ATOM   2593 C  CA    . VAL A 1 352 ? -26.708 -8.159  -44.578 1.00 31.43  ? 340 VAL A CA    1 
ATOM   2594 C  C     . VAL A 1 352 ? -26.530 -7.003  -45.591 1.00 33.01  ? 340 VAL A C     1 
ATOM   2595 O  O     . VAL A 1 352 ? -25.543 -6.960  -46.352 1.00 32.77  ? 340 VAL A O     1 
ATOM   2596 C  CB    . VAL A 1 352 ? -25.594 -8.182  -43.497 1.00 30.31  ? 340 VAL A CB    1 
ATOM   2597 C  CG1   . VAL A 1 352 ? -25.616 -6.889  -42.678 1.00 29.51  ? 340 VAL A CG1   1 
ATOM   2598 C  CG2   . VAL A 1 352 ? -25.717 -9.450  -42.615 1.00 28.57  ? 340 VAL A CG2   1 
ATOM   2599 N  N     . ILE A 1 353 ? -27.540 -6.124  -45.675 1.00 33.00  ? 341 ILE A N     1 
ATOM   2600 C  CA    . ILE A 1 353 ? -27.631 -5.130  -46.743 1.00 32.59  ? 341 ILE A CA    1 
ATOM   2601 C  C     . ILE A 1 353 ? -27.498 -3.778  -46.090 1.00 32.31  ? 341 ILE A C     1 
ATOM   2602 O  O     . ILE A 1 353 ? -28.291 -3.434  -45.261 1.00 33.25  ? 341 ILE A O     1 
ATOM   2603 C  CB    . ILE A 1 353 ? -28.954 -5.251  -47.506 1.00 33.19  ? 341 ILE A CB    1 
ATOM   2604 C  CG1   . ILE A 1 353 ? -29.167 -6.688  -47.955 1.00 35.21  ? 341 ILE A CG1   1 
ATOM   2605 C  CG2   . ILE A 1 353 ? -28.973 -4.303  -48.696 1.00 32.23  ? 341 ILE A CG2   1 
ATOM   2606 C  CD1   . ILE A 1 353 ? -30.623 -7.031  -48.331 1.00 35.67  ? 341 ILE A CD1   1 
ATOM   2607 N  N     . ASP A 1 354 ? -26.472 -3.028  -46.490 1.00 33.16  ? 342 ASP A N     1 
ATOM   2608 C  CA    . ASP A 1 354 ? -26.062 -1.786  -45.863 1.00 33.60  ? 342 ASP A CA    1 
ATOM   2609 C  C     . ASP A 1 354 ? -25.753 -0.722  -46.925 1.00 34.07  ? 342 ASP A C     1 
ATOM   2610 O  O     . ASP A 1 354 ? -25.458 -1.039  -48.110 1.00 34.15  ? 342 ASP A O     1 
ATOM   2611 C  CB    . ASP A 1 354 ? -24.819 -2.043  -44.993 1.00 34.06  ? 342 ASP A CB    1 
ATOM   2612 C  CG    . ASP A 1 354 ? -24.417 -0.851  -44.145 1.00 36.64  ? 342 ASP A CG    1 
ATOM   2613 O  OD1   . ASP A 1 354 ? -25.307 -0.021  -43.790 1.00 42.96  ? 342 ASP A OD1   1 
ATOM   2614 O  OD2   . ASP A 1 354 ? -23.190 -0.728  -43.838 1.00 37.95  ? 342 ASP A OD2   1 
ATOM   2615 N  N     . ALA A 1 355 ? -25.811 0.526   -46.481 1.00 32.99  ? 343 ALA A N     1 
ATOM   2616 C  CA    . ALA A 1 355 ? -25.207 1.658   -47.168 1.00 33.02  ? 343 ALA A CA    1 
ATOM   2617 C  C     . ALA A 1 355 ? -25.698 1.777   -48.602 1.00 32.53  ? 343 ALA A C     1 
ATOM   2618 O  O     . ALA A 1 355 ? -26.921 1.813   -48.863 1.00 31.72  ? 343 ALA A O     1 
ATOM   2619 C  CB    . ALA A 1 355 ? -23.648 1.603   -47.064 1.00 32.38  ? 343 ALA A CB    1 
ATOM   2620 N  N     . ASP A 1 356 ? -24.777 1.855   -49.544 1.00 34.56  ? 344 ASP A N     1 
ATOM   2621 C  CA    . ASP A 1 356 ? -25.170 1.988   -50.950 1.00 35.99  ? 344 ASP A CA    1 
ATOM   2622 C  C     . ASP A 1 356 ? -26.005 0.840   -51.495 1.00 35.67  ? 344 ASP A C     1 
ATOM   2623 O  O     . ASP A 1 356 ? -26.799 1.053   -52.414 1.00 37.60  ? 344 ASP A O     1 
ATOM   2624 C  CB    . ASP A 1 356 ? -23.959 2.241   -51.824 1.00 37.25  ? 344 ASP A CB    1 
ATOM   2625 C  CG    . ASP A 1 356 ? -23.482 3.683   -51.739 1.00 38.74  ? 344 ASP A CG    1 
ATOM   2626 O  OD1   . ASP A 1 356 ? -24.332 4.630   -51.713 1.00 42.76  ? 344 ASP A OD1   1 
ATOM   2627 O  OD2   . ASP A 1 356 ? -22.250 3.842   -51.700 1.00 43.29  ? 344 ASP A OD2   1 
ATOM   2628 N  N     . ALA A 1 357 ? -25.890 -0.366  -50.946 1.00 34.40  ? 345 ALA A N     1 
ATOM   2629 C  CA    . ALA A 1 357 ? -26.798 -1.459  -51.386 1.00 34.40  ? 345 ALA A CA    1 
ATOM   2630 C  C     . ALA A 1 357 ? -28.250 -1.165  -50.967 1.00 35.43  ? 345 ALA A C     1 
ATOM   2631 O  O     . ALA A 1 357 ? -29.186 -1.523  -51.677 1.00 36.25  ? 345 ALA A O     1 
ATOM   2632 C  CB    . ALA A 1 357 ? -26.319 -2.840  -50.887 1.00 33.75  ? 345 ALA A CB    1 
ATOM   2633 N  N     . ILE A 1 358 ? -28.444 -0.446  -49.846 1.00 34.86  ? 346 ILE A N     1 
ATOM   2634 C  CA    . ILE A 1 358 ? -29.781 0.039   -49.483 1.00 35.86  ? 346 ILE A CA    1 
ATOM   2635 C  C     . ILE A 1 358 ? -30.243 1.160   -50.444 1.00 37.79  ? 346 ILE A C     1 
ATOM   2636 O  O     . ILE A 1 358 ? -31.391 1.177   -50.901 1.00 36.98  ? 346 ILE A O     1 
ATOM   2637 C  CB    . ILE A 1 358 ? -29.882 0.556   -48.055 1.00 35.35  ? 346 ILE A CB    1 
ATOM   2638 C  CG1   . ILE A 1 358 ? -29.554 -0.545  -47.015 1.00 34.67  ? 346 ILE A CG1   1 
ATOM   2639 C  CG2   . ILE A 1 358 ? -31.310 1.109   -47.790 1.00 37.41  ? 346 ILE A CG2   1 
ATOM   2640 C  CD1   . ILE A 1 358 ? -29.359 -0.033  -45.587 1.00 32.33  ? 346 ILE A CD1   1 
ATOM   2641 N  N     . ASN A 1 359 ? -29.358 2.113   -50.704 1.00 38.74  ? 347 ASN A N     1 
ATOM   2642 C  CA    . ASN A 1 359 ? -29.669 3.244   -51.609 1.00 40.43  ? 347 ASN A CA    1 
ATOM   2643 C  C     . ASN A 1 359 ? -30.105 2.785   -53.011 1.00 41.35  ? 347 ASN A C     1 
ATOM   2644 O  O     . ASN A 1 359 ? -30.840 3.488   -53.686 1.00 42.67  ? 347 ASN A O     1 
ATOM   2645 C  CB    . ASN A 1 359 ? -28.450 4.190   -51.748 1.00 39.48  ? 347 ASN A CB    1 
ATOM   2646 C  CG    . ASN A 1 359 ? -28.149 4.962   -50.463 1.00 40.17  ? 347 ASN A CG    1 
ATOM   2647 O  OD1   . ASN A 1 359 ? -29.054 5.306   -49.709 1.00 39.05  ? 347 ASN A OD1   1 
ATOM   2648 N  ND2   . ASN A 1 359 ? -26.878 5.246   -50.224 1.00 36.73  ? 347 ASN A ND2   1 
ATOM   2649 N  N     . VAL A 1 360 ? -29.638 1.632   -53.470 1.00 39.97  ? 348 VAL A N     1 
ATOM   2650 C  CA    . VAL A 1 360 ? -30.090 1.161   -54.767 1.00 40.92  ? 348 VAL A CA    1 
ATOM   2651 C  C     . VAL A 1 360 ? -31.107 0.023   -54.704 1.00 40.80  ? 348 VAL A C     1 
ATOM   2652 O  O     . VAL A 1 360 ? -31.516 -0.453  -55.732 1.00 41.51  ? 348 VAL A O     1 
ATOM   2653 C  CB    . VAL A 1 360 ? -28.893 0.768   -55.697 1.00 40.43  ? 348 VAL A CB    1 
ATOM   2654 C  CG1   . VAL A 1 360 ? -28.011 1.932   -55.922 1.00 42.16  ? 348 VAL A CG1   1 
ATOM   2655 C  CG2   . VAL A 1 360 ? -28.091 -0.442  -55.185 1.00 37.01  ? 348 VAL A CG2   1 
ATOM   2656 N  N     . LEU A 1 361 ? -31.514 -0.407  -53.509 1.00 40.08  ? 349 LEU A N     1 
ATOM   2657 C  CA    . LEU A 1 361 ? -32.263 -1.630  -53.373 1.00 40.78  ? 349 LEU A CA    1 
ATOM   2658 C  C     . LEU A 1 361 ? -33.635 -1.458  -53.996 1.00 42.52  ? 349 LEU A C     1 
ATOM   2659 O  O     . LEU A 1 361 ? -34.264 -0.436  -53.839 1.00 42.28  ? 349 LEU A O     1 
ATOM   2660 C  CB    . LEU A 1 361 ? -32.430 -2.029  -51.901 1.00 39.58  ? 349 LEU A CB    1 
ATOM   2661 C  CG    . LEU A 1 361 ? -33.097 -3.378  -51.595 1.00 41.05  ? 349 LEU A CG    1 
ATOM   2662 C  CD1   . LEU A 1 361 ? -32.352 -4.587  -52.185 1.00 42.44  ? 349 LEU A CD1   1 
ATOM   2663 C  CD2   . LEU A 1 361 ? -33.220 -3.521  -50.100 1.00 41.64  ? 349 LEU A CD2   1 
ATOM   2664 N  N     . ASP A 1 362 ? -34.081 -2.486  -54.690 1.00 44.03  ? 350 ASP A N     1 
ATOM   2665 C  CA    . ASP A 1 362 ? -35.489 -2.599  -55.112 1.00 46.26  ? 350 ASP A CA    1 
ATOM   2666 C  C     . ASP A 1 362 ? -36.172 -3.482  -54.061 1.00 46.44  ? 350 ASP A C     1 
ATOM   2667 O  O     . ASP A 1 362 ? -35.861 -4.667  -53.912 1.00 45.87  ? 350 ASP A O     1 
ATOM   2668 C  CB    . ASP A 1 362 ? -35.524 -3.201  -56.520 1.00 47.74  ? 350 ASP A CB    1 
ATOM   2669 C  CG    . ASP A 1 362 ? -36.926 -3.579  -57.002 1.00 52.03  ? 350 ASP A CG    1 
ATOM   2670 O  OD1   . ASP A 1 362 ? -37.922 -3.501  -56.250 1.00 54.23  ? 350 ASP A OD1   1 
ATOM   2671 O  OD2   . ASP A 1 362 ? -36.994 -3.996  -58.173 1.00 57.56  ? 350 ASP A OD2   1 
ATOM   2672 N  N     . THR A 1 363 ? -37.066 -2.903  -53.275 1.00 48.32  ? 351 THR A N     1 
ATOM   2673 C  CA    . THR A 1 363 ? -37.673 -3.668  -52.172 1.00 49.15  ? 351 THR A CA    1 
ATOM   2674 C  C     . THR A 1 363 ? -38.507 -4.875  -52.644 1.00 50.05  ? 351 THR A C     1 
ATOM   2675 O  O     . THR A 1 363 ? -38.743 -5.790  -51.864 1.00 50.24  ? 351 THR A O     1 
ATOM   2676 C  CB    . THR A 1 363 ? -38.550 -2.787  -51.254 1.00 49.40  ? 351 THR A CB    1 
ATOM   2677 O  OG1   . THR A 1 363 ? -39.558 -2.197  -52.035 1.00 50.97  ? 351 THR A OG1   1 
ATOM   2678 C  CG2   . THR A 1 363 ? -37.739 -1.680  -50.580 1.00 50.81  ? 351 THR A CG2   1 
ATOM   2679 N  N     . SER A 1 364 ? -38.952 -4.897  -53.898 1.00 51.62  ? 352 SER A N     1 
ATOM   2680 C  CA    . SER A 1 364 ? -39.579 -6.129  -54.455 1.00 53.40  ? 352 SER A CA    1 
ATOM   2681 C  C     . SER A 1 364 ? -38.633 -7.296  -54.373 1.00 52.62  ? 352 SER A C     1 
ATOM   2682 O  O     . SER A 1 364 ? -39.044 -8.415  -54.119 1.00 52.97  ? 352 SER A O     1 
ATOM   2683 C  CB    . SER A 1 364 ? -39.960 -5.964  -55.929 1.00 54.47  ? 352 SER A CB    1 
ATOM   2684 O  OG    . SER A 1 364 ? -40.649 -4.747  -56.120 1.00 57.40  ? 352 SER A OG    1 
ATOM   2685 N  N     . VAL A 1 365 ? -37.351 -7.033  -54.597 1.00 50.82  ? 353 VAL A N     1 
ATOM   2686 C  CA    . VAL A 1 365 ? -36.338 -8.075  -54.461 1.00 51.53  ? 353 VAL A CA    1 
ATOM   2687 C  C     . VAL A 1 365 ? -36.386 -8.756  -53.088 1.00 50.66  ? 353 VAL A C     1 
ATOM   2688 O  O     . VAL A 1 365 ? -36.280 -9.973  -53.021 1.00 50.28  ? 353 VAL A O     1 
ATOM   2689 C  CB    . VAL A 1 365 ? -34.912 -7.538  -54.828 1.00 51.52  ? 353 VAL A CB    1 
ATOM   2690 C  CG1   . VAL A 1 365 ? -33.867 -8.576  -54.581 1.00 52.75  ? 353 VAL A CG1   1 
ATOM   2691 C  CG2   . VAL A 1 365 ? -34.877 -7.083  -56.299 1.00 52.98  ? 353 VAL A CG2   1 
ATOM   2692 N  N     . LEU A 1 366 ? -36.583 -7.999  -52.006 1.00 50.95  ? 354 LEU A N     1 
ATOM   2693 C  CA    . LEU A 1 366 ? -36.656 -8.594  -50.646 1.00 50.90  ? 354 LEU A CA    1 
ATOM   2694 C  C     . LEU A 1 366 ? -37.830 -9.498  -50.438 1.00 54.07  ? 354 LEU A C     1 
ATOM   2695 O  O     . LEU A 1 366 ? -37.739 -10.482 -49.723 1.00 54.95  ? 354 LEU A O     1 
ATOM   2696 C  CB    . LEU A 1 366 ? -36.827 -7.524  -49.579 1.00 50.26  ? 354 LEU A CB    1 
ATOM   2697 C  CG    . LEU A 1 366 ? -35.649 -6.660  -49.282 1.00 45.58  ? 354 LEU A CG    1 
ATOM   2698 C  CD1   . LEU A 1 366 ? -36.027 -5.621  -48.209 1.00 41.89  ? 354 LEU A CD1   1 
ATOM   2699 C  CD2   . LEU A 1 366 ? -34.537 -7.616  -48.809 1.00 43.10  ? 354 LEU A CD2   1 
ATOM   2700 N  N     . LYS A 1 367 ? -38.963 -9.138  -51.032 1.00 57.14  ? 355 LYS A N     1 
ATOM   2701 C  CA    . LYS A 1 367 ? -40.167 -9.921  -50.867 1.00 59.24  ? 355 LYS A CA    1 
ATOM   2702 C  C     . LYS A 1 367 ? -40.027 -11.254 -51.566 1.00 60.46  ? 355 LYS A C     1 
ATOM   2703 O  O     . LYS A 1 367 ? -40.612 -12.241 -51.122 1.00 62.33  ? 355 LYS A O     1 
ATOM   2704 C  CB    . LYS A 1 367 ? -41.397 -9.156  -51.372 1.00 60.46  ? 355 LYS A CB    1 
ATOM   2705 C  CG    . LYS A 1 367 ? -41.594 -7.809  -50.658 1.00 61.86  ? 355 LYS A CG    1 
ATOM   2706 C  CD    . LYS A 1 367 ? -42.865 -7.063  -51.134 1.00 64.61  ? 355 LYS A CD    1 
ATOM   2707 C  CE    . LYS A 1 367 ? -43.156 -5.784  -50.289 1.00 65.96  ? 355 LYS A CE    1 
ATOM   2708 N  NZ    . LYS A 1 367 ? -42.082 -4.681  -50.320 1.00 64.90  ? 355 LYS A NZ    1 
ATOM   2709 N  N     . GLU A 1 368 ? -39.260 -11.316 -52.649 1.00 60.32  ? 356 GLU A N     1 
ATOM   2710 C  CA    . GLU A 1 368 ? -39.162 -12.571 -53.388 1.00 61.12  ? 356 GLU A CA    1 
ATOM   2711 C  C     . GLU A 1 368 ? -38.002 -13.468 -52.915 1.00 59.24  ? 356 GLU A C     1 
ATOM   2712 O  O     . GLU A 1 368 ? -37.933 -14.616 -53.320 1.00 59.46  ? 356 GLU A O     1 
ATOM   2713 C  CB    . GLU A 1 368 ? -39.082 -12.312 -54.899 1.00 62.97  ? 356 GLU A CB    1 
ATOM   2714 C  CG    . GLU A 1 368 ? -37.648 -12.013 -55.433 1.00 66.83  ? 356 GLU A CG    1 
ATOM   2715 C  CD    . GLU A 1 368 ? -37.608 -11.787 -56.952 1.00 70.95  ? 356 GLU A CD    1 
ATOM   2716 O  OE1   . GLU A 1 368 ? -37.668 -10.612 -57.391 1.00 73.99  ? 356 GLU A OE1   1 
ATOM   2717 O  OE2   . GLU A 1 368 ? -37.533 -12.790 -57.700 1.00 75.53  ? 356 GLU A OE2   1 
ATOM   2718 N  N     . ARG A 1 369 ? -37.098 -12.960 -52.071 1.00 56.30  ? 357 ARG A N     1 
ATOM   2719 C  CA    . ARG A 1 369 ? -36.006 -13.779 -51.563 1.00 54.93  ? 357 ARG A CA    1 
ATOM   2720 C  C     . ARG A 1 369 ? -36.575 -14.816 -50.619 1.00 54.55  ? 357 ARG A C     1 
ATOM   2721 O  O     . ARG A 1 369 ? -37.383 -14.480 -49.748 1.00 54.21  ? 357 ARG A O     1 
ATOM   2722 C  CB    . ARG A 1 369 ? -34.974 -12.929 -50.795 1.00 53.90  ? 357 ARG A CB    1 
ATOM   2723 C  CG    . ARG A 1 369 ? -34.046 -12.121 -51.662 1.00 52.71  ? 357 ARG A CG    1 
ATOM   2724 C  CD    . ARG A 1 369 ? -33.093 -11.253 -50.823 1.00 50.44  ? 357 ARG A CD    1 
ATOM   2725 N  NE    . ARG A 1 369 ? -32.399 -11.972 -49.729 1.00 47.35  ? 357 ARG A NE    1 
ATOM   2726 C  CZ    . ARG A 1 369 ? -31.369 -12.792 -49.888 1.00 46.58  ? 357 ARG A CZ    1 
ATOM   2727 N  NH1   . ARG A 1 369 ? -30.862 -13.059 -51.083 1.00 43.43  ? 357 ARG A NH1   1 
ATOM   2728 N  NH2   . ARG A 1 369 ? -30.823 -13.355 -48.823 1.00 49.32  ? 357 ARG A NH2   1 
ATOM   2729 N  N     . LYS A 1 370 ? -36.159 -16.062 -50.795 1.00 54.51  ? 358 LYS A N     1 
ATOM   2730 C  CA    . LYS A 1 370 ? -36.454 -17.125 -49.834 1.00 55.34  ? 358 LYS A CA    1 
ATOM   2731 C  C     . LYS A 1 370 ? -35.531 -17.014 -48.611 1.00 53.40  ? 358 LYS A C     1 
ATOM   2732 O  O     . LYS A 1 370 ? -35.937 -17.307 -47.507 1.00 53.85  ? 358 LYS A O     1 
ATOM   2733 C  CB    . LYS A 1 370 ? -36.238 -18.539 -50.432 1.00 56.99  ? 358 LYS A CB    1 
ATOM   2734 C  CG    . LYS A 1 370 ? -36.749 -18.774 -51.867 1.00 61.10  ? 358 LYS A CG    1 
ATOM   2735 C  CD    . LYS A 1 370 ? -38.260 -18.685 -51.990 1.00 64.41  ? 358 LYS A CD    1 
ATOM   2736 C  CE    . LYS A 1 370 ? -38.722 -19.412 -53.258 1.00 68.35  ? 358 LYS A CE    1 
ATOM   2737 N  NZ    . LYS A 1 370 ? -40.159 -19.157 -53.568 1.00 69.70  ? 358 LYS A NZ    1 
ATOM   2738 N  N     . SER A 1 371 ? -34.276 -16.628 -48.821 1.00 50.72  ? 359 SER A N     1 
ATOM   2739 C  CA    . SER A 1 371 ? -33.317 -16.496 -47.718 1.00 48.72  ? 359 SER A CA    1 
ATOM   2740 C  C     . SER A 1 371 ? -33.502 -15.219 -46.877 1.00 46.27  ? 359 SER A C     1 
ATOM   2741 O  O     . SER A 1 371 ? -34.045 -14.249 -47.344 1.00 46.16  ? 359 SER A O     1 
ATOM   2742 C  CB    . SER A 1 371 ? -31.917 -16.520 -48.272 1.00 48.28  ? 359 SER A CB    1 
ATOM   2743 O  OG    . SER A 1 371 ? -31.573 -17.826 -48.598 1.00 48.87  ? 359 SER A OG    1 
ATOM   2744 N  N     . PRO A 1 372 ? -33.011 -15.222 -45.627 1.00 44.99  ? 360 PRO A N     1 
ATOM   2745 C  CA    . PRO A 1 372 ? -33.201 -14.043 -44.752 1.00 42.64  ? 360 PRO A CA    1 
ATOM   2746 C  C     . PRO A 1 372 ? -32.340 -12.831 -45.122 1.00 40.43  ? 360 PRO A C     1 
ATOM   2747 O  O     . PRO A 1 372 ? -31.416 -12.943 -45.922 1.00 39.54  ? 360 PRO A O     1 
ATOM   2748 C  CB    . PRO A 1 372 ? -32.832 -14.562 -43.359 1.00 43.06  ? 360 PRO A CB    1 
ATOM   2749 C  CG    . PRO A 1 372 ? -32.176 -15.886 -43.565 1.00 43.87  ? 360 PRO A CG    1 
ATOM   2750 C  CD    . PRO A 1 372 ? -32.517 -16.410 -44.890 1.00 44.61  ? 360 PRO A CD    1 
ATOM   2751 N  N     . ALA A 1 373 ? -32.682 -11.681 -44.557 1.00 38.18  ? 361 ALA A N     1 
ATOM   2752 C  CA    . ALA A 1 373 ? -31.932 -10.483 -44.764 1.00 37.61  ? 361 ALA A CA    1 
ATOM   2753 C  C     . ALA A 1 373 ? -32.004 -9.634  -43.516 1.00 36.71  ? 361 ALA A C     1 
ATOM   2754 O  O     . ALA A 1 373 ? -33.046 -9.583  -42.824 1.00 37.38  ? 361 ALA A O     1 
ATOM   2755 C  CB    . ALA A 1 373 ? -32.464 -9.685  -45.997 1.00 38.35  ? 361 ALA A CB    1 
ATOM   2756 N  N     . VAL A 1 374 ? -30.915 -8.943  -43.242 1.00 33.95  ? 362 VAL A N     1 
ATOM   2757 C  CA    . VAL A 1 374 ? -30.916 -7.827  -42.325 1.00 33.99  ? 362 VAL A CA    1 
ATOM   2758 C  C     . VAL A 1 374 ? -30.581 -6.564  -43.136 1.00 33.64  ? 362 VAL A C     1 
ATOM   2759 O  O     . VAL A 1 374 ? -29.600 -6.552  -43.903 1.00 32.66  ? 362 VAL A O     1 
ATOM   2760 C  CB    . VAL A 1 374 ? -29.825 -7.973  -41.235 1.00 33.44  ? 362 VAL A CB    1 
ATOM   2761 C  CG1   . VAL A 1 374 ? -29.852 -6.780  -40.258 1.00 32.53  ? 362 VAL A CG1   1 
ATOM   2762 C  CG2   . VAL A 1 374 ? -29.939 -9.284  -40.542 1.00 35.42  ? 362 VAL A CG2   1 
ATOM   2763 N  N     . LEU A 1 375 ? -31.346 -5.497  -42.921 1.00 33.89  ? 363 LEU A N     1 
ATOM   2764 C  CA    . LEU A 1 375 ? -31.049 -4.154  -43.491 1.00 33.01  ? 363 LEU A CA    1 
ATOM   2765 C  C     . LEU A 1 375 ? -30.633 -3.255  -42.380 1.00 32.13  ? 363 LEU A C     1 
ATOM   2766 O  O     . LEU A 1 375 ? -31.252 -3.295  -41.308 1.00 33.44  ? 363 LEU A O     1 
ATOM   2767 C  CB    . LEU A 1 375 ? -32.273 -3.564  -44.169 1.00 34.01  ? 363 LEU A CB    1 
ATOM   2768 C  CG    . LEU A 1 375 ? -32.525 -4.001  -45.609 1.00 37.19  ? 363 LEU A CG    1 
ATOM   2769 C  CD1   . LEU A 1 375 ? -32.947 -5.474  -45.661 1.00 38.64  ? 363 LEU A CD1   1 
ATOM   2770 C  CD2   . LEU A 1 375 ? -33.565 -3.065  -46.300 1.00 38.68  ? 363 LEU A CD2   1 
ATOM   2771 N  N     . THR A 1 376 ? -29.591 -2.457  -42.605 1.00 31.50  ? 364 THR A N     1 
ATOM   2772 C  CA    . THR A 1 376 ? -29.013 -1.608  -41.568 1.00 31.33  ? 364 THR A CA    1 
ATOM   2773 C  C     . THR A 1 376 ? -28.907 -0.146  -41.985 1.00 30.71  ? 364 THR A C     1 
ATOM   2774 O  O     . THR A 1 376 ? -27.816 0.381   -42.060 1.00 32.64  ? 364 THR A O     1 
ATOM   2775 C  CB    . THR A 1 376 ? -27.596 -2.088  -41.182 1.00 32.15  ? 364 THR A CB    1 
ATOM   2776 O  OG1   . THR A 1 376 ? -26.714 -1.880  -42.312 1.00 33.58  ? 364 THR A OG1   1 
ATOM   2777 C  CG2   . THR A 1 376 ? -27.612 -3.581  -40.742 1.00 31.14  ? 364 THR A CG2   1 
ATOM   2778 N  N     . PRO A 1 377 ? -30.036 0.529   -42.254 1.00 31.32  ? 365 PRO A N     1 
ATOM   2779 C  CA    . PRO A 1 377 ? -30.032 1.922   -42.650 1.00 31.38  ? 365 PRO A CA    1 
ATOM   2780 C  C     . PRO A 1 377 ? -29.860 2.878   -41.459 1.00 32.07  ? 365 PRO A C     1 
ATOM   2781 O  O     . PRO A 1 377 ? -30.370 2.565   -40.354 1.00 31.88  ? 365 PRO A O     1 
ATOM   2782 C  CB    . PRO A 1 377 ? -31.415 2.090   -43.263 1.00 32.34  ? 365 PRO A CB    1 
ATOM   2783 C  CG    . PRO A 1 377 ? -32.246 1.239   -42.447 1.00 31.89  ? 365 PRO A CG    1 
ATOM   2784 C  CD    . PRO A 1 377 ? -31.409 0.008   -42.193 1.00 31.87  ? 365 PRO A CD    1 
ATOM   2785 N  N     . HIS A 1 378 ? -29.168 4.016   -41.673 1.00 31.40  ? 366 HIS A N     1 
ATOM   2786 C  CA    . HIS A 1 378 ? -29.417 5.212   -40.847 1.00 31.62  ? 366 HIS A CA    1 
ATOM   2787 C  C     . HIS A 1 378 ? -30.711 5.934   -41.351 1.00 32.81  ? 366 HIS A C     1 
ATOM   2788 O  O     . HIS A 1 378 ? -31.296 5.530   -42.366 1.00 32.97  ? 366 HIS A O     1 
ATOM   2789 C  CB    . HIS A 1 378 ? -28.195 6.160   -40.700 1.00 31.85  ? 366 HIS A CB    1 
ATOM   2790 C  CG    . HIS A 1 378 ? -27.713 6.762   -41.983 1.00 33.28  ? 366 HIS A CG    1 
ATOM   2791 N  ND1   . HIS A 1 378 ? -28.475 7.650   -42.711 1.00 33.71  ? 366 HIS A ND1   1 
ATOM   2792 C  CD2   . HIS A 1 378 ? -26.559 6.596   -42.674 1.00 33.63  ? 366 HIS A CD2   1 
ATOM   2793 C  CE1   . HIS A 1 378 ? -27.807 8.005   -43.805 1.00 37.84  ? 366 HIS A CE1   1 
ATOM   2794 N  NE2   . HIS A 1 378 ? -26.648 7.368   -43.817 1.00 33.27  ? 366 HIS A NE2   1 
ATOM   2795 N  N     . PRO A 1 379 ? -31.226 6.909   -40.584 1.00 33.12  ? 367 PRO A N     1 
ATOM   2796 C  CA    . PRO A 1 379 ? -32.514 7.525   -40.979 1.00 34.13  ? 367 PRO A CA    1 
ATOM   2797 C  C     . PRO A 1 379 ? -32.543 8.127   -42.373 1.00 34.65  ? 367 PRO A C     1 
ATOM   2798 O  O     . PRO A 1 379 ? -33.602 8.140   -43.012 1.00 33.55  ? 367 PRO A O     1 
ATOM   2799 C  CB    . PRO A 1 379 ? -32.741 8.624   -39.915 1.00 34.44  ? 367 PRO A CB    1 
ATOM   2800 C  CG    . PRO A 1 379 ? -31.996 8.069   -38.640 1.00 34.30  ? 367 PRO A CG    1 
ATOM   2801 C  CD    . PRO A 1 379 ? -30.753 7.390   -39.263 1.00 33.80  ? 367 PRO A CD    1 
ATOM   2802 N  N     . GLY A 1 380 ? -31.398 8.635   -42.828 1.00 34.72  ? 368 GLY A N     1 
ATOM   2803 C  CA    . GLY A 1 380 ? -31.300 9.168   -44.169 1.00 35.65  ? 368 GLY A CA    1 
ATOM   2804 C  C     . GLY A 1 380 ? -31.557 8.109   -45.239 1.00 36.01  ? 368 GLY A C     1 
ATOM   2805 O  O     . GLY A 1 380 ? -32.294 8.312   -46.213 1.00 34.70  ? 368 GLY A O     1 
ATOM   2806 N  N     . GLU A 1 381 ? -30.924 6.969   -45.057 1.00 35.43  ? 369 GLU A N     1 
ATOM   2807 C  CA    . GLU A 1 381 ? -31.127 5.849   -45.952 1.00 36.06  ? 369 GLU A CA    1 
ATOM   2808 C  C     . GLU A 1 381 ? -32.539 5.266   -45.803 1.00 35.64  ? 369 GLU A C     1 
ATOM   2809 O  O     . GLU A 1 381 ? -33.117 4.840   -46.776 1.00 36.54  ? 369 GLU A O     1 
ATOM   2810 C  CB    . GLU A 1 381 ? -30.070 4.748   -45.647 1.00 35.50  ? 369 GLU A CB    1 
ATOM   2811 C  CG    . GLU A 1 381 ? -28.667 5.149   -46.077 1.00 35.34  ? 369 GLU A CG    1 
ATOM   2812 C  CD    . GLU A 1 381 ? -27.529 4.425   -45.359 1.00 35.60  ? 369 GLU A CD    1 
ATOM   2813 O  OE1   . GLU A 1 381 ? -27.766 3.781   -44.323 1.00 33.98  ? 369 GLU A OE1   1 
ATOM   2814 O  OE2   . GLU A 1 381 ? -26.380 4.524   -45.848 1.00 36.41  ? 369 GLU A OE2   1 
ATOM   2815 N  N     . MET A 1 382 ? -33.053 5.134   -44.578 1.00 35.74  ? 370 MET A N     1 
ATOM   2816 C  CA    . MET A 1 382 ? -34.433 4.635   -44.405 1.00 36.25  ? 370 MET A CA    1 
ATOM   2817 C  C     . MET A 1 382 ? -35.454 5.587   -45.083 1.00 37.39  ? 370 MET A C     1 
ATOM   2818 O  O     . MET A 1 382 ? -36.384 5.161   -45.720 1.00 37.25  ? 370 MET A O     1 
ATOM   2819 C  CB    . MET A 1 382 ? -34.781 4.567   -42.934 1.00 36.65  ? 370 MET A CB    1 
ATOM   2820 C  CG    . MET A 1 382 ? -36.198 4.055   -42.626 1.00 38.06  ? 370 MET A CG    1 
ATOM   2821 S  SD    . MET A 1 382 ? -36.226 2.298   -43.033 1.00 42.66  ? 370 MET A SD    1 
ATOM   2822 C  CE    . MET A 1 382 ? -37.965 1.946   -42.623 1.00 46.09  ? 370 MET A CE    1 
ATOM   2823 N  N     . ALA A 1 383 ? -35.274 6.883   -44.884 1.00 37.84  ? 371 ALA A N     1 
ATOM   2824 C  CA    . ALA A 1 383 ? -36.110 7.884   -45.512 1.00 39.41  ? 371 ALA A CA    1 
ATOM   2825 C  C     . ALA A 1 383 ? -36.180 7.689   -47.047 1.00 41.59  ? 371 ALA A C     1 
ATOM   2826 O  O     . ALA A 1 383 ? -37.265 7.616   -47.624 1.00 40.68  ? 371 ALA A O     1 
ATOM   2827 C  CB    . ALA A 1 383 ? -35.573 9.259   -45.190 1.00 38.77  ? 371 ALA A CB    1 
ATOM   2828 N  N     . ARG A 1 384 ? -35.017 7.595   -47.694 1.00 42.78  ? 372 ARG A N     1 
ATOM   2829 C  CA    . ARG A 1 384 ? -34.955 7.364   -49.153 1.00 45.88  ? 372 ARG A CA    1 
ATOM   2830 C  C     . ARG A 1 384 ? -35.552 6.022   -49.494 1.00 45.03  ? 372 ARG A C     1 
ATOM   2831 O  O     . ARG A 1 384 ? -36.261 5.898   -50.454 1.00 44.93  ? 372 ARG A O     1 
ATOM   2832 C  CB    . ARG A 1 384 ? -33.509 7.399   -49.710 1.00 46.79  ? 372 ARG A CB    1 
ATOM   2833 C  CG    . ARG A 1 384 ? -33.000 8.781   -50.134 1.00 53.81  ? 372 ARG A CG    1 
ATOM   2834 C  CD    . ARG A 1 384 ? -31.636 8.689   -50.891 1.00 59.94  ? 372 ARG A CD    1 
ATOM   2835 N  NE    . ARG A 1 384 ? -30.619 7.999   -50.085 1.00 64.80  ? 372 ARG A NE    1 
ATOM   2836 C  CZ    . ARG A 1 384 ? -29.883 8.577   -49.135 1.00 65.61  ? 372 ARG A CZ    1 
ATOM   2837 N  NH1   . ARG A 1 384 ? -30.036 9.879   -48.870 1.00 68.39  ? 372 ARG A NH1   1 
ATOM   2838 N  NH2   . ARG A 1 384 ? -29.011 7.863   -48.431 1.00 62.53  ? 372 ARG A NH2   1 
ATOM   2839 N  N     . LEU A 1 385 ? -35.308 5.012   -48.665 1.00 43.87  ? 373 LEU A N     1 
ATOM   2840 C  CA    . LEU A 1 385 ? -35.822 3.703   -49.015 1.00 44.02  ? 373 LEU A CA    1 
ATOM   2841 C  C     . LEU A 1 385 ? -37.375 3.680   -49.034 1.00 44.68  ? 373 LEU A C     1 
ATOM   2842 O  O     . LEU A 1 385 ? -37.957 3.080   -49.905 1.00 46.44  ? 373 LEU A O     1 
ATOM   2843 C  CB    . LEU A 1 385 ? -35.266 2.654   -48.050 1.00 44.02  ? 373 LEU A CB    1 
ATOM   2844 C  CG    . LEU A 1 385 ? -35.574 1.169   -48.298 1.00 43.62  ? 373 LEU A CG    1 
ATOM   2845 C  CD1   . LEU A 1 385 ? -34.953 0.733   -49.610 1.00 45.02  ? 373 LEU A CD1   1 
ATOM   2846 C  CD2   . LEU A 1 385 ? -35.080 0.365   -47.119 1.00 43.89  ? 373 LEU A CD2   1 
ATOM   2847 N  N     . VAL A 1 386 ? -38.049 4.316   -48.078 1.00 42.70  ? 374 VAL A N     1 
ATOM   2848 C  CA    . VAL A 1 386 ? -39.535 4.278   -48.053 1.00 42.41  ? 374 VAL A CA    1 
ATOM   2849 C  C     . VAL A 1 386 ? -40.138 5.591   -48.622 1.00 41.94  ? 374 VAL A C     1 
ATOM   2850 O  O     . VAL A 1 386 ? -41.329 5.776   -48.618 1.00 42.59  ? 374 VAL A O     1 
ATOM   2851 C  CB    . VAL A 1 386 ? -40.087 3.986   -46.627 1.00 41.71  ? 374 VAL A CB    1 
ATOM   2852 C  CG1   . VAL A 1 386 ? -39.586 2.604   -46.099 1.00 41.71  ? 374 VAL A CG1   1 
ATOM   2853 C  CG2   . VAL A 1 386 ? -39.665 5.114   -45.654 1.00 40.30  ? 374 VAL A CG2   1 
ATOM   2854 N  N     . LYS A 1 387 ? -39.309 6.490   -49.140 1.00 42.17  ? 375 LYS A N     1 
ATOM   2855 C  CA    . LYS A 1 387 ? -39.816 7.716   -49.799 1.00 42.88  ? 375 LYS A CA    1 
ATOM   2856 C  C     . LYS A 1 387 ? -40.554 8.617   -48.804 1.00 42.78  ? 375 LYS A C     1 
ATOM   2857 O  O     . LYS A 1 387 ? -41.596 9.177   -49.111 1.00 42.52  ? 375 LYS A O     1 
ATOM   2858 C  CB    . LYS A 1 387 ? -40.670 7.365   -51.047 1.00 43.93  ? 375 LYS A CB    1 
ATOM   2859 C  CG    . LYS A 1 387 ? -39.811 6.594   -52.104 1.00 45.59  ? 375 LYS A CG    1 
ATOM   2860 C  CD    . LYS A 1 387 ? -40.349 6.688   -53.509 1.00 51.69  ? 375 LYS A CD    1 
ATOM   2861 C  CE    . LYS A 1 387 ? -39.173 6.839   -54.546 1.00 55.30  ? 375 LYS A CE    1 
ATOM   2862 N  NZ    . LYS A 1 387 ? -38.250 8.049   -54.285 1.00 54.60  ? 375 LYS A NZ    1 
ATOM   2863 N  N     . LYS A 1 388 ? -39.975 8.773   -47.617 1.00 40.82  ? 376 LYS A N     1 
ATOM   2864 C  CA    . LYS A 1 388 ? -40.478 9.719   -46.620 1.00 42.26  ? 376 LYS A CA    1 
ATOM   2865 C  C     . LYS A 1 388 ? -39.358 10.700  -46.182 1.00 41.37  ? 376 LYS A C     1 
ATOM   2866 O  O     . LYS A 1 388 ? -38.229 10.575  -46.633 1.00 41.22  ? 376 LYS A O     1 
ATOM   2867 C  CB    . LYS A 1 388 ? -41.040 8.920   -45.436 1.00 42.22  ? 376 LYS A CB    1 
ATOM   2868 C  CG    . LYS A 1 388 ? -42.196 7.994   -45.922 1.00 45.34  ? 376 LYS A CG    1 
ATOM   2869 C  CD    . LYS A 1 388 ? -42.817 7.060   -44.888 1.00 48.21  ? 376 LYS A CD    1 
ATOM   2870 C  CE    . LYS A 1 388 ? -44.124 6.435   -45.507 1.00 52.39  ? 376 LYS A CE    1 
ATOM   2871 N  NZ    . LYS A 1 388 ? -45.108 5.945   -44.481 1.00 55.64  ? 376 LYS A NZ    1 
ATOM   2872 N  N     . THR A 1 389 ? -39.662 11.635  -45.289 1.00 40.42  ? 377 THR A N     1 
ATOM   2873 C  CA    . THR A 1 389 ? -38.682 12.555  -44.802 1.00 40.29  ? 377 THR A CA    1 
ATOM   2874 C  C     . THR A 1 389 ? -37.947 11.861  -43.638 1.00 39.79  ? 377 THR A C     1 
ATOM   2875 O  O     . THR A 1 389 ? -38.455 10.899  -43.060 1.00 39.94  ? 377 THR A O     1 
ATOM   2876 C  CB    . THR A 1 389 ? -39.325 13.847  -44.327 1.00 42.11  ? 377 THR A CB    1 
ATOM   2877 O  OG1   . THR A 1 389 ? -40.082 13.555  -43.152 1.00 41.82  ? 377 THR A OG1   1 
ATOM   2878 C  CG2   . THR A 1 389 ? -40.298 14.464  -45.429 1.00 41.25  ? 377 THR A CG2   1 
ATOM   2879 N  N     . VAL A 1 390 ? -36.733 12.311  -43.359 1.00 40.07  ? 378 VAL A N     1 
ATOM   2880 C  CA    . VAL A 1 390 ? -35.951 11.879  -42.214 1.00 40.03  ? 378 VAL A CA    1 
ATOM   2881 C  C     . VAL A 1 390 ? -36.721 12.064  -40.918 1.00 41.22  ? 378 VAL A C     1 
ATOM   2882 O  O     . VAL A 1 390 ? -36.725 11.183  -40.093 1.00 42.53  ? 378 VAL A O     1 
ATOM   2883 C  CB    . VAL A 1 390 ? -34.660 12.677  -42.130 1.00 40.61  ? 378 VAL A CB    1 
ATOM   2884 C  CG1   . VAL A 1 390 ? -33.962 12.503  -40.753 1.00 38.30  ? 378 VAL A CG1   1 
ATOM   2885 C  CG2   . VAL A 1 390 ? -33.739 12.283  -43.277 1.00 39.29  ? 378 VAL A CG2   1 
ATOM   2886 N  N     . GLY A 1 391 ? -37.358 13.212  -40.735 1.00 42.57  ? 379 GLY A N     1 
ATOM   2887 C  CA    . GLY A 1 391 ? -38.185 13.478  -39.547 1.00 43.15  ? 379 GLY A CA    1 
ATOM   2888 C  C     . GLY A 1 391 ? -39.366 12.516  -39.356 1.00 43.56  ? 379 GLY A C     1 
ATOM   2889 O  O     . GLY A 1 391 ? -39.774 12.253  -38.239 1.00 43.04  ? 379 GLY A O     1 
ATOM   2890 N  N     . ASP A 1 392 ? -39.925 11.994  -40.433 1.00 43.04  ? 380 ASP A N     1 
ATOM   2891 C  CA    . ASP A 1 392 ? -41.007 11.056  -40.300 1.00 43.63  ? 380 ASP A CA    1 
ATOM   2892 C  C     . ASP A 1 392 ? -40.540 9.617   -39.969 1.00 41.32  ? 380 ASP A C     1 
ATOM   2893 O  O     . ASP A 1 392 ? -41.299 8.867   -39.426 1.00 42.57  ? 380 ASP A O     1 
ATOM   2894 C  CB    . ASP A 1 392 ? -41.823 11.041  -41.602 1.00 45.85  ? 380 ASP A CB    1 
ATOM   2895 C  CG    . ASP A 1 392 ? -42.724 12.303  -41.755 1.00 52.67  ? 380 ASP A CG    1 
ATOM   2896 O  OD1   . ASP A 1 392 ? -42.913 13.114  -40.775 1.00 57.32  ? 380 ASP A OD1   1 
ATOM   2897 O  OD2   . ASP A 1 392 ? -43.248 12.480  -42.878 1.00 61.80  ? 380 ASP A OD2   1 
ATOM   2898 N  N     . VAL A 1 393 ? -39.319 9.237   -40.303 1.00 38.58  ? 381 VAL A N     1 
ATOM   2899 C  CA    . VAL A 1 393 ? -38.834 7.893   -40.038 1.00 37.53  ? 381 VAL A CA    1 
ATOM   2900 C  C     . VAL A 1 393 ? -37.954 7.840   -38.771 1.00 36.42  ? 381 VAL A C     1 
ATOM   2901 O  O     . VAL A 1 393 ? -37.841 6.799   -38.157 1.00 35.90  ? 381 VAL A O     1 
ATOM   2902 C  CB    . VAL A 1 393 ? -38.046 7.324   -41.249 1.00 36.74  ? 381 VAL A CB    1 
ATOM   2903 C  CG1   . VAL A 1 393 ? -38.796 7.582   -42.579 1.00 34.85  ? 381 VAL A CG1   1 
ATOM   2904 C  CG2   . VAL A 1 393 ? -36.655 7.910   -41.323 1.00 36.87  ? 381 VAL A CG2   1 
ATOM   2905 N  N     . LYS A 1 394 ? -37.375 8.968   -38.363 1.00 36.27  ? 382 LYS A N     1 
ATOM   2906 C  CA    . LYS A 1 394 ? -36.468 8.947   -37.267 1.00 36.39  ? 382 LYS A CA    1 
ATOM   2907 C  C     . LYS A 1 394 ? -37.170 8.470   -35.987 1.00 35.05  ? 382 LYS A C     1 
ATOM   2908 O  O     . LYS A 1 394 ? -38.178 9.013   -35.619 1.00 34.07  ? 382 LYS A O     1 
ATOM   2909 C  CB    . LYS A 1 394 ? -35.864 10.329  -37.013 1.00 36.98  ? 382 LYS A CB    1 
ATOM   2910 C  CG    . LYS A 1 394 ? -34.651 10.156  -36.132 1.00 40.46  ? 382 LYS A CG    1 
ATOM   2911 C  CD    . LYS A 1 394 ? -33.718 11.295  -36.113 1.00 46.78  ? 382 LYS A CD    1 
ATOM   2912 C  CE    . LYS A 1 394 ? -32.602 10.971  -35.067 1.00 47.33  ? 382 LYS A CE    1 
ATOM   2913 N  NZ    . LYS A 1 394 ? -32.207 12.212  -34.352 1.00 49.88  ? 382 LYS A NZ    1 
ATOM   2914 N  N     . TYR A 1 395 ? -36.626 7.467   -35.316 1.00 33.06  ? 383 TYR A N     1 
ATOM   2915 C  CA    . TYR A 1 395 ? -37.283 6.896   -34.085 1.00 34.40  ? 383 TYR A CA    1 
ATOM   2916 C  C     . TYR A 1 395 ? -38.709 6.390   -34.287 1.00 35.38  ? 383 TYR A C     1 
ATOM   2917 O  O     . TYR A 1 395 ? -39.446 6.256   -33.313 1.00 35.83  ? 383 TYR A O     1 
ATOM   2918 C  CB    . TYR A 1 395 ? -37.271 7.909   -32.916 1.00 34.25  ? 383 TYR A CB    1 
ATOM   2919 C  CG    . TYR A 1 395 ? -35.840 8.223   -32.499 1.00 34.51  ? 383 TYR A CG    1 
ATOM   2920 C  CD1   . TYR A 1 395 ? -34.934 7.190   -32.281 1.00 34.20  ? 383 TYR A CD1   1 
ATOM   2921 C  CD2   . TYR A 1 395 ? -35.388 9.534   -32.331 1.00 34.83  ? 383 TYR A CD2   1 
ATOM   2922 C  CE1   . TYR A 1 395 ? -33.623 7.435   -31.931 1.00 33.67  ? 383 TYR A CE1   1 
ATOM   2923 C  CE2   . TYR A 1 395 ? -34.013 9.792   -31.966 1.00 35.79  ? 383 TYR A CE2   1 
ATOM   2924 C  CZ    . TYR A 1 395 ? -33.158 8.729   -31.769 1.00 35.98  ? 383 TYR A CZ    1 
ATOM   2925 O  OH    . TYR A 1 395 ? -31.818 8.911   -31.414 1.00 34.82  ? 383 TYR A OH    1 
ATOM   2926 N  N     . ASN A 1 396 ? -39.111 6.136   -35.545 1.00 35.52  ? 384 ASN A N     1 
ATOM   2927 C  CA    . ASN A 1 396 ? -40.480 5.710   -35.807 1.00 35.81  ? 384 ASN A CA    1 
ATOM   2928 C  C     . ASN A 1 396 ? -40.504 4.193   -35.753 1.00 36.58  ? 384 ASN A C     1 
ATOM   2929 O  O     . ASN A 1 396 ? -40.383 3.504   -36.774 1.00 35.88  ? 384 ASN A O     1 
ATOM   2930 C  CB    . ASN A 1 396 ? -40.923 6.234   -37.162 1.00 35.93  ? 384 ASN A CB    1 
ATOM   2931 C  CG    . ASN A 1 396 ? -42.390 6.021   -37.414 1.00 37.62  ? 384 ASN A CG    1 
ATOM   2932 O  OD1   . ASN A 1 396 ? -43.002 5.104   -36.853 1.00 38.81  ? 384 ASN A OD1   1 
ATOM   2933 N  ND2   . ASN A 1 396 ? -42.971 6.865   -38.263 1.00 35.08  ? 384 ASN A ND2   1 
ATOM   2934 N  N     . TYR A 1 397 ? -40.563 3.649   -34.547 1.00 35.93  ? 385 TYR A N     1 
ATOM   2935 C  CA    . TYR A 1 397 ? -40.503 2.190   -34.418 1.00 36.84  ? 385 TYR A CA    1 
ATOM   2936 C  C     . TYR A 1 397 ? -41.683 1.464   -35.088 1.00 37.52  ? 385 TYR A C     1 
ATOM   2937 O  O     . TYR A 1 397 ? -41.488 0.367   -35.602 1.00 37.29  ? 385 TYR A O     1 
ATOM   2938 C  CB    . TYR A 1 397 ? -40.386 1.750   -32.966 1.00 35.65  ? 385 TYR A CB    1 
ATOM   2939 C  CG    . TYR A 1 397 ? -41.474 2.270   -32.096 1.00 38.38  ? 385 TYR A CG    1 
ATOM   2940 C  CD1   . TYR A 1 397 ? -41.378 3.518   -31.513 1.00 40.07  ? 385 TYR A CD1   1 
ATOM   2941 C  CD2   . TYR A 1 397 ? -42.636 1.529   -31.886 1.00 43.35  ? 385 TYR A CD2   1 
ATOM   2942 C  CE1   . TYR A 1 397 ? -42.399 4.021   -30.718 1.00 44.48  ? 385 TYR A CE1   1 
ATOM   2943 C  CE2   . TYR A 1 397 ? -43.673 2.012   -31.067 1.00 44.72  ? 385 TYR A CE2   1 
ATOM   2944 C  CZ    . TYR A 1 397 ? -43.532 3.255   -30.492 1.00 46.04  ? 385 TYR A CZ    1 
ATOM   2945 O  OH    . TYR A 1 397 ? -44.502 3.749   -29.701 1.00 47.37  ? 385 TYR A OH    1 
ATOM   2946 N  N     . GLU A 1 398 ? -42.882 2.052   -35.096 1.00 38.55  ? 386 GLU A N     1 
ATOM   2947 C  CA    . GLU A 1 398 ? -44.013 1.402   -35.773 1.00 41.18  ? 386 GLU A CA    1 
ATOM   2948 C  C     . GLU A 1 398 ? -43.787 1.296   -37.299 1.00 41.06  ? 386 GLU A C     1 
ATOM   2949 O  O     . GLU A 1 398 ? -44.109 0.288   -37.883 1.00 40.64  ? 386 GLU A O     1 
ATOM   2950 C  CB    . GLU A 1 398 ? -45.338 2.112   -35.513 1.00 42.84  ? 386 GLU A CB    1 
ATOM   2951 C  CG    . GLU A 1 398 ? -45.743 2.042   -34.028 1.00 47.83  ? 386 GLU A CG    1 
ATOM   2952 C  CD    . GLU A 1 398 ? -46.998 2.800   -33.738 1.00 52.08  ? 386 GLU A CD    1 
ATOM   2953 O  OE1   . GLU A 1 398 ? -47.018 4.036   -33.879 1.00 58.14  ? 386 GLU A OE1   1 
ATOM   2954 O  OE2   . GLU A 1 398 ? -47.960 2.159   -33.356 1.00 58.40  ? 386 GLU A OE2   1 
ATOM   2955 N  N     . LEU A 1 399 ? -43.183 2.316   -37.911 1.00 40.74  ? 387 LEU A N     1 
ATOM   2956 C  CA    . LEU A 1 399 ? -42.849 2.229   -39.325 1.00 40.67  ? 387 LEU A CA    1 
ATOM   2957 C  C     . LEU A 1 399 ? -41.801 1.160   -39.546 1.00 39.69  ? 387 LEU A C     1 
ATOM   2958 O  O     . LEU A 1 399 ? -41.921 0.355   -40.476 1.00 38.40  ? 387 LEU A O     1 
ATOM   2959 C  CB    . LEU A 1 399 ? -42.398 3.574   -39.862 1.00 41.39  ? 387 LEU A CB    1 
ATOM   2960 C  CG    . LEU A 1 399 ? -42.022 3.629   -41.355 1.00 43.05  ? 387 LEU A CG    1 
ATOM   2961 C  CD1   . LEU A 1 399 ? -43.187 3.147   -42.256 1.00 42.12  ? 387 LEU A CD1   1 
ATOM   2962 C  CD2   . LEU A 1 399 ? -41.650 5.076   -41.680 1.00 45.31  ? 387 LEU A CD2   1 
ATOM   2963 N  N     . ALA A 1 400 ? -40.796 1.105   -38.669 1.00 37.57  ? 388 ALA A N     1 
ATOM   2964 C  CA    . ALA A 1 400 ? -39.801 0.072   -38.783 1.00 37.76  ? 388 ALA A CA    1 
ATOM   2965 C  C     . ALA A 1 400 ? -40.428 -1.338  -38.716 1.00 38.45  ? 388 ALA A C     1 
ATOM   2966 O  O     . ALA A 1 400 ? -40.090 -2.218  -39.536 1.00 37.54  ? 388 ALA A O     1 
ATOM   2967 C  CB    . ALA A 1 400 ? -38.679 0.236   -37.702 1.00 36.32  ? 388 ALA A CB    1 
ATOM   2968 N  N     . GLU A 1 401 ? -41.312 -1.545  -37.736 1.00 39.71  ? 389 GLU A N     1 
ATOM   2969 C  CA    . GLU A 1 401 ? -42.010 -2.821  -37.578 1.00 41.50  ? 389 GLU A CA    1 
ATOM   2970 C  C     . GLU A 1 401 ? -42.795 -3.198  -38.833 1.00 42.45  ? 389 GLU A C     1 
ATOM   2971 O  O     . GLU A 1 401 ? -42.711 -4.356  -39.272 1.00 41.53  ? 389 GLU A O     1 
ATOM   2972 C  CB    . GLU A 1 401 ? -42.947 -2.839  -36.345 1.00 42.56  ? 389 GLU A CB    1 
ATOM   2973 C  CG    . GLU A 1 401 ? -42.145 -2.840  -35.036 1.00 44.14  ? 389 GLU A CG    1 
ATOM   2974 C  CD    . GLU A 1 401 ? -42.888 -2.321  -33.825 1.00 45.69  ? 389 GLU A CD    1 
ATOM   2975 O  OE1   . GLU A 1 401 ? -44.008 -1.802  -33.970 1.00 43.59  ? 389 GLU A OE1   1 
ATOM   2976 O  OE2   . GLU A 1 401 ? -42.326 -2.431  -32.699 1.00 49.50  ? 389 GLU A OE2   1 
ATOM   2977 N  N     . GLU A 1 402 ? -43.573 -2.261  -39.379 1.00 43.69  ? 390 GLU A N     1 
ATOM   2978 C  CA    . GLU A 1 402 ? -44.340 -2.532  -40.613 1.00 44.84  ? 390 GLU A CA    1 
ATOM   2979 C  C     . GLU A 1 402 ? -43.405 -2.896  -41.761 1.00 43.77  ? 390 GLU A C     1 
ATOM   2980 O  O     . GLU A 1 402 ? -43.675 -3.846  -42.504 1.00 42.83  ? 390 GLU A O     1 
ATOM   2981 C  CB    . GLU A 1 402 ? -45.051 -1.291  -41.116 1.00 47.36  ? 390 GLU A CB    1 
ATOM   2982 C  CG    . GLU A 1 402 ? -46.180 -0.771  -40.304 1.00 55.42  ? 390 GLU A CG    1 
ATOM   2983 C  CD    . GLU A 1 402 ? -46.866 0.411   -41.017 1.00 65.48  ? 390 GLU A CD    1 
ATOM   2984 O  OE1   . GLU A 1 402 ? -47.152 0.275   -42.244 1.00 68.64  ? 390 GLU A OE1   1 
ATOM   2985 O  OE2   . GLU A 1 402 ? -47.094 1.466   -40.349 1.00 71.35  ? 390 GLU A OE2   1 
ATOM   2986 N  N     . PHE A 1 403 ? -42.311 -2.137  -41.920 1.00 41.07  ? 391 PHE A N     1 
ATOM   2987 C  CA    . PHE A 1 403 ? -41.398 -2.421  -43.005 1.00 41.47  ? 391 PHE A CA    1 
ATOM   2988 C  C     . PHE A 1 403 ? -40.830 -3.853  -42.853 1.00 41.50  ? 391 PHE A C     1 
ATOM   2989 O  O     . PHE A 1 403 ? -40.764 -4.611  -43.845 1.00 41.14  ? 391 PHE A O     1 
ATOM   2990 C  CB    . PHE A 1 403 ? -40.258 -1.386  -43.093 1.00 40.55  ? 391 PHE A CB    1 
ATOM   2991 C  CG    . PHE A 1 403 ? -39.308 -1.632  -44.255 1.00 41.12  ? 391 PHE A CG    1 
ATOM   2992 C  CD1   . PHE A 1 403 ? -39.522 -1.025  -45.476 1.00 43.62  ? 391 PHE A CD1   1 
ATOM   2993 C  CD2   . PHE A 1 403 ? -38.242 -2.505  -44.134 1.00 39.66  ? 391 PHE A CD2   1 
ATOM   2994 C  CE1   . PHE A 1 403 ? -38.683 -1.261  -46.548 1.00 42.51  ? 391 PHE A CE1   1 
ATOM   2995 C  CE2   . PHE A 1 403 ? -37.387 -2.750  -45.223 1.00 41.63  ? 391 PHE A CE2   1 
ATOM   2996 C  CZ    . PHE A 1 403 ? -37.624 -2.125  -46.425 1.00 40.34  ? 391 PHE A CZ    1 
ATOM   2997 N  N     . ALA A 1 404 ? -40.403 -4.214  -41.633 1.00 41.25  ? 392 ALA A N     1 
ATOM   2998 C  CA    . ALA A 1 404 ? -39.769 -5.537  -41.403 1.00 41.67  ? 392 ALA A CA    1 
ATOM   2999 C  C     . ALA A 1 404 ? -40.752 -6.674  -41.715 1.00 43.74  ? 392 ALA A C     1 
ATOM   3000 O  O     . ALA A 1 404 ? -40.401 -7.651  -42.361 1.00 42.63  ? 392 ALA A O     1 
ATOM   3001 C  CB    . ALA A 1 404 ? -39.253 -5.671  -39.969 1.00 40.98  ? 392 ALA A CB    1 
ATOM   3002 N  N     . LYS A 1 405 ? -41.973 -6.510  -41.225 1.00 45.62  ? 393 LYS A N     1 
ATOM   3003 C  CA    . LYS A 1 405 ? -43.042 -7.466  -41.389 1.00 48.47  ? 393 LYS A CA    1 
ATOM   3004 C  C     . LYS A 1 405 ? -43.438 -7.589  -42.868 1.00 49.19  ? 393 LYS A C     1 
ATOM   3005 O  O     . LYS A 1 405 ? -43.544 -8.670  -43.384 1.00 49.66  ? 393 LYS A O     1 
ATOM   3006 C  CB    . LYS A 1 405 ? -44.228 -7.061  -40.506 1.00 49.14  ? 393 LYS A CB    1 
ATOM   3007 C  CG    . LYS A 1 405 ? -45.332 -8.050  -40.539 1.00 54.55  ? 393 LYS A CG    1 
ATOM   3008 C  CD    . LYS A 1 405 ? -46.424 -7.744  -39.538 1.00 59.94  ? 393 LYS A CD    1 
ATOM   3009 C  CE    . LYS A 1 405 ? -47.738 -8.408  -39.954 1.00 64.95  ? 393 LYS A CE    1 
ATOM   3010 N  NZ    . LYS A 1 405 ? -48.429 -7.630  -41.050 1.00 67.11  ? 393 LYS A NZ    1 
ATOM   3011 N  N     . GLU A 1 406 ? -43.576 -6.478  -43.570 1.00 50.24  ? 394 GLU A N     1 
ATOM   3012 C  CA    . GLU A 1 406 ? -43.950 -6.528  -44.980 1.00 51.60  ? 394 GLU A CA    1 
ATOM   3013 C  C     . GLU A 1 406 ? -42.876 -7.104  -45.906 1.00 50.29  ? 394 GLU A C     1 
ATOM   3014 O  O     . GLU A 1 406 ? -43.197 -7.698  -46.954 1.00 49.65  ? 394 GLU A O     1 
ATOM   3015 C  CB    . GLU A 1 406 ? -44.396 -5.157  -45.473 1.00 52.51  ? 394 GLU A CB    1 
ATOM   3016 C  CG    . GLU A 1 406 ? -45.842 -4.879  -45.056 1.00 59.84  ? 394 GLU A CG    1 
ATOM   3017 C  CD    . GLU A 1 406 ? -46.300 -3.447  -45.367 1.00 65.94  ? 394 GLU A CD    1 
ATOM   3018 O  OE1   . GLU A 1 406 ? -47.448 -3.084  -45.004 1.00 69.10  ? 394 GLU A OE1   1 
ATOM   3019 O  OE2   . GLU A 1 406 ? -45.500 -2.689  -45.963 1.00 70.93  ? 394 GLU A OE2   1 
ATOM   3020 N  N     . ASN A 1 407 ? -41.609 -6.936  -45.541 1.00 48.25  ? 395 ASN A N     1 
ATOM   3021 C  CA    . ASN A 1 407 ? -40.520 -7.348  -46.437 1.00 47.70  ? 395 ASN A CA    1 
ATOM   3022 C  C     . ASN A 1 407 ? -39.824 -8.594  -45.938 1.00 47.12  ? 395 ASN A C     1 
ATOM   3023 O  O     . ASN A 1 407 ? -38.816 -9.033  -46.499 1.00 46.72  ? 395 ASN A O     1 
ATOM   3024 C  CB    . ASN A 1 407 ? -39.552 -6.177  -46.628 1.00 47.25  ? 395 ASN A CB    1 
ATOM   3025 C  CG    . ASN A 1 407 ? -40.133 -5.077  -47.518 1.00 48.43  ? 395 ASN A CG    1 
ATOM   3026 O  OD1   . ASN A 1 407 ? -40.084 -5.197  -48.733 1.00 52.41  ? 395 ASN A OD1   1 
ATOM   3027 N  ND2   . ASN A 1 407 ? -40.667 -4.010  -46.923 1.00 45.07  ? 395 ASN A ND2   1 
ATOM   3028 N  N     . ASP A 1 408 ? -40.373 -9.174  -44.882 1.00 47.46  ? 396 ASP A N     1 
ATOM   3029 C  CA    . ASP A 1 408 ? -39.813 -10.385 -44.275 1.00 47.98  ? 396 ASP A CA    1 
ATOM   3030 C  C     . ASP A 1 408 ? -38.331 -10.264 -43.959 1.00 45.93  ? 396 ASP A C     1 
ATOM   3031 O  O     . ASP A 1 408 ? -37.555 -11.122 -44.344 1.00 45.90  ? 396 ASP A O     1 
ATOM   3032 C  CB    . ASP A 1 408 ? -39.996 -11.584 -45.192 1.00 49.38  ? 396 ASP A CB    1 
ATOM   3033 C  CG    . ASP A 1 408 ? -41.441 -11.959 -45.382 1.00 55.36  ? 396 ASP A CG    1 
ATOM   3034 O  OD1   . ASP A 1 408 ? -42.289 -11.644 -44.504 1.00 61.55  ? 396 ASP A OD1   1 
ATOM   3035 O  OD2   . ASP A 1 408 ? -41.733 -12.608 -46.421 1.00 63.85  ? 396 ASP A OD2   1 
ATOM   3036 N  N     . CYS A 1 409 ? -37.949 -9.213  -43.254 1.00 43.60  ? 397 CYS A N     1 
ATOM   3037 C  CA    . CYS A 1 409 ? -36.551 -8.996  -42.927 1.00 42.11  ? 397 CYS A CA    1 
ATOM   3038 C  C     . CYS A 1 409 ? -36.394 -8.540  -41.472 1.00 40.65  ? 397 CYS A C     1 
ATOM   3039 O  O     . CYS A 1 409 ? -37.367 -8.386  -40.737 1.00 41.28  ? 397 CYS A O     1 
ATOM   3040 C  CB    . CYS A 1 409 ? -35.926 -7.972  -43.892 1.00 42.01  ? 397 CYS A CB    1 
ATOM   3041 S  SG    . CYS A 1 409 ? -36.571 -6.255  -43.786 1.00 43.04  ? 397 CYS A SG    1 
ATOM   3042 N  N     . VAL A 1 410 ? -35.150 -8.357  -41.063 1.00 39.62  ? 398 VAL A N     1 
ATOM   3043 C  CA    . VAL A 1 410 ? -34.817 -7.678  -39.819 1.00 37.66  ? 398 VAL A CA    1 
ATOM   3044 C  C     . VAL A 1 410 ? -34.351 -6.313  -40.259 1.00 36.49  ? 398 VAL A C     1 
ATOM   3045 O  O     . VAL A 1 410 ? -33.575 -6.187  -41.226 1.00 36.36  ? 398 VAL A O     1 
ATOM   3046 C  CB    . VAL A 1 410 ? -33.707 -8.423  -39.007 1.00 36.62  ? 398 VAL A CB    1 
ATOM   3047 C  CG1   . VAL A 1 410 ? -33.291 -7.585  -37.816 1.00 32.85  ? 398 VAL A CG1   1 
ATOM   3048 C  CG2   . VAL A 1 410 ? -34.204 -9.794  -38.548 1.00 36.52  ? 398 VAL A CG2   1 
ATOM   3049 N  N     . LEU A 1 411 ? -34.864 -5.296  -39.578 1.00 35.58  ? 399 LEU A N     1 
ATOM   3050 C  CA    . LEU A 1 411 ? -34.491 -3.940  -39.818 1.00 34.96  ? 399 LEU A CA    1 
ATOM   3051 C  C     . LEU A 1 411 ? -33.769 -3.401  -38.605 1.00 33.58  ? 399 LEU A C     1 
ATOM   3052 O  O     . LEU A 1 411 ? -34.245 -3.516  -37.492 1.00 34.96  ? 399 LEU A O     1 
ATOM   3053 C  CB    . LEU A 1 411 ? -35.747 -3.104  -40.119 1.00 36.21  ? 399 LEU A CB    1 
ATOM   3054 C  CG    . LEU A 1 411 ? -35.464 -1.700  -40.567 1.00 37.68  ? 399 LEU A CG    1 
ATOM   3055 C  CD1   . LEU A 1 411 ? -34.804 -1.749  -41.976 1.00 36.61  ? 399 LEU A CD1   1 
ATOM   3056 C  CD2   . LEU A 1 411 ? -36.798 -0.937  -40.581 1.00 42.53  ? 399 LEU A CD2   1 
ATOM   3057 N  N     . VAL A 1 412 ? -32.588 -2.850  -38.823 1.00 33.43  ? 400 VAL A N     1 
ATOM   3058 C  CA    . VAL A 1 412 ? -31.756 -2.258  -37.780 1.00 31.68  ? 400 VAL A CA    1 
ATOM   3059 C  C     . VAL A 1 412 ? -31.683 -0.787  -38.175 1.00 31.65  ? 400 VAL A C     1 
ATOM   3060 O  O     . VAL A 1 412 ? -30.940 -0.440  -39.055 1.00 31.58  ? 400 VAL A O     1 
ATOM   3061 C  CB    . VAL A 1 412 ? -30.319 -2.877  -37.697 1.00 31.82  ? 400 VAL A CB    1 
ATOM   3062 C  CG1   . VAL A 1 412 ? -29.433 -2.134  -36.662 1.00 28.34  ? 400 VAL A CG1   1 
ATOM   3063 C  CG2   . VAL A 1 412 ? -30.354 -4.339  -37.366 1.00 30.99  ? 400 VAL A CG2   1 
ATOM   3064 N  N     . LEU A 1 413 ? -32.501 0.054   -37.559 1.00 32.41  ? 401 LEU A N     1 
ATOM   3065 C  CA    . LEU A 1 413 ? -32.556 1.518   -37.833 1.00 31.23  ? 401 LEU A CA    1 
ATOM   3066 C  C     . LEU A 1 413 ? -31.646 2.217   -36.862 1.00 31.44  ? 401 LEU A C     1 
ATOM   3067 O  O     . LEU A 1 413 ? -31.997 2.373   -35.708 1.00 30.78  ? 401 LEU A O     1 
ATOM   3068 C  CB    . LEU A 1 413 ? -33.953 2.046   -37.645 1.00 32.10  ? 401 LEU A CB    1 
ATOM   3069 C  CG    . LEU A 1 413 ? -34.174 3.535   -37.947 1.00 32.31  ? 401 LEU A CG    1 
ATOM   3070 C  CD1   . LEU A 1 413 ? -33.734 3.863   -39.386 1.00 30.21  ? 401 LEU A CD1   1 
ATOM   3071 C  CD2   . LEU A 1 413 ? -35.659 3.945   -37.675 1.00 34.80  ? 401 LEU A CD2   1 
ATOM   3072 N  N     . LYS A 1 414 ? -30.473 2.618   -37.348 1.00 32.16  ? 402 LYS A N     1 
ATOM   3073 C  CA    . LYS A 1 414 ? -29.385 3.162   -36.544 1.00 33.36  ? 402 LYS A CA    1 
ATOM   3074 C  C     . LYS A 1 414 ? -29.661 4.626   -36.086 1.00 33.71  ? 402 LYS A C     1 
ATOM   3075 O  O     . LYS A 1 414 ? -30.201 5.421   -36.840 1.00 36.03  ? 402 LYS A O     1 
ATOM   3076 C  CB    . LYS A 1 414 ? -28.090 3.090   -37.380 1.00 33.32  ? 402 LYS A CB    1 
ATOM   3077 C  CG    . LYS A 1 414 ? -27.703 1.684   -37.717 1.00 35.85  ? 402 LYS A CG    1 
ATOM   3078 C  CD    . LYS A 1 414 ? -26.404 1.487   -38.466 1.00 40.73  ? 402 LYS A CD    1 
ATOM   3079 C  CE    . LYS A 1 414 ? -26.318 2.162   -39.776 1.00 42.17  ? 402 LYS A CE    1 
ATOM   3080 N  NZ    . LYS A 1 414 ? -25.331 1.440   -40.643 1.00 41.16  ? 402 LYS A NZ    1 
ATOM   3081 N  N     . SER A 1 415 ? -29.354 4.933   -34.834 1.00 32.14  ? 403 SER A N     1 
ATOM   3082 C  CA    . SER A 1 415 ? -29.374 6.291   -34.281 1.00 32.41  ? 403 SER A CA    1 
ATOM   3083 C  C     . SER A 1 415 ? -28.858 6.132   -32.858 1.00 31.45  ? 403 SER A C     1 
ATOM   3084 O  O     . SER A 1 415 ? -28.513 5.008   -32.463 1.00 31.43  ? 403 SER A O     1 
ATOM   3085 C  CB    . SER A 1 415 ? -30.806 6.865   -34.245 1.00 33.50  ? 403 SER A CB    1 
ATOM   3086 O  OG    . SER A 1 415 ? -31.226 7.346   -35.497 1.00 36.79  ? 403 SER A OG    1 
ATOM   3087 N  N     . ALA A 1 416 ? -28.847 7.219   -32.072 1.00 31.38  ? 404 ALA A N     1 
ATOM   3088 C  CA    . ALA A 1 416 ? -28.257 7.165   -30.747 1.00 32.40  ? 404 ALA A CA    1 
ATOM   3089 C  C     . ALA A 1 416 ? -28.923 6.068   -29.942 1.00 31.95  ? 404 ALA A C     1 
ATOM   3090 O  O     . ALA A 1 416 ? -28.249 5.352   -29.171 1.00 33.18  ? 404 ALA A O     1 
ATOM   3091 C  CB    . ALA A 1 416 ? -28.334 8.518   -30.045 1.00 33.02  ? 404 ALA A CB    1 
ATOM   3092 N  N     . THR A 1 417 ? -30.225 5.905   -30.153 1.00 30.66  ? 405 THR A N     1 
ATOM   3093 C  CA    . THR A 1 417 ? -30.936 4.720   -29.727 1.00 31.03  ? 405 THR A CA    1 
ATOM   3094 C  C     . THR A 1 417 ? -31.247 3.974   -31.007 1.00 31.62  ? 405 THR A C     1 
ATOM   3095 O  O     . THR A 1 417 ? -31.870 4.538   -31.930 1.00 31.04  ? 405 THR A O     1 
ATOM   3096 C  CB    . THR A 1 417 ? -32.276 5.062   -28.989 1.00 31.74  ? 405 THR A CB    1 
ATOM   3097 O  OG1   . THR A 1 417 ? -31.974 5.791   -27.793 1.00 32.54  ? 405 THR A OG1   1 
ATOM   3098 C  CG2   . THR A 1 417 ? -33.042 3.777   -28.604 1.00 26.82  ? 405 THR A CG2   1 
ATOM   3099 N  N     . THR A 1 418 ? -30.775 2.740   -31.105 1.00 31.19  ? 406 THR A N     1 
ATOM   3100 C  CA    . THR A 1 418 ? -30.985 1.946   -32.318 1.00 31.27  ? 406 THR A CA    1 
ATOM   3101 C  C     . THR A 1 418 ? -32.169 1.009   -32.098 1.00 31.48  ? 406 THR A C     1 
ATOM   3102 O  O     . THR A 1 418 ? -32.354 0.459   -31.028 1.00 30.01  ? 406 THR A O     1 
ATOM   3103 C  CB    . THR A 1 418 ? -29.698 1.182   -32.692 1.00 32.20  ? 406 THR A CB    1 
ATOM   3104 O  OG1   . THR A 1 418 ? -28.753 2.119   -33.231 1.00 31.16  ? 406 THR A OG1   1 
ATOM   3105 C  CG2   . THR A 1 418 ? -29.943 0.025   -33.765 1.00 30.96  ? 406 THR A CG2   1 
ATOM   3106 N  N     . ILE A 1 419 ? -33.021 0.911   -33.116 1.00 32.66  ? 407 ILE A N     1 
ATOM   3107 C  CA    . ILE A 1 419 ? -34.192 0.046   -33.095 1.00 32.67  ? 407 ILE A CA    1 
ATOM   3108 C  C     . ILE A 1 419 ? -33.903 -1.202  -33.932 1.00 32.13  ? 407 ILE A C     1 
ATOM   3109 O  O     . ILE A 1 419 ? -33.441 -1.101  -35.066 1.00 31.82  ? 407 ILE A O     1 
ATOM   3110 C  CB    . ILE A 1 419 ? -35.409 0.774   -33.695 1.00 33.11  ? 407 ILE A CB    1 
ATOM   3111 C  CG1   . ILE A 1 419 ? -35.761 2.003   -32.840 1.00 35.21  ? 407 ILE A CG1   1 
ATOM   3112 C  CG2   . ILE A 1 419 ? -36.648 -0.168  -33.763 1.00 32.01  ? 407 ILE A CG2   1 
ATOM   3113 C  CD1   . ILE A 1 419 ? -36.813 2.926   -33.505 1.00 34.67  ? 407 ILE A CD1   1 
ATOM   3114 N  N     . VAL A 1 420 ? -34.158 -2.368  -33.378 1.00 32.05  ? 408 VAL A N     1 
ATOM   3115 C  CA    . VAL A 1 420 ? -33.919 -3.643  -34.072 1.00 32.00  ? 408 VAL A CA    1 
ATOM   3116 C  C     . VAL A 1 420 ? -35.250 -4.349  -34.070 1.00 33.95  ? 408 VAL A C     1 
ATOM   3117 O  O     . VAL A 1 420 ? -35.852 -4.526  -33.003 1.00 34.85  ? 408 VAL A O     1 
ATOM   3118 C  CB    . VAL A 1 420 ? -32.859 -4.472  -33.339 1.00 31.15  ? 408 VAL A CB    1 
ATOM   3119 C  CG1   . VAL A 1 420 ? -32.679 -5.849  -33.978 1.00 29.39  ? 408 VAL A CG1   1 
ATOM   3120 C  CG2   . VAL A 1 420 ? -31.501 -3.730  -33.271 1.00 30.94  ? 408 VAL A CG2   1 
ATOM   3121 N  N     . THR A 1 421 ? -35.772 -4.716  -35.238 1.00 35.56  ? 409 THR A N     1 
ATOM   3122 C  CA    . THR A 1 421 ? -37.098 -5.369  -35.269 1.00 36.23  ? 409 THR A CA    1 
ATOM   3123 C  C     . THR A 1 421 ? -37.191 -6.370  -36.403 1.00 36.36  ? 409 THR A C     1 
ATOM   3124 O  O     . THR A 1 421 ? -36.563 -6.206  -37.427 1.00 35.58  ? 409 THR A O     1 
ATOM   3125 C  CB    . THR A 1 421 ? -38.239 -4.293  -35.344 1.00 37.65  ? 409 THR A CB    1 
ATOM   3126 O  OG1   . THR A 1 421 ? -39.528 -4.912  -35.159 1.00 38.23  ? 409 THR A OG1   1 
ATOM   3127 C  CG2   . THR A 1 421 ? -38.215 -3.533  -36.646 1.00 35.92  ? 409 THR A CG2   1 
ATOM   3128 N  N     . ASP A 1 422 ? -37.945 -7.433  -36.190 1.00 38.53  ? 410 ASP A N     1 
ATOM   3129 C  CA    . ASP A 1 422 ? -38.350 -8.322  -37.264 1.00 39.86  ? 410 ASP A CA    1 
ATOM   3130 C  C     . ASP A 1 422 ? -39.861 -8.201  -37.597 1.00 42.81  ? 410 ASP A C     1 
ATOM   3131 O  O     . ASP A 1 422 ? -40.390 -8.978  -38.413 1.00 42.83  ? 410 ASP A O     1 
ATOM   3132 C  CB    . ASP A 1 422 ? -38.006 -9.743  -36.884 1.00 41.28  ? 410 ASP A CB    1 
ATOM   3133 C  CG    . ASP A 1 422 ? -38.823 -10.253 -35.708 1.00 42.40  ? 410 ASP A CG    1 
ATOM   3134 O  OD1   . ASP A 1 422 ? -39.668 -9.529  -35.126 1.00 44.15  ? 410 ASP A OD1   1 
ATOM   3135 O  OD2   . ASP A 1 422 ? -38.579 -11.386 -35.333 1.00 45.68  ? 410 ASP A OD2   1 
ATOM   3136 N  N     . GLY A 1 423 ? -40.536 -7.221  -36.994 1.00 43.62  ? 411 GLY A N     1 
ATOM   3137 C  CA    . GLY A 1 423 ? -41.971 -7.041  -37.208 1.00 46.56  ? 411 GLY A CA    1 
ATOM   3138 C  C     . GLY A 1 423 ? -42.800 -7.539  -36.033 1.00 49.02  ? 411 GLY A C     1 
ATOM   3139 O  O     . GLY A 1 423 ? -43.908 -7.074  -35.826 1.00 49.93  ? 411 GLY A O     1 
ATOM   3140 N  N     . GLU A 1 424 ? -42.271 -8.482  -35.261 1.00 50.16  ? 412 GLU A N     1 
ATOM   3141 C  CA    . GLU A 1 424 ? -43.017 -9.055  -34.141 1.00 52.89  ? 412 GLU A CA    1 
ATOM   3142 C  C     . GLU A 1 424 ? -42.398 -8.591  -32.851 1.00 51.41  ? 412 GLU A C     1 
ATOM   3143 O  O     . GLU A 1 424 ? -43.086 -8.177  -31.946 1.00 53.46  ? 412 GLU A O     1 
ATOM   3144 C  CB    . GLU A 1 424 ? -42.976 -10.596 -34.181 1.00 54.46  ? 412 GLU A CB    1 
ATOM   3145 C  CG    . GLU A 1 424 ? -43.462 -11.227 -35.492 1.00 59.62  ? 412 GLU A CG    1 
ATOM   3146 C  CD    . GLU A 1 424 ? -44.952 -11.004 -35.733 1.00 65.18  ? 412 GLU A CD    1 
ATOM   3147 O  OE1   . GLU A 1 424 ? -45.714 -11.936 -35.447 1.00 69.51  ? 412 GLU A OE1   1 
ATOM   3148 O  OE2   . GLU A 1 424 ? -45.367 -9.899  -36.198 1.00 70.57  ? 412 GLU A OE2   1 
ATOM   3149 N  N     . LYS A 1 425 ? -41.088 -8.730  -32.768 1.00 49.25  ? 413 LYS A N     1 
ATOM   3150 C  CA    . LYS A 1 425 ? -40.322 -8.347  -31.616 1.00 48.43  ? 413 LYS A CA    1 
ATOM   3151 C  C     . LYS A 1 425 ? -39.482 -7.098  -31.965 1.00 45.27  ? 413 LYS A C     1 
ATOM   3152 O  O     . LYS A 1 425 ? -38.897 -7.049  -33.018 1.00 43.37  ? 413 LYS A O     1 
ATOM   3153 C  CB    . LYS A 1 425 ? -39.423 -9.524  -31.238 1.00 49.17  ? 413 LYS A CB    1 
ATOM   3154 C  CG    . LYS A 1 425 ? -38.800 -9.393  -29.876 1.00 52.87  ? 413 LYS A CG    1 
ATOM   3155 C  CD    . LYS A 1 425 ? -38.410 -10.768 -29.256 1.00 58.05  ? 413 LYS A CD    1 
ATOM   3156 C  CE    . LYS A 1 425 ? -36.991 -11.179 -29.632 1.00 58.59  ? 413 LYS A CE    1 
ATOM   3157 N  NZ    . LYS A 1 425 ? -36.482 -12.292 -28.805 1.00 60.63  ? 413 LYS A NZ    1 
ATOM   3158 N  N     . THR A 1 426 ? -39.449 -6.124  -31.065 1.00 43.65  ? 414 THR A N     1 
ATOM   3159 C  CA    . THR A 1 426 ? -38.676 -4.905  -31.215 1.00 42.81  ? 414 THR A CA    1 
ATOM   3160 C  C     . THR A 1 426 ? -37.813 -4.659  -29.990 1.00 41.46  ? 414 THR A C     1 
ATOM   3161 O  O     . THR A 1 426 ? -38.291 -4.750  -28.847 1.00 42.15  ? 414 THR A O     1 
ATOM   3162 C  CB    . THR A 1 426 ? -39.592 -3.679  -31.438 1.00 44.01  ? 414 THR A CB    1 
ATOM   3163 O  OG1   . THR A 1 426 ? -40.344 -3.911  -32.623 1.00 43.73  ? 414 THR A OG1   1 
ATOM   3164 C  CG2   . THR A 1 426 ? -38.751 -2.361  -31.566 1.00 40.70  ? 414 THR A CG2   1 
ATOM   3165 N  N     . LEU A 1 427 ? -36.529 -4.417  -30.243 1.00 38.58  ? 415 LEU A N     1 
ATOM   3166 C  CA    . LEU A 1 427 ? -35.547 -4.189  -29.199 1.00 37.41  ? 415 LEU A CA    1 
ATOM   3167 C  C     . LEU A 1 427 ? -34.887 -2.813  -29.416 1.00 35.88  ? 415 LEU A C     1 
ATOM   3168 O  O     . LEU A 1 427 ? -34.716 -2.352  -30.561 1.00 34.15  ? 415 LEU A O     1 
ATOM   3169 C  CB    . LEU A 1 427 ? -34.510 -5.319  -29.153 1.00 36.99  ? 415 LEU A CB    1 
ATOM   3170 C  CG    . LEU A 1 427 ? -35.082 -6.777  -29.175 1.00 39.12  ? 415 LEU A CG    1 
ATOM   3171 C  CD1   . LEU A 1 427 ? -34.792 -7.463  -30.518 1.00 40.23  ? 415 LEU A CD1   1 
ATOM   3172 C  CD2   . LEU A 1 427 ? -34.525 -7.651  -28.110 1.00 38.29  ? 415 LEU A CD2   1 
ATOM   3173 N  N     . PHE A 1 428 ? -34.594 -2.147  -28.312 1.00 34.63  ? 416 PHE A N     1 
ATOM   3174 C  CA    . PHE A 1 428 ? -33.967 -0.841  -28.335 1.00 34.02  ? 416 PHE A CA    1 
ATOM   3175 C  C     . PHE A 1 428 ? -32.561 -0.929  -27.747 1.00 33.23  ? 416 PHE A C     1 
ATOM   3176 O  O     . PHE A 1 428 ? -32.364 -1.462  -26.648 1.00 33.37  ? 416 PHE A O     1 
ATOM   3177 C  CB    . PHE A 1 428 ? -34.777 0.134   -27.514 1.00 34.58  ? 416 PHE A CB    1 
ATOM   3178 C  CG    . PHE A 1 428 ? -36.190 0.322   -27.990 1.00 35.11  ? 416 PHE A CG    1 
ATOM   3179 C  CD1   . PHE A 1 428 ? -36.462 1.096   -29.087 1.00 37.05  ? 416 PHE A CD1   1 
ATOM   3180 C  CD2   . PHE A 1 428 ? -37.229 -0.231  -27.305 1.00 40.79  ? 416 PHE A CD2   1 
ATOM   3181 C  CE1   . PHE A 1 428 ? -37.761 1.271   -29.547 1.00 42.80  ? 416 PHE A CE1   1 
ATOM   3182 C  CE2   . PHE A 1 428 ? -38.551 -0.048  -27.738 1.00 42.12  ? 416 PHE A CE2   1 
ATOM   3183 C  CZ    . PHE A 1 428 ? -38.807 0.690   -28.873 1.00 41.50  ? 416 PHE A CZ    1 
ATOM   3184 N  N     . ASN A 1 429 ? -31.591 -0.367  -28.453 1.00 33.40  ? 417 ASN A N     1 
ATOM   3185 C  CA    . ASN A 1 429 ? -30.213 -0.343  -27.946 1.00 32.78  ? 417 ASN A CA    1 
ATOM   3186 C  C     . ASN A 1 429 ? -29.866 1.016   -27.383 1.00 32.81  ? 417 ASN A C     1 
ATOM   3187 O  O     . ASN A 1 429 ? -30.054 2.001   -28.083 1.00 30.57  ? 417 ASN A O     1 
ATOM   3188 C  CB    . ASN A 1 429 ? -29.200 -0.690  -29.058 1.00 32.11  ? 417 ASN A CB    1 
ATOM   3189 C  CG    . ASN A 1 429 ? -27.822 -0.850  -28.494 1.00 32.29  ? 417 ASN A CG    1 
ATOM   3190 O  OD1   . ASN A 1 429 ? -27.585 -1.781  -27.707 1.00 32.51  ? 417 ASN A OD1   1 
ATOM   3191 N  ND2   . ASN A 1 429 ? -26.949 0.092   -28.772 1.00 31.35  ? 417 ASN A ND2   1 
ATOM   3192 N  N     . ILE A 1 430 ? -29.343 1.066   -26.152 1.00 33.40  ? 418 ILE A N     1 
ATOM   3193 C  CA    . ILE A 1 430 ? -28.943 2.334   -25.549 1.00 34.71  ? 418 ILE A CA    1 
ATOM   3194 C  C     . ILE A 1 430 ? -27.413 2.422   -25.251 1.00 34.19  ? 418 ILE A C     1 
ATOM   3195 O  O     . ILE A 1 430 ? -26.981 3.319   -24.606 1.00 35.69  ? 418 ILE A O     1 
ATOM   3196 C  CB    . ILE A 1 430 ? -29.805 2.668   -24.317 1.00 35.53  ? 418 ILE A CB    1 
ATOM   3197 C  CG1   . ILE A 1 430 ? -29.740 1.553   -23.269 1.00 38.86  ? 418 ILE A CG1   1 
ATOM   3198 C  CG2   . ILE A 1 430 ? -31.307 2.830   -24.728 1.00 36.28  ? 418 ILE A CG2   1 
ATOM   3199 C  CD1   . ILE A 1 430 ? -30.345 1.916   -21.910 1.00 41.33  ? 418 ILE A CD1   1 
ATOM   3200 N  N     . THR A 1 431 ? -26.598 1.486   -25.725 1.00 33.50  ? 419 THR A N     1 
ATOM   3201 C  CA    . THR A 1 431 ? -25.138 1.605   -25.586 1.00 32.39  ? 419 THR A CA    1 
ATOM   3202 C  C     . THR A 1 431 ? -24.573 2.505   -26.660 1.00 32.43  ? 419 THR A C     1 
ATOM   3203 O  O     . THR A 1 431 ? -25.210 2.752   -27.674 1.00 33.21  ? 419 THR A O     1 
ATOM   3204 C  CB    . THR A 1 431 ? -24.416 0.202   -25.634 1.00 31.97  ? 419 THR A CB    1 
ATOM   3205 O  OG1   . THR A 1 431 ? -24.527 -0.341  -26.959 1.00 28.15  ? 419 THR A OG1   1 
ATOM   3206 C  CG2   . THR A 1 431 ? -25.067 -0.786  -24.584 1.00 32.73  ? 419 THR A CG2   1 
ATOM   3207 N  N     . GLY A 1 432 ? -23.361 3.004   -26.456 1.00 33.52  ? 420 GLY A N     1 
ATOM   3208 C  CA    . GLY A 1 432 ? -22.713 3.868   -27.441 1.00 33.64  ? 420 GLY A CA    1 
ATOM   3209 C  C     . GLY A 1 432 ? -22.534 5.282   -26.969 1.00 34.66  ? 420 GLY A C     1 
ATOM   3210 O  O     . GLY A 1 432 ? -22.945 5.646   -25.854 1.00 35.32  ? 420 GLY A O     1 
ATOM   3211 N  N     . ASN A 1 433 ? -21.868 6.078   -27.798 1.00 33.50  ? 421 ASN A N     1 
ATOM   3212 C  CA    . ASN A 1 433 ? -21.731 7.499   -27.541 1.00 33.03  ? 421 ASN A CA    1 
ATOM   3213 C  C     . ASN A 1 433 ? -21.445 8.213   -28.884 1.00 34.04  ? 421 ASN A C     1 
ATOM   3214 O  O     . ASN A 1 433 ? -21.520 7.567   -29.948 1.00 32.75  ? 421 ASN A O     1 
ATOM   3215 C  CB    . ASN A 1 433 ? -20.642 7.775   -26.498 1.00 32.11  ? 421 ASN A CB    1 
ATOM   3216 C  CG    . ASN A 1 433 ? -19.261 7.275   -26.922 1.00 33.01  ? 421 ASN A CG    1 
ATOM   3217 O  OD1   . ASN A 1 433 ? -18.884 7.340   -28.088 1.00 32.54  ? 421 ASN A OD1   1 
ATOM   3218 N  ND2   . ASN A 1 433 ? -18.487 6.805   -25.952 1.00 33.52  ? 421 ASN A ND2   1 
ATOM   3219 N  N     . THR A 1 434 ? -21.151 9.520   -28.824 1.00 33.77  ? 422 THR A N     1 
ATOM   3220 C  CA    . THR A 1 434 ? -20.991 10.307  -30.035 1.00 34.25  ? 422 THR A CA    1 
ATOM   3221 C  C     . THR A 1 434 ? -19.699 9.998   -30.802 1.00 34.51  ? 422 THR A C     1 
ATOM   3222 O  O     . THR A 1 434 ? -19.500 10.508  -31.912 1.00 36.25  ? 422 THR A O     1 
ATOM   3223 C  CB    . THR A 1 434 ? -21.080 11.804  -29.778 1.00 33.56  ? 422 THR A CB    1 
ATOM   3224 O  OG1   . THR A 1 434 ? -19.890 12.267  -29.117 1.00 32.37  ? 422 THR A OG1   1 
ATOM   3225 C  CG2   . THR A 1 434 ? -22.378 12.122  -28.940 1.00 33.95  ? 422 THR A CG2   1 
ATOM   3226 N  N     . GLY A 1 435 ? -18.822 9.174   -30.246 1.00 34.22  ? 423 GLY A N     1 
ATOM   3227 C  CA    . GLY A 1 435 ? -17.660 8.800   -30.996 1.00 34.31  ? 423 GLY A CA    1 
ATOM   3228 C  C     . GLY A 1 435 ? -18.037 7.925   -32.180 1.00 33.50  ? 423 GLY A C     1 
ATOM   3229 O  O     . GLY A 1 435 ? -17.240 7.761   -33.080 1.00 33.16  ? 423 GLY A O     1 
ATOM   3230 N  N     . LEU A 1 436 ? -19.231 7.335   -32.158 1.00 32.86  ? 424 LEU A N     1 
ATOM   3231 C  CA    . LEU A 1 436 ? -19.721 6.546   -33.283 1.00 32.95  ? 424 LEU A CA    1 
ATOM   3232 C  C     . LEU A 1 436 ? -20.316 7.416   -34.395 1.00 33.82  ? 424 LEU A C     1 
ATOM   3233 O  O     . LEU A 1 436 ? -20.613 6.925   -35.477 1.00 33.77  ? 424 LEU A O     1 
ATOM   3234 C  CB    . LEU A 1 436 ? -20.781 5.587   -32.763 1.00 32.97  ? 424 LEU A CB    1 
ATOM   3235 C  CG    . LEU A 1 436 ? -20.303 4.481   -31.809 1.00 32.20  ? 424 LEU A CG    1 
ATOM   3236 C  CD1   . LEU A 1 436 ? -21.533 3.660   -31.337 1.00 29.43  ? 424 LEU A CD1   1 
ATOM   3237 C  CD2   . LEU A 1 436 ? -19.249 3.634   -32.521 1.00 28.44  ? 424 LEU A CD2   1 
ATOM   3238 N  N     . SER A 1 437 ? -20.521 8.709   -34.110 1.00 35.27  ? 425 SER A N     1 
ATOM   3239 C  CA    . SER A 1 437 ? -21.036 9.701   -35.067 1.00 34.56  ? 425 SER A CA    1 
ATOM   3240 C  C     . SER A 1 437 ? -19.924 10.174  -35.992 1.00 35.24  ? 425 SER A C     1 
ATOM   3241 O  O     . SER A 1 437 ? -19.525 11.367  -35.988 1.00 36.01  ? 425 SER A O     1 
ATOM   3242 C  CB    . SER A 1 437 ? -21.610 10.892  -34.300 1.00 36.08  ? 425 SER A CB    1 
ATOM   3243 O  OG    . SER A 1 437 ? -22.715 10.466  -33.478 1.00 39.97  ? 425 SER A OG    1 
ATOM   3244 N  N     . LYS A 1 438 ? -19.418 9.237   -36.786 1.00 34.38  ? 426 LYS A N     1 
ATOM   3245 C  CA    . LYS A 1 438 ? -18.236 9.484   -37.577 1.00 35.89  ? 426 LYS A CA    1 
ATOM   3246 C  C     . LYS A 1 438 ? -18.142 8.361   -38.615 1.00 35.82  ? 426 LYS A C     1 
ATOM   3247 O  O     . LYS A 1 438 ? -18.414 7.193   -38.319 1.00 35.53  ? 426 LYS A O     1 
ATOM   3248 C  CB    . LYS A 1 438 ? -17.015 9.455   -36.612 1.00 37.02  ? 426 LYS A CB    1 
ATOM   3249 C  CG    . LYS A 1 438 ? -15.810 10.188  -37.046 1.00 39.94  ? 426 LYS A CG    1 
ATOM   3250 C  CD    . LYS A 1 438 ? -14.551 9.856   -36.182 1.00 41.32  ? 426 LYS A CD    1 
ATOM   3251 C  CE    . LYS A 1 438 ? -14.260 10.952  -35.110 1.00 43.39  ? 426 LYS A CE    1 
ATOM   3252 N  NZ    . LYS A 1 438 ? -15.134 10.774  -33.906 1.00 47.79  ? 426 LYS A NZ    1 
ATOM   3253 N  N     . GLY A 1 439 ? -17.788 8.719   -39.835 1.00 35.83  ? 427 GLY A N     1 
ATOM   3254 C  CA    . GLY A 1 439 ? -17.606 7.770   -40.907 1.00 35.34  ? 427 GLY A CA    1 
ATOM   3255 C  C     . GLY A 1 439 ? -16.826 6.525   -40.519 1.00 34.54  ? 427 GLY A C     1 
ATOM   3256 O  O     . GLY A 1 439 ? -15.742 6.589   -39.951 1.00 35.36  ? 427 GLY A O     1 
ATOM   3257 N  N     . GLY A 1 440 ? -17.358 5.386   -40.892 1.00 33.34  ? 428 GLY A N     1 
ATOM   3258 C  CA    . GLY A 1 440 ? -16.685 4.108   -40.628 1.00 33.05  ? 428 GLY A CA    1 
ATOM   3259 C  C     . GLY A 1 440 ? -17.367 3.249   -39.584 1.00 31.57  ? 428 GLY A C     1 
ATOM   3260 O  O     . GLY A 1 440 ? -17.248 2.003   -39.624 1.00 31.83  ? 428 GLY A O     1 
ATOM   3261 N  N     . SER A 1 441 ? -18.087 3.896   -38.669 1.00 31.05  ? 429 SER A N     1 
ATOM   3262 C  CA    . SER A 1 441 ? -18.768 3.206   -37.548 1.00 33.02  ? 429 SER A CA    1 
ATOM   3263 C  C     . SER A 1 441 ? -19.728 2.150   -38.061 1.00 31.29  ? 429 SER A C     1 
ATOM   3264 O  O     . SER A 1 441 ? -19.782 1.037   -37.536 1.00 30.85  ? 429 SER A O     1 
ATOM   3265 C  CB    . SER A 1 441 ? -19.623 4.204   -36.715 1.00 32.46  ? 429 SER A CB    1 
ATOM   3266 O  OG    . SER A 1 441 ? -18.679 5.072   -36.125 1.00 41.59  ? 429 SER A OG    1 
ATOM   3267 N  N     . GLY A 1 442 ? -20.557 2.573   -38.999 1.00 29.04  ? 430 GLY A N     1 
ATOM   3268 C  CA    . GLY A 1 442 ? -21.546 1.711   -39.627 1.00 29.19  ? 430 GLY A CA    1 
ATOM   3269 C  C     . GLY A 1 442 ? -20.930 0.512   -40.339 1.00 29.30  ? 430 GLY A C     1 
ATOM   3270 O  O     . GLY A 1 442 ? -21.472 -0.579  -40.338 1.00 30.56  ? 430 GLY A O     1 
ATOM   3271 N  N     . ASP A 1 443 ? -19.817 0.729   -40.988 1.00 29.50  ? 431 ASP A N     1 
ATOM   3272 C  CA    . ASP A 1 443 ? -19.171 -0.303  -41.738 1.00 30.74  ? 431 ASP A CA    1 
ATOM   3273 C  C     . ASP A 1 443 ? -18.752 -1.410  -40.763 1.00 29.78  ? 431 ASP A C     1 
ATOM   3274 O  O     . ASP A 1 443 ? -18.955 -2.551  -41.037 1.00 31.56  ? 431 ASP A O     1 
ATOM   3275 C  CB    . ASP A 1 443 ? -17.929 0.228   -42.426 1.00 30.76  ? 431 ASP A CB    1 
ATOM   3276 C  CG    . ASP A 1 443 ? -18.229 1.277   -43.490 1.00 34.84  ? 431 ASP A CG    1 
ATOM   3277 O  OD1   . ASP A 1 443 ? -19.368 1.322   -43.992 1.00 35.77  ? 431 ASP A OD1   1 
ATOM   3278 O  OD2   . ASP A 1 443 ? -17.304 2.079   -43.774 1.00 41.36  ? 431 ASP A OD2   1 
ATOM   3279 N  N     . VAL A 1 444 ? -18.228 -1.033  -39.604 1.00 29.53  ? 432 VAL A N     1 
ATOM   3280 C  CA    . VAL A 1 444 ? -17.883 -2.018  -38.579 1.00 28.68  ? 432 VAL A CA    1 
ATOM   3281 C  C     . VAL A 1 444 ? -19.093 -2.835  -38.184 1.00 29.39  ? 432 VAL A C     1 
ATOM   3282 O  O     . VAL A 1 444 ? -19.018 -4.054  -38.148 1.00 30.44  ? 432 VAL A O     1 
ATOM   3283 C  CB    . VAL A 1 444 ? -17.224 -1.363  -37.347 1.00 27.56  ? 432 VAL A CB    1 
ATOM   3284 C  CG1   . VAL A 1 444 ? -16.938 -2.401  -36.244 1.00 26.45  ? 432 VAL A CG1   1 
ATOM   3285 C  CG2   . VAL A 1 444 ? -15.880 -0.684  -37.793 1.00 25.81  ? 432 VAL A CG2   1 
ATOM   3286 N  N     . LEU A 1 445 ? -20.200 -2.166  -37.864 1.00 28.83  ? 433 LEU A N     1 
ATOM   3287 C  CA    . LEU A 1 445 ? -21.374 -2.863  -37.369 1.00 29.42  ? 433 LEU A CA    1 
ATOM   3288 C  C     . LEU A 1 445 ? -21.852 -3.912  -38.423 1.00 29.17  ? 433 LEU A C     1 
ATOM   3289 O  O     . LEU A 1 445 ? -22.242 -5.013  -38.084 1.00 30.15  ? 433 LEU A O     1 
ATOM   3290 C  CB    . LEU A 1 445 ? -22.511 -1.867  -37.136 1.00 28.72  ? 433 LEU A CB    1 
ATOM   3291 C  CG    . LEU A 1 445 ? -23.804 -2.522  -36.639 1.00 29.42  ? 433 LEU A CG    1 
ATOM   3292 C  CD1   . LEU A 1 445 ? -23.637 -3.049  -35.227 1.00 27.18  ? 433 LEU A CD1   1 
ATOM   3293 C  CD2   . LEU A 1 445 ? -24.916 -1.472  -36.697 1.00 30.09  ? 433 LEU A CD2   1 
ATOM   3294 N  N     . THR A 1 446 ? -21.824 -3.547  -39.696 1.00 29.61  ? 434 THR A N     1 
ATOM   3295 C  CA    . THR A 1 446 ? -22.215 -4.499  -40.753 1.00 29.68  ? 434 THR A CA    1 
ATOM   3296 C  C     . THR A 1 446 ? -21.469 -5.821  -40.721 1.00 29.64  ? 434 THR A C     1 
ATOM   3297 O  O     . THR A 1 446 ? -22.064 -6.897  -40.884 1.00 29.25  ? 434 THR A O     1 
ATOM   3298 C  CB    . THR A 1 446 ? -22.022 -3.874  -42.124 1.00 30.73  ? 434 THR A CB    1 
ATOM   3299 O  OG1   . THR A 1 446 ? -22.918 -2.758  -42.233 1.00 31.92  ? 434 THR A OG1   1 
ATOM   3300 C  CG2   . THR A 1 446 ? -22.296 -4.886  -43.269 1.00 30.75  ? 434 THR A CG2   1 
ATOM   3301 N  N     . GLY A 1 447 ? -20.154 -5.724  -40.554 1.00 28.65  ? 435 GLY A N     1 
ATOM   3302 C  CA    . GLY A 1 447 ? -19.320 -6.882  -40.410 1.00 29.43  ? 435 GLY A CA    1 
ATOM   3303 C  C     . GLY A 1 447 ? -19.637 -7.693  -39.156 1.00 28.84  ? 435 GLY A C     1 
ATOM   3304 O  O     . GLY A 1 447 ? -19.637 -8.902  -39.202 1.00 29.04  ? 435 GLY A O     1 
ATOM   3305 N  N     . MET A 1 448 ? -19.856 -7.015  -38.033 1.00 28.35  ? 436 MET A N     1 
ATOM   3306 C  CA    . MET A 1 448 ? -20.256 -7.685  -36.775 1.00 28.09  ? 436 MET A CA    1 
ATOM   3307 C  C     . MET A 1 448 ? -21.524 -8.523  -36.914 1.00 27.71  ? 436 MET A C     1 
ATOM   3308 O  O     . MET A 1 448 ? -21.602 -9.675  -36.491 1.00 27.68  ? 436 MET A O     1 
ATOM   3309 C  CB    . MET A 1 448 ? -20.484 -6.651  -35.688 1.00 27.87  ? 436 MET A CB    1 
ATOM   3310 C  CG    . MET A 1 448 ? -19.210 -5.877  -35.351 1.00 28.16  ? 436 MET A CG    1 
ATOM   3311 S  SD    . MET A 1 448 ? -19.483 -4.577  -34.121 1.00 30.58  ? 436 MET A SD    1 
ATOM   3312 C  CE    . MET A 1 448 ? -19.736 -5.575  -32.663 1.00 25.00  ? 436 MET A CE    1 
ATOM   3313 N  N     . ILE A 1 449 ? -22.534 -7.925  -37.514 1.00 28.82  ? 437 ILE A N     1 
ATOM   3314 C  CA    . ILE A 1 449 ? -23.787 -8.643  -37.738 1.00 29.04  ? 437 ILE A CA    1 
ATOM   3315 C  C     . ILE A 1 449 ? -23.572 -9.885  -38.615 1.00 30.31  ? 437 ILE A C     1 
ATOM   3316 O  O     . ILE A 1 449 ? -24.038 -10.983 -38.251 1.00 31.77  ? 437 ILE A O     1 
ATOM   3317 C  CB    . ILE A 1 449 ? -24.856 -7.733  -38.334 1.00 28.89  ? 437 ILE A CB    1 
ATOM   3318 C  CG1   . ILE A 1 449 ? -25.173 -6.611  -37.368 1.00 27.60  ? 437 ILE A CG1   1 
ATOM   3319 C  CG2   . ILE A 1 449 ? -26.169 -8.530  -38.630 1.00 26.79  ? 437 ILE A CG2   1 
ATOM   3320 C  CD1   . ILE A 1 449 ? -26.058 -5.522  -37.951 1.00 29.97  ? 437 ILE A CD1   1 
ATOM   3321 N  N     . ALA A 1 450 ? -22.911 -9.714  -39.775 1.00 31.12  ? 438 ALA A N     1 
ATOM   3322 C  CA    . ALA A 1 450 ? -22.632 -10.826 -40.702 1.00 31.49  ? 438 ALA A CA    1 
ATOM   3323 C  C     . ALA A 1 450 ? -21.896 -11.909 -39.959 1.00 32.48  ? 438 ALA A C     1 
ATOM   3324 O  O     . ALA A 1 450 ? -22.214 -13.092 -40.127 1.00 33.38  ? 438 ALA A O     1 
ATOM   3325 C  CB    . ALA A 1 450 ? -21.803 -10.387 -41.955 1.00 29.98  ? 438 ALA A CB    1 
ATOM   3326 N  N     . GLY A 1 451 ? -20.909 -11.506 -39.154 1.00 31.67  ? 439 GLY A N     1 
ATOM   3327 C  CA    . GLY A 1 451 ? -20.090 -12.439 -38.360 1.00 31.82  ? 439 GLY A CA    1 
ATOM   3328 C  C     . GLY A 1 451 ? -20.899 -13.286 -37.404 1.00 32.44  ? 439 GLY A C     1 
ATOM   3329 O  O     . GLY A 1 451 ? -20.744 -14.512 -37.319 1.00 33.08  ? 439 GLY A O     1 
ATOM   3330 N  N     . PHE A 1 452 ? -21.808 -12.651 -36.693 1.00 31.72  ? 440 PHE A N     1 
ATOM   3331 C  CA    . PHE A 1 452 ? -22.593 -13.394 -35.751 1.00 31.38  ? 440 PHE A CA    1 
ATOM   3332 C  C     . PHE A 1 452 ? -23.566 -14.308 -36.469 1.00 32.13  ? 440 PHE A C     1 
ATOM   3333 O  O     . PHE A 1 452 ? -23.861 -15.430 -35.977 1.00 32.81  ? 440 PHE A O     1 
ATOM   3334 C  CB    . PHE A 1 452 ? -23.302 -12.465 -34.756 1.00 31.66  ? 440 PHE A CB    1 
ATOM   3335 C  CG    . PHE A 1 452 ? -22.428 -12.001 -33.623 1.00 28.43  ? 440 PHE A CG    1 
ATOM   3336 C  CD1   . PHE A 1 452 ? -21.971 -12.881 -32.677 1.00 31.01  ? 440 PHE A CD1   1 
ATOM   3337 C  CD2   . PHE A 1 452 ? -22.097 -10.679 -33.472 1.00 27.81  ? 440 PHE A CD2   1 
ATOM   3338 C  CE1   . PHE A 1 452 ? -21.181 -12.438 -31.591 1.00 28.35  ? 440 PHE A CE1   1 
ATOM   3339 C  CE2   . PHE A 1 452 ? -21.279 -10.265 -32.425 1.00 26.22  ? 440 PHE A CE2   1 
ATOM   3340 C  CZ    . PHE A 1 452 ? -20.859 -11.132 -31.490 1.00 29.68  ? 440 PHE A CZ    1 
ATOM   3341 N  N     . ILE A 1 453 ? -24.084 -13.882 -37.612 1.00 32.07  ? 441 ILE A N     1 
ATOM   3342 C  CA    . ILE A 1 453 ? -24.925 -14.783 -38.367 1.00 32.73  ? 441 ILE A CA    1 
ATOM   3343 C  C     . ILE A 1 453 ? -24.142 -16.021 -38.800 1.00 33.34  ? 441 ILE A C     1 
ATOM   3344 O  O     . ILE A 1 453 ? -24.637 -17.128 -38.705 1.00 33.00  ? 441 ILE A O     1 
ATOM   3345 C  CB    . ILE A 1 453 ? -25.616 -14.153 -39.575 1.00 33.08  ? 441 ILE A CB    1 
ATOM   3346 C  CG1   . ILE A 1 453 ? -26.571 -13.035 -39.119 1.00 32.79  ? 441 ILE A CG1   1 
ATOM   3347 C  CG2   . ILE A 1 453 ? -26.404 -15.260 -40.344 1.00 34.26  ? 441 ILE A CG2   1 
ATOM   3348 C  CD1   . ILE A 1 453 ? -27.049 -12.072 -40.253 1.00 31.94  ? 441 ILE A CD1   1 
ATOM   3349 N  N     . ALA A 1 454 ? -22.925 -15.821 -39.282 1.00 32.61  ? 442 ALA A N     1 
ATOM   3350 C  CA    . ALA A 1 454 ? -22.096 -16.910 -39.723 1.00 33.03  ? 442 ALA A CA    1 
ATOM   3351 C  C     . ALA A 1 454 ? -21.818 -17.942 -38.567 1.00 33.81  ? 442 ALA A C     1 
ATOM   3352 O  O     . ALA A 1 454 ? -21.625 -19.156 -38.815 1.00 33.80  ? 442 ALA A O     1 
ATOM   3353 C  CB    . ALA A 1 454 ? -20.792 -16.338 -40.240 1.00 30.62  ? 442 ALA A CB    1 
ATOM   3354 N  N     . GLN A 1 455 ? -21.739 -17.426 -37.343 1.00 33.10  ? 443 GLN A N     1 
ATOM   3355 C  CA    . GLN A 1 455 ? -21.475 -18.251 -36.176 1.00 35.78  ? 443 GLN A CA    1 
ATOM   3356 C  C     . GLN A 1 455 ? -22.744 -18.992 -35.713 1.00 36.27  ? 443 GLN A C     1 
ATOM   3357 O  O     . GLN A 1 455 ? -22.661 -19.786 -34.837 1.00 38.64  ? 443 GLN A O     1 
ATOM   3358 C  CB    . GLN A 1 455 ? -20.905 -17.399 -35.024 1.00 35.63  ? 443 GLN A CB    1 
ATOM   3359 C  CG    . GLN A 1 455 ? -19.495 -16.862 -35.286 1.00 36.60  ? 443 GLN A CG    1 
ATOM   3360 C  CD    . GLN A 1 455 ? -19.058 -15.897 -34.193 1.00 37.44  ? 443 GLN A CD    1 
ATOM   3361 O  OE1   . GLN A 1 455 ? -19.013 -16.244 -33.008 1.00 44.50  ? 443 GLN A OE1   1 
ATOM   3362 N  NE2   . GLN A 1 455 ? -18.759 -14.694 -34.577 1.00 32.41  ? 443 GLN A NE2   1 
ATOM   3363 N  N     . GLY A 1 456 ? -23.907 -18.719 -36.290 1.00 36.29  ? 444 GLY A N     1 
ATOM   3364 C  CA    . GLY A 1 456 ? -25.091 -19.523 -36.017 1.00 37.90  ? 444 GLY A CA    1 
ATOM   3365 C  C     . GLY A 1 456 ? -26.223 -18.757 -35.350 1.00 38.32  ? 444 GLY A C     1 
ATOM   3366 O  O     . GLY A 1 456 ? -27.231 -19.342 -35.078 1.00 38.80  ? 444 GLY A O     1 
ATOM   3367 N  N     . LEU A 1 457 ? -26.077 -17.447 -35.103 1.00 37.00  ? 445 LEU A N     1 
ATOM   3368 C  CA    . LEU A 1 457 ? -27.176 -16.720 -34.507 1.00 37.63  ? 445 LEU A CA    1 
ATOM   3369 C  C     . LEU A 1 457 ? -28.180 -16.359 -35.632 1.00 36.85  ? 445 LEU A C     1 
ATOM   3370 O  O     . LEU A 1 457 ? -27.806 -16.187 -36.780 1.00 34.36  ? 445 LEU A O     1 
ATOM   3371 C  CB    . LEU A 1 457 ? -26.729 -15.451 -33.764 1.00 36.49  ? 445 LEU A CB    1 
ATOM   3372 C  CG    . LEU A 1 457 ? -25.673 -15.412 -32.642 1.00 39.46  ? 445 LEU A CG    1 
ATOM   3373 C  CD1   . LEU A 1 457 ? -25.793 -14.057 -31.795 1.00 34.30  ? 445 LEU A CD1   1 
ATOM   3374 C  CD2   . LEU A 1 457 ? -25.584 -16.575 -31.792 1.00 37.76  ? 445 LEU A CD2   1 
ATOM   3375 N  N     . SER A 1 458 ? -29.458 -16.323 -35.285 1.00 38.23  ? 446 SER A N     1 
ATOM   3376 C  CA    . SER A 1 458 ? -30.508 -15.849 -36.184 1.00 38.76  ? 446 SER A CA    1 
ATOM   3377 C  C     . SER A 1 458 ? -30.176 -14.410 -36.557 1.00 38.20  ? 446 SER A C     1 
ATOM   3378 O  O     . SER A 1 458 ? -29.474 -13.722 -35.822 1.00 37.71  ? 446 SER A O     1 
ATOM   3379 C  CB    . SER A 1 458 ? -31.928 -15.904 -35.515 1.00 40.02  ? 446 SER A CB    1 
ATOM   3380 O  OG    . SER A 1 458 ? -32.153 -14.856 -34.543 1.00 38.81  ? 446 SER A OG    1 
ATOM   3381 N  N     . PRO A 1 459 ? -30.654 -13.950 -37.718 1.00 37.76  ? 447 PRO A N     1 
ATOM   3382 C  CA    . PRO A 1 459 ? -30.481 -12.508 -38.075 1.00 36.00  ? 447 PRO A CA    1 
ATOM   3383 C  C     . PRO A 1 459 ? -30.918 -11.507 -36.981 1.00 35.63  ? 447 PRO A C     1 
ATOM   3384 O  O     . PRO A 1 459 ? -30.235 -10.480 -36.754 1.00 35.70  ? 447 PRO A O     1 
ATOM   3385 C  CB    . PRO A 1 459 ? -31.316 -12.360 -39.345 1.00 35.85  ? 447 PRO A CB    1 
ATOM   3386 C  CG    . PRO A 1 459 ? -31.409 -13.780 -39.911 1.00 37.84  ? 447 PRO A CG    1 
ATOM   3387 C  CD    . PRO A 1 459 ? -31.393 -14.716 -38.752 1.00 37.97  ? 447 PRO A CD    1 
ATOM   3388 N  N     . LEU A 1 460 ? -32.012 -11.788 -36.281 1.00 35.43  ? 448 LEU A N     1 
ATOM   3389 C  CA    . LEU A 1 460 ? -32.470 -10.901 -35.229 1.00 35.31  ? 448 LEU A CA    1 
ATOM   3390 C  C     . LEU A 1 460 ? -31.488 -10.986 -34.049 1.00 34.33  ? 448 LEU A C     1 
ATOM   3391 O  O     . LEU A 1 460 ? -31.145 -9.956  -33.464 1.00 32.04  ? 448 LEU A O     1 
ATOM   3392 C  CB    . LEU A 1 460 ? -33.938 -11.205 -34.777 1.00 36.23  ? 448 LEU A CB    1 
ATOM   3393 C  CG    . LEU A 1 460 ? -34.519 -10.303 -33.666 1.00 36.46  ? 448 LEU A CG    1 
ATOM   3394 C  CD1   . LEU A 1 460 ? -34.817 -8.891  -34.221 1.00 36.60  ? 448 LEU A CD1   1 
ATOM   3395 C  CD2   . LEU A 1 460 ? -35.825 -10.917 -32.936 1.00 37.85  ? 448 LEU A CD2   1 
ATOM   3396 N  N     . GLU A 1 461 ? -31.065 -12.202 -33.681 1.00 35.16  ? 449 GLU A N     1 
ATOM   3397 C  CA    . GLU A 1 461 ? -30.130 -12.356 -32.558 1.00 35.83  ? 449 GLU A CA    1 
ATOM   3398 C  C     . GLU A 1 461 ? -28.809 -11.686 -32.881 1.00 33.39  ? 449 GLU A C     1 
ATOM   3399 O  O     . GLU A 1 461 ? -28.235 -10.998 -32.050 1.00 34.52  ? 449 GLU A O     1 
ATOM   3400 C  CB    . GLU A 1 461 ? -29.881 -13.834 -32.218 1.00 37.27  ? 449 GLU A CB    1 
ATOM   3401 C  CG    . GLU A 1 461 ? -31.055 -14.494 -31.532 1.00 40.10  ? 449 GLU A CG    1 
ATOM   3402 C  CD    . GLU A 1 461 ? -30.985 -16.038 -31.577 1.00 44.99  ? 449 GLU A CD    1 
ATOM   3403 O  OE1   . GLU A 1 461 ? -30.179 -16.660 -32.338 1.00 44.04  ? 449 GLU A OE1   1 
ATOM   3404 O  OE2   . GLU A 1 461 ? -31.789 -16.624 -30.841 1.00 47.28  ? 449 GLU A OE2   1 
ATOM   3405 N  N     . ALA A 1 462 ? -28.314 -11.917 -34.082 1.00 32.34  ? 450 ALA A N     1 
ATOM   3406 C  CA    . ALA A 1 462 ? -27.038 -11.358 -34.517 1.00 30.99  ? 450 ALA A CA    1 
ATOM   3407 C  C     . ALA A 1 462 ? -27.084 -9.830  -34.441 1.00 31.17  ? 450 ALA A C     1 
ATOM   3408 O  O     . ALA A 1 462 ? -26.126 -9.199  -33.981 1.00 30.05  ? 450 ALA A O     1 
ATOM   3409 C  CB    . ALA A 1 462 ? -26.742 -11.796 -35.909 1.00 30.13  ? 450 ALA A CB    1 
ATOM   3410 N  N     . SER A 1 463 ? -28.220 -9.243  -34.866 1.00 31.60  ? 451 SER A N     1 
ATOM   3411 C  CA    . SER A 1 463 ? -28.381 -7.795  -34.864 1.00 31.01  ? 451 SER A CA    1 
ATOM   3412 C  C     . SER A 1 463 ? -28.435 -7.231  -33.427 1.00 31.87  ? 451 SER A C     1 
ATOM   3413 O  O     . SER A 1 463 ? -27.859 -6.177  -33.131 1.00 32.07  ? 451 SER A O     1 
ATOM   3414 C  CB    . SER A 1 463 ? -29.634 -7.387  -35.659 1.00 31.84  ? 451 SER A CB    1 
ATOM   3415 O  OG    . SER A 1 463 ? -29.623 -7.866  -37.002 1.00 31.48  ? 451 SER A OG    1 
ATOM   3416 N  N     . THR A 1 464 ? -29.070 -7.977  -32.528 1.00 31.50  ? 452 THR A N     1 
ATOM   3417 C  CA    . THR A 1 464 ? -29.269 -7.556  -31.140 1.00 31.76  ? 452 THR A CA    1 
ATOM   3418 C  C     . THR A 1 464 ? -27.925 -7.505  -30.432 1.00 32.17  ? 452 THR A C     1 
ATOM   3419 O  O     . THR A 1 464 ? -27.567 -6.489  -29.818 1.00 31.44  ? 452 THR A O     1 
ATOM   3420 C  CB    . THR A 1 464 ? -30.156 -8.571  -30.426 1.00 32.57  ? 452 THR A CB    1 
ATOM   3421 O  OG1   . THR A 1 464 ? -31.450 -8.595  -31.072 1.00 31.89  ? 452 THR A OG1   1 
ATOM   3422 C  CG2   . THR A 1 464 ? -30.234 -8.319  -28.897 1.00 33.59  ? 452 THR A CG2   1 
ATOM   3423 N  N     . VAL A 1 465 ? -27.172 -8.590  -30.583 1.00 31.93  ? 453 VAL A N     1 
ATOM   3424 C  CA    . VAL A 1 465 ? -25.842 -8.723  -29.974 1.00 32.55  ? 453 VAL A CA    1 
ATOM   3425 C  C     . VAL A 1 465 ? -24.887 -7.689  -30.574 1.00 31.20  ? 453 VAL A C     1 
ATOM   3426 O  O     . VAL A 1 465 ? -24.129 -7.067  -29.838 1.00 30.02  ? 453 VAL A O     1 
ATOM   3427 C  CB    . VAL A 1 465 ? -25.288 -10.176 -30.165 1.00 33.60  ? 453 VAL A CB    1 
ATOM   3428 C  CG1   . VAL A 1 465 ? -23.837 -10.235 -29.797 1.00 36.83  ? 453 VAL A CG1   1 
ATOM   3429 C  CG2   . VAL A 1 465 ? -26.120 -11.195 -29.254 1.00 33.61  ? 453 VAL A CG2   1 
ATOM   3430 N  N     . SER A 1 466 ? -24.958 -7.470  -31.889 1.00 29.92  ? 454 SER A N     1 
ATOM   3431 C  CA    . SER A 1 466 ? -23.958 -6.617  -32.546 1.00 29.93  ? 454 SER A CA    1 
ATOM   3432 C  C     . SER A 1 466 ? -24.166 -5.136  -32.185 1.00 29.34  ? 454 SER A C     1 
ATOM   3433 O  O     . SER A 1 466 ? -23.188 -4.408  -31.919 1.00 28.51  ? 454 SER A O     1 
ATOM   3434 C  CB    . SER A 1 466 ? -23.991 -6.756  -34.079 1.00 30.42  ? 454 SER A CB    1 
ATOM   3435 O  OG    . SER A 1 466 ? -23.654 -8.065  -34.508 1.00 34.65  ? 454 SER A OG    1 
ATOM   3436 N  N     . VAL A 1 467 ? -25.420 -4.682  -32.163 1.00 28.90  ? 455 VAL A N     1 
ATOM   3437 C  CA    . VAL A 1 467 ? -25.677 -3.269  -31.828 1.00 28.64  ? 455 VAL A CA    1 
ATOM   3438 C  C     . VAL A 1 467 ? -25.247 -2.971  -30.415 1.00 29.08  ? 455 VAL A C     1 
ATOM   3439 O  O     . VAL A 1 467 ? -24.657 -1.919  -30.147 1.00 29.39  ? 455 VAL A O     1 
ATOM   3440 C  CB    . VAL A 1 467 ? -27.135 -2.780  -32.099 1.00 29.21  ? 455 VAL A CB    1 
ATOM   3441 C  CG1   . VAL A 1 467 ? -27.485 -2.916  -33.559 1.00 29.28  ? 455 VAL A CG1   1 
ATOM   3442 C  CG2   . VAL A 1 467 ? -28.184 -3.412  -31.152 1.00 28.18  ? 455 VAL A CG2   1 
ATOM   3443 N  N     . TYR A 1 468 ? -25.482 -3.907  -29.506 1.00 30.09  ? 456 TYR A N     1 
ATOM   3444 C  CA    . TYR A 1 468 ? -25.105 -3.687  -28.114 1.00 30.87  ? 456 TYR A CA    1 
ATOM   3445 C  C     . TYR A 1 468 ? -23.581 -3.601  -27.965 1.00 30.42  ? 456 TYR A C     1 
ATOM   3446 O  O     . TYR A 1 468 ? -23.042 -2.660  -27.381 1.00 28.52  ? 456 TYR A O     1 
ATOM   3447 C  CB    . TYR A 1 468 ? -25.637 -4.847  -27.244 1.00 32.18  ? 456 TYR A CB    1 
ATOM   3448 C  CG    . TYR A 1 468 ? -25.343 -4.629  -25.779 1.00 33.46  ? 456 TYR A CG    1 
ATOM   3449 C  CD1   . TYR A 1 468 ? -24.133 -5.047  -25.211 1.00 34.61  ? 456 TYR A CD1   1 
ATOM   3450 C  CD2   . TYR A 1 468 ? -26.268 -4.020  -24.969 1.00 35.92  ? 456 TYR A CD2   1 
ATOM   3451 C  CE1   . TYR A 1 468 ? -23.839 -4.824  -23.868 1.00 38.16  ? 456 TYR A CE1   1 
ATOM   3452 C  CE2   . TYR A 1 468 ? -26.010 -3.798  -23.621 1.00 38.16  ? 456 TYR A CE2   1 
ATOM   3453 C  CZ    . TYR A 1 468 ? -24.795 -4.212  -23.083 1.00 40.93  ? 456 TYR A CZ    1 
ATOM   3454 O  OH    . TYR A 1 468 ? -24.567 -4.038  -21.779 1.00 44.59  ? 456 TYR A OH    1 
ATOM   3455 N  N     . LEU A 1 469 ? -22.886 -4.594  -28.506 1.00 30.80  ? 457 LEU A N     1 
ATOM   3456 C  CA    . LEU A 1 469 ? -21.403 -4.678  -28.365 1.00 30.17  ? 457 LEU A CA    1 
ATOM   3457 C  C     . LEU A 1 469 ? -20.676 -3.537  -29.079 1.00 30.15  ? 457 LEU A C     1 
ATOM   3458 O  O     . LEU A 1 469 ? -19.643 -3.056  -28.610 1.00 29.36  ? 457 LEU A O     1 
ATOM   3459 C  CB    . LEU A 1 469 ? -20.887 -5.988  -28.932 1.00 31.08  ? 457 LEU A CB    1 
ATOM   3460 C  CG    . LEU A 1 469 ? -21.114 -7.272  -28.120 1.00 35.01  ? 457 LEU A CG    1 
ATOM   3461 C  CD1   . LEU A 1 469 ? -20.812 -8.494  -29.000 1.00 36.15  ? 457 LEU A CD1   1 
ATOM   3462 C  CD2   . LEU A 1 469 ? -20.222 -7.239  -26.815 1.00 33.79  ? 457 LEU A CD2   1 
ATOM   3463 N  N     . HIS A 1 470 ? -21.206 -3.132  -30.210 1.00 30.09  ? 458 HIS A N     1 
ATOM   3464 C  CA    . HIS A 1 470 ? -20.660 -1.993  -31.037 1.00 30.47  ? 458 HIS A CA    1 
ATOM   3465 C  C     . HIS A 1 470 ? -20.702 -0.719  -30.200 1.00 30.57  ? 458 HIS A C     1 
ATOM   3466 O  O     . HIS A 1 470 ? -19.690 -0.037  -30.065 1.00 31.29  ? 458 HIS A O     1 
ATOM   3467 C  CB    . HIS A 1 470 ? -21.511 -1.909  -32.290 1.00 29.83  ? 458 HIS A CB    1 
ATOM   3468 C  CG    . HIS A 1 470 ? -21.206 -0.788  -33.225 1.00 30.74  ? 458 HIS A CG    1 
ATOM   3469 N  ND1   . HIS A 1 470 ? -22.047 0.290   -33.350 1.00 28.59  ? 458 HIS A ND1   1 
ATOM   3470 C  CD2   . HIS A 1 470 ? -20.275 -0.658  -34.202 1.00 28.59  ? 458 HIS A CD2   1 
ATOM   3471 C  CE1   . HIS A 1 470 ? -21.617 1.066   -34.326 1.00 31.36  ? 458 HIS A CE1   1 
ATOM   3472 N  NE2   . HIS A 1 470 ? -20.532 0.526   -34.846 1.00 33.06  ? 458 HIS A NE2   1 
ATOM   3473 N  N     . GLY A 1 471 ? -21.845 -0.445  -29.560 1.00 30.34  ? 459 GLY A N     1 
ATOM   3474 C  CA    . GLY A 1 471 ? -21.942 0.733   -28.692 1.00 29.78  ? 459 GLY A CA    1 
ATOM   3475 C  C     . GLY A 1 471 ? -21.114 0.576   -27.433 1.00 29.94  ? 459 GLY A C     1 
ATOM   3476 O  O     . GLY A 1 471 ? -20.491 1.507   -26.971 1.00 30.49  ? 459 GLY A O     1 
ATOM   3477 N  N     . PHE A 1 472 ? -21.104 -0.608  -26.845 1.00 30.06  ? 460 PHE A N     1 
ATOM   3478 C  CA    . PHE A 1 472 ? -20.324 -0.827  -25.628 1.00 31.34  ? 460 PHE A CA    1 
ATOM   3479 C  C     . PHE A 1 472 ? -18.805 -0.681  -25.893 1.00 30.95  ? 460 PHE A C     1 
ATOM   3480 O  O     . PHE A 1 472 ? -18.089 -0.070  -25.087 1.00 31.33  ? 460 PHE A O     1 
ATOM   3481 C  CB    . PHE A 1 472 ? -20.670 -2.208  -25.059 1.00 32.80  ? 460 PHE A CB    1 
ATOM   3482 C  CG    . PHE A 1 472 ? -20.013 -2.543  -23.749 1.00 36.22  ? 460 PHE A CG    1 
ATOM   3483 C  CD1   . PHE A 1 472 ? -19.772 -1.600  -22.787 1.00 42.91  ? 460 PHE A CD1   1 
ATOM   3484 C  CD2   . PHE A 1 472 ? -19.664 -3.839  -23.476 1.00 41.98  ? 460 PHE A CD2   1 
ATOM   3485 C  CE1   . PHE A 1 472 ? -19.194 -1.935  -21.582 1.00 44.22  ? 460 PHE A CE1   1 
ATOM   3486 C  CE2   . PHE A 1 472 ? -19.065 -4.177  -22.272 1.00 43.93  ? 460 PHE A CE2   1 
ATOM   3487 C  CZ    . PHE A 1 472 ? -18.849 -3.228  -21.323 1.00 44.17  ? 460 PHE A CZ    1 
ATOM   3488 N  N     . ALA A 1 473 ? -18.328 -1.183  -27.032 1.00 30.43  ? 461 ALA A N     1 
ATOM   3489 C  CA    . ALA A 1 473 ? -16.919 -1.005  -27.397 1.00 29.56  ? 461 ALA A CA    1 
ATOM   3490 C  C     . ALA A 1 473 ? -16.527 0.517   -27.452 1.00 29.66  ? 461 ALA A C     1 
ATOM   3491 O  O     . ALA A 1 473 ? -15.467 0.924   -26.943 1.00 31.69  ? 461 ALA A O     1 
ATOM   3492 C  CB    . ALA A 1 473 ? -16.569 -1.760  -28.714 1.00 30.21  ? 461 ALA A CB    1 
ATOM   3493 N  N     . ALA A 1 474 ? -17.426 1.339   -27.973 1.00 29.52  ? 462 ALA A N     1 
ATOM   3494 C  CA    . ALA A 1 474 ? -17.245 2.779   -28.061 1.00 29.93  ? 462 ALA A CA    1 
ATOM   3495 C  C     . ALA A 1 474 ? -17.099 3.385   -26.662 1.00 30.32  ? 462 ALA A C     1 
ATOM   3496 O  O     . ALA A 1 474 ? -16.183 4.177   -26.441 1.00 29.98  ? 462 ALA A O     1 
ATOM   3497 C  CB    . ALA A 1 474 ? -18.414 3.452   -28.867 1.00 29.24  ? 462 ALA A CB    1 
ATOM   3498 N  N     . GLU A 1 475 ? -17.915 2.930   -25.708 1.00 30.95  ? 463 GLU A N     1 
ATOM   3499 C  CA    . GLU A 1 475 ? -17.862 3.435   -24.352 1.00 32.72  ? 463 GLU A CA    1 
ATOM   3500 C  C     . GLU A 1 475 ? -16.560 3.060   -23.647 1.00 32.54  ? 463 GLU A C     1 
ATOM   3501 O  O     . GLU A 1 475 ? -16.218 3.657   -22.638 1.00 32.09  ? 463 GLU A O     1 
ATOM   3502 C  CB    . GLU A 1 475 ? -19.070 2.925   -23.520 1.00 33.14  ? 463 GLU A CB    1 
ATOM   3503 C  CG    . GLU A 1 475 ? -20.419 3.455   -23.997 1.00 37.35  ? 463 GLU A CG    1 
ATOM   3504 C  CD    . GLU A 1 475 ? -21.622 2.737   -23.358 1.00 43.97  ? 463 GLU A CD    1 
ATOM   3505 O  OE1   . GLU A 1 475 ? -21.500 2.052   -22.313 1.00 54.20  ? 463 GLU A OE1   1 
ATOM   3506 O  OE2   . GLU A 1 475 ? -22.712 2.787   -23.920 1.00 45.05  ? 463 GLU A OE2   1 
ATOM   3507 N  N     . LEU A 1 476 ? -15.867 2.062   -24.166 1.00 31.84  ? 464 LEU A N     1 
ATOM   3508 C  CA    . LEU A 1 476 ? -14.643 1.607   -23.547 1.00 32.84  ? 464 LEU A CA    1 
ATOM   3509 C  C     . LEU A 1 476 ? -13.434 2.393   -24.016 1.00 32.59  ? 464 LEU A C     1 
ATOM   3510 O  O     . LEU A 1 476 ? -12.353 2.185   -23.520 1.00 32.00  ? 464 LEU A O     1 
ATOM   3511 C  CB    . LEU A 1 476 ? -14.427 0.117   -23.772 1.00 31.96  ? 464 LEU A CB    1 
ATOM   3512 C  CG    . LEU A 1 476 ? -15.454 -0.832  -23.168 1.00 33.99  ? 464 LEU A CG    1 
ATOM   3513 C  CD1   . LEU A 1 476 ? -15.095 -2.241  -23.509 1.00 30.99  ? 464 LEU A CD1   1 
ATOM   3514 C  CD2   . LEU A 1 476 ? -15.573 -0.653  -21.690 1.00 33.15  ? 464 LEU A CD2   1 
ATOM   3515 N  N     . PHE A 1 477 ? -13.625 3.301   -24.961 1.00 32.87  ? 465 PHE A N     1 
ATOM   3516 C  CA    . PHE A 1 477 ? -12.516 4.094   -25.439 1.00 32.35  ? 465 PHE A CA    1 
ATOM   3517 C  C     . PHE A 1 477 ? -11.984 4.891   -24.265 1.00 34.59  ? 465 PHE A C     1 
ATOM   3518 O  O     . PHE A 1 477 ? -12.725 5.522   -23.539 1.00 35.04  ? 465 PHE A O     1 
ATOM   3519 C  CB    . PHE A 1 477 ? -12.983 5.035   -26.531 1.00 32.11  ? 465 PHE A CB    1 
ATOM   3520 C  CG    . PHE A 1 477 ? -11.889 5.821   -27.169 1.00 34.28  ? 465 PHE A CG    1 
ATOM   3521 C  CD1   . PHE A 1 477 ? -10.780 5.197   -27.696 1.00 36.71  ? 465 PHE A CD1   1 
ATOM   3522 C  CD2   . PHE A 1 477 ? -11.977 7.193   -27.268 1.00 33.56  ? 465 PHE A CD2   1 
ATOM   3523 C  CE1   . PHE A 1 477 ? -9.782  5.930   -28.296 1.00 39.50  ? 465 PHE A CE1   1 
ATOM   3524 C  CE2   . PHE A 1 477 ? -10.984 7.920   -27.867 1.00 34.78  ? 465 PHE A CE2   1 
ATOM   3525 C  CZ    . PHE A 1 477 ? -9.890  7.294   -28.379 1.00 35.89  ? 465 PHE A CZ    1 
ATOM   3526 N  N     . GLU A 1 478 ? -10.680 4.834   -24.091 1.00 35.55  ? 466 GLU A N     1 
ATOM   3527 C  CA    . GLU A 1 478 ? -9.979  5.482   -22.992 1.00 39.15  ? 466 GLU A CA    1 
ATOM   3528 C  C     . GLU A 1 478 ? -9.961  7.015   -22.960 1.00 39.24  ? 466 GLU A C     1 
ATOM   3529 O  O     . GLU A 1 478 ? -10.004 7.612   -21.909 1.00 40.35  ? 466 GLU A O     1 
ATOM   3530 C  CB    . GLU A 1 478 ? -8.570  4.912   -22.889 1.00 40.80  ? 466 GLU A CB    1 
ATOM   3531 C  CG    . GLU A 1 478 ? -8.534  3.395   -22.955 1.00 45.67  ? 466 GLU A CG    1 
ATOM   3532 C  CD    . GLU A 1 478 ? -8.384  2.820   -24.371 1.00 50.83  ? 466 GLU A CD    1 
ATOM   3533 O  OE1   . GLU A 1 478 ? -8.642  3.522   -25.367 1.00 43.08  ? 466 GLU A OE1   1 
ATOM   3534 O  OE2   . GLU A 1 478 ? -8.009  1.635   -24.471 1.00 54.23  ? 466 GLU A OE2   1 
ATOM   3535 N  N     . GLN A 1 479 ? -9.829  7.641   -24.115 1.00 37.37  ? 467 GLN A N     1 
ATOM   3536 C  CA    . GLN A 1 479 ? -9.763  9.086   -24.197 1.00 37.20  ? 467 GLN A CA    1 
ATOM   3537 C  C     . GLN A 1 479 ? -11.112 9.749   -24.527 1.00 36.61  ? 467 GLN A C     1 
ATOM   3538 O  O     . GLN A 1 479 ? -12.141 9.131   -24.396 1.00 35.26  ? 467 GLN A O     1 
ATOM   3539 C  CB    . GLN A 1 479 ? -8.644  9.499   -25.137 1.00 36.97  ? 467 GLN A CB    1 
ATOM   3540 C  CG    . GLN A 1 479 ? -7.312  8.887   -24.768 1.00 38.98  ? 467 GLN A CG    1 
ATOM   3541 C  CD    . GLN A 1 479 ? -6.915  9.172   -23.328 1.00 42.44  ? 467 GLN A CD    1 
ATOM   3542 O  OE1   . GLN A 1 479 ? -7.330  10.160  -22.749 1.00 43.75  ? 467 GLN A OE1   1 
ATOM   3543 N  NE2   . GLN A 1 479 ? -6.117  8.302   -22.754 1.00 44.15  ? 467 GLN A NE2   1 
ATOM   3544 N  N     . ASP A 1 480 ? -11.105 11.016  -24.919 1.00 35.71  ? 468 ASP A N     1 
ATOM   3545 C  CA    . ASP A 1 480 ? -12.361 11.674  -25.231 1.00 34.50  ? 468 ASP A CA    1 
ATOM   3546 C  C     . ASP A 1 480 ? -13.031 11.020  -26.419 1.00 33.15  ? 468 ASP A C     1 
ATOM   3547 O  O     . ASP A 1 480 ? -12.408 10.743  -27.423 1.00 33.36  ? 468 ASP A O     1 
ATOM   3548 C  CB    . ASP A 1 480 ? -12.193 13.160  -25.483 1.00 35.12  ? 468 ASP A CB    1 
ATOM   3549 C  CG    . ASP A 1 480 ? -13.506 13.885  -25.464 1.00 36.18  ? 468 ASP A CG    1 
ATOM   3550 O  OD1   . ASP A 1 480 ? -14.223 13.860  -26.469 1.00 35.29  ? 468 ASP A OD1   1 
ATOM   3551 O  OD2   . ASP A 1 480 ? -13.838 14.446  -24.425 1.00 38.54  ? 468 ASP A OD2   1 
ATOM   3552 N  N     . GLU A 1 481 ? -14.327 10.818  -26.288 1.00 32.99  ? 469 GLU A N     1 
ATOM   3553 C  CA    . GLU A 1 481 ? -15.101 10.009  -27.249 1.00 33.20  ? 469 GLU A CA    1 
ATOM   3554 C  C     . GLU A 1 481 ? -15.085 10.655  -28.593 1.00 33.55  ? 469 GLU A C     1 
ATOM   3555 O  O     . GLU A 1 481 ? -15.226 10.003  -29.590 1.00 33.87  ? 469 GLU A O     1 
ATOM   3556 C  CB    . GLU A 1 481 ? -16.537 9.855   -26.750 1.00 32.80  ? 469 GLU A CB    1 
ATOM   3557 C  CG    . GLU A 1 481 ? -17.347 11.114  -26.854 1.00 34.59  ? 469 GLU A CG    1 
ATOM   3558 C  CD    . GLU A 1 481 ? -18.768 10.984  -26.174 1.00 40.38  ? 469 GLU A CD    1 
ATOM   3559 O  OE1   . GLU A 1 481 ? -18.812 10.506  -25.025 1.00 40.66  ? 469 GLU A OE1   1 
ATOM   3560 O  OE2   . GLU A 1 481 ? -19.809 11.354  -26.783 1.00 37.14  ? 469 GLU A OE2   1 
ATOM   3561 N  N     . ARG A 1 482 ? -14.925 11.965  -28.661 1.00 34.34  ? 470 ARG A N     1 
ATOM   3562 C  CA    . ARG A 1 482 ? -14.980 12.552  -29.982 1.00 34.42  ? 470 ARG A CA    1 
ATOM   3563 C  C     . ARG A 1 482 ? -13.784 12.195  -30.874 1.00 34.50  ? 470 ARG A C     1 
ATOM   3564 O  O     . ARG A 1 482 ? -13.857 12.401  -32.073 1.00 33.92  ? 470 ARG A O     1 
ATOM   3565 C  CB    . ARG A 1 482 ? -15.120 14.050  -29.896 1.00 35.89  ? 470 ARG A CB    1 
ATOM   3566 C  CG    . ARG A 1 482 ? -13.885 14.801  -29.690 1.00 33.84  ? 470 ARG A CG    1 
ATOM   3567 C  CD    . ARG A 1 482 ? -14.319 16.268  -29.413 1.00 37.65  ? 470 ARG A CD    1 
ATOM   3568 N  NE    . ARG A 1 482 ? -14.931 16.445  -28.099 1.00 36.37  ? 470 ARG A NE    1 
ATOM   3569 C  CZ    . ARG A 1 482 ? -15.650 17.508  -27.721 1.00 39.04  ? 470 ARG A CZ    1 
ATOM   3570 N  NH1   . ARG A 1 482 ? -15.914 18.523  -28.544 1.00 38.41  ? 470 ARG A NH1   1 
ATOM   3571 N  NH2   . ARG A 1 482 ? -16.163 17.532  -26.513 1.00 38.81  ? 470 ARG A NH2   1 
ATOM   3572 N  N     . GLY A 1 483 ? -12.700 11.707  -30.277 1.00 33.37  ? 471 GLY A N     1 
ATOM   3573 C  CA    . GLY A 1 483 ? -11.556 11.273  -31.004 1.00 33.78  ? 471 GLY A CA    1 
ATOM   3574 C  C     . GLY A 1 483 ? -11.589 9.809   -31.401 1.00 33.01  ? 471 GLY A C     1 
ATOM   3575 O  O     . GLY A 1 483 ? -10.673 9.347   -32.058 1.00 34.43  ? 471 GLY A O     1 
ATOM   3576 N  N     . LEU A 1 484 ? -12.639 9.078   -31.025 1.00 33.21  ? 472 LEU A N     1 
ATOM   3577 C  CA    . LEU A 1 484 ? -12.749 7.669   -31.383 1.00 32.42  ? 472 LEU A CA    1 
ATOM   3578 C  C     . LEU A 1 484 ? -12.853 7.567   -32.872 1.00 33.05  ? 472 LEU A C     1 
ATOM   3579 O  O     . LEU A 1 484 ? -13.630 8.297   -33.481 1.00 32.01  ? 472 LEU A O     1 
ATOM   3580 C  CB    . LEU A 1 484 ? -14.033 7.064   -30.809 1.00 33.05  ? 472 LEU A CB    1 
ATOM   3581 C  CG    . LEU A 1 484 ? -14.264 5.585   -31.130 1.00 32.27  ? 472 LEU A CG    1 
ATOM   3582 C  CD1   . LEU A 1 484 ? -13.193 4.722   -30.451 1.00 29.88  ? 472 LEU A CD1   1 
ATOM   3583 C  CD2   . LEU A 1 484 ? -15.654 5.221   -30.680 1.00 32.64  ? 472 LEU A CD2   1 
ATOM   3584 N  N     . THR A 1 485 ? -12.106 6.640   -33.456 1.00 32.78  ? 473 THR A N     1 
ATOM   3585 C  CA    . THR A 1 485 ? -12.277 6.316   -34.852 1.00 33.69  ? 473 THR A CA    1 
ATOM   3586 C  C     . THR A 1 485 ? -12.571 4.840   -34.971 1.00 33.23  ? 473 THR A C     1 
ATOM   3587 O  O     . THR A 1 485 ? -12.329 4.077   -34.018 1.00 32.35  ? 473 THR A O     1 
ATOM   3588 C  CB    . THR A 1 485 ? -10.998 6.598   -35.650 1.00 35.44  ? 473 THR A CB    1 
ATOM   3589 O  OG1   . THR A 1 485 ? -9.993  5.778   -35.082 1.00 38.66  ? 473 THR A OG1   1 
ATOM   3590 C  CG2   . THR A 1 485 ? -10.595 8.094   -35.591 1.00 37.87  ? 473 THR A CG2   1 
ATOM   3591 N  N     . ALA A 1 486 ? -13.092 4.449   -36.148 1.00 32.99  ? 474 ALA A N     1 
ATOM   3592 C  CA    . ALA A 1 486 ? -13.453 3.054   -36.448 1.00 33.47  ? 474 ALA A CA    1 
ATOM   3593 C  C     . ALA A 1 486 ? -12.336 2.021   -36.204 1.00 33.13  ? 474 ALA A C     1 
ATOM   3594 O  O     . ALA A 1 486 ? -12.609 0.895   -35.760 1.00 32.17  ? 474 ALA A O     1 
ATOM   3595 C  CB    . ALA A 1 486 ? -13.955 2.951   -37.913 1.00 34.38  ? 474 ALA A CB    1 
ATOM   3596 N  N     . SER A 1 487 ? -11.102 2.384   -36.519 1.00 33.79  ? 475 SER A N     1 
ATOM   3597 C  CA    . SER A 1 487 ? -9.965  1.514   -36.316 1.00 35.68  ? 475 SER A CA    1 
ATOM   3598 C  C     . SER A 1 487 ? -9.790  1.229   -34.810 1.00 35.45  ? 475 SER A C     1 
ATOM   3599 O  O     . SER A 1 487 ? -9.526  0.109   -34.422 1.00 34.81  ? 475 SER A O     1 
ATOM   3600 C  CB    . SER A 1 487 ? -8.691  2.135   -36.898 1.00 36.38  ? 475 SER A CB    1 
ATOM   3601 O  OG    . SER A 1 487 ? -8.662  1.987   -38.278 1.00 39.32  ? 475 SER A OG    1 
ATOM   3602 N  N     . GLU A 1 488 ? -10.035 2.234   -33.971 1.00 35.07  ? 476 GLU A N     1 
ATOM   3603 C  CA    . GLU A 1 488 ? -9.868  2.078   -32.554 1.00 35.53  ? 476 GLU A CA    1 
ATOM   3604 C  C     . GLU A 1 488 ? -11.071 1.288   -32.022 1.00 34.11  ? 476 GLU A C     1 
ATOM   3605 O  O     . GLU A 1 488 ? -10.946 0.445   -31.114 1.00 33.66  ? 476 GLU A O     1 
ATOM   3606 C  CB    . GLU A 1 488 ? -9.729  3.457   -31.865 1.00 36.86  ? 476 GLU A CB    1 
ATOM   3607 C  CG    . GLU A 1 488 ? -8.331  4.133   -32.051 1.00 44.49  ? 476 GLU A CG    1 
ATOM   3608 C  CD    . GLU A 1 488 ? -7.191  3.169   -31.755 1.00 54.61  ? 476 GLU A CD    1 
ATOM   3609 O  OE1   . GLU A 1 488 ? -6.307  2.975   -32.639 1.00 62.13  ? 476 GLU A OE1   1 
ATOM   3610 O  OE2   . GLU A 1 488 ? -7.209  2.555   -30.648 1.00 58.57  ? 476 GLU A OE2   1 
ATOM   3611 N  N     . LEU A 1 489 ? -12.230 1.525   -32.621 1.00 32.39  ? 477 LEU A N     1 
ATOM   3612 C  CA    . LEU A 1 489 ? -13.414 0.772   -32.257 1.00 32.12  ? 477 LEU A CA    1 
ATOM   3613 C  C     . LEU A 1 489 ? -13.182 -0.727  -32.411 1.00 31.86  ? 477 LEU A C     1 
ATOM   3614 O  O     . LEU A 1 489 ? -13.526 -1.517  -31.532 1.00 31.09  ? 477 LEU A O     1 
ATOM   3615 C  CB    . LEU A 1 489 ? -14.606 1.255   -33.097 1.00 33.03  ? 477 LEU A CB    1 
ATOM   3616 C  CG    . LEU A 1 489 ? -15.958 0.612   -32.828 1.00 32.45  ? 477 LEU A CG    1 
ATOM   3617 C  CD1   . LEU A 1 489 ? -16.374 1.073   -31.398 1.00 32.32  ? 477 LEU A CD1   1 
ATOM   3618 C  CD2   . LEU A 1 489 ? -16.936 1.061   -33.972 1.00 34.02  ? 477 LEU A CD2   1 
ATOM   3619 N  N     . LEU A 1 490 ? -12.598 -1.113  -33.543 1.00 31.33  ? 478 LEU A N     1 
ATOM   3620 C  CA    . LEU A 1 490 ? -12.286 -2.497  -33.826 1.00 32.48  ? 478 LEU A CA    1 
ATOM   3621 C  C     . LEU A 1 490 ? -11.427 -3.140  -32.744 1.00 32.75  ? 478 LEU A C     1 
ATOM   3622 O  O     . LEU A 1 490 ? -11.671 -4.275  -32.348 1.00 33.36  ? 478 LEU A O     1 
ATOM   3623 C  CB    . LEU A 1 490 ? -11.557 -2.624  -35.187 1.00 32.11  ? 478 LEU A CB    1 
ATOM   3624 C  CG    . LEU A 1 490 ? -12.310 -2.437  -36.510 1.00 33.72  ? 478 LEU A CG    1 
ATOM   3625 C  CD1   . LEU A 1 490 ? -11.225 -2.362  -37.675 1.00 28.12  ? 478 LEU A CD1   1 
ATOM   3626 C  CD2   . LEU A 1 490 ? -13.279 -3.595  -36.716 1.00 33.45  ? 478 LEU A CD2   1 
ATOM   3627 N  N     . ARG A 1 491 ? -10.424 -2.408  -32.284 1.00 33.01  ? 479 ARG A N     1 
ATOM   3628 C  CA    . ARG A 1 491 ? -9.475  -2.886  -31.252 1.00 34.40  ? 479 ARG A CA    1 
ATOM   3629 C  C     . ARG A 1 491 ? -10.199 -3.073  -29.938 1.00 33.31  ? 479 ARG A C     1 
ATOM   3630 O  O     . ARG A 1 491 ? -9.824  -3.928  -29.169 1.00 33.53  ? 479 ARG A O     1 
ATOM   3631 C  CB    . ARG A 1 491 ? -8.296  -1.889  -31.100 1.00 36.04  ? 479 ARG A CB    1 
ATOM   3632 C  CG    . ARG A 1 491 ? -7.257  -2.196  -30.030 1.00 42.94  ? 479 ARG A CG    1 
ATOM   3633 C  CD    . ARG A 1 491 ? -6.271  -1.012  -29.735 1.00 48.50  ? 479 ARG A CD    1 
ATOM   3634 N  NE    . ARG A 1 491 ? -6.958  0.275   -29.471 1.00 54.30  ? 479 ARG A NE    1 
ATOM   3635 C  CZ    . ARG A 1 491 ? -7.527  0.665   -28.313 1.00 58.56  ? 479 ARG A CZ    1 
ATOM   3636 N  NH1   . ARG A 1 491 ? -7.539  -0.131  -27.238 1.00 56.09  ? 479 ARG A NH1   1 
ATOM   3637 N  NH2   . ARG A 1 491 ? -8.135  1.874   -28.244 1.00 59.16  ? 479 ARG A NH2   1 
ATOM   3638 N  N     . LEU A 1 492 ? -11.286 -2.334  -29.712 1.00 31.98  ? 480 LEU A N     1 
ATOM   3639 C  CA    . LEU A 1 492 ? -12.028 -2.413  -28.475 1.00 31.21  ? 480 LEU A CA    1 
ATOM   3640 C  C     . LEU A 1 492 ? -13.099 -3.518  -28.398 1.00 31.43  ? 480 LEU A C     1 
ATOM   3641 O  O     . LEU A 1 492 ? -13.558 -3.871  -27.303 1.00 32.06  ? 480 LEU A O     1 
ATOM   3642 C  CB    . LEU A 1 492 ? -12.627 -1.050  -28.143 1.00 30.77  ? 480 LEU A CB    1 
ATOM   3643 C  CG    . LEU A 1 492 ? -11.642 0.091   -27.734 1.00 31.70  ? 480 LEU A CG    1 
ATOM   3644 C  CD1   . LEU A 1 492 ? -12.292 1.482   -27.924 1.00 28.97  ? 480 LEU A CD1   1 
ATOM   3645 C  CD2   . LEU A 1 492 ? -11.079 -0.073  -26.308 1.00 30.03  ? 480 LEU A CD2   1 
ATOM   3646 N  N     . ILE A 1 493 ? -13.526 -4.025  -29.548 1.00 30.76  ? 481 ILE A N     1 
ATOM   3647 C  CA    . ILE A 1 493 ? -14.533 -5.071  -29.595 1.00 30.47  ? 481 ILE A CA    1 
ATOM   3648 C  C     . ILE A 1 493 ? -14.202 -6.289  -28.683 1.00 30.65  ? 481 ILE A C     1 
ATOM   3649 O  O     . ILE A 1 493 ? -15.046 -6.724  -27.945 1.00 30.66  ? 481 ILE A O     1 
ATOM   3650 C  CB    . ILE A 1 493 ? -14.849 -5.470  -31.056 1.00 30.22  ? 481 ILE A CB    1 
ATOM   3651 C  CG1   . ILE A 1 493 ? -15.653 -4.351  -31.725 1.00 29.27  ? 481 ILE A CG1   1 
ATOM   3652 C  CG2   . ILE A 1 493 ? -15.682 -6.825  -31.104 1.00 31.34  ? 481 ILE A CG2   1 
ATOM   3653 C  CD1   . ILE A 1 493 ? -15.808 -4.492  -33.299 1.00 29.45  ? 481 ILE A CD1   1 
ATOM   3654 N  N     . PRO A 1 494 ? -12.980 -6.839  -28.740 1.00 31.64  ? 482 PRO A N     1 
ATOM   3655 C  CA    . PRO A 1 494 ? -12.758 -8.025  -27.913 1.00 32.80  ? 482 PRO A CA    1 
ATOM   3656 C  C     . PRO A 1 494 ? -12.729 -7.727  -26.389 1.00 33.23  ? 482 PRO A C     1 
ATOM   3657 O  O     . PRO A 1 494 ? -12.953 -8.639  -25.587 1.00 32.08  ? 482 PRO A O     1 
ATOM   3658 C  CB    . PRO A 1 494 ? -11.390 -8.555  -28.397 1.00 33.42  ? 482 PRO A CB    1 
ATOM   3659 C  CG    . PRO A 1 494 ? -11.185 -7.909  -29.764 1.00 32.78  ? 482 PRO A CG    1 
ATOM   3660 C  CD    . PRO A 1 494 ? -11.881 -6.616  -29.714 1.00 31.55  ? 482 PRO A CD    1 
ATOM   3661 N  N     . GLU A 1 495 ? -12.425 -6.487  -26.007 1.00 33.08  ? 483 GLU A N     1 
ATOM   3662 C  CA    . GLU A 1 495 ? -12.552 -6.094  -24.619 1.00 34.68  ? 483 GLU A CA    1 
ATOM   3663 C  C     . GLU A 1 495 ? -14.037 -5.953  -24.228 1.00 33.73  ? 483 GLU A C     1 
ATOM   3664 O  O     . GLU A 1 495 ? -14.451 -6.388  -23.153 1.00 34.61  ? 483 GLU A O     1 
ATOM   3665 C  CB    . GLU A 1 495 ? -11.768 -4.782  -24.305 1.00 35.94  ? 483 GLU A CB    1 
ATOM   3666 C  CG    . GLU A 1 495 ? -11.830 -4.384  -22.795 1.00 39.96  ? 483 GLU A CG    1 
ATOM   3667 C  CD    . GLU A 1 495 ? -11.372 -2.942  -22.509 1.00 47.24  ? 483 GLU A CD    1 
ATOM   3668 O  OE1   . GLU A 1 495 ? -10.856 -2.276  -23.424 1.00 48.33  ? 483 GLU A OE1   1 
ATOM   3669 O  OE2   . GLU A 1 495 ? -11.574 -2.470  -21.360 1.00 49.03  ? 483 GLU A OE2   1 
ATOM   3670 N  N     . ALA A 1 496 ? -14.853 -5.379  -25.094 1.00 32.96  ? 484 ALA A N     1 
ATOM   3671 C  CA    . ALA A 1 496 ? -16.311 -5.403  -24.856 1.00 32.63  ? 484 ALA A CA    1 
ATOM   3672 C  C     . ALA A 1 496 ? -16.848 -6.837  -24.636 1.00 33.05  ? 484 ALA A C     1 
ATOM   3673 O  O     . ALA A 1 496 ? -17.676 -7.082  -23.766 1.00 33.62  ? 484 ALA A O     1 
ATOM   3674 C  CB    . ALA A 1 496 ? -17.071 -4.709  -25.990 1.00 30.58  ? 484 ALA A CB    1 
ATOM   3675 N  N     . ILE A 1 497 ? -16.441 -7.760  -25.485 1.00 33.44  ? 485 ILE A N     1 
ATOM   3676 C  CA    . ILE A 1 497 ? -16.860 -9.162  -25.377 1.00 34.66  ? 485 ILE A CA    1 
ATOM   3677 C  C     . ILE A 1 497 ? -16.416 -9.722  -24.034 1.00 35.27  ? 485 ILE A C     1 
ATOM   3678 O  O     . ILE A 1 497 ? -17.215 -10.339 -23.334 1.00 35.76  ? 485 ILE A O     1 
ATOM   3679 C  CB    . ILE A 1 497 ? -16.331 -10.027 -26.531 1.00 34.93  ? 485 ILE A CB    1 
ATOM   3680 C  CG1   . ILE A 1 497 ? -17.020 -9.573  -27.854 1.00 34.95  ? 485 ILE A CG1   1 
ATOM   3681 C  CG2   . ILE A 1 497 ? -16.572 -11.552 -26.225 1.00 35.27  ? 485 ILE A CG2   1 
ATOM   3682 C  CD1   . ILE A 1 497 ? -16.535 -10.249 -29.110 1.00 32.49  ? 485 ILE A CD1   1 
ATOM   3683 N  N     . ARG A 1 498 ? -15.173 -9.458  -23.635 1.00 35.85  ? 486 ARG A N     1 
ATOM   3684 C  CA    . ARG A 1 498 ? -14.688 -9.970  -22.338 1.00 38.25  ? 486 ARG A CA    1 
ATOM   3685 C  C     . ARG A 1 498 ? -15.502 -9.378  -21.190 1.00 40.12  ? 486 ARG A C     1 
ATOM   3686 O  O     . ARG A 1 498 ? -15.896 -10.117 -20.292 1.00 38.66  ? 486 ARG A O     1 
ATOM   3687 C  CB    . ARG A 1 498 ? -13.193 -9.695  -22.095 1.00 38.44  ? 486 ARG A CB    1 
ATOM   3688 C  CG    . ARG A 1 498 ? -12.721 -10.128 -20.707 1.00 41.95  ? 486 ARG A CG    1 
ATOM   3689 C  CD    . ARG A 1 498 ? -11.256 -9.876  -20.460 1.00 46.20  ? 486 ARG A CD    1 
ATOM   3690 N  NE    . ARG A 1 498 ? -10.948 -8.445  -20.385 1.00 49.04  ? 486 ARG A NE    1 
ATOM   3691 C  CZ    . ARG A 1 498 ? -11.221 -7.632  -19.348 1.00 53.61  ? 486 ARG A CZ    1 
ATOM   3692 N  NH1   . ARG A 1 498 ? -11.842 -8.085  -18.261 1.00 55.10  ? 486 ARG A NH1   1 
ATOM   3693 N  NH2   . ARG A 1 498 ? -10.904 -6.336  -19.412 1.00 53.35  ? 486 ARG A NH2   1 
ATOM   3694 N  N     . ARG A 1 499 ? -15.748 -8.066  -21.218 1.00 41.17  ? 487 ARG A N     1 
ATOM   3695 C  CA    . ARG A 1 499 ? -16.485 -7.423  -20.110 1.00 45.49  ? 487 ARG A CA    1 
ATOM   3696 C  C     . ARG A 1 499 ? -17.925 -7.892  -20.032 1.00 48.76  ? 487 ARG A C     1 
ATOM   3697 O  O     . ARG A 1 499 ? -18.499 -7.923  -18.957 1.00 51.49  ? 487 ARG A O     1 
ATOM   3698 C  CB    . ARG A 1 499 ? -16.379 -5.885  -20.130 1.00 44.87  ? 487 ARG A CB    1 
ATOM   3699 C  CG    . ARG A 1 499 ? -14.967 -5.429  -19.952 1.00 46.33  ? 487 ARG A CG    1 
ATOM   3700 C  CD    . ARG A 1 499 ? -14.781 -3.931  -20.012 1.00 49.95  ? 487 ARG A CD    1 
ATOM   3701 N  NE    . ARG A 1 499 ? -13.458 -3.546  -19.502 1.00 52.38  ? 487 ARG A NE    1 
ATOM   3702 C  CZ    . ARG A 1 499 ? -13.122 -3.512  -18.203 1.00 58.95  ? 487 ARG A CZ    1 
ATOM   3703 N  NH1   . ARG A 1 499 ? -14.005 -3.838  -17.263 1.00 61.82  ? 487 ARG A NH1   1 
ATOM   3704 N  NH2   . ARG A 1 499 ? -11.892 -3.157  -17.826 1.00 60.13  ? 487 ARG A NH2   1 
ATOM   3705 N  N     . LEU A 1 500 ? -18.472 -8.360  -21.137 1.00 51.27  ? 488 LEU A N     1 
ATOM   3706 C  CA    . LEU A 1 500 ? -19.835 -8.835  -21.161 1.00 54.80  ? 488 LEU A CA    1 
ATOM   3707 C  C     . LEU A 1 500 ? -19.992 -10.132 -20.348 1.00 58.08  ? 488 LEU A C     1 
ATOM   3708 O  O     . LEU A 1 500 ? -21.085 -10.424 -19.853 1.00 59.50  ? 488 LEU A O     1 
ATOM   3709 C  CB    . LEU A 1 500 ? -20.253 -9.050  -22.607 1.00 54.97  ? 488 LEU A CB    1 
ATOM   3710 C  CG    . LEU A 1 500 ? -21.736 -9.158  -22.876 1.00 57.22  ? 488 LEU A CG    1 
ATOM   3711 C  CD1   . LEU A 1 500 ? -22.298 -7.751  -22.966 1.00 57.71  ? 488 LEU A CD1   1 
ATOM   3712 C  CD2   . LEU A 1 500 ? -21.934 -9.952  -24.169 1.00 59.94  ? 488 LEU A CD2   1 
ATOM   3713 N  N     . LYS A 1 501 ? -18.907 -10.897 -20.185 1.00 59.77  ? 489 LYS A N     1 
ATOM   3714 C  CA    . LYS A 1 501 ? -18.910 -12.118 -19.335 1.00 62.05  ? 489 LYS A CA    1 
ATOM   3715 C  C     . LYS A 1 501 ? -17.722 -12.191 -18.384 1.00 62.70  ? 489 LYS A C     1 
ATOM   3716 O  O     . LYS A 1 501 ? -17.801 -11.707 -17.263 1.00 65.02  ? 489 LYS A O     1 
ATOM   3717 C  CB    . LYS A 1 501 ? -18.990 -13.404 -20.182 1.00 62.54  ? 489 LYS A CB    1 
ATOM   3718 C  CG    . LYS A 1 501 ? -18.777 -13.240 -21.710 1.00 62.19  ? 489 LYS A CG    1 
ATOM   3719 C  CD    . LYS A 1 501 ? -17.469 -13.786 -22.221 1.00 63.17  ? 489 LYS A CD    1 
ATOM   3720 C  CE    . LYS A 1 501 ? -17.534 -15.288 -22.598 1.00 66.18  ? 489 LYS A CE    1 
ATOM   3721 N  NZ    . LYS A 1 501 ? -16.361 -15.699 -23.517 1.00 67.04  ? 489 LYS A NZ    1 
ATOM   3722 N  N     . ALA B 2 1   ? -26.158 -8.767  -7.145  1.00 73.29  ? 0   ALA B N     1 
ATOM   3723 C  CA    . ALA B 2 1   ? -26.490 -7.409  -6.608  1.00 73.54  ? 0   ALA B CA    1 
ATOM   3724 C  C     . ALA B 2 1   ? -28.026 -7.316  -6.427  1.00 73.15  ? 0   ALA B C     1 
ATOM   3725 O  O     . ALA B 2 1   ? -28.770 -7.610  -7.381  1.00 73.90  ? 0   ALA B O     1 
ATOM   3726 C  CB    . ALA B 2 1   ? -25.964 -6.290  -7.570  1.00 73.49  ? 0   ALA B CB    1 
ATOM   3727 N  N     . PRO B 2 2   ? -28.509 -6.900  -5.218  1.00 71.93  ? 1   PRO B N     1 
ATOM   3728 C  CA    . PRO B 2 2   ? -29.972 -6.982  -4.916  1.00 70.13  ? 1   PRO B CA    1 
ATOM   3729 C  C     . PRO B 2 2   ? -30.928 -6.039  -5.746  1.00 67.64  ? 1   PRO B C     1 
ATOM   3730 O  O     . PRO B 2 2   ? -30.753 -4.829  -5.809  1.00 67.42  ? 1   PRO B O     1 
ATOM   3731 C  CB    . PRO B 2 2   ? -30.041 -6.681  -3.401  1.00 70.71  ? 1   PRO B CB    1 
ATOM   3732 C  CG    . PRO B 2 2   ? -28.590 -6.567  -2.903  1.00 71.72  ? 1   PRO B CG    1 
ATOM   3733 C  CD    . PRO B 2 2   ? -27.757 -6.256  -4.113  1.00 71.57  ? 1   PRO B CD    1 
ATOM   3734 N  N     . ALA B 2 3   ? -31.954 -6.628  -6.343  1.00 64.23  ? 2   ALA B N     1 
ATOM   3735 C  CA    . ALA B 2 3   ? -32.739 -5.952  -7.361  1.00 61.26  ? 2   ALA B CA    1 
ATOM   3736 C  C     . ALA B 2 3   ? -34.229 -6.202  -7.202  1.00 58.27  ? 2   ALA B C     1 
ATOM   3737 O  O     . ALA B 2 3   ? -34.950 -6.167  -8.195  1.00 57.95  ? 2   ALA B O     1 
ATOM   3738 C  CB    . ALA B 2 3   ? -32.264 -6.452  -8.738  1.00 61.56  ? 2   ALA B CB    1 
ATOM   3739 N  N     . TRP B 2 4   ? -34.710 -6.493  -5.975  1.00 54.24  ? 3   TRP B N     1 
ATOM   3740 C  CA    . TRP B 2 4   ? -36.161 -6.715  -5.781  1.00 51.08  ? 3   TRP B CA    1 
ATOM   3741 C  C     . TRP B 2 4   ? -36.953 -5.446  -6.127  1.00 48.84  ? 3   TRP B C     1 
ATOM   3742 O  O     . TRP B 2 4   ? -37.987 -5.534  -6.732  1.00 48.37  ? 3   TRP B O     1 
ATOM   3743 C  CB    . TRP B 2 4   ? -36.520 -7.165  -4.331  1.00 50.24  ? 3   TRP B CB    1 
ATOM   3744 C  CG    . TRP B 2 4   ? -37.985 -7.310  -4.167  1.00 48.64  ? 3   TRP B CG    1 
ATOM   3745 C  CD1   . TRP B 2 4   ? -38.754 -8.380  -4.551  1.00 46.09  ? 3   TRP B CD1   1 
ATOM   3746 C  CD2   . TRP B 2 4   ? -38.896 -6.341  -3.623  1.00 43.74  ? 3   TRP B CD2   1 
ATOM   3747 N  NE1   . TRP B 2 4   ? -40.070 -8.127  -4.281  1.00 45.31  ? 3   TRP B NE1   1 
ATOM   3748 C  CE2   . TRP B 2 4   ? -40.187 -6.893  -3.705  1.00 45.30  ? 3   TRP B CE2   1 
ATOM   3749 C  CE3   . TRP B 2 4   ? -38.744 -5.059  -3.105  1.00 47.05  ? 3   TRP B CE3   1 
ATOM   3750 C  CZ2   . TRP B 2 4   ? -41.339 -6.199  -3.293  1.00 46.37  ? 3   TRP B CZ2   1 
ATOM   3751 C  CZ3   . TRP B 2 4   ? -39.906 -4.378  -2.621  1.00 47.78  ? 3   TRP B CZ3   1 
ATOM   3752 C  CH2   . TRP B 2 4   ? -41.178 -4.965  -2.724  1.00 43.09  ? 3   TRP B CH2   1 
ATOM   3753 N  N     . LEU B 2 5   ? -36.481 -4.280  -5.698  1.00 47.83  ? 4   LEU B N     1 
ATOM   3754 C  CA    . LEU B 2 5   ? -37.218 -3.020  -5.880  1.00 47.90  ? 4   LEU B CA    1 
ATOM   3755 C  C     . LEU B 2 5   ? -36.886 -2.295  -7.213  1.00 48.72  ? 4   LEU B C     1 
ATOM   3756 O  O     . LEU B 2 5   ? -37.801 -1.889  -7.957  1.00 47.42  ? 4   LEU B O     1 
ATOM   3757 C  CB    . LEU B 2 5   ? -36.947 -2.076  -4.715  1.00 47.33  ? 4   LEU B CB    1 
ATOM   3758 C  CG    . LEU B 2 5   ? -37.759 -0.762  -4.710  1.00 46.95  ? 4   LEU B CG    1 
ATOM   3759 C  CD1   . LEU B 2 5   ? -39.300 -1.039  -4.887  1.00 45.82  ? 4   LEU B CD1   1 
ATOM   3760 C  CD2   . LEU B 2 5   ? -37.488 0.023   -3.490  1.00 46.78  ? 4   LEU B CD2   1 
ATOM   3761 N  N     . PHE B 2 6   ? -35.591 -2.167  -7.501  1.00 48.96  ? 5   PHE B N     1 
ATOM   3762 C  CA    . PHE B 2 6   ? -35.107 -1.377  -8.623  1.00 51.55  ? 5   PHE B CA    1 
ATOM   3763 C  C     . PHE B 2 6   ? -34.367 -2.210  -9.654  1.00 54.21  ? 5   PHE B C     1 
ATOM   3764 O  O     . PHE B 2 6   ? -33.566 -3.070  -9.289  1.00 54.16  ? 5   PHE B O     1 
ATOM   3765 C  CB    . PHE B 2 6   ? -34.183 -0.246  -8.149  1.00 50.05  ? 5   PHE B CB    1 
ATOM   3766 C  CG    . PHE B 2 6   ? -34.867 0.764   -7.331  1.00 49.42  ? 5   PHE B CG    1 
ATOM   3767 C  CD1   . PHE B 2 6   ? -35.948 1.460   -7.836  1.00 46.91  ? 5   PHE B CD1   1 
ATOM   3768 C  CD2   . PHE B 2 6   ? -34.481 0.997   -6.024  1.00 48.52  ? 5   PHE B CD2   1 
ATOM   3769 C  CE1   . PHE B 2 6   ? -36.615 2.402   -7.062  1.00 46.85  ? 5   PHE B CE1   1 
ATOM   3770 C  CE2   . PHE B 2 6   ? -35.145 1.950   -5.250  1.00 47.08  ? 5   PHE B CE2   1 
ATOM   3771 C  CZ    . PHE B 2 6   ? -36.228 2.626   -5.758  1.00 47.15  ? 5   PHE B CZ    1 
ATOM   3772 N  N     . GLU B 2 7   ? -34.706 -1.984  -10.917 1.00 57.97  ? 6   GLU B N     1 
ATOM   3773 C  CA    . GLU B 2 7   ? -33.825 -2.260  -12.079 1.00 62.32  ? 6   GLU B CA    1 
ATOM   3774 C  C     . GLU B 2 7   ? -33.208 -0.917  -12.585 1.00 64.36  ? 6   GLU B C     1 
ATOM   3775 O  O     . GLU B 2 7   ? -33.862 0.147   -12.584 1.00 64.84  ? 6   GLU B O     1 
ATOM   3776 C  CB    . GLU B 2 7   ? -34.610 -2.990  -13.169 1.00 63.25  ? 6   GLU B CB    1 
ATOM   3777 C  CG    . GLU B 2 7   ? -33.937 -2.971  -14.563 1.00 66.97  ? 6   GLU B CG    1 
ATOM   3778 C  CD    . GLU B 2 7   ? -34.937 -3.155  -15.701 1.00 70.26  ? 6   GLU B CD    1 
ATOM   3779 O  OE1   . GLU B 2 7   ? -35.886 -3.956  -15.548 1.00 76.68  ? 6   GLU B OE1   1 
ATOM   3780 O  OE2   . GLU B 2 7   ? -34.787 -2.504  -16.749 1.00 73.56  ? 6   GLU B OE2   1 
ATOM   3781 N  N     . ALA B 2 8   ? -31.923 -0.939  -12.943 1.00 66.99  ? 7   ALA B N     1 
ATOM   3782 C  CA    . ALA B 2 8   ? -31.191 0.305   -13.340 1.00 68.53  ? 7   ALA B CA    1 
ATOM   3783 C  C     . ALA B 2 8   ? -31.295 0.519   -14.834 1.00 68.99  ? 7   ALA B C     1 
ATOM   3784 O  O     . ALA B 2 8   ? -31.165 -0.446  -15.572 1.00 70.83  ? 7   ALA B O     1 
ATOM   3785 C  CB    . ALA B 2 8   ? -29.708 0.239   -12.918 1.00 68.47  ? 7   ALA B CB    1 
HETATM 3786 K  K     . K   C 3 .   ? -44.074 13.618  -14.032 1.00 47.54  ? 491 K   A K     1 
HETATM 3787 MG MG    . MG  D 4 .   ? -23.477 3.589   -43.141 1.00 58.75  ? 492 MG  A MG    1 
HETATM 3788 P  PA    . NAD E 5 .   ? -51.704 11.756  -15.590 1.00 49.64  ? 493 NAD A PA    1 
HETATM 3789 O  O1A   . NAD E 5 .   ? -51.659 12.153  -14.131 1.00 48.81  ? 493 NAD A O1A   1 
HETATM 3790 O  O2A   . NAD E 5 .   ? -50.434 11.408  -16.275 1.00 50.75  ? 493 NAD A O2A   1 
HETATM 3791 O  O5B   . NAD E 5 .   ? -52.168 13.108  -16.298 1.00 55.58  ? 493 NAD A O5B   1 
HETATM 3792 C  C5B   . NAD E 5 .   ? -53.557 13.397  -16.488 1.00 56.39  ? 493 NAD A C5B   1 
HETATM 3793 C  C4B   . NAD E 5 .   ? -53.855 14.768  -15.890 1.00 57.49  ? 493 NAD A C4B   1 
HETATM 3794 O  O4B   . NAD E 5 .   ? -53.220 15.839  -16.584 1.00 55.10  ? 493 NAD A O4B   1 
HETATM 3795 C  C3B   . NAD E 5 .   ? -55.316 15.141  -15.963 1.00 58.68  ? 493 NAD A C3B   1 
HETATM 3796 O  O3B   . NAD E 5 .   ? -55.504 16.091  -14.912 1.00 59.29  ? 493 NAD A O3B   1 
HETATM 3797 C  C2B   . NAD E 5 .   ? -55.411 15.778  -17.348 1.00 58.36  ? 493 NAD A C2B   1 
HETATM 3798 O  O2B   . NAD E 5 .   ? -56.476 16.680  -17.494 1.00 58.06  ? 493 NAD A O2B   1 
HETATM 3799 C  C1B   . NAD E 5 .   ? -54.133 16.607  -17.342 1.00 56.74  ? 493 NAD A C1B   1 
HETATM 3800 N  N9A   . NAD E 5 .   ? -53.517 16.916  -18.652 1.00 55.00  ? 493 NAD A N9A   1 
HETATM 3801 C  C8A   . NAD E 5 .   ? -53.086 16.005  -19.596 1.00 56.46  ? 493 NAD A C8A   1 
HETATM 3802 N  N7A   . NAD E 5 .   ? -52.508 16.706  -20.610 1.00 55.58  ? 493 NAD A N7A   1 
HETATM 3803 C  C5A   . NAD E 5 .   ? -52.577 18.025  -20.319 1.00 54.67  ? 493 NAD A C5A   1 
HETATM 3804 C  C6A   . NAD E 5 .   ? -52.153 19.136  -21.026 1.00 54.10  ? 493 NAD A C6A   1 
HETATM 3805 N  N6A   . NAD E 5 .   ? -51.460 18.951  -22.167 1.00 56.67  ? 493 NAD A N6A   1 
HETATM 3806 N  N1A   . NAD E 5 .   ? -52.349 20.377  -20.475 1.00 54.43  ? 493 NAD A N1A   1 
HETATM 3807 C  C2A   . NAD E 5 .   ? -52.960 20.530  -19.242 1.00 53.70  ? 493 NAD A C2A   1 
HETATM 3808 N  N3A   . NAD E 5 .   ? -53.375 19.403  -18.563 1.00 51.43  ? 493 NAD A N3A   1 
HETATM 3809 C  C4A   . NAD E 5 .   ? -53.212 18.176  -19.099 1.00 52.26  ? 493 NAD A C4A   1 
HETATM 3810 O  O3    . NAD E 5 .   ? -52.759 10.671  -16.062 1.00 49.59  ? 493 NAD A O3    1 
HETATM 3811 P  PN    . NAD E 5 .   ? -53.484 9.519   -15.226 1.00 48.43  ? 493 NAD A PN    1 
HETATM 3812 O  O1N   . NAD E 5 .   ? -53.732 8.523   -16.250 1.00 43.20  ? 493 NAD A O1N   1 
HETATM 3813 O  O2N   . NAD E 5 .   ? -54.355 10.178  -14.231 1.00 45.22  ? 493 NAD A O2N   1 
HETATM 3814 O  O5D   . NAD E 5 .   ? -52.255 8.901   -14.347 1.00 47.65  ? 493 NAD A O5D   1 
HETATM 3815 C  C5D   . NAD E 5 .   ? -51.153 8.227   -14.948 1.00 47.71  ? 493 NAD A C5D   1 
HETATM 3816 C  C4D   . NAD E 5 .   ? -50.030 8.168   -13.890 1.00 49.07  ? 493 NAD A C4D   1 
HETATM 3817 O  O4D   . NAD E 5 .   ? -50.505 7.524   -12.686 1.00 49.47  ? 493 NAD A O4D   1 
HETATM 3818 C  C3D   . NAD E 5 .   ? -48.785 7.390   -14.338 1.00 48.15  ? 493 NAD A C3D   1 
HETATM 3819 O  O3D   . NAD E 5 .   ? -47.855 8.203   -15.038 1.00 45.77  ? 493 NAD A O3D   1 
HETATM 3820 C  C2D   . NAD E 5 .   ? -48.257 6.914   -12.996 1.00 48.03  ? 493 NAD A C2D   1 
HETATM 3821 O  O2D   . NAD E 5 .   ? -47.632 8.019   -12.374 1.00 44.92  ? 493 NAD A O2D   1 
HETATM 3822 C  C1D   . NAD E 5 .   ? -49.531 6.599   -12.184 1.00 50.17  ? 493 NAD A C1D   1 
HETATM 3823 N  N1N   . NAD E 5 .   ? -49.938 5.206   -12.332 1.00 46.00  ? 493 NAD A N1N   1 
HETATM 3824 P  PG    . ATP F 6 .   ? -19.842 4.091   -42.205 1.00 96.27  ? 494 ATP A PG    1 
HETATM 3825 O  O1G   . ATP F 6 .   ? -18.837 5.070   -42.823 1.00 97.61  ? 494 ATP A O1G   1 
HETATM 3826 O  O2G   . ATP F 6 .   ? -20.946 3.786   -43.225 1.00 97.40  ? 494 ATP A O2G   1 
HETATM 3827 O  O3G   . ATP F 6 .   ? -19.238 2.884   -41.540 1.00 95.03  ? 494 ATP A O3G   1 
HETATM 3828 P  PB    . ATP F 6 .   ? -21.492 5.977   -41.248 1.00 76.70  ? 494 ATP A PB    1 
HETATM 3829 O  O1B   . ATP F 6 .   ? -22.134 5.601   -42.570 1.00 80.78  ? 494 ATP A O1B   1 
HETATM 3830 O  O2B   . ATP F 6 .   ? -20.726 7.259   -41.238 1.00 80.40  ? 494 ATP A O2B   1 
HETATM 3831 O  O3B   . ATP F 6 .   ? -20.490 4.823   -40.881 1.00 84.25  ? 494 ATP A O3B   1 
HETATM 3832 P  PA    . ATP F 6 .   ? -23.931 4.937   -40.129 1.00 61.82  ? 494 ATP A PA    1 
HETATM 3833 O  O1A   . ATP F 6 .   ? -24.099 3.894   -41.195 1.00 64.07  ? 494 ATP A O1A   1 
HETATM 3834 O  O2A   . ATP F 6 .   ? -25.062 5.827   -39.658 1.00 70.41  ? 494 ATP A O2A   1 
HETATM 3835 O  O3A   . ATP F 6 .   ? -22.722 6.022   -40.214 1.00 73.37  ? 494 ATP A O3A   1 
HETATM 3836 O  "O5'" . ATP F 6 .   ? -23.533 4.099   -38.812 1.00 60.37  ? 494 ATP A "O5'" 1 
HETATM 3837 C  "C5'" . ATP F 6 .   ? -23.251 4.820   -37.599 1.00 56.80  ? 494 ATP A "C5'" 1 
HETATM 3838 C  "C4'" . ATP F 6 .   ? -23.218 3.832   -36.416 1.00 55.75  ? 494 ATP A "C4'" 1 
HETATM 3839 O  "O4'" . ATP F 6 .   ? -22.852 4.546   -35.243 1.00 54.84  ? 494 ATP A "O4'" 1 
HETATM 3840 C  "C3'" . ATP F 6 .   ? -24.620 3.301   -36.083 1.00 56.34  ? 494 ATP A "C3'" 1 
HETATM 3841 O  "O3'" . ATP F 6 .   ? -24.589 2.088   -35.363 1.00 53.64  ? 494 ATP A "O3'" 1 
HETATM 3842 C  "C2'" . ATP F 6 .   ? -25.234 4.306   -35.152 1.00 58.18  ? 494 ATP A "C2'" 1 
HETATM 3843 O  "O2'" . ATP F 6 .   ? -26.283 3.726   -34.366 1.00 58.02  ? 494 ATP A "O2'" 1 
HETATM 3844 C  "C1'" . ATP F 6 .   ? -23.986 4.674   -34.352 1.00 57.96  ? 494 ATP A "C1'" 1 
HETATM 3845 N  N9    . ATP F 6 .   ? -24.086 6.029   -33.754 1.00 58.37  ? 494 ATP A N9    1 
HETATM 3846 C  C8    . ATP F 6 .   ? -23.899 7.197   -34.411 1.00 58.87  ? 494 ATP A C8    1 
HETATM 3847 N  N7    . ATP F 6 .   ? -24.025 8.250   -33.571 1.00 56.18  ? 494 ATP A N7    1 
HETATM 3848 C  C5    . ATP F 6 .   ? -24.292 7.736   -32.359 1.00 57.14  ? 494 ATP A C5    1 
HETATM 3849 C  C6    . ATP F 6 .   ? -24.548 8.320   -31.047 1.00 55.20  ? 494 ATP A C6    1 
HETATM 3850 N  N6    . ATP F 6 .   ? -24.530 9.684   -30.946 1.00 56.50  ? 494 ATP A N6    1 
HETATM 3851 N  N1    . ATP F 6 .   ? -24.784 7.465   -30.016 1.00 56.43  ? 494 ATP A N1    1 
HETATM 3852 C  C2    . ATP F 6 .   ? -24.813 6.107   -30.146 1.00 55.54  ? 494 ATP A C2    1 
HETATM 3853 N  N3    . ATP F 6 .   ? -24.615 5.500   -31.351 1.00 57.33  ? 494 ATP A N3    1 
HETATM 3854 C  C4    . ATP F 6 .   ? -24.336 6.262   -32.464 1.00 58.23  ? 494 ATP A C4    1 
HETATM 3855 P  PA    . NAD G 5 .   ? -25.815 9.771   -46.412 1.00 94.62  ? 495 NAD A PA    1 
HETATM 3856 O  O1A   . NAD G 5 .   ? -26.588 9.054   -47.458 1.00 92.29  ? 495 NAD A O1A   1 
HETATM 3857 O  O2A   . NAD G 5 .   ? -25.169 8.740   -45.544 1.00 94.47  ? 495 NAD A O2A   1 
HETATM 3858 O  O5B   . NAD G 5 .   ? -26.919 10.720  -45.709 1.00 89.89  ? 495 NAD A O5B   1 
HETATM 3859 C  C5B   . NAD G 5 .   ? -26.621 11.682  -44.724 1.00 85.84  ? 495 NAD A C5B   1 
HETATM 3860 C  C4B   . NAD G 5 .   ? -27.943 12.298  -44.286 1.00 83.95  ? 495 NAD A C4B   1 
HETATM 3861 O  O4B   . NAD G 5 .   ? -28.765 11.345  -43.622 1.00 80.92  ? 495 NAD A O4B   1 
HETATM 3862 C  C3B   . NAD G 5 .   ? -27.762 13.457  -43.314 1.00 83.12  ? 495 NAD A C3B   1 
HETATM 3863 O  O3B   . NAD G 5 .   ? -27.714 14.663  -44.030 1.00 86.01  ? 495 NAD A O3B   1 
HETATM 3864 C  C2B   . NAD G 5 .   ? -28.956 13.342  -42.363 1.00 81.10  ? 495 NAD A C2B   1 
HETATM 3865 O  O2B   . NAD G 5 .   ? -30.103 14.066  -42.750 1.00 80.42  ? 495 NAD A O2B   1 
HETATM 3866 C  C1B   . NAD G 5 .   ? -29.332 11.874  -42.433 1.00 77.88  ? 495 NAD A C1B   1 
HETATM 3867 N  N9A   . NAD G 5 .   ? -28.945 11.123  -41.217 1.00 71.78  ? 495 NAD A N9A   1 
HETATM 3868 C  C8A   . NAD G 5 .   ? -27.993 10.163  -41.022 1.00 69.61  ? 495 NAD A C8A   1 
HETATM 3869 N  N7A   . NAD G 5 .   ? -28.048 9.756   -39.729 1.00 66.66  ? 495 NAD A N7A   1 
HETATM 3870 C  C5A   . NAD G 5 .   ? -29.039 10.429  -39.089 1.00 66.99  ? 495 NAD A C5A   1 
HETATM 3871 C  C6A   . NAD G 5 .   ? -29.557 10.438  -37.763 1.00 67.10  ? 495 NAD A C6A   1 
HETATM 3872 N  N6A   . NAD G 5 .   ? -29.249 9.526   -36.790 1.00 61.82  ? 495 NAD A N6A   1 
HETATM 3873 N  N1A   . NAD G 5 .   ? -30.593 11.327  -37.504 1.00 66.30  ? 495 NAD A N1A   1 
HETATM 3874 C  C2A   . NAD G 5 .   ? -31.111 12.178  -38.461 1.00 67.38  ? 495 NAD A C2A   1 
HETATM 3875 N  N3A   . NAD G 5 .   ? -30.591 12.159  -39.737 1.00 68.90  ? 495 NAD A N3A   1 
HETATM 3876 C  C4A   . NAD G 5 .   ? -29.588 11.296  -40.037 1.00 69.15  ? 495 NAD A C4A   1 
HETATM 3877 O  O3    . NAD G 5 .   ? -24.717 10.852  -46.991 1.00 98.67  ? 495 NAD A O3    1 
HETATM 3878 P  PN    . NAD G 5 .   ? -23.176 11.160  -46.477 1.00 102.59 ? 495 NAD A PN    1 
HETATM 3879 O  O1N   . NAD G 5 .   ? -22.680 10.062  -45.610 1.00 103.00 ? 495 NAD A O1N   1 
HETATM 3880 O  O2N   . NAD G 5 .   ? -23.070 12.559  -45.977 1.00 103.07 ? 495 NAD A O2N   1 
HETATM 3881 O  O5D   . NAD G 5 .   ? -22.266 11.068  -47.823 1.00 102.51 ? 495 NAD A O5D   1 
HETATM 3882 O  O     . HOH H 7 .   ? -34.173 3.884   3.888   1.00 50.04  ? 496 HOH A O     1 
HETATM 3883 O  O     . HOH H 7 .   ? -24.428 0.337   -31.902 1.00 39.72  ? 497 HOH A O     1 
HETATM 3884 O  O     . HOH H 7 .   ? -24.248 1.441   -21.708 1.00 61.17  ? 498 HOH A O     1 
HETATM 3885 O  O     . HOH H 7 .   ? -12.691 5.015   -47.934 1.00 40.65  ? 499 HOH A O     1 
HETATM 3886 O  O     . HOH H 7 .   ? -18.437 -0.655  -56.410 1.00 43.44  ? 500 HOH A O     1 
HETATM 3887 O  O     . HOH H 7 .   ? -52.875 5.366   -2.034  1.00 46.06  ? 501 HOH A O     1 
HETATM 3888 O  O     . HOH H 7 .   ? -33.443 4.196   -34.281 1.00 40.11  ? 502 HOH A O     1 
HETATM 3889 O  O     . HOH H 7 .   ? -29.618 7.208   -21.119 1.00 63.93  ? 503 HOH A O     1 
HETATM 3890 O  O     . HOH H 7 .   ? -14.588 6.509   -37.317 1.00 42.00  ? 504 HOH A O     1 
HETATM 3891 O  O     . HOH H 7 .   ? -57.763 7.704   -9.214  1.00 51.60  ? 505 HOH A O     1 
HETATM 3892 O  O     . HOH H 7 .   ? -8.567  2.429   -59.520 1.00 47.97  ? 506 HOH A O     1 
HETATM 3893 O  O     . HOH H 7 .   ? -55.620 23.118  -0.542  1.00 57.86  ? 507 HOH A O     1 
HETATM 3894 O  O     . HOH H 7 .   ? -45.537 13.717  -19.381 1.00 43.59  ? 508 HOH A O     1 
HETATM 3895 O  O     . HOH H 7 .   ? -50.703 10.484  0.599   1.00 46.88  ? 509 HOH A O     1 
HETATM 3896 O  O     . HOH H 7 .   ? -51.325 14.179  -12.686 1.00 41.37  ? 510 HOH A O     1 
HETATM 3897 O  O     . HOH H 7 .   ? -59.238 -0.013  -6.540  1.00 45.69  ? 511 HOH A O     1 
HETATM 3898 O  O     . HOH H 7 .   ? -16.025 6.242   -35.109 1.00 49.20  ? 512 HOH A O     1 
HETATM 3899 O  O     . HOH H 7 .   ? -16.758 14.674  -25.047 1.00 61.64  ? 513 HOH A O     1 
HETATM 3900 O  O     . HOH H 7 .   ? -11.588 6.198   -50.157 1.00 38.81  ? 514 HOH A O     1 
HETATM 3901 O  O     . HOH H 7 .   ? -42.725 -0.540  -4.512  1.00 41.09  ? 515 HOH A O     1 
HETATM 3902 O  O     . HOH H 7 .   ? -27.692 2.600   -30.326 1.00 42.51  ? 516 HOH A O     1 
HETATM 3903 O  O     . HOH H 7 .   ? -43.965 3.050   -23.430 1.00 51.54  ? 517 HOH A O     1 
HETATM 3904 O  O     . HOH H 7 .   ? -30.276 5.726   -16.450 1.00 50.62  ? 518 HOH A O     1 
HETATM 3905 O  O     . HOH H 7 .   ? -17.199 -27.794 -35.564 1.00 53.48  ? 519 HOH A O     1 
HETATM 3906 O  O     . HOH H 7 .   ? -51.985 5.882   0.200   1.00 44.57  ? 520 HOH A O     1 
HETATM 3907 O  O     . HOH H 7 .   ? -44.218 -3.278  -10.930 1.00 49.58  ? 521 HOH A O     1 
HETATM 3908 O  O     . HOH H 7 .   ? -16.961 -0.296  -63.260 1.00 47.77  ? 522 HOH A O     1 
HETATM 3909 O  O     . HOH H 7 .   ? -34.273 -13.616 -37.005 1.00 48.71  ? 523 HOH A O     1 
HETATM 3910 O  O     . HOH H 7 .   ? -31.864 8.778   -19.717 1.00 51.49  ? 524 HOH A O     1 
HETATM 3911 O  O     . HOH H 7 .   ? -34.074 6.462   -35.769 1.00 38.75  ? 525 HOH A O     1 
HETATM 3912 O  O     . HOH H 7 .   ? -19.831 2.684   -46.455 1.00 47.98  ? 526 HOH A O     1 
HETATM 3913 O  O     . HOH H 7 .   ? -53.681 18.492  -13.622 1.00 50.22  ? 527 HOH A O     1 
HETATM 3914 O  O     . HOH H 7 .   ? -15.099 3.952   -47.331 1.00 44.57  ? 528 HOH A O     1 
HETATM 3915 O  O     . HOH H 7 .   ? -24.378 -0.959  -40.432 1.00 45.44  ? 529 HOH A O     1 
HETATM 3916 O  O     . HOH H 7 .   ? -8.744  4.653   -55.786 1.00 44.81  ? 530 HOH A O     1 
HETATM 3917 O  O     . HOH H 7 .   ? -26.344 0.819   -34.022 1.00 41.06  ? 531 HOH A O     1 
HETATM 3918 O  O     . HOH H 7 .   ? -46.659 10.965  -21.302 1.00 46.83  ? 532 HOH A O     1 
HETATM 3919 O  O     . HOH H 7 .   ? -26.744 5.452   -26.955 1.00 51.33  ? 533 HOH A O     1 
HETATM 3920 O  O     . HOH H 7 .   ? -9.871  -28.994 -33.389 1.00 42.85  ? 534 HOH A O     1 
HETATM 3921 O  O     . HOH H 7 .   ? -15.077 -29.314 -27.611 1.00 46.82  ? 535 HOH A O     1 
HETATM 3922 O  O     . HOH H 7 .   ? -14.708 4.179   -44.527 1.00 53.45  ? 536 HOH A O     1 
HETATM 3923 O  O     . HOH H 7 .   ? -39.872 16.525  -29.699 1.00 47.31  ? 537 HOH A O     1 
HETATM 3924 O  O     . HOH H 7 .   ? -28.693 -1.524  -25.062 1.00 41.01  ? 538 HOH A O     1 
HETATM 3925 O  O     . HOH H 7 .   ? -12.784 -17.654 -34.563 1.00 39.93  ? 539 HOH A O     1 
HETATM 3926 O  O     . HOH H 7 .   ? -8.161  -6.296  -30.157 1.00 57.24  ? 540 HOH A O     1 
HETATM 3927 O  O     . HOH H 7 .   ? -24.016 4.964   -44.998 1.00 49.63  ? 541 HOH A O     1 
HETATM 3928 O  O     . HOH H 7 .   ? -43.575 4.597   -34.226 1.00 48.71  ? 542 HOH A O     1 
HETATM 3929 O  O     . HOH H 7 .   ? -34.447 -15.004 -33.590 1.00 56.29  ? 543 HOH A O     1 
HETATM 3930 O  O     . HOH H 7 .   ? -46.904 4.144   -15.539 1.00 57.29  ? 544 HOH A O     1 
HETATM 3931 O  O     . HOH H 7 .   ? -11.166 -3.116  -61.115 1.00 47.86  ? 545 HOH A O     1 
HETATM 3932 O  O     . HOH H 7 .   ? -50.729 13.846  -27.053 1.00 59.53  ? 546 HOH A O     1 
HETATM 3933 O  O     . HOH H 7 .   ? -17.933 4.248   -47.747 1.00 59.95  ? 547 HOH A O     1 
HETATM 3934 O  O     . HOH H 7 .   ? -51.225 -8.629  -21.309 1.00 66.44  ? 548 HOH A O     1 
HETATM 3935 O  O     . HOH H 7 .   ? -37.213 15.862  -42.169 1.00 55.76  ? 549 HOH A O     1 
HETATM 3936 O  O     . HOH H 7 .   ? -8.529  5.982   -60.642 1.00 60.05  ? 550 HOH A O     1 
HETATM 3937 O  O     . HOH H 7 .   ? -41.012 7.555   -31.499 1.00 49.31  ? 551 HOH A O     1 
HETATM 3938 O  O     . HOH H 7 .   ? -36.750 -10.729 -47.431 1.00 56.72  ? 552 HOH A O     1 
HETATM 3939 O  O     . HOH H 7 .   ? -22.240 1.520   -43.170 1.00 48.48  ? 553 HOH A O     1 
HETATM 3940 O  O     . HOH H 7 .   ? -10.206 -14.091 -43.407 1.00 49.36  ? 554 HOH A O     1 
HETATM 3941 O  O     . HOH H 7 .   ? -45.104 29.633  -22.266 1.00 76.72  ? 555 HOH A O     1 
HETATM 3942 O  O     . HOH H 7 .   ? -24.244 -3.375  -64.298 1.00 48.79  ? 556 HOH A O     1 
HETATM 3943 O  O     . HOH H 7 .   ? -47.714 30.023  -22.981 1.00 72.17  ? 557 HOH A O     1 
HETATM 3944 O  O     . HOH H 7 .   ? -18.286 -12.097 -63.196 1.00 51.53  ? 558 HOH A O     1 
HETATM 3945 O  O     . HOH H 7 .   ? -25.538 2.650   -43.408 1.00 47.91  ? 559 HOH A O     1 
HETATM 3946 O  O     . HOH H 7 .   ? -32.645 10.846  -47.065 1.00 55.49  ? 560 HOH A O     1 
HETATM 3947 O  O     . HOH H 7 .   ? -10.789 0.366   -59.486 1.00 52.54  ? 561 HOH A O     1 
HETATM 3948 O  O     . HOH H 7 .   ? -26.014 6.287   -47.588 1.00 53.83  ? 562 HOH A O     1 
HETATM 3949 O  O     . HOH H 7 .   ? -5.292  -10.079 -52.623 1.00 49.34  ? 563 HOH A O     1 
HETATM 3950 O  O     . HOH H 7 .   ? -21.378 7.402   -56.289 1.00 69.55  ? 564 HOH A O     1 
HETATM 3951 O  O     . HOH H 7 .   ? -14.673 -33.325 -29.724 1.00 56.09  ? 565 HOH A O     1 
HETATM 3952 O  O     . HOH H 7 .   ? -24.663 5.008   -23.836 1.00 60.80  ? 566 HOH A O     1 
HETATM 3953 O  O     . HOH H 7 .   ? -14.495 7.568   -24.171 1.00 57.66  ? 567 HOH A O     1 
HETATM 3954 O  O     . HOH H 7 .   ? -52.293 7.386   -18.197 1.00 50.44  ? 568 HOH A O     1 
HETATM 3955 O  O     . HOH H 7 .   ? -17.256 4.330   -44.586 1.00 66.91  ? 569 HOH A O     1 
HETATM 3956 O  O     . HOH H 7 .   ? -49.934 4.463   -9.362  1.00 60.29  ? 570 HOH A O     1 
HETATM 3957 O  O     . HOH H 7 .   ? -53.407 2.876   -11.775 1.00 65.00  ? 571 HOH A O     1 
HETATM 3958 O  O     . HOH H 7 .   ? -59.950 0.923   -8.863  1.00 60.28  ? 572 HOH A O     1 
HETATM 3959 O  O     . HOH H 7 .   ? -61.223 8.563   -3.521  1.00 58.04  ? 573 HOH A O     1 
HETATM 3960 O  O     . HOH H 7 .   ? -33.099 9.357   4.268   1.00 52.97  ? 574 HOH A O     1 
HETATM 3961 O  O     . HOH H 7 .   ? -30.568 0.136   -8.378  1.00 76.79  ? 575 HOH A O     1 
HETATM 3962 O  O     . HOH H 7 .   ? -32.244 18.682  -13.852 1.00 52.70  ? 576 HOH A O     1 
HETATM 3963 O  O     . HOH H 7 .   ? -31.686 15.211  -17.918 1.00 53.51  ? 577 HOH A O     1 
HETATM 3964 O  O     . HOH H 7 .   ? -34.749 20.903  -14.725 1.00 55.22  ? 578 HOH A O     1 
HETATM 3965 O  O     . HOH H 7 .   ? -37.629 24.941  -20.329 1.00 54.98  ? 579 HOH A O     1 
HETATM 3966 O  O     . HOH H 7 .   ? -47.136 7.839   5.805   1.00 50.97  ? 580 HOH A O     1 
HETATM 3967 O  O     . HOH H 7 .   ? -44.919 10.682  6.965   1.00 60.36  ? 581 HOH A O     1 
HETATM 3968 O  O     . HOH H 7 .   ? -45.576 11.780  9.504   1.00 55.53  ? 582 HOH A O     1 
HETATM 3969 O  O     . HOH H 7 .   ? -54.365 24.482  -9.154  1.00 65.48  ? 583 HOH A O     1 
HETATM 3970 O  O     . HOH H 7 .   ? -59.423 1.998   -4.873  1.00 66.56  ? 584 HOH A O     1 
HETATM 3971 O  O     . HOH H 7 .   ? -49.021 8.096   -22.829 1.00 59.89  ? 585 HOH A O     1 
HETATM 3972 O  O     . HOH H 7 .   ? -46.336 4.674   -22.718 1.00 62.14  ? 586 HOH A O     1 
HETATM 3973 O  O     . HOH H 7 .   ? -31.880 21.025  -12.608 1.00 65.09  ? 587 HOH A O     1 
HETATM 3974 O  O     . HOH H 7 .   ? -26.611 18.311  -10.168 1.00 71.40  ? 588 HOH A O     1 
HETATM 3975 O  O     . HOH H 7 .   ? -45.541 12.572  -29.757 1.00 60.02  ? 589 HOH A O     1 
HETATM 3976 O  O     . HOH H 7 .   ? -32.033 15.063  -27.125 1.00 51.28  ? 590 HOH A O     1 
HETATM 3977 O  O     . HOH H 7 .   ? -43.657 -5.920  -10.726 1.00 59.57  ? 591 HOH A O     1 
HETATM 3978 O  O     . HOH H 7 .   ? -29.705 9.763   -19.622 1.00 61.80  ? 592 HOH A O     1 
HETATM 3979 O  O     . HOH H 7 .   ? -27.755 15.512  -25.472 1.00 65.12  ? 593 HOH A O     1 
HETATM 3980 O  O     . HOH H 7 .   ? -45.398 -5.125  -31.254 1.00 74.67  ? 594 HOH A O     1 
HETATM 3981 O  O     . HOH H 7 .   ? -18.793 -14.772 -31.056 1.00 46.94  ? 595 HOH A O     1 
HETATM 3982 O  O     . HOH H 7 .   ? -18.442 -18.109 -31.679 1.00 55.53  ? 596 HOH A O     1 
HETATM 3983 O  O     . HOH H 7 .   ? -20.228 -20.974 -34.224 1.00 47.50  ? 597 HOH A O     1 
HETATM 3984 O  O     . HOH H 7 .   ? -24.284 -20.301 -32.756 1.00 63.79  ? 598 HOH A O     1 
HETATM 3985 O  O     . HOH H 7 .   ? -33.587 -15.429 -29.382 1.00 53.37  ? 599 HOH A O     1 
HETATM 3986 O  O     . HOH H 7 .   ? -20.550 -25.329 -32.694 1.00 74.62  ? 600 HOH A O     1 
HETATM 3987 O  O     . HOH H 7 .   ? -17.910 -21.053 -24.795 1.00 56.07  ? 601 HOH A O     1 
HETATM 3988 O  O     . HOH H 7 .   ? -8.105  -26.503 -35.015 1.00 62.22  ? 602 HOH A O     1 
HETATM 3989 O  O     . HOH H 7 .   ? -8.672  -23.656 -37.670 1.00 50.88  ? 603 HOH A O     1 
HETATM 3990 O  O     . HOH H 7 .   ? -21.143 -21.616 -37.913 1.00 57.43  ? 604 HOH A O     1 
HETATM 3991 O  O     . HOH H 7 .   ? -26.212 -19.653 -44.003 1.00 59.25  ? 605 HOH A O     1 
HETATM 3992 O  O     . HOH H 7 .   ? -27.594 -18.171 -38.930 1.00 62.41  ? 606 HOH A O     1 
HETATM 3993 O  O     . HOH H 7 .   ? -10.180 -2.154  -49.889 1.00 49.81  ? 607 HOH A O     1 
HETATM 3994 O  O     . HOH H 7 .   ? -21.477 3.256   -49.225 1.00 56.60  ? 608 HOH A O     1 
HETATM 3995 O  O     . HOH H 7 .   ? -12.634 -10.397 -61.302 1.00 53.64  ? 609 HOH A O     1 
HETATM 3996 O  O     . HOH H 7 .   ? -16.222 -10.553 -62.063 1.00 56.77  ? 610 HOH A O     1 
HETATM 3997 O  O     . HOH H 7 .   ? -17.639 -3.965  -63.109 1.00 54.99  ? 611 HOH A O     1 
HETATM 3998 O  O     . HOH H 7 .   ? -22.522 9.205   -57.882 1.00 72.60  ? 612 HOH A O     1 
HETATM 3999 O  O     . HOH H 7 .   ? -34.068 -11.779 -47.689 1.00 51.12  ? 613 HOH A O     1 
HETATM 4000 O  O     . HOH H 7 .   ? -35.255 -12.244 -43.046 1.00 54.94  ? 614 HOH A O     1 
HETATM 4001 O  O     . HOH H 7 .   ? -38.735 4.261   -39.166 1.00 52.42  ? 615 HOH A O     1 
HETATM 4002 O  O     . HOH H 7 .   ? -36.772 10.700  -49.167 1.00 57.65  ? 616 HOH A O     1 
HETATM 4003 O  O     . HOH H 7 .   ? -25.452 3.087   -31.507 1.00 57.51  ? 617 HOH A O     1 
HETATM 4004 O  O     . HOH H 7 .   ? -32.757 -10.942 -29.968 1.00 53.45  ? 618 HOH A O     1 
HETATM 4005 O  O     . HOH H 7 .   ? -15.628 10.939  -23.659 1.00 50.29  ? 619 HOH A O     1 
HETATM 4006 O  O     . HOH H 7 .   ? -9.738  -4.892  -26.998 1.00 54.16  ? 620 HOH A O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . MET A 13  ? 0.9284 1.3311 0.8924 0.2013  0.1073  0.5414  1   MET A N   
2    C CA  . MET A 13  ? 0.8448 1.2245 0.9461 0.1042  0.0974  0.5063  1   MET A CA  
3    C C   . MET A 13  ? 0.8137 1.1842 0.9547 0.0616  0.0780  0.4748  1   MET A C   
4    O O   . MET A 13  ? 0.7515 1.1049 0.9204 -0.0130 0.0392  0.4123  1   MET A O   
5    C CB  . MET A 13  ? 0.8377 1.2234 1.0902 0.0855  0.1691  0.5630  1   MET A CB  
6    C CG  . MET A 13  ? 0.7785 1.1852 1.1521 -0.0336 0.1457  0.5106  1   MET A CG  
7    S SD  . MET A 13  ? 0.7928 1.2673 1.1253 -0.0761 0.0673  0.4698  1   MET A SD  
8    C CE  . MET A 13  ? 0.8503 1.3191 1.1040 0.0336  0.1052  0.5426  1   MET A CE  
9    N N   . LYS A 14  ? 0.8683 1.2619 1.0151 0.1221  0.1176  0.5352  2   LYS A N   
10   C CA  . LYS A 14  ? 0.8633 1.2607 1.0445 0.1068  0.1118  0.5303  2   LYS A CA  
11   C C   . LYS A 14  ? 0.8365 1.2805 0.9185 0.0828  0.0074  0.4641  2   LYS A C   
12   O O   . LYS A 14  ? 0.7908 1.2170 0.9111 0.0326  -0.0173 0.4258  2   LYS A O   
13   C CB  . LYS A 14  ? 0.9378 1.3886 1.1589 0.2018  0.1887  0.6459  2   LYS A CB  
14   C CG  . LYS A 14  ? 0.9495 1.3895 1.2517 0.1968  0.2243  0.6706  2   LYS A CG  
15   C CD  . LYS A 14  ? 1.0479 1.5715 1.4080 0.3145  0.3174  0.8220  2   LYS A CD  
16   C CE  . LYS A 14  ? 1.0771 1.5343 1.5607 0.3172  0.4122  0.8659  2   LYS A CE  
17   N NZ  . LYS A 14  ? 1.0163 1.4412 1.4705 0.2288  0.3284  0.7602  2   LYS A NZ  
18   N N   . GLU A 15  ? 0.8888 1.3777 0.8460 0.1150  -0.0389 0.4460  3   GLU A N   
19   C CA  . GLU A 15  ? 0.9035 1.4107 0.7721 0.0749  -0.1234 0.3628  3   GLU A CA  
20   C C   . GLU A 15  ? 0.8258 1.2416 0.7290 0.0082  -0.1341 0.2989  3   GLU A C   
21   O O   . GLU A 15  ? 0.8025 1.2116 0.7152 -0.0401 -0.1786 0.2463  3   GLU A O   
22   C CB  . GLU A 15  ? 1.0408 1.5804 0.7463 0.1158  -0.1451 0.3361  3   GLU A CB  
23   C CG  . GLU A 15  ? 1.0975 1.5302 0.7475 0.1335  -0.0961 0.3193  3   GLU A CG  
24   C CD  . GLU A 15  ? 1.3042 1.7513 0.7749 0.2034  -0.0772 0.3152  3   GLU A CD  
25   O OE1 . GLU A 15  ? 1.3668 1.9393 0.7495 0.2449  -0.1068 0.3365  3   GLU A OE1 
26   O OE2 . GLU A 15  ? 1.3970 1.7436 0.8107 0.2255  -0.0247 0.3012  3   GLU A OE2 
27   N N   . ILE A 16  ? 0.7947 1.1654 0.7328 0.0102  -0.0888 0.3190  4   ILE A N   
28   C CA  . ILE A 16  ? 0.7389 1.0757 0.7158 -0.0371 -0.0946 0.2884  4   ILE A CA  
29   C C   . ILE A 16  ? 0.6562 1.0023 0.7166 -0.0957 -0.1072 0.2715  4   ILE A C   
30   O O   . ILE A 16  ? 0.6348 0.9756 0.6993 -0.1255 -0.1329 0.2401  4   ILE A O   
31   C CB  . ILE A 16  ? 0.7502 1.0923 0.7546 -0.0151 -0.0486 0.3347  4   ILE A CB  
32   C CG1 . ILE A 16  ? 0.8646 1.1662 0.7532 0.0527  -0.0211 0.3418  4   ILE A CG1 
33   C CG2 . ILE A 16  ? 0.6862 1.0598 0.7534 -0.0553 -0.0547 0.3358  4   ILE A CG2 
34   C CD1 . ILE A 16  ? 0.9095 1.1978 0.8181 0.0805  0.0302  0.3849  4   ILE A CD1 
35   N N   . ASP A 17  ? 0.6331 0.9786 0.7556 -0.1067 -0.0725 0.2927  5   ASP A N   
36   C CA  . ASP A 17  ? 0.6061 0.9311 0.7753 -0.1563 -0.0661 0.2635  5   ASP A CA  
37   C C   . ASP A 17  ? 0.5894 0.9191 0.7386 -0.1464 -0.1010 0.2530  5   ASP A C   
38   O O   . ASP A 17  ? 0.5503 0.8742 0.7065 -0.1798 -0.1184 0.2226  5   ASP A O   
39   C CB  . ASP A 17  ? 0.6595 0.9384 0.8959 -0.1601 0.0096  0.2858  5   ASP A CB  
40   C CG  . ASP A 17  ? 0.6983 0.9732 0.9956 -0.2080 0.0474  0.2764  5   ASP A CG  
41   O OD1 . ASP A 17  ? 0.7076 1.0434 1.0002 -0.2572 0.0039  0.2452  5   ASP A OD1 
42   O OD2 . ASP A 17  ? 0.7904 1.0188 1.1589 -0.1960 0.1268  0.3115  5   ASP A OD2 
43   N N   . GLU A 18  ? 0.6042 0.9720 0.7365 -0.0996 -0.1109 0.2877  6   GLU A N   
44   C CA  . GLU A 18  ? 0.5965 1.0124 0.7447 -0.1008 -0.1490 0.2895  6   GLU A CA  
45   C C   . GLU A 18  ? 0.5789 0.9876 0.7071 -0.1404 -0.2022 0.2319  6   GLU A C   
46   O O   . GLU A 18  ? 0.5614 0.9766 0.7452 -0.1640 -0.2121 0.2275  6   GLU A O   
47   C CB  . GLU A 18  ? 0.6495 1.1754 0.7783 -0.0510 -0.1717 0.3400  6   GLU A CB  
48   C CG  . GLU A 18  ? 0.6929 1.2464 0.8828 0.0100  -0.0964 0.4359  6   GLU A CG  
49   C CD  . GLU A 18  ? 0.7921 1.5088 0.9484 0.0781  -0.1214 0.5101  6   GLU A CD  
50   O OE1 . GLU A 18  ? 0.8257 1.6767 0.9758 0.0625  -0.1994 0.5048  6   GLU A OE1 
51   O OE2 . GLU A 18  ? 0.8559 1.5882 0.9977 0.1453  -0.0633 0.5779  6   GLU A OE2 
52   N N   . LEU A 19  ? 0.5987 0.9844 0.6584 -0.1395 -0.2175 0.1980  7   LEU A N   
53   C CA  . LEU A 19  ? 0.6182 0.9657 0.6707 -0.1715 -0.2366 0.1469  7   LEU A CA  
54   C C   . LEU A 19  ? 0.5621 0.8748 0.6711 -0.1854 -0.2064 0.1587  7   LEU A C   
55   O O   . LEU A 19  ? 0.5458 0.8478 0.7079 -0.2071 -0.2084 0.1487  7   LEU A O   
56   C CB  . LEU A 19  ? 0.7050 1.0017 0.6627 -0.1575 -0.2269 0.1098  7   LEU A CB  
57   C CG  . LEU A 19  ? 0.8314 1.1726 0.6878 -0.1513 -0.2634 0.0722  7   LEU A CG  
58   C CD1 . LEU A 19  ? 0.9288 1.1774 0.6689 -0.1235 -0.2196 0.0377  7   LEU A CD1 
59   C CD2 . LEU A 19  ? 0.8377 1.2345 0.7164 -0.2158 -0.3251 0.0101  7   LEU A CD2 
60   N N   . THR A 20  ? 0.5310 0.8518 0.6357 -0.1750 -0.1794 0.1853  8   THR A N   
61   C CA  . THR A 20  ? 0.4825 0.8300 0.6181 -0.1884 -0.1630 0.2010  8   THR A CA  
62   C C   . THR A 20  ? 0.4698 0.8210 0.6377 -0.2076 -0.1631 0.1951  8   THR A C   
63   O O   . THR A 20  ? 0.4598 0.8262 0.6497 -0.2063 -0.1528 0.2075  8   THR A O   
64   C CB  . THR A 20  ? 0.4867 0.8888 0.6212 -0.1977 -0.1509 0.2198  8   THR A CB  
65   O OG1 . THR A 20  ? 0.4836 0.8867 0.6039 -0.1656 -0.1360 0.2473  8   THR A OG1 
66   C CG2 . THR A 20  ? 0.4422 0.9381 0.5919 -0.2179 -0.1515 0.2368  8   THR A CG2 
67   N N   . ILE A 21  ? 0.4590 0.7950 0.6357 -0.2107 -0.1563 0.1931  9   ILE A N   
68   C CA  . ILE A 21  ? 0.4685 0.7921 0.6787 -0.2135 -0.1346 0.2010  9   ILE A CA  
69   C C   . ILE A 21  ? 0.4538 0.7972 0.7265 -0.2065 -0.1576 0.2184  9   ILE A C   
70   O O   . ILE A 21  ? 0.4532 0.7963 0.7619 -0.2082 -0.1467 0.2276  9   ILE A O   
71   C CB  . ILE A 21  ? 0.5103 0.7983 0.7327 -0.2046 -0.0882 0.2145  9   ILE A CB  
72   C CG1 . ILE A 21  ? 0.5487 0.7981 0.7331 -0.2394 -0.0505 0.1762  9   ILE A CG1 
73   C CG2 . ILE A 21  ? 0.5262 0.7928 0.7906 -0.1898 -0.0468 0.2407  9   ILE A CG2 
74   C CD1 . ILE A 21  ? 0.5866 0.7925 0.8002 -0.2268 0.0005  0.1959  9   ILE A CD1 
75   N N   . LYS A 22  ? 0.4582 0.8395 0.7503 -0.2020 -0.1904 0.2257  10  LYS A N   
76   C CA  . LYS A 22  ? 0.4652 0.9055 0.8389 -0.2168 -0.2225 0.2378  10  LYS A CA  
77   C C   . LYS A 22  ? 0.4815 0.8953 0.8817 -0.2544 -0.2421 0.1933  10  LYS A C   
78   O O   . LYS A 22  ? 0.4761 0.9153 0.9812 -0.2785 -0.2442 0.2046  10  LYS A O   
79   C CB  . LYS A 22  ? 0.5008 1.0476 0.8791 -0.2081 -0.2663 0.2593  10  LYS A CB  
80   C CG  . LYS A 22  ? 0.5295 1.1938 1.0168 -0.2408 -0.3136 0.2758  10  LYS A CG  
81   C CD  . LYS A 22  ? 0.6135 1.4588 1.1059 -0.2353 -0.3749 0.3081  10  LYS A CD  
82   C CE  . LYS A 22  ? 0.6323 1.6192 1.2349 -0.3053 -0.4462 0.2913  10  LYS A CE  
83   N NZ  . LYS A 22  ? 0.7305 1.9586 1.3288 -0.3044 -0.5229 0.3277  10  LYS A NZ  
84   N N   . GLU A 23  ? 0.5157 0.8710 0.8424 -0.2574 -0.2393 0.1512  11  GLU A N   
85   C CA  . GLU A 23  ? 0.5908 0.8835 0.9541 -0.2891 -0.2243 0.1100  11  GLU A CA  
86   C C   . GLU A 23  ? 0.5619 0.7937 0.9396 -0.2556 -0.1556 0.1461  11  GLU A C   
87   O O   . GLU A 23  ? 0.6004 0.7884 1.0660 -0.2648 -0.1123 0.1543  11  GLU A O   
88   C CB  . GLU A 23  ? 0.7116 0.9699 0.9923 -0.3172 -0.2485 0.0335  11  GLU A CB  
89   C CG  . GLU A 23  ? 0.8087 1.1821 1.0790 -0.3612 -0.3290 -0.0051 11  GLU A CG  
90   C CD  . GLU A 23  ? 0.8782 1.3292 1.2948 -0.4285 -0.3635 -0.0147 11  GLU A CD  
91   O OE1 . GLU A 23  ? 0.9540 1.3225 1.4769 -0.4570 -0.3152 -0.0226 11  GLU A OE1 
92   O OE2 . GLU A 23  ? 0.9205 1.5382 1.3652 -0.4486 -0.4339 0.0015  11  GLU A OE2 
93   N N   . TYR A 24  ? 0.5206 0.7710 0.8298 -0.2175 -0.1411 0.1776  12  TYR A N   
94   C CA  . TYR A 24  ? 0.5121 0.7781 0.8390 -0.1786 -0.0861 0.2362  12  TYR A CA  
95   C C   . TYR A 24  ? 0.4664 0.7976 0.8167 -0.1676 -0.0793 0.2762  12  TYR A C   
96   O O   . TYR A 24  ? 0.4788 0.8432 0.8622 -0.1335 -0.0340 0.3321  12  TYR A O   
97   C CB  . TYR A 24  ? 0.5099 0.8133 0.7723 -0.1513 -0.0785 0.2601  12  TYR A CB  
98   C CG  . TYR A 24  ? 0.5718 0.7879 0.8099 -0.1373 -0.0456 0.2412  12  TYR A CG  
99   C CD1 . TYR A 24  ? 0.5962 0.7630 0.7658 -0.1598 -0.0812 0.1755  12  TYR A CD1 
100  C CD2 . TYR A 24  ? 0.6159 0.7973 0.8931 -0.0915 0.0370  0.2964  12  TYR A CD2 
101  C CE1 . TYR A 24  ? 0.7128 0.7816 0.8261 -0.1453 -0.0388 0.1436  12  TYR A CE1 
102  C CE2 . TYR A 24  ? 0.7163 0.7799 0.9599 -0.0727 0.0959  0.2746  12  TYR A CE2 
103  C CZ  . TYR A 24  ? 0.7753 0.7732 0.9237 -0.1048 0.0556  0.1861  12  TYR A CZ  
104  O OH  . TYR A 24  ? 0.9072 0.7726 0.9905 -0.0839 0.1260  0.1522  12  TYR A OH  
105  N N   . GLY A 25  ? 0.4531 0.7982 0.7823 -0.1869 -0.1093 0.2548  13  GLY A N   
106  C CA  . GLY A 25  ? 0.4457 0.8168 0.7827 -0.1739 -0.0835 0.2820  13  GLY A CA  
107  C C   . GLY A 25  ? 0.4487 0.8730 0.6838 -0.1738 -0.0773 0.2732  13  GLY A C   
108  O O   . GLY A 25  ? 0.4616 0.9126 0.6638 -0.1587 -0.0462 0.2878  13  GLY A O   
109  N N   . VAL A 26  ? 0.5033 0.6557 0.5390 -0.1654 -0.0487 0.1275  14  VAL A N   
110  C CA  . VAL A 26  ? 0.4606 0.6184 0.5008 -0.1371 -0.0355 0.1224  14  VAL A CA  
111  C C   . VAL A 26  ? 0.4488 0.6569 0.5110 -0.1268 -0.0280 0.1316  14  VAL A C   
112  O O   . VAL A 26  ? 0.4556 0.6806 0.5227 -0.1286 -0.0315 0.1290  14  VAL A O   
113  C CB  . VAL A 26  ? 0.4778 0.6011 0.5013 -0.1211 -0.0343 0.1015  14  VAL A CB  
114  C CG1 . VAL A 26  ? 0.4003 0.5288 0.4287 -0.0952 -0.0228 0.0981  14  VAL A CG1 
115  C CG2 . VAL A 26  ? 0.4736 0.5452 0.4734 -0.1296 -0.0415 0.0922  14  VAL A CG2 
116  N N   . ASP A 27  ? 0.4363 0.6669 0.5094 -0.1150 -0.0174 0.1427  15  ASP A N   
117  C CA  . ASP A 27  ? 0.4289 0.7017 0.5191 -0.1001 -0.0080 0.1507  15  ASP A CA  
118  C C   . ASP A 27  ? 0.4045 0.6683 0.4891 -0.0830 -0.0058 0.1350  15  ASP A C   
119  O O   . ASP A 27  ? 0.3989 0.6299 0.4691 -0.0724 -0.0047 0.1205  15  ASP A O   
120  C CB  . ASP A 27  ? 0.4259 0.7119 0.5192 -0.0847 0.0049  0.1601  15  ASP A CB  
121  C CG  . ASP A 27  ? 0.4840 0.8177 0.5958 -0.0722 0.0155  0.1738  15  ASP A CG  
122  O OD1 . ASP A 27  ? 0.4544 0.7957 0.5680 -0.0564 0.0192  0.1673  15  ASP A OD1 
123  O OD2 . ASP A 27  ? 0.5827 0.9475 0.7076 -0.0777 0.0208  0.1928  15  ASP A OD2 
124  N N   . SER A 28  ? 0.3712 0.6658 0.4685 -0.0802 -0.0054 0.1397  16  SER A N   
125  C CA  . SER A 28  ? 0.3656 0.6530 0.4579 -0.0649 -0.0030 0.1274  16  SER A CA  
126  C C   . SER A 28  ? 0.3450 0.6193 0.4304 -0.0424 0.0075  0.1212  16  SER A C   
127  O O   . SER A 28  ? 0.3357 0.5874 0.4111 -0.0335 0.0076  0.1074  16  SER A O   
128  C CB  . SER A 28  ? 0.3590 0.6842 0.4666 -0.0635 -0.0036 0.1370  16  SER A CB  
129  O OG  . SER A 28  ? 0.3635 0.7199 0.4849 -0.0482 0.0077  0.1507  16  SER A OG  
130  N N   . ARG A 29  ? 0.3233 0.6102 0.4120 -0.0343 0.0161  0.1312  17  ARG A N   
131  C CA  . ARG A 29  ? 0.3404 0.6113 0.4174 -0.0148 0.0245  0.1248  17  ARG A CA  
132  C C   . ARG A 29  ? 0.3414 0.5744 0.4026 -0.0151 0.0204  0.1119  17  ARG A C   
133  O O   . ARG A 29  ? 0.3370 0.5532 0.3882 -0.0021 0.0227  0.1025  17  ARG A O   
134  C CB  . ARG A 29  ? 0.3643 0.6568 0.4442 -0.0052 0.0355  0.1386  17  ARG A CB  
135  C CG  . ARG A 29  ? 0.4140 0.7441 0.5095 0.0034  0.0422  0.1505  17  ARG A CG  
136  C CD  . ARG A 29  ? 0.4987 0.8581 0.6002 0.0143  0.0555  0.1673  17  ARG A CD  
137  N NE  . ARG A 29  ? 0.5628 0.9378 0.6736 -0.0034 0.0534  0.1802  17  ARG A NE  
138  C CZ  . ARG A 29  ? 0.6466 1.0479 0.7627 0.0022  0.0649  0.1965  17  ARG A CZ  
139  N NH1 . ARG A 29  ? 0.6619 1.0754 0.7731 0.0274  0.0801  0.2004  17  ARG A NH1 
140  N NH2 . ARG A 29  ? 0.6453 1.0595 0.7702 -0.0169 0.0620  0.2094  17  ARG A NH2 
141  N N   . ILE A 30  ? 0.3478 0.5687 0.4070 -0.0299 0.0140  0.1132  18  ILE A N   
142  C CA  . ILE A 30  ? 0.3733 0.5600 0.4198 -0.0306 0.0093  0.1034  18  ILE A CA  
143  C C   . ILE A 30  ? 0.3676 0.5372 0.4107 -0.0281 0.0047  0.0887  18  ILE A C   
144  O O   . ILE A 30  ? 0.3688 0.5208 0.4052 -0.0183 0.0048  0.0801  18  ILE A O   
145  C CB  . ILE A 30  ? 0.4046 0.5798 0.4487 -0.0481 0.0033  0.1101  18  ILE A CB  
146  C CG1 . ILE A 30  ? 0.4226 0.6125 0.4681 -0.0486 0.0094  0.1256  18  ILE A CG1 
147  C CG2 . ILE A 30  ? 0.4086 0.5453 0.4394 -0.0479 -0.0023 0.0994  18  ILE A CG2 
148  C CD1 . ILE A 30  ? 0.4499 0.6354 0.4962 -0.0695 0.0039  0.1372  18  ILE A CD1 
149  N N   . LEU A 31  ? 0.3700 0.5477 0.4178 -0.0369 0.0009  0.0869  19  LEU A N   
150  C CA  . LEU A 31  ? 0.3807 0.5463 0.4245 -0.0338 -0.0013 0.0743  19  LEU A CA  
151  C C   . LEU A 31  ? 0.3613 0.5332 0.4075 -0.0186 0.0040  0.0705  19  LEU A C   
152  O O   . LEU A 31  ? 0.3446 0.5014 0.3869 -0.0121 0.0038  0.0610  19  LEU A O   
153  C CB  . LEU A 31  ? 0.3911 0.5653 0.4358 -0.0462 -0.0066 0.0741  19  LEU A CB  
154  C CG  . LEU A 31  ? 0.4515 0.6058 0.4862 -0.0630 -0.0146 0.0724  19  LEU A CG  
155  C CD1 . LEU A 31  ? 0.4700 0.6313 0.5010 -0.0755 -0.0214 0.0704  19  LEU A CD1 
156  C CD2 . LEU A 31  ? 0.4657 0.5834 0.4865 -0.0579 -0.0152 0.0607  19  LEU A CD2 
157  N N   . MET A 32  ? 0.3512 0.5449 0.4037 -0.0129 0.0090  0.0788  20  MET A N   
158  C CA  . MET A 32  ? 0.3380 0.5329 0.3893 0.0006  0.0138  0.0761  20  MET A CA  
159  C C   . MET A 32  ? 0.3408 0.5164 0.3823 0.0096  0.0152  0.0712  20  MET A C   
160  O O   . MET A 32  ? 0.3304 0.4945 0.3683 0.0153  0.0143  0.0636  20  MET A O   
161  C CB  . MET A 32  ? 0.3297 0.5494 0.3876 0.0069  0.0197  0.0869  20  MET A CB  
162  C CG  . MET A 32  ? 0.3519 0.5661 0.4045 0.0212  0.0244  0.0837  20  MET A CG  
163  S SD  . MET A 32  ? 0.4237 0.6661 0.4847 0.0315  0.0314  0.0967  20  MET A SD  
164  C CE  . MET A 32  ? 0.3972 0.6536 0.4683 0.0199  0.0240  0.0971  20  MET A CE  
165  N N   . GLU A 33  ? 0.3312 0.5041 0.3683 0.0092  0.0163  0.0763  21  GLU A N   
166  C CA  . GLU A 33  ? 0.3532 0.5078 0.3790 0.0160  0.0154  0.0722  21  GLU A CA  
167  C C   . GLU A 33  ? 0.3547 0.4921 0.3810 0.0134  0.0085  0.0630  21  GLU A C   
168  O O   . GLU A 33  ? 0.3407 0.4691 0.3635 0.0193  0.0063  0.0572  21  GLU A O   
169  C CB  . GLU A 33  ? 0.3627 0.5173 0.3821 0.0153  0.0175  0.0806  21  GLU A CB  
170  C CG  . GLU A 33  ? 0.3967 0.5342 0.4008 0.0232  0.0163  0.0777  21  GLU A CG  
171  C CD  . GLU A 33  ? 0.4589 0.5934 0.4501 0.0352  0.0208  0.0749  21  GLU A CD  
172  O OE1 . GLU A 33  ? 0.4201 0.5682 0.4136 0.0406  0.0282  0.0788  21  GLU A OE1 
173  O OE2 . GLU A 33  ? 0.4447 0.5611 0.4220 0.0395  0.0160  0.0690  21  GLU A OE2 
174  N N   . ARG A 34  ? 0.3514 0.4843 0.3815 0.0049  0.0053  0.0626  22  ARG A N   
175  C CA  . ARG A 34  ? 0.3621 0.4800 0.3929 0.0052  0.0011  0.0547  22  ARG A CA  
176  C C   . ARG A 34  ? 0.3596 0.4821 0.3959 0.0091  0.0018  0.0475  22  ARG A C   
177  O O   . ARG A 34  ? 0.3611 0.4772 0.3995 0.0142  -0.0003 0.0431  22  ARG A O   
178  C CB  . ARG A 34  ? 0.3756 0.4833 0.4047 -0.0037 -0.0013 0.0541  22  ARG A CB  
179  C CG  . ARG A 34  ? 0.3964 0.4937 0.4193 -0.0095 -0.0033 0.0619  22  ARG A CG  
180  C CD  . ARG A 34  ? 0.4266 0.5041 0.4443 -0.0027 -0.0062 0.0603  22  ARG A CD  
181  N NE  . ARG A 34  ? 0.4139 0.4760 0.4314 0.0009  -0.0079 0.0516  22  ARG A NE  
182  C CZ  . ARG A 34  ? 0.4332 0.4720 0.4425 -0.0029 -0.0102 0.0496  22  ARG A CZ  
183  N NH1 . ARG A 34  ? 0.4382 0.4650 0.4396 -0.0136 -0.0127 0.0565  22  ARG A NH1 
184  N NH2 . ARG A 34  ? 0.4246 0.4504 0.4321 0.0043  -0.0094 0.0410  22  ARG A NH2 
185  N N   . ALA A 35  ? 0.3296 0.4650 0.3691 0.0065  0.0044  0.0481  23  ALA A N   
186  C CA  . ALA A 35  ? 0.3317 0.4716 0.3752 0.0090  0.0056  0.0434  23  ALA A CA  
187  C C   . ALA A 35  ? 0.3436 0.4812 0.3864 0.0156  0.0054  0.0429  23  ALA A C   
188  O O   . ALA A 35  ? 0.3542 0.4888 0.4011 0.0172  0.0033  0.0388  23  ALA A O   
189  C CB  . ALA A 35  ? 0.3180 0.4726 0.3635 0.0051  0.0078  0.0464  23  ALA A CB  
190  N N   . GLY A 36  ? 0.3458 0.4842 0.3821 0.0192  0.0072  0.0474  24  GLY A N   
191  C CA  . GLY A 36  ? 0.3633 0.4927 0.3922 0.0246  0.0060  0.0457  24  GLY A CA  
192  C C   . GLY A 36  ? 0.3603 0.4791 0.3870 0.0248  -0.0002 0.0427  24  GLY A C   
193  O O   . GLY A 36  ? 0.3653 0.4800 0.3933 0.0241  -0.0045 0.0397  24  GLY A O   
194  N N   . ILE A 37  ? 0.3572 0.4726 0.3811 0.0249  -0.0018 0.0449  25  ILE A N   
195  C CA  . ILE A 37  ? 0.3637 0.4714 0.3865 0.0260  -0.0089 0.0437  25  ILE A CA  
196  C C   . ILE A 37  ? 0.3597 0.4726 0.3979 0.0249  -0.0118 0.0406  25  ILE A C   
197  O O   . ILE A 37  ? 0.3502 0.4636 0.3925 0.0255  -0.0181 0.0403  25  ILE A O   
198  C CB  . ILE A 37  ? 0.3849 0.4861 0.4006 0.0271  -0.0103 0.0481  25  ILE A CB  
199  C CG1 . ILE A 37  ? 0.4327 0.5345 0.4566 0.0239  -0.0083 0.0493  25  ILE A CG1 
200  C CG2 . ILE A 37  ? 0.3912 0.4899 0.3907 0.0297  -0.0059 0.0526  25  ILE A CG2 
201  C CD1 . ILE A 37  ? 0.5093 0.6019 0.5266 0.0234  -0.0099 0.0548  25  ILE A CD1 
202  N N   . SER A 38  ? 0.3416 0.4597 0.3877 0.0234  -0.0072 0.0389  26  SER A N   
203  C CA  . SER A 38  ? 0.3561 0.4796 0.4147 0.0252  -0.0073 0.0362  26  SER A CA  
204  C C   . SER A 38  ? 0.3449 0.4786 0.4113 0.0233  -0.0082 0.0355  26  SER A C   
205  O O   . SER A 38  ? 0.3527 0.4952 0.4314 0.0244  -0.0113 0.0364  26  SER A O   
206  C CB  . SER A 38  ? 0.3441 0.4651 0.4020 0.0241  -0.0021 0.0334  26  SER A CB  
207  O OG  . SER A 38  ? 0.4193 0.5488 0.4779 0.0204  0.0019  0.0318  26  SER A OG  
208  N N   . VAL A 39  ? 0.3405 0.4733 0.4002 0.0202  -0.0063 0.0357  27  VAL A N   
209  C CA  . VAL A 39  ? 0.3369 0.4735 0.4003 0.0167  -0.0079 0.0361  27  VAL A CA  
210  C C   . VAL A 39  ? 0.3522 0.4830 0.4132 0.0146  -0.0171 0.0371  27  VAL A C   
211  O O   . VAL A 39  ? 0.3440 0.4835 0.4165 0.0103  -0.0213 0.0387  27  VAL A O   
212  C CB  . VAL A 39  ? 0.3551 0.4875 0.4094 0.0157  -0.0040 0.0368  27  VAL A CB  
213  C CG1 . VAL A 39  ? 0.3531 0.4824 0.4080 0.0108  -0.0071 0.0379  27  VAL A CG1 
214  C CG2 . VAL A 39  ? 0.3324 0.4743 0.3901 0.0156  0.0027  0.0368  27  VAL A CG2 
215  N N   . VAL A 40  ? 0.3521 0.4701 0.3981 0.0170  -0.0206 0.0371  28  VAL A N   
216  C CA  . VAL A 40  ? 0.3679 0.4772 0.4055 0.0144  -0.0307 0.0375  28  VAL A CA  
217  C C   . VAL A 40  ? 0.3680 0.4915 0.4234 0.0139  -0.0372 0.0404  28  VAL A C   
218  O O   . VAL A 40  ? 0.3650 0.4947 0.4279 0.0075  -0.0460 0.0425  28  VAL A O   
219  C CB  . VAL A 40  ? 0.3747 0.4679 0.3896 0.0188  -0.0314 0.0372  28  VAL A CB  
220  C CG1 . VAL A 40  ? 0.3846 0.4678 0.3875 0.0155  -0.0438 0.0372  28  VAL A CG1 
221  C CG2 . VAL A 40  ? 0.3833 0.4651 0.3813 0.0223  -0.0237 0.0357  28  VAL A CG2 
222  N N   . LEU A 41  ? 0.3453 0.4738 0.4077 0.0204  -0.0334 0.0416  29  LEU A N   
223  C CA  . LEU A 41  ? 0.3665 0.5083 0.4462 0.0241  -0.0380 0.0454  29  LEU A CA  
224  C C   . LEU A 41  ? 0.3408 0.5040 0.4436 0.0229  -0.0359 0.0472  29  LEU A C   
225  O O   . LEU A 41  ? 0.3467 0.5268 0.4662 0.0226  -0.0430 0.0526  29  LEU A O   
226  C CB  . LEU A 41  ? 0.3717 0.5074 0.4501 0.0325  -0.0333 0.0460  29  LEU A CB  
227  C CG  . LEU A 41  ? 0.3925 0.5120 0.4519 0.0335  -0.0375 0.0482  29  LEU A CG  
228  C CD1 . LEU A 41  ? 0.4103 0.5193 0.4650 0.0377  -0.0314 0.0489  29  LEU A CD1 
229  C CD2 . LEU A 41  ? 0.4052 0.5287 0.4667 0.0348  -0.0497 0.0535  29  LEU A CD2 
230  N N   . ALA A 42  ? 0.3238 0.4891 0.4283 0.0222  -0.0262 0.0440  30  ALA A N   
231  C CA  . ALA A 42  ? 0.3145 0.5002 0.4378 0.0210  -0.0216 0.0461  30  ALA A CA  
232  C C   . ALA A 42  ? 0.3274 0.5217 0.4576 0.0097  -0.0303 0.0505  30  ALA A C   
233  O O   . ALA A 42  ? 0.3249 0.5426 0.4768 0.0077  -0.0323 0.0567  30  ALA A O   
234  C CB  . ALA A 42  ? 0.2915 0.4744 0.4091 0.0214  -0.0105 0.0419  30  ALA A CB  
235  N N   . MET A 43  ? 0.3599 0.5343 0.4709 0.0024  -0.0353 0.0480  31  MET A N   
236  C CA  . MET A 43  ? 0.3907 0.5637 0.5014 -0.0100 -0.0447 0.0510  31  MET A CA  
237  C C   . MET A 43  ? 0.4226 0.6042 0.5409 -0.0147 -0.0589 0.0557  31  MET A C   
238  O O   . MET A 43  ? 0.4048 0.6029 0.5391 -0.0258 -0.0671 0.0622  31  MET A O   
239  C CB  . MET A 43  ? 0.4133 0.5561 0.4959 -0.0135 -0.0463 0.0460  31  MET A CB  
240  C CG  . MET A 43  ? 0.4045 0.5427 0.4828 -0.0117 -0.0352 0.0444  31  MET A CG  
241  S SD  . MET A 43  ? 0.4459 0.5498 0.4940 -0.0143 -0.0369 0.0410  31  MET A SD  
242  C CE  . MET A 43  ? 0.4006 0.4850 0.4239 -0.0033 -0.0357 0.0360  31  MET A CE  
243  N N   . GLU A 44  ? 0.4304 0.6033 0.5384 -0.0074 -0.0624 0.0541  32  GLU A N   
244  C CA  . GLU A 44  ? 0.4650 0.6469 0.5786 -0.0104 -0.0769 0.0595  32  GLU A CA  
245  C C   . GLU A 44  ? 0.4620 0.6814 0.6116 -0.0067 -0.0773 0.0689  32  GLU A C   
246  O O   . GLU A 44  ? 0.4506 0.6901 0.6163 -0.0157 -0.0899 0.0769  32  GLU A O   
247  C CB  . GLU A 44  ? 0.4754 0.6393 0.5689 -0.0014 -0.0780 0.0568  32  GLU A CB  
248  C CG  . GLU A 44  ? 0.5511 0.7168 0.6405 -0.0047 -0.0938 0.0615  32  GLU A CG  
249  C CD  . GLU A 44  ? 0.6033 0.7483 0.6681 0.0038  -0.0934 0.0594  32  GLU A CD  
250  O OE1 . GLU A 44  ? 0.6265 0.7675 0.6914 0.0142  -0.0810 0.0578  32  GLU A OE1 
251  O OE2 . GLU A 44  ? 0.6448 0.7762 0.6879 -0.0012 -0.1057 0.0595  32  GLU A OE2 
252  N N   . GLU A 45  ? 0.4627 0.6911 0.6236 0.0070  -0.0634 0.0681  33  GLU A N   
253  C CA  . GLU A 45  ? 0.4750 0.7366 0.6673 0.0157  -0.0576 0.0756  33  GLU A CA  
254  C C   . GLU A 45  ? 0.4704 0.7586 0.6847 0.0049  -0.0570 0.0820  33  GLU A C   
255  O O   . GLU A 45  ? 0.4577 0.7803 0.7009 0.0053  -0.0603 0.0927  33  GLU A O   
256  C CB  . GLU A 45  ? 0.4814 0.7333 0.6684 0.0305  -0.0410 0.0692  33  GLU A CB  
257  C CG  . GLU A 45  ? 0.5489 0.8216 0.7569 0.0466  -0.0313 0.0735  33  GLU A CG  
258  C CD  . GLU A 45  ? 0.6417 0.8890 0.8312 0.0583  -0.0188 0.0643  33  GLU A CD  
259  O OE1 . GLU A 45  ? 0.6856 0.9172 0.8668 0.0680  -0.0204 0.0638  33  GLU A OE1 
260  O OE2 . GLU A 45  ? 0.7150 0.9555 0.8956 0.0557  -0.0088 0.0579  33  GLU A OE2 
261  N N   . GLU A 46  ? 0.4705 0.7441 0.6717 -0.0050 -0.0531 0.0771  34  GLU A N   
262  C CA  . GLU A 46  ? 0.4739 0.7684 0.6926 -0.0171 -0.0520 0.0840  34  GLU A CA  
263  C C   . GLU A 46  ? 0.4953 0.7867 0.7121 -0.0382 -0.0704 0.0891  34  GLU A C   
264  O O   . GLU A 46  ? 0.4877 0.8090 0.7299 -0.0498 -0.0756 0.1003  34  GLU A O   
265  C CB  . GLU A 46  ? 0.4794 0.7581 0.6836 -0.0166 -0.0386 0.0775  34  GLU A CB  
266  C CG  . GLU A 46  ? 0.5389 0.8311 0.7541 -0.0304 -0.0368 0.0844  34  GLU A CG  
267  C CD  . GLU A 46  ? 0.5869 0.9223 0.8347 -0.0254 -0.0265 0.0946  34  GLU A CD  
268  O OE1 . GLU A 46  ? 0.6081 0.9611 0.8690 -0.0089 -0.0200 0.0954  34  GLU A OE1 
269  O OE2 . GLU A 46  ? 0.6228 0.9729 0.8814 -0.0374 -0.0242 0.1025  34  GLU A OE2 
270  N N   . LEU A 47  ? 0.5043 0.7599 0.6903 -0.0440 -0.0807 0.0815  35  LEU A N   
271  C CA  . LEU A 47  ? 0.5326 0.7754 0.7082 -0.0645 -0.0983 0.0839  35  LEU A CA  
272  C C   . LEU A 47  ? 0.5535 0.7997 0.7274 -0.0696 -0.1173 0.0873  35  LEU A C   
273  O O   . LEU A 47  ? 0.5848 0.8229 0.7509 -0.0890 -0.1349 0.0902  35  LEU A O   
274  C CB  . LEU A 47  ? 0.5464 0.7425 0.6835 -0.0683 -0.0974 0.0732  35  LEU A CB  
275  C CG  . LEU A 47  ? 0.5430 0.7340 0.6793 -0.0658 -0.0817 0.0714  35  LEU A CG  
276  C CD1 . LEU A 47  ? 0.5638 0.7100 0.6624 -0.0645 -0.0805 0.0618  35  LEU A CD1 
277  C CD2 . LEU A 47  ? 0.5677 0.7799 0.7263 -0.0822 -0.0844 0.0820  35  LEU A CD2 
278  N N   . GLY A 48  ? 0.5323 0.7888 0.7119 -0.0534 -0.1148 0.0877  36  GLY A N   
279  C CA  . GLY A 48  ? 0.5498 0.8050 0.7218 -0.0560 -0.1324 0.0905  36  GLY A CA  
280  C C   . GLY A 48  ? 0.5786 0.7849 0.7037 -0.0566 -0.1357 0.0782  36  GLY A C   
281  O O   . GLY A 48  ? 0.5672 0.7487 0.6733 -0.0487 -0.1212 0.0689  36  GLY A O   
282  N N   . ASN A 49  ? 0.6004 0.7945 0.7065 -0.0657 -0.1545 0.0787  37  ASN A N   
283  C CA  . ASN A 49  ? 0.6384 0.7867 0.6968 -0.0653 -0.1579 0.0677  37  ASN A CA  
284  C C   . ASN A 49  ? 0.6423 0.7548 0.6741 -0.0708 -0.1508 0.0579  37  ASN A C   
285  O O   . ASN A 49  ? 0.6460 0.7550 0.6802 -0.0874 -0.1586 0.0595  37  ASN A O   
286  C CB  . ASN A 49  ? 0.6778 0.8181 0.7176 -0.0790 -0.1824 0.0702  37  ASN A CB  
287  C CG  . ASN A 49  ? 0.7342 0.8351 0.7265 -0.0715 -0.1836 0.0610  37  ASN A CG  
288  O OD1 . ASN A 49  ? 0.7439 0.8042 0.6984 -0.0725 -0.1792 0.0500  37  ASN A OD1 
289  N ND2 . ASN A 49  ? 0.7766 0.8897 0.7700 -0.0629 -0.1892 0.0666  37  ASN A ND2 
290  N N   . LEU A 50  ? 0.6339 0.7204 0.6408 -0.0566 -0.1362 0.0490  38  LEU A N   
291  C CA  . LEU A 50  ? 0.6373 0.6928 0.6216 -0.0572 -0.1271 0.0412  38  LEU A CA  
292  C C   . LEU A 50  ? 0.6825 0.6918 0.6195 -0.0649 -0.1383 0.0330  38  LEU A C   
293  O O   . LEU A 50  ? 0.6940 0.6729 0.6090 -0.0654 -0.1328 0.0270  38  LEU A O   
294  C CB  . LEU A 50  ? 0.6119 0.6646 0.5934 -0.0386 -0.1065 0.0372  38  LEU A CB  
295  C CG  . LEU A 50  ? 0.5782 0.6664 0.5977 -0.0308 -0.0939 0.0426  38  LEU A CG  
296  C CD1 . LEU A 50  ? 0.5255 0.6067 0.5377 -0.0166 -0.0765 0.0385  38  LEU A CD1 
297  C CD2 . LEU A 50  ? 0.5942 0.7017 0.6399 -0.0411 -0.0937 0.0475  38  LEU A CD2 
298  N N   . SER A 51  ? 0.7062 0.7077 0.6249 -0.0705 -0.1544 0.0329  39  SER A N   
299  C CA  . SER A 51  ? 0.7592 0.7120 0.6241 -0.0708 -0.1600 0.0227  39  SER A CA  
300  C C   . SER A 51  ? 0.8116 0.7297 0.6528 -0.0894 -0.1727 0.0180  39  SER A C   
301  O O   . SER A 51  ? 0.8506 0.7200 0.6440 -0.0859 -0.1716 0.0076  39  SER A O   
302  C CB  . SER A 51  ? 0.7747 0.7264 0.6207 -0.0702 -0.1729 0.0236  39  SER A CB  
303  O OG  . SER A 51  ? 0.7834 0.7433 0.6352 -0.0915 -0.1973 0.0286  39  SER A OG  
304  N N   . ASP A 52  ? 0.8151 0.7565 0.6886 -0.1083 -0.1834 0.0262  40  ASP A N   
305  C CA  . ASP A 52  ? 0.8728 0.7803 0.7258 -0.1286 -0.1957 0.0234  40  ASP A CA  
306  C C   . ASP A 52  ? 0.8629 0.7560 0.7191 -0.1245 -0.1796 0.0219  40  ASP A C   
307  O O   . ASP A 52  ? 0.9079 0.7633 0.7403 -0.1392 -0.1881 0.0188  40  ASP A O   
308  C CB  . ASP A 52  ? 0.8913 0.8326 0.7780 -0.1545 -0.2168 0.0355  40  ASP A CB  
309  C CG  . ASP A 52  ? 0.9546 0.9012 0.8300 -0.1642 -0.2389 0.0375  40  ASP A CG  
310  O OD1 . ASP A 52  ? 1.0603 0.9576 0.8842 -0.1742 -0.2539 0.0279  40  ASP A OD1 
311  O OD2 . ASP A 52  ? 1.0047 1.0031 0.9204 -0.1605 -0.2412 0.0485  40  ASP A OD2 
312  N N   . TYR A 53  ? 0.8009 0.7210 0.6840 -0.1060 -0.1581 0.0245  41  TYR A N   
313  C CA  . TYR A 53  ? 0.7824 0.6969 0.6741 -0.1032 -0.1443 0.0258  41  TYR A CA  
314  C C   . TYR A 53  ? 0.7857 0.6566 0.6378 -0.0844 -0.1298 0.0158  41  TYR A C   
315  O O   . TYR A 53  ? 0.7869 0.6503 0.6196 -0.0668 -0.1220 0.0099  41  TYR A O   
316  C CB  . TYR A 53  ? 0.7335 0.7010 0.6743 -0.0939 -0.1289 0.0343  41  TYR A CB  
317  C CG  . TYR A 53  ? 0.7320 0.7473 0.7172 -0.1080 -0.1373 0.0462  41  TYR A CG  
318  C CD1 . TYR A 53  ? 0.7816 0.8102 0.7888 -0.1241 -0.1394 0.0548  41  TYR A CD1 
319  C CD2 . TYR A 53  ? 0.7476 0.7968 0.7539 -0.1037 -0.1417 0.0503  41  TYR A CD2 
320  C CE1 . TYR A 53  ? 0.7825 0.8611 0.8334 -0.1352 -0.1450 0.0676  41  TYR A CE1 
321  C CE2 . TYR A 53  ? 0.7522 0.8489 0.8013 -0.1132 -0.1480 0.0625  41  TYR A CE2 
322  C CZ  . TYR A 53  ? 0.7678 0.8812 0.8401 -0.1284 -0.1489 0.0713  41  TYR A CZ  
323  O OH  . TYR A 53  ? 0.7793 0.9451 0.8963 -0.1353 -0.1527 0.0850  41  TYR A OH  
324  N N   . ARG A 54  ? 0.7797 0.6253 0.6224 -0.0873 -0.1254 0.0157  42  ARG A N   
325  C CA  . ARG A 54  ? 0.7831 0.5941 0.5961 -0.0675 -0.1098 0.0094  42  ARG A CA  
326  C C   . ARG A 54  ? 0.7177 0.5639 0.5655 -0.0556 -0.0916 0.0166  42  ARG A C   
327  O O   . ARG A 54  ? 0.6883 0.5554 0.5644 -0.0678 -0.0928 0.0247  42  ARG A O   
328  C CB  . ARG A 54  ? 0.8431 0.5954 0.6171 -0.0775 -0.1181 0.0049  42  ARG A CB  
329  C CG  . ARG A 54  ? 0.9142 0.6262 0.6481 -0.0927 -0.1390 -0.0031 42  ARG A CG  
330  C CD  . ARG A 54  ? 1.0043 0.6600 0.7050 -0.1114 -0.1524 -0.0058 42  ARG A CD  
331  N NE  . ARG A 54  ? 1.0102 0.6955 0.7516 -0.1353 -0.1604 0.0068  42  ARG A NE  
332  C CZ  . ARG A 54  ? 1.1101 0.7585 0.8368 -0.1560 -0.1713 0.0095  42  ARG A CZ  
333  N NH1 . ARG A 54  ? 1.1732 0.7463 0.8412 -0.1556 -0.1767 -0.0012 42  ARG A NH1 
334  N NH2 . ARG A 54  ? 1.1054 0.7912 0.8753 -0.1769 -0.1762 0.0236  42  ARG A NH2 
335  N N   . PHE A 55  ? 0.6762 0.5287 0.5201 -0.0328 -0.0753 0.0143  43  PHE A N   
336  C CA  . PHE A 55  ? 0.6280 0.5160 0.5032 -0.0221 -0.0598 0.0208  43  PHE A CA  
337  C C   . PHE A 55  ? 0.6396 0.5051 0.4969 -0.0055 -0.0464 0.0208  43  PHE A C   
338  O O   . PHE A 55  ? 0.6539 0.4941 0.4813 0.0106  -0.0399 0.0155  43  PHE A O   
339  C CB  . PHE A 55  ? 0.5822 0.5071 0.4769 -0.0113 -0.0525 0.0214  43  PHE A CB  
340  C CG  . PHE A 55  ? 0.5539 0.5080 0.4730 -0.0234 -0.0628 0.0239  43  PHE A CG  
341  C CD1 . PHE A 55  ? 0.5750 0.5144 0.4767 -0.0314 -0.0772 0.0202  43  PHE A CD1 
342  C CD2 . PHE A 55  ? 0.5078 0.5036 0.4656 -0.0256 -0.0583 0.0302  43  PHE A CD2 
343  C CE1 . PHE A 55  ? 0.5722 0.5419 0.4986 -0.0403 -0.0868 0.0244  43  PHE A CE1 
344  C CE2 . PHE A 55  ? 0.4979 0.5209 0.4783 -0.0326 -0.0662 0.0332  43  PHE A CE2 
345  C CZ  . PHE A 55  ? 0.5275 0.5394 0.4944 -0.0399 -0.0807 0.0313  43  PHE A CZ  
346  N N   . LEU A 56  ? 0.6247 0.5030 0.5016 -0.0085 -0.0415 0.0280  44  LEU A N   
347  C CA  . LEU A 56  ? 0.6268 0.4957 0.4965 0.0074  -0.0285 0.0316  44  LEU A CA  
348  C C   . LEU A 56  ? 0.5740 0.4920 0.4772 0.0147  -0.0180 0.0375  44  LEU A C   
349  O O   . LEU A 56  ? 0.5339 0.4827 0.4657 0.0033  -0.0197 0.0422  44  LEU A O   
350  C CB  . LEU A 56  ? 0.6575 0.5021 0.5217 -0.0028 -0.0324 0.0367  44  LEU A CB  
351  C CG  . LEU A 56  ? 0.6706 0.4960 0.5209 0.0148  -0.0209 0.0411  44  LEU A CG  
352  C CD1 . LEU A 56  ? 0.6583 0.4350 0.4657 0.0315  -0.0181 0.0335  44  LEU A CD1 
353  C CD2 . LEU A 56  ? 0.6450 0.4572 0.4987 0.0018  -0.0247 0.0492  44  LEU A CD2 
354  N N   . VAL A 57  ? 0.5640 0.4891 0.4622 0.0334  -0.0071 0.0375  45  VAL A N   
355  C CA  . VAL A 57  ? 0.5098 0.4778 0.4352 0.0389  0.0010  0.0426  45  VAL A CA  
356  C C   . VAL A 57  ? 0.5228 0.4921 0.4472 0.0522  0.0107  0.0499  45  VAL A C   
357  O O   . VAL A 57  ? 0.5608 0.5079 0.4632 0.0687  0.0171  0.0502  45  VAL A O   
358  C CB  . VAL A 57  ? 0.4967 0.4767 0.4200 0.0472  0.0043  0.0393  45  VAL A CB  
359  C CG1 . VAL A 57  ? 0.4345 0.4549 0.3841 0.0494  0.0106  0.0444  45  VAL A CG1 
360  C CG2 . VAL A 57  ? 0.4763 0.4505 0.3964 0.0355  -0.0066 0.0329  45  VAL A CG2 
361  N N   . LEU A 58  ? 0.5061 0.5005 0.4524 0.0460  0.0118  0.0562  46  LEU A N   
362  C CA  . LEU A 58  ? 0.5026 0.5014 0.4502 0.0558  0.0186  0.0651  46  LEU A CA  
363  C C   . LEU A 58  ? 0.4733 0.5129 0.4408 0.0615  0.0244  0.0695  46  LEU A C   
364  O O   . LEU A 58  ? 0.4664 0.5334 0.4533 0.0503  0.0220  0.0690  46  LEU A O   
365  C CB  . LEU A 58  ? 0.5024 0.4997 0.4572 0.0429  0.0147  0.0700  46  LEU A CB  
366  C CG  . LEU A 58  ? 0.5529 0.5131 0.4920 0.0311  0.0067  0.0675  46  LEU A CG  
367  C CD1 . LEU A 58  ? 0.5909 0.5577 0.5410 0.0185  0.0051  0.0757  46  LEU A CD1 
368  C CD2 . LEU A 58  ? 0.5806 0.4930 0.4863 0.0443  0.0081  0.0657  46  LEU A CD2 
369  N N   . CYS A 59  ? 0.4863 0.5299 0.4484 0.0788  0.0319  0.0744  47  CYS A N   
370  C CA  . CYS A 59  ? 0.4629 0.5452 0.4429 0.0830  0.0362  0.0798  47  CYS A CA  
371  C C   . CYS A 59  ? 0.4695 0.5702 0.4570 0.0935  0.0410  0.0922  47  CYS A C   
372  O O   . CYS A 59  ? 0.4971 0.5816 0.4718 0.1104  0.0467  0.0978  47  CYS A O   
373  C CB  . CYS A 59  ? 0.4715 0.5528 0.4433 0.0941  0.0414  0.0779  47  CYS A CB  
374  S SG  . CYS A 59  ? 0.4736 0.5456 0.4409 0.0824  0.0354  0.0663  47  CYS A SG  
375  N N   . GLY A 60  ? 0.4479 0.5821 0.4548 0.0840  0.0382  0.0967  48  GLY A N   
376  C CA  . GLY A 60  ? 0.4386 0.5999 0.4560 0.0914  0.0404  0.1095  48  GLY A CA  
377  C C   . GLY A 60  ? 0.4339 0.6227 0.4615 0.0999  0.0450  0.1154  48  GLY A C   
378  O O   . GLY A 60  ? 0.4226 0.6073 0.4473 0.0998  0.0471  0.1092  48  GLY A O   
379  N N   . GLY A 61  ? 0.4341 0.6532 0.4744 0.1068  0.0463  0.1292  49  GLY A N   
380  C CA  . GLY A 61  ? 0.4262 0.6800 0.4812 0.1141  0.0505  0.1393  49  GLY A CA  
381  C C   . GLY A 61  ? 0.4035 0.6887 0.4753 0.0951  0.0436  0.1394  49  GLY A C   
382  O O   . GLY A 61  ? 0.4149 0.7312 0.5009 0.0975  0.0462  0.1490  49  GLY A O   
383  N N   . GLY A 62  ? 0.3843 0.6608 0.4537 0.0764  0.0353  0.1294  50  GLY A N   
384  C CA  . GLY A 62  ? 0.3615 0.6579 0.4406 0.0576  0.0279  0.1272  50  GLY A CA  
385  C C   . GLY A 62  ? 0.3536 0.6340 0.4283 0.0501  0.0281  0.1157  50  GLY A C   
386  O O   . GLY A 62  ? 0.3497 0.6089 0.4152 0.0598  0.0339  0.1107  50  GLY A O   
387  N N   . ASN A 63  ? 0.3446 0.6321 0.4230 0.0329  0.0210  0.1113  51  ASN A N   
388  C CA  . ASN A 63  ? 0.3646 0.6368 0.4390 0.0259  0.0204  0.1019  51  ASN A CA  
389  C C   . ASN A 63  ? 0.3630 0.6037 0.4257 0.0260  0.0205  0.0883  51  ASN A C   
390  O O   . ASN A 63  ? 0.3670 0.5922 0.4254 0.0254  0.0211  0.0814  51  ASN A O   
391  C CB  . ASN A 63  ? 0.3606 0.6452 0.4398 0.0078  0.0125  0.1018  51  ASN A CB  
392  C CG  . ASN A 63  ? 0.3967 0.7140 0.4905 0.0045  0.0118  0.1165  51  ASN A CG  
393  O OD1 . ASN A 63  ? 0.3807 0.7107 0.4812 0.0174  0.0196  0.1257  51  ASN A OD1 
394  N ND2 . ASN A 63  ? 0.4143 0.7452 0.5118 -0.0133 0.0023  0.1192  51  ASN A ND2 
395  N N   . ASN A 64  ? 0.3576 0.5913 0.4162 0.0262  0.0196  0.0860  52  ASN A N   
396  C CA  . ASN A 64  ? 0.3637 0.5736 0.4149 0.0263  0.0201  0.0766  52  ASN A CA  
397  C C   . ASN A 64  ? 0.3765 0.5696 0.4210 0.0379  0.0243  0.0767  52  ASN A C   
398  O O   . ASN A 64  ? 0.3822 0.5584 0.4216 0.0372  0.0235  0.0694  52  ASN A O   
399  C CB  . ASN A 64  ? 0.3747 0.5830 0.4233 0.0243  0.0196  0.0772  52  ASN A CB  
400  C CG  . ASN A 64  ? 0.3324 0.5237 0.3779 0.0201  0.0194  0.0686  52  ASN A CG  
401  O OD1 . ASN A 64  ? 0.3528 0.5317 0.3946 0.0229  0.0207  0.0698  52  ASN A OD1 
402  N ND2 . ASN A 64  ? 0.3082 0.5003 0.3554 0.0131  0.0178  0.0614  52  ASN A ND2 
403  N N   . GLY A 65  ? 0.3711 0.5684 0.4138 0.0495  0.0286  0.0854  53  GLY A N   
404  C CA  . GLY A 65  ? 0.3961 0.5722 0.4263 0.0625  0.0335  0.0847  53  GLY A CA  
405  C C   . GLY A 65  ? 0.3998 0.5778 0.4283 0.0651  0.0359  0.0832  53  GLY A C   
406  O O   . GLY A 65  ? 0.4126 0.5666 0.4266 0.0699  0.0369  0.0771  53  GLY A O   
407  N N   . GLY A 66  ? 0.3839 0.5893 0.4255 0.0603  0.0359  0.0892  54  GLY A N   
408  C CA  . GLY A 66  ? 0.3782 0.5868 0.4188 0.0606  0.0383  0.0896  54  GLY A CA  
409  C C   . GLY A 66  ? 0.3757 0.5632 0.4095 0.0517  0.0328  0.0782  54  GLY A C   
410  O O   . GLY A 66  ? 0.3635 0.5380 0.3869 0.0559  0.0345  0.0755  54  GLY A O   
411  N N   . ASP A 67  ? 0.3729 0.5584 0.4124 0.0401  0.0265  0.0723  55  ASP A N   
412  C CA  . ASP A 67  ? 0.3691 0.5380 0.4054 0.0337  0.0216  0.0629  55  ASP A CA  
413  C C   . ASP A 67  ? 0.3705 0.5163 0.3940 0.0399  0.0212  0.0581  55  ASP A C   
414  O O   . ASP A 67  ? 0.3878 0.5201 0.4037 0.0399  0.0185  0.0537  55  ASP A O   
415  C CB  . ASP A 67  ? 0.3677 0.5397 0.4112 0.0241  0.0176  0.0583  55  ASP A CB  
416  C CG  . ASP A 67  ? 0.3796 0.5649 0.4291 0.0152  0.0154  0.0599  55  ASP A CG  
417  O OD1 . ASP A 67  ? 0.3810 0.5736 0.4322 0.0130  0.0155  0.0647  55  ASP A OD1 
418  O OD2 . ASP A 67  ? 0.3918 0.5776 0.4423 0.0091  0.0132  0.0557  55  ASP A OD2 
419  N N   . GLY A 68  ? 0.3804 0.5199 0.3995 0.0448  0.0231  0.0597  56  GLY A N   
420  C CA  . GLY A 68  ? 0.3955 0.5085 0.3991 0.0490  0.0217  0.0557  56  GLY A CA  
421  C C   . GLY A 68  ? 0.4168 0.5144 0.4020 0.0593  0.0249  0.0549  56  GLY A C   
422  O O   . GLY A 68  ? 0.4269 0.5024 0.3979 0.0576  0.0201  0.0487  56  GLY A O   
423  N N   . PHE A 69  ? 0.4209 0.5317 0.4055 0.0701  0.0332  0.0620  57  PHE A N   
424  C CA  . PHE A 69  ? 0.4373 0.5372 0.4036 0.0817  0.0389  0.0624  57  PHE A CA  
425  C C   . PHE A 69  ? 0.4242 0.5236 0.3886 0.0745  0.0347  0.0588  57  PHE A C   
426  O O   . PHE A 69  ? 0.4411 0.5186 0.3830 0.0797  0.0344  0.0544  57  PHE A O   
427  C CB  . PHE A 69  ? 0.4337 0.5567 0.4053 0.0952  0.0502  0.0736  57  PHE A CB  
428  C CG  . PHE A 69  ? 0.4536 0.5661 0.4157 0.1105  0.0567  0.0772  57  PHE A CG  
429  C CD1 . PHE A 69  ? 0.4989 0.5743 0.4311 0.1232  0.0600  0.0714  57  PHE A CD1 
430  C CD2 . PHE A 69  ? 0.4602 0.5967 0.4408 0.1121  0.0584  0.0864  57  PHE A CD2 
431  C CE1 . PHE A 69  ? 0.5675 0.6274 0.4882 0.1387  0.0661  0.0746  57  PHE A CE1 
432  C CE2 . PHE A 69  ? 0.4743 0.6001 0.4465 0.1273  0.0640  0.0910  57  PHE A CE2 
433  C CZ  . PHE A 69  ? 0.5338 0.6200 0.4759 0.1416  0.0686  0.0852  57  PHE A CZ  
434  N N   . VAL A 70  ? 0.3990 0.5186 0.3833 0.0630  0.0308  0.0605  58  VAL A N   
435  C CA  . VAL A 70  ? 0.3888 0.5046 0.3711 0.0564  0.0257  0.0577  58  VAL A CA  
436  C C   . VAL A 70  ? 0.3973 0.4904 0.3703 0.0517  0.0164  0.0489  58  VAL A C   
437  O O   . VAL A 70  ? 0.4200 0.4998 0.3782 0.0527  0.0129  0.0465  58  VAL A O   
438  C CB  . VAL A 70  ? 0.3658 0.5011 0.3683 0.0453  0.0229  0.0606  58  VAL A CB  
439  C CG1 . VAL A 70  ? 0.3681 0.4944 0.3679 0.0400  0.0170  0.0578  58  VAL A CG1 
440  C CG2 . VAL A 70  ? 0.3545 0.5134 0.3659 0.0463  0.0296  0.0708  58  VAL A CG2 
441  N N   . VAL A 71  ? 0.3972 0.4885 0.3793 0.0458  0.0119  0.0455  59  VAL A N   
442  C CA  . VAL A 71  ? 0.4011 0.4761 0.3783 0.0395  0.0027  0.0395  59  VAL A CA  
443  C C   . VAL A 71  ? 0.4484 0.4952 0.3971 0.0452  0.0009  0.0360  59  VAL A C   
444  O O   . VAL A 71  ? 0.4529 0.4867 0.3888 0.0423  -0.0065 0.0326  59  VAL A O   
445  C CB  . VAL A 71  ? 0.3938 0.4746 0.3859 0.0324  0.0003  0.0389  59  VAL A CB  
446  C CG1 . VAL A 71  ? 0.3699 0.4372 0.3590 0.0242  -0.0095 0.0353  59  VAL A CG1 
447  C CG2 . VAL A 71  ? 0.3174 0.4214 0.3315 0.0275  0.0018  0.0404  59  VAL A CG2 
448  N N   . ALA A 72  ? 0.4659 0.5019 0.4021 0.0544  0.0081  0.0372  60  ALA A N   
449  C CA  . ALA A 72  ? 0.4919 0.4938 0.3958 0.0614  0.0075  0.0325  60  ALA A CA  
450  C C   . ALA A 72  ? 0.5062 0.5009 0.3897 0.0685  0.0096  0.0314  60  ALA A C   
451  O O   . ALA A 72  ? 0.5226 0.4925 0.3828 0.0652  0.0013  0.0253  60  ALA A O   
452  C CB  . ALA A 72  ? 0.5158 0.5082 0.4102 0.0745  0.0175  0.0355  60  ALA A CB  
453  N N   . ARG A 73  ? 0.4824 0.5004 0.3748 0.0763  0.0198  0.0382  61  ARG A N   
454  C CA  . ARG A 73  ? 0.5059 0.5186 0.3779 0.0838  0.0238  0.0391  61  ARG A CA  
455  C C   . ARG A 73  ? 0.5114 0.5203 0.3815 0.0724  0.0115  0.0359  61  ARG A C   
456  O O   . ARG A 73  ? 0.4984 0.4875 0.3403 0.0758  0.0090  0.0327  61  ARG A O   
457  C CB  . ARG A 73  ? 0.4839 0.5284 0.3718 0.0905  0.0360  0.0497  61  ARG A CB  
458  C CG  . ARG A 73  ? 0.5416 0.5841 0.4092 0.0995  0.0431  0.0531  61  ARG A CG  
459  C CD  . ARG A 73  ? 0.5685 0.6473 0.4601 0.0975  0.0504  0.0653  61  ARG A CD  
460  N NE  . ARG A 73  ? 0.5744 0.6588 0.4778 0.0831  0.0407  0.0657  61  ARG A NE  
461  C CZ  . ARG A 73  ? 0.5234 0.6286 0.4554 0.0712  0.0369  0.0699  61  ARG A CZ  
462  N NH1 . ARG A 73  ? 0.4994 0.6249 0.4531 0.0690  0.0403  0.0740  61  ARG A NH1 
463  N NH2 . ARG A 73  ? 0.5055 0.6081 0.4413 0.0618  0.0289  0.0698  61  ARG A NH2 
464  N N   . ASN A 74  ? 0.4902 0.5184 0.3892 0.0605  0.0046  0.0374  62  ASN A N   
465  C CA  . ASN A 74  ? 0.5011 0.5291 0.4028 0.0515  -0.0069 0.0363  62  ASN A CA  
466  C C   . ASN A 74  ? 0.5374 0.5443 0.4260 0.0439  -0.0210 0.0296  62  ASN A C   
467  O O   . ASN A 74  ? 0.5575 0.5625 0.4424 0.0386  -0.0314 0.0296  62  ASN A O   
468  C CB  . ASN A 74  ? 0.4615 0.5143 0.3966 0.0440  -0.0084 0.0400  62  ASN A CB  
469  C CG  . ASN A 74  ? 0.4419 0.5102 0.3841 0.0466  -0.0008 0.0472  62  ASN A CG  
470  O OD1 . ASN A 74  ? 0.4720 0.5364 0.4031 0.0479  -0.0021 0.0503  62  ASN A OD1 
471  N ND2 . ASN A 74  ? 0.4219 0.5073 0.3813 0.0459  0.0062  0.0508  62  ASN A ND2 
472  N N   . LEU A 75  ? 0.5508 0.5424 0.4332 0.0420  -0.0226 0.0251  63  LEU A N   
473  C CA  . LEU A 75  ? 0.5746 0.5425 0.4406 0.0323  -0.0368 0.0194  63  LEU A CA  
474  C C   . LEU A 75  ? 0.6355 0.5654 0.4548 0.0389  -0.0380 0.0131  63  LEU A C   
475  O O   . LEU A 75  ? 0.6517 0.5594 0.4507 0.0292  -0.0527 0.0082  63  LEU A O   
476  C CB  . LEU A 75  ? 0.5759 0.5410 0.4546 0.0248  -0.0389 0.0184  63  LEU A CB  
477  C CG  . LEU A 75  ? 0.5486 0.5473 0.4679 0.0176  -0.0387 0.0235  63  LEU A CG  
478  C CD1 . LEU A 75  ? 0.5731 0.5688 0.5010 0.0125  -0.0374 0.0240  63  LEU A CD1 
479  C CD2 . LEU A 75  ? 0.5739 0.5869 0.5089 0.0073  -0.0513 0.0252  63  LEU A CD2 
480  N N   . LEU A 76  ? 0.6485 0.5711 0.4497 0.0553  -0.0227 0.0136  64  LEU A N   
481  C CA  . LEU A 76  ? 0.7116 0.5965 0.4648 0.0654  -0.0205 0.0072  64  LEU A CA  
482  C C   . LEU A 76  ? 0.7358 0.6103 0.4661 0.0599  -0.0321 0.0048  64  LEU A C   
483  O O   . LEU A 76  ? 0.7143 0.6149 0.4616 0.0584  -0.0325 0.0112  64  LEU A O   
484  C CB  . LEU A 76  ? 0.7143 0.6033 0.4568 0.0868  0.0003  0.0111  64  LEU A CB  
485  C CG  . LEU A 76  ? 0.7106 0.5996 0.4612 0.0974  0.0123  0.0132  64  LEU A CG  
486  C CD1 . LEU A 76  ? 0.6691 0.5765 0.4184 0.1180  0.0325  0.0210  64  LEU A CD1 
487  C CD2 . LEU A 76  ? 0.7355 0.5745 0.4498 0.0993  0.0075  0.0036  64  LEU A CD2 
488  N N   . GLY A 77  ? 0.7984 0.6320 0.4885 0.0556  -0.0432 -0.0042 65  GLY A N   
489  C CA  . GLY A 77  ? 0.8524 0.6712 0.5140 0.0493  -0.0567 -0.0073 65  GLY A CA  
490  C C   . GLY A 77  ? 0.8503 0.6895 0.5395 0.0291  -0.0773 -0.0038 65  GLY A C   
491  O O   . GLY A 77  ? 0.8954 0.7218 0.5612 0.0212  -0.0926 -0.0058 65  GLY A O   
492  N N   . VAL A 78  ? 0.8086 0.6802 0.5461 0.0215  -0.0777 0.0019  66  VAL A N   
493  C CA  . VAL A 78  ? 0.8048 0.7025 0.5734 0.0062  -0.0939 0.0074  66  VAL A CA  
494  C C   . VAL A 78  ? 0.7961 0.6907 0.5787 -0.0111 -0.1074 0.0060  66  VAL A C   
495  O O   . VAL A 78  ? 0.8058 0.7136 0.6025 -0.0258 -0.1248 0.0096  66  VAL A O   
496  C CB  . VAL A 78  ? 0.7534 0.6936 0.5660 0.0117  -0.0841 0.0166  66  VAL A CB  
497  C CG1 . VAL A 78  ? 0.7599 0.7287 0.6138 -0.0003 -0.0939 0.0217  66  VAL A CG1 
498  C CG2 . VAL A 78  ? 0.7817 0.7269 0.5824 0.0182  -0.0842 0.0210  66  VAL A CG2 
499  N N   . VAL A 79  ? 0.7843 0.6613 0.5618 -0.0097 -0.0998 0.0021  67  VAL A N   
500  C CA  . VAL A 79  ? 0.7801 0.6515 0.5686 -0.0271 -0.1114 0.0021  67  VAL A CA  
501  C C   . VAL A 79  ? 0.8385 0.6536 0.5763 -0.0291 -0.1160 -0.0078 67  VAL A C   
502  O O   . VAL A 79  ? 0.8625 0.6482 0.5609 -0.0136 -0.1069 -0.0144 67  VAL A O   
503  C CB  . VAL A 79  ? 0.7334 0.6303 0.5601 -0.0244 -0.0984 0.0073  67  VAL A CB  
504  C CG1 . VAL A 79  ? 0.6672 0.6119 0.5362 -0.0193 -0.0914 0.0151  67  VAL A CG1 
505  C CG2 . VAL A 79  ? 0.7214 0.5962 0.5282 -0.0079 -0.0809 0.0034  67  VAL A CG2 
506  N N   . LYS A 80  ? 0.8485 0.6487 0.5873 -0.0475 -0.1287 -0.0081 68  LYS A N   
507  C CA  . LYS A 80  ? 0.9214 0.6624 0.6100 -0.0535 -0.1370 -0.0176 68  LYS A CA  
508  C C   . LYS A 80  ? 0.9307 0.6376 0.5931 -0.0331 -0.1174 -0.0232 68  LYS A C   
509  O O   . LYS A 80  ? 0.9849 0.6404 0.5941 -0.0245 -0.1166 -0.0332 68  LYS A O   
510  C CB  . LYS A 80  ? 0.9443 0.6830 0.6477 -0.0815 -0.1560 -0.0136 68  LYS A CB  
511  C CG  . LYS A 80  ? 1.0606 0.7329 0.7093 -0.0942 -0.1704 -0.0234 68  LYS A CG  
512  C CD  . LYS A 80  ? 1.1271 0.8039 0.7953 -0.1266 -0.1919 -0.0166 68  LYS A CD  
513  C CE  . LYS A 80  ? 1.1603 0.8590 0.8356 -0.1472 -0.2164 -0.0129 68  LYS A CE  
514  N NZ  . LYS A 80  ? 1.1601 0.8922 0.8784 -0.1763 -0.2329 0.0000  68  LYS A NZ  
515  N N   . ASP A 81  ? 0.8742 0.6090 0.5721 -0.0243 -0.1019 -0.0164 69  ASP A N   
516  C CA  . ASP A 81  ? 0.8819 0.5922 0.5612 -0.0036 -0.0835 -0.0188 69  ASP A CA  
517  C C   . ASP A 81  ? 0.8103 0.5714 0.5388 0.0056  -0.0676 -0.0088 69  ASP A C   
518  O O   . ASP A 81  ? 0.7509 0.5487 0.5211 -0.0085 -0.0728 -0.0016 69  ASP A O   
519  C CB  . ASP A 81  ? 0.9369 0.5957 0.5886 -0.0131 -0.0907 -0.0228 69  ASP A CB  
520  C CG  . ASP A 81  ? 0.9880 0.6101 0.6089 0.0120  -0.0725 -0.0264 69  ASP A CG  
521  O OD1 . ASP A 81  ? 1.0422 0.6617 0.6434 0.0355  -0.0582 -0.0297 69  ASP A OD1 
522  O OD2 . ASP A 81  ? 1.0478 0.6446 0.6646 0.0094  -0.0717 -0.0244 69  ASP A OD2 
523  N N   . VAL A 82  ? 0.7921 0.5555 0.5139 0.0295  -0.0485 -0.0082 70  VAL A N   
524  C CA  . VAL A 82  ? 0.7486 0.5508 0.5081 0.0388  -0.0341 0.0006  70  VAL A CA  
525  C C   . VAL A 82  ? 0.7625 0.5369 0.5003 0.0576  -0.0207 0.0006  70  VAL A C   
526  O O   . VAL A 82  ? 0.7912 0.5361 0.4925 0.0744  -0.0134 -0.0045 70  VAL A O   
527  C CB  . VAL A 82  ? 0.7159 0.5578 0.4944 0.0508  -0.0231 0.0048  70  VAL A CB  
528  C CG1 . VAL A 82  ? 0.6670 0.5508 0.4868 0.0541  -0.0128 0.0140  70  VAL A CG1 
529  C CG2 . VAL A 82  ? 0.7076 0.5652 0.4940 0.0388  -0.0347 0.0038  70  VAL A CG2 
530  N N   . LEU A 83  ? 0.7430 0.5284 0.5031 0.0563  -0.0168 0.0073  71  LEU A N   
531  C CA  . LEU A 83  ? 0.7519 0.5243 0.5015 0.0777  -0.0019 0.0112  71  LEU A CA  
532  C C   . LEU A 83  ? 0.6919 0.5162 0.4857 0.0806  0.0068  0.0224  71  LEU A C   
533  O O   . LEU A 83  ? 0.6639 0.5129 0.4873 0.0631  -0.0003 0.0261  71  LEU A O   
534  C CB  . LEU A 83  ? 0.7922 0.5120 0.5142 0.0726  -0.0083 0.0086  71  LEU A CB  
535  C CG  . LEU A 83  ? 0.8161 0.5170 0.5260 0.0950  0.0055  0.0137  71  LEU A CG  
536  C CD1 . LEU A 83  ? 0.7891 0.4711 0.4660 0.1239  0.0199  0.0095  71  LEU A CD1 
537  C CD2 . LEU A 83  ? 0.8383 0.4865 0.5243 0.0842  -0.0037 0.0123  71  LEU A CD2 
538  N N   . VAL A 84  ? 0.6825 0.5252 0.4806 0.1022  0.0221  0.0283  72  VAL A N   
539  C CA  . VAL A 84  ? 0.6304 0.5159 0.4644 0.1047  0.0289  0.0393  72  VAL A CA  
540  C C   . VAL A 84  ? 0.6679 0.5317 0.4909 0.1184  0.0354  0.0452  72  VAL A C   
541  O O   . VAL A 84  ? 0.6973 0.5312 0.4912 0.1390  0.0440  0.0441  72  VAL A O   
542  C CB  . VAL A 84  ? 0.5996 0.5275 0.4523 0.1169  0.0398  0.0457  72  VAL A CB  
543  C CG1 . VAL A 84  ? 0.5513 0.5183 0.4357 0.1198  0.0454  0.0577  72  VAL A CG1 
544  C CG2 . VAL A 84  ? 0.5574 0.5089 0.4238 0.1038  0.0340  0.0421  72  VAL A CG2 
545  N N   . VAL A 85  ? 0.6576 0.5357 0.5023 0.1080  0.0318  0.0520  73  VAL A N   
546  C CA  . VAL A 85  ? 0.6868 0.5590 0.5302 0.1223  0.0391  0.0618  73  VAL A CA  
547  C C   . VAL A 85  ? 0.6456 0.5746 0.5237 0.1280  0.0460  0.0729  73  VAL A C   
548  O O   . VAL A 85  ? 0.6053 0.5681 0.5106 0.1112  0.0406  0.0749  73  VAL A O   
549  C CB  . VAL A 85  ? 0.6976 0.5478 0.5401 0.1066  0.0305  0.0643  73  VAL A CB  
550  C CG1 . VAL A 85  ? 0.7185 0.5600 0.5568 0.1238  0.0382  0.0758  73  VAL A CG1 
551  C CG2 . VAL A 85  ? 0.7378 0.5342 0.5486 0.0945  0.0201  0.0540  73  VAL A CG2 
552  N N   . PHE A 86  ? 0.6640 0.6044 0.5401 0.1517  0.0579  0.0802  74  PHE A N   
553  C CA  . PHE A 86  ? 0.6283 0.6236 0.5365 0.1558  0.0628  0.0920  74  PHE A CA  
554  C C   . PHE A 86  ? 0.6530 0.6510 0.5672 0.1633  0.0643  0.1041  74  PHE A C   
555  O O   . PHE A 86  ? 0.6773 0.6476 0.5719 0.1839  0.0712  0.1085  74  PHE A O   
556  C CB  . PHE A 86  ? 0.6271 0.6436 0.5362 0.1754  0.0745  0.0965  74  PHE A CB  
557  C CG  . PHE A 86  ? 0.6048 0.6770 0.5464 0.1794  0.0785  0.1113  74  PHE A CG  
558  C CD1 . PHE A 86  ? 0.5512 0.6616 0.5200 0.1582  0.0708  0.1120  74  PHE A CD1 
559  C CD2 . PHE A 86  ? 0.6547 0.7396 0.5993 0.2034  0.0885  0.1253  74  PHE A CD2 
560  C CE1 . PHE A 86  ? 0.5407 0.6997 0.5370 0.1581  0.0716  0.1253  74  PHE A CE1 
561  C CE2 . PHE A 86  ? 0.6356 0.7759 0.6127 0.2039  0.0893  0.1407  74  PHE A CE2 
562  C CZ  . PHE A 86  ? 0.5757 0.7520 0.5776 0.1797  0.0799  0.1404  74  PHE A CZ  
563  N N   . LEU A 87  ? 0.6371 0.6662 0.5756 0.1471  0.0578  0.1093  75  LEU A N   
564  C CA  . LEU A 87  ? 0.6569 0.6849 0.5983 0.1491  0.0565  0.1200  75  LEU A CA  
565  C C   . LEU A 87  ? 0.6431 0.7208 0.6089 0.1575  0.0596  0.1347  75  LEU A C   
566  O O   . LEU A 87  ? 0.6454 0.7275 0.6142 0.1617  0.0586  0.1459  75  LEU A O   
567  C CB  . LEU A 87  ? 0.6428 0.6678 0.5901 0.1240  0.0467  0.1160  75  LEU A CB  
568  C CG  . LEU A 87  ? 0.6835 0.6623 0.6099 0.1124  0.0412  0.1046  75  LEU A CG  
569  C CD1 . LEU A 87  ? 0.6433 0.6358 0.5842 0.0872  0.0331  0.1012  75  LEU A CD1 
570  C CD2 . LEU A 87  ? 0.7218 0.6533 0.6227 0.1227  0.0425  0.1093  75  LEU A CD2 
571  N N   . GLY A 88  ? 0.6260 0.7415 0.6089 0.1586  0.0622  0.1360  76  GLY A N   
572  C CA  . GLY A 88  ? 0.6168 0.7837 0.6249 0.1628  0.0628  0.1511  76  GLY A CA  
573  C C   . GLY A 88  ? 0.6534 0.8309 0.6624 0.1917  0.0734  0.1655  76  GLY A C   
574  O O   . GLY A 88  ? 0.6857 0.8242 0.6710 0.2119  0.0821  0.1627  76  GLY A O   
575  N N   . LYS A 89  ? 0.6451 0.8753 0.6804 0.1939  0.0725  0.1811  77  LYS A N   
576  C CA  . LYS A 89  ? 0.6864 0.9412 0.7311 0.2220  0.0826  0.1989  77  LYS A CA  
577  C C   . LYS A 89  ? 0.6665 0.9591 0.7280 0.2258  0.0892  0.2029  77  LYS A C   
578  O O   . LYS A 89  ? 0.7240 1.0143 0.7795 0.2517  0.1029  0.2084  77  LYS A O   
579  C CB  . LYS A 89  ? 0.6891 0.9847 0.7552 0.2227  0.0762  0.2180  77  LYS A CB  
580  C CG  . LYS A 89  ? 0.7753 1.0380 0.8250 0.2330  0.0748  0.2235  77  LYS A CG  
581  C CD  . LYS A 89  ? 0.8620 1.0533 0.8770 0.2302  0.0760  0.2061  77  LYS A CD  
582  C CE  . LYS A 89  ? 0.9344 1.0826 0.9243 0.2618  0.0897  0.2059  77  LYS A CE  
583  N NZ  . LYS A 89  ? 0.9829 1.0662 0.9391 0.2553  0.0901  0.1857  77  LYS A NZ  
584  N N   . LYS A 90  ? 0.6101 0.9381 0.6919 0.2007  0.0799  0.2017  78  LYS A N   
585  C CA  . LYS A 90  ? 0.5816 0.9497 0.6826 0.1985  0.0840  0.2077  78  LYS A CA  
586  C C   . LYS A 90  ? 0.5304 0.8844 0.6264 0.1709  0.0756  0.1904  78  LYS A C   
587  O O   . LYS A 90  ? 0.5074 0.8324 0.5915 0.1551  0.0667  0.1775  78  LYS A O   
588  C CB  . LYS A 90  ? 0.5739 1.0072 0.7092 0.1939  0.0783  0.2290  78  LYS A CB  
589  C CG  . LYS A 90  ? 0.6008 1.0461 0.7438 0.1652  0.0602  0.2271  78  LYS A CG  
590  C CD  . LYS A 90  ? 0.6523 1.1583 0.8247 0.1636  0.0527  0.2505  78  LYS A CD  
591  C CE  . LYS A 90  ? 0.6611 1.1734 0.8335 0.1352  0.0344  0.2469  78  LYS A CE  
592  N NZ  . LYS A 90  ? 0.6429 1.1364 0.8062 0.1073  0.0270  0.2277  78  LYS A NZ  
593  N N   . LYS A 91  ? 0.4773 0.8526 0.5829 0.1661  0.0791  0.1916  79  LYS A N   
594  C CA  . LYS A 91  ? 0.4550 0.8148 0.5547 0.1440  0.0726  0.1768  79  LYS A CA  
595  C C   . LYS A 91  ? 0.4178 0.8230 0.5428 0.1239  0.0651  0.1859  79  LYS A C   
596  O O   . LYS A 91  ? 0.4158 0.8631 0.5607 0.1314  0.0706  0.2030  79  LYS A O   
597  C CB  . LYS A 91  ? 0.4708 0.8023 0.5505 0.1561  0.0834  0.1680  79  LYS A CB  
598  C CG  . LYS A 91  ? 0.4954 0.7728 0.5441 0.1711  0.0877  0.1560  79  LYS A CG  
599  C CD  . LYS A 91  ? 0.5236 0.7702 0.5474 0.1818  0.0966  0.1464  79  LYS A CD  
600  C CE  . LYS A 91  ? 0.5506 0.7435 0.5407 0.1998  0.1015  0.1374  79  LYS A CE  
601  N NZ  . LYS A 91  ? 0.5624 0.7609 0.5485 0.2310  0.1158  0.1503  79  LYS A NZ  
602  N N   . THR A 92  ? 0.3764 0.7727 0.5002 0.0985  0.0529  0.1750  80  THR A N   
603  C CA  . THR A 92  ? 0.3701 0.7976 0.5111 0.0773  0.0453  0.1807  80  THR A CA  
604  C C   . THR A 92  ? 0.3801 0.8088 0.5208 0.0799  0.0539  0.1814  80  THR A C   
605  O O   . THR A 92  ? 0.3873 0.7856 0.5095 0.0953  0.0636  0.1729  80  THR A O   
606  C CB  . THR A 92  ? 0.3701 0.7780 0.5032 0.0525  0.0322  0.1666  80  THR A CB  
607  O OG1 . THR A 92  ? 0.3595 0.7259 0.4737 0.0527  0.0350  0.1495  80  THR A OG1 
608  C CG2 . THR A 92  ? 0.3849 0.7888 0.5138 0.0480  0.0240  0.1645  80  THR A CG2 
609  N N   . PRO A 93  ? 0.3726 0.8343 0.5313 0.0634  0.0494  0.1916  81  PRO A N   
610  C CA  . PRO A 93  ? 0.3810 0.8495 0.5411 0.0660  0.0585  0.1963  81  PRO A CA  
611  C C   . PRO A 93  ? 0.3755 0.7949 0.5100 0.0643  0.0594  0.1768  81  PRO A C   
612  O O   . PRO A 93  ? 0.3816 0.7879 0.5034 0.0798  0.0709  0.1753  81  PRO A O   
613  C CB  . PRO A 93  ? 0.3705 0.8752 0.5523 0.0400  0.0484  0.2083  81  PRO A CB  
614  C CG  . PRO A 93  ? 0.3905 0.9263 0.5892 0.0331  0.0382  0.2185  81  PRO A CG  
615  C CD  . PRO A 93  ? 0.3814 0.8804 0.5607 0.0430  0.0364  0.2031  81  PRO A CD  
616  N N   . ASP A 94  ? 0.3788 0.7713 0.5044 0.0468  0.0476  0.1623  82  ASP A N   
617  C CA  . ASP A 94  ? 0.3816 0.7326 0.4866 0.0448  0.0473  0.1460  82  ASP A CA  
618  C C   . ASP A 94  ? 0.3808 0.7000 0.4667 0.0631  0.0531  0.1354  82  ASP A C   
619  O O   . ASP A 94  ? 0.3845 0.6790 0.4539 0.0696  0.0573  0.1280  82  ASP A O   
620  C CB  . ASP A 94  ? 0.3801 0.7139 0.4823 0.0228  0.0345  0.1352  82  ASP A CB  
621  C CG  . ASP A 94  ? 0.4006 0.7553 0.5153 0.0027  0.0282  0.1444  82  ASP A CG  
622  O OD1 . ASP A 94  ? 0.4324 0.8122 0.5573 0.0051  0.0346  0.1583  82  ASP A OD1 
623  O OD2 . ASP A 94  ? 0.4603 0.8047 0.5728 -0.0155 0.0172  0.1381  82  ASP A OD2 
624  N N   . CYS A 95  ? 0.3663 0.6848 0.4527 0.0707  0.0525  0.1356  83  CYS A N   
625  C CA  . CYS A 95  ? 0.3792 0.6646 0.4459 0.0871  0.0575  0.1271  83  CYS A CA  
626  C C   . CYS A 95  ? 0.4076 0.6931 0.4649 0.1095  0.0712  0.1335  83  CYS A C   
627  O O   . CYS A 95  ? 0.4163 0.6670 0.4496 0.1189  0.0753  0.1235  83  CYS A O   
628  C CB  . CYS A 95  ? 0.3892 0.6741 0.4583 0.0899  0.0542  0.1285  83  CYS A CB  
629  S SG  . CYS A 95  ? 0.4303 0.6683 0.4734 0.1059  0.0583  0.1185  83  CYS A SG  
630  N N   . GLU A 96  ? 0.4043 0.7303 0.4797 0.1179  0.0783  0.1507  84  GLU A N   
631  C CA  . GLU A 96  ? 0.4283 0.7599 0.4960 0.1421  0.0938  0.1588  84  GLU A CA  
632  C C   . GLU A 96  ? 0.4281 0.7466 0.4811 0.1407  0.0987  0.1538  84  GLU A C   
633  O O   . GLU A 96  ? 0.4272 0.7175 0.4539 0.1588  0.1082  0.1478  84  GLU A O   
634  C CB  . GLU A 96  ? 0.4287 0.8164 0.5256 0.1496  0.1000  0.1814  84  GLU A CB  
635  C CG  . GLU A 96  ? 0.5208 0.9235 0.6138 0.1781  0.1191  0.1933  84  GLU A CG  
636  C CD  . GLU A 96  ? 0.6121 0.9803 0.6805 0.2068  0.1287  0.1883  84  GLU A CD  
637  O OE1 . GLU A 96  ? 0.7000 1.0381 0.7399 0.2245  0.1403  0.1813  84  GLU A OE1 
638  O OE2 . GLU A 96  ? 0.6920 1.0611 0.7669 0.2121  0.1247  0.1919  84  GLU A OE2 
639  N N   . TYR A 97  ? 0.4006 0.7374 0.4681 0.1191  0.0915  0.1564  85  TYR A N   
640  C CA  . TYR A 97  ? 0.4106 0.7381 0.4665 0.1151  0.0946  0.1541  85  TYR A CA  
641  C C   . TYR A 97  ? 0.4138 0.6895 0.4391 0.1168  0.0905  0.1348  85  TYR A C   
642  O O   . TYR A 97  ? 0.3965 0.6527 0.3982 0.1286  0.0981  0.1312  85  TYR A O   
643  C CB  . TYR A 97  ? 0.3971 0.7442 0.4722 0.0883  0.0842  0.1588  85  TYR A CB  
644  C CG  . TYR A 97  ? 0.4140 0.7473 0.4761 0.0824  0.0856  0.1567  85  TYR A CG  
645  C CD1 . TYR A 97  ? 0.4523 0.8093 0.5153 0.0909  0.0985  0.1709  85  TYR A CD1 
646  C CD2 . TYR A 97  ? 0.4211 0.7200 0.4704 0.0693  0.0747  0.1422  85  TYR A CD2 
647  C CE1 . TYR A 97  ? 0.4467 0.7898 0.4952 0.0858  0.0999  0.1700  85  TYR A CE1 
648  C CE2 . TYR A 97  ? 0.4488 0.7354 0.4861 0.0647  0.0751  0.1418  85  TYR A CE2 
649  C CZ  . TYR A 97  ? 0.4451 0.7516 0.4803 0.0726  0.0873  0.1553  85  TYR A CZ  
650  O OH  . TYR A 97  ? 0.4844 0.7762 0.5055 0.0672  0.0867  0.1553  85  TYR A OH  
651  N N   . ASN A 98  ? 0.4105 0.6652 0.4355 0.1049  0.0782  0.1229  86  ASN A N   
652  C CA  . ASN A 98  ? 0.4312 0.6426 0.4325 0.1030  0.0720  0.1064  86  ASN A CA  
653  C C   . ASN A 98  ? 0.4712 0.6496 0.4462 0.1210  0.0770  0.0990  86  ASN A C   
654  O O   . ASN A 98  ? 0.4824 0.6279 0.4310 0.1240  0.0757  0.0891  86  ASN A O   
655  C CB  . ASN A 98  ? 0.4126 0.6176 0.4247 0.0833  0.0584  0.0982  86  ASN A CB  
656  C CG  . ASN A 98  ? 0.3753 0.5890 0.3961 0.0678  0.0531  0.0996  86  ASN A CG  
657  O OD1 . ASN A 98  ? 0.3961 0.5941 0.4030 0.0683  0.0531  0.0961  86  ASN A OD1 
658  N ND2 . ASN A 98  ? 0.3172 0.5524 0.3580 0.0535  0.0476  0.1044  86  ASN A ND2 
659  N N   . TYR A 99  ? 0.4807 0.6672 0.4607 0.1335  0.0827  0.1051  87  TYR A N   
660  C CA  . TYR A 99  ? 0.5155 0.6716 0.4688 0.1555  0.0910  0.1018  87  TYR A CA  
661  C C   . TYR A 99  ? 0.5338 0.6855 0.4661 0.1729  0.1041  0.1043  87  TYR A C   
662  O O   . TYR A 99  ? 0.5772 0.6873 0.4744 0.1817  0.1056  0.0934  87  TYR A O   
663  C CB  . TYR A 99  ? 0.5204 0.6970 0.4889 0.1681  0.0966  0.1133  87  TYR A CB  
664  C CG  . TYR A 99  ? 0.5843 0.7392 0.5293 0.1968  0.1098  0.1155  87  TYR A CG  
665  C CD1 . TYR A 99  ? 0.6403 0.7430 0.5552 0.2022  0.1066  0.1035  87  TYR A CD1 
666  C CD2 . TYR A 99  ? 0.6481 0.8354 0.6014 0.2191  0.1257  0.1310  87  TYR A CD2 
667  C CE1 . TYR A 99  ? 0.7066 0.7811 0.5953 0.2290  0.1182  0.1044  87  TYR A CE1 
668  C CE2 . TYR A 99  ? 0.7027 0.8670 0.6323 0.2496  0.1395  0.1331  87  TYR A CE2 
669  C CZ  . TYR A 99  ? 0.7510 0.8545 0.6458 0.2544  0.1353  0.1186  87  TYR A CZ  
670  O OH  . TYR A 99  ? 0.8141 0.8822 0.6781 0.2835  0.1474  0.1179  87  TYR A OH  
671  N N   . GLY A 100 ? 0.5262 0.7217 0.4788 0.1771  0.1134  0.1194  88  GLY A N   
672  C CA  . GLY A 100 ? 0.5389 0.7389 0.4747 0.1934  0.1281  0.1249  88  GLY A CA  
673  C C   . GLY A 100 ? 0.5494 0.7187 0.4595 0.1836  0.1221  0.1128  88  GLY A C   
674  O O   . GLY A 100 ? 0.5729 0.7121 0.4469 0.1993  0.1300  0.1065  88  GLY A O   
675  N N   . LEU A 101 ? 0.5156 0.6888 0.4408 0.1587  0.1077  0.1088  89  LEU A N   
676  C CA  . LEU A 101 ? 0.5223 0.6664 0.4239 0.1497  0.1002  0.0983  89  LEU A CA  
677  C C   . LEU A 101 ? 0.5496 0.6422 0.4170 0.1531  0.0928  0.0813  89  LEU A C   
678  O O   . LEU A 101 ? 0.5610 0.6244 0.3935 0.1595  0.0939  0.0742  89  LEU A O   
679  C CB  . LEU A 101 ? 0.4818 0.6379 0.4064 0.1250  0.0865  0.0978  89  LEU A CB  
680  C CG  . LEU A 101 ? 0.4918 0.6886 0.4422 0.1160  0.0903  0.1131  89  LEU A CG  
681  C CD1 . LEU A 101 ? 0.4593 0.6546 0.4239 0.0931  0.0760  0.1098  89  LEU A CD1 
682  C CD2 . LEU A 101 ? 0.5054 0.7129 0.4405 0.1284  0.1047  0.1234  89  LEU A CD2 
683  N N   . TYR A 102 ? 0.5439 0.6261 0.4206 0.1473  0.0846  0.0757  90  TYR A N   
684  C CA  . TYR A 102 ? 0.5742 0.6100 0.4235 0.1463  0.0756  0.0614  90  TYR A CA  
685  C C   . TYR A 102 ? 0.6182 0.6216 0.4269 0.1690  0.0869  0.0578  90  TYR A C   
686  O O   . TYR A 102 ? 0.6642 0.6295 0.4369 0.1686  0.0816  0.0469  90  TYR A O   
687  C CB  . TYR A 102 ? 0.5467 0.5815 0.4138 0.1394  0.0690  0.0601  90  TYR A CB  
688  C CG  . TYR A 102 ? 0.5862 0.5737 0.4266 0.1366  0.0599  0.0478  90  TYR A CG  
689  C CD1 . TYR A 102 ? 0.5826 0.5511 0.4161 0.1189  0.0447  0.0383  90  TYR A CD1 
690  C CD2 . TYR A 102 ? 0.6041 0.5675 0.4284 0.1503  0.0653  0.0472  90  TYR A CD2 
691  C CE1 . TYR A 102 ? 0.5673 0.4953 0.3783 0.1131  0.0349  0.0290  90  TYR A CE1 
692  C CE2 . TYR A 102 ? 0.6344 0.5515 0.4335 0.1447  0.0556  0.0369  90  TYR A CE2 
693  C CZ  . TYR A 102 ? 0.6121 0.5133 0.4056 0.1248  0.0401  0.0282  90  TYR A CZ  
694  O OH  . TYR A 102 ? 0.6751 0.5320 0.4443 0.1170  0.0296  0.0197  90  TYR A OH  
695  N N   . LYS A 103 ? 1.7032 0.7614 0.4601 0.7145  0.2627  0.0934  91  LYS A N   
696  C CA  . LYS A 103 ? 1.7862 0.7869 0.4628 0.7484  0.2685  0.0898  91  LYS A CA  
697  C C   . LYS A 103 ? 1.8744 0.8273 0.4720 0.8021  0.3158  0.1110  91  LYS A C   
698  O O   . LYS A 103 ? 1.9437 0.8495 0.4352 0.8337  0.3025  0.0998  91  LYS A O   
699  C CB  . LYS A 103 ? 1.7752 0.7837 0.5152 0.7394  0.2835  0.0874  91  LYS A CB  
700  C CG  . LYS A 103 ? 1.7475 0.7963 0.5398 0.6948  0.2340  0.0723  91  LYS A CG  
701  C CD  . LYS A 103 ? 1.8139 0.8627 0.6532 0.6916  0.2365  0.0714  91  LYS A CD  
702  C CE  . LYS A 103 ? 1.9315 0.9241 0.7109 0.7122  0.2254  0.0610  91  LYS A CE  
703  N NZ  . LYS A 103 ? 2.0104 0.9807 0.7173 0.7096  0.1820  0.0431  91  LYS A NZ  
704  N N   . LYS A 104 ? 1.8682 0.8339 0.5176 0.8151  0.3722  0.1408  92  LYS A N   
705  C CA  . LYS A 104 ? 1.9835 0.9015 0.5542 0.8708  0.4274  0.1720  92  LYS A CA  
706  C C   . LYS A 104 ? 2.0471 0.9459 0.5065 0.8920  0.3888  0.1734  92  LYS A C   
707  O O   . LYS A 104 ? 2.1413 0.9916 0.4777 0.9427  0.4031  0.1840  92  LYS A O   
708  C CB  . LYS A 104 ? 1.9637 0.9021 0.6373 0.8785  0.4994  0.2082  92  LYS A CB  
709  C CG  . LYS A 104 ? 1.9707 0.9046 0.7301 0.8849  0.5589  0.2137  92  LYS A CG  
710  C CD  . LYS A 104 ? 2.1254 0.9925 0.7933 0.9420  0.6220  0.2392  92  LYS A CD  
711  C CE  . LYS A 104 ? 2.1124 0.9736 0.8912 0.9489  0.6918  0.2465  92  LYS A CE  
712  N NZ  . LYS A 104 ? 2.2437 1.0371 0.9209 0.9949  0.7366  0.2531  92  LYS A NZ  
713  N N   . PHE A 105 ? 1.9711 0.9101 0.4751 0.8537  0.3377  0.1592  93  PHE A N   
714  C CA  . PHE A 105 ? 2.0347 0.9611 0.4570 0.8692  0.2928  0.1556  93  PHE A CA  
715  C C   . PHE A 105 ? 2.0909 0.9884 0.4189 0.8756  0.2278  0.1131  93  PHE A C   
716  O O   . PHE A 105 ? 2.1553 1.0398 0.4137 0.8936  0.1839  0.1017  93  PHE A O   
717  C CB  . PHE A 105 ? 1.9311 0.9088 0.4485 0.8265  0.2669  0.1535  93  PHE A CB  
718  C CG  . PHE A 105 ? 1.9373 0.9312 0.5115 0.8408  0.3186  0.1964  93  PHE A CG  
719  C CD1 . PHE A 105 ? 1.9068 0.9128 0.5662 0.8461  0.3913  0.2239  93  PHE A CD1 
720  C CD2 . PHE A 105 ? 1.9580 0.9579 0.5215 0.8469  0.2933  0.2076  93  PHE A CD2 
721  C CE1 . PHE A 105 ? 1.8760 0.8991 0.6126 0.8576  0.4423  0.2631  93  PHE A CE1 
722  C CE2 . PHE A 105 ? 1.9355 0.9510 0.5667 0.8596  0.3421  0.2503  93  PHE A CE2 
723  C CZ  . PHE A 105 ? 1.8993 0.9267 0.6200 0.8645  0.4182  0.2785  93  PHE A CZ  
724  N N   . GLY A 106 ? 2.0831 0.9705 0.4179 0.8636  0.2210  0.0882  94  GLY A N   
725  C CA  . GLY A 106 ? 2.1216 0.9830 0.3922 0.8685  0.1637  0.0436  94  GLY A CA  
726  C C   . GLY A 106 ? 2.0282 0.9206 0.3824 0.8133  0.1106  0.0144  94  GLY A C   
727  O O   . GLY A 106 ? 2.0552 0.9313 0.3837 0.8121  0.0598  -0.0234 94  GLY A O   
728  N N   . GLY A 107 ? 1.9211 0.8585 0.3800 0.7694  0.1255  0.0303  95  GLY A N   
729  C CA  . GLY A 107 ? 1.8509 0.8192 0.3807 0.7192  0.0824  0.0104  95  GLY A CA  
730  C C   . GLY A 107 ? 1.8347 0.7951 0.3904 0.7047  0.0720  -0.0026 95  GLY A C   
731  O O   . GLY A 107 ? 1.8305 0.7821 0.3924 0.7173  0.1059  0.0094  95  GLY A O   
732  N N   . LYS A 108 ? 1.8252 0.7904 0.4116 0.6763  0.0279  -0.0244 96  LYS A N   
733  C CA  . LYS A 108 ? 1.8238 0.7811 0.4471 0.6618  0.0167  -0.0314 96  LYS A CA  
734  C C   . LYS A 108 ? 1.7395 0.7458 0.4434 0.6172  0.0204  -0.0097 96  LYS A C   
735  O O   . LYS A 108 ? 1.6946 0.7303 0.4301 0.5871  0.0041  -0.0112 96  LYS A O   
736  C CB  . LYS A 108 ? 1.8635 0.7907 0.4785 0.6643  -0.0301 -0.0692 96  LYS A CB  
737  C CG  . LYS A 108 ? 1.9250 0.8379 0.5887 0.6540  -0.0400 -0.0766 96  LYS A CG  
738  C CD  . LYS A 108 ? 2.0080 0.8932 0.6865 0.6569  -0.0860 -0.1215 96  LYS A CD  
739  C CE  . LYS A 108 ? 2.0610 0.9151 0.7657 0.6706  -0.0910 -0.1426 96  LYS A CE  
740  N NZ  . LYS A 108 ? 2.0389 0.9082 0.8091 0.6472  -0.0670 -0.1036 96  LYS A NZ  
741  N N   . VAL A 109 ? 1.7181 0.7345 0.4541 0.6150  0.0415  0.0087  97  VAL A N   
742  C CA  . VAL A 109 ? 1.6700 0.7330 0.4695 0.5802  0.0392  0.0285  97  VAL A CA  
743  C C   . VAL A 109 ? 1.6847 0.7279 0.5081 0.5767  0.0235  0.0332  97  VAL A C   
744  O O   . VAL A 109 ? 1.7381 0.7421 0.5460 0.6025  0.0294  0.0249  97  VAL A O   
745  C CB  . VAL A 109 ? 1.6389 0.7391 0.4729 0.5819  0.0712  0.0468  97  VAL A CB  
746  C CG1 . VAL A 109 ? 1.5726 0.7263 0.4597 0.5499  0.0591  0.0623  97  VAL A CG1 
747  C CG2 . VAL A 109 ? 1.6063 0.7253 0.4364 0.5886  0.0960  0.0449  97  VAL A CG2 
748  N N   . VAL A 110 ? 1.6511 0.7196 0.5142 0.5463  0.0069  0.0476  98  VAL A N   
749  C CA  . VAL A 110 ? 1.6697 0.7270 0.5702 0.5436  -0.0008 0.0662  98  VAL A CA  
750  C C   . VAL A 110 ? 1.6430 0.7568 0.5726 0.5212  0.0017  0.0987  98  VAL A C   
751  O O   . VAL A 110 ? 1.6038 0.7611 0.5277 0.5027  0.0049  0.0971  98  VAL A O   
752  C CB  . VAL A 110 ? 1.6964 0.7185 0.6207 0.5362  -0.0236 0.0548  98  VAL A CB  
753  C CG1 . VAL A 110 ? 1.7184 0.6881 0.6142 0.5655  -0.0328 0.0129  98  VAL A CG1 
754  C CG2 . VAL A 110 ? 1.6569 0.7015 0.5935 0.5062  -0.0341 0.0544  98  VAL A CG2 
755  N N   . GLU A 111 ? 1.6631 0.7792 0.6242 0.5253  -0.0007 0.1255  99  GLU A N   
756  C CA  . GLU A 111 ? 1.6653 0.8373 0.6446 0.5111  -0.0050 0.1574  99  GLU A CA  
757  C C   . GLU A 111 ? 1.6986 0.8709 0.6970 0.4967  -0.0172 0.1921  99  GLU A C   
758  O O   . GLU A 111 ? 1.6989 0.9180 0.6961 0.4870  -0.0223 0.2216  99  GLU A O   
759  C CB  . GLU A 111 ? 1.6685 0.8533 0.6733 0.5311  0.0003  0.1665  99  GLU A CB  
760  C CG  . GLU A 111 ? 1.6748 0.8795 0.6765 0.5412  0.0203  0.1406  99  GLU A CG  
761  C CD  . GLU A 111 ? 1.7090 0.9358 0.7570 0.5579  0.0259  0.1468  99  GLU A CD  
762  O OE1 . GLU A 111 ? 1.6894 0.9491 0.7580 0.5619  0.0421  0.1292  99  GLU A OE1 
763  O OE2 . GLU A 111 ? 1.7537 0.9655 0.8300 0.5673  0.0143  0.1683  99  GLU A OE2 
764  N N   . GLN A 112 ? 1.7459 0.8665 0.7651 0.4981  -0.0208 0.1883  100 GLN A N   
765  C CA  . GLN A 112 ? 1.7877 0.9009 0.8410 0.4843  -0.0242 0.2228  100 GLN A CA  
766  C C   . GLN A 112 ? 1.7950 0.8840 0.8563 0.4679  -0.0245 0.1963  100 GLN A C   
767  O O   . GLN A 112 ? 1.7907 0.8542 0.8366 0.4753  -0.0300 0.1503  100 GLN A O   
768  C CB  . GLN A 112 ? 1.8257 0.8981 0.9347 0.5016  -0.0268 0.2416  100 GLN A CB  
769  C CG  . GLN A 112 ? 1.8643 0.9665 0.9879 0.5106  -0.0303 0.2918  100 GLN A CG  
770  C CD  . GLN A 112 ? 1.9224 0.9827 1.1167 0.5268  -0.0316 0.3114  100 GLN A CD  
771  O OE1 . GLN A 112 ? 1.9638 0.9797 1.1843 0.5396  -0.0291 0.2725  100 GLN A OE1 
772  N NE2 . GLN A 112 ? 1.9714 1.0466 1.1974 0.5283  -0.0349 0.3717  100 GLN A NE2 
773  N N   . PHE A 113 ? 1.8217 0.9189 0.9079 0.4478  -0.0180 0.2262  101 PHE A N   
774  C CA  . PHE A 113 ? 1.8293 0.8986 0.9501 0.4321  -0.0171 0.2021  101 PHE A CA  
775  C C   . PHE A 113 ? 1.8667 0.9115 1.0602 0.4257  -0.0052 0.2415  101 PHE A C   
776  O O   . PHE A 113 ? 1.8888 0.9525 1.0839 0.4275  0.0059  0.2993  101 PHE A O   
777  C CB  . PHE A 113 ? 1.8065 0.9156 0.8931 0.4076  -0.0098 0.1925  101 PHE A CB  
778  C CG  . PHE A 113 ? 1.8421 0.9974 0.9113 0.3916  0.0076  0.2415  101 PHE A CG  
779  C CD1 . PHE A 113 ? 1.9042 1.0477 1.0146 0.3750  0.0269  0.2722  101 PHE A CD1 
780  C CD2 . PHE A 113 ? 1.8467 1.0578 0.8614 0.3959  0.0061  0.2560  101 PHE A CD2 
781  C CE1 . PHE A 113 ? 1.9574 1.1434 1.0362 0.3649  0.0470  0.3220  101 PHE A CE1 
782  C CE2 . PHE A 113 ? 1.9061 1.1655 0.8920 0.3860  0.0177  0.2970  101 PHE A CE2 
783  C CZ  . PHE A 113 ? 1.9603 1.2066 0.9686 0.3715  0.0395  0.3336  101 PHE A CZ  
784  N N   . GLU A 114 ? 1.8729 0.8756 1.1333 0.4210  -0.0082 0.2100  102 GLU A N   
785  C CA  . GLU A 114 ? 1.9036 0.8828 1.2537 0.4102  0.0112  0.2434  102 GLU A CA  
786  C C   . GLU A 114 ? 1.8830 0.8710 1.2464 0.3831  0.0245  0.2318  102 GLU A C   
787  O O   . GLU A 114 ? 1.8457 0.8416 1.1744 0.3772  0.0081  0.1807  102 GLU A O   
788  C CB  . GLU A 114 ? 1.9266 0.8515 1.3748 0.4253  -0.0005 0.2091  102 GLU A CB  
789  C CG  . GLU A 114 ? 1.9582 0.8704 1.4310 0.4472  -0.0013 0.2366  102 GLU A CG  
790  C CD  . GLU A 114 ? 1.9879 0.8503 1.5780 0.4593  -0.0086 0.1998  102 GLU A CD  
791  O OE1 . GLU A 114 ? 2.0378 0.8842 1.7069 0.4673  0.0046  0.2402  102 GLU A OE1 
792  O OE2 . GLU A 114 ? 1.9991 0.8406 1.6091 0.4621  -0.0296 0.1281  102 GLU A OE2 
793  N N   . PRO A 115 ? 1.9065 0.8913 1.3248 0.3680  0.0577  0.2819  103 PRO A N   
794  C CA  . PRO A 115 ? 1.8972 0.8853 1.3459 0.3409  0.0797  0.2742  103 PRO A CA  
795  C C   . PRO A 115 ? 1.8627 0.8192 1.3729 0.3364  0.0545  0.1954  103 PRO A C   
796  O O   . PRO A 115 ? 1.8392 0.8129 1.3317 0.3176  0.0538  0.1659  103 PRO A O   
797  C CB  . PRO A 115 ? 1.9531 0.9175 1.4902 0.3363  0.1210  0.3365  103 PRO A CB  
798  C CG  . PRO A 115 ? 1.9884 0.9616 1.4944 0.3580  0.1227  0.3968  103 PRO A CG  
799  C CD  . PRO A 115 ? 1.9554 0.9267 1.4232 0.3783  0.0800  0.3506  103 PRO A CD  
800  N N   . SER A 116 ? 1.8602 0.7747 1.4402 0.3561  0.0303  0.1582  104 SER A N   
801  C CA  . SER A 116 ? 1.8442 0.7291 1.4812 0.3607  -0.0038 0.0770  104 SER A CA  
802  C C   . SER A 116 ? 1.8099 0.7136 1.3467 0.3693  -0.0400 0.0248  104 SER A C   
803  O O   . SER A 116 ? 1.8031 0.6872 1.3749 0.3751  -0.0717 -0.0394 104 SER A O   
804  C CB  . SER A 116 ? 1.8725 0.7162 1.5934 0.3857  -0.0240 0.0454  104 SER A CB  
805  O OG  . SER A 116 ? 1.8658 0.7174 1.5021 0.4096  -0.0384 0.0511  104 SER A OG  
806  N N   . ILE A 117 ? 1.7871 0.7277 1.2080 0.3737  -0.0370 0.0508  105 ILE A N   
807  C CA  . ILE A 117 ? 1.7654 0.7189 1.1017 0.3871  -0.0652 0.0075  105 ILE A CA  
808  C C   . ILE A 117 ? 1.7313 0.6974 1.0775 0.3668  -0.0718 -0.0230 105 ILE A C   
809  O O   . ILE A 117 ? 1.7367 0.6917 1.0642 0.3816  -0.1046 -0.0739 105 ILE A O   
810  C CB  . ILE A 117 ? 1.7475 0.7393 0.9799 0.3954  -0.0555 0.0396  105 ILE A CB  
811  C CG1 . ILE A 117 ? 1.7458 0.7388 0.9073 0.4165  -0.0790 -0.0028 105 ILE A CG1 
812  C CG2 . ILE A 117 ? 1.7237 0.7655 0.9283 0.3681  -0.0270 0.0824  105 ILE A CG2 
813  C CD1 . ILE A 117 ? 1.7996 0.7446 0.9736 0.4483  -0.1111 -0.0555 105 ILE A CD1 
814  N N   . LEU A 118 ? 1.7132 0.7015 1.0902 0.3351  -0.0400 0.0083  106 LEU A N   
815  C CA  . LEU A 118 ? 1.6866 0.6875 1.0908 0.3113  -0.0402 -0.0194 106 LEU A CA  
816  C C   . LEU A 118 ? 1.7000 0.6592 1.1929 0.3180  -0.0745 -0.0812 106 LEU A C   
817  O O   . LEU A 118 ? 1.6832 0.6488 1.1771 0.3136  -0.0966 -0.1206 106 LEU A O   
818  C CB  . LEU A 118 ? 1.6862 0.7096 1.1241 0.2778  0.0070  0.0240  106 LEU A CB  
819  C CG  . LEU A 118 ? 1.6805 0.7596 1.0227 0.2703  0.0339  0.0730  106 LEU A CG  
820  C CD1 . LEU A 118 ? 1.7181 0.8120 1.0830 0.2476  0.0824  0.1250  106 LEU A CD1 
821  C CD2 . LEU A 118 ? 1.6348 0.7576 0.9206 0.2614  0.0250  0.0454  106 LEU A CD2 
822  N N   . ASN A 119 ? 1.7368 0.6557 1.3117 0.3306  -0.0816 -0.0922 107 ASN A N   
823  C CA  . ASN A 119 ? 1.7593 0.6402 1.4314 0.3429  -0.1216 -0.1614 107 ASN A CA  
824  C C   . ASN A 119 ? 1.7545 0.6357 1.3649 0.3676  -0.1753 -0.2210 107 ASN A C   
825  O O   . ASN A 119 ? 1.7525 0.6285 1.4184 0.3609  -0.2001 -0.2649 107 ASN A O   
826  C CB  . ASN A 119 ? 1.7970 0.6418 1.5403 0.3648  -0.1302 -0.1734 107 ASN A CB  
827  C CG  . ASN A 119 ? 1.8230 0.6567 1.6647 0.3442  -0.0794 -0.1188 107 ASN A CG  
828  O OD1 . ASN A 119 ? 1.8348 0.6866 1.6849 0.3144  -0.0377 -0.0746 107 ASN A OD1 
829  N ND2 . ASN A 119 ? 1.8344 0.6395 1.7523 0.3610  -0.0786 -0.1188 107 ASN A ND2 
830  N N   . GLU A 120 ? 1.7629 0.6484 1.2619 0.3983  -0.1919 -0.2208 108 GLU A N   
831  C CA  . GLU A 120 ? 1.7794 0.6599 1.2091 0.4311  -0.2410 -0.2729 108 GLU A CA  
832  C C   . GLU A 120 ? 1.7314 0.6452 1.0782 0.4240  -0.2373 -0.2576 108 GLU A C   
833  O O   . GLU A 120 ? 1.7483 0.6615 1.0061 0.4566  -0.2641 -0.2768 108 GLU A O   
834  C CB  . GLU A 120 ? 1.8240 0.6894 1.1709 0.4726  -0.2562 -0.2838 108 GLU A CB  
835  C CG  . GLU A 120 ? 1.8809 0.7183 1.3037 0.4817  -0.2541 -0.2941 108 GLU A CG  
836  C CD  . GLU A 120 ? 1.9011 0.7490 1.2910 0.4744  -0.2095 -0.2284 108 GLU A CD  
837  O OE1 . GLU A 120 ? 1.8924 0.7728 1.2108 0.4585  -0.1806 -0.1775 108 GLU A OE1 
838  O OE2 . GLU A 120 ? 1.9446 0.7707 1.3911 0.4846  -0.2050 -0.2303 108 GLU A OE2 
839  N N   . PHE A 121 ? 1.6689 0.6118 1.0474 0.3843  -0.2025 -0.2244 109 PHE A N   
840  C CA  . PHE A 121 ? 1.6256 0.6054 0.9439 0.3745  -0.1938 -0.2108 109 PHE A CA  
841  C C   . PHE A 121 ? 1.5917 0.5869 0.9961 0.3365  -0.1841 -0.2205 109 PHE A C   
842  O O   . PHE A 121 ? 1.5854 0.5708 1.0812 0.3105  -0.1637 -0.2168 109 PHE A O   
843  C CB  . PHE A 121 ? 1.5912 0.6068 0.8284 0.3695  -0.1531 -0.1563 109 PHE A CB  
844  C CG  . PHE A 121 ? 1.6068 0.6085 0.7595 0.4087  -0.1622 -0.1518 109 PHE A CG  
845  C CD1 . PHE A 121 ? 1.6386 0.6391 0.7164 0.4398  -0.1811 -0.1675 109 PHE A CD1 
846  C CD2 . PHE A 121 ? 1.6254 0.6113 0.7792 0.4171  -0.1502 -0.1315 109 PHE A CD2 
847  C CE1 . PHE A 121 ? 1.6635 0.6460 0.6630 0.4785  -0.1834 -0.1650 109 PHE A CE1 
848  C CE2 . PHE A 121 ? 1.6477 0.6180 0.7336 0.4526  -0.1559 -0.1322 109 PHE A CE2 
849  C CZ  . PHE A 121 ? 1.6699 0.6376 0.6760 0.4835  -0.1710 -0.1507 109 PHE A CZ  
850  N N   . ASP A 122 ? 0.6709 0.5596 0.5586 -0.0923 -0.0336 -0.0353 110 ASP A N   
851  C CA  . ASP A 122 ? 0.6472 0.5737 0.5655 -0.1085 -0.0406 -0.0243 110 ASP A CA  
852  C C   . ASP A 122 ? 0.6027 0.5641 0.5556 -0.0935 -0.0339 -0.0145 110 ASP A C   
853  O O   . ASP A 122 ? 0.5765 0.5589 0.5518 -0.1016 -0.0355 -0.0053 110 ASP A O   
854  C CB  . ASP A 122 ? 0.6462 0.6018 0.5696 -0.1208 -0.0500 -0.0238 110 ASP A CB  
855  C CG  . ASP A 122 ? 0.7009 0.6229 0.5861 -0.1358 -0.0572 -0.0347 110 ASP A CG  
856  O OD1 . ASP A 122 ? 0.7427 0.6350 0.6093 -0.1541 -0.0622 -0.0368 110 ASP A OD1 
857  O OD2 . ASP A 122 ? 0.7515 0.6734 0.6222 -0.1296 -0.0573 -0.0414 110 ASP A OD2 
858  N N   . VAL A 123 ? 0.5749 0.5453 0.5315 -0.0730 -0.0270 -0.0163 111 VAL A N   
859  C CA  . VAL A 123 ? 0.5352 0.5358 0.5197 -0.0600 -0.0215 -0.0082 111 VAL A CA  
860  C C   . VAL A 123 ? 0.5307 0.5152 0.5078 -0.0403 -0.0122 -0.0105 111 VAL A C   
861  O O   . VAL A 123 ? 0.5591 0.5273 0.5165 -0.0307 -0.0090 -0.0180 111 VAL A O   
862  C CB  . VAL A 123 ? 0.5138 0.5490 0.5135 -0.0570 -0.0238 -0.0052 111 VAL A CB  
863  C CG1 . VAL A 123 ? 0.4429 0.5011 0.4654 -0.0442 -0.0179 0.0021  111 VAL A CG1 
864  C CG2 . VAL A 123 ? 0.4997 0.5554 0.5090 -0.0747 -0.0336 -0.0009 111 VAL A CG2 
865  N N   . VAL A 124 ? 0.5158 0.5062 0.5078 -0.0346 -0.0080 -0.0035 112 VAL A N   
866  C CA  . VAL A 124 ? 0.5127 0.4997 0.5048 -0.0158 -0.0002 -0.0022 112 VAL A CA  
867  C C   . VAL A 124 ? 0.4655 0.4879 0.4802 -0.0091 0.0017  0.0039  112 VAL A C   
868  O O   . VAL A 124 ? 0.4586 0.4988 0.4908 -0.0155 0.0001  0.0102  112 VAL A O   
869  C CB  . VAL A 124 ? 0.5386 0.5050 0.5279 -0.0144 0.0024  0.0020  112 VAL A CB  
870  C CG1 . VAL A 124 ? 0.5309 0.4977 0.5205 0.0061  0.0094  0.0045  112 VAL A CG1 
871  C CG2 . VAL A 124 ? 0.5896 0.5140 0.5526 -0.0235 0.0000  -0.0036 112 VAL A CG2 
872  N N   . VAL A 125 ? 0.4608 0.4928 0.4734 0.0033  0.0055  0.0023  113 VAL A N   
873  C CA  . VAL A 125 ? 0.4209 0.4814 0.4503 0.0082  0.0071  0.0082  113 VAL A CA  
874  C C   . VAL A 125 ? 0.4149 0.4745 0.4464 0.0199  0.0121  0.0123  113 VAL A C   
875  O O   . VAL A 125 ? 0.4464 0.4985 0.4677 0.0319  0.0163  0.0100  113 VAL A O   
876  C CB  . VAL A 125 ? 0.4280 0.5048 0.4551 0.0111  0.0071  0.0060  113 VAL A CB  
877  C CG1 . VAL A 125 ? 0.3699 0.4719 0.4110 0.0148  0.0088  0.0129  113 VAL A CG1 
878  C CG2 . VAL A 125 ? 0.3956 0.4759 0.4217 -0.0007 0.0008  0.0039  113 VAL A CG2 
879  N N   . ASP A 126 ? 0.3962 0.4651 0.4402 0.0173  0.0119  0.0190  114 ASP A N   
880  C CA  . ASP A 126 ? 0.4008 0.4705 0.4469 0.0263  0.0151  0.0244  114 ASP A CA  
881  C C   . ASP A 126 ? 0.3789 0.4756 0.4342 0.0304  0.0159  0.0291  114 ASP A C   
882  O O   . ASP A 126 ? 0.3697 0.4788 0.4335 0.0233  0.0141  0.0329  114 ASP A O   
883  C CB  . ASP A 126 ? 0.3985 0.4614 0.4493 0.0190  0.0143  0.0289  114 ASP A CB  
884  C CG  . ASP A 126 ? 0.4137 0.4859 0.4692 0.0246  0.0160  0.0361  114 ASP A CG  
885  O OD1 . ASP A 126 ? 0.3837 0.4573 0.4355 0.0363  0.0178  0.0384  114 ASP A OD1 
886  O OD2 . ASP A 126 ? 0.3980 0.4772 0.4600 0.0175  0.0154  0.0397  114 ASP A OD2 
887  N N   . ALA A 127 ? 0.3958 0.5010 0.4476 0.0415  0.0189  0.0289  115 ALA A N   
888  C CA  . ALA A 127 ? 0.3761 0.5099 0.4361 0.0442  0.0193  0.0346  115 ALA A CA  
889  C C   . ALA A 127 ? 0.3735 0.5147 0.4347 0.0573  0.0221  0.0405  115 ALA A C   
890  O O   . ALA A 127 ? 0.3739 0.5389 0.4391 0.0650  0.0243  0.0442  115 ALA A O   
891  C CB  . ALA A 127 ? 0.3733 0.5215 0.4313 0.0453  0.0207  0.0317  115 ALA A CB  
892  N N   . ILE A 128 ? 0.3937 0.5171 0.4520 0.0596  0.0219  0.0427  116 ILE A N   
893  C CA  . ILE A 128 ? 0.4030 0.5307 0.4611 0.0740  0.0241  0.0494  116 ILE A CA  
894  C C   . ILE A 128 ? 0.3870 0.5447 0.4564 0.0694  0.0206  0.0588  116 ILE A C   
895  O O   . ILE A 128 ? 0.3838 0.5705 0.4600 0.0766  0.0214  0.0644  116 ILE A O   
896  C CB  . ILE A 128 ? 0.4199 0.5144 0.4679 0.0776  0.0246  0.0495  116 ILE A CB  
897  C CG1 . ILE A 128 ? 0.4492 0.5107 0.4825 0.0778  0.0265  0.0400  116 ILE A CG1 
898  C CG2 . ILE A 128 ? 0.4313 0.5310 0.4787 0.0950  0.0265  0.0582  116 ILE A CG2 
899  C CD1 . ILE A 128 ? 0.5001 0.5235 0.5201 0.0771  0.0263  0.0405  116 ILE A CD1 
900  N N   . PHE A 129 ? 0.3842 0.5357 0.4543 0.0571  0.0170  0.0608  117 PHE A N   
901  C CA  . PHE A 129 ? 0.3823 0.5568 0.4577 0.0489  0.0128  0.0681  117 PHE A CA  
902  C C   . PHE A 129 ? 0.3857 0.5558 0.4597 0.0325  0.0103  0.0646  117 PHE A C   
903  O O   . PHE A 129 ? 0.3834 0.5323 0.4540 0.0278  0.0115  0.0598  117 PHE A O   
904  C CB  . PHE A 129 ? 0.3959 0.5664 0.4687 0.0516  0.0110  0.0756  117 PHE A CB  
905  C CG  . PHE A 129 ? 0.4269 0.5943 0.4985 0.0698  0.0134  0.0803  117 PHE A CG  
906  C CD1 . PHE A 129 ? 0.4528 0.6491 0.5319 0.0824  0.0142  0.0864  117 PHE A CD1 
907  C CD2 . PHE A 129 ? 0.4338 0.5695 0.4960 0.0747  0.0152  0.0799  117 PHE A CD2 
908  C CE1 . PHE A 129 ? 0.4825 0.6744 0.5595 0.1034  0.0175  0.0915  117 PHE A CE1 
909  C CE2 . PHE A 129 ? 0.4407 0.5667 0.4980 0.0929  0.0176  0.0846  117 PHE A CE2 
910  C CZ  . PHE A 129 ? 0.4969 0.6505 0.5615 0.1091  0.0191  0.0902  117 PHE A CZ  
911  N N   . GLY A 130 ? 0.3868 0.5769 0.4624 0.0237  0.0069  0.0680  118 GLY A N   
912  C CA  . GLY A 130 ? 0.3865 0.5680 0.4565 0.0097  0.0049  0.0653  118 GLY A CA  
913  C C   . GLY A 130 ? 0.3902 0.5765 0.4537 0.0015  0.0009  0.0711  118 GLY A C   
914  O O   . GLY A 130 ? 0.3961 0.5771 0.4573 0.0052  0.0010  0.0742  118 GLY A O   
915  N N   . THR A 131 ? 0.3911 0.5858 0.4490 -0.0107 -0.0029 0.0726  119 THR A N   
916  C CA  . THR A 131 ? 0.4069 0.6031 0.4536 -0.0218 -0.0077 0.0770  119 THR A CA  
917  C C   . THR A 131 ? 0.4181 0.6435 0.4711 -0.0194 -0.0122 0.0870  119 THR A C   
918  O O   . THR A 131 ? 0.4260 0.6546 0.4696 -0.0280 -0.0171 0.0917  119 THR A O   
919  C CB  . THR A 131 ? 0.4155 0.6079 0.4502 -0.0378 -0.0115 0.0758  119 THR A CB  
920  O OG1 . THR A 131 ? 0.3877 0.6053 0.4318 -0.0397 -0.0135 0.0796  119 THR A OG1 
921  C CG2 . THR A 131 ? 0.4154 0.5782 0.4424 -0.0380 -0.0071 0.0675  119 THR A CG2 
922  N N   . GLY A 132 ? 0.4233 0.6703 0.4910 -0.0069 -0.0103 0.0904  120 GLY A N   
923  C CA  . GLY A 132 ? 0.4298 0.7094 0.5065 0.0000  -0.0135 0.1014  120 GLY A CA  
924  C C   . GLY A 132 ? 0.4365 0.7068 0.5146 0.0154  -0.0113 0.1045  120 GLY A C   
925  O O   . GLY A 132 ? 0.4345 0.7298 0.5203 0.0251  -0.0135 0.1145  120 GLY A O   
926  N N   . LEU A 133 ? 0.4419 0.6777 0.5125 0.0177  -0.0073 0.0974  121 LEU A N   
927  C CA  . LEU A 133 ? 0.4487 0.6714 0.5165 0.0285  -0.0060 0.1015  121 LEU A CA  
928  C C   . LEU A 133 ? 0.4589 0.6985 0.5220 0.0229  -0.0129 0.1119  121 LEU A C   
929  O O   . LEU A 133 ? 0.4526 0.6921 0.5058 0.0062  -0.0171 0.1110  121 LEU A O   
930  C CB  . LEU A 133 ? 0.4532 0.6401 0.5118 0.0243  -0.0018 0.0934  121 LEU A CB  
931  C CG  . LEU A 133 ? 0.4697 0.6385 0.5223 0.0313  -0.0004 0.0977  121 LEU A CG  
932  C CD1 . LEU A 133 ? 0.4406 0.6048 0.4981 0.0492  0.0024  0.1000  121 LEU A CD1 
933  C CD2 . LEU A 133 ? 0.4381 0.5795 0.4828 0.0230  0.0036  0.0909  121 LEU A CD2 
934  N N   . ARG A 134 ? 0.4721 0.7269 0.5410 0.0371  -0.0144 0.1221  122 ARG A N   
935  C CA  . ARG A 134 ? 0.5129 0.7834 0.5769 0.0335  -0.0216 0.1336  122 ARG A CA  
936  C C   . ARG A 134 ? 0.5127 0.7666 0.5742 0.0509  -0.0192 0.1398  122 ARG A C   
937  O O   . ARG A 134 ? 0.5253 0.7819 0.5953 0.0711  -0.0154 0.1430  122 ARG A O   
938  C CB  . ARG A 134 ? 0.5198 0.8393 0.5956 0.0325  -0.0288 0.1453  122 ARG A CB  
939  C CG  . ARG A 134 ? 0.5833 0.9195 0.6575 0.0105  -0.0336 0.1422  122 ARG A CG  
940  C CD  . ARG A 134 ? 0.6434 0.9573 0.6953 -0.0126 -0.0384 0.1372  122 ARG A CD  
941  N NE  . ARG A 134 ? 0.6787 1.0027 0.7265 -0.0323 -0.0425 0.1340  122 ARG A NE  
942  C CZ  . ARG A 134 ? 0.6978 1.0015 0.7427 -0.0375 -0.0375 0.1230  122 ARG A CZ  
943  N NH1 . ARG A 134 ? 0.6982 0.9716 0.7444 -0.0258 -0.0285 0.1132  122 ARG A NH1 
944  N NH2 . ARG A 134 ? 0.7036 1.0166 0.7426 -0.0561 -0.0424 0.1226  122 ARG A NH2 
945  N N   . GLY A 135 ? 0.5131 0.7468 0.5602 0.0435  -0.0208 0.1413  123 GLY A N   
946  C CA  . GLY A 135 ? 0.5257 0.7412 0.5673 0.0571  -0.0193 0.1485  123 GLY A CA  
947  C C   . GLY A 135 ? 0.5314 0.7079 0.5696 0.0649  -0.0107 0.1400  123 GLY A C   
948  O O   . GLY A 135 ? 0.4887 0.6557 0.5314 0.0624  -0.0059 0.1285  123 GLY A O   
949  N N   . GLU A 136 ? 0.5457 0.6997 0.5744 0.0735  -0.0098 0.1469  124 GLU A N   
950  C CA  . GLU A 136 ? 0.5706 0.6844 0.5918 0.0779  -0.0032 0.1413  124 GLU A CA  
951  C C   . GLU A 136 ? 0.5708 0.6778 0.5988 0.0933  0.0012  0.1355  124 GLU A C   
952  O O   . GLU A 136 ? 0.5518 0.6802 0.5879 0.1097  0.0003  0.1415  124 GLU A O   
953  C CB  . GLU A 136 ? 0.6110 0.7033 0.6187 0.0854  -0.0044 0.1530  124 GLU A CB  
954  C CG  . GLU A 136 ? 0.6574 0.7557 0.6548 0.0707  -0.0086 0.1597  124 GLU A CG  
955  C CD  . GLU A 136 ? 0.7399 0.8132 0.7272 0.0532  -0.0034 0.1518  124 GLU A CD  
956  O OE1 . GLU A 136 ? 0.8030 0.8882 0.7904 0.0383  -0.0030 0.1448  124 GLU A OE1 
957  O OE2 . GLU A 136 ? 0.8147 0.8563 0.7932 0.0543  0.0005  0.1529  124 GLU A OE2 
958  N N   . ILE A 137 ? 0.5794 0.6577 0.6033 0.0878  0.0064  0.1242  125 ILE A N   
959  C CA  . ILE A 137 ? 0.6044 0.6657 0.6277 0.1008  0.0111  0.1174  125 ILE A CA  
960  C C   . ILE A 137 ? 0.6563 0.6783 0.6635 0.1143  0.0133  0.1223  125 ILE A C   
961  O O   . ILE A 137 ? 0.6851 0.6758 0.6799 0.1035  0.0139  0.1221  125 ILE A O   
962  C CB  . ILE A 137 ? 0.5857 0.6332 0.6096 0.0865  0.0142  0.1033  125 ILE A CB  
963  C CG1 . ILE A 137 ? 0.5539 0.6352 0.5913 0.0762  0.0124  0.0986  125 ILE A CG1 
964  C CG2 . ILE A 137 ? 0.5984 0.6197 0.6152 0.0973  0.0186  0.0954  125 ILE A CG2 
965  C CD1 . ILE A 137 ? 0.5192 0.5904 0.5586 0.0642  0.0149  0.0860  125 ILE A CD1 
966  N N   . THR A 138 ? 0.6917 0.7142 0.6979 0.1378  0.0153  0.1265  126 THR A N   
967  C CA  . THR A 138 ? 0.7504 0.7298 0.7376 0.1548  0.0182  0.1305  126 THR A CA  
968  C C   . THR A 138 ? 0.7751 0.7365 0.7558 0.1726  0.0246  0.1216  126 THR A C   
969  O O   . THR A 138 ? 0.7525 0.7378 0.7447 0.1705  0.0267  0.1127  126 THR A O   
970  C CB  . THR A 138 ? 0.7666 0.7617 0.7547 0.1742  0.0151  0.1479  126 THR A CB  
971  O OG1 . THR A 138 ? 0.7641 0.8137 0.7733 0.1838  0.0136  0.1522  126 THR A OG1 
972  C CG2 . THR A 138 ? 0.7596 0.7552 0.7436 0.1589  0.0094  0.1575  126 THR A CG2 
973  N N   . GLY A 139 ? 0.8217 0.7381 0.7807 0.1900  0.0280  0.1241  127 GLY A N   
974  C CA  . GLY A 139 ? 0.8545 0.7531 0.8032 0.2143  0.0351  0.1181  127 GLY A CA  
975  C C   . GLY A 139 ? 0.8647 0.7369 0.8029 0.2010  0.0382  0.1006  127 GLY A C   
976  O O   . GLY A 139 ? 0.8712 0.7198 0.8021 0.1763  0.0352  0.0950  127 GLY A O   
977  N N   . GLU A 140 ? 0.8694 0.7497 0.8075 0.2169  0.0443  0.0928  128 GLU A N   
978  C CA  . GLU A 140 ? 0.8732 0.7357 0.8020 0.2047  0.0468  0.0761  128 GLU A CA  
979  C C   . GLU A 140 ? 0.8153 0.7105 0.7643 0.1754  0.0414  0.0712  128 GLU A C   
980  O O   . GLU A 140 ? 0.8248 0.7005 0.7654 0.1580  0.0406  0.0594  128 GLU A O   
981  C CB  . GLU A 140 ? 0.8825 0.7648 0.8133 0.2270  0.0546  0.0705  128 GLU A CB  
982  C CG  . GLU A 140 ? 0.9744 0.8105 0.8759 0.2556  0.0632  0.0667  128 GLU A CG  
983  C CD  . GLU A 140 ? 1.0099 0.8724 0.9149 0.2750  0.0720  0.0601  128 GLU A CD  
984  O OE1 . GLU A 140 ? 1.0178 0.9088 0.9352 0.2577  0.0707  0.0518  128 GLU A OE1 
985  O OE2 . GLU A 140 ? 1.0511 0.9069 0.9461 0.3083  0.0805  0.0640  128 GLU A OE2 
986  N N   . TYR A 141 ? 0.7598 0.7055 0.7341 0.1705  0.0376  0.0798  129 TYR A N   
987  C CA  . TYR A 141 ? 0.7060 0.6776 0.6962 0.1446  0.0330  0.0753  129 TYR A CA  
988  C C   . TYR A 141 ? 0.6998 0.6400 0.6807 0.1234  0.0296  0.0738  129 TYR A C   
989  O O   . TYR A 141 ? 0.6940 0.6233 0.6724 0.1065  0.0287  0.0643  129 TYR A O   
990  C CB  . TYR A 141 ? 0.6666 0.6906 0.6800 0.1414  0.0292  0.0846  129 TYR A CB  
991  C CG  . TYR A 141 ? 0.6405 0.7049 0.6673 0.1552  0.0319  0.0861  129 TYR A CG  
992  C CD1 . TYR A 141 ? 0.6233 0.7019 0.6553 0.1482  0.0337  0.0766  129 TYR A CD1 
993  C CD2 . TYR A 141 ? 0.6639 0.7556 0.6987 0.1750  0.0324  0.0984  129 TYR A CD2 
994  C CE1 . TYR A 141 ? 0.5871 0.7053 0.6313 0.1589  0.0366  0.0790  129 TYR A CE1 
995  C CE2 . TYR A 141 ? 0.6402 0.7754 0.6894 0.1866  0.0353  0.1013  129 TYR A CE2 
996  C CZ  . TYR A 141 ? 0.6228 0.7702 0.6762 0.1773  0.0375  0.0913  129 TYR A CZ  
997  O OH  . TYR A 141 ? 0.6830 0.8753 0.7504 0.1866  0.0407  0.0949  129 TYR A OH  
998  N N   . ALA A 142 ? 0.7035 0.6310 0.6788 0.1248  0.0276  0.0841  130 ALA A N   
999  C CA  . ALA A 142 ? 0.7121 0.6136 0.6788 0.1050  0.0251  0.0852  130 ALA A CA  
1000 C C   . ALA A 142 ? 0.7550 0.6087 0.7005 0.0977  0.0265  0.0760  130 ALA A C   
1001 O O   . ALA A 142 ? 0.7337 0.5804 0.6792 0.0753  0.0244  0.0716  130 ALA A O   
1002 C CB  . ALA A 142 ? 0.7237 0.6151 0.6834 0.1114  0.0235  0.0988  130 ALA A CB  
1003 N N   . GLU A 143 ? 0.7975 0.6193 0.7238 0.1170  0.0301  0.0733  131 GLU A N   
1004 C CA  . GLU A 143 ? 0.8518 0.6201 0.7508 0.1103  0.0308  0.0646  131 GLU A CA  
1005 C C   . GLU A 143 ? 0.8287 0.6042 0.7310 0.0943  0.0298  0.0514  131 GLU A C   
1006 O O   . GLU A 143 ? 0.8532 0.6018 0.7434 0.0726  0.0266  0.0467  131 GLU A O   
1007 C CB  . GLU A 143 ? 0.9150 0.6450 0.7892 0.1378  0.0361  0.0634  131 GLU A CB  
1008 C CG  . GLU A 143 ? 1.0112 0.6721 0.8492 0.1316  0.0359  0.0602  131 GLU A CG  
1009 C CD  . GLU A 143 ? 1.1370 0.7573 0.9497 0.1630  0.0413  0.0646  131 GLU A CD  
1010 O OE1 . GLU A 143 ? 1.1987 0.8119 1.0013 0.1849  0.0476  0.0564  131 GLU A OE1 
1011 O OE2 . GLU A 143 ? 1.1843 0.7805 0.9867 0.1668  0.0398  0.0767  131 GLU A OE2 
1012 N N   . ILE A 144 ? 0.7782 0.5899 0.6957 0.1035  0.0320  0.0463  132 ILE A N   
1013 C CA  . ILE A 144 ? 0.7630 0.5831 0.6833 0.0885  0.0303  0.0349  132 ILE A CA  
1014 C C   . ILE A 144 ? 0.7099 0.5573 0.6507 0.0633  0.0251  0.0373  132 ILE A C   
1015 O O   . ILE A 144 ? 0.7051 0.5446 0.6424 0.0448  0.0219  0.0307  132 ILE A O   
1016 C CB  . ILE A 144 ? 0.7470 0.6002 0.6779 0.1025  0.0340  0.0297  132 ILE A CB  
1017 C CG1 . ILE A 144 ? 0.7702 0.6247 0.6984 0.0864  0.0317  0.0181  132 ILE A CG1 
1018 C CG2 . ILE A 144 ? 0.6881 0.5958 0.6487 0.1037  0.0330  0.0375  132 ILE A CG2 
1019 C CD1 . ILE A 144 ? 0.8423 0.6432 0.7379 0.0782  0.0307  0.0076  132 ILE A CD1 
1020 N N   . ILE A 145 ? 0.6525 0.5319 0.6130 0.0631  0.0244  0.0469  133 ILE A N   
1021 C CA  . ILE A 145 ? 0.6068 0.5106 0.5844 0.0432  0.0213  0.0491  133 ILE A CA  
1022 C C   . ILE A 145 ? 0.6274 0.5027 0.5941 0.0250  0.0193  0.0511  133 ILE A C   
1023 O O   . ILE A 145 ? 0.5972 0.4828 0.5718 0.0066  0.0170  0.0484  133 ILE A O   
1024 C CB  . ILE A 145 ? 0.5745 0.5135 0.5698 0.0468  0.0214  0.0581  133 ILE A CB  
1025 C CG1 . ILE A 145 ? 0.5451 0.5196 0.5546 0.0556  0.0218  0.0557  133 ILE A CG1 
1026 C CG2 . ILE A 145 ? 0.5335 0.4861 0.5393 0.0277  0.0200  0.0610  133 ILE A CG2 
1027 C CD1 . ILE A 145 ? 0.5338 0.5373 0.5542 0.0622  0.0211  0.0647  133 ILE A CD1 
1028 N N   . ASN A 146 ? 0.6630 0.5036 0.6113 0.0303  0.0201  0.0567  134 ASN A N   
1029 C CA  . ASN A 146 ? 0.7061 0.5161 0.6407 0.0113  0.0180  0.0598  134 ASN A CA  
1030 C C   . ASN A 146 ? 0.7365 0.5172 0.6546 -0.0024 0.0153  0.0499  134 ASN A C   
1031 O O   . ASN A 146 ? 0.7440 0.5245 0.6637 -0.0259 0.0120  0.0506  134 ASN A O   
1032 C CB  . ASN A 146 ? 0.7330 0.5094 0.6492 0.0202  0.0192  0.0695  134 ASN A CB  
1033 C CG  . ASN A 146 ? 0.7331 0.5408 0.6649 0.0274  0.0202  0.0805  134 ASN A CG  
1034 O OD1 . ASN A 146 ? 0.7001 0.5453 0.6521 0.0171  0.0201  0.0818  134 ASN A OD1 
1035 N ND2 . ASN A 146 ? 0.7536 0.5447 0.6741 0.0456  0.0211  0.0887  134 ASN A ND2 
1036 N N   . LEU A 147 ? 0.7666 0.5253 0.6684 0.0118  0.0166  0.0412  135 LEU A N   
1037 C CA  . LEU A 147 ? 0.8057 0.5384 0.6893 -0.0003 0.0136  0.0301  135 LEU A CA  
1038 C C   . LEU A 147 ? 0.7657 0.5393 0.6713 -0.0166 0.0099  0.0255  135 LEU A C   
1039 O O   . LEU A 147 ? 0.7842 0.5492 0.6844 -0.0397 0.0047  0.0233  135 LEU A O   
1040 C CB  . LEU A 147 ? 0.8385 0.5443 0.7002 0.0219  0.0177  0.0209  135 LEU A CB  
1041 C CG  . LEU A 147 ? 0.9220 0.5743 0.7534 0.0390  0.0213  0.0238  135 LEU A CG  
1042 C CD1 . LEU A 147 ? 0.9384 0.5828 0.7582 0.0689  0.0281  0.0170  135 LEU A CD1 
1043 C CD2 . LEU A 147 ? 0.9896 0.5807 0.7862 0.0186  0.0172  0.0212  135 LEU A CD2 
1044 N N   . VAL A 148 ? 0.7215 0.5395 0.6514 -0.0053 0.0120  0.0253  136 VAL A N   
1045 C CA  . VAL A 148 ? 0.6747 0.5315 0.6260 -0.0180 0.0088  0.0230  136 VAL A CA  
1046 C C   . VAL A 148 ? 0.6630 0.5357 0.6286 -0.0388 0.0061  0.0304  136 VAL A C   
1047 O O   . VAL A 148 ? 0.6551 0.5344 0.6234 -0.0575 0.0013  0.0283  136 VAL A O   
1048 C CB  . VAL A 148 ? 0.6354 0.5345 0.6092 -0.0037 0.0117  0.0240  136 VAL A CB  
1049 C CG1 . VAL A 148 ? 0.5971 0.5305 0.5909 -0.0167 0.0085  0.0236  136 VAL A CG1 
1050 C CG2 . VAL A 148 ? 0.6480 0.5418 0.6115 0.0150  0.0148  0.0172  136 VAL A CG2 
1051 N N   . ASN A 149 ? 0.6496 0.5298 0.6234 -0.0359 0.0092  0.0397  137 ASN A N   
1052 C CA  . ASN A 149 ? 0.6386 0.5358 0.6252 -0.0540 0.0086  0.0476  137 ASN A CA  
1053 C C   . ASN A 149 ? 0.6784 0.5480 0.6497 -0.0768 0.0044  0.0491  137 ASN A C   
1054 O O   . ASN A 149 ? 0.6514 0.5440 0.6365 -0.0949 0.0030  0.0542  137 ASN A O   
1055 C CB  . ASN A 149 ? 0.6304 0.5363 0.6232 -0.0464 0.0132  0.0571  137 ASN A CB  
1056 C CG  . ASN A 149 ? 0.5664 0.5066 0.5768 -0.0318 0.0160  0.0572  137 ASN A CG  
1057 O OD1 . ASN A 149 ? 0.4942 0.4562 0.5160 -0.0297 0.0150  0.0516  137 ASN A OD1 
1058 N ND2 . ASN A 149 ? 0.5588 0.5023 0.5692 -0.0231 0.0188  0.0642  137 ASN A ND2 
1059 N N   . LYS A 150 ? 0.7344 0.5553 0.6764 -0.0762 0.0027  0.0452  138 LYS A N   
1060 C CA  . LYS A 150 ? 0.7916 0.5806 0.7140 -0.1010 -0.0024 0.0459  138 LYS A CA  
1061 C C   . LYS A 150 ? 0.8058 0.5897 0.7196 -0.1141 -0.0089 0.0360  138 LYS A C   
1062 O O   . LYS A 150 ? 0.8455 0.6035 0.7413 -0.1374 -0.0148 0.0357  138 LYS A O   
1063 C CB  . LYS A 150 ? 0.8467 0.5751 0.7345 -0.0961 -0.0015 0.0470  138 LYS A CB  
1064 C CG  . LYS A 150 ? 0.8832 0.6092 0.7734 -0.0923 0.0024  0.0596  138 LYS A CG  
1065 C CD  . LYS A 150 ? 0.9995 0.6611 0.8528 -0.0850 0.0028  0.0610  138 LYS A CD  
1066 C CE  . LYS A 150 ? 1.0450 0.7014 0.8977 -0.0795 0.0063  0.0749  138 LYS A CE  
1067 N NZ  . LYS A 150 ? 1.0442 0.7224 0.9098 -0.0491 0.0112  0.0776  138 LYS A NZ  
1068 N N   . SER A 151 ? 0.7764 0.5835 0.7007 -0.1013 -0.0086 0.0283  139 SER A N   
1069 C CA  . SER A 151 ? 0.7973 0.5890 0.7046 -0.1094 -0.0144 0.0176  139 SER A CA  
1070 C C   . SER A 151 ? 0.7818 0.6107 0.7075 -0.1331 -0.0217 0.0196  139 SER A C   
1071 O O   . SER A 151 ? 0.8100 0.6233 0.7183 -0.1484 -0.0289 0.0128  139 SER A O   
1072 C CB  . SER A 151 ? 0.7755 0.5771 0.6848 -0.0850 -0.0104 0.0095  139 SER A CB  
1073 O OG  . SER A 151 ? 0.7061 0.5630 0.6493 -0.0815 -0.0098 0.0130  139 SER A OG  
1074 N N   . GLY A 152 ? 0.7384 0.6175 0.6985 -0.1339 -0.0196 0.0287  140 GLY A N   
1075 C CA  . GLY A 152 ? 0.7135 0.6371 0.6967 -0.1502 -0.0253 0.0324  140 GLY A CA  
1076 C C   . GLY A 152 ? 0.6892 0.6325 0.6778 -0.1424 -0.0285 0.0249  140 GLY A C   
1077 O O   . GLY A 152 ? 0.6857 0.6575 0.6859 -0.1571 -0.0355 0.0267  140 GLY A O   
1078 N N   . LYS A 153 ? 0.6731 0.6029 0.6529 -0.1200 -0.0238 0.0175  141 LYS A N   
1079 C CA  . LYS A 153 ? 0.6388 0.5903 0.6251 -0.1112 -0.0256 0.0120  141 LYS A CA  
1080 C C   . LYS A 153 ? 0.5734 0.5721 0.5927 -0.1008 -0.0220 0.0192  141 LYS A C   
1081 O O   . LYS A 153 ? 0.5602 0.5702 0.5937 -0.0956 -0.0164 0.0263  141 LYS A O   
1082 C CB  . LYS A 153 ? 0.6595 0.5827 0.6249 -0.0911 -0.0208 0.0026  141 LYS A CB  
1083 C CG  . LYS A 153 ? 0.7324 0.6015 0.6593 -0.0957 -0.0224 -0.0062 141 LYS A CG  
1084 C CD  . LYS A 153 ? 0.7716 0.6302 0.6825 -0.1211 -0.0326 -0.0106 141 LYS A CD  
1085 C CE  . LYS A 153 ? 0.8284 0.6237 0.6963 -0.1278 -0.0338 -0.0188 141 LYS A CE  
1086 N NZ  . LYS A 153 ? 0.8595 0.6418 0.7061 -0.1528 -0.0446 -0.0251 141 LYS A NZ  
1087 N N   . VAL A 154 ? 0.5434 0.5671 0.5718 -0.0986 -0.0254 0.0174  142 VAL A N   
1088 C CA  . VAL A 154 ? 0.4943 0.5547 0.5477 -0.0858 -0.0218 0.0226  142 VAL A CA  
1089 C C   . VAL A 154 ? 0.4767 0.5266 0.5257 -0.0656 -0.0144 0.0196  142 VAL A C   
1090 O O   . VAL A 154 ? 0.4940 0.5254 0.5257 -0.0584 -0.0141 0.0121  142 VAL A O   
1091 C CB  . VAL A 154 ? 0.4812 0.5654 0.5409 -0.0884 -0.0283 0.0218  142 VAL A CB  
1092 C CG1 . VAL A 154 ? 0.4240 0.5367 0.5036 -0.0731 -0.0240 0.0266  142 VAL A CG1 
1093 C CG2 . VAL A 154 ? 0.4611 0.5634 0.5282 -0.1104 -0.0371 0.0271  142 VAL A CG2 
1094 N N   . VAL A 155 ? 0.4521 0.5145 0.5153 -0.0571 -0.0085 0.0256  143 VAL A N   
1095 C CA  . VAL A 155 ? 0.4343 0.4916 0.4950 -0.0405 -0.0025 0.0246  143 VAL A CA  
1096 C C   . VAL A 155 ? 0.4009 0.4843 0.4763 -0.0323 -0.0007 0.0276  143 VAL A C   
1097 O O   . VAL A 155 ? 0.3930 0.4943 0.4826 -0.0339 0.0006  0.0331  143 VAL A O   
1098 C CB  . VAL A 155 ? 0.4440 0.4870 0.5016 -0.0380 0.0020  0.0286  143 VAL A CB  
1099 C CG1 . VAL A 155 ? 0.3984 0.4394 0.4533 -0.0218 0.0066  0.0287  143 VAL A CG1 
1100 C CG2 . VAL A 155 ? 0.4905 0.4998 0.5287 -0.0468 -0.0001 0.0260  143 VAL A CG2 
1101 N N   . VAL A 156 ? 0.3972 0.4810 0.4671 -0.0231 -0.0001 0.0239  144 VAL A N   
1102 C CA  . VAL A 156 ? 0.3674 0.4697 0.4459 -0.0170 0.0008  0.0264  144 VAL A CA  
1103 C C   . VAL A 156 ? 0.3732 0.4720 0.4475 -0.0072 0.0050  0.0269  144 VAL A C   
1104 O O   . VAL A 156 ? 0.3807 0.4721 0.4453 -0.0014 0.0059  0.0233  144 VAL A O   
1105 C CB  . VAL A 156 ? 0.3673 0.4772 0.4423 -0.0177 -0.0032 0.0232  144 VAL A CB  
1106 C CG1 . VAL A 156 ? 0.3372 0.4614 0.4180 -0.0122 -0.0022 0.0267  144 VAL A CG1 
1107 C CG2 . VAL A 156 ? 0.3783 0.4955 0.4576 -0.0288 -0.0094 0.0239  144 VAL A CG2 
1108 N N   . SER A 157 ? 0.3664 0.4719 0.4472 -0.0051 0.0078  0.0316  145 SER A N   
1109 C CA  . SER A 157 ? 0.3477 0.4541 0.4252 0.0013  0.0102  0.0336  145 SER A CA  
1110 C C   . SER A 157 ? 0.3445 0.4638 0.4229 0.0028  0.0095  0.0348  145 SER A C   
1111 O O   . SER A 157 ? 0.3513 0.4754 0.4330 0.0000  0.0088  0.0364  145 SER A O   
1112 C CB  . SER A 157 ? 0.3508 0.4536 0.4299 0.0006  0.0130  0.0379  145 SER A CB  
1113 O OG  . SER A 157 ? 0.3490 0.4370 0.4236 0.0001  0.0138  0.0382  145 SER A OG  
1114 N N   . VAL A 158 ? 0.3424 0.4668 0.4168 0.0076  0.0099  0.0349  146 VAL A N   
1115 C CA  . VAL A 158 ? 0.3414 0.4789 0.4153 0.0065  0.0089  0.0373  146 VAL A CA  
1116 C C   . VAL A 158 ? 0.3336 0.4736 0.4067 0.0043  0.0092  0.0420  146 VAL A C   
1117 O O   . VAL A 158 ? 0.3526 0.4946 0.4253 0.0080  0.0101  0.0445  146 VAL A O   
1118 C CB  . VAL A 158 ? 0.3402 0.4882 0.4113 0.0119  0.0098  0.0364  146 VAL A CB  
1119 C CG1 . VAL A 158 ? 0.3225 0.4872 0.3934 0.0078  0.0085  0.0407  146 VAL A CG1 
1120 C CG2 . VAL A 158 ? 0.3197 0.4617 0.3865 0.0130  0.0095  0.0306  146 VAL A CG2 
1121 N N   . ASP A 159 ? 0.3296 0.4675 0.4000 -0.0012 0.0081  0.0433  147 ASP A N   
1122 C CA  . ASP A 159 ? 0.3615 0.4960 0.4252 -0.0058 0.0079  0.0464  147 ASP A CA  
1123 C C   . ASP A 159 ? 0.3649 0.4893 0.4274 -0.0047 0.0107  0.0467  147 ASP A C   
1124 O O   . ASP A 159 ? 0.3741 0.4887 0.4314 -0.0064 0.0126  0.0462  147 ASP A O   
1125 C CB  . ASP A 159 ? 0.3659 0.5142 0.4266 -0.0089 0.0054  0.0506  147 ASP A CB  
1126 C CG  . ASP A 159 ? 0.4144 0.5576 0.4628 -0.0192 0.0027  0.0532  147 ASP A CG  
1127 O OD1 . ASP A 159 ? 0.4179 0.5443 0.4583 -0.0219 0.0034  0.0511  147 ASP A OD1 
1128 O OD2 . ASP A 159 ? 0.4077 0.5635 0.4530 -0.0248 -0.0003 0.0577  147 ASP A OD2 
1129 N N   . VAL A 160 ? 0.3726 0.4984 0.4383 -0.0009 0.0116  0.0478  148 VAL A N   
1130 C CA  . VAL A 160 ? 0.4072 0.5245 0.4710 -0.0007 0.0143  0.0492  148 VAL A CA  
1131 C C   . VAL A 160 ? 0.3906 0.5043 0.4590 0.0040  0.0151  0.0492  148 VAL A C   
1132 O O   . VAL A 160 ? 0.3978 0.5159 0.4673 0.0088  0.0137  0.0490  148 VAL A O   
1133 C CB  . VAL A 160 ? 0.4423 0.5612 0.4970 -0.0035 0.0130  0.0535  148 VAL A CB  
1134 C CG1 . VAL A 160 ? 0.4883 0.6056 0.5327 -0.0106 0.0112  0.0530  148 VAL A CG1 
1135 C CG2 . VAL A 160 ? 0.4548 0.5868 0.5125 0.0002  0.0100  0.0573  148 VAL A CG2 
1136 N N   . PRO A 161 ? 0.3889 0.4935 0.4587 0.0025  0.0177  0.0493  149 PRO A N   
1137 C CA  . PRO A 161 ? 0.3988 0.4935 0.4683 0.0051  0.0178  0.0495  149 PRO A CA  
1138 C C   . PRO A 161 ? 0.4012 0.4946 0.4650 0.0114  0.0171  0.0541  149 PRO A C   
1139 O O   . PRO A 161 ? 0.3984 0.4950 0.4584 0.0098  0.0172  0.0587  149 PRO A O   
1140 C CB  . PRO A 161 ? 0.3995 0.4873 0.4703 -0.0006 0.0207  0.0511  149 PRO A CB  
1141 C CG  . PRO A 161 ? 0.3903 0.4873 0.4654 -0.0034 0.0226  0.0502  149 PRO A CG  
1142 C CD  . PRO A 161 ? 0.3976 0.4999 0.4677 -0.0012 0.0212  0.0498  149 PRO A CD  
1143 N N   . SER A 162 ? 0.3942 0.4839 0.4564 0.0192  0.0164  0.0532  150 SER A N   
1144 C CA  . SER A 162 ? 0.3931 0.4864 0.4522 0.0289  0.0159  0.0589  150 SER A CA  
1145 C C   . SER A 162 ? 0.4109 0.4914 0.4639 0.0284  0.0164  0.0648  150 SER A C   
1146 O O   . SER A 162 ? 0.4186 0.4790 0.4672 0.0254  0.0180  0.0637  150 SER A O   
1147 C CB  . SER A 162 ? 0.4108 0.4968 0.4668 0.0400  0.0171  0.0559  150 SER A CB  
1148 O OG  . SER A 162 ? 0.3712 0.4735 0.4321 0.0404  0.0168  0.0517  150 SER A OG  
1149 N N   . GLY A 163 ? 0.4060 0.4985 0.4576 0.0295  0.0146  0.0717  151 GLY A N   
1150 C CA  . GLY A 163 ? 0.4279 0.5097 0.4721 0.0281  0.0149  0.0782  151 GLY A CA  
1151 C C   . GLY A 163 ? 0.4236 0.5099 0.4647 0.0167  0.0155  0.0787  151 GLY A C   
1152 O O   . GLY A 163 ? 0.4284 0.5109 0.4616 0.0148  0.0154  0.0848  151 GLY A O   
1153 N N   . ILE A 164 ? 0.4100 0.5027 0.4549 0.0102  0.0166  0.0725  152 ILE A N   
1154 C CA  . ILE A 164 ? 0.4210 0.5163 0.4592 0.0022  0.0178  0.0723  152 ILE A CA  
1155 C C   . ILE A 164 ? 0.4165 0.5255 0.4496 -0.0002 0.0131  0.0741  152 ILE A C   
1156 O O   . ILE A 164 ? 0.4295 0.5493 0.4683 0.0003  0.0104  0.0718  152 ILE A O   
1157 C CB  . ILE A 164 ? 0.4101 0.5029 0.4527 -0.0018 0.0217  0.0655  152 ILE A CB  
1158 C CG1 . ILE A 164 ? 0.4275 0.5115 0.4754 -0.0029 0.0257  0.0653  152 ILE A CG1 
1159 C CG2 . ILE A 164 ? 0.4246 0.5162 0.4569 -0.0069 0.0243  0.0641  152 ILE A CG2 
1160 C CD1 . ILE A 164 ? 0.4894 0.5662 0.5300 -0.0058 0.0290  0.0707  152 ILE A CD1 
1161 N N   . ASP A 165 ? 0.4329 0.5421 0.4539 -0.0048 0.0116  0.0785  153 ASP A N   
1162 C CA  . ASP A 165 ? 0.4338 0.5542 0.4458 -0.0120 0.0061  0.0801  153 ASP A CA  
1163 C C   . ASP A 165 ? 0.4393 0.5499 0.4438 -0.0189 0.0088  0.0724  153 ASP A C   
1164 O O   . ASP A 165 ? 0.4333 0.5293 0.4293 -0.0203 0.0147  0.0689  153 ASP A O   
1165 C CB  . ASP A 165 ? 0.4698 0.5891 0.4668 -0.0165 0.0038  0.0863  153 ASP A CB  
1166 C CG  . ASP A 165 ? 0.4816 0.6128 0.4664 -0.0270 -0.0037 0.0890  153 ASP A CG  
1167 O OD1 . ASP A 165 ? 0.5511 0.6833 0.5328 -0.0342 -0.0056 0.0842  153 ASP A OD1 
1168 O OD2 . ASP A 165 ? 0.5723 0.7109 0.5490 -0.0292 -0.0084 0.0966  153 ASP A OD2 
1169 N N   . SER A 166 ? 0.4370 0.5556 0.4440 -0.0223 0.0050  0.0704  154 SER A N   
1170 C CA  . SER A 166 ? 0.4479 0.5543 0.4485 -0.0265 0.0074  0.0637  154 SER A CA  
1171 C C   . SER A 166 ? 0.4718 0.5626 0.4474 -0.0365 0.0070  0.0616  154 SER A C   
1172 O O   . SER A 166 ? 0.4761 0.5497 0.4418 -0.0376 0.0106  0.0559  154 SER A O   
1173 C CB  . SER A 166 ? 0.4498 0.5687 0.4595 -0.0279 0.0033  0.0634  154 SER A CB  
1174 O OG  . SER A 166 ? 0.4842 0.6159 0.4862 -0.0377 -0.0038 0.0681  154 SER A OG  
1175 N N   . ASN A 167 ? 0.4951 0.5904 0.4586 -0.0430 0.0024  0.0664  155 ASN A N   
1176 C CA  . ASN A 167 ? 0.5341 0.6116 0.4688 -0.0536 0.0015  0.0639  155 ASN A CA  
1177 C C   . ASN A 167 ? 0.5302 0.5922 0.4530 -0.0494 0.0095  0.0620  155 ASN A C   
1178 O O   . ASN A 167 ? 0.5557 0.5965 0.4516 -0.0554 0.0121  0.0574  155 ASN A O   
1179 C CB  . ASN A 167 ? 0.5547 0.6483 0.4801 -0.0653 -0.0089 0.0713  155 ASN A CB  
1180 C CG  . ASN A 167 ? 0.6156 0.7325 0.5536 -0.0708 -0.0169 0.0758  155 ASN A CG  
1181 O OD1 . ASN A 167 ? 0.6920 0.7999 0.6229 -0.0785 -0.0183 0.0717  155 ASN A OD1 
1182 N ND2 . ASN A 167 ? 0.6866 0.8341 0.6437 -0.0655 -0.0216 0.0849  155 ASN A ND2 
1183 N N   . THR A 168 ? 0.4885 0.5595 0.4282 -0.0402 0.0134  0.0659  156 THR A N   
1184 C CA  . THR A 168 ? 0.5009 0.5619 0.4302 -0.0379 0.0207  0.0663  156 THR A CA  
1185 C C   . THR A 168 ? 0.4833 0.5439 0.4308 -0.0279 0.0302  0.0649  156 THR A C   
1186 O O   . THR A 168 ? 0.4671 0.5197 0.4064 -0.0261 0.0388  0.0638  156 THR A O   
1187 C CB  . THR A 168 ? 0.5084 0.5806 0.4357 -0.0399 0.0153  0.0757  156 THR A CB  
1188 O OG1 . THR A 168 ? 0.5006 0.5859 0.4526 -0.0313 0.0138  0.0810  156 THR A OG1 
1189 C CG2 . THR A 168 ? 0.5459 0.6269 0.4591 -0.0509 0.0039  0.0796  156 THR A CG2 
1190 N N   . GLY A 169 ? 0.4474 0.5183 0.4182 -0.0227 0.0284  0.0656  157 GLY A N   
1191 C CA  . GLY A 169 ? 0.4477 0.5205 0.4353 -0.0168 0.0347  0.0657  157 GLY A CA  
1192 C C   . GLY A 169 ? 0.4447 0.5193 0.4366 -0.0162 0.0351  0.0729  157 GLY A C   
1193 O O   . GLY A 169 ? 0.4197 0.4942 0.4224 -0.0148 0.0400  0.0738  157 GLY A O   
1194 N N   . LYS A 170 ? 0.4479 0.5241 0.4307 -0.0180 0.0293  0.0788  158 LYS A N   
1195 C CA  . LYS A 170 ? 0.4682 0.5428 0.4528 -0.0161 0.0283  0.0870  158 LYS A CA  
1196 C C   . LYS A 170 ? 0.4565 0.5326 0.4571 -0.0095 0.0246  0.0884  158 LYS A C   
1197 O O   . LYS A 170 ? 0.4181 0.5023 0.4273 -0.0063 0.0207  0.0848  158 LYS A O   
1198 C CB  . LYS A 170 ? 0.4990 0.5765 0.4674 -0.0189 0.0225  0.0941  158 LYS A CB  
1199 C CG  . LYS A 170 ? 0.5686 0.6386 0.5164 -0.0257 0.0281  0.0923  158 LYS A CG  
1200 C CD  . LYS A 170 ? 0.6804 0.7514 0.6080 -0.0308 0.0229  0.0992  158 LYS A CD  
1201 C CE  . LYS A 170 ? 0.7590 0.8191 0.6680 -0.0350 0.0324  0.0990  158 LYS A CE  
1202 N NZ  . LYS A 170 ? 0.8395 0.8963 0.7196 -0.0430 0.0290  0.1006  158 LYS A NZ  
1203 N N   . VAL A 171 ? 0.4684 0.5345 0.4707 -0.0081 0.0266  0.0933  159 VAL A N   
1204 C CA  . VAL A 171 ? 0.4830 0.5424 0.4941 -0.0012 0.0237  0.0944  159 VAL A CA  
1205 C C   . VAL A 171 ? 0.5041 0.5646 0.5092 0.0065  0.0179  0.1033  159 VAL A C   
1206 O O   . VAL A 171 ? 0.5112 0.5662 0.5053 0.0050  0.0176  0.1112  159 VAL A O   
1207 C CB  . VAL A 171 ? 0.5053 0.5479 0.5173 -0.0053 0.0280  0.0959  159 VAL A CB  
1208 C CG1 . VAL A 171 ? 0.5335 0.5589 0.5447 0.0021  0.0246  0.0985  159 VAL A CG1 
1209 C CG2 . VAL A 171 ? 0.4766 0.5249 0.4996 -0.0117 0.0326  0.0883  159 VAL A CG2 
1210 N N   . LEU A 172 ? 0.5059 0.5768 0.5183 0.0153  0.0136  0.1028  160 LEU A N   
1211 C CA  . LEU A 172 ? 0.5262 0.6032 0.5363 0.0259  0.0085  0.1125  160 LEU A CA  
1212 C C   . LEU A 172 ? 0.5390 0.5930 0.5475 0.0371  0.0101  0.1155  160 LEU A C   
1213 O O   . LEU A 172 ? 0.5259 0.5793 0.5409 0.0476  0.0102  0.1121  160 LEU A O   
1214 C CB  . LEU A 172 ? 0.5152 0.6199 0.5341 0.0299  0.0036  0.1123  160 LEU A CB  
1215 C CG  . LEU A 172 ? 0.5173 0.6362 0.5318 0.0160  0.0015  0.1089  160 LEU A CG  
1216 C CD1 . LEU A 172 ? 0.4953 0.6428 0.5161 0.0164  -0.0048 0.1117  160 LEU A CD1 
1217 C CD2 . LEU A 172 ? 0.5421 0.6549 0.5402 0.0075  0.0010  0.1139  160 LEU A CD2 
1218 N N   . ARG A 173 ? 0.5513 0.5841 0.5483 0.0334  0.0118  0.1214  161 ARG A N   
1219 C CA  . ARG A 173 ? 0.5906 0.5917 0.5793 0.0392  0.0135  0.1246  161 ARG A CA  
1220 C C   . ARG A 173 ? 0.5883 0.5703 0.5789 0.0319  0.0174  0.1150  161 ARG A C   
1221 O O   . ARG A 173 ? 0.6062 0.5667 0.5887 0.0219  0.0199  0.1168  161 ARG A O   
1222 C CB  . ARG A 173 ? 0.6143 0.6114 0.6014 0.0596  0.0107  0.1306  161 ARG A CB  
1223 C CG  . ARG A 173 ? 0.6899 0.6476 0.6601 0.0661  0.0116  0.1381  161 ARG A CG  
1224 C CD  . ARG A 173 ? 0.7462 0.7016 0.7126 0.0897  0.0091  0.1475  161 ARG A CD  
1225 N NE  . ARG A 173 ? 0.8383 0.7461 0.7858 0.0974  0.0113  0.1507  161 ARG A NE  
1226 C CZ  . ARG A 173 ? 0.8755 0.7543 0.8159 0.1059  0.0146  0.1426  161 ARG A CZ  
1227 N NH1 . ARG A 173 ? 0.8536 0.7491 0.8061 0.1093  0.0166  0.1311  161 ARG A NH1 
1228 N NH2 . ARG A 173 ? 0.9397 0.7688 0.8574 0.1106  0.0159  0.1463  161 ARG A NH2 
1229 N N   . THR A 174 ? 0.5723 0.5632 0.5730 0.0353  0.0176  0.1056  162 THR A N   
1230 C CA  . THR A 174 ? 0.5708 0.5478 0.5733 0.0261  0.0201  0.0967  162 THR A CA  
1231 C C   . THR A 174 ? 0.5278 0.5290 0.5443 0.0250  0.0200  0.0875  162 THR A C   
1232 O O   . THR A 174 ? 0.5182 0.5405 0.5407 0.0334  0.0180  0.0879  162 THR A O   
1233 C CB  . THR A 174 ? 0.6120 0.5535 0.6017 0.0330  0.0201  0.0957  162 THR A CB  
1234 O OG1 . THR A 174 ? 0.6249 0.5529 0.6139 0.0191  0.0211  0.0882  162 THR A OG1 
1235 C CG2 . THR A 174 ? 0.6061 0.5512 0.5971 0.0520  0.0196  0.0923  162 THR A CG2 
1236 N N   . ALA A 175 ? 0.5034 0.5035 0.5252 0.0137  0.0216  0.0806  163 ALA A N   
1237 C CA  . ALA A 175 ? 0.4690 0.4899 0.5027 0.0119  0.0213  0.0729  163 ALA A CA  
1238 C C   . ALA A 175 ? 0.4580 0.4706 0.4943 0.0036  0.0215  0.0663  163 ALA A C   
1239 O O   . ALA A 175 ? 0.4652 0.4619 0.4967 -0.0054 0.0221  0.0678  163 ALA A O   
1240 C CB  . ALA A 175 ? 0.4429 0.4854 0.4827 0.0057  0.0227  0.0738  163 ALA A CB  
1241 N N   . VAL A 176 ? 0.4471 0.4718 0.4904 0.0060  0.0203  0.0596  164 VAL A N   
1242 C CA  . VAL A 176 ? 0.4417 0.4629 0.4875 -0.0013 0.0191  0.0532  164 VAL A CA  
1243 C C   . VAL A 176 ? 0.4359 0.4723 0.4923 -0.0130 0.0204  0.0546  164 VAL A C   
1244 O O   . VAL A 176 ? 0.4145 0.4687 0.4777 -0.0116 0.0225  0.0563  164 VAL A O   
1245 C CB  . VAL A 176 ? 0.4301 0.4635 0.4798 0.0052  0.0176  0.0472  164 VAL A CB  
1246 C CG1 . VAL A 176 ? 0.3968 0.4337 0.4510 -0.0040 0.0153  0.0413  164 VAL A CG1 
1247 C CG2 . VAL A 176 ? 0.4386 0.4577 0.4774 0.0185  0.0178  0.0458  164 VAL A CG2 
1248 N N   . LYS A 177 ? 0.4366 0.4661 0.4933 -0.0244 0.0193  0.0541  165 LYS A N   
1249 C CA  . LYS A 177 ? 0.4498 0.5003 0.5199 -0.0335 0.0206  0.0557  165 LYS A CA  
1250 C C   . LYS A 177 ? 0.4365 0.4986 0.5138 -0.0350 0.0168  0.0500  165 LYS A C   
1251 O O   . LYS A 177 ? 0.4618 0.5120 0.5333 -0.0420 0.0126  0.0467  165 LYS A O   
1252 C CB  . LYS A 177 ? 0.4738 0.5180 0.5426 -0.0478 0.0213  0.0611  165 LYS A CB  
1253 C CG  . LYS A 177 ? 0.5337 0.6080 0.6197 -0.0547 0.0246  0.0651  165 LYS A CG  
1254 C CD  . LYS A 177 ? 0.6082 0.6838 0.6954 -0.0702 0.0263  0.0726  165 LYS A CD  
1255 C CE  . LYS A 177 ? 0.6283 0.7392 0.7334 -0.0716 0.0326  0.0781  165 LYS A CE  
1256 N NZ  . LYS A 177 ? 0.6169 0.7531 0.7382 -0.0714 0.0300  0.0760  165 LYS A NZ  
1257 N N   . ALA A 178 ? 0.4111 0.4938 0.4985 -0.0294 0.0181  0.0493  166 ALA A N   
1258 C CA  . ALA A 178 ? 0.4041 0.4983 0.4974 -0.0290 0.0142  0.0450  166 ALA A CA  
1259 C C   . ALA A 178 ? 0.3907 0.5067 0.4984 -0.0361 0.0137  0.0484  166 ALA A C   
1260 O O   . ALA A 178 ? 0.3908 0.5200 0.5069 -0.0356 0.0187  0.0535  166 ALA A O   
1261 C CB  . ALA A 178 ? 0.3755 0.4770 0.4691 -0.0186 0.0151  0.0432  166 ALA A CB  
1262 N N   . ASP A 179 ? 0.3936 0.5153 0.5038 -0.0413 0.0079  0.0458  167 ASP A N   
1263 C CA  . ASP A 179 ? 0.3938 0.5429 0.5202 -0.0451 0.0063  0.0502  167 ASP A CA  
1264 C C   . ASP A 179 ? 0.3727 0.5337 0.5044 -0.0326 0.0080  0.0503  167 ASP A C   
1265 O O   . ASP A 179 ? 0.3740 0.5554 0.5185 -0.0286 0.0109  0.0555  167 ASP A O   
1266 C CB  . ASP A 179 ? 0.4002 0.5517 0.5255 -0.0573 -0.0020 0.0483  167 ASP A CB  
1267 C CG  . ASP A 179 ? 0.4703 0.6040 0.5858 -0.0725 -0.0046 0.0481  167 ASP A CG  
1268 O OD1 . ASP A 179 ? 0.5557 0.7038 0.6815 -0.0820 -0.0032 0.0551  167 ASP A OD1 
1269 O OD2 . ASP A 179 ? 0.5644 0.6685 0.6605 -0.0749 -0.0074 0.0415  167 ASP A OD2 
1270 N N   . LEU A 180 ? 0.3670 0.5145 0.4878 -0.0261 0.0068  0.0451  168 LEU A N   
1271 C CA  . LEU A 180 ? 0.3569 0.5101 0.4782 -0.0169 0.0072  0.0451  168 LEU A CA  
1272 C C   . LEU A 180 ? 0.3460 0.4839 0.4552 -0.0113 0.0094  0.0419  168 LEU A C   
1273 O O   . LEU A 180 ? 0.3634 0.4903 0.4644 -0.0126 0.0079  0.0383  168 LEU A O   
1274 C CB  . LEU A 180 ? 0.3615 0.5215 0.4830 -0.0194 0.0003  0.0435  168 LEU A CB  
1275 C CG  . LEU A 180 ? 0.3899 0.5510 0.5079 -0.0117 -0.0002 0.0437  168 LEU A CG  
1276 C CD1 . LEU A 180 ? 0.4219 0.5936 0.5488 -0.0041 0.0033  0.0497  168 LEU A CD1 
1277 C CD2 . LEU A 180 ? 0.4147 0.5799 0.5288 -0.0155 -0.0073 0.0417  168 LEU A CD2 
1278 N N   . THR A 181 ? 0.3397 0.4767 0.4465 -0.0052 0.0132  0.0436  169 THR A N   
1279 C CA  . THR A 181 ? 0.3330 0.4607 0.4291 -0.0024 0.0137  0.0420  169 THR A CA  
1280 C C   . THR A 181 ? 0.3438 0.4728 0.4363 0.0002  0.0121  0.0425  169 THR A C   
1281 O O   . THR A 181 ? 0.3406 0.4710 0.4353 0.0038  0.0140  0.0449  169 THR A O   
1282 C CB  . THR A 181 ? 0.3433 0.4643 0.4341 -0.0013 0.0184  0.0437  169 THR A CB  
1283 O OG1 . THR A 181 ? 0.3271 0.4450 0.4197 -0.0042 0.0194  0.0443  169 THR A OG1 
1284 C CG2 . THR A 181 ? 0.3237 0.4392 0.4035 -0.0007 0.0173  0.0433  169 THR A CG2 
1285 N N   . VAL A 182 ? 0.3474 0.4756 0.4336 -0.0008 0.0090  0.0409  170 VAL A N   
1286 C CA  . VAL A 182 ? 0.3439 0.4708 0.4237 -0.0006 0.0071  0.0424  170 VAL A CA  
1287 C C   . VAL A 182 ? 0.3510 0.4724 0.4205 -0.0031 0.0077  0.0431  170 VAL A C   
1288 O O   . VAL A 182 ? 0.3449 0.4727 0.4137 -0.0047 0.0067  0.0426  170 VAL A O   
1289 C CB  . VAL A 182 ? 0.3549 0.4890 0.4345 -0.0023 0.0028  0.0414  170 VAL A CB  
1290 C CG1 . VAL A 182 ? 0.3296 0.4602 0.4015 -0.0029 0.0008  0.0447  170 VAL A CG1 
1291 C CG2 . VAL A 182 ? 0.3427 0.4836 0.4308 -0.0027 0.0004  0.0405  170 VAL A CG2 
1292 N N   . THR A 183 ? 0.3417 0.4516 0.4022 -0.0034 0.0094  0.0446  171 THR A N   
1293 C CA  . THR A 183 ? 0.3686 0.4723 0.4163 -0.0092 0.0086  0.0456  171 THR A CA  
1294 C C   . THR A 183 ? 0.3887 0.4835 0.4236 -0.0145 0.0055  0.0477  171 THR A C   
1295 O O   . THR A 183 ? 0.3950 0.4846 0.4296 -0.0112 0.0050  0.0485  171 THR A O   
1296 C CB  . THR A 183 ? 0.3782 0.4701 0.4180 -0.0087 0.0125  0.0451  171 THR A CB  
1297 O OG1 . THR A 183 ? 0.3908 0.4818 0.4196 -0.0165 0.0099  0.0465  171 THR A OG1 
1298 C CG2 . THR A 183 ? 0.3666 0.4404 0.3961 -0.0046 0.0160  0.0446  171 THR A CG2 
1299 N N   . PHE A 184 ? 0.3954 0.4898 0.4197 -0.0237 0.0028  0.0496  172 PHE A N   
1300 C CA  . PHE A 184 ? 0.4244 0.5140 0.4371 -0.0323 -0.0011 0.0527  172 PHE A CA  
1301 C C   . PHE A 184 ? 0.4577 0.5218 0.4472 -0.0406 -0.0021 0.0533  172 PHE A C   
1302 O O   . PHE A 184 ? 0.4773 0.5398 0.4600 -0.0459 -0.0024 0.0527  172 PHE A O   
1303 C CB  . PHE A 184 ? 0.4084 0.5241 0.4286 -0.0382 -0.0040 0.0556  172 PHE A CB  
1304 C CG  . PHE A 184 ? 0.3852 0.5190 0.4227 -0.0287 -0.0020 0.0533  172 PHE A CG  
1305 C CD1 . PHE A 184 ? 0.3526 0.4835 0.3945 -0.0230 -0.0016 0.0515  172 PHE A CD1 
1306 C CD2 . PHE A 184 ? 0.3625 0.5138 0.4093 -0.0253 -0.0008 0.0532  172 PHE A CD2 
1307 C CE1 . PHE A 184 ? 0.3310 0.4739 0.3841 -0.0164 -0.0004 0.0483  172 PHE A CE1 
1308 C CE2 . PHE A 184 ? 0.3399 0.4997 0.3969 -0.0166 0.0013  0.0500  172 PHE A CE2 
1309 C CZ  . PHE A 184 ? 0.3516 0.5058 0.4105 -0.0133 0.0013  0.0470  172 PHE A CZ  
1310 N N   . GLY A 185 ? 0.4813 0.5225 0.4562 -0.0412 -0.0027 0.0542  173 GLY A N   
1311 C CA  . GLY A 185 ? 0.5156 0.5234 0.4620 -0.0493 -0.0036 0.0540  173 GLY A CA  
1312 C C   . GLY A 185 ? 0.5374 0.5214 0.4741 -0.0384 0.0027  0.0493  173 GLY A C   
1313 O O   . GLY A 185 ? 0.5571 0.5128 0.4789 -0.0310 0.0056  0.0487  173 GLY A O   
1314 N N   . VAL A 186 ? 0.5252 0.5199 0.4684 -0.0370 0.0053  0.0467  174 VAL A N   
1315 C CA  . VAL A 186 ? 0.5569 0.5314 0.4884 -0.0287 0.0121  0.0424  174 VAL A CA  
1316 C C   . VAL A 186 ? 0.5282 0.5287 0.4826 -0.0215 0.0158  0.0417  174 VAL A C   
1317 O O   . VAL A 186 ? 0.4972 0.5234 0.4677 -0.0263 0.0119  0.0438  174 VAL A O   
1318 C CB  . VAL A 186 ? 0.5928 0.5398 0.4916 -0.0417 0.0103  0.0400  174 VAL A CB  
1319 C CG1 . VAL A 186 ? 0.6534 0.5645 0.5233 -0.0488 0.0075  0.0402  174 VAL A CG1 
1320 C CG2 . VAL A 186 ? 0.5700 0.5412 0.4739 -0.0569 0.0032  0.0429  174 VAL A CG2 
1321 N N   . PRO A 187 ? 0.5427 0.5366 0.4983 -0.0091 0.0239  0.0393  175 PRO A N   
1322 C CA  . PRO A 187 ? 0.5261 0.5396 0.4976 -0.0055 0.0275  0.0393  175 PRO A CA  
1323 C C   . PRO A 187 ? 0.5337 0.5455 0.4920 -0.0167 0.0245  0.0390  175 PRO A C   
1324 O O   . PRO A 187 ? 0.5675 0.5573 0.4999 -0.0252 0.0224  0.0373  175 PRO A O   
1325 C CB  . PRO A 187 ? 0.5449 0.5482 0.5131 0.0076  0.0374  0.0375  175 PRO A CB  
1326 C CG  . PRO A 187 ? 0.5753 0.5488 0.5216 0.0125  0.0394  0.0359  175 PRO A CG  
1327 C CD  . PRO A 187 ? 0.5691 0.5384 0.5115 0.0029  0.0306  0.0377  175 PRO A CD  
1328 N N   . LYS A 188 ? 0.5086 0.5423 0.4831 -0.0175 0.0234  0.0412  176 LYS A N   
1329 C CA  . LYS A 188 ? 0.5154 0.5517 0.4798 -0.0264 0.0200  0.0428  176 LYS A CA  
1330 C C   . LYS A 188 ? 0.5066 0.5366 0.4654 -0.0210 0.0274  0.0416  176 LYS A C   
1331 O O   . LYS A 188 ? 0.4913 0.5259 0.4634 -0.0109 0.0344  0.0412  176 LYS A O   
1332 C CB  . LYS A 188 ? 0.4959 0.5592 0.4799 -0.0285 0.0144  0.0474  176 LYS A CB  
1333 C CG  . LYS A 188 ? 0.5252 0.6019 0.5213 -0.0299 0.0096  0.0488  176 LYS A CG  
1334 C CD  . LYS A 188 ? 0.5624 0.6385 0.5455 -0.0420 0.0032  0.0509  176 LYS A CD  
1335 C CE  . LYS A 188 ? 0.5271 0.6197 0.5233 -0.0427 0.0000  0.0530  176 LYS A CE  
1336 N NZ  . LYS A 188 ? 0.5088 0.5863 0.5026 -0.0393 0.0019  0.0503  176 LYS A NZ  
1337 N N   . ILE A 189 ? 0.5094 0.5315 0.4485 -0.0289 0.0257  0.0419  177 ILE A N   
1338 C CA  . ILE A 189 ? 0.5132 0.5279 0.4423 -0.0250 0.0331  0.0409  177 ILE A CA  
1339 C C   . ILE A 189 ? 0.4881 0.5237 0.4419 -0.0183 0.0365  0.0450  177 ILE A C   
1340 O O   . ILE A 189 ? 0.4658 0.4994 0.4204 -0.0115 0.0455  0.0444  177 ILE A O   
1341 C CB  . ILE A 189 ? 0.5584 0.5642 0.4614 -0.0369 0.0285  0.0416  177 ILE A CB  
1342 C CG1 . ILE A 189 ? 0.6043 0.5795 0.4747 -0.0447 0.0272  0.0360  177 ILE A CG1 
1343 C CG2 . ILE A 189 ? 0.5288 0.5319 0.4235 -0.0331 0.0361  0.0421  177 ILE A CG2 
1344 C CD1 . ILE A 189 ? 0.6729 0.6366 0.5133 -0.0587 0.0220  0.0358  177 ILE A CD1 
1345 N N   . GLY A 190 ? 0.4444 0.4987 0.4170 -0.0199 0.0299  0.0492  178 GLY A N   
1346 C CA  . GLY A 190 ? 0.4373 0.5050 0.4294 -0.0150 0.0319  0.0529  178 GLY A CA  
1347 C C   . GLY A 190 ? 0.4170 0.4902 0.4278 -0.0083 0.0366  0.0514  178 GLY A C   
1348 O O   . GLY A 190 ? 0.4134 0.4938 0.4363 -0.0068 0.0385  0.0543  178 GLY A O   
1349 N N   . HIS A 191 ? 0.4001 0.4694 0.4120 -0.0052 0.0376  0.0478  179 HIS A N   
1350 C CA  . HIS A 191 ? 0.3945 0.4713 0.4224 0.0012  0.0421  0.0475  179 HIS A CA  
1351 C C   . HIS A 191 ? 0.4114 0.4837 0.4325 0.0071  0.0521  0.0471  179 HIS A C   
1352 O O   . HIS A 191 ? 0.4008 0.4854 0.4369 0.0124  0.0569  0.0488  179 HIS A O   
1353 C CB  . HIS A 191 ? 0.3942 0.4685 0.4238 0.0039  0.0393  0.0451  179 HIS A CB  
1354 C CG  . HIS A 191 ? 0.3772 0.4574 0.4121 -0.0008 0.0309  0.0452  179 HIS A CG  
1355 N ND1 . HIS A 191 ? 0.3729 0.4453 0.3970 -0.0044 0.0265  0.0440  179 HIS A ND1 
1356 C CD2 . HIS A 191 ? 0.3727 0.4652 0.4212 -0.0021 0.0269  0.0464  179 HIS A CD2 
1357 C CE1 . HIS A 191 ? 0.3900 0.4744 0.4232 -0.0073 0.0207  0.0451  179 HIS A CE1 
1358 N NE2 . HIS A 191 ? 0.3592 0.4545 0.4064 -0.0047 0.0212  0.0459  179 HIS A NE2 
1359 N N   . ILE A 192 ? 0.4235 0.4790 0.4208 0.0062  0.0552  0.0449  180 ILE A N   
1360 C CA  . ILE A 192 ? 0.4536 0.4996 0.4382 0.0144  0.0662  0.0430  180 ILE A CA  
1361 C C   . ILE A 192 ? 0.4605 0.5111 0.4400 0.0128  0.0728  0.0457  180 ILE A C   
1362 O O   . ILE A 192 ? 0.4583 0.5162 0.4412 0.0207  0.0835  0.0469  180 ILE A O   
1363 C CB  . ILE A 192 ? 0.4855 0.5023 0.4396 0.0141  0.0658  0.0374  180 ILE A CB  
1364 C CG1 . ILE A 192 ? 0.5032 0.5145 0.4617 0.0163  0.0607  0.0361  180 ILE A CG1 
1365 C CG2 . ILE A 192 ? 0.5380 0.5383 0.4711 0.0234  0.0780  0.0341  180 ILE A CG2 
1366 C CD1 . ILE A 192 ? 0.6013 0.5793 0.5262 0.0100  0.0569  0.0313  180 ILE A CD1 
1367 N N   . LEU A 193 ? 0.4479 0.4965 0.4196 0.0032  0.0666  0.0476  181 LEU A N   
1368 C CA  . LEU A 193 ? 0.4588 0.5102 0.4235 0.0001  0.0713  0.0514  181 LEU A CA  
1369 C C   . LEU A 193 ? 0.4482 0.5176 0.4364 -0.0030 0.0687  0.0579  181 LEU A C   
1370 O O   . LEU A 193 ? 0.4211 0.4961 0.4242 -0.0049 0.0607  0.0587  181 LEU A O   
1371 C CB  . LEU A 193 ? 0.4691 0.5066 0.4082 -0.0083 0.0655  0.0511  181 LEU A CB  
1372 C CG  . LEU A 193 ? 0.4778 0.4910 0.3867 -0.0092 0.0662  0.0440  181 LEU A CG  
1373 C CD1 . LEU A 193 ? 0.4809 0.4840 0.3648 -0.0211 0.0584  0.0446  181 LEU A CD1 
1374 C CD2 . LEU A 193 ? 0.4681 0.4697 0.3623 0.0006  0.0804  0.0398  181 LEU A CD2 
1375 N N   . PHE A 194 ? 0.4529 0.5292 0.4418 -0.0039 0.0762  0.0626  182 PHE A N   
1376 C CA  . PHE A 194 ? 0.4409 0.5295 0.4481 -0.0091 0.0743  0.0694  182 PHE A CA  
1377 C C   . PHE A 194 ? 0.4465 0.5257 0.4417 -0.0151 0.0676  0.0736  182 PHE A C   
1378 O O   . PHE A 194 ? 0.4384 0.5090 0.4126 -0.0162 0.0685  0.0732  182 PHE A O   
1379 C CB  . PHE A 194 ? 0.4451 0.5468 0.4571 -0.0092 0.0856  0.0741  182 PHE A CB  
1380 C CG  . PHE A 194 ? 0.4370 0.5558 0.4667 -0.0024 0.0920  0.0730  182 PHE A CG  
1381 C CD1 . PHE A 194 ? 0.4517 0.5699 0.4722 0.0083  0.1015  0.0690  182 PHE A CD1 
1382 C CD2 . PHE A 194 ? 0.3935 0.5278 0.4477 -0.0064 0.0876  0.0759  182 PHE A CD2 
1383 C CE1 . PHE A 194 ? 0.4582 0.5951 0.4969 0.0172  0.1072  0.0695  182 PHE A CE1 
1384 C CE2 . PHE A 194 ? 0.4290 0.5837 0.5009 -0.0006 0.0922  0.0766  182 PHE A CE2 
1385 C CZ  . PHE A 194 ? 0.4328 0.5910 0.4988 0.0123  0.1022  0.0741  182 PHE A CZ  
1386 N N   . PRO A 195 ? 0.4387 0.5187 0.4451 -0.0185 0.0613  0.0781  183 PRO A N   
1387 C CA  . PRO A 195 ? 0.4356 0.5231 0.4626 -0.0199 0.0605  0.0787  183 PRO A CA  
1388 C C   . PRO A 195 ? 0.4174 0.5073 0.4560 -0.0161 0.0547  0.0727  183 PRO A C   
1389 O O   . PRO A 195 ? 0.4234 0.5201 0.4769 -0.0179 0.0539  0.0724  183 PRO A O   
1390 C CB  . PRO A 195 ? 0.4445 0.5223 0.4698 -0.0248 0.0556  0.0852  183 PRO A CB  
1391 C CG  . PRO A 195 ? 0.4611 0.5305 0.4711 -0.0223 0.0508  0.0869  183 PRO A CG  
1392 C CD  . PRO A 195 ? 0.4427 0.5144 0.4388 -0.0217 0.0557  0.0844  183 PRO A CD  
1393 N N   . GLY A 196 ? 0.4016 0.4867 0.4320 -0.0125 0.0504  0.0685  184 GLY A N   
1394 C CA  . GLY A 196 ? 0.4004 0.4879 0.4399 -0.0098 0.0447  0.0639  184 GLY A CA  
1395 C C   . GLY A 196 ? 0.3892 0.4853 0.4406 -0.0071 0.0483  0.0607  184 GLY A C   
1396 O O   . GLY A 196 ? 0.3499 0.4508 0.4133 -0.0071 0.0442  0.0591  184 GLY A O   
1397 N N   . ARG A 197 ? 0.3998 0.4982 0.4467 -0.0039 0.0562  0.0603  185 ARG A N   
1398 C CA  . ARG A 197 ? 0.4052 0.5144 0.4639 0.0015  0.0603  0.0590  185 ARG A CA  
1399 C C   . ARG A 197 ? 0.4148 0.5404 0.4938 -0.0030 0.0596  0.0630  185 ARG A C   
1400 O O   . ARG A 197 ? 0.4084 0.5446 0.5008 -0.0015 0.0570  0.0623  185 ARG A O   
1401 C CB  . ARG A 197 ? 0.4191 0.5278 0.4679 0.0084  0.0711  0.0587  185 ARG A CB  
1402 C CG  . ARG A 197 ? 0.3991 0.5224 0.4616 0.0174  0.0766  0.0593  185 ARG A CG  
1403 C CD  . ARG A 197 ? 0.4458 0.5637 0.4941 0.0284  0.0884  0.0579  185 ARG A CD  
1404 N NE  . ARG A 197 ? 0.4526 0.5927 0.5191 0.0387  0.0951  0.0614  185 ARG A NE  
1405 C CZ  . ARG A 197 ? 0.4502 0.5984 0.5137 0.0504  0.1082  0.0632  185 ARG A CZ  
1406 N NH1 . ARG A 197 ? 0.4575 0.5899 0.4973 0.0524  0.1164  0.0606  185 ARG A NH1 
1407 N NH2 . ARG A 197 ? 0.4574 0.6317 0.5416 0.0606  0.1131  0.0682  185 ARG A NH2 
1408 N N   . ASP A 198 ? 0.4383 0.5652 0.5175 -0.0101 0.0614  0.0678  186 ASP A N   
1409 C CA  . ASP A 198 ? 0.4660 0.6046 0.5607 -0.0185 0.0595  0.0720  186 ASP A CA  
1410 C C   . ASP A 198 ? 0.4601 0.5901 0.5583 -0.0228 0.0495  0.0690  186 ASP A C   
1411 O O   . ASP A 198 ? 0.4797 0.6205 0.5904 -0.0277 0.0463  0.0694  186 ASP A O   
1412 C CB  . ASP A 198 ? 0.4920 0.6294 0.5823 -0.0270 0.0635  0.0787  186 ASP A CB  
1413 C CG  . ASP A 198 ? 0.5705 0.7269 0.6768 -0.0369 0.0650  0.0847  186 ASP A CG  
1414 O OD1 . ASP A 198 ? 0.5930 0.7744 0.7121 -0.0334 0.0716  0.0872  186 ASP A OD1 
1415 O OD2 . ASP A 198 ? 0.6784 0.8247 0.7837 -0.0484 0.0594  0.0873  186 ASP A OD2 
1416 N N   . LEU A 199 ? 0.4394 0.5515 0.5256 -0.0208 0.0447  0.0664  187 LEU A N   
1417 C CA  . LEU A 199 ? 0.4334 0.5350 0.5194 -0.0224 0.0370  0.0634  187 LEU A CA  
1418 C C   . LEU A 199 ? 0.4209 0.5285 0.5125 -0.0177 0.0329  0.0578  187 LEU A C   
1419 O O   . LEU A 199 ? 0.3991 0.5010 0.4911 -0.0193 0.0275  0.0547  187 LEU A O   
1420 C CB  . LEU A 199 ? 0.4450 0.5296 0.5176 -0.0193 0.0346  0.0644  187 LEU A CB  
1421 C CG  . LEU A 199 ? 0.4915 0.5648 0.5557 -0.0239 0.0367  0.0709  187 LEU A CG  
1422 C CD1 . LEU A 199 ? 0.5569 0.6149 0.6101 -0.0181 0.0327  0.0724  187 LEU A CD1 
1423 C CD2 . LEU A 199 ? 0.5646 0.6331 0.6326 -0.0345 0.0364  0.0737  187 LEU A CD2 
1424 N N   . THR A 200 ? 0.4130 0.5289 0.5056 -0.0119 0.0358  0.0566  188 THR A N   
1425 C CA  . THR A 200 ? 0.4078 0.5275 0.5028 -0.0074 0.0326  0.0528  188 THR A CA  
1426 C C   . THR A 200 ? 0.4094 0.5429 0.5181 -0.0096 0.0306  0.0532  188 THR A C   
1427 O O   . THR A 200 ? 0.3873 0.5221 0.4976 -0.0089 0.0253  0.0503  188 THR A O   
1428 C CB  . THR A 200 ? 0.4121 0.5289 0.4982 -0.0010 0.0367  0.0519  188 THR A CB  
1429 O OG1 . THR A 200 ? 0.4379 0.5433 0.5099 -0.0018 0.0354  0.0514  188 THR A OG1 
1430 C CG2 . THR A 200 ? 0.4142 0.5324 0.5012 0.0028  0.0339  0.0495  188 THR A CG2 
1431 N N   . GLY A 201 ? 0.4088 0.5553 0.5273 -0.0133 0.0345  0.0578  189 GLY A N   
1432 C CA  . GLY A 201 ? 0.4037 0.5699 0.5372 -0.0162 0.0323  0.0602  189 GLY A CA  
1433 C C   . GLY A 201 ? 0.4002 0.5743 0.5367 -0.0050 0.0338  0.0600  189 GLY A C   
1434 O O   . GLY A 201 ? 0.4081 0.5763 0.5372 0.0035  0.0402  0.0598  189 GLY A O   
1435 N N   . LYS A 202 ? 0.3940 0.5791 0.5388 -0.0054 0.0278  0.0602  190 LYS A N   
1436 C CA  . LYS A 202 ? 0.4028 0.5934 0.5495 0.0058  0.0288  0.0614  190 LYS A CA  
1437 C C   . LYS A 202 ? 0.3934 0.5610 0.5230 0.0094  0.0267  0.0561  190 LYS A C   
1438 O O   . LYS A 202 ? 0.3885 0.5482 0.5129 0.0033  0.0208  0.0523  190 LYS A O   
1439 C CB  . LYS A 202 ? 0.4079 0.6195 0.5684 0.0032  0.0219  0.0649  190 LYS A CB  
1440 C CG  . LYS A 202 ? 0.4709 0.6858 0.6318 0.0155  0.0212  0.0673  190 LYS A CG  
1441 C CD  . LYS A 202 ? 0.5426 0.7788 0.7157 0.0112  0.0123  0.0712  190 LYS A CD  
1442 C CE  . LYS A 202 ? 0.5949 0.8658 0.7898 0.0089  0.0134  0.0796  190 LYS A CE  
1443 N NZ  . LYS A 202 ? 0.6474 0.9452 0.8557 0.0062  0.0042  0.0859  190 LYS A NZ  
1444 N N   . LEU A 203 ? 0.3764 0.5328 0.4959 0.0188  0.0319  0.0558  191 LEU A N   
1445 C CA  . LEU A 203 ? 0.3958 0.5312 0.4980 0.0187  0.0295  0.0518  191 LEU A CA  
1446 C C   . LEU A 203 ? 0.3908 0.5231 0.4900 0.0242  0.0264  0.0530  191 LEU A C   
1447 O O   . LEU A 203 ? 0.3724 0.5042 0.4715 0.0343  0.0308  0.0560  191 LEU A O   
1448 C CB  . LEU A 203 ? 0.4091 0.5271 0.4950 0.0215  0.0359  0.0501  191 LEU A CB  
1449 C CG  . LEU A 203 ? 0.4250 0.5226 0.4913 0.0176  0.0324  0.0468  191 LEU A CG  
1450 C CD1 . LEU A 203 ? 0.3531 0.4539 0.4202 0.0088  0.0271  0.0455  191 LEU A CD1 
1451 C CD2 . LEU A 203 ? 0.4376 0.5159 0.4843 0.0201  0.0386  0.0452  191 LEU A CD2 
1452 N N   . LYS A 204 ? 0.3827 0.5112 0.4772 0.0187  0.0195  0.0512  192 LYS A N   
1453 C CA  . LYS A 204 ? 0.3926 0.5117 0.4780 0.0222  0.0167  0.0528  192 LYS A CA  
1454 C C   . LYS A 204 ? 0.3919 0.4913 0.4581 0.0167  0.0155  0.0502  192 LYS A C   
1455 O O   . LYS A 204 ? 0.3791 0.4817 0.4446 0.0091  0.0134  0.0477  192 LYS A O   
1456 C CB  . LYS A 204 ? 0.4131 0.5467 0.5074 0.0192  0.0096  0.0543  192 LYS A CB  
1457 C CG  . LYS A 204 ? 0.4456 0.6021 0.5587 0.0225  0.0088  0.0586  192 LYS A CG  
1458 C CD  . LYS A 204 ? 0.5410 0.7088 0.6578 0.0201  0.0008  0.0611  192 LYS A CD  
1459 C CE  . LYS A 204 ? 0.5653 0.7578 0.6985 0.0133  -0.0040 0.0626  192 LYS A CE  
1460 N NZ  . LYS A 204 ? 0.6501 0.8650 0.7998 0.0207  -0.0032 0.0706  192 LYS A NZ  
1461 N N   . VAL A 205 ? 0.3883 0.4673 0.4384 0.0206  0.0171  0.0514  193 VAL A N   
1462 C CA  . VAL A 205 ? 0.3975 0.4567 0.4269 0.0124  0.0149  0.0502  193 VAL A CA  
1463 C C   . VAL A 205 ? 0.4142 0.4694 0.4375 0.0094  0.0092  0.0534  193 VAL A C   
1464 O O   . VAL A 205 ? 0.4127 0.4572 0.4313 0.0175  0.0096  0.0568  193 VAL A O   
1465 C CB  . VAL A 205 ? 0.4444 0.4760 0.4532 0.0167  0.0203  0.0489  193 VAL A CB  
1466 C CG1 . VAL A 205 ? 0.4743 0.4846 0.4586 0.0033  0.0163  0.0477  193 VAL A CG1 
1467 C CG2 . VAL A 205 ? 0.3786 0.4164 0.3938 0.0219  0.0274  0.0466  193 VAL A CG2 
1468 N N   . ALA A 206 ? 0.3873 0.4530 0.4112 -0.0011 0.0044  0.0533  194 ALA A N   
1469 C CA  . ALA A 206 ? 0.3910 0.4579 0.4100 -0.0059 -0.0006 0.0568  194 ALA A CA  
1470 C C   . ALA A 206 ? 0.4117 0.4599 0.4090 -0.0170 -0.0029 0.0589  194 ALA A C   
1471 O O   . ALA A 206 ? 0.4193 0.4682 0.4114 -0.0257 -0.0030 0.0574  194 ALA A O   
1472 C CB  . ALA A 206 ? 0.3626 0.4566 0.3958 -0.0100 -0.0034 0.0555  194 ALA A CB  
1473 N N   . ASN A 207 ? 0.4384 0.4715 0.4232 -0.0178 -0.0057 0.0635  195 ASN A N   
1474 C CA  . ASN A 207 ? 0.4610 0.4759 0.4238 -0.0313 -0.0093 0.0671  195 ASN A CA  
1475 C C   . ASN A 207 ? 0.4388 0.4827 0.4102 -0.0423 -0.0130 0.0696  195 ASN A C   
1476 O O   . ASN A 207 ? 0.4244 0.4826 0.4043 -0.0386 -0.0145 0.0718  195 ASN A O   
1477 C CB  . ASN A 207 ? 0.4990 0.4841 0.4447 -0.0253 -0.0103 0.0720  195 ASN A CB  
1478 C CG  . ASN A 207 ? 0.5235 0.4909 0.4464 -0.0411 -0.0154 0.0778  195 ASN A CG  
1479 O OD1 . ASN A 207 ? 0.4799 0.4495 0.3941 -0.0580 -0.0177 0.0779  195 ASN A OD1 
1480 N ND2 . ASN A 207 ? 0.5087 0.4597 0.4217 -0.0362 -0.0176 0.0839  195 ASN A ND2 
1481 N N   . ILE A 208 ? 0.4273 0.4823 0.3966 -0.0547 -0.0141 0.0697  196 ILE A N   
1482 C CA  . ILE A 208 ? 0.4286 0.5144 0.4058 -0.0636 -0.0160 0.0731  196 ILE A CA  
1483 C C   . ILE A 208 ? 0.4526 0.5331 0.4117 -0.0824 -0.0202 0.0801  196 ILE A C   
1484 O O   . ILE A 208 ? 0.4566 0.5661 0.4217 -0.0914 -0.0211 0.0842  196 ILE A O   
1485 C CB  . ILE A 208 ? 0.3926 0.5082 0.3882 -0.0604 -0.0134 0.0696  196 ILE A CB  
1486 C CG1 . ILE A 208 ? 0.4155 0.5285 0.4046 -0.0695 -0.0145 0.0701  196 ILE A CG1 
1487 C CG2 . ILE A 208 ? 0.3647 0.4830 0.3754 -0.0449 -0.0100 0.0635  196 ILE A CG2 
1488 C CD1 . ILE A 208 ? 0.3843 0.5297 0.3906 -0.0666 -0.0127 0.0694  196 ILE A CD1 
1489 N N   . GLY A 209 ? 0.5038 0.5461 0.4392 -0.0882 -0.0224 0.0819  197 GLY A N   
1490 C CA  . GLY A 209 ? 0.5289 0.5549 0.4412 -0.1070 -0.0273 0.0895  197 GLY A CA  
1491 C C   . GLY A 209 ? 0.5599 0.5715 0.4530 -0.1259 -0.0308 0.0907  197 GLY A C   
1492 O O   . GLY A 209 ? 0.5629 0.5663 0.4376 -0.1462 -0.0357 0.0978  197 GLY A O   
1493 N N   . HIS A 210 ? 0.5494 0.5567 0.4445 -0.1213 -0.0289 0.0844  198 HIS A N   
1494 C CA  . HIS A 210 ? 0.5843 0.5667 0.4535 -0.1395 -0.0331 0.0845  198 HIS A CA  
1495 C C   . HIS A 210 ? 0.6357 0.5598 0.4675 -0.1452 -0.0349 0.0850  198 HIS A C   
1496 O O   . HIS A 210 ? 0.6196 0.5177 0.4475 -0.1269 -0.0307 0.0824  198 HIS A O   
1497 C CB  . HIS A 210 ? 0.5748 0.5550 0.4477 -0.1310 -0.0301 0.0770  198 HIS A CB  
1498 C CG  . HIS A 210 ? 0.5526 0.5815 0.4586 -0.1226 -0.0278 0.0763  198 HIS A CG  
1499 N ND1 . HIS A 210 ? 0.5707 0.6100 0.4985 -0.1006 -0.0217 0.0710  198 HIS A ND1 
1500 C CD2 . HIS A 210 ? 0.5443 0.6130 0.4641 -0.1328 -0.0310 0.0808  198 HIS A CD2 
1501 C CE1 . HIS A 210 ? 0.5662 0.6438 0.5166 -0.0977 -0.0210 0.0716  198 HIS A CE1 
1502 N NE2 . HIS A 210 ? 0.5529 0.6502 0.5000 -0.1152 -0.0262 0.0777  198 HIS A NE2 
1503 N N   . PRO A 211 ? 0.6750 0.5774 0.4777 -0.1708 -0.0415 0.0890  199 PRO A N   
1504 C CA  . PRO A 211 ? 0.7393 0.5770 0.5006 -0.1756 -0.0429 0.0886  199 PRO A CA  
1505 C C   . PRO A 211 ? 0.7772 0.5779 0.5271 -0.1540 -0.0360 0.0785  199 PRO A C   
1506 O O   . PRO A 211 ? 0.7621 0.5746 0.5186 -0.1517 -0.0340 0.0723  199 PRO A O   
1507 C CB  . PRO A 211 ? 0.7792 0.6031 0.5114 -0.2093 -0.0516 0.0925  199 PRO A CB  
1508 C CG  . PRO A 211 ? 0.7308 0.6222 0.4946 -0.2229 -0.0553 0.0994  199 PRO A CG  
1509 C CD  . PRO A 211 ? 0.6801 0.6158 0.4856 -0.1964 -0.0482 0.0948  199 PRO A CD  
1510 N N   . VAL A 212 ? 0.8330 0.5896 0.5644 -0.1382 -0.0321 0.0777  200 VAL A N   
1511 C CA  . VAL A 212 ? 0.8792 0.6062 0.6026 -0.1143 -0.0236 0.0691  200 VAL A CA  
1512 C C   . VAL A 212 ? 0.9405 0.6285 0.6279 -0.1264 -0.0239 0.0618  200 VAL A C   
1513 O O   . VAL A 212 ? 0.9254 0.6172 0.6190 -0.1128 -0.0175 0.0543  200 VAL A O   
1514 C CB  . VAL A 212 ? 0.9095 0.5990 0.6206 -0.0922 -0.0190 0.0712  200 VAL A CB  
1515 C CG1 . VAL A 212 ? 0.9386 0.6021 0.6422 -0.0660 -0.0086 0.0629  200 VAL A CG1 
1516 C CG2 . VAL A 212 ? 0.8627 0.5970 0.6117 -0.0798 -0.0191 0.0776  200 VAL A CG2 
1517 N N   . HIS A 213 ? 1.0037 0.6573 0.6537 -0.1542 -0.0319 0.0645  201 HIS A N   
1518 C CA  . HIS A 213 ? 1.0678 0.6851 0.6793 -0.1728 -0.0349 0.0583  201 HIS A CA  
1519 C C   . HIS A 213 ? 1.0214 0.6887 0.6586 -0.1783 -0.0360 0.0552  201 HIS A C   
1520 O O   . HIS A 213 ? 1.0423 0.6872 0.6592 -0.1770 -0.0332 0.0471  201 HIS A O   
1521 C CB  . HIS A 213 ? 1.1243 0.7107 0.6980 -0.2090 -0.0463 0.0647  201 HIS A CB  
1522 C CG  . HIS A 213 ? 1.2493 0.7939 0.7774 -0.2331 -0.0516 0.0587  201 HIS A CG  
1523 N ND1 . HIS A 213 ? 1.2835 0.8683 0.8223 -0.2536 -0.0582 0.0587  201 HIS A ND1 
1524 C CD2 . HIS A 213 ? 1.3826 0.8465 0.8508 -0.2412 -0.0520 0.0529  201 HIS A CD2 
1525 C CE1 . HIS A 213 ? 1.3634 0.8966 0.8517 -0.2745 -0.0630 0.0530  201 HIS A CE1 
1526 N NE2 . HIS A 213 ? 1.4145 0.8715 0.8577 -0.2678 -0.0591 0.0487  201 HIS A NE2 
1527 N N   . LEU A 214 ? 0.9635 0.6968 0.6434 -0.1829 -0.0395 0.0618  202 LEU A N   
1528 C CA  . LEU A 214 ? 0.9241 0.7031 0.6285 -0.1845 -0.0402 0.0600  202 LEU A CA  
1529 C C   . LEU A 214 ? 0.9037 0.6939 0.6313 -0.1537 -0.0294 0.0528  202 LEU A C   
1530 O O   . LEU A 214 ? 0.9095 0.7021 0.6335 -0.1529 -0.0278 0.0477  202 LEU A O   
1531 C CB  . LEU A 214 ? 0.8727 0.7171 0.6131 -0.1968 -0.0463 0.0693  202 LEU A CB  
1532 C CG  . LEU A 214 ? 0.8866 0.7392 0.6113 -0.2316 -0.0577 0.0783  202 LEU A CG  
1533 C CD1 . LEU A 214 ? 0.8200 0.7469 0.5888 -0.2337 -0.0598 0.0870  202 LEU A CD1 
1534 C CD2 . LEU A 214 ? 0.9385 0.7655 0.6266 -0.2572 -0.0655 0.0759  202 LEU A CD2 
1535 N N   . ILE A 215 ? 0.8894 0.6886 0.6403 -0.1305 -0.0229 0.0534  203 ILE A N   
1536 C CA  . ILE A 215 ? 0.8696 0.6828 0.6446 -0.1031 -0.0131 0.0483  203 ILE A CA  
1537 C C   . ILE A 215 ? 0.9323 0.6970 0.6750 -0.0929 -0.0060 0.0402  203 ILE A C   
1538 O O   . ILE A 215 ? 0.9148 0.6900 0.6666 -0.0811 0.0003  0.0352  203 ILE A O   
1539 C CB  . ILE A 215 ? 0.8443 0.6705 0.6439 -0.0833 -0.0091 0.0515  203 ILE A CB  
1540 C CG1 . ILE A 215 ? 0.7932 0.6690 0.6246 -0.0907 -0.0145 0.0582  203 ILE A CG1 
1541 C CG2 . ILE A 215 ? 0.8315 0.6676 0.6515 -0.0570 0.0005  0.0471  203 ILE A CG2 
1542 C CD1 . ILE A 215 ? 0.7494 0.6730 0.6103 -0.0917 -0.0149 0.0577  203 ILE A CD1 
1543 N N   . ASN A 216 ? 1.0106 0.7196 0.7123 -0.0980 -0.0067 0.0389  204 ASN A N   
1544 C CA  . ASN A 216 ? 1.0764 0.7315 0.7412 -0.0855 0.0016  0.0306  204 ASN A CA  
1545 C C   . ASN A 216 ? 1.1160 0.7487 0.7476 -0.1040 -0.0010 0.0243  204 ASN A C   
1546 O O   . ASN A 216 ? 1.1646 0.7540 0.7639 -0.0932 0.0069  0.0161  204 ASN A O   
1547 C CB  . ASN A 216 ? 1.1300 0.7271 0.7598 -0.0803 0.0029  0.0315  204 ASN A CB  
1548 C CG  . ASN A 216 ? 1.1321 0.7427 0.7892 -0.0516 0.0098  0.0356  204 ASN A CG  
1549 O OD1 . ASN A 216 ? 1.1822 0.7782 0.8343 -0.0514 0.0063  0.0421  204 ASN A OD1 
1550 N ND2 . ASN A 216 ? 1.1360 0.7778 0.8232 -0.0283 0.0191  0.0330  204 ASN A ND2 
1551 N N   . SER A 217 ? 1.1110 0.7734 0.7487 -0.1312 -0.0122 0.0284  205 SER A N   
1552 C CA  . SER A 217 ? 1.1491 0.7923 0.7532 -0.1530 -0.0176 0.0240  205 SER A CA  
1553 C C   . SER A 217 ? 1.1226 0.7997 0.7477 -0.1427 -0.0127 0.0206  205 SER A C   
1554 O O   . SER A 217 ? 1.1565 0.8134 0.7516 -0.1542 -0.0144 0.0154  205 SER A O   
1555 C CB  . SER A 217 ? 1.1491 0.8137 0.7510 -0.1880 -0.0327 0.0320  205 SER A CB  
1556 O OG  . SER A 217 ? 1.0906 0.8271 0.7442 -0.1869 -0.0358 0.0398  205 SER A OG  
1557 N N   . ILE A 218 ? 1.0732 0.7994 0.7468 -0.1228 -0.0073 0.0237  206 ILE A N   
1558 C CA  . ILE A 218 ? 1.0483 0.8067 0.7430 -0.1130 -0.0026 0.0218  206 ILE A CA  
1559 C C   . ILE A 218 ? 1.0801 0.7975 0.7420 -0.1009 0.0078  0.0122  206 ILE A C   
1560 O O   . ILE A 218 ? 1.1156 0.7984 0.7634 -0.0818 0.0178  0.0077  206 ILE A O   
1561 C CB  . ILE A 218 ? 0.9977 0.8025 0.7434 -0.0913 0.0031  0.0256  206 ILE A CB  
1562 C CG1 . ILE A 218 ? 0.9574 0.8180 0.7385 -0.1017 -0.0051 0.0332  206 ILE A CG1 
1563 C CG2 . ILE A 218 ? 1.0065 0.8122 0.7589 -0.0699 0.0152  0.0206  206 ILE A CG2 
1564 C CD1 . ILE A 218 ? 0.9260 0.8069 0.7254 -0.1079 -0.0111 0.0398  206 ILE A CD1 
1565 N N   . ASN A 219 ? 1.0738 0.7956 0.7225 -0.1110 0.0059  0.0098  207 ASN A N   
1566 C CA  . ASN A 219 ? 1.1079 0.7880 0.7181 -0.1033 0.0153  0.0003  207 ASN A CA  
1567 C C   . ASN A 219 ? 1.0571 0.7591 0.6899 -0.0786 0.0287  -0.0015 207 ASN A C   
1568 O O   . ASN A 219 ? 1.0912 0.7642 0.6942 -0.0710 0.0379  -0.0088 207 ASN A O   
1569 C CB  . ASN A 219 ? 1.1513 0.8165 0.7245 -0.1307 0.0054  -0.0018 207 ASN A CB  
1570 C CG  . ASN A 219 ? 1.2710 0.8632 0.7798 -0.1366 0.0087  -0.0124 207 ASN A CG  
1571 O OD1 . ASN A 219 ? 1.3432 0.8963 0.8345 -0.1139 0.0221  -0.0192 207 ASN A OD1 
1572 N ND2 . ASN A 219 ? 1.3300 0.9033 0.8016 -0.1672 -0.0035 -0.0135 207 ASN A ND2 
1573 N N   . ARG A 220 ? 0.9737 0.7255 0.6569 -0.0669 0.0301  0.0050  208 ARG A N   
1574 C CA  . ARG A 220 ? 0.9331 0.7071 0.6385 -0.0466 0.0418  0.0046  208 ARG A CA  
1575 C C   . ARG A 220 ? 0.8989 0.6924 0.6402 -0.0259 0.0483  0.0079  208 ARG A C   
1576 O O   . ARG A 220 ? 0.8833 0.7085 0.6569 -0.0295 0.0411  0.0141  208 ARG A O   
1577 C CB  . ARG A 220 ? 0.8855 0.7028 0.6153 -0.0559 0.0358  0.0103  208 ARG A CB  
1578 C CG  . ARG A 220 ? 0.9004 0.7041 0.5968 -0.0748 0.0295  0.0083  208 ARG A CG  
1579 C CD  . ARG A 220 ? 0.8572 0.7028 0.5780 -0.0787 0.0254  0.0150  208 ARG A CD  
1580 N NE  . ARG A 220 ? 0.8797 0.7159 0.5687 -0.0971 0.0183  0.0144  208 ARG A NE  
1581 C CZ  . ARG A 220 ? 0.8576 0.7184 0.5520 -0.1164 0.0038  0.0216  208 ARG A CZ  
1582 N NH1 . ARG A 220 ? 0.8527 0.7061 0.5169 -0.1335 -0.0032 0.0218  208 ARG A NH1 
1583 N NH2 . ARG A 220 ? 0.7858 0.6808 0.5157 -0.1179 -0.0032 0.0292  208 ARG A NH2 
1584 N N   . TYR A 221 ? 0.8864 0.6618 0.6207 -0.0040 0.0618  0.0043  209 TYR A N   
1585 C CA  . TYR A 221 ? 0.8449 0.6373 0.6097 0.0150  0.0669  0.0083  209 TYR A CA  
1586 C C   . TYR A 221 ? 0.7827 0.6029 0.5731 0.0353  0.0794  0.0100  209 TYR A C   
1587 O O   . TYR A 221 ? 0.7512 0.5674 0.5284 0.0391  0.0878  0.0068  209 TYR A O   
1588 C CB  . TYR A 221 ? 0.9024 0.6503 0.6399 0.0271  0.0717  0.0053  209 TYR A CB  
1589 C CG  . TYR A 221 ? 1.0086 0.7000 0.6942 0.0130  0.0671  -0.0006 209 TYR A CG  
1590 C CD1 . TYR A 221 ? 1.0916 0.7670 0.7692 -0.0006 0.0562  0.0022  209 TYR A CD1 
1591 C CD2 . TYR A 221 ? 1.0997 0.7509 0.7418 0.0136  0.0743  -0.0091 209 TYR A CD2 
1592 C CE1 . TYR A 221 ? 1.1821 0.8036 0.8106 -0.0159 0.0513  -0.0025 209 TYR A CE1 
1593 C CE2 . TYR A 221 ? 1.2052 0.8002 0.7960 -0.0010 0.0695  -0.0150 209 TYR A CE2 
1594 C CZ  . TYR A 221 ? 1.2446 0.8243 0.8287 -0.0168 0.0575  -0.0114 209 TYR A CZ  
1595 O OH  . TYR A 221 ? 1.3380 0.8590 0.8686 -0.0354 0.0512  -0.0164 209 TYR A OH  
1596 N N   . VAL A 222 ? 0.5242 0.5771 0.5907 0.0172  0.0376  0.0712  210 VAL A N   
1597 C CA  . VAL A 222 ? 0.5050 0.5541 0.5575 0.0186  0.0337  0.0684  210 VAL A CA  
1598 C C   . VAL A 222 ? 0.4928 0.5378 0.5403 0.0175  0.0338  0.0738  210 VAL A C   
1599 O O   . VAL A 222 ? 0.4888 0.5373 0.5377 0.0175  0.0389  0.0801  210 VAL A O   
1600 C CB  . VAL A 222 ? 0.5228 0.5790 0.5655 0.0225  0.0368  0.0664  210 VAL A CB  
1601 C CG1 . VAL A 222 ? 0.4943 0.5467 0.5241 0.0240  0.0326  0.0635  210 VAL A CG1 
1602 C CG2 . VAL A 222 ? 0.5199 0.5806 0.5685 0.0238  0.0367  0.0608  210 VAL A CG2 
1603 N N   . ILE A 223 ? 0.4660 0.5037 0.5083 0.0164  0.0280  0.0713  211 ILE A N   
1604 C CA  . ILE A 223 ? 0.4556 0.4893 0.4935 0.0155  0.0275  0.0753  211 ILE A CA  
1605 C C   . ILE A 223 ? 0.4742 0.5116 0.4995 0.0186  0.0301  0.0771  211 ILE A C   
1606 O O   . ILE A 223 ? 0.4657 0.5038 0.4823 0.0208  0.0282  0.0725  211 ILE A O   
1607 C CB  . ILE A 223 ? 0.4430 0.4687 0.4786 0.0138  0.0209  0.0714  211 ILE A CB  
1608 C CG1 . ILE A 223 ? 0.4579 0.4799 0.5050 0.0111  0.0177  0.0694  211 ILE A CG1 
1609 C CG2 . ILE A 223 ? 0.4293 0.4514 0.4612 0.0130  0.0203  0.0748  211 ILE A CG2 
1610 C CD1 . ILE A 223 ? 0.4404 0.4553 0.4843 0.0097  0.0114  0.0649  211 ILE A CD1 
1611 N N   . THR A 224 ? 0.4590 0.4986 0.4838 0.0189  0.0344  0.0840  212 THR A N   
1612 C CA  . THR A 224 ? 0.4751 0.5184 0.4875 0.0222  0.0368  0.0862  212 THR A CA  
1613 C C   . THR A 224 ? 0.4887 0.5268 0.4964 0.0217  0.0346  0.0894  212 THR A C   
1614 O O   . THR A 224 ? 0.4780 0.5106 0.4934 0.0186  0.0324  0.0913  212 THR A O   
1615 C CB  . THR A 224 ? 0.4771 0.5284 0.4898 0.0239  0.0444  0.0925  212 THR A CB  
1616 O OG1 . THR A 224 ? 0.4631 0.5122 0.4849 0.0211  0.0465  0.0998  212 THR A OG1 
1617 C CG2 . THR A 224 ? 0.4624 0.5199 0.4817 0.0244  0.0476  0.0897  212 THR A CG2 
1618 N N   . ARG A 225 ? 0.5053 0.5456 0.5008 0.0250  0.0350  0.0896  213 ARG A N   
1619 C CA  . ARG A 225 ? 0.5321 0.5681 0.5219 0.0252  0.0326  0.0918  213 ARG A CA  
1620 C C   . ARG A 225 ? 0.5215 0.5563 0.5183 0.0233  0.0354  0.1004  213 ARG A C   
1621 O O   . ARG A 225 ? 0.4925 0.5214 0.4926 0.0214  0.0320  0.1016  213 ARG A O   
1622 C CB  . ARG A 225 ? 0.5598 0.5998 0.5358 0.0297  0.0331  0.0909  213 ARG A CB  
1623 C CG  . ARG A 225 ? 0.6444 0.6806 0.6140 0.0307  0.0307  0.0936  213 ARG A CG  
1624 C CD  . ARG A 225 ? 0.7408 0.7822 0.6973 0.0356  0.0326  0.0951  213 ARG A CD  
1625 N NE  . ARG A 225 ? 0.8087 0.8465 0.7577 0.0373  0.0272  0.0907  213 ARG A NE  
1626 C CZ  . ARG A 225 ? 0.8587 0.8957 0.8046 0.0384  0.0234  0.0824  213 ARG A CZ  
1627 N NH1 . ARG A 225 ? 0.8971 0.9366 0.8461 0.0380  0.0238  0.0774  213 ARG A NH1 
1628 N NH2 . ARG A 225 ? 0.8805 0.9142 0.8209 0.0398  0.0189  0.0790  213 ARG A NH2 
1629 N N   . GLU A 226 ? 0.5183 0.5588 0.5187 0.0237  0.0415  0.1063  214 GLU A N   
1630 C CA  . GLU A 226 ? 0.5374 0.5772 0.5449 0.0219  0.0447  0.1154  214 GLU A CA  
1631 C C   . GLU A 226 ? 0.5099 0.5444 0.5331 0.0176  0.0422  0.1151  214 GLU A C   
1632 O O   . GLU A 226 ? 0.4874 0.5172 0.5169 0.0157  0.0406  0.1192  214 GLU A O   
1633 C CB  . GLU A 226 ? 0.5665 0.6142 0.5747 0.0231  0.0526  0.1221  214 GLU A CB  
1634 C CG  . GLU A 226 ? 0.6665 0.7216 0.6598 0.0279  0.0556  0.1203  214 GLU A CG  
1635 C CD  . GLU A 226 ? 0.7439 0.8028 0.7369 0.0290  0.0548  0.1111  214 GLU A CD  
1636 O OE1 . GLU A 226 ? 0.7140 0.7723 0.6970 0.0316  0.0506  0.1041  214 GLU A OE1 
1637 O OE2 . GLU A 226 ? 0.8314 0.8936 0.8352 0.0273  0.0580  0.1107  214 GLU A OE2 
1638 N N   . MET A 227 ? 0.4977 0.5330 0.5278 0.0163  0.0415  0.1098  215 MET A N   
1639 C CA  . MET A 227 ? 0.4902 0.5206 0.5346 0.0126  0.0384  0.1084  215 MET A CA  
1640 C C   . MET A 227 ? 0.4708 0.4935 0.5131 0.0115  0.0317  0.1043  215 MET A C   
1641 O O   . MET A 227 ? 0.4485 0.4668 0.5003 0.0092  0.0295  0.1062  215 MET A O   
1642 C CB  . MET A 227 ? 0.4915 0.5240 0.5416 0.0121  0.0381  0.1026  215 MET A CB  
1643 C CG  . MET A 227 ? 0.5260 0.5537 0.5897 0.0089  0.0342  0.0999  215 MET A CG  
1644 S SD  . MET A 227 ? 0.5956 0.6249 0.6630 0.0089  0.0323  0.0921  215 MET A SD  
1645 C CE  . MET A 227 ? 0.4744 0.5144 0.5384 0.0117  0.0408  0.0958  215 MET A CE  
1646 N N   . VAL A 228 ? 0.4684 0.4900 0.4990 0.0133  0.0285  0.0986  216 VAL A N   
1647 C CA  . VAL A 228 ? 0.4800 0.4950 0.5084 0.0122  0.0226  0.0943  216 VAL A CA  
1648 C C   . VAL A 228 ? 0.5024 0.5152 0.5293 0.0125  0.0223  0.0992  216 VAL A C   
1649 O O   . VAL A 228 ? 0.4898 0.4975 0.5228 0.0106  0.0188  0.0985  216 VAL A O   
1650 C CB  . VAL A 228 ? 0.4798 0.4943 0.4972 0.0138  0.0196  0.0870  216 VAL A CB  
1651 C CG1 . VAL A 228 ? 0.4622 0.4710 0.4761 0.0130  0.0147  0.0834  216 VAL A CG1 
1652 C CG2 . VAL A 228 ? 0.4499 0.4647 0.4718 0.0127  0.0184  0.0820  216 VAL A CG2 
1653 N N   . ARG A 229 ? 0.5231 0.5397 0.5421 0.0152  0.0259  0.1043  217 ARG A N   
1654 C CA  . ARG A 229 ? 0.5516 0.5659 0.5688 0.0158  0.0254  0.1097  217 ARG A CA  
1655 C C   . ARG A 229 ? 0.5458 0.5576 0.5773 0.0130  0.0261  0.1158  217 ARG A C   
1656 O O   . ARG A 229 ? 0.5395 0.5465 0.5749 0.0120  0.0227  0.1165  217 ARG A O   
1657 C CB  . ARG A 229 ? 0.5687 0.5880 0.5743 0.0194  0.0293  0.1148  217 ARG A CB  
1658 C CG  . ARG A 229 ? 0.6447 0.6610 0.6474 0.0204  0.0279  0.1205  217 ARG A CG  
1659 C CD  . ARG A 229 ? 0.7489 0.7700 0.7381 0.0247  0.0312  0.1255  217 ARG A CD  
1660 N NE  . ARG A 229 ? 0.8437 0.8715 0.8328 0.0254  0.0381  0.1311  217 ARG A NE  
1661 C CZ  . ARG A 229 ? 0.9176 0.9515 0.9012 0.0272  0.0411  0.1272  217 ARG A CZ  
1662 N NH1 . ARG A 229 ? 0.9262 0.9666 0.9111 0.0277  0.0478  0.1326  217 ARG A NH1 
1663 N NH2 . ARG A 229 ? 0.9334 0.9672 0.9110 0.0285  0.0375  0.1178  217 ARG A NH2 
1664 N N   . SER A 230 ? 0.5366 0.5518 0.5772 0.0117  0.0305  0.1198  218 SER A N   
1665 C CA  . SER A 230 ? 0.5458 0.5587 0.6017 0.0090  0.0310  0.1255  218 SER A CA  
1666 C C   . SER A 230 ? 0.5379 0.5454 0.6055 0.0061  0.0256  0.1197  218 SER A C   
1667 O O   . SER A 230 ? 0.5396 0.5440 0.6196 0.0042  0.0243  0.1231  218 SER A O   
1668 C CB  . SER A 230 ? 0.5454 0.5637 0.6094 0.0082  0.0376  0.1317  218 SER A CB  
1669 O OG  . SER A 230 ? 0.5931 0.6129 0.6618 0.0073  0.0371  0.1254  218 SER A OG  
1670 N N   . LEU A 231 ? 0.5153 0.5219 0.5788 0.0061  0.0224  0.1112  219 LEU A N   
1671 C CA  . LEU A 231 ? 0.5049 0.5067 0.5766 0.0039  0.0171  0.1050  219 LEU A CA  
1672 C C   . LEU A 231 ? 0.5043 0.5012 0.5709 0.0040  0.0119  0.1007  219 LEU A C   
1673 O O   . LEU A 231 ? 0.5061 0.4992 0.5805 0.0024  0.0078  0.0971  219 LEU A O   
1674 C CB  . LEU A 231 ? 0.4908 0.4936 0.5610 0.0037  0.0160  0.0984  219 LEU A CB  
1675 C CG  . LEU A 231 ? 0.4812 0.4881 0.5604 0.0030  0.0197  0.1003  219 LEU A CG  
1676 C CD1 . LEU A 231 ? 0.4546 0.4621 0.5307 0.0032  0.0179  0.0935  219 LEU A CD1 
1677 C CD2 . LEU A 231 ? 0.4358 0.4410 0.5323 0.0007  0.0192  0.1031  219 LEU A CD2 
1678 N N   . LEU A 232 ? 0.5085 0.5060 0.5624 0.0062  0.0121  0.1007  220 LEU A N   
1679 C CA  . LEU A 232 ? 0.5169 0.5104 0.5662 0.0064  0.0076  0.0963  220 LEU A CA  
1680 C C   . LEU A 232 ? 0.5169 0.5067 0.5776 0.0050  0.0052  0.0989  220 LEU A C   
1681 O O   . LEU A 232 ? 0.5145 0.5049 0.5799 0.0052  0.0074  0.1063  220 LEU A O   
1682 C CB  . LEU A 232 ? 0.5221 0.5171 0.5581 0.0092  0.0086  0.0975  220 LEU A CB  
1683 C CG  . LEU A 232 ? 0.5720 0.5683 0.5958 0.0108  0.0077  0.0912  220 LEU A CG  
1684 C CD1 . LEU A 232 ? 0.5719 0.5688 0.5859 0.0135  0.0076  0.0927  220 LEU A CD1 
1685 C CD2 . LEU A 232 ? 0.5698 0.5623 0.5946 0.0091  0.0035  0.0838  220 LEU A CD2 
1686 N N   . PRO A 233 ? 0.5102 0.4963 0.5751 0.0037  0.0006  0.0929  221 PRO A N   
1687 C CA  . PRO A 233 ? 0.5125 0.4953 0.5898 0.0025  -0.0021 0.0946  221 PRO A CA  
1688 C C   . PRO A 233 ? 0.5120 0.4934 0.5861 0.0039  -0.0028 0.0984  221 PRO A C   
1689 O O   . PRO A 233 ? 0.4869 0.4693 0.5487 0.0059  -0.0023 0.0977  221 PRO A O   
1690 C CB  . PRO A 233 ? 0.5129 0.4927 0.5926 0.0013  -0.0069 0.0858  221 PRO A CB  
1691 C CG  . PRO A 233 ? 0.5027 0.4838 0.5693 0.0020  -0.0066 0.0805  221 PRO A CG  
1692 C CD  . PRO A 233 ? 0.5171 0.5019 0.5781 0.0030  -0.0022 0.0846  221 PRO A CD  
1693 N N   . GLU A 234 ? 0.5324 0.5114 0.6189 0.0030  -0.0042 0.1025  222 GLU A N   
1694 C CA  . GLU A 234 ? 0.5486 0.5258 0.6347 0.0043  -0.0055 0.1069  222 GLU A CA  
1695 C C   . GLU A 234 ? 0.5265 0.5008 0.6112 0.0046  -0.0106 0.0992  222 GLU A C   
1696 O O   . GLU A 234 ? 0.5369 0.5099 0.6261 0.0033  -0.0134 0.0920  222 GLU A O   
1697 C CB  . GLU A 234 ? 0.5729 0.5484 0.6750 0.0029  -0.0053 0.1145  222 GLU A CB  
1698 C CG  . GLU A 234 ? 0.6437 0.6225 0.7471 0.0027  0.0005  0.1235  222 GLU A CG  
1699 C CD  . GLU A 234 ? 0.7541 0.7312 0.8734 0.0013  0.0011  0.1322  222 GLU A CD  
1700 O OE1 . GLU A 234 ? 0.7877 0.7617 0.9088 0.0020  -0.0012 0.1360  222 GLU A OE1 
1701 O OE2 . GLU A 234 ? 0.8206 0.7992 0.9513 -0.0005 0.0038  0.1354  222 GLU A OE2 
1702 N N   . ARG A 235 ? 0.5056 0.4790 0.5835 0.0065  -0.0117 0.1006  223 ARG A N   
1703 C CA  . ARG A 235 ? 0.4857 0.4565 0.5641 0.0069  -0.0164 0.0940  223 ARG A CA  
1704 C C   . ARG A 235 ? 0.4793 0.4469 0.5671 0.0074  -0.0192 0.0990  223 ARG A C   
1705 O O   . ARG A 235 ? 0.4615 0.4287 0.5427 0.0095  -0.0198 0.1020  223 ARG A O   
1706 C CB  . ARG A 235 ? 0.4821 0.4544 0.5450 0.0090  -0.0162 0.0898  223 ARG A CB  
1707 C CG  . ARG A 235 ? 0.4692 0.4446 0.5218 0.0090  -0.0132 0.0865  223 ARG A CG  
1708 C CD  . ARG A 235 ? 0.4474 0.4221 0.5020 0.0071  -0.0150 0.0781  223 ARG A CD  
1709 N NE  . ARG A 235 ? 0.3942 0.3674 0.4474 0.0073  -0.0184 0.0711  223 ARG A NE  
1710 C CZ  . ARG A 235 ? 0.3864 0.3595 0.4386 0.0060  -0.0197 0.0634  223 ARG A CZ  
1711 N NH1 . ARG A 235 ? 0.3751 0.3490 0.4271 0.0046  -0.0185 0.0616  223 ARG A NH1 
1712 N NH2 . ARG A 235 ? 0.3908 0.3631 0.4421 0.0063  -0.0220 0.0574  223 ARG A NH2 
1713 N N   . PRO A 236 ? 0.4667 0.4320 0.5706 0.0056  -0.0215 0.0998  224 PRO A N   
1714 C CA  . PRO A 236 ? 0.4868 0.4487 0.6014 0.0060  -0.0247 0.1047  224 PRO A CA  
1715 C C   . PRO A 236 ? 0.4713 0.4315 0.5836 0.0074  -0.0293 0.0977  224 PRO A C   
1716 O O   . PRO A 236 ? 0.4231 0.3840 0.5334 0.0069  -0.0310 0.0878  224 PRO A O   
1717 C CB  . PRO A 236 ? 0.4831 0.4432 0.6168 0.0037  -0.0269 0.1039  224 PRO A CB  
1718 C CG  . PRO A 236 ? 0.4892 0.4513 0.6210 0.0025  -0.0266 0.0955  224 PRO A CG  
1719 C CD  . PRO A 236 ? 0.4815 0.4469 0.5956 0.0034  -0.0221 0.0955  224 PRO A CD  
1720 N N   . ARG A 237 ? 0.4679 0.4258 0.5803 0.0091  -0.0312 0.1029  225 ARG A N   
1721 C CA  . ARG A 237 ? 0.4816 0.4382 0.5913 0.0107  -0.0355 0.0967  225 ARG A CA  
1722 C C   . ARG A 237 ? 0.4692 0.4238 0.5928 0.0095  -0.0404 0.0884  225 ARG A C   
1723 O O   . ARG A 237 ? 0.4590 0.4144 0.5789 0.0101  -0.0425 0.0792  225 ARG A O   
1724 C CB  . ARG A 237 ? 0.4964 0.4508 0.6032 0.0130  -0.0369 0.1043  225 ARG A CB  
1725 C CG  . ARG A 237 ? 0.5648 0.5219 0.6540 0.0151  -0.0327 0.1091  225 ARG A CG  
1726 C CD  . ARG A 237 ? 0.6415 0.5965 0.7248 0.0182  -0.0356 0.1130  225 ARG A CD  
1727 N NE  . ARG A 237 ? 0.6629 0.6148 0.7540 0.0183  -0.0363 0.1240  225 ARG A NE  
1728 C CZ  . ARG A 237 ? 0.6657 0.6139 0.7593 0.0203  -0.0409 0.1276  225 ARG A CZ  
1729 N NH1 . ARG A 237 ? 0.6952 0.6425 0.7852 0.0224  -0.0454 0.1203  225 ARG A NH1 
1730 N NH2 . ARG A 237 ? 0.6610 0.6063 0.7618 0.0202  -0.0411 0.1386  225 ARG A NH2 
1731 N N   . ASP A 238 ? 0.4571 0.4097 0.5970 0.0079  -0.0420 0.0912  226 ASP A N   
1732 C CA  . ASP A 238 ? 0.4611 0.4124 0.6153 0.0071  -0.0470 0.0827  226 ASP A CA  
1733 C C   . ASP A 238 ? 0.4535 0.4074 0.6071 0.0054  -0.0457 0.0750  226 ASP A C   
1734 O O   . ASP A 238 ? 0.4614 0.4150 0.6260 0.0039  -0.0457 0.0764  226 ASP A O   
1735 C CB  . ASP A 238 ? 0.4548 0.4025 0.6290 0.0062  -0.0504 0.0881  226 ASP A CB  
1736 C CG  . ASP A 238 ? 0.4485 0.3948 0.6371 0.0061  -0.0565 0.0784  226 ASP A CG  
1737 O OD1 . ASP A 238 ? 0.4776 0.4252 0.6612 0.0072  -0.0586 0.0691  226 ASP A OD1 
1738 O OD2 . ASP A 238 ? 0.5268 0.4709 0.7330 0.0051  -0.0594 0.0805  226 ASP A OD2 
1739 N N   . SER A 239 ? 0.4470 0.4034 0.5881 0.0058  -0.0445 0.0673  227 SER A N   
1740 C CA  . SER A 239 ? 0.4340 0.3929 0.5711 0.0044  -0.0426 0.0612  227 SER A CA  
1741 C C   . SER A 239 ? 0.4346 0.3950 0.5670 0.0048  -0.0445 0.0499  227 SER A C   
1742 O O   . SER A 239 ? 0.4437 0.4036 0.5762 0.0061  -0.0467 0.0474  227 SER A O   
1743 C CB  . SER A 239 ? 0.4334 0.3946 0.5559 0.0043  -0.0371 0.0659  227 SER A CB  
1744 O OG  . SER A 239 ? 0.4341 0.3962 0.5427 0.0060  -0.0355 0.0668  227 SER A OG  
1745 N N   . HIS A 240 ? 0.4246 0.3869 0.5540 0.0037  -0.0438 0.0433  228 HIS A N   
1746 C CA  . HIS A 240 ? 0.4242 0.3885 0.5479 0.0038  -0.0446 0.0331  228 HIS A CA  
1747 C C   . HIS A 240 ? 0.4109 0.3771 0.5242 0.0027  -0.0415 0.0308  228 HIS A C   
1748 O O   . HIS A 240 ? 0.4001 0.3660 0.5126 0.0020  -0.0395 0.0365  228 HIS A O   
1749 C CB  . HIS A 240 ? 0.4215 0.3854 0.5595 0.0039  -0.0495 0.0256  228 HIS A CB  
1750 C CG  . HIS A 240 ? 0.4584 0.4216 0.6080 0.0031  -0.0515 0.0255  228 HIS A CG  
1751 N ND1 . HIS A 240 ? 0.5248 0.4898 0.6717 0.0024  -0.0516 0.0187  228 HIS A ND1 
1752 C CD2 . HIS A 240 ? 0.5066 0.4673 0.6709 0.0028  -0.0536 0.0313  228 HIS A CD2 
1753 C CE1 . HIS A 240 ? 0.5197 0.4834 0.6792 0.0020  -0.0540 0.0200  228 HIS A CE1 
1754 N NE2 . HIS A 240 ? 0.5018 0.4630 0.6726 0.0020  -0.0550 0.0277  228 HIS A NE2 
1755 N N   . LYS A 241 ? 0.4003 0.3685 0.5058 0.0025  -0.0411 0.0229  229 LYS A N   
1756 C CA  . LYS A 241 ? 0.4182 0.3878 0.5122 0.0015  -0.0382 0.0216  229 LYS A CA  
1757 C C   . LYS A 241 ? 0.4043 0.3733 0.5042 0.0007  -0.0392 0.0223  229 LYS A C   
1758 O O   . LYS A 241 ? 0.3854 0.3545 0.4787 0.0001  -0.0368 0.0259  229 LYS A O   
1759 C CB  . LYS A 241 ? 0.4334 0.4053 0.5189 0.0012  -0.0374 0.0133  229 LYS A CB  
1760 C CG  . LYS A 241 ? 0.4626 0.4356 0.5542 0.0011  -0.0403 0.0047  229 LYS A CG  
1761 C CD  . LYS A 241 ? 0.5248 0.5003 0.6034 0.0004  -0.0377 -0.0013 229 LYS A CD  
1762 C CE  . LYS A 241 ? 0.5439 0.5216 0.6266 0.0007  -0.0398 -0.0108 229 LYS A CE  
1763 N NZ  . LYS A 241 ? 0.6033 0.5814 0.6969 0.0018  -0.0422 -0.0133 229 LYS A NZ  
1764 N N   . GLY A 242 ? 0.4142 0.3824 0.5275 0.0008  -0.0432 0.0188  230 GLY A N   
1765 C CA  . GLY A 242 ? 0.4278 0.3953 0.5495 0.0003  -0.0450 0.0190  230 GLY A CA  
1766 C C   . GLY A 242 ? 0.4266 0.3927 0.5529 -0.0001 -0.0432 0.0287  230 GLY A C   
1767 O O   . GLY A 242 ? 0.4493 0.4155 0.5762 -0.0008 -0.0428 0.0296  230 GLY A O   
1768 N N   . THR A 243 ? 0.4162 0.3813 0.5455 0.0001  -0.0419 0.0360  231 THR A N   
1769 C CA  . THR A 243 ? 0.4085 0.3731 0.5390 -0.0002 -0.0388 0.0459  231 THR A CA  
1770 C C   . THR A 243 ? 0.4142 0.3806 0.5310 -0.0006 -0.0347 0.0476  231 THR A C   
1771 O O   . THR A 243 ? 0.4009 0.3676 0.5212 -0.0012 -0.0327 0.0529  231 THR A O   
1772 C CB  . THR A 243 ? 0.4104 0.3742 0.5403 0.0006  -0.0375 0.0531  231 THR A CB  
1773 O OG1 . THR A 243 ? 0.4228 0.3848 0.5642 0.0012  -0.0418 0.0504  231 THR A OG1 
1774 C CG2 . THR A 243 ? 0.4027 0.3661 0.5375 0.0002  -0.0346 0.0637  231 THR A CG2 
1775 N N   . TYR A 244 ? 0.4029 0.3706 0.5052 -0.0002 -0.0333 0.0432  232 TYR A N   
1776 C CA  . TYR A 244 ? 0.4013 0.3704 0.4906 -0.0004 -0.0296 0.0450  232 TYR A CA  
1777 C C   . TYR A 244 ? 0.4148 0.3843 0.4989 -0.0011 -0.0304 0.0389  232 TYR A C   
1778 O O   . TYR A 244 ? 0.3904 0.3608 0.4632 -0.0013 -0.0280 0.0391  232 TYR A O   
1779 C CB  . TYR A 244 ? 0.4041 0.3741 0.4815 0.0006  -0.0275 0.0456  232 TYR A CB  
1780 C CG  . TYR A 244 ? 0.3804 0.3498 0.4623 0.0017  -0.0269 0.0529  232 TYR A CG  
1781 C CD1 . TYR A 244 ? 0.3787 0.3484 0.4638 0.0017  -0.0244 0.0613  232 TYR A CD1 
1782 C CD2 . TYR A 244 ? 0.3675 0.3361 0.4508 0.0027  -0.0288 0.0515  232 TYR A CD2 
1783 C CE1 . TYR A 244 ? 0.3750 0.3440 0.4636 0.0027  -0.0238 0.0686  232 TYR A CE1 
1784 C CE2 . TYR A 244 ? 0.3439 0.3114 0.4315 0.0038  -0.0290 0.0583  232 TYR A CE2 
1785 C CZ  . TYR A 244 ? 0.3592 0.3268 0.4484 0.0038  -0.0263 0.0671  232 TYR A CZ  
1786 O OH  . TYR A 244 ? 0.3867 0.3532 0.4784 0.0051  -0.0263 0.0744  232 TYR A OH  
1787 N N   . GLY A 245 ? 0.4375 0.4062 0.5303 -0.0015 -0.0342 0.0334  233 GLY A N   
1788 C CA  . GLY A 245 ? 0.4353 0.4041 0.5245 -0.0019 -0.0358 0.0278  233 GLY A CA  
1789 C C   . GLY A 245 ? 0.4461 0.4157 0.5221 -0.0020 -0.0356 0.0213  233 GLY A C   
1790 O O   . GLY A 245 ? 0.4345 0.4050 0.5026 -0.0018 -0.0335 0.0208  233 GLY A O   
1791 N N   . LYS A 246 ? 0.4449 0.4142 0.5188 -0.0022 -0.0378 0.0164  234 LYS A N   
1792 C CA  . LYS A 246 ? 0.4489 0.4190 0.5109 -0.0024 -0.0378 0.0105  234 LYS A CA  
1793 C C   . LYS A 246 ? 0.4265 0.3958 0.4802 -0.0028 -0.0376 0.0110  234 LYS A C   
1794 O O   . LYS A 246 ? 0.4039 0.3721 0.4644 -0.0026 -0.0399 0.0119  234 LYS A O   
1795 C CB  . LYS A 246 ? 0.4660 0.4367 0.5340 -0.0017 -0.0418 0.0027  234 LYS A CB  
1796 C CG  . LYS A 246 ? 0.5310 0.5021 0.6115 -0.0011 -0.0433 0.0017  234 LYS A CG  
1797 C CD  . LYS A 246 ? 0.5901 0.5622 0.6770 -0.0001 -0.0476 -0.0071 234 LYS A CD  
1798 C CE  . LYS A 246 ? 0.6599 0.6314 0.7652 0.0005  -0.0511 -0.0073 234 LYS A CE  
1799 N NZ  . LYS A 246 ? 0.7016 0.6732 0.8169 0.0016  -0.0565 -0.0140 234 LYS A NZ  
1800 N N   . VAL A 247 ? 0.4256 0.3952 0.4653 -0.0034 -0.0350 0.0107  235 VAL A N   
1801 C CA  . VAL A 247 ? 0.4168 0.3853 0.4472 -0.0039 -0.0348 0.0113  235 VAL A CA  
1802 C C   . VAL A 247 ? 0.4244 0.3932 0.4442 -0.0042 -0.0355 0.0056  235 VAL A C   
1803 O O   . VAL A 247 ? 0.4123 0.3825 0.4277 -0.0045 -0.0336 0.0029  235 VAL A O   
1804 C CB  . VAL A 247 ? 0.4257 0.3944 0.4488 -0.0043 -0.0309 0.0166  235 VAL A CB  
1805 C CG1 . VAL A 247 ? 0.4057 0.3731 0.4182 -0.0049 -0.0309 0.0165  235 VAL A CG1 
1806 C CG2 . VAL A 247 ? 0.4169 0.3860 0.4489 -0.0038 -0.0296 0.0228  235 VAL A CG2 
1807 N N   . LEU A 248 ? 0.4213 0.3886 0.4370 -0.0040 -0.0381 0.0037  236 LEU A N   
1808 C CA  . LEU A 248 ? 0.4288 0.3959 0.4316 -0.0044 -0.0383 0.0000  236 LEU A CA  
1809 C C   . LEU A 248 ? 0.4315 0.3966 0.4252 -0.0052 -0.0370 0.0042  236 LEU A C   
1810 O O   . LEU A 248 ? 0.4400 0.4035 0.4381 -0.0048 -0.0388 0.0070  236 LEU A O   
1811 C CB  . LEU A 248 ? 0.4310 0.3978 0.4349 -0.0032 -0.0430 -0.0058 236 LEU A CB  
1812 C CG  . LEU A 248 ? 0.4409 0.4075 0.4299 -0.0033 -0.0434 -0.0093 236 LEU A CG  
1813 C CD1 . LEU A 248 ? 0.4185 0.3880 0.4011 -0.0039 -0.0398 -0.0128 236 LEU A CD1 
1814 C CD2 . LEU A 248 ? 0.3933 0.3592 0.3826 -0.0016 -0.0488 -0.0144 236 LEU A CD2 
1815 N N   . ILE A 249 ? 0.4189 0.3842 0.4013 -0.0063 -0.0340 0.0046  237 ILE A N   
1816 C CA  . ILE A 249 ? 0.4364 0.3995 0.4098 -0.0071 -0.0333 0.0081  237 ILE A CA  
1817 C C   . ILE A 249 ? 0.4335 0.3956 0.3949 -0.0076 -0.0342 0.0052  237 ILE A C   
1818 O O   . ILE A 249 ? 0.4581 0.4220 0.4138 -0.0083 -0.0317 0.0026  237 ILE A O   
1819 C CB  . ILE A 249 ? 0.4478 0.4117 0.4187 -0.0080 -0.0289 0.0117  237 ILE A CB  
1820 C CG1 . ILE A 249 ? 0.4631 0.4283 0.4448 -0.0072 -0.0281 0.0146  237 ILE A CG1 
1821 C CG2 . ILE A 249 ? 0.4411 0.4027 0.4036 -0.0088 -0.0285 0.0149  237 ILE A CG2 
1822 C CD1 . ILE A 249 ? 0.5234 0.4894 0.5035 -0.0074 -0.0248 0.0181  237 ILE A CD1 
1823 N N   . ILE A 250 ? 0.4345 0.3938 0.3925 -0.0071 -0.0377 0.0058  238 ILE A N   
1824 C CA  . ILE A 250 ? 0.4536 0.4113 0.3989 -0.0073 -0.0392 0.0041  238 ILE A CA  
1825 C C   . ILE A 250 ? 0.4542 0.4092 0.3918 -0.0086 -0.0377 0.0092  238 ILE A C   
1826 O O   . ILE A 250 ? 0.4655 0.4181 0.4064 -0.0082 -0.0401 0.0120  238 ILE A O   
1827 C CB  . ILE A 250 ? 0.4467 0.4025 0.3933 -0.0055 -0.0452 0.0012  238 ILE A CB  
1828 C CG1 . ILE A 250 ? 0.4628 0.4213 0.4182 -0.0040 -0.0473 -0.0044 238 ILE A CG1 
1829 C CG2 . ILE A 250 ? 0.4557 0.4092 0.3875 -0.0055 -0.0470 0.0006  238 ILE A CG2 
1830 C CD1 . ILE A 250 ? 0.4783 0.4354 0.4403 -0.0019 -0.0535 -0.0075 238 ILE A CD1 
1831 N N   . ALA A 251 ? 0.4655 0.4210 0.3938 -0.0102 -0.0339 0.0101  239 ALA A N   
1832 C CA  . ALA A 251 ? 0.4649 0.4183 0.3887 -0.0117 -0.0319 0.0149  239 ALA A CA  
1833 C C   . ALA A 251 ? 0.4754 0.4289 0.3881 -0.0135 -0.0284 0.0154  239 ALA A C   
1834 O O   . ALA A 251 ? 0.4873 0.4436 0.3965 -0.0139 -0.0263 0.0119  239 ALA A O   
1835 C CB  . ALA A 251 ? 0.4555 0.4107 0.3884 -0.0118 -0.0292 0.0170  239 ALA A CB  
1836 N N   . GLY A 252 ? 0.4730 0.4237 0.3810 -0.0148 -0.0278 0.0198  240 GLY A N   
1837 C CA  . GLY A 252 ? 0.4793 0.4298 0.3786 -0.0170 -0.0239 0.0217  240 GLY A CA  
1838 C C   . GLY A 252 ? 0.4884 0.4367 0.3750 -0.0175 -0.0252 0.0221  240 GLY A C   
1839 O O   . GLY A 252 ? 0.4905 0.4378 0.3744 -0.0158 -0.0294 0.0198  240 GLY A O   
1840 N N   . SER A 253 ? 0.4983 0.4460 0.3774 -0.0197 -0.0215 0.0249  241 SER A N   
1841 C CA  . SER A 253 ? 0.5097 0.4549 0.3753 -0.0207 -0.0219 0.0270  241 SER A CA  
1842 C C   . SER A 253 ? 0.5177 0.4639 0.3793 -0.0236 -0.0159 0.0301  241 SER A C   
1843 O O   . SER A 253 ? 0.4995 0.4477 0.3696 -0.0246 -0.0125 0.0301  241 SER A O   
1844 C CB  . SER A 253 ? 0.5189 0.4582 0.3815 -0.0200 -0.0274 0.0312  241 SER A CB  
1845 O OG  . SER A 253 ? 0.5102 0.4472 0.3771 -0.0215 -0.0263 0.0357  241 SER A OG  
1846 N N   . ARG A 254 ? 0.5376 0.4823 0.3865 -0.0250 -0.0145 0.0326  242 ARG A N   
1847 C CA  . ARG A 254 ? 0.5672 0.5126 0.4127 -0.0281 -0.0085 0.0361  242 ARG A CA  
1848 C C   . ARG A 254 ? 0.5674 0.5088 0.4192 -0.0295 -0.0092 0.0415  242 ARG A C   
1849 O O   . ARG A 254 ? 0.5647 0.5076 0.4210 -0.0317 -0.0045 0.0429  242 ARG A O   
1850 C CB  . ARG A 254 ? 0.5935 0.5378 0.4234 -0.0294 -0.0068 0.0389  242 ARG A CB  
1851 C CG  . ARG A 254 ? 0.6569 0.5943 0.4797 -0.0290 -0.0123 0.0444  242 ARG A CG  
1852 C CD  . ARG A 254 ? 0.7578 0.6941 0.5637 -0.0293 -0.0120 0.0465  242 ARG A CD  
1853 N NE  . ARG A 254 ? 0.8082 0.7463 0.6087 -0.0327 -0.0046 0.0503  242 ARG A NE  
1854 C CZ  . ARG A 254 ? 0.8429 0.7765 0.6408 -0.0354 -0.0033 0.0579  242 ARG A CZ  
1855 N NH1 . ARG A 254 ? 0.8399 0.7761 0.6342 -0.0386 0.0041  0.0609  242 ARG A NH1 
1856 N NH2 . ARG A 254 ? 0.8518 0.7787 0.6516 -0.0349 -0.0093 0.0623  242 ARG A NH2 
1857 N N   . LEU A 255 ? 0.5682 0.5048 0.4213 -0.0281 -0.0152 0.0437  243 LEU A N   
1858 C CA  . LEU A 255 ? 0.5788 0.5120 0.4389 -0.0288 -0.0166 0.0477  243 LEU A CA  
1859 C C   . LEU A 255 ? 0.5503 0.4866 0.4241 -0.0278 -0.0158 0.0447  243 LEU A C   
1860 O O   . LEU A 255 ? 0.5569 0.4930 0.4370 -0.0290 -0.0139 0.0466  243 LEU A O   
1861 C CB  . LEU A 255 ? 0.5795 0.5068 0.4372 -0.0275 -0.0234 0.0507  243 LEU A CB  
1862 C CG  . LEU A 255 ? 0.6476 0.5702 0.4911 -0.0283 -0.0254 0.0551  243 LEU A CG  
1863 C CD1 . LEU A 255 ? 0.6497 0.5663 0.4946 -0.0268 -0.0329 0.0578  243 LEU A CD1 
1864 C CD2 . LEU A 255 ? 0.6519 0.5732 0.4888 -0.0320 -0.0202 0.0608  243 LEU A CD2 
1865 N N   . TYR A 256 ? 0.5248 0.4640 0.4035 -0.0254 -0.0175 0.0401  244 TYR A N   
1866 C CA  . TYR A 256 ? 0.5225 0.4640 0.4133 -0.0239 -0.0179 0.0380  244 TYR A CA  
1867 C C   . TYR A 256 ? 0.5180 0.4647 0.4128 -0.0233 -0.0148 0.0332  244 TYR A C   
1868 O O   . TYR A 256 ? 0.5234 0.4715 0.4207 -0.0213 -0.0172 0.0301  244 TYR A O   
1869 C CB  . TYR A 256 ? 0.5172 0.4566 0.4122 -0.0215 -0.0236 0.0377  244 TYR A CB  
1870 C CG  . TYR A 256 ? 0.5366 0.4706 0.4280 -0.0218 -0.0274 0.0419  244 TYR A CG  
1871 C CD1 . TYR A 256 ? 0.5478 0.4799 0.4424 -0.0229 -0.0268 0.0451  244 TYR A CD1 
1872 C CD2 . TYR A 256 ? 0.5466 0.4772 0.4317 -0.0208 -0.0322 0.0423  244 TYR A CD2 
1873 C CE1 . TYR A 256 ? 0.6113 0.5379 0.5031 -0.0233 -0.0308 0.0491  244 TYR A CE1 
1874 C CE2 . TYR A 256 ? 0.5782 0.5034 0.4600 -0.0210 -0.0363 0.0462  244 TYR A CE2 
1875 C CZ  . TYR A 256 ? 0.6099 0.5331 0.4954 -0.0223 -0.0355 0.0498  244 TYR A CZ  
1876 O OH  . TYR A 256 ? 0.6515 0.5691 0.5346 -0.0226 -0.0398 0.0537  244 TYR A OH  
1877 N N   . SER A 257 ? 0.5012 0.4509 0.3979 -0.0248 -0.0099 0.0324  245 SER A N   
1878 C CA  . SER A 257 ? 0.5026 0.4572 0.4027 -0.0244 -0.0070 0.0277  245 SER A CA  
1879 C C   . SER A 257 ? 0.5017 0.4588 0.4129 -0.0228 -0.0071 0.0258  245 SER A C   
1880 O O   . SER A 257 ? 0.5219 0.4824 0.4373 -0.0218 -0.0062 0.0219  245 SER A O   
1881 C CB  . SER A 257 ? 0.5120 0.4689 0.4085 -0.0269 -0.0014 0.0273  245 SER A CB  
1882 O OG  . SER A 257 ? 0.5044 0.4601 0.4042 -0.0286 0.0005  0.0306  245 SER A OG  
1883 N N   . GLY A 258 ? 0.4881 0.4433 0.4039 -0.0223 -0.0085 0.0284  246 GLY A N   
1884 C CA  . GLY A 258 ? 0.4772 0.4350 0.4023 -0.0205 -0.0084 0.0269  246 GLY A CA  
1885 C C   . GLY A 258 ? 0.4748 0.4328 0.4042 -0.0181 -0.0117 0.0263  246 GLY A C   
1886 O O   . GLY A 258 ? 0.4647 0.4255 0.4004 -0.0166 -0.0112 0.0245  246 GLY A O   
1887 N N   . ALA A 259 ? 0.4558 0.4108 0.3823 -0.0176 -0.0152 0.0280  247 ALA A N   
1888 C CA  . ALA A 259 ? 0.4664 0.4217 0.3983 -0.0155 -0.0181 0.0277  247 ALA A CA  
1889 C C   . ALA A 259 ? 0.4645 0.4228 0.4012 -0.0144 -0.0178 0.0247  247 ALA A C   
1890 O O   . ALA A 259 ? 0.4740 0.4340 0.4178 -0.0128 -0.0180 0.0249  247 ALA A O   
1891 C CB  . ALA A 259 ? 0.4672 0.4187 0.3952 -0.0153 -0.0222 0.0292  247 ALA A CB  
1892 N N   . PRO A 260 ? 0.4761 0.4353 0.4092 -0.0150 -0.0171 0.0218  248 PRO A N   
1893 C CA  . PRO A 260 ? 0.4685 0.4303 0.4072 -0.0139 -0.0174 0.0184  248 PRO A CA  
1894 C C   . PRO A 260 ? 0.4617 0.4265 0.4075 -0.0132 -0.0151 0.0177  248 PRO A C   
1895 O O   . PRO A 260 ? 0.4484 0.4146 0.4016 -0.0118 -0.0162 0.0169  248 PRO A O   
1896 C CB  . PRO A 260 ? 0.4809 0.4437 0.4132 -0.0150 -0.0162 0.0150  248 PRO A CB  
1897 C CG  . PRO A 260 ? 0.4859 0.4456 0.4081 -0.0163 -0.0167 0.0174  248 PRO A CG  
1898 C CD  . PRO A 260 ? 0.4872 0.4453 0.4109 -0.0169 -0.0158 0.0214  248 PRO A CD  
1899 N N   . VAL A 261 ? 0.4471 0.4128 0.3910 -0.0143 -0.0121 0.0181  249 VAL A N   
1900 C CA  . VAL A 261 ? 0.4488 0.4171 0.3982 -0.0137 -0.0101 0.0170  249 VAL A CA  
1901 C C   . VAL A 261 ? 0.4364 0.4047 0.3911 -0.0117 -0.0114 0.0198  249 VAL A C   
1902 O O   . VAL A 261 ? 0.4255 0.3956 0.3859 -0.0103 -0.0114 0.0193  249 VAL A O   
1903 C CB  . VAL A 261 ? 0.4559 0.4246 0.4023 -0.0153 -0.0070 0.0169  249 VAL A CB  
1904 C CG1 . VAL A 261 ? 0.4675 0.4391 0.4198 -0.0145 -0.0054 0.0147  249 VAL A CG1 
1905 C CG2 . VAL A 261 ? 0.4630 0.4314 0.4022 -0.0175 -0.0052 0.0155  249 VAL A CG2 
1906 N N   . LEU A 262 ? 0.4175 0.3838 0.3699 -0.0117 -0.0124 0.0226  250 LEU A N   
1907 C CA  . LEU A 262 ? 0.4159 0.3829 0.3727 -0.0097 -0.0132 0.0250  250 LEU A CA  
1908 C C   . LEU A 262 ? 0.4102 0.3775 0.3717 -0.0085 -0.0150 0.0258  250 LEU A C   
1909 O O   . LEU A 262 ? 0.4068 0.3759 0.3732 -0.0069 -0.0147 0.0269  250 LEU A O   
1910 C CB  . LEU A 262 ? 0.4192 0.3844 0.3734 -0.0099 -0.0141 0.0271  250 LEU A CB  
1911 C CG  . LEU A 262 ? 0.4332 0.3980 0.3846 -0.0111 -0.0125 0.0267  250 LEU A CG  
1912 C CD1 . LEU A 262 ? 0.4005 0.3626 0.3497 -0.0115 -0.0141 0.0289  250 LEU A CD1 
1913 C CD2 . LEU A 262 ? 0.4257 0.3934 0.3812 -0.0095 -0.0111 0.0257  250 LEU A CD2 
1914 N N   . SER A 263 ? 0.4201 0.3855 0.3802 -0.0092 -0.0170 0.0252  251 SER A N   
1915 C CA  . SER A 263 ? 0.4284 0.3941 0.3946 -0.0082 -0.0189 0.0256  251 SER A CA  
1916 C C   . SER A 263 ? 0.4296 0.3973 0.4015 -0.0076 -0.0183 0.0239  251 SER A C   
1917 O O   . SER A 263 ? 0.3935 0.3624 0.3723 -0.0063 -0.0184 0.0258  251 SER A O   
1918 C CB  . SER A 263 ? 0.4402 0.4033 0.4040 -0.0088 -0.0219 0.0245  251 SER A CB  
1919 O OG  . SER A 263 ? 0.4473 0.4082 0.4081 -0.0089 -0.0233 0.0267  251 SER A OG  
1920 N N   . GLY A 264 ? 0.4357 0.4038 0.4050 -0.0085 -0.0176 0.0205  252 GLY A N   
1921 C CA  . GLY A 264 ? 0.4382 0.4083 0.4135 -0.0080 -0.0173 0.0182  252 GLY A CA  
1922 C C   . GLY A 264 ? 0.4247 0.3965 0.4043 -0.0067 -0.0159 0.0202  252 GLY A C   
1923 O O   . GLY A 264 ? 0.4119 0.3844 0.3988 -0.0055 -0.0167 0.0213  252 GLY A O   
1924 N N   . MET A 265 ? 0.4300 0.4023 0.4054 -0.0068 -0.0139 0.0208  253 MET A N   
1925 C CA  . MET A 265 ? 0.4315 0.4055 0.4100 -0.0051 -0.0130 0.0225  253 MET A CA  
1926 C C   . MET A 265 ? 0.4228 0.3971 0.4039 -0.0035 -0.0135 0.0268  253 MET A C   
1927 O O   . MET A 265 ? 0.4064 0.3820 0.3913 -0.0018 -0.0132 0.0288  253 MET A O   
1928 C CB  . MET A 265 ? 0.4470 0.4217 0.4211 -0.0053 -0.0113 0.0214  253 MET A CB  
1929 C CG  . MET A 265 ? 0.4854 0.4607 0.4587 -0.0068 -0.0101 0.0172  253 MET A CG  
1930 S SD  . MET A 265 ? 0.5734 0.5504 0.5541 -0.0058 -0.0108 0.0146  253 MET A SD  
1931 C CE  . MET A 265 ? 0.3991 0.3768 0.3827 -0.0029 -0.0114 0.0184  253 MET A CE  
1932 N N   . GLY A 266 ? 0.4256 0.3987 0.4047 -0.0039 -0.0141 0.0283  254 GLY A N   
1933 C CA  . GLY A 266 ? 0.4239 0.3977 0.4065 -0.0026 -0.0142 0.0321  254 GLY A CA  
1934 C C   . GLY A 266 ? 0.4114 0.3856 0.4018 -0.0021 -0.0149 0.0335  254 GLY A C   
1935 O O   . GLY A 266 ? 0.4110 0.3867 0.4051 -0.0007 -0.0140 0.0369  254 GLY A O   
1936 N N   . SER A 267 ? 0.4095 0.3823 0.4026 -0.0032 -0.0167 0.0309  255 SER A N   
1937 C CA  . SER A 267 ? 0.4058 0.3788 0.4080 -0.0029 -0.0178 0.0318  255 SER A CA  
1938 C C   . SER A 267 ? 0.4067 0.3808 0.4116 -0.0019 -0.0171 0.0320  255 SER A C   
1939 O O   . SER A 267 ? 0.3978 0.3724 0.4092 -0.0010 -0.0171 0.0355  255 SER A O   
1940 C CB  . SER A 267 ? 0.4069 0.3784 0.4116 -0.0039 -0.0204 0.0277  255 SER A CB  
1941 O OG  . SER A 267 ? 0.4349 0.4049 0.4370 -0.0046 -0.0219 0.0271  255 SER A OG  
1942 N N   . LEU A 268 ? 0.4070 0.3814 0.4075 -0.0022 -0.0166 0.0285  256 LEU A N   
1943 C CA  . LEU A 268 ? 0.4085 0.3839 0.4126 -0.0012 -0.0166 0.0282  256 LEU A CA  
1944 C C   . LEU A 268 ? 0.4062 0.3827 0.4092 0.0006  -0.0153 0.0327  256 LEU A C   
1945 O O   . LEU A 268 ? 0.3906 0.3674 0.3988 0.0018  -0.0159 0.0351  256 LEU A O   
1946 C CB  . LEU A 268 ? 0.4142 0.3901 0.4149 -0.0019 -0.0162 0.0230  256 LEU A CB  
1947 C CG  . LEU A 268 ? 0.4360 0.4117 0.4392 -0.0033 -0.0175 0.0179  256 LEU A CG  
1948 C CD1 . LEU A 268 ? 0.4333 0.4102 0.4320 -0.0041 -0.0159 0.0133  256 LEU A CD1 
1949 C CD2 . LEU A 268 ? 0.3992 0.3748 0.4127 -0.0026 -0.0198 0.0171  256 LEU A CD2 
1950 N N   . LYS A 269 ? 0.3948 0.3721 0.3912 0.0010  -0.0138 0.0337  257 LYS A N   
1951 C CA  . LYS A 269 ? 0.4015 0.3804 0.3955 0.0033  -0.0127 0.0370  257 LYS A CA  
1952 C C   . LYS A 269 ? 0.3905 0.3702 0.3885 0.0044  -0.0121 0.0428  257 LYS A C   
1953 O O   . LYS A 269 ? 0.3939 0.3751 0.3905 0.0065  -0.0112 0.0460  257 LYS A O   
1954 C CB  . LYS A 269 ? 0.4177 0.3975 0.4047 0.0036  -0.0116 0.0361  257 LYS A CB  
1955 C CG  . LYS A 269 ? 0.4550 0.4344 0.4382 0.0029  -0.0117 0.0315  257 LYS A CG  
1956 C CD  . LYS A 269 ? 0.5312 0.5116 0.5156 0.0045  -0.0122 0.0302  257 LYS A CD  
1957 C CE  . LYS A 269 ? 0.6003 0.5812 0.5816 0.0042  -0.0118 0.0261  257 LYS A CE  
1958 N NZ  . LYS A 269 ? 0.6165 0.5988 0.5983 0.0067  -0.0127 0.0254  257 LYS A NZ  
1959 N N   . VAL A 270 ? 0.3873 0.3662 0.3904 0.0031  -0.0124 0.0441  258 VAL A N   
1960 C CA  . VAL A 270 ? 0.3864 0.3663 0.3949 0.0039  -0.0113 0.0498  258 VAL A CA  
1961 C C   . VAL A 270 ? 0.3982 0.3769 0.4158 0.0037  -0.0126 0.0517  258 VAL A C   
1962 O O   . VAL A 270 ? 0.3815 0.3608 0.4053 0.0039  -0.0117 0.0566  258 VAL A O   
1963 C CB  . VAL A 270 ? 0.3890 0.3690 0.3996 0.0029  -0.0109 0.0506  258 VAL A CB  
1964 C CG1 . VAL A 270 ? 0.3529 0.3342 0.3554 0.0035  -0.0097 0.0495  258 VAL A CG1 
1965 C CG2 . VAL A 270 ? 0.3463 0.3237 0.3618 0.0008  -0.0136 0.0468  258 VAL A CG2 
1966 N N   . GLY A 271 ? 0.3987 0.3760 0.4180 0.0031  -0.0147 0.0475  259 GLY A N   
1967 C CA  . GLY A 271 ? 0.4167 0.3928 0.4449 0.0033  -0.0165 0.0485  259 GLY A CA  
1968 C C   . GLY A 271 ? 0.4105 0.3850 0.4474 0.0017  -0.0190 0.0453  259 GLY A C   
1969 O O   . GLY A 271 ? 0.4170 0.3905 0.4637 0.0017  -0.0207 0.0468  259 GLY A O   
1970 N N   . THR A 272 ? 0.4119 0.3860 0.4453 0.0004  -0.0195 0.0407  260 THR A N   
1971 C CA  . THR A 272 ? 0.4160 0.3889 0.4561 -0.0006 -0.0223 0.0363  260 THR A CA  
1972 C C   . THR A 272 ? 0.4150 0.3877 0.4579 -0.0006 -0.0242 0.0313  260 THR A C   
1973 O O   . THR A 272 ? 0.4184 0.3919 0.4551 -0.0002 -0.0232 0.0293  260 THR A O   
1974 C CB  . THR A 272 ? 0.4299 0.4025 0.4641 -0.0017 -0.0226 0.0326  260 THR A CB  
1975 O OG1 . THR A 272 ? 0.4478 0.4208 0.4794 -0.0016 -0.0209 0.0370  260 THR A OG1 
1976 C CG2 . THR A 272 ? 0.4082 0.3797 0.4497 -0.0024 -0.0259 0.0287  260 THR A CG2 
1977 N N   . GLY A 273 ? 0.4054 0.3773 0.4589 -0.0008 -0.0271 0.0291  261 GLY A N   
1978 C CA  . GLY A 273 ? 0.4278 0.3998 0.4859 -0.0005 -0.0292 0.0242  261 GLY A CA  
1979 C C   . GLY A 273 ? 0.4330 0.4063 0.4848 -0.0011 -0.0294 0.0164  261 GLY A C   
1980 O O   . GLY A 273 ? 0.4347 0.4091 0.4846 -0.0009 -0.0290 0.0127  261 GLY A O   
1981 N N   . LEU A 274 ? 0.4856 0.4205 0.4734 0.0230  -0.0440 0.0343  262 LEU A N   
1982 C CA  . LEU A 274 ? 0.4859 0.4232 0.4739 0.0245  -0.0437 0.0220  262 LEU A CA  
1983 C C   . LEU A 274 ? 0.4787 0.4223 0.4615 0.0177  -0.0423 0.0161  262 LEU A C   
1984 O O   . LEU A 274 ? 0.4715 0.4105 0.4546 0.0117  -0.0421 0.0177  262 LEU A O   
1985 C CB  . LEU A 274 ? 0.5115 0.4319 0.5058 0.0268  -0.0442 0.0163  262 LEU A CB  
1986 C CG  . LEU A 274 ? 0.5457 0.4686 0.5401 0.0311  -0.0430 0.0041  262 LEU A CG  
1987 C CD1 . LEU A 274 ? 0.5851 0.5213 0.5823 0.0396  -0.0427 0.0052  262 LEU A CD1 
1988 C CD2 . LEU A 274 ? 0.5996 0.5033 0.5993 0.0333  -0.0434 -0.0023 262 LEU A CD2 
1989 N N   . VAL A 275 ? 0.4736 0.4282 0.4526 0.0186  -0.0412 0.0101  263 VAL A N   
1990 C CA  . VAL A 275 ? 0.4742 0.4333 0.4479 0.0133  -0.0398 0.0054  263 VAL A CA  
1991 C C   . VAL A 275 ? 0.4772 0.4375 0.4491 0.0146  -0.0384 -0.0032 263 VAL A C   
1992 O O   . VAL A 275 ? 0.4575 0.4243 0.4314 0.0190  -0.0371 -0.0058 263 VAL A O   
1993 C CB  . VAL A 275 ? 0.4813 0.4517 0.4506 0.0113  -0.0387 0.0080  263 VAL A CB  
1994 C CG1 . VAL A 275 ? 0.4738 0.4452 0.4390 0.0068  -0.0372 0.0044  263 VAL A CG1 
1995 C CG2 . VAL A 275 ? 0.4904 0.4615 0.4596 0.0107  -0.0391 0.0166  263 VAL A CG2 
1996 N N   . LYS A 276 ? 0.4744 0.4295 0.4428 0.0110  -0.0387 -0.0074 264 LYS A N   
1997 C CA  . LYS A 276 ? 0.5002 0.4565 0.4634 0.0115  -0.0371 -0.0151 264 LYS A CA  
1998 C C   . LYS A 276 ? 0.4723 0.4335 0.4289 0.0073  -0.0365 -0.0144 264 LYS A C   
1999 O O   . LYS A 276 ? 0.4735 0.4328 0.4303 0.0039  -0.0388 -0.0115 264 LYS A O   
2000 C CB  . LYS A 276 ? 0.5174 0.4627 0.4802 0.0114  -0.0393 -0.0213 264 LYS A CB  
2001 C CG  . LYS A 276 ? 0.6046 0.5429 0.5727 0.0172  -0.0387 -0.0252 264 LYS A CG  
2002 C CD  . LYS A 276 ? 0.6773 0.6024 0.6443 0.0164  -0.0410 -0.0341 264 LYS A CD  
2003 C CE  . LYS A 276 ? 0.7528 0.6756 0.7185 0.0235  -0.0379 -0.0441 264 LYS A CE  
2004 N NZ  . LYS A 276 ? 0.8025 0.7076 0.7756 0.0276  -0.0393 -0.0497 264 LYS A NZ  
2005 N N   . LEU A 277 ? 0.4689 0.4368 0.4208 0.0077  -0.0331 -0.0163 265 LEU A N   
2006 C CA  . LEU A 277 ? 0.4625 0.4327 0.4071 0.0045  -0.0321 -0.0151 265 LEU A CA  
2007 C C   . LEU A 277 ? 0.4614 0.4310 0.3974 0.0051  -0.0313 -0.0201 265 LEU A C   
2008 O O   . LEU A 277 ? 0.4828 0.4533 0.4183 0.0081  -0.0289 -0.0255 265 LEU A O   
2009 C CB  . LEU A 277 ? 0.4528 0.4294 0.3979 0.0032  -0.0283 -0.0125 265 LEU A CB  
2010 C CG  . LEU A 277 ? 0.4609 0.4416 0.4130 0.0033  -0.0286 -0.0100 265 LEU A CG  
2011 C CD1 . LEU A 277 ? 0.4457 0.4327 0.3980 0.0009  -0.0249 -0.0105 265 LEU A CD1 
2012 C CD2 . LEU A 277 ? 0.3985 0.3769 0.3518 0.0022  -0.0310 -0.0059 265 LEU A CD2 
2013 N N   . ALA A 278 ? 0.4629 0.4316 0.3918 0.0030  -0.0336 -0.0187 266 ALA A N   
2014 C CA  . ALA A 278 ? 0.4680 0.4385 0.3848 0.0034  -0.0328 -0.0217 266 ALA A CA  
2015 C C   . ALA A 278 ? 0.4624 0.4357 0.3738 0.0019  -0.0300 -0.0145 266 ALA A C   
2016 O O   . ALA A 278 ? 0.4830 0.4549 0.3965 0.0009  -0.0328 -0.0094 266 ALA A O   
2017 C CB  . ALA A 278 ? 0.4738 0.4415 0.3862 0.0026  -0.0394 -0.0258 266 ALA A CB  
2018 N N   . VAL A 279 ? 0.4573 0.4344 0.3638 0.0019  -0.0238 -0.0140 267 VAL A N   
2019 C CA  . VAL A 279 ? 0.4602 0.4378 0.3636 -0.0002 -0.0196 -0.0069 267 VAL A CA  
2020 C C   . VAL A 279 ? 0.4741 0.4560 0.3648 0.0000  -0.0145 -0.0067 267 VAL A C   
2021 O O   . VAL A 279 ? 0.4777 0.4647 0.3671 0.0016  -0.0112 -0.0131 267 VAL A O   
2022 C CB  . VAL A 279 ? 0.4537 0.4332 0.3683 -0.0025 -0.0154 -0.0060 267 VAL A CB  
2023 C CG1 . VAL A 279 ? 0.4694 0.4469 0.3821 -0.0061 -0.0106 0.0004  267 VAL A CG1 
2024 C CG2 . VAL A 279 ? 0.4319 0.4086 0.3563 -0.0022 -0.0200 -0.0063 267 VAL A CG2 
2025 N N   . PRO A 280 ? 0.4875 0.4674 0.3683 -0.0009 -0.0134 0.0009  268 PRO A N   
2026 C CA  . PRO A 280 ? 0.5023 0.4870 0.3691 -0.0010 -0.0074 0.0033  268 PRO A CA  
2027 C C   . PRO A 280 ? 0.5032 0.4944 0.3763 -0.0037 0.0021  0.0021  268 PRO A C   
2028 O O   . PRO A 280 ? 0.4786 0.4683 0.3640 -0.0074 0.0050  0.0051  268 PRO A O   
2029 C CB  . PRO A 280 ? 0.5145 0.4936 0.3736 -0.0018 -0.0077 0.0149  268 PRO A CB  
2030 C CG  . PRO A 280 ? 0.5230 0.4967 0.3890 0.0002  -0.0170 0.0153  268 PRO A CG  
2031 C CD  . PRO A 280 ? 0.4901 0.4635 0.3719 -0.0010 -0.0175 0.0085  268 PRO A CD  
2032 N N   . PHE A 281 ? 0.5068 0.5064 0.3715 -0.0018 0.0071  -0.0027 269 PHE A N   
2033 C CA  . PHE A 281 ? 0.5073 0.5171 0.3776 -0.0038 0.0174  -0.0034 269 PHE A CA  
2034 C C   . PHE A 281 ? 0.5247 0.5340 0.3905 -0.0094 0.0247  0.0082  269 PHE A C   
2035 O O   . PHE A 281 ? 0.5349 0.5400 0.3839 -0.0088 0.0241  0.0154  269 PHE A O   
2036 C CB  . PHE A 281 ? 0.5077 0.5269 0.3673 0.0007  0.0218  -0.0118 269 PHE A CB  
2037 C CG  . PHE A 281 ? 0.5160 0.5489 0.3831 -0.0004 0.0332  -0.0131 269 PHE A CG  
2038 C CD1 . PHE A 281 ? 0.5063 0.5458 0.3930 0.0012  0.0340  -0.0198 269 PHE A CD1 
2039 C CD2 . PHE A 281 ? 0.5835 0.6242 0.4387 -0.0032 0.0432  -0.0065 269 PHE A CD2 
2040 C CE1 . PHE A 281 ? 0.5577 0.6132 0.4544 0.0003  0.0443  -0.0209 269 PHE A CE1 
2041 C CE2 . PHE A 281 ? 0.5678 0.6239 0.4321 -0.0050 0.0547  -0.0073 269 PHE A CE2 
2042 C CZ  . PHE A 281 ? 0.5763 0.6408 0.4623 -0.0031 0.0552  -0.0151 269 PHE A CZ  
2043 N N   . PRO A 282 ? 0.5228 0.5371 0.4034 -0.0149 0.0316  0.0104  270 PRO A N   
2044 C CA  . PRO A 282 ? 0.5191 0.5424 0.4201 -0.0159 0.0327  0.0032  270 PRO A CA  
2045 C C   . PRO A 282 ? 0.5017 0.5168 0.4163 -0.0184 0.0257  0.0032  270 PRO A C   
2046 O O   . PRO A 282 ? 0.4968 0.5200 0.4279 -0.0202 0.0260  -0.0011 270 PRO A O   
2047 C CB  . PRO A 282 ? 0.5302 0.5652 0.4376 -0.0224 0.0445  0.0076  270 PRO A CB  
2048 C CG  . PRO A 282 ? 0.5523 0.5755 0.4496 -0.0282 0.0475  0.0203  270 PRO A CG  
2049 C CD  . PRO A 282 ? 0.5501 0.5627 0.4265 -0.0214 0.0399  0.0221  270 PRO A CD  
2050 N N   . GLN A 283 ? 0.5059 0.5070 0.4140 -0.0178 0.0193  0.0075  271 GLN A N   
2051 C CA  . GLN A 283 ? 0.4910 0.4843 0.4100 -0.0200 0.0141  0.0074  271 GLN A CA  
2052 C C   . GLN A 283 ? 0.4788 0.4765 0.4065 -0.0159 0.0079  -0.0005 271 GLN A C   
2053 O O   . GLN A 283 ? 0.4645 0.4619 0.4031 -0.0180 0.0052  -0.0024 271 GLN A O   
2054 C CB  . GLN A 283 ? 0.5104 0.4892 0.4216 -0.0190 0.0096  0.0138  271 GLN A CB  
2055 C CG  . GLN A 283 ? 0.5155 0.4856 0.4219 -0.0236 0.0153  0.0239  271 GLN A CG  
2056 C CD  . GLN A 283 ? 0.5550 0.5289 0.4463 -0.0228 0.0206  0.0300  271 GLN A CD  
2057 O OE1 . GLN A 283 ? 0.5654 0.5436 0.4449 -0.0172 0.0169  0.0275  271 GLN A OE1 
2058 N NE2 . GLN A 283 ? 0.5198 0.4921 0.4105 -0.0288 0.0292  0.0379  271 GLN A NE2 
2059 N N   . ASN A 284 ? 0.4713 0.4725 0.3939 -0.0102 0.0059  -0.0055 272 ASN A N   
2060 C CA  . ASN A 284 ? 0.4638 0.4676 0.3949 -0.0058 0.0009  -0.0119 272 ASN A CA  
2061 C C   . ASN A 284 ? 0.4483 0.4643 0.3944 -0.0066 0.0034  -0.0150 272 ASN A C   
2062 O O   . ASN A 284 ? 0.4311 0.4480 0.3857 -0.0043 -0.0017 -0.0173 272 ASN A O   
2063 C CB  . ASN A 284 ? 0.4646 0.4680 0.3889 0.0001  -0.0009 -0.0177 272 ASN A CB  
2064 C CG  . ASN A 284 ? 0.4462 0.4600 0.3686 0.0020  0.0064  -0.0216 272 ASN A CG  
2065 O OD1 . ASN A 284 ? 0.4419 0.4591 0.3563 -0.0011 0.0126  -0.0175 272 ASN A OD1 
2066 N ND2 . ASN A 284 ? 0.3904 0.4094 0.3203 0.0075  0.0066  -0.0287 272 ASN A ND2 
2067 N N   . LEU A 285 ? 0.4486 0.4749 0.3983 -0.0099 0.0110  -0.0145 273 LEU A N   
2068 C CA  . LEU A 285 ? 0.4635 0.5055 0.4299 -0.0108 0.0132  -0.0178 273 LEU A CA  
2069 C C   . LEU A 285 ? 0.4673 0.5101 0.4441 -0.0167 0.0097  -0.0166 273 LEU A C   
2070 O O   . LEU A 285 ? 0.4501 0.5053 0.4404 -0.0158 0.0070  -0.0201 273 LEU A O   
2071 C CB  . LEU A 285 ? 0.4858 0.5419 0.4552 -0.0130 0.0233  -0.0178 273 LEU A CB  
2072 C CG  . LEU A 285 ? 0.5158 0.5745 0.4765 -0.0050 0.0263  -0.0224 273 LEU A CG  
2073 C CD1 . LEU A 285 ? 0.5763 0.6509 0.5392 -0.0071 0.0378  -0.0221 273 LEU A CD1 
2074 C CD2 . LEU A 285 ? 0.5397 0.6009 0.5093 0.0039  0.0207  -0.0293 273 LEU A CD2 
2075 N N   . ILE A 286 ? 0.4728 0.5020 0.4426 -0.0215 0.0086  -0.0124 274 ILE A N   
2076 C CA  . ILE A 286 ? 0.4862 0.5123 0.4626 -0.0266 0.0050  -0.0129 274 ILE A CA  
2077 C C   . ILE A 286 ? 0.4740 0.5028 0.4541 -0.0215 -0.0028 -0.0166 274 ILE A C   
2078 O O   . ILE A 286 ? 0.4492 0.4862 0.4386 -0.0245 -0.0058 -0.0197 274 ILE A O   
2079 C CB  . ILE A 286 ? 0.5078 0.5153 0.4742 -0.0298 0.0053  -0.0078 274 ILE A CB  
2080 C CG1 . ILE A 286 ? 0.5293 0.5344 0.4939 -0.0360 0.0134  -0.0025 274 ILE A CG1 
2081 C CG2 . ILE A 286 ? 0.5222 0.5230 0.4927 -0.0331 0.0011  -0.0101 274 ILE A CG2 
2082 C CD1 . ILE A 286 ? 0.5217 0.5397 0.4999 -0.0429 0.0177  -0.0048 274 ILE A CD1 
2083 N N   . ALA A 287 ? 0.4514 0.4736 0.4238 -0.0145 -0.0063 -0.0159 275 ALA A N   
2084 C CA  . ALA A 287 ? 0.4379 0.4586 0.4113 -0.0105 -0.0132 -0.0167 275 ALA A CA  
2085 C C   . ALA A 287 ? 0.4370 0.4723 0.4212 -0.0068 -0.0157 -0.0194 275 ALA A C   
2086 O O   . ALA A 287 ? 0.4382 0.4787 0.4263 -0.0068 -0.0204 -0.0200 275 ALA A O   
2087 C CB  . ALA A 287 ? 0.4204 0.4304 0.3853 -0.0054 -0.0158 -0.0149 275 ALA A CB  
2088 N N   . THR A 288 ? 0.4381 0.4810 0.4267 -0.0029 -0.0124 -0.0212 276 THR A N   
2089 C CA  . THR A 288 ? 0.4407 0.4974 0.4409 0.0030  -0.0148 -0.0232 276 THR A CA  
2090 C C   . THR A 288 ? 0.4431 0.5188 0.4568 -0.0015 -0.0135 -0.0254 276 THR A C   
2091 O O   . THR A 288 ? 0.4392 0.5287 0.4635 0.0023  -0.0177 -0.0265 276 THR A O   
2092 C CB  . THR A 288 ? 0.4505 0.5071 0.4510 0.0104  -0.0113 -0.0255 276 THR A CB  
2093 O OG1 . THR A 288 ? 0.4748 0.5337 0.4715 0.0064  -0.0033 -0.0268 276 THR A OG1 
2094 C CG2 . THR A 288 ? 0.4296 0.4683 0.4199 0.0150  -0.0148 -0.0244 276 THR A CG2 
2095 N N   . SER A 289 ? 0.4594 0.5367 0.4738 -0.0103 -0.0078 -0.0258 277 SER A N   
2096 C CA  . SER A 289 ? 0.4777 0.5717 0.5061 -0.0171 -0.0077 -0.0283 277 SER A CA  
2097 C C   . SER A 289 ? 0.4799 0.5731 0.5081 -0.0204 -0.0156 -0.0298 277 SER A C   
2098 O O   . SER A 289 ? 0.4912 0.6016 0.5316 -0.0231 -0.0194 -0.0332 277 SER A O   
2099 C CB  . SER A 289 ? 0.5013 0.5942 0.5308 -0.0273 0.0007  -0.0273 277 SER A CB  
2100 O OG  . SER A 289 ? 0.5527 0.6265 0.5713 -0.0329 0.0001  -0.0251 277 SER A OG  
2101 N N   . ARG A 290 ? 0.4841 0.5593 0.4988 -0.0201 -0.0182 -0.0279 278 ARG A N   
2102 C CA  . ARG A 290 ? 0.5049 0.5797 0.5171 -0.0226 -0.0248 -0.0303 278 ARG A CA  
2103 C C   . ARG A 290 ? 0.4806 0.5606 0.4905 -0.0131 -0.0321 -0.0281 278 ARG A C   
2104 O O   . ARG A 290 ? 0.4649 0.5591 0.4796 -0.0127 -0.0382 -0.0302 278 ARG A O   
2105 C CB  . ARG A 290 ? 0.5244 0.5781 0.5240 -0.0260 -0.0225 -0.0289 278 ARG A CB  
2106 C CG  . ARG A 290 ? 0.6170 0.6660 0.6105 -0.0276 -0.0272 -0.0319 278 ARG A CG  
2107 C CD  . ARG A 290 ? 0.7169 0.7677 0.7163 -0.0377 -0.0266 -0.0386 278 ARG A CD  
2108 N NE  . ARG A 290 ? 0.7809 0.8540 0.7932 -0.0403 -0.0305 -0.0429 278 ARG A NE  
2109 C CZ  . ARG A 290 ? 0.8508 0.9378 0.8632 -0.0373 -0.0384 -0.0459 278 ARG A CZ  
2110 N NH1 . ARG A 290 ? 0.8640 0.9441 0.8632 -0.0320 -0.0421 -0.0448 278 ARG A NH1 
2111 N NH2 . ARG A 290 ? 0.8813 0.9912 0.9075 -0.0394 -0.0427 -0.0495 278 ARG A NH2 
2112 N N   . PHE A 291 ? 0.4528 0.5209 0.4552 -0.0062 -0.0312 -0.0235 279 PHE A N   
2113 C CA  . PHE A 291 ? 0.4549 0.5238 0.4557 0.0024  -0.0364 -0.0196 279 PHE A CA  
2114 C C   . PHE A 291 ? 0.4352 0.5010 0.4395 0.0098  -0.0339 -0.0178 279 PHE A C   
2115 O O   . PHE A 291 ? 0.4194 0.4702 0.4162 0.0107  -0.0311 -0.0165 279 PHE A O   
2116 C CB  . PHE A 291 ? 0.4563 0.5104 0.4443 0.0026  -0.0379 -0.0161 279 PHE A CB  
2117 C CG  . PHE A 291 ? 0.5000 0.5554 0.4829 -0.0033 -0.0395 -0.0192 279 PHE A CG  
2118 C CD1 . PHE A 291 ? 0.5597 0.6292 0.5439 -0.0031 -0.0453 -0.0210 279 PHE A CD1 
2119 C CD2 . PHE A 291 ? 0.5377 0.5802 0.5142 -0.0084 -0.0356 -0.0208 279 PHE A CD2 
2120 C CE1 . PHE A 291 ? 0.6161 0.6863 0.5944 -0.0085 -0.0467 -0.0260 279 PHE A CE1 
2121 C CE2 . PHE A 291 ? 0.5814 0.6234 0.5536 -0.0129 -0.0366 -0.0251 279 PHE A CE2 
2122 C CZ  . PHE A 291 ? 0.5589 0.6144 0.5315 -0.0133 -0.0419 -0.0285 279 PHE A CZ  
2123 N N   . PRO A 292 ? 0.4357 0.5163 0.4518 0.0157  -0.0356 -0.0183 280 PRO A N   
2124 C CA  . PRO A 292 ? 0.4391 0.5174 0.4600 0.0238  -0.0327 -0.0185 280 PRO A CA  
2125 C C   . PRO A 292 ? 0.4508 0.5136 0.4661 0.0313  -0.0361 -0.0137 280 PRO A C   
2126 O O   . PRO A 292 ? 0.4528 0.5082 0.4701 0.0374  -0.0336 -0.0150 280 PRO A O   
2127 C CB  . PRO A 292 ? 0.4464 0.5479 0.4842 0.0282  -0.0339 -0.0205 280 PRO A CB  
2128 C CG  . PRO A 292 ? 0.4447 0.5599 0.4853 0.0235  -0.0400 -0.0202 280 PRO A CG  
2129 C CD  . PRO A 292 ? 0.4248 0.5274 0.4522 0.0141  -0.0396 -0.0206 280 PRO A CD  
2130 N N   . GLU A 293 ? 0.4543 0.5125 0.4628 0.0303  -0.0411 -0.0085 281 GLU A N   
2131 C CA  . GLU A 293 ? 0.4762 0.5188 0.4789 0.0350  -0.0437 -0.0021 281 GLU A CA  
2132 C C   . GLU A 293 ? 0.4560 0.4802 0.4512 0.0316  -0.0397 -0.0038 281 GLU A C   
2133 O O   . GLU A 293 ? 0.4660 0.4766 0.4606 0.0353  -0.0403 -0.0012 281 GLU A O   
2134 C CB  . GLU A 293 ? 0.4897 0.5338 0.4848 0.0327  -0.0481 0.0036  281 GLU A CB  
2135 C CG  . GLU A 293 ? 0.5367 0.5993 0.5363 0.0361  -0.0538 0.0057  281 GLU A CG  
2136 C CD  . GLU A 293 ? 0.5649 0.6415 0.5640 0.0283  -0.0543 -0.0006 281 GLU A CD  
2137 O OE1 . GLU A 293 ? 0.6383 0.7240 0.6320 0.0270  -0.0591 0.0008  281 GLU A OE1 
2138 O OE2 . GLU A 293 ? 0.5427 0.6208 0.5461 0.0230  -0.0497 -0.0071 281 GLU A OE2 
2139 N N   . LEU A 294 ? 0.4513 0.4748 0.4410 0.0241  -0.0364 -0.0076 282 LEU A N   
2140 C CA  . LEU A 294 ? 0.4480 0.4574 0.4303 0.0208  -0.0337 -0.0090 282 LEU A CA  
2141 C C   . LEU A 294 ? 0.4534 0.4591 0.4374 0.0242  -0.0303 -0.0144 282 LEU A C   
2142 O O   . LEU A 294 ? 0.4511 0.4675 0.4417 0.0272  -0.0277 -0.0179 282 LEU A O   
2143 C CB  . LEU A 294 ? 0.4426 0.4529 0.4189 0.0133  -0.0313 -0.0105 282 LEU A CB  
2144 C CG  . LEU A 294 ? 0.4557 0.4663 0.4278 0.0097  -0.0334 -0.0073 282 LEU A CG  
2145 C CD1 . LEU A 294 ? 0.4300 0.4414 0.3991 0.0036  -0.0305 -0.0100 282 LEU A CD1 
2146 C CD2 . LEU A 294 ? 0.4108 0.4106 0.3784 0.0101  -0.0349 -0.0029 282 LEU A CD2 
2147 N N   . ILE A 295 ? 0.4589 0.4509 0.4371 0.0235  -0.0303 -0.0156 283 ILE A N   
2148 C CA  . ILE A 295 ? 0.4594 0.4475 0.4352 0.0255  -0.0271 -0.0224 283 ILE A CA  
2149 C C   . ILE A 295 ? 0.4636 0.4509 0.4292 0.0189  -0.0251 -0.0232 283 ILE A C   
2150 O O   . ILE A 295 ? 0.4443 0.4251 0.4054 0.0149  -0.0278 -0.0200 283 ILE A O   
2151 C CB  . ILE A 295 ? 0.4742 0.4467 0.4501 0.0287  -0.0297 -0.0243 283 ILE A CB  
2152 C CG1 . ILE A 295 ? 0.5046 0.4754 0.4909 0.0365  -0.0316 -0.0219 283 ILE A CG1 
2153 C CG2 . ILE A 295 ? 0.4766 0.4445 0.4464 0.0297  -0.0270 -0.0333 283 ILE A CG2 
2154 C CD1 . ILE A 295 ? 0.5049 0.4575 0.4932 0.0390  -0.0340 -0.0227 283 ILE A CD1 
2155 N N   . SER A 296 ? 0.4515 0.4466 0.4143 0.0181  -0.0200 -0.0266 284 SER A N   
2156 C CA  . SER A 296 ? 0.4559 0.4499 0.4085 0.0124  -0.0180 -0.0253 284 SER A CA  
2157 C C   . SER A 296 ? 0.4781 0.4718 0.4220 0.0143  -0.0143 -0.0310 284 SER A C   
2158 O O   . SER A 296 ? 0.4663 0.4699 0.4114 0.0157  -0.0082 -0.0335 284 SER A O   
2159 C CB  . SER A 296 ? 0.4538 0.4570 0.4092 0.0078  -0.0145 -0.0219 284 SER A CB  
2160 O OG  . SER A 296 ? 0.4623 0.4605 0.4087 0.0029  -0.0135 -0.0184 284 SER A OG  
2161 N N   . VAL A 297 ? 0.4744 0.4582 0.4100 0.0142  -0.0181 -0.0334 285 VAL A N   
2162 C CA  . VAL A 297 ? 0.4946 0.4773 0.4199 0.0164  -0.0163 -0.0406 285 VAL A CA  
2163 C C   . VAL A 297 ? 0.4914 0.4795 0.4036 0.0128  -0.0126 -0.0373 285 VAL A C   
2164 O O   . VAL A 297 ? 0.4854 0.4708 0.3940 0.0089  -0.0155 -0.0309 285 VAL A O   
2165 C CB  . VAL A 297 ? 0.5126 0.4832 0.4348 0.0161  -0.0233 -0.0449 285 VAL A CB  
2166 C CG1 . VAL A 297 ? 0.5420 0.5122 0.4496 0.0170  -0.0228 -0.0530 285 VAL A CG1 
2167 C CG2 . VAL A 297 ? 0.5264 0.4886 0.4616 0.0203  -0.0257 -0.0478 285 VAL A CG2 
2168 N N   . PRO A 298 ? 0.5055 0.5014 0.4106 0.0148  -0.0058 -0.0411 286 PRO A N   
2169 C CA  . PRO A 298 ? 0.5156 0.5159 0.4072 0.0113  -0.0018 -0.0357 286 PRO A CA  
2170 C C   . PRO A 298 ? 0.5370 0.5324 0.4117 0.0116  -0.0069 -0.0383 286 PRO A C   
2171 O O   . PRO A 298 ? 0.5460 0.5396 0.4151 0.0150  -0.0085 -0.0482 286 PRO A O   
2172 C CB  . PRO A 298 ? 0.5191 0.5315 0.4098 0.0134  0.0080  -0.0390 286 PRO A CB  
2173 C CG  . PRO A 298 ? 0.5194 0.5309 0.4147 0.0200  0.0075  -0.0500 286 PRO A CG  
2174 C CD  . PRO A 298 ? 0.5156 0.5179 0.4253 0.0205  -0.0001 -0.0491 286 PRO A CD  
2175 N N   . ILE A 299 ? 0.5462 0.5397 0.4133 0.0083  -0.0099 -0.0299 287 ILE A N   
2176 C CA  . ILE A 299 ? 0.5513 0.5431 0.4025 0.0087  -0.0160 -0.0315 287 ILE A CA  
2177 C C   . ILE A 299 ? 0.5768 0.5755 0.4109 0.0083  -0.0097 -0.0248 287 ILE A C   
2178 O O   . ILE A 299 ? 0.5563 0.5550 0.3930 0.0055  -0.0053 -0.0138 287 ILE A O   
2179 C CB  . ILE A 299 ? 0.5406 0.5268 0.3970 0.0066  -0.0249 -0.0258 287 ILE A CB  
2180 C CG1 . ILE A 299 ? 0.5294 0.5095 0.4026 0.0062  -0.0297 -0.0304 287 ILE A CG1 
2181 C CG2 . ILE A 299 ? 0.5117 0.5001 0.3521 0.0071  -0.0325 -0.0266 287 ILE A CG2 
2182 C CD1 . ILE A 299 ? 0.5015 0.4779 0.3736 0.0077  -0.0340 -0.0427 287 ILE A CD1 
2183 N N   . ASP A 300 ? 0.6085 0.6122 0.4246 0.0108  -0.0092 -0.0314 288 ASP A N   
2184 C CA  . ASP A 300 ? 0.6506 0.6620 0.4474 0.0108  -0.0024 -0.0245 288 ASP A CA  
2185 C C   . ASP A 300 ? 0.6559 0.6651 0.4406 0.0103  -0.0109 -0.0156 288 ASP A C   
2186 O O   . ASP A 300 ? 0.6717 0.6805 0.4501 0.0117  -0.0209 -0.0223 288 ASP A O   
2187 C CB  . ASP A 300 ? 0.6874 0.7071 0.4686 0.0146  0.0026  -0.0364 288 ASP A CB  
2188 C CG  . ASP A 300 ? 0.7632 0.7923 0.5194 0.0148  0.0092  -0.0288 288 ASP A CG  
2189 O OD1 . ASP A 300 ? 0.8833 0.9133 0.6392 0.0116  0.0151  -0.0134 288 ASP A OD1 
2190 O OD2 . ASP A 300 ? 0.8699 0.9050 0.6057 0.0181  0.0083  -0.0380 288 ASP A OD2 
2191 N N   . THR A 301 ? 0.6479 0.6554 0.4315 0.0083  -0.0074 -0.0006 289 THR A N   
2192 C CA  . THR A 301 ? 0.6515 0.6562 0.4265 0.0092  -0.0150 0.0100  289 THR A CA  
2193 C C   . THR A 301 ? 0.6912 0.7007 0.4448 0.0097  -0.0082 0.0214  289 THR A C   
2194 O O   . THR A 301 ? 0.6906 0.7031 0.4436 0.0074  0.0039  0.0239  289 THR A O   
2195 C CB  . THR A 301 ? 0.6312 0.6261 0.4247 0.0073  -0.0163 0.0200  289 THR A CB  
2196 O OG1 . THR A 301 ? 0.6057 0.5975 0.4050 0.0036  -0.0050 0.0277  289 THR A OG1 
2197 C CG2 . THR A 301 ? 0.5888 0.5797 0.4031 0.0065  -0.0220 0.0107  289 THR A CG2 
2198 N N   . GLU A 302 ? 0.7221 0.7330 0.4600 0.0126  -0.0157 0.0299  290 GLU A N   
2199 C CA  . GLU A 302 ? 0.7640 0.7787 0.4793 0.0137  -0.0097 0.0439  290 GLU A CA  
2200 C C   . GLU A 302 ? 0.7539 0.7582 0.4782 0.0104  -0.0006 0.0609  290 GLU A C   
2201 O O   . GLU A 302 ? 0.7632 0.7701 0.4790 0.0076  0.0115  0.0680  290 GLU A O   
2202 C CB  . GLU A 302 ? 0.7964 0.8164 0.4925 0.0187  -0.0220 0.0491  290 GLU A CB  
2203 C CG  . GLU A 302 ? 0.8787 0.9082 0.5420 0.0211  -0.0170 0.0581  290 GLU A CG  
2204 C CD  . GLU A 302 ? 0.9598 1.0023 0.6053 0.0216  -0.0136 0.0410  290 GLU A CD  
2205 O OE1 . GLU A 302 ? 1.0309 1.0840 0.6468 0.0245  -0.0130 0.0446  290 GLU A OE1 
2206 O OE2 . GLU A 302 ? 0.9863 1.0283 0.6464 0.0197  -0.0113 0.0240  290 GLU A OE2 
2207 N N   . LYS A 303 ? 0.7317 0.7245 0.4741 0.0104  -0.0059 0.0664  291 LYS A N   
2208 C CA  . LYS A 303 ? 0.7331 0.7126 0.4849 0.0075  0.0008  0.0814  291 LYS A CA  
2209 C C   . LYS A 303 ? 0.6908 0.6603 0.4707 0.0039  0.0014  0.0758  291 LYS A C   
2210 O O   . LYS A 303 ? 0.6919 0.6483 0.4814 0.0023  0.0041  0.0857  291 LYS A O   
2211 C CB  . LYS A 303 ? 0.7584 0.7313 0.5014 0.0132  -0.0066 0.0967  291 LYS A CB  
2212 C CG  . LYS A 303 ? 0.8321 0.8151 0.5456 0.0179  -0.0093 0.1048  291 LYS A CG  
2213 C CD  . LYS A 303 ? 0.9001 0.8806 0.6093 0.0257  -0.0220 0.1161  291 LYS A CD  
2214 C CE  . LYS A 303 ? 0.9415 0.9323 0.6192 0.0312  -0.0258 0.1274  291 LYS A CE  
2215 N NZ  . LYS A 303 ? 0.9853 0.9693 0.6476 0.0289  -0.0126 0.1458  291 LYS A NZ  
2216 N N   . GLY A 304 ? 0.6468 0.6217 0.4389 0.0029  -0.0010 0.0602  292 GLY A N   
2217 C CA  . GLY A 304 ? 0.6183 0.5864 0.4341 -0.0006 0.0002  0.0549  292 GLY A CA  
2218 C C   . GLY A 304 ? 0.5981 0.5624 0.4250 0.0028  -0.0102 0.0509  292 GLY A C   
2219 O O   . GLY A 304 ? 0.5864 0.5452 0.4305 0.0007  -0.0097 0.0473  292 GLY A O   
2220 N N   . PHE A 305 ? 0.5941 0.5634 0.4113 0.0079  -0.0197 0.0510  293 PHE A N   
2221 C CA  . PHE A 305 ? 0.5871 0.5564 0.4159 0.0109  -0.0295 0.0472  293 PHE A CA  
2222 C C   . PHE A 305 ? 0.5770 0.5572 0.4009 0.0120  -0.0377 0.0360  293 PHE A C   
2223 O O   . PHE A 305 ? 0.5753 0.5627 0.3813 0.0131  -0.0391 0.0346  293 PHE A O   
2224 C CB  . PHE A 305 ? 0.6033 0.5686 0.4298 0.0163  -0.0349 0.0597  293 PHE A CB  
2225 C CG  . PHE A 305 ? 0.6191 0.5699 0.4515 0.0158  -0.0277 0.0706  293 PHE A CG  
2226 C CD1 . PHE A 305 ? 0.5948 0.5370 0.4460 0.0157  -0.0272 0.0685  293 PHE A CD1 
2227 C CD2 . PHE A 305 ? 0.6569 0.6019 0.4757 0.0150  -0.0209 0.0827  293 PHE A CD2 
2228 C CE1 . PHE A 305 ? 0.6149 0.5416 0.4717 0.0149  -0.0206 0.0767  293 PHE A CE1 
2229 C CE2 . PHE A 305 ? 0.6634 0.5923 0.4890 0.0134  -0.0140 0.0926  293 PHE A CE2 
2230 C CZ  . PHE A 305 ? 0.6427 0.5616 0.4872 0.0134  -0.0142 0.0890  293 PHE A CZ  
2231 N N   . PHE A 306 ? 0.5548 0.5356 0.3945 0.0111  -0.0427 0.0277  294 PHE A N   
2232 C CA  . PHE A 306 ? 0.5476 0.5365 0.3862 0.0113  -0.0517 0.0181  294 PHE A CA  
2233 C C   . PHE A 306 ? 0.5558 0.5527 0.3825 0.0150  -0.0609 0.0231  294 PHE A C   
2234 O O   . PHE A 306 ? 0.5493 0.5449 0.3776 0.0187  -0.0628 0.0344  294 PHE A O   
2235 C CB  . PHE A 306 ? 0.5261 0.5140 0.3850 0.0097  -0.0556 0.0129  294 PHE A CB  
2236 C CG  . PHE A 306 ? 0.5111 0.4945 0.3792 0.0065  -0.0499 0.0051  294 PHE A CG  
2237 C CD1 . PHE A 306 ? 0.5300 0.5149 0.3962 0.0049  -0.0516 -0.0058 294 PHE A CD1 
2238 C CD2 . PHE A 306 ? 0.5227 0.5000 0.4015 0.0055  -0.0433 0.0086  294 PHE A CD2 
2239 C CE1 . PHE A 306 ? 0.5366 0.5170 0.4125 0.0033  -0.0468 -0.0117 294 PHE A CE1 
2240 C CE2 . PHE A 306 ? 0.5087 0.4839 0.3959 0.0033  -0.0396 0.0023  294 PHE A CE2 
2241 C CZ  . PHE A 306 ? 0.5160 0.4929 0.4020 0.0028  -0.0412 -0.0068 294 PHE A CZ  
2242 N N   . SER A 307 ? 0.5726 0.5778 0.3876 0.0144  -0.0670 0.0138  295 SER A N   
2243 C CA  . SER A 307 ? 0.5796 0.5959 0.3829 0.0174  -0.0781 0.0158  295 SER A CA  
2244 C C   . SER A 307 ? 0.5959 0.6194 0.3995 0.0140  -0.0866 0.0000  295 SER A C   
2245 O O   . SER A 307 ? 0.5836 0.6011 0.3949 0.0100  -0.0829 -0.0117 295 SER A O   
2246 C CB  . SER A 307 ? 0.6107 0.6303 0.3874 0.0208  -0.0752 0.0241  295 SER A CB  
2247 O OG  . SER A 307 ? 0.5719 0.5936 0.3330 0.0186  -0.0704 0.0135  295 SER A OG  
2248 N N   . LEU A 308 ? 0.6072 0.6432 0.4025 0.0155  -0.0986 -0.0006 296 LEU A N   
2249 C CA  . LEU A 308 ? 0.6196 0.6623 0.4137 0.0112  -0.1076 -0.0171 296 LEU A CA  
2250 C C   . LEU A 308 ? 0.6349 0.6717 0.4145 0.0091  -0.1011 -0.0305 296 LEU A C   
2251 O O   . LEU A 308 ? 0.6374 0.6713 0.4249 0.0046  -0.1043 -0.0454 296 LEU A O   
2252 C CB  . LEU A 308 ? 0.6332 0.6928 0.4153 0.0131  -0.1218 -0.0168 296 LEU A CB  
2253 C CG  . LEU A 308 ? 0.6386 0.7091 0.4417 0.0133  -0.1329 -0.0118 296 LEU A CG  
2254 C CD1 . LEU A 308 ? 0.6013 0.6911 0.3871 0.0163  -0.1473 -0.0114 296 LEU A CD1 
2255 C CD2 . LEU A 308 ? 0.6220 0.6908 0.4522 0.0056  -0.1358 -0.0232 296 LEU A CD2 
2256 N N   . GLN A 309 ? 0.6491 0.6840 0.4097 0.0124  -0.0913 -0.0256 297 GLN A N   
2257 C CA  . GLN A 309 ? 0.6762 0.7073 0.4256 0.0115  -0.0841 -0.0393 297 GLN A CA  
2258 C C   . GLN A 309 ? 0.6553 0.6738 0.4268 0.0086  -0.0771 -0.0469 297 GLN A C   
2259 O O   . GLN A 309 ? 0.6626 0.6770 0.4303 0.0083  -0.0730 -0.0605 297 GLN A O   
2260 C CB  . GLN A 309 ? 0.7069 0.7407 0.4334 0.0152  -0.0734 -0.0315 297 GLN A CB  
2261 C CG  . GLN A 309 ? 0.7623 0.7872 0.4995 0.0150  -0.0589 -0.0238 297 GLN A CG  
2262 C CD  . GLN A 309 ? 0.8370 0.8664 0.5527 0.0171  -0.0466 -0.0204 297 GLN A CD  
2263 O OE1 . GLN A 309 ? 0.9085 0.9467 0.5996 0.0196  -0.0481 -0.0144 297 GLN A OE1 
2264 N NE2 . GLN A 309 ? 0.8068 0.8318 0.5323 0.0161  -0.0343 -0.0236 297 GLN A NE2 
2265 N N   . ASN A 310 ? 0.6213 0.6338 0.4151 0.0072  -0.0759 -0.0384 298 ASN A N   
2266 C CA  . ASN A 310 ? 0.6012 0.6033 0.4144 0.0051  -0.0702 -0.0435 298 ASN A CA  
2267 C C   . ASN A 310 ? 0.5921 0.5910 0.4240 0.0007  -0.0787 -0.0503 298 ASN A C   
2268 O O   . ASN A 310 ? 0.5710 0.5608 0.4197 -0.0009 -0.0750 -0.0526 298 ASN A O   
2269 C CB  . ASN A 310 ? 0.5729 0.5704 0.3975 0.0059  -0.0620 -0.0304 298 ASN A CB  
2270 C CG  . ASN A 310 ? 0.5821 0.5816 0.3920 0.0084  -0.0526 -0.0224 298 ASN A CG  
2271 O OD1 . ASN A 310 ? 0.5753 0.5753 0.3836 0.0095  -0.0515 -0.0093 298 ASN A OD1 
2272 N ND2 . ASN A 310 ? 0.5756 0.5761 0.3755 0.0095  -0.0452 -0.0301 298 ASN A ND2 
2273 N N   . LEU A 311 ? 0.5888 0.5963 0.4192 -0.0011 -0.0901 -0.0519 299 LEU A N   
2274 C CA  . LEU A 311 ? 0.5931 0.6003 0.4435 -0.0066 -0.0983 -0.0569 299 LEU A CA  
2275 C C   . LEU A 311 ? 0.6023 0.5975 0.4590 -0.0103 -0.0970 -0.0714 299 LEU A C   
2276 O O   . LEU A 311 ? 0.6010 0.5875 0.4775 -0.0133 -0.0947 -0.0705 299 LEU A O   
2277 C CB  . LEU A 311 ? 0.5981 0.6199 0.4443 -0.0084 -0.1119 -0.0590 299 LEU A CB  
2278 C CG  . LEU A 311 ? 0.5901 0.6153 0.4584 -0.0158 -0.1214 -0.0648 299 LEU A CG  
2279 C CD1 . LEU A 311 ? 0.5882 0.6126 0.4794 -0.0162 -0.1174 -0.0529 299 LEU A CD1 
2280 C CD2 . LEU A 311 ? 0.5415 0.5851 0.4047 -0.0177 -0.1362 -0.0685 299 LEU A CD2 
2281 N N   . GLN A 312 ? 0.6273 0.6214 0.4666 -0.0094 -0.0979 -0.0845 300 GLN A N   
2282 C CA  . GLN A 312 ? 0.6487 0.6303 0.4936 -0.0123 -0.0981 -0.1001 300 GLN A CA  
2283 C C   . GLN A 312 ? 0.6337 0.6020 0.4892 -0.0092 -0.0868 -0.0976 300 GLN A C   
2284 O O   . GLN A 312 ? 0.6211 0.5772 0.4943 -0.0124 -0.0869 -0.1011 300 GLN A O   
2285 C CB  . GLN A 312 ? 0.6823 0.6659 0.5043 -0.0108 -0.1006 -0.1162 300 GLN A CB  
2286 C CG  . GLN A 312 ? 0.7757 0.7444 0.6052 -0.0146 -0.1032 -0.1346 300 GLN A CG  
2287 C CD  . GLN A 312 ? 0.8716 0.8365 0.7253 -0.0240 -0.1127 -0.1354 300 GLN A CD  
2288 O OE1 . GLN A 312 ? 0.9007 0.8795 0.7558 -0.0288 -0.1235 -0.1335 300 GLN A OE1 
2289 N NE2 . GLN A 312 ? 0.9135 0.8605 0.7872 -0.0262 -0.1084 -0.1367 300 GLN A NE2 
2290 N N   . GLU A 313 ? 0.6277 0.5989 0.4734 -0.0033 -0.0771 -0.0907 301 GLU A N   
2291 C CA  . GLU A 313 ? 0.6310 0.5930 0.4884 -0.0001 -0.0673 -0.0877 301 GLU A CA  
2292 C C   . GLU A 313 ? 0.6032 0.5609 0.4826 -0.0031 -0.0677 -0.0769 301 GLU A C   
2293 O O   . GLU A 313 ? 0.6015 0.5490 0.4940 -0.0023 -0.0640 -0.0775 301 GLU A O   
2294 C CB  . GLU A 313 ? 0.6337 0.6026 0.4797 0.0050  -0.0572 -0.0813 301 GLU A CB  
2295 C CG  . GLU A 313 ? 0.6611 0.6241 0.5194 0.0084  -0.0484 -0.0800 301 GLU A CG  
2296 C CD  . GLU A 313 ? 0.7309 0.7023 0.5797 0.0127  -0.0380 -0.0764 301 GLU A CD  
2297 O OE1 . GLU A 313 ? 0.7473 0.7166 0.6059 0.0164  -0.0310 -0.0782 301 GLU A OE1 
2298 O OE2 . GLU A 313 ? 0.7334 0.7141 0.5664 0.0124  -0.0368 -0.0709 301 GLU A OE2 
2299 N N   . CYS A 314 ? 0.5853 0.5511 0.4682 -0.0057 -0.0720 -0.0666 302 CYS A N   
2300 C CA  . CYS A 314 ? 0.5628 0.5268 0.4639 -0.0078 -0.0713 -0.0567 302 CYS A CA  
2301 C C   . CYS A 314 ? 0.5639 0.5214 0.4806 -0.0137 -0.0772 -0.0614 302 CYS A C   
2302 O O   . CYS A 314 ? 0.5409 0.4919 0.4721 -0.0149 -0.0742 -0.0563 302 CYS A O   
2303 C CB  . CYS A 314 ? 0.5533 0.5278 0.4538 -0.0074 -0.0727 -0.0449 302 CYS A CB  
2304 S SG  . CYS A 314 ? 0.5483 0.5250 0.4382 -0.0020 -0.0630 -0.0355 302 CYS A SG  
2305 N N   . LEU A 315 ? 0.5787 0.5384 0.4926 -0.0179 -0.0857 -0.0708 303 LEU A N   
2306 C CA  . LEU A 315 ? 0.5816 0.5347 0.5118 -0.0254 -0.0914 -0.0761 303 LEU A CA  
2307 C C   . LEU A 315 ? 0.5991 0.5338 0.5330 -0.0244 -0.0870 -0.0841 303 LEU A C   
2308 O O   . LEU A 315 ? 0.6064 0.5307 0.5566 -0.0279 -0.0859 -0.0810 303 LEU A O   
2309 C CB  . LEU A 315 ? 0.6001 0.5618 0.5265 -0.0309 -0.1027 -0.0858 303 LEU A CB  
2310 C CG  . LEU A 315 ? 0.5963 0.5776 0.5235 -0.0313 -0.1085 -0.0766 303 LEU A CG  
2311 C CD1 . LEU A 315 ? 0.6151 0.6091 0.5320 -0.0344 -0.1208 -0.0866 303 LEU A CD1 
2312 C CD2 . LEU A 315 ? 0.5894 0.5743 0.5409 -0.0362 -0.1084 -0.0666 303 LEU A CD2 
2313 N N   . GLU A 316 ? 0.6154 0.5461 0.5338 -0.0188 -0.0836 -0.0934 304 GLU A N   
2314 C CA  . GLU A 316 ? 0.6403 0.5541 0.5625 -0.0155 -0.0788 -0.1011 304 GLU A CA  
2315 C C   . GLU A 316 ? 0.6164 0.5247 0.5513 -0.0118 -0.0714 -0.0886 304 GLU A C   
2316 O O   . GLU A 316 ? 0.6074 0.5010 0.5559 -0.0129 -0.0708 -0.0884 304 GLU A O   
2317 C CB  . GLU A 316 ? 0.6665 0.5812 0.5699 -0.0084 -0.0746 -0.1121 304 GLU A CB  
2318 C CG  . GLU A 316 ? 0.7502 0.6470 0.6573 -0.0054 -0.0722 -0.1252 304 GLU A CG  
2319 C CD  . GLU A 316 ? 0.8757 0.7609 0.7871 -0.0134 -0.0814 -0.1393 304 GLU A CD  
2320 O OE1 . GLU A 316 ? 0.9327 0.8288 0.8393 -0.0205 -0.0902 -0.1418 304 GLU A OE1 
2321 O OE2 . GLU A 316 ? 0.9353 0.8004 0.8558 -0.0124 -0.0801 -0.1483 304 GLU A OE2 
2322 N N   . LEU A 317 ? 0.5937 0.5139 0.5238 -0.0078 -0.0665 -0.0779 305 LEU A N   
2323 C CA  . LEU A 317 ? 0.5876 0.5063 0.5269 -0.0044 -0.0606 -0.0671 305 LEU A CA  
2324 C C   . LEU A 317 ? 0.5795 0.4953 0.5346 -0.0101 -0.0632 -0.0577 305 LEU A C   
2325 O O   . LEU A 317 ? 0.5603 0.4693 0.5245 -0.0083 -0.0599 -0.0515 305 LEU A O   
2326 C CB  . LEU A 317 ? 0.5773 0.5098 0.5082 -0.0009 -0.0557 -0.0591 305 LEU A CB  
2327 C CG  . LEU A 317 ? 0.5729 0.5094 0.4918 0.0052  -0.0497 -0.0648 305 LEU A CG  
2328 C CD1 . LEU A 317 ? 0.5319 0.4808 0.4441 0.0057  -0.0459 -0.0557 305 LEU A CD1 
2329 C CD2 . LEU A 317 ? 0.5408 0.4697 0.4675 0.0116  -0.0443 -0.0682 305 LEU A CD2 
2330 N N   . SER A 318 ? 0.5815 0.5041 0.5392 -0.0167 -0.0689 -0.0564 306 SER A N   
2331 C CA  . SER A 318 ? 0.5904 0.5131 0.5639 -0.0230 -0.0708 -0.0482 306 SER A CA  
2332 C C   . SER A 318 ? 0.6053 0.5119 0.5919 -0.0281 -0.0725 -0.0513 306 SER A C   
2333 O O   . SER A 318 ? 0.5916 0.4962 0.5912 -0.0320 -0.0709 -0.0416 306 SER A O   
2334 C CB  . SER A 318 ? 0.5886 0.5255 0.5636 -0.0285 -0.0771 -0.0476 306 SER A CB  
2335 O OG  . SER A 318 ? 0.6172 0.5664 0.5842 -0.0235 -0.0741 -0.0401 306 SER A OG  
2336 N N   . LYS A 319 ? 0.6242 0.5188 0.6071 -0.0282 -0.0752 -0.0647 307 LYS A N   
2337 C CA  . LYS A 319 ? 0.6589 0.5350 0.6549 -0.0339 -0.0773 -0.0691 307 LYS A CA  
2338 C C   . LYS A 319 ? 0.6603 0.5225 0.6652 -0.0297 -0.0712 -0.0591 307 LYS A C   
2339 O O   . LYS A 319 ? 0.6675 0.5183 0.6863 -0.0358 -0.0716 -0.0542 307 LYS A O   
2340 C CB  . LYS A 319 ? 0.6824 0.5468 0.6709 -0.0333 -0.0809 -0.0876 307 LYS A CB  
2341 C CG  . LYS A 319 ? 0.7323 0.6099 0.7145 -0.0398 -0.0891 -0.0968 307 LYS A CG  
2342 C CD  . LYS A 319 ? 0.8134 0.6835 0.7821 -0.0379 -0.0923 -0.1163 307 LYS A CD  
2343 C CE  . LYS A 319 ? 0.8490 0.7342 0.8102 -0.0447 -0.1022 -0.1255 307 LYS A CE  
2344 N NZ  . LYS A 319 ? 0.8913 0.7697 0.8366 -0.0427 -0.1054 -0.1461 307 LYS A NZ  
2345 N N   . ASP A 320 ? 0.6584 0.5231 0.6555 -0.0196 -0.0657 -0.0555 308 ASP A N   
2346 C CA  . ASP A 320 ? 0.6803 0.5340 0.6841 -0.0138 -0.0611 -0.0467 308 ASP A CA  
2347 C C   . ASP A 320 ? 0.6563 0.5231 0.6620 -0.0132 -0.0578 -0.0303 308 ASP A C   
2348 O O   . ASP A 320 ? 0.6681 0.5326 0.6743 -0.0060 -0.0542 -0.0231 308 ASP A O   
2349 C CB  . ASP A 320 ? 0.6981 0.5502 0.6936 -0.0025 -0.0575 -0.0536 308 ASP A CB  
2350 C CG  . ASP A 320 ? 0.7801 0.6266 0.7674 -0.0018 -0.0597 -0.0721 308 ASP A CG  
2351 O OD1 . ASP A 320 ? 0.8282 0.6543 0.8223 -0.0032 -0.0616 -0.0806 308 ASP A OD1 
2352 O OD2 . ASP A 320 ? 0.8274 0.6890 0.8008 -0.0002 -0.0593 -0.0779 308 ASP A OD2 
2353 N N   . VAL A 321 ? 0.6088 0.4902 0.6149 -0.0196 -0.0592 -0.0254 309 VAL A N   
2354 C CA  . VAL A 321 ? 0.5703 0.4634 0.5776 -0.0190 -0.0556 -0.0119 309 VAL A CA  
2355 C C   . VAL A 321 ? 0.5629 0.4586 0.5817 -0.0283 -0.0562 -0.0043 309 VAL A C   
2356 O O   . VAL A 321 ? 0.5537 0.4457 0.5804 -0.0362 -0.0604 -0.0101 309 VAL A O   
2357 C CB  . VAL A 321 ? 0.5621 0.4731 0.5582 -0.0152 -0.0542 -0.0119 309 VAL A CB  
2358 C CG1 . VAL A 321 ? 0.5296 0.4405 0.5157 -0.0068 -0.0522 -0.0184 309 VAL A CG1 
2359 C CG2 . VAL A 321 ? 0.5225 0.4435 0.5174 -0.0205 -0.0579 -0.0161 309 VAL A CG2 
2360 N N   . ASP A 322 ? 0.5256 0.4293 0.5457 -0.0274 -0.0519 0.0082  310 ASP A N   
2361 C CA  . ASP A 322 ? 0.5305 0.4405 0.5614 -0.0353 -0.0503 0.0171  310 ASP A CA  
2362 C C   . ASP A 322 ? 0.5097 0.4399 0.5397 -0.0370 -0.0504 0.0170  310 ASP A C   
2363 O O   . ASP A 322 ? 0.5214 0.4593 0.5627 -0.0442 -0.0506 0.0200  310 ASP A O   
2364 C CB  . ASP A 322 ? 0.5342 0.4423 0.5654 -0.0330 -0.0449 0.0312  310 ASP A CB  
2365 C CG  . ASP A 322 ? 0.5907 0.4776 0.6243 -0.0301 -0.0450 0.0335  310 ASP A CG  
2366 O OD1 . ASP A 322 ? 0.6462 0.5184 0.6904 -0.0367 -0.0472 0.0305  310 ASP A OD1 
2367 O OD2 . ASP A 322 ? 0.5369 0.4215 0.5627 -0.0210 -0.0438 0.0365  310 ASP A OD2 
2368 N N   . VAL A 323 ? 0.4813 0.4204 0.4994 -0.0301 -0.0498 0.0142  311 VAL A N   
2369 C CA  . VAL A 323 ? 0.4711 0.4272 0.4881 -0.0298 -0.0492 0.0149  311 VAL A CA  
2370 C C   . VAL A 323 ? 0.4497 0.4076 0.4542 -0.0241 -0.0512 0.0074  311 VAL A C   
2371 O O   . VAL A 323 ? 0.4502 0.4006 0.4461 -0.0191 -0.0503 0.0044  311 VAL A O   
2372 C CB  . VAL A 323 ? 0.4668 0.4325 0.4828 -0.0274 -0.0427 0.0248  311 VAL A CB  
2373 C CG1 . VAL A 323 ? 0.5084 0.4701 0.5134 -0.0209 -0.0404 0.0259  311 VAL A CG1 
2374 C CG2 . VAL A 323 ? 0.4425 0.4239 0.4581 -0.0256 -0.0416 0.0244  311 VAL A CG2 
2375 N N   . VAL A 324 ? 0.4257 0.3944 0.4301 -0.0245 -0.0537 0.0052  312 VAL A N   
2376 C CA  . VAL A 324 ? 0.4217 0.3933 0.4142 -0.0193 -0.0544 0.0012  312 VAL A CA  
2377 C C   . VAL A 324 ? 0.4163 0.3986 0.4082 -0.0160 -0.0514 0.0061  312 VAL A C   
2378 O O   . VAL A 324 ? 0.4246 0.4168 0.4258 -0.0180 -0.0525 0.0088  312 VAL A O   
2379 C CB  . VAL A 324 ? 0.4220 0.3946 0.4114 -0.0211 -0.0612 -0.0064 312 VAL A CB  
2380 C CG1 . VAL A 324 ? 0.4151 0.3897 0.3903 -0.0155 -0.0607 -0.0085 312 VAL A CG1 
2381 C CG2 . VAL A 324 ? 0.4154 0.3762 0.4060 -0.0244 -0.0642 -0.0136 312 VAL A CG2 
2382 N N   . ALA A 325 ? 0.4051 0.3858 0.3874 -0.0112 -0.0476 0.0065  313 ALA A N   
2383 C CA  . ALA A 325 ? 0.3917 0.3787 0.3717 -0.0075 -0.0449 0.0092  313 ALA A CA  
2384 C C   . ALA A 325 ? 0.4030 0.3885 0.3741 -0.0050 -0.0475 0.0063  313 ALA A C   
2385 O O   . ALA A 325 ? 0.4025 0.3821 0.3657 -0.0050 -0.0481 0.0025  313 ALA A O   
2386 C CB  . ALA A 325 ? 0.3810 0.3664 0.3565 -0.0049 -0.0393 0.0108  313 ALA A CB  
2387 N N   . ILE A 326 ? 0.3975 0.3890 0.3704 -0.0026 -0.0487 0.0087  314 ILE A N   
2388 C CA  . ILE A 326 ? 0.4148 0.4051 0.3785 0.0001  -0.0512 0.0086  314 ILE A CA  
2389 C C   . ILE A 326 ? 0.4052 0.3963 0.3692 0.0051  -0.0484 0.0133  314 ILE A C   
2390 O O   . ILE A 326 ? 0.4085 0.4056 0.3823 0.0069  -0.0471 0.0156  314 ILE A O   
2391 C CB  . ILE A 326 ? 0.4338 0.4306 0.3990 -0.0016 -0.0592 0.0066  314 ILE A CB  
2392 C CG1 . ILE A 326 ? 0.4452 0.4415 0.3975 0.0015  -0.0621 0.0073  314 ILE A CG1 
2393 C CG2 . ILE A 326 ? 0.4134 0.4223 0.3939 -0.0022 -0.0623 0.0095  314 ILE A CG2 
2394 C CD1 . ILE A 326 ? 0.4424 0.4440 0.3911 -0.0010 -0.0703 0.0024  314 ILE A CD1 
2395 N N   . GLY A 327 ? 0.4216 0.4059 0.3752 0.0075  -0.0467 0.0147  315 GLY A N   
2396 C CA  . GLY A 327 ? 0.4178 0.3993 0.3715 0.0126  -0.0446 0.0196  315 GLY A CA  
2397 C C   . GLY A 327 ? 0.4338 0.4045 0.3828 0.0132  -0.0382 0.0201  315 GLY A C   
2398 O O   . GLY A 327 ? 0.4599 0.4240 0.4046 0.0164  -0.0372 0.0247  315 GLY A O   
2399 N N   . PRO A 328 ? 0.4411 0.4095 0.3913 0.0101  -0.0340 0.0158  316 PRO A N   
2400 C CA  . PRO A 328 ? 0.4490 0.4081 0.3967 0.0097  -0.0286 0.0149  316 PRO A CA  
2401 C C   . PRO A 328 ? 0.4600 0.4127 0.3988 0.0077  -0.0274 0.0171  316 PRO A C   
2402 O O   . PRO A 328 ? 0.4546 0.4108 0.3886 0.0047  -0.0284 0.0153  316 PRO A O   
2403 C CB  . PRO A 328 ? 0.4528 0.4146 0.4019 0.0061  -0.0265 0.0095  316 PRO A CB  
2404 C CG  . PRO A 328 ? 0.4401 0.4107 0.3947 0.0063  -0.0292 0.0094  316 PRO A CG  
2405 C CD  . PRO A 328 ? 0.4475 0.4216 0.4024 0.0071  -0.0343 0.0122  316 PRO A CD  
2406 N N   . GLY A 329 ? 0.4712 0.4143 0.4082 0.0096  -0.0247 0.0214  317 GLY A N   
2407 C CA  . GLY A 329 ? 0.4912 0.4277 0.4200 0.0071  -0.0221 0.0255  317 GLY A CA  
2408 C C   . GLY A 329 ? 0.4950 0.4361 0.4141 0.0085  -0.0256 0.0306  317 GLY A C   
2409 O O   . GLY A 329 ? 0.5012 0.4391 0.4119 0.0058  -0.0222 0.0337  317 GLY A O   
2410 N N   . LEU A 330 ? 0.4901 0.4395 0.4097 0.0123  -0.0322 0.0313  318 LEU A N   
2411 C CA  . LEU A 330 ? 0.4975 0.4525 0.4059 0.0135  -0.0367 0.0346  318 LEU A CA  
2412 C C   . LEU A 330 ? 0.5286 0.4770 0.4280 0.0172  -0.0360 0.0452  318 LEU A C   
2413 O O   . LEU A 330 ? 0.5320 0.4826 0.4177 0.0167  -0.0364 0.0488  318 LEU A O   
2414 C CB  . LEU A 330 ? 0.4981 0.4646 0.4108 0.0160  -0.0452 0.0326  318 LEU A CB  
2415 C CG  . LEU A 330 ? 0.4971 0.4704 0.4164 0.0121  -0.0474 0.0238  318 LEU A CG  
2416 C CD1 . LEU A 330 ? 0.4921 0.4766 0.4154 0.0128  -0.0561 0.0222  318 LEU A CD1 
2417 C CD2 . LEU A 330 ? 0.5089 0.4804 0.4200 0.0082  -0.0443 0.0186  318 LEU A CD2 
2418 N N   . GLY A 331 ? 0.5522 0.4919 0.4586 0.0214  -0.0345 0.0506  319 GLY A N   
2419 C CA  . GLY A 331 ? 0.5822 0.5148 0.4819 0.0270  -0.0353 0.0626  319 GLY A CA  
2420 C C   . GLY A 331 ? 0.5997 0.5442 0.5021 0.0342  -0.0447 0.0657  319 GLY A C   
2421 O O   . GLY A 331 ? 0.5881 0.5463 0.4957 0.0331  -0.0502 0.0585  319 GLY A O   
2422 N N   . ASN A 332 ? 0.6423 0.5819 0.5422 0.0416  -0.0468 0.0770  320 ASN A N   
2423 C CA  . ASN A 332 ? 0.6681 0.6208 0.5729 0.0495  -0.0563 0.0809  320 ASN A CA  
2424 C C   . ASN A 332 ? 0.6895 0.6406 0.5785 0.0549  -0.0601 0.0946  320 ASN A C   
2425 O O   . ASN A 332 ? 0.7406 0.6766 0.6285 0.0602  -0.0564 0.1058  320 ASN A O   
2426 C CB  . ASN A 332 ? 0.6740 0.6232 0.5976 0.0559  -0.0548 0.0805  320 ASN A CB  
2427 C CG  . ASN A 332 ? 0.7453 0.6978 0.6731 0.0674  -0.0609 0.0914  320 ASN A CG  
2428 O OD1 . ASN A 332 ? 0.8511 0.8196 0.7739 0.0706  -0.0705 0.0956  320 ASN A OD1 
2429 N ND2 . ASN A 332 ? 0.7985 0.7360 0.7356 0.0744  -0.0558 0.0960  320 ASN A ND2 
2430 N N   . ASN A 333 ? 0.6766 0.6411 0.5514 0.0525  -0.0662 0.0933  321 ASN A N   
2431 C CA  . ASN A 333 ? 0.6942 0.6631 0.5507 0.0578  -0.0719 0.1055  321 ASN A CA  
2432 C C   . ASN A 333 ? 0.6820 0.6743 0.5366 0.0574  -0.0840 0.0975  321 ASN A C   
2433 O O   . ASN A 333 ? 0.6423 0.6428 0.5103 0.0521  -0.0856 0.0840  321 ASN A O   
2434 C CB  . ASN A 333 ? 0.7013 0.6604 0.5371 0.0524  -0.0638 0.1102  321 ASN A CB  
2435 C CG  . ASN A 333 ? 0.7091 0.6743 0.5399 0.0427  -0.0602 0.0957  321 ASN A CG  
2436 O OD1 . ASN A 333 ? 0.7211 0.7021 0.5479 0.0412  -0.0679 0.0865  321 ASN A OD1 
2437 N ND2 . ASN A 333 ? 0.7424 0.6952 0.5750 0.0360  -0.0488 0.0932  321 ASN A ND2 
2438 N N   . GLU A 334 ? 0.6859 0.6888 0.5245 0.0623  -0.0926 0.1055  322 GLU A N   
2439 C CA  . GLU A 334 ? 0.7001 0.7261 0.5388 0.0625  -0.1060 0.0982  322 GLU A CA  
2440 C C   . GLU A 334 ? 0.6772 0.7100 0.5092 0.0523  -0.1063 0.0814  322 GLU A C   
2441 O O   . GLU A 334 ? 0.6658 0.7127 0.5098 0.0491  -0.1144 0.0705  322 GLU A O   
2442 C CB  . GLU A 334 ? 0.7331 0.7703 0.5541 0.0707  -0.1162 0.1109  322 GLU A CB  
2443 C CG  . GLU A 334 ? 0.8200 0.8662 0.6598 0.0819  -0.1250 0.1204  322 GLU A CG  
2444 C CD  . GLU A 334 ? 0.8939 0.9658 0.7523 0.0805  -0.1376 0.1088  322 GLU A CD  
2445 O OE1 . GLU A 334 ? 0.9653 1.0431 0.8266 0.0700  -0.1380 0.0926  322 GLU A OE1 
2446 O OE2 . GLU A 334 ? 0.9580 1.0443 0.8295 0.0901  -0.1472 0.1166  322 GLU A OE2 
2447 N N   . HIS A 335 ? 0.6648 0.6874 0.4797 0.0473  -0.0972 0.0796  323 HIS A N   
2448 C CA  . HIS A 335 ? 0.6604 0.6867 0.4687 0.0391  -0.0959 0.0638  323 HIS A CA  
2449 C C   . HIS A 335 ? 0.6233 0.6448 0.4546 0.0333  -0.0919 0.0523  323 HIS A C   
2450 O O   . HIS A 335 ? 0.6212 0.6502 0.4569 0.0282  -0.0967 0.0390  323 HIS A O   
2451 C CB  . HIS A 335 ? 0.6773 0.6945 0.4642 0.0365  -0.0850 0.0662  323 HIS A CB  
2452 C CG  . HIS A 335 ? 0.7575 0.7819 0.5175 0.0412  -0.0887 0.0763  323 HIS A CG  
2453 N ND1 . HIS A 335 ? 0.8140 0.8362 0.5509 0.0390  -0.0802 0.0779  323 HIS A ND1 
2454 C CD2 . HIS A 335 ? 0.7870 0.8229 0.5389 0.0482  -0.1004 0.0855  323 HIS A CD2 
2455 C CE1 . HIS A 335 ? 0.8455 0.8765 0.5594 0.0443  -0.0860 0.0882  323 HIS A CE1 
2456 N NE2 . HIS A 335 ? 0.8433 0.8827 0.5656 0.0502  -0.0989 0.0931  323 HIS A NE2 
2457 N N   . VAL A 336 ? 0.5916 0.6003 0.4368 0.0341  -0.0834 0.0574  324 VAL A N   
2458 C CA  . VAL A 336 ? 0.5651 0.5710 0.4313 0.0299  -0.0803 0.0486  324 VAL A CA  
2459 C C   . VAL A 336 ? 0.5501 0.5701 0.4335 0.0314  -0.0902 0.0456  324 VAL A C   
2460 O O   . VAL A 336 ? 0.5346 0.5595 0.4285 0.0257  -0.0922 0.0353  324 VAL A O   
2461 C CB  . VAL A 336 ? 0.5564 0.5464 0.4322 0.0304  -0.0695 0.0535  324 VAL A CB  
2462 C CG1 . VAL A 336 ? 0.5244 0.5144 0.4212 0.0274  -0.0674 0.0455  324 VAL A CG1 
2463 C CG2 . VAL A 336 ? 0.5561 0.5350 0.4194 0.0261  -0.0594 0.0537  324 VAL A CG2 
2464 N N   . ARG A 337 ? 0.5644 0.5915 0.4515 0.0389  -0.0963 0.0553  325 ARG A N   
2465 C CA  . ARG A 337 ? 0.5559 0.6004 0.4615 0.0407  -0.1058 0.0532  325 ARG A CA  
2466 C C   . ARG A 337 ? 0.5621 0.6209 0.4640 0.0341  -0.1156 0.0421  325 ARG A C   
2467 O O   . ARG A 337 ? 0.5418 0.6087 0.4616 0.0286  -0.1185 0.0338  325 ARG A O   
2468 C CB  . ARG A 337 ? 0.5691 0.6211 0.4770 0.0515  -0.1122 0.0662  325 ARG A CB  
2469 C CG  . ARG A 337 ? 0.5822 0.6577 0.5091 0.0540  -0.1238 0.0647  325 ARG A CG  
2470 C CD  . ARG A 337 ? 0.6471 0.7299 0.5759 0.0669  -0.1300 0.0791  325 ARG A CD  
2471 N NE  . ARG A 337 ? 0.6866 0.7495 0.6195 0.0742  -0.1191 0.0884  325 ARG A NE  
2472 C CZ  . ARG A 337 ? 0.7256 0.7882 0.6815 0.0788  -0.1143 0.0886  325 ARG A CZ  
2473 N NH1 . ARG A 337 ? 0.7235 0.8066 0.7015 0.0770  -0.1189 0.0818  325 ARG A NH1 
2474 N NH2 . ARG A 337 ? 0.7401 0.7820 0.6973 0.0848  -0.1043 0.0952  325 ARG A NH2 
2475 N N   . GLU A 338 ? 0.5772 0.6390 0.4560 0.0343  -0.1205 0.0418  326 GLU A N   
2476 C CA  . GLU A 338 ? 0.5912 0.6661 0.4647 0.0281  -0.1306 0.0292  326 GLU A CA  
2477 C C   . GLU A 338 ? 0.5640 0.6293 0.4430 0.0187  -0.1246 0.0152  326 GLU A C   
2478 O O   . GLU A 338 ? 0.5526 0.6253 0.4447 0.0122  -0.1306 0.0048  326 GLU A O   
2479 C CB  . GLU A 338 ? 0.6239 0.7029 0.4675 0.0304  -0.1354 0.0302  326 GLU A CB  
2480 C CG  . GLU A 338 ? 0.6909 0.7820 0.5261 0.0398  -0.1441 0.0440  326 GLU A CG  
2481 C CD  . GLU A 338 ? 0.7908 0.8793 0.5916 0.0433  -0.1429 0.0504  326 GLU A CD  
2482 O OE1 . GLU A 338 ? 0.8090 0.8910 0.5927 0.0379  -0.1370 0.0409  326 GLU A OE1 
2483 O OE2 . GLU A 338 ? 0.8324 0.9257 0.6236 0.0522  -0.1471 0.0659  326 GLU A OE2 
2484 N N   . PHE A 339 ? 0.5596 0.6082 0.4294 0.0180  -0.1127 0.0155  327 PHE A N   
2485 C CA  . PHE A 339 ? 0.5396 0.5783 0.4149 0.0111  -0.1064 0.0042  327 PHE A CA  
2486 C C   . PHE A 339 ? 0.5241 0.5625 0.4256 0.0076  -0.1051 0.0026  327 PHE A C   
2487 O O   . PHE A 339 ? 0.5179 0.5574 0.4288 0.0011  -0.1081 -0.0071 327 PHE A O   
2488 C CB  . PHE A 339 ? 0.5495 0.5737 0.4127 0.0120  -0.0941 0.0065  327 PHE A CB  
2489 C CG  . PHE A 339 ? 0.5339 0.5479 0.4071 0.0071  -0.0868 -0.0015 327 PHE A CG  
2490 C CD1 . PHE A 339 ? 0.5752 0.5873 0.4438 0.0030  -0.0880 -0.0142 327 PHE A CD1 
2491 C CD2 . PHE A 339 ? 0.5180 0.5244 0.4050 0.0074  -0.0794 0.0034  327 PHE A CD2 
2492 C CE1 . PHE A 339 ? 0.5906 0.5929 0.4693 0.0000  -0.0818 -0.0202 327 PHE A CE1 
2493 C CE2 . PHE A 339 ? 0.5287 0.5276 0.4244 0.0037  -0.0739 -0.0026 327 PHE A CE2 
2494 C CZ  . PHE A 339 ? 0.5563 0.5528 0.4480 0.0003  -0.0750 -0.0137 327 PHE A CZ  
2495 N N   . VAL A 340 ? 0.5063 0.5428 0.4190 0.0119  -0.1003 0.0123  328 VAL A N   
2496 C CA  . VAL A 340 ? 0.4855 0.5221 0.4205 0.0091  -0.0969 0.0115  328 VAL A CA  
2497 C C   . VAL A 340 ? 0.4859 0.5386 0.4377 0.0051  -0.1063 0.0074  328 VAL A C   
2498 O O   . VAL A 340 ? 0.4634 0.5153 0.4284 -0.0017 -0.1052 0.0014  328 VAL A O   
2499 C CB  . VAL A 340 ? 0.4688 0.5018 0.4111 0.0156  -0.0904 0.0215  328 VAL A CB  
2500 C CG1 . VAL A 340 ? 0.4531 0.4926 0.4182 0.0143  -0.0885 0.0213  328 VAL A CG1 
2501 C CG2 . VAL A 340 ? 0.4610 0.4767 0.3925 0.0162  -0.0797 0.0231  328 VAL A CG2 
2502 N N   . ASN A 341 ? 0.5007 0.5686 0.4526 0.0093  -0.1158 0.0114  329 ASN A N   
2503 C CA  . ASN A 341 ? 0.5120 0.5996 0.4824 0.0056  -0.1260 0.0081  329 ASN A CA  
2504 C C   . ASN A 341 ? 0.5302 0.6197 0.4971 -0.0042 -0.1335 -0.0053 329 ASN A C   
2505 O O   . ASN A 341 ? 0.5288 0.6240 0.5149 -0.0123 -0.1358 -0.0110 329 ASN A O   
2506 C CB  . ASN A 341 ? 0.5216 0.6264 0.4936 0.0144  -0.1346 0.0170  329 ASN A CB  
2507 C CG  . ASN A 341 ? 0.5359 0.6389 0.5199 0.0232  -0.1270 0.0280  329 ASN A CG  
2508 O OD1 . ASN A 341 ? 0.5583 0.6646 0.5628 0.0209  -0.1218 0.0273  329 ASN A OD1 
2509 N ND2 . ASN A 341 ? 0.5206 0.6157 0.4907 0.0328  -0.1248 0.0378  329 ASN A ND2 
2510 N N   . GLU A 342 ? 0.5479 0.6318 0.4907 -0.0038 -0.1364 -0.0106 330 GLU A N   
2511 C CA  . GLU A 342 ? 0.5777 0.6600 0.5154 -0.0125 -0.1424 -0.0256 330 GLU A CA  
2512 C C   . GLU A 342 ? 0.5586 0.6225 0.5034 -0.0190 -0.1332 -0.0323 330 GLU A C   
2513 O O   . GLU A 342 ? 0.5582 0.6209 0.5141 -0.0278 -0.1373 -0.0426 330 GLU A O   
2514 C CB  . GLU A 342 ? 0.6071 0.6879 0.5149 -0.0094 -0.1460 -0.0303 330 GLU A CB  
2515 C CG  . GLU A 342 ? 0.7027 0.8049 0.6039 -0.0079 -0.1609 -0.0312 330 GLU A CG  
2516 C CD  . GLU A 342 ? 0.7724 0.8867 0.6909 -0.0181 -0.1726 -0.0442 330 GLU A CD  
2517 O OE1 . GLU A 342 ? 0.8327 0.9359 0.7479 -0.0259 -0.1722 -0.0588 330 GLU A OE1 
2518 O OE2 . GLU A 342 ? 0.8355 0.9701 0.7730 -0.0185 -0.1815 -0.0399 330 GLU A OE2 
2519 N N   . PHE A 343 ? 0.5377 0.5874 0.4779 -0.0147 -0.1212 -0.0261 331 PHE A N   
2520 C CA  . PHE A 343 ? 0.5227 0.5569 0.4704 -0.0192 -0.1131 -0.0302 331 PHE A CA  
2521 C C   . PHE A 343 ? 0.5153 0.5541 0.4888 -0.0250 -0.1130 -0.0279 331 PHE A C   
2522 O O   . PHE A 343 ? 0.5211 0.5535 0.5042 -0.0327 -0.1138 -0.0351 331 PHE A O   
2523 C CB  . PHE A 343 ? 0.5197 0.5419 0.4587 -0.0133 -0.1014 -0.0231 331 PHE A CB  
2524 C CG  . PHE A 343 ? 0.4954 0.5037 0.4412 -0.0163 -0.0936 -0.0259 331 PHE A CG  
2525 C CD1 . PHE A 343 ? 0.5152 0.5127 0.4532 -0.0185 -0.0929 -0.0360 331 PHE A CD1 
2526 C CD2 . PHE A 343 ? 0.4674 0.4740 0.4271 -0.0161 -0.0873 -0.0184 331 PHE A CD2 
2527 C CE1 . PHE A 343 ? 0.5162 0.5009 0.4613 -0.0200 -0.0864 -0.0372 331 PHE A CE1 
2528 C CE2 . PHE A 343 ? 0.4909 0.4860 0.4555 -0.0182 -0.0811 -0.0196 331 PHE A CE2 
2529 C CZ  . PHE A 343 ? 0.5103 0.4942 0.4685 -0.0200 -0.0810 -0.0285 331 PHE A CZ  
2530 N N   . LEU A 344 ? 0.5029 0.5515 0.4878 -0.0210 -0.1105 -0.0175 332 LEU A N   
2531 C CA  . LEU A 344 ? 0.4972 0.5520 0.5061 -0.0258 -0.1081 -0.0141 332 LEU A CA  
2532 C C   . LEU A 344 ? 0.5045 0.5736 0.5301 -0.0349 -0.1185 -0.0204 332 LEU A C   
2533 O O   . LEU A 344 ? 0.4810 0.5500 0.5244 -0.0429 -0.1167 -0.0213 332 LEU A O   
2534 C CB  . LEU A 344 ? 0.4650 0.5292 0.4818 -0.0184 -0.1033 -0.0032 332 LEU A CB  
2535 C CG  . LEU A 344 ? 0.4829 0.5324 0.4891 -0.0124 -0.0922 0.0018  332 LEU A CG  
2536 C CD1 . LEU A 344 ? 0.4764 0.5344 0.4889 -0.0040 -0.0889 0.0107  332 LEU A CD1 
2537 C CD2 . LEU A 344 ? 0.4082 0.4469 0.4205 -0.0175 -0.0844 0.0009  332 LEU A CD2 
2538 N N   . LYS A 345 ? 0.5352 0.6165 0.5540 -0.0339 -0.1296 -0.0247 333 LYS A N   
2539 C CA  . LYS A 345 ? 0.5594 0.6560 0.5929 -0.0430 -0.1413 -0.0325 333 LYS A CA  
2540 C C   . LYS A 345 ? 0.5632 0.6437 0.5959 -0.0536 -0.1426 -0.0454 333 LYS A C   
2541 O O   . LYS A 345 ? 0.5683 0.6536 0.6213 -0.0642 -0.1464 -0.0500 333 LYS A O   
2542 C CB  . LYS A 345 ? 0.5820 0.6968 0.6046 -0.0378 -0.1538 -0.0335 333 LYS A CB  
2543 C CG  . LYS A 345 ? 0.6452 0.7773 0.6767 -0.0468 -0.1689 -0.0444 333 LYS A CG  
2544 C CD  . LYS A 345 ? 0.7212 0.8736 0.7397 -0.0387 -0.1810 -0.0420 333 LYS A CD  
2545 C CE  . LYS A 345 ? 0.7981 0.9639 0.8126 -0.0466 -0.1974 -0.0564 333 LYS A CE  
2546 N NZ  . LYS A 345 ? 0.8080 0.9914 0.8542 -0.0595 -0.2059 -0.0634 333 LYS A NZ  
2547 N N   . THR A 346 ? 0.5663 0.6269 0.5771 -0.0506 -0.1383 -0.0509 334 THR A N   
2548 C CA  . THR A 346 ? 0.5809 0.6235 0.5896 -0.0584 -0.1389 -0.0640 334 THR A CA  
2549 C C   . THR A 346 ? 0.5575 0.5802 0.5746 -0.0601 -0.1273 -0.0598 334 THR A C   
2550 O O   . THR A 346 ? 0.5555 0.5643 0.5805 -0.0679 -0.1275 -0.0674 334 THR A O   
2551 C CB  . THR A 346 ? 0.5955 0.6275 0.5756 -0.0528 -0.1394 -0.0731 334 THR A CB  
2552 O OG1 . THR A 346 ? 0.6611 0.7109 0.6270 -0.0476 -0.1476 -0.0723 334 THR A OG1 
2553 C CG2 . THR A 346 ? 0.6252 0.6440 0.6037 -0.0606 -0.1439 -0.0901 334 THR A CG2 
2554 N N   . LEU A 347 ? 0.5303 0.5505 0.5445 -0.0524 -0.1173 -0.0478 335 LEU A N   
2555 C CA  . LEU A 347 ? 0.5225 0.5256 0.5419 -0.0529 -0.1071 -0.0432 335 LEU A CA  
2556 C C   . LEU A 347 ? 0.5265 0.5317 0.5707 -0.0623 -0.1059 -0.0390 335 LEU A C   
2557 O O   . LEU A 347 ? 0.5113 0.5338 0.5696 -0.0631 -0.1051 -0.0304 335 LEU A O   
2558 C CB  . LEU A 347 ? 0.5014 0.5045 0.5124 -0.0432 -0.0977 -0.0321 335 LEU A CB  
2559 C CG  . LEU A 347 ? 0.4924 0.4821 0.5068 -0.0421 -0.0877 -0.0257 335 LEU A CG  
2560 C CD1 . LEU A 347 ? 0.4824 0.4532 0.4858 -0.0405 -0.0856 -0.0329 335 LEU A CD1 
2561 C CD2 . LEU A 347 ? 0.4830 0.4787 0.4928 -0.0343 -0.0808 -0.0158 335 LEU A CD2 
2562 N N   . GLU A 348 ? 0.5429 0.5299 0.5929 -0.0689 -0.1047 -0.0441 336 GLU A N   
2563 C CA  . GLU A 348 ? 0.5568 0.5427 0.6301 -0.0789 -0.1022 -0.0384 336 GLU A CA  
2564 C C   . GLU A 348 ? 0.5584 0.5301 0.6318 -0.0756 -0.0909 -0.0275 336 GLU A C   
2565 O O   . GLU A 348 ? 0.5808 0.5348 0.6623 -0.0814 -0.0884 -0.0271 336 GLU A O   
2566 C CB  . GLU A 348 ? 0.5946 0.5698 0.6779 -0.0906 -0.1097 -0.0508 336 GLU A CB  
2567 C CG  . GLU A 348 ? 0.6369 0.6314 0.7239 -0.0960 -0.1223 -0.0611 336 GLU A CG  
2568 C CD  . GLU A 348 ? 0.7392 0.7249 0.8402 -0.1102 -0.1303 -0.0743 336 GLU A CD  
2569 O OE1 . GLU A 348 ? 0.8093 0.7683 0.9067 -0.1123 -0.1279 -0.0812 336 GLU A OE1 
2570 O OE2 . GLU A 348 ? 0.7966 0.8024 0.9139 -0.1192 -0.1391 -0.0778 336 GLU A OE2 
2571 N N   . LYS A 349 ? 0.5320 0.5106 0.5953 -0.0659 -0.0846 -0.0189 337 LYS A N   
2572 C CA  . LYS A 349 ? 0.5115 0.4815 0.5723 -0.0615 -0.0749 -0.0085 337 LYS A CA  
2573 C C   . LYS A 349 ? 0.4839 0.4735 0.5482 -0.0577 -0.0701 0.0012  337 LYS A C   
2574 O O   . LYS A 349 ? 0.4820 0.4864 0.5439 -0.0541 -0.0738 -0.0008 337 LYS A O   
2575 C CB  . LYS A 349 ? 0.5106 0.4678 0.5516 -0.0519 -0.0725 -0.0119 337 LYS A CB  
2576 C CG  . LYS A 349 ? 0.5450 0.4808 0.5810 -0.0523 -0.0747 -0.0215 337 LYS A CG  
2577 C CD  . LYS A 349 ? 0.5867 0.5071 0.6370 -0.0590 -0.0722 -0.0168 337 LYS A CD  
2578 C CE  . LYS A 349 ? 0.6132 0.5092 0.6621 -0.0592 -0.0738 -0.0259 337 LYS A CE  
2579 N NZ  . LYS A 349 ? 0.6520 0.5432 0.6837 -0.0494 -0.0739 -0.0346 337 LYS A NZ  
2580 N N   . PRO A 350 ? 0.4656 0.4550 0.5341 -0.0573 -0.0617 0.0118  338 PRO A N   
2581 C CA  . PRO A 350 ? 0.4468 0.4519 0.5135 -0.0512 -0.0562 0.0187  338 PRO A CA  
2582 C C   . PRO A 350 ? 0.4326 0.4376 0.4817 -0.0412 -0.0570 0.0148  338 PRO A C   
2583 O O   . PRO A 350 ? 0.4075 0.3988 0.4432 -0.0375 -0.0576 0.0107  338 PRO A O   
2584 C CB  . PRO A 350 ? 0.4530 0.4528 0.5189 -0.0507 -0.0473 0.0287  338 PRO A CB  
2585 C CG  . PRO A 350 ? 0.4740 0.4595 0.5502 -0.0599 -0.0482 0.0302  338 PRO A CG  
2586 C CD  . PRO A 350 ? 0.4761 0.4501 0.5491 -0.0614 -0.0568 0.0181  338 PRO A CD  
2587 N N   . ALA A 351 ? 0.4249 0.4453 0.4756 -0.0367 -0.0568 0.0163  339 ALA A N   
2588 C CA  . ALA A 351 ? 0.4285 0.4480 0.4643 -0.0280 -0.0572 0.0140  339 ALA A CA  
2589 C C   . ALA A 351 ? 0.4181 0.4447 0.4530 -0.0219 -0.0497 0.0197  339 ALA A C   
2590 O O   . ALA A 351 ? 0.4233 0.4635 0.4713 -0.0230 -0.0468 0.0239  339 ALA A O   
2591 C CB  . ALA A 351 ? 0.4169 0.4451 0.4531 -0.0270 -0.0655 0.0095  339 ALA A CB  
2592 N N   . VAL A 352 ? 0.4010 0.4191 0.4213 -0.0160 -0.0463 0.0189  340 VAL A N   
2593 C CA  . VAL A 352 ? 0.3848 0.4073 0.4019 -0.0098 -0.0403 0.0213  340 VAL A CA  
2594 C C   . VAL A 352 ? 0.4079 0.4285 0.4177 -0.0042 -0.0435 0.0187  340 VAL A C   
2595 O O   . VAL A 352 ? 0.4120 0.4226 0.4103 -0.0037 -0.0459 0.0156  340 VAL A O   
2596 C CB  . VAL A 352 ? 0.3767 0.3911 0.3837 -0.0085 -0.0345 0.0222  340 VAL A CB  
2597 C CG1 . VAL A 352 ? 0.3665 0.3849 0.3695 -0.0026 -0.0288 0.0224  340 VAL A CG1 
2598 C CG2 . VAL A 352 ? 0.3528 0.3672 0.3653 -0.0137 -0.0321 0.0269  340 VAL A CG2 
2599 N N   . ILE A 353 ? 0.4016 0.4328 0.4193 0.0001  -0.0435 0.0208  341 ILE A N   
2600 C CA  . ILE A 353 ? 0.3983 0.4286 0.4113 0.0056  -0.0477 0.0207  341 ILE A CA  
2601 C C   . ILE A 353 ? 0.3968 0.4237 0.4070 0.0128  -0.0415 0.0219  341 ILE A C   
2602 O O   . ILE A 353 ? 0.4024 0.4383 0.4225 0.0158  -0.0371 0.0233  341 ILE A O   
2603 C CB  . ILE A 353 ? 0.3965 0.4421 0.4224 0.0057  -0.0547 0.0222  341 ILE A CB  
2604 C CG1 . ILE A 353 ? 0.4193 0.4680 0.4504 -0.0031 -0.0605 0.0192  341 ILE A CG1 
2605 C CG2 . ILE A 353 ? 0.3873 0.4315 0.4057 0.0120  -0.0601 0.0237  341 ILE A CG2 
2606 C CD1 . ILE A 353 ? 0.4124 0.4805 0.4620 -0.0058 -0.0668 0.0201  341 ILE A CD1 
2607 N N   . ASP A 354 ? 0.4163 0.4299 0.4134 0.0152  -0.0406 0.0208  342 ASP A N   
2608 C CA  . ASP A 354 ? 0.4262 0.4315 0.4190 0.0202  -0.0345 0.0202  342 ASP A CA  
2609 C C   . ASP A 354 ? 0.4376 0.4333 0.4232 0.0244  -0.0366 0.0226  342 ASP A C   
2610 O O   . ASP A 354 ? 0.4415 0.4356 0.4202 0.0225  -0.0419 0.0242  342 ASP A O   
2611 C CB  . ASP A 354 ? 0.4375 0.4347 0.4217 0.0162  -0.0300 0.0163  342 ASP A CB  
2612 C CG  . ASP A 354 ? 0.4739 0.4637 0.4545 0.0197  -0.0240 0.0134  342 ASP A CG  
2613 O OD1 . ASP A 354 ? 0.5508 0.5434 0.5380 0.0257  -0.0212 0.0137  342 ASP A OD1 
2614 O OD2 . ASP A 354 ? 0.4960 0.4775 0.4681 0.0166  -0.0222 0.0099  342 ASP A OD2 
2615 N N   . ALA A 355 ? 0.4261 0.4147 0.4124 0.0302  -0.0319 0.0229  343 ALA A N   
2616 C CA  . ALA A 355 ? 0.4341 0.4079 0.4124 0.0330  -0.0312 0.0254  343 ALA A CA  
2617 C C   . ALA A 355 ? 0.4277 0.4042 0.4041 0.0363  -0.0379 0.0324  343 ALA A C   
2618 O O   . ALA A 355 ? 0.4103 0.3985 0.3965 0.0418  -0.0421 0.0359  343 ALA A O   
2619 C CB  . ALA A 355 ? 0.4335 0.3959 0.4006 0.0263  -0.0282 0.0217  343 ALA A CB  
2620 N N   . ASP A 356 ? 0.4605 0.4283 0.4243 0.0332  -0.0391 0.0347  344 ASP A N   
2621 C CA  . ASP A 356 ? 0.4795 0.4503 0.4375 0.0364  -0.0456 0.0417  344 ASP A CA  
2622 C C   . ASP A 356 ? 0.4683 0.4567 0.4300 0.0349  -0.0538 0.0406  344 ASP A C   
2623 O O   . ASP A 356 ? 0.4902 0.4863 0.4519 0.0398  -0.0607 0.0462  344 ASP A O   
2624 C CB  . ASP A 356 ? 0.5044 0.4639 0.4468 0.0328  -0.0437 0.0443  344 ASP A CB  
2625 C CG  . ASP A 356 ? 0.5299 0.4719 0.4700 0.0357  -0.0376 0.0494  344 ASP A CG  
2626 O OD1 . ASP A 356 ? 0.5800 0.5179 0.5265 0.0439  -0.0381 0.0551  344 ASP A OD1 
2627 O OD2 . ASP A 356 ? 0.5930 0.5253 0.5263 0.0297  -0.0324 0.0475  344 ASP A OD2 
2628 N N   . ALA A 357 ? 0.4487 0.4437 0.4144 0.0283  -0.0540 0.0338  345 ALA A N   
2629 C CA  . ALA A 357 ? 0.4412 0.4520 0.4137 0.0257  -0.0619 0.0318  345 ALA A CA  
2630 C C   . ALA A 357 ? 0.4436 0.4686 0.4338 0.0309  -0.0642 0.0348  345 ALA A C   
2631 O O   . ALA A 357 ? 0.4470 0.4866 0.4434 0.0316  -0.0725 0.0361  345 ALA A O   
2632 C CB  . ALA A 357 ? 0.4324 0.4437 0.4061 0.0173  -0.0610 0.0247  345 ALA A CB  
2633 N N   . ILE A 358 ? 0.4345 0.4568 0.4331 0.0352  -0.0569 0.0353  346 ILE A N   
2634 C CA  . ILE A 358 ? 0.4368 0.4728 0.4526 0.0423  -0.0575 0.0384  346 ILE A CA  
2635 C C   . ILE A 358 ? 0.4620 0.4970 0.4765 0.0523  -0.0621 0.0460  346 ILE A C   
2636 O O   . ILE A 358 ? 0.4421 0.4943 0.4685 0.0573  -0.0690 0.0497  346 ILE A O   
2637 C CB  . ILE A 358 ? 0.4287 0.4621 0.4523 0.0455  -0.0477 0.0359  346 ILE A CB  
2638 C CG1 . ILE A 358 ? 0.4185 0.4551 0.4435 0.0367  -0.0432 0.0305  346 ILE A CG1 
2639 C CG2 . ILE A 358 ? 0.4431 0.4926 0.4857 0.0546  -0.0477 0.0389  346 ILE A CG2 
2640 C CD1 . ILE A 358 ? 0.3901 0.4222 0.4161 0.0391  -0.0331 0.0270  346 ILE A CD1 
2641 N N   . ASN A 359 ? 0.4851 0.5005 0.4863 0.0553  -0.0584 0.0490  347 ASN A N   
2642 C CA  . ASN A 359 ? 0.5094 0.5194 0.5072 0.0650  -0.0618 0.0584  347 ASN A CA  
2643 C C   . ASN A 359 ? 0.5186 0.5417 0.5104 0.0653  -0.0734 0.0635  347 ASN A C   
2644 O O   . ASN A 359 ? 0.5326 0.5610 0.5273 0.0747  -0.0790 0.0720  347 ASN A O   
2645 C CB  . ASN A 359 ? 0.5109 0.4954 0.4937 0.0648  -0.0553 0.0612  347 ASN A CB  
2646 C CG  . ASN A 359 ? 0.5222 0.4928 0.5111 0.0666  -0.0453 0.0564  347 ASN A CG  
2647 O OD1 . ASN A 359 ? 0.5009 0.4780 0.5045 0.0736  -0.0431 0.0547  347 ASN A OD1 
2648 N ND2 . ASN A 359 ? 0.4882 0.4410 0.4662 0.0604  -0.0392 0.0533  347 ASN A ND2 
2649 N N   . VAL A 360 ? 0.5025 0.5306 0.4853 0.0556  -0.0772 0.0581  348 VAL A N   
2650 C CA  . VAL A 360 ? 0.5123 0.5539 0.4884 0.0556  -0.0887 0.0605  348 VAL A CA  
2651 C C   . VAL A 360 ? 0.4980 0.5628 0.4894 0.0508  -0.0966 0.0544  348 VAL A C   
2652 O O   . VAL A 360 ? 0.5042 0.5818 0.4910 0.0495  -0.1071 0.0541  348 VAL A O   
2653 C CB  . VAL A 360 ? 0.5175 0.5488 0.4696 0.0493  -0.0889 0.0590  348 VAL A CB  
2654 C CG1 . VAL A 360 ? 0.5505 0.5621 0.4894 0.0534  -0.0819 0.0669  348 VAL A CG1 
2655 C CG2 . VAL A 360 ? 0.4760 0.5039 0.4262 0.0384  -0.0849 0.0477  348 VAL A CG2 
2656 N N   . LEU A 361 ? 0.4809 0.5514 0.4903 0.0476  -0.0914 0.0494  349 LEU A N   
2657 C CA  . LEU A 361 ? 0.4790 0.5678 0.5025 0.0398  -0.0969 0.0431  349 LEU A CA  
2658 C C   . LEU A 361 ? 0.4879 0.6011 0.5263 0.0453  -0.1077 0.0472  349 LEU A C   
2659 O O   . LEU A 361 ? 0.4801 0.5984 0.5280 0.0562  -0.1069 0.0543  349 LEU A O   
2660 C CB  . LEU A 361 ? 0.4581 0.5482 0.4973 0.0358  -0.0877 0.0394  349 LEU A CB  
2661 C CG  . LEU A 361 ? 0.4662 0.5721 0.5212 0.0255  -0.0909 0.0338  349 LEU A CG  
2662 C CD1 . LEU A 361 ? 0.4908 0.5884 0.5332 0.0149  -0.0952 0.0267  349 LEU A CD1 
2663 C CD2 . LEU A 361 ? 0.4695 0.5757 0.5370 0.0237  -0.0800 0.0331  349 LEU A CD2 
2664 N N   . ASP A 362 ? 0.5011 0.6293 0.5422 0.0377  -0.1180 0.0419  350 ASP A N   
2665 C CA  . ASP A 362 ? 0.5132 0.6702 0.5741 0.0398  -0.1292 0.0435  350 ASP A CA  
2666 C C   . ASP A 362 ? 0.5026 0.6729 0.5890 0.0311  -0.1253 0.0381  350 ASP A C   
2667 O O   . ASP A 362 ? 0.4968 0.6631 0.5827 0.0186  -0.1251 0.0301  350 ASP A O   
2668 C CB  . ASP A 362 ? 0.5337 0.6992 0.5810 0.0354  -0.1434 0.0395  350 ASP A CB  
2669 C CG  . ASP A 362 ? 0.5701 0.7680 0.6386 0.0342  -0.1572 0.0383  350 ASP A CG  
2670 O OD1 . ASP A 362 ? 0.5825 0.7987 0.6791 0.0357  -0.1556 0.0403  350 ASP A OD1 
2671 O OD2 . ASP A 362 ? 0.6415 0.8477 0.6976 0.0312  -0.1698 0.0344  350 ASP A OD2 
2672 N N   . THR A 363 ? 0.5142 0.6988 0.6229 0.0380  -0.1208 0.0428  351 THR A N   
2673 C CA  . THR A 363 ? 0.5126 0.7099 0.6448 0.0299  -0.1144 0.0394  351 THR A CA  
2674 C C   . THR A 363 ? 0.5108 0.7306 0.6601 0.0176  -0.1252 0.0338  351 THR A C   
2675 O O   . THR A 363 ? 0.5068 0.7310 0.6707 0.0067  -0.1199 0.0303  351 THR A O   
2676 C CB  . THR A 363 ? 0.5036 0.7155 0.6576 0.0405  -0.1066 0.0450  351 THR A CB  
2677 O OG1 . THR A 363 ? 0.5114 0.7463 0.6788 0.0500  -0.1172 0.0499  351 THR A OG1 
2678 C CG2 . THR A 363 ? 0.5344 0.7222 0.6738 0.0507  -0.0946 0.0481  351 THR A CG2 
2679 N N   . SER A 364 ? 0.5266 0.7605 0.6739 0.0186  -0.1402 0.0329  352 SER A N   
2680 C CA  . SER A 364 ? 0.5389 0.7908 0.6990 0.0047  -0.1518 0.0247  352 SER A CA  
2681 C C   . SER A 364 ? 0.5415 0.7704 0.6873 -0.0088 -0.1486 0.0158  352 SER A C   
2682 O O   . SER A 364 ? 0.5382 0.7741 0.7003 -0.0224 -0.1502 0.0096  352 SER A O   
2683 C CB  . SER A 364 ? 0.5501 0.8172 0.7021 0.0081  -0.1696 0.0236  352 SER A CB  
2684 O OG  . SER A 364 ? 0.5789 0.8628 0.7392 0.0239  -0.1729 0.0338  352 SER A OG  
2685 N N   . VAL A 365 ? 0.6073 0.6948 0.6289 0.0375  -0.1229 -0.0234 353 VAL A N   
2686 C CA  . VAL A 365 ? 0.6194 0.6974 0.6409 0.0309  -0.1179 -0.0265 353 VAL A CA  
2687 C C   . VAL A 365 ? 0.5989 0.6796 0.6460 0.0198  -0.1122 -0.0244 353 VAL A C   
2688 O O   . VAL A 365 ? 0.5913 0.6701 0.6490 0.0134  -0.1145 -0.0308 353 VAL A O   
2689 C CB  . VAL A 365 ? 0.6329 0.6961 0.6284 0.0351  -0.1079 -0.0212 353 VAL A CB  
2690 C CG1 . VAL A 365 ? 0.6504 0.7053 0.6483 0.0289  -0.1025 -0.0243 353 VAL A CG1 
2691 C CG2 . VAL A 365 ? 0.6619 0.7210 0.6301 0.0456  -0.1137 -0.0241 353 VAL A CG2 
2692 N N   . LEU A 366 ? 0.5984 0.6829 0.6546 0.0179  -0.1049 -0.0156 354 LEU A N   
2693 C CA  . LEU A 366 ? 0.5897 0.6765 0.6678 0.0080  -0.0988 -0.0126 354 LEU A CA  
2694 C C   . LEU A 366 ? 0.6176 0.7160 0.7206 0.0015  -0.1061 -0.0189 354 LEU A C   
2695 O O   . LEU A 366 ? 0.6245 0.7207 0.7423 -0.0072 -0.1032 -0.0195 354 LEU A O   
2696 C CB  . LEU A 366 ? 0.5789 0.6694 0.6614 0.0084  -0.0906 -0.0031 354 LEU A CB  
2697 C CG  . LEU A 366 ? 0.5292 0.6084 0.5942 0.0114  -0.0807 0.0044  354 LEU A CG  
2698 C CD1 . LEU A 366 ? 0.4786 0.5626 0.5501 0.0117  -0.0742 0.0122  354 LEU A CD1 
2699 C CD2 . LEU A 366 ? 0.5007 0.5702 0.5664 0.0050  -0.0751 0.0041  354 LEU A CD2 
2700 N N   . LYS A 367 ? 0.6504 0.7616 0.7590 0.0059  -0.1154 -0.0233 355 LYS A N   
2701 C CA  . LYS A 367 ? 0.6634 0.7884 0.7988 -0.0005 -0.1226 -0.0300 355 LYS A CA  
2702 C C   . LYS A 367 ? 0.6796 0.7997 0.8179 -0.0049 -0.1301 -0.0405 355 LYS A C   
2703 O O   . LYS A 367 ? 0.6937 0.8188 0.8555 -0.0144 -0.1319 -0.0448 355 LYS A O   
2704 C CB  . LYS A 367 ? 0.6713 0.8130 0.8128 0.0064  -0.1318 -0.0329 355 LYS A CB  
2705 C CG  . LYS A 367 ? 0.6882 0.8342 0.8278 0.0114  -0.1245 -0.0230 355 LYS A CG  
2706 C CD  . LYS A 367 ? 0.7147 0.8778 0.8622 0.0194  -0.1342 -0.0262 355 LYS A CD  
2707 C CE  . LYS A 367 ? 0.7296 0.8973 0.8790 0.0240  -0.1264 -0.0169 355 LYS A CE  
2708 N NZ  . LYS A 367 ? 0.7314 0.8822 0.8523 0.0312  -0.1184 -0.0078 355 LYS A NZ  
2709 N N   . GLU A 368 ? 0.6890 0.7988 0.8038 0.0014  -0.1339 -0.0448 356 GLU A N   
2710 C CA  . GLU A 368 ? 0.7001 0.8052 0.8168 -0.0017 -0.1419 -0.0563 356 GLU A CA  
2711 C C   . GLU A 368 ? 0.6825 0.7714 0.7967 -0.0077 -0.1337 -0.0549 356 GLU A C   
2712 O O   . GLU A 368 ? 0.6853 0.7689 0.8048 -0.0118 -0.1391 -0.0640 356 GLU A O   
2713 C CB  . GLU A 368 ? 0.7318 0.8355 0.8250 0.0087  -0.1519 -0.0640 356 GLU A CB  
2714 C CG  . GLU A 368 ? 0.7964 0.8838 0.8589 0.0152  -0.1449 -0.0607 356 GLU A CG  
2715 C CD  . GLU A 368 ? 0.8576 0.9433 0.8948 0.0258  -0.1542 -0.0681 356 GLU A CD  
2716 O OE1 . GLU A 368 ? 0.9018 0.9888 0.9206 0.0350  -0.1540 -0.0623 356 GLU A OE1 
2717 O OE2 . GLU A 368 ? 0.9175 0.9998 0.9525 0.0251  -0.1618 -0.0796 356 GLU A OE2 
2718 N N   . ARG A 369 ? 0.6504 0.7315 0.7571 -0.0079 -0.1214 -0.0441 357 ARG A N   
2719 C CA  . ARG A 369 ? 0.6382 0.7052 0.7437 -0.0126 -0.1143 -0.0425 357 ARG A CA  
2720 C C   . ARG A 369 ? 0.6244 0.6923 0.7558 -0.0237 -0.1136 -0.0428 357 ARG A C   
2721 O O   . ARG A 369 ? 0.6114 0.6892 0.7589 -0.0281 -0.1107 -0.0372 357 ARG A O   
2722 C CB  . ARG A 369 ? 0.6311 0.6918 0.7248 -0.0103 -0.1021 -0.0311 357 ARG A CB  
2723 C CG  . ARG A 369 ? 0.6269 0.6816 0.6943 -0.0011 -0.0998 -0.0303 357 ARG A CG  
2724 C CD  . ARG A 369 ? 0.6023 0.6521 0.6619 -0.0001 -0.0878 -0.0197 357 ARG A CD  
2725 N NE  . ARG A 369 ? 0.5621 0.6052 0.6318 -0.0065 -0.0813 -0.0162 357 ARG A NE  
2726 C CZ  . ARG A 369 ? 0.5573 0.5902 0.6224 -0.0069 -0.0795 -0.0196 357 ARG A CZ  
2727 N NH1 . ARG A 369 ? 0.5236 0.5518 0.5747 -0.0019 -0.0828 -0.0271 357 ARG A NH1 
2728 N NH2 . ARG A 369 ? 0.5909 0.6180 0.6650 -0.0118 -0.0742 -0.0155 357 ARG A NH2 
2729 N N   . LYS A 370 ? 0.6262 0.6833 0.7613 -0.0280 -0.1159 -0.0492 358 LYS A N   
2730 C CA  . LYS A 370 ? 0.6310 0.6837 0.7879 -0.0387 -0.1132 -0.0479 358 LYS A CA  
2731 C C   . LYS A 370 ? 0.6107 0.6540 0.7640 -0.0404 -0.1012 -0.0361 358 LYS A C   
2732 O O   . LYS A 370 ? 0.6111 0.6550 0.7798 -0.0478 -0.0960 -0.0297 358 LYS A O   
2733 C CB  . LYS A 370 ? 0.6544 0.6955 0.8154 -0.0423 -0.1197 -0.0588 358 LYS A CB  
2734 C CG  . LYS A 370 ? 0.7060 0.7521 0.8633 -0.0384 -0.1326 -0.0730 358 LYS A CG  
2735 C CD  . LYS A 370 ? 0.7353 0.7986 0.9130 -0.0428 -0.1407 -0.0777 358 LYS A CD  
2736 C CE  . LYS A 370 ? 0.7844 0.8490 0.9635 -0.0419 -0.1547 -0.0941 358 LYS A CE  
2737 N NZ  . LYS A 370 ? 0.7889 0.8732 0.9859 -0.0438 -0.1644 -0.1002 358 LYS A NZ  
2738 N N   . SER A 371 ? 0.5864 0.6212 0.7196 -0.0335 -0.0969 -0.0338 359 SER A N   
2739 C CA  . SER A 371 ? 0.5650 0.5918 0.6942 -0.0341 -0.0868 -0.0239 359 SER A CA  
2740 C C   . SER A 371 ? 0.5316 0.5673 0.6590 -0.0327 -0.0798 -0.0136 359 SER A C   
2741 O O   . SER A 371 ? 0.5281 0.5742 0.6513 -0.0286 -0.0819 -0.0138 359 SER A O   
2742 C CB  . SER A 371 ? 0.5689 0.5855 0.6799 -0.0274 -0.0848 -0.0261 359 SER A CB  
2743 O OG  . SER A 371 ? 0.5788 0.5842 0.6935 -0.0295 -0.0887 -0.0335 359 SER A OG  
2744 N N   . PRO A 372 ? 0.5162 0.5471 0.6458 -0.0355 -0.0717 -0.0047 360 PRO A N   
2745 C CA  . PRO A 372 ? 0.4844 0.5232 0.6125 -0.0344 -0.0650 0.0042  360 PRO A CA  
2746 C C   . PRO A 372 ? 0.4623 0.5014 0.5720 -0.0264 -0.0618 0.0062  360 PRO A C   
2747 O O   . PRO A 372 ? 0.4574 0.4899 0.5548 -0.0220 -0.0630 0.0020  360 PRO A O   
2748 C CB  . PRO A 372 ? 0.4902 0.5218 0.6239 -0.0394 -0.0582 0.0119  360 PRO A CB  
2749 C CG  . PRO A 372 ? 0.5048 0.5227 0.6394 -0.0414 -0.0608 0.0079  360 PRO A CG  
2750 C CD  . PRO A 372 ? 0.5136 0.5318 0.6497 -0.0406 -0.0693 -0.0028 360 PRO A CD  
2751 N N   . ALA A 373 ? 0.4317 0.4784 0.5402 -0.0247 -0.0574 0.0124  361 ALA A N   
2752 C CA  . ALA A 373 ? 0.4300 0.4760 0.5230 -0.0183 -0.0535 0.0152  361 ALA A CA  
2753 C C   . ALA A 373 ? 0.4167 0.4662 0.5118 -0.0192 -0.0464 0.0233  361 ALA A C   
2754 O O   . ALA A 373 ? 0.4185 0.4758 0.5257 -0.0226 -0.0456 0.0260  361 ALA A O   
2755 C CB  . ALA A 373 ? 0.4402 0.4921 0.5248 -0.0123 -0.0585 0.0114  361 ALA A CB  
2756 N N   . VAL A 374 ? 0.3873 0.4316 0.4710 -0.0160 -0.0410 0.0265  362 VAL A N   
2757 C CA  . VAL A 374 ? 0.3873 0.4348 0.4691 -0.0149 -0.0350 0.0326  362 VAL A CA  
2758 C C   . VAL A 374 ? 0.3875 0.4346 0.4560 -0.0087 -0.0339 0.0323  362 VAL A C   
2759 O O   . VAL A 374 ? 0.3807 0.4215 0.4387 -0.0062 -0.0335 0.0298  362 VAL A O   
2760 C CB  . VAL A 374 ? 0.3833 0.4245 0.4627 -0.0165 -0.0295 0.0364  362 VAL A CB  
2761 C CG1 . VAL A 374 ? 0.3715 0.4160 0.4484 -0.0152 -0.0238 0.0415  362 VAL A CG1 
2762 C CG2 . VAL A 374 ? 0.4064 0.4443 0.4951 -0.0216 -0.0305 0.0373  362 VAL A CG2 
2763 N N   . LEU A 375 ? 0.3886 0.4415 0.4575 -0.0063 -0.0326 0.0352  363 LEU A N   
2764 C CA  . LEU A 375 ? 0.3826 0.4329 0.4385 -0.0005 -0.0303 0.0368  363 LEU A CA  
2765 C C   . LEU A 375 ? 0.3723 0.4210 0.4272 -0.0008 -0.0234 0.0414  363 LEU A C   
2766 O O   . LEU A 375 ? 0.3840 0.4381 0.4483 -0.0032 -0.0217 0.0438  363 LEU A O   
2767 C CB  . LEU A 375 ? 0.3929 0.4499 0.4494 0.0039  -0.0351 0.0360  363 LEU A CB  
2768 C CG  . LEU A 375 ? 0.4351 0.4921 0.4856 0.0071  -0.0426 0.0309  363 LEU A CG  
2769 C CD1 . LEU A 375 ? 0.4480 0.5090 0.5111 0.0019  -0.0482 0.0257  363 LEU A CD1 
2770 C CD2 . LEU A 375 ? 0.4535 0.5157 0.5002 0.0139  -0.0472 0.0311  363 LEU A CD2 
2771 N N   . THR A 376 ? 0.3704 0.4120 0.4142 0.0013  -0.0189 0.0424  364 THR A N   
2772 C CA  . THR A 376 ? 0.3695 0.4086 0.4121 0.0007  -0.0127 0.0455  364 THR A CA  
2773 C C   . THR A 376 ? 0.3665 0.4008 0.3994 0.0050  -0.0093 0.0475  364 THR A C   
2774 O O   . THR A 376 ? 0.3954 0.4231 0.4217 0.0047  -0.0047 0.0477  364 THR A O   
2775 C CB  . THR A 376 ? 0.3819 0.4162 0.4234 -0.0022 -0.0098 0.0444  364 THR A CB  
2776 O OG1 . THR A 376 ? 0.4050 0.4337 0.4371 -0.0003 -0.0084 0.0423  364 THR A OG1 
2777 C CG2 . THR A 376 ? 0.3655 0.4018 0.4155 -0.0059 -0.0131 0.0430  364 THR A CG2 
2778 N N   . PRO A 377 ? 0.3733 0.4108 0.4060 0.0092  -0.0115 0.0490  365 PRO A N   
2779 C CA  . PRO A 377 ? 0.3794 0.4104 0.4023 0.0140  -0.0086 0.0515  365 PRO A CA  
2780 C C   . PRO A 377 ? 0.3881 0.4171 0.4132 0.0134  -0.0030 0.0535  365 PRO A C   
2781 O O   . PRO A 377 ? 0.3799 0.4162 0.4150 0.0113  -0.0029 0.0533  365 PRO A O   
2782 C CB  . PRO A 377 ? 0.3891 0.4260 0.4135 0.0193  -0.0146 0.0516  365 PRO A CB  
2783 C CG  . PRO A 377 ? 0.3744 0.4229 0.4142 0.0159  -0.0173 0.0501  365 PRO A CG  
2784 C CD  . PRO A 377 ? 0.3734 0.4210 0.4164 0.0096  -0.0169 0.0481  365 PRO A CD  
2785 N N   . HIS A 378 ? 0.3861 0.4049 0.4020 0.0151  0.0018  0.0551  366 HIS A N   
2786 C CA  . HIS A 378 ? 0.3898 0.4055 0.4062 0.0170  0.0056  0.0566  366 HIS A CA  
2787 C C   . HIS A 378 ? 0.4052 0.4217 0.4196 0.0244  0.0025  0.0587  366 HIS A C   
2788 O O   . HIS A 378 ? 0.4071 0.4265 0.4189 0.0277  -0.0028 0.0589  366 HIS A O   
2789 C CB  . HIS A 378 ? 0.3985 0.4028 0.4086 0.0150  0.0122  0.0569  366 HIS A CB  
2790 C CG  . HIS A 378 ? 0.4245 0.4177 0.4223 0.0172  0.0146  0.0592  366 HIS A CG  
2791 N ND1 . HIS A 378 ? 0.4349 0.4215 0.4242 0.0238  0.0138  0.0627  366 HIS A ND1 
2792 C CD2 . HIS A 378 ? 0.4326 0.4202 0.4248 0.0141  0.0182  0.0589  366 HIS A CD2 
2793 C CE1 . HIS A 378 ? 0.4949 0.4709 0.4719 0.0245  0.0170  0.0652  366 HIS A CE1 
2794 N NE2 . HIS A 378 ? 0.4360 0.4131 0.4150 0.0184  0.0202  0.0627  366 HIS A NE2 
2795 N N   . PRO A 379 ? 0.4087 0.4243 0.4254 0.0274  0.0049  0.0594  367 PRO A N   
2796 C CA  . PRO A 379 ? 0.4205 0.4387 0.4376 0.0353  0.0012  0.0609  367 PRO A CA  
2797 C C   . PRO A 379 ? 0.4349 0.4429 0.4386 0.0414  -0.0008 0.0639  367 PRO A C   
2798 O O   . PRO A 379 ? 0.4191 0.4325 0.4231 0.0479  -0.0070 0.0644  367 PRO A O   
2799 C CB  . PRO A 379 ? 0.4245 0.4396 0.4442 0.0376  0.0058  0.0608  367 PRO A CB  
2800 C CG  . PRO A 379 ? 0.4194 0.4385 0.4452 0.0299  0.0097  0.0581  367 PRO A CG  
2801 C CD  . PRO A 379 ? 0.4166 0.4305 0.4370 0.0243  0.0101  0.0581  367 PRO A CD  
2802 N N   . GLY A 380 ? 0.4445 0.4383 0.4364 0.0394  0.0042  0.0659  368 GLY A N   
2803 C CA  . GLY A 380 ? 0.4653 0.4476 0.4416 0.0447  0.0035  0.0697  368 GLY A CA  
2804 C C   . GLY A 380 ? 0.4688 0.4578 0.4414 0.0458  -0.0030 0.0686  368 GLY A C   
2805 O O   . GLY A 380 ? 0.4554 0.4432 0.4195 0.0534  -0.0086 0.0704  368 GLY A O   
2806 N N   . GLU A 381 ? 0.4573 0.4530 0.4359 0.0388  -0.0028 0.0651  369 GLU A N   
2807 C CA  . GLU A 381 ? 0.4635 0.4659 0.4404 0.0390  -0.0092 0.0626  369 GLU A CA  
2808 C C   . GLU A 381 ? 0.4492 0.4663 0.4384 0.0419  -0.0178 0.0599  369 GLU A C   
2809 O O   . GLU A 381 ? 0.4608 0.4816 0.4459 0.0460  -0.0250 0.0584  369 GLU A O   
2810 C CB  . GLU A 381 ? 0.4538 0.4591 0.4360 0.0308  -0.0065 0.0591  369 GLU A CB  
2811 C CG  . GLU A 381 ? 0.4594 0.4528 0.4306 0.0282  0.0012  0.0607  369 GLU A CG  
2812 C CD  . GLU A 381 ? 0.4587 0.4550 0.4386 0.0204  0.0052  0.0574  369 GLU A CD  
2813 O OE1 . GLU A 381 ? 0.4309 0.4360 0.4240 0.0170  0.0030  0.0551  369 GLU A OE1 
2814 O OE2 . GLU A 381 ? 0.4735 0.4631 0.4465 0.0181  0.0109  0.0574  369 GLU A OE2 
2815 N N   . MET A 382 ? 0.4421 0.4687 0.4471 0.0390  -0.0171 0.0586  370 MET A N   
2816 C CA  . MET A 382 ? 0.4388 0.4806 0.4578 0.0411  -0.0241 0.0560  370 MET A CA  
2817 C C   . MET A 382 ? 0.4549 0.4966 0.4690 0.0514  -0.0291 0.0578  370 MET A C   
2818 O O   . MET A 382 ? 0.4483 0.4998 0.4669 0.0552  -0.0374 0.0552  370 MET A O   
2819 C CB  . MET A 382 ? 0.4360 0.4862 0.4703 0.0370  -0.0202 0.0555  370 MET A CB  
2820 C CG  . MET A 382 ? 0.4423 0.5098 0.4939 0.0379  -0.0254 0.0529  370 MET A CG  
2821 S SD  . MET A 382 ? 0.4949 0.5707 0.5552 0.0308  -0.0310 0.0487  370 MET A SD  
2822 C CE  . MET A 382 ? 0.5238 0.6203 0.6069 0.0316  -0.0358 0.0459  370 MET A CE  
2823 N N   . ALA A 383 ? 0.4670 0.4977 0.4730 0.0559  -0.0242 0.0617  371 ALA A N   
2824 C CA  . ALA A 383 ? 0.4902 0.5175 0.4894 0.0667  -0.0284 0.0642  371 ALA A CA  
2825 C C   . ALA A 383 ? 0.5244 0.5474 0.5083 0.0723  -0.0355 0.0649  371 ALA A C   
2826 O O   . ALA A 383 ? 0.5089 0.5411 0.4957 0.0796  -0.0447 0.0632  371 ALA A O   
2827 C CB  . ALA A 383 ? 0.4911 0.5017 0.4801 0.0694  -0.0208 0.0687  371 ALA A CB  
2828 N N   . ARG A 384 ? 0.5492 0.5592 0.5171 0.0692  -0.0312 0.0670  372 ARG A N   
2829 C CA  . ARG A 384 ? 0.5960 0.6008 0.5463 0.0743  -0.0368 0.0676  372 ARG A CA  
2830 C C   . ARG A 384 ? 0.5764 0.5975 0.5370 0.0724  -0.0461 0.0609  372 ARG A C   
2831 O O   . ARG A 384 ? 0.5760 0.6008 0.5302 0.0796  -0.0553 0.0594  372 ARG A O   
2832 C CB  . ARG A 384 ? 0.6185 0.6079 0.5514 0.0701  -0.0286 0.0704  372 ARG A CB  
2833 C CG  . ARG A 384 ? 0.7205 0.6896 0.6342 0.0749  -0.0216 0.0780  372 ARG A CG  
2834 C CD  . ARG A 384 ? 0.8082 0.7643 0.7048 0.0706  -0.0135 0.0804  372 ARG A CD  
2835 N NE  . ARG A 384 ? 0.8638 0.8248 0.7734 0.0595  -0.0070 0.0765  372 ARG A NE  
2836 C CZ  . ARG A 384 ? 0.8735 0.8290 0.7902 0.0535  0.0017  0.0778  372 ARG A CZ  
2837 N NH1 . ARG A 384 ? 0.9140 0.8577 0.8264 0.0569  0.0057  0.0827  372 ARG A NH1 
2838 N NH2 . ARG A 384 ? 0.8286 0.7901 0.7570 0.0444  0.0058  0.0737  372 ARG A NH2 
2839 N N   . LEU A 385 ? 0.5529 0.5836 0.5302 0.0629  -0.0441 0.0567  373 LEU A N   
2840 C CA  . LEU A 385 ? 0.5470 0.5910 0.5343 0.0602  -0.0525 0.0501  373 LEU A CA  
2841 C C   . LEU A 385 ? 0.5453 0.6052 0.5470 0.0656  -0.0624 0.0470  373 LEU A C   
2842 O O   . LEU A 385 ? 0.5652 0.6323 0.5668 0.0687  -0.0721 0.0423  373 LEU A O   
2843 C CB  . LEU A 385 ? 0.5404 0.5896 0.5426 0.0491  -0.0479 0.0472  373 LEU A CB  
2844 C CG  . LEU A 385 ? 0.5281 0.5878 0.5414 0.0441  -0.0548 0.0405  373 LEU A CG  
2845 C CD1 . LEU A 385 ? 0.5543 0.6062 0.5499 0.0463  -0.0581 0.0380  373 LEU A CD1 
2846 C CD2 . LEU A 385 ? 0.5258 0.5883 0.5535 0.0342  -0.0490 0.0397  373 LEU A CD2 
2847 N N   . VAL A 386 ? 0.5136 0.5799 0.5287 0.0670  -0.0600 0.0486  374 VAL A N   
2848 C CA  . VAL A 386 ? 0.4985 0.5824 0.5305 0.0720  -0.0688 0.0450  374 VAL A CA  
2849 C C   . VAL A 386 ? 0.4979 0.5768 0.5188 0.0853  -0.0728 0.0486  374 VAL A C   
2850 O O   . VAL A 386 ? 0.4971 0.5899 0.5311 0.0914  -0.0799 0.0460  374 VAL A O   
2851 C CB  . VAL A 386 ? 0.4766 0.5745 0.5336 0.0655  -0.0640 0.0434  374 VAL A CB  
2852 C CG1 . VAL A 386 ? 0.4717 0.5737 0.5392 0.0531  -0.0611 0.0403  374 VAL A CG1 
2853 C CG2 . VAL A 386 ? 0.4633 0.5515 0.5163 0.0666  -0.0538 0.0488  374 VAL A CG2 
2854 N N   . LYS A 387 ? 0.5154 0.5742 0.5124 0.0898  -0.0682 0.0547  375 LYS A N   
2855 C CA  . LYS A 387 ? 0.5319 0.5823 0.5149 0.1031  -0.0722 0.0592  375 LYS A CA  
2856 C C   . LYS A 387 ? 0.5243 0.5796 0.5215 0.1073  -0.0695 0.0605  375 LYS A C   
2857 O O   . LYS A 387 ? 0.5178 0.5794 0.5182 0.1181  -0.0771 0.0602  375 LYS A O   
2858 C CB  . LYS A 387 ? 0.5442 0.6029 0.5220 0.1120  -0.0865 0.0556  375 LYS A CB  
2859 C CG  . LYS A 387 ? 0.5743 0.6247 0.5332 0.1089  -0.0881 0.0544  375 LYS A CG  
2860 C CD  . LYS A 387 ? 0.6577 0.7071 0.5989 0.1205  -0.1003 0.0535  375 LYS A CD  
2861 C CE  . LYS A 387 ? 0.7215 0.7495 0.6301 0.1218  -0.0955 0.0585  375 LYS A CE  
2862 N NZ  . LYS A 387 ? 0.7257 0.7311 0.6178 0.1223  -0.0822 0.0687  375 LYS A NZ  
2863 N N   . LYS A 388 ? 0.4980 0.5501 0.5028 0.0994  -0.0587 0.0617  376 LYS A N   
2864 C CA  . LYS A 388 ? 0.5125 0.5658 0.5273 0.1032  -0.0541 0.0629  376 LYS A CA  
2865 C C   . LYS A 388 ? 0.5135 0.5445 0.5137 0.1011  -0.0429 0.0684  376 LYS A C   
2866 O O   . LYS A 388 ? 0.5213 0.5384 0.5062 0.0962  -0.0386 0.0711  376 LYS A O   
2867 C CB  . LYS A 388 ? 0.4962 0.5704 0.5374 0.0954  -0.0521 0.0576  376 LYS A CB  
2868 C CG  . LYS A 388 ? 0.5228 0.6191 0.5806 0.0969  -0.0632 0.0517  376 LYS A CG  
2869 C CD  . LYS A 388 ? 0.5431 0.6606 0.6279 0.0883  -0.0611 0.0467  376 LYS A CD  
2870 C CE  . LYS A 388 ? 0.5829 0.7223 0.6854 0.0920  -0.0732 0.0406  376 LYS A CE  
2871 N NZ  . LYS A 388 ? 0.6066 0.7688 0.7385 0.0872  -0.0708 0.0363  376 LYS A NZ  
2872 N N   . THR A 389 ? 0.5002 0.5288 0.5066 0.1045  -0.0381 0.0691  377 THR A N   
2873 C CA  . THR A 389 ? 0.5088 0.5175 0.5043 0.1021  -0.0282 0.0729  377 THR A CA  
2874 C C   . THR A 389 ? 0.4970 0.5115 0.5032 0.0893  -0.0207 0.0696  377 THR A C   
2875 O O   . THR A 389 ? 0.4870 0.5204 0.5100 0.0846  -0.0226 0.0653  377 THR A O   
2876 C CB  . THR A 389 ? 0.5332 0.5359 0.5306 0.1117  -0.0267 0.0741  377 THR A CB  
2877 O OG1 . THR A 389 ? 0.5160 0.5378 0.5351 0.1099  -0.0256 0.0687  377 THR A OG1 
2878 C CG2 . THR A 389 ? 0.5258 0.5261 0.5152 0.1266  -0.0364 0.0769  377 THR A CG2 
2879 N N   . VAL A 390 ? 0.5094 0.5074 0.5055 0.0837  -0.0125 0.0718  378 VAL A N   
2880 C CA  . VAL A 390 ? 0.5053 0.5062 0.5091 0.0733  -0.0057 0.0689  378 VAL A CA  
2881 C C   . VAL A 390 ? 0.5115 0.5241 0.5306 0.0743  -0.0037 0.0653  378 VAL A C   
2882 O O   . VAL A 390 ? 0.5199 0.5455 0.5504 0.0674  -0.0023 0.0622  378 VAL A O   
2883 C CB  . VAL A 390 ? 0.5236 0.5041 0.5150 0.0694  0.0021  0.0713  378 VAL A CB  
2884 C CG1 . VAL A 390 ? 0.4906 0.4740 0.4907 0.0607  0.0084  0.0675  378 VAL A CG1 
2885 C CG2 . VAL A 390 ? 0.5144 0.4859 0.4924 0.0661  0.0023  0.0743  378 VAL A CG2 
2886 N N   . GLY A 391 ? 0.5305 0.5376 0.5491 0.0831  -0.0032 0.0659  379 GLY A N   
2887 C CA  . GLY A 391 ? 0.5294 0.5481 0.5620 0.0857  -0.0009 0.0620  379 GLY A CA  
2888 C C   . GLY A 391 ? 0.5202 0.5639 0.5707 0.0862  -0.0057 0.0589  379 GLY A C   
2889 O O   . GLY A 391 ? 0.5052 0.5615 0.5683 0.0835  -0.0018 0.0556  379 GLY A O   
2890 N N   . ASP A 392 ? 0.5107 0.5619 0.5627 0.0895  -0.0139 0.0597  380 ASP A N   
2891 C CA  . ASP A 392 ? 0.5039 0.5789 0.5747 0.0888  -0.0185 0.0562  380 ASP A CA  
2892 C C   . ASP A 392 ? 0.4694 0.5534 0.5469 0.0763  -0.0172 0.0547  380 ASP A C   
2893 O O   . ASP A 392 ? 0.4735 0.5758 0.5682 0.0730  -0.0173 0.0518  380 ASP A O   
2894 C CB  . ASP A 392 ? 0.5303 0.6106 0.6010 0.0975  -0.0293 0.0564  380 ASP A CB  
2895 C CG  . ASP A 392 ? 0.6172 0.6957 0.6883 0.1116  -0.0321 0.0569  380 ASP A CG  
2896 O OD1 . ASP A 392 ? 0.6752 0.7518 0.7507 0.1147  -0.0256 0.0560  380 ASP A OD1 
2897 O OD2 . ASP A 392 ? 0.7344 0.8129 0.8006 0.1205  -0.0413 0.0580  380 ASP A OD2 
2898 N N   . VAL A 393 ? 0.4433 0.5145 0.5078 0.0696  -0.0155 0.0567  381 VAL A N   
2899 C CA  . VAL A 393 ? 0.4261 0.5039 0.4960 0.0590  -0.0148 0.0554  381 VAL A CA  
2900 C C   . VAL A 393 ? 0.4140 0.4868 0.4826 0.0517  -0.0061 0.0555  381 VAL A C   
2901 O O   . VAL A 393 ? 0.4021 0.4831 0.4785 0.0441  -0.0045 0.0545  381 VAL A O   
2902 C CB  . VAL A 393 ? 0.4230 0.4921 0.4807 0.0566  -0.0192 0.0565  381 VAL A CB  
2903 C CG1 . VAL A 393 ? 0.4001 0.4705 0.4535 0.0656  -0.0282 0.0567  381 VAL A CG1 
2904 C CG2 . VAL A 393 ? 0.4368 0.4864 0.4776 0.0544  -0.0135 0.0593  381 VAL A CG2 
2905 N N   . LYS A 394 ? 0.4199 0.4792 0.4787 0.0543  -0.0010 0.0565  382 LYS A N   
2906 C CA  . LYS A 394 ? 0.4240 0.4782 0.4803 0.0480  0.0056  0.0558  382 LYS A CA  
2907 C C   . LYS A 394 ? 0.3977 0.4669 0.4669 0.0455  0.0090  0.0537  382 LYS A C   
2908 O O   . LYS A 394 ? 0.3802 0.4572 0.4568 0.0514  0.0100  0.0524  382 LYS A O   
2909 C CB  . LYS A 394 ? 0.4405 0.4784 0.4862 0.0515  0.0101  0.0560  382 LYS A CB  
2910 C CG  . LYS A 394 ? 0.4879 0.5198 0.5296 0.0438  0.0151  0.0546  382 LYS A CG  
2911 C CD  . LYS A 394 ? 0.5773 0.5916 0.6086 0.0443  0.0189  0.0543  382 LYS A CD  
2912 C CE  . LYS A 394 ? 0.5850 0.5978 0.6154 0.0365  0.0227  0.0515  382 LYS A CE  
2913 N NZ  . LYS A 394 ? 0.6224 0.6241 0.6486 0.0382  0.0270  0.0485  382 LYS A NZ  
2914 N N   . TYR A 395 ? 0.3708 0.4435 0.4419 0.0373  0.0113  0.0536  383 TYR A N   
2915 C CA  . TYR A 395 ? 0.3798 0.4660 0.4613 0.0344  0.0155  0.0528  383 TYR A CA  
2916 C C   . TYR A 395 ? 0.3808 0.4846 0.4786 0.0360  0.0132  0.0523  383 TYR A C   
2917 O O   . TYR A 395 ? 0.3796 0.4949 0.4867 0.0355  0.0181  0.0516  383 TYR A O   
2918 C CB  . TYR A 395 ? 0.3801 0.4632 0.4578 0.0378  0.0219  0.0509  383 TYR A CB  
2919 C CG  . TYR A 395 ? 0.3928 0.4612 0.4572 0.0343  0.0241  0.0503  383 TYR A CG  
2920 C CD1 . TYR A 395 ? 0.3902 0.4573 0.4518 0.0268  0.0236  0.0514  383 TYR A CD1 
2921 C CD2 . TYR A 395 ? 0.4037 0.4597 0.4598 0.0386  0.0263  0.0482  383 TYR A CD2 
2922 C CE1 . TYR A 395 ? 0.3905 0.4463 0.4424 0.0238  0.0248  0.0501  383 TYR A CE1 
2923 C CE2 . TYR A 395 ? 0.4232 0.4669 0.4695 0.0344  0.0279  0.0466  383 TYR A CE2 
2924 C CZ  . TYR A 395 ? 0.4258 0.4707 0.4706 0.0272  0.0269  0.0475  383 TYR A CZ  
2925 O OH  . TYR A 395 ? 0.4166 0.4521 0.4542 0.0233  0.0276  0.0453  383 TYR A OH  
2926 N N   . ASN A 396 ? 0.3805 0.4871 0.4819 0.0382  0.0060  0.0522  384 ASN A N   
2927 C CA  . ASN A 396 ? 0.3722 0.4969 0.4912 0.0400  0.0026  0.0506  384 ASN A CA  
2928 C C   . ASN A 396 ? 0.3764 0.5088 0.5045 0.0305  0.0016  0.0508  384 ASN A C   
2929 O O   . ASN A 396 ? 0.3677 0.4993 0.4962 0.0284  -0.0052 0.0502  384 ASN A O   
2930 C CB  . ASN A 396 ? 0.3747 0.4983 0.4922 0.0479  -0.0057 0.0498  384 ASN A CB  
2931 C CG  . ASN A 396 ? 0.3829 0.5266 0.5199 0.0516  -0.0101 0.0469  384 ASN A CG  
2932 O OD1 . ASN A 396 ? 0.3875 0.5463 0.5408 0.0453  -0.0079 0.0456  384 ASN A OD1 
2933 N ND2 . ASN A 396 ? 0.3510 0.4950 0.4869 0.0619  -0.0163 0.0460  384 ASN A ND2 
2934 N N   . TYR A 397 ? 0.3647 0.5024 0.4980 0.0246  0.0086  0.0519  385 TYR A N   
2935 C CA  . TYR A 397 ? 0.3723 0.5142 0.5131 0.0152  0.0085  0.0531  385 TYR A CA  
2936 C C   . TYR A 397 ? 0.3690 0.5269 0.5294 0.0134  0.0033  0.0506  385 TYR A C   
2937 O O   . TYR A 397 ? 0.3653 0.5222 0.5292 0.0072  -0.0008 0.0503  385 TYR A O   
2938 C CB  . TYR A 397 ? 0.3567 0.5002 0.4977 0.0096  0.0175  0.0558  385 TYR A CB  
2939 C CG  . TYR A 397 ? 0.3832 0.5404 0.5347 0.0127  0.0242  0.0551  385 TYR A CG  
2940 C CD1 . TYR A 397 ? 0.4087 0.5622 0.5515 0.0197  0.0284  0.0540  385 TYR A CD1 
2941 C CD2 . TYR A 397 ? 0.4337 0.6081 0.6052 0.0085  0.0266  0.0548  385 TYR A CD2 
2942 C CE1 . TYR A 397 ? 0.4569 0.6235 0.6094 0.0234  0.0350  0.0526  385 TYR A CE1 
2943 C CE2 . TYR A 397 ? 0.4425 0.6315 0.6251 0.0114  0.0340  0.0539  385 TYR A CE2 
2944 C CZ  . TYR A 397 ? 0.4639 0.6488 0.6363 0.0193  0.0381  0.0527  385 TYR A CZ  
2945 O OH  . TYR A 397 ? 0.4729 0.6716 0.6552 0.0230  0.0456  0.0511  385 TYR A OH  
2946 N N   . GLU A 398 ? 0.3726 0.5452 0.5467 0.0190  0.0031  0.0482  386 GLU A N   
2947 C CA  . GLU A 398 ? 0.3933 0.5830 0.5882 0.0175  -0.0028 0.0447  386 GLU A CA  
2948 C C   . GLU A 398 ? 0.3954 0.5798 0.5849 0.0207  -0.0147 0.0420  386 GLU A C   
2949 O O   . GLU A 398 ? 0.3844 0.5751 0.5846 0.0154  -0.0203 0.0394  386 GLU A O   
2950 C CB  . GLU A 398 ? 0.4024 0.6107 0.6145 0.0240  -0.0012 0.0419  386 GLU A CB  
2951 C CG  . GLU A 398 ? 0.4600 0.6770 0.6802 0.0200  0.0113  0.0438  386 GLU A CG  
2952 C CD  . GLU A 398 ? 0.5018 0.7377 0.7391 0.0272  0.0139  0.0405  386 GLU A CD  
2953 O OE1 . GLU A 398 ? 0.5826 0.8144 0.8119 0.0379  0.0124  0.0393  386 GLU A OE1 
2954 O OE2 . GLU A 398 ? 0.5683 0.8228 0.8275 0.0220  0.0177  0.0391  386 GLU A OE2 
2955 N N   . LEU A 399 ? 0.4017 0.5730 0.5732 0.0290  -0.0179 0.0428  387 LEU A N   
2956 C CA  . LEU A 399 ? 0.4063 0.5704 0.5682 0.0323  -0.0279 0.0412  387 LEU A CA  
2957 C C   . LEU A 399 ? 0.4005 0.5535 0.5539 0.0238  -0.0283 0.0420  387 LEU A C   
2958 O O   . LEU A 399 ? 0.3823 0.5376 0.5390 0.0216  -0.0360 0.0388  387 LEU A O   
2959 C CB  . LEU A 399 ? 0.4262 0.5769 0.5695 0.0425  -0.0294 0.0431  387 LEU A CB  
2960 C CG  . LEU A 399 ? 0.4549 0.5963 0.5842 0.0472  -0.0387 0.0425  387 LEU A CG  
2961 C CD1 . LEU A 399 ? 0.4328 0.5907 0.5766 0.0503  -0.0495 0.0374  387 LEU A CD1 
2962 C CD2 . LEU A 399 ? 0.4942 0.6214 0.6057 0.0571  -0.0377 0.0457  387 LEU A CD2 
2963 N N   . ALA A 400 ? 0.3808 0.5224 0.5241 0.0192  -0.0204 0.0457  388 ALA A N   
2964 C CA  . ALA A 400 ? 0.3887 0.5205 0.5254 0.0118  -0.0206 0.0463  388 ALA A CA  
2965 C C   . ALA A 400 ? 0.3881 0.5302 0.5424 0.0036  -0.0227 0.0442  388 ALA A C   
2966 O O   . ALA A 400 ? 0.3785 0.5164 0.5314 0.0003  -0.0286 0.0417  388 ALA A O   
2967 C CB  . ALA A 400 ? 0.3782 0.4983 0.5033 0.0087  -0.0122 0.0502  388 ALA A CB  
2968 N N   . GLU A 401 ? 0.3946 0.5493 0.5649 0.0000  -0.0172 0.0450  389 GLU A N   
2969 C CA  . GLU A 401 ? 0.4076 0.5723 0.5969 -0.0086 -0.0176 0.0435  389 GLU A CA  
2970 C C   . GLU A 401 ? 0.4122 0.5869 0.6137 -0.0075 -0.0285 0.0372  389 GLU A C   
2971 O O   . GLU A 401 ? 0.3992 0.5722 0.6065 -0.0142 -0.0327 0.0346  389 GLU A O   
2972 C CB  . GLU A 401 ? 0.4110 0.5894 0.6164 -0.0121 -0.0086 0.0456  389 GLU A CB  
2973 C CG  . GLU A 401 ? 0.4387 0.6067 0.6317 -0.0152 0.0016  0.0517  389 GLU A CG  
2974 C CD  . GLU A 401 ? 0.4521 0.6311 0.6525 -0.0144 0.0114  0.0539  389 GLU A CD  
2975 O OE1 . GLU A 401 ? 0.4151 0.6102 0.6306 -0.0105 0.0110  0.0508  389 GLU A OE1 
2976 O OE2 . GLU A 401 ? 0.5063 0.6776 0.6966 -0.0171 0.0197  0.0586  389 GLU A OE2 
2977 N N   . GLU A 402 ? 0.4231 0.6080 0.6287 0.0011  -0.0333 0.0343  390 GLU A N   
2978 C CA  . GLU A 402 ? 0.4309 0.6262 0.6467 0.0037  -0.0452 0.0277  390 GLU A CA  
2979 C C   . GLU A 402 ? 0.4282 0.6087 0.6261 0.0049  -0.0529 0.0258  390 GLU A C   
2980 O O   . GLU A 402 ? 0.4123 0.5966 0.6183 0.0010  -0.0607 0.0203  390 GLU A O   
2981 C CB  . GLU A 402 ? 0.4599 0.6637 0.6757 0.0157  -0.0502 0.0259  390 GLU A CB  
2982 C CG  . GLU A 402 ? 0.5494 0.7714 0.7847 0.0178  -0.0453 0.0256  390 GLU A CG  
2983 C CD  . GLU A 402 ? 0.6746 0.9038 0.9093 0.0314  -0.0528 0.0231  390 GLU A CD  
2984 O OE1 . GLU A 402 ? 0.7138 0.9461 0.9480 0.0359  -0.0650 0.0184  390 GLU A OE1 
2985 O OE2 . GLU A 402 ? 0.7489 0.9798 0.9823 0.0380  -0.0466 0.0257  390 GLU A OE2 
2986 N N   . PHE A 403 ? 0.4076 0.5714 0.5814 0.0102  -0.0505 0.0297  391 PHE A N   
2987 C CA  . PHE A 403 ? 0.4231 0.5733 0.5792 0.0117  -0.0563 0.0281  391 PHE A CA  
2988 C C   . PHE A 403 ? 0.4240 0.5686 0.5838 0.0015  -0.0555 0.0267  391 PHE A C   
2989 O O   . PHE A 403 ? 0.4204 0.5634 0.5792 0.0005  -0.0635 0.0214  391 PHE A O   
2990 C CB  . PHE A 403 ? 0.4251 0.5586 0.5568 0.0176  -0.0518 0.0330  391 PHE A CB  
2991 C CG  . PHE A 403 ? 0.4430 0.5633 0.5561 0.0195  -0.0565 0.0314  391 PHE A CG  
2992 C CD1 . PHE A 403 ? 0.4791 0.5978 0.5804 0.0284  -0.0640 0.0297  391 PHE A CD1 
2993 C CD2 . PHE A 403 ? 0.4298 0.5399 0.5371 0.0129  -0.0535 0.0316  391 PHE A CD2 
2994 C CE1 . PHE A 403 ? 0.4749 0.5821 0.5581 0.0302  -0.0674 0.0282  391 PHE A CE1 
2995 C CE2 . PHE A 403 ? 0.4637 0.5631 0.5547 0.0149  -0.0571 0.0294  391 PHE A CE2 
2996 C CZ  . PHE A 403 ? 0.4519 0.5500 0.5306 0.0234  -0.0637 0.0278  391 PHE A CZ  
2997 N N   . ALA A 404 ? 0.4213 0.5619 0.5840 -0.0051 -0.0462 0.0313  392 ALA A N   
2998 C CA  . ALA A 404 ? 0.4288 0.5612 0.5932 -0.0139 -0.0448 0.0311  392 ALA A CA  
2999 C C   . ALA A 404 ? 0.4444 0.5875 0.6299 -0.0205 -0.0505 0.0256  392 ALA A C   
3000 O O   . ALA A 404 ? 0.4327 0.5694 0.6176 -0.0241 -0.0558 0.0214  392 ALA A O   
3001 C CB  . ALA A 404 ? 0.4222 0.5491 0.5855 -0.0189 -0.0343 0.0376  392 ALA A CB  
3002 N N   . LYS A 405 ? 0.4561 0.6157 0.6612 -0.0221 -0.0490 0.0252  393 LYS A N   
3003 C CA  . LYS A 405 ? 0.4798 0.6525 0.7092 -0.0292 -0.0532 0.0199  393 LYS A CA  
3004 C C   . LYS A 405 ? 0.4866 0.6645 0.7175 -0.0248 -0.0669 0.0110  393 LYS A C   
3005 O O   . LYS A 405 ? 0.4902 0.6672 0.7294 -0.0308 -0.0727 0.0053  393 LYS A O   
3006 C CB  . LYS A 405 ? 0.4753 0.6663 0.7252 -0.0307 -0.0472 0.0215  393 LYS A CB  
3007 C CG  . LYS A 405 ? 0.5296 0.7353 0.8077 -0.0396 -0.0497 0.0164  393 LYS A CG  
3008 C CD  . LYS A 405 ? 0.5847 0.8085 0.8839 -0.0423 -0.0413 0.0187  393 LYS A CD  
3009 C CE  . LYS A 405 ? 0.6309 0.8752 0.9616 -0.0483 -0.0471 0.0108  393 LYS A CE  
3010 N NZ  . LYS A 405 ? 0.6517 0.9107 0.9872 -0.0380 -0.0596 0.0031  393 LYS A NZ  
3011 N N   . GLU A 406 ? 0.5024 0.6837 0.7227 -0.0139 -0.0722 0.0098  394 GLU A N   
3012 C CA  . GLU A 406 ? 0.5188 0.7046 0.7371 -0.0083 -0.0857 0.0017  394 GLU A CA  
3013 C C   . GLU A 406 ? 0.5145 0.6834 0.7129 -0.0078 -0.0905 -0.0010 394 GLU A C   
3014 O O   . GLU A 406 ? 0.5044 0.6766 0.7054 -0.0073 -0.1015 -0.0094 394 GLU A O   
3015 C CB  . GLU A 406 ? 0.5308 0.7232 0.7411 0.0042  -0.0900 0.0022  394 GLU A CB  
3016 C CG  . GLU A 406 ? 0.6069 0.8225 0.8441 0.0047  -0.0913 -0.0002 394 GLU A CG  
3017 C CD  . GLU A 406 ? 0.6846 0.9060 0.9146 0.0182  -0.0945 0.0011  394 GLU A CD  
3018 O OE1 . GLU A 406 ? 0.7109 0.9518 0.9625 0.0203  -0.0951 -0.0008 394 GLU A OE1 
3019 O OE2 . GLU A 406 ? 0.7619 0.9679 0.9652 0.0266  -0.0958 0.0045  394 GLU A OE2 
3020 N N   . ASN A 407 ? 0.5008 0.6525 0.6798 -0.0078 -0.0826 0.0051  395 ASN A N   
3021 C CA  . ASN A 407 ? 0.5056 0.6420 0.6647 -0.0060 -0.0861 0.0026  395 ASN A CA  
3022 C C   . ASN A 407 ? 0.5003 0.6266 0.6633 -0.0155 -0.0819 0.0026  395 ASN A C   
3023 O O   . ASN A 407 ? 0.5045 0.6177 0.6527 -0.0147 -0.0829 0.0008  395 ASN A O   
3024 C CB  . ASN A 407 ? 0.5121 0.6370 0.6459 0.0023  -0.0814 0.0085  395 ASN A CB  
3025 C CG  . ASN A 407 ? 0.5283 0.6587 0.6531 0.0131  -0.0881 0.0074  395 ASN A CG  
3026 O OD1 . ASN A 407 ? 0.5832 0.7112 0.6966 0.0182  -0.0967 0.0023  395 ASN A OD1 
3027 N ND2 . ASN A 407 ? 0.4823 0.6192 0.6110 0.0174  -0.0844 0.0122  395 ASN A ND2 
3028 N N   . ASP A 408 ? 0.4960 0.6282 0.6789 -0.0241 -0.0768 0.0049  396 ASP A N   
3029 C CA  . ASP A 408 ? 0.5044 0.6261 0.6922 -0.0331 -0.0724 0.0061  396 ASP A CA  
3030 C C   . ASP A 408 ? 0.4911 0.5958 0.6583 -0.0310 -0.0660 0.0115  396 ASP A C   
3031 O O   . ASP A 408 ? 0.4965 0.5896 0.6576 -0.0329 -0.0680 0.0085  396 ASP A O   
3032 C CB  . ASP A 408 ? 0.5205 0.6401 0.7154 -0.0372 -0.0816 -0.0031 396 ASP A CB  
3033 C CG  . ASP A 408 ? 0.5822 0.7188 0.8023 -0.0418 -0.0879 -0.0094 396 ASP A CG  
3034 O OD1 . ASP A 408 ? 0.6509 0.8000 0.8876 -0.0452 -0.0825 -0.0054 396 ASP A OD1 
3035 O OD2 . ASP A 408 ? 0.6879 0.8261 0.9120 -0.0423 -0.0985 -0.0193 396 ASP A OD2 
3036 N N   . CYS A 409 ? 0.4650 0.5688 0.6228 -0.0271 -0.0586 0.0186  397 CYS A N   
3037 C CA  . CYS A 409 ? 0.4566 0.5465 0.5968 -0.0250 -0.0529 0.0230  397 CYS A CA  
3038 C C   . CYS A 409 ? 0.4378 0.5276 0.5790 -0.0270 -0.0432 0.0311  397 CYS A C   
3039 O O   . CYS A 409 ? 0.4379 0.5380 0.5923 -0.0297 -0.0400 0.0335  397 CYS A O   
3040 C CB  . CYS A 409 ? 0.4630 0.5489 0.5839 -0.0161 -0.0550 0.0219  397 CYS A CB  
3041 S SG  . CYS A 409 ? 0.4745 0.5692 0.5914 -0.0085 -0.0530 0.0258  397 CYS A SG  
3042 N N   . VAL A 410 ? 0.4330 0.5116 0.5605 -0.0255 -0.0385 0.0346  398 VAL A N   
3043 C CA  . VAL A 410 ? 0.4099 0.4875 0.5333 -0.0251 -0.0303 0.0413  398 VAL A CA  
3044 C C   . VAL A 410 ? 0.4001 0.4765 0.5098 -0.0177 -0.0296 0.0415  398 VAL A C   
3045 O O   . VAL A 410 ? 0.4043 0.4741 0.5028 -0.0142 -0.0325 0.0387  398 VAL A O   
3046 C CB  . VAL A 410 ? 0.4024 0.4684 0.5204 -0.0284 -0.0264 0.0446  398 VAL A CB  
3047 C CG1 . VAL A 410 ? 0.3572 0.4224 0.4684 -0.0267 -0.0193 0.0503  398 VAL A CG1 
3048 C CG2 . VAL A 410 ? 0.3973 0.4618 0.5281 -0.0358 -0.0266 0.0454  398 VAL A CG2 
3049 N N   . LEU A 411 ? 0.3860 0.4687 0.4969 -0.0153 -0.0252 0.0448  399 LEU A N   
3050 C CA  . LEU A 411 ? 0.3831 0.4632 0.4821 -0.0088 -0.0235 0.0458  399 LEU A CA  
3051 C C   . LEU A 411 ? 0.3691 0.4444 0.4622 -0.0092 -0.0162 0.0499  399 LEU A C   
3052 O O   . LEU A 411 ? 0.3827 0.4628 0.4827 -0.0119 -0.0119 0.0527  399 LEU A O   
3053 C CB  . LEU A 411 ? 0.3931 0.4840 0.4984 -0.0042 -0.0257 0.0450  399 LEU A CB  
3054 C CG  . LEU A 411 ? 0.4175 0.5039 0.5100 0.0032  -0.0249 0.0460  399 LEU A CG  
3055 C CD1 . LEU A 411 ? 0.4110 0.4892 0.4906 0.0064  -0.0299 0.0434  399 LEU A CD1 
3056 C CD2 . LEU A 411 ? 0.4722 0.5701 0.5734 0.0081  -0.0266 0.0457  399 LEU A CD2 
3057 N N   . VAL A 412 ? 0.3745 0.4406 0.4549 -0.0067 -0.0145 0.0500  400 VAL A N   
3058 C CA  . VAL A 412 ? 0.3560 0.4173 0.4301 -0.0067 -0.0088 0.0525  400 VAL A CA  
3059 C C   . VAL A 412 ? 0.3592 0.4179 0.4253 -0.0012 -0.0071 0.0525  400 VAL A C   
3060 O O   . VAL A 412 ? 0.3634 0.4154 0.4209 0.0007  -0.0079 0.0513  400 VAL A O   
3061 C CB  . VAL A 412 ? 0.3627 0.4153 0.4308 -0.0090 -0.0084 0.0518  400 VAL A CB  
3062 C CG1 . VAL A 412 ? 0.3218 0.3707 0.3839 -0.0084 -0.0036 0.0533  400 VAL A CG1 
3063 C CG2 . VAL A 412 ? 0.3500 0.4024 0.4249 -0.0136 -0.0104 0.0522  400 VAL A CG2 
3064 N N   . LEU A 413 ? 0.3661 0.4300 0.4352 0.0012  -0.0045 0.0539  401 LEU A N   
3065 C CA  . LEU A 413 ? 0.3548 0.4149 0.4168 0.0070  -0.0027 0.0542  401 LEU A CA  
3066 C C   . LEU A 413 ? 0.3616 0.4152 0.4176 0.0063  0.0027  0.0547  401 LEU A C   
3067 O O   . LEU A 413 ? 0.3507 0.4084 0.4101 0.0058  0.0060  0.0554  401 LEU A O   
3068 C CB  . LEU A 413 ? 0.3601 0.4295 0.4300 0.0109  -0.0030 0.0545  401 LEU A CB  
3069 C CG  . LEU A 413 ? 0.3664 0.4312 0.4297 0.0180  -0.0018 0.0550  401 LEU A CG  
3070 C CD1 . LEU A 413 ? 0.3463 0.4023 0.3990 0.0214  -0.0055 0.0551  401 LEU A CD1 
3071 C CD2 . LEU A 413 ? 0.3906 0.4671 0.4645 0.0226  -0.0026 0.0547  401 LEU A CD2 
3072 N N   . LYS A 414 ? 0.3769 0.4208 0.4240 0.0063  0.0037  0.0540  402 LYS A N   
3073 C CA  . LYS A 414 ? 0.3956 0.4334 0.4382 0.0046  0.0078  0.0531  402 LYS A CA  
3074 C C   . LYS A 414 ? 0.4023 0.4365 0.4417 0.0084  0.0115  0.0531  402 LYS A C   
3075 O O   . LYS A 414 ? 0.4337 0.4647 0.4703 0.0128  0.0112  0.0540  402 LYS A O   
3076 C CB  . LYS A 414 ? 0.3995 0.4298 0.4364 0.0029  0.0080  0.0518  402 LYS A CB  
3077 C CG  . LYS A 414 ? 0.4297 0.4626 0.4696 -0.0001 0.0047  0.0510  402 LYS A CG  
3078 C CD  . LYS A 414 ? 0.4947 0.5221 0.5305 -0.0016 0.0055  0.0490  402 LYS A CD  
3079 C CE  . LYS A 414 ? 0.5175 0.5391 0.5455 0.0010  0.0066  0.0494  402 LYS A CE  
3080 N NZ  . LYS A 414 ? 0.5062 0.5257 0.5318 -0.0004 0.0065  0.0471  402 LYS A NZ  
3081 N N   . SER A 415 ? 0.3824 0.4167 0.4219 0.0072  0.0145  0.0518  403 SER A N   
3082 C CA  . SER A 415 ? 0.3887 0.4178 0.4247 0.0102  0.0181  0.0502  403 SER A CA  
3083 C C   . SER A 415 ? 0.3760 0.4072 0.4117 0.0077  0.0198  0.0480  403 SER A C   
3084 O O   . SER A 415 ? 0.3736 0.4093 0.4111 0.0043  0.0180  0.0486  403 SER A O   
3085 C CB  . SER A 415 ? 0.4000 0.4337 0.4391 0.0157  0.0185  0.0514  403 SER A CB  
3086 O OG  . SER A 415 ? 0.4437 0.4734 0.4807 0.0198  0.0165  0.0531  403 SER A OG  
3087 N N   . ALA A 416 ? 0.3773 0.4047 0.4100 0.0099  0.0228  0.0452  404 ALA A N   
3088 C CA  . ALA A 416 ? 0.3907 0.4193 0.4209 0.0082  0.0237  0.0422  404 ALA A CA  
3089 C C   . ALA A 416 ? 0.3810 0.4196 0.4131 0.0076  0.0234  0.0447  404 ALA A C   
3090 O O   . ALA A 416 ? 0.3971 0.4371 0.4265 0.0050  0.0221  0.0443  404 ALA A O   
3091 C CB  . ALA A 416 ? 0.4015 0.4248 0.4281 0.0113  0.0267  0.0380  404 ALA A CB  
3092 N N   . THR A 417 ? 0.3608 0.4061 0.3978 0.0099  0.0244  0.0475  405 THR A N   
3093 C CA  . THR A 417 ? 0.3610 0.4155 0.4023 0.0079  0.0246  0.0510  405 THR A CA  
3094 C C   . THR A 417 ? 0.3656 0.4222 0.4136 0.0062  0.0210  0.0535  405 THR A C   
3095 O O   . THR A 417 ? 0.3571 0.4139 0.4082 0.0094  0.0200  0.0534  405 THR A O   
3096 C CB  . THR A 417 ? 0.3659 0.4290 0.4107 0.0113  0.0290  0.0515  405 THR A CB  
3097 O OG1 . THR A 417 ? 0.3797 0.4402 0.4165 0.0134  0.0324  0.0484  405 THR A OG1 
3098 C CG2 . THR A 417 ? 0.2983 0.3711 0.3494 0.0079  0.0304  0.0558  405 THR A CG2 
3099 N N   . THR A 418 ? 0.3595 0.4164 0.4088 0.0020  0.0184  0.0553  406 THR A N   
3100 C CA  . THR A 418 ? 0.3584 0.4165 0.4133 0.0002  0.0145  0.0565  406 THR A CA  
3101 C C   . THR A 418 ? 0.3547 0.4222 0.4189 -0.0018 0.0148  0.0592  406 THR A C   
3102 O O   . THR A 418 ? 0.3351 0.4056 0.3996 -0.0040 0.0178  0.0614  406 THR A O   
3103 C CB  . THR A 418 ? 0.3732 0.4251 0.4249 -0.0028 0.0114  0.0558  406 THR A CB  
3104 O OG1 . THR A 418 ? 0.3644 0.4090 0.4105 -0.0013 0.0116  0.0531  406 THR A OG1 
3105 C CG2 . THR A 418 ? 0.3552 0.4085 0.4126 -0.0052 0.0072  0.0567  406 THR A CG2 
3106 N N   . ILE A 419 ? 0.3656 0.4380 0.4373 -0.0008 0.0119  0.0589  407 ILE A N   
3107 C CA  . ILE A 419 ? 0.3583 0.4409 0.4421 -0.0034 0.0117  0.0604  407 ILE A CA  
3108 C C   . ILE A 419 ? 0.3510 0.4313 0.4384 -0.0077 0.0065  0.0602  407 ILE A C   
3109 O O   . ILE A 419 ? 0.3498 0.4254 0.4337 -0.0061 0.0020  0.0580  407 ILE A O   
3110 C CB  . ILE A 419 ? 0.3582 0.4497 0.4501 0.0010  0.0106  0.0589  407 ILE A CB  
3111 C CG1 . ILE A 419 ? 0.3850 0.4784 0.4741 0.0059  0.0159  0.0585  407 ILE A CG1 
3112 C CG2 . ILE A 419 ? 0.3347 0.4389 0.4427 -0.0025 0.0097  0.0593  407 ILE A CG2 
3113 C CD1 . ILE A 419 ? 0.3739 0.4739 0.4693 0.0125  0.0141  0.0566  407 ILE A CD1 
3114 N N   . VAL A 420 ? 0.3472 0.4297 0.4407 -0.0130 0.0076  0.0626  408 VAL A N   
3115 C CA  . VAL A 420 ? 0.3463 0.4255 0.4440 -0.0173 0.0029  0.0620  408 VAL A CA  
3116 C C   . VAL A 420 ? 0.3625 0.4518 0.4756 -0.0213 0.0031  0.0626  408 VAL A C   
3117 O O   . VAL A 420 ? 0.3706 0.4649 0.4885 -0.0239 0.0090  0.0661  408 VAL A O   
3118 C CB  . VAL A 420 ? 0.3409 0.4107 0.4317 -0.0203 0.0040  0.0646  408 VAL A CB  
3119 C CG1 . VAL A 420 ? 0.3185 0.3837 0.4144 -0.0245 -0.0005 0.0639  408 VAL A CG1 
3120 C CG2 . VAL A 420 ? 0.3452 0.4071 0.4231 -0.0166 0.0038  0.0631  408 VAL A CG2 
3121 N N   . THR A 421 ? 0.3788 0.4720 0.5003 -0.0218 -0.0029 0.0590  409 THR A N   
3122 C CA  . THR A 421 ? 0.3774 0.4822 0.5168 -0.0262 -0.0032 0.0584  409 THR A CA  
3123 C C   . THR A 421 ? 0.3772 0.4806 0.5236 -0.0294 -0.0109 0.0541  409 THR A C   
3124 O O   . THR A 421 ? 0.3721 0.4696 0.5098 -0.0258 -0.0166 0.0507  409 THR A O   
3125 C CB  . THR A 421 ? 0.3881 0.5068 0.5356 -0.0215 -0.0023 0.0567  409 THR A CB  
3126 O OG1 . THR A 421 ? 0.3841 0.5165 0.5517 -0.0264 -0.0011 0.0561  409 THR A OG1 
3127 C CG2 . THR A 421 ? 0.3676 0.4864 0.5106 -0.0147 -0.0096 0.0524  409 THR A CG2 
3128 N N   . ASP A 422 ? 0.3981 0.5062 0.5595 -0.0365 -0.0105 0.0543  410 ASP A N   
3129 C CA  . ASP A 422 ? 0.4108 0.5207 0.5829 -0.0398 -0.0182 0.0488  410 ASP A CA  
3130 C C   . ASP A 422 ? 0.4355 0.5634 0.6278 -0.0411 -0.0207 0.0450  410 ASP A C   
3131 O O   . ASP A 422 ? 0.4301 0.5621 0.6348 -0.0447 -0.0275 0.0394  410 ASP A O   
3132 C CB  . ASP A 422 ? 0.4309 0.5307 0.6066 -0.0477 -0.0170 0.0508  410 ASP A CB  
3133 C CG  . ASP A 422 ? 0.4390 0.5441 0.6276 -0.0549 -0.0089 0.0561  410 ASP A CG  
3134 O OD1 . ASP A 422 ? 0.4546 0.5726 0.6503 -0.0540 -0.0036 0.0580  410 ASP A OD1 
3135 O OD2 . ASP A 422 ? 0.4831 0.5784 0.6740 -0.0612 -0.0072 0.0589  410 ASP A OD2 
3136 N N   . GLY A 423 ? 0.4405 0.5797 0.6368 -0.0377 -0.0156 0.0471  411 GLY A N   
3137 C CA  . GLY A 423 ? 0.4644 0.6228 0.6816 -0.0381 -0.0173 0.0434  411 GLY A CA  
3138 C C   . GLY A 423 ? 0.4869 0.6546 0.7208 -0.0458 -0.0078 0.0473  411 GLY A C   
3139 O O   . GLY A 423 ? 0.4874 0.6725 0.7371 -0.0448 -0.0055 0.0457  411 GLY A O   
3140 N N   . GLU A 424 ? 0.5064 0.6626 0.7367 -0.0531 -0.0020 0.0525  412 GLU A N   
3141 C CA  . GLU A 424 ? 0.5341 0.6968 0.7783 -0.0612 0.0081  0.0574  412 GLU A CA  
3142 C C   . GLU A 424 ? 0.5238 0.6786 0.7507 -0.0589 0.0181  0.0652  412 GLU A C   
3143 O O   . GLU A 424 ? 0.5444 0.7097 0.7771 -0.0592 0.0271  0.0682  412 GLU A O   
3144 C CB  . GLU A 424 ? 0.5541 0.7079 0.8072 -0.0718 0.0077  0.0583  412 GLU A CB  
3145 C CG  . GLU A 424 ? 0.6124 0.7713 0.8815 -0.0749 -0.0034 0.0494  412 GLU A CG  
3146 C CD  . GLU A 424 ? 0.6658 0.8487 0.9618 -0.0771 -0.0042 0.0441  412 GLU A CD  
3147 O OE1 . GLU A 424 ? 0.7118 0.9004 1.0288 -0.0875 -0.0006 0.0441  412 GLU A OE1 
3148 O OE2 . GLU A 424 ? 0.7294 0.9254 1.0262 -0.0683 -0.0085 0.0400  412 GLU A OE2 
3149 N N   . LYS A 425 ? 0.5093 0.6461 0.7155 -0.0567 0.0164  0.0678  413 LYS A N   
3150 C CA  . LYS A 425 ? 0.5082 0.6359 0.6959 -0.0540 0.0238  0.0742  413 LYS A CA  
3151 C C   . LYS A 425 ? 0.4752 0.5989 0.6460 -0.0442 0.0197  0.0715  413 LYS A C   
3152 O O   . LYS A 425 ? 0.4545 0.5726 0.6207 -0.0414 0.0114  0.0673  413 LYS A O   
3153 C CB  . LYS A 425 ? 0.5266 0.6366 0.7050 -0.0590 0.0242  0.0791  413 LYS A CB  
3154 C CG  . LYS A 425 ? 0.5819 0.6834 0.7433 -0.0575 0.0322  0.0865  413 LYS A CG  
3155 C CD  . LYS A 425 ? 0.6537 0.7405 0.8114 -0.0642 0.0352  0.0933  413 LYS A CD  
3156 C CE  . LYS A 425 ? 0.6711 0.7410 0.8140 -0.0610 0.0277  0.0926  413 LYS A CE  
3157 N NZ  . LYS A 425 ? 0.7048 0.7591 0.8395 -0.0646 0.0309  0.1002  413 LYS A NZ  
3158 N N   . THR A 426 ? 0.4567 0.5830 0.6186 -0.0395 0.0261  0.0738  414 THR A N   
3159 C CA  . THR A 426 ? 0.4527 0.5743 0.5994 -0.0312 0.0238  0.0716  414 THR A CA  
3160 C C   . THR A 426 ? 0.4445 0.5569 0.5738 -0.0296 0.0296  0.0759  414 THR A C   
3161 O O   . THR A 426 ? 0.4519 0.5683 0.5812 -0.0315 0.0379  0.0800  414 THR A O   
3162 C CB  . THR A 426 ? 0.4610 0.5960 0.6149 -0.0250 0.0245  0.0680  414 THR A CB  
3163 O OG1 . THR A 426 ? 0.4495 0.5933 0.6185 -0.0255 0.0174  0.0635  414 THR A OG1 
3164 C CG2 . THR A 426 ? 0.4272 0.5546 0.5645 -0.0167 0.0227  0.0661  414 THR A CG2 
3165 N N   . LEU A 427 ? 0.4169 0.5171 0.5316 -0.0264 0.0251  0.0748  415 LEU A N   
3166 C CA  . LEU A 427 ? 0.4106 0.5018 0.5088 -0.0244 0.0282  0.0774  415 LEU A CA  
3167 C C   . LEU A 427 ? 0.3954 0.4841 0.4837 -0.0176 0.0262  0.0732  415 LEU A C   
3168 O O   . LEU A 427 ? 0.3730 0.4610 0.4634 -0.0152 0.0209  0.0693  415 LEU A O   
3169 C CB  . LEU A 427 ? 0.4118 0.4905 0.5032 -0.0277 0.0249  0.0800  415 LEU A CB  
3170 C CG  . LEU A 427 ? 0.4355 0.5132 0.5375 -0.0350 0.0257  0.0839  415 LEU A CG  
3171 C CD1 . LEU A 427 ? 0.4487 0.5222 0.5576 -0.0369 0.0176  0.0800  415 LEU A CD1 
3172 C CD2 . LEU A 427 ? 0.4319 0.4992 0.5238 -0.0372 0.0289  0.0903  415 LEU A CD2 
3173 N N   . PHE A 428 ? 0.3836 0.4709 0.4612 -0.0147 0.0309  0.0739  416 PHE A N   
3174 C CA  . PHE A 428 ? 0.3800 0.4638 0.4487 -0.0090 0.0298  0.0697  416 PHE A CA  
3175 C C   . PHE A 428 ? 0.3780 0.4514 0.4329 -0.0086 0.0280  0.0696  416 PHE A C   
3176 O O   . PHE A 428 ? 0.3829 0.4543 0.4305 -0.0097 0.0308  0.0730  416 PHE A O   
3177 C CB  . PHE A 428 ? 0.3848 0.4759 0.4530 -0.0051 0.0362  0.0688  416 PHE A CB  
3178 C CG  . PHE A 428 ? 0.3823 0.4858 0.4656 -0.0044 0.0381  0.0682  416 PHE A CG  
3179 C CD1 . PHE A 428 ? 0.4045 0.5097 0.4933 -0.0005 0.0338  0.0646  416 PHE A CD1 
3180 C CD2 . PHE A 428 ? 0.4482 0.5617 0.5398 -0.0073 0.0444  0.0713  416 PHE A CD2 
3181 C CE1 . PHE A 428 ? 0.4684 0.5861 0.5718 0.0011  0.0342  0.0635  416 PHE A CE1 
3182 C CE2 . PHE A 428 ? 0.4549 0.5823 0.5633 -0.0066 0.0460  0.0699  416 PHE A CE2 
3183 C CZ  . PHE A 428 ? 0.4442 0.5740 0.5587 -0.0020 0.0401  0.0657  416 PHE A CZ  
3184 N N   . ASN A 429 ? 0.3835 0.4508 0.4348 -0.0067 0.0234  0.0657  417 ASN A N   
3185 C CA  . ASN A 429 ? 0.3817 0.4412 0.4225 -0.0061 0.0211  0.0642  417 ASN A CA  
3186 C C   . ASN A 429 ? 0.3849 0.4430 0.4185 -0.0021 0.0229  0.0599  417 ASN A C   
3187 O O   . ASN A 429 ? 0.3557 0.4135 0.3922 0.0000  0.0230  0.0568  417 ASN A O   
3188 C CB  . ASN A 429 ? 0.3746 0.4283 0.4172 -0.0073 0.0155  0.0621  417 ASN A CB  
3189 C CG  . ASN A 429 ? 0.3812 0.4293 0.4162 -0.0069 0.0128  0.0604  417 ASN A CG  
3190 O OD1 . ASN A 429 ? 0.3859 0.4322 0.4169 -0.0077 0.0121  0.0636  417 ASN A OD1 
3191 N ND2 . ASN A 429 ? 0.3711 0.4163 0.4038 -0.0053 0.0116  0.0555  417 ASN A ND2 
3192 N N   . ILE A 430 ? 0.3964 0.4526 0.4199 -0.0009 0.0239  0.0594  418 ILE A N   
3193 C CA  . ILE A 430 ? 0.4160 0.4702 0.4325 0.0025  0.0249  0.0540  418 ILE A CA  
3194 C C   . ILE A 430 ? 0.4135 0.4619 0.4237 0.0025  0.0200  0.0499  418 ILE A C   
3195 O O   . ILE A 430 ? 0.4351 0.4817 0.4393 0.0048  0.0200  0.0449  418 ILE A O   
3196 C CB  . ILE A 430 ? 0.4269 0.4858 0.4371 0.0052  0.0307  0.0547  418 ILE A CB  
3197 C CG1 . ILE A 430 ? 0.4717 0.5309 0.4736 0.0041  0.0317  0.0599  418 ILE A CG1 
3198 C CG2 . ILE A 430 ? 0.4305 0.4971 0.4505 0.0057  0.0357  0.0570  418 ILE A CG2 
3199 C CD1 . ILE A 430 ? 0.5054 0.5680 0.4967 0.0073  0.0378  0.0601  418 ILE A CD1 
3200 N N   . THR A 431 ? 0.4047 0.4507 0.4173 0.0002  0.0155  0.0513  419 THR A N   
3201 C CA  . THR A 431 ? 0.3926 0.4352 0.4026 0.0004  0.0105  0.0465  419 THR A CA  
3202 C C   . THR A 431 ? 0.3917 0.4318 0.4086 -0.0007 0.0100  0.0416  419 THR A C   
3203 O O   . THR A 431 ? 0.3998 0.4397 0.4223 -0.0014 0.0122  0.0432  419 THR A O   
3204 C CB  . THR A 431 ? 0.3877 0.4288 0.3981 -0.0007 0.0058  0.0496  419 THR A CB  
3205 O OG1 . THR A 431 ? 0.3364 0.3768 0.3562 -0.0033 0.0052  0.0514  419 THR A OG1 
3206 C CG2 . THR A 431 ? 0.3999 0.4412 0.4023 0.0000  0.0072  0.0564  419 THR A CG2 
3207 N N   . GLY A 432 ? 0.4062 0.4446 0.4228 -0.0008 0.0071  0.0357  420 GLY A N   
3208 C CA  . GLY A 432 ? 0.4065 0.4418 0.4297 -0.0028 0.0078  0.0313  420 GLY A CA  
3209 C C   . GLY A 432 ? 0.4212 0.4534 0.4424 -0.0021 0.0096  0.0253  420 GLY A C   
3210 O O   . GLY A 432 ? 0.4315 0.4647 0.4456 0.0004  0.0102  0.0236  420 GLY A O   
3211 N N   . ASN A 433 ? 0.4059 0.4339 0.4330 -0.0046 0.0109  0.0216  421 ASN A N   
3212 C CA  . ASN A 433 ? 0.4018 0.4244 0.4286 -0.0047 0.0133  0.0160  421 ASN A CA  
3213 C C   . ASN A 433 ? 0.4150 0.4307 0.4477 -0.0075 0.0171  0.0162  421 ASN A C   
3214 O O   . ASN A 433 ? 0.3975 0.4138 0.4328 -0.0085 0.0177  0.0209  421 ASN A O   
3215 C CB  . ASN A 433 ? 0.3895 0.4141 0.4161 -0.0055 0.0093  0.0080  421 ASN A CB  
3216 C CG  . ASN A 433 ? 0.3969 0.4249 0.4322 -0.0091 0.0059  0.0050  421 ASN A CG  
3217 O OD1 . ASN A 433 ? 0.3893 0.4151 0.4318 -0.0122 0.0086  0.0062  421 ASN A OD1 
3218 N ND2 . ASN A 433 ? 0.4018 0.4356 0.4361 -0.0080 0.0000  0.0007  421 ASN A ND2 
3219 N N   . THR A 434 ? 0.4136 0.4220 0.4474 -0.0087 0.0197  0.0112  422 THR A N   
3220 C CA  . THR A 434 ? 0.4216 0.4210 0.4587 -0.0110 0.0244  0.0126  422 THR A CA  
3221 C C   . THR A 434 ? 0.4219 0.4224 0.4668 -0.0163 0.0249  0.0110  422 THR A C   
3222 O O   . THR A 434 ? 0.4458 0.4390 0.4923 -0.0185 0.0296  0.0133  422 THR A O   
3223 C CB  . THR A 434 ? 0.4167 0.4056 0.4528 -0.0110 0.0278  0.0083  422 THR A CB  
3224 O OG1 . THR A 434 ? 0.3996 0.3885 0.4415 -0.0153 0.0263  -0.0002 422 THR A OG1 
3225 C CG2 . THR A 434 ? 0.4241 0.4130 0.4528 -0.0049 0.0278  0.0089  422 THR A CG2 
3226 N N   . GLY A 435 ? 0.4136 0.4232 0.4631 -0.0178 0.0202  0.0074  423 GLY A N   
3227 C CA  . GLY A 435 ? 0.4108 0.4236 0.4692 -0.0220 0.0209  0.0058  423 GLY A CA  
3228 C C   . GLY A 435 ? 0.4010 0.4143 0.4574 -0.0209 0.0224  0.0128  423 GLY A C   
3229 O O   . GLY A 435 ? 0.3947 0.4085 0.4567 -0.0239 0.0251  0.0124  423 GLY A O   
3230 N N   . LEU A 436 ? 0.3951 0.4092 0.4442 -0.0167 0.0208  0.0185  424 LEU A N   
3231 C CA  . LEU A 436 ? 0.3969 0.4111 0.4439 -0.0155 0.0214  0.0244  424 LEU A CA  
3232 C C   . LEU A 436 ? 0.4125 0.4175 0.4548 -0.0149 0.0266  0.0282  424 LEU A C   
3233 O O   . LEU A 436 ? 0.4131 0.4173 0.4526 -0.0139 0.0273  0.0322  424 LEU A O   
3234 C CB  . LEU A 436 ? 0.3969 0.4160 0.4397 -0.0120 0.0174  0.0284  424 LEU A CB  
3235 C CG  . LEU A 436 ? 0.3840 0.4105 0.4287 -0.0117 0.0122  0.0268  424 LEU A CG  
3236 C CD1 . LEU A 436 ? 0.3497 0.3788 0.3897 -0.0089 0.0102  0.0321  424 LEU A CD1 
3237 C CD2 . LEU A 436 ? 0.3334 0.3629 0.3841 -0.0135 0.0107  0.0254  424 LEU A CD2 
3238 N N   . SER A 437 ? 0.4342 0.4314 0.4745 -0.0148 0.0298  0.0269  425 SER A N   
3239 C CA  . SER A 437 ? 0.4308 0.4167 0.4656 -0.0135 0.0347  0.0307  425 SER A CA  
3240 C C   . SER A 437 ? 0.4406 0.4201 0.4779 -0.0182 0.0403  0.0300  425 SER A C   
3241 O O   . SER A 437 ? 0.4534 0.4230 0.4916 -0.0208 0.0451  0.0282  425 SER A O   
3242 C CB  . SER A 437 ? 0.4531 0.4319 0.4855 -0.0113 0.0360  0.0289  425 SER A CB  
3243 O OG  . SER A 437 ? 0.5009 0.4866 0.5309 -0.0067 0.0321  0.0299  425 SER A OG  
3244 N N   . LYS A 438 ? 0.4276 0.4123 0.4662 -0.0195 0.0402  0.0312  426 LYS A N   
3245 C CA  . LYS A 438 ? 0.4463 0.4282 0.4889 -0.0244 0.0461  0.0298  426 LYS A CA  
3246 C C   . LYS A 438 ? 0.4447 0.4317 0.4846 -0.0231 0.0456  0.0326  426 LYS A C   
3247 O O   . LYS A 438 ? 0.4375 0.4335 0.4789 -0.0208 0.0396  0.0321  426 LYS A O   
3248 C CB  . LYS A 438 ? 0.4537 0.4434 0.5094 -0.0294 0.0449  0.0218  426 LYS A CB  
3249 C CG  . LYS A 438 ? 0.4892 0.4753 0.5529 -0.0358 0.0520  0.0185  426 LYS A CG  
3250 C CD  . LYS A 438 ? 0.4974 0.4957 0.5765 -0.0401 0.0489  0.0096  426 LYS A CD  
3251 C CE  . LYS A 438 ? 0.5227 0.5178 0.6082 -0.0434 0.0483  0.0031  426 LYS A CE  
3252 N NZ  . LYS A 438 ? 0.5796 0.5769 0.6589 -0.0382 0.0405  0.0021  426 LYS A NZ  
3253 N N   . GLY A 439 ? 0.4487 0.4286 0.4837 -0.0244 0.0523  0.0355  427 GLY A N   
3254 C CA  . GLY A 439 ? 0.4427 0.4262 0.4737 -0.0230 0.0528  0.0372  427 GLY A CA  
3255 C C   . GLY A 439 ? 0.4246 0.4214 0.4662 -0.0243 0.0488  0.0319  427 GLY A C   
3256 O O   . GLY A 439 ? 0.4292 0.4317 0.4826 -0.0285 0.0500  0.0265  427 GLY A O   
3257 N N   . GLY A 440 ? 0.4092 0.4106 0.4468 -0.0205 0.0437  0.0333  428 GLY A N   
3258 C CA  . GLY A 440 ? 0.3991 0.4110 0.4454 -0.0206 0.0396  0.0288  428 GLY A CA  
3259 C C   . GLY A 440 ? 0.3777 0.3951 0.4264 -0.0181 0.0309  0.0286  428 GLY A C   
3260 O O   . GLY A 440 ? 0.3784 0.4012 0.4298 -0.0164 0.0264  0.0272  428 GLY A O   
3261 N N   . SER A 441 ? 0.3725 0.3875 0.4196 -0.0176 0.0290  0.0302  429 SER A N   
3262 C CA  . SER A 441 ? 0.3954 0.4152 0.4439 -0.0156 0.0222  0.0306  429 SER A CA  
3263 C C   . SER A 441 ? 0.3745 0.3953 0.4188 -0.0127 0.0182  0.0340  429 SER A C   
3264 O O   . SER A 441 ? 0.3663 0.3916 0.4139 -0.0120 0.0133  0.0335  429 SER A O   
3265 C CB  . SER A 441 ? 0.3906 0.4068 0.4357 -0.0148 0.0224  0.0323  429 SER A CB  
3266 O OG  . SER A 441 ? 0.5048 0.5203 0.5550 -0.0179 0.0249  0.0279  429 SER A OG  
3267 N N   . GLY A 442 ? 0.3502 0.3660 0.3870 -0.0109 0.0200  0.0374  430 GLY A N   
3268 C CA  . GLY A 442 ? 0.3529 0.3698 0.3862 -0.0083 0.0159  0.0397  430 GLY A CA  
3269 C C   . GLY A 442 ? 0.3530 0.3723 0.3879 -0.0084 0.0141  0.0372  430 GLY A C   
3270 O O   . GLY A 442 ? 0.3675 0.3894 0.4042 -0.0075 0.0091  0.0372  430 GLY A O   
3271 N N   . ASP A 443 ? 0.3560 0.3740 0.3908 -0.0096 0.0187  0.0346  431 ASP A N   
3272 C CA  . ASP A 443 ? 0.3706 0.3908 0.4065 -0.0090 0.0180  0.0315  431 ASP A CA  
3273 C C   . ASP A 443 ? 0.3534 0.3790 0.3988 -0.0093 0.0129  0.0288  431 ASP A C   
3274 O O   . ASP A 443 ? 0.3755 0.4018 0.4217 -0.0079 0.0087  0.0278  431 ASP A O   
3275 C CB  . ASP A 443 ? 0.3709 0.3905 0.4071 -0.0107 0.0255  0.0289  431 ASP A CB  
3276 C CG  . ASP A 443 ? 0.4291 0.4410 0.4536 -0.0101 0.0315  0.0324  431 ASP A CG  
3277 O OD1 . ASP A 443 ? 0.4453 0.4533 0.4605 -0.0070 0.0285  0.0359  431 ASP A OD1 
3278 O OD2 . ASP A 443 ? 0.5120 0.5219 0.5373 -0.0128 0.0393  0.0318  431 ASP A OD2 
3279 N N   . VAL A 444 ? 0.3472 0.3757 0.3990 -0.0110 0.0128  0.0279  432 VAL A N   
3280 C CA  . VAL A 444 ? 0.3329 0.3654 0.3914 -0.0103 0.0074  0.0264  432 VAL A CA  
3281 C C   . VAL A 444 ? 0.3433 0.3741 0.3992 -0.0092 0.0022  0.0302  432 VAL A C   
3282 O O   . VAL A 444 ? 0.3557 0.3864 0.4142 -0.0080 -0.0018 0.0295  432 VAL A O   
3283 C CB  . VAL A 444 ? 0.3158 0.3517 0.3794 -0.0116 0.0073  0.0246  432 VAL A CB  
3284 C CG1 . VAL A 444 ? 0.2994 0.3383 0.3671 -0.0097 0.0008  0.0240  432 VAL A CG1 
3285 C CG2 . VAL A 444 ? 0.2905 0.3295 0.3605 -0.0137 0.0125  0.0196  432 VAL A CG2 
3286 N N   . LEU A 445 ? 0.3381 0.3674 0.3897 -0.0095 0.0028  0.0340  433 LEU A N   
3287 C CA  . LEU A 445 ? 0.3457 0.3750 0.3970 -0.0093 -0.0009 0.0376  433 LEU A CA  
3288 C C   . LEU A 445 ? 0.3431 0.3709 0.3944 -0.0088 -0.0038 0.0372  433 LEU A C   
3289 O O   . LEU A 445 ? 0.3546 0.3818 0.4090 -0.0092 -0.0076 0.0382  433 LEU A O   
3290 C CB  . LEU A 445 ? 0.3380 0.3674 0.3858 -0.0092 0.0010  0.0409  433 LEU A CB  
3291 C CG  . LEU A 445 ? 0.3457 0.3769 0.3952 -0.0095 -0.0017 0.0445  433 LEU A CG  
3292 C CD1 . LEU A 445 ? 0.3164 0.3487 0.3676 -0.0102 -0.0029 0.0461  433 LEU A CD1 
3293 C CD2 . LEU A 445 ? 0.3544 0.3870 0.4017 -0.0084 0.0004  0.0467  433 LEU A CD2 
3294 N N   . THR A 446 ? 0.3506 0.3769 0.3975 -0.0078 -0.0019 0.0355  434 THR A N   
3295 C CA  . THR A 446 ? 0.3523 0.3772 0.3980 -0.0068 -0.0052 0.0336  434 THR A CA  
3296 C C   . THR A 446 ? 0.3506 0.3744 0.4011 -0.0066 -0.0081 0.0303  434 THR A C   
3297 O O   . THR A 446 ? 0.3455 0.3675 0.3984 -0.0069 -0.0127 0.0298  434 THR A O   
3298 C CB  . THR A 446 ? 0.3690 0.3919 0.4066 -0.0050 -0.0021 0.0319  434 THR A CB  
3299 O OG1 . THR A 446 ? 0.3860 0.4083 0.4184 -0.0042 -0.0006 0.0355  434 THR A OG1 
3300 C CG2 . THR A 446 ? 0.3707 0.3921 0.4054 -0.0033 -0.0059 0.0285  434 THR A CG2 
3301 N N   . GLY A 447 ? 0.3368 0.3618 0.3897 -0.0060 -0.0057 0.0276  435 GLY A N   
3302 C CA  . GLY A 447 ? 0.3451 0.3694 0.4034 -0.0046 -0.0085 0.0243  435 GLY A CA  
3303 C C   . GLY A 447 ? 0.3368 0.3593 0.3994 -0.0051 -0.0131 0.0275  435 GLY A C   
3304 O O   . GLY A 447 ? 0.3398 0.3584 0.4051 -0.0042 -0.0171 0.0265  435 GLY A O   
3305 N N   . MET A 448 ? 0.3301 0.3547 0.3924 -0.0063 -0.0123 0.0312  436 MET A N   
3306 C CA  . MET A 448 ? 0.3272 0.3494 0.3906 -0.0067 -0.0156 0.0355  436 MET A CA  
3307 C C   . MET A 448 ? 0.3235 0.3418 0.3874 -0.0087 -0.0178 0.0387  436 MET A C   
3308 O O   . MET A 448 ? 0.3240 0.3372 0.3903 -0.0088 -0.0211 0.0404  436 MET A O   
3309 C CB  . MET A 448 ? 0.3242 0.3497 0.3850 -0.0075 -0.0134 0.0386  436 MET A CB  
3310 C CG  . MET A 448 ? 0.3261 0.3555 0.3882 -0.0063 -0.0120 0.0348  436 MET A CG  
3311 S SD  . MET A 448 ? 0.3570 0.3893 0.4153 -0.0071 -0.0098 0.0368  436 MET A SD  
3312 C CE  . MET A 448 ? 0.2882 0.3180 0.3434 -0.0055 -0.0142 0.0414  436 MET A CE  
3313 N N   . ILE A 449 ? 0.3373 0.3580 0.3997 -0.0103 -0.0162 0.0394  437 ILE A N   
3314 C CA  . ILE A 449 ? 0.3396 0.3588 0.4050 -0.0128 -0.0185 0.0413  437 ILE A CA  
3315 C C   . ILE A 449 ? 0.3565 0.3704 0.4247 -0.0125 -0.0225 0.0372  437 ILE A C   
3316 O O   . ILE A 449 ? 0.3750 0.3841 0.4477 -0.0146 -0.0252 0.0390  437 ILE A O   
3317 C CB  . ILE A 449 ? 0.3365 0.3605 0.4005 -0.0134 -0.0171 0.0417  437 ILE A CB  
3318 C CG1 . ILE A 449 ? 0.3194 0.3475 0.3815 -0.0135 -0.0133 0.0455  437 ILE A CG1 
3319 C CG2 . ILE A 449 ? 0.3076 0.3323 0.3778 -0.0162 -0.0203 0.0423  437 ILE A CG2 
3320 C CD1 . ILE A 449 ? 0.3487 0.3810 0.4089 -0.0125 -0.0117 0.0458  437 ILE A CD1 
3321 N N   . ALA A 450 ? 0.3676 0.3819 0.4328 -0.0100 -0.0223 0.0317  438 ALA A N   
3322 C CA  . ALA A 450 ? 0.3733 0.3828 0.4400 -0.0088 -0.0258 0.0264  438 ALA A CA  
3323 C C   . ALA A 450 ? 0.3865 0.3899 0.4575 -0.0078 -0.0281 0.0267  438 ALA A C   
3324 O O   . ALA A 450 ? 0.3989 0.3955 0.4736 -0.0087 -0.0319 0.0253  438 ALA A O   
3325 C CB  . ALA A 450 ? 0.3556 0.3668 0.4166 -0.0054 -0.0236 0.0206  438 ALA A CB  
3326 N N   . GLY A 451 ? 0.3757 0.3812 0.4464 -0.0058 -0.0262 0.0281  439 GLY A N   
3327 C CA  . GLY A 451 ? 0.3783 0.3786 0.4521 -0.0033 -0.0290 0.0287  439 GLY A CA  
3328 C C   . GLY A 451 ? 0.3881 0.3811 0.4632 -0.0058 -0.0315 0.0349  439 GLY A C   
3329 O O   . GLY A 451 ? 0.3983 0.3822 0.4761 -0.0048 -0.0350 0.0347  439 GLY A O   
3330 N N   . PHE A 452 ? 0.3786 0.3747 0.4518 -0.0091 -0.0291 0.0405  440 PHE A N   
3331 C CA  . PHE A 452 ? 0.3761 0.3659 0.4502 -0.0121 -0.0297 0.0471  440 PHE A CA  
3332 C C   . PHE A 452 ? 0.3854 0.3700 0.4653 -0.0160 -0.0317 0.0460  440 PHE A C   
3333 O O   . PHE A 452 ? 0.3964 0.3711 0.4790 -0.0181 -0.0333 0.0496  440 PHE A O   
3334 C CB  . PHE A 452 ? 0.3789 0.3744 0.4496 -0.0143 -0.0258 0.0530  440 PHE A CB  
3335 C CG  . PHE A 452 ? 0.3396 0.3363 0.4043 -0.0108 -0.0253 0.0554  440 PHE A CG  
3336 C CD1 . PHE A 452 ? 0.3759 0.3646 0.4376 -0.0086 -0.0277 0.0596  440 PHE A CD1 
3337 C CD2 . PHE A 452 ? 0.3299 0.3351 0.3916 -0.0095 -0.0228 0.0536  440 PHE A CD2 
3338 C CE1 . PHE A 452 ? 0.3438 0.3344 0.3990 -0.0046 -0.0285 0.0613  440 PHE A CE1 
3339 C CE2 . PHE A 452 ? 0.3108 0.3176 0.3677 -0.0064 -0.0233 0.0545  440 PHE A CE2 
3340 C CZ  . PHE A 452 ? 0.3579 0.3582 0.4113 -0.0038 -0.0264 0.0582  440 PHE A CZ  
3341 N N   . ILE A 453 ? 0.3822 0.3724 0.4638 -0.0173 -0.0318 0.0410  441 ILE A N   
3342 C CA  . ILE A 453 ? 0.3899 0.3759 0.4778 -0.0207 -0.0350 0.0381  441 ILE A CA  
3343 C C   . ILE A 453 ? 0.4007 0.3759 0.4902 -0.0183 -0.0390 0.0335  441 ILE A C   
3344 O O   . ILE A 453 ? 0.3976 0.3635 0.4926 -0.0215 -0.0414 0.0342  441 ILE A O   
3345 C CB  . ILE A 453 ? 0.3916 0.3854 0.4797 -0.0214 -0.0358 0.0329  441 ILE A CB  
3346 C CG1 . ILE A 453 ? 0.3846 0.3883 0.4729 -0.0235 -0.0324 0.0375  441 ILE A CG1 
3347 C CG2 . ILE A 453 ? 0.4057 0.3947 0.5013 -0.0249 -0.0407 0.0282  441 ILE A CG2 
3348 C CD1 . ILE A 453 ? 0.3720 0.3840 0.4574 -0.0218 -0.0331 0.0332  441 ILE A CD1 
3349 N N   . ALA A 454 ? 0.3924 0.3686 0.4778 -0.0127 -0.0393 0.0286  442 ALA A N   
3350 C CA  . ALA A 454 ? 0.4001 0.3673 0.4872 -0.0091 -0.0427 0.0234  442 ALA A CA  
3351 C C   . ALA A 454 ? 0.4133 0.3686 0.5026 -0.0085 -0.0446 0.0292  442 ALA A C   
3352 O O   . ALA A 454 ? 0.4160 0.3594 0.5086 -0.0073 -0.0482 0.0264  442 ALA A O   
3353 C CB  . ALA A 454 ? 0.3688 0.3421 0.4522 -0.0031 -0.0411 0.0180  442 ALA A CB  
3354 N N   . GLN A 455 ? 0.4046 0.3623 0.4905 -0.0085 -0.0422 0.0368  443 GLN A N   
3355 C CA  . GLN A 455 ? 0.4427 0.3893 0.5272 -0.0072 -0.0436 0.0436  443 GLN A CA  
3356 C C   . GLN A 455 ? 0.4509 0.3884 0.5385 -0.0141 -0.0428 0.0501  443 GLN A C   
3357 O O   . GLN A 455 ? 0.4856 0.4113 0.5712 -0.0137 -0.0434 0.0564  443 GLN A O   
3358 C CB  . GLN A 455 ? 0.4409 0.3939 0.5189 -0.0041 -0.0417 0.0488  443 GLN A CB  
3359 C CG  . GLN A 455 ? 0.4507 0.4114 0.5283 0.0025  -0.0429 0.0427  443 GLN A CG  
3360 C CD  . GLN A 455 ? 0.4606 0.4291 0.5329 0.0044  -0.0415 0.0465  443 GLN A CD  
3361 O OE1 . GLN A 455 ? 0.5537 0.5163 0.6209 0.0060  -0.0430 0.0532  443 GLN A OE1 
3362 N NE2 . GLN A 455 ? 0.3926 0.3734 0.4652 0.0042  -0.0386 0.0424  443 GLN A NE2 
3363 N N   . GLY A 456 ? 0.4476 0.3907 0.5402 -0.0204 -0.0412 0.0486  444 GLY A N   
3364 C CA  . GLY A 456 ? 0.4684 0.4038 0.5676 -0.0278 -0.0403 0.0529  444 GLY A CA  
3365 C C   . GLY A 456 ? 0.4701 0.4151 0.5705 -0.0334 -0.0350 0.0593  444 GLY A C   
3366 O O   . GLY A 456 ? 0.4754 0.4161 0.5827 -0.0401 -0.0332 0.0631  444 GLY A O   
3367 N N   . LEU A 457 ? 0.4511 0.4090 0.5457 -0.0308 -0.0322 0.0601  445 LEU A N   
3368 C CA  . LEU A 457 ? 0.4554 0.4226 0.5517 -0.0354 -0.0271 0.0652  445 LEU A CA  
3369 C C   . LEU A 457 ? 0.4390 0.4163 0.5445 -0.0392 -0.0282 0.0590  445 LEU A C   
3370 O O   . LEU A 457 ? 0.4067 0.3866 0.5121 -0.0363 -0.0322 0.0511  445 LEU A O   
3371 C CB  . LEU A 457 ? 0.4411 0.4173 0.5281 -0.0313 -0.0237 0.0680  445 LEU A CB  
3372 C CG  . LEU A 457 ? 0.4840 0.4551 0.5603 -0.0261 -0.0234 0.0727  445 LEU A CG  
3373 C CD1 . LEU A 457 ? 0.4173 0.3992 0.4865 -0.0246 -0.0190 0.0756  445 LEU A CD1 
3374 C CD2 . LEU A 457 ? 0.4680 0.4250 0.5415 -0.0266 -0.0237 0.0795  445 LEU A CD2 
3375 N N   . SER A 458 ? 0.4520 0.4347 0.5656 -0.0454 -0.0249 0.0626  446 SER A N   
3376 C CA  . SER A 458 ? 0.4516 0.4464 0.5745 -0.0482 -0.0263 0.0572  446 SER A CA  
3377 C C   . SER A 458 ? 0.4434 0.4493 0.5584 -0.0424 -0.0259 0.0545  446 SER A C   
3378 O O   . SER A 458 ? 0.4403 0.4466 0.5458 -0.0385 -0.0227 0.0582  446 SER A O   
3379 C CB  . SER A 458 ? 0.4616 0.4632 0.5958 -0.0555 -0.0213 0.0623  446 SER A CB  
3380 O OG  . SER A 458 ? 0.4452 0.4555 0.5739 -0.0539 -0.0149 0.0682  446 SER A OG  
3381 N N   . PRO A 459 ? 0.4340 0.4481 0.5525 -0.0415 -0.0295 0.0479  447 PRO A N   
3382 C CA  . PRO A 459 ? 0.4112 0.4346 0.5219 -0.0362 -0.0284 0.0464  447 PRO A CA  
3383 C C   . PRO A 459 ? 0.4045 0.4354 0.5137 -0.0361 -0.0222 0.0527  447 PRO A C   
3384 O O   . PRO A 459 ? 0.4080 0.4405 0.5076 -0.0314 -0.0199 0.0535  447 PRO A O   
3385 C CB  . PRO A 459 ? 0.4049 0.4356 0.5213 -0.0363 -0.0334 0.0398  447 PRO A CB  
3386 C CG  . PRO A 459 ? 0.4303 0.4532 0.5541 -0.0401 -0.0386 0.0351  447 PRO A CG  
3387 C CD  . PRO A 459 ? 0.4331 0.4476 0.5620 -0.0451 -0.0351 0.0413  447 PRO A CD  
3388 N N   . LEU A 460 ? 0.3972 0.4326 0.5161 -0.0412 -0.0191 0.0567  448 LEU A N   
3389 C CA  . LEU A 460 ? 0.3939 0.4365 0.5111 -0.0407 -0.0127 0.0620  448 LEU A CA  
3390 C C   . LEU A 460 ? 0.3881 0.4221 0.4941 -0.0390 -0.0090 0.0676  448 LEU A C   
3391 O O   . LEU A 460 ? 0.3608 0.3981 0.4584 -0.0352 -0.0058 0.0691  448 LEU A O   
3392 C CB  . LEU A 460 ? 0.3978 0.4490 0.5295 -0.0468 -0.0092 0.0647  448 LEU A CB  
3393 C CG  . LEU A 460 ? 0.3981 0.4581 0.5288 -0.0460 -0.0016 0.0698  448 LEU A CG  
3394 C CD1 . LEU A 460 ? 0.3969 0.4675 0.5261 -0.0402 -0.0027 0.0658  448 LEU A CD1 
3395 C CD2 . LEU A 460 ? 0.4086 0.4752 0.5539 -0.0534 0.0043  0.0741  448 LEU A CD2 
3396 N N   . GLU A 461 ? 0.4024 0.4252 0.5081 -0.0416 -0.0098 0.0704  449 GLU A N   
3397 C CA  . GLU A 461 ? 0.4176 0.4319 0.5118 -0.0391 -0.0075 0.0757  449 GLU A CA  
3398 C C   . GLU A 461 ? 0.3903 0.4035 0.4748 -0.0326 -0.0107 0.0715  449 GLU A C   
3399 O O   . GLU A 461 ? 0.4074 0.4214 0.4828 -0.0291 -0.0085 0.0737  449 GLU A O   
3400 C CB  . GLU A 461 ? 0.4401 0.4405 0.5353 -0.0421 -0.0087 0.0795  449 GLU A CB  
3401 C CG  . GLU A 461 ? 0.4737 0.4733 0.5767 -0.0492 -0.0034 0.0859  449 GLU A CG  
3402 C CD  . GLU A 461 ? 0.5392 0.5235 0.6467 -0.0534 -0.0053 0.0883  449 GLU A CD  
3403 O OE1 . GLU A 461 ? 0.5302 0.5056 0.6373 -0.0510 -0.0117 0.0834  449 GLU A OE1 
3404 O OE2 . GLU A 461 ? 0.5678 0.5488 0.6798 -0.0595 0.0002  0.0951  449 GLU A OE2 
3405 N N   . ALA A 462 ? 0.3769 0.3881 0.4636 -0.0311 -0.0156 0.0652  450 ALA A N   
3406 C CA  . ALA A 462 ? 0.3624 0.3730 0.4419 -0.0257 -0.0177 0.0607  450 ALA A CA  
3407 C C   . ALA A 462 ? 0.3631 0.3828 0.4383 -0.0232 -0.0146 0.0599  450 ALA A C   
3408 O O   . ALA A 462 ? 0.3511 0.3708 0.4196 -0.0199 -0.0137 0.0595  450 ALA A O   
3409 C CB  . ALA A 462 ? 0.3512 0.3597 0.4339 -0.0249 -0.0222 0.0540  450 ALA A CB  
3410 N N   . SER A 463 ? 0.3644 0.3918 0.4443 -0.0249 -0.0132 0.0594  451 SER A N   
3411 C CA  . SER A 463 ? 0.3559 0.3903 0.4319 -0.0222 -0.0104 0.0587  451 SER A CA  
3412 C C   . SER A 463 ? 0.3677 0.4039 0.4391 -0.0217 -0.0058 0.0632  451 SER A C   
3413 O O   . SER A 463 ? 0.3720 0.4095 0.4370 -0.0185 -0.0041 0.0620  451 SER A O   
3414 C CB  . SER A 463 ? 0.3616 0.4037 0.4442 -0.0229 -0.0111 0.0570  451 SER A CB  
3415 O OG  . SER A 463 ? 0.3568 0.3974 0.4418 -0.0228 -0.0160 0.0522  451 SER A OG  
3416 N N   . THR A 464 ? 0.3625 0.3978 0.4365 -0.0248 -0.0035 0.0683  452 THR A N   
3417 C CA  . THR A 464 ? 0.3671 0.4042 0.4353 -0.0243 0.0013  0.0729  452 THR A CA  
3418 C C   . THR A 464 ? 0.3779 0.4087 0.4354 -0.0209 0.0000  0.0730  452 THR A C   
3419 O O   . THR A 464 ? 0.3701 0.4036 0.4207 -0.0178 0.0017  0.0720  452 THR A O   
3420 C CB  . THR A 464 ? 0.3764 0.4121 0.4490 -0.0290 0.0046  0.0789  452 THR A CB  
3421 O OG1 . THR A 464 ? 0.3607 0.4045 0.4461 -0.0326 0.0056  0.0778  452 THR A OG1 
3422 C CG2 . THR A 464 ? 0.3925 0.4280 0.4556 -0.0280 0.0102  0.0845  452 THR A CG2 
3423 N N   . VAL A 465 ? 0.3777 0.4004 0.4349 -0.0210 -0.0039 0.0734  453 VAL A N   
3424 C CA  . VAL A 465 ? 0.3901 0.4075 0.4391 -0.0171 -0.0068 0.0730  453 VAL A CA  
3425 C C   . VAL A 465 ? 0.3718 0.3933 0.4201 -0.0139 -0.0085 0.0662  453 VAL A C   
3426 O O   . VAL A 465 ? 0.3586 0.3812 0.4007 -0.0110 -0.0088 0.0650  453 VAL A O   
3427 C CB  . VAL A 465 ? 0.4061 0.4136 0.4568 -0.0172 -0.0111 0.0743  453 VAL A CB  
3428 C CG1 . VAL A 465 ? 0.4500 0.4543 0.4950 -0.0121 -0.0153 0.0721  453 VAL A CG1 
3429 C CG2 . VAL A 465 ? 0.4090 0.4098 0.4581 -0.0205 -0.0083 0.0827  453 VAL A CG2 
3430 N N   . SER A 466 ? 0.3529 0.3765 0.4071 -0.0147 -0.0094 0.0619  454 SER A N   
3431 C CA  . SER A 466 ? 0.3526 0.3784 0.4061 -0.0123 -0.0101 0.0561  454 SER A CA  
3432 C C   . SER A 466 ? 0.3447 0.3753 0.3946 -0.0115 -0.0064 0.0552  454 SER A C   
3433 O O   . SER A 466 ? 0.3347 0.3662 0.3822 -0.0097 -0.0063 0.0519  454 SER A O   
3434 C CB  . SER A 466 ? 0.3574 0.3831 0.4153 -0.0129 -0.0113 0.0523  454 SER A CB  
3435 O OG  . SER A 466 ? 0.4116 0.4321 0.4728 -0.0131 -0.0149 0.0514  454 SER A OG  
3436 N N   . VAL A 467 ? 0.3376 0.3717 0.3886 -0.0127 -0.0034 0.0576  455 VAL A N   
3437 C CA  . VAL A 467 ? 0.3342 0.3718 0.3820 -0.0112 0.0000  0.0565  455 VAL A CA  
3438 C C   . VAL A 467 ? 0.3420 0.3795 0.3833 -0.0098 0.0010  0.0572  455 VAL A C   
3439 O O   . VAL A 467 ? 0.3469 0.3848 0.3850 -0.0082 0.0019  0.0536  455 VAL A O   
3440 C CB  . VAL A 467 ? 0.3387 0.3810 0.3898 -0.0116 0.0028  0.0583  455 VAL A CB  
3441 C CG1 . VAL A 467 ? 0.3380 0.3807 0.3938 -0.0119 0.0006  0.0566  455 VAL A CG1 
3442 C CG2 . VAL A 467 ? 0.3240 0.3696 0.3771 -0.0134 0.0051  0.0631  455 VAL A CG2 
3443 N N   . TYR A 468 ? 0.3561 0.3921 0.3948 -0.0104 0.0006  0.0616  456 TYR A N   
3444 C CA  . TYR A 468 ? 0.3691 0.4047 0.3989 -0.0082 0.0011  0.0625  456 TYR A CA  
3445 C C   . TYR A 468 ? 0.3649 0.3985 0.3924 -0.0059 -0.0034 0.0579  456 TYR A C   
3446 O O   . TYR A 468 ? 0.3416 0.3771 0.3650 -0.0040 -0.0036 0.0540  456 TYR A O   
3447 C CB  . TYR A 468 ? 0.3880 0.4205 0.4139 -0.0091 0.0019  0.0694  456 TYR A CB  
3448 C CG  . TYR A 468 ? 0.4087 0.4404 0.4223 -0.0061 0.0026  0.0710  456 TYR A CG  
3449 C CD1 . TYR A 468 ? 0.4267 0.4543 0.4337 -0.0029 -0.0027 0.0700  456 TYR A CD1 
3450 C CD2 . TYR A 468 ? 0.4402 0.4758 0.4487 -0.0057 0.0082  0.0730  456 TYR A CD2 
3451 C CE1 . TYR A 468 ? 0.4762 0.5032 0.4703 0.0006  -0.0033 0.0709  456 TYR A CE1 
3452 C CE2 . TYR A 468 ? 0.4733 0.5080 0.4683 -0.0024 0.0089  0.0739  456 TYR A CE2 
3453 C CZ  . TYR A 468 ? 0.5126 0.5426 0.4998 0.0007  0.0027  0.0730  456 TYR A CZ  
3454 O OH  . TYR A 468 ? 0.5641 0.5932 0.5367 0.0046  0.0024  0.0738  456 TYR A OH  
3455 N N   . LEU A 469 ? 0.3695 0.3999 0.4008 -0.0059 -0.0075 0.0577  457 LEU A N   
3456 C CA  . LEU A 469 ? 0.3615 0.3917 0.3931 -0.0033 -0.0123 0.0531  457 LEU A CA  
3457 C C   . LEU A 469 ? 0.3581 0.3922 0.3950 -0.0038 -0.0114 0.0461  457 LEU A C   
3458 O O   . LEU A 469 ? 0.3472 0.3839 0.3842 -0.0022 -0.0138 0.0412  457 LEU A O   
3459 C CB  . LEU A 469 ? 0.3730 0.3989 0.4090 -0.0028 -0.0162 0.0539  457 LEU A CB  
3460 C CG  . LEU A 469 ? 0.4268 0.4461 0.4574 -0.0014 -0.0186 0.0604  457 LEU A CG  
3461 C CD1 . LEU A 469 ? 0.4408 0.4546 0.4779 -0.0015 -0.0217 0.0604  457 LEU A CD1 
3462 C CD2 . LEU A 469 ? 0.4143 0.4334 0.4361 0.0033  -0.0228 0.0602  457 LEU A CD2 
3463 N N   . HIS A 470 ? 0.3558 0.3902 0.3971 -0.0061 -0.0081 0.0456  458 HIS A N   
3464 C CA  . HIS A 470 ? 0.3588 0.3948 0.4040 -0.0071 -0.0055 0.0404  458 HIS A CA  
3465 C C   . HIS A 470 ? 0.3610 0.3983 0.4023 -0.0068 -0.0034 0.0381  458 HIS A C   
3466 O O   . HIS A 470 ? 0.3687 0.4075 0.4126 -0.0071 -0.0039 0.0327  458 HIS A O   
3467 C CB  . HIS A 470 ? 0.3506 0.3852 0.3976 -0.0086 -0.0027 0.0421  458 HIS A CB  
3468 C CG  . HIS A 470 ? 0.3619 0.3958 0.4101 -0.0094 0.0008  0.0390  458 HIS A CG  
3469 N ND1 . HIS A 470 ? 0.3361 0.3687 0.3814 -0.0093 0.0043  0.0402  458 HIS A ND1 
3470 C CD2 . HIS A 470 ? 0.3337 0.3671 0.3853 -0.0102 0.0020  0.0355  458 HIS A CD2 
3471 C CE1 . HIS A 470 ? 0.3719 0.4019 0.4176 -0.0100 0.0073  0.0381  458 HIS A CE1 
3472 N NE2 . HIS A 470 ? 0.3920 0.4227 0.4414 -0.0109 0.0065  0.0353  458 HIS A NE2 
3473 N N   . GLY A 471 ? 0.3599 0.3970 0.3958 -0.0062 -0.0012 0.0417  459 GLY A N   
3474 C CA  . GLY A 471 ? 0.3541 0.3918 0.3855 -0.0052 0.0007  0.0389  459 GLY A CA  
3475 C C   . GLY A 471 ? 0.3572 0.3965 0.3839 -0.0033 -0.0033 0.0362  459 GLY A C   
3476 O O   . GLY A 471 ? 0.3640 0.4040 0.3901 -0.0030 -0.0038 0.0305  459 GLY A O   
3477 N N   . PHE A 472 ? 0.3601 0.3991 0.3827 -0.0017 -0.0065 0.0403  460 PHE A N   
3478 C CA  . PHE A 472 ? 0.3783 0.4183 0.3942 0.0013  -0.0113 0.0383  460 PHE A CA  
3479 C C   . PHE A 472 ? 0.3697 0.4127 0.3934 0.0015  -0.0163 0.0310  460 PHE A C   
3480 O O   . PHE A 472 ? 0.3742 0.4201 0.3958 0.0031  -0.0196 0.0252  460 PHE A O   
3481 C CB  . PHE A 472 ? 0.3999 0.4369 0.4092 0.0031  -0.0133 0.0456  460 PHE A CB  
3482 C CG  . PHE A 472 ? 0.4468 0.4834 0.4457 0.0076  -0.0187 0.0453  460 PHE A CG  
3483 C CD1 . PHE A 472 ? 0.5331 0.5724 0.5246 0.0098  -0.0197 0.0404  460 PHE A CD1 
3484 C CD2 . PHE A 472 ? 0.5222 0.5548 0.5177 0.0101  -0.0230 0.0501  460 PHE A CD2 
3485 C CE1 . PHE A 472 ? 0.5537 0.5927 0.5337 0.0147  -0.0255 0.0400  460 PHE A CE1 
3486 C CE2 . PHE A 472 ? 0.5511 0.5826 0.5352 0.0153  -0.0287 0.0505  460 PHE A CE2 
3487 C CZ  . PHE A 472 ? 0.5557 0.5909 0.5315 0.0177  -0.0300 0.0455  460 PHE A CZ  
3488 N N   . ALA A 473 ? 0.3473 0.4005 0.4083 0.0073  0.0266  0.0291  461 ALA A N   
3489 C CA  . ALA A 473 ? 0.3415 0.3920 0.3896 0.0087  0.0212  0.0270  461 ALA A CA  
3490 C C   . ALA A 473 ? 0.3424 0.3946 0.3899 0.0102  0.0208  0.0231  461 ALA A C   
3491 O O   . ALA A 473 ? 0.3714 0.4222 0.4103 0.0110  0.0194  0.0216  461 ALA A O   
3492 C CB  . ALA A 473 ? 0.3515 0.3974 0.3989 0.0084  0.0149  0.0280  461 ALA A CB  
3493 N N   . ALA A 474 ? 0.3360 0.3903 0.3954 0.0102  0.0207  0.0220  462 ALA A N   
3494 C CA  . ALA A 474 ? 0.3405 0.3951 0.4015 0.0115  0.0200  0.0187  462 ALA A CA  
3495 C C   . ALA A 474 ? 0.3489 0.4016 0.4013 0.0129  0.0261  0.0154  462 ALA A C   
3496 O O   . ALA A 474 ? 0.3483 0.3979 0.3928 0.0133  0.0227  0.0129  462 ALA A O   
3497 C CB  . ALA A 474 ? 0.3255 0.3813 0.4041 0.0114  0.0170  0.0190  462 ALA A CB  
3498 N N   . GLU A 475 ? 0.3579 0.4091 0.4090 0.0133  0.0351  0.0160  463 GLU A N   
3499 C CA  . GLU A 475 ? 0.3891 0.4312 0.4228 0.0148  0.0427  0.0126  463 GLU A CA  
3500 C C   . GLU A 475 ? 0.3979 0.4311 0.4073 0.0136  0.0358  0.0127  463 GLU A C   
3501 O O   . GLU A 475 ? 0.4033 0.4236 0.3919 0.0143  0.0362  0.0092  463 GLU A O   
3502 C CB  . GLU A 475 ? 0.3946 0.4342 0.4304 0.0154  0.0579  0.0145  463 GLU A CB  
3503 C CG  . GLU A 475 ? 0.4344 0.4827 0.5018 0.0170  0.0652  0.0146  463 GLU A CG  
3504 C CD  . GLU A 475 ? 0.5134 0.5628 0.5942 0.0170  0.0816  0.0188  463 GLU A CD  
3505 O OE1 . GLU A 475 ? 0.6540 0.6933 0.7117 0.0162  0.0915  0.0205  463 GLU A OE1 
3506 O OE2 . GLU A 475 ? 0.5117 0.5714 0.6283 0.0171  0.0840  0.0215  463 GLU A OE2 
3507 N N   . LEU A 476 ? 0.3867 0.4242 0.3989 0.0121  0.0286  0.0167  464 LEU A N   
3508 C CA  . LEU A 476 ? 0.4067 0.4370 0.4039 0.0112  0.0202  0.0180  464 LEU A CA  
3509 C C   . LEU A 476 ? 0.4002 0.4330 0.4049 0.0111  0.0100  0.0165  464 LEU A C   
3510 O O   . LEU A 476 ? 0.3961 0.4238 0.3958 0.0103  0.0006  0.0179  464 LEU A O   
3511 C CB  . LEU A 476 ? 0.3939 0.4265 0.3939 0.0102  0.0183  0.0233  464 LEU A CB  
3512 C CG  . LEU A 476 ? 0.4232 0.4518 0.4163 0.0092  0.0272  0.0266  464 LEU A CG  
3513 C CD1 . LEU A 476 ? 0.3832 0.4132 0.3808 0.0082  0.0227  0.0315  464 LEU A CD1 
3514 C CD2 . LEU A 476 ? 0.4273 0.4395 0.3926 0.0088  0.0318  0.0262  464 LEU A CD2 
3515 N N   . PHE A 477 ? 0.3967 0.4365 0.4156 0.0117  0.0113  0.0145  465 PHE A N   
3516 C CA  . PHE A 477 ? 0.3863 0.4281 0.4147 0.0111  0.0040  0.0141  465 PHE A CA  
3517 C C   . PHE A 477 ? 0.4227 0.4534 0.4382 0.0103  -0.0033 0.0110  465 PHE A C   
3518 O O   . PHE A 477 ? 0.4364 0.4578 0.4371 0.0112  0.0005  0.0066  465 PHE A O   
3519 C CB  . PHE A 477 ? 0.3777 0.4244 0.4178 0.0115  0.0071  0.0129  465 PHE A CB  
3520 C CG  . PHE A 477 ? 0.4007 0.4493 0.4522 0.0104  0.0026  0.0140  465 PHE A CG  
3521 C CD1 . PHE A 477 ? 0.4269 0.4793 0.4886 0.0100  0.0019  0.0181  465 PHE A CD1 
3522 C CD2 . PHE A 477 ? 0.3913 0.4374 0.4463 0.0099  0.0007  0.0114  465 PHE A CD2 
3523 C CE1 . PHE A 477 ? 0.4564 0.5110 0.5332 0.0088  0.0010  0.0203  465 PHE A CE1 
3524 C CE2 . PHE A 477 ? 0.4020 0.4496 0.4697 0.0082  -0.0023 0.0136  465 PHE A CE2 
3525 C CZ  . PHE A 477 ? 0.4106 0.4628 0.4900 0.0075  -0.0013 0.0184  465 PHE A CZ  
3526 N N   . GLU A 478 ? 0.4329 0.4626 0.4551 0.0088  -0.0143 0.0133  466 GLU A N   
3527 C CA  . GLU A 478 ? 0.4872 0.5027 0.4974 0.0070  -0.0272 0.0111  466 GLU A CA  
3528 C C   . GLU A 478 ? 0.4901 0.5000 0.5008 0.0063  -0.0307 0.0062  466 GLU A C   
3529 O O   . GLU A 478 ? 0.5180 0.5094 0.5056 0.0057  -0.0373 0.0016  466 GLU A O   
3530 C CB  . GLU A 478 ? 0.5021 0.5195 0.5286 0.0053  -0.0407 0.0164  466 GLU A CB  
3531 C CG  . GLU A 478 ? 0.5618 0.5836 0.5897 0.0065  -0.0379 0.0212  466 GLU A CG  
3532 C CD  . GLU A 478 ? 0.6127 0.6518 0.6668 0.0085  -0.0271 0.0244  466 GLU A CD  
3533 O OE1 . GLU A 478 ? 0.5087 0.5551 0.5726 0.0089  -0.0187 0.0231  466 GLU A OE1 
3534 O OE2 . GLU A 478 ? 0.6525 0.6943 0.7137 0.0097  -0.0272 0.0284  466 GLU A OE2 
3535 N N   . GLN A 479 ? 0.4543 0.4767 0.4887 0.0062  -0.0268 0.0075  467 GLN A N   
3536 C CA  . GLN A 479 ? 0.4523 0.4700 0.4910 0.0052  -0.0306 0.0039  467 GLN A CA  
3537 C C   . GLN A 479 ? 0.4470 0.4642 0.4795 0.0079  -0.0193 -0.0004 467 GLN A C   
3538 O O   . GLN A 479 ? 0.4329 0.4511 0.4558 0.0104  -0.0095 -0.0014 467 GLN A O   
3539 C CB  . GLN A 479 ? 0.4357 0.4638 0.5050 0.0026  -0.0345 0.0092  467 GLN A CB  
3540 C CG  . GLN A 479 ? 0.4554 0.4852 0.5403 0.0004  -0.0459 0.0141  467 GLN A CG  
3541 C CD  . GLN A 479 ? 0.5113 0.5223 0.5786 -0.0017 -0.0642 0.0108  467 GLN A CD  
3542 O OE1 . GLN A 479 ? 0.5392 0.5354 0.5875 -0.0021 -0.0687 0.0046  467 GLN A OE1 
3543 N NE2 . GLN A 479 ? 0.5324 0.5409 0.6040 -0.0028 -0.0758 0.0148  467 GLN A NE2 
3544 N N   . ASP A 480 ? 0.4333 0.4486 0.4748 0.0074  -0.0214 -0.0024 468 ASP A N   
3545 C CA  . ASP A 480 ? 0.4184 0.4329 0.4592 0.0104  -0.0126 -0.0060 468 ASP A CA  
3546 C C   . ASP A 480 ? 0.3929 0.4206 0.4459 0.0113  -0.0045 -0.0012 468 ASP A C   
3547 O O   . ASP A 480 ? 0.3894 0.4244 0.4535 0.0092  -0.0055 0.0042  468 ASP A O   
3548 C CB  . ASP A 480 ? 0.4254 0.4341 0.4746 0.0095  -0.0179 -0.0085 468 ASP A CB  
3549 C CG  . ASP A 480 ? 0.4409 0.4448 0.4888 0.0136  -0.0102 -0.0134 468 ASP A CG  
3550 O OD1 . ASP A 480 ? 0.4217 0.4349 0.4840 0.0147  -0.0055 -0.0100 468 ASP A OD1 
3551 O OD2 . ASP A 480 ? 0.4812 0.4699 0.5131 0.0161  -0.0092 -0.0207 468 ASP A OD2 
3552 N N   . GLU A 481 ? 0.3915 0.4195 0.4422 0.0143  0.0035  -0.0034 469 GLU A N   
3553 C CA  . GLU A 481 ? 0.3877 0.4251 0.4483 0.0147  0.0079  0.0009  469 GLU A CA  
3554 C C   . GLU A 481 ? 0.3880 0.4267 0.4601 0.0134  0.0038  0.0044  469 GLU A C   
3555 O O   . GLU A 481 ? 0.3906 0.4318 0.4644 0.0123  0.0034  0.0089  469 GLU A O   
3556 C CB  . GLU A 481 ? 0.3815 0.4189 0.4456 0.0179  0.0166  -0.0014 469 GLU A CB  
3557 C CG  . GLU A 481 ? 0.4012 0.4352 0.4778 0.0206  0.0179  -0.0048 469 GLU A CG  
3558 C CD  . GLU A 481 ? 0.4711 0.5054 0.5576 0.0248  0.0305  -0.0073 469 GLU A CD  
3559 O OE1 . GLU A 481 ? 0.4823 0.5105 0.5521 0.0261  0.0400  -0.0101 469 GLU A OE1 
3560 O OE2 . GLU A 481 ? 0.4201 0.4593 0.5317 0.0267  0.0309  -0.0057 469 GLU A OE2 
3561 N N   . ARG A 482 ? 0.3980 0.4316 0.4748 0.0132  0.0000  0.0025  470 ARG A N   
3562 C CA  . ARG A 482 ? 0.3973 0.4290 0.4815 0.0116  -0.0038 0.0070  470 ARG A CA  
3563 C C   . ARG A 482 ? 0.3995 0.4312 0.4799 0.0081  -0.0039 0.0129  470 ARG A C   
3564 O O   . ARG A 482 ? 0.3948 0.4208 0.4731 0.0065  -0.0049 0.0177  470 ARG A O   
3565 C CB  . ARG A 482 ? 0.4157 0.4406 0.5071 0.0122  -0.0078 0.0044  470 ARG A CB  
3566 C CG  . ARG A 482 ? 0.3911 0.4122 0.4822 0.0093  -0.0118 0.0044  470 ARG A CG  
3567 C CD  . ARG A 482 ? 0.4403 0.4524 0.5378 0.0108  -0.0160 0.0000  470 ARG A CD  
3568 N NE  . ARG A 482 ? 0.4279 0.4347 0.5193 0.0151  -0.0126 -0.0086 470 ARG A NE  
3569 C CZ  . ARG A 482 ? 0.4630 0.4609 0.5593 0.0188  -0.0122 -0.0143 470 ARG A CZ  
3570 N NH1 . ARG A 482 ? 0.4515 0.4460 0.5617 0.0185  -0.0175 -0.0118 470 ARG A NH1 
3571 N NH2 . ARG A 482 ? 0.4663 0.4563 0.5519 0.0232  -0.0052 -0.0224 470 ARG A NH2 
3572 N N   . GLY A 483 ? 0.3840 0.4198 0.4638 0.0070  -0.0028 0.0130  471 GLY A N   
3573 C CA  . GLY A 483 ? 0.3878 0.4251 0.4705 0.0047  0.0004  0.0185  471 GLY A CA  
3574 C C   . GLY A 483 ? 0.3797 0.4196 0.4550 0.0059  0.0059  0.0207  471 GLY A C   
3575 O O   . GLY A 483 ? 0.3971 0.4366 0.4744 0.0051  0.0117  0.0250  471 GLY A O   
3576 N N   . LEU A 484 ? 0.3840 0.4253 0.4523 0.0079  0.0054  0.0180  472 LEU A N   
3577 C CA  . LEU A 484 ? 0.3762 0.4179 0.4373 0.0087  0.0089  0.0198  472 LEU A CA  
3578 C C   . LEU A 484 ? 0.3910 0.4223 0.4422 0.0078  0.0109  0.0235  472 LEU A C   
3579 O O   . LEU A 484 ? 0.3814 0.4053 0.4292 0.0070  0.0063  0.0241  472 LEU A O   
3580 C CB  . LEU A 484 ? 0.3842 0.4281 0.4434 0.0101  0.0077  0.0173  472 LEU A CB  
3581 C CG  . LEU A 484 ? 0.3767 0.4198 0.4296 0.0103  0.0094  0.0191  472 LEU A CG  
3582 C CD1 . LEU A 484 ? 0.3451 0.3925 0.3974 0.0109  0.0121  0.0197  472 LEU A CD1 
3583 C CD2 . LEU A 484 ? 0.3789 0.4244 0.4366 0.0108  0.0082  0.0180  472 LEU A CD2 
3584 N N   . THR A 485 ? 0.3912 0.4186 0.4356 0.0082  0.0175  0.0260  473 THR A N   
3585 C CA  . THR A 485 ? 0.4149 0.4255 0.4396 0.0077  0.0203  0.0286  473 THR A CA  
3586 C C   . THR A 485 ? 0.4138 0.4204 0.4283 0.0092  0.0210  0.0276  473 THR A C   
3587 O O   . THR A 485 ? 0.3950 0.4136 0.4205 0.0106  0.0220  0.0261  473 THR A O   
3588 C CB  . THR A 485 ? 0.4405 0.4436 0.4621 0.0074  0.0323  0.0326  473 THR A CB  
3589 O OG1 . THR A 485 ? 0.4729 0.4867 0.5093 0.0094  0.0395  0.0327  473 THR A OG1 
3590 C CG2 . THR A 485 ? 0.4662 0.4722 0.5002 0.0051  0.0316  0.0348  473 THR A CG2 
3591 N N   . ALA A 486 ? 0.4253 0.4116 0.4162 0.0085  0.0189  0.0287  474 ALA A N   
3592 C CA  . ALA A 486 ? 0.4392 0.4159 0.4164 0.0094  0.0173  0.0275  474 ALA A CA  
3593 C C   . ALA A 486 ? 0.4325 0.4131 0.4129 0.0125  0.0293  0.0270  474 ALA A C   
3594 O O   . ALA A 486 ? 0.4185 0.4022 0.4013 0.0135  0.0268  0.0255  474 ALA A O   
3595 C CB  . ALA A 486 ? 0.4723 0.4182 0.4158 0.0078  0.0122  0.0286  474 ALA A CB  
3596 N N   . SER A 487 ? 0.4402 0.4199 0.4236 0.0139  0.0425  0.0289  475 SER A N   
3597 C CA  . SER A 487 ? 0.4587 0.4432 0.4535 0.0175  0.0544  0.0293  475 SER A CA  
3598 C C   . SER A 487 ? 0.4383 0.4468 0.4615 0.0178  0.0475  0.0287  475 SER A C   
3599 O O   . SER A 487 ? 0.4278 0.4388 0.4561 0.0201  0.0485  0.0282  475 SER A O   
3600 C CB  . SER A 487 ? 0.4661 0.4476 0.4683 0.0186  0.0708  0.0329  475 SER A CB  
3601 O OG  . SER A 487 ? 0.5239 0.4772 0.4927 0.0195  0.0819  0.0335  475 SER A OG  
3602 N N   . GLU A 488 ? 0.4247 0.4464 0.4613 0.0154  0.0395  0.0286  476 GLU A N   
3603 C CA  . GLU A 488 ? 0.4196 0.4567 0.4737 0.0153  0.0325  0.0279  476 GLU A CA  
3604 C C   . GLU A 488 ? 0.4049 0.4417 0.4491 0.0149  0.0256  0.0258  476 GLU A C   
3605 O O   . GLU A 488 ? 0.3958 0.4379 0.4449 0.0156  0.0229  0.0261  476 GLU A O   
3606 C CB  . GLU A 488 ? 0.4298 0.4751 0.4956 0.0131  0.0269  0.0276  476 GLU A CB  
3607 C CG  . GLU A 488 ? 0.5182 0.5676 0.6046 0.0127  0.0318  0.0310  476 GLU A CG  
3608 C CD  . GLU A 488 ? 0.6381 0.6931 0.7437 0.0151  0.0351  0.0337  476 GLU A CD  
3609 O OE1 . GLU A 488 ? 0.7306 0.7829 0.8469 0.0169  0.0482  0.0370  476 GLU A OE1 
3610 O OE2 . GLU A 488 ? 0.6853 0.7453 0.7946 0.0153  0.0255  0.0328  476 GLU A OE2 
3611 N N   . LEU A 489 ? 0.3896 0.4191 0.4217 0.0134  0.0222  0.0248  477 LEU A N   
3612 C CA  . LEU A 489 ? 0.3872 0.4165 0.4165 0.0125  0.0166  0.0240  477 LEU A CA  
3613 C C   . LEU A 489 ? 0.3878 0.4113 0.4114 0.0138  0.0183  0.0247  477 LEU A C   
3614 O O   . LEU A 489 ? 0.3746 0.4035 0.4031 0.0135  0.0160  0.0253  477 LEU A O   
3615 C CB  . LEU A 489 ? 0.4039 0.4243 0.4266 0.0105  0.0103  0.0239  477 LEU A CB  
3616 C CG  . LEU A 489 ? 0.3943 0.4155 0.4230 0.0089  0.0035  0.0243  477 LEU A CG  
3617 C CD1 . LEU A 489 ? 0.3820 0.4188 0.4271 0.0091  0.0064  0.0236  477 LEU A CD1 
3618 C CD2 . LEU A 489 ? 0.4203 0.4281 0.4440 0.0067  -0.0065 0.0252  477 LEU A CD2 
3619 N N   . LEU A 490 ? 0.3898 0.3994 0.4009 0.0155  0.0235  0.0246  478 LEU A N   
3620 C CA  . LEU A 490 ? 0.4099 0.4102 0.4140 0.0177  0.0264  0.0243  478 LEU A CA  
3621 C C   . LEU A 490 ? 0.4031 0.4162 0.4249 0.0198  0.0287  0.0258  478 LEU A C   
3622 O O   . LEU A 490 ? 0.4114 0.4228 0.4331 0.0201  0.0256  0.0263  478 LEU A O   
3623 C CB  . LEU A 490 ? 0.4181 0.3983 0.4035 0.0203  0.0366  0.0234  478 LEU A CB  
3624 C CG  . LEU A 490 ? 0.4574 0.4119 0.4118 0.0185  0.0328  0.0221  478 LEU A CG  
3625 C CD1 . LEU A 490 ? 0.4003 0.3338 0.3340 0.0220  0.0496  0.0218  478 LEU A CD1 
3626 C CD2 . LEU A 490 ? 0.4628 0.4036 0.4045 0.0171  0.0219  0.0205  478 LEU A CD2 
3627 N N   . ARG A 491 ? 0.3976 0.4215 0.4352 0.0208  0.0320  0.0271  479 ARG A N   
3628 C CA  . ARG A 491 ? 0.4054 0.4394 0.4621 0.0225  0.0302  0.0294  479 ARG A CA  
3629 C C   . ARG A 491 ? 0.3904 0.4303 0.4450 0.0198  0.0203  0.0300  479 ARG A C   
3630 O O   . ARG A 491 ? 0.3911 0.4320 0.4509 0.0206  0.0163  0.0322  479 ARG A O   
3631 C CB  . ARG A 491 ? 0.4164 0.4592 0.4936 0.0229  0.0326  0.0313  479 ARG A CB  
3632 C CG  . ARG A 491 ? 0.4931 0.5447 0.5938 0.0238  0.0258  0.0345  479 ARG A CG  
3633 C CD  . ARG A 491 ? 0.5527 0.6131 0.6768 0.0225  0.0229  0.0366  479 ARG A CD  
3634 N NE  . ARG A 491 ? 0.6299 0.6911 0.7419 0.0187  0.0179  0.0341  479 ARG A NE  
3635 C CZ  . ARG A 491 ? 0.6878 0.7487 0.7885 0.0160  0.0063  0.0323  479 ARG A CZ  
3636 N NH1 . ARG A 491 ? 0.6591 0.7174 0.7544 0.0159  -0.0026 0.0334  479 ARG A NH1 
3637 N NH2 . ARG A 491 ? 0.6986 0.7588 0.7903 0.0137  0.0048  0.0294  479 ARG A NH2 
3638 N N   . LEU A 492 ? 0.3758 0.4173 0.4220 0.0169  0.0176  0.0284  480 LEU A N   
3639 C CA  . LEU A 492 ? 0.3664 0.4108 0.4085 0.0148  0.0131  0.0289  480 LEU A CA  
3640 C C   . LEU A 492 ? 0.3726 0.4127 0.4088 0.0134  0.0130  0.0303  480 LEU A C   
3641 O O   . LEU A 492 ? 0.3818 0.4222 0.4142 0.0118  0.0122  0.0323  480 LEU A O   
3642 C CB  . LEU A 492 ? 0.3602 0.4081 0.4007 0.0132  0.0128  0.0265  480 LEU A CB  
3643 C CG  . LEU A 492 ? 0.3691 0.4200 0.4151 0.0133  0.0099  0.0255  480 LEU A CG  
3644 C CD1 . LEU A 492 ? 0.3345 0.3864 0.3798 0.0124  0.0109  0.0224  480 LEU A CD1 
3645 C CD2 . LEU A 492 ? 0.3505 0.3986 0.3919 0.0127  0.0029  0.0266  480 LEU A CD2 
3646 N N   . ILE A 493 ? 0.3672 0.4007 0.4008 0.0135  0.0137  0.0296  481 ILE A N   
3647 C CA  . ILE A 493 ? 0.3658 0.3941 0.3977 0.0115  0.0112  0.0313  481 ILE A CA  
3648 C C   . ILE A 493 ? 0.3684 0.3955 0.4005 0.0116  0.0105  0.0347  481 ILE A C   
3649 O O   . ILE A 493 ? 0.3679 0.3959 0.4011 0.0088  0.0104  0.0377  481 ILE A O   
3650 C CB  . ILE A 493 ? 0.3697 0.3845 0.3937 0.0115  0.0085  0.0295  481 ILE A CB  
3651 C CG1 . ILE A 493 ? 0.3582 0.3720 0.3817 0.0096  0.0053  0.0280  481 ILE A CG1 
3652 C CG2 . ILE A 493 ? 0.3866 0.3932 0.4107 0.0091  0.0032  0.0315  481 ILE A CG2 
3653 C CD1 . ILE A 493 ? 0.3733 0.3665 0.3792 0.0094  0.0003  0.0261  481 ILE A CD1 
3654 N N   . PRO A 494 ? 0.3814 0.4059 0.4148 0.0149  0.0105  0.0351  482 PRO A N   
3655 C CA  . PRO A 494 ? 0.3970 0.4182 0.4309 0.0149  0.0074  0.0391  482 PRO A CA  
3656 C C   . PRO A 494 ? 0.4028 0.4274 0.4323 0.0128  0.0048  0.0425  482 PRO A C   
3657 O O   . PRO A 494 ? 0.3919 0.4108 0.4160 0.0111  0.0025  0.0470  482 PRO A O   
3658 C CB  . PRO A 494 ? 0.4033 0.4210 0.4451 0.0198  0.0081  0.0386  482 PRO A CB  
3659 C CG  . PRO A 494 ? 0.3968 0.4116 0.4368 0.0221  0.0148  0.0340  482 PRO A CG  
3660 C CD  . PRO A 494 ? 0.3803 0.4019 0.4165 0.0189  0.0145  0.0326  482 PRO A CD  
3661 N N   . GLU A 495 ? 0.3996 0.4294 0.4278 0.0128  0.0047  0.0405  483 GLU A N   
3662 C CA  . GLU A 495 ? 0.4253 0.4517 0.4405 0.0106  0.0025  0.0424  483 GLU A CA  
3663 C C   . GLU A 495 ? 0.4163 0.4417 0.4236 0.0077  0.0108  0.0428  483 GLU A C   
3664 O O   . GLU A 495 ? 0.4348 0.4520 0.4281 0.0055  0.0132  0.0466  483 GLU A O   
3665 C CB  . GLU A 495 ? 0.4406 0.4693 0.4557 0.0114  -0.0016 0.0395  483 GLU A CB  
3666 C CG  . GLU A 495 ? 0.5029 0.5201 0.4953 0.0092  -0.0057 0.0406  483 GLU A CG  
3667 C CD  . GLU A 495 ? 0.5963 0.6127 0.5856 0.0092  -0.0100 0.0364  483 GLU A CD  
3668 O OE1 . GLU A 495 ? 0.6002 0.6270 0.6088 0.0106  -0.0104 0.0339  483 GLU A OE1 
3669 O OE2 . GLU A 495 ? 0.6319 0.6344 0.5964 0.0076  -0.0121 0.0355  483 GLU A OE2 
3670 N N   . ALA A 496 ? 0.4008 0.4332 0.4183 0.0075  0.0156  0.0398  484 ALA A N   
3671 C CA  . ALA A 496 ? 0.3948 0.4284 0.4164 0.0049  0.0235  0.0414  484 ALA A CA  
3672 C C   . ALA A 496 ? 0.4011 0.4298 0.4248 0.0023  0.0244  0.0472  484 ALA A C   
3673 O O   . ALA A 496 ? 0.4101 0.4359 0.4312 -0.0001 0.0328  0.0512  484 ALA A O   
3674 C CB  . ALA A 496 ? 0.3612 0.4016 0.3988 0.0049  0.0236  0.0383  484 ALA A CB  
3675 N N   . ILE A 497 ? 0.4051 0.4314 0.4339 0.0029  0.0174  0.0476  485 ILE A N   
3676 C CA  . ILE A 497 ? 0.4216 0.4416 0.4534 0.0003  0.0161  0.0529  485 ILE A CA  
3677 C C   . ILE A 497 ? 0.4371 0.4494 0.4534 -0.0004 0.0174  0.0581  485 ILE A C   
3678 O O   . ILE A 497 ? 0.4455 0.4531 0.4601 -0.0040 0.0233  0.0640  485 ILE A O   
3679 C CB  . ILE A 497 ? 0.4260 0.4401 0.4611 0.0022  0.0082  0.0509  485 ILE A CB  
3680 C CG1 . ILE A 497 ? 0.4234 0.4378 0.4664 0.0016  0.0053  0.0468  485 ILE A CG1 
3681 C CG2 . ILE A 497 ? 0.4328 0.4378 0.4691 -0.0001 0.0054  0.0566  485 ILE A CG2 
3682 C CD1 . ILE A 497 ? 0.3985 0.4004 0.4355 0.0038  -0.0008 0.0432  485 ILE A CD1 
3683 N N   . ARG A 498 ? 0.4492 0.4584 0.4543 0.0024  0.0116  0.0568  486 ARG A N   
3684 C CA  . ARG A 498 ? 0.4901 0.4870 0.4762 0.0012  0.0084  0.0624  486 ARG A CA  
3685 C C   . ARG A 498 ? 0.5226 0.5126 0.4892 -0.0016 0.0188  0.0644  486 ARG A C   
3686 O O   . ARG A 498 ? 0.5133 0.4907 0.4646 -0.0046 0.0230  0.0711  486 ARG A O   
3687 C CB  . ARG A 498 ? 0.4946 0.4887 0.4771 0.0044  -0.0034 0.0612  486 ARG A CB  
3688 C CG  . ARG A 498 ? 0.5528 0.5294 0.5116 0.0026  -0.0112 0.0675  486 ARG A CG  
3689 C CD  . ARG A 498 ? 0.6066 0.5799 0.5686 0.0051  -0.0271 0.0674  486 ARG A CD  
3690 N NE  . ARG A 498 ? 0.6421 0.6195 0.6014 0.0057  -0.0283 0.0618  486 ARG A NE  
3691 C CZ  . ARG A 498 ? 0.7144 0.6782 0.6442 0.0033  -0.0284 0.0610  486 ARG A CZ  
3692 N NH1 . ARG A 498 ? 0.7509 0.6949 0.6478 0.0001  -0.0247 0.0657  486 ARG A NH1 
3693 N NH2 . ARG A 498 ? 0.7096 0.6771 0.6403 0.0041  -0.0306 0.0553  486 ARG A NH2 
3694 N N   . ARG A 499 ? 0.5343 0.5300 0.4999 -0.0004 0.0243  0.0589  487 ARG A N   
3695 C CA  . ARG A 499 ? 0.5995 0.5851 0.5438 -0.0019 0.0370  0.0595  487 ARG A CA  
3696 C C   . ARG A 499 ? 0.6359 0.6242 0.5924 -0.0047 0.0532  0.0640  487 ARG A C   
3697 O O   . ARG A 499 ? 0.6817 0.6564 0.6180 -0.0065 0.0668  0.0679  487 ARG A O   
3698 C CB  . ARG A 499 ? 0.5916 0.5807 0.5326 0.0005  0.0389  0.0519  487 ARG A CB  
3699 C CG  . ARG A 499 ? 0.6158 0.5992 0.5449 0.0021  0.0229  0.0490  487 ARG A CG  
3700 C CD  . ARG A 499 ? 0.6616 0.6472 0.5890 0.0040  0.0226  0.0418  487 ARG A CD  
3701 N NE  . ARG A 499 ? 0.7007 0.6755 0.6137 0.0042  0.0060  0.0407  487 ARG A NE  
3702 C CZ  . ARG A 499 ? 0.8044 0.7543 0.6810 0.0026  -0.0001 0.0422  487 ARG A CZ  
3703 N NH1 . ARG A 499 ? 0.8568 0.7888 0.7032 0.0010  0.0129  0.0448  487 ARG A NH1 
3704 N NH2 . ARG A 499 ? 0.8250 0.7652 0.6944 0.0022  -0.0197 0.0417  487 ARG A NH2 
3705 N N   . LEU A 500 ? 0.6525 0.6549 0.6407 -0.0056 0.0514  0.0645  488 LEU A N   
3706 C CA  . LEU A 500 ? 0.6886 0.6953 0.6982 -0.0090 0.0635  0.0698  488 LEU A CA  
3707 C C   . LEU A 500 ? 0.7385 0.7320 0.7363 -0.0129 0.0677  0.0791  488 LEU A C   
3708 O O   . LEU A 500 ? 0.7537 0.7456 0.7612 -0.0162 0.0836  0.0854  488 LEU A O   
3709 C CB  . LEU A 500 ? 0.6752 0.6953 0.7181 -0.0095 0.0541  0.0679  488 LEU A CB  
3710 C CG  . LEU A 500 ? 0.6895 0.7180 0.7663 -0.0129 0.0625  0.0720  488 LEU A CG  
3711 C CD1 . LEU A 500 ? 0.6884 0.7262 0.7781 -0.0103 0.0704  0.0673  488 LEU A CD1 
3712 C CD2 . LEU A 500 ? 0.7158 0.7470 0.8145 -0.0151 0.0464  0.0723  488 LEU A CD2 
3713 N N   . LYS A 501 ? 0.7694 0.7528 0.7487 -0.0125 0.0544  0.0808  489 LYS A N   
3714 C CA  . LYS A 501 ? 0.8091 0.7761 0.7722 -0.0162 0.0558  0.0904  489 LYS A CA  
3715 C C   . LYS A 501 ? 0.8366 0.7842 0.7613 -0.0149 0.0461  0.0918  489 LYS A C   
3716 O O   . LYS A 501 ? 0.8827 0.8134 0.7744 -0.0158 0.0548  0.0935  489 LYS A O   
3717 C CB  . LYS A 501 ? 0.8059 0.7770 0.7933 -0.0181 0.0459  0.0938  489 LYS A CB  
3718 C CG  . LYS A 501 ? 0.7881 0.7736 0.8012 -0.0152 0.0341  0.0859  489 LYS A CG  
3719 C CD  . LYS A 501 ? 0.8037 0.7849 0.8116 -0.0113 0.0186  0.0828  489 LYS A CD  
3720 C CE  . LYS A 501 ? 0.8413 0.8143 0.8589 -0.0132 0.0113  0.0875  489 LYS A CE  
3721 N NZ  . LYS A 501 ? 0.8518 0.8227 0.8725 -0.0076 -0.0010 0.0817  489 LYS A NZ  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -11 ?   ?   ?   A . n 
A 1 2   GLY 2   -10 ?   ?   ?   A . n 
A 1 3   SER 3   -9  ?   ?   ?   A . n 
A 1 4   ASP 4   -8  ?   ?   ?   A . n 
A 1 5   LYS 5   -7  ?   ?   ?   A . n 
A 1 6   ILE 6   -6  ?   ?   ?   A . n 
A 1 7   HIS 7   -5  ?   ?   ?   A . n 
A 1 8   HIS 8   -4  ?   ?   ?   A . n 
A 1 9   HIS 9   -3  ?   ?   ?   A . n 
A 1 10  HIS 10  -2  ?   ?   ?   A . n 
A 1 11  HIS 11  -1  ?   ?   ?   A . n 
A 1 12  HIS 12  0   ?   ?   ?   A . n 
A 1 13  MET 13  1   1   MET MET A . n 
A 1 14  LYS 14  2   2   LYS LYS A . n 
A 1 15  GLU 15  3   3   GLU GLU A . n 
A 1 16  ILE 16  4   4   ILE ILE A . n 
A 1 17  ASP 17  5   5   ASP ASP A . n 
A 1 18  GLU 18  6   6   GLU GLU A . n 
A 1 19  LEU 19  7   7   LEU LEU A . n 
A 1 20  THR 20  8   8   THR THR A . n 
A 1 21  ILE 21  9   9   ILE ILE A . n 
A 1 22  LYS 22  10  10  LYS LYS A . n 
A 1 23  GLU 23  11  11  GLU GLU A . n 
A 1 24  TYR 24  12  12  TYR TYR A . n 
A 1 25  GLY 25  13  13  GLY GLY A . n 
A 1 26  VAL 26  14  14  VAL VAL A . n 
A 1 27  ASP 27  15  15  ASP ASP A . n 
A 1 28  SER 28  16  16  SER SER A . n 
A 1 29  ARG 29  17  17  ARG ARG A . n 
A 1 30  ILE 30  18  18  ILE ILE A . n 
A 1 31  LEU 31  19  19  LEU LEU A . n 
A 1 32  MET 32  20  20  MET MET A . n 
A 1 33  GLU 33  21  21  GLU GLU A . n 
A 1 34  ARG 34  22  22  ARG ARG A . n 
A 1 35  ALA 35  23  23  ALA ALA A . n 
A 1 36  GLY 36  24  24  GLY GLY A . n 
A 1 37  ILE 37  25  25  ILE ILE A . n 
A 1 38  SER 38  26  26  SER SER A . n 
A 1 39  VAL 39  27  27  VAL VAL A . n 
A 1 40  VAL 40  28  28  VAL VAL A . n 
A 1 41  LEU 41  29  29  LEU LEU A . n 
A 1 42  ALA 42  30  30  ALA ALA A . n 
A 1 43  MET 43  31  31  MET MET A . n 
A 1 44  GLU 44  32  32  GLU GLU A . n 
A 1 45  GLU 45  33  33  GLU GLU A . n 
A 1 46  GLU 46  34  34  GLU GLU A . n 
A 1 47  LEU 47  35  35  LEU LEU A . n 
A 1 48  GLY 48  36  36  GLY GLY A . n 
A 1 49  ASN 49  37  37  ASN ASN A . n 
A 1 50  LEU 50  38  38  LEU LEU A . n 
A 1 51  SER 51  39  39  SER SER A . n 
A 1 52  ASP 52  40  40  ASP ASP A . n 
A 1 53  TYR 53  41  41  TYR TYR A . n 
A 1 54  ARG 54  42  42  ARG ARG A . n 
A 1 55  PHE 55  43  43  PHE PHE A . n 
A 1 56  LEU 56  44  44  LEU LEU A . n 
A 1 57  VAL 57  45  45  VAL VAL A . n 
A 1 58  LEU 58  46  46  LEU LEU A . n 
A 1 59  CYS 59  47  47  CYS CYS A . n 
A 1 60  GLY 60  48  48  GLY GLY A . n 
A 1 61  GLY 61  49  49  GLY GLY A . n 
A 1 62  GLY 62  50  50  GLY GLY A . n 
A 1 63  ASN 63  51  51  ASN ASN A . n 
A 1 64  ASN 64  52  52  ASN ASN A . n 
A 1 65  GLY 65  53  53  GLY GLY A . n 
A 1 66  GLY 66  54  54  GLY GLY A . n 
A 1 67  ASP 67  55  55  ASP ASP A . n 
A 1 68  GLY 68  56  56  GLY GLY A . n 
A 1 69  PHE 69  57  57  PHE PHE A . n 
A 1 70  VAL 70  58  58  VAL VAL A . n 
A 1 71  VAL 71  59  59  VAL VAL A . n 
A 1 72  ALA 72  60  60  ALA ALA A . n 
A 1 73  ARG 73  61  61  ARG ARG A . n 
A 1 74  ASN 74  62  62  ASN ASN A . n 
A 1 75  LEU 75  63  63  LEU LEU A . n 
A 1 76  LEU 76  64  64  LEU LEU A . n 
A 1 77  GLY 77  65  65  GLY GLY A . n 
A 1 78  VAL 78  66  66  VAL VAL A . n 
A 1 79  VAL 79  67  67  VAL VAL A . n 
A 1 80  LYS 80  68  68  LYS LYS A . n 
A 1 81  ASP 81  69  69  ASP ASP A . n 
A 1 82  VAL 82  70  70  VAL VAL A . n 
A 1 83  LEU 83  71  71  LEU LEU A . n 
A 1 84  VAL 84  72  72  VAL VAL A . n 
A 1 85  VAL 85  73  73  VAL VAL A . n 
A 1 86  PHE 86  74  74  PHE PHE A . n 
A 1 87  LEU 87  75  75  LEU LEU A . n 
A 1 88  GLY 88  76  76  GLY GLY A . n 
A 1 89  LYS 89  77  77  LYS LYS A . n 
A 1 90  LYS 90  78  78  LYS LYS A . n 
A 1 91  LYS 91  79  79  LYS LYS A . n 
A 1 92  THR 92  80  80  THR THR A . n 
A 1 93  PRO 93  81  81  PRO PRO A . n 
A 1 94  ASP 94  82  82  ASP ASP A . n 
A 1 95  CYS 95  83  83  CYS CYS A . n 
A 1 96  GLU 96  84  84  GLU GLU A . n 
A 1 97  TYR 97  85  85  TYR TYR A . n 
A 1 98  ASN 98  86  86  ASN ASN A . n 
A 1 99  TYR 99  87  87  TYR TYR A . n 
A 1 100 GLY 100 88  88  GLY GLY A . n 
A 1 101 LEU 101 89  89  LEU LEU A . n 
A 1 102 TYR 102 90  90  TYR TYR A . n 
A 1 103 LYS 103 91  91  LYS LYS A . n 
A 1 104 LYS 104 92  92  LYS LYS A . n 
A 1 105 PHE 105 93  93  PHE PHE A . n 
A 1 106 GLY 106 94  94  GLY GLY A . n 
A 1 107 GLY 107 95  95  GLY GLY A . n 
A 1 108 LYS 108 96  96  LYS LYS A . n 
A 1 109 VAL 109 97  97  VAL VAL A . n 
A 1 110 VAL 110 98  98  VAL VAL A . n 
A 1 111 GLU 111 99  99  GLU GLU A . n 
A 1 112 GLN 112 100 100 GLN GLN A . n 
A 1 113 PHE 113 101 101 PHE PHE A . n 
A 1 114 GLU 114 102 102 GLU GLU A . n 
A 1 115 PRO 115 103 103 PRO PRO A . n 
A 1 116 SER 116 104 104 SER SER A . n 
A 1 117 ILE 117 105 105 ILE ILE A . n 
A 1 118 LEU 118 106 106 LEU LEU A . n 
A 1 119 ASN 119 107 107 ASN ASN A . n 
A 1 120 GLU 120 108 108 GLU GLU A . n 
A 1 121 PHE 121 109 109 PHE PHE A . n 
A 1 122 ASP 122 110 110 ASP ASP A . n 
A 1 123 VAL 123 111 111 VAL VAL A . n 
A 1 124 VAL 124 112 112 VAL VAL A . n 
A 1 125 VAL 125 113 113 VAL VAL A . n 
A 1 126 ASP 126 114 114 ASP ASP A . n 
A 1 127 ALA 127 115 115 ALA ALA A . n 
A 1 128 ILE 128 116 116 ILE ILE A . n 
A 1 129 PHE 129 117 117 PHE PHE A . n 
A 1 130 GLY 130 118 118 GLY GLY A . n 
A 1 131 THR 131 119 119 THR THR A . n 
A 1 132 GLY 132 120 120 GLY GLY A . n 
A 1 133 LEU 133 121 121 LEU LEU A . n 
A 1 134 ARG 134 122 122 ARG ARG A . n 
A 1 135 GLY 135 123 123 GLY GLY A . n 
A 1 136 GLU 136 124 124 GLU GLU A . n 
A 1 137 ILE 137 125 125 ILE ILE A . n 
A 1 138 THR 138 126 126 THR THR A . n 
A 1 139 GLY 139 127 127 GLY GLY A . n 
A 1 140 GLU 140 128 128 GLU GLU A . n 
A 1 141 TYR 141 129 129 TYR TYR A . n 
A 1 142 ALA 142 130 130 ALA ALA A . n 
A 1 143 GLU 143 131 131 GLU GLU A . n 
A 1 144 ILE 144 132 132 ILE ILE A . n 
A 1 145 ILE 145 133 133 ILE ILE A . n 
A 1 146 ASN 146 134 134 ASN ASN A . n 
A 1 147 LEU 147 135 135 LEU LEU A . n 
A 1 148 VAL 148 136 136 VAL VAL A . n 
A 1 149 ASN 149 137 137 ASN ASN A . n 
A 1 150 LYS 150 138 138 LYS LYS A . n 
A 1 151 SER 151 139 139 SER SER A . n 
A 1 152 GLY 152 140 140 GLY GLY A . n 
A 1 153 LYS 153 141 141 LYS LYS A . n 
A 1 154 VAL 154 142 142 VAL VAL A . n 
A 1 155 VAL 155 143 143 VAL VAL A . n 
A 1 156 VAL 156 144 144 VAL VAL A . n 
A 1 157 SER 157 145 145 SER SER A . n 
A 1 158 VAL 158 146 146 VAL VAL A . n 
A 1 159 ASP 159 147 147 ASP ASP A . n 
A 1 160 VAL 160 148 148 VAL VAL A . n 
A 1 161 PRO 161 149 149 PRO PRO A . n 
A 1 162 SER 162 150 150 SER SER A . n 
A 1 163 GLY 163 151 151 GLY GLY A . n 
A 1 164 ILE 164 152 152 ILE ILE A . n 
A 1 165 ASP 165 153 153 ASP ASP A . n 
A 1 166 SER 166 154 154 SER SER A . n 
A 1 167 ASN 167 155 155 ASN ASN A . n 
A 1 168 THR 168 156 156 THR THR A . n 
A 1 169 GLY 169 157 157 GLY GLY A . n 
A 1 170 LYS 170 158 158 LYS LYS A . n 
A 1 171 VAL 171 159 159 VAL VAL A . n 
A 1 172 LEU 172 160 160 LEU LEU A . n 
A 1 173 ARG 173 161 161 ARG ARG A . n 
A 1 174 THR 174 162 162 THR THR A . n 
A 1 175 ALA 175 163 163 ALA ALA A . n 
A 1 176 VAL 176 164 164 VAL VAL A . n 
A 1 177 LYS 177 165 165 LYS LYS A . n 
A 1 178 ALA 178 166 166 ALA ALA A . n 
A 1 179 ASP 179 167 167 ASP ASP A . n 
A 1 180 LEU 180 168 168 LEU LEU A . n 
A 1 181 THR 181 169 169 THR THR A . n 
A 1 182 VAL 182 170 170 VAL VAL A . n 
A 1 183 THR 183 171 171 THR THR A . n 
A 1 184 PHE 184 172 172 PHE PHE A . n 
A 1 185 GLY 185 173 173 GLY GLY A . n 
A 1 186 VAL 186 174 174 VAL VAL A . n 
A 1 187 PRO 187 175 175 PRO PRO A . n 
A 1 188 LYS 188 176 176 LYS LYS A . n 
A 1 189 ILE 189 177 177 ILE ILE A . n 
A 1 190 GLY 190 178 178 GLY GLY A . n 
A 1 191 HIS 191 179 179 HIS HIS A . n 
A 1 192 ILE 192 180 180 ILE ILE A . n 
A 1 193 LEU 193 181 181 LEU LEU A . n 
A 1 194 PHE 194 182 182 PHE PHE A . n 
A 1 195 PRO 195 183 183 PRO PRO A . n 
A 1 196 GLY 196 184 184 GLY GLY A . n 
A 1 197 ARG 197 185 185 ARG ARG A . n 
A 1 198 ASP 198 186 186 ASP ASP A . n 
A 1 199 LEU 199 187 187 LEU LEU A . n 
A 1 200 THR 200 188 188 THR THR A . n 
A 1 201 GLY 201 189 189 GLY GLY A . n 
A 1 202 LYS 202 190 190 LYS LYS A . n 
A 1 203 LEU 203 191 191 LEU LEU A . n 
A 1 204 LYS 204 192 192 LYS LYS A . n 
A 1 205 VAL 205 193 193 VAL VAL A . n 
A 1 206 ALA 206 194 194 ALA ALA A . n 
A 1 207 ASN 207 195 195 ASN ASN A . n 
A 1 208 ILE 208 196 196 ILE ILE A . n 
A 1 209 GLY 209 197 197 GLY GLY A . n 
A 1 210 HIS 210 198 198 HIS HIS A . n 
A 1 211 PRO 211 199 199 PRO PRO A . n 
A 1 212 VAL 212 200 200 VAL VAL A . n 
A 1 213 HIS 213 201 201 HIS HIS A . n 
A 1 214 LEU 214 202 202 LEU LEU A . n 
A 1 215 ILE 215 203 203 ILE ILE A . n 
A 1 216 ASN 216 204 204 ASN ASN A . n 
A 1 217 SER 217 205 205 SER SER A . n 
A 1 218 ILE 218 206 206 ILE ILE A . n 
A 1 219 ASN 219 207 207 ASN ASN A . n 
A 1 220 ARG 220 208 208 ARG ARG A . n 
A 1 221 TYR 221 209 209 TYR TYR A . n 
A 1 222 VAL 222 210 210 VAL VAL A . n 
A 1 223 ILE 223 211 211 ILE ILE A . n 
A 1 224 THR 224 212 212 THR THR A . n 
A 1 225 ARG 225 213 213 ARG ARG A . n 
A 1 226 GLU 226 214 214 GLU GLU A . n 
A 1 227 MET 227 215 215 MET MET A . n 
A 1 228 VAL 228 216 216 VAL VAL A . n 
A 1 229 ARG 229 217 217 ARG ARG A . n 
A 1 230 SER 230 218 218 SER SER A . n 
A 1 231 LEU 231 219 219 LEU LEU A . n 
A 1 232 LEU 232 220 220 LEU LEU A . n 
A 1 233 PRO 233 221 221 PRO PRO A . n 
A 1 234 GLU 234 222 222 GLU GLU A . n 
A 1 235 ARG 235 223 223 ARG ARG A . n 
A 1 236 PRO 236 224 224 PRO PRO A . n 
A 1 237 ARG 237 225 225 ARG ARG A . n 
A 1 238 ASP 238 226 226 ASP ASP A . n 
A 1 239 SER 239 227 227 SER SER A . n 
A 1 240 HIS 240 228 228 HIS HIS A . n 
A 1 241 LYS 241 229 229 LYS LYS A . n 
A 1 242 GLY 242 230 230 GLY GLY A . n 
A 1 243 THR 243 231 231 THR THR A . n 
A 1 244 TYR 244 232 232 TYR TYR A . n 
A 1 245 GLY 245 233 233 GLY GLY A . n 
A 1 246 LYS 246 234 234 LYS LYS A . n 
A 1 247 VAL 247 235 235 VAL VAL A . n 
A 1 248 LEU 248 236 236 LEU LEU A . n 
A 1 249 ILE 249 237 237 ILE ILE A . n 
A 1 250 ILE 250 238 238 ILE ILE A . n 
A 1 251 ALA 251 239 239 ALA ALA A . n 
A 1 252 GLY 252 240 240 GLY GLY A . n 
A 1 253 SER 253 241 241 SER SER A . n 
A 1 254 ARG 254 242 242 ARG ARG A . n 
A 1 255 LEU 255 243 243 LEU LEU A . n 
A 1 256 TYR 256 244 244 TYR TYR A . n 
A 1 257 SER 257 245 245 SER SER A . n 
A 1 258 GLY 258 246 246 GLY GLY A . n 
A 1 259 ALA 259 247 247 ALA ALA A . n 
A 1 260 PRO 260 248 248 PRO PRO A . n 
A 1 261 VAL 261 249 249 VAL VAL A . n 
A 1 262 LEU 262 250 250 LEU LEU A . n 
A 1 263 SER 263 251 251 SER SER A . n 
A 1 264 GLY 264 252 252 GLY GLY A . n 
A 1 265 MET 265 253 253 MET MET A . n 
A 1 266 GLY 266 254 254 GLY GLY A . n 
A 1 267 SER 267 255 255 SER SER A . n 
A 1 268 LEU 268 256 256 LEU LEU A . n 
A 1 269 LYS 269 257 257 LYS LYS A . n 
A 1 270 VAL 270 258 258 VAL VAL A . n 
A 1 271 GLY 271 259 259 GLY GLY A . n 
A 1 272 THR 272 260 260 THR THR A . n 
A 1 273 GLY 273 261 261 GLY GLY A . n 
A 1 274 LEU 274 262 262 LEU LEU A . n 
A 1 275 VAL 275 263 263 VAL VAL A . n 
A 1 276 LYS 276 264 264 LYS LYS A . n 
A 1 277 LEU 277 265 265 LEU LEU A . n 
A 1 278 ALA 278 266 266 ALA ALA A . n 
A 1 279 VAL 279 267 267 VAL VAL A . n 
A 1 280 PRO 280 268 268 PRO PRO A . n 
A 1 281 PHE 281 269 269 PHE PHE A . n 
A 1 282 PRO 282 270 270 PRO PRO A . n 
A 1 283 GLN 283 271 271 GLN GLN A . n 
A 1 284 ASN 284 272 272 ASN ASN A . n 
A 1 285 LEU 285 273 273 LEU LEU A . n 
A 1 286 ILE 286 274 274 ILE ILE A . n 
A 1 287 ALA 287 275 275 ALA ALA A . n 
A 1 288 THR 288 276 276 THR THR A . n 
A 1 289 SER 289 277 277 SER SER A . n 
A 1 290 ARG 290 278 278 ARG ARG A . n 
A 1 291 PHE 291 279 279 PHE PHE A . n 
A 1 292 PRO 292 280 280 PRO PRO A . n 
A 1 293 GLU 293 281 281 GLU GLU A . n 
A 1 294 LEU 294 282 282 LEU LEU A . n 
A 1 295 ILE 295 283 283 ILE ILE A . n 
A 1 296 SER 296 284 284 SER SER A . n 
A 1 297 VAL 297 285 285 VAL VAL A . n 
A 1 298 PRO 298 286 286 PRO PRO A . n 
A 1 299 ILE 299 287 287 ILE ILE A . n 
A 1 300 ASP 300 288 288 ASP ASP A . n 
A 1 301 THR 301 289 289 THR THR A . n 
A 1 302 GLU 302 290 290 GLU GLU A . n 
A 1 303 LYS 303 291 291 LYS LYS A . n 
A 1 304 GLY 304 292 292 GLY GLY A . n 
A 1 305 PHE 305 293 293 PHE PHE A . n 
A 1 306 PHE 306 294 294 PHE PHE A . n 
A 1 307 SER 307 295 295 SER SER A . n 
A 1 308 LEU 308 296 296 LEU LEU A . n 
A 1 309 GLN 309 297 297 GLN GLN A . n 
A 1 310 ASN 310 298 298 ASN ASN A . n 
A 1 311 LEU 311 299 299 LEU LEU A . n 
A 1 312 GLN 312 300 300 GLN GLN A . n 
A 1 313 GLU 313 301 301 GLU GLU A . n 
A 1 314 CYS 314 302 302 CYS CYS A . n 
A 1 315 LEU 315 303 303 LEU LEU A . n 
A 1 316 GLU 316 304 304 GLU GLU A . n 
A 1 317 LEU 317 305 305 LEU LEU A . n 
A 1 318 SER 318 306 306 SER SER A . n 
A 1 319 LYS 319 307 307 LYS LYS A . n 
A 1 320 ASP 320 308 308 ASP ASP A . n 
A 1 321 VAL 321 309 309 VAL VAL A . n 
A 1 322 ASP 322 310 310 ASP ASP A . n 
A 1 323 VAL 323 311 311 VAL VAL A . n 
A 1 324 VAL 324 312 312 VAL VAL A . n 
A 1 325 ALA 325 313 313 ALA ALA A . n 
A 1 326 ILE 326 314 314 ILE ILE A . n 
A 1 327 GLY 327 315 315 GLY GLY A . n 
A 1 328 PRO 328 316 316 PRO PRO A . n 
A 1 329 GLY 329 317 317 GLY GLY A . n 
A 1 330 LEU 330 318 318 LEU LEU A . n 
A 1 331 GLY 331 319 319 GLY GLY A . n 
A 1 332 ASN 332 320 320 ASN ASN A . n 
A 1 333 ASN 333 321 321 ASN ASN A . n 
A 1 334 GLU 334 322 322 GLU GLU A . n 
A 1 335 HIS 335 323 323 HIS HIS A . n 
A 1 336 VAL 336 324 324 VAL VAL A . n 
A 1 337 ARG 337 325 325 ARG ARG A . n 
A 1 338 GLU 338 326 326 GLU GLU A . n 
A 1 339 PHE 339 327 327 PHE PHE A . n 
A 1 340 VAL 340 328 328 VAL VAL A . n 
A 1 341 ASN 341 329 329 ASN ASN A . n 
A 1 342 GLU 342 330 330 GLU GLU A . n 
A 1 343 PHE 343 331 331 PHE PHE A . n 
A 1 344 LEU 344 332 332 LEU LEU A . n 
A 1 345 LYS 345 333 333 LYS LYS A . n 
A 1 346 THR 346 334 334 THR THR A . n 
A 1 347 LEU 347 335 335 LEU LEU A . n 
A 1 348 GLU 348 336 336 GLU GLU A . n 
A 1 349 LYS 349 337 337 LYS LYS A . n 
A 1 350 PRO 350 338 338 PRO PRO A . n 
A 1 351 ALA 351 339 339 ALA ALA A . n 
A 1 352 VAL 352 340 340 VAL VAL A . n 
A 1 353 ILE 353 341 341 ILE ILE A . n 
A 1 354 ASP 354 342 342 ASP ASP A . n 
A 1 355 ALA 355 343 343 ALA ALA A . n 
A 1 356 ASP 356 344 344 ASP ASP A . n 
A 1 357 ALA 357 345 345 ALA ALA A . n 
A 1 358 ILE 358 346 346 ILE ILE A . n 
A 1 359 ASN 359 347 347 ASN ASN A . n 
A 1 360 VAL 360 348 348 VAL VAL A . n 
A 1 361 LEU 361 349 349 LEU LEU A . n 
A 1 362 ASP 362 350 350 ASP ASP A . n 
A 1 363 THR 363 351 351 THR THR A . n 
A 1 364 SER 364 352 352 SER SER A . n 
A 1 365 VAL 365 353 353 VAL VAL A . n 
A 1 366 LEU 366 354 354 LEU LEU A . n 
A 1 367 LYS 367 355 355 LYS LYS A . n 
A 1 368 GLU 368 356 356 GLU GLU A . n 
A 1 369 ARG 369 357 357 ARG ARG A . n 
A 1 370 LYS 370 358 358 LYS LYS A . n 
A 1 371 SER 371 359 359 SER SER A . n 
A 1 372 PRO 372 360 360 PRO PRO A . n 
A 1 373 ALA 373 361 361 ALA ALA A . n 
A 1 374 VAL 374 362 362 VAL VAL A . n 
A 1 375 LEU 375 363 363 LEU LEU A . n 
A 1 376 THR 376 364 364 THR THR A . n 
A 1 377 PRO 377 365 365 PRO PRO A . n 
A 1 378 HIS 378 366 366 HIS HIS A . n 
A 1 379 PRO 379 367 367 PRO PRO A . n 
A 1 380 GLY 380 368 368 GLY GLY A . n 
A 1 381 GLU 381 369 369 GLU GLU A . n 
A 1 382 MET 382 370 370 MET MET A . n 
A 1 383 ALA 383 371 371 ALA ALA A . n 
A 1 384 ARG 384 372 372 ARG ARG A . n 
A 1 385 LEU 385 373 373 LEU LEU A . n 
A 1 386 VAL 386 374 374 VAL VAL A . n 
A 1 387 LYS 387 375 375 LYS LYS A . n 
A 1 388 LYS 388 376 376 LYS LYS A . n 
A 1 389 THR 389 377 377 THR THR A . n 
A 1 390 VAL 390 378 378 VAL VAL A . n 
A 1 391 GLY 391 379 379 GLY GLY A . n 
A 1 392 ASP 392 380 380 ASP ASP A . n 
A 1 393 VAL 393 381 381 VAL VAL A . n 
A 1 394 LYS 394 382 382 LYS LYS A . n 
A 1 395 TYR 395 383 383 TYR TYR A . n 
A 1 396 ASN 396 384 384 ASN ASN A . n 
A 1 397 TYR 397 385 385 TYR TYR A . n 
A 1 398 GLU 398 386 386 GLU GLU A . n 
A 1 399 LEU 399 387 387 LEU LEU A . n 
A 1 400 ALA 400 388 388 ALA ALA A . n 
A 1 401 GLU 401 389 389 GLU GLU A . n 
A 1 402 GLU 402 390 390 GLU GLU A . n 
A 1 403 PHE 403 391 391 PHE PHE A . n 
A 1 404 ALA 404 392 392 ALA ALA A . n 
A 1 405 LYS 405 393 393 LYS LYS A . n 
A 1 406 GLU 406 394 394 GLU GLU A . n 
A 1 407 ASN 407 395 395 ASN ASN A . n 
A 1 408 ASP 408 396 396 ASP ASP A . n 
A 1 409 CYS 409 397 397 CYS CYS A . n 
A 1 410 VAL 410 398 398 VAL VAL A . n 
A 1 411 LEU 411 399 399 LEU LEU A . n 
A 1 412 VAL 412 400 400 VAL VAL A . n 
A 1 413 LEU 413 401 401 LEU LEU A . n 
A 1 414 LYS 414 402 402 LYS LYS A . n 
A 1 415 SER 415 403 403 SER SER A . n 
A 1 416 ALA 416 404 404 ALA ALA A . n 
A 1 417 THR 417 405 405 THR THR A . n 
A 1 418 THR 418 406 406 THR THR A . n 
A 1 419 ILE 419 407 407 ILE ILE A . n 
A 1 420 VAL 420 408 408 VAL VAL A . n 
A 1 421 THR 421 409 409 THR THR A . n 
A 1 422 ASP 422 410 410 ASP ASP A . n 
A 1 423 GLY 423 411 411 GLY GLY A . n 
A 1 424 GLU 424 412 412 GLU GLU A . n 
A 1 425 LYS 425 413 413 LYS LYS A . n 
A 1 426 THR 426 414 414 THR THR A . n 
A 1 427 LEU 427 415 415 LEU LEU A . n 
A 1 428 PHE 428 416 416 PHE PHE A . n 
A 1 429 ASN 429 417 417 ASN ASN A . n 
A 1 430 ILE 430 418 418 ILE ILE A . n 
A 1 431 THR 431 419 419 THR THR A . n 
A 1 432 GLY 432 420 420 GLY GLY A . n 
A 1 433 ASN 433 421 421 ASN ASN A . n 
A 1 434 THR 434 422 422 THR THR A . n 
A 1 435 GLY 435 423 423 GLY GLY A . n 
A 1 436 LEU 436 424 424 LEU LEU A . n 
A 1 437 SER 437 425 425 SER SER A . n 
A 1 438 LYS 438 426 426 LYS LYS A . n 
A 1 439 GLY 439 427 427 GLY GLY A . n 
A 1 440 GLY 440 428 428 GLY GLY A . n 
A 1 441 SER 441 429 429 SER SER A . n 
A 1 442 GLY 442 430 430 GLY GLY A . n 
A 1 443 ASP 443 431 431 ASP ASP A . n 
A 1 444 VAL 444 432 432 VAL VAL A . n 
A 1 445 LEU 445 433 433 LEU LEU A . n 
A 1 446 THR 446 434 434 THR THR A . n 
A 1 447 GLY 447 435 435 GLY GLY A . n 
A 1 448 MET 448 436 436 MET MET A . n 
A 1 449 ILE 449 437 437 ILE ILE A . n 
A 1 450 ALA 450 438 438 ALA ALA A . n 
A 1 451 GLY 451 439 439 GLY GLY A . n 
A 1 452 PHE 452 440 440 PHE PHE A . n 
A 1 453 ILE 453 441 441 ILE ILE A . n 
A 1 454 ALA 454 442 442 ALA ALA A . n 
A 1 455 GLN 455 443 443 GLN GLN A . n 
A 1 456 GLY 456 444 444 GLY GLY A . n 
A 1 457 LEU 457 445 445 LEU LEU A . n 
A 1 458 SER 458 446 446 SER SER A . n 
A 1 459 PRO 459 447 447 PRO PRO A . n 
A 1 460 LEU 460 448 448 LEU LEU A . n 
A 1 461 GLU 461 449 449 GLU GLU A . n 
A 1 462 ALA 462 450 450 ALA ALA A . n 
A 1 463 SER 463 451 451 SER SER A . n 
A 1 464 THR 464 452 452 THR THR A . n 
A 1 465 VAL 465 453 453 VAL VAL A . n 
A 1 466 SER 466 454 454 SER SER A . n 
A 1 467 VAL 467 455 455 VAL VAL A . n 
A 1 468 TYR 468 456 456 TYR TYR A . n 
A 1 469 LEU 469 457 457 LEU LEU A . n 
A 1 470 HIS 470 458 458 HIS HIS A . n 
A 1 471 GLY 471 459 459 GLY GLY A . n 
A 1 472 PHE 472 460 460 PHE PHE A . n 
A 1 473 ALA 473 461 461 ALA ALA A . n 
A 1 474 ALA 474 462 462 ALA ALA A . n 
A 1 475 GLU 475 463 463 GLU GLU A . n 
A 1 476 LEU 476 464 464 LEU LEU A . n 
A 1 477 PHE 477 465 465 PHE PHE A . n 
A 1 478 GLU 478 466 466 GLU GLU A . n 
A 1 479 GLN 479 467 467 GLN GLN A . n 
A 1 480 ASP 480 468 468 ASP ASP A . n 
A 1 481 GLU 481 469 469 GLU GLU A . n 
A 1 482 ARG 482 470 470 ARG ARG A . n 
A 1 483 GLY 483 471 471 GLY GLY A . n 
A 1 484 LEU 484 472 472 LEU LEU A . n 
A 1 485 THR 485 473 473 THR THR A . n 
A 1 486 ALA 486 474 474 ALA ALA A . n 
A 1 487 SER 487 475 475 SER SER A . n 
A 1 488 GLU 488 476 476 GLU GLU A . n 
A 1 489 LEU 489 477 477 LEU LEU A . n 
A 1 490 LEU 490 478 478 LEU LEU A . n 
A 1 491 ARG 491 479 479 ARG ARG A . n 
A 1 492 LEU 492 480 480 LEU LEU A . n 
A 1 493 ILE 493 481 481 ILE ILE A . n 
A 1 494 PRO 494 482 482 PRO PRO A . n 
A 1 495 GLU 495 483 483 GLU GLU A . n 
A 1 496 ALA 496 484 484 ALA ALA A . n 
A 1 497 ILE 497 485 485 ILE ILE A . n 
A 1 498 ARG 498 486 486 ARG ARG A . n 
A 1 499 ARG 499 487 487 ARG ARG A . n 
A 1 500 LEU 500 488 488 LEU LEU A . n 
A 1 501 LYS 501 489 489 LYS LYS A . n 
A 1 502 GLU 502 490 ?   ?   ?   A . n 
B 2 1   ALA 1   0   0   ALA ALA B . n 
B 2 2   PRO 2   1   1   PRO PRO B . n 
B 2 3   ALA 3   2   2   ALA ALA B . n 
B 2 4   TRP 4   3   3   TRP TRP B . n 
B 2 5   LEU 5   4   4   LEU LEU B . n 
B 2 6   PHE 6   5   5   PHE PHE B . n 
B 2 7   GLU 7   6   6   GLU GLU B . n 
B 2 8   ALA 8   7   7   ALA ALA B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 K   1   491 1   K   K   A . 
D 4 MG  1   492 2   MG  MG  A . 
E 5 NAD 1   493 3   NAD NAD A . 
F 6 ATP 1   494 4   ATP ATP A . 
G 5 NAD 1   495 5   NAD NAD A . 
H 7 HOH 1   496 1   HOH HOH A . 
H 7 HOH 2   497 2   HOH HOH A . 
H 7 HOH 3   498 3   HOH HOH A . 
H 7 HOH 4   499 4   HOH HOH A . 
H 7 HOH 5   500 5   HOH HOH A . 
H 7 HOH 6   501 6   HOH HOH A . 
H 7 HOH 7   502 7   HOH HOH A . 
H 7 HOH 8   503 8   HOH HOH A . 
H 7 HOH 9   504 9   HOH HOH A . 
H 7 HOH 10  505 10  HOH HOH A . 
H 7 HOH 11  506 11  HOH HOH A . 
H 7 HOH 12  507 12  HOH HOH A . 
H 7 HOH 13  508 13  HOH HOH A . 
H 7 HOH 14  509 14  HOH HOH A . 
H 7 HOH 15  510 15  HOH HOH A . 
H 7 HOH 16  511 16  HOH HOH A . 
H 7 HOH 17  512 17  HOH HOH A . 
H 7 HOH 18  513 18  HOH HOH A . 
H 7 HOH 19  514 19  HOH HOH A . 
H 7 HOH 20  515 20  HOH HOH A . 
H 7 HOH 21  516 21  HOH HOH A . 
H 7 HOH 22  517 22  HOH HOH A . 
H 7 HOH 23  518 23  HOH HOH A . 
H 7 HOH 24  519 24  HOH HOH A . 
H 7 HOH 25  520 25  HOH HOH A . 
H 7 HOH 26  521 26  HOH HOH A . 
H 7 HOH 27  522 27  HOH HOH A . 
H 7 HOH 28  523 28  HOH HOH A . 
H 7 HOH 29  524 29  HOH HOH A . 
H 7 HOH 30  525 30  HOH HOH A . 
H 7 HOH 31  526 31  HOH HOH A . 
H 7 HOH 32  527 32  HOH HOH A . 
H 7 HOH 33  528 33  HOH HOH A . 
H 7 HOH 34  529 34  HOH HOH A . 
H 7 HOH 35  530 35  HOH HOH A . 
H 7 HOH 36  531 36  HOH HOH A . 
H 7 HOH 37  532 37  HOH HOH A . 
H 7 HOH 38  533 38  HOH HOH A . 
H 7 HOH 39  534 39  HOH HOH A . 
H 7 HOH 40  535 40  HOH HOH A . 
H 7 HOH 41  536 41  HOH HOH A . 
H 7 HOH 42  537 42  HOH HOH A . 
H 7 HOH 43  538 43  HOH HOH A . 
H 7 HOH 44  539 44  HOH HOH A . 
H 7 HOH 45  540 45  HOH HOH A . 
H 7 HOH 46  541 46  HOH HOH A . 
H 7 HOH 47  542 47  HOH HOH A . 
H 7 HOH 48  543 48  HOH HOH A . 
H 7 HOH 49  544 49  HOH HOH A . 
H 7 HOH 50  545 50  HOH HOH A . 
H 7 HOH 51  546 51  HOH HOH A . 
H 7 HOH 52  547 52  HOH HOH A . 
H 7 HOH 53  548 53  HOH HOH A . 
H 7 HOH 54  549 54  HOH HOH A . 
H 7 HOH 55  550 55  HOH HOH A . 
H 7 HOH 56  551 56  HOH HOH A . 
H 7 HOH 57  552 57  HOH HOH A . 
H 7 HOH 58  553 58  HOH HOH A . 
H 7 HOH 59  554 59  HOH HOH A . 
H 7 HOH 60  555 60  HOH HOH A . 
H 7 HOH 61  556 61  HOH HOH A . 
H 7 HOH 62  557 62  HOH HOH A . 
H 7 HOH 63  558 63  HOH HOH A . 
H 7 HOH 64  559 64  HOH HOH A . 
H 7 HOH 65  560 65  HOH HOH A . 
H 7 HOH 66  561 66  HOH HOH A . 
H 7 HOH 67  562 67  HOH HOH A . 
H 7 HOH 68  563 68  HOH HOH A . 
H 7 HOH 69  564 69  HOH HOH A . 
H 7 HOH 70  565 70  HOH HOH A . 
H 7 HOH 71  566 71  HOH HOH A . 
H 7 HOH 72  567 72  HOH HOH A . 
H 7 HOH 73  568 73  HOH HOH A . 
H 7 HOH 74  569 74  HOH HOH A . 
H 7 HOH 75  570 75  HOH HOH A . 
H 7 HOH 76  571 76  HOH HOH A . 
H 7 HOH 77  572 77  HOH HOH A . 
H 7 HOH 78  573 78  HOH HOH A . 
H 7 HOH 79  574 79  HOH HOH A . 
H 7 HOH 80  575 80  HOH HOH A . 
H 7 HOH 81  576 81  HOH HOH A . 
H 7 HOH 82  577 82  HOH HOH A . 
H 7 HOH 83  578 83  HOH HOH A . 
H 7 HOH 84  579 84  HOH HOH A . 
H 7 HOH 85  580 85  HOH HOH A . 
H 7 HOH 86  581 86  HOH HOH A . 
H 7 HOH 87  582 87  HOH HOH A . 
H 7 HOH 88  583 88  HOH HOH A . 
H 7 HOH 89  584 89  HOH HOH A . 
H 7 HOH 90  585 90  HOH HOH A . 
H 7 HOH 91  586 91  HOH HOH A . 
H 7 HOH 92  587 92  HOH HOH A . 
H 7 HOH 93  588 93  HOH HOH A . 
H 7 HOH 94  589 94  HOH HOH A . 
H 7 HOH 95  590 95  HOH HOH A . 
H 7 HOH 96  591 96  HOH HOH A . 
H 7 HOH 97  592 97  HOH HOH A . 
H 7 HOH 98  593 98  HOH HOH A . 
H 7 HOH 99  594 99  HOH HOH A . 
H 7 HOH 100 595 100 HOH HOH A . 
H 7 HOH 101 596 101 HOH HOH A . 
H 7 HOH 102 597 102 HOH HOH A . 
H 7 HOH 103 598 103 HOH HOH A . 
H 7 HOH 104 599 104 HOH HOH A . 
H 7 HOH 105 600 105 HOH HOH A . 
H 7 HOH 106 601 106 HOH HOH A . 
H 7 HOH 107 602 107 HOH HOH A . 
H 7 HOH 108 603 108 HOH HOH A . 
H 7 HOH 109 604 109 HOH HOH A . 
H 7 HOH 110 605 110 HOH HOH A . 
H 7 HOH 111 606 111 HOH HOH A . 
H 7 HOH 112 607 112 HOH HOH A . 
H 7 HOH 113 608 113 HOH HOH A . 
H 7 HOH 114 609 114 HOH HOH A . 
H 7 HOH 115 610 115 HOH HOH A . 
H 7 HOH 116 611 116 HOH HOH A . 
H 7 HOH 117 612 117 HOH HOH A . 
H 7 HOH 118 613 118 HOH HOH A . 
H 7 HOH 119 614 119 HOH HOH A . 
H 7 HOH 120 615 120 HOH HOH A . 
H 7 HOH 121 616 121 HOH HOH A . 
H 7 HOH 122 617 122 HOH HOH A . 
H 7 HOH 123 618 123 HOH HOH A . 
H 7 HOH 124 619 124 HOH HOH A . 
H 7 HOH 125 620 125 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   hexadecameric 
_pdbx_struct_assembly.oligomeric_count     16 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4,5,6,7,8 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 64960  ? 
1 MORE         -283   ? 
1 'SSA (A^2)'  131940 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_555 -x,-y,z  -1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
3 'crystal symmetry operation' 3_555 -y,x,z   0.0000000000  -1.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
4 'crystal symmetry operation' 4_555 y,-x,z   0.0000000000  1.0000000000  0.0000000000 0.0000000000 -1.0000000000 0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
5 'crystal symmetry operation' 5_555 -x,y,-z  -1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
6 'crystal symmetry operation' 6_555 x,-y,-z  1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
7 'crystal symmetry operation' 7_555 y,x,-z   0.0000000000  1.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
8 'crystal symmetry operation' 8_555 -y,-x,-z 0.0000000000  -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASN 64  ? A ASN 52  ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A ASP 126 ? A ASP 114 ? 1_555 91.1  ? 
2  OD1 ? A ASN 64  ? A ASN 52  ? 1_555 K  ? C K  . ? A K  491 ? 1_555 OD2 ? A ASP 126 ? A ASP 114 ? 1_555 144.1 ? 
3  O   ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 OD2 ? A ASP 126 ? A ASP 114 ? 1_555 63.3  ? 
4  OD1 ? A ASN 64  ? A ASN 52  ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A PHE 129 ? A PHE 117 ? 1_555 74.0  ? 
5  O   ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A PHE 129 ? A PHE 117 ? 1_555 156.1 ? 
6  OD2 ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A PHE 129 ? A PHE 117 ? 1_555 119.7 ? 
7  OD1 ? A ASN 64  ? A ASN 52  ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A VAL 158 ? A VAL 146 ? 1_555 79.1  ? 
8  O   ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A VAL 158 ? A VAL 146 ? 1_555 87.0  ? 
9  OD2 ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A VAL 158 ? A VAL 146 ? 1_555 121.0 ? 
10 O   ? A PHE 129 ? A PHE 117 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A VAL 158 ? A VAL 146 ? 1_555 107.7 ? 
11 OD1 ? A ASN 64  ? A ASN 52  ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A VAL 160 ? A VAL 148 ? 1_555 133.0 ? 
12 O   ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A VAL 160 ? A VAL 148 ? 1_555 122.2 ? 
13 OD2 ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A VAL 160 ? A VAL 148 ? 1_555 82.9  ? 
14 O   ? A PHE 129 ? A PHE 117 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A VAL 160 ? A VAL 148 ? 1_555 81.0  ? 
15 O   ? A VAL 158 ? A VAL 146 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 O   ? A VAL 160 ? A VAL 148 ? 1_555 71.5  ? 
16 OD1 ? A ASN 64  ? A ASN 52  ? 1_555 K  ? C K  . ? A K  491 ? 1_555 OG  ? A SER 162 ? A SER 150 ? 1_555 100.6 ? 
17 O   ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 OG  ? A SER 162 ? A SER 150 ? 1_555 102.5 ? 
18 OD2 ? A ASP 126 ? A ASP 114 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 OG  ? A SER 162 ? A SER 150 ? 1_555 64.5  ? 
19 O   ? A PHE 129 ? A PHE 117 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 OG  ? A SER 162 ? A SER 150 ? 1_555 63.4  ? 
20 O   ? A VAL 158 ? A VAL 146 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 OG  ? A SER 162 ? A SER 150 ? 1_555 170.5 ? 
21 O   ? A VAL 160 ? A VAL 148 ? 1_555 K  ? C K  . ? A K  491 ? 1_555 OG  ? A SER 162 ? A SER 150 ? 1_555 102.7 ? 
22 O1A ? F ATP .   ? A ATP 494 ? 1_555 MG ? D MG . ? A MG 492 ? 1_555 O1B ? F ATP .   ? A ATP 494 ? 1_555 80.0  ? 
23 O1A ? F ATP .   ? A ATP 494 ? 1_555 MG ? D MG . ? A MG 492 ? 1_555 O2G ? F ATP .   ? A ATP 494 ? 1_555 108.6 ? 
24 O1B ? F ATP .   ? A ATP 494 ? 1_555 MG ? D MG . ? A MG 492 ? 1_555 O2G ? F ATP .   ? A ATP 494 ? 1_555 53.6  ? 
25 O1A ? F ATP .   ? A ATP 494 ? 1_555 MG ? D MG . ? A MG 492 ? 1_555 O   ? H HOH .   ? A HOH 541 ? 1_555 125.7 ? 
26 O1B ? F ATP .   ? A ATP 494 ? 1_555 MG ? D MG . ? A MG 492 ? 1_555 O   ? H HOH .   ? A HOH 541 ? 1_555 80.4  ? 
27 O2G ? F ATP .   ? A ATP 494 ? 1_555 MG ? D MG . ? A MG 492 ? 1_555 O   ? H HOH .   ? A HOH 541 ? 1_555 98.9  ? 
28 O1A ? F ATP .   ? A ATP 494 ? 1_555 MG ? D MG . ? A MG 492 ? 1_555 O   ? H HOH .   ? A HOH 553 ? 1_555 107.0 ? 
29 O1B ? F ATP .   ? A ATP 494 ? 1_555 MG ? D MG . ? A MG 492 ? 1_555 O   ? H HOH .   ? A HOH 553 ? 1_555 114.8 ? 
30 O2G ? F ATP .   ? A ATP 494 ? 1_555 MG ? D MG . ? A MG 492 ? 1_555 O   ? H HOH .   ? A HOH 553 ? 1_555 63.6  ? 
31 O   ? H HOH .   ? A HOH 541 ? 1_555 MG ? D MG . ? A MG 492 ? 1_555 O   ? H HOH .   ? A HOH 553 ? 1_555 127.2 ? 
32 O1A ? F ATP .   ? A ATP 494 ? 1_555 MG ? D MG . ? A MG 492 ? 1_555 O   ? H HOH .   ? A HOH 559 ? 1_555 84.2  ? 
33 O1B ? F ATP .   ? A ATP 494 ? 1_555 MG ? D MG . ? A MG 492 ? 1_555 O   ? H HOH .   ? A HOH 559 ? 1_555 148.1 ? 
34 O2G ? F ATP .   ? A ATP 494 ? 1_555 MG ? D MG . ? A MG 492 ? 1_555 O   ? H HOH .   ? A HOH 559 ? 1_555 158.2 ? 
35 O   ? H HOH .   ? A HOH 541 ? 1_555 MG ? D MG . ? A MG 492 ? 1_555 O   ? H HOH .   ? A HOH 559 ? 1_555 86.7  ? 
36 O   ? H HOH .   ? A HOH 553 ? 1_555 MG ? D MG . ? A MG 492 ? 1_555 O   ? H HOH .   ? A HOH 559 ? 1_555 96.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-06-22 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2012-09-19 
4 'Structure model' 1 3 2012-10-31 
5 'Structure model' 1 4 2022-04-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
3 4 'Structure model' 'Database references'       
4 5 'Structure model' 'Database references'       
5 5 'Structure model' 'Derived calculations'      
6 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' audit_author           
2 5 'Structure model' citation_author        
3 5 'Structure model' database_2             
4 5 'Structure model' pdbx_struct_conn_angle 
5 5 'Structure model' struct_conn            
6 5 'Structure model' struct_ref_seq_dif     
7 5 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  5 'Structure model' '_audit_author.identifier_ORCID'              
2  5 'Structure model' '_citation_author.identifier_ORCID'           
3  5 'Structure model' '_database_2.pdbx_DOI'                        
4  5 'Structure model' '_database_2.pdbx_database_accession'         
5  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
6  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
7  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
8  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
9  5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id'  
12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 
15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 
16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
17 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
18 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
19 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
20 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
21 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
22 5 'Structure model' '_pdbx_struct_conn_angle.value'               
23 5 'Structure model' '_struct_conn.pdbx_dist_value'                
24 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
25 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
26 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
27 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
28 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
29 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
30 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
31 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
32 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
33 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
34 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
35 5 'Structure model' '_struct_ref_seq_dif.details'                 
36 5 'Structure model' '_struct_site.pdbx_auth_asym_id'              
37 5 'Structure model' '_struct_site.pdbx_auth_comp_id'              
38 5 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
_diffrn_reflns.av_R_equivalents   0.054 
_diffrn_reflns.number             310804 
_diffrn_reflns.diffrn_id          1 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined -54.7551 -4.1569  -14.9095 0.1932 0.5553 0.2670 -0.1380 -0.1893 0.2114  27.9669 15.7487 18.8383 -3.6069 -16.8266 
-10.0716 0.8777  -0.5103 -0.3674 1.7401  0.3079  0.5525  -1.1825 0.3781  -0.6929 'X-RAY DIFFRACTION' 
2 ? refined -46.1583 12.3010  -2.7157  0.0843 0.1653 0.0567 0.0541  0.0174  0.0469  1.6097  2.1615  3.4147  -0.0728 0.1878   
-1.3050  -0.0554 0.1598  -0.1044 -0.0635 0.1036  -0.0137 0.3939  -0.4167 -0.2454 'X-RAY DIFFRACTION' 
3 ? refined -46.5043 25.0519  -1.4128  1.3091 0.3405 0.1982 0.5075  -0.0561 -0.0076 9.7052  8.3849  -0.5129 -2.6964 -1.6556  
1.8137   -0.6100 0.7539  -0.1439 -0.0473 1.3087  -0.4612 0.8585  -0.6582 -0.1516 'X-RAY DIFFRACTION' 
4 ? refined -41.1099 11.1167  -17.8868 0.0183 0.1271 0.0818 -0.0001 0.0176  0.0508  1.2826  1.4464  3.6288  0.2947  0.0031   
-0.9108  -0.0195 0.0516  -0.0322 0.0490  0.1327  -0.0756 -0.1394 -0.0548 -0.1322 'X-RAY DIFFRACTION' 
5 ? refined -17.8643 -11.4925 -36.4029 0.0949 0.0701 0.1130 -0.0006 -0.0163 0.0422  0.8230  0.6654  0.1330  -0.1714 0.2142   
0.1905   -0.0031 0.0559  -0.0528 -0.0375 -0.1988 0.0959  -0.0003 0.0098  -0.0009 'X-RAY DIFFRACTION' 
6 ? refined -19.5795 -7.1131  -53.8805 0.1167 0.0942 0.0298 0.0002  -0.0528 -0.0074 2.2098  1.4572  1.7130  -0.1569 -0.1281  
0.0134   0.0519  0.0150  -0.0668 0.3252  -0.0943 0.1137  -0.2718 0.0221  -0.0908 'X-RAY DIFFRACTION' 
7 ? refined -31.7830 -2.2526  -38.3711 0.0414 0.1021 0.1143 -0.0058 -0.0108 0.0514  1.1351  1.3429  1.1014  -0.3518 -0.0428  
0.3784   0.0715  -0.0301 -0.0414 0.0349  -0.1151 0.1909  -0.0695 -0.0178 -0.1908 'X-RAY DIFFRACTION' 
8 ? refined -13.4640 0.4564   -26.9697 0.0587 0.1081 0.0940 0.0118  0.0130  0.0232  1.1053  4.7733  0.8366  0.0996  0.3677   
-0.5667  0.0021  -0.0168 0.0147  -0.1261 0.0102  -0.0387 0.1820  0.0277  -0.0003 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 1   A 13  ? . . . . 'X-RAY DIFFRACTION' ? 
2 2 A 14  A 90  ? . . . . 'X-RAY DIFFRACTION' ? 
3 3 A 91  A 109 ? . . . . 'X-RAY DIFFRACTION' ? 
4 4 A 110 A 209 ? . . . . 'X-RAY DIFFRACTION' ? 
5 5 A 210 A 261 ? . . . . 'X-RAY DIFFRACTION' ? 
6 6 A 262 A 352 ? . . . . 'X-RAY DIFFRACTION' ? 
7 7 A 353 A 460 ? . . . . 'X-RAY DIFFRACTION' ? 
8 8 A 461 A 489 ? . . . . 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC      5.5.0109 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 1 
PDB_EXTRACT 3.006    'June 11, 2008' package PDB                  help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 2 
HKL-3000    .        ?               ?       ?                    ?                     'data collection' ? ?          ? 3 
HKL-3000    .        ?               ?       ?                    ?                     'data reduction'  ? ?          ? 4 
HKL-3000    .        ?               ?       ?                    ?                     'data scaling'    ? ?          ? 5 
HKL-3000    MOLREP   ?               ?       ?                    ?                     phasing           ? ?          ? 6 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 147 ? ? 69.56   -60.53  
2 1 ARG A 161 ? ? 72.37   -58.16  
3 1 GLU A 336 ? ? -104.54 51.55   
4 1 ALA A 343 ? ? 55.70   -127.52 
5 1 TYR A 383 ? ? 56.94   18.55   
6 1 SER A 403 ? ? -176.19 -175.86 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 N 1 A NAD 493 ? C2N ? E NAD 1 C2N 
2  1 N 1 A NAD 493 ? C3N ? E NAD 1 C3N 
3  1 N 1 A NAD 493 ? C7N ? E NAD 1 C7N 
4  1 N 1 A NAD 493 ? O7N ? E NAD 1 O7N 
5  1 N 1 A NAD 493 ? N7N ? E NAD 1 N7N 
6  1 N 1 A NAD 493 ? C4N ? E NAD 1 C4N 
7  1 N 1 A NAD 493 ? C5N ? E NAD 1 C5N 
8  1 N 1 A NAD 493 ? C6N ? E NAD 1 C6N 
9  1 N 1 A NAD 495 ? C5D ? G NAD 1 C5D 
10 1 N 1 A NAD 495 ? C4D ? G NAD 1 C4D 
11 1 N 1 A NAD 495 ? O4D ? G NAD 1 O4D 
12 1 N 1 A NAD 495 ? C3D ? G NAD 1 C3D 
13 1 N 1 A NAD 495 ? O3D ? G NAD 1 O3D 
14 1 N 1 A NAD 495 ? C2D ? G NAD 1 C2D 
15 1 N 1 A NAD 495 ? O2D ? G NAD 1 O2D 
16 1 N 1 A NAD 495 ? C1D ? G NAD 1 C1D 
17 1 N 1 A NAD 495 ? N1N ? G NAD 1 N1N 
18 1 N 1 A NAD 495 ? C2N ? G NAD 1 C2N 
19 1 N 1 A NAD 495 ? C3N ? G NAD 1 C3N 
20 1 N 1 A NAD 495 ? C7N ? G NAD 1 C7N 
21 1 N 1 A NAD 495 ? O7N ? G NAD 1 O7N 
22 1 N 1 A NAD 495 ? N7N ? G NAD 1 N7N 
23 1 N 1 A NAD 495 ? C4N ? G NAD 1 C4N 
24 1 N 1 A NAD 495 ? C5N ? G NAD 1 C5N 
25 1 N 1 A NAD 495 ? C6N ? G NAD 1 C6N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -11 ? A MET 1   
2  1 Y 1 A GLY -10 ? A GLY 2   
3  1 Y 1 A SER -9  ? A SER 3   
4  1 Y 1 A ASP -8  ? A ASP 4   
5  1 Y 1 A LYS -7  ? A LYS 5   
6  1 Y 1 A ILE -6  ? A ILE 6   
7  1 Y 1 A HIS -5  ? A HIS 7   
8  1 Y 1 A HIS -4  ? A HIS 8   
9  1 Y 1 A HIS -3  ? A HIS 9   
10 1 Y 1 A HIS -2  ? A HIS 10  
11 1 Y 1 A HIS -1  ? A HIS 11  
12 1 Y 1 A HIS 0   ? A HIS 12  
13 1 Y 1 A GLU 490 ? A GLU 502 
# 
_cell_measurement.reflns_used   310804 
_cell_measurement.entry_id      3RTC 
# 
_diffrn_measurement.method      '\w scans' 
_diffrn_measurement.details     '1.00 degrees, 12.00 sec, detector distance 180.00 mm' 
_diffrn_measurement.diffrn_id   1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'POTASSIUM ION'                   K   
4 'MAGNESIUM ION'                   MG  
5 NICOTINAMIDE-ADENINE-DINUCLEOTIDE NAD 
6 "ADENOSINE-5'-TRIPHOSPHATE"       ATP 
7 water                             HOH 
#